data_1J5O
# 
_entry.id   1J5O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1J5O         
NDB   PD0316       
RCSB  RCSB001643   
WWPDB D_1000001643 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.pdb_id           1J5O 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1C9R 
_pdbx_database_PDB_obs_spr.date             2002-06-14 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1QE1 'UNLIGANDED MET184ILE HIV-1 REVERSE TRANSCRIPTASE'                                            unspecified 
PDB 2HMI 'WILD-TYPE HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH A DOUBLE STRANDED DNA TEMPLATE-PRIMER' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1J5O 
_pdbx_database_status.recvd_initial_deposition_date   2002-05-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sarafianos, S.G.' 1 
'Das, K.'          2 
'Arnold, E.'       3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Lamivudine (3TC) resistance in HIV-1 reverse transcriptase involves steric hindrance with beta-branched amino acids.' 
Proc.Natl.Acad.Sci.USA 96  10027 10032 1999 PNASA6 US 0027-8424 0040 ? 10468556 10.1073/pnas.96.18.10027        
1       
;Structure and Functional Implications of the Polymerase Active Site Region in a Complex of HIV-1 RT with a Double-Stranded DNA template-primer and an Antibody Fab Fragment at 2.8 Angstroms Resolution
;
J.Mol.Biol.            284 1095  1111  1998 JMOBAK UK 0022-2836 0070 ? ?        10.1006/jmbi.1998.2208          
2       'Touching the Heart of HIV-1 Drug Resistance: The Fingers Close Down on the dNTP at the Polymerase Active Site' Chem.Biol. 
6   R137  R146  1999 CBOLE2 UK 1074-5521 2050 ? ?        '10.1016/S1074-5521(99)80071-4' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sarafianos, S.G.'  1  
primary 'Das, K.'           2  
primary 'Clark Jr., A.D.'   3  
primary 'Ding, J.'          4  
primary 'Boyer, P.L.'       5  
primary 'Hughes, S.H.'      6  
primary 'Arnold, E.'        7  
1       'Ding, J.'          8  
1       'Das, K.'           9  
1       'Hsiou, Y.'         10 
1       'Sarafianos, S.G.'  11 
1       'Clark Jr., A.D.'   12 
1       'Jacobo-Molina, A.' 13 
1       'Tantillo, C.'      14 
1       'Hughes, S.H.'      15 
1       'Arnold, E.'        16 
2       'Sarafianos, S.G.'  17 
2       'Das, K.'           18 
2       'Ding, J.'          19 
2       'Boyer, P.L.'       20 
2       'Hughes, S.H.'      21 
2       'Arnold, E.'        22 
# 
_cell.entry_id           1J5O 
_cell.length_a           169.180 
_cell.length_b           169.180 
_cell.length_c           221.910 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1J5O 
_symmetry.space_group_name_H-M             'P 32 1 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                153 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*GP*AP*C)-3'" 5864.801  1 ?        ?           ?     ? 
2 polymer syn "5'-D(*GP*TP*CP*CP*CP*TP*GP*TP*TP*CP*GP*GP*GP*CP*GP*CP*CP*A)-3'"    5484.528  1 ?        ?           ?     ? 
3 polymer man 'Reverse transcriptase'                                             64256.613 1 2.7.7.49 M184I,C280S ?     ? 
4 polymer man 'Reverse transcriptase'                                             50263.723 1 2.7.7.49 M184I,C280S ?     ? 
5 polymer nat 'ANTIBODY (LIGHT CHAIN)'                                            22984.068 1 ?        ?           FAB28 ? 
6 polymer nat 'ANTIBODY (HEAVY CHAIN)'                                            23457.156 1 ?        ?           FAB28 ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'HIV-1 RT' 
4 'HIV-1 RT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DA)(DT)(DG)(DG)(DC)(DG)(DC)(DC)(DC)(DG)(DA)(DA)(DC)(DA)(DG)(DG)(DG)(DA)(DC)' ATGGCGCCCGAACAGGGAC 
T ? 
2 polydeoxyribonucleotide no no '(DG)(DT)(DC)(DC)(DC)(DT)(DG)(DT)(DT)(DC)(DG)(DG)(DG)(DC)(DG)(DC)(DC)(DA)' GTCCCTGTTCGGGCGCCA P ? 
3 'polypeptide(L)'        no no 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
;
A ? 
4 'polypeptide(L)'        no no 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLE
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLE
;
B ? 
5 'polypeptide(L)'        no no 
;DIQMTQTTSSLSASLGDRVTISCSASQDISSYLNWYQQKPEGTVKLLIYYTSSLHSGVPSAFSGSGSGTDYSLTISNLEP
EDFATYYCQQYSKFPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVAWAIDGSAAANGVL
NSWTDQDSKDSTYSMSSTLTLTADEYEAANSYTCAATHKTSTSPIVKSFNANEC
;
;DIQMTQTTSSLSASLGDRVTISCSASQDISSYLNWYQQKPEGTVKLLIYYTSSLHSGVPSAFSGSGSGTDYSLTISNLEP
EDFATYYCQQYSKFPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVAWAIDGSAAANGVL
NSWTDQDSKDSTYSMSSTLTLTADEYEAANSYTCAATHKTSTSPIVKSFNANEC
;
L ? 
6 'polypeptide(L)'        no no 
;QITLKESGPGIVQPSQPFRLTCTFSGFSLSTSGIGVTWIRQPSGKGLEWLATIWWDDDNRYNPSLKSRLTVSKDTSNNQA
FLNMMTVETADTAIYYCAQSAITSVTDSAMDHWGQGTSVTVSSAATTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPV
TVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI
;
;QITLKESGPGIVQPSQPFRLTCTFSGFSLSTSGIGVTWIRQPSGKGLEWLATIWWDDDNRYNPSLKSRLTVSKDTSNNQA
FLNMMTVETADTAIYYCAQSAITSVTDSAMDHWGQGTSVTVSSAATTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPV
TVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI
;
H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DG  n 
1 4   DG  n 
1 5   DC  n 
1 6   DG  n 
1 7   DC  n 
1 8   DC  n 
1 9   DC  n 
1 10  DG  n 
1 11  DA  n 
1 12  DA  n 
1 13  DC  n 
1 14  DA  n 
1 15  DG  n 
1 16  DG  n 
1 17  DG  n 
1 18  DA  n 
1 19  DC  n 
2 1   DG  n 
2 2   DT  n 
2 3   DC  n 
2 4   DC  n 
2 5   DC  n 
2 6   DT  n 
2 7   DG  n 
2 8   DT  n 
2 9   DT  n 
2 10  DC  n 
2 11  DG  n 
2 12  DG  n 
2 13  DG  n 
2 14  DC  n 
2 15  DG  n 
2 16  DC  n 
2 17  DC  n 
2 18  DA  n 
3 1   PRO n 
3 2   ILE n 
3 3   SER n 
3 4   PRO n 
3 5   ILE n 
3 6   GLU n 
3 7   THR n 
3 8   VAL n 
3 9   PRO n 
3 10  VAL n 
3 11  LYS n 
3 12  LEU n 
3 13  LYS n 
3 14  PRO n 
3 15  GLY n 
3 16  MET n 
3 17  ASP n 
3 18  GLY n 
3 19  PRO n 
3 20  LYS n 
3 21  VAL n 
3 22  LYS n 
3 23  GLN n 
3 24  TRP n 
3 25  PRO n 
3 26  LEU n 
3 27  THR n 
3 28  GLU n 
3 29  GLU n 
3 30  LYS n 
3 31  ILE n 
3 32  LYS n 
3 33  ALA n 
3 34  LEU n 
3 35  VAL n 
3 36  GLU n 
3 37  ILE n 
3 38  CYS n 
3 39  THR n 
3 40  GLU n 
3 41  MET n 
3 42  GLU n 
3 43  LYS n 
3 44  GLU n 
3 45  GLY n 
3 46  LYS n 
3 47  ILE n 
3 48  SER n 
3 49  LYS n 
3 50  ILE n 
3 51  GLY n 
3 52  PRO n 
3 53  GLU n 
3 54  ASN n 
3 55  PRO n 
3 56  TYR n 
3 57  ASN n 
3 58  THR n 
3 59  PRO n 
3 60  VAL n 
3 61  PHE n 
3 62  ALA n 
3 63  ILE n 
3 64  LYS n 
3 65  LYS n 
3 66  LYS n 
3 67  ASP n 
3 68  SER n 
3 69  THR n 
3 70  LYS n 
3 71  TRP n 
3 72  ARG n 
3 73  LYS n 
3 74  LEU n 
3 75  VAL n 
3 76  ASP n 
3 77  PHE n 
3 78  ARG n 
3 79  GLU n 
3 80  LEU n 
3 81  ASN n 
3 82  LYS n 
3 83  ARG n 
3 84  THR n 
3 85  GLN n 
3 86  ASP n 
3 87  PHE n 
3 88  TRP n 
3 89  GLU n 
3 90  VAL n 
3 91  GLN n 
3 92  LEU n 
3 93  GLY n 
3 94  ILE n 
3 95  PRO n 
3 96  HIS n 
3 97  PRO n 
3 98  ALA n 
3 99  GLY n 
3 100 LEU n 
3 101 LYS n 
3 102 LYS n 
3 103 LYS n 
3 104 LYS n 
3 105 SER n 
3 106 VAL n 
3 107 THR n 
3 108 VAL n 
3 109 LEU n 
3 110 ASP n 
3 111 VAL n 
3 112 GLY n 
3 113 ASP n 
3 114 ALA n 
3 115 TYR n 
3 116 PHE n 
3 117 SER n 
3 118 VAL n 
3 119 PRO n 
3 120 LEU n 
3 121 ASP n 
3 122 GLU n 
3 123 ASP n 
3 124 PHE n 
3 125 ARG n 
3 126 LYS n 
3 127 TYR n 
3 128 THR n 
3 129 ALA n 
3 130 PHE n 
3 131 THR n 
3 132 ILE n 
3 133 PRO n 
3 134 SER n 
3 135 ILE n 
3 136 ASN n 
3 137 ASN n 
3 138 GLU n 
3 139 THR n 
3 140 PRO n 
3 141 GLY n 
3 142 ILE n 
3 143 ARG n 
3 144 TYR n 
3 145 GLN n 
3 146 TYR n 
3 147 ASN n 
3 148 VAL n 
3 149 LEU n 
3 150 PRO n 
3 151 GLN n 
3 152 GLY n 
3 153 TRP n 
3 154 LYS n 
3 155 GLY n 
3 156 SER n 
3 157 PRO n 
3 158 ALA n 
3 159 ILE n 
3 160 PHE n 
3 161 GLN n 
3 162 SER n 
3 163 SER n 
3 164 MET n 
3 165 THR n 
3 166 LYS n 
3 167 ILE n 
3 168 LEU n 
3 169 GLU n 
3 170 PRO n 
3 171 PHE n 
3 172 LYS n 
3 173 LYS n 
3 174 GLN n 
3 175 ASN n 
3 176 PRO n 
3 177 ASP n 
3 178 ILE n 
3 179 VAL n 
3 180 ILE n 
3 181 TYR n 
3 182 GLN n 
3 183 TYR n 
3 184 ILE n 
3 185 ASP n 
3 186 ASP n 
3 187 LEU n 
3 188 TYR n 
3 189 VAL n 
3 190 GLY n 
3 191 SER n 
3 192 ASP n 
3 193 LEU n 
3 194 GLU n 
3 195 ILE n 
3 196 GLY n 
3 197 GLN n 
3 198 HIS n 
3 199 ARG n 
3 200 THR n 
3 201 LYS n 
3 202 ILE n 
3 203 GLU n 
3 204 GLU n 
3 205 LEU n 
3 206 ARG n 
3 207 GLN n 
3 208 HIS n 
3 209 LEU n 
3 210 LEU n 
3 211 ARG n 
3 212 TRP n 
3 213 GLY n 
3 214 LEU n 
3 215 THR n 
3 216 THR n 
3 217 PRO n 
3 218 ASP n 
3 219 LYS n 
3 220 LYS n 
3 221 HIS n 
3 222 GLN n 
3 223 LYS n 
3 224 GLU n 
3 225 PRO n 
3 226 PRO n 
3 227 PHE n 
3 228 LEU n 
3 229 TRP n 
3 230 MET n 
3 231 GLY n 
3 232 TYR n 
3 233 GLU n 
3 234 LEU n 
3 235 HIS n 
3 236 PRO n 
3 237 ASP n 
3 238 LYS n 
3 239 TRP n 
3 240 THR n 
3 241 VAL n 
3 242 GLN n 
3 243 PRO n 
3 244 ILE n 
3 245 VAL n 
3 246 LEU n 
3 247 PRO n 
3 248 GLU n 
3 249 LYS n 
3 250 ASP n 
3 251 SER n 
3 252 TRP n 
3 253 THR n 
3 254 VAL n 
3 255 ASN n 
3 256 ASP n 
3 257 ILE n 
3 258 GLN n 
3 259 LYS n 
3 260 LEU n 
3 261 VAL n 
3 262 GLY n 
3 263 LYS n 
3 264 LEU n 
3 265 ASN n 
3 266 TRP n 
3 267 ALA n 
3 268 SER n 
3 269 GLN n 
3 270 ILE n 
3 271 TYR n 
3 272 PRO n 
3 273 GLY n 
3 274 ILE n 
3 275 LYS n 
3 276 VAL n 
3 277 ARG n 
3 278 GLN n 
3 279 LEU n 
3 280 SER n 
3 281 LYS n 
3 282 LEU n 
3 283 LEU n 
3 284 ARG n 
3 285 GLY n 
3 286 THR n 
3 287 LYS n 
3 288 ALA n 
3 289 LEU n 
3 290 THR n 
3 291 GLU n 
3 292 VAL n 
3 293 ILE n 
3 294 PRO n 
3 295 LEU n 
3 296 THR n 
3 297 GLU n 
3 298 GLU n 
3 299 ALA n 
3 300 GLU n 
3 301 LEU n 
3 302 GLU n 
3 303 LEU n 
3 304 ALA n 
3 305 GLU n 
3 306 ASN n 
3 307 ARG n 
3 308 GLU n 
3 309 ILE n 
3 310 LEU n 
3 311 LYS n 
3 312 GLU n 
3 313 PRO n 
3 314 VAL n 
3 315 HIS n 
3 316 GLY n 
3 317 VAL n 
3 318 TYR n 
3 319 TYR n 
3 320 ASP n 
3 321 PRO n 
3 322 SER n 
3 323 LYS n 
3 324 ASP n 
3 325 LEU n 
3 326 ILE n 
3 327 ALA n 
3 328 GLU n 
3 329 ILE n 
3 330 GLN n 
3 331 LYS n 
3 332 GLN n 
3 333 GLY n 
3 334 GLN n 
3 335 GLY n 
3 336 GLN n 
3 337 TRP n 
3 338 THR n 
3 339 TYR n 
3 340 GLN n 
3 341 ILE n 
3 342 TYR n 
3 343 GLN n 
3 344 GLU n 
3 345 PRO n 
3 346 PHE n 
3 347 LYS n 
3 348 ASN n 
3 349 LEU n 
3 350 LYS n 
3 351 THR n 
3 352 GLY n 
3 353 LYS n 
3 354 TYR n 
3 355 ALA n 
3 356 ARG n 
3 357 MET n 
3 358 ARG n 
3 359 GLY n 
3 360 ALA n 
3 361 HIS n 
3 362 THR n 
3 363 ASN n 
3 364 ASP n 
3 365 VAL n 
3 366 LYS n 
3 367 GLN n 
3 368 LEU n 
3 369 THR n 
3 370 GLU n 
3 371 ALA n 
3 372 VAL n 
3 373 GLN n 
3 374 LYS n 
3 375 ILE n 
3 376 THR n 
3 377 THR n 
3 378 GLU n 
3 379 SER n 
3 380 ILE n 
3 381 VAL n 
3 382 ILE n 
3 383 TRP n 
3 384 GLY n 
3 385 LYS n 
3 386 THR n 
3 387 PRO n 
3 388 LYS n 
3 389 PHE n 
3 390 LYS n 
3 391 LEU n 
3 392 PRO n 
3 393 ILE n 
3 394 GLN n 
3 395 LYS n 
3 396 GLU n 
3 397 THR n 
3 398 TRP n 
3 399 GLU n 
3 400 THR n 
3 401 TRP n 
3 402 TRP n 
3 403 THR n 
3 404 GLU n 
3 405 TYR n 
3 406 TRP n 
3 407 GLN n 
3 408 ALA n 
3 409 THR n 
3 410 TRP n 
3 411 ILE n 
3 412 PRO n 
3 413 GLU n 
3 414 TRP n 
3 415 GLU n 
3 416 PHE n 
3 417 VAL n 
3 418 ASN n 
3 419 THR n 
3 420 PRO n 
3 421 PRO n 
3 422 LEU n 
3 423 VAL n 
3 424 LYS n 
3 425 LEU n 
3 426 TRP n 
3 427 TYR n 
3 428 GLN n 
3 429 LEU n 
3 430 GLU n 
3 431 LYS n 
3 432 GLU n 
3 433 PRO n 
3 434 ILE n 
3 435 VAL n 
3 436 GLY n 
3 437 ALA n 
3 438 GLU n 
3 439 THR n 
3 440 PHE n 
3 441 TYR n 
3 442 VAL n 
3 443 ASP n 
3 444 GLY n 
3 445 ALA n 
3 446 ALA n 
3 447 ASN n 
3 448 ARG n 
3 449 GLU n 
3 450 THR n 
3 451 LYS n 
3 452 LEU n 
3 453 GLY n 
3 454 LYS n 
3 455 ALA n 
3 456 GLY n 
3 457 TYR n 
3 458 VAL n 
3 459 THR n 
3 460 ASN n 
3 461 LYS n 
3 462 GLY n 
3 463 ARG n 
3 464 GLN n 
3 465 LYS n 
3 466 VAL n 
3 467 VAL n 
3 468 PRO n 
3 469 LEU n 
3 470 THR n 
3 471 ASN n 
3 472 THR n 
3 473 THR n 
3 474 ASN n 
3 475 GLN n 
3 476 LYS n 
3 477 THR n 
3 478 GLU n 
3 479 LEU n 
3 480 GLN n 
3 481 ALA n 
3 482 ILE n 
3 483 TYR n 
3 484 LEU n 
3 485 ALA n 
3 486 LEU n 
3 487 GLN n 
3 488 ASP n 
3 489 SER n 
3 490 GLY n 
3 491 LEU n 
3 492 GLU n 
3 493 VAL n 
3 494 ASN n 
3 495 ILE n 
3 496 VAL n 
3 497 THR n 
3 498 ASP n 
3 499 SER n 
3 500 GLN n 
3 501 TYR n 
3 502 ALA n 
3 503 LEU n 
3 504 GLY n 
3 505 ILE n 
3 506 ILE n 
3 507 GLN n 
3 508 ALA n 
3 509 GLN n 
3 510 PRO n 
3 511 ASP n 
3 512 LYS n 
3 513 SER n 
3 514 GLU n 
3 515 SER n 
3 516 GLU n 
3 517 LEU n 
3 518 VAL n 
3 519 ASN n 
3 520 GLN n 
3 521 ILE n 
3 522 ILE n 
3 523 GLU n 
3 524 GLN n 
3 525 LEU n 
3 526 ILE n 
3 527 LYS n 
3 528 LYS n 
3 529 GLU n 
3 530 LYS n 
3 531 VAL n 
3 532 TYR n 
3 533 LEU n 
3 534 ALA n 
3 535 TRP n 
3 536 VAL n 
3 537 PRO n 
3 538 ALA n 
3 539 HIS n 
3 540 LYS n 
3 541 GLY n 
3 542 ILE n 
3 543 GLY n 
3 544 GLY n 
3 545 ASN n 
3 546 GLU n 
3 547 GLN n 
3 548 VAL n 
3 549 ASP n 
3 550 LYS n 
3 551 LEU n 
3 552 VAL n 
3 553 SER n 
3 554 ALA n 
3 555 GLY n 
3 556 ILE n 
3 557 ARG n 
3 558 LYS n 
4 1   PRO n 
4 2   ILE n 
4 3   SER n 
4 4   PRO n 
4 5   ILE n 
4 6   GLU n 
4 7   THR n 
4 8   VAL n 
4 9   PRO n 
4 10  VAL n 
4 11  LYS n 
4 12  LEU n 
4 13  LYS n 
4 14  PRO n 
4 15  GLY n 
4 16  MET n 
4 17  ASP n 
4 18  GLY n 
4 19  PRO n 
4 20  LYS n 
4 21  VAL n 
4 22  LYS n 
4 23  GLN n 
4 24  TRP n 
4 25  PRO n 
4 26  LEU n 
4 27  THR n 
4 28  GLU n 
4 29  GLU n 
4 30  LYS n 
4 31  ILE n 
4 32  LYS n 
4 33  ALA n 
4 34  LEU n 
4 35  VAL n 
4 36  GLU n 
4 37  ILE n 
4 38  CYS n 
4 39  THR n 
4 40  GLU n 
4 41  MET n 
4 42  GLU n 
4 43  LYS n 
4 44  GLU n 
4 45  GLY n 
4 46  LYS n 
4 47  ILE n 
4 48  SER n 
4 49  LYS n 
4 50  ILE n 
4 51  GLY n 
4 52  PRO n 
4 53  GLU n 
4 54  ASN n 
4 55  PRO n 
4 56  TYR n 
4 57  ASN n 
4 58  THR n 
4 59  PRO n 
4 60  VAL n 
4 61  PHE n 
4 62  ALA n 
4 63  ILE n 
4 64  LYS n 
4 65  LYS n 
4 66  LYS n 
4 67  ASP n 
4 68  SER n 
4 69  THR n 
4 70  LYS n 
4 71  TRP n 
4 72  ARG n 
4 73  LYS n 
4 74  LEU n 
4 75  VAL n 
4 76  ASP n 
4 77  PHE n 
4 78  ARG n 
4 79  GLU n 
4 80  LEU n 
4 81  ASN n 
4 82  LYS n 
4 83  ARG n 
4 84  THR n 
4 85  GLN n 
4 86  ASP n 
4 87  PHE n 
4 88  TRP n 
4 89  GLU n 
4 90  VAL n 
4 91  GLN n 
4 92  LEU n 
4 93  GLY n 
4 94  ILE n 
4 95  PRO n 
4 96  HIS n 
4 97  PRO n 
4 98  ALA n 
4 99  GLY n 
4 100 LEU n 
4 101 LYS n 
4 102 LYS n 
4 103 LYS n 
4 104 LYS n 
4 105 SER n 
4 106 VAL n 
4 107 THR n 
4 108 VAL n 
4 109 LEU n 
4 110 ASP n 
4 111 VAL n 
4 112 GLY n 
4 113 ASP n 
4 114 ALA n 
4 115 TYR n 
4 116 PHE n 
4 117 SER n 
4 118 VAL n 
4 119 PRO n 
4 120 LEU n 
4 121 ASP n 
4 122 GLU n 
4 123 ASP n 
4 124 PHE n 
4 125 ARG n 
4 126 LYS n 
4 127 TYR n 
4 128 THR n 
4 129 ALA n 
4 130 PHE n 
4 131 THR n 
4 132 ILE n 
4 133 PRO n 
4 134 SER n 
4 135 ILE n 
4 136 ASN n 
4 137 ASN n 
4 138 GLU n 
4 139 THR n 
4 140 PRO n 
4 141 GLY n 
4 142 ILE n 
4 143 ARG n 
4 144 TYR n 
4 145 GLN n 
4 146 TYR n 
4 147 ASN n 
4 148 VAL n 
4 149 LEU n 
4 150 PRO n 
4 151 GLN n 
4 152 GLY n 
4 153 TRP n 
4 154 LYS n 
4 155 GLY n 
4 156 SER n 
4 157 PRO n 
4 158 ALA n 
4 159 ILE n 
4 160 PHE n 
4 161 GLN n 
4 162 SER n 
4 163 SER n 
4 164 MET n 
4 165 THR n 
4 166 LYS n 
4 167 ILE n 
4 168 LEU n 
4 169 GLU n 
4 170 PRO n 
4 171 PHE n 
4 172 LYS n 
4 173 LYS n 
4 174 GLN n 
4 175 ASN n 
4 176 PRO n 
4 177 ASP n 
4 178 ILE n 
4 179 VAL n 
4 180 ILE n 
4 181 TYR n 
4 182 GLN n 
4 183 TYR n 
4 184 ILE n 
4 185 ASP n 
4 186 ASP n 
4 187 LEU n 
4 188 TYR n 
4 189 VAL n 
4 190 GLY n 
4 191 SER n 
4 192 ASP n 
4 193 LEU n 
4 194 GLU n 
4 195 ILE n 
4 196 GLY n 
4 197 GLN n 
4 198 HIS n 
4 199 ARG n 
4 200 THR n 
4 201 LYS n 
4 202 ILE n 
4 203 GLU n 
4 204 GLU n 
4 205 LEU n 
4 206 ARG n 
4 207 GLN n 
4 208 HIS n 
4 209 LEU n 
4 210 LEU n 
4 211 ARG n 
4 212 TRP n 
4 213 GLY n 
4 214 LEU n 
4 215 THR n 
4 216 THR n 
4 217 PRO n 
4 218 ASP n 
4 219 LYS n 
4 220 LYS n 
4 221 HIS n 
4 222 GLN n 
4 223 LYS n 
4 224 GLU n 
4 225 PRO n 
4 226 PRO n 
4 227 PHE n 
4 228 LEU n 
4 229 TRP n 
4 230 MET n 
4 231 GLY n 
4 232 TYR n 
4 233 GLU n 
4 234 LEU n 
4 235 HIS n 
4 236 PRO n 
4 237 ASP n 
4 238 LYS n 
4 239 TRP n 
4 240 THR n 
4 241 VAL n 
4 242 GLN n 
4 243 PRO n 
4 244 ILE n 
4 245 VAL n 
4 246 LEU n 
4 247 PRO n 
4 248 GLU n 
4 249 LYS n 
4 250 ASP n 
4 251 SER n 
4 252 TRP n 
4 253 THR n 
4 254 VAL n 
4 255 ASN n 
4 256 ASP n 
4 257 ILE n 
4 258 GLN n 
4 259 LYS n 
4 260 LEU n 
4 261 VAL n 
4 262 GLY n 
4 263 LYS n 
4 264 LEU n 
4 265 ASN n 
4 266 TRP n 
4 267 ALA n 
4 268 SER n 
4 269 GLN n 
4 270 ILE n 
4 271 TYR n 
4 272 PRO n 
4 273 GLY n 
4 274 ILE n 
4 275 LYS n 
4 276 VAL n 
4 277 ARG n 
4 278 GLN n 
4 279 LEU n 
4 280 SER n 
4 281 LYS n 
4 282 LEU n 
4 283 LEU n 
4 284 ARG n 
4 285 GLY n 
4 286 THR n 
4 287 LYS n 
4 288 ALA n 
4 289 LEU n 
4 290 THR n 
4 291 GLU n 
4 292 VAL n 
4 293 ILE n 
4 294 PRO n 
4 295 LEU n 
4 296 THR n 
4 297 GLU n 
4 298 GLU n 
4 299 ALA n 
4 300 GLU n 
4 301 LEU n 
4 302 GLU n 
4 303 LEU n 
4 304 ALA n 
4 305 GLU n 
4 306 ASN n 
4 307 ARG n 
4 308 GLU n 
4 309 ILE n 
4 310 LEU n 
4 311 LYS n 
4 312 GLU n 
4 313 PRO n 
4 314 VAL n 
4 315 HIS n 
4 316 GLY n 
4 317 VAL n 
4 318 TYR n 
4 319 TYR n 
4 320 ASP n 
4 321 PRO n 
4 322 SER n 
4 323 LYS n 
4 324 ASP n 
4 325 LEU n 
4 326 ILE n 
4 327 ALA n 
4 328 GLU n 
4 329 ILE n 
4 330 GLN n 
4 331 LYS n 
4 332 GLN n 
4 333 GLY n 
4 334 GLN n 
4 335 GLY n 
4 336 GLN n 
4 337 TRP n 
4 338 THR n 
4 339 TYR n 
4 340 GLN n 
4 341 ILE n 
4 342 TYR n 
4 343 GLN n 
4 344 GLU n 
4 345 PRO n 
4 346 PHE n 
4 347 LYS n 
4 348 ASN n 
4 349 LEU n 
4 350 LYS n 
4 351 THR n 
4 352 GLY n 
4 353 LYS n 
4 354 TYR n 
4 355 ALA n 
4 356 ARG n 
4 357 MET n 
4 358 ARG n 
4 359 GLY n 
4 360 ALA n 
4 361 HIS n 
4 362 THR n 
4 363 ASN n 
4 364 ASP n 
4 365 VAL n 
4 366 LYS n 
4 367 GLN n 
4 368 LEU n 
4 369 THR n 
4 370 GLU n 
4 371 ALA n 
4 372 VAL n 
4 373 GLN n 
4 374 LYS n 
4 375 ILE n 
4 376 THR n 
4 377 THR n 
4 378 GLU n 
4 379 SER n 
4 380 ILE n 
4 381 VAL n 
4 382 ILE n 
4 383 TRP n 
4 384 GLY n 
4 385 LYS n 
4 386 THR n 
4 387 PRO n 
4 388 LYS n 
4 389 PHE n 
4 390 LYS n 
4 391 LEU n 
4 392 PRO n 
4 393 ILE n 
4 394 GLN n 
4 395 LYS n 
4 396 GLU n 
4 397 THR n 
4 398 TRP n 
4 399 GLU n 
4 400 THR n 
4 401 TRP n 
4 402 TRP n 
4 403 THR n 
4 404 GLU n 
4 405 TYR n 
4 406 TRP n 
4 407 GLN n 
4 408 ALA n 
4 409 THR n 
4 410 TRP n 
4 411 ILE n 
4 412 PRO n 
4 413 GLU n 
4 414 TRP n 
4 415 GLU n 
4 416 PHE n 
4 417 VAL n 
4 418 ASN n 
4 419 THR n 
4 420 PRO n 
4 421 PRO n 
4 422 LEU n 
4 423 VAL n 
4 424 LYS n 
4 425 LEU n 
4 426 TRP n 
4 427 TYR n 
4 428 GLN n 
4 429 LEU n 
4 430 GLU n 
5 1   ASP n 
5 2   ILE n 
5 3   GLN n 
5 4   MET n 
5 5   THR n 
5 6   GLN n 
5 7   THR n 
5 8   THR n 
5 9   SER n 
5 10  SER n 
5 11  LEU n 
5 12  SER n 
5 13  ALA n 
5 14  SER n 
5 15  LEU n 
5 16  GLY n 
5 17  ASP n 
5 18  ARG n 
5 19  VAL n 
5 20  THR n 
5 21  ILE n 
5 22  SER n 
5 23  CYS n 
5 24  SER n 
5 25  ALA n 
5 26  SER n 
5 27  GLN n 
5 28  ASP n 
5 29  ILE n 
5 30  SER n 
5 31  SER n 
5 32  TYR n 
5 33  LEU n 
5 34  ASN n 
5 35  TRP n 
5 36  TYR n 
5 37  GLN n 
5 38  GLN n 
5 39  LYS n 
5 40  PRO n 
5 41  GLU n 
5 42  GLY n 
5 43  THR n 
5 44  VAL n 
5 45  LYS n 
5 46  LEU n 
5 47  LEU n 
5 48  ILE n 
5 49  TYR n 
5 50  TYR n 
5 51  THR n 
5 52  SER n 
5 53  SER n 
5 54  LEU n 
5 55  HIS n 
5 56  SER n 
5 57  GLY n 
5 58  VAL n 
5 59  PRO n 
5 60  SER n 
5 61  ALA n 
5 62  PHE n 
5 63  SER n 
5 64  GLY n 
5 65  SER n 
5 66  GLY n 
5 67  SER n 
5 68  GLY n 
5 69  THR n 
5 70  ASP n 
5 71  TYR n 
5 72  SER n 
5 73  LEU n 
5 74  THR n 
5 75  ILE n 
5 76  SER n 
5 77  ASN n 
5 78  LEU n 
5 79  GLU n 
5 80  PRO n 
5 81  GLU n 
5 82  ASP n 
5 83  PHE n 
5 84  ALA n 
5 85  THR n 
5 86  TYR n 
5 87  TYR n 
5 88  CYS n 
5 89  GLN n 
5 90  GLN n 
5 91  TYR n 
5 92  SER n 
5 93  LYS n 
5 94  PHE n 
5 95  PRO n 
5 96  TRP n 
5 97  THR n 
5 98  PHE n 
5 99  GLY n 
5 100 GLY n 
5 101 GLY n 
5 102 THR n 
5 103 LYS n 
5 104 LEU n 
5 105 GLU n 
5 106 ILE n 
5 107 LYS n 
5 108 ARG n 
5 109 ALA n 
5 110 ASP n 
5 111 ALA n 
5 112 ALA n 
5 113 PRO n 
5 114 THR n 
5 115 VAL n 
5 116 SER n 
5 117 ILE n 
5 118 PHE n 
5 119 PRO n 
5 120 PRO n 
5 121 SER n 
5 122 SER n 
5 123 GLU n 
5 124 GLN n 
5 125 LEU n 
5 126 THR n 
5 127 SER n 
5 128 GLY n 
5 129 GLY n 
5 130 ALA n 
5 131 SER n 
5 132 VAL n 
5 133 VAL n 
5 134 CYS n 
5 135 PHE n 
5 136 LEU n 
5 137 ASN n 
5 138 ASN n 
5 139 PHE n 
5 140 TYR n 
5 141 PRO n 
5 142 LYS n 
5 143 ASP n 
5 144 ILE n 
5 145 ASN n 
5 146 VAL n 
5 147 ALA n 
5 148 TRP n 
5 149 ALA n 
5 150 ILE n 
5 151 ASP n 
5 152 GLY n 
5 153 SER n 
5 154 ALA n 
5 155 ALA n 
5 156 ALA n 
5 157 ASN n 
5 158 GLY n 
5 159 VAL n 
5 160 LEU n 
5 161 ASN n 
5 162 SER n 
5 163 TRP n 
5 164 THR n 
5 165 ASP n 
5 166 GLN n 
5 167 ASP n 
5 168 SER n 
5 169 LYS n 
5 170 ASP n 
5 171 SER n 
5 172 THR n 
5 173 TYR n 
5 174 SER n 
5 175 MET n 
5 176 SER n 
5 177 SER n 
5 178 THR n 
5 179 LEU n 
5 180 THR n 
5 181 LEU n 
5 182 THR n 
5 183 ALA n 
5 184 ASP n 
5 185 GLU n 
5 186 TYR n 
5 187 GLU n 
5 188 ALA n 
5 189 ALA n 
5 190 ASN n 
5 191 SER n 
5 192 TYR n 
5 193 THR n 
5 194 CYS n 
5 195 ALA n 
5 196 ALA n 
5 197 THR n 
5 198 HIS n 
5 199 LYS n 
5 200 THR n 
5 201 SER n 
5 202 THR n 
5 203 SER n 
5 204 PRO n 
5 205 ILE n 
5 206 VAL n 
5 207 LYS n 
5 208 SER n 
5 209 PHE n 
5 210 ASN n 
5 211 ALA n 
5 212 ASN n 
5 213 GLU n 
5 214 CYS n 
6 1   GLN n 
6 2   ILE n 
6 3   THR n 
6 4   LEU n 
6 5   LYS n 
6 6   GLU n 
6 7   SER n 
6 8   GLY n 
6 9   PRO n 
6 10  GLY n 
6 11  ILE n 
6 12  VAL n 
6 13  GLN n 
6 14  PRO n 
6 15  SER n 
6 16  GLN n 
6 17  PRO n 
6 18  PHE n 
6 19  ARG n 
6 20  LEU n 
6 21  THR n 
6 22  CYS n 
6 23  THR n 
6 24  PHE n 
6 25  SER n 
6 26  GLY n 
6 27  PHE n 
6 28  SER n 
6 29  LEU n 
6 30  SER n 
6 31  THR n 
6 32  SER n 
6 33  GLY n 
6 34  ILE n 
6 35  GLY n 
6 36  VAL n 
6 37  THR n 
6 38  TRP n 
6 39  ILE n 
6 40  ARG n 
6 41  GLN n 
6 42  PRO n 
6 43  SER n 
6 44  GLY n 
6 45  LYS n 
6 46  GLY n 
6 47  LEU n 
6 48  GLU n 
6 49  TRP n 
6 50  LEU n 
6 51  ALA n 
6 52  THR n 
6 53  ILE n 
6 54  TRP n 
6 55  TRP n 
6 56  ASP n 
6 57  ASP n 
6 58  ASP n 
6 59  ASN n 
6 60  ARG n 
6 61  TYR n 
6 62  ASN n 
6 63  PRO n 
6 64  SER n 
6 65  LEU n 
6 66  LYS n 
6 67  SER n 
6 68  ARG n 
6 69  LEU n 
6 70  THR n 
6 71  VAL n 
6 72  SER n 
6 73  LYS n 
6 74  ASP n 
6 75  THR n 
6 76  SER n 
6 77  ASN n 
6 78  ASN n 
6 79  GLN n 
6 80  ALA n 
6 81  PHE n 
6 82  LEU n 
6 83  ASN n 
6 84  MET n 
6 85  MET n 
6 86  THR n 
6 87  VAL n 
6 88  GLU n 
6 89  THR n 
6 90  ALA n 
6 91  ASP n 
6 92  THR n 
6 93  ALA n 
6 94  ILE n 
6 95  TYR n 
6 96  TYR n 
6 97  CYS n 
6 98  ALA n 
6 99  GLN n 
6 100 SER n 
6 101 ALA n 
6 102 ILE n 
6 103 THR n 
6 104 SER n 
6 105 VAL n 
6 106 THR n 
6 107 ASP n 
6 108 SER n 
6 109 ALA n 
6 110 MET n 
6 111 ASP n 
6 112 HIS n 
6 113 TRP n 
6 114 GLY n 
6 115 GLN n 
6 116 GLY n 
6 117 THR n 
6 118 SER n 
6 119 VAL n 
6 120 THR n 
6 121 VAL n 
6 122 SER n 
6 123 SER n 
6 124 ALA n 
6 125 ALA n 
6 126 THR n 
6 127 THR n 
6 128 PRO n 
6 129 PRO n 
6 130 SER n 
6 131 VAL n 
6 132 TYR n 
6 133 PRO n 
6 134 LEU n 
6 135 ALA n 
6 136 PRO n 
6 137 GLY n 
6 138 SER n 
6 139 ALA n 
6 140 ALA n 
6 141 GLN n 
6 142 THR n 
6 143 ASN n 
6 144 SER n 
6 145 MET n 
6 146 VAL n 
6 147 THR n 
6 148 LEU n 
6 149 GLY n 
6 150 CYS n 
6 151 LEU n 
6 152 VAL n 
6 153 LYS n 
6 154 GLY n 
6 155 TYR n 
6 156 PHE n 
6 157 PRO n 
6 158 GLU n 
6 159 PRO n 
6 160 VAL n 
6 161 THR n 
6 162 VAL n 
6 163 THR n 
6 164 TRP n 
6 165 ASN n 
6 166 SER n 
6 167 GLY n 
6 168 SER n 
6 169 LEU n 
6 170 SER n 
6 171 SER n 
6 172 GLY n 
6 173 VAL n 
6 174 HIS n 
6 175 THR n 
6 176 PHE n 
6 177 PRO n 
6 178 ALA n 
6 179 VAL n 
6 180 LEU n 
6 181 GLN n 
6 182 SER n 
6 183 ASP n 
6 184 LEU n 
6 185 TYR n 
6 186 THR n 
6 187 LEU n 
6 188 SER n 
6 189 SER n 
6 190 SER n 
6 191 VAL n 
6 192 THR n 
6 193 VAL n 
6 194 PRO n 
6 195 SER n 
6 196 SER n 
6 197 THR n 
6 198 TRP n 
6 199 PRO n 
6 200 SER n 
6 201 GLU n 
6 202 THR n 
6 203 VAL n 
6 204 THR n 
6 205 CYS n 
6 206 ASN n 
6 207 VAL n 
6 208 ALA n 
6 209 HIS n 
6 210 PRO n 
6 211 ALA n 
6 212 SER n 
6 213 SER n 
6 214 THR n 
6 215 LYS n 
6 216 VAL n 
6 217 ASP n 
6 218 LYS n 
6 219 LYS n 
6 220 ILE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? ? Lentivirus ? ? ? ? ? ? ? 'Human immunodeficiency virus 1' 11676 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? ? Lentivirus ? ? ? ? ? ? ? 'Human immunodeficiency virus 1' 11676 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
5 1 sample ? ? 'house mouse' 'Mus musculus' 10090 Mus ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample ? ? 'house mouse' 'Mus musculus' 10090 Mus ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP POL_HV1B1 3 P03366 168 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
;
? 
2 UNP POL_HV1B1 4 P03366 168 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLE
;
? 
3 PDB 1J5O      1 1J5O   ?   ? ? 
4 PDB 1J5O      2 1J5O   ?   ? ? 
5 PDB 1J5O      5 1J5O   ?   ? ? 
6 PDB 1J5O      6 1J5O   ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1J5O A 1 ? 558 ? P03366 168 ? 725 ? 1   558 
2 2 1J5O B 1 ? 430 ? P03366 168 ? 597 ? 1   430 
3 3 1J5O T 1 ? 19  ? 1J5O   801 ? 819 ? 801 819 
4 4 1J5O P 1 ? 18  ? 1J5O   821 ? 838 ? 821 838 
5 5 1J5O L 1 ? 214 ? 1J5O   1   ? 214 ? 1   214 
6 6 1J5O H 1 ? 220 ? 1J5O   1   ? 220 ? 1   220 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1J5O ILE A 184 ? UNP P03366 MET 351 ENGINEERED 184 1 
1 1J5O SER A 280 ? UNP P03366 CYS 447 ENGINEERED 280 2 
2 1J5O ILE B 184 ? UNP P03366 MET 351 ENGINEERED 184 3 
2 1J5O SER B 280 ? UNP P03366 CYS 447 ENGINEERED 280 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1J5O 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   10 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   76.88 
_exptl_crystal.density_Matthews      5.32 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    
'30 % SATURATED AMMONIUM SULFATE, 100 MM CACODYLATE PH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 277 ? 1 
2 105 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 'IMAGE PLATE' FUJI        1996-09-10 ? 
2 'IMAGE PLATE' MARRESEARCH 1997-06-10 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M ? 'SINGLE WAVELENGTH' x-ray 
2 1 M ? 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.918 1.0 
2 1.1   1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'CHESS BEAMLINE F1' CHESS F1  0.918 ? 
2 SYNCHROTRON 'NSLS BEAMLINE X25' NSLS  X25 1.1   ? 
# 
_reflns.entry_id                     1J5O 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             40 
_reflns.d_resolution_high            3.5 
_reflns.number_obs                   42062 
_reflns.number_all                   46038 
_reflns.percent_possible_obs         91.4 
_reflns.pdbx_Rmerge_I_obs            0.118 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.91 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1,2 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.5 
_reflns_shell.d_res_low              3.63 
_reflns_shell.percent_possible_all   83 
_reflns_shell.Rmerge_I_obs           0.4 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        2.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1J5O 
_refine.ls_number_reflns_obs                     39033 
_refine.ls_number_reflns_all                     46020 
_refine.pdbx_ls_sigma_I                          1 
_refine.pdbx_ls_sigma_F                          1 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10 
_refine.ls_d_res_high                            3.5 
_refine.ls_percent_reflns_obs                    91.5 
_refine.ls_R_factor_obs                          0.27 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.262 
_refine.ls_R_factor_R_free                       0.338 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1700 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10967 
_refine_hist.pdbx_number_atoms_nucleic_acid   753 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               11720 
_refine_hist.d_res_high                       3.5 
_refine_hist.d_res_low                        10 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.68  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1J5O 
_struct.title                     
'CRYSTAL STRUCTURE OF MET184ILE MUTANT OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH DOUBLE STRANDED DNA TEMPLATE-PRIMER' 
_struct.pdbx_descriptor           
'CRYSTAL STRUCTURE OF MET184ILE MUTANT OF HIV-1 REVERSE TRANSCRIPTASE IN COMPLEX WITH DOUBLE STRANDED DNA TEMPLATE-PRIMER' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1J5O 
_struct_keywords.pdbx_keywords   'TRANSFERASE/IMMUNE SYSTEM/DNA' 
_struct_keywords.text            
'HIV, REVERSE TRANSCRIPTASE, MET184ILE, 3TC, PROTEIN-DNA COMPLEX, DRUG RESISTANCE, M184I, TRANSFERASE-IMMUNE SYSTEM-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR C 27  ? GLY C 45  ? THR A 27  GLY A 45  1 ? 19 
HELX_P HELX_P2  2  PHE C 77  ? THR C 84  ? PHE A 77  THR A 84  1 ? 8  
HELX_P HELX_P3  3  ASP C 113 ? VAL C 118 ? ASP A 113 VAL A 118 1 ? 6  
HELX_P HELX_P4  4  ASP C 121 ? LYS C 126 ? ASP A 121 LYS A 126 1 ? 6  
HELX_P HELX_P5  5  LYS C 154 ? ASN C 175 ? LYS A 154 ASN A 175 1 ? 22 
HELX_P HELX_P6  6  GLU C 194 ? TRP C 212 ? GLU A 194 TRP A 212 1 ? 19 
HELX_P HELX_P7  10 ASN C 363 ? GLY C 384 ? ASN A 363 GLY A 384 1 ? 22 
HELX_P HELX_P8  11 GLN C 394 ? TYR C 405 ? GLN A 394 TYR A 405 1 ? 12 
HELX_P HELX_P9  12 THR C 473 ? ASP C 488 ? THR A 473 ASP A 488 1 ? 16 
HELX_P HELX_P10 13 SER C 499 ? ALA C 508 ? SER A 499 ALA A 508 1 ? 10 
HELX_P HELX_P11 14 SER C 515 ? LYS C 528 ? SER A 515 LYS A 528 1 ? 14 
HELX_P HELX_P12 15 GLY C 544 ? SER C 553 ? GLY A 544 SER A 553 1 ? 10 
HELX_P HELX_P13 16 THR D 27  ? GLU D 44  ? THR B 27  GLU B 44  1 ? 18 
HELX_P HELX_P14 17 PHE D 77  ? THR D 84  ? PHE B 77  THR B 84  1 ? 8  
HELX_P HELX_P15 18 PHE D 87  ? ILE D 94  ? PHE B 87  ILE B 94  1 ? 8  
HELX_P HELX_P16 19 ASP D 113 ? VAL D 118 ? ASP B 113 VAL B 118 1 ? 6  
HELX_P HELX_P17 20 GLU D 122 ? ALA D 129 ? GLU B 122 ALA B 129 5 ? 8  
HELX_P HELX_P18 21 SER D 134 ? GLU D 138 ? SER B 134 GLU B 138 5 ? 5  
HELX_P HELX_P19 22 LYS D 154 ? GLN D 174 ? LYS B 154 GLN B 174 1 ? 21 
HELX_P HELX_P20 23 GLU D 194 ? TRP D 212 ? GLU B 194 TRP B 212 1 ? 19 
HELX_P HELX_P21 24 GLY D 213 ? THR D 215 ? GLY B 213 THR B 215 5 ? 3  
HELX_P HELX_P22 25 PHE D 227 ? GLY D 231 ? PHE B 227 GLY B 231 5 ? 5  
HELX_P HELX_P23 29 ASN D 363 ? ILE D 382 ? ASN B 363 ILE B 382 1 ? 20 
HELX_P HELX_P24 30 GLN D 394 ? TRP D 402 ? GLN B 394 TRP B 402 1 ? 9  
HELX_P HELX_P25 31 THR D 403 ? TRP D 406 ? THR B 403 TRP B 406 5 ? 4  
HELX_P HELX_P26 32 PRO D 420 ? LEU D 425 ? PRO B 420 LEU B 425 1 ? 6  
HELX_P HELX_P27 33 SER E 121 ? THR E 126 ? SER L 121 THR L 126 1 ? 6  
HELX_P HELX_P28 34 THR E 182 ? ALA E 189 ? THR L 182 ALA L 189 1 ? 8  
HELX_P HELX_P29 35 LEU F 65  ? SER F 67  ? LEU H 65  SER H 67  5 ? 3  
HELX_P HELX_P30 36 THR F 75  ? ASN F 77  ? THR H 75  ASN H 77  5 ? 3  
HELX_P HELX_P31 37 GLU F 88  ? THR F 92  ? GLU H 88  THR H 92  5 ? 5  
HELX_P HELX_P32 38 SER F 196 ? GLU F 201 ? SER H 196 GLU H 201 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? E CYS 23  SG ? ? ? 1_555 E CYS 88  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ?            2.023 ? 
disulf2  disulf ? ? E CYS 134 SG ? ? ? 1_555 E CYS 194 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ?            2.038 ? 
disulf3  disulf ? ? F CYS 22  SG ? ? ? 1_555 F CYS 97  SG ? ? H CYS 22  H CYS 97  1_555 ? ? ? ? ? ? ?            2.030 ? 
disulf4  disulf ? ? F CYS 150 SG ? ? ? 1_555 F CYS 205 SG ? ? H CYS 150 H CYS 205 1_555 ? ? ? ? ? ? ?            2.033 ? 
hydrog1  hydrog ? ? A DT  2   N3 ? ? ? 1_555 B DA  18  N1 ? ? T DT  802 P DA  838 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DT  2   O4 ? ? ? 1_555 B DA  18  N6 ? ? T DT  802 P DA  838 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG  3   N1 ? ? ? 1_555 B DC  17  N3 ? ? T DG  803 P DC  837 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DG  3   N2 ? ? ? 1_555 B DC  17  O2 ? ? T DG  803 P DC  837 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG  3   O6 ? ? ? 1_555 B DC  17  N4 ? ? T DG  803 P DC  837 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG  4   N1 ? ? ? 1_555 B DC  16  N3 ? ? T DG  804 P DC  836 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DG  4   N2 ? ? ? 1_555 B DC  16  O2 ? ? T DG  804 P DC  836 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DG  4   O6 ? ? ? 1_555 B DC  16  N4 ? ? T DG  804 P DC  836 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DC  5   N4 ? ? ? 1_555 B DG  15  O6 ? ? T DC  805 P DG  835 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog10 hydrog ? ? A DG  6   N1 ? ? ? 1_555 B DC  14  N3 ? ? T DG  806 P DC  834 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  6   N2 ? ? ? 1_555 B DC  14  O2 ? ? T DG  806 P DC  834 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG  6   O6 ? ? ? 1_555 B DC  14  N4 ? ? T DG  806 P DC  834 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DC  7   N3 ? ? ? 1_555 B DG  13  N1 ? ? T DC  807 P DG  833 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DC  7   N4 ? ? ? 1_555 B DG  13  O6 ? ? T DC  807 P DG  833 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DC  7   O2 ? ? ? 1_555 B DG  13  N2 ? ? T DC  807 P DG  833 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DC  8   N3 ? ? ? 1_555 B DG  12  N1 ? ? T DC  808 P DG  832 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DC  8   N4 ? ? ? 1_555 B DG  12  O6 ? ? T DC  808 P DG  832 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC  8   O2 ? ? ? 1_555 B DG  12  N2 ? ? T DC  808 P DG  832 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC  9   N3 ? ? ? 1_555 B DG  11  N1 ? ? T DC  809 P DG  831 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DC  9   N4 ? ? ? 1_555 B DG  11  O6 ? ? T DC  809 P DG  831 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DC  9   O2 ? ? ? 1_555 B DG  11  N2 ? ? T DC  809 P DG  831 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DG  10  N1 ? ? ? 1_555 B DC  10  N3 ? ? T DG  810 P DC  830 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DG  10  N2 ? ? ? 1_555 B DC  10  O2 ? ? T DG  810 P DC  830 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DG  10  O6 ? ? ? 1_555 B DC  10  N4 ? ? T DG  810 P DC  830 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DA  11  N1 ? ? ? 1_555 B DT  9   N3 ? ? T DA  811 P DT  829 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DA  11  N6 ? ? ? 1_555 B DT  9   O4 ? ? T DA  811 P DT  829 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DA  12  N1 ? ? ? 1_555 B DT  8   N3 ? ? T DA  812 P DT  828 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DA  12  N6 ? ? ? 1_555 B DT  8   O4 ? ? T DA  812 P DT  828 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DC  13  N3 ? ? ? 1_555 B DG  7   N1 ? ? T DC  813 P DG  827 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DC  13  N4 ? ? ? 1_555 B DG  7   O6 ? ? T DC  813 P DG  827 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DC  13  O2 ? ? ? 1_555 B DG  7   N2 ? ? T DC  813 P DG  827 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DA  14  N1 ? ? ? 1_555 B DT  6   N3 ? ? T DA  814 P DT  826 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A DA  14  N6 ? ? ? 1_555 B DT  6   O4 ? ? T DA  814 P DT  826 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A DG  15  N1 ? ? ? 1_555 B DC  5   N3 ? ? T DG  815 P DC  825 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? A DG  15  N2 ? ? ? 1_555 B DC  5   O2 ? ? T DG  815 P DC  825 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? A DG  15  O6 ? ? ? 1_555 B DC  5   N4 ? ? T DG  815 P DC  825 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? A DG  16  N1 ? ? ? 1_555 B DC  4   N3 ? ? T DG  816 P DC  824 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? A DG  16  N2 ? ? ? 1_555 B DC  4   O2 ? ? T DG  816 P DC  824 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? A DG  16  O6 ? ? ? 1_555 B DC  4   N4 ? ? T DG  816 P DC  824 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? A DG  17  N1 ? ? ? 1_555 B DC  3   N3 ? ? T DG  817 P DC  823 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? A DG  17  N2 ? ? ? 1_555 B DC  3   O2 ? ? T DG  817 P DC  823 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? A DG  17  O6 ? ? ? 1_555 B DC  3   N4 ? ? T DG  817 P DC  823 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? A DA  18  N1 ? ? ? 1_555 B DT  2   N3 ? ? T DA  818 P DT  822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? A DA  18  N6 ? ? ? 1_555 B DT  2   O4 ? ? T DA  818 P DT  822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? A DC  19  N3 ? ? ? 1_555 B DG  1   N1 ? ? T DC  819 P DG  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? A DC  19  N4 ? ? ? 1_555 B DG  1   O6 ? ? T DC  819 P DG  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? A DC  19  O2 ? ? ? 1_555 B DG  1   N2 ? ? T DC  819 P DG  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 4 ? 
D ? 5 ? 
E ? 3 ? 
F ? 2 ? 
G ? 3 ? 
H ? 3 ? 
I ? 5 ? 
J ? 4 ? 
K ? 2 ? 
L ? 4 ? 
M ? 4 ? 
N ? 3 ? 
O ? 4 ? 
P ? 2 ? 
Q ? 5 ? 
R ? 4 ? 
S ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? parallel      
I 4 5 ? parallel      
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? parallel      
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? parallel      
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
Q 4 5 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE C 47  ? LYS C 49  ? ILE A 47  LYS A 49  
A 2 ILE C 142 ? TYR C 146 ? ILE A 142 TYR A 146 
A 3 ALA C 129 ? ILE C 132 ? ALA A 129 ILE A 132 
B 1 SER C 105 ? ASP C 110 ? SER A 105 ASP A 110 
B 2 ASP C 186 ? SER C 191 ? ASP A 186 SER A 191 
B 3 VAL C 179 ? TYR C 183 ? VAL A 179 TYR A 183 
C 1 PHE C 227 ? TRP C 229 ? PHE A 227 TRP A 229 
C 2 TYR C 232 ? LEU C 234 ? TYR A 232 LEU A 234 
C 3 GLY C 316 ? VAL C 317 ? GLY A 316 VAL A 317 
D 1 LYS C 347 ? TYR C 354 ? LYS A 347 TYR A 354 
D 2 TRP C 337 ? GLU C 344 ? TRP A 337 GLU A 344 
D 3 LYS C 388 ? LEU C 391 ? LYS A 388 LEU A 391 
D 4 TRP C 414 ? PHE C 416 ? TRP A 414 PHE A 416 
E 1 PHE C 440 ? GLY C 444 ? PHE A 440 GLY A 444 
E 2 LEU C 452 ? THR C 459 ? LEU A 452 THR A 459 
E 3 PRO C 468 ? THR C 470 ? PRO A 468 THR A 470 
F 1 ASN C 494 ? THR C 497 ? ASN A 494 THR A 497 
F 2 TYR C 532 ? TRP C 535 ? TYR A 532 TRP A 535 
G 1 ILE D 47  ? ILE D 50  ? ILE B 47  ILE B 50  
G 2 ILE D 142 ? TYR D 146 ? ILE B 142 TYR B 146 
G 3 PHE D 130 ? ILE D 132 ? PHE B 130 ILE B 132 
H 1 VAL D 106 ? ASP D 110 ? VAL B 106 ASP B 110 
H 2 ASP D 186 ? SER D 191 ? ASP B 186 SER B 191 
H 3 ILE D 178 ? TYR D 183 ? ILE B 178 TYR B 183 
I 1 LYS D 347 ? TYR D 354 ? LYS B 347 TYR B 354 
I 2 TRP D 337 ? GLU D 344 ? TRP B 337 GLU B 344 
I 3 ILE D 326 ? GLN D 330 ? ILE B 326 GLN B 330 
I 4 LYS D 388 ? LEU D 391 ? LYS B 388 LEU B 391 
I 5 TRP D 414 ? PHE D 416 ? TRP B 414 PHE B 416 
J 1 THR E 5   ? GLN E 6   ? THR L 5   GLN L 6   
J 2 VAL E 19  ? SER E 24  ? VAL L 19  SER L 24  
J 3 ASP E 70  ? ILE E 75  ? ASP L 70  ILE L 75  
J 4 PHE E 62  ? SER E 67  ? PHE L 62  SER L 67  
K 1 SER E 10  ? ALA E 13  ? SER L 10  ALA L 13  
K 2 LYS E 103 ? ILE E 106 ? LYS L 103 ILE L 106 
L 1 SER E 53  ? LEU E 54  ? SER L 53  LEU L 54  
L 2 VAL E 44  ? TYR E 49  ? VAL L 44  TYR L 49  
L 3 LEU E 33  ? GLN E 38  ? LEU L 33  GLN L 38  
L 4 THR E 85  ? GLN E 90  ? THR L 85  GLN L 90  
M 1 THR E 114 ? PHE E 118 ? THR L 114 PHE L 118 
M 2 SER E 131 ? PHE E 139 ? SER L 131 PHE L 139 
M 3 TYR E 173 ? THR E 180 ? TYR L 173 THR L 180 
M 4 VAL E 159 ? TRP E 163 ? VAL L 159 TRP L 163 
N 1 ASN E 145 ? ALA E 149 ? ASN L 145 ALA L 149 
N 2 SER E 191 ? THR E 197 ? SER L 191 THR L 197 
N 3 PRO E 204 ? ASN E 210 ? PRO L 204 ASN L 210 
O 1 LEU F 4   ? SER F 7   ? LEU H 4   SER H 7   
O 2 PHE F 18  ? PHE F 24  ? PHE H 18  PHE H 24  
O 3 GLN F 79  ? MET F 84  ? GLN H 79  MET H 84  
O 4 LEU F 69  ? ASP F 74  ? LEU H 69  ASP H 74  
P 1 ILE F 11  ? VAL F 12  ? ILE H 11  VAL H 12  
P 2 THR F 120 ? VAL F 121 ? THR H 120 VAL H 121 
Q 1 ARG F 60  ? TYR F 61  ? ARG H 60  TYR H 61  
Q 2 GLU F 48  ? TRP F 54  ? GLU H 48  TRP H 54  
Q 3 ILE F 34  ? GLN F 41  ? ILE H 34  GLN H 41  
Q 4 ILE F 94  ? SER F 104 ? ILE H 94  SER H 104 
Q 5 ASP F 107 ? HIS F 112 ? ASP H 107 HIS H 112 
R 1 SER F 130 ? LEU F 134 ? SER H 130 LEU H 134 
R 2 MET F 145 ? TYR F 155 ? MET H 145 TYR H 155 
R 3 TYR F 185 ? PRO F 194 ? TYR H 185 PRO H 194 
R 4 VAL F 173 ? LEU F 180 ? VAL H 173 LEU H 180 
S 1 THR F 161 ? TRP F 164 ? THR H 161 TRP H 164 
S 2 THR F 204 ? HIS F 209 ? THR H 204 HIS H 209 
S 3 THR F 214 ? LYS F 219 ? THR H 214 LYS H 219 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER C 48  ? N SER A 48  O GLN C 145 ? O GLN A 145 
A 2 3 O TYR C 144 ? O TYR A 144 N PHE C 130 ? N PHE A 130 
B 1 2 N LEU C 109 ? N LEU A 109 O LEU C 187 ? O LEU A 187 
B 2 3 O GLY C 190 ? O GLY A 190 N VAL C 179 ? N VAL A 179 
C 1 2 N TRP C 229 ? N TRP A 229 O TYR C 232 ? O TYR A 232 
C 2 3 N TRP C 239 ? N TRP A 239 O GLY C 316 ? O GLY A 316 
D 1 2 O LYS C 350 ? O LYS A 350 N ILE C 341 ? N ILE A 341 
D 2 3 N ALA C 327 ? N ALA A 327 O LYS C 390 ? O LYS A 390 
D 3 4 N PHE C 389 ? N PHE A 389 O GLU C 415 ? O GLU A 415 
E 1 2 N ASP C 443 ? N ASP A 443 O GLY C 456 ? O GLY A 456 
E 2 3 N GLY C 453 ? N GLY A 453 O LEU C 469 ? O LEU A 469 
F 1 2 N THR C 497 ? N THR A 497 O ALA C 534 ? O ALA A 534 
G 1 2 N ILE D 50  ? N ILE B 50  O ARG D 143 ? O ARG B 143 
G 2 3 O ILE D 142 ? O ILE B 142 N ILE D 132 ? N ILE B 132 
H 1 2 N THR D 107 ? N THR B 107 O VAL D 189 ? O VAL B 189 
H 2 3 O TYR D 188 ? O TYR B 188 N TYR D 181 ? N TYR B 181 
I 1 2 O LEU D 349 ? O LEU B 349 N ILE D 341 ? N ILE B 341 
I 2 3 O TYR D 342 ? O TYR B 342 N ILE D 326 ? N ILE B 326 
I 3 4 N ALA D 327 ? N ALA B 327 O LYS D 388 ? O LYS B 388 
I 4 5 N LEU D 391 ? N LEU B 391 O GLU D 415 ? O GLU B 415 
J 1 2 N THR E 5   ? N THR L 5   O SER E 24  ? O SER L 24  
J 2 3 N ILE E 21  ? N ILE L 21  O LEU E 73  ? O LEU L 73  
J 3 4 O ASP E 70  ? O ASP L 70  N SER E 67  ? N SER L 67  
K 1 2 N ALA E 13  ? N ALA L 13  O GLU E 105 ? O GLU L 105 
L 1 2 O SER E 53  ? O SER L 53  N TYR E 49  ? N TYR L 49  
L 2 3 O LEU E 47  ? O LEU L 47  N TRP E 35  ? N TRP L 35  
L 3 4 N ASN E 34  ? N ASN L 34  O GLN E 89  ? O GLN L 89  
M 1 2 N PHE E 118 ? N PHE L 118 O VAL E 133 ? O VAL L 133 
M 2 3 N VAL E 132 ? N VAL L 132 O LEU E 179 ? O LEU L 179 
M 3 4 O THR E 178 ? O THR L 178 N LEU E 160 ? N LEU L 160 
N 1 2 N ALA E 147 ? N ALA L 147 O ALA E 195 ? O ALA L 195 
N 2 3 N ALA E 196 ? N ALA L 196 O ILE E 205 ? O ILE L 205 
O 1 2 N LYS F 5   ? N LYS H 5   O THR F 23  ? O THR H 23  
O 2 3 N CYS F 22  ? N CYS H 22  O ALA F 80  ? O ALA H 80  
O 3 4 O PHE F 81  ? O PHE H 81  N SER F 72  ? N SER H 72  
P 1 2 N VAL F 12  ? N VAL H 12  O THR F 120 ? O THR H 120 
Q 1 2 O ARG F 60  ? O ARG H 60  N THR F 52  ? N THR H 52  
Q 2 3 O ALA F 51  ? O ALA H 51  N TRP F 38  ? N TRP H 38  
Q 3 4 N THR F 37  ? N THR H 37  O ALA F 98  ? O ALA H 98  
Q 4 5 N GLN F 99  ? N GLN H 99  O HIS F 112 ? O HIS H 112 
R 1 2 N TYR F 132 ? N TYR H 132 O LEU F 151 ? O LEU H 151 
R 2 3 N VAL F 152 ? N VAL H 152 O LEU F 187 ? O LEU H 187 
R 3 4 O SER F 190 ? O SER H 190 N HIS F 174 ? N HIS H 174 
S 1 2 N THR F 161 ? N THR H 161 O ALA F 208 ? O ALA H 208 
S 2 3 N CYS F 205 ? N CYS H 205 O LYS F 218 ? O LYS H 218 
# 
_database_PDB_matrix.entry_id          1J5O 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1J5O 
_atom_sites.fract_transf_matrix[1][1]   0.00591 
_atom_sites.fract_transf_matrix[1][2]   0.00341 
_atom_sites.fract_transf_matrix[1][3]   0.00000 
_atom_sites.fract_transf_matrix[2][1]   0.00000 
_atom_sites.fract_transf_matrix[2][2]   0.00682 
_atom_sites.fract_transf_matrix[2][3]   0.00000 
_atom_sites.fract_transf_matrix[3][1]   0.00000 
_atom_sites.fract_transf_matrix[3][2]   0.00000 
_atom_sites.fract_transf_matrix[3][3]   0.00451 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     O "O5'" . DA  A 1 1   ? 24.252  141.830 -32.916 1.00 85.54  ? 801 DA  T "O5'" 1 
ATOM 2     C "C5'" . DA  A 1 1   ? 23.317  140.805 -33.329 1.00 86.32  ? 801 DA  T "C5'" 1 
ATOM 3     C "C4'" . DA  A 1 1   ? 22.856  139.865 -32.230 1.00 86.12  ? 801 DA  T "C4'" 1 
ATOM 4     O "O4'" . DA  A 1 1   ? 24.014  139.466 -31.445 1.00 86.48  ? 801 DA  T "O4'" 1 
ATOM 5     C "C3'" . DA  A 1 1   ? 21.836  140.468 -31.241 1.00 85.81  ? 801 DA  T "C3'" 1 
ATOM 6     O "O3'" . DA  A 1 1   ? 20.770  139.546 -30.846 1.00 85.38  ? 801 DA  T "O3'" 1 
ATOM 7     C "C2'" . DA  A 1 1   ? 22.702  140.872 -30.058 1.00 84.61  ? 801 DA  T "C2'" 1 
ATOM 8     C "C1'" . DA  A 1 1   ? 23.851  139.861 -30.080 1.00 83.52  ? 801 DA  T "C1'" 1 
ATOM 9     N N9    . DA  A 1 1   ? 25.136  140.389 -29.590 1.00 80.38  ? 801 DA  T N9    1 
ATOM 10    C C8    . DA  A 1 1   ? 25.986  141.287 -30.213 1.00 78.62  ? 801 DA  T C8    1 
ATOM 11    N N7    . DA  A 1 1   ? 27.073  141.556 -29.525 1.00 77.11  ? 801 DA  T N7    1 
ATOM 12    C C5    . DA  A 1 1   ? 26.934  140.795 -28.368 1.00 77.83  ? 801 DA  T C5    1 
ATOM 13    C C6    . DA  A 1 1   ? 27.755  140.638 -27.229 1.00 77.56  ? 801 DA  T C6    1 
ATOM 14    N N6    . DA  A 1 1   ? 28.929  141.263 -27.061 1.00 77.24  ? 801 DA  T N6    1 
ATOM 15    N N1    . DA  A 1 1   ? 27.321  139.800 -26.257 1.00 77.69  ? 801 DA  T N1    1 
ATOM 16    C C2    . DA  A 1 1   ? 26.141  139.171 -26.426 1.00 77.96  ? 801 DA  T C2    1 
ATOM 17    N N3    . DA  A 1 1   ? 25.284  139.237 -27.444 1.00 77.67  ? 801 DA  T N3    1 
ATOM 18    C C4    . DA  A 1 1   ? 25.744  140.074 -28.394 1.00 78.49  ? 801 DA  T C4    1 
ATOM 19    P P     . DT  A 1 2   ? 19.237  140.090 -30.704 1.00 69.03  ? 802 DT  T P     1 
ATOM 20    O OP1   . DT  A 1 2   ? 18.408  139.606 -31.861 1.00 69.40  ? 802 DT  T OP1   1 
ATOM 21    O OP2   . DT  A 1 2   ? 19.379  141.561 -30.485 1.00 68.94  ? 802 DT  T OP2   1 
ATOM 22    O "O5'" . DT  A 1 2   ? 18.701  139.447 -29.323 1.00 66.53  ? 802 DT  T "O5'" 1 
ATOM 23    C "C5'" . DT  A 1 2   ? 17.738  138.386 -29.304 1.00 61.75  ? 802 DT  T "C5'" 1 
ATOM 24    C "C4'" . DT  A 1 2   ? 17.837  137.600 -28.010 1.00 58.71  ? 802 DT  T "C4'" 1 
ATOM 25    O "O4'" . DT  A 1 2   ? 19.215  137.603 -27.566 1.00 57.47  ? 802 DT  T "O4'" 1 
ATOM 26    C "C3'" . DT  A 1 2   ? 17.007  138.097 -26.815 1.00 57.13  ? 802 DT  T "C3'" 1 
ATOM 27    O "O3'" . DT  A 1 2   ? 16.412  137.011 -26.107 1.00 55.73  ? 802 DT  T "O3'" 1 
ATOM 28    C "C2'" . DT  A 1 2   ? 18.012  138.739 -25.888 1.00 56.92  ? 802 DT  T "C2'" 1 
ATOM 29    C "C1'" . DT  A 1 2   ? 19.313  138.042 -26.215 1.00 56.76  ? 802 DT  T "C1'" 1 
ATOM 30    N N1    . DT  A 1 2   ? 20.354  139.059 -26.137 1.00 56.18  ? 802 DT  T N1    1 
ATOM 31    C C2    . DT  A 1 2   ? 21.204  139.053 -25.066 1.00 55.43  ? 802 DT  T C2    1 
ATOM 32    O O2    . DT  A 1 2   ? 21.185  138.189 -24.214 1.00 55.57  ? 802 DT  T O2    1 
ATOM 33    N N3    . DT  A 1 2   ? 22.074  140.109 -25.019 1.00 54.60  ? 802 DT  T N3    1 
ATOM 34    C C4    . DT  A 1 2   ? 22.168  141.149 -25.920 1.00 54.90  ? 802 DT  T C4    1 
ATOM 35    O O4    . DT  A 1 2   ? 22.973  142.052 -25.731 1.00 54.71  ? 802 DT  T O4    1 
ATOM 36    C C5    . DT  A 1 2   ? 21.261  141.076 -27.041 1.00 55.31  ? 802 DT  T C5    1 
ATOM 37    C C7    . DT  A 1 2   ? 21.279  142.167 -28.066 1.00 55.73  ? 802 DT  T C7    1 
ATOM 38    C C6    . DT  A 1 2   ? 20.425  140.034 -27.103 1.00 55.76  ? 802 DT  T C6    1 
ATOM 39    P P     . DG  A 1 3   ? 15.636  137.303 -24.721 1.00 63.20  ? 803 DG  T P     1 
ATOM 40    O OP1   . DG  A 1 3   ? 14.273  136.739 -24.835 1.00 63.32  ? 803 DG  T OP1   1 
ATOM 41    O OP2   . DG  A 1 3   ? 15.817  138.724 -24.330 1.00 63.39  ? 803 DG  T OP2   1 
ATOM 42    O "O5'" . DG  A 1 3   ? 16.365  136.441 -23.604 1.00 62.40  ? 803 DG  T "O5'" 1 
ATOM 43    C "C5'" . DG  A 1 3   ? 17.445  136.975 -22.862 1.00 61.62  ? 803 DG  T "C5'" 1 
ATOM 44    C "C4'" . DG  A 1 3   ? 17.368  136.514 -21.427 1.00 62.26  ? 803 DG  T "C4'" 1 
ATOM 45    O "O4'" . DG  A 1 3   ? 18.704  136.610 -20.911 1.00 62.84  ? 803 DG  T "O4'" 1 
ATOM 46    C "C3'" . DG  A 1 3   ? 16.499  137.387 -20.525 1.00 62.78  ? 803 DG  T "C3'" 1 
ATOM 47    O "O3'" . DG  A 1 3   ? 15.806  136.687 -19.506 1.00 61.57  ? 803 DG  T "O3'" 1 
ATOM 48    C "C2'" . DG  A 1 3   ? 17.471  138.321 -19.839 1.00 64.13  ? 803 DG  T "C2'" 1 
ATOM 49    C "C1'" . DG  A 1 3   ? 18.839  137.733 -20.066 1.00 65.34  ? 803 DG  T "C1'" 1 
ATOM 50    N N9    . DG  A 1 3   ? 19.537  138.740 -20.828 1.00 68.49  ? 803 DG  T N9    1 
ATOM 51    C C8    . DG  A 1 3   ? 19.394  138.982 -22.169 1.00 68.66  ? 803 DG  T C8    1 
ATOM 52    N N7    . DG  A 1 3   ? 20.047  140.034 -22.564 1.00 69.74  ? 803 DG  T N7    1 
ATOM 53    C C5    . DG  A 1 3   ? 20.680  140.487 -21.420 1.00 71.05  ? 803 DG  T C5    1 
ATOM 54    C C6    . DG  A 1 3   ? 21.512  141.591 -21.232 1.00 72.44  ? 803 DG  T C6    1 
ATOM 55    O O6    . DG  A 1 3   ? 21.866  142.426 -22.064 1.00 72.85  ? 803 DG  T O6    1 
ATOM 56    N N1    . DG  A 1 3   ? 21.940  141.692 -19.912 1.00 73.56  ? 803 DG  T N1    1 
ATOM 57    C C2    . DG  A 1 3   ? 21.595  140.827 -18.899 1.00 73.43  ? 803 DG  T C2    1 
ATOM 58    N N2    . DG  A 1 3   ? 22.105  141.097 -17.680 1.00 73.37  ? 803 DG  T N2    1 
ATOM 59    N N3    . DG  A 1 3   ? 20.807  139.781 -19.070 1.00 72.56  ? 803 DG  T N3    1 
ATOM 60    C C4    . DG  A 1 3   ? 20.388  139.676 -20.347 1.00 70.39  ? 803 DG  T C4    1 
ATOM 61    P P     . DG  A 1 4   ? 14.975  137.533 -18.414 1.00 59.46  ? 804 DG  T P     1 
ATOM 62    O OP1   . DG  A 1 4   ? 13.745  136.795 -18.053 1.00 59.96  ? 804 DG  T OP1   1 
ATOM 63    O OP2   . DG  A 1 4   ? 14.884  138.922 -18.919 1.00 59.63  ? 804 DG  T OP2   1 
ATOM 64    O "O5'" . DG  A 1 4   ? 15.902  137.552 -17.130 1.00 58.14  ? 804 DG  T "O5'" 1 
ATOM 65    C "C5'" . DG  A 1 4   ? 17.142  138.229 -17.136 1.00 56.90  ? 804 DG  T "C5'" 1 
ATOM 66    C "C4'" . DG  A 1 4   ? 17.515  138.591 -15.724 1.00 57.96  ? 804 DG  T "C4'" 1 
ATOM 67    O "O4'" . DG  A 1 4   ? 18.734  139.352 -15.786 1.00 57.24  ? 804 DG  T "O4'" 1 
ATOM 68    C "C3'" . DG  A 1 4   ? 16.478  139.491 -15.080 1.00 59.18  ? 804 DG  T "C3'" 1 
ATOM 69    O "O3'" . DG  A 1 4   ? 16.281  139.235 -13.701 1.00 61.26  ? 804 DG  T "O3'" 1 
ATOM 70    C "C2'" . DG  A 1 4   ? 17.006  140.895 -15.299 1.00 59.15  ? 804 DG  T "C2'" 1 
ATOM 71    C "C1'" . DG  A 1 4   ? 18.484  140.723 -15.563 1.00 58.17  ? 804 DG  T "C1'" 1 
ATOM 72    N N9    . DG  A 1 4   ? 18.801  141.422 -16.794 1.00 59.07  ? 804 DG  T N9    1 
ATOM 73    C C8    . DG  A 1 4   ? 18.431  141.072 -18.076 1.00 59.40  ? 804 DG  T C8    1 
ATOM 74    N N7    . DG  A 1 4   ? 18.813  141.942 -18.970 1.00 59.70  ? 804 DG  T N7    1 
ATOM 75    C C5    . DG  A 1 4   ? 19.487  142.910 -18.234 1.00 61.48  ? 804 DG  T C5    1 
ATOM 76    C C6    . DG  A 1 4   ? 20.124  144.104 -18.647 1.00 62.98  ? 804 DG  T C6    1 
ATOM 77    O O6    . DG  A 1 4   ? 20.229  144.570 -19.795 1.00 64.44  ? 804 DG  T O6    1 
ATOM 78    N N1    . DG  A 1 4   ? 20.675  144.791 -17.558 1.00 64.02  ? 804 DG  T N1    1 
ATOM 79    C C2    . DG  A 1 4   ? 20.617  144.378 -16.242 1.00 63.61  ? 804 DG  T C2    1 
ATOM 80    N N2    . DG  A 1 4   ? 21.188  145.174 -15.323 1.00 63.92  ? 804 DG  T N2    1 
ATOM 81    N N3    . DG  A 1 4   ? 20.034  143.263 -15.853 1.00 62.63  ? 804 DG  T N3    1 
ATOM 82    C C4    . DG  A 1 4   ? 19.491  142.585 -16.889 1.00 60.70  ? 804 DG  T C4    1 
ATOM 83    P P     . DC  A 1 5   ? 15.289  140.227 -12.937 1.00 61.83  ? 805 DC  T P     1 
ATOM 84    O OP1   . DC  A 1 5   ? 15.078  139.669 -11.584 1.00 61.45  ? 805 DC  T OP1   1 
ATOM 85    O OP2   . DC  A 1 5   ? 14.118  140.509 -13.816 1.00 60.63  ? 805 DC  T OP2   1 
ATOM 86    O "O5'" . DC  A 1 5   ? 16.135  141.571 -12.825 1.00 61.68  ? 805 DC  T "O5'" 1 
ATOM 87    C "C5'" . DC  A 1 5   ? 17.393  141.581 -12.152 1.00 63.73  ? 805 DC  T "C5'" 1 
ATOM 88    C "C4'" . DC  A 1 5   ? 17.552  142.872 -11.390 1.00 64.62  ? 805 DC  T "C4'" 1 
ATOM 89    O "O4'" . DC  A 1 5   ? 18.175  143.810 -12.301 1.00 64.34  ? 805 DC  T "O4'" 1 
ATOM 90    C "C3'" . DC  A 1 5   ? 16.193  143.467 -11.015 1.00 64.86  ? 805 DC  T "C3'" 1 
ATOM 91    O "O3'" . DC  A 1 5   ? 16.179  144.124 -9.745  1.00 63.66  ? 805 DC  T "O3'" 1 
ATOM 92    C "C2'" . DC  A 1 5   ? 15.908  144.440 -12.139 1.00 66.47  ? 805 DC  T "C2'" 1 
ATOM 93    C "C1'" . DC  A 1 5   ? 17.290  144.877 -12.599 1.00 67.40  ? 805 DC  T "C1'" 1 
ATOM 94    N N1    . DC  A 1 5   ? 17.350  145.151 -14.051 1.00 68.25  ? 805 DC  T N1    1 
ATOM 95    C C2    . DC  A 1 5   ? 18.447  145.837 -14.574 1.00 67.85  ? 805 DC  T C2    1 
ATOM 96    O O2    . DC  A 1 5   ? 19.380  146.127 -13.824 1.00 68.68  ? 805 DC  T O2    1 
ATOM 97    N N3    . DC  A 1 5   ? 18.460  146.165 -15.886 1.00 68.73  ? 805 DC  T N3    1 
ATOM 98    C C4    . DC  A 1 5   ? 17.439  145.816 -16.670 1.00 70.39  ? 805 DC  T C4    1 
ATOM 99    N N4    . DC  A 1 5   ? 17.479  146.182 -17.953 1.00 71.83  ? 805 DC  T N4    1 
ATOM 100   C C5    . DC  A 1 5   ? 16.325  145.081 -16.173 1.00 70.50  ? 805 DC  T C5    1 
ATOM 101   C C6    . DC  A 1 5   ? 16.325  144.767 -14.872 1.00 70.00  ? 805 DC  T C6    1 
ATOM 102   P P     . DG  A 1 6   ? 14.846  144.901 -9.272  1.00 65.00  ? 806 DG  T P     1 
ATOM 103   O OP1   . DG  A 1 6   ? 14.625  144.631 -7.830  1.00 64.85  ? 806 DG  T OP1   1 
ATOM 104   O OP2   . DG  A 1 6   ? 13.746  144.645 -10.238 1.00 62.69  ? 806 DG  T OP2   1 
ATOM 105   O "O5'" . DG  A 1 6   ? 15.231  146.434 -9.458  1.00 65.57  ? 806 DG  T "O5'" 1 
ATOM 106   C "C5'" . DG  A 1 6   ? 16.301  147.024 -8.715  1.00 68.81  ? 806 DG  T "C5'" 1 
ATOM 107   C "C4'" . DG  A 1 6   ? 16.314  148.518 -8.939  1.00 70.51  ? 806 DG  T "C4'" 1 
ATOM 108   O "O4'" . DG  A 1 6   ? 16.693  148.748 -10.320 1.00 69.92  ? 806 DG  T "O4'" 1 
ATOM 109   C "C3'" . DG  A 1 6   ? 14.926  149.143 -8.760  1.00 69.63  ? 806 DG  T "C3'" 1 
ATOM 110   O "O3'" . DG  A 1 6   ? 14.960  150.455 -8.187  1.00 68.53  ? 806 DG  T "O3'" 1 
ATOM 111   C "C2'" . DG  A 1 6   ? 14.386  149.212 -10.172 1.00 70.89  ? 806 DG  T "C2'" 1 
ATOM 112   C "C1'" . DG  A 1 6   ? 15.634  149.383 -11.022 1.00 71.76  ? 806 DG  T "C1'" 1 
ATOM 113   N N9    . DG  A 1 6   ? 15.463  148.716 -12.308 1.00 72.32  ? 806 DG  T N9    1 
ATOM 114   C C8    . DG  A 1 6   ? 14.975  147.446 -12.513 1.00 72.67  ? 806 DG  T C8    1 
ATOM 115   N N7    . DG  A 1 6   ? 14.818  147.157 -13.775 1.00 72.19  ? 806 DG  T N7    1 
ATOM 116   C C5    . DG  A 1 6   ? 15.255  148.289 -14.444 1.00 72.66  ? 806 DG  T C5    1 
ATOM 117   C C6    . DG  A 1 6   ? 15.302  148.565 -15.820 1.00 72.07  ? 806 DG  T C6    1 
ATOM 118   O O6    . DG  A 1 6   ? 14.960  147.835 -16.756 1.00 72.69  ? 806 DG  T O6    1 
ATOM 119   N N1    . DG  A 1 6   ? 15.802  149.840 -16.072 1.00 71.64  ? 806 DG  T N1    1 
ATOM 120   C C2    . DG  A 1 6   ? 16.210  150.732 -15.110 1.00 71.91  ? 806 DG  T C2    1 
ATOM 121   N N2    . DG  A 1 6   ? 16.661  151.918 -15.549 1.00 71.78  ? 806 DG  T N2    1 
ATOM 122   N N3    . DG  A 1 6   ? 16.175  150.481 -13.814 1.00 72.29  ? 806 DG  T N3    1 
ATOM 123   C C4    . DG  A 1 6   ? 15.684  149.253 -13.553 1.00 71.94  ? 806 DG  T C4    1 
ATOM 124   P P     . DC  A 1 7   ? 13.587  151.291 -8.030  1.00 67.78  ? 807 DC  T P     1 
ATOM 125   O OP1   . DC  A 1 7   ? 13.338  151.543 -6.586  1.00 66.88  ? 807 DC  T OP1   1 
ATOM 126   O OP2   . DC  A 1 7   ? 12.530  150.635 -8.845  1.00 66.00  ? 807 DC  T OP2   1 
ATOM 127   O "O5'" . DC  A 1 7   ? 13.925  152.679 -8.732  1.00 65.08  ? 807 DC  T "O5'" 1 
ATOM 128   C "C5'" . DC  A 1 7   ? 14.587  152.713 -9.992  1.00 60.80  ? 807 DC  T "C5'" 1 
ATOM 129   C "C4'" . DC  A 1 7   ? 14.478  154.087 -10.606 1.00 59.12  ? 807 DC  T "C4'" 1 
ATOM 130   O "O4'" . DC  A 1 7   ? 14.519  153.910 -12.040 1.00 58.08  ? 807 DC  T "O4'" 1 
ATOM 131   C "C3'" . DC  A 1 7   ? 13.184  154.855 -10.300 1.00 58.88  ? 807 DC  T "C3'" 1 
ATOM 132   O "O3'" . DC  A 1 7   ? 13.450  156.266 -10.148 1.00 57.21  ? 807 DC  T "O3'" 1 
ATOM 133   C "C2'" . DC  A 1 7   ? 12.308  154.555 -11.503 1.00 57.85  ? 807 DC  T "C2'" 1 
ATOM 134   C "C1'" . DC  A 1 7   ? 13.308  154.337 -12.633 1.00 58.40  ? 807 DC  T "C1'" 1 
ATOM 135   N N1    . DC  A 1 7   ? 12.896  153.294 -13.575 1.00 58.95  ? 807 DC  T N1    1 
ATOM 136   C C2    . DC  A 1 7   ? 13.051  153.522 -14.935 1.00 58.27  ? 807 DC  T C2    1 
ATOM 137   O O2    . DC  A 1 7   ? 13.566  154.586 -15.300 1.00 57.22  ? 807 DC  T O2    1 
ATOM 138   N N3    . DC  A 1 7   ? 12.642  152.580 -15.815 1.00 57.37  ? 807 DC  T N3    1 
ATOM 139   C C4    . DC  A 1 7   ? 12.114  151.438 -15.370 1.00 58.25  ? 807 DC  T C4    1 
ATOM 140   N N4    . DC  A 1 7   ? 11.723  150.539 -16.266 1.00 56.71  ? 807 DC  T N4    1 
ATOM 141   C C5    . DC  A 1 7   ? 11.962  151.171 -13.982 1.00 58.90  ? 807 DC  T C5    1 
ATOM 142   C C6    . DC  A 1 7   ? 12.362  152.118 -13.127 1.00 59.66  ? 807 DC  T C6    1 
ATOM 143   P P     . DC  A 1 8   ? 12.261  157.289 -9.751  1.00 53.25  ? 808 DC  T P     1 
ATOM 144   O OP1   . DC  A 1 8   ? 12.916  158.515 -9.242  1.00 53.71  ? 808 DC  T OP1   1 
ATOM 145   O OP2   . DC  A 1 8   ? 11.233  156.611 -8.928  1.00 53.04  ? 808 DC  T OP2   1 
ATOM 146   O "O5'" . DC  A 1 8   ? 11.605  157.642 -11.147 1.00 53.38  ? 808 DC  T "O5'" 1 
ATOM 147   C "C5'" . DC  A 1 8   ? 12.431  157.893 -12.271 1.00 56.26  ? 808 DC  T "C5'" 1 
ATOM 148   C "C4'" . DC  A 1 8   ? 11.574  158.158 -13.479 1.00 60.56  ? 808 DC  T "C4'" 1 
ATOM 149   O "O4'" . DC  A 1 8   ? 11.394  156.912 -14.204 1.00 62.07  ? 808 DC  T "O4'" 1 
ATOM 150   C "C3'" . DC  A 1 8   ? 10.169  158.651 -13.114 1.00 64.67  ? 808 DC  T "C3'" 1 
ATOM 151   O "O3'" . DC  A 1 8   ? 9.735   159.676 -14.020 1.00 68.21  ? 808 DC  T "O3'" 1 
ATOM 152   C "C2'" . DC  A 1 8   ? 9.314   157.409 -13.272 1.00 64.17  ? 808 DC  T "C2'" 1 
ATOM 153   C "C1'" . DC  A 1 8   ? 10.010  156.704 -14.423 1.00 63.21  ? 808 DC  T "C1'" 1 
ATOM 154   N N1    . DC  A 1 8   ? 9.746   155.257 -14.497 1.00 62.87  ? 808 DC  T N1    1 
ATOM 155   C C2    . DC  A 1 8   ? 9.794   154.619 -15.743 1.00 61.67  ? 808 DC  T C2    1 
ATOM 156   O O2    . DC  A 1 8   ? 10.133  155.271 -16.736 1.00 61.81  ? 808 DC  T O2    1 
ATOM 157   N N3    . DC  A 1 8   ? 9.472   153.311 -15.830 1.00 62.32  ? 808 DC  T N3    1 
ATOM 158   C C4    . DC  A 1 8   ? 9.127   152.636 -14.729 1.00 62.38  ? 808 DC  T C4    1 
ATOM 159   N N4    . DC  A 1 8   ? 8.784   151.353 -14.861 1.00 61.88  ? 808 DC  T N4    1 
ATOM 160   C C5    . DC  A 1 8   ? 9.109   153.251 -13.444 1.00 62.44  ? 808 DC  T C5    1 
ATOM 161   C C6    . DC  A 1 8   ? 9.427   154.547 -13.373 1.00 63.12  ? 808 DC  T C6    1 
ATOM 162   P P     . DC  A 1 9   ? 8.395   160.515 -13.703 1.00 68.91  ? 809 DC  T P     1 
ATOM 163   O OP1   . DC  A 1 9   ? 8.474   161.791 -14.457 1.00 69.86  ? 809 DC  T OP1   1 
ATOM 164   O OP2   . DC  A 1 9   ? 8.202   160.549 -12.229 1.00 68.40  ? 809 DC  T OP2   1 
ATOM 165   O "O5'" . DC  A 1 9   ? 7.232   159.644 -14.353 1.00 68.74  ? 809 DC  T "O5'" 1 
ATOM 166   C "C5'" . DC  A 1 9   ? 6.141   160.274 -15.011 1.00 71.84  ? 809 DC  T "C5'" 1 
ATOM 167   C "C4'" . DC  A 1 9   ? 6.196   159.992 -16.492 1.00 74.42  ? 809 DC  T "C4'" 1 
ATOM 168   O "O4'" . DC  A 1 9   ? 6.732   158.661 -16.700 1.00 73.42  ? 809 DC  T "O4'" 1 
ATOM 169   C "C3'" . DC  A 1 9   ? 4.820   160.006 -17.159 1.00 76.13  ? 809 DC  T "C3'" 1 
ATOM 170   O "O3'" . DC  A 1 9   ? 4.886   160.557 -18.484 1.00 81.13  ? 809 DC  T "O3'" 1 
ATOM 171   C "C2'" . DC  A 1 9   ? 4.434   158.539 -17.193 1.00 75.89  ? 809 DC  T "C2'" 1 
ATOM 172   C "C1'" . DC  A 1 9   ? 5.776   157.849 -17.372 1.00 74.12  ? 809 DC  T "C1'" 1 
ATOM 173   N N1    . DC  A 1 9   ? 5.829   156.495 -16.794 1.00 72.55  ? 809 DC  T N1    1 
ATOM 174   C C2    . DC  A 1 9   ? 5.387   155.425 -17.569 1.00 71.20  ? 809 DC  T C2    1 
ATOM 175   O O2    . DC  A 1 9   ? 4.970   155.654 -18.710 1.00 71.12  ? 809 DC  T O2    1 
ATOM 176   N N3    . DC  A 1 9   ? 5.424   154.176 -17.062 1.00 70.30  ? 809 DC  T N3    1 
ATOM 177   C C4    . DC  A 1 9   ? 5.878   153.974 -15.826 1.00 69.99  ? 809 DC  T C4    1 
ATOM 178   N N4    . DC  A 1 9   ? 5.898   152.723 -15.367 1.00 68.86  ? 809 DC  T N4    1 
ATOM 179   C C5    . DC  A 1 9   ? 6.334   155.046 -15.007 1.00 70.53  ? 809 DC  T C5    1 
ATOM 180   C C6    . DC  A 1 9   ? 6.292   156.279 -15.525 1.00 72.28  ? 809 DC  T C6    1 
ATOM 181   P P     . DG  A 1 10  ? 3.522   160.959 -19.245 1.00 84.84  ? 810 DG  T P     1 
ATOM 182   O OP1   . DG  A 1 10  ? 3.804   161.088 -20.704 1.00 84.75  ? 810 DG  T OP1   1 
ATOM 183   O OP2   . DG  A 1 10  ? 2.940   162.114 -18.506 1.00 84.79  ? 810 DG  T OP2   1 
ATOM 184   O "O5'" . DG  A 1 10  ? 2.597   159.680 -19.001 1.00 84.42  ? 810 DG  T "O5'" 1 
ATOM 185   C "C5'" . DG  A 1 10  ? 1.310   159.534 -19.613 1.00 84.43  ? 810 DG  T "C5'" 1 
ATOM 186   C "C4'" . DG  A 1 10  ? 1.261   158.250 -20.412 1.00 84.54  ? 810 DG  T "C4'" 1 
ATOM 187   O "O4'" . DG  A 1 10  ? 2.022   157.219 -19.736 1.00 82.54  ? 810 DG  T "O4'" 1 
ATOM 188   C "C3'" . DG  A 1 10  ? -0.133  157.667 -20.646 1.00 83.74  ? 810 DG  T "C3'" 1 
ATOM 189   O "O3'" . DG  A 1 10  ? -0.218  157.097 -21.955 1.00 85.43  ? 810 DG  T "O3'" 1 
ATOM 190   C "C2'" . DG  A 1 10  ? -0.228  156.565 -19.605 1.00 82.62  ? 810 DG  T "C2'" 1 
ATOM 191   C "C1'" . DG  A 1 10  ? 1.211   156.077 -19.506 1.00 81.93  ? 810 DG  T "C1'" 1 
ATOM 192   N N9    . DG  A 1 10  ? 1.591   155.520 -18.206 1.00 79.99  ? 810 DG  T N9    1 
ATOM 193   C C8    . DG  A 1 10  ? 1.854   156.221 -17.054 1.00 78.77  ? 810 DG  T C8    1 
ATOM 194   N N7    . DG  A 1 10  ? 2.164   155.452 -16.047 1.00 78.26  ? 810 DG  T N7    1 
ATOM 195   C C5    . DG  A 1 10  ? 2.104   154.168 -16.565 1.00 78.58  ? 810 DG  T C5    1 
ATOM 196   C C6    . DG  A 1 10  ? 2.340   152.920 -15.942 1.00 78.77  ? 810 DG  T C6    1 
ATOM 197   O O6    . DG  A 1 10  ? 2.653   152.697 -14.771 1.00 80.32  ? 810 DG  T O6    1 
ATOM 198   N N1    . DG  A 1 10  ? 2.176   151.862 -16.828 1.00 78.45  ? 810 DG  T N1    1 
ATOM 199   C C2    . DG  A 1 10  ? 1.826   151.985 -18.145 1.00 78.44  ? 810 DG  T C2    1 
ATOM 200   N N2    . DG  A 1 10  ? 1.721   150.839 -18.831 1.00 77.14  ? 810 DG  T N2    1 
ATOM 201   N N3    . DG  A 1 10  ? 1.600   153.147 -18.743 1.00 78.88  ? 810 DG  T N3    1 
ATOM 202   C C4    . DG  A 1 10  ? 1.756   154.189 -17.897 1.00 78.91  ? 810 DG  T C4    1 
ATOM 203   P P     . DA  A 1 11  ? -1.654  156.941 -22.661 1.00 88.62  ? 811 DA  T P     1 
ATOM 204   O OP1   . DA  A 1 11  ? -1.877  158.110 -23.554 1.00 88.21  ? 811 DA  T OP1   1 
ATOM 205   O OP2   . DA  A 1 11  ? -2.619  156.652 -21.563 1.00 88.22  ? 811 DA  T OP2   1 
ATOM 206   O "O5'" . DA  A 1 11  ? -1.506  155.635 -23.565 1.00 87.16  ? 811 DA  T "O5'" 1 
ATOM 207   C "C5'" . DA  A 1 11  ? -0.896  154.466 -23.028 1.00 86.74  ? 811 DA  T "C5'" 1 
ATOM 208   C "C4'" . DA  A 1 11  ? -1.844  153.290 -23.087 1.00 85.09  ? 811 DA  T "C4'" 1 
ATOM 209   O "O4'" . DA  A 1 11  ? -1.540  152.469 -21.933 1.00 83.58  ? 811 DA  T "O4'" 1 
ATOM 210   C "C3'" . DA  A 1 11  ? -3.331  153.620 -22.959 1.00 84.16  ? 811 DA  T "C3'" 1 
ATOM 211   O "O3'" . DA  A 1 11  ? -4.109  152.641 -23.676 1.00 85.79  ? 811 DA  T "O3'" 1 
ATOM 212   C "C2'" . DA  A 1 11  ? -3.566  153.585 -21.461 1.00 83.16  ? 811 DA  T "C2'" 1 
ATOM 213   C "C1'" . DA  A 1 11  ? -2.607  152.508 -20.989 1.00 81.05  ? 811 DA  T "C1'" 1 
ATOM 214   N N9    . DA  A 1 11  ? -2.031  152.831 -19.687 1.00 78.53  ? 811 DA  T N9    1 
ATOM 215   C C8    . DA  A 1 11  ? -1.696  154.083 -19.243 1.00 76.98  ? 811 DA  T C8    1 
ATOM 216   N N7    . DA  A 1 11  ? -1.208  154.099 -18.027 1.00 77.28  ? 811 DA  T N7    1 
ATOM 217   C C5    . DA  A 1 11  ? -1.223  152.767 -17.642 1.00 76.95  ? 811 DA  T C5    1 
ATOM 218   C C6    . DA  A 1 11  ? -0.830  152.127 -16.459 1.00 74.66  ? 811 DA  T C6    1 
ATOM 219   N N6    . DA  A 1 11  ? -0.355  152.779 -15.399 1.00 73.71  ? 811 DA  T N6    1 
ATOM 220   N N1    . DA  A 1 11  ? -0.949  150.782 -16.399 1.00 75.05  ? 811 DA  T N1    1 
ATOM 221   C C2    . DA  A 1 11  ? -1.449  150.137 -17.462 1.00 75.90  ? 811 DA  T C2    1 
ATOM 222   N N3    . DA  A 1 11  ? -1.868  150.631 -18.629 1.00 77.20  ? 811 DA  T N3    1 
ATOM 223   C C4    . DA  A 1 11  ? -1.724  151.970 -18.657 1.00 78.20  ? 811 DA  T C4    1 
ATOM 224   P P     . DA  A 1 12  ? -5.293  151.831 -22.928 1.00 87.50  ? 812 DA  T P     1 
ATOM 225   O OP1   . DA  A 1 12  ? -6.162  151.215 -23.970 1.00 86.65  ? 812 DA  T OP1   1 
ATOM 226   O OP2   . DA  A 1 12  ? -5.909  152.694 -21.881 1.00 86.68  ? 812 DA  T OP2   1 
ATOM 227   O "O5'" . DA  A 1 12  ? -4.532  150.654 -22.172 1.00 84.20  ? 812 DA  T "O5'" 1 
ATOM 228   C "C5'" . DA  A 1 12  ? -4.506  149.330 -22.707 1.00 81.91  ? 812 DA  T "C5'" 1 
ATOM 229   C "C4'" . DA  A 1 12  ? -5.346  148.413 -21.850 1.00 80.52  ? 812 DA  T "C4'" 1 
ATOM 230   O "O4'" . DA  A 1 12  ? -4.912  148.590 -20.479 1.00 77.88  ? 812 DA  T "O4'" 1 
ATOM 231   C "C3'" . DA  A 1 12  ? -6.843  148.734 -21.846 1.00 79.50  ? 812 DA  T "C3'" 1 
ATOM 232   O "O3'" . DA  A 1 12  ? -7.596  147.516 -21.669 1.00 81.48  ? 812 DA  T "O3'" 1 
ATOM 233   C "C2'" . DA  A 1 12  ? -6.982  149.695 -20.680 1.00 77.86  ? 812 DA  T "C2'" 1 
ATOM 234   C "C1'" . DA  A 1 12  ? -5.972  149.128 -19.701 1.00 74.81  ? 812 DA  T "C1'" 1 
ATOM 235   N N9    . DA  A 1 12  ? -5.406  150.116 -18.791 1.00 71.84  ? 812 DA  T N9    1 
ATOM 236   C C8    . DA  A 1 12  ? -5.248  151.468 -18.978 1.00 70.33  ? 812 DA  T C8    1 
ATOM 237   N N7    . DA  A 1 12  ? -4.729  152.083 -17.946 1.00 68.76  ? 812 DA  T N7    1 
ATOM 238   C C5    . DA  A 1 12  ? -4.524  151.066 -17.023 1.00 67.57  ? 812 DA  T C5    1 
ATOM 239   C C6    . DA  A 1 12  ? -3.998  151.063 -15.726 1.00 69.08  ? 812 DA  T C6    1 
ATOM 240   N N6    . DA  A 1 12  ? -3.555  152.163 -15.113 1.00 68.18  ? 812 DA  T N6    1 
ATOM 241   N N1    . DA  A 1 12  ? -3.937  149.879 -15.071 1.00 67.82  ? 812 DA  T N1    1 
ATOM 242   C C2    . DA  A 1 12  ? -4.372  148.776 -15.701 1.00 67.61  ? 812 DA  T C2    1 
ATOM 243   N N3    . DA  A 1 12  ? -4.882  148.654 -16.925 1.00 67.71  ? 812 DA  T N3    1 
ATOM 244   C C4    . DA  A 1 12  ? -4.932  149.850 -17.536 1.00 69.15  ? 812 DA  T C4    1 
ATOM 245   P P     . DC  A 1 13  ? -8.510  147.299 -20.351 1.00 83.18  ? 813 DC  T P     1 
ATOM 246   O OP1   . DC  A 1 13  ? -9.354  146.092 -20.567 1.00 82.82  ? 813 DC  T OP1   1 
ATOM 247   O OP2   . DC  A 1 13  ? -9.154  148.590 -19.966 1.00 82.56  ? 813 DC  T OP2   1 
ATOM 248   O "O5'" . DC  A 1 13  ? -7.461  146.933 -19.208 1.00 82.17  ? 813 DC  T "O5'" 1 
ATOM 249   C "C5'" . DC  A 1 13  ? -6.750  145.696 -19.241 1.00 81.72  ? 813 DC  T "C5'" 1 
ATOM 250   C "C4'" . DC  A 1 13  ? -6.971  144.935 -17.954 1.00 79.97  ? 813 DC  T "C4'" 1 
ATOM 251   O "O4'" . DC  A 1 13  ? -6.553  145.762 -16.842 1.00 79.02  ? 813 DC  T "O4'" 1 
ATOM 252   C "C3'" . DC  A 1 13  ? -8.431  144.573 -17.688 1.00 81.18  ? 813 DC  T "C3'" 1 
ATOM 253   O "O3'" . DC  A 1 13  ? -8.526  143.300 -17.035 1.00 84.24  ? 813 DC  T "O3'" 1 
ATOM 254   C "C2'" . DC  A 1 13  ? -8.916  145.697 -16.792 1.00 79.49  ? 813 DC  T "C2'" 1 
ATOM 255   C "C1'" . DC  A 1 13  ? -7.664  146.116 -16.029 1.00 77.99  ? 813 DC  T "C1'" 1 
ATOM 256   N N1    . DC  A 1 13  ? -7.589  147.567 -15.789 1.00 74.46  ? 813 DC  T N1    1 
ATOM 257   C C2    . DC  A 1 13  ? -7.233  148.031 -14.516 1.00 72.98  ? 813 DC  T C2    1 
ATOM 258   O O2    . DC  A 1 13  ? -7.006  147.209 -13.615 1.00 70.64  ? 813 DC  T O2    1 
ATOM 259   N N3    . DC  A 1 13  ? -7.146  149.361 -14.303 1.00 71.21  ? 813 DC  T N3    1 
ATOM 260   C C4    . DC  A 1 13  ? -7.394  150.215 -15.299 1.00 72.15  ? 813 DC  T C4    1 
ATOM 261   N N4    . DC  A 1 13  ? -7.274  151.518 -15.048 1.00 69.71  ? 813 DC  T N4    1 
ATOM 262   C C5    . DC  A 1 13  ? -7.773  149.769 -16.598 1.00 72.47  ? 813 DC  T C5    1 
ATOM 263   C C6    . DC  A 1 13  ? -7.855  148.452 -16.798 1.00 73.61  ? 813 DC  T C6    1 
ATOM 264   P P     . DA  A 1 14  ? -9.935  142.515 -17.008 1.00 85.81  ? 814 DA  T P     1 
ATOM 265   O OP1   . DA  A 1 14  ? -9.761  141.125 -17.522 1.00 85.45  ? 814 DA  T OP1   1 
ATOM 266   O OP2   . DA  A 1 14  ? -10.952 143.407 -17.626 1.00 86.80  ? 814 DA  T OP2   1 
ATOM 267   O "O5'" . DA  A 1 14  ? -10.245 142.406 -15.457 1.00 85.00  ? 814 DA  T "O5'" 1 
ATOM 268   C "C5'" . DA  A 1 14  ? -9.212  142.049 -14.552 1.00 84.78  ? 814 DA  T "C5'" 1 
ATOM 269   C "C4'" . DA  A 1 14  ? -9.534  142.565 -13.175 1.00 85.90  ? 814 DA  T "C4'" 1 
ATOM 270   O "O4'" . DA  A 1 14  ? -9.297  143.991 -13.065 1.00 85.96  ? 814 DA  T "O4'" 1 
ATOM 271   C "C3'" . DA  A 1 14  ? -10.994 142.355 -12.781 1.00 85.89  ? 814 DA  T "C3'" 1 
ATOM 272   O "O3'" . DA  A 1 14  ? -11.044 142.014 -11.406 1.00 85.10  ? 814 DA  T "O3'" 1 
ATOM 273   C "C2'" . DA  A 1 14  ? -11.608 143.730 -12.967 1.00 86.27  ? 814 DA  T "C2'" 1 
ATOM 274   C "C1'" . DA  A 1 14  ? -10.456 144.600 -12.506 1.00 85.48  ? 814 DA  T "C1'" 1 
ATOM 275   N N9    . DA  A 1 14  ? -10.494 146.001 -12.935 1.00 84.84  ? 814 DA  T N9    1 
ATOM 276   C C8    . DA  A 1 14  ? -10.832 146.500 -14.169 1.00 83.59  ? 814 DA  T C8    1 
ATOM 277   N N7    . DA  A 1 14  ? -10.718 147.803 -14.261 1.00 82.43  ? 814 DA  T N7    1 
ATOM 278   C C5    . DA  A 1 14  ? -10.288 148.192 -13.000 1.00 81.54  ? 814 DA  T C5    1 
ATOM 279   C C6    . DA  A 1 14  ? -9.972  149.445 -12.457 1.00 79.52  ? 814 DA  T C6    1 
ATOM 280   N N6    . DA  A 1 14  ? -10.032 150.585 -13.146 1.00 79.38  ? 814 DA  T N6    1 
ATOM 281   N N1    . DA  A 1 14  ? -9.583  149.491 -11.167 1.00 78.99  ? 814 DA  T N1    1 
ATOM 282   C C2    . DA  A 1 14  ? -9.516  148.347 -10.477 1.00 79.03  ? 814 DA  T C2    1 
ATOM 283   N N3    . DA  A 1 14  ? -9.781  147.108 -10.876 1.00 80.32  ? 814 DA  T N3    1 
ATOM 284   C C4    . DA  A 1 14  ? -10.163 147.096 -12.165 1.00 83.03  ? 814 DA  T C4    1 
ATOM 285   P P     . DG  A 1 15  ? -12.365 141.340 -10.817 1.00 85.37  ? 815 DG  T P     1 
ATOM 286   O OP1   . DG  A 1 15  ? -11.994 139.985 -10.337 1.00 86.17  ? 815 DG  T OP1   1 
ATOM 287   O OP2   . DG  A 1 15  ? -13.439 141.504 -11.840 1.00 84.17  ? 815 DG  T OP2   1 
ATOM 288   O "O5'" . DG  A 1 15  ? -12.700 142.227 -9.543  1.00 82.88  ? 815 DG  T "O5'" 1 
ATOM 289   C "C5'" . DG  A 1 15  ? -11.841 142.223 -8.414  1.00 79.12  ? 815 DG  T "C5'" 1 
ATOM 290   C "C4'" . DG  A 1 15  ? -12.267 143.312 -7.464  1.00 76.58  ? 815 DG  T "C4'" 1 
ATOM 291   O "O4'" . DG  A 1 15  ? -12.109 144.583 -8.142  1.00 74.40  ? 815 DG  T "O4'" 1 
ATOM 292   C "C3'" . DG  A 1 15  ? -13.744 143.213 -7.093  1.00 76.99  ? 815 DG  T "C3'" 1 
ATOM 293   O "O3'" . DG  A 1 15  ? -13.934 143.679 -5.755  1.00 77.91  ? 815 DG  T "O3'" 1 
ATOM 294   C "C2'" . DG  A 1 15  ? -14.406 144.142 -8.092  1.00 74.82  ? 815 DG  T "C2'" 1 
ATOM 295   C "C1'" . DG  A 1 15  ? -13.363 145.238 -8.219  1.00 74.36  ? 815 DG  T "C1'" 1 
ATOM 296   N N9    . DG  A 1 15  ? -13.399 145.994 -9.467  1.00 73.05  ? 815 DG  T N9    1 
ATOM 297   C C8    . DG  A 1 15  ? -13.340 145.489 -10.742 1.00 71.25  ? 815 DG  T C8    1 
ATOM 298   N N7    . DG  A 1 15  ? -13.382 146.415 -11.662 1.00 72.03  ? 815 DG  T N7    1 
ATOM 299   C C5    . DG  A 1 15  ? -13.478 147.607 -10.950 1.00 72.63  ? 815 DG  T C5    1 
ATOM 300   C C6    . DG  A 1 15  ? -13.554 148.964 -11.408 1.00 74.14  ? 815 DG  T C6    1 
ATOM 301   O O6    . DG  A 1 15  ? -13.555 149.386 -12.568 1.00 75.32  ? 815 DG  T O6    1 
ATOM 302   N N1    . DG  A 1 15  ? -13.632 149.864 -10.350 1.00 73.04  ? 815 DG  T N1    1 
ATOM 303   C C2    . DG  A 1 15  ? -13.633 149.524 -9.025  1.00 72.24  ? 815 DG  T C2    1 
ATOM 304   N N2    . DG  A 1 15  ? -13.693 150.557 -8.164  1.00 70.28  ? 815 DG  T N2    1 
ATOM 305   N N3    . DG  A 1 15  ? -13.575 148.267 -8.579  1.00 72.81  ? 815 DG  T N3    1 
ATOM 306   C C4    . DG  A 1 15  ? -13.495 147.368 -9.593  1.00 73.17  ? 815 DG  T C4    1 
ATOM 307   P P     . DG  A 1 16  ? -14.548 142.690 -4.649  1.00 81.40  ? 816 DG  T P     1 
ATOM 308   O OP1   . DG  A 1 16  ? -13.735 141.444 -4.605  1.00 81.54  ? 816 DG  T OP1   1 
ATOM 309   O OP2   . DG  A 1 16  ? -16.006 142.615 -4.933  1.00 81.18  ? 816 DG  T OP2   1 
ATOM 310   O "O5'" . DG  A 1 16  ? -14.355 143.460 -3.270  1.00 80.75  ? 816 DG  T "O5'" 1 
ATOM 311   C "C5'" . DG  A 1 16  ? -15.418 144.235 -2.725  1.00 84.99  ? 816 DG  T "C5'" 1 
ATOM 312   C "C4'" . DG  A 1 16  ? -15.132 145.709 -2.902  1.00 88.38  ? 816 DG  T "C4'" 1 
ATOM 313   O "O4'" . DG  A 1 16  ? -14.933 146.036 -4.307  1.00 87.24  ? 816 DG  T "O4'" 1 
ATOM 314   C "C3'" . DG  A 1 16  ? -16.230 146.654 -2.399  1.00 90.09  ? 816 DG  T "C3'" 1 
ATOM 315   O "O3'" . DG  A 1 16  ? -15.625 147.734 -1.664  1.00 95.13  ? 816 DG  T "O3'" 1 
ATOM 316   C "C2'" . DG  A 1 16  ? -16.887 147.153 -3.682  1.00 87.81  ? 816 DG  T "C2'" 1 
ATOM 317   C "C1'" . DG  A 1 16  ? -15.702 147.193 -4.634  1.00 85.33  ? 816 DG  T "C1'" 1 
ATOM 318   N N9    . DG  A 1 16  ? -15.986 147.180 -6.075  1.00 80.68  ? 816 DG  T N9    1 
ATOM 319   C C8    . DG  A 1 16  ? -16.052 146.078 -6.894  1.00 79.24  ? 816 DG  T C8    1 
ATOM 320   N N7    . DG  A 1 16  ? -16.254 146.380 -8.149  1.00 76.93  ? 816 DG  T N7    1 
ATOM 321   C C5    . DG  A 1 16  ? -16.344 147.763 -8.164  1.00 74.37  ? 816 DG  T C5    1 
ATOM 322   C C6    . DG  A 1 16  ? -16.549 148.654 -9.247  1.00 71.19  ? 816 DG  T C6    1 
ATOM 323   O O6    . DG  A 1 16  ? -16.692 148.385 -10.446 1.00 67.82  ? 816 DG  T O6    1 
ATOM 324   N N1    . DG  A 1 16  ? -16.574 149.978 -8.824  1.00 71.24  ? 816 DG  T N1    1 
ATOM 325   C C2    . DG  A 1 16  ? -16.421 150.394 -7.523  1.00 72.36  ? 816 DG  T C2    1 
ATOM 326   N N2    . DG  A 1 16  ? -16.459 151.721 -7.312  1.00 72.57  ? 816 DG  T N2    1 
ATOM 327   N N3    . DG  A 1 16  ? -16.235 149.571 -6.502  1.00 74.04  ? 816 DG  T N3    1 
ATOM 328   C C4    . DG  A 1 16  ? -16.201 148.280 -6.892  1.00 76.00  ? 816 DG  T C4    1 
ATOM 329   P P     . DG  A 1 17  ? -16.452 148.482 -0.498  1.00 99.26  ? 817 DG  T P     1 
ATOM 330   O OP1   . DG  A 1 17  ? -15.472 149.111 0.440   1.00 99.08  ? 817 DG  T OP1   1 
ATOM 331   O OP2   . DG  A 1 17  ? -17.464 147.520 0.033   1.00 98.67  ? 817 DG  T OP2   1 
ATOM 332   O "O5'" . DG  A 1 17  ? -17.216 149.643 -1.284  1.00 97.95  ? 817 DG  T "O5'" 1 
ATOM 333   C "C5'" . DG  A 1 17  ? -18.612 149.873 -1.105  1.00 95.63  ? 817 DG  T "C5'" 1 
ATOM 334   C "C4'" . DG  A 1 17  ? -19.015 151.152 -1.801  1.00 93.35  ? 817 DG  T "C4'" 1 
ATOM 335   O "O4'" . DG  A 1 17  ? -18.691 151.064 -3.211  1.00 91.31  ? 817 DG  T "O4'" 1 
ATOM 336   C "C3'" . DG  A 1 17  ? -20.508 151.465 -1.734  1.00 94.41  ? 817 DG  T "C3'" 1 
ATOM 337   O "O3'" . DG  A 1 17  ? -20.690 152.882 -1.635  1.00 97.35  ? 817 DG  T "O3'" 1 
ATOM 338   C "C2'" . DG  A 1 17  ? -21.023 150.956 -3.065  1.00 91.85  ? 817 DG  T "C2'" 1 
ATOM 339   C "C1'" . DG  A 1 17  ? -19.864 151.284 -3.977  1.00 89.68  ? 817 DG  T "C1'" 1 
ATOM 340   N N9    . DG  A 1 17  ? -19.799 150.437 -5.159  1.00 86.84  ? 817 DG  T N9    1 
ATOM 341   C C8    . DG  A 1 17  ? -19.866 149.067 -5.214  1.00 86.56  ? 817 DG  T C8    1 
ATOM 342   N N7    . DG  A 1 17  ? -19.799 148.600 -6.431  1.00 86.50  ? 817 DG  T N7    1 
ATOM 343   C C5    . DG  A 1 17  ? -19.676 149.732 -7.222  1.00 85.79  ? 817 DG  T C5    1 
ATOM 344   C C6    . DG  A 1 17  ? -19.566 149.862 -8.631  1.00 85.63  ? 817 DG  T C6    1 
ATOM 345   O O6    . DG  A 1 17  ? -19.549 148.968 -9.490  1.00 85.98  ? 817 DG  T O6    1 
ATOM 346   N N1    . DG  A 1 17  ? -19.470 151.199 -9.013  1.00 86.36  ? 817 DG  T N1    1 
ATOM 347   C C2    . DG  A 1 17  ? -19.482 152.273 -8.150  1.00 86.41  ? 817 DG  T C2    1 
ATOM 348   N N2    . DG  A 1 17  ? -19.386 153.488 -8.710  1.00 85.62  ? 817 DG  T N2    1 
ATOM 349   N N3    . DG  A 1 17  ? -19.580 152.161 -6.837  1.00 86.38  ? 817 DG  T N3    1 
ATOM 350   C C4    . DG  A 1 17  ? -19.674 150.873 -6.448  1.00 85.96  ? 817 DG  T C4    1 
ATOM 351   P P     . DA  A 1 18  ? -22.174 153.501 -1.528  1.00 98.57  ? 818 DA  T P     1 
ATOM 352   O OP1   . DA  A 1 18  ? -22.160 154.497 -0.421  1.00 99.19  ? 818 DA  T OP1   1 
ATOM 353   O OP2   . DA  A 1 18  ? -23.169 152.391 -1.501  1.00 98.63  ? 818 DA  T OP2   1 
ATOM 354   O "O5'" . DA  A 1 18  ? -22.355 154.267 -2.916  1.00 97.12  ? 818 DA  T "O5'" 1 
ATOM 355   C "C5'" . DA  A 1 18  ? -22.274 153.564 -4.157  1.00 94.76  ? 818 DA  T "C5'" 1 
ATOM 356   C "C4'" . DA  A 1 18  ? -23.319 154.079 -5.121  1.00 95.96  ? 818 DA  T "C4'" 1 
ATOM 357   O "O4'" . DA  A 1 18  ? -23.198 153.307 -6.339  1.00 93.92  ? 818 DA  T "O4'" 1 
ATOM 358   C "C3'" . DA  A 1 18  ? -24.763 153.896 -4.640  1.00 96.07  ? 818 DA  T "C3'" 1 
ATOM 359   O "O3'" . DA  A 1 18  ? -25.621 154.969 -5.083  1.00 98.59  ? 818 DA  T "O3'" 1 
ATOM 360   C "C2'" . DA  A 1 18  ? -25.175 152.581 -5.273  1.00 95.24  ? 818 DA  T "C2'" 1 
ATOM 361   C "C1'" . DA  A 1 18  ? -24.385 152.563 -6.573  1.00 93.52  ? 818 DA  T "C1'" 1 
ATOM 362   N N9    . DA  A 1 18  ? -23.997 151.215 -7.003  1.00 93.20  ? 818 DA  T N9    1 
ATOM 363   C C8    . DA  A 1 18  ? -23.804 150.103 -6.210  1.00 92.51  ? 818 DA  T C8    1 
ATOM 364   N N7    . DA  A 1 18  ? -23.493 149.019 -6.884  1.00 91.61  ? 818 DA  T N7    1 
ATOM 365   C C5    . DA  A 1 18  ? -23.474 149.443 -8.205  1.00 91.23  ? 818 DA  T C5    1 
ATOM 366   C C6    . DA  A 1 18  ? -23.219 148.769 -9.403  1.00 90.67  ? 818 DA  T C6    1 
ATOM 367   N N6    . DA  A 1 18  ? -22.951 147.462 -9.473  1.00 90.11  ? 818 DA  T N6    1 
ATOM 368   N N1    . DA  A 1 18  ? -23.259 149.488 -10.544 1.00 90.65  ? 818 DA  T N1    1 
ATOM 369   C C2    . DA  A 1 18  ? -23.560 150.793 -10.477 1.00 90.30  ? 818 DA  T C2    1 
ATOM 370   N N3    . DA  A 1 18  ? -23.836 151.537 -9.415  1.00 89.94  ? 818 DA  T N3    1 
ATOM 371   C C4    . DA  A 1 18  ? -23.773 150.797 -8.293  1.00 91.58  ? 818 DA  T C4    1 
ATOM 372   P P     . DC  A 1 19  ? -26.718 155.601 -4.071  1.00 100.00 ? 819 DC  T P     1 
ATOM 373   O OP1   . DC  A 1 19  ? -26.003 156.432 -3.055  1.00 100.00 ? 819 DC  T OP1   1 
ATOM 374   O OP2   . DC  A 1 19  ? -27.638 154.516 -3.620  1.00 100.00 ? 819 DC  T OP2   1 
ATOM 375   O "O5'" . DC  A 1 19  ? -27.569 156.593 -4.985  1.00 99.39  ? 819 DC  T "O5'" 1 
ATOM 376   C "C5'" . DC  A 1 19  ? -28.274 156.111 -6.126  1.00 96.52  ? 819 DC  T "C5'" 1 
ATOM 377   C "C4'" . DC  A 1 19  ? -27.593 156.579 -7.393  1.00 95.73  ? 819 DC  T "C4'" 1 
ATOM 378   O "O4'" . DC  A 1 19  ? -26.745 155.518 -7.891  1.00 95.57  ? 819 DC  T "O4'" 1 
ATOM 379   C "C3'" . DC  A 1 19  ? -28.551 156.901 -8.537  1.00 95.79  ? 819 DC  T "C3'" 1 
ATOM 380   O "O3'" . DC  A 1 19  ? -27.903 157.783 -9.466  1.00 96.72  ? 819 DC  T "O3'" 1 
ATOM 381   C "C2'" . DC  A 1 19  ? -28.713 155.551 -9.214  1.00 96.02  ? 819 DC  T "C2'" 1 
ATOM 382   C "C1'" . DC  A 1 19  ? -27.322 154.924 -9.052  1.00 94.90  ? 819 DC  T "C1'" 1 
ATOM 383   N N1    . DC  A 1 19  ? -27.341 153.464 -8.836  1.00 95.03  ? 819 DC  T N1    1 
ATOM 384   C C2    . DC  A 1 19  ? -27.267 152.596 -9.937  1.00 93.96  ? 819 DC  T C2    1 
ATOM 385   O O2    . DC  A 1 19  ? -27.159 153.071 -11.070 1.00 92.46  ? 819 DC  T O2    1 
ATOM 386   N N3    . DC  A 1 19  ? -27.323 151.259 -9.732  1.00 93.83  ? 819 DC  T N3    1 
ATOM 387   C C4    . DC  A 1 19  ? -27.441 150.780 -8.491  1.00 94.57  ? 819 DC  T C4    1 
ATOM 388   N N4    . DC  A 1 19  ? -27.494 149.452 -8.329  1.00 94.62  ? 819 DC  T N4    1 
ATOM 389   C C5    . DC  A 1 19  ? -27.508 151.638 -7.356  1.00 94.71  ? 819 DC  T C5    1 
ATOM 390   C C6    . DC  A 1 19  ? -27.450 152.957 -7.570  1.00 94.71  ? 819 DC  T C6    1 
ATOM 391   O "O5'" . DG  B 2 1   ? -28.526 142.836 -16.637 1.00 87.88  ? 821 DG  P "O5'" 1 
ATOM 392   C "C5'" . DG  B 2 1   ? -27.309 143.441 -17.099 1.00 89.94  ? 821 DG  P "C5'" 1 
ATOM 393   C "C4'" . DG  B 2 1   ? -27.519 144.879 -17.512 1.00 89.53  ? 821 DG  P "C4'" 1 
ATOM 394   O "O4'" . DG  B 2 1   ? -28.112 145.594 -16.407 1.00 89.36  ? 821 DG  P "O4'" 1 
ATOM 395   C "C3'" . DG  B 2 1   ? -26.252 145.657 -17.872 1.00 91.21  ? 821 DG  P "C3'" 1 
ATOM 396   O "O3'" . DG  B 2 1   ? -26.556 146.634 -18.874 1.00 91.56  ? 821 DG  P "O3'" 1 
ATOM 397   C "C2'" . DG  B 2 1   ? -25.892 146.350 -16.572 1.00 89.71  ? 821 DG  P "C2'" 1 
ATOM 398   C "C1'" . DG  B 2 1   ? -27.257 146.643 -15.976 1.00 88.03  ? 821 DG  P "C1'" 1 
ATOM 399   N N9    . DG  B 2 1   ? -27.229 146.618 -14.521 1.00 86.66  ? 821 DG  P N9    1 
ATOM 400   C C8    . DG  B 2 1   ? -27.323 145.504 -13.726 1.00 86.37  ? 821 DG  P C8    1 
ATOM 401   N N7    . DG  B 2 1   ? -27.314 145.782 -12.453 1.00 86.87  ? 821 DG  P N7    1 
ATOM 402   C C5    . DG  B 2 1   ? -27.215 147.167 -12.405 1.00 85.73  ? 821 DG  P C5    1 
ATOM 403   C C6    . DG  B 2 1   ? -27.279 148.044 -11.303 1.00 85.57  ? 821 DG  P C6    1 
ATOM 404   O O6    . DG  B 2 1   ? -27.398 147.761 -10.101 1.00 83.45  ? 821 DG  P O6    1 
ATOM 405   N N1    . DG  B 2 1   ? -27.209 149.378 -11.707 1.00 85.13  ? 821 DG  P N1    1 
ATOM 406   C C2    . DG  B 2 1   ? -27.080 149.803 -13.008 1.00 84.64  ? 821 DG  P C2    1 
ATOM 407   N N2    . DG  B 2 1   ? -27.030 151.127 -13.193 1.00 84.13  ? 821 DG  P N2    1 
ATOM 408   N N3    . DG  B 2 1   ? -27.018 148.990 -14.047 1.00 83.99  ? 821 DG  P N3    1 
ATOM 409   C C4    . DG  B 2 1   ? -27.108 147.695 -13.675 1.00 84.75  ? 821 DG  P C4    1 
ATOM 410   P P     . DT  B 2 2   ? -25.363 147.450 -19.583 1.00 93.86  ? 822 DT  P P     1 
ATOM 411   O OP1   . DT  B 2 2   ? -25.940 148.098 -20.793 1.00 93.16  ? 822 DT  P OP1   1 
ATOM 412   O OP2   . DT  B 2 2   ? -24.198 146.526 -19.721 1.00 91.90  ? 822 DT  P OP2   1 
ATOM 413   O "O5'" . DT  B 2 2   ? -24.980 148.594 -18.536 1.00 92.81  ? 822 DT  P "O5'" 1 
ATOM 414   C "C5'" . DT  B 2 2   ? -23.700 149.237 -18.592 1.00 90.77  ? 822 DT  P "C5'" 1 
ATOM 415   C "C4'" . DT  B 2 2   ? -23.790 150.660 -18.084 1.00 88.62  ? 822 DT  P "C4'" 1 
ATOM 416   O "O4'" . DT  B 2 2   ? -24.443 150.669 -16.797 1.00 87.82  ? 822 DT  P "O4'" 1 
ATOM 417   C "C3'" . DT  B 2 2   ? -22.431 151.324 -17.864 1.00 87.75  ? 822 DT  P "C3'" 1 
ATOM 418   O "O3'" . DT  B 2 2   ? -22.490 152.738 -18.088 1.00 89.51  ? 822 DT  P "O3'" 1 
ATOM 419   C "C2'" . DT  B 2 2   ? -22.133 151.017 -16.412 1.00 85.30  ? 822 DT  P "C2'" 1 
ATOM 420   C "C1'" . DT  B 2 2   ? -23.507 150.929 -15.762 1.00 84.90  ? 822 DT  P "C1'" 1 
ATOM 421   N N1    . DT  B 2 2   ? -23.603 149.809 -14.824 1.00 83.39  ? 822 DT  P N1    1 
ATOM 422   C C2    . DT  B 2 2   ? -23.748 150.075 -13.487 1.00 82.24  ? 822 DT  P C2    1 
ATOM 423   O O2    . DT  B 2 2   ? -23.799 151.208 -13.030 1.00 80.18  ? 822 DT  P O2    1 
ATOM 424   N N3    . DT  B 2 2   ? -23.831 148.958 -12.698 1.00 80.74  ? 822 DT  P N3    1 
ATOM 425   C C4    . DT  B 2 2   ? -23.776 147.636 -13.098 1.00 81.05  ? 822 DT  P C4    1 
ATOM 426   O O4    . DT  B 2 2   ? -23.857 146.742 -12.257 1.00 79.55  ? 822 DT  P O4    1 
ATOM 427   C C5    . DT  B 2 2   ? -23.620 147.431 -14.523 1.00 81.93  ? 822 DT  P C5    1 
ATOM 428   C C7    . DT  B 2 2   ? -23.544 146.036 -15.062 1.00 81.52  ? 822 DT  P C7    1 
ATOM 429   C C6    . DT  B 2 2   ? -23.545 148.514 -15.301 1.00 81.39  ? 822 DT  P C6    1 
ATOM 430   P P     . DC  B 2 3   ? -21.843 153.358 -19.430 1.00 91.71  ? 823 DC  P P     1 
ATOM 431   O OP1   . DC  B 2 3   ? -22.946 153.661 -20.382 1.00 92.20  ? 823 DC  P OP1   1 
ATOM 432   O OP2   . DC  B 2 3   ? -20.731 152.460 -19.857 1.00 91.03  ? 823 DC  P OP2   1 
ATOM 433   O "O5'" . DC  B 2 3   ? -21.216 154.739 -18.955 1.00 88.65  ? 823 DC  P "O5'" 1 
ATOM 434   C "C5'" . DC  B 2 3   ? -20.183 154.756 -17.996 1.00 85.60  ? 823 DC  P "C5'" 1 
ATOM 435   C "C4'" . DC  B 2 3   ? -20.576 155.633 -16.841 1.00 83.84  ? 823 DC  P "C4'" 1 
ATOM 436   O "O4'" . DC  B 2 3   ? -21.174 154.823 -15.800 1.00 82.10  ? 823 DC  P "O4'" 1 
ATOM 437   C "C3'" . DC  B 2 3   ? -19.366 156.308 -16.218 1.00 82.73  ? 823 DC  P "C3'" 1 
ATOM 438   O "O3'" . DC  B 2 3   ? -19.690 157.654 -15.865 1.00 83.89  ? 823 DC  P "O3'" 1 
ATOM 439   C "C2'" . DC  B 2 3   ? -19.039 155.423 -15.028 1.00 82.91  ? 823 DC  P "C2'" 1 
ATOM 440   C "C1'" . DC  B 2 3   ? -20.392 154.879 -14.615 1.00 81.51  ? 823 DC  P "C1'" 1 
ATOM 441   N N1    . DC  B 2 3   ? -20.352 153.522 -14.028 1.00 81.66  ? 823 DC  P N1    1 
ATOM 442   C C2    . DC  B 2 3   ? -20.150 153.388 -12.648 1.00 82.01  ? 823 DC  P C2    1 
ATOM 443   O O2    . DC  B 2 3   ? -19.961 154.409 -11.968 1.00 81.55  ? 823 DC  P O2    1 
ATOM 444   N N3    . DC  B 2 3   ? -20.161 152.146 -12.092 1.00 81.79  ? 823 DC  P N3    1 
ATOM 445   C C4    . DC  B 2 3   ? -20.356 151.070 -12.861 1.00 81.47  ? 823 DC  P C4    1 
ATOM 446   N N4    . DC  B 2 3   ? -20.395 149.868 -12.270 1.00 80.26  ? 823 DC  P N4    1 
ATOM 447   C C5    . DC  B 2 3   ? -20.532 151.179 -14.272 1.00 81.73  ? 823 DC  P C5    1 
ATOM 448   C C6    . DC  B 2 3   ? -20.522 152.412 -14.809 1.00 82.49  ? 823 DC  P C6    1 
ATOM 449   P P     . DC  B 2 4   ? -18.574 158.802 -16.023 1.00 85.72  ? 824 DC  P P     1 
ATOM 450   O OP1   . DC  B 2 4   ? -19.250 160.123 -16.083 1.00 85.74  ? 824 DC  P OP1   1 
ATOM 451   O OP2   . DC  B 2 4   ? -17.660 158.389 -17.123 1.00 85.09  ? 824 DC  P OP2   1 
ATOM 452   O "O5'" . DC  B 2 4   ? -17.771 158.715 -14.652 1.00 85.46  ? 824 DC  P "O5'" 1 
ATOM 453   C "C5'" . DC  B 2 4   ? -17.796 157.510 -13.889 1.00 84.34  ? 824 DC  P "C5'" 1 
ATOM 454   C "C4'" . DC  B 2 4   ? -17.840 157.818 -12.413 1.00 82.75  ? 824 DC  P "C4'" 1 
ATOM 455   O "O4'" . DC  B 2 4   ? -18.225 156.625 -11.681 1.00 82.66  ? 824 DC  P "O4'" 1 
ATOM 456   C "C3'" . DC  B 2 4   ? -16.468 158.209 -11.886 1.00 81.90  ? 824 DC  P "C3'" 1 
ATOM 457   O "O3'" . DC  B 2 4   ? -16.559 159.253 -10.920 1.00 79.83  ? 824 DC  P "O3'" 1 
ATOM 458   C "C2'" . DC  B 2 4   ? -15.909 156.917 -11.313 1.00 81.60  ? 824 DC  P "C2'" 1 
ATOM 459   C "C1'" . DC  B 2 4   ? -17.142 156.132 -10.894 1.00 80.79  ? 824 DC  P "C1'" 1 
ATOM 460   N N1    . DC  B 2 4   ? -17.026 154.679 -11.143 1.00 80.02  ? 824 DC  P N1    1 
ATOM 461   C C2    . DC  B 2 4   ? -16.604 153.836 -10.099 1.00 79.68  ? 824 DC  P C2    1 
ATOM 462   O O2    . DC  B 2 4   ? -16.301 154.335 -8.999  1.00 80.35  ? 824 DC  P O2    1 
ATOM 463   N N3    . DC  B 2 4   ? -16.530 152.502 -10.323 1.00 79.65  ? 824 DC  P N3    1 
ATOM 464   C C4    . DC  B 2 4   ? -16.846 152.004 -11.523 1.00 79.06  ? 824 DC  P C4    1 
ATOM 465   N N4    . DC  B 2 4   ? -16.765 150.682 -11.693 1.00 78.98  ? 824 DC  P N4    1 
ATOM 466   C C5    . DC  B 2 4   ? -17.257 152.840 -12.602 1.00 78.24  ? 824 DC  P C5    1 
ATOM 467   C C6    . DC  B 2 4   ? -17.332 154.156 -12.371 1.00 79.45  ? 824 DC  P C6    1 
ATOM 468   P P     . DC  B 2 5   ? -15.225 160.033 -10.501 1.00 81.04  ? 825 DC  P P     1 
ATOM 469   O OP1   . DC  B 2 5   ? -15.428 160.715 -9.191  1.00 80.45  ? 825 DC  P OP1   1 
ATOM 470   O OP2   . DC  B 2 5   ? -14.770 160.815 -11.685 1.00 80.17  ? 825 DC  P OP2   1 
ATOM 471   O "O5'" . DC  B 2 5   ? -14.202 158.831 -10.293 1.00 79.79  ? 825 DC  P "O5'" 1 
ATOM 472   C "C5'" . DC  B 2 5   ? -12.931 159.036 -9.700  1.00 74.59  ? 825 DC  P "C5'" 1 
ATOM 473   C "C4'" . DC  B 2 5   ? -12.852 158.298 -8.387  1.00 70.60  ? 825 DC  P "C4'" 1 
ATOM 474   O "O4'" . DC  B 2 5   ? -13.460 156.986 -8.478  1.00 69.56  ? 825 DC  P "O4'" 1 
ATOM 475   C "C3'" . DC  B 2 5   ? -11.425 158.068 -7.925  1.00 67.91  ? 825 DC  P "C3'" 1 
ATOM 476   O "O3'" . DC  B 2 5   ? -11.389 158.233 -6.511  1.00 66.99  ? 825 DC  P "O3'" 1 
ATOM 477   C "C2'" . DC  B 2 5   ? -11.131 156.653 -8.398  1.00 68.89  ? 825 DC  P "C2'" 1 
ATOM 478   C "C1'" . DC  B 2 5   ? -12.486 155.962 -8.331  1.00 69.27  ? 825 DC  P "C1'" 1 
ATOM 479   N N1    . DC  B 2 5   ? -12.730 154.975 -9.402  1.00 70.25  ? 825 DC  P N1    1 
ATOM 480   C C2    . DC  B 2 5   ? -12.544 153.589 -9.147  1.00 70.39  ? 825 DC  P C2    1 
ATOM 481   O O2    . DC  B 2 5   ? -12.150 153.215 -8.034  1.00 71.37  ? 825 DC  P O2    1 
ATOM 482   N N3    . DC  B 2 5   ? -12.801 152.700 -10.128 1.00 69.15  ? 825 DC  P N3    1 
ATOM 483   C C4    . DC  B 2 5   ? -13.212 153.128 -11.323 1.00 70.87  ? 825 DC  P C4    1 
ATOM 484   N N4    . DC  B 2 5   ? -13.451 152.211 -12.260 1.00 70.65  ? 825 DC  P N4    1 
ATOM 485   C C5    . DC  B 2 5   ? -13.396 154.516 -11.610 1.00 69.71  ? 825 DC  P C5    1 
ATOM 486   C C6    . DC  B 2 5   ? -13.144 155.393 -10.634 1.00 68.25  ? 825 DC  P C6    1 
ATOM 487   P P     . DT  B 2 6   ? -10.020 158.650 -5.800  1.00 66.88  ? 826 DT  P P     1 
ATOM 488   O OP1   . DT  B 2 6   ? -10.316 159.415 -4.563  1.00 65.14  ? 826 DT  P OP1   1 
ATOM 489   O OP2   . DT  B 2 6   ? -9.138  159.236 -6.840  1.00 63.15  ? 826 DT  P OP2   1 
ATOM 490   O "O5'" . DT  B 2 6   ? -9.439  157.233 -5.387  1.00 69.05  ? 826 DT  P "O5'" 1 
ATOM 491   C "C5'" . DT  B 2 6   ? -9.899  156.062 -6.060  1.00 71.86  ? 826 DT  P "C5'" 1 
ATOM 492   C "C4'" . DT  B 2 6   ? -9.102  154.856 -5.632  1.00 72.99  ? 826 DT  P "C4'" 1 
ATOM 493   O "O4'" . DT  B 2 6   ? -9.516  153.707 -6.411  1.00 73.16  ? 826 DT  P "O4'" 1 
ATOM 494   C "C3'" . DT  B 2 6   ? -7.604  155.003 -5.862  1.00 73.27  ? 826 DT  P "C3'" 1 
ATOM 495   O "O3'" . DT  B 2 6   ? -6.922  154.359 -4.789  1.00 73.00  ? 826 DT  P "O3'" 1 
ATOM 496   C "C2'" . DT  B 2 6   ? -7.381  154.342 -7.214  1.00 73.04  ? 826 DT  P "C2'" 1 
ATOM 497   C "C1'" . DT  B 2 6   ? -8.497  153.306 -7.315  1.00 73.58  ? 826 DT  P "C1'" 1 
ATOM 498   N N1    . DT  B 2 6   ? -9.113  153.211 -8.656  1.00 74.27  ? 826 DT  P N1    1 
ATOM 499   C C2    . DT  B 2 6   ? -9.490  151.971 -9.123  1.00 75.18  ? 826 DT  P C2    1 
ATOM 500   O O2    . DT  B 2 6   ? -9.357  150.946 -8.477  1.00 74.99  ? 826 DT  P O2    1 
ATOM 501   N N3    . DT  B 2 6   ? -10.035 151.972 -10.384 1.00 74.65  ? 826 DT  P N3    1 
ATOM 502   C C4    . DT  B 2 6   ? -10.247 153.064 -11.200 1.00 75.27  ? 826 DT  P C4    1 
ATOM 503   O O4    . DT  B 2 6   ? -10.729 152.902 -12.319 1.00 76.40  ? 826 DT  P O4    1 
ATOM 504   C C5    . DT  B 2 6   ? -9.856  154.343 -10.636 1.00 76.19  ? 826 DT  P C5    1 
ATOM 505   C C7    . DT  B 2 6   ? -10.089 155.595 -11.429 1.00 74.44  ? 826 DT  P C7    1 
ATOM 506   C C6    . DT  B 2 6   ? -9.308  154.348 -9.412  1.00 74.40  ? 826 DT  P C6    1 
ATOM 507   P P     . DG  B 2 7   ? -5.340  154.535 -4.615  1.00 73.80  ? 827 DG  P P     1 
ATOM 508   O OP1   . DG  B 2 7   ? -5.077  155.200 -3.305  1.00 72.62  ? 827 DG  P OP1   1 
ATOM 509   O OP2   . DG  B 2 7   ? -4.786  155.126 -5.867  1.00 73.56  ? 827 DG  P OP2   1 
ATOM 510   O "O5'" . DG  B 2 7   ? -4.863  153.015 -4.536  1.00 76.59  ? 827 DG  P "O5'" 1 
ATOM 511   C "C5'" . DG  B 2 7   ? -5.726  152.001 -3.981  1.00 78.56  ? 827 DG  P "C5'" 1 
ATOM 512   C "C4'" . DG  B 2 7   ? -5.408  150.640 -4.568  1.00 79.22  ? 827 DG  P "C4'" 1 
ATOM 513   O "O4'" . DG  B 2 7   ? -5.995  150.480 -5.885  1.00 79.03  ? 827 DG  P "O4'" 1 
ATOM 514   C "C3'" . DG  B 2 7   ? -3.916  150.374 -4.734  1.00 81.34  ? 827 DG  P "C3'" 1 
ATOM 515   O "O3'" . DG  B 2 7   ? -3.581  149.028 -4.375  1.00 84.10  ? 827 DG  P "O3'" 1 
ATOM 516   C "C2'" . DG  B 2 7   ? -3.671  150.636 -6.211  1.00 78.43  ? 827 DG  P "C2'" 1 
ATOM 517   C "C1'" . DG  B 2 7   ? -4.983  150.218 -6.852  1.00 77.18  ? 827 DG  P "C1'" 1 
ATOM 518   N N9    . DG  B 2 7   ? -5.307  150.979 -8.052  1.00 74.88  ? 827 DG  P N9    1 
ATOM 519   C C8    . DG  B 2 7   ? -5.212  152.344 -8.220  1.00 73.87  ? 827 DG  P C8    1 
ATOM 520   N N7    . DG  B 2 7   ? -5.586  152.742 -9.403  1.00 73.23  ? 827 DG  P N7    1 
ATOM 521   C C5    . DG  B 2 7   ? -5.947  151.572 -10.062 1.00 74.06  ? 827 DG  P C5    1 
ATOM 522   C C6    . DG  B 2 7   ? -6.439  151.372 -11.379 1.00 73.23  ? 827 DG  P C6    1 
ATOM 523   O O6    . DG  B 2 7   ? -6.677  152.212 -12.248 1.00 73.78  ? 827 DG  P O6    1 
ATOM 524   N N1    . DG  B 2 7   ? -6.661  150.025 -11.643 1.00 73.94  ? 827 DG  P N1    1 
ATOM 525   C C2    . DG  B 2 7   ? -6.451  149.003 -10.757 1.00 73.92  ? 827 DG  P C2    1 
ATOM 526   N N2    . DG  B 2 7   ? -6.717  147.773 -11.212 1.00 72.17  ? 827 DG  P N2    1 
ATOM 527   N N3    . DG  B 2 7   ? -6.008  149.174 -9.519  1.00 74.37  ? 827 DG  P N3    1 
ATOM 528   C C4    . DG  B 2 7   ? -5.775  150.478 -9.243  1.00 75.02  ? 827 DG  P C4    1 
ATOM 529   P P     . DT  B 2 8   ? -2.040  148.565 -4.422  1.00 87.80  ? 828 DT  P P     1 
ATOM 530   O OP1   . DT  B 2 8   ? -2.016  147.105 -4.736  1.00 86.16  ? 828 DT  P OP1   1 
ATOM 531   O OP2   . DT  B 2 8   ? -1.331  149.069 -3.207  1.00 86.05  ? 828 DT  P OP2   1 
ATOM 532   O "O5'" . DT  B 2 8   ? -1.496  149.380 -5.681  1.00 85.69  ? 828 DT  P "O5'" 1 
ATOM 533   C "C5'" . DT  B 2 8   ? -0.650  148.764 -6.638  1.00 85.18  ? 828 DT  P "C5'" 1 
ATOM 534   C "C4'" . DT  B 2 8   ? -1.301  147.515 -7.178  1.00 83.79  ? 828 DT  P "C4'" 1 
ATOM 535   O "O4'" . DT  B 2 8   ? -2.434  147.836 -8.020  1.00 83.00  ? 828 DT  P "O4'" 1 
ATOM 536   C "C3'" . DT  B 2 8   ? -0.358  146.705 -8.045  1.00 83.68  ? 828 DT  P "C3'" 1 
ATOM 537   O "O3'" . DT  B 2 8   ? -0.589  145.322 -7.836  1.00 83.30  ? 828 DT  P "O3'" 1 
ATOM 538   C "C2'" . DT  B 2 8   ? -0.703  147.128 -9.458  1.00 82.97  ? 828 DT  P "C2'" 1 
ATOM 539   C "C1'" . DT  B 2 8   ? -2.172  147.499 -9.377  1.00 82.18  ? 828 DT  P "C1'" 1 
ATOM 540   N N1    . DT  B 2 8   ? -2.450  148.693 -10.182 1.00 84.68  ? 828 DT  P N1    1 
ATOM 541   C C2    . DT  B 2 8   ? -2.882  148.558 -11.490 1.00 85.82  ? 828 DT  P C2    1 
ATOM 542   O O2    . DT  B 2 8   ? -3.105  147.479 -12.020 1.00 86.11  ? 828 DT  P O2    1 
ATOM 543   N N3    . DT  B 2 8   ? -3.050  149.747 -12.158 1.00 86.24  ? 828 DT  P N3    1 
ATOM 544   C C4    . DT  B 2 8   ? -2.847  151.022 -11.656 1.00 86.41  ? 828 DT  P C4    1 
ATOM 545   O O4    . DT  B 2 8   ? -3.014  151.997 -12.381 1.00 87.19  ? 828 DT  P O4    1 
ATOM 546   C C5    . DT  B 2 8   ? -2.432  151.085 -10.270 1.00 85.70  ? 828 DT  P C5    1 
ATOM 547   C C7    . DT  B 2 8   ? -2.228  152.422 -9.626  1.00 86.37  ? 828 DT  P C7    1 
ATOM 548   C C6    . DT  B 2 8   ? -2.253  149.935 -9.618  1.00 85.81  ? 828 DT  P C6    1 
ATOM 549   P P     . DT  B 2 9   ? 0.444   144.271 -8.444  1.00 83.43  ? 829 DT  P P     1 
ATOM 550   O OP1   . DT  B 2 9   ? -0.158  142.911 -8.325  1.00 83.11  ? 829 DT  P OP1   1 
ATOM 551   O OP2   . DT  B 2 9   ? 1.775   144.570 -7.830  1.00 81.36  ? 829 DT  P OP2   1 
ATOM 552   O "O5'" . DT  B 2 9   ? 0.473   144.664 -9.983  1.00 81.68  ? 829 DT  P "O5'" 1 
ATOM 553   C "C5'" . DT  B 2 9   ? 1.536   144.257 -10.819 1.00 78.90  ? 829 DT  P "C5'" 1 
ATOM 554   C "C4'" . DT  B 2 9   ? 0.999   143.920 -12.186 1.00 77.02  ? 829 DT  P "C4'" 1 
ATOM 555   O "O4'" . DT  B 2 9   ? 0.152   145.005 -12.637 1.00 76.67  ? 829 DT  P "O4'" 1 
ATOM 556   C "C3'" . DT  B 2 9   ? 2.082   143.756 -13.247 1.00 78.27  ? 829 DT  P "C3'" 1 
ATOM 557   O "O3'" . DT  B 2 9   ? 1.728   142.717 -14.167 1.00 78.50  ? 829 DT  P "O3'" 1 
ATOM 558   C "C2'" . DT  B 2 9   ? 2.121   145.118 -13.921 1.00 76.79  ? 829 DT  P "C2'" 1 
ATOM 559   C "C1'" . DT  B 2 9   ? 0.673   145.577 -13.834 1.00 74.41  ? 829 DT  P "C1'" 1 
ATOM 560   N N1    . DT  B 2 9   ? 0.488   147.046 -13.755 1.00 71.28  ? 829 DT  P N1    1 
ATOM 561   C C2    . DT  B 2 9   ? 0.062   147.720 -14.880 1.00 69.26  ? 829 DT  P C2    1 
ATOM 562   O O2    . DT  B 2 9   ? -0.152  147.170 -15.948 1.00 68.17  ? 829 DT  P O2    1 
ATOM 563   N N3    . DT  B 2 9   ? -0.107  149.073 -14.703 1.00 68.86  ? 829 DT  P N3    1 
ATOM 564   C C4    . DT  B 2 9   ? 0.101   149.799 -13.542 1.00 68.21  ? 829 DT  P C4    1 
ATOM 565   O O4    . DT  B 2 9   ? -0.103  151.008 -13.527 1.00 67.41  ? 829 DT  P O4    1 
ATOM 566   C C5    . DT  B 2 9   ? 0.554   149.030 -12.407 1.00 69.54  ? 829 DT  P C5    1 
ATOM 567   C C7    . DT  B 2 9   ? 0.802   149.730 -11.106 1.00 70.05  ? 829 DT  P C7    1 
ATOM 568   C C6    . DT  B 2 9   ? 0.729   147.712 -12.570 1.00 71.30  ? 829 DT  P C6    1 
ATOM 569   P P     . DC  B 2 10  ? 2.870   141.743 -14.735 1.00 77.50  ? 830 DC  P P     1 
ATOM 570   O OP1   . DC  B 2 10  ? 2.345   141.124 -15.980 1.00 78.25  ? 830 DC  P OP1   1 
ATOM 571   O OP2   . DC  B 2 10  ? 3.345   140.883 -13.623 1.00 78.60  ? 830 DC  P OP2   1 
ATOM 572   O "O5'" . DC  B 2 10  ? 4.055   142.736 -15.112 1.00 78.53  ? 830 DC  P "O5'" 1 
ATOM 573   C "C5'" . DC  B 2 10  ? 4.418   142.947 -16.465 1.00 77.85  ? 830 DC  P "C5'" 1 
ATOM 574   C "C4'" . DC  B 2 10  ? 3.201   143.340 -17.265 1.00 77.74  ? 830 DC  P "C4'" 1 
ATOM 575   O "O4'" . DC  B 2 10  ? 2.517   144.457 -16.644 1.00 76.18  ? 830 DC  P "O4'" 1 
ATOM 576   C "C3'" . DC  B 2 10  ? 3.528   143.782 -18.683 1.00 78.96  ? 830 DC  P "C3'" 1 
ATOM 577   O "O3'" . DC  B 2 10  ? 2.527   143.296 -19.580 1.00 82.68  ? 830 DC  P "O3'" 1 
ATOM 578   C "C2'" . DC  B 2 10  ? 3.527   145.298 -18.588 1.00 77.06  ? 830 DC  P "C2'" 1 
ATOM 579   C "C1'" . DC  B 2 10  ? 2.486   145.577 -17.521 1.00 74.65  ? 830 DC  P "C1'" 1 
ATOM 580   N N1    . DC  B 2 10  ? 2.734   146.788 -16.714 1.00 73.18  ? 830 DC  P N1    1 
ATOM 581   C C2    . DC  B 2 10  ? 2.095   147.986 -17.063 1.00 71.99  ? 830 DC  P C2    1 
ATOM 582   O O2    . DC  B 2 10  ? 1.380   148.018 -18.067 1.00 72.14  ? 830 DC  P O2    1 
ATOM 583   N N3    . DC  B 2 10  ? 2.275   149.080 -16.294 1.00 70.53  ? 830 DC  P N3    1 
ATOM 584   C C4    . DC  B 2 10  ? 3.056   149.011 -15.217 1.00 71.10  ? 830 DC  P C4    1 
ATOM 585   N N4    . DC  B 2 10  ? 3.182   150.103 -14.467 1.00 70.09  ? 830 DC  P N4    1 
ATOM 586   C C5    . DC  B 2 10  ? 3.742   147.816 -14.856 1.00 71.85  ? 830 DC  P C5    1 
ATOM 587   C C6    . DC  B 2 10  ? 3.558   146.741 -15.628 1.00 72.23  ? 830 DC  P C6    1 
ATOM 588   P P     . DG  B 2 11  ? 2.909   143.040 -21.115 1.00 85.90  ? 831 DG  P P     1 
ATOM 589   O OP1   . DG  B 2 11  ? 1.707   142.619 -21.897 1.00 84.59  ? 831 DG  P OP1   1 
ATOM 590   O OP2   . DG  B 2 11  ? 4.125   142.188 -21.111 1.00 85.70  ? 831 DG  P OP2   1 
ATOM 591   O "O5'" . DG  B 2 11  ? 3.340   144.488 -21.596 1.00 82.91  ? 831 DG  P "O5'" 1 
ATOM 592   C "C5'" . DG  B 2 11  ? 4.563   144.695 -22.265 1.00 80.58  ? 831 DG  P "C5'" 1 
ATOM 593   C "C4'" . DG  B 2 11  ? 4.414   145.869 -23.194 1.00 81.04  ? 831 DG  P "C4'" 1 
ATOM 594   O "O4'" . DG  B 2 11  ? 3.895   146.990 -22.446 1.00 80.07  ? 831 DG  P "O4'" 1 
ATOM 595   C "C3'" . DG  B 2 11  ? 5.715   146.340 -23.814 1.00 80.80  ? 831 DG  P "C3'" 1 
ATOM 596   O "O3'" . DG  B 2 11  ? 5.425   146.817 -25.126 1.00 80.90  ? 831 DG  P "O3'" 1 
ATOM 597   C "C2'" . DG  B 2 11  ? 6.194   147.411 -22.845 1.00 79.97  ? 831 DG  P "C2'" 1 
ATOM 598   C "C1'" . DG  B 2 11  ? 4.913   147.950 -22.204 1.00 78.98  ? 831 DG  P "C1'" 1 
ATOM 599   N N9    . DG  B 2 11  ? 4.980   148.141 -20.755 1.00 76.69  ? 831 DG  P N9    1 
ATOM 600   C C8    . DG  B 2 11  ? 4.927   147.157 -19.798 1.00 76.52  ? 831 DG  P C8    1 
ATOM 601   N N7    . DG  B 2 11  ? 4.961   147.620 -18.576 1.00 75.34  ? 831 DG  P N7    1 
ATOM 602   C C5    . DG  B 2 11  ? 5.054   148.995 -18.733 1.00 75.13  ? 831 DG  P C5    1 
ATOM 603   C C6    . DG  B 2 11  ? 5.122   150.023 -17.763 1.00 73.68  ? 831 DG  P C6    1 
ATOM 604   O O6    . DG  B 2 11  ? 5.115   149.923 -16.537 1.00 71.86  ? 831 DG  P O6    1 
ATOM 605   N N1    . DG  B 2 11  ? 5.212   151.278 -18.355 1.00 74.06  ? 831 DG  P N1    1 
ATOM 606   C C2    . DG  B 2 11  ? 5.237   151.513 -19.709 1.00 75.38  ? 831 DG  P C2    1 
ATOM 607   N N2    . DG  B 2 11  ? 5.333   152.796 -20.086 1.00 76.00  ? 831 DG  P N2    1 
ATOM 608   N N3    . DG  B 2 11  ? 5.174   150.562 -20.627 1.00 76.26  ? 831 DG  P N3    1 
ATOM 609   C C4    . DG  B 2 11  ? 5.080   149.334 -20.073 1.00 76.31  ? 831 DG  P C4    1 
ATOM 610   P P     . DG  B 2 12  ? 6.616   147.290 -26.082 1.00 83.17  ? 832 DG  P P     1 
ATOM 611   O OP1   . DG  B 2 12  ? 6.331   146.779 -27.449 1.00 82.92  ? 832 DG  P OP1   1 
ATOM 612   O OP2   . DG  B 2 12  ? 7.913   146.965 -25.424 1.00 81.42  ? 832 DG  P OP2   1 
ATOM 613   O "O5'" . DG  B 2 12  ? 6.447   148.871 -26.057 1.00 82.47  ? 832 DG  P "O5'" 1 
ATOM 614   C "C5'" . DG  B 2 12  ? 6.181   149.532 -24.823 1.00 79.56  ? 832 DG  P "C5'" 1 
ATOM 615   C "C4'" . DG  B 2 12  ? 6.967   150.815 -24.740 1.00 77.70  ? 832 DG  P "C4'" 1 
ATOM 616   O "O4'" . DG  B 2 12  ? 6.951   151.255 -23.362 1.00 76.28  ? 832 DG  P "O4'" 1 
ATOM 617   C "C3'" . DG  B 2 12  ? 8.440   150.664 -25.107 1.00 75.94  ? 832 DG  P "C3'" 1 
ATOM 618   O "O3'" . DG  B 2 12  ? 8.889   151.879 -25.720 1.00 78.41  ? 832 DG  P "O3'" 1 
ATOM 619   C "C2'" . DG  B 2 12  ? 9.109   150.391 -23.770 1.00 75.16  ? 832 DG  P "C2'" 1 
ATOM 620   C "C1'" . DG  B 2 12  ? 8.252   151.180 -22.791 1.00 73.27  ? 832 DG  P "C1'" 1 
ATOM 621   N N9    . DG  B 2 12  ? 8.110   150.565 -21.474 1.00 69.88  ? 832 DG  P N9    1 
ATOM 622   C C8    . DG  B 2 12  ? 7.854   149.245 -21.205 1.00 69.52  ? 832 DG  P C8    1 
ATOM 623   N N7    . DG  B 2 12  ? 7.733   148.998 -19.931 1.00 68.32  ? 832 DG  P N7    1 
ATOM 624   C C5    . DG  B 2 12  ? 7.930   150.226 -19.321 1.00 68.00  ? 832 DG  P C5    1 
ATOM 625   C C6    . DG  B 2 12  ? 7.899   150.583 -17.952 1.00 68.84  ? 832 DG  P C6    1 
ATOM 626   O O6    . DG  B 2 12  ? 7.672   149.857 -16.971 1.00 67.68  ? 832 DG  P O6    1 
ATOM 627   N N1    . DG  B 2 12  ? 8.161   151.940 -17.770 1.00 67.83  ? 832 DG  P N1    1 
ATOM 628   C C2    . DG  B 2 12  ? 8.408   152.839 -18.781 1.00 67.81  ? 832 DG  P C2    1 
ATOM 629   N N2    . DG  B 2 12  ? 8.640   154.105 -18.406 1.00 66.74  ? 832 DG  P N2    1 
ATOM 630   N N3    . DG  B 2 12  ? 8.428   152.516 -20.064 1.00 69.08  ? 832 DG  P N3    1 
ATOM 631   C C4    . DG  B 2 12  ? 8.180   151.203 -20.260 1.00 68.23  ? 832 DG  P C4    1 
ATOM 632   P P     . DG  B 2 13  ? 10.406  152.009 -26.231 1.00 79.06  ? 833 DG  P P     1 
ATOM 633   O OP1   . DG  B 2 13  ? 10.420  152.567 -27.611 1.00 78.44  ? 833 DG  P OP1   1 
ATOM 634   O OP2   . DG  B 2 13  ? 11.108  150.725 -25.953 1.00 81.00  ? 833 DG  P OP2   1 
ATOM 635   O "O5'" . DG  B 2 13  ? 10.997  153.111 -25.254 1.00 76.52  ? 833 DG  P "O5'" 1 
ATOM 636   C "C5'" . DG  B 2 13  ? 10.854  154.493 -25.546 1.00 72.65  ? 833 DG  P "C5'" 1 
ATOM 637   C "C4'" . DG  B 2 13  ? 12.084  155.220 -25.065 1.00 69.57  ? 833 DG  P "C4'" 1 
ATOM 638   O "O4'" . DG  B 2 13  ? 12.078  155.248 -23.624 1.00 67.71  ? 833 DG  P "O4'" 1 
ATOM 639   C "C3'" . DG  B 2 13  ? 13.348  154.465 -25.440 1.00 68.29  ? 833 DG  P "C3'" 1 
ATOM 640   O "O3'" . DG  B 2 13  ? 14.418  155.394 -25.431 1.00 67.99  ? 833 DG  P "O3'" 1 
ATOM 641   C "C2'" . DG  B 2 13  ? 13.466  153.466 -24.312 1.00 67.27  ? 833 DG  P "C2'" 1 
ATOM 642   C "C1'" . DG  B 2 13  ? 12.976  154.271 -23.118 1.00 67.64  ? 833 DG  P "C1'" 1 
ATOM 643   N N9    . DG  B 2 13  ? 12.230  153.452 -22.176 1.00 67.61  ? 833 DG  P N9    1 
ATOM 644   C C8    . DG  B 2 13  ? 11.212  152.577 -22.468 1.00 67.72  ? 833 DG  P C8    1 
ATOM 645   N N7    . DG  B 2 13  ? 10.731  151.982 -21.414 1.00 67.28  ? 833 DG  P N7    1 
ATOM 646   C C5    . DG  B 2 13  ? 11.473  152.500 -20.364 1.00 65.93  ? 833 DG  P C5    1 
ATOM 647   C C6    . DG  B 2 13  ? 11.403  152.239 -18.975 1.00 65.44  ? 833 DG  P C6    1 
ATOM 648   O O6    . DG  B 2 13  ? 10.646  151.479 -18.371 1.00 64.89  ? 833 DG  P O6    1 
ATOM 649   N N1    . DG  B 2 13  ? 12.346  152.971 -18.274 1.00 65.06  ? 833 DG  P N1    1 
ATOM 650   C C2    . DG  B 2 13  ? 13.244  153.840 -18.834 1.00 65.70  ? 833 DG  P C2    1 
ATOM 651   N N2    . DG  B 2 13  ? 14.088  154.432 -17.988 1.00 67.05  ? 833 DG  P N2    1 
ATOM 652   N N3    . DG  B 2 13  ? 13.316  154.101 -20.124 1.00 65.28  ? 833 DG  P N3    1 
ATOM 653   C C4    . DG  B 2 13  ? 12.406  153.402 -20.823 1.00 65.49  ? 833 DG  P C4    1 
ATOM 654   P P     . DC  B 2 14  ? 15.888  154.922 -25.017 1.00 69.02  ? 834 DC  P P     1 
ATOM 655   O OP1   . DC  B 2 14  ? 16.699  154.920 -26.261 1.00 69.59  ? 834 DC  P OP1   1 
ATOM 656   O OP2   . DC  B 2 14  ? 15.838  153.702 -24.177 1.00 69.26  ? 834 DC  P OP2   1 
ATOM 657   O "O5'" . DC  B 2 14  ? 16.364  156.102 -24.065 1.00 66.83  ? 834 DC  P "O5'" 1 
ATOM 658   C "C5'" . DC  B 2 14  ? 15.699  156.350 -22.830 1.00 63.10  ? 834 DC  P "C5'" 1 
ATOM 659   C "C4'" . DC  B 2 14  ? 16.653  156.102 -21.690 1.00 62.64  ? 834 DC  P "C4'" 1 
ATOM 660   O "O4'" . DC  B 2 14  ? 16.011  155.239 -20.721 1.00 62.74  ? 834 DC  P "O4'" 1 
ATOM 661   C "C3'" . DC  B 2 14  ? 17.903  155.352 -22.145 1.00 61.64  ? 834 DC  P "C3'" 1 
ATOM 662   O "O3'" . DC  B 2 14  ? 19.052  155.757 -21.418 1.00 61.38  ? 834 DC  P "O3'" 1 
ATOM 663   C "C2'" . DC  B 2 14  ? 17.597  153.917 -21.786 1.00 61.96  ? 834 DC  P "C2'" 1 
ATOM 664   C "C1'" . DC  B 2 14  ? 16.845  154.119 -20.494 1.00 61.72  ? 834 DC  P "C1'" 1 
ATOM 665   N N1    . DC  B 2 14  ? 16.005  152.990 -20.101 1.00 60.20  ? 834 DC  P N1    1 
ATOM 666   C C2    . DC  B 2 14  ? 15.959  152.638 -18.757 1.00 61.47  ? 834 DC  P C2    1 
ATOM 667   O O2    . DC  B 2 14  ? 16.601  153.314 -17.936 1.00 61.51  ? 834 DC  P O2    1 
ATOM 668   N N3    . DC  B 2 14  ? 15.217  151.582 -18.380 1.00 61.57  ? 834 DC  P N3    1 
ATOM 669   C C4    . DC  B 2 14  ? 14.534  150.892 -19.292 1.00 61.80  ? 834 DC  P C4    1 
ATOM 670   N N4    . DC  B 2 14  ? 13.820  149.852 -18.873 1.00 63.77  ? 834 DC  P N4    1 
ATOM 671   C C5    . DC  B 2 14  ? 14.552  151.237 -20.673 1.00 60.56  ? 834 DC  P C5    1 
ATOM 672   C C6    . DC  B 2 14  ? 15.294  152.284 -21.028 1.00 60.31  ? 834 DC  P C6    1 
ATOM 673   P P     . DG  B 2 15  ? 20.492  155.292 -21.935 1.00 62.22  ? 835 DG  P P     1 
ATOM 674   O OP1   . DG  B 2 15  ? 20.692  155.919 -23.256 1.00 64.27  ? 835 DG  P OP1   1 
ATOM 675   O OP2   . DG  B 2 15  ? 20.588  153.822 -21.802 1.00 63.13  ? 835 DG  P OP2   1 
ATOM 676   O "O5'" . DG  B 2 15  ? 21.516  155.951 -20.925 1.00 63.34  ? 835 DG  P "O5'" 1 
ATOM 677   C "C5'" . DG  B 2 15  ? 21.082  156.457 -19.673 1.00 65.48  ? 835 DG  P "C5'" 1 
ATOM 678   C "C4'" . DG  B 2 15  ? 21.855  155.780 -18.567 1.00 66.34  ? 835 DG  P "C4'" 1 
ATOM 679   O "O4'" . DG  B 2 15  ? 20.992  154.836 -17.889 1.00 67.47  ? 835 DG  P "O4'" 1 
ATOM 680   C "C3'" . DG  B 2 15  ? 23.045  154.976 -19.092 1.00 65.80  ? 835 DG  P "C3'" 1 
ATOM 681   O "O3'" . DG  B 2 15  ? 24.149  155.075 -18.192 1.00 64.96  ? 835 DG  P "O3'" 1 
ATOM 682   C "C2'" . DG  B 2 15  ? 22.491  153.567 -19.158 1.00 67.09  ? 835 DG  P "C2'" 1 
ATOM 683   C "C1'" . DG  B 2 15  ? 21.563  153.542 -17.953 1.00 68.62  ? 835 DG  P "C1'" 1 
ATOM 684   N N9    . DG  B 2 15  ? 20.472  152.573 -18.059 1.00 70.20  ? 835 DG  P N9    1 
ATOM 685   C C8    . DG  B 2 15  ? 19.432  152.593 -18.958 1.00 70.71  ? 835 DG  P C8    1 
ATOM 686   N N7    . DG  B 2 15  ? 18.637  151.560 -18.845 1.00 70.13  ? 835 DG  P N7    1 
ATOM 687   C C5    . DG  B 2 15  ? 19.178  150.821 -17.802 1.00 68.85  ? 835 DG  P C5    1 
ATOM 688   C C6    . DG  B 2 15  ? 18.763  149.595 -17.241 1.00 68.84  ? 835 DG  P C6    1 
ATOM 689   O O6    . DG  B 2 15  ? 17.809  148.884 -17.573 1.00 69.39  ? 835 DG  P O6    1 
ATOM 690   N N1    . DG  B 2 15  ? 19.593  149.204 -16.199 1.00 67.46  ? 835 DG  P N1    1 
ATOM 691   C C2    . DG  B 2 15  ? 20.694  149.902 -15.761 1.00 67.47  ? 835 DG  P C2    1 
ATOM 692   N N2    . DG  B 2 15  ? 21.374  149.362 -14.748 1.00 68.00  ? 835 DG  P N2    1 
ATOM 693   N N3    . DG  B 2 15  ? 21.098  151.041 -16.281 1.00 68.37  ? 835 DG  P N3    1 
ATOM 694   C C4    . DG  B 2 15  ? 20.303  151.442 -17.292 1.00 68.82  ? 835 DG  P C4    1 
ATOM 695   P P     . DC  B 2 16  ? 25.102  153.885 -18.012 1.00 60.64  ? 836 DC  P P     1 
ATOM 696   O OP1   . DC  B 2 16  ? 26.253  154.343 -17.192 1.00 61.33  ? 836 DC  P OP1   1 
ATOM 697   O OP2   . DC  B 2 16  ? 25.326  153.321 -19.367 1.00 60.29  ? 836 DC  P OP2   1 
ATOM 698   O "O5'" . DC  B 2 16  ? 24.218  152.843 -17.198 1.00 60.69  ? 836 DC  P "O5'" 1 
ATOM 699   C "C5'" . DC  B 2 16  ? 24.481  152.570 -15.826 1.00 61.37  ? 836 DC  P "C5'" 1 
ATOM 700   C "C4'" . DC  B 2 16  ? 24.930  151.139 -15.657 1.00 61.64  ? 836 DC  P "C4'" 1 
ATOM 701   O "O4'" . DC  B 2 16  ? 23.756  150.287 -15.781 1.00 61.75  ? 836 DC  P "O4'" 1 
ATOM 702   C "C3'" . DC  B 2 16  ? 25.936  150.659 -16.712 1.00 62.01  ? 836 DC  P "C3'" 1 
ATOM 703   O "O3'" . DC  B 2 16  ? 27.162  150.175 -16.144 1.00 62.03  ? 836 DC  P "O3'" 1 
ATOM 704   C "C2'" . DC  B 2 16  ? 25.229  149.518 -17.427 1.00 62.60  ? 836 DC  P "C2'" 1 
ATOM 705   C "C1'" . DC  B 2 16  ? 24.095  149.116 -16.507 1.00 63.03  ? 836 DC  P "C1'" 1 
ATOM 706   N N1    . DC  B 2 16  ? 22.958  148.720 -17.359 1.00 64.16  ? 836 DC  P N1    1 
ATOM 707   C C2    . DC  B 2 16  ? 22.336  147.490 -17.137 1.00 64.41  ? 836 DC  P C2    1 
ATOM 708   O O2    . DC  B 2 16  ? 22.670  146.820 -16.143 1.00 64.98  ? 836 DC  P O2    1 
ATOM 709   N N3    . DC  B 2 16  ? 21.391  147.062 -18.016 1.00 64.49  ? 836 DC  P N3    1 
ATOM 710   C C4    . DC  B 2 16  ? 21.064  147.820 -19.071 1.00 64.73  ? 836 DC  P C4    1 
ATOM 711   N N4    . DC  B 2 16  ? 20.187  147.330 -19.952 1.00 64.28  ? 836 DC  P N4    1 
ATOM 712   C C5    . DC  B 2 16  ? 21.638  149.104 -19.280 1.00 64.98  ? 836 DC  P C5    1 
ATOM 713   C C6    . DC  B 2 16  ? 22.564  149.515 -18.404 1.00 64.94  ? 836 DC  P C6    1 
ATOM 714   P P     . DC  B 2 17  ? 28.113  149.214 -17.011 1.00 62.28  ? 837 DC  P P     1 
ATOM 715   O OP1   . DC  B 2 17  ? 29.458  149.172 -16.391 1.00 61.86  ? 837 DC  P OP1   1 
ATOM 716   O OP2   . DC  B 2 17  ? 27.962  149.513 -18.469 1.00 62.08  ? 837 DC  P OP2   1 
ATOM 717   O "O5'" . DC  B 2 17  ? 27.438  147.797 -16.780 1.00 63.06  ? 837 DC  P "O5'" 1 
ATOM 718   C "C5'" . DC  B 2 17  ? 27.316  147.264 -15.487 1.00 64.36  ? 837 DC  P "C5'" 1 
ATOM 719   C "C4'" . DC  B 2 17  ? 27.522  145.763 -15.552 1.00 65.79  ? 837 DC  P "C4'" 1 
ATOM 720   O "O4'" . DC  B 2 17  ? 26.313  145.079 -15.939 1.00 66.98  ? 837 DC  P "O4'" 1 
ATOM 721   C "C3'" . DC  B 2 17  ? 28.579  145.438 -16.624 1.00 66.07  ? 837 DC  P "C3'" 1 
ATOM 722   O "O3'" . DC  B 2 17  ? 29.708  144.784 -16.085 1.00 65.26  ? 837 DC  P "O3'" 1 
ATOM 723   C "C2'" . DC  B 2 17  ? 27.895  144.520 -17.586 1.00 67.28  ? 837 DC  P "C2'" 1 
ATOM 724   C "C1'" . DC  B 2 17  ? 26.566  144.114 -16.964 1.00 68.58  ? 837 DC  P "C1'" 1 
ATOM 725   N N1    . DC  B 2 17  ? 25.546  144.251 -18.020 1.00 71.15  ? 837 DC  P N1    1 
ATOM 726   C C2    . DC  B 2 17  ? 24.383  143.460 -18.004 1.00 71.36  ? 837 DC  P C2    1 
ATOM 727   O O2    . DC  B 2 17  ? 24.172  142.711 -17.040 1.00 71.35  ? 837 DC  P O2    1 
ATOM 728   N N3    . DC  B 2 17  ? 23.514  143.549 -19.051 1.00 72.07  ? 837 DC  P N3    1 
ATOM 729   C C4    . DC  B 2 17  ? 23.761  144.395 -20.059 1.00 72.80  ? 837 DC  P C4    1 
ATOM 730   N N4    . DC  B 2 17  ? 22.909  144.418 -21.093 1.00 72.97  ? 837 DC  P N4    1 
ATOM 731   C C5    . DC  B 2 17  ? 24.905  145.245 -20.065 1.00 72.93  ? 837 DC  P C5    1 
ATOM 732   C C6    . DC  B 2 17  ? 25.765  145.136 -19.043 1.00 72.26  ? 837 DC  P C6    1 
ATOM 733   P P     . DA  B 2 18  ? 30.755  144.207 -17.144 1.00 65.15  ? 838 DA  P P     1 
ATOM 734   O OP1   . DA  B 2 18  ? 31.992  143.823 -16.423 1.00 65.44  ? 838 DA  P OP1   1 
ATOM 735   O OP2   . DA  B 2 18  ? 30.899  145.153 -18.323 1.00 65.61  ? 838 DA  P OP2   1 
ATOM 736   O "O5'" . DA  B 2 18  ? 29.973  142.921 -17.678 1.00 64.06  ? 838 DA  P "O5'" 1 
ATOM 737   C "C5'" . DA  B 2 18  ? 29.185  142.124 -16.762 1.00 63.10  ? 838 DA  P "C5'" 1 
ATOM 738   C "C4'" . DA  B 2 18  ? 28.689  140.848 -17.415 1.00 61.74  ? 838 DA  P "C4'" 1 
ATOM 739   O "O4'" . DA  B 2 18  ? 27.585  141.140 -18.301 1.00 61.00  ? 838 DA  P "O4'" 1 
ATOM 740   C "C3'" . DA  B 2 18  ? 29.714  140.095 -18.262 1.00 60.81  ? 838 DA  P "C3'" 1 
ATOM 741   O "O3'" . DA  B 2 18  ? 30.505  139.110 -17.585 1.00 60.51  ? 838 DA  P "O3'" 1 
ATOM 742   C "C2'" . DA  B 2 18  ? 28.988  139.733 -19.551 1.00 60.55  ? 838 DA  P "C2'" 1 
ATOM 743   C "C1'" . DA  B 2 18  ? 27.537  140.155 -19.325 1.00 60.02  ? 838 DA  P "C1'" 1 
ATOM 744   N N9    . DA  B 2 18  ? 27.008  140.789 -20.533 1.00 59.63  ? 838 DA  P N9    1 
ATOM 745   C C8    . DA  B 2 18  ? 27.604  141.839 -21.186 1.00 59.61  ? 838 DA  P C8    1 
ATOM 746   N N7    . DA  B 2 18  ? 27.014  142.170 -22.305 1.00 59.83  ? 838 DA  P N7    1 
ATOM 747   C C5    . DA  B 2 18  ? 25.939  141.293 -22.388 1.00 59.40  ? 838 DA  P C5    1 
ATOM 748   C C6    . DA  B 2 18  ? 24.939  141.120 -23.359 1.00 59.50  ? 838 DA  P C6    1 
ATOM 749   N N6    . DA  B 2 18  ? 24.895  141.830 -24.481 1.00 59.41  ? 838 DA  P N6    1 
ATOM 750   N N1    . DA  B 2 18  ? 23.994  140.175 -23.142 1.00 59.24  ? 838 DA  P N1    1 
ATOM 751   C C2    . DA  B 2 18  ? 24.074  139.444 -22.023 1.00 59.40  ? 838 DA  P C2    1 
ATOM 752   N N3    . DA  B 2 18  ? 24.982  139.499 -21.041 1.00 59.64  ? 838 DA  P N3    1 
ATOM 753   C C4    . DA  B 2 18  ? 25.900  140.456 -21.287 1.00 59.65  ? 838 DA  P C4    1 
ATOM 754   N N     . PRO C 3 1   ? 39.469  124.177 -27.203 1.00 60.70  ? 1   PRO A N     1 
ATOM 755   C CA    . PRO C 3 1   ? 38.707  122.905 -27.034 1.00 59.64  ? 1   PRO A CA    1 
ATOM 756   C C     . PRO C 3 1   ? 37.277  123.159 -26.555 1.00 57.93  ? 1   PRO A C     1 
ATOM 757   O O     . PRO C 3 1   ? 36.791  124.295 -26.593 1.00 56.39  ? 1   PRO A O     1 
ATOM 758   C CB    . PRO C 3 1   ? 39.472  122.040 -26.032 1.00 60.17  ? 1   PRO A CB    1 
ATOM 759   C CG    . PRO C 3 1   ? 40.904  122.596 -26.191 1.00 61.67  ? 1   PRO A CG    1 
ATOM 760   C CD    . PRO C 3 1   ? 40.722  124.123 -26.425 1.00 61.15  ? 1   PRO A CD    1 
ATOM 761   N N     . ILE C 3 2   ? 36.613  122.101 -26.094 1.00 56.07  ? 2   ILE A N     1 
ATOM 762   C CA    . ILE C 3 2   ? 35.231  122.207 -25.633 1.00 53.61  ? 2   ILE A CA    1 
ATOM 763   C C     . ILE C 3 2   ? 34.940  121.481 -24.336 1.00 51.85  ? 2   ILE A C     1 
ATOM 764   O O     . ILE C 3 2   ? 35.582  120.483 -23.994 1.00 50.72  ? 2   ILE A O     1 
ATOM 765   C CB    . ILE C 3 2   ? 34.228  121.694 -26.720 1.00 53.22  ? 2   ILE A CB    1 
ATOM 766   C CG1   . ILE C 3 2   ? 34.162  122.693 -27.874 1.00 53.32  ? 2   ILE A CG1   1 
ATOM 767   C CG2   . ILE C 3 2   ? 32.823  121.445 -26.134 1.00 50.16  ? 2   ILE A CG2   1 
ATOM 768   C CD1   . ILE C 3 2   ? 33.227  122.282 -28.985 1.00 54.82  ? 2   ILE A CD1   1 
ATOM 769   N N     . SER C 3 3   ? 33.950  122.004 -23.627 1.00 50.21  ? 3   SER A N     1 
ATOM 770   C CA    . SER C 3 3   ? 33.514  121.415 -22.390 1.00 49.96  ? 3   SER A CA    1 
ATOM 771   C C     . SER C 3 3   ? 32.725  120.136 -22.628 1.00 49.12  ? 3   SER A C     1 
ATOM 772   O O     . SER C 3 3   ? 31.836  120.067 -23.490 1.00 48.00  ? 3   SER A O     1 
ATOM 773   C CB    . SER C 3 3   ? 32.647  122.381 -21.599 1.00 51.45  ? 3   SER A CB    1 
ATOM 774   O OG    . SER C 3 3   ? 32.078  121.699 -20.485 1.00 52.98  ? 3   SER A OG    1 
ATOM 775   N N     . PRO C 3 4   ? 33.081  119.087 -21.883 1.00 47.95  ? 4   PRO A N     1 
ATOM 776   C CA    . PRO C 3 4   ? 32.436  117.782 -21.960 1.00 46.26  ? 4   PRO A CA    1 
ATOM 777   C C     . PRO C 3 4   ? 31.306  117.736 -20.933 1.00 45.24  ? 4   PRO A C     1 
ATOM 778   O O     . PRO C 3 4   ? 31.034  116.684 -20.338 1.00 45.15  ? 4   PRO A O     1 
ATOM 779   C CB    . PRO C 3 4   ? 33.569  116.841 -21.577 1.00 46.07  ? 4   PRO A CB    1 
ATOM 780   C CG    . PRO C 3 4   ? 34.259  117.613 -20.500 1.00 46.73  ? 4   PRO A CG    1 
ATOM 781   C CD    . PRO C 3 4   ? 34.320  119.011 -21.084 1.00 47.05  ? 4   PRO A CD    1 
ATOM 782   N N     . ILE C 3 5   ? 30.697  118.888 -20.660 1.00 42.68  ? 5   ILE A N     1 
ATOM 783   C CA    . ILE C 3 5   ? 29.613  118.879 -19.699 1.00 40.26  ? 5   ILE A CA    1 
ATOM 784   C C     . ILE C 3 5   ? 28.343  118.442 -20.374 1.00 39.49  ? 5   ILE A C     1 
ATOM 785   O O     . ILE C 3 5   ? 28.037  118.848 -21.495 1.00 38.47  ? 5   ILE A O     1 
ATOM 786   C CB    . ILE C 3 5   ? 29.394  120.217 -18.975 1.00 38.16  ? 5   ILE A CB    1 
ATOM 787   C CG1   . ILE C 3 5   ? 28.231  120.069 -17.986 1.00 36.29  ? 5   ILE A CG1   1 
ATOM 788   C CG2   . ILE C 3 5   ? 29.110  121.318 -19.968 1.00 37.06  ? 5   ILE A CG2   1 
ATOM 789   C CD1   . ILE C 3 5   ? 28.342  118.860 -17.055 1.00 33.18  ? 5   ILE A CD1   1 
ATOM 790   N N     . GLU C 3 6   ? 27.642  117.558 -19.685 1.00 39.60  ? 6   GLU A N     1 
ATOM 791   C CA    . GLU C 3 6   ? 26.395  117.004 -20.157 1.00 41.02  ? 6   GLU A CA    1 
ATOM 792   C C     . GLU C 3 6   ? 25.525  118.151 -20.630 1.00 39.60  ? 6   GLU A C     1 
ATOM 793   O O     . GLU C 3 6   ? 25.267  119.088 -19.875 1.00 40.90  ? 6   GLU A O     1 
ATOM 794   C CB    . GLU C 3 6   ? 25.744  116.256 -19.001 1.00 45.89  ? 6   GLU A CB    1 
ATOM 795   C CG    . GLU C 3 6   ? 26.754  115.373 -18.263 1.00 51.81  ? 6   GLU A CG    1 
ATOM 796   C CD    . GLU C 3 6   ? 26.385  115.108 -16.809 1.00 56.13  ? 6   GLU A CD    1 
ATOM 797   O OE1   . GLU C 3 6   ? 26.264  113.914 -16.448 1.00 59.01  ? 6   GLU A OE1   1 
ATOM 798   O OE2   . GLU C 3 6   ? 26.240  116.079 -16.024 1.00 58.45  ? 6   GLU A OE2   1 
ATOM 799   N N     . THR C 3 7   ? 25.138  118.109 -21.900 1.00 36.92  ? 7   THR A N     1 
ATOM 800   C CA    . THR C 3 7   ? 24.314  119.168 -22.465 1.00 35.23  ? 7   THR A CA    1 
ATOM 801   C C     . THR C 3 7   ? 22.900  119.204 -21.899 1.00 33.50  ? 7   THR A C     1 
ATOM 802   O O     . THR C 3 7   ? 22.317  118.177 -21.519 1.00 32.61  ? 7   THR A O     1 
ATOM 803   C CB    . THR C 3 7   ? 24.220  119.080 -24.013 1.00 37.18  ? 7   THR A CB    1 
ATOM 804   O OG1   . THR C 3 7   ? 23.895  120.372 -24.549 1.00 38.28  ? 7   THR A OG1   1 
ATOM 805   C CG2   . THR C 3 7   ? 23.132  118.082 -24.439 1.00 37.05  ? 7   THR A CG2   1 
ATOM 806   N N     . VAL C 3 8   ? 22.371  120.419 -21.830 1.00 31.60  ? 8   VAL A N     1 
ATOM 807   C CA    . VAL C 3 8   ? 21.026  120.632 -21.353 1.00 28.37  ? 8   VAL A CA    1 
ATOM 808   C C     . VAL C 3 8   ? 20.110  120.587 -22.536 1.00 28.14  ? 8   VAL A C     1 
ATOM 809   O O     . VAL C 3 8   ? 20.357  121.211 -23.574 1.00 26.01  ? 8   VAL A O     1 
ATOM 810   C CB    . VAL C 3 8   ? 20.862  121.963 -20.669 1.00 27.55  ? 8   VAL A CB    1 
ATOM 811   C CG1   . VAL C 3 8   ? 21.633  121.949 -19.378 1.00 29.05  ? 8   VAL A CG1   1 
ATOM 812   C CG2   . VAL C 3 8   ? 21.330  123.079 -21.584 1.00 25.94  ? 8   VAL A CG2   1 
ATOM 813   N N     . PRO C 3 9   ? 19.046  119.806 -22.401 1.00 28.69  ? 9   PRO A N     1 
ATOM 814   C CA    . PRO C 3 9   ? 18.023  119.611 -23.421 1.00 29.13  ? 9   PRO A CA    1 
ATOM 815   C C     . PRO C 3 9   ? 17.262  120.909 -23.571 1.00 30.53  ? 9   PRO A C     1 
ATOM 816   O O     . PRO C 3 9   ? 17.223  121.713 -22.638 1.00 30.95  ? 9   PRO A O     1 
ATOM 817   C CB    . PRO C 3 9   ? 17.147  118.532 -22.798 1.00 28.88  ? 9   PRO A CB    1 
ATOM 818   C CG    . PRO C 3 9   ? 17.225  118.859 -21.345 1.00 28.30  ? 9   PRO A CG    1 
ATOM 819   C CD    . PRO C 3 9   ? 18.689  119.115 -21.152 1.00 27.34  ? 9   PRO A CD    1 
ATOM 820   N N     . VAL C 3 10  ? 16.661  121.115 -24.736 1.00 30.95  ? 10  VAL A N     1 
ATOM 821   C CA    . VAL C 3 10  ? 15.898  122.330 -24.972 1.00 32.91  ? 10  VAL A CA    1 
ATOM 822   C C     . VAL C 3 10  ? 14.907  122.178 -26.108 1.00 33.74  ? 10  VAL A C     1 
ATOM 823   O O     . VAL C 3 10  ? 15.275  122.226 -27.278 1.00 33.60  ? 10  VAL A O     1 
ATOM 824   C CB    . VAL C 3 10  ? 16.831  123.544 -25.213 1.00 33.31  ? 10  VAL A CB    1 
ATOM 825   C CG1   . VAL C 3 10  ? 17.985  123.147 -26.096 1.00 33.46  ? 10  VAL A CG1   1 
ATOM 826   C CG2   . VAL C 3 10  ? 16.053  124.721 -25.811 1.00 34.13  ? 10  VAL A CG2   1 
ATOM 827   N N     . LYS C 3 11  ? 13.638  122.019 -25.751 1.00 35.14  ? 11  LYS A N     1 
ATOM 828   C CA    . LYS C 3 11  ? 12.588  121.857 -26.746 1.00 37.20  ? 11  LYS A CA    1 
ATOM 829   C C     . LYS C 3 11  ? 12.077  123.186 -27.292 1.00 36.83  ? 11  LYS A C     1 
ATOM 830   O O     . LYS C 3 11  ? 12.436  124.260 -26.808 1.00 35.28  ? 11  LYS A O     1 
ATOM 831   C CB    . LYS C 3 11  ? 11.410  121.062 -26.156 1.00 39.90  ? 11  LYS A CB    1 
ATOM 832   C CG    . LYS C 3 11  ? 10.662  121.770 -25.001 1.00 44.67  ? 11  LYS A CG    1 
ATOM 833   C CD    . LYS C 3 11  ? 9.509   120.926 -24.393 1.00 46.80  ? 11  LYS A CD    1 
ATOM 834   C CE    . LYS C 3 11  ? 8.239   120.859 -25.276 1.00 48.64  ? 11  LYS A CE    1 
ATOM 835   N NZ    . LYS C 3 11  ? 8.375   120.149 -26.601 1.00 48.78  ? 11  LYS A NZ    1 
ATOM 836   N N     . LEU C 3 12  ? 11.290  123.091 -28.358 1.00 37.24  ? 12  LEU A N     1 
ATOM 837   C CA    . LEU C 3 12  ? 10.663  124.255 -28.972 1.00 37.61  ? 12  LEU A CA    1 
ATOM 838   C C     . LEU C 3 12  ? 9.305   124.354 -28.298 1.00 38.20  ? 12  LEU A C     1 
ATOM 839   O O     . LEU C 3 12  ? 8.711   123.330 -27.952 1.00 38.92  ? 12  LEU A O     1 
ATOM 840   C CB    . LEU C 3 12  ? 10.386  124.009 -30.447 1.00 35.37  ? 12  LEU A CB    1 
ATOM 841   C CG    . LEU C 3 12  ? 11.507  123.716 -31.416 1.00 34.77  ? 12  LEU A CG    1 
ATOM 842   C CD1   . LEU C 3 12  ? 10.880  123.541 -32.790 1.00 33.07  ? 12  LEU A CD1   1 
ATOM 843   C CD2   . LEU C 3 12  ? 12.498  124.862 -31.398 1.00 33.46  ? 12  LEU A CD2   1 
ATOM 844   N N     . LYS C 3 13  ? 8.778   125.565 -28.172 1.00 38.23  ? 13  LYS A N     1 
ATOM 845   C CA    . LYS C 3 13  ? 7.466   125.739 -27.559 1.00 38.00  ? 13  LYS A CA    1 
ATOM 846   C C     . LYS C 3 13  ? 6.389   124.892 -28.265 1.00 37.45  ? 13  LYS A C     1 
ATOM 847   O O     . LYS C 3 13  ? 6.333   124.832 -29.496 1.00 35.75  ? 13  LYS A O     1 
ATOM 848   C CB    . LYS C 3 13  ? 7.084   127.207 -27.565 1.00 39.50  ? 13  LYS A CB    1 
ATOM 849   N N     . PRO C 3 14  ? 5.521   124.229 -27.481 1.00 37.90  ? 14  PRO A N     1 
ATOM 850   C CA    . PRO C 3 14  ? 4.437   123.377 -27.977 1.00 39.80  ? 14  PRO A CA    1 
ATOM 851   C C     . PRO C 3 14  ? 3.561   124.124 -28.960 1.00 41.63  ? 14  PRO A C     1 
ATOM 852   O O     . PRO C 3 14  ? 2.917   125.134 -28.635 1.00 40.93  ? 14  PRO A O     1 
ATOM 853   C CB    . PRO C 3 14  ? 3.686   123.007 -26.705 1.00 39.04  ? 14  PRO A CB    1 
ATOM 854   C CG    . PRO C 3 14  ? 3.919   124.183 -25.834 1.00 39.38  ? 14  PRO A CG    1 
ATOM 855   C CD    . PRO C 3 14  ? 5.385   124.423 -26.031 1.00 38.68  ? 14  PRO A CD    1 
ATOM 856   N N     . GLY C 3 15  ? 3.575   123.614 -30.181 1.00 44.04  ? 15  GLY A N     1 
ATOM 857   C CA    . GLY C 3 15  ? 2.826   124.232 -31.248 1.00 48.13  ? 15  GLY A CA    1 
ATOM 858   C C     . GLY C 3 15  ? 3.759   124.537 -32.407 1.00 50.85  ? 15  GLY A C     1 
ATOM 859   O O     . GLY C 3 15  ? 3.692   123.860 -33.441 1.00 52.51  ? 15  GLY A O     1 
ATOM 860   N N     . MET C 3 16  ? 4.665   125.504 -32.222 1.00 52.08  ? 16  MET A N     1 
ATOM 861   C CA    . MET C 3 16  ? 5.614   125.902 -33.275 1.00 53.24  ? 16  MET A CA    1 
ATOM 862   C C     . MET C 3 16  ? 6.506   124.785 -33.813 1.00 52.79  ? 16  MET A C     1 
ATOM 863   O O     . MET C 3 16  ? 6.523   123.668 -33.286 1.00 53.85  ? 16  MET A O     1 
ATOM 864   C CB    . MET C 3 16  ? 6.519   127.045 -32.805 1.00 54.43  ? 16  MET A CB    1 
ATOM 865   C CG    . MET C 3 16  ? 5.819   128.358 -32.562 1.00 56.66  ? 16  MET A CG    1 
ATOM 866   S SD    . MET C 3 16  ? 5.900   128.799 -30.826 1.00 59.83  ? 16  MET A SD    1 
ATOM 867   C CE    . MET C 3 16  ? 4.572   127.686 -30.146 1.00 56.82  ? 16  MET A CE    1 
ATOM 868   N N     . ASP C 3 17  ? 7.246   125.112 -34.871 1.00 51.70  ? 17  ASP A N     1 
ATOM 869   C CA    . ASP C 3 17  ? 8.182   124.190 -35.511 1.00 50.96  ? 17  ASP A CA    1 
ATOM 870   C C     . ASP C 3 17  ? 9.476   124.968 -35.775 1.00 49.72  ? 17  ASP A C     1 
ATOM 871   O O     . ASP C 3 17  ? 9.587   126.136 -35.406 1.00 50.10  ? 17  ASP A O     1 
ATOM 872   C CB    . ASP C 3 17  ? 7.592   123.655 -36.823 1.00 52.47  ? 17  ASP A CB    1 
ATOM 873   C CG    . ASP C 3 17  ? 8.302   122.408 -37.322 1.00 54.00  ? 17  ASP A CG    1 
ATOM 874   O OD1   . ASP C 3 17  ? 8.763   121.605 -36.477 1.00 55.17  ? 17  ASP A OD1   1 
ATOM 875   O OD2   . ASP C 3 17  ? 8.388   122.231 -38.560 1.00 54.99  ? 17  ASP A OD2   1 
ATOM 876   N N     . GLY C 3 18  ? 10.457  124.338 -36.404 1.00 48.65  ? 18  GLY A N     1 
ATOM 877   C CA    . GLY C 3 18  ? 11.697  125.046 -36.668 1.00 49.00  ? 18  GLY A CA    1 
ATOM 878   C C     . GLY C 3 18  ? 11.577  126.300 -37.523 1.00 48.68  ? 18  GLY A C     1 
ATOM 879   O O     . GLY C 3 18  ? 10.657  126.432 -38.329 1.00 48.95  ? 18  GLY A O     1 
ATOM 880   N N     . PRO C 3 19  ? 12.503  127.252 -37.353 1.00 47.77  ? 19  PRO A N     1 
ATOM 881   C CA    . PRO C 3 19  ? 12.518  128.506 -38.102 1.00 46.52  ? 19  PRO A CA    1 
ATOM 882   C C     . PRO C 3 19  ? 13.149  128.320 -39.473 1.00 45.74  ? 19  PRO A C     1 
ATOM 883   O O     . PRO C 3 19  ? 14.353  128.170 -39.601 1.00 45.53  ? 19  PRO A O     1 
ATOM 884   C CB    . PRO C 3 19  ? 13.370  129.404 -37.216 1.00 46.33  ? 19  PRO A CB    1 
ATOM 885   C CG    . PRO C 3 19  ? 14.406  128.449 -36.720 1.00 46.33  ? 19  PRO A CG    1 
ATOM 886   C CD    . PRO C 3 19  ? 13.577  127.235 -36.344 1.00 47.52  ? 19  PRO A CD    1 
ATOM 887   N N     . LYS C 3 20  ? 12.310  128.243 -40.487 1.00 46.33  ? 20  LYS A N     1 
ATOM 888   C CA    . LYS C 3 20  ? 12.784  128.096 -41.847 1.00 48.06  ? 20  LYS A CA    1 
ATOM 889   C C     . LYS C 3 20  ? 12.553  129.457 -42.452 1.00 48.65  ? 20  LYS A C     1 
ATOM 890   O O     . LYS C 3 20  ? 11.411  129.870 -42.648 1.00 49.60  ? 20  LYS A O     1 
ATOM 891   C CB    . LYS C 3 20  ? 11.954  127.058 -42.589 1.00 49.60  ? 20  LYS A CB    1 
ATOM 892   C CG    . LYS C 3 20  ? 11.808  125.767 -41.829 1.00 50.97  ? 20  LYS A CG    1 
ATOM 893   C CD    . LYS C 3 20  ? 11.183  124.661 -42.666 1.00 51.43  ? 20  LYS A CD    1 
ATOM 894   C CE    . LYS C 3 20  ? 9.696   124.517 -42.400 1.00 50.70  ? 20  LYS A CE    1 
ATOM 895   N NZ    . LYS C 3 20  ? 9.155   123.310 -43.084 1.00 51.38  ? 20  LYS A NZ    1 
ATOM 896   N N     . VAL C 3 21  ? 13.624  130.176 -42.729 1.00 48.79  ? 21  VAL A N     1 
ATOM 897   C CA    . VAL C 3 21  ? 13.457  131.498 -43.280 1.00 50.33  ? 21  VAL A CA    1 
ATOM 898   C C     . VAL C 3 21  ? 14.407  131.770 -44.401 1.00 51.26  ? 21  VAL A C     1 
ATOM 899   O O     . VAL C 3 21  ? 15.614  131.665 -44.230 1.00 52.32  ? 21  VAL A O     1 
ATOM 900   C CB    . VAL C 3 21  ? 13.667  132.560 -42.214 1.00 50.78  ? 21  VAL A CB    1 
ATOM 901   C CG1   . VAL C 3 21  ? 13.416  133.938 -42.803 1.00 52.12  ? 21  VAL A CG1   1 
ATOM 902   C CG2   . VAL C 3 21  ? 12.748  132.300 -41.038 1.00 50.50  ? 21  VAL A CG2   1 
ATOM 903   N N     . LYS C 3 22  ? 13.845  132.201 -45.521 1.00 52.76  ? 22  LYS A N     1 
ATOM 904   C CA    . LYS C 3 22  ? 14.607  132.520 -46.713 1.00 56.26  ? 22  LYS A CA    1 
ATOM 905   C C     . LYS C 3 22  ? 15.777  133.457 -46.439 1.00 58.26  ? 22  LYS A C     1 
ATOM 906   O O     . LYS C 3 22  ? 15.628  134.504 -45.796 1.00 58.66  ? 22  LYS A O     1 
ATOM 907   C CB    . LYS C 3 22  ? 13.681  133.123 -47.762 1.00 58.24  ? 22  LYS A CB    1 
ATOM 908   C CG    . LYS C 3 22  ? 12.896  134.342 -47.280 1.00 60.58  ? 22  LYS A CG    1 
ATOM 909   C CD    . LYS C 3 22  ? 11.430  134.295 -47.738 1.00 63.31  ? 22  LYS A CD    1 
ATOM 910   C CE    . LYS C 3 22  ? 11.277  133.901 -49.219 1.00 64.98  ? 22  LYS A CE    1 
ATOM 911   N NZ    . LYS C 3 22  ? 12.019  134.794 -50.163 1.00 65.35  ? 22  LYS A NZ    1 
ATOM 912   N N     . GLN C 3 23  ? 16.951  133.028 -46.888 1.00 60.57  ? 23  GLN A N     1 
ATOM 913   C CA    . GLN C 3 23  ? 18.180  133.785 -46.723 1.00 62.68  ? 23  GLN A CA    1 
ATOM 914   C C     . GLN C 3 23  ? 18.455  134.612 -47.962 1.00 64.36  ? 23  GLN A C     1 
ATOM 915   O O     . GLN C 3 23  ? 18.865  134.088 -48.998 1.00 63.90  ? 23  GLN A O     1 
ATOM 916   C CB    . GLN C 3 23  ? 19.357  132.840 -46.476 1.00 63.42  ? 23  GLN A CB    1 
ATOM 917   C CG    . GLN C 3 23  ? 20.725  133.507 -46.583 1.00 63.76  ? 23  GLN A CG    1 
ATOM 918   C CD    . GLN C 3 23  ? 20.930  134.584 -45.544 1.00 62.75  ? 23  GLN A CD    1 
ATOM 919   O OE1   . GLN C 3 23  ? 20.638  134.386 -44.370 1.00 61.76  ? 23  GLN A OE1   1 
ATOM 920   N NE2   . GLN C 3 23  ? 21.442  135.728 -45.972 1.00 61.26  ? 23  GLN A NE2   1 
ATOM 921   N N     . TRP C 3 24  ? 18.210  135.908 -47.846 1.00 66.97  ? 24  TRP A N     1 
ATOM 922   C CA    . TRP C 3 24  ? 18.435  136.855 -48.936 1.00 70.07  ? 24  TRP A CA    1 
ATOM 923   C C     . TRP C 3 24  ? 19.921  136.931 -49.311 1.00 69.54  ? 24  TRP A C     1 
ATOM 924   O O     . TRP C 3 24  ? 20.795  136.716 -48.465 1.00 69.41  ? 24  TRP A O     1 
ATOM 925   C CB    . TRP C 3 24  ? 17.923  138.240 -48.525 1.00 74.40  ? 24  TRP A CB    1 
ATOM 926   C CG    . TRP C 3 24  ? 17.994  138.472 -47.036 1.00 79.33  ? 24  TRP A CG    1 
ATOM 927   C CD1   . TRP C 3 24  ? 18.973  138.037 -46.173 1.00 79.76  ? 24  TRP A CD1   1 
ATOM 928   C CD2   . TRP C 3 24  ? 17.007  139.113 -46.225 1.00 80.60  ? 24  TRP A CD2   1 
ATOM 929   N NE1   . TRP C 3 24  ? 18.642  138.355 -44.882 1.00 79.93  ? 24  TRP A NE1   1 
ATOM 930   C CE2   . TRP C 3 24  ? 17.443  139.019 -44.882 1.00 81.29  ? 24  TRP A CE2   1 
ATOM 931   C CE3   . TRP C 3 24  ? 15.792  139.754 -46.502 1.00 82.70  ? 24  TRP A CE3   1 
ATOM 932   C CZ2   . TRP C 3 24  ? 16.707  139.541 -43.816 1.00 81.79  ? 24  TRP A CZ2   1 
ATOM 933   C CZ3   . TRP C 3 24  ? 15.055  140.275 -45.439 1.00 83.91  ? 24  TRP A CZ3   1 
ATOM 934   C CH2   . TRP C 3 24  ? 15.519  140.164 -44.111 1.00 83.07  ? 24  TRP A CH2   1 
ATOM 935   N N     . PRO C 3 25  ? 20.218  137.221 -50.595 1.00 68.92  ? 25  PRO A N     1 
ATOM 936   C CA    . PRO C 3 25  ? 21.588  137.328 -51.105 1.00 67.40  ? 25  PRO A CA    1 
ATOM 937   C C     . PRO C 3 25  ? 22.335  138.538 -50.583 1.00 67.05  ? 25  PRO A C     1 
ATOM 938   O O     . PRO C 3 25  ? 21.977  139.695 -50.846 1.00 65.33  ? 25  PRO A O     1 
ATOM 939   C CB    . PRO C 3 25  ? 21.389  137.400 -52.613 1.00 67.19  ? 25  PRO A CB    1 
ATOM 940   C CG    . PRO C 3 25  ? 20.079  138.116 -52.731 1.00 67.76  ? 25  PRO A CG    1 
ATOM 941   C CD    . PRO C 3 25  ? 19.245  137.421 -51.685 1.00 67.94  ? 25  PRO A CD    1 
ATOM 942   N N     . LEU C 3 26  ? 23.349  138.232 -49.786 1.00 67.26  ? 26  LEU A N     1 
ATOM 943   C CA    . LEU C 3 26  ? 24.223  139.224 -49.190 1.00 67.54  ? 26  LEU A CA    1 
ATOM 944   C C     . LEU C 3 26  ? 25.194  139.670 -50.274 1.00 68.11  ? 26  LEU A C     1 
ATOM 945   O O     . LEU C 3 26  ? 25.150  139.185 -51.408 1.00 67.92  ? 26  LEU A O     1 
ATOM 946   C CB    . LEU C 3 26  ? 24.995  138.606 -48.013 1.00 66.73  ? 26  LEU A CB    1 
ATOM 947   C CG    . LEU C 3 26  ? 24.311  138.365 -46.657 1.00 66.88  ? 26  LEU A CG    1 
ATOM 948   C CD1   . LEU C 3 26  ? 24.796  139.389 -45.647 1.00 67.68  ? 26  LEU A CD1   1 
ATOM 949   C CD2   . LEU C 3 26  ? 22.796  138.396 -46.777 1.00 65.86  ? 26  LEU A CD2   1 
ATOM 950   N N     . THR C 3 27  ? 26.084  140.579 -49.914 1.00 68.70  ? 27  THR A N     1 
ATOM 951   C CA    . THR C 3 27  ? 27.064  141.089 -50.858 1.00 69.20  ? 27  THR A CA    1 
ATOM 952   C C     . THR C 3 27  ? 28.186  140.097 -51.185 1.00 67.60  ? 27  THR A C     1 
ATOM 953   O O     . THR C 3 27  ? 28.467  139.173 -50.415 1.00 66.34  ? 27  THR A O     1 
ATOM 954   C CB    . THR C 3 27  ? 27.632  142.424 -50.357 1.00 71.25  ? 27  THR A CB    1 
ATOM 955   O OG1   . THR C 3 27  ? 28.175  142.260 -49.036 1.00 73.70  ? 27  THR A OG1   1 
ATOM 956   C CG2   . THR C 3 27  ? 26.516  143.469 -50.322 1.00 72.77  ? 27  THR A CG2   1 
ATOM 957   N N     . GLU C 3 28  ? 28.821  140.317 -52.335 1.00 66.62  ? 28  GLU A N     1 
ATOM 958   C CA    . GLU C 3 28  ? 29.902  139.471 -52.854 1.00 66.06  ? 28  GLU A CA    1 
ATOM 959   C C     . GLU C 3 28  ? 31.137  139.276 -51.960 1.00 65.58  ? 28  GLU A C     1 
ATOM 960   O O     . GLU C 3 28  ? 31.542  138.142 -51.668 1.00 64.27  ? 28  GLU A O     1 
ATOM 961   C CB    . GLU C 3 28  ? 30.325  139.973 -54.239 1.00 66.00  ? 28  GLU A CB    1 
ATOM 962   N N     . GLU C 3 29  ? 31.768  140.377 -51.572 1.00 65.93  ? 29  GLU A N     1 
ATOM 963   C CA    . GLU C 3 29  ? 32.947  140.292 -50.723 1.00 65.41  ? 29  GLU A CA    1 
ATOM 964   C C     . GLU C 3 29  ? 32.526  139.667 -49.412 1.00 63.14  ? 29  GLU A C     1 
ATOM 965   O O     . GLU C 3 29  ? 33.269  138.892 -48.814 1.00 61.81  ? 29  GLU A O     1 
ATOM 966   C CB    . GLU C 3 29  ? 33.557  141.677 -50.512 1.00 68.59  ? 29  GLU A CB    1 
ATOM 967   C CG    . GLU C 3 29  ? 34.217  142.220 -51.781 1.00 73.96  ? 29  GLU A CG    1 
ATOM 968   C CD    . GLU C 3 29  ? 34.697  143.662 -51.665 1.00 77.11  ? 29  GLU A CD    1 
ATOM 969   O OE1   . GLU C 3 29  ? 34.584  144.269 -50.570 1.00 79.32  ? 29  GLU A OE1   1 
ATOM 970   O OE2   . GLU C 3 29  ? 35.191  144.188 -52.691 1.00 77.77  ? 29  GLU A OE2   1 
ATOM 971   N N     . LYS C 3 30  ? 31.286  139.947 -49.028 1.00 60.69  ? 30  LYS A N     1 
ATOM 972   C CA    . LYS C 3 30  ? 30.713  139.410 -47.807 1.00 58.09  ? 30  LYS A CA    1 
ATOM 973   C C     . LYS C 3 30  ? 30.618  137.883 -47.875 1.00 55.42  ? 30  LYS A C     1 
ATOM 974   O O     . LYS C 3 30  ? 31.008  137.188 -46.931 1.00 54.36  ? 30  LYS A O     1 
ATOM 975   C CB    . LYS C 3 30  ? 29.340  140.012 -47.578 1.00 59.63  ? 30  LYS A CB    1 
ATOM 976   N N     . ILE C 3 31  ? 30.096  137.371 -48.987 1.00 52.21  ? 31  ILE A N     1 
ATOM 977   C CA    . ILE C 3 31  ? 29.964  135.932 -49.168 1.00 50.16  ? 31  ILE A CA    1 
ATOM 978   C C     . ILE C 3 31  ? 31.270  135.310 -48.736 1.00 49.17  ? 31  ILE A C     1 
ATOM 979   O O     . ILE C 3 31  ? 31.362  134.724 -47.659 1.00 47.45  ? 31  ILE A O     1 
ATOM 980   C CB    . ILE C 3 31  ? 29.664  135.586 -50.642 1.00 50.10  ? 31  ILE A CB    1 
ATOM 981   C CG1   . ILE C 3 31  ? 28.185  135.838 -50.935 1.00 50.18  ? 31  ILE A CG1   1 
ATOM 982   C CG2   . ILE C 3 31  ? 30.043  134.147 -50.963 1.00 50.40  ? 31  ILE A CG2   1 
ATOM 983   C CD1   . ILE C 3 31  ? 27.786  135.572 -52.369 1.00 49.38  ? 31  ILE A CD1   1 
ATOM 984   N N     . LYS C 3 32  ? 32.306  135.602 -49.508 1.00 49.99  ? 32  LYS A N     1 
ATOM 985   C CA    . LYS C 3 32  ? 33.637  135.096 -49.238 1.00 51.57  ? 32  LYS A CA    1 
ATOM 986   C C     . LYS C 3 32  ? 34.033  135.363 -47.788 1.00 52.24  ? 32  LYS A C     1 
ATOM 987   O O     . LYS C 3 32  ? 34.626  134.509 -47.126 1.00 53.07  ? 32  LYS A O     1 
ATOM 988   C CB    . LYS C 3 32  ? 34.624  135.747 -50.178 1.00 51.04  ? 32  LYS A CB    1 
ATOM 989   N N     . ALA C 3 33  ? 33.680  136.545 -47.294 1.00 52.60  ? 33  ALA A N     1 
ATOM 990   C CA    . ALA C 3 33  ? 33.995  136.927 -45.921 1.00 52.23  ? 33  ALA A CA    1 
ATOM 991   C C     . ALA C 3 33  ? 33.374  135.911 -44.982 1.00 50.80  ? 33  ALA A C     1 
ATOM 992   O O     . ALA C 3 33  ? 34.074  135.173 -44.288 1.00 47.62  ? 33  ALA A O     1 
ATOM 993   C CB    . ALA C 3 33  ? 33.451  138.329 -45.624 1.00 52.62  ? 33  ALA A CB    1 
ATOM 994   N N     . LEU C 3 34  ? 32.051  135.851 -45.022 1.00 49.90  ? 34  LEU A N     1 
ATOM 995   C CA    . LEU C 3 34  ? 31.304  134.929 -44.207 1.00 51.09  ? 34  LEU A CA    1 
ATOM 996   C C     . LEU C 3 34  ? 31.880  133.535 -44.357 1.00 52.28  ? 34  LEU A C     1 
ATOM 997   O O     . LEU C 3 34  ? 31.982  132.790 -43.384 1.00 52.31  ? 34  LEU A O     1 
ATOM 998   C CB    . LEU C 3 34  ? 29.839  134.952 -44.616 1.00 50.43  ? 34  LEU A CB    1 
ATOM 999   C CG    . LEU C 3 34  ? 28.993  135.967 -43.844 1.00 52.16  ? 34  LEU A CG    1 
ATOM 1000  C CD1   . LEU C 3 34  ? 27.756  136.384 -44.633 1.00 52.20  ? 34  LEU A CD1   1 
ATOM 1001  C CD2   . LEU C 3 34  ? 28.610  135.385 -42.480 1.00 52.58  ? 34  LEU A CD2   1 
ATOM 1002  N N     . VAL C 3 35  ? 32.295  133.198 -45.575 1.00 53.78  ? 35  VAL A N     1 
ATOM 1003  C CA    . VAL C 3 35  ? 32.872  131.884 -45.824 1.00 55.38  ? 35  VAL A CA    1 
ATOM 1004  C C     . VAL C 3 35  ? 34.116  131.739 -44.969 1.00 56.00  ? 35  VAL A C     1 
ATOM 1005  O O     . VAL C 3 35  ? 34.148  130.924 -44.045 1.00 56.34  ? 35  VAL A O     1 
ATOM 1006  C CB    . VAL C 3 35  ? 33.267  131.676 -47.310 1.00 56.01  ? 35  VAL A CB    1 
ATOM 1007  C CG1   . VAL C 3 35  ? 33.817  130.257 -47.511 1.00 55.74  ? 35  VAL A CG1   1 
ATOM 1008  C CG2   . VAL C 3 35  ? 32.075  131.921 -48.229 1.00 55.96  ? 35  VAL A CG2   1 
ATOM 1009  N N     . GLU C 3 36  ? 35.106  132.585 -45.255 1.00 57.08  ? 36  GLU A N     1 
ATOM 1010  C CA    . GLU C 3 36  ? 36.386  132.604 -44.551 1.00 57.47  ? 36  GLU A CA    1 
ATOM 1011  C C     . GLU C 3 36  ? 36.170  132.442 -43.050 1.00 57.26  ? 36  GLU A C     1 
ATOM 1012  O O     . GLU C 3 36  ? 36.960  131.808 -42.345 1.00 57.43  ? 36  GLU A O     1 
ATOM 1013  C CB    . GLU C 3 36  ? 37.112  133.914 -44.845 1.00 57.35  ? 36  GLU A CB    1 
ATOM 1014  N N     . ILE C 3 37  ? 35.046  132.975 -42.594 1.00 57.01  ? 37  ILE A N     1 
ATOM 1015  C CA    . ILE C 3 37  ? 34.667  132.916 -41.200 1.00 58.01  ? 37  ILE A CA    1 
ATOM 1016  C C     . ILE C 3 37  ? 34.262  131.488 -40.798 1.00 57.99  ? 37  ILE A C     1 
ATOM 1017  O O     . ILE C 3 37  ? 34.991  130.814 -40.058 1.00 57.53  ? 37  ILE A O     1 
ATOM 1018  C CB    . ILE C 3 37  ? 33.515  133.914 -40.943 1.00 59.03  ? 37  ILE A CB    1 
ATOM 1019  C CG1   . ILE C 3 37  ? 33.906  135.295 -41.486 1.00 59.63  ? 37  ILE A CG1   1 
ATOM 1020  C CG2   . ILE C 3 37  ? 33.217  134.014 -39.454 1.00 60.72  ? 37  ILE A CG2   1 
ATOM 1021  C CD1   . ILE C 3 37  ? 32.788  136.306 -41.512 1.00 58.88  ? 37  ILE A CD1   1 
ATOM 1022  N N     . CYS C 3 38  ? 33.126  131.024 -41.322 1.00 57.63  ? 38  CYS A N     1 
ATOM 1023  C CA    . CYS C 3 38  ? 32.599  129.686 -41.022 1.00 56.45  ? 38  CYS A CA    1 
ATOM 1024  C C     . CYS C 3 38  ? 33.656  128.603 -41.031 1.00 54.77  ? 38  CYS A C     1 
ATOM 1025  O O     . CYS C 3 38  ? 33.650  127.722 -40.178 1.00 54.77  ? 38  CYS A O     1 
ATOM 1026  C CB    . CYS C 3 38  ? 31.506  129.298 -42.012 1.00 56.47  ? 38  CYS A CB    1 
ATOM 1027  S SG    . CYS C 3 38  ? 29.972  130.155 -41.769 1.00 58.81  ? 38  CYS A SG    1 
ATOM 1028  N N     . THR C 3 39  ? 34.547  128.673 -42.015 1.00 53.13  ? 39  THR A N     1 
ATOM 1029  C CA    . THR C 3 39  ? 35.622  127.710 -42.155 1.00 52.69  ? 39  THR A CA    1 
ATOM 1030  C C     . THR C 3 39  ? 36.310  127.558 -40.805 1.00 53.46  ? 39  THR A C     1 
ATOM 1031  O O     . THR C 3 39  ? 36.323  126.465 -40.214 1.00 53.78  ? 39  THR A O     1 
ATOM 1032  C CB    . THR C 3 39  ? 36.638  128.185 -43.215 1.00 52.17  ? 39  THR A CB    1 
ATOM 1033  O OG1   . THR C 3 39  ? 36.008  128.203 -44.501 1.00 50.43  ? 39  THR A OG1   1 
ATOM 1034  C CG2   . THR C 3 39  ? 37.849  127.262 -43.266 1.00 52.43  ? 39  THR A CG2   1 
ATOM 1035  N N     . GLU C 3 40  ? 36.802  128.683 -40.287 1.00 53.08  ? 40  GLU A N     1 
ATOM 1036  C CA    . GLU C 3 40  ? 37.492  128.706 -39.000 1.00 51.81  ? 40  GLU A CA    1 
ATOM 1037  C C     . GLU C 3 40  ? 36.575  128.112 -37.949 1.00 50.23  ? 40  GLU A C     1 
ATOM 1038  O O     . GLU C 3 40  ? 36.941  127.170 -37.238 1.00 48.63  ? 40  GLU A O     1 
ATOM 1039  C CB    . GLU C 3 40  ? 37.877  130.142 -38.627 1.00 51.66  ? 40  GLU A CB    1 
ATOM 1040  N N     . MET C 3 41  ? 35.352  128.622 -37.920 1.00 49.51  ? 41  MET A N     1 
ATOM 1041  C CA    . MET C 3 41  ? 34.367  128.147 -36.975 1.00 51.04  ? 41  MET A CA    1 
ATOM 1042  C C     . MET C 3 41  ? 34.305  126.616 -37.034 1.00 51.02  ? 41  MET A C     1 
ATOM 1043  O O     . MET C 3 41  ? 34.319  125.960 -35.987 1.00 52.08  ? 41  MET A O     1 
ATOM 1044  C CB    . MET C 3 41  ? 32.995  128.760 -37.287 1.00 53.10  ? 41  MET A CB    1 
ATOM 1045  C CG    . MET C 3 41  ? 32.939  130.297 -37.297 1.00 55.18  ? 41  MET A CG    1 
ATOM 1046  S SD    . MET C 3 41  ? 31.968  131.046 -35.937 1.00 58.15  ? 41  MET A SD    1 
ATOM 1047  C CE    . MET C 3 41  ? 33.284  131.383 -34.742 1.00 57.94  ? 41  MET A CE    1 
ATOM 1048  N N     . GLU C 3 42  ? 34.357  126.052 -38.248 1.00 49.65  ? 42  GLU A N     1 
ATOM 1049  C CA    . GLU C 3 42  ? 34.269  124.599 -38.399 1.00 48.25  ? 42  GLU A CA    1 
ATOM 1050  C C     . GLU C 3 42  ? 35.379  123.813 -37.736 1.00 47.31  ? 42  GLU A C     1 
ATOM 1051  O O     . GLU C 3 42  ? 35.097  123.010 -36.849 1.00 48.15  ? 42  GLU A O     1 
ATOM 1052  C CB    . GLU C 3 42  ? 34.081  124.131 -39.860 1.00 48.22  ? 42  GLU A CB    1 
ATOM 1053  C CG    . GLU C 3 42  ? 33.561  122.639 -39.930 1.00 49.17  ? 42  GLU A CG    1 
ATOM 1054  C CD    . GLU C 3 42  ? 33.186  122.111 -41.333 1.00 48.18  ? 42  GLU A CD    1 
ATOM 1055  O OE1   . GLU C 3 42  ? 33.668  122.677 -42.343 1.00 47.63  ? 42  GLU A OE1   1 
ATOM 1056  O OE2   . GLU C 3 42  ? 32.421  121.109 -41.406 1.00 45.62  ? 42  GLU A OE2   1 
ATOM 1057  N N     . LYS C 3 43  ? 36.631  124.023 -38.136 1.00 45.40  ? 43  LYS A N     1 
ATOM 1058  C CA    . LYS C 3 43  ? 37.724  123.269 -37.514 1.00 43.79  ? 43  LYS A CA    1 
ATOM 1059  C C     . LYS C 3 43  ? 37.634  123.415 -36.001 1.00 42.25  ? 43  LYS A C     1 
ATOM 1060  O O     . LYS C 3 43  ? 37.868  122.464 -35.255 1.00 41.04  ? 43  LYS A O     1 
ATOM 1061  C CB    . LYS C 3 43  ? 39.077  123.747 -38.024 1.00 43.57  ? 43  LYS A CB    1 
ATOM 1062  N N     . GLU C 3 44  ? 37.193  124.590 -35.568 1.00 42.15  ? 44  GLU A N     1 
ATOM 1063  C CA    . GLU C 3 44  ? 37.033  124.866 -34.158 1.00 44.37  ? 44  GLU A CA    1 
ATOM 1064  C C     . GLU C 3 44  ? 36.088  123.855 -33.519 1.00 43.92  ? 44  GLU A C     1 
ATOM 1065  O O     . GLU C 3 44  ? 36.271  123.446 -32.371 1.00 44.33  ? 44  GLU A O     1 
ATOM 1066  C CB    . GLU C 3 44  ? 36.508  126.279 -33.970 1.00 47.84  ? 44  GLU A CB    1 
ATOM 1067  C CG    . GLU C 3 44  ? 37.507  127.330 -34.408 1.00 55.44  ? 44  GLU A CG    1 
ATOM 1068  C CD    . GLU C 3 44  ? 37.209  128.716 -33.846 1.00 60.89  ? 44  GLU A CD    1 
ATOM 1069  O OE1   . GLU C 3 44  ? 36.312  129.404 -34.399 1.00 62.60  ? 44  GLU A OE1   1 
ATOM 1070  O OE2   . GLU C 3 44  ? 37.881  129.116 -32.854 1.00 63.08  ? 44  GLU A OE2   1 
ATOM 1071  N N     . GLY C 3 45  ? 35.138  123.373 -34.305 1.00 43.32  ? 45  GLY A N     1 
ATOM 1072  C CA    . GLY C 3 45  ? 34.179  122.417 -33.789 1.00 42.08  ? 45  GLY A CA    1 
ATOM 1073  C C     . GLY C 3 45  ? 32.934  123.177 -33.401 1.00 41.70  ? 45  GLY A C     1 
ATOM 1074  O O     . GLY C 3 45  ? 31.970  122.613 -32.882 1.00 41.32  ? 45  GLY A O     1 
ATOM 1075  N N     . LYS C 3 46  ? 32.969  124.478 -33.661 1.00 41.06  ? 46  LYS A N     1 
ATOM 1076  C CA    . LYS C 3 46  ? 31.854  125.342 -33.356 1.00 40.77  ? 46  LYS A CA    1 
ATOM 1077  C C     . LYS C 3 46  ? 30.676  125.005 -34.245 1.00 41.40  ? 46  LYS A C     1 
ATOM 1078  O O     . LYS C 3 46  ? 29.525  125.139 -33.836 1.00 42.24  ? 46  LYS A O     1 
ATOM 1079  C CB    . LYS C 3 46  ? 32.274  126.788 -33.516 1.00 38.98  ? 46  LYS A CB    1 
ATOM 1080  C CG    . LYS C 3 46  ? 33.315  127.170 -32.506 1.00 38.66  ? 46  LYS A CG    1 
ATOM 1081  C CD    . LYS C 3 46  ? 33.719  128.601 -32.680 1.00 39.97  ? 46  LYS A CD    1 
ATOM 1082  C CE    . LYS C 3 46  ? 34.596  129.053 -31.522 1.00 41.67  ? 46  LYS A CE    1 
ATOM 1083  N NZ    . LYS C 3 46  ? 35.113  130.447 -31.722 1.00 42.87  ? 46  LYS A NZ    1 
ATOM 1084  N N     . ILE C 3 47  ? 30.973  124.506 -35.441 1.00 42.75  ? 47  ILE A N     1 
ATOM 1085  C CA    . ILE C 3 47  ? 29.945  124.102 -36.401 1.00 44.77  ? 47  ILE A CA    1 
ATOM 1086  C C     . ILE C 3 47  ? 30.349  122.871 -37.229 1.00 46.94  ? 47  ILE A C     1 
ATOM 1087  O O     . ILE C 3 47  ? 31.396  122.251 -37.001 1.00 47.96  ? 47  ILE A O     1 
ATOM 1088  C CB    . ILE C 3 47  ? 29.577  125.250 -37.376 1.00 44.09  ? 47  ILE A CB    1 
ATOM 1089  C CG1   . ILE C 3 47  ? 30.844  125.959 -37.872 1.00 43.20  ? 47  ILE A CG1   1 
ATOM 1090  C CG2   . ILE C 3 47  ? 28.602  126.196 -36.722 1.00 43.09  ? 47  ILE A CG2   1 
ATOM 1091  C CD1   . ILE C 3 47  ? 30.604  127.044 -38.925 1.00 43.73  ? 47  ILE A CD1   1 
ATOM 1092  N N     . SER C 3 48  ? 29.501  122.524 -38.190 1.00 48.09  ? 48  SER A N     1 
ATOM 1093  C CA    . SER C 3 48  ? 29.742  121.392 -39.073 1.00 49.06  ? 48  SER A CA    1 
ATOM 1094  C C     . SER C 3 48  ? 28.771  121.486 -40.236 1.00 49.35  ? 48  SER A C     1 
ATOM 1095  O O     . SER C 3 48  ? 27.721  122.140 -40.146 1.00 48.79  ? 48  SER A O     1 
ATOM 1096  C CB    . SER C 3 48  ? 29.510  120.075 -38.329 1.00 50.38  ? 48  SER A CB    1 
ATOM 1097  O OG    . SER C 3 48  ? 28.195  120.022 -37.794 1.00 52.28  ? 48  SER A OG    1 
ATOM 1098  N N     . LYS C 3 49  ? 29.125  120.852 -41.342 1.00 48.42  ? 49  LYS A N     1 
ATOM 1099  C CA    . LYS C 3 49  ? 28.236  120.874 -42.486 1.00 46.77  ? 49  LYS A CA    1 
ATOM 1100  C C     . LYS C 3 49  ? 27.048  120.020 -42.061 1.00 44.18  ? 49  LYS A C     1 
ATOM 1101  O O     . LYS C 3 49  ? 27.150  119.218 -41.123 1.00 41.78  ? 49  LYS A O     1 
ATOM 1102  C CB    . LYS C 3 49  ? 28.904  120.258 -43.709 1.00 50.13  ? 49  LYS A CB    1 
ATOM 1103  C CG    . LYS C 3 49  ? 30.393  120.577 -43.898 1.00 52.81  ? 49  LYS A CG    1 
ATOM 1104  C CD    . LYS C 3 49  ? 30.659  121.997 -44.371 1.00 52.34  ? 49  LYS A CD    1 
ATOM 1105  C CE    . LYS C 3 49  ? 32.003  122.059 -45.088 1.00 51.21  ? 49  LYS A CE    1 
ATOM 1106  N NZ    . LYS C 3 49  ? 33.052  121.267 -44.379 1.00 51.06  ? 49  LYS A NZ    1 
ATOM 1107  N N     . ILE C 3 50  ? 25.933  120.172 -42.764 1.00 42.38  ? 50  ILE A N     1 
ATOM 1108  C CA    . ILE C 3 50  ? 24.730  119.429 -42.419 1.00 40.73  ? 50  ILE A CA    1 
ATOM 1109  C C     . ILE C 3 50  ? 24.081  118.714 -43.601 1.00 39.43  ? 50  ILE A C     1 
ATOM 1110  O O     . ILE C 3 50  ? 24.270  119.090 -44.765 1.00 39.67  ? 50  ILE A O     1 
ATOM 1111  C CB    . ILE C 3 50  ? 23.686  120.362 -41.800 1.00 41.95  ? 50  ILE A CB    1 
ATOM 1112  C CG1   . ILE C 3 50  ? 23.058  121.213 -42.900 1.00 42.67  ? 50  ILE A CG1   1 
ATOM 1113  C CG2   . ILE C 3 50  ? 24.349  121.303 -40.800 1.00 40.57  ? 50  ILE A CG2   1 
ATOM 1114  C CD1   . ILE C 3 50  ? 21.846  122.001 -42.463 1.00 45.63  ? 50  ILE A CD1   1 
ATOM 1115  N N     . GLY C 3 51  ? 23.270  117.709 -43.277 1.00 37.79  ? 51  GLY A N     1 
ATOM 1116  C CA    . GLY C 3 51  ? 22.582  116.945 -44.297 1.00 34.28  ? 51  GLY A CA    1 
ATOM 1117  C C     . GLY C 3 51  ? 21.440  117.717 -44.913 1.00 32.41  ? 51  GLY A C     1 
ATOM 1118  O O     . GLY C 3 51  ? 20.761  118.470 -44.239 1.00 32.14  ? 51  GLY A O     1 
ATOM 1119  N N     . PRO C 3 52  ? 21.210  117.546 -46.210 1.00 32.70  ? 52  PRO A N     1 
ATOM 1120  C CA    . PRO C 3 52  ? 20.146  118.208 -46.968 1.00 34.05  ? 52  PRO A CA    1 
ATOM 1121  C C     . PRO C 3 52  ? 18.768  117.677 -46.594 1.00 33.71  ? 52  PRO A C     1 
ATOM 1122  O O     . PRO C 3 52  ? 18.105  117.022 -47.390 1.00 32.59  ? 52  PRO A O     1 
ATOM 1123  C CB    . PRO C 3 52  ? 20.491  117.849 -48.409 1.00 35.05  ? 52  PRO A CB    1 
ATOM 1124  C CG    . PRO C 3 52  ? 21.115  116.473 -48.261 1.00 34.31  ? 52  PRO A CG    1 
ATOM 1125  C CD    . PRO C 3 52  ? 22.039  116.713 -47.092 1.00 33.67  ? 52  PRO A CD    1 
ATOM 1126  N N     . GLU C 3 53  ? 18.375  117.920 -45.354 1.00 35.26  ? 53  GLU A N     1 
ATOM 1127  C CA    . GLU C 3 53  ? 17.074  117.501 -44.854 1.00 36.95  ? 53  GLU A CA    1 
ATOM 1128  C C     . GLU C 3 53  ? 16.690  118.398 -43.692 1.00 38.32  ? 53  GLU A C     1 
ATOM 1129  O O     . GLU C 3 53  ? 15.619  118.242 -43.119 1.00 38.88  ? 53  GLU A O     1 
ATOM 1130  C CB    . GLU C 3 53  ? 17.090  116.046 -44.390 1.00 37.01  ? 53  GLU A CB    1 
ATOM 1131  C CG    . GLU C 3 53  ? 18.067  115.772 -43.259 1.00 37.13  ? 53  GLU A CG    1 
ATOM 1132  C CD    . GLU C 3 53  ? 19.281  115.030 -43.742 1.00 36.89  ? 53  GLU A CD    1 
ATOM 1133  O OE1   . GLU C 3 53  ? 19.708  114.093 -43.035 1.00 38.49  ? 53  GLU A OE1   1 
ATOM 1134  O OE2   . GLU C 3 53  ? 19.779  115.358 -44.843 1.00 36.10  ? 53  GLU A OE2   1 
ATOM 1135  N N     . ASN C 3 54  ? 17.621  119.256 -43.281 1.00 40.30  ? 54  ASN A N     1 
ATOM 1136  C CA    . ASN C 3 54  ? 17.378  120.207 -42.204 1.00 42.83  ? 54  ASN A CA    1 
ATOM 1137  C C     . ASN C 3 54  ? 16.896  121.422 -42.975 1.00 42.76  ? 54  ASN A C     1 
ATOM 1138  O O     . ASN C 3 54  ? 17.693  122.274 -43.371 1.00 42.85  ? 54  ASN A O     1 
ATOM 1139  C CB    . ASN C 3 54  ? 18.677  120.526 -41.452 1.00 46.13  ? 54  ASN A CB    1 
ATOM 1140  C CG    . ASN C 3 54  ? 19.324  119.281 -40.827 1.00 51.00  ? 54  ASN A CG    1 
ATOM 1141  O OD1   . ASN C 3 54  ? 18.767  118.671 -39.910 1.00 54.28  ? 54  ASN A OD1   1 
ATOM 1142  N ND2   . ASN C 3 54  ? 20.511  118.911 -41.316 1.00 51.59  ? 54  ASN A ND2   1 
ATOM 1143  N N     . PRO C 3 55  ? 15.576  121.520 -43.194 1.00 41.21  ? 55  PRO A N     1 
ATOM 1144  C CA    . PRO C 3 55  ? 14.973  122.624 -43.934 1.00 41.17  ? 55  PRO A CA    1 
ATOM 1145  C C     . PRO C 3 55  ? 14.980  123.918 -43.148 1.00 41.00  ? 55  PRO A C     1 
ATOM 1146  O O     . PRO C 3 55  ? 15.077  124.994 -43.731 1.00 41.51  ? 55  PRO A O     1 
ATOM 1147  C CB    . PRO C 3 55  ? 13.552  122.131 -44.141 1.00 39.78  ? 55  PRO A CB    1 
ATOM 1148  C CG    . PRO C 3 55  ? 13.258  121.531 -42.819 1.00 40.21  ? 55  PRO A CG    1 
ATOM 1149  C CD    . PRO C 3 55  ? 14.532  120.776 -42.462 1.00 40.96  ? 55  PRO A CD    1 
ATOM 1150  N N     . TYR C 3 56  ? 14.919  123.805 -41.825 1.00 39.73  ? 56  TYR A N     1 
ATOM 1151  C CA    . TYR C 3 56  ? 14.886  124.985 -40.980 1.00 39.63  ? 56  TYR A CA    1 
ATOM 1152  C C     . TYR C 3 56  ? 15.979  125.986 -41.359 1.00 40.51  ? 56  TYR A C     1 
ATOM 1153  O O     . TYR C 3 56  ? 17.140  125.605 -41.524 1.00 39.86  ? 56  TYR A O     1 
ATOM 1154  C CB    . TYR C 3 56  ? 14.978  124.572 -39.515 1.00 38.38  ? 56  TYR A CB    1 
ATOM 1155  C CG    . TYR C 3 56  ? 13.898  123.592 -39.122 1.00 35.89  ? 56  TYR A CG    1 
ATOM 1156  C CD1   . TYR C 3 56  ? 14.199  122.452 -38.400 1.00 35.31  ? 56  TYR A CD1   1 
ATOM 1157  C CD2   . TYR C 3 56  ? 12.573  123.798 -39.487 1.00 34.55  ? 56  TYR A CD2   1 
ATOM 1158  C CE1   . TYR C 3 56  ? 13.207  121.541 -38.047 1.00 33.33  ? 56  TYR A CE1   1 
ATOM 1159  C CE2   . TYR C 3 56  ? 11.574  122.892 -39.137 1.00 32.28  ? 56  TYR A CE2   1 
ATOM 1160  C CZ    . TYR C 3 56  ? 11.904  121.771 -38.419 1.00 31.91  ? 56  TYR A CZ    1 
ATOM 1161  O OH    . TYR C 3 56  ? 10.939  120.876 -38.062 1.00 31.14  ? 56  TYR A OH    1 
ATOM 1162  N N     . ASN C 3 57  ? 15.578  127.233 -41.603 1.00 40.91  ? 57  ASN A N     1 
ATOM 1163  C CA    . ASN C 3 57  ? 16.532  128.271 -41.970 1.00 41.04  ? 57  ASN A CA    1 
ATOM 1164  C C     . ASN C 3 57  ? 16.335  129.621 -41.297 1.00 40.10  ? 57  ASN A C     1 
ATOM 1165  O O     . ASN C 3 57  ? 15.214  130.027 -41.029 1.00 38.39  ? 57  ASN A O     1 
ATOM 1166  C CB    . ASN C 3 57  ? 16.551  128.502 -43.482 1.00 43.14  ? 57  ASN A CB    1 
ATOM 1167  C CG    . ASN C 3 57  ? 17.652  129.473 -43.903 1.00 46.02  ? 57  ASN A CG    1 
ATOM 1168  O OD1   . ASN C 3 57  ? 18.628  129.680 -43.177 1.00 47.65  ? 57  ASN A OD1   1 
ATOM 1169  N ND2   . ASN C 3 57  ? 17.500  130.064 -45.084 1.00 47.16  ? 57  ASN A ND2   1 
ATOM 1170  N N     . THR C 3 58  ? 17.441  130.316 -41.055 1.00 39.85  ? 58  THR A N     1 
ATOM 1171  C CA    . THR C 3 58  ? 17.436  131.633 -40.434 1.00 40.79  ? 58  THR A CA    1 
ATOM 1172  C C     . THR C 3 58  ? 18.495  132.480 -41.167 1.00 41.85  ? 58  THR A C     1 
ATOM 1173  O O     . THR C 3 58  ? 19.558  131.995 -41.542 1.00 41.41  ? 58  THR A O     1 
ATOM 1174  C CB    . THR C 3 58  ? 17.765  131.589 -38.892 1.00 39.82  ? 58  THR A CB    1 
ATOM 1175  O OG1   . THR C 3 58  ? 19.130  131.966 -38.676 1.00 39.82  ? 58  THR A OG1   1 
ATOM 1176  C CG2   . THR C 3 58  ? 17.504  130.190 -38.281 1.00 38.77  ? 58  THR A CG2   1 
ATOM 1177  N N     . PRO C 3 59  ? 18.197  133.764 -41.400 1.00 43.12  ? 59  PRO A N     1 
ATOM 1178  C CA    . PRO C 3 59  ? 19.078  134.707 -42.089 1.00 43.26  ? 59  PRO A CA    1 
ATOM 1179  C C     . PRO C 3 59  ? 20.360  135.024 -41.336 1.00 42.67  ? 59  PRO A C     1 
ATOM 1180  O O     . PRO C 3 59  ? 20.392  135.000 -40.105 1.00 41.29  ? 59  PRO A O     1 
ATOM 1181  C CB    . PRO C 3 59  ? 18.181  135.928 -42.242 1.00 44.88  ? 59  PRO A CB    1 
ATOM 1182  C CG    . PRO C 3 59  ? 16.856  135.292 -42.462 1.00 42.95  ? 59  PRO A CG    1 
ATOM 1183  C CD    . PRO C 3 59  ? 16.860  134.357 -41.275 1.00 42.03  ? 59  PRO A CD    1 
ATOM 1184  N N     . VAL C 3 60  ? 21.374  135.401 -42.112 1.00 42.37  ? 60  VAL A N     1 
ATOM 1185  C CA    . VAL C 3 60  ? 22.700  135.727 -41.607 1.00 42.34  ? 60  VAL A CA    1 
ATOM 1186  C C     . VAL C 3 60  ? 23.363  136.819 -42.419 1.00 42.17  ? 60  VAL A C     1 
ATOM 1187  O O     . VAL C 3 60  ? 23.119  136.978 -43.610 1.00 41.69  ? 60  VAL A O     1 
ATOM 1188  C CB    . VAL C 3 60  ? 23.636  134.483 -41.700 1.00 43.22  ? 60  VAL A CB    1 
ATOM 1189  C CG1   . VAL C 3 60  ? 23.509  133.822 -43.084 1.00 41.95  ? 60  VAL A CG1   1 
ATOM 1190  C CG2   . VAL C 3 60  ? 25.102  134.886 -41.430 1.00 41.86  ? 60  VAL A CG2   1 
ATOM 1191  N N     . PHE C 3 61  ? 24.225  137.559 -41.749 1.00 44.50  ? 61  PHE A N     1 
ATOM 1192  C CA    . PHE C 3 61  ? 24.981  138.616 -42.390 1.00 49.22  ? 61  PHE A CA    1 
ATOM 1193  C C     . PHE C 3 61  ? 26.331  138.676 -41.714 1.00 52.21  ? 61  PHE A C     1 
ATOM 1194  O O     . PHE C 3 61  ? 26.599  137.937 -40.758 1.00 53.02  ? 61  PHE A O     1 
ATOM 1195  C CB    . PHE C 3 61  ? 24.310  139.975 -42.225 1.00 51.58  ? 61  PHE A CB    1 
ATOM 1196  C CG    . PHE C 3 61  ? 22.849  139.954 -42.500 1.00 53.81  ? 61  PHE A CG    1 
ATOM 1197  C CD1   . PHE C 3 61  ? 21.979  139.343 -41.603 1.00 55.35  ? 61  PHE A CD1   1 
ATOM 1198  C CD2   . PHE C 3 61  ? 22.340  140.495 -43.672 1.00 54.62  ? 61  PHE A CD2   1 
ATOM 1199  C CE1   . PHE C 3 61  ? 20.613  139.263 -41.869 1.00 55.41  ? 61  PHE A CE1   1 
ATOM 1200  C CE2   . PHE C 3 61  ? 20.968  140.422 -43.948 1.00 56.26  ? 61  PHE A CE2   1 
ATOM 1201  C CZ    . PHE C 3 61  ? 20.108  139.802 -43.041 1.00 54.93  ? 61  PHE A CZ    1 
ATOM 1202  N N     . ALA C 3 62  ? 27.158  139.603 -42.170 1.00 55.00  ? 62  ALA A N     1 
ATOM 1203  C CA    . ALA C 3 62  ? 28.484  139.772 -41.604 1.00 58.10  ? 62  ALA A CA    1 
ATOM 1204  C C     . ALA C 3 62  ? 28.987  141.164 -41.872 1.00 60.26  ? 62  ALA A C     1 
ATOM 1205  O O     . ALA C 3 62  ? 28.621  141.770 -42.882 1.00 61.27  ? 62  ALA A O     1 
ATOM 1206  C CB    . ALA C 3 62  ? 29.440  138.776 -42.204 1.00 58.83  ? 62  ALA A CB    1 
ATOM 1207  N N     . ILE C 3 63  ? 29.812  141.678 -40.964 1.00 61.69  ? 63  ILE A N     1 
ATOM 1208  C CA    . ILE C 3 63  ? 30.371  143.004 -41.134 1.00 63.75  ? 63  ILE A CA    1 
ATOM 1209  C C     . ILE C 3 63  ? 31.341  143.379 -40.023 1.00 66.41  ? 63  ILE A C     1 
ATOM 1210  O O     . ILE C 3 63  ? 30.938  143.826 -38.942 1.00 66.42  ? 63  ILE A O     1 
ATOM 1211  C CB    . ILE C 3 63  ? 29.259  144.090 -41.300 1.00 61.59  ? 63  ILE A CB    1 
ATOM 1212  C CG1   . ILE C 3 63  ? 29.865  145.411 -41.772 1.00 60.18  ? 63  ILE A CG1   1 
ATOM 1213  C CG2   . ILE C 3 63  ? 28.440  144.241 -40.011 1.00 60.11  ? 63  ILE A CG2   1 
ATOM 1214  C CD1   . ILE C 3 63  ? 28.850  146.376 -42.344 1.00 59.16  ? 63  ILE A CD1   1 
ATOM 1215  N N     . LYS C 3 64  ? 32.631  143.171 -40.286 1.00 69.63  ? 64  LYS A N     1 
ATOM 1216  C CA    . LYS C 3 64  ? 33.662  143.514 -39.311 1.00 73.21  ? 64  LYS A CA    1 
ATOM 1217  C C     . LYS C 3 64  ? 33.904  145.026 -39.326 1.00 75.84  ? 64  LYS A C     1 
ATOM 1218  O O     . LYS C 3 64  ? 34.684  145.511 -40.154 1.00 76.72  ? 64  LYS A O     1 
ATOM 1219  C CB    . LYS C 3 64  ? 35.007  142.835 -39.627 1.00 73.43  ? 64  LYS A CB    1 
ATOM 1220  C CG    . LYS C 3 64  ? 34.995  141.339 -39.900 1.00 72.48  ? 64  LYS A CG    1 
ATOM 1221  C CD    . LYS C 3 64  ? 36.432  140.846 -40.049 1.00 71.64  ? 64  LYS A CD    1 
ATOM 1222  C CE    . LYS C 3 64  ? 36.501  139.367 -40.374 1.00 71.15  ? 64  LYS A CE    1 
ATOM 1223  N NZ    . LYS C 3 64  ? 37.910  138.877 -40.353 1.00 71.22  ? 64  LYS A NZ    1 
ATOM 1224  N N     . LYS C 3 65  ? 33.216  145.776 -38.461 1.00 78.71  ? 65  LYS A N     1 
ATOM 1225  C CA    . LYS C 3 65  ? 33.452  147.218 -38.382 1.00 81.37  ? 65  LYS A CA    1 
ATOM 1226  C C     . LYS C 3 65  ? 34.932  147.330 -37.970 1.00 84.04  ? 65  LYS A C     1 
ATOM 1227  O O     . LYS C 3 65  ? 35.384  146.603 -37.073 1.00 84.38  ? 65  LYS A O     1 
ATOM 1228  C CB    . LYS C 3 65  ? 32.555  147.873 -37.322 1.00 80.99  ? 65  LYS A CB    1 
ATOM 1229  C CG    . LYS C 3 65  ? 32.855  149.363 -37.121 1.00 81.80  ? 65  LYS A CG    1 
ATOM 1230  C CD    . LYS C 3 65  ? 32.162  149.982 -35.896 1.00 82.21  ? 65  LYS A CD    1 
ATOM 1231  C CE    . LYS C 3 65  ? 32.556  151.468 -35.733 1.00 83.38  ? 65  LYS A CE    1 
ATOM 1232  N NZ    . LYS C 3 65  ? 31.957  152.181 -34.551 1.00 82.52  ? 65  LYS A NZ    1 
ATOM 1233  N N     . LYS C 3 66  ? 35.679  148.193 -38.667 1.00 86.63  ? 66  LYS A N     1 
ATOM 1234  C CA    . LYS C 3 66  ? 37.124  148.427 -38.455 1.00 89.02  ? 66  LYS A CA    1 
ATOM 1235  C C     . LYS C 3 66  ? 37.763  148.137 -37.069 1.00 90.80  ? 66  LYS A C     1 
ATOM 1236  O O     . LYS C 3 66  ? 37.889  149.038 -36.218 1.00 92.04  ? 66  LYS A O     1 
ATOM 1237  C CB    . LYS C 3 66  ? 37.494  149.849 -38.928 1.00 87.82  ? 66  LYS A CB    1 
ATOM 1238  N N     . ASP C 3 67  ? 38.192  146.883 -36.880 1.00 91.31  ? 67  ASP A N     1 
ATOM 1239  C CA    . ASP C 3 67  ? 38.846  146.412 -35.645 1.00 91.87  ? 67  ASP A CA    1 
ATOM 1240  C C     . ASP C 3 67  ? 39.639  145.120 -35.928 1.00 92.36  ? 67  ASP A C     1 
ATOM 1241  O O     . ASP C 3 67  ? 39.210  144.275 -36.730 1.00 92.46  ? 67  ASP A O     1 
ATOM 1242  C CB    . ASP C 3 67  ? 37.811  146.189 -34.518 1.00 90.79  ? 67  ASP A CB    1 
ATOM 1243  N N     . SER C 3 68  ? 40.807  144.997 -35.292 1.00 92.14  ? 68  SER A N     1 
ATOM 1244  C CA    . SER C 3 68  ? 41.696  143.841 -35.463 1.00 91.57  ? 68  SER A CA    1 
ATOM 1245  C C     . SER C 3 68  ? 41.195  142.580 -34.753 1.00 91.12  ? 68  SER A C     1 
ATOM 1246  O O     . SER C 3 68  ? 40.789  141.607 -35.404 1.00 90.40  ? 68  SER A O     1 
ATOM 1247  C CB    . SER C 3 68  ? 43.113  144.191 -34.987 1.00 90.81  ? 68  SER A CB    1 
ATOM 1248  N N     . THR C 3 69  ? 41.237  142.604 -33.419 1.00 90.93  ? 69  THR A N     1 
ATOM 1249  C CA    . THR C 3 69  ? 40.788  141.479 -32.595 1.00 90.80  ? 69  THR A CA    1 
ATOM 1250  C C     . THR C 3 69  ? 39.311  141.158 -32.869 1.00 91.04  ? 69  THR A C     1 
ATOM 1251  O O     . THR C 3 69  ? 38.830  140.051 -32.571 1.00 92.01  ? 69  THR A O     1 
ATOM 1252  C CB    . THR C 3 69  ? 41.001  141.795 -31.105 1.00 91.20  ? 69  THR A CB    1 
ATOM 1253  N N     . LYS C 3 70  ? 38.620  142.123 -33.483 1.00 90.12  ? 70  LYS A N     1 
ATOM 1254  C CA    . LYS C 3 70  ? 37.201  141.999 -33.814 1.00 88.76  ? 70  LYS A CA    1 
ATOM 1255  C C     . LYS C 3 70  ? 36.877  141.643 -35.274 1.00 87.24  ? 70  LYS A C     1 
ATOM 1256  O O     . LYS C 3 70  ? 37.541  142.089 -36.222 1.00 86.76  ? 70  LYS A O     1 
ATOM 1257  C CB    . LYS C 3 70  ? 36.452  143.272 -33.398 1.00 88.10  ? 70  LYS A CB    1 
ATOM 1258  N N     . TRP C 3 71  ? 35.821  140.846 -35.421 1.00 84.83  ? 71  TRP A N     1 
ATOM 1259  C CA    . TRP C 3 71  ? 35.313  140.384 -36.710 1.00 81.71  ? 71  TRP A CA    1 
ATOM 1260  C C     . TRP C 3 71  ? 33.809  140.166 -36.517 1.00 79.92  ? 71  TRP A C     1 
ATOM 1261  O O     . TRP C 3 71  ? 33.398  139.627 -35.488 1.00 80.85  ? 71  TRP A O     1 
ATOM 1262  C CB    . TRP C 3 71  ? 35.995  139.075 -37.100 1.00 81.19  ? 71  TRP A CB    1 
ATOM 1263  N N     . ARG C 3 72  ? 32.985  140.609 -37.469 1.00 76.71  ? 72  ARG A N     1 
ATOM 1264  C CA    . ARG C 3 72  ? 31.537  140.437 -37.332 1.00 73.22  ? 72  ARG A CA    1 
ATOM 1265  C C     . ARG C 3 72  ? 30.853  139.716 -38.481 1.00 70.86  ? 72  ARG A C     1 
ATOM 1266  O O     . ARG C 3 72  ? 31.081  140.010 -39.653 1.00 68.10  ? 72  ARG A O     1 
ATOM 1267  C CB    . ARG C 3 72  ? 30.860  141.763 -37.059 1.00 73.35  ? 72  ARG A CB    1 
ATOM 1268  N N     . LYS C 3 73  ? 29.998  138.772 -38.101 1.00 69.36  ? 73  LYS A N     1 
ATOM 1269  C CA    . LYS C 3 73  ? 29.231  137.940 -39.016 1.00 68.12  ? 73  LYS A CA    1 
ATOM 1270  C C     . LYS C 3 73  ? 28.121  137.342 -38.181 1.00 66.97  ? 73  LYS A C     1 
ATOM 1271  O O     . LYS C 3 73  ? 28.179  136.167 -37.822 1.00 67.32  ? 73  LYS A O     1 
ATOM 1272  C CB    . LYS C 3 73  ? 30.109  136.827 -39.575 1.00 67.52  ? 73  LYS A CB    1 
ATOM 1273  N N     . LEU C 3 74  ? 27.103  138.139 -37.878 1.00 66.28  ? 74  LEU A N     1 
ATOM 1274  C CA    . LEU C 3 74  ? 26.024  137.648 -37.034 1.00 66.41  ? 74  LEU A CA    1 
ATOM 1275  C C     . LEU C 3 74  ? 24.716  137.170 -37.683 1.00 64.91  ? 74  LEU A C     1 
ATOM 1276  O O     . LEU C 3 74  ? 24.454  137.415 -38.871 1.00 65.56  ? 74  LEU A O     1 
ATOM 1277  C CB    . LEU C 3 74  ? 25.742  138.663 -35.919 1.00 69.23  ? 74  LEU A CB    1 
ATOM 1278  C CG    . LEU C 3 74  ? 26.883  138.899 -34.913 1.00 70.98  ? 74  LEU A CG    1 
ATOM 1279  C CD1   . LEU C 3 74  ? 27.489  140.294 -35.131 1.00 70.88  ? 74  LEU A CD1   1 
ATOM 1280  C CD2   . LEU C 3 74  ? 26.369  138.753 -33.464 1.00 70.60  ? 74  LEU A CD2   1 
ATOM 1281  N N     . VAL C 3 75  ? 23.927  136.452 -36.871 1.00 62.61  ? 75  VAL A N     1 
ATOM 1282  C CA    . VAL C 3 75  ? 22.618  135.885 -37.240 1.00 59.63  ? 75  VAL A CA    1 
ATOM 1283  C C     . VAL C 3 75  ? 21.465  136.556 -36.470 1.00 57.76  ? 75  VAL A C     1 
ATOM 1284  O O     . VAL C 3 75  ? 21.639  137.036 -35.342 1.00 56.70  ? 75  VAL A O     1 
ATOM 1285  C CB    . VAL C 3 75  ? 22.547  134.384 -36.903 1.00 59.31  ? 75  VAL A CB    1 
ATOM 1286  C CG1   . VAL C 3 75  ? 21.292  133.759 -37.503 1.00 59.17  ? 75  VAL A CG1   1 
ATOM 1287  C CG2   . VAL C 3 75  ? 23.801  133.682 -37.367 1.00 58.07  ? 75  VAL A CG2   1 
ATOM 1288  N N     . ASP C 3 76  ? 20.272  136.534 -37.054 1.00 56.22  ? 76  ASP A N     1 
ATOM 1289  C CA    . ASP C 3 76  ? 19.119  137.145 -36.407 1.00 54.78  ? 76  ASP A CA    1 
ATOM 1290  C C     . ASP C 3 76  ? 18.105  136.090 -36.003 1.00 53.04  ? 76  ASP A C     1 
ATOM 1291  O O     . ASP C 3 76  ? 17.041  135.964 -36.616 1.00 52.55  ? 76  ASP A O     1 
ATOM 1292  C CB    . ASP C 3 76  ? 18.477  138.156 -37.347 1.00 56.68  ? 76  ASP A CB    1 
ATOM 1293  C CG    . ASP C 3 76  ? 17.690  139.219 -36.610 1.00 57.93  ? 76  ASP A CG    1 
ATOM 1294  O OD1   . ASP C 3 76  ? 17.928  139.413 -35.387 1.00 58.90  ? 76  ASP A OD1   1 
ATOM 1295  O OD2   . ASP C 3 76  ? 16.848  139.867 -37.277 1.00 57.62  ? 76  ASP A OD2   1 
ATOM 1296  N N     . PHE C 3 77  ? 18.424  135.373 -34.931 1.00 50.83  ? 77  PHE A N     1 
ATOM 1297  C CA    . PHE C 3 77  ? 17.575  134.294 -34.439 1.00 49.34  ? 77  PHE A CA    1 
ATOM 1298  C C     . PHE C 3 77  ? 16.224  134.727 -33.839 1.00 48.47  ? 77  PHE A C     1 
ATOM 1299  O O     . PHE C 3 77  ? 15.659  134.034 -32.987 1.00 46.26  ? 77  PHE A O     1 
ATOM 1300  C CB    . PHE C 3 77  ? 18.369  133.406 -33.465 1.00 47.92  ? 77  PHE A CB    1 
ATOM 1301  C CG    . PHE C 3 77  ? 19.502  132.621 -34.114 1.00 47.94  ? 77  PHE A CG    1 
ATOM 1302  C CD1   . PHE C 3 77  ? 19.241  131.629 -35.057 1.00 47.61  ? 77  PHE A CD1   1 
ATOM 1303  C CD2   . PHE C 3 77  ? 20.830  132.832 -33.730 1.00 48.00  ? 77  PHE A CD2   1 
ATOM 1304  C CE1   . PHE C 3 77  ? 20.283  130.859 -35.598 1.00 47.79  ? 77  PHE A CE1   1 
ATOM 1305  C CE2   . PHE C 3 77  ? 21.880  132.062 -34.269 1.00 46.65  ? 77  PHE A CE2   1 
ATOM 1306  C CZ    . PHE C 3 77  ? 21.603  131.077 -35.199 1.00 47.38  ? 77  PHE A CZ    1 
ATOM 1307  N N     . ARG C 3 78  ? 15.682  135.838 -34.336 1.00 48.60  ? 78  ARG A N     1 
ATOM 1308  C CA    . ARG C 3 78  ? 14.399  136.342 -33.854 1.00 49.24  ? 78  ARG A CA    1 
ATOM 1309  C C     . ARG C 3 78  ? 13.276  135.313 -33.961 1.00 48.23  ? 78  ARG A C     1 
ATOM 1310  O O     . ARG C 3 78  ? 12.702  134.917 -32.944 1.00 48.48  ? 78  ARG A O     1 
ATOM 1311  C CB    . ARG C 3 78  ? 13.991  137.613 -34.600 1.00 50.28  ? 78  ARG A CB    1 
ATOM 1312  C CG    . ARG C 3 78  ? 14.881  138.803 -34.322 1.00 55.64  ? 78  ARG A CG    1 
ATOM 1313  C CD    . ARG C 3 78  ? 14.323  140.100 -34.940 1.00 60.66  ? 78  ARG A CD    1 
ATOM 1314  N NE    . ARG C 3 78  ? 15.351  141.147 -35.053 1.00 64.56  ? 78  ARG A NE    1 
ATOM 1315  C CZ    . ARG C 3 78  ? 15.374  142.108 -35.981 1.00 64.95  ? 78  ARG A CZ    1 
ATOM 1316  N NH1   . ARG C 3 78  ? 14.413  142.192 -36.900 1.00 65.99  ? 78  ARG A NH1   1 
ATOM 1317  N NH2   . ARG C 3 78  ? 16.422  142.925 -36.051 1.00 64.90  ? 78  ARG A NH2   1 
ATOM 1318  N N     . GLU C 3 79  ? 12.981  134.869 -35.183 1.00 45.61  ? 79  GLU A N     1 
ATOM 1319  C CA    . GLU C 3 79  ? 11.918  133.894 -35.416 1.00 42.51  ? 79  GLU A CA    1 
ATOM 1320  C C     . GLU C 3 79  ? 12.098  132.645 -34.573 1.00 40.42  ? 79  GLU A C     1 
ATOM 1321  O O     . GLU C 3 79  ? 11.138  132.056 -34.079 1.00 37.94  ? 79  GLU A O     1 
ATOM 1322  C CB    . GLU C 3 79  ? 11.871  133.498 -36.882 1.00 43.06  ? 79  GLU A CB    1 
ATOM 1323  C CG    . GLU C 3 79  ? 10.618  132.707 -37.233 1.00 46.05  ? 79  GLU A CG    1 
ATOM 1324  C CD    . GLU C 3 79  ? 9.330   133.478 -36.933 1.00 48.74  ? 79  GLU A CD    1 
ATOM 1325  O OE1   . GLU C 3 79  ? 9.242   134.679 -37.298 1.00 50.78  ? 79  GLU A OE1   1 
ATOM 1326  O OE2   . GLU C 3 79  ? 8.407   132.884 -36.328 1.00 49.19  ? 79  GLU A OE2   1 
ATOM 1327  N N     . LEU C 3 80  ? 13.349  132.243 -34.428 1.00 39.38  ? 80  LEU A N     1 
ATOM 1328  C CA    . LEU C 3 80  ? 13.679  131.080 -33.638 1.00 38.69  ? 80  LEU A CA    1 
ATOM 1329  C C     . LEU C 3 80  ? 13.372  131.404 -32.194 1.00 36.97  ? 80  LEU A C     1 
ATOM 1330  O O     . LEU C 3 80  ? 12.544  130.750 -31.580 1.00 34.63  ? 80  LEU A O     1 
ATOM 1331  C CB    . LEU C 3 80  ? 15.165  130.743 -33.797 1.00 41.56  ? 80  LEU A CB    1 
ATOM 1332  C CG    . LEU C 3 80  ? 15.833  129.511 -33.142 1.00 44.33  ? 80  LEU A CG    1 
ATOM 1333  C CD1   . LEU C 3 80  ? 16.082  129.722 -31.656 1.00 43.23  ? 80  LEU A CD1   1 
ATOM 1334  C CD2   . LEU C 3 80  ? 15.044  128.232 -33.388 1.00 43.94  ? 80  LEU A CD2   1 
ATOM 1335  N N     . ASN C 3 81  ? 14.034  132.424 -31.656 1.00 36.02  ? 81  ASN A N     1 
ATOM 1336  C CA    . ASN C 3 81  ? 13.816  132.795 -30.261 1.00 36.33  ? 81  ASN A CA    1 
ATOM 1337  C C     . ASN C 3 81  ? 12.327  132.957 -30.031 1.00 35.94  ? 81  ASN A C     1 
ATOM 1338  O O     . ASN C 3 81  ? 11.792  132.640 -28.966 1.00 34.08  ? 81  ASN A O     1 
ATOM 1339  C CB    . ASN C 3 81  ? 14.560  134.086 -29.911 1.00 36.69  ? 81  ASN A CB    1 
ATOM 1340  C CG    . ASN C 3 81  ? 16.049  133.859 -29.625 1.00 38.22  ? 81  ASN A CG    1 
ATOM 1341  O OD1   . ASN C 3 81  ? 16.435  133.161 -28.673 1.00 34.73  ? 81  ASN A OD1   1 
ATOM 1342  N ND2   . ASN C 3 81  ? 16.892  134.483 -30.438 1.00 41.00  ? 81  ASN A ND2   1 
ATOM 1343  N N     . LYS C 3 82  ? 11.664  133.416 -31.078 1.00 36.73  ? 82  LYS A N     1 
ATOM 1344  C CA    . LYS C 3 82  ? 10.241  133.610 -31.053 1.00 38.85  ? 82  LYS A CA    1 
ATOM 1345  C C     . LYS C 3 82  ? 9.604   132.237 -30.878 1.00 39.83  ? 82  LYS A C     1 
ATOM 1346  O O     . LYS C 3 82  ? 8.613   132.082 -30.164 1.00 41.15  ? 82  LYS A O     1 
ATOM 1347  C CB    . LYS C 3 82  ? 9.810   134.257 -32.370 1.00 40.01  ? 82  LYS A CB    1 
ATOM 1348  C CG    . LYS C 3 82  ? 8.318   134.292 -32.611 1.00 43.26  ? 82  LYS A CG    1 
ATOM 1349  C CD    . LYS C 3 82  ? 7.879   135.610 -33.250 1.00 46.08  ? 82  LYS A CD    1 
ATOM 1350  C CE    . LYS C 3 82  ? 8.642   135.920 -34.535 1.00 47.19  ? 82  LYS A CE    1 
ATOM 1351  N NZ    . LYS C 3 82  ? 8.006   137.023 -35.326 1.00 49.32  ? 82  LYS A NZ    1 
ATOM 1352  N N     . ARG C 3 83  ? 10.246  131.226 -31.455 1.00 39.84  ? 83  ARG A N     1 
ATOM 1353  C CA    . ARG C 3 83  ? 9.747   129.859 -31.400 1.00 39.29  ? 83  ARG A CA    1 
ATOM 1354  C C     . ARG C 3 83  ? 10.224  128.986 -30.237 1.00 39.00  ? 83  ARG A C     1 
ATOM 1355  O O     . ARG C 3 83  ? 9.440   128.214 -29.688 1.00 38.32  ? 83  ARG A O     1 
ATOM 1356  C CB    . ARG C 3 83  ? 10.035  129.175 -32.731 1.00 38.41  ? 83  ARG A CB    1 
ATOM 1357  C CG    . ARG C 3 83  ? 9.403   129.889 -33.886 1.00 38.10  ? 83  ARG A CG    1 
ATOM 1358  C CD    . ARG C 3 83  ? 9.804   129.257 -35.177 1.00 39.98  ? 83  ARG A CD    1 
ATOM 1359  N NE    . ARG C 3 83  ? 9.131   129.861 -36.324 1.00 43.62  ? 83  ARG A NE    1 
ATOM 1360  C CZ    . ARG C 3 83  ? 7.809   129.918 -36.497 1.00 44.23  ? 83  ARG A CZ    1 
ATOM 1361  N NH1   . ARG C 3 83  ? 6.980   129.412 -35.586 1.00 43.33  ? 83  ARG A NH1   1 
ATOM 1362  N NH2   . ARG C 3 83  ? 7.315   130.451 -37.613 1.00 45.07  ? 83  ARG A NH2   1 
ATOM 1363  N N     . THR C 3 84  ? 11.492  129.115 -29.856 1.00 38.50  ? 84  THR A N     1 
ATOM 1364  C CA    . THR C 3 84  ? 12.062  128.315 -28.770 1.00 38.60  ? 84  THR A CA    1 
ATOM 1365  C C     . THR C 3 84  ? 11.325  128.424 -27.445 1.00 39.23  ? 84  THR A C     1 
ATOM 1366  O O     . THR C 3 84  ? 10.716  129.447 -27.135 1.00 39.94  ? 84  THR A O     1 
ATOM 1367  C CB    . THR C 3 84  ? 13.531  128.683 -28.529 1.00 37.23  ? 84  THR A CB    1 
ATOM 1368  O OG1   . THR C 3 84  ? 14.284  128.372 -29.701 1.00 38.95  ? 84  THR A OG1   1 
ATOM 1369  C CG2   . THR C 3 84  ? 14.114  127.913 -27.343 1.00 36.94  ? 84  THR A CG2   1 
ATOM 1370  N N     . GLN C 3 85  ? 11.398  127.353 -26.664 1.00 39.15  ? 85  GLN A N     1 
ATOM 1371  C CA    . GLN C 3 85  ? 10.768  127.293 -25.352 1.00 39.02  ? 85  GLN A CA    1 
ATOM 1372  C C     . GLN C 3 85  ? 11.277  128.378 -24.397 1.00 38.91  ? 85  GLN A C     1 
ATOM 1373  O O     . GLN C 3 85  ? 12.361  128.929 -24.584 1.00 37.39  ? 85  GLN A O     1 
ATOM 1374  C CB    . GLN C 3 85  ? 11.059  125.941 -24.709 1.00 38.21  ? 85  GLN A CB    1 
ATOM 1375  C CG    . GLN C 3 85  ? 12.523  125.745 -24.365 1.00 35.84  ? 85  GLN A CG    1 
ATOM 1376  C CD    . GLN C 3 85  ? 12.702  124.819 -23.204 1.00 35.23  ? 85  GLN A CD    1 
ATOM 1377  O OE1   . GLN C 3 85  ? 13.333  123.775 -23.322 1.00 35.85  ? 85  GLN A OE1   1 
ATOM 1378  N NE2   . GLN C 3 85  ? 12.133  125.191 -22.063 1.00 34.02  ? 85  GLN A NE2   1 
ATOM 1379  N N     . ASP C 3 86  ? 10.488  128.670 -23.368 1.00 39.46  ? 86  ASP A N     1 
ATOM 1380  C CA    . ASP C 3 86  ? 10.892  129.649 -22.370 1.00 40.29  ? 86  ASP A CA    1 
ATOM 1381  C C     . ASP C 3 86  ? 11.385  128.819 -21.234 1.00 38.69  ? 86  ASP A C     1 
ATOM 1382  O O     . ASP C 3 86  ? 10.746  127.838 -20.868 1.00 39.56  ? 86  ASP A O     1 
ATOM 1383  C CB    . ASP C 3 86  ? 9.711   130.431 -21.797 1.00 44.19  ? 86  ASP A CB    1 
ATOM 1384  C CG    . ASP C 3 86  ? 8.853   131.062 -22.852 1.00 48.75  ? 86  ASP A CG    1 
ATOM 1385  O OD1   . ASP C 3 86  ? 9.404   131.767 -23.733 1.00 52.11  ? 86  ASP A OD1   1 
ATOM 1386  O OD2   . ASP C 3 86  ? 7.618   130.862 -22.779 1.00 50.38  ? 86  ASP A OD2   1 
ATOM 1387  N N     . PHE C 3 87  ? 12.553  129.144 -20.723 1.00 36.15  ? 87  PHE A N     1 
ATOM 1388  C CA    . PHE C 3 87  ? 13.016  128.422 -19.569 1.00 33.62  ? 87  PHE A CA    1 
ATOM 1389  C C     . PHE C 3 87  ? 13.076  129.507 -18.545 1.00 32.05  ? 87  PHE A C     1 
ATOM 1390  O O     . PHE C 3 87  ? 13.165  130.685 -18.884 1.00 30.71  ? 87  PHE A O     1 
ATOM 1391  C CB    . PHE C 3 87  ? 14.408  127.817 -19.722 1.00 34.61  ? 87  PHE A CB    1 
ATOM 1392  C CG    . PHE C 3 87  ? 14.995  127.927 -21.088 1.00 34.97  ? 87  PHE A CG    1 
ATOM 1393  C CD1   . PHE C 3 87  ? 15.728  129.050 -21.448 1.00 34.39  ? 87  PHE A CD1   1 
ATOM 1394  C CD2   . PHE C 3 87  ? 14.892  126.871 -21.989 1.00 37.30  ? 87  PHE A CD2   1 
ATOM 1395  C CE1   . PHE C 3 87  ? 16.359  129.119 -22.680 1.00 34.01  ? 87  PHE A CE1   1 
ATOM 1396  C CE2   . PHE C 3 87  ? 15.521  126.928 -23.228 1.00 37.32  ? 87  PHE A CE2   1 
ATOM 1397  C CZ    . PHE C 3 87  ? 16.259  128.057 -23.574 1.00 35.73  ? 87  PHE A CZ    1 
ATOM 1398  N N     . TRP C 3 88  ? 12.985  129.105 -17.291 1.00 31.31  ? 88  TRP A N     1 
ATOM 1399  C CA    . TRP C 3 88  ? 13.048  130.029 -16.174 1.00 30.35  ? 88  TRP A CA    1 
ATOM 1400  C C     . TRP C 3 88  ? 14.462  130.592 -16.013 1.00 27.96  ? 88  TRP A C     1 
ATOM 1401  O O     . TRP C 3 88  ? 15.392  129.866 -15.665 1.00 26.44  ? 88  TRP A O     1 
ATOM 1402  C CB    . TRP C 3 88  ? 12.635  129.286 -14.912 1.00 31.09  ? 88  TRP A CB    1 
ATOM 1403  C CG    . TRP C 3 88  ? 12.731  130.080 -13.694 1.00 33.11  ? 88  TRP A CG    1 
ATOM 1404  C CD1   . TRP C 3 88  ? 13.844  130.298 -12.953 1.00 33.24  ? 88  TRP A CD1   1 
ATOM 1405  C CD2   . TRP C 3 88  ? 11.653  130.716 -13.009 1.00 35.46  ? 88  TRP A CD2   1 
ATOM 1406  N NE1   . TRP C 3 88  ? 13.534  131.027 -11.836 1.00 34.62  ? 88  TRP A NE1   1 
ATOM 1407  C CE2   . TRP C 3 88  ? 12.192  131.296 -11.843 1.00 35.04  ? 88  TRP A CE2   1 
ATOM 1408  C CE3   . TRP C 3 88  ? 10.277  130.842 -13.261 1.00 36.94  ? 88  TRP A CE3   1 
ATOM 1409  C CZ2   . TRP C 3 88  ? 11.405  131.992 -10.921 1.00 36.30  ? 88  TRP A CZ2   1 
ATOM 1410  C CZ3   . TRP C 3 88  ? 9.489   131.535 -12.340 1.00 37.02  ? 88  TRP A CZ3   1 
ATOM 1411  C CH2   . TRP C 3 88  ? 10.061  132.100 -11.186 1.00 36.94  ? 88  TRP A CH2   1 
ATOM 1412  N N     . GLU C 3 89  ? 14.628  131.884 -16.257 1.00 26.22  ? 89  GLU A N     1 
ATOM 1413  C CA    . GLU C 3 89  ? 15.939  132.464 -16.109 1.00 26.23  ? 89  GLU A CA    1 
ATOM 1414  C C     . GLU C 3 89  ? 16.385  132.289 -14.709 1.00 26.49  ? 89  GLU A C     1 
ATOM 1415  O O     . GLU C 3 89  ? 15.585  132.190 -13.791 1.00 26.24  ? 89  GLU A O     1 
ATOM 1416  C CB    . GLU C 3 89  ? 15.930  133.939 -16.374 1.00 28.49  ? 89  GLU A CB    1 
ATOM 1417  C CG    . GLU C 3 89  ? 16.595  134.254 -17.636 1.00 33.70  ? 89  GLU A CG    1 
ATOM 1418  C CD    . GLU C 3 89  ? 15.854  133.642 -18.782 1.00 37.72  ? 89  GLU A CD    1 
ATOM 1419  O OE1   . GLU C 3 89  ? 14.600  133.686 -18.767 1.00 39.08  ? 89  GLU A OE1   1 
ATOM 1420  O OE2   . GLU C 3 89  ? 16.523  133.099 -19.683 1.00 40.73  ? 89  GLU A OE2   1 
ATOM 1421  N N     . VAL C 3 90  ? 17.685  132.314 -14.536 1.00 27.14  ? 90  VAL A N     1 
ATOM 1422  C CA    . VAL C 3 90  ? 18.225  132.164 -13.219 1.00 28.75  ? 90  VAL A CA    1 
ATOM 1423  C C     . VAL C 3 90  ? 18.878  133.477 -12.900 1.00 30.28  ? 90  VAL A C     1 
ATOM 1424  O O     . VAL C 3 90  ? 19.815  133.854 -13.595 1.00 29.93  ? 90  VAL A O     1 
ATOM 1425  C CB    . VAL C 3 90  ? 19.263  131.077 -13.226 1.00 29.52  ? 90  VAL A CB    1 
ATOM 1426  C CG1   . VAL C 3 90  ? 19.814  130.868 -11.828 1.00 30.22  ? 90  VAL A CG1   1 
ATOM 1427  C CG2   . VAL C 3 90  ? 18.654  129.813 -13.799 1.00 28.64  ? 90  VAL A CG2   1 
ATOM 1428  N N     . GLN C 3 91  ? 18.353  134.183 -11.892 1.00 32.54  ? 91  GLN A N     1 
ATOM 1429  C CA    . GLN C 3 91  ? 18.885  135.483 -11.461 1.00 35.21  ? 91  GLN A CA    1 
ATOM 1430  C C     . GLN C 3 91  ? 18.066  136.289 -10.446 1.00 34.42  ? 91  GLN A C     1 
ATOM 1431  O O     . GLN C 3 91  ? 16.982  136.771 -10.775 1.00 36.44  ? 91  GLN A O     1 
ATOM 1432  C CB    . GLN C 3 91  ? 19.106  136.414 -12.668 1.00 38.68  ? 91  GLN A CB    1 
ATOM 1433  C CG    . GLN C 3 91  ? 20.505  136.377 -13.304 1.00 45.42  ? 91  GLN A CG    1 
ATOM 1434  C CD    . GLN C 3 91  ? 21.644  136.415 -12.281 1.00 48.97  ? 91  GLN A CD    1 
ATOM 1435  O OE1   . GLN C 3 91  ? 21.444  136.798 -11.116 1.00 49.93  ? 91  GLN A OE1   1 
ATOM 1436  N NE2   . GLN C 3 91  ? 22.849  136.015 -12.716 1.00 50.34  ? 91  GLN A NE2   1 
ATOM 1437  N N     . LEU C 3 92  ? 18.556  136.457 -9.225  1.00 32.77  ? 92  LEU A N     1 
ATOM 1438  C CA    . LEU C 3 92  ? 17.818  137.314 -8.298  1.00 32.79  ? 92  LEU A CA    1 
ATOM 1439  C C     . LEU C 3 92  ? 18.502  138.699 -8.349  1.00 31.15  ? 92  LEU A C     1 
ATOM 1440  O O     . LEU C 3 92  ? 18.778  139.337 -7.323  1.00 29.85  ? 92  LEU A O     1 
ATOM 1441  C CB    . LEU C 3 92  ? 17.783  136.758 -6.863  1.00 35.14  ? 92  LEU A CB    1 
ATOM 1442  C CG    . LEU C 3 92  ? 17.242  137.734 -5.779  1.00 35.79  ? 92  LEU A CG    1 
ATOM 1443  C CD1   . LEU C 3 92  ? 15.698  137.747 -5.660  1.00 33.05  ? 92  LEU A CD1   1 
ATOM 1444  C CD2   . LEU C 3 92  ? 17.888  137.411 -4.441  1.00 35.26  ? 92  LEU A CD2   1 
ATOM 1445  N N     . GLY C 3 93  ? 18.802  139.149 -9.562  1.00 29.13  ? 93  GLY A N     1 
ATOM 1446  C CA    . GLY C 3 93  ? 19.450  140.443 -9.718  1.00 27.18  ? 93  GLY A CA    1 
ATOM 1447  C C     . GLY C 3 93  ? 20.961  140.332 -9.694  1.00 24.71  ? 93  GLY A C     1 
ATOM 1448  O O     . GLY C 3 93  ? 21.488  139.273 -9.354  1.00 25.15  ? 93  GLY A O     1 
ATOM 1449  N N     . ILE C 3 94  ? 21.662  141.406 -10.058 1.00 21.61  ? 94  ILE A N     1 
ATOM 1450  C CA    . ILE C 3 94  ? 23.119  141.371 -10.073 1.00 18.74  ? 94  ILE A CA    1 
ATOM 1451  C C     . ILE C 3 94  ? 23.652  141.630 -8.683  1.00 19.67  ? 94  ILE A C     1 
ATOM 1452  O O     . ILE C 3 94  ? 22.893  141.924 -7.754  1.00 20.43  ? 94  ILE A O     1 
ATOM 1453  C CB    . ILE C 3 94  ? 23.728  142.435 -10.997 1.00 17.86  ? 94  ILE A CB    1 
ATOM 1454  C CG1   . ILE C 3 94  ? 23.940  143.741 -10.242 1.00 18.61  ? 94  ILE A CG1   1 
ATOM 1455  C CG2   . ILE C 3 94  ? 22.820  142.710 -12.148 1.00 18.30  ? 94  ILE A CG2   1 
ATOM 1456  C CD1   . ILE C 3 94  ? 25.226  144.429 -10.603 1.00 19.19  ? 94  ILE A CD1   1 
ATOM 1457  N N     . PRO C 3 95  ? 24.974  141.523 -8.519  1.00 19.85  ? 95  PRO A N     1 
ATOM 1458  C CA    . PRO C 3 95  ? 25.567  141.767 -7.208  1.00 19.67  ? 95  PRO A CA    1 
ATOM 1459  C C     . PRO C 3 95  ? 25.727  143.263 -6.993  1.00 20.60  ? 95  PRO A C     1 
ATOM 1460  O O     . PRO C 3 95  ? 25.088  144.076 -7.666  1.00 19.29  ? 95  PRO A O     1 
ATOM 1461  C CB    . PRO C 3 95  ? 26.921  141.092 -7.333  1.00 19.03  ? 95  PRO A CB    1 
ATOM 1462  C CG    . PRO C 3 95  ? 27.262  141.364 -8.755  1.00 19.67  ? 95  PRO A CG    1 
ATOM 1463  C CD    . PRO C 3 95  ? 25.986  141.014 -9.459  1.00 19.00  ? 95  PRO A CD    1 
ATOM 1464  N N     . HIS C 3 96  ? 26.594  143.612 -6.051  1.00 21.70  ? 96  HIS A N     1 
ATOM 1465  C CA    . HIS C 3 96  ? 26.872  144.999 -5.709  1.00 23.89  ? 96  HIS A CA    1 
ATOM 1466  C C     . HIS C 3 96  ? 27.897  144.977 -4.591  1.00 24.16  ? 96  HIS A C     1 
ATOM 1467  O O     . HIS C 3 96  ? 27.712  144.321 -3.557  1.00 24.24  ? 96  HIS A O     1 
ATOM 1468  C CB    . HIS C 3 96  ? 25.605  145.720 -5.242  1.00 24.93  ? 96  HIS A CB    1 
ATOM 1469  C CG    . HIS C 3 96  ? 25.772  147.202 -5.097  1.00 26.90  ? 96  HIS A CG    1 
ATOM 1470  N ND1   . HIS C 3 96  ? 26.626  147.768 -4.177  1.00 25.21  ? 96  HIS A ND1   1 
ATOM 1471  C CD2   . HIS C 3 96  ? 25.177  148.233 -5.744  1.00 26.43  ? 96  HIS A CD2   1 
ATOM 1472  C CE1   . HIS C 3 96  ? 26.549  149.083 -4.263  1.00 26.57  ? 96  HIS A CE1   1 
ATOM 1473  N NE2   . HIS C 3 96  ? 25.678  149.392 -5.206  1.00 26.18  ? 96  HIS A NE2   1 
ATOM 1474  N N     . PRO C 3 97  ? 28.971  145.750 -4.763  1.00 24.09  ? 97  PRO A N     1 
ATOM 1475  C CA    . PRO C 3 97  ? 30.089  145.881 -3.826  1.00 24.83  ? 97  PRO A CA    1 
ATOM 1476  C C     . PRO C 3 97  ? 29.667  146.007 -2.363  1.00 24.96  ? 97  PRO A C     1 
ATOM 1477  O O     . PRO C 3 97  ? 30.271  145.390 -1.483  1.00 22.98  ? 97  PRO A O     1 
ATOM 1478  C CB    . PRO C 3 97  ? 30.794  147.139 -4.330  1.00 23.66  ? 97  PRO A CB    1 
ATOM 1479  C CG    . PRO C 3 97  ? 29.685  147.893 -5.034  1.00 23.08  ? 97  PRO A CG    1 
ATOM 1480  C CD    . PRO C 3 97  ? 29.023  146.807 -5.782  1.00 22.14  ? 97  PRO A CD    1 
ATOM 1481  N N     . ALA C 3 98  ? 28.605  146.778 -2.133  1.00 27.53  ? 98  ALA A N     1 
ATOM 1482  C CA    . ALA C 3 98  ? 28.059  147.028 -0.796  1.00 29.96  ? 98  ALA A CA    1 
ATOM 1483  C C     . ALA C 3 98  ? 27.942  145.754 0.026   1.00 31.57  ? 98  ALA A C     1 
ATOM 1484  O O     . ALA C 3 98  ? 28.162  145.767 1.241   1.00 31.88  ? 98  ALA A O     1 
ATOM 1485  C CB    . ALA C 3 98  ? 26.691  147.712 -0.901  1.00 28.95  ? 98  ALA A CB    1 
ATOM 1486  N N     . GLY C 3 99  ? 27.590  144.665 -0.656  1.00 33.23  ? 99  GLY A N     1 
ATOM 1487  C CA    . GLY C 3 99  ? 27.443  143.372 -0.013  1.00 34.85  ? 99  GLY A CA    1 
ATOM 1488  C C     . GLY C 3 99  ? 28.765  142.643 0.019   1.00 35.83  ? 99  GLY A C     1 
ATOM 1489  O O     . GLY C 3 99  ? 29.018  141.812 0.885   1.00 35.72  ? 99  GLY A O     1 
ATOM 1490  N N     . LEU C 3 100 ? 29.605  142.947 -0.957  1.00 36.74  ? 100 LEU A N     1 
ATOM 1491  C CA    . LEU C 3 100 ? 30.911  142.343 -1.035  1.00 37.32  ? 100 LEU A CA    1 
ATOM 1492  C C     . LEU C 3 100 ? 31.715  142.770 0.180   1.00 38.85  ? 100 LEU A C     1 
ATOM 1493  O O     . LEU C 3 100 ? 31.807  143.953 0.485   1.00 39.28  ? 100 LEU A O     1 
ATOM 1494  C CB    . LEU C 3 100 ? 31.597  142.812 -2.304  1.00 35.43  ? 100 LEU A CB    1 
ATOM 1495  C CG    . LEU C 3 100 ? 33.100  142.644 -2.352  1.00 34.50  ? 100 LEU A CG    1 
ATOM 1496  C CD1   . LEU C 3 100 ? 33.507  141.202 -2.043  1.00 34.61  ? 100 LEU A CD1   1 
ATOM 1497  C CD2   . LEU C 3 100 ? 33.516  143.060 -3.732  1.00 35.83  ? 100 LEU A CD2   1 
ATOM 1498  N N     . LYS C 3 101 ? 32.242  141.792 0.903   1.00 41.18  ? 101 LYS A N     1 
ATOM 1499  C CA    . LYS C 3 101 ? 33.060  142.064 2.076   1.00 44.69  ? 101 LYS A CA    1 
ATOM 1500  C C     . LYS C 3 101 ? 34.518  142.252 1.633   1.00 46.87  ? 101 LYS A C     1 
ATOM 1501  O O     . LYS C 3 101 ? 34.773  142.585 0.468   1.00 47.60  ? 101 LYS A O     1 
ATOM 1502  C CB    . LYS C 3 101 ? 32.914  140.956 3.132   1.00 45.11  ? 101 LYS A CB    1 
ATOM 1503  C CG    . LYS C 3 101 ? 33.303  139.552 2.666   1.00 50.31  ? 101 LYS A CG    1 
ATOM 1504  C CD    . LYS C 3 101 ? 32.505  139.075 1.432   1.00 55.00  ? 101 LYS A CD    1 
ATOM 1505  C CE    . LYS C 3 101 ? 31.007  138.902 1.729   1.00 58.67  ? 101 LYS A CE    1 
ATOM 1506  N NZ    . LYS C 3 101 ? 30.149  138.865 0.495   1.00 59.01  ? 101 LYS A NZ    1 
ATOM 1507  N N     . LYS C 3 102 ? 35.470  141.975 2.524   1.00 49.22  ? 102 LYS A N     1 
ATOM 1508  C CA    . LYS C 3 102 ? 36.893  142.191 2.219   1.00 51.94  ? 102 LYS A CA    1 
ATOM 1509  C C     . LYS C 3 102 ? 37.855  141.015 2.410   1.00 52.60  ? 102 LYS A C     1 
ATOM 1510  O O     . LYS C 3 102 ? 37.772  140.278 3.397   1.00 53.03  ? 102 LYS A O     1 
ATOM 1511  C CB    . LYS C 3 102 ? 37.396  143.351 3.082   1.00 53.10  ? 102 LYS A CB    1 
ATOM 1512  C CG    . LYS C 3 102 ? 38.412  144.302 2.444   1.00 55.48  ? 102 LYS A CG    1 
ATOM 1513  C CD    . LYS C 3 102 ? 38.403  145.607 3.262   1.00 56.86  ? 102 LYS A CD    1 
ATOM 1514  C CE    . LYS C 3 102 ? 39.223  146.733 2.667   1.00 55.44  ? 102 LYS A CE    1 
ATOM 1515  N NZ    . LYS C 3 102 ? 40.634  146.730 3.144   1.00 56.46  ? 102 LYS A NZ    1 
ATOM 1516  N N     . LYS C 3 103 ? 38.799  140.878 1.480   1.00 52.47  ? 103 LYS A N     1 
ATOM 1517  C CA    . LYS C 3 103 ? 39.815  139.832 1.564   1.00 52.38  ? 103 LYS A CA    1 
ATOM 1518  C C     . LYS C 3 103 ? 41.190  140.443 1.350   1.00 52.48  ? 103 LYS A C     1 
ATOM 1519  O O     . LYS C 3 103 ? 41.315  141.510 0.749   1.00 52.67  ? 103 LYS A O     1 
ATOM 1520  C CB    . LYS C 3 103 ? 39.565  138.704 0.561   1.00 51.43  ? 103 LYS A CB    1 
ATOM 1521  C CG    . LYS C 3 103 ? 38.273  137.912 0.807   1.00 51.60  ? 103 LYS A CG    1 
ATOM 1522  C CD    . LYS C 3 103 ? 38.202  137.218 2.175   1.00 50.36  ? 103 LYS A CD    1 
ATOM 1523  C CE    . LYS C 3 103 ? 36.796  136.641 2.405   1.00 50.78  ? 103 LYS A CE    1 
ATOM 1524  N NZ    . LYS C 3 103 ? 36.537  136.075 3.767   1.00 52.18  ? 103 LYS A NZ    1 
ATOM 1525  N N     . LYS C 3 104 ? 42.210  139.764 1.865   1.00 53.42  ? 104 LYS A N     1 
ATOM 1526  C CA    . LYS C 3 104 ? 43.598  140.215 1.776   1.00 54.82  ? 104 LYS A CA    1 
ATOM 1527  C C     . LYS C 3 104 ? 44.071  140.458 0.344   1.00 55.16  ? 104 LYS A C     1 
ATOM 1528  O O     . LYS C 3 104 ? 44.723  141.471 0.045   1.00 55.16  ? 104 LYS A O     1 
ATOM 1529  C CB    . LYS C 3 104 ? 44.512  139.193 2.448   1.00 55.46  ? 104 LYS A CB    1 
ATOM 1530  C CG    . LYS C 3 104 ? 45.690  139.814 3.172   1.00 57.99  ? 104 LYS A CG    1 
ATOM 1531  C CD    . LYS C 3 104 ? 45.213  140.726 4.305   1.00 60.86  ? 104 LYS A CD    1 
ATOM 1532  C CE    . LYS C 3 104 ? 46.360  141.164 5.230   1.00 64.55  ? 104 LYS A CE    1 
ATOM 1533  N NZ    . LYS C 3 104 ? 47.426  141.988 4.561   1.00 65.90  ? 104 LYS A NZ    1 
ATOM 1534  N N     . SER C 3 105 ? 43.756  139.510 -0.531  1.00 54.98  ? 105 SER A N     1 
ATOM 1535  C CA    . SER C 3 105 ? 44.131  139.606 -1.935  1.00 54.22  ? 105 SER A CA    1 
ATOM 1536  C C     . SER C 3 105 ? 42.923  139.231 -2.783  1.00 53.05  ? 105 SER A C     1 
ATOM 1537  O O     . SER C 3 105 ? 42.025  138.514 -2.320  1.00 52.80  ? 105 SER A O     1 
ATOM 1538  C CB    . SER C 3 105 ? 45.297  138.668 -2.238  1.00 54.38  ? 105 SER A CB    1 
ATOM 1539  O OG    . SER C 3 105 ? 46.330  138.821 -1.282  1.00 55.66  ? 105 SER A OG    1 
ATOM 1540  N N     . VAL C 3 106 ? 42.910  139.711 -4.026  1.00 51.87  ? 106 VAL A N     1 
ATOM 1541  C CA    . VAL C 3 106 ? 41.800  139.454 -4.944  1.00 51.59  ? 106 VAL A CA    1 
ATOM 1542  C C     . VAL C 3 106 ? 42.273  139.307 -6.393  1.00 50.28  ? 106 VAL A C     1 
ATOM 1543  O O     . VAL C 3 106 ? 43.416  139.618 -6.711  1.00 51.32  ? 106 VAL A O     1 
ATOM 1544  C CB    . VAL C 3 106 ? 40.771  140.626 -4.907  1.00 52.78  ? 106 VAL A CB    1 
ATOM 1545  C CG1   . VAL C 3 106 ? 39.469  140.248 -5.633  1.00 53.39  ? 106 VAL A CG1   1 
ATOM 1546  C CG2   . VAL C 3 106 ? 40.501  141.073 -3.474  1.00 54.91  ? 106 VAL A CG2   1 
ATOM 1547  N N     . THR C 3 107 ? 41.378  138.840 -7.261  1.00 48.09  ? 107 THR A N     1 
ATOM 1548  C CA    . THR C 3 107 ? 41.653  138.670 -8.684  1.00 44.34  ? 107 THR A CA    1 
ATOM 1549  C C     . THR C 3 107 ? 40.315  138.705 -9.403  1.00 41.65  ? 107 THR A C     1 
ATOM 1550  O O     . THR C 3 107 ? 39.261  138.490 -8.797  1.00 40.10  ? 107 THR A O     1 
ATOM 1551  C CB    . THR C 3 107 ? 42.345  137.320 -9.001  1.00 44.68  ? 107 THR A CB    1 
ATOM 1552  O OG1   . THR C 3 107 ? 43.587  137.219 -8.288  1.00 44.68  ? 107 THR A OG1   1 
ATOM 1553  C CG2   . THR C 3 107 ? 42.624  137.211 -10.494 1.00 43.68  ? 107 THR A CG2   1 
ATOM 1554  N N     . VAL C 3 108 ? 40.357  138.971 -10.698 1.00 39.13  ? 108 VAL A N     1 
ATOM 1555  C CA    . VAL C 3 108 ? 39.141  139.038 -11.476 1.00 39.81  ? 108 VAL A CA    1 
ATOM 1556  C C     . VAL C 3 108 ? 39.336  138.411 -12.843 1.00 40.52  ? 108 VAL A C     1 
ATOM 1557  O O     . VAL C 3 108 ? 39.840  139.039 -13.775 1.00 41.04  ? 108 VAL A O     1 
ATOM 1558  C CB    . VAL C 3 108 ? 38.683  140.479 -11.637 1.00 40.86  ? 108 VAL A CB    1 
ATOM 1559  C CG1   . VAL C 3 108 ? 37.443  140.530 -12.486 1.00 42.21  ? 108 VAL A CG1   1 
ATOM 1560  C CG2   . VAL C 3 108 ? 38.421  141.107 -10.273 1.00 42.18  ? 108 VAL A CG2   1 
ATOM 1561  N N     . LEU C 3 109 ? 38.864  137.179 -12.967 1.00 41.69  ? 109 LEU A N     1 
ATOM 1562  C CA    . LEU C 3 109 ? 38.996  136.424 -14.200 1.00 41.55  ? 109 LEU A CA    1 
ATOM 1563  C C     . LEU C 3 109 ? 37.776  136.443 -15.075 1.00 41.23  ? 109 LEU A C     1 
ATOM 1564  O O     . LEU C 3 109 ? 36.648  136.600 -14.616 1.00 38.86  ? 109 LEU A O     1 
ATOM 1565  C CB    . LEU C 3 109 ? 39.337  134.978 -13.885 1.00 42.18  ? 109 LEU A CB    1 
ATOM 1566  C CG    . LEU C 3 109 ? 40.614  134.875 -13.065 1.00 43.18  ? 109 LEU A CG    1 
ATOM 1567  C CD1   . LEU C 3 109 ? 40.654  133.565 -12.293 1.00 45.64  ? 109 LEU A CD1   1 
ATOM 1568  C CD2   . LEU C 3 109 ? 41.795  135.037 -13.994 1.00 42.83  ? 109 LEU A CD2   1 
ATOM 1569  N N     . ASP C 3 110 ? 38.036  136.221 -16.353 1.00 42.19  ? 110 ASP A N     1 
ATOM 1570  C CA    . ASP C 3 110 ? 37.008  136.190 -17.368 1.00 43.56  ? 110 ASP A CA    1 
ATOM 1571  C C     . ASP C 3 110 ? 37.369  135.017 -18.248 1.00 44.07  ? 110 ASP A C     1 
ATOM 1572  O O     . ASP C 3 110 ? 38.496  134.932 -18.738 1.00 44.66  ? 110 ASP A O     1 
ATOM 1573  C CB    . ASP C 3 110 ? 37.069  137.447 -18.232 1.00 45.13  ? 110 ASP A CB    1 
ATOM 1574  C CG    . ASP C 3 110 ? 37.341  138.700 -17.428 1.00 48.55  ? 110 ASP A CG    1 
ATOM 1575  O OD1   . ASP C 3 110 ? 38.387  138.764 -16.724 1.00 48.46  ? 110 ASP A OD1   1 
ATOM 1576  O OD2   . ASP C 3 110 ? 36.507  139.625 -17.528 1.00 50.24  ? 110 ASP A OD2   1 
ATOM 1577  N N     . VAL C 3 111 ? 36.451  134.074 -18.394 1.00 43.75  ? 111 VAL A N     1 
ATOM 1578  C CA    . VAL C 3 111 ? 36.723  132.947 -19.265 1.00 42.34  ? 111 VAL A CA    1 
ATOM 1579  C C     . VAL C 3 111 ? 36.357  133.387 -20.666 1.00 42.17  ? 111 VAL A C     1 
ATOM 1580  O O     . VAL C 3 111 ? 35.299  133.984 -20.889 1.00 41.90  ? 111 VAL A O     1 
ATOM 1581  C CB    . VAL C 3 111 ? 35.945  131.704 -18.870 1.00 41.68  ? 111 VAL A CB    1 
ATOM 1582  C CG1   . VAL C 3 111 ? 36.629  131.042 -17.685 1.00 41.92  ? 111 VAL A CG1   1 
ATOM 1583  C CG2   . VAL C 3 111 ? 34.506  132.070 -18.539 1.00 42.15  ? 111 VAL A CG2   1 
ATOM 1584  N N     . GLY C 3 112 ? 37.277  133.158 -21.593 1.00 41.64  ? 112 GLY A N     1 
ATOM 1585  C CA    . GLY C 3 112 ? 37.052  133.558 -22.964 1.00 41.62  ? 112 GLY A CA    1 
ATOM 1586  C C     . GLY C 3 112 ? 36.222  132.606 -23.789 1.00 41.17  ? 112 GLY A C     1 
ATOM 1587  O O     . GLY C 3 112 ? 36.088  131.417 -23.475 1.00 39.87  ? 112 GLY A O     1 
ATOM 1588  N N     . ASP C 3 113 ? 35.622  133.176 -24.828 1.00 41.93  ? 113 ASP A N     1 
ATOM 1589  C CA    . ASP C 3 113 ? 34.796  132.446 -25.776 1.00 43.96  ? 113 ASP A CA    1 
ATOM 1590  C C     . ASP C 3 113 ? 33.639  131.686 -25.125 1.00 43.23  ? 113 ASP A C     1 
ATOM 1591  O O     . ASP C 3 113 ? 32.975  130.871 -25.773 1.00 43.26  ? 113 ASP A O     1 
ATOM 1592  C CB    . ASP C 3 113 ? 35.681  131.488 -26.583 1.00 46.98  ? 113 ASP A CB    1 
ATOM 1593  C CG    . ASP C 3 113 ? 35.222  131.335 -28.029 1.00 51.06  ? 113 ASP A CG    1 
ATOM 1594  O OD1   . ASP C 3 113 ? 34.057  131.690 -28.338 1.00 51.96  ? 113 ASP A OD1   1 
ATOM 1595  O OD2   . ASP C 3 113 ? 36.042  130.868 -28.859 1.00 53.90  ? 113 ASP A OD2   1 
ATOM 1596  N N     . ALA C 3 114 ? 33.418  131.975 -23.845 1.00 42.39  ? 114 ALA A N     1 
ATOM 1597  C CA    . ALA C 3 114 ? 32.375  131.376 -23.009 1.00 41.37  ? 114 ALA A CA    1 
ATOM 1598  C C     . ALA C 3 114 ? 31.272  130.606 -23.733 1.00 40.03  ? 114 ALA A C     1 
ATOM 1599  O O     . ALA C 3 114 ? 31.187  129.371 -23.661 1.00 39.10  ? 114 ALA A O     1 
ATOM 1600  C CB    . ALA C 3 114 ? 31.751  132.465 -22.139 1.00 42.80  ? 114 ALA A CB    1 
ATOM 1601  N N     . TYR C 3 115 ? 30.411  131.364 -24.398 1.00 38.71  ? 115 TYR A N     1 
ATOM 1602  C CA    . TYR C 3 115 ? 29.296  130.814 -25.142 1.00 37.98  ? 115 TYR A CA    1 
ATOM 1603  C C     . TYR C 3 115 ? 29.727  129.682 -26.057 1.00 36.47  ? 115 TYR A C     1 
ATOM 1604  O O     . TYR C 3 115 ? 29.430  128.513 -25.793 1.00 36.09  ? 115 TYR A O     1 
ATOM 1605  C CB    . TYR C 3 115 ? 28.632  131.934 -25.923 1.00 40.17  ? 115 TYR A CB    1 
ATOM 1606  C CG    . TYR C 3 115 ? 27.896  132.882 -25.013 1.00 43.23  ? 115 TYR A CG    1 
ATOM 1607  C CD1   . TYR C 3 115 ? 26.574  132.621 -24.639 1.00 43.90  ? 115 TYR A CD1   1 
ATOM 1608  C CD2   . TYR C 3 115 ? 28.518  134.022 -24.498 1.00 44.57  ? 115 TYR A CD2   1 
ATOM 1609  C CE1   . TYR C 3 115 ? 25.883  133.462 -23.774 1.00 45.93  ? 115 TYR A CE1   1 
ATOM 1610  C CE2   . TYR C 3 115 ? 27.833  134.880 -23.623 1.00 47.58  ? 115 TYR A CE2   1 
ATOM 1611  C CZ    . TYR C 3 115 ? 26.513  134.587 -23.270 1.00 47.67  ? 115 TYR A CZ    1 
ATOM 1612  O OH    . TYR C 3 115 ? 25.816  135.407 -22.416 1.00 50.02  ? 115 TYR A OH    1 
ATOM 1613  N N     . PHE C 3 116 ? 30.483  130.027 -27.093 1.00 34.65  ? 116 PHE A N     1 
ATOM 1614  C CA    . PHE C 3 116 ? 30.986  129.044 -28.037 1.00 32.66  ? 116 PHE A CA    1 
ATOM 1615  C C     . PHE C 3 116 ? 31.793  127.955 -27.341 1.00 31.09  ? 116 PHE A C     1 
ATOM 1616  O O     . PHE C 3 116 ? 32.324  127.079 -28.006 1.00 32.42  ? 116 PHE A O     1 
ATOM 1617  C CB    . PHE C 3 116 ? 31.922  129.691 -29.046 1.00 33.79  ? 116 PHE A CB    1 
ATOM 1618  C CG    . PHE C 3 116 ? 31.265  130.645 -29.973 1.00 34.66  ? 116 PHE A CG    1 
ATOM 1619  C CD1   . PHE C 3 116 ? 30.662  131.796 -29.498 1.00 37.01  ? 116 PHE A CD1   1 
ATOM 1620  C CD2   . PHE C 3 116 ? 31.305  130.422 -31.343 1.00 35.69  ? 116 PHE A CD2   1 
ATOM 1621  C CE1   . PHE C 3 116 ? 30.111  132.715 -30.382 1.00 38.78  ? 116 PHE A CE1   1 
ATOM 1622  C CE2   . PHE C 3 116 ? 30.762  131.327 -32.236 1.00 37.24  ? 116 PHE A CE2   1 
ATOM 1623  C CZ    . PHE C 3 116 ? 30.165  132.478 -31.756 1.00 39.00  ? 116 PHE A CZ    1 
ATOM 1624  N N     . SER C 3 117 ? 31.971  128.043 -26.030 1.00 27.96  ? 117 SER A N     1 
ATOM 1625  C CA    . SER C 3 117 ? 32.734  127.020 -25.341 1.00 25.90  ? 117 SER A CA    1 
ATOM 1626  C C     . SER C 3 117 ? 31.853  125.912 -24.808 1.00 24.20  ? 117 SER A C     1 
ATOM 1627  O O     . SER C 3 117 ? 32.314  124.815 -24.509 1.00 25.44  ? 117 SER A O     1 
ATOM 1628  C CB    . SER C 3 117 ? 33.592  127.628 -24.247 1.00 27.88  ? 117 SER A CB    1 
ATOM 1629  O OG    . SER C 3 117 ? 34.714  128.271 -24.824 1.00 28.77  ? 117 SER A OG    1 
ATOM 1630  N N     . VAL C 3 118 ? 30.579  126.201 -24.648 1.00 21.39  ? 118 VAL A N     1 
ATOM 1631  C CA    . VAL C 3 118 ? 29.692  125.163 -24.197 1.00 19.33  ? 118 VAL A CA    1 
ATOM 1632  C C     . VAL C 3 118 ? 29.072  124.593 -25.454 1.00 18.19  ? 118 VAL A C     1 
ATOM 1633  O O     . VAL C 3 118 ? 28.743  125.320 -26.380 1.00 18.10  ? 118 VAL A O     1 
ATOM 1634  C CB    . VAL C 3 118 ? 28.618  125.718 -23.292 1.00 20.10  ? 118 VAL A CB    1 
ATOM 1635  C CG1   . VAL C 3 118 ? 27.591  124.652 -22.967 1.00 20.71  ? 118 VAL A CG1   1 
ATOM 1636  C CG2   . VAL C 3 118 ? 29.251  126.246 -22.036 1.00 20.48  ? 118 VAL A CG2   1 
ATOM 1637  N N     . PRO C 3 119 ? 28.960  123.272 -25.528 1.00 17.47  ? 119 PRO A N     1 
ATOM 1638  C CA    . PRO C 3 119 ? 28.373  122.609 -26.691 1.00 17.34  ? 119 PRO A CA    1 
ATOM 1639  C C     . PRO C 3 119 ? 26.880  122.727 -26.631 1.00 16.36  ? 119 PRO A C     1 
ATOM 1640  O O     . PRO C 3 119 ? 26.293  122.847 -25.551 1.00 14.54  ? 119 PRO A O     1 
ATOM 1641  C CB    . PRO C 3 119 ? 28.767  121.164 -26.483 1.00 18.23  ? 119 PRO A CB    1 
ATOM 1642  C CG    . PRO C 3 119 ? 28.648  121.039 -24.974 1.00 19.01  ? 119 PRO A CG    1 
ATOM 1643  C CD    . PRO C 3 119 ? 29.373  122.291 -24.514 1.00 19.20  ? 119 PRO A CD    1 
ATOM 1644  N N     . LEU C 3 120 ? 26.265  122.618 -27.792 1.00 16.14  ? 120 LEU A N     1 
ATOM 1645  C CA    . LEU C 3 120 ? 24.828  122.717 -27.879 1.00 17.98  ? 120 LEU A CA    1 
ATOM 1646  C C     . LEU C 3 120 ? 24.125  121.374 -27.758 1.00 19.23  ? 120 LEU A C     1 
ATOM 1647  O O     . LEU C 3 120 ? 24.689  120.325 -28.065 1.00 18.51  ? 120 LEU A O     1 
ATOM 1648  C CB    . LEU C 3 120 ? 24.464  123.406 -29.191 1.00 17.66  ? 120 LEU A CB    1 
ATOM 1649  C CG    . LEU C 3 120 ? 23.011  123.694 -29.574 1.00 19.51  ? 120 LEU A CG    1 
ATOM 1650  C CD1   . LEU C 3 120 ? 22.180  124.028 -28.347 1.00 19.81  ? 120 LEU A CD1   1 
ATOM 1651  C CD2   . LEU C 3 120 ? 22.976  124.833 -30.604 1.00 18.07  ? 120 LEU A CD2   1 
ATOM 1652  N N     . ASP C 3 121 ? 22.912  121.400 -27.226 1.00 21.88  ? 121 ASP A N     1 
ATOM 1653  C CA    . ASP C 3 121 ? 22.147  120.175 -27.120 1.00 26.90  ? 121 ASP A CA    1 
ATOM 1654  C C     . ASP C 3 121 ? 22.034  119.651 -28.543 1.00 28.54  ? 121 ASP A C     1 
ATOM 1655  O O     . ASP C 3 121 ? 21.382  120.277 -29.379 1.00 28.37  ? 121 ASP A O     1 
ATOM 1656  C CB    . ASP C 3 121 ? 20.754  120.460 -26.550 1.00 29.21  ? 121 ASP A CB    1 
ATOM 1657  C CG    . ASP C 3 121 ? 19.743  119.350 -26.862 1.00 31.41  ? 121 ASP A CG    1 
ATOM 1658  O OD1   . ASP C 3 121 ? 20.102  118.152 -26.825 1.00 32.02  ? 121 ASP A OD1   1 
ATOM 1659  O OD2   . ASP C 3 121 ? 18.578  119.679 -27.159 1.00 34.02  ? 121 ASP A OD2   1 
ATOM 1660  N N     . GLU C 3 122 ? 22.706  118.530 -28.814 1.00 31.15  ? 122 GLU A N     1 
ATOM 1661  C CA    . GLU C 3 122 ? 22.702  117.891 -30.136 1.00 34.07  ? 122 GLU A CA    1 
ATOM 1662  C C     . GLU C 3 122 ? 21.326  117.946 -30.795 1.00 33.44  ? 122 GLU A C     1 
ATOM 1663  O O     . GLU C 3 122 ? 21.180  118.369 -31.939 1.00 32.00  ? 122 GLU A O     1 
ATOM 1664  C CB    . GLU C 3 122 ? 23.081  116.407 -30.036 1.00 39.34  ? 122 GLU A CB    1 
ATOM 1665  C CG    . GLU C 3 122 ? 24.342  116.016 -29.241 1.00 44.88  ? 122 GLU A CG    1 
ATOM 1666  C CD    . GLU C 3 122 ? 24.568  114.480 -29.235 1.00 48.30  ? 122 GLU A CD    1 
ATOM 1667  O OE1   . GLU C 3 122 ? 24.346  113.825 -28.177 1.00 48.94  ? 122 GLU A OE1   1 
ATOM 1668  O OE2   . GLU C 3 122 ? 24.951  113.935 -30.306 1.00 48.73  ? 122 GLU A OE2   1 
ATOM 1669  N N     . ASP C 3 123 ? 20.325  117.508 -30.043 1.00 33.39  ? 123 ASP A N     1 
ATOM 1670  C CA    . ASP C 3 123 ? 18.942  117.455 -30.496 1.00 34.12  ? 123 ASP A CA    1 
ATOM 1671  C C     . ASP C 3 123 ? 18.410  118.773 -31.071 1.00 31.72  ? 123 ASP A C     1 
ATOM 1672  O O     . ASP C 3 123 ? 17.968  118.825 -32.218 1.00 30.31  ? 123 ASP A O     1 
ATOM 1673  C CB    . ASP C 3 123 ? 18.062  116.984 -29.335 1.00 38.86  ? 123 ASP A CB    1 
ATOM 1674  C CG    . ASP C 3 123 ? 16.785  116.316 -29.804 1.00 43.38  ? 123 ASP A CG    1 
ATOM 1675  O OD1   . ASP C 3 123 ? 16.850  115.164 -30.305 1.00 44.28  ? 123 ASP A OD1   1 
ATOM 1676  O OD2   . ASP C 3 123 ? 15.715  116.949 -29.668 1.00 46.85  ? 123 ASP A OD2   1 
ATOM 1677  N N     . PHE C 3 124 ? 18.475  119.835 -30.277 1.00 29.75  ? 124 PHE A N     1 
ATOM 1678  C CA    . PHE C 3 124 ? 17.997  121.155 -30.687 1.00 28.00  ? 124 PHE A CA    1 
ATOM 1679  C C     . PHE C 3 124 ? 18.868  121.811 -31.760 1.00 26.72  ? 124 PHE A C     1 
ATOM 1680  O O     . PHE C 3 124 ? 18.476  122.810 -32.374 1.00 26.23  ? 124 PHE A O     1 
ATOM 1681  C CB    . PHE C 3 124 ? 17.937  122.065 -29.465 1.00 27.11  ? 124 PHE A CB    1 
ATOM 1682  C CG    . PHE C 3 124 ? 17.303  123.398 -29.725 1.00 27.54  ? 124 PHE A CG    1 
ATOM 1683  C CD1   . PHE C 3 124 ? 15.921  123.519 -29.808 1.00 27.04  ? 124 PHE A CD1   1 
ATOM 1684  C CD2   . PHE C 3 124 ? 18.086  124.541 -29.844 1.00 27.57  ? 124 PHE A CD2   1 
ATOM 1685  C CE1   . PHE C 3 124 ? 15.328  124.750 -29.997 1.00 27.54  ? 124 PHE A CE1   1 
ATOM 1686  C CE2   . PHE C 3 124 ? 17.504  125.781 -30.035 1.00 28.34  ? 124 PHE A CE2   1 
ATOM 1687  C CZ    . PHE C 3 124 ? 16.120  125.886 -30.111 1.00 29.41  ? 124 PHE A CZ    1 
ATOM 1688  N N     . ARG C 3 125 ? 20.048  121.243 -31.973 1.00 24.77  ? 125 ARG A N     1 
ATOM 1689  C CA    . ARG C 3 125 ? 20.988  121.765 -32.942 1.00 23.45  ? 125 ARG A CA    1 
ATOM 1690  C C     . ARG C 3 125 ? 20.375  121.896 -34.306 1.00 24.61  ? 125 ARG A C     1 
ATOM 1691  O O     . ARG C 3 125 ? 20.663  122.845 -35.031 1.00 24.33  ? 125 ARG A O     1 
ATOM 1692  C CB    . ARG C 3 125 ? 22.204  120.862 -33.023 1.00 21.58  ? 125 ARG A CB    1 
ATOM 1693  C CG    . ARG C 3 125 ? 23.055  120.872 -31.780 1.00 19.98  ? 125 ARG A CG    1 
ATOM 1694  C CD    . ARG C 3 125 ? 24.294  120.039 -31.968 1.00 18.20  ? 125 ARG A CD    1 
ATOM 1695  N NE    . ARG C 3 125 ? 25.259  120.295 -30.914 1.00 17.23  ? 125 ARG A NE    1 
ATOM 1696  C CZ    . ARG C 3 125 ? 26.162  119.416 -30.513 1.00 18.96  ? 125 ARG A CZ    1 
ATOM 1697  N NH1   . ARG C 3 125 ? 26.211  118.218 -31.077 1.00 19.81  ? 125 ARG A NH1   1 
ATOM 1698  N NH2   . ARG C 3 125 ? 27.047  119.752 -29.583 1.00 20.19  ? 125 ARG A NH2   1 
ATOM 1699  N N     . LYS C 3 126 ? 19.484  120.966 -34.624 1.00 27.51  ? 126 LYS A N     1 
ATOM 1700  C CA    . LYS C 3 126 ? 18.812  120.942 -35.921 1.00 32.12  ? 126 LYS A CA    1 
ATOM 1701  C C     . LYS C 3 126 ? 18.239  122.291 -36.331 1.00 31.64  ? 126 LYS A C     1 
ATOM 1702  O O     . LYS C 3 126 ? 18.141  122.609 -37.518 1.00 33.22  ? 126 LYS A O     1 
ATOM 1703  C CB    . LYS C 3 126 ? 17.699  119.882 -35.929 1.00 36.56  ? 126 LYS A CB    1 
ATOM 1704  C CG    . LYS C 3 126 ? 18.209  118.457 -36.192 1.00 44.22  ? 126 LYS A CG    1 
ATOM 1705  C CD    . LYS C 3 126 ? 17.380  117.369 -35.471 1.00 48.12  ? 126 LYS A CD    1 
ATOM 1706  C CE    . LYS C 3 126 ? 18.155  116.029 -35.399 1.00 48.79  ? 126 LYS A CE    1 
ATOM 1707  N NZ    . LYS C 3 126 ? 17.532  115.015 -34.478 1.00 50.62  ? 126 LYS A NZ    1 
ATOM 1708  N N     . TYR C 3 127 ? 17.921  123.108 -35.344 1.00 29.66  ? 127 TYR A N     1 
ATOM 1709  C CA    . TYR C 3 127 ? 17.343  124.392 -35.624 1.00 26.81  ? 127 TYR A CA    1 
ATOM 1710  C C     . TYR C 3 127 ? 18.360  125.478 -35.882 1.00 25.47  ? 127 TYR A C     1 
ATOM 1711  O O     . TYR C 3 127 ? 18.237  126.201 -36.857 1.00 25.18  ? 127 TYR A O     1 
ATOM 1712  C CB    . TYR C 3 127 ? 16.409  124.752 -34.484 1.00 27.72  ? 127 TYR A CB    1 
ATOM 1713  C CG    . TYR C 3 127 ? 15.302  123.736 -34.335 1.00 25.74  ? 127 TYR A CG    1 
ATOM 1714  C CD1   . TYR C 3 127 ? 14.318  123.627 -35.308 1.00 25.90  ? 127 TYR A CD1   1 
ATOM 1715  C CD2   . TYR C 3 127 ? 15.244  122.875 -33.236 1.00 24.99  ? 127 TYR A CD2   1 
ATOM 1716  C CE1   . TYR C 3 127 ? 13.294  122.690 -35.202 1.00 27.39  ? 127 TYR A CE1   1 
ATOM 1717  C CE2   . TYR C 3 127 ? 14.217  121.923 -33.118 1.00 26.39  ? 127 TYR A CE2   1 
ATOM 1718  C CZ    . TYR C 3 127 ? 13.235  121.835 -34.114 1.00 27.37  ? 127 TYR A CZ    1 
ATOM 1719  O OH    . TYR C 3 127 ? 12.189  120.913 -34.047 1.00 26.23  ? 127 TYR A OH    1 
ATOM 1720  N N     . THR C 3 128 ? 19.399  125.529 -35.056 1.00 24.81  ? 128 THR A N     1 
ATOM 1721  C CA    . THR C 3 128 ? 20.442  126.553 -35.146 1.00 25.10  ? 128 THR A CA    1 
ATOM 1722  C C     . THR C 3 128 ? 21.288  126.490 -36.397 1.00 24.21  ? 128 THR A C     1 
ATOM 1723  O O     . THR C 3 128 ? 22.500  126.705 -36.356 1.00 22.82  ? 128 THR A O     1 
ATOM 1724  C CB    . THR C 3 128 ? 21.404  126.457 -33.973 1.00 26.31  ? 128 THR A CB    1 
ATOM 1725  O OG1   . THR C 3 128 ? 22.154  125.241 -34.098 1.00 27.59  ? 128 THR A OG1   1 
ATOM 1726  C CG2   . THR C 3 128 ? 20.644  126.475 -32.645 1.00 26.75  ? 128 THR A CG2   1 
ATOM 1727  N N     . ALA C 3 129 ? 20.649  126.218 -37.518 1.00 25.69  ? 129 ALA A N     1 
ATOM 1728  C CA    . ALA C 3 129 ? 21.369  126.127 -38.774 1.00 28.31  ? 129 ALA A CA    1 
ATOM 1729  C C     . ALA C 3 129 ? 21.284  127.407 -39.586 1.00 28.37  ? 129 ALA A C     1 
ATOM 1730  O O     . ALA C 3 129 ? 20.515  128.307 -39.262 1.00 27.84  ? 129 ALA A O     1 
ATOM 1731  C CB    . ALA C 3 129 ? 20.838  124.957 -39.595 1.00 30.55  ? 129 ALA A CB    1 
ATOM 1732  N N     . PHE C 3 130 ? 22.068  127.458 -40.659 1.00 28.95  ? 130 PHE A N     1 
ATOM 1733  C CA    . PHE C 3 130 ? 22.087  128.604 -41.552 1.00 29.20  ? 130 PHE A CA    1 
ATOM 1734  C C     . PHE C 3 130 ? 22.760  128.313 -42.873 1.00 29.71  ? 130 PHE A C     1 
ATOM 1735  O O     . PHE C 3 130 ? 23.656  127.464 -42.979 1.00 30.22  ? 130 PHE A O     1 
ATOM 1736  C CB    . PHE C 3 130 ? 22.791  129.785 -40.913 1.00 28.87  ? 130 PHE A CB    1 
ATOM 1737  C CG    . PHE C 3 130 ? 24.231  129.536 -40.604 1.00 28.98  ? 130 PHE A CG    1 
ATOM 1738  C CD1   . PHE C 3 130 ? 24.599  128.945 -39.400 1.00 27.07  ? 130 PHE A CD1   1 
ATOM 1739  C CD2   . PHE C 3 130 ? 25.223  129.954 -41.483 1.00 28.25  ? 130 PHE A CD2   1 
ATOM 1740  C CE1   . PHE C 3 130 ? 25.933  128.782 -39.073 1.00 27.30  ? 130 PHE A CE1   1 
ATOM 1741  C CE2   . PHE C 3 130 ? 26.564  129.795 -41.166 1.00 27.78  ? 130 PHE A CE2   1 
ATOM 1742  C CZ    . PHE C 3 130 ? 26.923  129.210 -39.954 1.00 26.92  ? 130 PHE A CZ    1 
ATOM 1743  N N     . THR C 3 131 ? 22.382  129.111 -43.858 1.00 29.55  ? 131 THR A N     1 
ATOM 1744  C CA    . THR C 3 131 ? 22.920  128.963 -45.181 1.00 29.49  ? 131 THR A CA    1 
ATOM 1745  C C     . THR C 3 131 ? 23.805  130.113 -45.527 1.00 30.55  ? 131 THR A C     1 
ATOM 1746  O O     . THR C 3 131 ? 23.356  131.256 -45.556 1.00 30.11  ? 131 THR A O     1 
ATOM 1747  C CB    . THR C 3 131 ? 21.832  128.983 -46.210 1.00 29.96  ? 131 THR A CB    1 
ATOM 1748  O OG1   . THR C 3 131 ? 20.794  128.082 -45.819 1.00 29.41  ? 131 THR A OG1   1 
ATOM 1749  C CG2   . THR C 3 131 ? 22.408  128.591 -47.563 1.00 31.22  ? 131 THR A CG2   1 
ATOM 1750  N N     . ILE C 3 132 ? 25.070  129.820 -45.770 1.00 32.47  ? 132 ILE A N     1 
ATOM 1751  C CA    . ILE C 3 132 ? 25.975  130.870 -46.175 1.00 35.43  ? 132 ILE A CA    1 
ATOM 1752  C C     . ILE C 3 132 ? 25.970  130.735 -47.680 1.00 38.96  ? 132 ILE A C     1 
ATOM 1753  O O     . ILE C 3 132 ? 26.329  129.692 -48.211 1.00 38.12  ? 132 ILE A O     1 
ATOM 1754  C CB    . ILE C 3 132 ? 27.355  130.705 -45.592 1.00 35.26  ? 132 ILE A CB    1 
ATOM 1755  C CG1   . ILE C 3 132 ? 28.347  131.511 -46.420 1.00 34.75  ? 132 ILE A CG1   1 
ATOM 1756  C CG2   . ILE C 3 132 ? 27.703  129.244 -45.454 1.00 34.51  ? 132 ILE A CG2   1 
ATOM 1757  C CD1   . ILE C 3 132 ? 29.689  131.540 -45.817 1.00 35.58  ? 132 ILE A CD1   1 
ATOM 1758  N N     . PRO C 3 133 ? 25.518  131.790 -48.378 1.00 43.78  ? 133 PRO A N     1 
ATOM 1759  C CA    . PRO C 3 133 ? 25.368  131.956 -49.830 1.00 46.70  ? 133 PRO A CA    1 
ATOM 1760  C C     . PRO C 3 133 ? 26.608  131.971 -50.655 1.00 49.54  ? 133 PRO A C     1 
ATOM 1761  O O     . PRO C 3 133 ? 27.713  132.185 -50.156 1.00 50.18  ? 133 PRO A O     1 
ATOM 1762  C CB    . PRO C 3 133 ? 24.650  133.303 -49.969 1.00 47.02  ? 133 PRO A CB    1 
ATOM 1763  C CG    . PRO C 3 133 ? 24.106  133.578 -48.586 1.00 47.72  ? 133 PRO A CG    1 
ATOM 1764  C CD    . PRO C 3 133 ? 25.205  133.055 -47.704 1.00 44.81  ? 133 PRO A CD    1 
ATOM 1765  N N     . SER C 3 134 ? 26.370  131.878 -51.957 1.00 53.01  ? 134 SER A N     1 
ATOM 1766  C CA    . SER C 3 134 ? 27.436  131.862 -52.932 1.00 57.69  ? 134 SER A CA    1 
ATOM 1767  C C     . SER C 3 134 ? 27.110  132.628 -54.211 1.00 60.57  ? 134 SER A C     1 
ATOM 1768  O O     . SER C 3 134 ? 25.988  133.096 -54.437 1.00 59.95  ? 134 SER A O     1 
ATOM 1769  C CB    . SER C 3 134 ? 27.799  130.413 -53.280 1.00 57.73  ? 134 SER A CB    1 
ATOM 1770  O OG    . SER C 3 134 ? 26.677  129.715 -53.809 1.00 58.04  ? 134 SER A OG    1 
ATOM 1771  N N     . ILE C 3 135 ? 28.133  132.712 -55.049 1.00 64.03  ? 135 ILE A N     1 
ATOM 1772  C CA    . ILE C 3 135 ? 28.105  133.376 -56.344 1.00 66.49  ? 135 ILE A CA    1 
ATOM 1773  C C     . ILE C 3 135 ? 27.965  132.333 -57.473 1.00 67.93  ? 135 ILE A C     1 
ATOM 1774  O O     . ILE C 3 135 ? 28.470  131.211 -57.359 1.00 68.96  ? 135 ILE A O     1 
ATOM 1775  C CB    . ILE C 3 135 ? 29.429  134.123 -56.521 1.00 66.40  ? 135 ILE A CB    1 
ATOM 1776  C CG1   . ILE C 3 135 ? 30.587  133.156 -56.190 1.00 68.54  ? 135 ILE A CG1   1 
ATOM 1777  C CG2   . ILE C 3 135 ? 29.466  135.326 -55.579 1.00 65.88  ? 135 ILE A CG2   1 
ATOM 1778  C CD1   . ILE C 3 135 ? 31.983  133.632 -56.546 1.00 70.79  ? 135 ILE A CD1   1 
ATOM 1779  N N     . ASN C 3 136 ? 27.284  132.716 -58.551 1.00 68.39  ? 136 ASN A N     1 
ATOM 1780  C CA    . ASN C 3 136 ? 27.046  131.874 -59.744 1.00 68.79  ? 136 ASN A CA    1 
ATOM 1781  C C     . ASN C 3 136 ? 27.509  130.383 -59.836 1.00 68.23  ? 136 ASN A C     1 
ATOM 1782  O O     . ASN C 3 136 ? 26.675  129.473 -59.688 1.00 67.27  ? 136 ASN A O     1 
ATOM 1783  C CB    . ASN C 3 136 ? 27.486  132.645 -61.000 1.00 70.25  ? 136 ASN A CB    1 
ATOM 1784  N N     . ASN C 3 137 ? 28.803  130.159 -60.136 1.00 67.38  ? 137 ASN A N     1 
ATOM 1785  C CA    . ASN C 3 137 ? 29.425  128.814 -60.287 1.00 66.78  ? 137 ASN A CA    1 
ATOM 1786  C C     . ASN C 3 137 ? 28.674  127.705 -59.551 1.00 66.34  ? 137 ASN A C     1 
ATOM 1787  O O     . ASN C 3 137 ? 27.887  126.961 -60.154 1.00 65.20  ? 137 ASN A O     1 
ATOM 1788  C CB    . ASN C 3 137 ? 30.912  128.838 -59.838 1.00 67.27  ? 137 ASN A CB    1 
ATOM 1789  C CG    . ASN C 3 137 ? 31.566  127.431 -59.804 1.00 65.95  ? 137 ASN A CG    1 
ATOM 1790  O OD1   . ASN C 3 137 ? 32.142  127.027 -58.786 1.00 64.69  ? 137 ASN A OD1   1 
ATOM 1791  N ND2   . ASN C 3 137 ? 31.473  126.695 -60.914 1.00 65.05  ? 137 ASN A ND2   1 
ATOM 1792  N N     . GLU C 3 138 ? 28.951  127.591 -58.253 1.00 66.23  ? 138 GLU A N     1 
ATOM 1793  C CA    . GLU C 3 138 ? 28.297  126.612 -57.405 1.00 65.66  ? 138 GLU A CA    1 
ATOM 1794  C C     . GLU C 3 138 ? 26.930  127.207 -57.105 1.00 65.44  ? 138 GLU A C     1 
ATOM 1795  O O     . GLU C 3 138 ? 26.726  127.871 -56.084 1.00 64.83  ? 138 GLU A O     1 
ATOM 1796  C CB    . GLU C 3 138 ? 29.092  126.398 -56.116 1.00 65.92  ? 138 GLU A CB    1 
ATOM 1797  N N     . THR C 3 139 ? 26.021  127.027 -58.057 1.00 65.11  ? 139 THR A N     1 
ATOM 1798  C CA    . THR C 3 139 ? 24.656  127.524 -57.940 1.00 65.38  ? 139 THR A CA    1 
ATOM 1799  C C     . THR C 3 139 ? 24.055  127.196 -56.555 1.00 64.70  ? 139 THR A C     1 
ATOM 1800  O O     . THR C 3 139 ? 23.431  128.056 -55.924 1.00 65.94  ? 139 THR A O     1 
ATOM 1801  C CB    . THR C 3 139 ? 23.783  126.965 -59.092 1.00 65.26  ? 139 THR A CB    1 
ATOM 1802  O OG1   . THR C 3 139 ? 24.404  127.283 -60.345 1.00 65.34  ? 139 THR A OG1   1 
ATOM 1803  C CG2   . THR C 3 139 ? 22.374  127.561 -59.061 1.00 65.25  ? 139 THR A CG2   1 
ATOM 1804  N N     . PRO C 3 140 ? 24.275  125.964 -56.049 1.00 62.65  ? 140 PRO A N     1 
ATOM 1805  C CA    . PRO C 3 140 ? 23.751  125.551 -54.736 1.00 60.76  ? 140 PRO A CA    1 
ATOM 1806  C C     . PRO C 3 140 ? 24.497  126.189 -53.565 1.00 58.94  ? 140 PRO A C     1 
ATOM 1807  O O     . PRO C 3 140 ? 25.699  126.449 -53.651 1.00 58.26  ? 140 PRO A O     1 
ATOM 1808  C CB    . PRO C 3 140 ? 23.970  124.041 -54.745 1.00 62.06  ? 140 PRO A CB    1 
ATOM 1809  C CG    . PRO C 3 140 ? 23.989  123.700 -56.232 1.00 62.35  ? 140 PRO A CG    1 
ATOM 1810  C CD    . PRO C 3 140 ? 24.813  124.802 -56.778 1.00 61.35  ? 140 PRO A CD    1 
ATOM 1811  N N     . GLY C 3 141 ? 23.791  126.362 -52.451 1.00 56.28  ? 141 GLY A N     1 
ATOM 1812  C CA    . GLY C 3 141 ? 24.386  126.984 -51.280 1.00 53.46  ? 141 GLY A CA    1 
ATOM 1813  C C     . GLY C 3 141 ? 24.990  126.062 -50.238 1.00 50.90  ? 141 GLY A C     1 
ATOM 1814  O O     . GLY C 3 141 ? 24.885  124.836 -50.341 1.00 50.76  ? 141 GLY A O     1 
ATOM 1815  N N     . ILE C 3 142 ? 25.615  126.683 -49.231 1.00 49.44  ? 142 ILE A N     1 
ATOM 1816  C CA    . ILE C 3 142 ? 26.267  126.000 -48.106 1.00 46.47  ? 142 ILE A CA    1 
ATOM 1817  C C     . ILE C 3 142 ? 25.430  126.092 -46.822 1.00 44.36  ? 142 ILE A C     1 
ATOM 1818  O O     . ILE C 3 142 ? 24.962  127.164 -46.421 1.00 42.82  ? 142 ILE A O     1 
ATOM 1819  C CB    . ILE C 3 142 ? 27.683  126.585 -47.818 1.00 46.50  ? 142 ILE A CB    1 
ATOM 1820  C CG1   . ILE C 3 142 ? 28.565  126.484 -49.064 1.00 45.35  ? 142 ILE A CG1   1 
ATOM 1821  C CG2   . ILE C 3 142 ? 28.346  125.855 -46.644 1.00 45.57  ? 142 ILE A CG2   1 
ATOM 1822  C CD1   . ILE C 3 142 ? 29.994  126.939 -48.832 1.00 46.56  ? 142 ILE A CD1   1 
ATOM 1823  N N     . ARG C 3 143 ? 25.303  124.953 -46.159 1.00 41.88  ? 143 ARG A N     1 
ATOM 1824  C CA    . ARG C 3 143 ? 24.527  124.848 -44.942 1.00 40.14  ? 143 ARG A CA    1 
ATOM 1825  C C     . ARG C 3 143 ? 25.395  124.516 -43.744 1.00 39.00  ? 143 ARG A C     1 
ATOM 1826  O O     . ARG C 3 143 ? 26.282  123.669 -43.807 1.00 39.13  ? 143 ARG A O     1 
ATOM 1827  C CB    . ARG C 3 143 ? 23.483  123.767 -45.137 1.00 40.46  ? 143 ARG A CB    1 
ATOM 1828  C CG    . ARG C 3 143 ? 22.747  123.883 -46.455 1.00 42.32  ? 143 ARG A CG    1 
ATOM 1829  C CD    . ARG C 3 143 ? 22.122  125.252 -46.583 1.00 44.77  ? 143 ARG A CD    1 
ATOM 1830  N NE    . ARG C 3 143 ? 21.424  125.643 -45.360 1.00 48.03  ? 143 ARG A NE    1 
ATOM 1831  C CZ    . ARG C 3 143 ? 20.256  125.141 -44.958 1.00 50.78  ? 143 ARG A CZ    1 
ATOM 1832  N NH1   . ARG C 3 143 ? 19.633  124.219 -45.687 1.00 51.77  ? 143 ARG A NH1   1 
ATOM 1833  N NH2   . ARG C 3 143 ? 19.722  125.541 -43.805 1.00 51.40  ? 143 ARG A NH2   1 
ATOM 1834  N N     . TYR C 3 144 ? 25.097  125.140 -42.623 1.00 37.94  ? 144 TYR A N     1 
ATOM 1835  C CA    . TYR C 3 144 ? 25.877  124.901 -41.429 1.00 39.36  ? 144 TYR A CA    1 
ATOM 1836  C C     . TYR C 3 144 ? 24.982  125.044 -40.220 1.00 39.23  ? 144 TYR A C     1 
ATOM 1837  O O     . TYR C 3 144 ? 24.202  125.992 -40.127 1.00 38.55  ? 144 TYR A O     1 
ATOM 1838  C CB    . TYR C 3 144 ? 26.950  125.972 -41.295 1.00 41.08  ? 144 TYR A CB    1 
ATOM 1839  C CG    . TYR C 3 144 ? 28.299  125.753 -41.942 1.00 42.94  ? 144 TYR A CG    1 
ATOM 1840  C CD1   . TYR C 3 144 ? 28.693  126.514 -43.052 1.00 42.62  ? 144 TYR A CD1   1 
ATOM 1841  C CD2   . TYR C 3 144 ? 29.267  124.969 -41.317 1.00 43.86  ? 144 TYR A CD2   1 
ATOM 1842  C CE1   . TYR C 3 144 ? 30.031  126.521 -43.506 1.00 42.81  ? 144 TYR A CE1   1 
ATOM 1843  C CE2   . TYR C 3 144 ? 30.607  124.967 -41.758 1.00 44.52  ? 144 TYR A CE2   1 
ATOM 1844  C CZ    . TYR C 3 144 ? 30.986  125.750 -42.846 1.00 44.20  ? 144 TYR A CZ    1 
ATOM 1845  O OH    . TYR C 3 144 ? 32.320  125.801 -43.219 1.00 42.84  ? 144 TYR A OH    1 
ATOM 1846  N N     . GLN C 3 145 ? 25.127  124.130 -39.273 1.00 39.27  ? 145 GLN A N     1 
ATOM 1847  C CA    . GLN C 3 145 ? 24.355  124.210 -38.044 1.00 40.16  ? 145 GLN A CA    1 
ATOM 1848  C C     . GLN C 3 145 ? 25.335  124.436 -36.897 1.00 39.36  ? 145 GLN A C     1 
ATOM 1849  O O     . GLN C 3 145 ? 26.528  124.117 -37.019 1.00 38.99  ? 145 GLN A O     1 
ATOM 1850  C CB    . GLN C 3 145 ? 23.545  122.931 -37.807 1.00 42.33  ? 145 GLN A CB    1 
ATOM 1851  C CG    . GLN C 3 145 ? 24.389  121.691 -37.581 1.00 46.72  ? 145 GLN A CG    1 
ATOM 1852  C CD    . GLN C 3 145 ? 23.581  120.463 -37.158 1.00 50.10  ? 145 GLN A CD    1 
ATOM 1853  O OE1   . GLN C 3 145 ? 22.471  120.203 -37.661 1.00 52.51  ? 145 GLN A OE1   1 
ATOM 1854  N NE2   . GLN C 3 145 ? 24.157  119.678 -36.245 1.00 51.59  ? 145 GLN A NE2   1 
ATOM 1855  N N     . TYR C 3 146 ? 24.835  125.023 -35.809 1.00 38.31  ? 146 TYR A N     1 
ATOM 1856  C CA    . TYR C 3 146 ? 25.641  125.296 -34.612 1.00 38.01  ? 146 TYR A CA    1 
ATOM 1857  C C     . TYR C 3 146 ? 25.841  124.014 -33.787 1.00 38.01  ? 146 TYR A C     1 
ATOM 1858  O O     . TYR C 3 146 ? 24.894  123.254 -33.590 1.00 38.63  ? 146 TYR A O     1 
ATOM 1859  C CB    . TYR C 3 146 ? 24.954  126.362 -33.737 1.00 36.88  ? 146 TYR A CB    1 
ATOM 1860  C CG    . TYR C 3 146 ? 25.236  127.803 -34.115 1.00 35.05  ? 146 TYR A CG    1 
ATOM 1861  C CD1   . TYR C 3 146 ? 25.491  128.168 -35.434 1.00 34.09  ? 146 TYR A CD1   1 
ATOM 1862  C CD2   . TYR C 3 146 ? 25.287  128.792 -33.140 1.00 34.01  ? 146 TYR A CD2   1 
ATOM 1863  C CE1   . TYR C 3 146 ? 25.794  129.472 -35.765 1.00 33.79  ? 146 TYR A CE1   1 
ATOM 1864  C CE2   . TYR C 3 146 ? 25.588  130.102 -33.464 1.00 34.10  ? 146 TYR A CE2   1 
ATOM 1865  C CZ    . TYR C 3 146 ? 25.843  130.430 -34.776 1.00 34.63  ? 146 TYR A CZ    1 
ATOM 1866  O OH    . TYR C 3 146 ? 26.166  131.715 -35.104 1.00 36.07  ? 146 TYR A OH    1 
ATOM 1867  N N     . ASN C 3 147 ? 27.063  123.757 -33.327 1.00 37.13  ? 147 ASN A N     1 
ATOM 1868  C CA    . ASN C 3 147 ? 27.309  122.567 -32.520 1.00 37.37  ? 147 ASN A CA    1 
ATOM 1869  C C     . ASN C 3 147 ? 27.566  122.955 -31.071 1.00 37.17  ? 147 ASN A C     1 
ATOM 1870  O O     . ASN C 3 147 ? 27.768  122.108 -30.201 1.00 36.00  ? 147 ASN A O     1 
ATOM 1871  C CB    . ASN C 3 147 ? 28.470  121.754 -33.090 1.00 39.65  ? 147 ASN A CB    1 
ATOM 1872  C CG    . ASN C 3 147 ? 28.067  120.313 -33.425 1.00 44.38  ? 147 ASN A CG    1 
ATOM 1873  O OD1   . ASN C 3 147 ? 27.431  120.046 -34.457 1.00 46.43  ? 147 ASN A OD1   1 
ATOM 1874  N ND2   . ASN C 3 147 ? 28.428  119.378 -32.544 1.00 44.92  ? 147 ASN A ND2   1 
ATOM 1875  N N     . VAL C 3 148 ? 27.501  124.256 -30.819 1.00 37.94  ? 148 VAL A N     1 
ATOM 1876  C CA    . VAL C 3 148 ? 27.718  124.824 -29.492 1.00 38.87  ? 148 VAL A CA    1 
ATOM 1877  C C     . VAL C 3 148 ? 26.714  125.955 -29.248 1.00 40.84  ? 148 VAL A C     1 
ATOM 1878  O O     . VAL C 3 148 ? 25.784  126.138 -30.042 1.00 42.82  ? 148 VAL A O     1 
ATOM 1879  C CB    . VAL C 3 148 ? 29.142  125.381 -29.376 1.00 37.90  ? 148 VAL A CB    1 
ATOM 1880  C CG1   . VAL C 3 148 ? 30.136  124.242 -29.366 1.00 38.11  ? 148 VAL A CG1   1 
ATOM 1881  C CG2   . VAL C 3 148 ? 29.431  126.341 -30.533 1.00 34.46  ? 148 VAL A CG2   1 
ATOM 1882  N N     . LEU C 3 149 ? 26.905  126.720 -28.170 1.00 41.13  ? 149 LEU A N     1 
ATOM 1883  C CA    . LEU C 3 149 ? 26.008  127.836 -27.838 1.00 40.76  ? 149 LEU A CA    1 
ATOM 1884  C C     . LEU C 3 149 ? 26.041  129.070 -28.766 1.00 41.64  ? 149 LEU A C     1 
ATOM 1885  O O     . LEU C 3 149 ? 27.057  129.778 -28.871 1.00 41.75  ? 149 LEU A O     1 
ATOM 1886  C CB    . LEU C 3 149 ? 26.204  128.267 -26.385 1.00 39.79  ? 149 LEU A CB    1 
ATOM 1887  C CG    . LEU C 3 149 ? 25.607  127.337 -25.329 1.00 38.76  ? 149 LEU A CG    1 
ATOM 1888  C CD1   . LEU C 3 149 ? 25.806  127.941 -23.935 1.00 39.47  ? 149 LEU A CD1   1 
ATOM 1889  C CD2   . LEU C 3 149 ? 24.124  127.143 -25.616 1.00 36.39  ? 149 LEU A CD2   1 
ATOM 1890  N N     . PRO C 3 150 ? 24.915  129.329 -29.458 1.00 42.33  ? 150 PRO A N     1 
ATOM 1891  C CA    . PRO C 3 150 ? 24.700  130.437 -30.395 1.00 42.67  ? 150 PRO A CA    1 
ATOM 1892  C C     . PRO C 3 150 ? 24.656  131.819 -29.744 1.00 42.87  ? 150 PRO A C     1 
ATOM 1893  O O     . PRO C 3 150 ? 23.881  132.070 -28.815 1.00 42.35  ? 150 PRO A O     1 
ATOM 1894  C CB    . PRO C 3 150 ? 23.369  130.073 -31.057 1.00 43.63  ? 150 PRO A CB    1 
ATOM 1895  C CG    . PRO C 3 150 ? 22.670  129.291 -29.995 1.00 43.03  ? 150 PRO A CG    1 
ATOM 1896  C CD    . PRO C 3 150 ? 23.761  128.416 -29.470 1.00 42.12  ? 150 PRO A CD    1 
ATOM 1897  N N     . GLN C 3 151 ? 25.445  132.719 -30.326 1.00 42.62  ? 151 GLN A N     1 
ATOM 1898  C CA    . GLN C 3 151 ? 25.627  134.105 -29.892 1.00 41.37  ? 151 GLN A CA    1 
ATOM 1899  C C     . GLN C 3 151 ? 24.439  135.044 -29.653 1.00 38.68  ? 151 GLN A C     1 
ATOM 1900  O O     . GLN C 3 151 ? 24.627  136.145 -29.131 1.00 39.81  ? 151 GLN A O     1 
ATOM 1901  C CB    . GLN C 3 151 ? 26.635  134.785 -30.821 1.00 45.16  ? 151 GLN A CB    1 
ATOM 1902  C CG    . GLN C 3 151 ? 26.430  134.467 -32.312 1.00 48.37  ? 151 GLN A CG    1 
ATOM 1903  C CD    . GLN C 3 151 ? 27.749  134.166 -33.028 1.00 49.81  ? 151 GLN A CD    1 
ATOM 1904  O OE1   . GLN C 3 151 ? 28.784  134.765 -32.721 1.00 50.45  ? 151 GLN A OE1   1 
ATOM 1905  N NE2   . GLN C 3 151 ? 27.723  133.217 -33.962 1.00 49.98  ? 151 GLN A NE2   1 
ATOM 1906  N N     . GLY C 3 152 ? 23.229  134.629 -30.007 1.00 34.93  ? 152 GLY A N     1 
ATOM 1907  C CA    . GLY C 3 152 ? 22.081  135.495 -29.783 1.00 31.37  ? 152 GLY A CA    1 
ATOM 1908  C C     . GLY C 3 152 ? 20.829  134.698 -29.494 1.00 28.62  ? 152 GLY A C     1 
ATOM 1909  O O     . GLY C 3 152 ? 19.721  135.137 -29.791 1.00 27.75  ? 152 GLY A O     1 
ATOM 1910  N N     . TRP C 3 153 ? 21.019  133.508 -28.932 1.00 26.25  ? 153 TRP A N     1 
ATOM 1911  C CA    . TRP C 3 153 ? 19.917  132.622 -28.603 1.00 22.60  ? 153 TRP A CA    1 
ATOM 1912  C C     . TRP C 3 153 ? 19.558  132.650 -27.135 1.00 21.15  ? 153 TRP A C     1 
ATOM 1913  O O     . TRP C 3 153 ? 20.342  132.219 -26.287 1.00 20.60  ? 153 TRP A O     1 
ATOM 1914  C CB    . TRP C 3 153 ? 20.265  131.198 -28.975 1.00 20.08  ? 153 TRP A CB    1 
ATOM 1915  C CG    . TRP C 3 153 ? 19.207  130.266 -28.584 1.00 21.24  ? 153 TRP A CG    1 
ATOM 1916  C CD1   . TRP C 3 153 ? 17.919  130.269 -29.021 1.00 21.09  ? 153 TRP A CD1   1 
ATOM 1917  C CD2   . TRP C 3 153 ? 19.338  129.144 -27.722 1.00 22.24  ? 153 TRP A CD2   1 
ATOM 1918  N NE1   . TRP C 3 153 ? 17.234  129.202 -28.499 1.00 21.03  ? 153 TRP A NE1   1 
ATOM 1919  C CE2   . TRP C 3 153 ? 18.083  128.491 -27.695 1.00 21.17  ? 153 TRP A CE2   1 
ATOM 1920  C CE3   . TRP C 3 153 ? 20.395  128.616 -26.974 1.00 20.59  ? 153 TRP A CE3   1 
ATOM 1921  C CZ2   . TRP C 3 153 ? 17.855  127.335 -26.952 1.00 20.75  ? 153 TRP A CZ2   1 
ATOM 1922  C CZ3   . TRP C 3 153 ? 20.172  127.466 -26.232 1.00 21.58  ? 153 TRP A CZ3   1 
ATOM 1923  C CH2   . TRP C 3 153 ? 18.907  126.835 -26.229 1.00 21.94  ? 153 TRP A CH2   1 
ATOM 1924  N N     . LYS C 3 154 ? 18.326  133.054 -26.856 1.00 19.42  ? 154 LYS A N     1 
ATOM 1925  C CA    . LYS C 3 154 ? 17.828  133.127 -25.487 1.00 19.61  ? 154 LYS A CA    1 
ATOM 1926  C C     . LYS C 3 154 ? 18.366  132.011 -24.584 1.00 17.79  ? 154 LYS A C     1 
ATOM 1927  O O     . LYS C 3 154 ? 18.710  132.242 -23.411 1.00 16.60  ? 154 LYS A O     1 
ATOM 1928  C CB    . LYS C 3 154 ? 16.299  133.087 -25.498 1.00 22.40  ? 154 LYS A CB    1 
ATOM 1929  C CG    . LYS C 3 154 ? 15.726  131.902 -26.246 1.00 26.60  ? 154 LYS A CG    1 
ATOM 1930  C CD    . LYS C 3 154 ? 14.256  132.116 -26.601 1.00 31.78  ? 154 LYS A CD    1 
ATOM 1931  C CE    . LYS C 3 154 ? 13.300  131.858 -25.423 1.00 34.85  ? 154 LYS A CE    1 
ATOM 1932  N NZ    . LYS C 3 154 ? 11.843  131.828 -25.835 1.00 35.03  ? 154 LYS A NZ    1 
ATOM 1933  N N     . GLY C 3 155 ? 18.487  130.816 -25.157 1.00 14.73  ? 155 GLY A N     1 
ATOM 1934  C CA    . GLY C 3 155 ? 18.972  129.701 -24.388 1.00 11.05  ? 155 GLY A CA    1 
ATOM 1935  C C     . GLY C 3 155 ? 20.304  130.037 -23.797 1.00 10.09  ? 155 GLY A C     1 
ATOM 1936  O O     . GLY C 3 155 ? 20.413  130.339 -22.608 1.00 9.02   ? 155 GLY A O     1 
ATOM 1937  N N     . SER C 3 156 ? 21.302  130.048 -24.663 1.00 10.73  ? 156 SER A N     1 
ATOM 1938  C CA    . SER C 3 156 ? 22.686  130.322 -24.291 1.00 13.79  ? 156 SER A CA    1 
ATOM 1939  C C     . SER C 3 156 ? 22.884  131.022 -22.954 1.00 14.36  ? 156 SER A C     1 
ATOM 1940  O O     . SER C 3 156 ? 23.461  130.449 -22.034 1.00 15.25  ? 156 SER A O     1 
ATOM 1941  C CB    . SER C 3 156 ? 23.397  131.126 -25.388 1.00 17.29  ? 156 SER A CB    1 
ATOM 1942  O OG    . SER C 3 156 ? 23.252  130.551 -26.680 1.00 23.87  ? 156 SER A OG    1 
ATOM 1943  N N     . PRO C 3 157 ? 22.341  132.245 -22.810 1.00 16.01  ? 157 PRO A N     1 
ATOM 1944  C CA    . PRO C 3 157 ? 22.435  133.065 -21.601 1.00 15.79  ? 157 PRO A CA    1 
ATOM 1945  C C     . PRO C 3 157 ? 22.458  132.248 -20.335 1.00 17.17  ? 157 PRO A C     1 
ATOM 1946  O O     . PRO C 3 157 ? 23.494  132.088 -19.684 1.00 16.53  ? 157 PRO A O     1 
ATOM 1947  C CB    . PRO C 3 157 ? 21.155  133.870 -21.668 1.00 15.92  ? 157 PRO A CB    1 
ATOM 1948  C CG    . PRO C 3 157 ? 21.062  134.165 -23.081 1.00 16.29  ? 157 PRO A CG    1 
ATOM 1949  C CD    . PRO C 3 157 ? 21.411  132.876 -23.761 1.00 14.84  ? 157 PRO A CD    1 
ATOM 1950  N N     . ALA C 3 158 ? 21.306  131.679 -20.025 1.00 19.10  ? 158 ALA A N     1 
ATOM 1951  C CA    . ALA C 3 158 ? 21.177  130.873 -18.832 1.00 20.88  ? 158 ALA A CA    1 
ATOM 1952  C C     . ALA C 3 158 ? 21.979  129.590 -18.947 1.00 20.48  ? 158 ALA A C     1 
ATOM 1953  O O     . ALA C 3 158 ? 22.619  129.148 -17.985 1.00 21.42  ? 158 ALA A O     1 
ATOM 1954  C CB    . ALA C 3 158 ? 19.733  130.563 -18.579 1.00 23.23  ? 158 ALA A CB    1 
ATOM 1955  N N     . ILE C 3 159 ? 21.957  129.002 -20.133 1.00 18.45  ? 159 ILE A N     1 
ATOM 1956  C CA    . ILE C 3 159 ? 22.683  127.774 -20.332 1.00 18.46  ? 159 ILE A CA    1 
ATOM 1957  C C     . ILE C 3 159 ? 24.083  127.926 -19.800 1.00 18.02  ? 159 ILE A C     1 
ATOM 1958  O O     . ILE C 3 159 ? 24.437  127.320 -18.788 1.00 18.37  ? 159 ILE A O     1 
ATOM 1959  C CB    . ILE C 3 159 ? 22.838  127.431 -21.788 1.00 19.62  ? 159 ILE A CB    1 
ATOM 1960  C CG1   . ILE C 3 159 ? 21.519  127.598 -22.526 1.00 20.75  ? 159 ILE A CG1   1 
ATOM 1961  C CG2   . ILE C 3 159 ? 23.371  126.024 -21.901 1.00 20.95  ? 159 ILE A CG2   1 
ATOM 1962  C CD1   . ILE C 3 159 ? 20.377  126.877 -21.911 1.00 23.81  ? 159 ILE A CD1   1 
ATOM 1963  N N     . PHE C 3 160 ? 24.841  128.815 -20.434 1.00 17.94  ? 160 PHE A N     1 
ATOM 1964  C CA    . PHE C 3 160 ? 26.216  129.029 -20.047 1.00 17.13  ? 160 PHE A CA    1 
ATOM 1965  C C     . PHE C 3 160 ? 26.337  129.140 -18.570 1.00 16.64  ? 160 PHE A C     1 
ATOM 1966  O O     . PHE C 3 160 ? 27.230  128.545 -17.969 1.00 14.75  ? 160 PHE A O     1 
ATOM 1967  C CB    . PHE C 3 160 ? 26.814  130.280 -20.651 1.00 16.94  ? 160 PHE A CB    1 
ATOM 1968  C CG    . PHE C 3 160 ? 28.261  130.396 -20.367 1.00 15.53  ? 160 PHE A CG    1 
ATOM 1969  C CD1   . PHE C 3 160 ? 29.181  129.693 -21.133 1.00 17.43  ? 160 PHE A CD1   1 
ATOM 1970  C CD2   . PHE C 3 160 ? 28.707  131.083 -19.259 1.00 17.32  ? 160 PHE A CD2   1 
ATOM 1971  C CE1   . PHE C 3 160 ? 30.528  129.660 -20.788 1.00 16.97  ? 160 PHE A CE1   1 
ATOM 1972  C CE2   . PHE C 3 160 ? 30.052  131.056 -18.910 1.00 18.90  ? 160 PHE A CE2   1 
ATOM 1973  C CZ    . PHE C 3 160 ? 30.965  130.338 -19.680 1.00 16.86  ? 160 PHE A CZ    1 
ATOM 1974  N N     . GLN C 3 161 ? 25.418  129.892 -17.986 1.00 17.60  ? 161 GLN A N     1 
ATOM 1975  C CA    . GLN C 3 161 ? 25.431  130.063 -16.551 1.00 21.54  ? 161 GLN A CA    1 
ATOM 1976  C C     . GLN C 3 161 ? 25.363  128.723 -15.856 1.00 21.66  ? 161 GLN A C     1 
ATOM 1977  O O     . GLN C 3 161 ? 26.374  128.221 -15.354 1.00 22.70  ? 161 GLN A O     1 
ATOM 1978  C CB    . GLN C 3 161 ? 24.270  130.925 -16.092 1.00 23.90  ? 161 GLN A CB    1 
ATOM 1979  C CG    . GLN C 3 161 ? 24.500  132.393 -16.272 1.00 27.75  ? 161 GLN A CG    1 
ATOM 1980  C CD    . GLN C 3 161 ? 23.196  133.135 -16.386 1.00 30.61  ? 161 GLN A CD    1 
ATOM 1981  O OE1   . GLN C 3 161 ? 22.635  133.243 -17.482 1.00 29.55  ? 161 GLN A OE1   1 
ATOM 1982  N NE2   . GLN C 3 161 ? 22.679  133.626 -15.251 1.00 31.71  ? 161 GLN A NE2   1 
ATOM 1983  N N     . SER C 3 162 ? 24.182  128.122 -15.885 1.00 21.57  ? 162 SER A N     1 
ATOM 1984  C CA    . SER C 3 162 ? 23.961  126.838 -15.246 1.00 21.80  ? 162 SER A CA    1 
ATOM 1985  C C     . SER C 3 162 ? 25.194  125.937 -15.390 1.00 20.75  ? 162 SER A C     1 
ATOM 1986  O O     . SER C 3 162 ? 25.683  125.351 -14.415 1.00 19.56  ? 162 SER A O     1 
ATOM 1987  C CB    . SER C 3 162 ? 22.732  126.171 -15.851 1.00 21.76  ? 162 SER A CB    1 
ATOM 1988  O OG    . SER C 3 162 ? 21.995  125.519 -14.832 1.00 24.89  ? 162 SER A OG    1 
ATOM 1989  N N     . SER C 3 163 ? 25.757  125.934 -16.592 1.00 18.70  ? 163 SER A N     1 
ATOM 1990  C CA    . SER C 3 163 ? 26.932  125.141 -16.861 1.00 18.02  ? 163 SER A CA    1 
ATOM 1991  C C     . SER C 3 163 ? 28.081  125.608 -15.973 1.00 18.18  ? 163 SER A C     1 
ATOM 1992  O O     . SER C 3 163 ? 28.438  124.921 -15.018 1.00 17.49  ? 163 SER A O     1 
ATOM 1993  C CB    . SER C 3 163 ? 27.321  125.259 -18.332 1.00 18.39  ? 163 SER A CB    1 
ATOM 1994  O OG    . SER C 3 163 ? 26.278  124.829 -19.186 1.00 18.23  ? 163 SER A OG    1 
ATOM 1995  N N     . MET C 3 164 ? 28.605  126.802 -16.261 1.00 18.05  ? 164 MET A N     1 
ATOM 1996  C CA    . MET C 3 164 ? 29.731  127.420 -15.541 1.00 18.11  ? 164 MET A CA    1 
ATOM 1997  C C     . MET C 3 164 ? 29.753  127.141 -14.042 1.00 17.68  ? 164 MET A C     1 
ATOM 1998  O O     . MET C 3 164 ? 30.807  127.017 -13.426 1.00 15.43  ? 164 MET A O     1 
ATOM 1999  C CB    . MET C 3 164 ? 29.700  128.930 -15.767 1.00 19.70  ? 164 MET A CB    1 
ATOM 2000  C CG    . MET C 3 164 ? 31.009  129.533 -16.240 1.00 23.79  ? 164 MET A CG    1 
ATOM 2001  S SD    . MET C 3 164 ? 32.369  129.197 -15.150 1.00 27.76  ? 164 MET A SD    1 
ATOM 2002  C CE    . MET C 3 164 ? 31.943  130.350 -13.854 1.00 30.51  ? 164 MET A CE    1 
ATOM 2003  N N     . THR C 3 165 ? 28.560  127.038 -13.477 1.00 18.81  ? 165 THR A N     1 
ATOM 2004  C CA    . THR C 3 165 ? 28.356  126.765 -12.067 1.00 20.68  ? 165 THR A CA    1 
ATOM 2005  C C     . THR C 3 165 ? 28.898  125.380 -11.726 1.00 20.78  ? 165 THR A C     1 
ATOM 2006  O O     . THR C 3 165 ? 29.877  125.241 -10.986 1.00 20.37  ? 165 THR A O     1 
ATOM 2007  C CB    . THR C 3 165 ? 26.855  126.758 -11.753 1.00 21.98  ? 165 THR A CB    1 
ATOM 2008  O OG1   . THR C 3 165 ? 26.163  127.585 -12.699 1.00 22.27  ? 165 THR A OG1   1 
ATOM 2009  C CG2   . THR C 3 165 ? 26.601  127.271 -10.340 1.00 21.83  ? 165 THR A CG2   1 
ATOM 2010  N N     . LYS C 3 166 ? 28.254  124.363 -12.301 1.00 21.84  ? 166 LYS A N     1 
ATOM 2011  C CA    . LYS C 3 166 ? 28.621  122.961 -12.087 1.00 23.24  ? 166 LYS A CA    1 
ATOM 2012  C C     . LYS C 3 166 ? 30.125  122.798 -12.049 1.00 22.08  ? 166 LYS A C     1 
ATOM 2013  O O     . LYS C 3 166 ? 30.674  122.095 -11.204 1.00 22.37  ? 166 LYS A O     1 
ATOM 2014  C CB    . LYS C 3 166 ? 28.015  122.054 -13.179 1.00 25.24  ? 166 LYS A CB    1 
ATOM 2015  C CG    . LYS C 3 166 ? 26.524  121.739 -12.985 1.00 26.74  ? 166 LYS A CG    1 
ATOM 2016  C CD    . LYS C 3 166 ? 26.014  120.684 -13.952 1.00 29.80  ? 166 LYS A CD    1 
ATOM 2017  C CE    . LYS C 3 166 ? 25.821  121.248 -15.358 1.00 33.64  ? 166 LYS A CE    1 
ATOM 2018  N NZ    . LYS C 3 166 ? 25.482  120.202 -16.390 1.00 36.62  ? 166 LYS A NZ    1 
ATOM 2019  N N     . ILE C 3 167 ? 30.776  123.524 -12.938 1.00 20.08  ? 167 ILE A N     1 
ATOM 2020  C CA    . ILE C 3 167 ? 32.204  123.501 -13.049 1.00 19.61  ? 167 ILE A CA    1 
ATOM 2021  C C     . ILE C 3 167 ? 32.813  124.077 -11.796 1.00 18.38  ? 167 ILE A C     1 
ATOM 2022  O O     . ILE C 3 167 ? 33.611  123.440 -11.134 1.00 19.67  ? 167 ILE A O     1 
ATOM 2023  C CB    . ILE C 3 167 ? 32.627  124.339 -14.230 1.00 21.14  ? 167 ILE A CB    1 
ATOM 2024  C CG1   . ILE C 3 167 ? 32.288  123.606 -15.528 1.00 24.62  ? 167 ILE A CG1   1 
ATOM 2025  C CG2   . ILE C 3 167 ? 34.101  124.669 -14.141 1.00 22.31  ? 167 ILE A CG2   1 
ATOM 2026  C CD1   . ILE C 3 167 ? 30.801  123.335 -15.760 1.00 23.76  ? 167 ILE A CD1   1 
ATOM 2027  N N     . LEU C 3 168 ? 32.412  125.284 -11.458 1.00 16.56  ? 168 LEU A N     1 
ATOM 2028  C CA    . LEU C 3 168 ? 32.954  125.934 -10.292 1.00 15.60  ? 168 LEU A CA    1 
ATOM 2029  C C     . LEU C 3 168 ? 32.704  125.175 -9.006  1.00 17.42  ? 168 LEU A C     1 
ATOM 2030  O O     . LEU C 3 168 ? 33.593  125.073 -8.169  1.00 17.52  ? 168 LEU A O     1 
ATOM 2031  C CB    . LEU C 3 168 ? 32.381  127.340 -10.187 1.00 13.10  ? 168 LEU A CB    1 
ATOM 2032  C CG    . LEU C 3 168 ? 33.057  128.358 -11.094 1.00 11.75  ? 168 LEU A CG    1 
ATOM 2033  C CD1   . LEU C 3 168 ? 34.332  128.772 -10.454 1.00 11.77  ? 168 LEU A CD1   1 
ATOM 2034  C CD2   . LEU C 3 168 ? 33.349  127.780 -12.440 1.00 12.75  ? 168 LEU A CD2   1 
ATOM 2035  N N     . GLU C 3 169 ? 31.539  124.553 -8.899  1.00 20.26  ? 169 GLU A N     1 
ATOM 2036  C CA    . GLU C 3 169 ? 31.157  123.849 -7.679  1.00 24.82  ? 169 GLU A CA    1 
ATOM 2037  C C     . GLU C 3 169 ? 32.173  123.002 -6.890  1.00 24.57  ? 169 GLU A C     1 
ATOM 2038  O O     . GLU C 3 169 ? 32.540  123.355 -5.766  1.00 24.64  ? 169 GLU A O     1 
ATOM 2039  C CB    . GLU C 3 169 ? 29.866  123.057 -7.905  1.00 29.55  ? 169 GLU A CB    1 
ATOM 2040  C CG    . GLU C 3 169 ? 29.325  122.320 -6.654  1.00 37.60  ? 169 GLU A CG    1 
ATOM 2041  C CD    . GLU C 3 169 ? 28.824  123.251 -5.533  1.00 42.26  ? 169 GLU A CD    1 
ATOM 2042  O OE1   . GLU C 3 169 ? 27.811  123.980 -5.729  1.00 43.75  ? 169 GLU A OE1   1 
ATOM 2043  O OE2   . GLU C 3 169 ? 29.443  123.228 -4.442  1.00 45.22  ? 169 GLU A OE2   1 
ATOM 2044  N N     . PRO C 3 170 ? 32.665  121.900 -7.472  1.00 24.15  ? 170 PRO A N     1 
ATOM 2045  C CA    . PRO C 3 170 ? 33.627  121.054 -6.755  1.00 24.14  ? 170 PRO A CA    1 
ATOM 2046  C C     . PRO C 3 170 ? 34.824  121.833 -6.243  1.00 23.75  ? 170 PRO A C     1 
ATOM 2047  O O     . PRO C 3 170 ? 35.224  121.677 -5.096  1.00 22.54  ? 170 PRO A O     1 
ATOM 2048  C CB    . PRO C 3 170 ? 34.029  120.034 -7.810  1.00 24.54  ? 170 PRO A CB    1 
ATOM 2049  C CG    . PRO C 3 170 ? 33.957  120.841 -9.084  1.00 24.29  ? 170 PRO A CG    1 
ATOM 2050  C CD    . PRO C 3 170 ? 32.646  121.566 -8.906  1.00 24.07  ? 170 PRO A CD    1 
ATOM 2051  N N     . PHE C 3 171 ? 35.363  122.697 -7.093  1.00 24.49  ? 171 PHE A N     1 
ATOM 2052  C CA    . PHE C 3 171 ? 36.500  123.519 -6.731  1.00 27.18  ? 171 PHE A CA    1 
ATOM 2053  C C     . PHE C 3 171 ? 36.104  124.260 -5.479  1.00 28.92  ? 171 PHE A C     1 
ATOM 2054  O O     . PHE C 3 171 ? 36.882  124.365 -4.540  1.00 27.63  ? 171 PHE A O     1 
ATOM 2055  C CB    . PHE C 3 171 ? 36.801  124.503 -7.852  1.00 28.49  ? 171 PHE A CB    1 
ATOM 2056  C CG    . PHE C 3 171 ? 37.980  125.389 -7.584  1.00 31.34  ? 171 PHE A CG    1 
ATOM 2057  C CD1   . PHE C 3 171 ? 39.236  124.850 -7.372  1.00 32.06  ? 171 PHE A CD1   1 
ATOM 2058  C CD2   . PHE C 3 171 ? 37.833  126.770 -7.555  1.00 33.54  ? 171 PHE A CD2   1 
ATOM 2059  C CE1   . PHE C 3 171 ? 40.328  125.670 -7.137  1.00 33.62  ? 171 PHE A CE1   1 
ATOM 2060  C CE2   . PHE C 3 171 ? 38.924  127.604 -7.320  1.00 34.55  ? 171 PHE A CE2   1 
ATOM 2061  C CZ    . PHE C 3 171 ? 40.172  127.052 -7.110  1.00 34.50  ? 171 PHE A CZ    1 
ATOM 2062  N N     . LYS C 3 172 ? 34.860  124.721 -5.458  1.00 32.01  ? 172 LYS A N     1 
ATOM 2063  C CA    . LYS C 3 172 ? 34.329  125.429 -4.304  1.00 36.28  ? 172 LYS A CA    1 
ATOM 2064  C C     . LYS C 3 172 ? 34.346  124.469 -3.117  1.00 37.16  ? 172 LYS A C     1 
ATOM 2065  O O     . LYS C 3 172 ? 34.721  124.847 -2.006  1.00 36.95  ? 172 LYS A O     1 
ATOM 2066  C CB    . LYS C 3 172 ? 32.904  125.903 -4.587  1.00 38.62  ? 172 LYS A CB    1 
ATOM 2067  C CG    . LYS C 3 172 ? 32.782  126.779 -5.838  1.00 43.24  ? 172 LYS A CG    1 
ATOM 2068  C CD    . LYS C 3 172 ? 31.321  127.173 -6.169  1.00 45.72  ? 172 LYS A CD    1 
ATOM 2069  C CE    . LYS C 3 172 ? 30.778  128.341 -5.313  1.00 45.41  ? 172 LYS A CE    1 
ATOM 2070  N NZ    . LYS C 3 172 ? 30.603  128.027 -3.857  1.00 46.59  ? 172 LYS A NZ    1 
ATOM 2071  N N     . LYS C 3 173 ? 33.969  123.219 -3.371  1.00 37.20  ? 173 LYS A N     1 
ATOM 2072  C CA    . LYS C 3 173 ? 33.975  122.199 -2.335  1.00 38.58  ? 173 LYS A CA    1 
ATOM 2073  C C     . LYS C 3 173 ? 35.398  121.988 -1.852  1.00 39.18  ? 173 LYS A C     1 
ATOM 2074  O O     . LYS C 3 173 ? 35.626  121.617 -0.706  1.00 39.30  ? 173 LYS A O     1 
ATOM 2075  C CB    . LYS C 3 173 ? 33.475  120.871 -2.892  1.00 38.83  ? 173 LYS A CB    1 
ATOM 2076  C CG    . LYS C 3 173 ? 31.983  120.809 -3.146  1.00 43.03  ? 173 LYS A CG    1 
ATOM 2077  C CD    . LYS C 3 173 ? 31.203  120.505 -1.863  1.00 44.70  ? 173 LYS A CD    1 
ATOM 2078  C CE    . LYS C 3 173 ? 29.700  120.244 -2.123  1.00 45.62  ? 173 LYS A CE    1 
ATOM 2079  N NZ    . LYS C 3 173 ? 28.840  121.468 -2.262  1.00 45.77  ? 173 LYS A NZ    1 
ATOM 2080  N N     . GLN C 3 174 ? 36.356  122.265 -2.724  1.00 40.14  ? 174 GLN A N     1 
ATOM 2081  C CA    . GLN C 3 174 ? 37.753  122.048 -2.393  1.00 42.80  ? 174 GLN A CA    1 
ATOM 2082  C C     . GLN C 3 174 ? 38.459  123.160 -1.648  1.00 41.60  ? 174 GLN A C     1 
ATOM 2083  O O     . GLN C 3 174 ? 39.451  122.916 -0.965  1.00 41.46  ? 174 GLN A O     1 
ATOM 2084  C CB    . GLN C 3 174 ? 38.542  121.694 -3.657  1.00 47.83  ? 174 GLN A CB    1 
ATOM 2085  C CG    . GLN C 3 174 ? 37.964  120.512 -4.476  1.00 55.56  ? 174 GLN A CG    1 
ATOM 2086  C CD    . GLN C 3 174 ? 37.918  119.176 -3.709  1.00 58.87  ? 174 GLN A CD    1 
ATOM 2087  O OE1   . GLN C 3 174 ? 36.858  118.755 -3.212  1.00 61.69  ? 174 GLN A OE1   1 
ATOM 2088  N NE2   . GLN C 3 174 ? 39.066  118.498 -3.634  1.00 58.57  ? 174 GLN A NE2   1 
ATOM 2089  N N     . ASN C 3 175 ? 37.982  124.386 -1.790  1.00 41.36  ? 175 ASN A N     1 
ATOM 2090  C CA    . ASN C 3 175 ? 38.645  125.493 -1.111  1.00 41.23  ? 175 ASN A CA    1 
ATOM 2091  C C     . ASN C 3 175 ? 37.663  126.483 -0.501  1.00 41.74  ? 175 ASN A C     1 
ATOM 2092  O O     . ASN C 3 175 ? 37.418  127.559 -1.044  1.00 42.16  ? 175 ASN A O     1 
ATOM 2093  C CB    . ASN C 3 175 ? 39.643  126.197 -2.049  1.00 39.96  ? 175 ASN A CB    1 
ATOM 2094  C CG    . ASN C 3 175 ? 39.567  125.688 -3.492  1.00 39.82  ? 175 ASN A CG    1 
ATOM 2095  O OD1   . ASN C 3 175 ? 38.667  126.055 -4.251  1.00 38.93  ? 175 ASN A OD1   1 
ATOM 2096  N ND2   . ASN C 3 175 ? 40.508  124.828 -3.865  1.00 38.56  ? 175 ASN A ND2   1 
ATOM 2097  N N     . PRO C 3 176 ? 37.095  126.123 0.658   1.00 42.51  ? 176 PRO A N     1 
ATOM 2098  C CA    . PRO C 3 176 ? 36.131  126.937 1.400   1.00 42.88  ? 176 PRO A CA    1 
ATOM 2099  C C     . PRO C 3 176 ? 36.852  128.035 2.171   1.00 43.57  ? 176 PRO A C     1 
ATOM 2100  O O     . PRO C 3 176 ? 36.947  127.998 3.402   1.00 44.42  ? 176 PRO A O     1 
ATOM 2101  C CB    . PRO C 3 176 ? 35.505  125.921 2.346   1.00 42.83  ? 176 PRO A CB    1 
ATOM 2102  C CG    . PRO C 3 176 ? 36.681  125.070 2.704   1.00 42.99  ? 176 PRO A CG    1 
ATOM 2103  C CD    . PRO C 3 176 ? 37.349  124.849 1.357   1.00 43.01  ? 176 PRO A CD    1 
ATOM 2104  N N     . ASP C 3 177 ? 37.458  128.942 1.419   1.00 43.65  ? 177 ASP A N     1 
ATOM 2105  C CA    . ASP C 3 177 ? 38.187  130.081 1.964   1.00 44.08  ? 177 ASP A CA    1 
ATOM 2106  C C     . ASP C 3 177 ? 38.315  131.069 0.817   1.00 41.96  ? 177 ASP A C     1 
ATOM 2107  O O     . ASP C 3 177 ? 38.171  132.279 0.979   1.00 42.27  ? 177 ASP A O     1 
ATOM 2108  C CB    . ASP C 3 177 ? 39.552  129.677 2.579   1.00 47.25  ? 177 ASP A CB    1 
ATOM 2109  C CG    . ASP C 3 177 ? 40.264  128.532 1.831   1.00 51.43  ? 177 ASP A CG    1 
ATOM 2110  O OD1   . ASP C 3 177 ? 39.651  127.476 1.559   1.00 52.65  ? 177 ASP A OD1   1 
ATOM 2111  O OD2   . ASP C 3 177 ? 41.482  128.665 1.571   1.00 53.42  ? 177 ASP A OD2   1 
ATOM 2112  N N     . ILE C 3 178 ? 38.514  130.527 -0.370  1.00 39.58  ? 178 ILE A N     1 
ATOM 2113  C CA    . ILE C 3 178 ? 38.583  131.350 -1.542  1.00 38.22  ? 178 ILE A CA    1 
ATOM 2114  C C     . ILE C 3 178 ? 37.147  131.705 -1.765  1.00 37.45  ? 178 ILE A C     1 
ATOM 2115  O O     . ILE C 3 178 ? 36.253  130.957 -1.388  1.00 37.46  ? 178 ILE A O     1 
ATOM 2116  C CB    . ILE C 3 178 ? 39.048  130.566 -2.739  1.00 38.45  ? 178 ILE A CB    1 
ATOM 2117  C CG1   . ILE C 3 178 ? 40.531  130.248 -2.593  1.00 39.84  ? 178 ILE A CG1   1 
ATOM 2118  C CG2   . ILE C 3 178 ? 38.774  131.344 -4.015  1.00 39.81  ? 178 ILE A CG2   1 
ATOM 2119  C CD1   . ILE C 3 178 ? 40.862  129.328 -1.446  1.00 39.09  ? 178 ILE A CD1   1 
ATOM 2120  N N     . VAL C 3 179 ? 36.920  132.855 -2.364  1.00 38.49  ? 179 VAL A N     1 
ATOM 2121  C CA    . VAL C 3 179 ? 35.571  133.295 -2.631  1.00 39.97  ? 179 VAL A CA    1 
ATOM 2122  C C     . VAL C 3 179 ? 35.440  133.571 -4.106  1.00 39.22  ? 179 VAL A C     1 
ATOM 2123  O O     . VAL C 3 179 ? 36.405  134.005 -4.743  1.00 39.48  ? 179 VAL A O     1 
ATOM 2124  C CB    . VAL C 3 179 ? 35.242  134.567 -1.869  1.00 41.18  ? 179 VAL A CB    1 
ATOM 2125  C CG1   . VAL C 3 179 ? 33.737  134.851 -1.978  1.00 39.69  ? 179 VAL A CG1   1 
ATOM 2126  C CG2   . VAL C 3 179 ? 35.706  134.440 -0.406  1.00 43.11  ? 179 VAL A CG2   1 
ATOM 2127  N N     . ILE C 3 180 ? 34.261  133.283 -4.654  1.00 38.24  ? 180 ILE A N     1 
ATOM 2128  C CA    . ILE C 3 180 ? 34.023  133.505 -6.068  1.00 37.73  ? 180 ILE A CA    1 
ATOM 2129  C C     . ILE C 3 180 ? 32.598  133.893 -6.413  1.00 37.66  ? 180 ILE A C     1 
ATOM 2130  O O     . ILE C 3 180 ? 31.670  133.090 -6.302  1.00 37.92  ? 180 ILE A O     1 
ATOM 2131  C CB    . ILE C 3 180 ? 34.374  132.276 -6.921  1.00 37.40  ? 180 ILE A CB    1 
ATOM 2132  C CG1   . ILE C 3 180 ? 35.748  131.731 -6.552  1.00 36.74  ? 180 ILE A CG1   1 
ATOM 2133  C CG2   . ILE C 3 180 ? 34.395  132.676 -8.376  1.00 35.92  ? 180 ILE A CG2   1 
ATOM 2134  C CD1   . ILE C 3 180 ? 36.126  130.485 -7.288  1.00 37.75  ? 180 ILE A CD1   1 
ATOM 2135  N N     . TYR C 3 181 ? 32.442  135.133 -6.855  1.00 38.05  ? 181 TYR A N     1 
ATOM 2136  C CA    . TYR C 3 181 ? 31.146  135.631 -7.266  1.00 38.34  ? 181 TYR A CA    1 
ATOM 2137  C C     . TYR C 3 181 ? 31.065  135.480 -8.769  1.00 37.68  ? 181 TYR A C     1 
ATOM 2138  O O     . TYR C 3 181 ? 31.603  136.282 -9.534  1.00 37.25  ? 181 TYR A O     1 
ATOM 2139  C CB    . TYR C 3 181 ? 30.961  137.092 -6.865  1.00 41.04  ? 181 TYR A CB    1 
ATOM 2140  C CG    . TYR C 3 181 ? 30.521  137.293 -5.434  1.00 41.41  ? 181 TYR A CG    1 
ATOM 2141  C CD1   . TYR C 3 181 ? 29.675  138.342 -5.094  1.00 42.10  ? 181 TYR A CD1   1 
ATOM 2142  C CD2   . TYR C 3 181 ? 30.923  136.420 -4.426  1.00 42.69  ? 181 TYR A CD2   1 
ATOM 2143  C CE1   . TYR C 3 181 ? 29.234  138.517 -3.794  1.00 45.06  ? 181 TYR A CE1   1 
ATOM 2144  C CE2   . TYR C 3 181 ? 30.485  136.587 -3.114  1.00 44.41  ? 181 TYR A CE2   1 
ATOM 2145  C CZ    . TYR C 3 181 ? 29.637  137.637 -2.808  1.00 45.75  ? 181 TYR A CZ    1 
ATOM 2146  O OH    . TYR C 3 181 ? 29.162  137.793 -1.529  1.00 46.99  ? 181 TYR A OH    1 
ATOM 2147  N N     . GLN C 3 182 ? 30.458  134.388 -9.188  1.00 37.70  ? 182 GLN A N     1 
ATOM 2148  C CA    . GLN C 3 182 ? 30.310  134.128 -10.600 1.00 39.50  ? 182 GLN A CA    1 
ATOM 2149  C C     . GLN C 3 182 ? 29.217  135.005 -11.240 1.00 38.52  ? 182 GLN A C     1 
ATOM 2150  O O     . GLN C 3 182 ? 28.113  135.165 -10.677 1.00 39.07  ? 182 GLN A O     1 
ATOM 2151  C CB    . GLN C 3 182 ? 30.031  132.643 -10.813 1.00 43.59  ? 182 GLN A CB    1 
ATOM 2152  C CG    . GLN C 3 182 ? 28.990  132.091 -9.843  1.00 49.99  ? 182 GLN A CG    1 
ATOM 2153  C CD    . GLN C 3 182 ? 28.810  130.576 -9.923  1.00 53.52  ? 182 GLN A CD    1 
ATOM 2154  O OE1   . GLN C 3 182 ? 29.312  129.833 -9.065  1.00 55.98  ? 182 GLN A OE1   1 
ATOM 2155  N NE2   . GLN C 3 182 ? 28.069  130.113 -10.937 1.00 54.46  ? 182 GLN A NE2   1 
ATOM 2156  N N     . TYR C 3 183 ? 29.557  135.664 -12.432 1.00 31.11  ? 183 TYR A N     1 
ATOM 2157  C CA    . TYR C 3 183 ? 28.647  136.514 -13.168 1.00 28.14  ? 183 TYR A CA    1 
ATOM 2158  C C     . TYR C 3 183 ? 28.767  136.228 -14.625 1.00 26.49  ? 183 TYR A C     1 
ATOM 2159  O O     . TYR C 3 183 ? 29.626  136.850 -15.257 1.00 27.45  ? 183 TYR A O     1 
ATOM 2160  C CB    . TYR C 3 183 ? 28.852  137.992 -12.864 1.00 32.81  ? 183 TYR A CB    1 
ATOM 2161  C CG    . TYR C 3 183 ? 27.733  138.838 -13.494 1.00 34.53  ? 183 TYR A CG    1 
ATOM 2162  C CD1   . TYR C 3 183 ? 26.420  138.590 -13.166 1.00 36.62  ? 183 TYR A CD1   1 
ATOM 2163  C CD2   . TYR C 3 183 ? 28.022  139.833 -14.401 1.00 36.04  ? 183 TYR A CD2   1 
ATOM 2164  C CE1   . TYR C 3 183 ? 25.402  139.339 -13.745 1.00 39.28  ? 183 TYR A CE1   1 
ATOM 2165  C CE2   . TYR C 3 183 ? 26.983  140.574 -14.968 1.00 38.44  ? 183 TYR A CE2   1 
ATOM 2166  C CZ    . TYR C 3 183 ? 25.705  140.326 -14.641 1.00 39.04  ? 183 TYR A CZ    1 
ATOM 2167  O OH    . TYR C 3 183 ? 24.698  141.093 -15.212 1.00 43.64  ? 183 TYR A OH    1 
ATOM 2168  N N     . ILE C 3 184 ? 27.863  135.342 -15.088 1.00 31.34  ? 184 ILE A N     1 
ATOM 2169  C CA    . ILE C 3 184 ? 27.887  135.004 -16.498 1.00 32.06  ? 184 ILE A CA    1 
ATOM 2170  C C     . ILE C 3 184 ? 29.284  134.482 -16.889 1.00 33.72  ? 184 ILE A C     1 
ATOM 2171  O O     . ILE C 3 184 ? 29.581  133.307 -16.660 1.00 33.87  ? 184 ILE A O     1 
ATOM 2172  C CB    . ILE C 3 184 ? 27.520  136.213 -17.389 1.00 31.27  ? 184 ILE A CB    1 
ATOM 2173  C CG1   . ILE C 3 184 ? 26.242  136.875 -16.878 1.00 30.91  ? 184 ILE A CG1   1 
ATOM 2174  C CG2   . ILE C 3 184 ? 27.348  135.769 -18.851 1.00 29.83  ? 184 ILE A CG2   1 
ATOM 2175  C CD1   . ILE C 3 184 ? 25.766  138.050 -17.707 1.00 31.95  ? 184 ILE A CD1   1 
ATOM 2176  N N     . ASP C 3 185 ? 30.168  135.334 -17.552 1.00 31.44  ? 185 ASP A N     1 
ATOM 2177  C CA    . ASP C 3 185 ? 31.492  134.890 -17.933 1.00 35.03  ? 185 ASP A CA    1 
ATOM 2178  C C     . ASP C 3 185 ? 32.566  135.638 -17.119 1.00 36.43  ? 185 ASP A C     1 
ATOM 2179  O O     . ASP C 3 185 ? 33.587  135.961 -17.617 1.00 36.65  ? 185 ASP A O     1 
ATOM 2180  C CB    . ASP C 3 185 ? 31.713  135.045 -19.454 1.00 42.37  ? 185 ASP A CB    1 
ATOM 2181  C CG    . ASP C 3 185 ? 31.850  136.507 -19.943 1.00 47.79  ? 185 ASP A CG    1 
ATOM 2182  O OD1   . ASP C 3 185 ? 31.930  137.396 -19.143 1.00 50.46  ? 185 ASP A OD1   1 
ATOM 2183  O OD2   . ASP C 3 185 ? 31.892  136.669 -21.091 1.00 50.96  ? 185 ASP A OD2   1 
ATOM 2184  N N     . ASP C 3 186 ? 32.293  135.850 -15.813 1.00 41.60  ? 186 ASP A N     1 
ATOM 2185  C CA    . ASP C 3 186 ? 33.237  136.625 -15.040 1.00 45.31  ? 186 ASP A CA    1 
ATOM 2186  C C     . ASP C 3 186 ? 33.383  136.197 -13.587 1.00 46.50  ? 186 ASP A C     1 
ATOM 2187  O O     . ASP C 3 186 ? 32.411  136.231 -12.829 1.00 46.68  ? 186 ASP A O     1 
ATOM 2188  C CB    . ASP C 3 186 ? 32.817  138.083 -15.115 1.00 48.28  ? 186 ASP A CB    1 
ATOM 2189  C CG    . ASP C 3 186 ? 33.972  139.014 -14.935 1.00 51.46  ? 186 ASP A CG    1 
ATOM 2190  O OD1   . ASP C 3 186 ? 34.523  139.045 -13.802 1.00 53.46  ? 186 ASP A OD1   1 
ATOM 2191  O OD2   . ASP C 3 186 ? 34.320  139.703 -15.925 1.00 52.28  ? 186 ASP A OD2   1 
ATOM 2192  N N     . LEU C 3 187 ? 34.619  135.909 -13.178 1.00 46.64  ? 187 LEU A N     1 
ATOM 2193  C CA    . LEU C 3 187 ? 34.883  135.449 -11.819 1.00 46.80  ? 187 LEU A CA    1 
ATOM 2194  C C     . LEU C 3 187 ? 35.723  136.326 -10.889 1.00 47.11  ? 187 LEU A C     1 
ATOM 2195  O O     . LEU C 3 187 ? 36.940  136.424 -11.053 1.00 47.22  ? 187 LEU A O     1 
ATOM 2196  C CB    . LEU C 3 187 ? 35.476  134.034 -11.857 1.00 45.02  ? 187 LEU A CB    1 
ATOM 2197  C CG    . LEU C 3 187 ? 34.581  132.902 -12.379 1.00 44.27  ? 187 LEU A CG    1 
ATOM 2198  C CD1   . LEU C 3 187 ? 35.370  131.610 -12.428 1.00 42.51  ? 187 LEU A CD1   1 
ATOM 2199  C CD2   . LEU C 3 187 ? 33.340  132.717 -11.502 1.00 42.02  ? 187 LEU A CD2   1 
ATOM 2200  N N     . TYR C 3 188 ? 35.059  136.952 -9.912  1.00 47.55  ? 188 TYR A N     1 
ATOM 2201  C CA    . TYR C 3 188 ? 35.728  137.778 -8.903  1.00 47.88  ? 188 TYR A CA    1 
ATOM 2202  C C     . TYR C 3 188 ? 36.169  136.743 -7.901  1.00 48.09  ? 188 TYR A C     1 
ATOM 2203  O O     . TYR C 3 188 ? 35.333  136.001 -7.379  1.00 47.29  ? 188 TYR A O     1 
ATOM 2204  C CB    . TYR C 3 188 ? 34.733  138.736 -8.223  1.00 48.65  ? 188 TYR A CB    1 
ATOM 2205  C CG    . TYR C 3 188 ? 35.243  139.472 -6.973  1.00 48.41  ? 188 TYR A CG    1 
ATOM 2206  C CD1   . TYR C 3 188 ? 35.674  138.771 -5.828  1.00 48.13  ? 188 TYR A CD1   1 
ATOM 2207  C CD2   . TYR C 3 188 ? 35.242  140.871 -6.914  1.00 48.65  ? 188 TYR A CD2   1 
ATOM 2208  C CE1   . TYR C 3 188 ? 36.087  139.443 -4.660  1.00 47.69  ? 188 TYR A CE1   1 
ATOM 2209  C CE2   . TYR C 3 188 ? 35.652  141.550 -5.750  1.00 48.35  ? 188 TYR A CE2   1 
ATOM 2210  C CZ    . TYR C 3 188 ? 36.070  140.832 -4.625  1.00 48.04  ? 188 TYR A CZ    1 
ATOM 2211  O OH    . TYR C 3 188 ? 36.448  141.505 -3.471  1.00 46.76  ? 188 TYR A OH    1 
ATOM 2212  N N     . VAL C 3 189 ? 37.471  136.688 -7.633  1.00 49.47  ? 189 VAL A N     1 
ATOM 2213  C CA    . VAL C 3 189 ? 37.994  135.715 -6.682  1.00 50.26  ? 189 VAL A CA    1 
ATOM 2214  C C     . VAL C 3 189 ? 38.746  136.351 -5.537  1.00 51.34  ? 189 VAL A C     1 
ATOM 2215  O O     . VAL C 3 189 ? 39.577  137.228 -5.756  1.00 51.82  ? 189 VAL A O     1 
ATOM 2216  C CB    . VAL C 3 189 ? 38.926  134.717 -7.340  1.00 49.26  ? 189 VAL A CB    1 
ATOM 2217  C CG1   . VAL C 3 189 ? 39.277  133.634 -6.342  1.00 49.35  ? 189 VAL A CG1   1 
ATOM 2218  C CG2   . VAL C 3 189 ? 38.268  134.127 -8.579  1.00 48.98  ? 189 VAL A CG2   1 
ATOM 2219  N N     . GLY C 3 190 ? 38.491  135.858 -4.327  1.00 51.75  ? 190 GLY A N     1 
ATOM 2220  C CA    . GLY C 3 190 ? 39.153  136.401 -3.161  1.00 52.60  ? 190 GLY A CA    1 
ATOM 2221  C C     . GLY C 3 190 ? 39.260  135.435 -2.007  1.00 53.08  ? 190 GLY A C     1 
ATOM 2222  O O     . GLY C 3 190 ? 38.559  134.439 -1.935  1.00 52.80  ? 190 GLY A O     1 
ATOM 2223  N N     . SER C 3 191 ? 40.166  135.749 -1.096  1.00 54.56  ? 191 SER A N     1 
ATOM 2224  C CA    . SER C 3 191 ? 40.396  134.943 0.086   1.00 56.80  ? 191 SER A CA    1 
ATOM 2225  C C     . SER C 3 191 ? 41.501  135.636 0.851   1.00 59.21  ? 191 SER A C     1 
ATOM 2226  O O     . SER C 3 191 ? 42.344  136.323 0.256   1.00 59.33  ? 191 SER A O     1 
ATOM 2227  C CB    . SER C 3 191 ? 40.841  133.536 -0.298  1.00 55.63  ? 191 SER A CB    1 
ATOM 2228  O OG    . SER C 3 191 ? 42.003  133.585 -1.100  1.00 54.28  ? 191 SER A OG    1 
ATOM 2229  N N     . ASP C 3 192 ? 41.477  135.484 2.172   1.00 61.68  ? 192 ASP A N     1 
ATOM 2230  C CA    . ASP C 3 192 ? 42.488  136.092 3.036   1.00 64.87  ? 192 ASP A CA    1 
ATOM 2231  C C     . ASP C 3 192 ? 43.806  135.298 3.019   1.00 65.61  ? 192 ASP A C     1 
ATOM 2232  O O     . ASP C 3 192 ? 44.358  134.976 4.076   1.00 66.06  ? 192 ASP A O     1 
ATOM 2233  C CB    . ASP C 3 192 ? 41.963  136.216 4.479   1.00 67.66  ? 192 ASP A CB    1 
ATOM 2234  C CG    . ASP C 3 192 ? 40.924  137.325 4.645   1.00 70.05  ? 192 ASP A CG    1 
ATOM 2235  O OD1   . ASP C 3 192 ? 39.850  137.050 5.233   1.00 72.08  ? 192 ASP A OD1   1 
ATOM 2236  O OD2   . ASP C 3 192 ? 41.192  138.473 4.212   1.00 70.66  ? 192 ASP A OD2   1 
ATOM 2237  N N     . LEU C 3 193 ? 44.310  134.994 1.822   1.00 65.18  ? 193 LEU A N     1 
ATOM 2238  C CA    . LEU C 3 193 ? 45.553  134.236 1.677   1.00 64.26  ? 193 LEU A CA    1 
ATOM 2239  C C     . LEU C 3 193 ? 46.748  135.067 1.238   1.00 63.92  ? 193 LEU A C     1 
ATOM 2240  O O     . LEU C 3 193 ? 46.662  135.806 0.252   1.00 63.74  ? 193 LEU A O     1 
ATOM 2241  C CB    . LEU C 3 193 ? 45.369  133.084 0.690   1.00 63.38  ? 193 LEU A CB    1 
ATOM 2242  C CG    . LEU C 3 193 ? 44.592  131.872 1.194   1.00 62.84  ? 193 LEU A CG    1 
ATOM 2243  C CD1   . LEU C 3 193 ? 44.648  130.787 0.134   1.00 62.82  ? 193 LEU A CD1   1 
ATOM 2244  C CD2   . LEU C 3 193 ? 45.193  131.368 2.507   1.00 62.13  ? 193 LEU A CD2   1 
ATOM 2245  N N     . GLU C 3 194 ? 47.868  134.903 1.949   1.00 63.52  ? 194 GLU A N     1 
ATOM 2246  C CA    . GLU C 3 194 ? 49.105  135.618 1.636   1.00 63.39  ? 194 GLU A CA    1 
ATOM 2247  C C     . GLU C 3 194 ? 49.272  135.581 0.134   1.00 61.41  ? 194 GLU A C     1 
ATOM 2248  O O     . GLU C 3 194 ? 49.262  134.514 -0.472  1.00 60.24  ? 194 GLU A O     1 
ATOM 2249  C CB    . GLU C 3 194 ? 50.314  134.973 2.331   1.00 66.38  ? 194 GLU A CB    1 
ATOM 2250  C CG    . GLU C 3 194 ? 50.244  135.017 3.874   1.00 69.59  ? 194 GLU A CG    1 
ATOM 2251  C CD    . GLU C 3 194 ? 51.615  134.910 4.565   1.00 71.36  ? 194 GLU A CD    1 
ATOM 2252  O OE1   . GLU C 3 194 ? 52.523  135.699 4.212   1.00 72.17  ? 194 GLU A OE1   1 
ATOM 2253  O OE2   . GLU C 3 194 ? 51.776  134.057 5.477   1.00 71.23  ? 194 GLU A OE2   1 
ATOM 2254  N N     . ILE C 3 195 ? 49.286  136.773 -0.451  1.00 60.19  ? 195 ILE A N     1 
ATOM 2255  C CA    . ILE C 3 195 ? 49.390  136.976 -1.890  1.00 59.57  ? 195 ILE A CA    1 
ATOM 2256  C C     . ILE C 3 195 ? 50.021  135.835 -2.661  1.00 59.50  ? 195 ILE A C     1 
ATOM 2257  O O     . ILE C 3 195 ? 49.620  135.550 -3.787  1.00 59.35  ? 195 ILE A O     1 
ATOM 2258  C CB    . ILE C 3 195 ? 50.135  138.276 -2.212  1.00 59.81  ? 195 ILE A CB    1 
ATOM 2259  C CG1   . ILE C 3 195 ? 51.619  138.141 -1.868  1.00 60.45  ? 195 ILE A CG1   1 
ATOM 2260  C CG2   . ILE C 3 195 ? 49.520  139.433 -1.441  1.00 59.91  ? 195 ILE A CG2   1 
ATOM 2261  C CD1   . ILE C 3 195 ? 52.501  137.785 -3.064  1.00 61.81  ? 195 ILE A CD1   1 
ATOM 2262  N N     . GLY C 3 196 ? 51.026  135.205 -2.061  1.00 59.10  ? 196 GLY A N     1 
ATOM 2263  C CA    . GLY C 3 196 ? 51.680  134.092 -2.713  1.00 59.69  ? 196 GLY A CA    1 
ATOM 2264  C C     . GLY C 3 196 ? 50.738  132.910 -2.731  1.00 59.88  ? 196 GLY A C     1 
ATOM 2265  O O     . GLY C 3 196 ? 50.422  132.353 -3.787  1.00 59.38  ? 196 GLY A O     1 
ATOM 2266  N N     . GLN C 3 197 ? 50.255  132.549 -1.550  1.00 60.39  ? 197 GLN A N     1 
ATOM 2267  C CA    . GLN C 3 197 ? 49.342  131.431 -1.437  1.00 61.70  ? 197 GLN A CA    1 
ATOM 2268  C C     . GLN C 3 197 ? 48.141  131.675 -2.313  1.00 61.21  ? 197 GLN A C     1 
ATOM 2269  O O     . GLN C 3 197 ? 47.675  130.777 -3.016  1.00 60.00  ? 197 GLN A O     1 
ATOM 2270  C CB    . GLN C 3 197 ? 48.879  131.240 0.001   1.00 64.32  ? 197 GLN A CB    1 
ATOM 2271  C CG    . GLN C 3 197 ? 48.232  129.887 0.204   1.00 67.61  ? 197 GLN A CG    1 
ATOM 2272  C CD    . GLN C 3 197 ? 49.108  128.777 -0.346  1.00 70.04  ? 197 GLN A CD    1 
ATOM 2273  O OE1   . GLN C 3 197 ? 49.022  128.426 -1.530  1.00 70.04  ? 197 GLN A OE1   1 
ATOM 2274  N NE2   . GLN C 3 197 ? 49.999  128.256 0.496   1.00 72.16  ? 197 GLN A NE2   1 
ATOM 2275  N N     . HIS C 3 198 ? 47.653  132.908 -2.267  1.00 61.50  ? 198 HIS A N     1 
ATOM 2276  C CA    . HIS C 3 198 ? 46.506  133.303 -3.063  1.00 62.33  ? 198 HIS A CA    1 
ATOM 2277  C C     . HIS C 3 198 ? 46.802  132.953 -4.530  1.00 60.78  ? 198 HIS A C     1 
ATOM 2278  O O     . HIS C 3 198 ? 45.995  132.302 -5.197  1.00 61.47  ? 198 HIS A O     1 
ATOM 2279  C CB    . HIS C 3 198 ? 46.246  134.812 -2.892  1.00 64.36  ? 198 HIS A CB    1 
ATOM 2280  C CG    . HIS C 3 198 ? 44.859  135.246 -3.279  1.00 67.40  ? 198 HIS A CG    1 
ATOM 2281  N ND1   . HIS C 3 198 ? 44.529  135.649 -4.559  1.00 68.68  ? 198 HIS A ND1   1 
ATOM 2282  C CD2   . HIS C 3 198 ? 43.726  135.370 -2.545  1.00 68.63  ? 198 HIS A CD2   1 
ATOM 2283  C CE1   . HIS C 3 198 ? 43.255  136.001 -4.594  1.00 69.07  ? 198 HIS A CE1   1 
ATOM 2284  N NE2   . HIS C 3 198 ? 42.744  135.842 -3.386  1.00 69.22  ? 198 HIS A NE2   1 
ATOM 2285  N N     . ARG C 3 199 ? 48.012  133.277 -4.978  1.00 58.63  ? 199 ARG A N     1 
ATOM 2286  C CA    . ARG C 3 199 ? 48.430  133.034 -6.356  1.00 56.86  ? 199 ARG A CA    1 
ATOM 2287  C C     . ARG C 3 199 ? 48.289  131.587 -6.823  1.00 54.98  ? 199 ARG A C     1 
ATOM 2288  O O     . ARG C 3 199 ? 47.735  131.314 -7.891  1.00 53.81  ? 199 ARG A O     1 
ATOM 2289  C CB    . ARG C 3 199 ? 49.861  133.514 -6.551  1.00 58.64  ? 199 ARG A CB    1 
ATOM 2290  N N     . THR C 3 200 ? 48.795  130.663 -6.016  1.00 53.54  ? 200 THR A N     1 
ATOM 2291  C CA    . THR C 3 200 ? 48.733  129.242 -6.341  1.00 52.08  ? 200 THR A CA    1 
ATOM 2292  C C     . THR C 3 200 ? 47.295  128.752 -6.560  1.00 50.69  ? 200 THR A C     1 
ATOM 2293  O O     . THR C 3 200 ? 47.020  127.921 -7.426  1.00 50.43  ? 200 THR A O     1 
ATOM 2294  C CB    . THR C 3 200 ? 49.433  128.397 -5.238  1.00 52.34  ? 200 THR A CB    1 
ATOM 2295  O OG1   . THR C 3 200 ? 49.131  128.935 -3.944  1.00 50.74  ? 200 THR A OG1   1 
ATOM 2296  C CG2   . THR C 3 200 ? 50.942  128.407 -5.437  1.00 51.99  ? 200 THR A CG2   1 
ATOM 2297  N N     . LYS C 3 201 ? 46.373  129.308 -5.794  1.00 49.29  ? 201 LYS A N     1 
ATOM 2298  C CA    . LYS C 3 201 ? 44.987  128.924 -5.909  1.00 47.41  ? 201 LYS A CA    1 
ATOM 2299  C C     . LYS C 3 201 ? 44.364  129.362 -7.211  1.00 45.62  ? 201 LYS A C     1 
ATOM 2300  O O     . LYS C 3 201 ? 43.844  128.538 -7.950  1.00 43.82  ? 201 LYS A O     1 
ATOM 2301  C CB    . LYS C 3 201 ? 44.200  129.483 -4.738  1.00 49.37  ? 201 LYS A CB    1 
ATOM 2302  C CG    . LYS C 3 201 ? 44.410  128.696 -3.468  1.00 53.25  ? 201 LYS A CG    1 
ATOM 2303  C CD    . LYS C 3 201 ? 43.888  127.269 -3.640  1.00 56.83  ? 201 LYS A CD    1 
ATOM 2304  C CE    . LYS C 3 201 ? 43.839  126.517 -2.310  1.00 59.17  ? 201 LYS A CE    1 
ATOM 2305  N NZ    . LYS C 3 201 ? 43.092  125.224 -2.405  1.00 61.67  ? 201 LYS A NZ    1 
ATOM 2306  N N     . ILE C 3 202 ? 44.426  130.658 -7.496  1.00 44.22  ? 202 ILE A N     1 
ATOM 2307  C CA    . ILE C 3 202 ? 43.837  131.185 -8.714  1.00 43.51  ? 202 ILE A CA    1 
ATOM 2308  C C     . ILE C 3 202 ? 44.240  130.283 -9.855  1.00 44.05  ? 202 ILE A C     1 
ATOM 2309  O O     . ILE C 3 202 ? 43.396  129.760 -10.568 1.00 44.31  ? 202 ILE A O     1 
ATOM 2310  C CB    . ILE C 3 202 ? 44.340  132.594 -9.035  1.00 43.28  ? 202 ILE A CB    1 
ATOM 2311  C CG1   . ILE C 3 202 ? 44.102  133.540 -7.853  1.00 43.97  ? 202 ILE A CG1   1 
ATOM 2312  C CG2   . ILE C 3 202 ? 43.665  133.108 -10.306 1.00 42.00  ? 202 ILE A CG2   1 
ATOM 2313  C CD1   . ILE C 3 202 ? 42.705  134.109 -7.761  1.00 44.20  ? 202 ILE A CD1   1 
ATOM 2314  N N     . GLU C 3 203 ? 45.538  130.032 -9.947  1.00 45.06  ? 203 GLU A N     1 
ATOM 2315  C CA    . GLU C 3 203 ? 46.082  129.182 -10.993 1.00 46.71  ? 203 GLU A CA    1 
ATOM 2316  C C     . GLU C 3 203 ? 45.421  127.823 -10.923 1.00 47.32  ? 203 GLU A C     1 
ATOM 2317  O O     . GLU C 3 203 ? 44.954  127.291 -11.932 1.00 47.16  ? 203 GLU A O     1 
ATOM 2318  C CB    . GLU C 3 203 ? 47.576  129.041 -10.822 1.00 48.34  ? 203 GLU A CB    1 
ATOM 2319  N N     . GLU C 3 204 ? 45.382  127.275 -9.714  1.00 48.53  ? 204 GLU A N     1 
ATOM 2320  C CA    . GLU C 3 204 ? 44.765  125.982 -9.472  1.00 49.72  ? 204 GLU A CA    1 
ATOM 2321  C C     . GLU C 3 204 ? 43.412  126.039 -10.170 1.00 49.45  ? 204 GLU A C     1 
ATOM 2322  O O     . GLU C 3 204 ? 43.096  125.223 -11.045 1.00 48.83  ? 204 GLU A O     1 
ATOM 2323  C CB    . GLU C 3 204 ? 44.576  125.803 -7.967  1.00 51.11  ? 204 GLU A CB    1 
ATOM 2324  C CG    . GLU C 3 204 ? 43.883  124.529 -7.556  1.00 53.48  ? 204 GLU A CG    1 
ATOM 2325  C CD    . GLU C 3 204 ? 44.844  123.541 -6.952  1.00 55.75  ? 204 GLU A CD    1 
ATOM 2326  O OE1   . GLU C 3 204 ? 45.475  122.798 -7.738  1.00 57.80  ? 204 GLU A OE1   1 
ATOM 2327  O OE2   . GLU C 3 204 ? 44.981  123.523 -5.701  1.00 55.95  ? 204 GLU A OE2   1 
ATOM 2328  N N     . LEU C 3 205 ? 42.677  127.096 -9.854  1.00 48.72  ? 205 LEU A N     1 
ATOM 2329  C CA    . LEU C 3 205 ? 41.375  127.321 -10.432 1.00 48.58  ? 205 LEU A CA    1 
ATOM 2330  C C     . LEU C 3 205 ? 41.487  127.371 -11.949 1.00 49.58  ? 205 LEU A C     1 
ATOM 2331  O O     . LEU C 3 205 ? 40.905  126.546 -12.656 1.00 48.99  ? 205 LEU A O     1 
ATOM 2332  C CB    . LEU C 3 205 ? 40.818  128.637 -9.911  1.00 47.27  ? 205 LEU A CB    1 
ATOM 2333  C CG    . LEU C 3 205 ? 39.588  129.125 -10.651 1.00 46.44  ? 205 LEU A CG    1 
ATOM 2334  C CD1   . LEU C 3 205 ? 38.487  128.068 -10.599 1.00 45.88  ? 205 LEU A CD1   1 
ATOM 2335  C CD2   . LEU C 3 205 ? 39.152  130.427 -10.042 1.00 46.17  ? 205 LEU A CD2   1 
ATOM 2336  N N     . ARG C 3 206 ? 42.271  128.330 -12.430 1.00 51.21  ? 206 ARG A N     1 
ATOM 2337  C CA    . ARG C 3 206 ? 42.479  128.541 -13.858 1.00 53.49  ? 206 ARG A CA    1 
ATOM 2338  C C     . ARG C 3 206 ? 42.687  127.238 -14.595 1.00 54.07  ? 206 ARG A C     1 
ATOM 2339  O O     . ARG C 3 206 ? 42.085  127.004 -15.640 1.00 55.63  ? 206 ARG A O     1 
ATOM 2340  C CB    . ARG C 3 206 ? 43.688  129.450 -14.105 1.00 55.08  ? 206 ARG A CB    1 
ATOM 2341  C CG    . ARG C 3 206 ? 43.547  130.852 -13.544 1.00 56.19  ? 206 ARG A CG    1 
ATOM 2342  C CD    . ARG C 3 206 ? 44.649  131.767 -14.033 1.00 57.09  ? 206 ARG A CD    1 
ATOM 2343  N NE    . ARG C 3 206 ? 45.951  131.374 -13.505 1.00 59.63  ? 206 ARG A NE    1 
ATOM 2344  C CZ    . ARG C 3 206 ? 46.946  130.890 -14.245 1.00 60.69  ? 206 ARG A CZ    1 
ATOM 2345  N NH1   . ARG C 3 206 ? 46.788  130.729 -15.556 1.00 62.15  ? 206 ARG A NH1   1 
ATOM 2346  N NH2   . ARG C 3 206 ? 48.113  130.598 -13.678 1.00 59.18  ? 206 ARG A NH2   1 
ATOM 2347  N N     . GLN C 3 207 ? 43.507  126.375 -14.011 1.00 54.31  ? 207 GLN A N     1 
ATOM 2348  C CA    . GLN C 3 207 ? 43.825  125.091 -14.608 1.00 55.25  ? 207 GLN A CA    1 
ATOM 2349  C C     . GLN C 3 207 ? 42.577  124.237 -14.726 1.00 54.43  ? 207 GLN A C     1 
ATOM 2350  O O     . GLN C 3 207 ? 42.293  123.670 -15.781 1.00 53.11  ? 207 GLN A O     1 
ATOM 2351  C CB    . GLN C 3 207 ? 44.868  124.385 -13.751 1.00 57.61  ? 207 GLN A CB    1 
ATOM 2352  C CG    . GLN C 3 207 ? 45.600  123.260 -14.447 1.00 60.13  ? 207 GLN A CG    1 
ATOM 2353  C CD    . GLN C 3 207 ? 46.873  122.886 -13.714 1.00 61.70  ? 207 GLN A CD    1 
ATOM 2354  O OE1   . GLN C 3 207 ? 46.835  122.463 -12.557 1.00 63.93  ? 207 GLN A OE1   1 
ATOM 2355  N NE2   . GLN C 3 207 ? 48.013  123.069 -14.375 1.00 61.81  ? 207 GLN A NE2   1 
ATOM 2356  N N     . HIS C 3 208 ? 41.824  124.192 -13.635 1.00 53.76  ? 208 HIS A N     1 
ATOM 2357  C CA    . HIS C 3 208 ? 40.588  123.428 -13.554 1.00 53.59  ? 208 HIS A CA    1 
ATOM 2358  C C     . HIS C 3 208 ? 39.562  123.960 -14.540 1.00 51.55  ? 208 HIS A C     1 
ATOM 2359  O O     . HIS C 3 208 ? 39.000  123.212 -15.343 1.00 49.32  ? 208 HIS A O     1 
ATOM 2360  C CB    . HIS C 3 208 ? 40.051  123.519 -12.124 1.00 56.03  ? 208 HIS A CB    1 
ATOM 2361  C CG    . HIS C 3 208 ? 38.637  123.048 -11.962 1.00 58.31  ? 208 HIS A CG    1 
ATOM 2362  N ND1   . HIS C 3 208 ? 37.945  122.388 -12.958 1.00 57.97  ? 208 HIS A ND1   1 
ATOM 2363  C CD2   . HIS C 3 208 ? 37.788  123.145 -10.914 1.00 58.17  ? 208 HIS A CD2   1 
ATOM 2364  C CE1   . HIS C 3 208 ? 36.730  122.100 -12.526 1.00 58.86  ? 208 HIS A CE1   1 
ATOM 2365  N NE2   . HIS C 3 208 ? 36.608  122.548 -11.289 1.00 58.48  ? 208 HIS A NE2   1 
ATOM 2366  N N     . LEU C 3 209 ? 39.288  125.251 -14.430 1.00 51.03  ? 209 LEU A N     1 
ATOM 2367  C CA    . LEU C 3 209 ? 38.336  125.910 -15.301 1.00 51.85  ? 209 LEU A CA    1 
ATOM 2368  C C     . LEU C 3 209 ? 38.712  125.666 -16.751 1.00 51.81  ? 209 LEU A C     1 
ATOM 2369  O O     . LEU C 3 209 ? 37.865  125.360 -17.589 1.00 50.16  ? 209 LEU A O     1 
ATOM 2370  C CB    . LEU C 3 209 ? 38.353  127.406 -15.032 1.00 52.69  ? 209 LEU A CB    1 
ATOM 2371  C CG    . LEU C 3 209 ? 37.073  128.009 -14.472 1.00 53.61  ? 209 LEU A CG    1 
ATOM 2372  C CD1   . LEU C 3 209 ? 37.288  129.499 -14.292 1.00 53.84  ? 209 LEU A CD1   1 
ATOM 2373  C CD2   . LEU C 3 209 ? 35.906  127.751 -15.412 1.00 54.18  ? 209 LEU A CD2   1 
ATOM 2374  N N     . LEU C 3 210 ? 39.996  125.829 -17.038 1.00 52.70  ? 210 LEU A N     1 
ATOM 2375  C CA    . LEU C 3 210 ? 40.505  125.628 -18.378 1.00 53.61  ? 210 LEU A CA    1 
ATOM 2376  C C     . LEU C 3 210 ? 40.387  124.154 -18.725 1.00 52.43  ? 210 LEU A C     1 
ATOM 2377  O O     . LEU C 3 210 ? 40.023  123.805 -19.851 1.00 52.01  ? 210 LEU A O     1 
ATOM 2378  C CB    . LEU C 3 210 ? 41.956  126.108 -18.465 1.00 56.76  ? 210 LEU A CB    1 
ATOM 2379  C CG    . LEU C 3 210 ? 42.587  126.265 -19.857 1.00 60.63  ? 210 LEU A CG    1 
ATOM 2380  C CD1   . LEU C 3 210 ? 43.770  127.256 -19.814 1.00 61.87  ? 210 LEU A CD1   1 
ATOM 2381  C CD2   . LEU C 3 210 ? 43.027  124.894 -20.396 1.00 60.45  ? 210 LEU A CD2   1 
ATOM 2382  N N     . ARG C 3 211 ? 40.647  123.300 -17.735 1.00 50.75  ? 211 ARG A N     1 
ATOM 2383  C CA    . ARG C 3 211 ? 40.571  121.854 -17.915 1.00 48.86  ? 211 ARG A CA    1 
ATOM 2384  C C     . ARG C 3 211 ? 39.202  121.458 -18.445 1.00 47.58  ? 211 ARG A C     1 
ATOM 2385  O O     . ARG C 3 211 ? 39.098  120.560 -19.282 1.00 47.74  ? 211 ARG A O     1 
ATOM 2386  C CB    . ARG C 3 211 ? 40.856  121.134 -16.605 1.00 48.55  ? 211 ARG A CB    1 
ATOM 2387  N N     . TRP C 3 212 ? 38.161  122.139 -17.963 1.00 45.97  ? 212 TRP A N     1 
ATOM 2388  C CA    . TRP C 3 212 ? 36.795  121.874 -18.408 1.00 43.91  ? 212 TRP A CA    1 
ATOM 2389  C C     . TRP C 3 212 ? 36.467  122.570 -19.726 1.00 42.94  ? 212 TRP A C     1 
ATOM 2390  O O     . TRP C 3 212 ? 35.336  122.527 -20.201 1.00 42.30  ? 212 TRP A O     1 
ATOM 2391  C CB    . TRP C 3 212 ? 35.780  122.254 -17.323 1.00 42.46  ? 212 TRP A CB    1 
ATOM 2392  C CG    . TRP C 3 212 ? 35.442  121.102 -16.439 1.00 42.80  ? 212 TRP A CG    1 
ATOM 2393  C CD1   . TRP C 3 212 ? 36.178  120.628 -15.392 1.00 42.57  ? 212 TRP A CD1   1 
ATOM 2394  C CD2   . TRP C 3 212 ? 34.315  120.227 -16.566 1.00 41.96  ? 212 TRP A CD2   1 
ATOM 2395  N NE1   . TRP C 3 212 ? 35.584  119.505 -14.862 1.00 43.53  ? 212 TRP A NE1   1 
ATOM 2396  C CE2   . TRP C 3 212 ? 34.439  119.237 -15.564 1.00 43.04  ? 212 TRP A CE2   1 
ATOM 2397  C CE3   . TRP C 3 212 ? 33.216  120.180 -17.434 1.00 42.70  ? 212 TRP A CE3   1 
ATOM 2398  C CZ2   . TRP C 3 212 ? 33.500  118.206 -15.406 1.00 42.30  ? 212 TRP A CZ2   1 
ATOM 2399  C CZ3   . TRP C 3 212 ? 32.283  119.153 -17.277 1.00 42.96  ? 212 TRP A CZ3   1 
ATOM 2400  C CH2   . TRP C 3 212 ? 32.434  118.181 -16.271 1.00 42.14  ? 212 TRP A CH2   1 
ATOM 2401  N N     . GLY C 3 213 ? 37.478  123.179 -20.334 1.00 42.04  ? 213 GLY A N     1 
ATOM 2402  C CA    . GLY C 3 213 ? 37.272  123.861 -21.596 1.00 42.60  ? 213 GLY A CA    1 
ATOM 2403  C C     . GLY C 3 213 ? 37.144  125.355 -21.427 1.00 42.08  ? 213 GLY A C     1 
ATOM 2404  O O     . GLY C 3 213 ? 37.077  126.098 -22.405 1.00 41.70  ? 213 GLY A O     1 
ATOM 2405  N N     . LEU C 3 214 ? 37.097  125.810 -20.186 1.00 42.61  ? 214 LEU A N     1 
ATOM 2406  C CA    . LEU C 3 214 ? 36.974  127.228 -19.967 1.00 44.20  ? 214 LEU A CA    1 
ATOM 2407  C C     . LEU C 3 214 ? 38.319  127.901 -19.895 1.00 45.68  ? 214 LEU A C     1 
ATOM 2408  O O     . LEU C 3 214 ? 38.979  127.903 -18.856 1.00 44.83  ? 214 LEU A O     1 
ATOM 2409  C CB    . LEU C 3 214 ? 36.129  127.526 -18.737 1.00 44.33  ? 214 LEU A CB    1 
ATOM 2410  C CG    . LEU C 3 214 ? 34.621  127.518 -19.016 1.00 45.39  ? 214 LEU A CG    1 
ATOM 2411  C CD1   . LEU C 3 214 ? 34.315  128.450 -20.199 1.00 45.48  ? 214 LEU A CD1   1 
ATOM 2412  C CD2   . LEU C 3 214 ? 34.126  126.099 -19.304 1.00 45.37  ? 214 LEU A CD2   1 
ATOM 2413  N N     . THR C 3 215 ? 38.720  128.457 -21.035 1.00 47.95  ? 215 THR A N     1 
ATOM 2414  C CA    . THR C 3 215 ? 39.981  129.173 -21.159 1.00 49.52  ? 215 THR A CA    1 
ATOM 2415  C C     . THR C 3 215 ? 39.984  130.289 -20.135 1.00 50.73  ? 215 THR A C     1 
ATOM 2416  O O     . THR C 3 215 ? 38.958  130.928 -19.879 1.00 50.18  ? 215 THR A O     1 
ATOM 2417  C CB    . THR C 3 215 ? 40.153  129.845 -22.556 1.00 50.14  ? 215 THR A CB    1 
ATOM 2418  O OG1   . THR C 3 215 ? 39.214  130.921 -22.700 1.00 50.67  ? 215 THR A OG1   1 
ATOM 2419  C CG2   . THR C 3 215 ? 39.942  128.846 -23.682 1.00 51.59  ? 215 THR A CG2   1 
ATOM 2420  N N     . THR C 3 216 ? 41.153  130.536 -19.569 1.00 52.14  ? 216 THR A N     1 
ATOM 2421  C CA    . THR C 3 216 ? 41.307  131.589 -18.587 1.00 53.69  ? 216 THR A CA    1 
ATOM 2422  C C     . THR C 3 216 ? 42.227  132.611 -19.254 1.00 54.29  ? 216 THR A C     1 
ATOM 2423  O O     . THR C 3 216 ? 43.393  132.762 -18.876 1.00 55.02  ? 216 THR A O     1 
ATOM 2424  C CB    . THR C 3 216 ? 41.944  131.034 -17.291 1.00 54.98  ? 216 THR A CB    1 
ATOM 2425  O OG1   . THR C 3 216 ? 41.387  129.743 -16.985 1.00 54.02  ? 216 THR A OG1   1 
ATOM 2426  C CG2   . THR C 3 216 ? 41.667  131.986 -16.135 1.00 55.32  ? 216 THR A CG2   1 
ATOM 2427  N N     . PRO C 3 217 ? 41.699  133.338 -20.254 1.00 55.30  ? 217 PRO A N     1 
ATOM 2428  C CA    . PRO C 3 217 ? 42.400  134.360 -21.040 1.00 57.27  ? 217 PRO A CA    1 
ATOM 2429  C C     . PRO C 3 217 ? 43.221  135.361 -20.244 1.00 59.82  ? 217 PRO A C     1 
ATOM 2430  O O     . PRO C 3 217 ? 42.852  135.735 -19.130 1.00 59.63  ? 217 PRO A O     1 
ATOM 2431  C CB    . PRO C 3 217 ? 41.267  135.021 -21.814 1.00 57.37  ? 217 PRO A CB    1 
ATOM 2432  C CG    . PRO C 3 217 ? 40.290  133.886 -21.983 1.00 55.29  ? 217 PRO A CG    1 
ATOM 2433  C CD    . PRO C 3 217 ? 40.270  133.331 -20.600 1.00 54.63  ? 217 PRO A CD    1 
ATOM 2434  N N     . ASP C 3 218 ? 44.309  135.826 -20.857 1.00 63.02  ? 218 ASP A N     1 
ATOM 2435  C CA    . ASP C 3 218 ? 45.241  136.755 -20.222 1.00 66.29  ? 218 ASP A CA    1 
ATOM 2436  C C     . ASP C 3 218 ? 44.699  138.094 -19.733 1.00 67.94  ? 218 ASP A C     1 
ATOM 2437  O O     . ASP C 3 218 ? 45.422  138.898 -19.119 1.00 66.80  ? 218 ASP A O     1 
ATOM 2438  C CB    . ASP C 3 218 ? 46.451  136.982 -21.110 1.00 65.82  ? 218 ASP A CB    1 
ATOM 2439  C CG    . ASP C 3 218 ? 47.732  137.021 -20.318 1.00 66.53  ? 218 ASP A CG    1 
ATOM 2440  O OD1   . ASP C 3 218 ? 47.704  137.413 -19.125 1.00 65.59  ? 218 ASP A OD1   1 
ATOM 2441  O OD2   . ASP C 3 218 ? 48.769  136.639 -20.887 1.00 68.07  ? 218 ASP A OD2   1 
ATOM 2442  N N     . LYS C 3 219 ? 43.414  138.309 -19.984 1.00 69.95  ? 219 LYS A N     1 
ATOM 2443  C CA    . LYS C 3 219 ? 42.719  139.512 -19.557 1.00 71.59  ? 219 LYS A CA    1 
ATOM 2444  C C     . LYS C 3 219 ? 42.362  139.296 -18.074 1.00 71.75  ? 219 LYS A C     1 
ATOM 2445  O O     . LYS C 3 219 ? 41.211  139.457 -17.643 1.00 70.74  ? 219 LYS A O     1 
ATOM 2446  C CB    . LYS C 3 219 ? 41.478  139.721 -20.434 1.00 73.07  ? 219 LYS A CB    1 
ATOM 2447  C CG    . LYS C 3 219 ? 41.800  139.969 -21.934 1.00 76.20  ? 219 LYS A CG    1 
ATOM 2448  C CD    . LYS C 3 219 ? 42.598  138.823 -22.636 1.00 77.57  ? 219 LYS A CD    1 
ATOM 2449  C CE    . LYS C 3 219 ? 42.886  139.133 -24.121 1.00 77.85  ? 219 LYS A CE    1 
ATOM 2450  N NZ    . LYS C 3 219 ? 43.674  138.085 -24.841 1.00 77.52  ? 219 LYS A NZ    1 
ATOM 2451  N N     . LYS C 3 220 ? 43.385  138.860 -17.332 1.00 71.72  ? 220 LYS A N     1 
ATOM 2452  C CA    . LYS C 3 220 ? 43.323  138.577 -15.899 1.00 71.19  ? 220 LYS A CA    1 
ATOM 2453  C C     . LYS C 3 220 ? 43.680  139.831 -15.100 1.00 71.48  ? 220 LYS A C     1 
ATOM 2454  O O     . LYS C 3 220 ? 44.390  140.712 -15.595 1.00 71.71  ? 220 LYS A O     1 
ATOM 2455  C CB    . LYS C 3 220 ? 44.309  137.450 -15.539 1.00 69.45  ? 220 LYS A CB    1 
ATOM 2456  C CG    . LYS C 3 220 ? 44.509  137.241 -14.030 1.00 67.87  ? 220 LYS A CG    1 
ATOM 2457  C CD    . LYS C 3 220 ? 45.448  136.086 -13.699 1.00 66.60  ? 220 LYS A CD    1 
ATOM 2458  C CE    . LYS C 3 220 ? 45.613  135.930 -12.186 1.00 65.13  ? 220 LYS A CE    1 
ATOM 2459  N NZ    . LYS C 3 220 ? 46.534  134.816 -11.805 1.00 65.47  ? 220 LYS A NZ    1 
ATOM 2460  N N     . HIS C 3 221 ? 43.194  139.895 -13.860 1.00 70.81  ? 221 HIS A N     1 
ATOM 2461  C CA    . HIS C 3 221 ? 43.461  141.025 -12.976 1.00 69.93  ? 221 HIS A CA    1 
ATOM 2462  C C     . HIS C 3 221 ? 44.503  140.701 -11.887 1.00 70.14  ? 221 HIS A C     1 
ATOM 2463  O O     . HIS C 3 221 ? 44.349  139.733 -11.125 1.00 69.91  ? 221 HIS A O     1 
ATOM 2464  C CB    . HIS C 3 221 ? 42.151  141.537 -12.357 1.00 68.71  ? 221 HIS A CB    1 
ATOM 2465  C CG    . HIS C 3 221 ? 41.325  142.368 -13.294 1.00 67.83  ? 221 HIS A CG    1 
ATOM 2466  N ND1   . HIS C 3 221 ? 40.917  141.919 -14.533 1.00 67.16  ? 221 HIS A ND1   1 
ATOM 2467  C CD2   . HIS C 3 221 ? 40.853  143.634 -13.179 1.00 67.29  ? 221 HIS A CD2   1 
ATOM 2468  C CE1   . HIS C 3 221 ? 40.234  142.871 -15.141 1.00 67.12  ? 221 HIS A CE1   1 
ATOM 2469  N NE2   . HIS C 3 221 ? 40.180  143.922 -14.342 1.00 67.27  ? 221 HIS A NE2   1 
ATOM 2470  N N     . GLN C 3 222 ? 45.552  141.532 -11.831 1.00 69.74  ? 222 GLN A N     1 
ATOM 2471  C CA    . GLN C 3 222 ? 46.667  141.400 -10.877 1.00 68.02  ? 222 GLN A CA    1 
ATOM 2472  C C     . GLN C 3 222 ? 46.918  142.703 -10.114 1.00 66.37  ? 222 GLN A C     1 
ATOM 2473  O O     . GLN C 3 222 ? 47.116  142.690 -8.892  1.00 63.50  ? 222 GLN A O     1 
ATOM 2474  C CB    . GLN C 3 222 ? 47.940  140.991 -11.626 1.00 68.67  ? 222 GLN A CB    1 
ATOM 2475  N N     . LYS C 3 223 ? 46.959  143.803 -10.875 1.00 66.51  ? 223 LYS A N     1 
ATOM 2476  C CA    . LYS C 3 223 ? 47.168  145.162 -10.369 1.00 66.04  ? 223 LYS A CA    1 
ATOM 2477  C C     . LYS C 3 223 ? 46.129  145.410 -9.303  1.00 65.43  ? 223 LYS A C     1 
ATOM 2478  O O     . LYS C 3 223 ? 45.047  145.943 -9.568  1.00 63.86  ? 223 LYS A O     1 
ATOM 2479  C CB    . LYS C 3 223 ? 47.015  146.174 -11.499 1.00 66.99  ? 223 LYS A CB    1 
ATOM 2480  N N     . GLU C 3 224 ? 46.476  144.994 -8.093  1.00 65.95  ? 224 GLU A N     1 
ATOM 2481  C CA    . GLU C 3 224 ? 45.595  145.101 -6.948  1.00 67.34  ? 224 GLU A CA    1 
ATOM 2482  C C     . GLU C 3 224 ? 44.700  146.340 -6.907  1.00 65.71  ? 224 GLU A C     1 
ATOM 2483  O O     . GLU C 3 224 ? 43.518  146.250 -7.238  1.00 65.87  ? 224 GLU A O     1 
ATOM 2484  C CB    . GLU C 3 224 ? 46.385  144.950 -5.637  1.00 69.37  ? 224 GLU A CB    1 
ATOM 2485  C CG    . GLU C 3 224 ? 45.510  144.979 -4.379  1.00 73.61  ? 224 GLU A CG    1 
ATOM 2486  C CD    . GLU C 3 224 ? 46.164  145.691 -3.190  1.00 76.46  ? 224 GLU A CD    1 
ATOM 2487  O OE1   . GLU C 3 224 ? 46.077  145.156 -2.055  1.00 78.67  ? 224 GLU A OE1   1 
ATOM 2488  O OE2   . GLU C 3 224 ? 46.735  146.795 -3.382  1.00 78.06  ? 224 GLU A OE2   1 
ATOM 2489  N N     . PRO C 3 225 ? 45.279  147.527 -6.659  1.00 64.30  ? 225 PRO A N     1 
ATOM 2490  C CA    . PRO C 3 225 ? 44.471  148.746 -6.587  1.00 64.34  ? 225 PRO A CA    1 
ATOM 2491  C C     . PRO C 3 225 ? 43.426  148.878 -7.679  1.00 62.99  ? 225 PRO A C     1 
ATOM 2492  O O     . PRO C 3 225 ? 42.267  149.139 -7.381  1.00 64.19  ? 225 PRO A O     1 
ATOM 2493  C CB    . PRO C 3 225 ? 45.517  149.859 -6.612  1.00 65.89  ? 225 PRO A CB    1 
ATOM 2494  C CG    . PRO C 3 225 ? 46.719  149.198 -5.998  1.00 66.30  ? 225 PRO A CG    1 
ATOM 2495  C CD    . PRO C 3 225 ? 46.709  147.869 -6.700  1.00 65.15  ? 225 PRO A CD    1 
ATOM 2496  N N     . PRO C 3 226 ? 43.816  148.747 -8.956  1.00 61.55  ? 226 PRO A N     1 
ATOM 2497  C CA    . PRO C 3 226 ? 42.726  148.877 -9.926  1.00 61.71  ? 226 PRO A CA    1 
ATOM 2498  C C     . PRO C 3 226 ? 42.135  147.519 -10.384 1.00 60.29  ? 226 PRO A C     1 
ATOM 2499  O O     . PRO C 3 226 ? 42.774  146.730 -11.099 1.00 59.78  ? 226 PRO A O     1 
ATOM 2500  C CB    . PRO C 3 226 ? 43.375  149.680 -11.053 1.00 61.57  ? 226 PRO A CB    1 
ATOM 2501  C CG    . PRO C 3 226 ? 44.768  149.140 -11.069 1.00 62.15  ? 226 PRO A CG    1 
ATOM 2502  C CD    . PRO C 3 226 ? 45.127  148.971 -9.600  1.00 61.54  ? 226 PRO A CD    1 
ATOM 2503  N N     . PHE C 3 227 ? 40.921  147.246 -9.907  1.00 58.50  ? 227 PHE A N     1 
ATOM 2504  C CA    . PHE C 3 227 ? 40.189  146.026 -10.231 1.00 56.71  ? 227 PHE A CA    1 
ATOM 2505  C C     . PHE C 3 227 ? 38.890  146.370 -10.938 1.00 56.35  ? 227 PHE A C     1 
ATOM 2506  O O     . PHE C 3 227 ? 37.923  146.804 -10.299 1.00 56.41  ? 227 PHE A O     1 
ATOM 2507  C CB    . PHE C 3 227 ? 39.842  145.243 -8.969  1.00 55.27  ? 227 PHE A CB    1 
ATOM 2508  C CG    . PHE C 3 227 ? 40.912  144.294 -8.519  1.00 54.94  ? 227 PHE A CG    1 
ATOM 2509  C CD1   . PHE C 3 227 ? 42.096  144.153 -9.233  1.00 55.64  ? 227 PHE A CD1   1 
ATOM 2510  C CD2   . PHE C 3 227 ? 40.730  143.530 -7.372  1.00 53.35  ? 227 PHE A CD2   1 
ATOM 2511  C CE1   . PHE C 3 227 ? 43.077  143.259 -8.808  1.00 54.42  ? 227 PHE A CE1   1 
ATOM 2512  C CE2   . PHE C 3 227 ? 41.704  142.642 -6.948  1.00 51.45  ? 227 PHE A CE2   1 
ATOM 2513  C CZ    . PHE C 3 227 ? 42.874  142.504 -7.660  1.00 52.99  ? 227 PHE A CZ    1 
ATOM 2514  N N     . LEU C 3 228 ? 38.880  146.174 -12.257 1.00 55.49  ? 228 LEU A N     1 
ATOM 2515  C CA    . LEU C 3 228 ? 37.706  146.437 -13.097 1.00 53.61  ? 228 LEU A CA    1 
ATOM 2516  C C     . LEU C 3 228 ? 36.675  145.358 -12.779 1.00 52.13  ? 228 LEU A C     1 
ATOM 2517  O O     . LEU C 3 228 ? 36.781  144.226 -13.255 1.00 51.42  ? 228 LEU A O     1 
ATOM 2518  C CB    . LEU C 3 228 ? 38.104  146.361 -14.578 1.00 54.65  ? 228 LEU A CB    1 
ATOM 2519  C CG    . LEU C 3 228 ? 37.141  146.631 -15.747 1.00 55.64  ? 228 LEU A CG    1 
ATOM 2520  C CD1   . LEU C 3 228 ? 37.345  145.536 -16.808 1.00 55.95  ? 228 LEU A CD1   1 
ATOM 2521  C CD2   . LEU C 3 228 ? 35.671  146.693 -15.306 1.00 56.26  ? 228 LEU A CD2   1 
ATOM 2522  N N     . TRP C 3 229 ? 35.652  145.711 -12.015 1.00 49.78  ? 229 TRP A N     1 
ATOM 2523  C CA    . TRP C 3 229 ? 34.676  144.710 -11.674 1.00 47.21  ? 229 TRP A CA    1 
ATOM 2524  C C     . TRP C 3 229 ? 33.233  145.140 -11.674 1.00 46.54  ? 229 TRP A C     1 
ATOM 2525  O O     . TRP C 3 229 ? 32.821  146.009 -10.907 1.00 44.20  ? 229 TRP A O     1 
ATOM 2526  C CB    . TRP C 3 229 ? 35.031  144.066 -10.347 1.00 46.01  ? 229 TRP A CB    1 
ATOM 2527  C CG    . TRP C 3 229 ? 33.956  143.195 -9.872  1.00 45.60  ? 229 TRP A CG    1 
ATOM 2528  C CD1   . TRP C 3 229 ? 33.672  141.939 -10.295 1.00 45.34  ? 229 TRP A CD1   1 
ATOM 2529  C CD2   . TRP C 3 229 ? 32.966  143.535 -8.916  1.00 45.83  ? 229 TRP A CD2   1 
ATOM 2530  N NE1   . TRP C 3 229 ? 32.553  141.470 -9.663  1.00 43.59  ? 229 TRP A NE1   1 
ATOM 2531  C CE2   . TRP C 3 229 ? 32.101  142.434 -8.807  1.00 43.91  ? 229 TRP A CE2   1 
ATOM 2532  C CE3   . TRP C 3 229 ? 32.724  144.668 -8.136  1.00 45.70  ? 229 TRP A CE3   1 
ATOM 2533  C CZ2   . TRP C 3 229 ? 31.010  142.430 -7.951  1.00 44.97  ? 229 TRP A CZ2   1 
ATOM 2534  C CZ3   . TRP C 3 229 ? 31.641  144.666 -7.282  1.00 46.15  ? 229 TRP A CZ3   1 
ATOM 2535  C CH2   . TRP C 3 229 ? 30.796  143.552 -7.194  1.00 46.32  ? 229 TRP A CH2   1 
ATOM 2536  N N     . MET C 3 230 ? 32.460  144.432 -12.491 1.00 47.65  ? 230 MET A N     1 
ATOM 2537  C CA    . MET C 3 230 ? 31.032  144.668 -12.655 1.00 49.50  ? 230 MET A CA    1 
ATOM 2538  C C     . MET C 3 230 ? 30.724  146.130 -12.857 1.00 51.42  ? 230 MET A C     1 
ATOM 2539  O O     . MET C 3 230 ? 29.600  146.579 -12.641 1.00 50.00  ? 230 MET A O     1 
ATOM 2540  C CB    . MET C 3 230 ? 30.253  144.115 -11.464 1.00 47.40  ? 230 MET A CB    1 
ATOM 2541  C CG    . MET C 3 230 ? 29.850  142.660 -11.645 1.00 44.67  ? 230 MET A CG    1 
ATOM 2542  S SD    . MET C 3 230 ? 28.182  142.388 -12.388 1.00 41.39  ? 230 MET A SD    1 
ATOM 2543  C CE    . MET C 3 230 ? 28.156  143.506 -13.788 1.00 39.76  ? 230 MET A CE    1 
ATOM 2544  N N     . GLY C 3 231 ? 31.741  146.858 -13.301 1.00 54.70  ? 231 GLY A N     1 
ATOM 2545  C CA    . GLY C 3 231 ? 31.599  148.284 -13.520 1.00 59.78  ? 231 GLY A CA    1 
ATOM 2546  C C     . GLY C 3 231 ? 32.175  149.122 -12.386 1.00 61.97  ? 231 GLY A C     1 
ATOM 2547  O O     . GLY C 3 231 ? 32.572  150.287 -12.567 1.00 62.30  ? 231 GLY A O     1 
ATOM 2548  N N     . TYR C 3 232 ? 32.237  148.525 -11.205 1.00 62.72  ? 232 TYR A N     1 
ATOM 2549  C CA    . TYR C 3 232 ? 32.757  149.229 -10.055 1.00 64.30  ? 232 TYR A CA    1 
ATOM 2550  C C     . TYR C 3 232 ? 34.270  149.158 -9.968  1.00 65.92  ? 232 TYR A C     1 
ATOM 2551  O O     . TYR C 3 232 ? 34.867  148.096 -10.193 1.00 66.01  ? 232 TYR A O     1 
ATOM 2552  C CB    . TYR C 3 232 ? 32.167  148.651 -8.781  1.00 63.95  ? 232 TYR A CB    1 
ATOM 2553  C CG    . TYR C 3 232 ? 30.664  148.654 -8.720  1.00 63.80  ? 232 TYR A CG    1 
ATOM 2554  C CD1   . TYR C 3 232 ? 29.917  147.711 -9.428  1.00 64.06  ? 232 TYR A CD1   1 
ATOM 2555  C CD2   . TYR C 3 232 ? 29.991  149.526 -7.864  1.00 64.41  ? 232 TYR A CD2   1 
ATOM 2556  C CE1   . TYR C 3 232 ? 28.534  147.629 -9.269  1.00 65.60  ? 232 TYR A CE1   1 
ATOM 2557  C CE2   . TYR C 3 232 ? 28.611  149.454 -7.696  1.00 65.98  ? 232 TYR A CE2   1 
ATOM 2558  C CZ    . TYR C 3 232 ? 27.890  148.501 -8.395  1.00 66.19  ? 232 TYR A CZ    1 
ATOM 2559  O OH    . TYR C 3 232 ? 26.536  148.392 -8.183  1.00 67.11  ? 232 TYR A OH    1 
ATOM 2560  N N     . GLU C 3 233 ? 34.879  150.303 -9.664  1.00 66.90  ? 233 GLU A N     1 
ATOM 2561  C CA    . GLU C 3 233 ? 36.322  150.396 -9.488  1.00 68.12  ? 233 GLU A CA    1 
ATOM 2562  C C     . GLU C 3 233 ? 36.538  149.888 -8.073  1.00 67.67  ? 233 GLU A C     1 
ATOM 2563  O O     . GLU C 3 233 ? 36.175  150.555 -7.097  1.00 67.03  ? 233 GLU A O     1 
ATOM 2564  C CB    . GLU C 3 233 ? 36.812  151.847 -9.604  1.00 70.18  ? 233 GLU A CB    1 
ATOM 2565  C CG    . GLU C 3 233 ? 38.340  152.000 -9.465  1.00 73.89  ? 233 GLU A CG    1 
ATOM 2566  C CD    . GLU C 3 233 ? 38.817  153.457 -9.419  1.00 75.11  ? 233 GLU A CD    1 
ATOM 2567  O OE1   . GLU C 3 233 ? 38.912  154.096 -10.495 1.00 74.14  ? 233 GLU A OE1   1 
ATOM 2568  O OE2   . GLU C 3 233 ? 39.116  153.952 -8.303  1.00 76.62  ? 233 GLU A OE2   1 
ATOM 2569  N N     . LEU C 3 234 ? 37.052  148.668 -7.981  1.00 67.81  ? 234 LEU A N     1 
ATOM 2570  C CA    . LEU C 3 234 ? 37.306  148.019 -6.702  1.00 69.07  ? 234 LEU A CA    1 
ATOM 2571  C C     . LEU C 3 234 ? 38.722  148.340 -6.211  1.00 69.53  ? 234 LEU A C     1 
ATOM 2572  O O     . LEU C 3 234 ? 39.702  148.041 -6.897  1.00 70.01  ? 234 LEU A O     1 
ATOM 2573  C CB    . LEU C 3 234 ? 37.121  146.502 -6.867  1.00 68.47  ? 234 LEU A CB    1 
ATOM 2574  C CG    . LEU C 3 234 ? 36.256  145.662 -5.913  1.00 68.19  ? 234 LEU A CG    1 
ATOM 2575  C CD1   . LEU C 3 234 ? 35.639  144.535 -6.723  1.00 66.19  ? 234 LEU A CD1   1 
ATOM 2576  C CD2   . LEU C 3 234 ? 37.054  145.108 -4.714  1.00 67.79  ? 234 LEU A CD2   1 
ATOM 2577  N N     . HIS C 3 235 ? 38.821  148.983 -5.047  1.00 70.21  ? 235 HIS A N     1 
ATOM 2578  C CA    . HIS C 3 235 ? 40.114  149.338 -4.455  1.00 71.04  ? 235 HIS A CA    1 
ATOM 2579  C C     . HIS C 3 235 ? 40.329  148.522 -3.185  1.00 69.64  ? 235 HIS A C     1 
ATOM 2580  O O     . HIS C 3 235 ? 39.379  147.980 -2.619  1.00 70.50  ? 235 HIS A O     1 
ATOM 2581  C CB    . HIS C 3 235 ? 40.169  150.838 -4.119  1.00 73.32  ? 235 HIS A CB    1 
ATOM 2582  C CG    . HIS C 3 235 ? 41.063  151.634 -5.024  1.00 76.15  ? 235 HIS A CG    1 
ATOM 2583  N ND1   . HIS C 3 235 ? 42.439  151.601 -4.927  1.00 76.80  ? 235 HIS A ND1   1 
ATOM 2584  C CD2   . HIS C 3 235 ? 40.778  152.492 -6.033  1.00 76.12  ? 235 HIS A CD2   1 
ATOM 2585  C CE1   . HIS C 3 235 ? 42.962  152.407 -5.838  1.00 77.47  ? 235 HIS A CE1   1 
ATOM 2586  N NE2   . HIS C 3 235 ? 41.975  152.958 -6.521  1.00 76.91  ? 235 HIS A NE2   1 
ATOM 2587  N N     . PRO C 3 236 ? 41.578  148.438 -2.703  1.00 67.78  ? 236 PRO A N     1 
ATOM 2588  C CA    . PRO C 3 236 ? 41.847  147.666 -1.484  1.00 66.64  ? 236 PRO A CA    1 
ATOM 2589  C C     . PRO C 3 236 ? 41.013  148.114 -0.289  1.00 64.80  ? 236 PRO A C     1 
ATOM 2590  O O     . PRO C 3 236 ? 41.131  147.530 0.776   1.00 64.73  ? 236 PRO A O     1 
ATOM 2591  C CB    . PRO C 3 236 ? 43.326  147.939 -1.226  1.00 66.84  ? 236 PRO A CB    1 
ATOM 2592  C CG    . PRO C 3 236 ? 43.873  148.168 -2.605  1.00 67.32  ? 236 PRO A CG    1 
ATOM 2593  C CD    . PRO C 3 236 ? 42.820  149.010 -3.256  1.00 66.91  ? 236 PRO A CD    1 
ATOM 2594  N N     . ASP C 3 237 ? 40.181  149.144 -0.466  1.00 63.34  ? 237 ASP A N     1 
ATOM 2595  C CA    . ASP C 3 237 ? 39.357  149.649 0.628   1.00 61.99  ? 237 ASP A CA    1 
ATOM 2596  C C     . ASP C 3 237 ? 38.091  150.420 0.276   1.00 60.53  ? 237 ASP A C     1 
ATOM 2597  O O     . ASP C 3 237 ? 37.187  150.560 1.110   1.00 59.63  ? 237 ASP A O     1 
ATOM 2598  C CB    . ASP C 3 237 ? 40.202  150.510 1.549   1.00 62.73  ? 237 ASP A CB    1 
ATOM 2599  C CG    . ASP C 3 237 ? 40.108  150.061 2.975   1.00 63.71  ? 237 ASP A CG    1 
ATOM 2600  O OD1   . ASP C 3 237 ? 41.150  149.651 3.522   1.00 66.73  ? 237 ASP A OD1   1 
ATOM 2601  O OD2   . ASP C 3 237 ? 38.988  150.076 3.532   1.00 64.57  ? 237 ASP A OD2   1 
ATOM 2602  N N     . LYS C 3 238 ? 38.048  150.967 -0.930  1.00 59.05  ? 238 LYS A N     1 
ATOM 2603  C CA    . LYS C 3 238 ? 36.889  151.731 -1.359  1.00 58.16  ? 238 LYS A CA    1 
ATOM 2604  C C     . LYS C 3 238 ? 36.434  151.259 -2.713  1.00 57.04  ? 238 LYS A C     1 
ATOM 2605  O O     . LYS C 3 238 ? 37.198  150.657 -3.459  1.00 56.00  ? 238 LYS A O     1 
ATOM 2606  C CB    . LYS C 3 238 ? 37.214  153.217 -1.410  1.00 59.16  ? 238 LYS A CB    1 
ATOM 2607  N N     . TRP C 3 239 ? 35.173  151.514 -3.018  1.00 56.25  ? 239 TRP A N     1 
ATOM 2608  C CA    . TRP C 3 239 ? 34.625  151.118 -4.296  1.00 55.88  ? 239 TRP A CA    1 
ATOM 2609  C C     . TRP C 3 239 ? 33.981  152.321 -4.910  1.00 55.17  ? 239 TRP A C     1 
ATOM 2610  O O     . TRP C 3 239 ? 33.527  153.213 -4.201  1.00 53.13  ? 239 TRP A O     1 
ATOM 2611  C CB    . TRP C 3 239 ? 33.615  149.987 -4.141  1.00 56.72  ? 239 TRP A CB    1 
ATOM 2612  C CG    . TRP C 3 239 ? 32.377  150.335 -3.380  1.00 56.27  ? 239 TRP A CG    1 
ATOM 2613  C CD1   . TRP C 3 239 ? 32.142  150.120 -2.056  1.00 57.99  ? 239 TRP A CD1   1 
ATOM 2614  C CD2   . TRP C 3 239 ? 31.173  150.881 -3.919  1.00 56.98  ? 239 TRP A CD2   1 
ATOM 2615  N NE1   . TRP C 3 239 ? 30.861  150.492 -1.731  1.00 57.31  ? 239 TRP A NE1   1 
ATOM 2616  C CE2   . TRP C 3 239 ? 30.241  150.961 -2.858  1.00 56.66  ? 239 TRP A CE2   1 
ATOM 2617  C CE3   . TRP C 3 239 ? 30.783  151.299 -5.198  1.00 57.47  ? 239 TRP A CE3   1 
ATOM 2618  C CZ2   . TRP C 3 239 ? 28.947  151.444 -3.036  1.00 57.62  ? 239 TRP A CZ2   1 
ATOM 2619  C CZ3   . TRP C 3 239 ? 29.499  151.776 -5.376  1.00 57.12  ? 239 TRP A CZ3   1 
ATOM 2620  C CH2   . TRP C 3 239 ? 28.593  151.844 -4.299  1.00 58.14  ? 239 TRP A CH2   1 
ATOM 2621  N N     . THR C 3 240 ? 33.948  152.348 -6.235  1.00 56.36  ? 240 THR A N     1 
ATOM 2622  C CA    . THR C 3 240 ? 33.381  153.480 -6.942  1.00 58.45  ? 240 THR A CA    1 
ATOM 2623  C C     . THR C 3 240 ? 33.306  153.249 -8.421  1.00 58.82  ? 240 THR A C     1 
ATOM 2624  O O     . THR C 3 240 ? 34.065  152.477 -8.976  1.00 59.05  ? 240 THR A O     1 
ATOM 2625  C CB    . THR C 3 240 ? 34.251  154.705 -6.769  1.00 60.00  ? 240 THR A CB    1 
ATOM 2626  O OG1   . THR C 3 240 ? 35.376  154.378 -5.939  1.00 60.78  ? 240 THR A OG1   1 
ATOM 2627  C CG2   . THR C 3 240 ? 33.450  155.834 -6.158  1.00 61.84  ? 240 THR A CG2   1 
ATOM 2628  N N     . VAL C 3 241 ? 32.445  154.005 -9.071  1.00 60.60  ? 241 VAL A N     1 
ATOM 2629  C CA    . VAL C 3 241 ? 32.287  153.878 -10.501 1.00 64.02  ? 241 VAL A CA    1 
ATOM 2630  C C     . VAL C 3 241 ? 32.660  155.170 -11.181 1.00 64.39  ? 241 VAL A C     1 
ATOM 2631  O O     . VAL C 3 241 ? 31.812  155.910 -11.671 1.00 64.22  ? 241 VAL A O     1 
ATOM 2632  C CB    . VAL C 3 241 ? 30.863  153.481 -10.853 1.00 66.25  ? 241 VAL A CB    1 
ATOM 2633  C CG1   . VAL C 3 241 ? 30.716  151.979 -10.718 1.00 68.11  ? 241 VAL A CG1   1 
ATOM 2634  C CG2   . VAL C 3 241 ? 29.878  154.186 -9.909  1.00 66.48  ? 241 VAL A CG2   1 
ATOM 2635  N N     . GLN C 3 242 ? 33.965  155.395 -11.262 1.00 66.42  ? 242 GLN A N     1 
ATOM 2636  C CA    . GLN C 3 242 ? 34.536  156.590 -11.879 1.00 67.43  ? 242 GLN A CA    1 
ATOM 2637  C C     . GLN C 3 242 ? 33.865  157.069 -13.166 1.00 67.28  ? 242 GLN A C     1 
ATOM 2638  O O     . GLN C 3 242 ? 33.765  158.271 -13.405 1.00 67.91  ? 242 GLN A O     1 
ATOM 2639  C CB    . GLN C 3 242 ? 36.032  156.390 -12.112 1.00 69.11  ? 242 GLN A CB    1 
ATOM 2640  N N     . PRO C 3 243 ? 33.422  156.139 -14.027 1.00 67.47  ? 243 PRO A N     1 
ATOM 2641  C CA    . PRO C 3 243 ? 32.767  156.545 -15.275 1.00 67.13  ? 243 PRO A CA    1 
ATOM 2642  C C     . PRO C 3 243 ? 31.517  157.426 -15.120 1.00 66.68  ? 243 PRO A C     1 
ATOM 2643  O O     . PRO C 3 243 ? 30.718  157.538 -16.048 1.00 66.61  ? 243 PRO A O     1 
ATOM 2644  C CB    . PRO C 3 243 ? 32.427  155.197 -15.929 1.00 69.24  ? 243 PRO A CB    1 
ATOM 2645  C CG    . PRO C 3 243 ? 32.411  154.216 -14.744 1.00 68.70  ? 243 PRO A CG    1 
ATOM 2646  C CD    . PRO C 3 243 ? 33.609  154.678 -13.999 1.00 67.36  ? 243 PRO A CD    1 
ATOM 2647  N N     . ILE C 3 244 ? 31.369  158.062 -13.961 1.00 66.36  ? 244 ILE A N     1 
ATOM 2648  C CA    . ILE C 3 244 ? 30.233  158.928 -13.678 1.00 66.37  ? 244 ILE A CA    1 
ATOM 2649  C C     . ILE C 3 244 ? 30.280  160.194 -14.520 1.00 66.92  ? 244 ILE A C     1 
ATOM 2650  O O     . ILE C 3 244 ? 30.296  161.310 -13.993 1.00 67.57  ? 244 ILE A O     1 
ATOM 2651  C CB    . ILE C 3 244 ? 30.204  159.275 -12.197 1.00 66.26  ? 244 ILE A CB    1 
ATOM 2652  N N     . VAL C 3 245 ? 30.336  160.007 -15.834 1.00 68.40  ? 245 VAL A N     1 
ATOM 2653  C CA    . VAL C 3 245 ? 30.374  161.114 -16.788 1.00 70.68  ? 245 VAL A CA    1 
ATOM 2654  C C     . VAL C 3 245 ? 28.968  161.353 -17.278 1.00 71.59  ? 245 VAL A C     1 
ATOM 2655  O O     . VAL C 3 245 ? 28.167  160.423 -17.342 1.00 71.58  ? 245 VAL A O     1 
ATOM 2656  C CB    . VAL C 3 245 ? 31.276  160.785 -17.958 1.00 71.97  ? 245 VAL A CB    1 
ATOM 2657  N N     . LEU C 3 246 ? 28.692  162.578 -17.702 1.00 72.56  ? 246 LEU A N     1 
ATOM 2658  C CA    . LEU C 3 246 ? 27.351  162.910 -18.146 1.00 74.65  ? 246 LEU A CA    1 
ATOM 2659  C C     . LEU C 3 246 ? 27.296  163.773 -19.389 1.00 76.39  ? 246 LEU A C     1 
ATOM 2660  O O     . LEU C 3 246 ? 28.200  164.566 -19.642 1.00 76.91  ? 246 LEU A O     1 
ATOM 2661  C CB    . LEU C 3 246 ? 26.602  163.600 -17.009 1.00 74.30  ? 246 LEU A CB    1 
ATOM 2662  C CG    . LEU C 3 246 ? 27.299  164.792 -16.349 1.00 73.87  ? 246 LEU A CG    1 
ATOM 2663  C CD1   . LEU C 3 246 ? 26.252  165.556 -15.581 1.00 74.99  ? 246 LEU A CD1   1 
ATOM 2664  C CD2   . LEU C 3 246 ? 28.457  164.362 -15.431 1.00 72.53  ? 246 LEU A CD2   1 
ATOM 2665  N N     . PRO C 3 247 ? 26.223  163.601 -20.161 1.00 78.46  ? 247 PRO A N     1 
ATOM 2666  C CA    . PRO C 3 247 ? 25.997  164.362 -21.391 1.00 80.13  ? 247 PRO A CA    1 
ATOM 2667  C C     . PRO C 3 247 ? 25.145  165.605 -21.083 1.00 81.60  ? 247 PRO A C     1 
ATOM 2668  O O     . PRO C 3 247 ? 24.200  165.529 -20.286 1.00 81.82  ? 247 PRO A O     1 
ATOM 2669  C CB    . PRO C 3 247 ? 25.315  163.479 -22.436 1.00 79.52  ? 247 PRO A CB    1 
ATOM 2670  N N     . GLU C 3 248 ? 25.474  166.735 -21.722 1.00 83.34  ? 248 GLU A N     1 
ATOM 2671  C CA    . GLU C 3 248 ? 24.768  168.012 -21.501 1.00 84.51  ? 248 GLU A CA    1 
ATOM 2672  C C     . GLU C 3 248 ? 24.482  168.894 -22.739 1.00 84.96  ? 248 GLU A C     1 
ATOM 2673  O O     . GLU C 3 248 ? 23.544  169.704 -22.721 1.00 84.90  ? 248 GLU A O     1 
ATOM 2674  C CB    . GLU C 3 248 ? 25.517  168.837 -20.446 1.00 85.39  ? 248 GLU A CB    1 
ATOM 2675  N N     . LYS C 3 249 ? 25.303  168.767 -23.785 1.00 85.17  ? 249 LYS A N     1 
ATOM 2676  C CA    . LYS C 3 249 ? 25.148  169.559 -25.018 1.00 84.83  ? 249 LYS A CA    1 
ATOM 2677  C C     . LYS C 3 249 ? 23.807  169.323 -25.715 1.00 84.32  ? 249 LYS A C     1 
ATOM 2678  O O     . LYS C 3 249 ? 23.173  170.258 -26.233 1.00 84.84  ? 249 LYS A O     1 
ATOM 2679  C CB    . LYS C 3 249 ? 26.303  169.260 -25.988 1.00 84.33  ? 249 LYS A CB    1 
ATOM 2680  N N     . ASP C 3 250 ? 23.396  168.059 -25.720 1.00 83.55  ? 250 ASP A N     1 
ATOM 2681  C CA    . ASP C 3 250 ? 22.150  167.628 -26.331 1.00 82.71  ? 250 ASP A CA    1 
ATOM 2682  C C     . ASP C 3 250 ? 20.928  168.198 -25.607 1.00 82.58  ? 250 ASP A C     1 
ATOM 2683  O O     . ASP C 3 250 ? 19.978  168.634 -26.264 1.00 82.16  ? 250 ASP A O     1 
ATOM 2684  C CB    . ASP C 3 250 ? 22.093  166.106 -26.358 1.00 82.12  ? 250 ASP A CB    1 
ATOM 2685  N N     . SER C 3 251 ? 20.991  168.206 -24.267 1.00 82.55  ? 251 SER A N     1 
ATOM 2686  C CA    . SER C 3 251 ? 19.938  168.706 -23.359 1.00 81.90  ? 251 SER A CA    1 
ATOM 2687  C C     . SER C 3 251 ? 18.753  169.384 -24.048 1.00 81.46  ? 251 SER A C     1 
ATOM 2688  O O     . SER C 3 251 ? 18.636  170.616 -24.053 1.00 82.24  ? 251 SER A O     1 
ATOM 2689  C CB    . SER C 3 251 ? 20.541  169.656 -22.310 1.00 81.88  ? 251 SER A CB    1 
ATOM 2690  O OG    . SER C 3 251 ? 19.533  170.247 -21.501 1.00 80.44  ? 251 SER A OG    1 
ATOM 2691  N N     . TRP C 3 252 ? 17.893  168.562 -24.645 1.00 79.72  ? 252 TRP A N     1 
ATOM 2692  C CA    . TRP C 3 252 ? 16.716  169.038 -25.362 1.00 77.77  ? 252 TRP A CA    1 
ATOM 2693  C C     . TRP C 3 252 ? 15.809  167.879 -25.814 1.00 76.59  ? 252 TRP A C     1 
ATOM 2694  O O     . TRP C 3 252 ? 14.720  167.708 -25.253 1.00 76.72  ? 252 TRP A O     1 
ATOM 2695  C CB    . TRP C 3 252 ? 17.135  169.897 -26.561 1.00 77.12  ? 252 TRP A CB    1 
ATOM 2696  N N     . THR C 3 253 ? 16.243  167.094 -26.813 1.00 73.83  ? 253 THR A N     1 
ATOM 2697  C CA    . THR C 3 253 ? 15.445  165.963 -27.312 1.00 70.74  ? 253 THR A CA    1 
ATOM 2698  C C     . THR C 3 253 ? 15.104  165.046 -26.147 1.00 69.56  ? 253 THR A C     1 
ATOM 2699  O O     . THR C 3 253 ? 15.928  164.824 -25.257 1.00 67.95  ? 253 THR A O     1 
ATOM 2700  C CB    . THR C 3 253 ? 16.183  165.198 -28.402 1.00 69.19  ? 253 THR A CB    1 
ATOM 2701  N N     . VAL C 3 254 ? 13.866  164.560 -26.136 1.00 69.39  ? 254 VAL A N     1 
ATOM 2702  C CA    . VAL C 3 254 ? 13.365  163.701 -25.061 1.00 68.26  ? 254 VAL A CA    1 
ATOM 2703  C C     . VAL C 3 254 ? 14.376  162.676 -24.560 1.00 68.51  ? 254 VAL A C     1 
ATOM 2704  O O     . VAL C 3 254 ? 14.573  162.510 -23.357 1.00 67.41  ? 254 VAL A O     1 
ATOM 2705  C CB    . VAL C 3 254 ? 12.054  162.983 -25.470 1.00 66.81  ? 254 VAL A CB    1 
ATOM 2706  C CG1   . VAL C 3 254 ? 10.965  164.000 -25.768 1.00 65.74  ? 254 VAL A CG1   1 
ATOM 2707  C CG2   . VAL C 3 254 ? 12.289  162.089 -26.668 1.00 66.39  ? 254 VAL A CG2   1 
ATOM 2708  N N     . ASN C 3 255 ? 15.055  162.039 -25.502 1.00 69.53  ? 255 ASN A N     1 
ATOM 2709  C CA    . ASN C 3 255 ? 16.053  161.027 -25.204 1.00 71.53  ? 255 ASN A CA    1 
ATOM 2710  C C     . ASN C 3 255 ? 17.083  161.592 -24.237 1.00 72.43  ? 255 ASN A C     1 
ATOM 2711  O O     . ASN C 3 255 ? 17.308  161.050 -23.155 1.00 71.98  ? 255 ASN A O     1 
ATOM 2712  C CB    . ASN C 3 255 ? 16.743  160.613 -26.501 1.00 72.21  ? 255 ASN A CB    1 
ATOM 2713  C CG    . ASN C 3 255 ? 15.766  160.438 -27.641 1.00 73.25  ? 255 ASN A CG    1 
ATOM 2714  O OD1   . ASN C 3 255 ? 15.198  161.412 -28.145 1.00 73.41  ? 255 ASN A OD1   1 
ATOM 2715  N ND2   . ASN C 3 255 ? 15.549  159.192 -28.045 1.00 74.31  ? 255 ASN A ND2   1 
ATOM 2716  N N     . ASP C 3 256 ? 17.648  162.729 -24.631 1.00 73.48  ? 256 ASP A N     1 
ATOM 2717  C CA    . ASP C 3 256 ? 18.667  163.436 -23.869 1.00 73.86  ? 256 ASP A CA    1 
ATOM 2718  C C     . ASP C 3 256 ? 18.196  163.617 -22.434 1.00 73.06  ? 256 ASP A C     1 
ATOM 2719  O O     . ASP C 3 256 ? 18.975  163.488 -21.487 1.00 73.33  ? 256 ASP A O     1 
ATOM 2720  C CB    . ASP C 3 256 ? 18.935  164.807 -24.507 1.00 76.08  ? 256 ASP A CB    1 
ATOM 2721  C CG    . ASP C 3 256 ? 18.839  164.788 -26.045 1.00 77.59  ? 256 ASP A CG    1 
ATOM 2722  O OD1   . ASP C 3 256 ? 18.934  163.704 -26.673 1.00 78.46  ? 256 ASP A OD1   1 
ATOM 2723  O OD2   . ASP C 3 256 ? 18.661  165.881 -26.630 1.00 77.77  ? 256 ASP A OD2   1 
ATOM 2724  N N     . ILE C 3 257 ? 16.905  163.887 -22.285 1.00 71.61  ? 257 ILE A N     1 
ATOM 2725  C CA    . ILE C 3 257 ? 16.304  164.074 -20.972 1.00 71.07  ? 257 ILE A CA    1 
ATOM 2726  C C     . ILE C 3 257 ? 16.409  162.741 -20.264 1.00 69.99  ? 257 ILE A C     1 
ATOM 2727  O O     . ILE C 3 257 ? 17.089  162.605 -19.243 1.00 69.76  ? 257 ILE A O     1 
ATOM 2728  C CB    . ILE C 3 257 ? 14.813  164.447 -21.104 1.00 72.07  ? 257 ILE A CB    1 
ATOM 2729  C CG1   . ILE C 3 257 ? 14.650  165.530 -22.180 1.00 72.70  ? 257 ILE A CG1   1 
ATOM 2730  C CG2   . ILE C 3 257 ? 14.228  164.864 -19.750 1.00 71.14  ? 257 ILE A CG2   1 
ATOM 2731  C CD1   . ILE C 3 257 ? 15.716  166.632 -22.153 1.00 73.85  ? 257 ILE A CD1   1 
ATOM 2732  N N     . GLN C 3 258 ? 15.785  161.748 -20.883 1.00 69.05  ? 258 GLN A N     1 
ATOM 2733  C CA    . GLN C 3 258 ? 15.765  160.385 -20.384 1.00 68.72  ? 258 GLN A CA    1 
ATOM 2734  C C     . GLN C 3 258 ? 17.186  159.888 -20.140 1.00 66.72  ? 258 GLN A C     1 
ATOM 2735  O O     . GLN C 3 258 ? 17.422  159.055 -19.264 1.00 66.84  ? 258 GLN A O     1 
ATOM 2736  C CB    . GLN C 3 258 ? 15.055  159.490 -21.398 1.00 71.14  ? 258 GLN A CB    1 
ATOM 2737  C CG    . GLN C 3 258 ? 13.651  159.975 -21.769 1.00 73.86  ? 258 GLN A CG    1 
ATOM 2738  C CD    . GLN C 3 258 ? 13.101  159.298 -23.020 1.00 76.33  ? 258 GLN A CD    1 
ATOM 2739  O OE1   . GLN C 3 258 ? 11.887  159.101 -23.159 1.00 76.81  ? 258 GLN A OE1   1 
ATOM 2740  N NE2   . GLN C 3 258 ? 13.995  158.945 -23.944 1.00 77.67  ? 258 GLN A NE2   1 
ATOM 2741  N N     . LYS C 3 259 ? 18.133  160.416 -20.904 1.00 64.21  ? 259 LYS A N     1 
ATOM 2742  C CA    . LYS C 3 259 ? 19.519  160.026 -20.741 1.00 62.63  ? 259 LYS A CA    1 
ATOM 2743  C C     . LYS C 3 259 ? 19.962  160.492 -19.357 1.00 60.75  ? 259 LYS A C     1 
ATOM 2744  O O     . LYS C 3 259 ? 20.121  159.675 -18.458 1.00 61.07  ? 259 LYS A O     1 
ATOM 2745  C CB    . LYS C 3 259 ? 20.392  160.652 -21.836 1.00 63.88  ? 259 LYS A CB    1 
ATOM 2746  C CG    . LYS C 3 259 ? 21.450  159.711 -22.447 1.00 64.29  ? 259 LYS A CG    1 
ATOM 2747  C CD    . LYS C 3 259 ? 22.330  160.446 -23.469 1.00 64.73  ? 259 LYS A CD    1 
ATOM 2748  C CE    . LYS C 3 259 ? 23.386  159.544 -24.117 1.00 65.04  ? 259 LYS A CE    1 
ATOM 2749  N NZ    . LYS C 3 259 ? 22.932  158.938 -25.405 1.00 64.43  ? 259 LYS A NZ    1 
ATOM 2750  N N     . LEU C 3 260 ? 20.045  161.807 -19.161 1.00 58.83  ? 260 LEU A N     1 
ATOM 2751  C CA    . LEU C 3 260 ? 20.478  162.366 -17.883 1.00 57.06  ? 260 LEU A CA    1 
ATOM 2752  C C     . LEU C 3 260 ? 19.810  161.722 -16.683 1.00 55.69  ? 260 LEU A C     1 
ATOM 2753  O O     . LEU C 3 260 ? 20.487  161.173 -15.814 1.00 54.32  ? 260 LEU A O     1 
ATOM 2754  C CB    . LEU C 3 260 ? 20.226  163.870 -17.829 1.00 57.63  ? 260 LEU A CB    1 
ATOM 2755  C CG    . LEU C 3 260 ? 20.682  164.470 -16.494 1.00 57.94  ? 260 LEU A CG    1 
ATOM 2756  C CD1   . LEU C 3 260 ? 22.190  164.239 -16.314 1.00 58.27  ? 260 LEU A CD1   1 
ATOM 2757  C CD2   . LEU C 3 260 ? 20.340  165.946 -16.431 1.00 56.83  ? 260 LEU A CD2   1 
ATOM 2758  N N     . VAL C 3 261 ? 18.483  161.816 -16.649 1.00 55.50  ? 261 VAL A N     1 
ATOM 2759  C CA    . VAL C 3 261 ? 17.655  161.266 -15.574 1.00 55.23  ? 261 VAL A CA    1 
ATOM 2760  C C     . VAL C 3 261 ? 18.219  159.976 -15.017 1.00 54.70  ? 261 VAL A C     1 
ATOM 2761  O O     . VAL C 3 261 ? 18.530  159.874 -13.828 1.00 53.08  ? 261 VAL A O     1 
ATOM 2762  C CB    . VAL C 3 261 ? 16.226  160.962 -16.074 1.00 56.08  ? 261 VAL A CB    1 
ATOM 2763  C CG1   . VAL C 3 261 ? 15.411  160.265 -14.980 1.00 56.23  ? 261 VAL A CG1   1 
ATOM 2764  C CG2   . VAL C 3 261 ? 15.546  162.242 -16.519 1.00 56.00  ? 261 VAL A CG2   1 
ATOM 2765  N N     . GLY C 3 262 ? 18.331  158.995 -15.906 1.00 54.21  ? 262 GLY A N     1 
ATOM 2766  C CA    . GLY C 3 262 ? 18.847  157.696 -15.536 1.00 53.80  ? 262 GLY A CA    1 
ATOM 2767  C C     . GLY C 3 262 ? 20.253  157.769 -14.989 1.00 52.83  ? 262 GLY A C     1 
ATOM 2768  O O     . GLY C 3 262 ? 20.525  157.220 -13.926 1.00 53.45  ? 262 GLY A O     1 
ATOM 2769  N N     . LYS C 3 263 ? 21.138  158.456 -15.709 1.00 50.93  ? 263 LYS A N     1 
ATOM 2770  C CA    . LYS C 3 263 ? 22.531  158.600 -15.297 1.00 49.04  ? 263 LYS A CA    1 
ATOM 2771  C C     . LYS C 3 263 ? 22.528  158.896 -13.812 1.00 46.83  ? 263 LYS A C     1 
ATOM 2772  O O     . LYS C 3 263 ? 23.194  158.232 -13.003 1.00 43.49  ? 263 LYS A O     1 
ATOM 2773  C CB    . LYS C 3 263 ? 23.180  159.750 -16.071 1.00 51.00  ? 263 LYS A CB    1 
ATOM 2774  C CG    . LYS C 3 263 ? 23.243  159.532 -17.586 1.00 54.44  ? 263 LYS A CG    1 
ATOM 2775  C CD    . LYS C 3 263 ? 24.003  158.244 -17.955 1.00 56.79  ? 263 LYS A CD    1 
ATOM 2776  C CE    . LYS C 3 263 ? 25.474  158.475 -18.335 1.00 58.52  ? 263 LYS A CE    1 
ATOM 2777  N NZ    . LYS C 3 263 ? 25.658  158.946 -19.748 1.00 59.89  ? 263 LYS A NZ    1 
ATOM 2778  N N     . LEU C 3 264 ? 21.657  159.834 -13.472 1.00 45.56  ? 264 LEU A N     1 
ATOM 2779  C CA    . LEU C 3 264 ? 21.451  160.258 -12.108 1.00 44.81  ? 264 LEU A CA    1 
ATOM 2780  C C     . LEU C 3 264 ? 21.073  158.983 -11.354 1.00 43.59  ? 264 LEU A C     1 
ATOM 2781  O O     . LEU C 3 264 ? 21.886  158.449 -10.588 1.00 42.86  ? 264 LEU A O     1 
ATOM 2782  C CB    . LEU C 3 264 ? 20.298  161.270 -12.072 1.00 45.29  ? 264 LEU A CB    1 
ATOM 2783  C CG    . LEU C 3 264 ? 20.242  162.281 -13.228 1.00 45.00  ? 264 LEU A CG    1 
ATOM 2784  C CD1   . LEU C 3 264 ? 18.972  163.099 -13.175 1.00 42.55  ? 264 LEU A CD1   1 
ATOM 2785  C CD2   . LEU C 3 264 ? 21.467  163.176 -13.199 1.00 46.20  ? 264 LEU A CD2   1 
ATOM 2786  N N     . ASN C 3 265 ? 19.880  158.462 -11.670 1.00 42.11  ? 265 ASN A N     1 
ATOM 2787  C CA    . ASN C 3 265 ? 19.332  157.241 -11.073 1.00 40.70  ? 265 ASN A CA    1 
ATOM 2788  C C     . ASN C 3 265 ? 20.454  156.265 -10.839 1.00 39.75  ? 265 ASN A C     1 
ATOM 2789  O O     . ASN C 3 265 ? 20.622  155.759 -9.742  1.00 39.25  ? 265 ASN A O     1 
ATOM 2790  C CB    . ASN C 3 265 ? 18.322  156.576 -12.013 1.00 41.77  ? 265 ASN A CB    1 
ATOM 2791  C CG    . ASN C 3 265 ? 16.870  156.888 -11.658 1.00 44.79  ? 265 ASN A CG    1 
ATOM 2792  O OD1   . ASN C 3 265 ? 16.536  157.172 -10.498 1.00 45.70  ? 265 ASN A OD1   1 
ATOM 2793  N ND2   . ASN C 3 265 ? 15.987  156.799 -12.659 1.00 45.24  ? 265 ASN A ND2   1 
ATOM 2794  N N     . TRP C 3 266 ? 21.281  156.093 -11.862 1.00 39.25  ? 266 TRP A N     1 
ATOM 2795  C CA    . TRP C 3 266 ? 22.399  155.179 -11.808 1.00 36.90  ? 266 TRP A CA    1 
ATOM 2796  C C     . TRP C 3 266 ? 23.455  155.596 -10.811 1.00 34.79  ? 266 TRP A C     1 
ATOM 2797  O O     . TRP C 3 266 ? 23.845  154.809 -9.950  1.00 31.97  ? 266 TRP A O     1 
ATOM 2798  C CB    . TRP C 3 266 ? 23.026  155.034 -13.185 1.00 36.71  ? 266 TRP A CB    1 
ATOM 2799  C CG    . TRP C 3 266 ? 24.216  154.225 -13.113 1.00 37.71  ? 266 TRP A CG    1 
ATOM 2800  C CD1   . TRP C 3 266 ? 25.477  154.626 -13.361 1.00 39.28  ? 266 TRP A CD1   1 
ATOM 2801  C CD2   . TRP C 3 266 ? 24.297  152.877 -12.662 1.00 38.96  ? 266 TRP A CD2   1 
ATOM 2802  N NE1   . TRP C 3 266 ? 26.361  153.615 -13.084 1.00 40.51  ? 266 TRP A NE1   1 
ATOM 2803  C CE2   . TRP C 3 266 ? 25.658  152.524 -12.653 1.00 40.48  ? 266 TRP A CE2   1 
ATOM 2804  C CE3   . TRP C 3 266 ? 23.352  151.931 -12.260 1.00 41.31  ? 266 TRP A CE3   1 
ATOM 2805  C CZ2   . TRP C 3 266 ? 26.106  151.266 -12.258 1.00 40.35  ? 266 TRP A CZ2   1 
ATOM 2806  C CZ3   . TRP C 3 266 ? 23.794  150.679 -11.868 1.00 42.42  ? 266 TRP A CZ3   1 
ATOM 2807  C CH2   . TRP C 3 266 ? 25.161  150.357 -11.869 1.00 41.83  ? 266 TRP A CH2   1 
ATOM 2808  N N     . ALA C 3 267 ? 23.913  156.835 -10.943 1.00 33.73  ? 267 ALA A N     1 
ATOM 2809  C CA    . ALA C 3 267 ? 24.932  157.384 -10.058 1.00 34.45  ? 267 ALA A CA    1 
ATOM 2810  C C     . ALA C 3 267 ? 24.428  157.576 -8.624  1.00 34.79  ? 267 ALA A C     1 
ATOM 2811  O O     . ALA C 3 267 ? 25.187  157.949 -7.723  1.00 33.55  ? 267 ALA A O     1 
ATOM 2812  C CB    . ALA C 3 267 ? 25.443  158.690 -10.615 1.00 34.81  ? 267 ALA A CB    1 
ATOM 2813  N N     . SER C 3 268 ? 23.153  157.263 -8.418  1.00 36.40  ? 268 SER A N     1 
ATOM 2814  C CA    . SER C 3 268 ? 22.510  157.393 -7.110  1.00 39.47  ? 268 SER A CA    1 
ATOM 2815  C C     . SER C 3 268 ? 22.980  156.363 -6.074  1.00 42.83  ? 268 SER A C     1 
ATOM 2816  O O     . SER C 3 268 ? 22.467  156.331 -4.940  1.00 42.69  ? 268 SER A O     1 
ATOM 2817  C CB    . SER C 3 268 ? 21.000  157.256 -7.269  1.00 37.39  ? 268 SER A CB    1 
ATOM 2818  O OG    . SER C 3 268 ? 20.580  157.802 -8.498  1.00 33.38  ? 268 SER A OG    1 
ATOM 2819  N N     . GLN C 3 269 ? 23.939  155.525 -6.474  1.00 45.07  ? 269 GLN A N     1 
ATOM 2820  C CA    . GLN C 3 269 ? 24.485  154.465 -5.623  1.00 46.13  ? 269 GLN A CA    1 
ATOM 2821  C C     . GLN C 3 269 ? 25.304  154.968 -4.427  1.00 46.00  ? 269 GLN A C     1 
ATOM 2822  O O     . GLN C 3 269 ? 25.209  154.417 -3.324  1.00 44.98  ? 269 GLN A O     1 
ATOM 2823  C CB    . GLN C 3 269 ? 25.310  153.494 -6.469  1.00 45.97  ? 269 GLN A CB    1 
ATOM 2824  C CG    . GLN C 3 269 ? 24.558  152.918 -7.663  1.00 45.73  ? 269 GLN A CG    1 
ATOM 2825  C CD    . GLN C 3 269 ? 25.471  152.153 -8.611  1.00 45.64  ? 269 GLN A CD    1 
ATOM 2826  O OE1   . GLN C 3 269 ? 25.614  152.516 -9.780  1.00 43.36  ? 269 GLN A OE1   1 
ATOM 2827  N NE2   . GLN C 3 269 ? 26.099  151.095 -8.105  1.00 43.91  ? 269 GLN A NE2   1 
ATOM 2828  N N     . ILE C 3 270 ? 26.152  155.965 -4.650  1.00 46.38  ? 270 ILE A N     1 
ATOM 2829  C CA    . ILE C 3 270 ? 26.921  156.515 -3.542  1.00 48.42  ? 270 ILE A CA    1 
ATOM 2830  C C     . ILE C 3 270 ? 26.961  158.021 -3.552  1.00 49.16  ? 270 ILE A C     1 
ATOM 2831  O O     . ILE C 3 270 ? 27.416  158.631 -2.583  1.00 49.67  ? 270 ILE A O     1 
ATOM 2832  C CB    . ILE C 3 270 ? 28.344  155.961 -3.416  1.00 48.95  ? 270 ILE A CB    1 
ATOM 2833  C CG1   . ILE C 3 270 ? 29.002  155.840 -4.787  1.00 50.51  ? 270 ILE A CG1   1 
ATOM 2834  C CG2   . ILE C 3 270 ? 28.331  154.679 -2.593  1.00 47.74  ? 270 ILE A CG2   1 
ATOM 2835  C CD1   . ILE C 3 270 ? 30.496  155.644 -4.709  1.00 51.57  ? 270 ILE A CD1   1 
ATOM 2836  N N     . TYR C 3 271 ? 26.531  158.622 -4.658  1.00 49.75  ? 271 TYR A N     1 
ATOM 2837  C CA    . TYR C 3 271 ? 26.466  160.071 -4.723  1.00 50.22  ? 271 TYR A CA    1 
ATOM 2838  C C     . TYR C 3 271 ? 25.225  160.390 -3.910  1.00 49.10  ? 271 TYR A C     1 
ATOM 2839  O O     . TYR C 3 271 ? 24.104  160.147 -4.355  1.00 49.31  ? 271 TYR A O     1 
ATOM 2840  C CB    . TYR C 3 271 ? 26.273  160.541 -6.152  1.00 53.17  ? 271 TYR A CB    1 
ATOM 2841  C CG    . TYR C 3 271 ? 27.551  160.658 -6.936  1.00 55.30  ? 271 TYR A CG    1 
ATOM 2842  C CD1   . TYR C 3 271 ? 28.739  161.042 -6.319  1.00 55.28  ? 271 TYR A CD1   1 
ATOM 2843  C CD2   . TYR C 3 271 ? 27.569  160.399 -8.310  1.00 56.03  ? 271 TYR A CD2   1 
ATOM 2844  C CE1   . TYR C 3 271 ? 29.915  161.164 -7.050  1.00 57.52  ? 271 TYR A CE1   1 
ATOM 2845  C CE2   . TYR C 3 271 ? 28.732  160.515 -9.051  1.00 56.51  ? 271 TYR A CE2   1 
ATOM 2846  C CZ    . TYR C 3 271 ? 29.902  160.897 -8.421  1.00 58.26  ? 271 TYR A CZ    1 
ATOM 2847  O OH    . TYR C 3 271 ? 31.050  161.006 -9.171  1.00 59.68  ? 271 TYR A OH    1 
ATOM 2848  N N     . PRO C 3 272 ? 25.412  160.907 -2.693  1.00 48.29  ? 272 PRO A N     1 
ATOM 2849  C CA    . PRO C 3 272 ? 24.324  161.257 -1.784  1.00 49.29  ? 272 PRO A CA    1 
ATOM 2850  C C     . PRO C 3 272 ? 23.148  162.036 -2.373  1.00 50.03  ? 272 PRO A C     1 
ATOM 2851  O O     . PRO C 3 272 ? 23.324  162.945 -3.193  1.00 50.48  ? 272 PRO A O     1 
ATOM 2852  C CB    . PRO C 3 272 ? 25.044  162.014 -0.664  1.00 49.21  ? 272 PRO A CB    1 
ATOM 2853  C CG    . PRO C 3 272 ? 26.272  162.532 -1.327  1.00 49.13  ? 272 PRO A CG    1 
ATOM 2854  C CD    . PRO C 3 272 ? 26.697  161.362 -2.145  1.00 48.29  ? 272 PRO A CD    1 
ATOM 2855  N N     . GLY C 3 273 ? 21.955  161.607 -1.949  1.00 50.33  ? 273 GLY A N     1 
ATOM 2856  C CA    . GLY C 3 273 ? 20.666  162.165 -2.343  1.00 49.67  ? 273 GLY A CA    1 
ATOM 2857  C C     . GLY C 3 273 ? 20.529  163.244 -3.399  1.00 48.63  ? 273 GLY A C     1 
ATOM 2858  O O     . GLY C 3 273 ? 21.047  164.351 -3.264  1.00 50.26  ? 273 GLY A O     1 
ATOM 2859  N N     . ILE C 3 274 ? 19.806  162.917 -4.457  1.00 47.35  ? 274 ILE A N     1 
ATOM 2860  C CA    . ILE C 3 274 ? 19.568  163.862 -5.531  1.00 46.17  ? 274 ILE A CA    1 
ATOM 2861  C C     . ILE C 3 274 ? 18.089  163.837 -5.834  1.00 46.52  ? 274 ILE A C     1 
ATOM 2862  O O     . ILE C 3 274 ? 17.369  162.921 -5.447  1.00 46.12  ? 274 ILE A O     1 
ATOM 2863  C CB    . ILE C 3 274 ? 20.393  163.523 -6.798  1.00 46.32  ? 274 ILE A CB    1 
ATOM 2864  C CG1   . ILE C 3 274 ? 21.868  163.845 -6.547  1.00 43.77  ? 274 ILE A CG1   1 
ATOM 2865  C CG2   . ILE C 3 274 ? 19.840  164.245 -8.047  1.00 42.84  ? 274 ILE A CG2   1 
ATOM 2866  C CD1   . ILE C 3 274 ? 22.638  162.710 -5.924  1.00 42.52  ? 274 ILE A CD1   1 
ATOM 2867  N N     . LYS C 3 275 ? 17.626  164.890 -6.476  1.00 48.15  ? 275 LYS A N     1 
ATOM 2868  C CA    . LYS C 3 275 ? 16.233  164.983 -6.821  1.00 51.98  ? 275 LYS A CA    1 
ATOM 2869  C C     . LYS C 3 275 ? 16.085  164.932 -8.322  1.00 54.56  ? 275 LYS A C     1 
ATOM 2870  O O     . LYS C 3 275 ? 16.369  165.913 -9.017  1.00 56.32  ? 275 LYS A O     1 
ATOM 2871  C CB    . LYS C 3 275 ? 15.649  166.281 -6.280  1.00 52.98  ? 275 LYS A CB    1 
ATOM 2872  N N     . VAL C 3 276 ? 15.670  163.784 -8.838  1.00 56.23  ? 276 VAL A N     1 
ATOM 2873  C CA    . VAL C 3 276 ? 15.477  163.693 -10.272 1.00 58.16  ? 276 VAL A CA    1 
ATOM 2874  C C     . VAL C 3 276 ? 14.084  164.193 -10.662 1.00 59.31  ? 276 VAL A C     1 
ATOM 2875  O O     . VAL C 3 276 ? 13.928  164.777 -11.740 1.00 59.48  ? 276 VAL A O     1 
ATOM 2876  C CB    . VAL C 3 276 ? 15.730  162.272 -10.809 1.00 58.02  ? 276 VAL A CB    1 
ATOM 2877  C CG1   . VAL C 3 276 ? 15.529  162.235 -12.321 1.00 57.56  ? 276 VAL A CG1   1 
ATOM 2878  C CG2   . VAL C 3 276 ? 17.152  161.852 -10.474 1.00 60.61  ? 276 VAL A CG2   1 
ATOM 2879  N N     . ARG C 3 277 ? 13.108  164.045 -9.752  1.00 59.73  ? 277 ARG A N     1 
ATOM 2880  C CA    . ARG C 3 277 ? 11.709  164.473 -9.985  1.00 59.27  ? 277 ARG A CA    1 
ATOM 2881  C C     . ARG C 3 277 ? 11.590  165.816 -10.701 1.00 57.41  ? 277 ARG A C     1 
ATOM 2882  O O     . ARG C 3 277 ? 10.763  165.979 -11.607 1.00 57.24  ? 277 ARG A O     1 
ATOM 2883  C CB    . ARG C 3 277 ? 10.905  164.534 -8.669  1.00 60.72  ? 277 ARG A CB    1 
ATOM 2884  C CG    . ARG C 3 277 ? 9.444   165.017 -8.844  1.00 62.35  ? 277 ARG A CG    1 
ATOM 2885  C CD    . ARG C 3 277 ? 8.604   164.954 -7.555  1.00 63.25  ? 277 ARG A CD    1 
ATOM 2886  N NE    . ARG C 3 277 ? 8.907   166.023 -6.599  1.00 65.75  ? 277 ARG A NE    1 
ATOM 2887  C CZ    . ARG C 3 277 ? 9.271   165.823 -5.332  1.00 65.99  ? 277 ARG A CZ    1 
ATOM 2888  N NH1   . ARG C 3 277 ? 9.381   164.590 -4.860  1.00 65.98  ? 277 ARG A NH1   1 
ATOM 2889  N NH2   . ARG C 3 277 ? 9.529   166.856 -4.533  1.00 65.52  ? 277 ARG A NH2   1 
ATOM 2890  N N     . GLN C 3 278 ? 12.428  166.760 -10.277 1.00 54.94  ? 278 GLN A N     1 
ATOM 2891  C CA    . GLN C 3 278 ? 12.471  168.092 -10.846 1.00 53.47  ? 278 GLN A CA    1 
ATOM 2892  C C     . GLN C 3 278 ? 12.514  167.956 -12.358 1.00 52.83  ? 278 GLN A C     1 
ATOM 2893  O O     . GLN C 3 278 ? 11.590  168.338 -13.070 1.00 52.57  ? 278 GLN A O     1 
ATOM 2894  C CB    . GLN C 3 278 ? 13.709  168.808 -10.340 1.00 52.02  ? 278 GLN A CB    1 
ATOM 2895  N N     . LEU C 3 279 ? 13.549  167.284 -12.822 1.00 53.24  ? 279 LEU A N     1 
ATOM 2896  C CA    . LEU C 3 279 ? 13.754  167.062 -14.237 1.00 54.55  ? 279 LEU A CA    1 
ATOM 2897  C C     . LEU C 3 279 ? 12.786  166.028 -14.789 1.00 54.88  ? 279 LEU A C     1 
ATOM 2898  O O     . LEU C 3 279 ? 12.253  166.196 -15.885 1.00 53.97  ? 279 LEU A O     1 
ATOM 2899  C CB    . LEU C 3 279 ? 15.185  166.597 -14.462 1.00 54.86  ? 279 LEU A CB    1 
ATOM 2900  C CG    . LEU C 3 279 ? 16.226  167.345 -13.620 1.00 57.34  ? 279 LEU A CG    1 
ATOM 2901  C CD1   . LEU C 3 279 ? 16.219  166.849 -12.159 1.00 56.93  ? 279 LEU A CD1   1 
ATOM 2902  C CD2   . LEU C 3 279 ? 17.601  167.149 -14.245 1.00 57.65  ? 279 LEU A CD2   1 
ATOM 2903  N N     . SER C 3 280 ? 12.584  164.948 -14.034 1.00 56.32  ? 280 SER A N     1 
ATOM 2904  C CA    . SER C 3 280 ? 11.685  163.865 -14.434 1.00 57.15  ? 280 SER A CA    1 
ATOM 2905  C C     . SER C 3 280 ? 10.364  164.429 -14.906 1.00 57.85  ? 280 SER A C     1 
ATOM 2906  O O     . SER C 3 280 ? 9.771   163.933 -15.867 1.00 58.16  ? 280 SER A O     1 
ATOM 2907  C CB    . SER C 3 280 ? 11.451  162.890 -13.277 1.00 57.32  ? 280 SER A CB    1 
ATOM 2908  O OG    . SER C 3 280 ? 12.580  162.054 -13.088 1.00 57.36  ? 280 SER A OG    1 
ATOM 2909  N N     . LYS C 3 281 ? 9.915   165.478 -14.227 1.00 57.85  ? 281 LYS A N     1 
ATOM 2910  C CA    . LYS C 3 281 ? 8.680   166.141 -14.596 1.00 58.23  ? 281 LYS A CA    1 
ATOM 2911  C C     . LYS C 3 281 ? 8.836   166.509 -16.067 1.00 58.26  ? 281 LYS A C     1 
ATOM 2912  O O     . LYS C 3 281 ? 8.049   166.082 -16.915 1.00 58.19  ? 281 LYS A O     1 
ATOM 2913  C CB    . LYS C 3 281 ? 8.497   167.383 -13.754 1.00 57.45  ? 281 LYS A CB    1 
ATOM 2914  N N     . LEU C 3 282 ? 9.929   167.208 -16.367 1.00 58.31  ? 282 LEU A N     1 
ATOM 2915  C CA    . LEU C 3 282 ? 10.232  167.628 -17.727 1.00 59.15  ? 282 LEU A CA    1 
ATOM 2916  C C     . LEU C 3 282 ? 10.379  166.421 -18.666 1.00 59.56  ? 282 LEU A C     1 
ATOM 2917  O O     . LEU C 3 282 ? 10.414  166.581 -19.886 1.00 60.17  ? 282 LEU A O     1 
ATOM 2918  C CB    . LEU C 3 282 ? 11.501  168.489 -17.745 1.00 59.05  ? 282 LEU A CB    1 
ATOM 2919  N N     . LEU C 3 283 ? 10.467  165.217 -18.099 1.00 59.06  ? 283 LEU A N     1 
ATOM 2920  C CA    . LEU C 3 283 ? 10.582  163.998 -18.902 1.00 58.81  ? 283 LEU A CA    1 
ATOM 2921  C C     . LEU C 3 283 ? 9.195   163.437 -19.265 1.00 58.38  ? 283 LEU A C     1 
ATOM 2922  O O     . LEU C 3 283 ? 9.056   162.663 -20.218 1.00 58.21  ? 283 LEU A O     1 
ATOM 2923  C CB    . LEU C 3 283 ? 11.412  162.944 -18.161 1.00 56.77  ? 283 LEU A CB    1 
ATOM 2924  N N     . ARG C 3 284 ? 8.171   163.879 -18.533 1.00 57.87  ? 284 ARG A N     1 
ATOM 2925  C CA    . ARG C 3 284 ? 6.791   163.433 -18.742 1.00 57.81  ? 284 ARG A CA    1 
ATOM 2926  C C     . ARG C 3 284 ? 6.095   164.039 -19.971 1.00 57.96  ? 284 ARG A C     1 
ATOM 2927  O O     . ARG C 3 284 ? 6.717   164.238 -21.016 1.00 59.00  ? 284 ARG A O     1 
ATOM 2928  C CB    . ARG C 3 284 ? 5.973   163.702 -17.481 1.00 56.90  ? 284 ARG A CB    1 
ATOM 2929  N N     . GLY C 3 285 ? 4.783   164.247 -19.851 1.00 58.56  ? 285 GLY A N     1 
ATOM 2930  C CA    . GLY C 3 285 ? 3.981   164.835 -20.916 1.00 60.07  ? 285 GLY A CA    1 
ATOM 2931  C C     . GLY C 3 285 ? 4.047   164.216 -22.302 1.00 61.68  ? 285 GLY A C     1 
ATOM 2932  O O     . GLY C 3 285 ? 3.629   163.067 -22.510 1.00 60.05  ? 285 GLY A O     1 
ATOM 2933  N N     . THR C 3 286 ? 4.501   165.014 -23.271 1.00 63.97  ? 286 THR A N     1 
ATOM 2934  C CA    . THR C 3 286 ? 4.626   164.532 -24.641 1.00 66.29  ? 286 THR A CA    1 
ATOM 2935  C C     . THR C 3 286 ? 5.815   163.613 -24.645 1.00 67.68  ? 286 THR A C     1 
ATOM 2936  O O     . THR C 3 286 ? 6.904   163.962 -24.168 1.00 67.20  ? 286 THR A O     1 
ATOM 2937  C CB    . THR C 3 286 ? 4.883   165.645 -25.716 1.00 66.40  ? 286 THR A CB    1 
ATOM 2938  O OG1   . THR C 3 286 ? 6.295   165.862 -25.883 1.00 66.41  ? 286 THR A OG1   1 
ATOM 2939  C CG2   . THR C 3 286 ? 4.183   166.955 -25.342 1.00 66.07  ? 286 THR A CG2   1 
ATOM 2940  N N     . LYS C 3 287 ? 5.570   162.410 -25.133 1.00 69.43  ? 287 LYS A N     1 
ATOM 2941  C CA    . LYS C 3 287 ? 6.606   161.408 -25.232 1.00 71.32  ? 287 LYS A CA    1 
ATOM 2942  C C     . LYS C 3 287 ? 7.070   161.373 -26.698 1.00 73.11  ? 287 LYS A C     1 
ATOM 2943  O O     . LYS C 3 287 ? 7.607   160.370 -27.190 1.00 73.74  ? 287 LYS A O     1 
ATOM 2944  C CB    . LYS C 3 287 ? 6.063   160.059 -24.742 1.00 71.00  ? 287 LYS A CB    1 
ATOM 2945  C CG    . LYS C 3 287 ? 5.715   160.041 -23.244 1.00 69.28  ? 287 LYS A CG    1 
ATOM 2946  C CD    . LYS C 3 287 ? 6.905   159.600 -22.417 1.00 69.19  ? 287 LYS A CD    1 
ATOM 2947  C CE    . LYS C 3 287 ? 7.273   158.161 -22.759 1.00 69.40  ? 287 LYS A CE    1 
ATOM 2948  N NZ    . LYS C 3 287 ? 8.748   157.937 -22.804 1.00 70.61  ? 287 LYS A NZ    1 
ATOM 2949  N N     . ALA C 3 288 ? 6.850   162.496 -27.383 1.00 74.21  ? 288 ALA A N     1 
ATOM 2950  C CA    . ALA C 3 288 ? 7.250   162.659 -28.772 1.00 75.65  ? 288 ALA A CA    1 
ATOM 2951  C C     . ALA C 3 288 ? 8.786   162.730 -28.822 1.00 77.03  ? 288 ALA A C     1 
ATOM 2952  O O     . ALA C 3 288 ? 9.390   163.635 -28.229 1.00 76.50  ? 288 ALA A O     1 
ATOM 2953  C CB    . ALA C 3 288 ? 6.633   163.930 -29.334 1.00 75.96  ? 288 ALA A CB    1 
ATOM 2954  N N     . LEU C 3 289 ? 9.393   161.761 -29.518 1.00 78.44  ? 289 LEU A N     1 
ATOM 2955  C CA    . LEU C 3 289 ? 10.856  161.623 -29.669 1.00 80.56  ? 289 LEU A CA    1 
ATOM 2956  C C     . LEU C 3 289 ? 11.672  162.895 -29.985 1.00 81.86  ? 289 LEU A C     1 
ATOM 2957  O O     . LEU C 3 289 ? 12.665  163.209 -29.305 1.00 81.32  ? 289 LEU A O     1 
ATOM 2958  C CB    . LEU C 3 289 ? 11.165  160.539 -30.705 1.00 79.56  ? 289 LEU A CB    1 
ATOM 2959  N N     . THR C 3 290 ? 11.253  163.606 -31.031 1.00 83.70  ? 290 THR A N     1 
ATOM 2960  C CA    . THR C 3 290 ? 11.916  164.833 -31.480 1.00 85.24  ? 290 THR A CA    1 
ATOM 2961  C C     . THR C 3 290 ? 11.603  166.110 -30.671 1.00 85.80  ? 290 THR A C     1 
ATOM 2962  O O     . THR C 3 290 ? 12.445  167.017 -30.586 1.00 85.50  ? 290 THR A O     1 
ATOM 2963  C CB    . THR C 3 290 ? 11.623  165.061 -32.973 1.00 85.70  ? 290 THR A CB    1 
ATOM 2964  N N     . GLU C 3 291 ? 10.397  166.186 -30.100 1.00 85.93  ? 291 GLU A N     1 
ATOM 2965  C CA    . GLU C 3 291 ? 9.977   167.341 -29.304 1.00 84.84  ? 291 GLU A CA    1 
ATOM 2966  C C     . GLU C 3 291 ? 11.027  167.608 -28.228 1.00 83.64  ? 291 GLU A C     1 
ATOM 2967  O O     . GLU C 3 291 ? 11.659  166.678 -27.709 1.00 83.01  ? 291 GLU A O     1 
ATOM 2968  C CB    . GLU C 3 291 ? 8.600   167.090 -28.678 1.00 85.46  ? 291 GLU A CB    1 
ATOM 2969  C CG    . GLU C 3 291 ? 7.706   168.324 -28.653 1.00 87.01  ? 291 GLU A CG    1 
ATOM 2970  C CD    . GLU C 3 291 ? 6.227   167.994 -28.462 1.00 88.11  ? 291 GLU A CD    1 
ATOM 2971  O OE1   . GLU C 3 291 ? 5.789   166.881 -28.833 1.00 87.78  ? 291 GLU A OE1   1 
ATOM 2972  O OE2   . GLU C 3 291 ? 5.493   168.862 -27.946 1.00 88.31  ? 291 GLU A OE2   1 
ATOM 2973  N N     . VAL C 3 292 ? 11.237  168.882 -27.921 1.00 82.16  ? 292 VAL A N     1 
ATOM 2974  C CA    . VAL C 3 292 ? 12.248  169.255 -26.946 1.00 80.91  ? 292 VAL A CA    1 
ATOM 2975  C C     . VAL C 3 292 ? 11.791  170.265 -25.910 1.00 80.16  ? 292 VAL A C     1 
ATOM 2976  O O     . VAL C 3 292 ? 11.929  171.476 -26.101 1.00 79.12  ? 292 VAL A O     1 
ATOM 2977  C CB    . VAL C 3 292 ? 13.484  169.771 -27.671 1.00 80.53  ? 292 VAL A CB    1 
ATOM 2978  N N     . ILE C 3 293 ? 11.262  169.762 -24.800 1.00 80.02  ? 293 ILE A N     1 
ATOM 2979  C CA    . ILE C 3 293 ? 10.823  170.637 -23.719 1.00 80.24  ? 293 ILE A CA    1 
ATOM 2980  C C     . ILE C 3 293 ? 12.020  171.459 -23.217 1.00 80.11  ? 293 ILE A C     1 
ATOM 2981  O O     . ILE C 3 293 ? 13.172  171.005 -23.253 1.00 79.97  ? 293 ILE A O     1 
ATOM 2982  C CB    . ILE C 3 293 ? 10.231  169.808 -22.590 1.00 79.82  ? 293 ILE A CB    1 
ATOM 2983  N N     . PRO C 3 294 ? 11.736  172.676 -22.767 1.00 79.95  ? 294 PRO A N     1 
ATOM 2984  C CA    . PRO C 3 294 ? 12.774  173.557 -22.268 1.00 80.30  ? 294 PRO A CA    1 
ATOM 2985  C C     . PRO C 3 294 ? 12.471  174.156 -20.892 1.00 80.47  ? 294 PRO A C     1 
ATOM 2986  O O     . PRO C 3 294 ? 13.024  175.195 -20.547 1.00 82.25  ? 294 PRO A O     1 
ATOM 2987  C CB    . PRO C 3 294 ? 13.073  174.652 -23.282 1.00 80.67  ? 294 PRO A CB    1 
ATOM 2988  N N     . LEU C 3 295 ? 11.577  173.521 -20.124 1.00 73.77  ? 295 LEU A N     1 
ATOM 2989  C CA    . LEU C 3 295 ? 11.274  173.969 -18.748 1.00 72.29  ? 295 LEU A CA    1 
ATOM 2990  C C     . LEU C 3 295 ? 12.580  173.853 -17.962 1.00 74.35  ? 295 LEU A C     1 
ATOM 2991  O O     . LEU C 3 295 ? 12.609  173.935 -16.730 1.00 74.30  ? 295 LEU A O     1 
ATOM 2992  C CB    . LEU C 3 295 ? 10.225  173.050 -18.119 1.00 68.23  ? 295 LEU A CB    1 
ATOM 2993  N N     . THR C 3 296 ? 13.661  173.649 -18.713 1.00 77.88  ? 296 THR A N     1 
ATOM 2994  C CA    . THR C 3 296 ? 15.019  173.512 -18.231 1.00 77.37  ? 296 THR A CA    1 
ATOM 2995  C C     . THR C 3 296 ? 15.259  174.550 -17.144 1.00 81.39  ? 296 THR A C     1 
ATOM 2996  O O     . THR C 3 296 ? 15.946  174.281 -16.155 1.00 84.69  ? 296 THR A O     1 
ATOM 2997  C CB    . THR C 3 296 ? 16.039  173.718 -19.390 1.00 84.61  ? 296 THR A CB    1 
ATOM 2998  O OG1   . THR C 3 296 ? 15.605  172.968 -20.535 1.00 86.39  ? 296 THR A OG1   1 
ATOM 2999  C CG2   . THR C 3 296 ? 17.431  173.220 -18.998 1.00 86.79  ? 296 THR A CG2   1 
ATOM 3000  N N     . GLU C 3 297 ? 14.675  175.734 -17.326 1.00 77.45  ? 297 GLU A N     1 
ATOM 3001  C CA    . GLU C 3 297 ? 14.781  176.818 -16.350 1.00 70.76  ? 297 GLU A CA    1 
ATOM 3002  C C     . GLU C 3 297 ? 14.173  176.362 -15.028 1.00 69.85  ? 297 GLU A C     1 
ATOM 3003  O O     . GLU C 3 297 ? 14.757  176.530 -13.945 1.00 67.63  ? 297 GLU A O     1 
ATOM 3004  C CB    . GLU C 3 297 ? 14.017  178.046 -16.851 1.00 67.84  ? 297 GLU A CB    1 
ATOM 3005  N N     . GLU C 3 298 ? 12.977  175.784 -15.144 1.00 69.60  ? 298 GLU A N     1 
ATOM 3006  C CA    . GLU C 3 298 ? 12.221  175.272 -14.015 1.00 70.38  ? 298 GLU A CA    1 
ATOM 3007  C C     . GLU C 3 298 ? 13.018  174.252 -13.177 1.00 69.31  ? 298 GLU A C     1 
ATOM 3008  O O     . GLU C 3 298 ? 12.916  174.245 -11.952 1.00 70.24  ? 298 GLU A O     1 
ATOM 3009  C CB    . GLU C 3 298 ? 10.918  174.640 -14.516 1.00 69.65  ? 298 GLU A CB    1 
ATOM 3010  N N     . ALA C 3 299 ? 13.806  173.395 -13.825 1.00 68.27  ? 299 ALA A N     1 
ATOM 3011  C CA    . ALA C 3 299 ? 14.589  172.370 -13.102 1.00 66.36  ? 299 ALA A CA    1 
ATOM 3012  C C     . ALA C 3 299 ? 16.086  172.689 -12.995 1.00 64.50  ? 299 ALA A C     1 
ATOM 3013  O O     . ALA C 3 299 ? 16.872  171.857 -12.518 1.00 62.96  ? 299 ALA A O     1 
ATOM 3014  C CB    . ALA C 3 299 ? 14.406  171.002 -13.781 1.00 68.16  ? 299 ALA A CB    1 
ATOM 3015  N N     . GLU C 3 300 ? 16.477  173.880 -13.456 1.00 62.68  ? 300 GLU A N     1 
ATOM 3016  C CA    . GLU C 3 300 ? 17.880  174.334 -13.475 1.00 59.87  ? 300 GLU A CA    1 
ATOM 3017  C C     . GLU C 3 300 ? 18.543  174.009 -12.190 1.00 59.64  ? 300 GLU A C     1 
ATOM 3018  O O     . GLU C 3 300 ? 19.689  173.531 -12.095 1.00 59.44  ? 300 GLU A O     1 
ATOM 3019  C CB    . GLU C 3 300 ? 17.948  175.845 -13.679 1.00 56.36  ? 300 GLU A CB    1 
ATOM 3020  N N     . LEU C 3 301 ? 17.760  174.331 -11.168 1.00 58.82  ? 301 LEU A N     1 
ATOM 3021  C CA    . LEU C 3 301 ? 18.117  174.144 -9.800  1.00 59.50  ? 301 LEU A CA    1 
ATOM 3022  C C     . LEU C 3 301 ? 18.624  172.739 -9.600  1.00 59.71  ? 301 LEU A C     1 
ATOM 3023  O O     . LEU C 3 301 ? 19.793  172.524 -9.252  1.00 59.33  ? 301 LEU A O     1 
ATOM 3024  C CB    . LEU C 3 301 ? 16.869  174.386 -8.957  1.00 67.65  ? 301 LEU A CB    1 
ATOM 3025  C CG    . LEU C 3 301 ? 16.372  175.846 -8.998  1.00 72.66  ? 301 LEU A CG    1 
ATOM 3026  C CD1   . LEU C 3 301 ? 15.112  176.011 -8.176  1.00 73.26  ? 301 LEU A CD1   1 
ATOM 3027  C CD2   . LEU C 3 301 ? 17.425  176.800 -8.450  1.00 72.93  ? 301 LEU A CD2   1 
ATOM 3028  N N     . GLU C 3 302 ? 17.730  171.779 -9.838  1.00 57.40  ? 302 GLU A N     1 
ATOM 3029  C CA    . GLU C 3 302 ? 18.053  170.378 -9.687  1.00 52.60  ? 302 GLU A CA    1 
ATOM 3030  C C     . GLU C 3 302 ? 19.318  170.022 -10.453 1.00 53.24  ? 302 GLU A C     1 
ATOM 3031  O O     . GLU C 3 302 ? 20.323  169.614 -9.822  1.00 50.48  ? 302 GLU A O     1 
ATOM 3032  C CB    . GLU C 3 302 ? 16.892  169.520 -10.169 1.00 47.60  ? 302 GLU A CB    1 
ATOM 3033  N N     . LEU C 3 303 ? 19.281  170.200 -11.763 1.00 60.26  ? 303 LEU A N     1 
ATOM 3034  C CA    . LEU C 3 303 ? 20.394  169.862 -12.655 1.00 60.04  ? 303 LEU A CA    1 
ATOM 3035  C C     . LEU C 3 303 ? 21.729  170.186 -12.032 1.00 60.30  ? 303 LEU A C     1 
ATOM 3036  O O     . LEU C 3 303 ? 22.498  169.281 -11.700 1.00 60.82  ? 303 LEU A O     1 
ATOM 3037  C CB    . LEU C 3 303 ? 20.306  170.549 -14.029 1.00 59.70  ? 303 LEU A CB    1 
ATOM 3038  C CG    . LEU C 3 303 ? 21.591  170.447 -14.877 1.00 59.49  ? 303 LEU A CG    1 
ATOM 3039  C CD1   . LEU C 3 303 ? 21.950  168.997 -15.203 1.00 58.84  ? 303 LEU A CD1   1 
ATOM 3040  C CD2   . LEU C 3 303 ? 21.423  171.246 -16.150 1.00 59.71  ? 303 LEU A CD2   1 
ATOM 3041  N N     . ALA C 3 304 ? 21.964  171.476 -11.806 1.00 59.54  ? 304 ALA A N     1 
ATOM 3042  C CA    . ALA C 3 304 ? 23.218  171.955 -11.232 1.00 58.28  ? 304 ALA A CA    1 
ATOM 3043  C C     . ALA C 3 304 ? 23.519  171.471 -9.819  1.00 56.59  ? 304 ALA A C     1 
ATOM 3044  O O     . ALA C 3 304 ? 24.642  171.037 -9.532  1.00 55.89  ? 304 ALA A O     1 
ATOM 3045  C CB    . ALA C 3 304 ? 23.278  173.475 -11.297 1.00 58.74  ? 304 ALA A CB    1 
ATOM 3046  N N     . GLU C 3 305 ? 22.527  171.560 -8.936  1.00 54.81  ? 305 GLU A N     1 
ATOM 3047  C CA    . GLU C 3 305 ? 22.712  171.123 -7.560  1.00 54.44  ? 305 GLU A CA    1 
ATOM 3048  C C     . GLU C 3 305 ? 23.300  169.720 -7.628  1.00 54.02  ? 305 GLU A C     1 
ATOM 3049  O O     . GLU C 3 305 ? 24.390  169.447 -7.110  1.00 53.79  ? 305 GLU A O     1 
ATOM 3050  C CB    . GLU C 3 305 ? 21.381  171.113 -6.834  1.00 54.70  ? 305 GLU A CB    1 
ATOM 3051  N N     . ASN C 3 306 ? 22.615  168.873 -8.385  1.00 53.39  ? 306 ASN A N     1 
ATOM 3052  C CA    . ASN C 3 306 ? 23.036  167.500 -8.586  1.00 52.28  ? 306 ASN A CA    1 
ATOM 3053  C C     . ASN C 3 306 ? 24.413  167.520 -9.240  1.00 51.10  ? 306 ASN A C     1 
ATOM 3054  O O     . ASN C 3 306 ? 25.336  166.850 -8.788  1.00 49.44  ? 306 ASN A O     1 
ATOM 3055  C CB    . ASN C 3 306 ? 22.030  166.784 -9.476  1.00 52.03  ? 306 ASN A CB    1 
ATOM 3056  N N     . ARG C 3 307 ? 24.545  168.349 -10.270 1.00 51.34  ? 307 ARG A N     1 
ATOM 3057  C CA    . ARG C 3 307 ? 25.784  168.495 -11.016 1.00 52.81  ? 307 ARG A CA    1 
ATOM 3058  C C     . ARG C 3 307 ? 26.950  168.651 -10.092 1.00 52.84  ? 307 ARG A C     1 
ATOM 3059  O O     . ARG C 3 307 ? 28.005  168.062 -10.293 1.00 52.67  ? 307 ARG A O     1 
ATOM 3060  C CB    . ARG C 3 307 ? 25.719  169.737 -11.886 1.00 55.26  ? 307 ARG A CB    1 
ATOM 3061  C CG    . ARG C 3 307 ? 25.393  169.468 -13.310 1.00 58.91  ? 307 ARG A CG    1 
ATOM 3062  C CD    . ARG C 3 307 ? 26.648  169.155 -14.099 1.00 63.06  ? 307 ARG A CD    1 
ATOM 3063  N NE    . ARG C 3 307 ? 26.309  168.669 -15.430 1.00 67.94  ? 307 ARG A NE    1 
ATOM 3064  C CZ    . ARG C 3 307 ? 25.478  169.282 -16.271 1.00 70.60  ? 307 ARG A CZ    1 
ATOM 3065  N NH1   . ARG C 3 307 ? 24.899  170.437 -15.938 1.00 70.50  ? 307 ARG A NH1   1 
ATOM 3066  N NH2   . ARG C 3 307 ? 25.152  168.688 -17.413 1.00 72.37  ? 307 ARG A NH2   1 
ATOM 3067  N N     . GLU C 3 308 ? 26.752  169.476 -9.082  1.00 53.47  ? 308 GLU A N     1 
ATOM 3068  C CA    . GLU C 3 308 ? 27.801  169.733 -8.130  1.00 56.08  ? 308 GLU A CA    1 
ATOM 3069  C C     . GLU C 3 308 ? 27.975  168.544 -7.178  1.00 56.33  ? 308 GLU A C     1 
ATOM 3070  O O     . GLU C 3 308 ? 29.067  168.328 -6.627  1.00 56.07  ? 308 GLU A O     1 
ATOM 3071  C CB    . GLU C 3 308 ? 27.492  171.030 -7.397  1.00 58.64  ? 308 GLU A CB    1 
ATOM 3072  C CG    . GLU C 3 308 ? 28.521  171.436 -6.379  1.00 62.76  ? 308 GLU A CG    1 
ATOM 3073  C CD    . GLU C 3 308 ? 27.893  171.629 -5.023  1.00 65.29  ? 308 GLU A CD    1 
ATOM 3074  O OE1   . GLU C 3 308 ? 27.133  172.616 -4.872  1.00 67.43  ? 308 GLU A OE1   1 
ATOM 3075  O OE2   . GLU C 3 308 ? 28.129  170.777 -4.130  1.00 65.43  ? 308 GLU A OE2   1 
ATOM 3076  N N     . ILE C 3 309 ? 26.907  167.764 -7.003  1.00 55.87  ? 309 ILE A N     1 
ATOM 3077  C CA    . ILE C 3 309 ? 26.956  166.583 -6.143  1.00 55.93  ? 309 ILE A CA    1 
ATOM 3078  C C     . ILE C 3 309 ? 27.806  165.561 -6.879  1.00 56.47  ? 309 ILE A C     1 
ATOM 3079  O O     . ILE C 3 309 ? 28.723  164.965 -6.304  1.00 56.95  ? 309 ILE A O     1 
ATOM 3080  C CB    . ILE C 3 309 ? 25.559  166.036 -5.902  1.00 55.02  ? 309 ILE A CB    1 
ATOM 3081  N N     . LEU C 3 310 ? 27.514  165.425 -8.174  1.00 58.11  ? 310 LEU A N     1 
ATOM 3082  C CA    . LEU C 3 310 ? 28.217  164.528 -9.100  1.00 59.18  ? 310 LEU A CA    1 
ATOM 3083  C C     . LEU C 3 310 ? 29.671  165.005 -9.251  1.00 60.04  ? 310 LEU A C     1 
ATOM 3084  O O     . LEU C 3 310 ? 30.529  164.282 -9.769  1.00 59.75  ? 310 LEU A O     1 
ATOM 3085  C CB    . LEU C 3 310 ? 27.523  164.562 -10.470 1.00 60.20  ? 310 LEU A CB    1 
ATOM 3086  C CG    . LEU C 3 310 ? 27.071  163.285 -11.189 1.00 59.56  ? 310 LEU A CG    1 
ATOM 3087  C CD1   . LEU C 3 310 ? 26.251  163.679 -12.409 1.00 60.02  ? 310 LEU A CD1   1 
ATOM 3088  C CD2   . LEU C 3 310 ? 28.257  162.436 -11.611 1.00 59.46  ? 310 LEU A CD2   1 
ATOM 3089  N N     . LYS C 3 311 ? 29.915  166.250 -8.839  1.00 60.72  ? 311 LYS A N     1 
ATOM 3090  C CA    . LYS C 3 311 ? 31.245  166.846 -8.888  1.00 61.14  ? 311 LYS A CA    1 
ATOM 3091  C C     . LYS C 3 311 ? 32.038  166.305 -7.700  1.00 61.38  ? 311 LYS A C     1 
ATOM 3092  O O     . LYS C 3 311 ? 33.102  165.695 -7.874  1.00 60.40  ? 311 LYS A O     1 
ATOM 3093  C CB    . LYS C 3 311 ? 31.145  168.371 -8.820  1.00 59.82  ? 311 LYS A CB    1 
ATOM 3094  N N     . GLU C 3 312 ? 31.481  166.495 -6.503  1.00 62.21  ? 312 GLU A N     1 
ATOM 3095  C CA    . GLU C 3 312 ? 32.094  166.031 -5.261  1.00 63.46  ? 312 GLU A CA    1 
ATOM 3096  C C     . GLU C 3 312 ? 32.439  164.538 -5.390  1.00 64.17  ? 312 GLU A C     1 
ATOM 3097  O O     . GLU C 3 312 ? 31.558  163.713 -5.662  1.00 64.41  ? 312 GLU A O     1 
ATOM 3098  C CB    . GLU C 3 312 ? 31.138  166.272 -4.085  1.00 62.55  ? 312 GLU A CB    1 
ATOM 3099  N N     . PRO C 3 313 ? 33.740  164.191 -5.268  1.00 63.82  ? 313 PRO A N     1 
ATOM 3100  C CA    . PRO C 3 313 ? 34.280  162.823 -5.362  1.00 63.66  ? 313 PRO A CA    1 
ATOM 3101  C C     . PRO C 3 313 ? 33.910  161.941 -4.169  1.00 63.03  ? 313 PRO A C     1 
ATOM 3102  O O     . PRO C 3 313 ? 34.440  162.101 -3.065  1.00 62.54  ? 313 PRO A O     1 
ATOM 3103  C CB    . PRO C 3 313 ? 35.795  163.051 -5.438  1.00 64.01  ? 313 PRO A CB    1 
ATOM 3104  C CG    . PRO C 3 313 ? 35.917  164.464 -5.958  1.00 64.56  ? 313 PRO A CG    1 
ATOM 3105  C CD    . PRO C 3 313 ? 34.842  165.162 -5.172  1.00 63.59  ? 313 PRO A CD    1 
ATOM 3106  N N     . VAL C 3 314 ? 33.018  160.988 -4.419  1.00 62.21  ? 314 VAL A N     1 
ATOM 3107  C CA    . VAL C 3 314 ? 32.534  160.077 -3.387  1.00 61.79  ? 314 VAL A CA    1 
ATOM 3108  C C     . VAL C 3 314 ? 33.214  158.717 -3.461  1.00 61.27  ? 314 VAL A C     1 
ATOM 3109  O O     . VAL C 3 314 ? 34.232  158.563 -4.143  1.00 61.13  ? 314 VAL A O     1 
ATOM 3110  C CB    . VAL C 3 314 ? 31.007  159.869 -3.517  1.00 62.95  ? 314 VAL A CB    1 
ATOM 3111  C CG1   . VAL C 3 314 ? 30.283  161.224 -3.546  1.00 60.95  ? 314 VAL A CG1   1 
ATOM 3112  C CG2   . VAL C 3 314 ? 30.695  159.047 -4.761  1.00 61.77  ? 314 VAL A CG2   1 
ATOM 3113  N N     . HIS C 3 315 ? 32.642  157.752 -2.738  1.00 60.20  ? 315 HIS A N     1 
ATOM 3114  C CA    . HIS C 3 315 ? 33.129  156.370 -2.684  1.00 60.22  ? 315 HIS A CA    1 
ATOM 3115  C C     . HIS C 3 315 ? 32.421  155.572 -1.598  1.00 58.96  ? 315 HIS A C     1 
ATOM 3116  O O     . HIS C 3 315 ? 31.857  156.131 -0.657  1.00 58.90  ? 315 HIS A O     1 
ATOM 3117  C CB    . HIS C 3 315 ? 34.647  156.299 -2.439  1.00 61.81  ? 315 HIS A CB    1 
ATOM 3118  C CG    . HIS C 3 315 ? 35.074  156.873 -1.127  1.00 63.88  ? 315 HIS A CG    1 
ATOM 3119  N ND1   . HIS C 3 315 ? 35.510  158.175 -0.993  1.00 65.21  ? 315 HIS A ND1   1 
ATOM 3120  C CD2   . HIS C 3 315 ? 35.088  156.342 0.119   1.00 64.64  ? 315 HIS A CD2   1 
ATOM 3121  C CE1   . HIS C 3 315 ? 35.767  158.422 0.279   1.00 66.09  ? 315 HIS A CE1   1 
ATOM 3122  N NE2   . HIS C 3 315 ? 35.520  157.327 0.976   1.00 66.16  ? 315 HIS A NE2   1 
ATOM 3123  N N     . GLY C 3 316 ? 32.482  154.256 -1.725  1.00 57.43  ? 316 GLY A N     1 
ATOM 3124  C CA    . GLY C 3 316 ? 31.863  153.397 -0.742  1.00 55.78  ? 316 GLY A CA    1 
ATOM 3125  C C     . GLY C 3 316 ? 32.895  152.461 -0.150  1.00 54.78  ? 316 GLY A C     1 
ATOM 3126  O O     . GLY C 3 316 ? 33.762  151.937 -0.854  1.00 54.27  ? 316 GLY A O     1 
ATOM 3127  N N     . VAL C 3 317 ? 32.828  152.276 1.160   1.00 53.84  ? 317 VAL A N     1 
ATOM 3128  C CA    . VAL C 3 317 ? 33.756  151.388 1.833   1.00 53.31  ? 317 VAL A CA    1 
ATOM 3129  C C     . VAL C 3 317 ? 33.136  149.998 1.827   1.00 52.41  ? 317 VAL A C     1 
ATOM 3130  O O     . VAL C 3 317 ? 31.966  149.840 1.468   1.00 52.34  ? 317 VAL A O     1 
ATOM 3131  C CB    . VAL C 3 317 ? 34.045  151.870 3.271   1.00 54.82  ? 317 VAL A CB    1 
ATOM 3132  C CG1   . VAL C 3 317 ? 32.764  151.851 4.101   1.00 53.52  ? 317 VAL A CG1   1 
ATOM 3133  C CG2   . VAL C 3 317 ? 35.174  151.040 3.909   1.00 54.34  ? 317 VAL A CG2   1 
ATOM 3134  N N     . TYR C 3 318 ? 33.916  149.005 2.247   1.00 52.05  ? 318 TYR A N     1 
ATOM 3135  C CA    . TYR C 3 318 ? 33.485  147.608 2.261   1.00 51.48  ? 318 TYR A CA    1 
ATOM 3136  C C     . TYR C 3 318 ? 32.651  147.154 3.475   1.00 50.29  ? 318 TYR A C     1 
ATOM 3137  O O     . TYR C 3 318 ? 32.765  147.718 4.569   1.00 49.77  ? 318 TYR A O     1 
ATOM 3138  C CB    . TYR C 3 318 ? 34.715  146.708 2.032   1.00 53.10  ? 318 TYR A CB    1 
ATOM 3139  C CG    . TYR C 3 318 ? 35.388  146.930 0.673   1.00 54.59  ? 318 TYR A CG    1 
ATOM 3140  C CD1   . TYR C 3 318 ? 34.721  147.610 -0.346  1.00 56.66  ? 318 TYR A CD1   1 
ATOM 3141  C CD2   . TYR C 3 318 ? 36.675  146.443 0.396   1.00 55.29  ? 318 TYR A CD2   1 
ATOM 3142  C CE1   . TYR C 3 318 ? 35.302  147.806 -1.602  1.00 56.92  ? 318 TYR A CE1   1 
ATOM 3143  C CE2   . TYR C 3 318 ? 37.271  146.635 -0.873  1.00 56.17  ? 318 TYR A CE2   1 
ATOM 3144  C CZ    . TYR C 3 318 ? 36.563  147.321 -1.862  1.00 55.84  ? 318 TYR A CZ    1 
ATOM 3145  O OH    . TYR C 3 318 ? 37.071  147.535 -3.121  1.00 55.56  ? 318 TYR A OH    1 
ATOM 3146  N N     . TYR C 3 319 ? 31.808  146.140 3.264   1.00 48.60  ? 319 TYR A N     1 
ATOM 3147  C CA    . TYR C 3 319 ? 30.939  145.609 4.314   1.00 46.73  ? 319 TYR A CA    1 
ATOM 3148  C C     . TYR C 3 319 ? 31.617  144.804 5.401   1.00 44.88  ? 319 TYR A C     1 
ATOM 3149  O O     . TYR C 3 319 ? 32.335  143.845 5.129   1.00 44.62  ? 319 TYR A O     1 
ATOM 3150  C CB    . TYR C 3 319 ? 29.825  144.742 3.719   1.00 47.10  ? 319 TYR A CB    1 
ATOM 3151  C CG    . TYR C 3 319 ? 29.027  143.947 4.755   1.00 49.34  ? 319 TYR A CG    1 
ATOM 3152  C CD1   . TYR C 3 319 ? 28.557  144.541 5.930   1.00 49.16  ? 319 TYR A CD1   1 
ATOM 3153  C CD2   . TYR C 3 319 ? 28.727  142.597 4.549   1.00 50.82  ? 319 TYR A CD2   1 
ATOM 3154  C CE1   . TYR C 3 319 ? 27.802  143.807 6.868   1.00 48.34  ? 319 TYR A CE1   1 
ATOM 3155  C CE2   . TYR C 3 319 ? 27.970  141.856 5.484   1.00 50.07  ? 319 TYR A CE2   1 
ATOM 3156  C CZ    . TYR C 3 319 ? 27.512  142.467 6.636   1.00 48.78  ? 319 TYR A CZ    1 
ATOM 3157  O OH    . TYR C 3 319 ? 26.740  141.748 7.528   1.00 47.04  ? 319 TYR A OH    1 
ATOM 3158  N N     . ASP C 3 320 ? 31.330  145.166 6.641   1.00 44.01  ? 320 ASP A N     1 
ATOM 3159  C CA    . ASP C 3 320 ? 31.875  144.428 7.753   1.00 44.76  ? 320 ASP A CA    1 
ATOM 3160  C C     . ASP C 3 320 ? 30.813  143.951 8.710   1.00 44.52  ? 320 ASP A C     1 
ATOM 3161  O O     . ASP C 3 320 ? 30.147  144.731 9.384   1.00 45.08  ? 320 ASP A O     1 
ATOM 3162  C CB    . ASP C 3 320 ? 32.906  145.203 8.558   1.00 47.87  ? 320 ASP A CB    1 
ATOM 3163  C CG    . ASP C 3 320 ? 33.160  144.552 9.919   1.00 49.14  ? 320 ASP A CG    1 
ATOM 3164  O OD1   . ASP C 3 320 ? 33.621  143.385 9.931   1.00 48.37  ? 320 ASP A OD1   1 
ATOM 3165  O OD2   . ASP C 3 320 ? 32.816  145.166 10.959  1.00 49.84  ? 320 ASP A OD2   1 
ATOM 3166  N N     . PRO C 3 321 ? 30.738  142.641 8.867   1.00 44.70  ? 321 PRO A N     1 
ATOM 3167  C CA    . PRO C 3 321 ? 29.823  141.889 9.724   1.00 46.43  ? 321 PRO A CA    1 
ATOM 3168  C C     . PRO C 3 321 ? 30.102  142.079 11.212  1.00 46.89  ? 321 PRO A C     1 
ATOM 3169  O O     . PRO C 3 321 ? 29.193  142.002 12.045  1.00 46.62  ? 321 PRO A O     1 
ATOM 3170  C CB    . PRO C 3 321 ? 30.098  140.456 9.302   1.00 47.29  ? 321 PRO A CB    1 
ATOM 3171  C CG    . PRO C 3 321 ? 31.558  140.516 8.916   1.00 46.99  ? 321 PRO A CG    1 
ATOM 3172  C CD    . PRO C 3 321 ? 31.578  141.735 8.074   1.00 44.84  ? 321 PRO A CD    1 
ATOM 3173  N N     . SER C 3 322 ? 31.364  142.296 11.551  1.00 48.24  ? 322 SER A N     1 
ATOM 3174  C CA    . SER C 3 322 ? 31.727  142.487 12.945  1.00 51.02  ? 322 SER A CA    1 
ATOM 3175  C C     . SER C 3 322 ? 30.908  143.645 13.516  1.00 52.43  ? 322 SER A C     1 
ATOM 3176  O O     . SER C 3 322 ? 30.458  143.614 14.670  1.00 52.26  ? 322 SER A O     1 
ATOM 3177  C CB    . SER C 3 322 ? 33.223  142.751 13.052  1.00 50.60  ? 322 SER A CB    1 
ATOM 3178  O OG    . SER C 3 322 ? 33.936  141.753 12.339  1.00 50.68  ? 322 SER A OG    1 
ATOM 3179  N N     . LYS C 3 323 ? 30.661  144.642 12.674  1.00 54.06  ? 323 LYS A N     1 
ATOM 3180  C CA    . LYS C 3 323 ? 29.867  145.772 13.099  1.00 55.84  ? 323 LYS A CA    1 
ATOM 3181  C C     . LYS C 3 323 ? 28.391  145.511 12.811  1.00 56.07  ? 323 LYS A C     1 
ATOM 3182  O O     . LYS C 3 323 ? 27.970  144.361 12.757  1.00 56.27  ? 323 LYS A O     1 
ATOM 3183  C CB    . LYS C 3 323 ? 30.379  147.063 12.464  1.00 57.56  ? 323 LYS A CB    1 
ATOM 3184  C CG    . LYS C 3 323 ? 31.053  147.997 13.475  1.00 59.56  ? 323 LYS A CG    1 
ATOM 3185  C CD    . LYS C 3 323 ? 30.044  148.499 14.539  1.00 61.04  ? 323 LYS A CD    1 
ATOM 3186  C CE    . LYS C 3 323 ? 30.667  149.468 15.566  1.00 61.99  ? 323 LYS A CE    1 
ATOM 3187  N NZ    . LYS C 3 323 ? 29.652  150.069 16.498  1.00 60.94  ? 323 LYS A NZ    1 
ATOM 3188  N N     . ASP C 3 324 ? 27.612  146.565 12.605  1.00 57.82  ? 324 ASP A N     1 
ATOM 3189  C CA    . ASP C 3 324 ? 26.179  146.415 12.367  1.00 59.63  ? 324 ASP A CA    1 
ATOM 3190  C C     . ASP C 3 324 ? 25.632  147.267 11.234  1.00 59.21  ? 324 ASP A C     1 
ATOM 3191  O O     . ASP C 3 324 ? 26.294  148.188 10.744  1.00 57.50  ? 324 ASP A O     1 
ATOM 3192  C CB    . ASP C 3 324 ? 25.423  146.772 13.636  1.00 63.70  ? 324 ASP A CB    1 
ATOM 3193  C CG    . ASP C 3 324 ? 25.898  148.089 14.231  1.00 67.88  ? 324 ASP A CG    1 
ATOM 3194  O OD1   . ASP C 3 324 ? 26.476  148.929 13.492  1.00 68.91  ? 324 ASP A OD1   1 
ATOM 3195  O OD2   . ASP C 3 324 ? 25.722  148.273 15.454  1.00 72.05  ? 324 ASP A OD2   1 
ATOM 3196  N N     . LEU C 3 325 ? 24.360  147.022 10.923  1.00 59.18  ? 325 LEU A N     1 
ATOM 3197  C CA    . LEU C 3 325 ? 23.677  147.714 9.840   1.00 59.05  ? 325 LEU A CA    1 
ATOM 3198  C C     . LEU C 3 325 ? 22.661  148.753 10.262  1.00 57.75  ? 325 LEU A C     1 
ATOM 3199  O O     . LEU C 3 325 ? 21.826  148.521 11.141  1.00 57.10  ? 325 LEU A O     1 
ATOM 3200  C CB    . LEU C 3 325 ? 23.003  146.713 8.899   1.00 59.40  ? 325 LEU A CB    1 
ATOM 3201  C CG    . LEU C 3 325 ? 23.562  146.664 7.474   1.00 60.29  ? 325 LEU A CG    1 
ATOM 3202  C CD1   . LEU C 3 325 ? 22.759  145.673 6.647   1.00 60.58  ? 325 LEU A CD1   1 
ATOM 3203  C CD2   . LEU C 3 325 ? 23.529  148.055 6.843   1.00 59.93  ? 325 LEU A CD2   1 
ATOM 3204  N N     . ILE C 3 326 ? 22.735  149.896 9.585   1.00 56.88  ? 326 ILE A N     1 
ATOM 3205  C CA    . ILE C 3 326 ? 21.845  151.016 9.833   1.00 55.93  ? 326 ILE A CA    1 
ATOM 3206  C C     . ILE C 3 326 ? 21.758  151.945 8.636   1.00 55.18  ? 326 ILE A C     1 
ATOM 3207  O O     . ILE C 3 326 ? 22.675  152.026 7.806   1.00 54.58  ? 326 ILE A O     1 
ATOM 3208  C CB    . ILE C 3 326 ? 22.284  151.887 11.026  1.00 56.48  ? 326 ILE A CB    1 
ATOM 3209  C CG1   . ILE C 3 326 ? 23.474  151.283 11.779  1.00 57.12  ? 326 ILE A CG1   1 
ATOM 3210  C CG2   . ILE C 3 326 ? 21.125  152.071 11.954  1.00 54.73  ? 326 ILE A CG2   1 
ATOM 3211  C CD1   . ILE C 3 326 ? 24.793  151.315 11.024  1.00 58.58  ? 326 ILE A CD1   1 
ATOM 3212  N N     . ALA C 3 327 ? 20.667  152.697 8.602   1.00 54.44  ? 327 ALA A N     1 
ATOM 3213  C CA    . ALA C 3 327 ? 20.437  153.643 7.534   1.00 54.23  ? 327 ALA A CA    1 
ATOM 3214  C C     . ALA C 3 327 ? 19.492  154.772 7.961   1.00 54.35  ? 327 ALA A C     1 
ATOM 3215  O O     . ALA C 3 327 ? 18.459  154.519 8.596   1.00 53.50  ? 327 ALA A O     1 
ATOM 3216  C CB    . ALA C 3 327 ? 19.885  152.920 6.339   1.00 53.95  ? 327 ALA A CB    1 
ATOM 3217  N N     . GLU C 3 328 ? 19.887  156.015 7.661   1.00 53.76  ? 328 GLU A N     1 
ATOM 3218  C CA    . GLU C 3 328 ? 19.079  157.197 7.971   1.00 52.78  ? 328 GLU A CA    1 
ATOM 3219  C C     . GLU C 3 328 ? 18.561  157.837 6.680   1.00 52.57  ? 328 GLU A C     1 
ATOM 3220  O O     . GLU C 3 328 ? 19.241  157.848 5.640   1.00 51.54  ? 328 GLU A O     1 
ATOM 3221  C CB    . GLU C 3 328 ? 19.857  158.227 8.809   1.00 52.51  ? 328 GLU A CB    1 
ATOM 3222  C CG    . GLU C 3 328 ? 21.002  158.947 8.101   1.00 54.34  ? 328 GLU A CG    1 
ATOM 3223  C CD    . GLU C 3 328 ? 21.498  160.175 8.867   1.00 55.28  ? 328 GLU A CD    1 
ATOM 3224  O OE1   . GLU C 3 328 ? 21.782  161.217 8.232   1.00 53.49  ? 328 GLU A OE1   1 
ATOM 3225  O OE2   . GLU C 3 328 ? 21.607  160.100 10.109  1.00 57.27  ? 328 GLU A OE2   1 
ATOM 3226  N N     . ILE C 3 329 ? 17.340  158.352 6.750   1.00 51.57  ? 329 ILE A N     1 
ATOM 3227  C CA    . ILE C 3 329 ? 16.722  158.974 5.593   1.00 50.85  ? 329 ILE A CA    1 
ATOM 3228  C C     . ILE C 3 329 ? 16.328  160.417 5.866   1.00 52.25  ? 329 ILE A C     1 
ATOM 3229  O O     . ILE C 3 329 ? 16.018  160.787 6.997   1.00 52.02  ? 329 ILE A O     1 
ATOM 3230  C CB    . ILE C 3 329 ? 15.477  158.192 5.138   1.00 49.67  ? 329 ILE A CB    1 
ATOM 3231  C CG1   . ILE C 3 329 ? 14.322  158.419 6.106   1.00 48.92  ? 329 ILE A CG1   1 
ATOM 3232  C CG2   . ILE C 3 329 ? 15.780  156.703 5.103   1.00 48.65  ? 329 ILE A CG2   1 
ATOM 3233  C CD1   . ILE C 3 329 ? 14.557  157.793 7.430   1.00 47.76  ? 329 ILE A CD1   1 
ATOM 3234  N N     . GLN C 3 330 ? 16.347  161.221 4.810   1.00 53.51  ? 330 GLN A N     1 
ATOM 3235  C CA    . GLN C 3 330 ? 15.996  162.638 4.883   1.00 55.92  ? 330 GLN A CA    1 
ATOM 3236  C C     . GLN C 3 330 ? 14.893  162.916 3.849   1.00 57.38  ? 330 GLN A C     1 
ATOM 3237  O O     . GLN C 3 330 ? 14.678  162.110 2.937   1.00 58.66  ? 330 GLN A O     1 
ATOM 3238  C CB    . GLN C 3 330 ? 17.222  163.510 4.543   1.00 56.64  ? 330 GLN A CB    1 
ATOM 3239  C CG    . GLN C 3 330 ? 18.515  163.229 5.335   1.00 56.99  ? 330 GLN A CG    1 
ATOM 3240  C CD    . GLN C 3 330 ? 19.212  161.918 4.952   1.00 56.92  ? 330 GLN A CD    1 
ATOM 3241  O OE1   . GLN C 3 330 ? 19.317  161.560 3.774   1.00 56.16  ? 330 GLN A OE1   1 
ATOM 3242  N NE2   . GLN C 3 330 ? 19.704  161.206 5.958   1.00 56.49  ? 330 GLN A NE2   1 
ATOM 3243  N N     . LYS C 3 331 ? 14.183  164.036 3.997   1.00 57.52  ? 331 LYS A N     1 
ATOM 3244  C CA    . LYS C 3 331 ? 13.139  164.415 3.036   1.00 57.29  ? 331 LYS A CA    1 
ATOM 3245  C C     . LYS C 3 331 ? 13.679  165.582 2.224   1.00 57.43  ? 331 LYS A C     1 
ATOM 3246  O O     . LYS C 3 331 ? 14.100  166.594 2.784   1.00 57.18  ? 331 LYS A O     1 
ATOM 3247  C CB    . LYS C 3 331 ? 11.873  164.819 3.749   1.00 57.53  ? 331 LYS A CB    1 
ATOM 3248  N N     . GLN C 3 332 ? 13.704  165.436 0.908   1.00 57.14  ? 332 GLN A N     1 
ATOM 3249  C CA    . GLN C 3 332 ? 14.232  166.503 0.081   1.00 58.03  ? 332 GLN A CA    1 
ATOM 3250  C C     . GLN C 3 332 ? 13.126  167.444 -0.395  1.00 57.03  ? 332 GLN A C     1 
ATOM 3251  O O     . GLN C 3 332 ? 13.058  168.596 0.026   1.00 56.99  ? 332 GLN A O     1 
ATOM 3252  C CB    . GLN C 3 332 ? 15.025  165.918 -1.095  1.00 59.71  ? 332 GLN A CB    1 
ATOM 3253  C CG    . GLN C 3 332 ? 16.285  166.721 -1.452  1.00 63.74  ? 332 GLN A CG    1 
ATOM 3254  C CD    . GLN C 3 332 ? 17.070  166.167 -2.656  1.00 65.33  ? 332 GLN A CD    1 
ATOM 3255  O OE1   . GLN C 3 332 ? 17.089  166.780 -3.727  1.00 65.05  ? 332 GLN A OE1   1 
ATOM 3256  N NE2   . GLN C 3 332 ? 17.744  165.028 -2.467  1.00 66.14  ? 332 GLN A NE2   1 
ATOM 3257  N N     . GLY C 3 333 ? 12.268  166.942 -1.272  1.00 56.05  ? 333 GLY A N     1 
ATOM 3258  C CA    . GLY C 3 333 ? 11.166  167.721 -1.798  1.00 55.45  ? 333 GLY A CA    1 
ATOM 3259  C C     . GLY C 3 333 ? 9.907   166.954 -1.457  1.00 56.40  ? 333 GLY A C     1 
ATOM 3260  O O     . GLY C 3 333 ? 9.986   165.928 -0.775  1.00 55.63  ? 333 GLY A O     1 
ATOM 3261  N N     . GLN C 3 334 ? 8.751   167.452 -1.900  1.00 57.66  ? 334 GLN A N     1 
ATOM 3262  C CA    . GLN C 3 334 ? 7.473   166.789 -1.627  1.00 58.37  ? 334 GLN A CA    1 
ATOM 3263  C C     . GLN C 3 334 ? 7.394   165.526 -2.466  1.00 57.18  ? 334 GLN A C     1 
ATOM 3264  O O     . GLN C 3 334 ? 6.809   165.509 -3.558  1.00 57.74  ? 334 GLN A O     1 
ATOM 3265  C CB    . GLN C 3 334 ? 6.272   167.714 -1.910  1.00 60.01  ? 334 GLN A CB    1 
ATOM 3266  C CG    . GLN C 3 334 ? 5.993   168.796 -0.825  1.00 63.23  ? 334 GLN A CG    1 
ATOM 3267  C CD    . GLN C 3 334 ? 5.282   168.274 0.438   1.00 64.02  ? 334 GLN A CD    1 
ATOM 3268  O OE1   . GLN C 3 334 ? 5.849   167.489 1.208   1.00 64.08  ? 334 GLN A OE1   1 
ATOM 3269  N NE2   . GLN C 3 334 ? 4.050   168.745 0.671   1.00 63.63  ? 334 GLN A NE2   1 
ATOM 3270  N N     . GLY C 3 335 ? 8.005   164.474 -1.928  1.00 55.00  ? 335 GLY A N     1 
ATOM 3271  C CA    . GLY C 3 335 ? 8.064   163.187 -2.592  1.00 52.19  ? 335 GLY A CA    1 
ATOM 3272  C C     . GLY C 3 335 ? 9.517   162.770 -2.568  1.00 49.94  ? 335 GLY A C     1 
ATOM 3273  O O     . GLY C 3 335 ? 9.852   161.588 -2.469  1.00 49.95  ? 335 GLY A O     1 
ATOM 3274  N N     . GLN C 3 336 ? 10.390  163.766 -2.639  1.00 47.31  ? 336 GLN A N     1 
ATOM 3275  C CA    . GLN C 3 336 ? 11.803  163.502 -2.608  1.00 46.12  ? 336 GLN A CA    1 
ATOM 3276  C C     . GLN C 3 336 ? 12.191  162.940 -1.263  1.00 44.57  ? 336 GLN A C     1 
ATOM 3277  O O     . GLN C 3 336 ? 12.086  163.600 -0.224  1.00 45.16  ? 336 GLN A O     1 
ATOM 3278  C CB    . GLN C 3 336 ? 12.601  164.755 -2.898  1.00 47.28  ? 336 GLN A CB    1 
ATOM 3279  C CG    . GLN C 3 336 ? 12.465  165.251 -4.301  1.00 50.99  ? 336 GLN A CG    1 
ATOM 3280  C CD    . GLN C 3 336 ? 12.988  164.251 -5.311  1.00 54.18  ? 336 GLN A CD    1 
ATOM 3281  O OE1   . GLN C 3 336 ? 13.474  163.169 -4.949  1.00 55.00  ? 336 GLN A OE1   1 
ATOM 3282  N NE2   . GLN C 3 336 ? 12.909  164.613 -6.588  1.00 56.22  ? 336 GLN A NE2   1 
ATOM 3283  N N     . TRP C 3 337 ? 12.637  161.695 -1.309  1.00 41.77  ? 337 TRP A N     1 
ATOM 3284  C CA    . TRP C 3 337 ? 13.063  160.964 -0.137  1.00 38.04  ? 337 TRP A CA    1 
ATOM 3285  C C     . TRP C 3 337 ? 14.356  160.226 -0.460  1.00 36.68  ? 337 TRP A C     1 
ATOM 3286  O O     . TRP C 3 337 ? 14.445  159.535 -1.478  1.00 35.23  ? 337 TRP A O     1 
ATOM 3287  C CB    . TRP C 3 337 ? 12.006  159.936 0.210   1.00 36.45  ? 337 TRP A CB    1 
ATOM 3288  C CG    . TRP C 3 337 ? 10.782  160.457 0.851   1.00 32.99  ? 337 TRP A CG    1 
ATOM 3289  C CD1   . TRP C 3 337 ? 9.582   160.691 0.250   1.00 30.30  ? 337 TRP A CD1   1 
ATOM 3290  C CD2   . TRP C 3 337 ? 10.564  160.598 2.256   1.00 32.31  ? 337 TRP A CD2   1 
ATOM 3291  N NE1   . TRP C 3 337 ? 8.624   160.931 1.192   1.00 29.10  ? 337 TRP A NE1   1 
ATOM 3292  C CE2   . TRP C 3 337 ? 9.196   160.879 2.437   1.00 32.51  ? 337 TRP A CE2   1 
ATOM 3293  C CE3   . TRP C 3 337 ? 11.393  160.495 3.387   1.00 33.76  ? 337 TRP A CE3   1 
ATOM 3294  C CZ2   . TRP C 3 337 ? 8.624   161.060 3.712   1.00 32.85  ? 337 TRP A CZ2   1 
ATOM 3295  C CZ3   . TRP C 3 337 ? 10.830  160.675 4.658   1.00 34.90  ? 337 TRP A CZ3   1 
ATOM 3296  C CH2   . TRP C 3 337 ? 9.455   160.953 4.805   1.00 34.23  ? 337 TRP A CH2   1 
ATOM 3297  N N     . THR C 3 338 ? 15.357  160.373 0.399   1.00 35.99  ? 338 THR A N     1 
ATOM 3298  C CA    . THR C 3 338 ? 16.628  159.690 0.184   1.00 37.04  ? 338 THR A CA    1 
ATOM 3299  C C     . THR C 3 338 ? 17.170  159.121 1.488   1.00 36.94  ? 338 THR A C     1 
ATOM 3300  O O     . THR C 3 338 ? 16.776  159.536 2.579   1.00 37.46  ? 338 THR A O     1 
ATOM 3301  C CB    . THR C 3 338 ? 17.703  160.614 -0.461  1.00 37.87  ? 338 THR A CB    1 
ATOM 3302  O OG1   . THR C 3 338 ? 18.669  159.806 -1.147  1.00 38.71  ? 338 THR A OG1   1 
ATOM 3303  C CG2   . THR C 3 338 ? 18.434  161.450 0.603   1.00 38.33  ? 338 THR A CG2   1 
ATOM 3304  N N     . TYR C 3 339 ? 18.095  158.182 1.370   1.00 36.49  ? 339 TYR A N     1 
ATOM 3305  C CA    . TYR C 3 339 ? 18.669  157.571 2.548   1.00 36.23  ? 339 TYR A CA    1 
ATOM 3306  C C     . TYR C 3 339 ? 20.156  157.476 2.439   1.00 36.24  ? 339 TYR A C     1 
ATOM 3307  O O     . TYR C 3 339 ? 20.775  158.050 1.550   1.00 35.69  ? 339 TYR A O     1 
ATOM 3308  C CB    . TYR C 3 339 ? 18.095  156.166 2.760   1.00 36.28  ? 339 TYR A CB    1 
ATOM 3309  C CG    . TYR C 3 339 ? 18.143  155.256 1.545   1.00 35.50  ? 339 TYR A CG    1 
ATOM 3310  C CD1   . TYR C 3 339 ? 19.323  155.070 0.822   1.00 34.69  ? 339 TYR A CD1   1 
ATOM 3311  C CD2   . TYR C 3 339 ? 16.987  154.602 1.104   1.00 34.55  ? 339 TYR A CD2   1 
ATOM 3312  C CE1   . TYR C 3 339 ? 19.348  154.268 -0.297  1.00 34.52  ? 339 TYR A CE1   1 
ATOM 3313  C CE2   . TYR C 3 339 ? 17.001  153.798 -0.020  1.00 34.90  ? 339 TYR A CE2   1 
ATOM 3314  C CZ    . TYR C 3 339 ? 18.183  153.642 -0.723  1.00 35.54  ? 339 TYR A CZ    1 
ATOM 3315  O OH    . TYR C 3 339 ? 18.190  152.912 -1.888  1.00 36.14  ? 339 TYR A OH    1 
ATOM 3316  N N     . GLN C 3 340 ? 20.708  156.683 3.339   1.00 37.25  ? 340 GLN A N     1 
ATOM 3317  C CA    . GLN C 3 340 ? 22.128  156.440 3.398   1.00 39.56  ? 340 GLN A CA    1 
ATOM 3318  C C     . GLN C 3 340 ? 22.392  155.306 4.395   1.00 39.12  ? 340 GLN A C     1 
ATOM 3319  O O     . GLN C 3 340 ? 22.020  155.386 5.572   1.00 39.01  ? 340 GLN A O     1 
ATOM 3320  C CB    . GLN C 3 340 ? 22.863  157.735 3.771   1.00 40.95  ? 340 GLN A CB    1 
ATOM 3321  C CG    . GLN C 3 340 ? 22.117  158.650 4.744   1.00 44.53  ? 340 GLN A CG    1 
ATOM 3322  C CD    . GLN C 3 340 ? 22.735  160.038 4.808   1.00 46.62  ? 340 GLN A CD    1 
ATOM 3323  O OE1   . GLN C 3 340 ? 22.805  160.738 3.791   1.00 47.88  ? 340 GLN A OE1   1 
ATOM 3324  N NE2   . GLN C 3 340 ? 23.199  160.439 5.998   1.00 45.80  ? 340 GLN A NE2   1 
ATOM 3325  N N     . ILE C 3 341 ? 22.983  154.224 3.901   1.00 36.94  ? 341 ILE A N     1 
ATOM 3326  C CA    . ILE C 3 341 ? 23.261  153.078 4.736   1.00 36.11  ? 341 ILE A CA    1 
ATOM 3327  C C     . ILE C 3 341 ? 24.719  153.039 5.034   1.00 36.80  ? 341 ILE A C     1 
ATOM 3328  O O     . ILE C 3 341 ? 25.523  152.766 4.154   1.00 35.97  ? 341 ILE A O     1 
ATOM 3329  C CB    . ILE C 3 341 ? 22.956  151.799 4.021   1.00 34.09  ? 341 ILE A CB    1 
ATOM 3330  C CG1   . ILE C 3 341 ? 22.032  152.077 2.846   1.00 34.68  ? 341 ILE A CG1   1 
ATOM 3331  C CG2   . ILE C 3 341 ? 22.340  150.820 4.977   1.00 35.14  ? 341 ILE A CG2   1 
ATOM 3332  C CD1   . ILE C 3 341 ? 22.060  151.009 1.808   1.00 35.43  ? 341 ILE A CD1   1 
ATOM 3333  N N     . TYR C 3 342 ? 25.066  153.339 6.269   1.00 39.68  ? 342 TYR A N     1 
ATOM 3334  C CA    . TYR C 3 342 ? 26.455  153.307 6.674   1.00 43.55  ? 342 TYR A CA    1 
ATOM 3335  C C     . TYR C 3 342 ? 26.527  152.491 7.940   1.00 43.99  ? 342 TYR A C     1 
ATOM 3336  O O     . TYR C 3 342 ? 25.507  152.203 8.566   1.00 42.91  ? 342 TYR A O     1 
ATOM 3337  C CB    . TYR C 3 342 ? 26.983  154.712 6.961   1.00 46.54  ? 342 TYR A CB    1 
ATOM 3338  C CG    . TYR C 3 342 ? 26.237  155.411 8.077   1.00 53.08  ? 342 TYR A CG    1 
ATOM 3339  C CD1   . TYR C 3 342 ? 26.843  155.658 9.315   1.00 54.60  ? 342 TYR A CD1   1 
ATOM 3340  C CD2   . TYR C 3 342 ? 24.906  155.807 7.900   1.00 56.29  ? 342 TYR A CD2   1 
ATOM 3341  C CE1   . TYR C 3 342 ? 26.130  156.282 10.363  1.00 58.07  ? 342 TYR A CE1   1 
ATOM 3342  C CE2   . TYR C 3 342 ? 24.181  156.429 8.931   1.00 58.84  ? 342 TYR A CE2   1 
ATOM 3343  C CZ    . TYR C 3 342 ? 24.791  156.666 10.159  1.00 59.50  ? 342 TYR A CZ    1 
ATOM 3344  O OH    . TYR C 3 342 ? 24.047  157.270 11.163  1.00 59.11  ? 342 TYR A OH    1 
ATOM 3345  N N     . GLN C 3 343 ? 27.737  152.059 8.257   1.00 45.84  ? 343 GLN A N     1 
ATOM 3346  C CA    . GLN C 3 343 ? 27.997  151.297 9.469   1.00 48.70  ? 343 GLN A CA    1 
ATOM 3347  C C     . GLN C 3 343 ? 28.733  152.264 10.384  1.00 51.18  ? 343 GLN A C     1 
ATOM 3348  O O     . GLN C 3 343 ? 28.596  152.209 11.605  1.00 52.12  ? 343 GLN A O     1 
ATOM 3349  C CB    . GLN C 3 343 ? 28.900  150.093 9.194   1.00 48.46  ? 343 GLN A CB    1 
ATOM 3350  C CG    . GLN C 3 343 ? 28.207  148.829 8.737   1.00 45.37  ? 343 GLN A CG    1 
ATOM 3351  C CD    . GLN C 3 343 ? 29.073  147.604 8.972   1.00 45.08  ? 343 GLN A CD    1 
ATOM 3352  O OE1   . GLN C 3 343 ? 30.007  147.321 8.213   1.00 44.82  ? 343 GLN A OE1   1 
ATOM 3353  N NE2   . GLN C 3 343 ? 28.784  146.885 10.047  1.00 44.04  ? 343 GLN A NE2   1 
ATOM 3354  N N     . GLU C 3 344 ? 29.545  153.129 9.776   1.00 53.41  ? 344 GLU A N     1 
ATOM 3355  C CA    . GLU C 3 344 ? 30.303  154.131 10.509  1.00 55.02  ? 344 GLU A CA    1 
ATOM 3356  C C     . GLU C 3 344 ? 30.138  155.491 9.856   1.00 56.33  ? 344 GLU A C     1 
ATOM 3357  O O     . GLU C 3 344 ? 30.453  155.676 8.682   1.00 55.77  ? 344 GLU A O     1 
ATOM 3358  C CB    . GLU C 3 344 ? 31.788  153.762 10.592  1.00 54.75  ? 344 GLU A CB    1 
ATOM 3359  C CG    . GLU C 3 344 ? 32.100  152.521 11.442  1.00 56.21  ? 344 GLU A CG    1 
ATOM 3360  C CD    . GLU C 3 344 ? 31.880  152.716 12.946  1.00 56.86  ? 344 GLU A CD    1 
ATOM 3361  O OE1   . GLU C 3 344 ? 30.926  153.429 13.343  1.00 56.53  ? 344 GLU A OE1   1 
ATOM 3362  O OE2   . GLU C 3 344 ? 32.664  152.135 13.734  1.00 57.44  ? 344 GLU A OE2   1 
ATOM 3363  N N     . PRO C 3 345 ? 29.653  156.466 10.633  1.00 57.53  ? 345 PRO A N     1 
ATOM 3364  C CA    . PRO C 3 345 ? 29.378  157.864 10.317  1.00 59.61  ? 345 PRO A CA    1 
ATOM 3365  C C     . PRO C 3 345 ? 29.607  158.372 8.892   1.00 61.06  ? 345 PRO A C     1 
ATOM 3366  O O     . PRO C 3 345 ? 28.766  158.128 8.030   1.00 60.62  ? 345 PRO A O     1 
ATOM 3367  C CB    . PRO C 3 345 ? 30.211  158.579 11.358  1.00 59.77  ? 345 PRO A CB    1 
ATOM 3368  C CG    . PRO C 3 345 ? 29.894  157.730 12.598  1.00 59.68  ? 345 PRO A CG    1 
ATOM 3369  C CD    . PRO C 3 345 ? 29.682  156.293 12.095  1.00 57.43  ? 345 PRO A CD    1 
ATOM 3370  N N     . PHE C 3 346 ? 30.716  159.070 8.633   1.00 63.32  ? 346 PHE A N     1 
ATOM 3371  C CA    . PHE C 3 346 ? 30.949  159.616 7.284   1.00 66.88  ? 346 PHE A CA    1 
ATOM 3372  C C     . PHE C 3 346 ? 31.427  158.619 6.229   1.00 66.87  ? 346 PHE A C     1 
ATOM 3373  O O     . PHE C 3 346 ? 31.531  158.951 5.040   1.00 66.81  ? 346 PHE A O     1 
ATOM 3374  C CB    . PHE C 3 346 ? 31.858  160.862 7.308   1.00 71.05  ? 346 PHE A CB    1 
ATOM 3375  C CG    . PHE C 3 346 ? 31.504  161.906 6.245   1.00 75.21  ? 346 PHE A CG    1 
ATOM 3376  C CD1   . PHE C 3 346 ? 30.570  162.915 6.518   1.00 76.89  ? 346 PHE A CD1   1 
ATOM 3377  C CD2   . PHE C 3 346 ? 32.103  161.879 4.976   1.00 76.74  ? 346 PHE A CD2   1 
ATOM 3378  C CE1   . PHE C 3 346 ? 30.239  163.881 5.549   1.00 78.12  ? 346 PHE A CE1   1 
ATOM 3379  C CE2   . PHE C 3 346 ? 31.779  162.841 3.998   1.00 76.74  ? 346 PHE A CE2   1 
ATOM 3380  C CZ    . PHE C 3 346 ? 30.845  163.842 4.287   1.00 78.04  ? 346 PHE A CZ    1 
ATOM 3381  N N     . LYS C 3 347 ? 31.771  157.413 6.660   1.00 66.78  ? 347 LYS A N     1 
ATOM 3382  C CA    . LYS C 3 347 ? 32.170  156.408 5.693   1.00 66.79  ? 347 LYS A CA    1 
ATOM 3383  C C     . LYS C 3 347 ? 30.885  155.696 5.291   1.00 65.31  ? 347 LYS A C     1 
ATOM 3384  O O     . LYS C 3 347 ? 30.218  155.044 6.109   1.00 64.09  ? 347 LYS A O     1 
ATOM 3385  C CB    . LYS C 3 347 ? 33.232  155.457 6.258   1.00 68.91  ? 347 LYS A CB    1 
ATOM 3386  C CG    . LYS C 3 347 ? 34.661  155.917 5.938   1.00 70.29  ? 347 LYS A CG    1 
ATOM 3387  C CD    . LYS C 3 347 ? 35.721  154.832 6.184   1.00 71.08  ? 347 LYS A CD    1 
ATOM 3388  C CE    . LYS C 3 347 ? 37.048  155.211 5.496   1.00 71.30  ? 347 LYS A CE    1 
ATOM 3389  N NZ    . LYS C 3 347 ? 38.168  154.225 5.661   1.00 72.36  ? 347 LYS A NZ    1 
ATOM 3390  N N     . ASN C 3 348 ? 30.499  155.886 4.037   1.00 63.45  ? 348 ASN A N     1 
ATOM 3391  C CA    . ASN C 3 348 ? 29.261  155.297 3.567   1.00 62.71  ? 348 ASN A CA    1 
ATOM 3392  C C     . ASN C 3 348 ? 29.348  153.968 2.828   1.00 59.61  ? 348 ASN A C     1 
ATOM 3393  O O     . ASN C 3 348 ? 30.262  153.742 2.027   1.00 60.19  ? 348 ASN A O     1 
ATOM 3394  C CB    . ASN C 3 348 ? 28.488  156.309 2.728   1.00 67.26  ? 348 ASN A CB    1 
ATOM 3395  C CG    . ASN C 3 348 ? 26.975  156.112 2.821   1.00 71.67  ? 348 ASN A CG    1 
ATOM 3396  O OD1   . ASN C 3 348 ? 26.205  156.887 2.244   1.00 74.22  ? 348 ASN A OD1   1 
ATOM 3397  N ND2   . ASN C 3 348 ? 26.542  155.086 3.563   1.00 73.12  ? 348 ASN A ND2   1 
ATOM 3398  N N     . LEU C 3 349 ? 28.356  153.112 3.089   1.00 54.51  ? 349 LEU A N     1 
ATOM 3399  C CA    . LEU C 3 349 ? 28.259  151.796 2.467   1.00 49.31  ? 349 LEU A CA    1 
ATOM 3400  C C     . LEU C 3 349 ? 27.561  151.875 1.115   1.00 47.11  ? 349 LEU A C     1 
ATOM 3401  O O     . LEU C 3 349 ? 27.972  151.217 0.156   1.00 46.74  ? 349 LEU A O     1 
ATOM 3402  C CB    . LEU C 3 349 ? 27.518  150.834 3.384   1.00 46.92  ? 349 LEU A CB    1 
ATOM 3403  C CG    . LEU C 3 349 ? 28.267  149.522 3.553   1.00 44.68  ? 349 LEU A CG    1 
ATOM 3404  C CD1   . LEU C 3 349 ? 27.609  148.703 4.626   1.00 44.13  ? 349 LEU A CD1   1 
ATOM 3405  C CD2   . LEU C 3 349 ? 28.318  148.769 2.239   1.00 44.24  ? 349 LEU A CD2   1 
ATOM 3406  N N     . LYS C 3 350 ? 26.489  152.659 1.057   1.00 45.18  ? 350 LYS A N     1 
ATOM 3407  C CA    . LYS C 3 350 ? 25.746  152.862 -0.179  1.00 44.36  ? 350 LYS A CA    1 
ATOM 3408  C C     . LYS C 3 350 ? 24.568  153.806 0.054   1.00 44.80  ? 350 LYS A C     1 
ATOM 3409  O O     . LYS C 3 350 ? 23.980  153.829 1.142   1.00 44.04  ? 350 LYS A O     1 
ATOM 3410  C CB    . LYS C 3 350 ? 25.258  151.533 -0.741  1.00 43.89  ? 350 LYS A CB    1 
ATOM 3411  C CG    . LYS C 3 350 ? 25.020  151.558 -2.232  1.00 43.10  ? 350 LYS A CG    1 
ATOM 3412  C CD    . LYS C 3 350 ? 23.759  150.786 -2.580  1.00 43.25  ? 350 LYS A CD    1 
ATOM 3413  C CE    . LYS C 3 350 ? 22.559  151.376 -1.832  1.00 43.08  ? 350 LYS A CE    1 
ATOM 3414  N NZ    . LYS C 3 350 ? 21.264  150.750 -2.191  1.00 41.27  ? 350 LYS A NZ    1 
ATOM 3415  N N     . THR C 3 351 ? 24.224  154.570 -0.983  1.00 45.34  ? 351 THR A N     1 
ATOM 3416  C CA    . THR C 3 351 ? 23.133  155.553 -0.926  1.00 45.26  ? 351 THR A CA    1 
ATOM 3417  C C     . THR C 3 351 ? 21.992  155.281 -1.921  1.00 45.90  ? 351 THR A C     1 
ATOM 3418  O O     . THR C 3 351 ? 22.078  154.380 -2.749  1.00 47.16  ? 351 THR A O     1 
ATOM 3419  C CB    . THR C 3 351 ? 23.673  156.962 -1.225  1.00 43.59  ? 351 THR A CB    1 
ATOM 3420  O OG1   . THR C 3 351 ? 23.762  157.153 -2.644  1.00 42.28  ? 351 THR A OG1   1 
ATOM 3421  C CG2   . THR C 3 351 ? 25.057  157.125 -0.628  1.00 43.32  ? 351 THR A CG2   1 
ATOM 3422  N N     . GLY C 3 352 ? 20.939  156.088 -1.861  1.00 44.78  ? 352 GLY A N     1 
ATOM 3423  C CA    . GLY C 3 352 ? 19.842  155.895 -2.785  1.00 44.47  ? 352 GLY A CA    1 
ATOM 3424  C C     . GLY C 3 352 ? 18.616  156.698 -2.430  1.00 44.93  ? 352 GLY A C     1 
ATOM 3425  O O     . GLY C 3 352 ? 18.332  156.953 -1.261  1.00 44.45  ? 352 GLY A O     1 
ATOM 3426  N N     . LYS C 3 353 ? 17.870  157.047 -3.469  1.00 46.12  ? 353 LYS A N     1 
ATOM 3427  C CA    . LYS C 3 353 ? 16.651  157.838 -3.372  1.00 46.93  ? 353 LYS A CA    1 
ATOM 3428  C C     . LYS C 3 353 ? 15.386  156.998 -3.383  1.00 47.32  ? 353 LYS A C     1 
ATOM 3429  O O     . LYS C 3 353 ? 15.441  155.773 -3.461  1.00 47.42  ? 353 LYS A O     1 
ATOM 3430  C CB    . LYS C 3 353 ? 16.596  158.824 -4.545  1.00 47.95  ? 353 LYS A CB    1 
ATOM 3431  C CG    . LYS C 3 353 ? 16.819  158.204 -5.958  1.00 48.37  ? 353 LYS A CG    1 
ATOM 3432  C CD    . LYS C 3 353 ? 15.708  157.242 -6.422  1.00 49.15  ? 353 LYS A CD    1 
ATOM 3433  C CE    . LYS C 3 353 ? 14.400  157.961 -6.723  1.00 49.97  ? 353 LYS A CE    1 
ATOM 3434  N NZ    . LYS C 3 353 ? 13.236  157.025 -6.740  1.00 50.12  ? 353 LYS A NZ    1 
ATOM 3435  N N     . TYR C 3 354 ? 14.252  157.695 -3.448  1.00 48.44  ? 354 TYR A N     1 
ATOM 3436  C CA    . TYR C 3 354 ? 12.934  157.079 -3.479  1.00 49.31  ? 354 TYR A CA    1 
ATOM 3437  C C     . TYR C 3 354 ? 11.880  158.147 -3.719  1.00 51.01  ? 354 TYR A C     1 
ATOM 3438  O O     . TYR C 3 354 ? 11.950  159.231 -3.136  1.00 50.14  ? 354 TYR A O     1 
ATOM 3439  C CB    . TYR C 3 354 ? 12.658  156.395 -2.152  1.00 48.69  ? 354 TYR A CB    1 
ATOM 3440  C CG    . TYR C 3 354 ? 11.278  155.830 -2.045  1.00 48.33  ? 354 TYR A CG    1 
ATOM 3441  C CD1   . TYR C 3 354 ? 10.482  156.114 -0.949  1.00 49.27  ? 354 TYR A CD1   1 
ATOM 3442  C CD2   . TYR C 3 354 ? 10.776  154.993 -3.029  1.00 48.28  ? 354 TYR A CD2   1 
ATOM 3443  C CE1   . TYR C 3 354 ? 9.215   155.575 -0.827  1.00 50.43  ? 354 TYR A CE1   1 
ATOM 3444  C CE2   . TYR C 3 354 ? 9.515   154.449 -2.920  1.00 49.73  ? 354 TYR A CE2   1 
ATOM 3445  C CZ    . TYR C 3 354 ? 8.736   154.740 -1.812  1.00 50.77  ? 354 TYR A CZ    1 
ATOM 3446  O OH    . TYR C 3 354 ? 7.491   154.168 -1.673  1.00 52.35  ? 354 TYR A OH    1 
ATOM 3447  N N     . ALA C 3 355 ? 10.871  157.816 -4.522  1.00 53.74  ? 355 ALA A N     1 
ATOM 3448  C CA    . ALA C 3 355 ? 9.810   158.771 -4.837  1.00 56.86  ? 355 ALA A CA    1 
ATOM 3449  C C     . ALA C 3 355 ? 8.458   158.162 -5.249  1.00 59.26  ? 355 ALA A C     1 
ATOM 3450  O O     . ALA C 3 355 ? 7.637   158.827 -5.895  1.00 59.34  ? 355 ALA A O     1 
ATOM 3451  C CB    . ALA C 3 355 ? 10.302  159.728 -5.916  1.00 56.87  ? 355 ALA A CB    1 
ATOM 3452  N N     . ARG C 3 356 ? 8.198   156.925 -4.834  1.00 62.59  ? 356 ARG A N     1 
ATOM 3453  C CA    . ARG C 3 356 ? 6.944   156.260 -5.192  1.00 65.87  ? 356 ARG A CA    1 
ATOM 3454  C C     . ARG C 3 356 ? 5.688   157.021 -4.805  1.00 65.39  ? 356 ARG A C     1 
ATOM 3455  O O     . ARG C 3 356 ? 5.369   157.190 -3.627  1.00 63.94  ? 356 ARG A O     1 
ATOM 3456  C CB    . ARG C 3 356 ? 6.880   154.837 -4.608  1.00 70.40  ? 356 ARG A CB    1 
ATOM 3457  C CG    . ARG C 3 356 ? 5.511   154.122 -4.723  1.00 75.64  ? 356 ARG A CG    1 
ATOM 3458  C CD    . ARG C 3 356 ? 5.534   152.702 -4.118  1.00 79.49  ? 356 ARG A CD    1 
ATOM 3459  N NE    . ARG C 3 356 ? 6.462   151.805 -4.818  1.00 83.41  ? 356 ARG A NE    1 
ATOM 3460  C CZ    . ARG C 3 356 ? 6.117   150.671 -5.435  1.00 85.65  ? 356 ARG A CZ    1 
ATOM 3461  N NH1   . ARG C 3 356 ? 4.848   150.263 -5.450  1.00 86.31  ? 356 ARG A NH1   1 
ATOM 3462  N NH2   . ARG C 3 356 ? 7.044   149.941 -6.052  1.00 85.92  ? 356 ARG A NH2   1 
ATOM 3463  N N     . MET C 3 357 ? 4.991   157.514 -5.811  1.00 65.92  ? 357 MET A N     1 
ATOM 3464  C CA    . MET C 3 357 ? 3.751   158.193 -5.545  1.00 68.22  ? 357 MET A CA    1 
ATOM 3465  C C     . MET C 3 357 ? 2.732   157.054 -5.512  1.00 68.46  ? 357 MET A C     1 
ATOM 3466  O O     . MET C 3 357 ? 2.128   156.733 -6.537  1.00 68.73  ? 357 MET A O     1 
ATOM 3467  C CB    . MET C 3 357 ? 3.435   159.166 -6.671  1.00 70.86  ? 357 MET A CB    1 
ATOM 3468  C CG    . MET C 3 357 ? 2.247   160.080 -6.374  1.00 75.30  ? 357 MET A CG    1 
ATOM 3469  S SD    . MET C 3 357 ? 2.573   161.220 -4.995  1.00 78.47  ? 357 MET A SD    1 
ATOM 3470  C CE    . MET C 3 357 ? 1.961   160.256 -3.606  1.00 77.37  ? 357 MET A CE    1 
ATOM 3471  N N     . ARG C 3 358 ? 2.575   156.418 -4.350  1.00 68.45  ? 358 ARG A N     1 
ATOM 3472  C CA    . ARG C 3 358 ? 1.653   155.288 -4.217  1.00 68.83  ? 358 ARG A CA    1 
ATOM 3473  C C     . ARG C 3 358 ? 0.178   155.623 -4.485  1.00 67.57  ? 358 ARG A C     1 
ATOM 3474  O O     . ARG C 3 358 ? -0.197  155.845 -5.640  1.00 67.73  ? 358 ARG A O     1 
ATOM 3475  C CB    . ARG C 3 358 ? 1.831   154.582 -2.861  1.00 71.10  ? 358 ARG A CB    1 
ATOM 3476  C CG    . ARG C 3 358 ? 1.862   153.043 -2.968  1.00 73.48  ? 358 ARG A CG    1 
ATOM 3477  C CD    . ARG C 3 358 ? 1.947   152.322 -1.601  1.00 75.17  ? 358 ARG A CD    1 
ATOM 3478  N NE    . ARG C 3 358 ? 0.667   152.249 -0.881  1.00 77.67  ? 358 ARG A NE    1 
ATOM 3479  C CZ    . ARG C 3 358 ? 0.514   151.798 0.368   1.00 77.58  ? 358 ARG A CZ    1 
ATOM 3480  N NH1   . ARG C 3 358 ? 1.559   151.370 1.073   1.00 77.48  ? 358 ARG A NH1   1 
ATOM 3481  N NH2   . ARG C 3 358 ? -0.698  151.760 0.913   1.00 78.25  ? 358 ARG A NH2   1 
ATOM 3482  N N     . GLY C 3 359 ? -0.647  155.662 -3.435  1.00 66.52  ? 359 GLY A N     1 
ATOM 3483  C CA    . GLY C 3 359 ? -2.070  155.949 -3.597  1.00 64.23  ? 359 GLY A CA    1 
ATOM 3484  C C     . GLY C 3 359 ? -2.429  157.232 -4.337  1.00 63.26  ? 359 GLY A C     1 
ATOM 3485  O O     . GLY C 3 359 ? -1.576  158.107 -4.541  1.00 63.36  ? 359 GLY A O     1 
ATOM 3486  N N     . ALA C 3 360 ? -3.689  157.334 -4.764  1.00 60.88  ? 360 ALA A N     1 
ATOM 3487  C CA    . ALA C 3 360 ? -4.188  158.514 -5.481  1.00 58.86  ? 360 ALA A CA    1 
ATOM 3488  C C     . ALA C 3 360 ? -4.189  159.733 -4.550  1.00 56.81  ? 360 ALA A C     1 
ATOM 3489  O O     . ALA C 3 360 ? -4.166  160.886 -4.990  1.00 56.62  ? 360 ALA A O     1 
ATOM 3490  C CB    . ALA C 3 360 ? -5.596  158.253 -6.013  1.00 57.42  ? 360 ALA A CB    1 
ATOM 3491  N N     . HIS C 3 361 ? -4.232  159.456 -3.256  1.00 54.18  ? 361 HIS A N     1 
ATOM 3492  C CA    . HIS C 3 361 ? -4.222  160.491 -2.249  1.00 52.17  ? 361 HIS A CA    1 
ATOM 3493  C C     . HIS C 3 361 ? -3.443  159.900 -1.100  1.00 51.15  ? 361 HIS A C     1 
ATOM 3494  O O     . HIS C 3 361 ? -3.984  159.095 -0.343  1.00 51.78  ? 361 HIS A O     1 
ATOM 3495  C CB    . HIS C 3 361 ? -5.635  160.767 -1.735  1.00 52.99  ? 361 HIS A CB    1 
ATOM 3496  C CG    . HIS C 3 361 ? -6.666  160.938 -2.803  1.00 53.65  ? 361 HIS A CG    1 
ATOM 3497  N ND1   . HIS C 3 361 ? -6.538  161.856 -3.823  1.00 54.18  ? 361 HIS A ND1   1 
ATOM 3498  C CD2   . HIS C 3 361 ? -7.874  160.353 -2.970  1.00 53.53  ? 361 HIS A CD2   1 
ATOM 3499  C CE1   . HIS C 3 361 ? -7.627  161.832 -4.568  1.00 55.47  ? 361 HIS A CE1   1 
ATOM 3500  N NE2   . HIS C 3 361 ? -8.455  160.930 -4.072  1.00 54.62  ? 361 HIS A NE2   1 
ATOM 3501  N N     . THR C 3 362 ? -2.167  160.229 -0.980  1.00 49.98  ? 362 THR A N     1 
ATOM 3502  C CA    . THR C 3 362 ? -1.414  159.678 0.140   1.00 50.52  ? 362 THR A CA    1 
ATOM 3503  C C     . THR C 3 362 ? -0.649  160.731 0.916   1.00 48.18  ? 362 THR A C     1 
ATOM 3504  O O     . THR C 3 362 ? -0.029  161.627 0.341   1.00 46.25  ? 362 THR A O     1 
ATOM 3505  C CB    . THR C 3 362 ? -0.459  158.499 -0.265  1.00 53.13  ? 362 THR A CB    1 
ATOM 3506  O OG1   . THR C 3 362 ? 0.435   158.916 -1.304  1.00 56.49  ? 362 THR A OG1   1 
ATOM 3507  C CG2   . THR C 3 362 ? -1.254  157.268 -0.722  1.00 52.71  ? 362 THR A CG2   1 
ATOM 3508  N N     . ASN C 3 363 ? -0.722  160.625 2.237   1.00 46.70  ? 363 ASN A N     1 
ATOM 3509  C CA    . ASN C 3 363 ? -0.037  161.567 3.095   1.00 45.60  ? 363 ASN A CA    1 
ATOM 3510  C C     . ASN C 3 363 ? 1.453   161.330 3.185   1.00 44.60  ? 363 ASN A C     1 
ATOM 3511  O O     . ASN C 3 363 ? 1.989   160.383 2.608   1.00 46.32  ? 363 ASN A O     1 
ATOM 3512  C CB    . ASN C 3 363 ? -0.661  161.615 4.492   1.00 45.98  ? 363 ASN A CB    1 
ATOM 3513  C CG    . ASN C 3 363 ? -0.369  160.382 5.338   1.00 46.43  ? 363 ASN A CG    1 
ATOM 3514  O OD1   . ASN C 3 363 ? 0.741   159.838 5.331   1.00 46.56  ? 363 ASN A OD1   1 
ATOM 3515  N ND2   . ASN C 3 363 ? -1.356  159.983 6.136   1.00 45.79  ? 363 ASN A ND2   1 
ATOM 3516  N N     . ASP C 3 364 ? 2.089   162.136 4.018   1.00 42.43  ? 364 ASP A N     1 
ATOM 3517  C CA    . ASP C 3 364 ? 3.518   162.089 4.202   1.00 41.82  ? 364 ASP A CA    1 
ATOM 3518  C C     . ASP C 3 364 ? 4.119   160.958 5.039   1.00 39.85  ? 364 ASP A C     1 
ATOM 3519  O O     . ASP C 3 364 ? 5.315   160.670 4.921   1.00 38.70  ? 364 ASP A O     1 
ATOM 3520  C CB    . ASP C 3 364 ? 3.971   163.431 4.739   1.00 45.40  ? 364 ASP A CB    1 
ATOM 3521  C CG    . ASP C 3 364 ? 5.177   163.943 4.020   1.00 48.04  ? 364 ASP A CG    1 
ATOM 3522  O OD1   . ASP C 3 364 ? 5.010   164.501 2.913   1.00 50.92  ? 364 ASP A OD1   1 
ATOM 3523  O OD2   . ASP C 3 364 ? 6.294   163.761 4.553   1.00 51.34  ? 364 ASP A OD2   1 
ATOM 3524  N N     . VAL C 3 365 ? 3.323   160.339 5.905   1.00 38.28  ? 365 VAL A N     1 
ATOM 3525  C CA    . VAL C 3 365 ? 3.850   159.252 6.730   1.00 37.86  ? 365 VAL A CA    1 
ATOM 3526  C C     . VAL C 3 365 ? 4.093   158.086 5.811   1.00 37.81  ? 365 VAL A C     1 
ATOM 3527  O O     . VAL C 3 365 ? 5.207   157.569 5.716   1.00 36.83  ? 365 VAL A O     1 
ATOM 3528  C CB    . VAL C 3 365 ? 2.853   158.747 7.777   1.00 36.92  ? 365 VAL A CB    1 
ATOM 3529  C CG1   . VAL C 3 365 ? 3.593   158.339 9.035   1.00 35.84  ? 365 VAL A CG1   1 
ATOM 3530  C CG2   . VAL C 3 365 ? 1.798   159.773 8.056   1.00 37.09  ? 365 VAL A CG2   1 
ATOM 3531  N N     . LYS C 3 366 ? 3.011   157.695 5.141   1.00 38.24  ? 366 LYS A N     1 
ATOM 3532  C CA    . LYS C 3 366 ? 2.997   156.593 4.195   1.00 39.31  ? 366 LYS A CA    1 
ATOM 3533  C C     . LYS C 3 366 ? 4.296   156.606 3.418   1.00 39.27  ? 366 LYS A C     1 
ATOM 3534  O O     . LYS C 3 366 ? 4.989   155.595 3.340   1.00 38.92  ? 366 LYS A O     1 
ATOM 3535  C CB    . LYS C 3 366 ? 1.794   156.738 3.256   1.00 40.41  ? 366 LYS A CB    1 
ATOM 3536  C CG    . LYS C 3 366 ? 0.468   156.833 4.009   1.00 42.29  ? 366 LYS A CG    1 
ATOM 3537  C CD    . LYS C 3 366 ? -0.744  156.992 3.096   1.00 43.85  ? 366 LYS A CD    1 
ATOM 3538  C CE    . LYS C 3 366 ? -1.118  155.693 2.384   1.00 45.51  ? 366 LYS A CE    1 
ATOM 3539  N NZ    . LYS C 3 366 ? -2.449  155.791 1.691   1.00 47.81  ? 366 LYS A NZ    1 
ATOM 3540  N N     . GLN C 3 367 ? 4.668   157.798 2.959   1.00 39.22  ? 367 GLN A N     1 
ATOM 3541  C CA    . GLN C 3 367 ? 5.898   158.012 2.204   1.00 39.57  ? 367 GLN A CA    1 
ATOM 3542  C C     . GLN C 3 367 ? 7.095   157.377 2.910   1.00 37.56  ? 367 GLN A C     1 
ATOM 3543  O O     . GLN C 3 367 ? 7.677   156.425 2.400   1.00 36.53  ? 367 GLN A O     1 
ATOM 3544  C CB    . GLN C 3 367 ? 6.139   159.513 2.019   1.00 41.96  ? 367 GLN A CB    1 
ATOM 3545  C CG    . GLN C 3 367 ? 5.063   160.264 1.215   1.00 45.40  ? 367 GLN A CG    1 
ATOM 3546  C CD    . GLN C 3 367 ? 5.411   160.422 -0.261  1.00 45.77  ? 367 GLN A CD    1 
ATOM 3547  O OE1   . GLN C 3 367 ? 6.392   161.087 -0.611  1.00 45.19  ? 367 GLN A OE1   1 
ATOM 3548  N NE2   . GLN C 3 367 ? 4.599   159.824 -1.134  1.00 45.98  ? 367 GLN A NE2   1 
ATOM 3549  N N     . LEU C 3 368 ? 7.438   157.879 4.096   1.00 35.36  ? 368 LEU A N     1 
ATOM 3550  C CA    . LEU C 3 368 ? 8.560   157.328 4.841   1.00 33.65  ? 368 LEU A CA    1 
ATOM 3551  C C     . LEU C 3 368 ? 8.348   155.849 5.050   1.00 33.07  ? 368 LEU A C     1 
ATOM 3552  O O     . LEU C 3 368 ? 9.258   155.050 4.847   1.00 31.67  ? 368 LEU A O     1 
ATOM 3553  C CB    . LEU C 3 368 ? 8.706   157.987 6.204   1.00 32.38  ? 368 LEU A CB    1 
ATOM 3554  C CG    . LEU C 3 368 ? 9.747   157.256 7.064   1.00 32.84  ? 368 LEU A CG    1 
ATOM 3555  C CD1   . LEU C 3 368 ? 11.082  157.242 6.354   1.00 34.32  ? 368 LEU A CD1   1 
ATOM 3556  C CD2   . LEU C 3 368 ? 9.891   157.902 8.417   1.00 33.58  ? 368 LEU A CD2   1 
ATOM 3557  N N     . THR C 3 369 ? 7.145   155.504 5.492   1.00 33.50  ? 369 THR A N     1 
ATOM 3558  C CA    . THR C 3 369 ? 6.781   154.120 5.732   1.00 35.02  ? 369 THR A CA    1 
ATOM 3559  C C     . THR C 3 369 ? 7.290   153.330 4.542   1.00 35.37  ? 369 THR A C     1 
ATOM 3560  O O     . THR C 3 369 ? 8.257   152.567 4.655   1.00 34.70  ? 369 THR A O     1 
ATOM 3561  C CB    . THR C 3 369 ? 5.245   153.983 5.868   1.00 35.92  ? 369 THR A CB    1 
ATOM 3562  O OG1   . THR C 3 369 ? 4.842   154.421 7.174   1.00 36.76  ? 369 THR A OG1   1 
ATOM 3563  C CG2   . THR C 3 369 ? 4.786   152.539 5.636   1.00 37.18  ? 369 THR A CG2   1 
ATOM 3564  N N     . GLU C 3 370 ? 6.725   153.645 3.381   1.00 36.82  ? 370 GLU A N     1 
ATOM 3565  C CA    . GLU C 3 370 ? 7.098   153.014 2.123   1.00 37.34  ? 370 GLU A CA    1 
ATOM 3566  C C     . GLU C 3 370 ? 8.604   153.121 1.947   1.00 35.72  ? 370 GLU A C     1 
ATOM 3567  O O     . GLU C 3 370 ? 9.294   152.118 1.796   1.00 36.33  ? 370 GLU A O     1 
ATOM 3568  C CB    . GLU C 3 370 ? 6.392   153.716 0.964   1.00 38.45  ? 370 GLU A CB    1 
ATOM 3569  C CG    . GLU C 3 370 ? 4.875   153.591 0.996   1.00 42.58  ? 370 GLU A CG    1 
ATOM 3570  C CD    . GLU C 3 370 ? 4.165   154.560 0.045   1.00 45.11  ? 370 GLU A CD    1 
ATOM 3571  O OE1   . GLU C 3 370 ? 3.052   155.004 0.407   1.00 47.68  ? 370 GLU A OE1   1 
ATOM 3572  O OE2   . GLU C 3 370 ? 4.694   154.873 -1.053  1.00 45.34  ? 370 GLU A OE2   1 
ATOM 3573  N N     . ALA C 3 371 ? 9.110   154.341 2.080   1.00 33.71  ? 371 ALA A N     1 
ATOM 3574  C CA    . ALA C 3 371 ? 10.527  154.617 1.940   1.00 31.95  ? 371 ALA A CA    1 
ATOM 3575  C C     . ALA C 3 371 ? 11.372  153.615 2.692   1.00 30.81  ? 371 ALA A C     1 
ATOM 3576  O O     . ALA C 3 371 ? 12.280  153.016 2.128   1.00 30.36  ? 371 ALA A O     1 
ATOM 3577  C CB    . ALA C 3 371 ? 10.827  156.019 2.422   1.00 31.36  ? 371 ALA A CB    1 
ATOM 3578  N N     . VAL C 3 372 ? 11.017  153.380 3.947   1.00 30.32  ? 372 VAL A N     1 
ATOM 3579  C CA    . VAL C 3 372 ? 11.769  152.451 4.765   1.00 32.20  ? 372 VAL A CA    1 
ATOM 3580  C C     . VAL C 3 372 ? 11.794  151.060 4.167   1.00 33.01  ? 372 VAL A C     1 
ATOM 3581  O O     . VAL C 3 372 ? 12.865  150.472 3.989   1.00 32.50  ? 372 VAL A O     1 
ATOM 3582  C CB    . VAL C 3 372 ? 11.229  152.408 6.197   1.00 32.30  ? 372 VAL A CB    1 
ATOM 3583  C CG1   . VAL C 3 372 ? 11.874  151.274 6.978   1.00 30.47  ? 372 VAL A CG1   1 
ATOM 3584  C CG2   . VAL C 3 372 ? 11.523  153.734 6.875   1.00 32.26  ? 372 VAL A CG2   1 
ATOM 3585  N N     . GLN C 3 373 ? 10.618  150.568 3.797   1.00 34.24  ? 373 GLN A N     1 
ATOM 3586  C CA    . GLN C 3 373 ? 10.496  149.233 3.220   1.00 35.95  ? 373 GLN A CA    1 
ATOM 3587  C C     . GLN C 3 373 ? 11.440  148.976 2.035   1.00 35.00  ? 373 GLN A C     1 
ATOM 3588  O O     . GLN C 3 373 ? 12.142  147.958 2.006   1.00 33.60  ? 373 GLN A O     1 
ATOM 3589  C CB    . GLN C 3 373 ? 9.026   148.932 2.883   1.00 38.01  ? 373 GLN A CB    1 
ATOM 3590  C CG    . GLN C 3 373 ? 8.132   148.873 4.149   1.00 43.02  ? 373 GLN A CG    1 
ATOM 3591  C CD    . GLN C 3 373 ? 6.658   148.523 3.879   1.00 45.14  ? 373 GLN A CD    1 
ATOM 3592  O OE1   . GLN C 3 373 ? 6.348   147.539 3.197   1.00 47.07  ? 373 GLN A OE1   1 
ATOM 3593  N NE2   . GLN C 3 373 ? 5.746   149.321 4.440   1.00 44.68  ? 373 GLN A NE2   1 
ATOM 3594  N N     . LYS C 3 374 ? 11.534  149.937 1.115   1.00 34.31  ? 374 LYS A N     1 
ATOM 3595  C CA    . LYS C 3 374 ? 12.421  149.798 -0.044  1.00 33.23  ? 374 LYS A CA    1 
ATOM 3596  C C     . LYS C 3 374 ? 13.852  149.570 0.430   1.00 31.07  ? 374 LYS A C     1 
ATOM 3597  O O     . LYS C 3 374 ? 14.646  148.869 -0.203  1.00 30.90  ? 374 LYS A O     1 
ATOM 3598  C CB    . LYS C 3 374 ? 12.395  151.051 -0.929  1.00 34.88  ? 374 LYS A CB    1 
ATOM 3599  C CG    . LYS C 3 374 ? 13.437  150.987 -2.065  1.00 37.69  ? 374 LYS A CG    1 
ATOM 3600  C CD    . LYS C 3 374 ? 13.672  152.330 -2.758  1.00 38.90  ? 374 LYS A CD    1 
ATOM 3601  C CE    . LYS C 3 374 ? 14.773  152.245 -3.837  1.00 39.37  ? 374 LYS A CE    1 
ATOM 3602  N NZ    . LYS C 3 374 ? 16.114  151.851 -3.303  1.00 38.53  ? 374 LYS A NZ    1 
ATOM 3603  N N     . ILE C 3 375 ? 14.178  150.204 1.541   1.00 27.82  ? 375 ILE A N     1 
ATOM 3604  C CA    . ILE C 3 375 ? 15.493  150.083 2.106   1.00 26.46  ? 375 ILE A CA    1 
ATOM 3605  C C     . ILE C 3 375 ? 15.636  148.655 2.605   1.00 25.11  ? 375 ILE A C     1 
ATOM 3606  O O     . ILE C 3 375 ? 16.592  147.950 2.259   1.00 24.04  ? 375 ILE A O     1 
ATOM 3607  C CB    . ILE C 3 375 ? 15.639  151.038 3.272   1.00 27.55  ? 375 ILE A CB    1 
ATOM 3608  C CG1   . ILE C 3 375 ? 15.241  152.447 2.837   1.00 29.76  ? 375 ILE A CG1   1 
ATOM 3609  C CG2   . ILE C 3 375 ? 17.051  151.053 3.722   1.00 29.32  ? 375 ILE A CG2   1 
ATOM 3610  C CD1   . ILE C 3 375 ? 15.142  153.450 3.972   1.00 30.59  ? 375 ILE A CD1   1 
ATOM 3611  N N     . THR C 3 376 ? 14.631  148.223 3.361   1.00 22.82  ? 376 THR A N     1 
ATOM 3612  C CA    . THR C 3 376 ? 14.597  146.886 3.943   1.00 20.23  ? 376 THR A CA    1 
ATOM 3613  C C     . THR C 3 376 ? 14.942  145.862 2.873   1.00 18.75  ? 376 THR A C     1 
ATOM 3614  O O     . THR C 3 376 ? 16.102  145.448 2.738   1.00 17.70  ? 376 THR A O     1 
ATOM 3615  C CB    . THR C 3 376 ? 13.190  146.568 4.507   1.00 20.56  ? 376 THR A CB    1 
ATOM 3616  O OG1   . THR C 3 376 ? 12.633  147.749 5.093   1.00 20.20  ? 376 THR A OG1   1 
ATOM 3617  C CG2   . THR C 3 376 ? 13.259  145.488 5.576   1.00 20.67  ? 376 THR A CG2   1 
ATOM 3618  N N     . THR C 3 377 ? 13.931  145.519 2.084   1.00 16.32  ? 377 THR A N     1 
ATOM 3619  C CA    . THR C 3 377 ? 14.054  144.562 1.006   1.00 15.54  ? 377 THR A CA    1 
ATOM 3620  C C     . THR C 3 377 ? 15.432  144.646 0.384   1.00 16.09  ? 377 THR A C     1 
ATOM 3621  O O     . THR C 3 377 ? 16.247  143.744 0.542   1.00 14.54  ? 377 THR A O     1 
ATOM 3622  C CB    . THR C 3 377 ? 12.954  144.816 -0.041  1.00 15.04  ? 377 THR A CB    1 
ATOM 3623  O OG1   . THR C 3 377 ? 11.867  143.917 0.197   1.00 15.73  ? 377 THR A OG1   1 
ATOM 3624  C CG2   . THR C 3 377 ? 13.457  144.634 -1.461  1.00 13.95  ? 377 THR A CG2   1 
ATOM 3625  N N     . GLU C 3 378 ? 15.721  145.788 -0.214  1.00 17.37  ? 378 GLU A N     1 
ATOM 3626  C CA    . GLU C 3 378 ? 16.998  146.005 -0.843  1.00 19.41  ? 378 GLU A CA    1 
ATOM 3627  C C     . GLU C 3 378 ? 18.109  145.505 0.055   1.00 18.42  ? 378 GLU A C     1 
ATOM 3628  O O     . GLU C 3 378 ? 18.808  144.577 -0.304  1.00 17.44  ? 378 GLU A O     1 
ATOM 3629  C CB    . GLU C 3 378 ? 17.166  147.483 -1.111  1.00 24.58  ? 378 GLU A CB    1 
ATOM 3630  C CG    . GLU C 3 378 ? 18.504  147.860 -1.680  1.00 31.44  ? 378 GLU A CG    1 
ATOM 3631  C CD    . GLU C 3 378 ? 18.559  149.327 -2.043  1.00 35.98  ? 378 GLU A CD    1 
ATOM 3632  O OE1   . GLU C 3 378 ? 18.501  150.167 -1.108  1.00 38.20  ? 378 GLU A OE1   1 
ATOM 3633  O OE2   . GLU C 3 378 ? 18.644  149.634 -3.259  1.00 37.77  ? 378 GLU A OE2   1 
ATOM 3634  N N     . SER C 3 379 ? 18.189  146.040 1.265   1.00 18.29  ? 379 SER A N     1 
ATOM 3635  C CA    . SER C 3 379 ? 19.225  145.625 2.196   1.00 21.03  ? 379 SER A CA    1 
ATOM 3636  C C     . SER C 3 379 ? 19.248  144.135 2.438   1.00 22.78  ? 379 SER A C     1 
ATOM 3637  O O     . SER C 3 379 ? 20.308  143.534 2.636   1.00 23.60  ? 379 SER A O     1 
ATOM 3638  C CB    . SER C 3 379 ? 19.048  146.297 3.539   1.00 22.52  ? 379 SER A CB    1 
ATOM 3639  O OG    . SER C 3 379 ? 19.881  145.649 4.491   1.00 23.18  ? 379 SER A OG    1 
ATOM 3640  N N     . ILE C 3 380 ? 18.062  143.561 2.544   1.00 24.49  ? 380 ILE A N     1 
ATOM 3641  C CA    . ILE C 3 380 ? 17.957  142.135 2.754   1.00 27.74  ? 380 ILE A CA    1 
ATOM 3642  C C     . ILE C 3 380 ? 18.765  141.468 1.671   1.00 28.02  ? 380 ILE A C     1 
ATOM 3643  O O     . ILE C 3 380 ? 19.581  140.598 1.921   1.00 27.39  ? 380 ILE A O     1 
ATOM 3644  C CB    . ILE C 3 380 ? 16.503  141.674 2.611   1.00 31.13  ? 380 ILE A CB    1 
ATOM 3645  C CG1   . ILE C 3 380 ? 15.775  141.909 3.926   1.00 31.56  ? 380 ILE A CG1   1 
ATOM 3646  C CG2   . ILE C 3 380 ? 16.429  140.204 2.144   1.00 32.31  ? 380 ILE A CG2   1 
ATOM 3647  C CD1   . ILE C 3 380 ? 16.475  141.254 5.123   1.00 33.54  ? 380 ILE A CD1   1 
ATOM 3648  N N     . VAL C 3 381 ? 18.533  141.924 0.454   1.00 28.93  ? 381 VAL A N     1 
ATOM 3649  C CA    . VAL C 3 381 ? 19.206  141.387 -0.704  1.00 29.12  ? 381 VAL A CA    1 
ATOM 3650  C C     . VAL C 3 381 ? 20.696  141.682 -0.664  1.00 28.51  ? 381 VAL A C     1 
ATOM 3651  O O     . VAL C 3 381 ? 21.500  140.900 -1.156  1.00 28.99  ? 381 VAL A O     1 
ATOM 3652  C CB    . VAL C 3 381 ? 18.600  141.977 -1.981  1.00 29.65  ? 381 VAL A CB    1 
ATOM 3653  C CG1   . VAL C 3 381 ? 18.944  141.115 -3.180  1.00 29.98  ? 381 VAL A CG1   1 
ATOM 3654  C CG2   . VAL C 3 381 ? 17.099  142.099 -1.824  1.00 30.35  ? 381 VAL A CG2   1 
ATOM 3655  N N     . ILE C 3 382 ? 21.081  142.782 -0.038  1.00 28.17  ? 382 ILE A N     1 
ATOM 3656  C CA    . ILE C 3 382 ? 22.492  143.091 -0.018  1.00 27.57  ? 382 ILE A CA    1 
ATOM 3657  C C     . ILE C 3 382 ? 23.235  142.476 1.143   1.00 26.53  ? 382 ILE A C     1 
ATOM 3658  O O     . ILE C 3 382 ? 24.423  142.224 1.027   1.00 26.49  ? 382 ILE A O     1 
ATOM 3659  C CB    . ILE C 3 382 ? 22.776  144.601 -0.076  1.00 29.93  ? 382 ILE A CB    1 
ATOM 3660  C CG1   . ILE C 3 382 ? 21.579  145.360 -0.660  1.00 31.39  ? 382 ILE A CG1   1 
ATOM 3661  C CG2   . ILE C 3 382 ? 24.012  144.851 -0.950  1.00 28.53  ? 382 ILE A CG2   1 
ATOM 3662  C CD1   . ILE C 3 382 ? 21.245  144.994 -2.102  1.00 32.60  ? 382 ILE A CD1   1 
ATOM 3663  N N     . TRP C 3 383 ? 22.563  142.238 2.264   1.00 25.57  ? 383 TRP A N     1 
ATOM 3664  C CA    . TRP C 3 383 ? 23.255  141.644 3.404   1.00 25.97  ? 383 TRP A CA    1 
ATOM 3665  C C     . TRP C 3 383 ? 22.445  140.625 4.129   1.00 26.71  ? 383 TRP A C     1 
ATOM 3666  O O     . TRP C 3 383 ? 22.857  140.140 5.177   1.00 27.72  ? 383 TRP A O     1 
ATOM 3667  C CB    . TRP C 3 383 ? 23.712  142.710 4.386   1.00 24.40  ? 383 TRP A CB    1 
ATOM 3668  C CG    . TRP C 3 383 ? 24.568  143.670 3.720   1.00 23.50  ? 383 TRP A CG    1 
ATOM 3669  C CD1   . TRP C 3 383 ? 25.873  143.504 3.384   1.00 22.86  ? 383 TRP A CD1   1 
ATOM 3670  C CD2   . TRP C 3 383 ? 24.165  144.925 3.183   1.00 23.22  ? 383 TRP A CD2   1 
ATOM 3671  N NE1   . TRP C 3 383 ? 26.314  144.579 2.657   1.00 22.11  ? 383 TRP A NE1   1 
ATOM 3672  C CE2   . TRP C 3 383 ? 25.282  145.469 2.518   1.00 23.65  ? 383 TRP A CE2   1 
ATOM 3673  C CE3   . TRP C 3 383 ? 22.965  145.642 3.191   1.00 20.62  ? 383 TRP A CE3   1 
ATOM 3674  C CZ2   . TRP C 3 383 ? 25.235  146.703 1.865   1.00 22.42  ? 383 TRP A CZ2   1 
ATOM 3675  C CZ3   . TRP C 3 383 ? 22.915  146.864 2.545   1.00 21.08  ? 383 TRP A CZ3   1 
ATOM 3676  C CH2   . TRP C 3 383 ? 24.045  147.385 1.888   1.00 22.11  ? 383 TRP A CH2   1 
ATOM 3677  N N     . GLY C 3 384 ? 21.278  140.318 3.586   1.00 27.54  ? 384 GLY A N     1 
ATOM 3678  C CA    . GLY C 3 384 ? 20.425  139.336 4.212   1.00 29.61  ? 384 GLY A CA    1 
ATOM 3679  C C     . GLY C 3 384 ? 20.209  139.710 5.652   1.00 32.01  ? 384 GLY A C     1 
ATOM 3680  O O     . GLY C 3 384 ? 20.061  138.833 6.496   1.00 32.63  ? 384 GLY A O     1 
ATOM 3681  N N     . LYS C 3 385 ? 20.281  141.006 5.939   1.00 34.28  ? 385 LYS A N     1 
ATOM 3682  C CA    . LYS C 3 385 ? 20.079  141.496 7.294   1.00 37.35  ? 385 LYS A CA    1 
ATOM 3683  C C     . LYS C 3 385 ? 19.283  142.781 7.309   1.00 37.96  ? 385 LYS A C     1 
ATOM 3684  O O     . LYS C 3 385 ? 19.459  143.630 6.432   1.00 39.18  ? 385 LYS A O     1 
ATOM 3685  C CB    . LYS C 3 385 ? 21.406  141.773 8.018   1.00 39.00  ? 385 LYS A CB    1 
ATOM 3686  C CG    . LYS C 3 385 ? 21.147  142.503 9.340   1.00 41.91  ? 385 LYS A CG    1 
ATOM 3687  C CD    . LYS C 3 385 ? 22.355  143.052 10.067  1.00 46.37  ? 385 LYS A CD    1 
ATOM 3688  C CE    . LYS C 3 385 ? 21.874  143.942 11.250  1.00 49.68  ? 385 LYS A CE    1 
ATOM 3689  N NZ    . LYS C 3 385 ? 22.935  144.588 12.120  1.00 51.79  ? 385 LYS A NZ    1 
ATOM 3690  N N     . THR C 3 386 ? 18.420  142.920 8.316   1.00 38.27  ? 386 THR A N     1 
ATOM 3691  C CA    . THR C 3 386 ? 17.628  144.134 8.491   1.00 39.91  ? 386 THR A CA    1 
ATOM 3692  C C     . THR C 3 386 ? 18.499  145.073 9.319   1.00 39.35  ? 386 THR A C     1 
ATOM 3693  O O     . THR C 3 386 ? 19.016  144.666 10.369  1.00 39.54  ? 386 THR A O     1 
ATOM 3694  C CB    . THR C 3 386 ? 16.320  143.881 9.287   1.00 41.90  ? 386 THR A CB    1 
ATOM 3695  O OG1   . THR C 3 386 ? 15.451  143.025 8.534   1.00 42.49  ? 386 THR A OG1   1 
ATOM 3696  C CG2   . THR C 3 386 ? 15.599  145.209 9.587   1.00 40.84  ? 386 THR A CG2   1 
ATOM 3697  N N     . PRO C 3 387 ? 18.721  146.315 8.831   1.00 37.86  ? 387 PRO A N     1 
ATOM 3698  C CA    . PRO C 3 387 ? 19.532  147.320 9.519   1.00 36.43  ? 387 PRO A CA    1 
ATOM 3699  C C     . PRO C 3 387 ? 18.640  148.132 10.433  1.00 34.77  ? 387 PRO A C     1 
ATOM 3700  O O     . PRO C 3 387 ? 17.421  148.188 10.245  1.00 31.28  ? 387 PRO A O     1 
ATOM 3701  C CB    . PRO C 3 387 ? 20.037  148.175 8.367   1.00 35.10  ? 387 PRO A CB    1 
ATOM 3702  C CG    . PRO C 3 387 ? 18.854  148.254 7.511   1.00 36.60  ? 387 PRO A CG    1 
ATOM 3703  C CD    . PRO C 3 387 ? 18.293  146.827 7.515   1.00 37.48  ? 387 PRO A CD    1 
ATOM 3704  N N     . LYS C 3 388 ? 19.234  148.742 11.444  1.00 35.03  ? 388 LYS A N     1 
ATOM 3705  C CA    . LYS C 3 388 ? 18.433  149.541 12.336  1.00 37.89  ? 388 LYS A CA    1 
ATOM 3706  C C     . LYS C 3 388 ? 18.113  150.824 11.583  1.00 39.02  ? 388 LYS A C     1 
ATOM 3707  O O     . LYS C 3 388 ? 18.703  151.097 10.529  1.00 38.97  ? 388 LYS A O     1 
ATOM 3708  C CB    . LYS C 3 388 ? 19.139  149.749 13.673  1.00 39.50  ? 388 LYS A CB    1 
ATOM 3709  C CG    . LYS C 3 388 ? 19.480  148.413 14.347  1.00 42.71  ? 388 LYS A CG    1 
ATOM 3710  C CD    . LYS C 3 388 ? 19.820  148.514 15.836  1.00 45.71  ? 388 LYS A CD    1 
ATOM 3711  C CE    . LYS C 3 388 ? 20.210  147.129 16.401  1.00 48.50  ? 388 LYS A CE    1 
ATOM 3712  N NZ    . LYS C 3 388 ? 20.247  147.053 17.908  1.00 50.75  ? 388 LYS A NZ    1 
ATOM 3713  N N     . PHE C 3 389 ? 17.193  151.619 12.115  1.00 40.69  ? 389 PHE A N     1 
ATOM 3714  C CA    . PHE C 3 389 ? 16.768  152.812 11.397  1.00 42.38  ? 389 PHE A CA    1 
ATOM 3715  C C     . PHE C 3 389 ? 16.721  154.192 12.065  1.00 43.13  ? 389 PHE A C     1 
ATOM 3716  O O     . PHE C 3 389 ? 16.099  154.385 13.120  1.00 42.92  ? 389 PHE A O     1 
ATOM 3717  C CB    . PHE C 3 389 ? 15.392  152.544 10.798  1.00 44.38  ? 389 PHE A CB    1 
ATOM 3718  C CG    . PHE C 3 389 ? 15.411  151.770 9.515   1.00 45.37  ? 389 PHE A CG    1 
ATOM 3719  C CD1   . PHE C 3 389 ? 14.905  150.479 9.465   1.00 46.14  ? 389 PHE A CD1   1 
ATOM 3720  C CD2   . PHE C 3 389 ? 15.821  152.380 8.330   1.00 45.67  ? 389 PHE A CD2   1 
ATOM 3721  C CE1   . PHE C 3 389 ? 14.797  149.812 8.252   1.00 46.76  ? 389 PHE A CE1   1 
ATOM 3722  C CE2   . PHE C 3 389 ? 15.717  151.723 7.112   1.00 45.17  ? 389 PHE A CE2   1 
ATOM 3723  C CZ    . PHE C 3 389 ? 15.202  150.440 7.069   1.00 46.12  ? 389 PHE A CZ    1 
ATOM 3724  N N     . LYS C 3 390 ? 17.298  155.168 11.361  1.00 42.47  ? 390 LYS A N     1 
ATOM 3725  C CA    . LYS C 3 390 ? 17.316  156.560 11.795  1.00 40.62  ? 390 LYS A CA    1 
ATOM 3726  C C     . LYS C 3 390 ? 16.308  157.285 10.907  1.00 38.78  ? 390 LYS A C     1 
ATOM 3727  O O     . LYS C 3 390 ? 16.577  157.586 9.737   1.00 37.86  ? 390 LYS A O     1 
ATOM 3728  C CB    . LYS C 3 390 ? 18.714  157.170 11.634  1.00 40.74  ? 390 LYS A CB    1 
ATOM 3729  C CG    . LYS C 3 390 ? 19.680  156.940 12.801  1.00 42.07  ? 390 LYS A CG    1 
ATOM 3730  C CD    . LYS C 3 390 ? 21.032  157.634 12.534  1.00 45.01  ? 390 LYS A CD    1 
ATOM 3731  C CE    . LYS C 3 390 ? 22.064  157.429 13.665  1.00 47.36  ? 390 LYS A CE    1 
ATOM 3732  N NZ    . LYS C 3 390 ? 23.300  158.283 13.507  1.00 45.55  ? 390 LYS A NZ    1 
ATOM 3733  N N     . LEU C 3 391 ? 15.122  157.509 11.452  1.00 37.05  ? 391 LEU A N     1 
ATOM 3734  C CA    . LEU C 3 391 ? 14.084  158.182 10.700  1.00 36.48  ? 391 LEU A CA    1 
ATOM 3735  C C     . LEU C 3 391 ? 13.766  159.573 11.245  1.00 38.45  ? 391 LEU A C     1 
ATOM 3736  O O     . LEU C 3 391 ? 13.767  159.805 12.467  1.00 38.59  ? 391 LEU A O     1 
ATOM 3737  C CB    . LEU C 3 391 ? 12.817  157.344 10.691  1.00 32.37  ? 391 LEU A CB    1 
ATOM 3738  C CG    . LEU C 3 391 ? 12.978  155.848 10.524  1.00 28.67  ? 391 LEU A CG    1 
ATOM 3739  C CD1   . LEU C 3 391 ? 11.625  155.262 10.668  1.00 29.20  ? 391 LEU A CD1   1 
ATOM 3740  C CD2   . LEU C 3 391 ? 13.553  155.485 9.201   1.00 25.70  ? 391 LEU A CD2   1 
ATOM 3741  N N     . PRO C 3 392 ? 13.473  160.517 10.334  1.00 39.12  ? 392 PRO A N     1 
ATOM 3742  C CA    . PRO C 3 392 ? 13.136  161.910 10.628  1.00 39.61  ? 392 PRO A CA    1 
ATOM 3743  C C     . PRO C 3 392 ? 11.666  162.035 11.007  1.00 39.97  ? 392 PRO A C     1 
ATOM 3744  O O     . PRO C 3 392 ? 10.801  162.243 10.151  1.00 40.03  ? 392 PRO A O     1 
ATOM 3745  C CB    . PRO C 3 392 ? 13.424  162.601 9.301   1.00 40.51  ? 392 PRO A CB    1 
ATOM 3746  C CG    . PRO C 3 392 ? 12.975  161.567 8.298   1.00 40.43  ? 392 PRO A CG    1 
ATOM 3747  C CD    . PRO C 3 392 ? 13.533  160.290 8.877   1.00 39.30  ? 392 PRO A CD    1 
ATOM 3748  N N     . ILE C 3 393 ? 11.383  161.864 12.289  1.00 40.70  ? 393 ILE A N     1 
ATOM 3749  C CA    . ILE C 3 393 ? 10.017  161.966 12.779  1.00 43.07  ? 393 ILE A CA    1 
ATOM 3750  C C     . ILE C 3 393 ? 10.032  161.578 14.239  1.00 45.62  ? 393 ILE A C     1 
ATOM 3751  O O     . ILE C 3 393 ? 10.685  160.608 14.628  1.00 46.13  ? 393 ILE A O     1 
ATOM 3752  C CB    . ILE C 3 393 ? 9.047   161.043 11.990  1.00 40.97  ? 393 ILE A CB    1 
ATOM 3753  C CG1   . ILE C 3 393 ? 7.616   161.294 12.416  1.00 39.00  ? 393 ILE A CG1   1 
ATOM 3754  C CG2   . ILE C 3 393 ? 9.379   159.594 12.216  1.00 40.91  ? 393 ILE A CG2   1 
ATOM 3755  C CD1   . ILE C 3 393 ? 6.644   160.362 11.778  1.00 39.87  ? 393 ILE A CD1   1 
ATOM 3756  N N     . GLN C 3 394 ? 9.357   162.362 15.064  1.00 49.53  ? 394 GLN A N     1 
ATOM 3757  C CA    . GLN C 3 394 ? 9.340   162.042 16.471  1.00 53.26  ? 394 GLN A CA    1 
ATOM 3758  C C     . GLN C 3 394 ? 8.534   160.804 16.772  1.00 54.11  ? 394 GLN A C     1 
ATOM 3759  O O     . GLN C 3 394 ? 8.012   160.146 15.874  1.00 53.70  ? 394 GLN A O     1 
ATOM 3760  C CB    . GLN C 3 394 ? 8.890   163.226 17.313  1.00 56.40  ? 394 GLN A CB    1 
ATOM 3761  C CG    . GLN C 3 394 ? 10.003  164.240 17.501  1.00 61.18  ? 394 GLN A CG    1 
ATOM 3762  C CD    . GLN C 3 394 ? 9.787   165.143 18.699  1.00 65.09  ? 394 GLN A CD    1 
ATOM 3763  O OE1   . GLN C 3 394 ? 9.335   166.281 18.551  1.00 67.78  ? 394 GLN A OE1   1 
ATOM 3764  N NE2   . GLN C 3 394 ? 10.107  164.642 19.900  1.00 66.62  ? 394 GLN A NE2   1 
ATOM 3765  N N     . LYS C 3 395 ? 8.477   160.468 18.049  1.00 56.26  ? 395 LYS A N     1 
ATOM 3766  C CA    . LYS C 3 395 ? 7.780   159.278 18.497  1.00 58.53  ? 395 LYS A CA    1 
ATOM 3767  C C     . LYS C 3 395 ? 6.269   159.466 18.543  1.00 58.89  ? 395 LYS A C     1 
ATOM 3768  O O     . LYS C 3 395 ? 5.531   158.804 17.800  1.00 57.02  ? 395 LYS A O     1 
ATOM 3769  C CB    . LYS C 3 395 ? 8.326   158.831 19.864  1.00 60.42  ? 395 LYS A CB    1 
ATOM 3770  C CG    . LYS C 3 395 ? 9.565   159.614 20.363  1.00 64.31  ? 395 LYS A CG    1 
ATOM 3771  C CD    . LYS C 3 395 ? 10.804  159.507 19.439  1.00 66.64  ? 395 LYS A CD    1 
ATOM 3772  C CE    . LYS C 3 395 ? 11.552  158.163 19.564  1.00 68.95  ? 395 LYS A CE    1 
ATOM 3773  N NZ    . LYS C 3 395 ? 10.856  157.000 18.922  1.00 70.00  ? 395 LYS A NZ    1 
ATOM 3774  N N     . GLU C 3 396 ? 5.821   160.392 19.393  1.00 61.06  ? 396 GLU A N     1 
ATOM 3775  C CA    . GLU C 3 396 ? 4.394   160.686 19.555  1.00 61.67  ? 396 GLU A CA    1 
ATOM 3776  C C     . GLU C 3 396 ? 3.749   160.867 18.185  1.00 59.40  ? 396 GLU A C     1 
ATOM 3777  O O     . GLU C 3 396 ? 2.553   160.622 18.015  1.00 57.92  ? 396 GLU A O     1 
ATOM 3778  C CB    . GLU C 3 396 ? 4.176   161.949 20.411  1.00 66.44  ? 396 GLU A CB    1 
ATOM 3779  C CG    . GLU C 3 396 ? 4.585   161.828 21.896  1.00 71.59  ? 396 GLU A CG    1 
ATOM 3780  C CD    . GLU C 3 396 ? 4.171   163.041 22.762  1.00 74.88  ? 396 GLU A CD    1 
ATOM 3781  O OE1   . GLU C 3 396 ? 3.935   162.845 23.979  1.00 74.25  ? 396 GLU A OE1   1 
ATOM 3782  O OE2   . GLU C 3 396 ? 4.086   164.184 22.242  1.00 77.20  ? 396 GLU A OE2   1 
ATOM 3783  N N     . THR C 3 397 ? 4.564   161.256 17.206  1.00 56.14  ? 397 THR A N     1 
ATOM 3784  C CA    . THR C 3 397 ? 4.087   161.458 15.849  1.00 53.64  ? 397 THR A CA    1 
ATOM 3785  C C     . THR C 3 397 ? 3.721   160.108 15.239  1.00 52.09  ? 397 THR A C     1 
ATOM 3786  O O     . THR C 3 397 ? 2.541   159.752 15.175  1.00 52.48  ? 397 THR A O     1 
ATOM 3787  C CB    . THR C 3 397 ? 5.139   162.175 14.976  1.00 53.02  ? 397 THR A CB    1 
ATOM 3788  O OG1   . THR C 3 397 ? 6.331   161.394 14.926  1.00 52.76  ? 397 THR A OG1   1 
ATOM 3789  C CG2   . THR C 3 397 ? 5.481   163.528 15.554  1.00 52.60  ? 397 THR A CG2   1 
ATOM 3790  N N     . TRP C 3 398 ? 4.733   159.335 14.852  1.00 49.39  ? 398 TRP A N     1 
ATOM 3791  C CA    . TRP C 3 398 ? 4.508   158.024 14.258  1.00 46.40  ? 398 TRP A CA    1 
ATOM 3792  C C     . TRP C 3 398 ? 3.524   157.206 15.104  1.00 46.29  ? 398 TRP A C     1 
ATOM 3793  O O     . TRP C 3 398 ? 2.733   156.429 14.566  1.00 44.91  ? 398 TRP A O     1 
ATOM 3794  C CB    . TRP C 3 398 ? 5.849   157.291 14.070  1.00 43.46  ? 398 TRP A CB    1 
ATOM 3795  C CG    . TRP C 3 398 ? 5.715   155.815 13.961  1.00 40.40  ? 398 TRP A CG    1 
ATOM 3796  C CD1   . TRP C 3 398 ? 5.981   154.905 14.935  1.00 40.45  ? 398 TRP A CD1   1 
ATOM 3797  C CD2   . TRP C 3 398 ? 5.141   155.086 12.878  1.00 38.72  ? 398 TRP A CD2   1 
ATOM 3798  N NE1   . TRP C 3 398 ? 5.580   153.657 14.542  1.00 40.02  ? 398 TRP A NE1   1 
ATOM 3799  C CE2   . TRP C 3 398 ? 5.058   153.739 13.281  1.00 37.98  ? 398 TRP A CE2   1 
ATOM 3800  C CE3   . TRP C 3 398 ? 4.682   155.440 11.610  1.00 38.25  ? 398 TRP A CE3   1 
ATOM 3801  C CZ2   . TRP C 3 398 ? 4.530   152.745 12.462  1.00 38.16  ? 398 TRP A CZ2   1 
ATOM 3802  C CZ3   . TRP C 3 398 ? 4.160   154.450 10.794  1.00 38.71  ? 398 TRP A CZ3   1 
ATOM 3803  C CH2   . TRP C 3 398 ? 4.087   153.118 11.227  1.00 38.07  ? 398 TRP A CH2   1 
ATOM 3804  N N     . GLU C 3 399 ? 3.530   157.443 16.414  1.00 46.20  ? 399 GLU A N     1 
ATOM 3805  C CA    . GLU C 3 399 ? 2.638   156.739 17.323  1.00 47.32  ? 399 GLU A CA    1 
ATOM 3806  C C     . GLU C 3 399 ? 1.188   157.025 16.996  1.00 46.58  ? 399 GLU A C     1 
ATOM 3807  O O     . GLU C 3 399 ? 0.441   156.131 16.614  1.00 44.85  ? 399 GLU A O     1 
ATOM 3808  C CB    . GLU C 3 399 ? 2.908   157.142 18.776  1.00 50.53  ? 399 GLU A CB    1 
ATOM 3809  C CG    . GLU C 3 399 ? 2.140   156.303 19.836  1.00 56.52  ? 399 GLU A CG    1 
ATOM 3810  C CD    . GLU C 3 399 ? 0.827   156.937 20.357  1.00 59.59  ? 399 GLU A CD    1 
ATOM 3811  O OE1   . GLU C 3 399 ? 0.365   157.961 19.806  1.00 59.91  ? 399 GLU A OE1   1 
ATOM 3812  O OE2   . GLU C 3 399 ? 0.256   156.406 21.343  1.00 60.82  ? 399 GLU A OE2   1 
ATOM 3813  N N     . THR C 3 400 ? 0.787   158.280 17.152  1.00 47.43  ? 400 THR A N     1 
ATOM 3814  C CA    . THR C 3 400 ? -0.595  158.657 16.891  1.00 49.04  ? 400 THR A CA    1 
ATOM 3815  C C     . THR C 3 400 ? -1.009  158.226 15.516  1.00 48.60  ? 400 THR A C     1 
ATOM 3816  O O     . THR C 3 400 ? -2.121  157.738 15.320  1.00 48.35  ? 400 THR A O     1 
ATOM 3817  C CB    . THR C 3 400 ? -0.835  160.167 17.008  1.00 50.90  ? 400 THR A CB    1 
ATOM 3818  O OG1   . THR C 3 400 ? -0.502  160.598 18.333  1.00 54.23  ? 400 THR A OG1   1 
ATOM 3819  C CG2   . THR C 3 400 ? -2.309  160.495 16.725  1.00 50.45  ? 400 THR A CG2   1 
ATOM 3820  N N     . TRP C 3 401 ? -0.085  158.374 14.576  1.00 49.08  ? 401 TRP A N     1 
ATOM 3821  C CA    . TRP C 3 401 ? -0.353  158.006 13.207  1.00 49.74  ? 401 TRP A CA    1 
ATOM 3822  C C     . TRP C 3 401 ? -1.049  156.649 13.140  1.00 51.27  ? 401 TRP A C     1 
ATOM 3823  O O     . TRP C 3 401 ? -2.141  156.527 12.580  1.00 51.79  ? 401 TRP A O     1 
ATOM 3824  C CB    . TRP C 3 401 ? 0.934   157.997 12.382  1.00 47.87  ? 401 TRP A CB    1 
ATOM 3825  C CG    . TRP C 3 401 ? 0.738   157.301 11.087  1.00 47.64  ? 401 TRP A CG    1 
ATOM 3826  C CD1   . TRP C 3 401 ? 1.408   156.210 10.652  1.00 48.34  ? 401 TRP A CD1   1 
ATOM 3827  C CD2   . TRP C 3 401 ? -0.274  157.572 10.103  1.00 47.81  ? 401 TRP A CD2   1 
ATOM 3828  N NE1   . TRP C 3 401 ? 0.877   155.763 9.466   1.00 48.42  ? 401 TRP A NE1   1 
ATOM 3829  C CE2   . TRP C 3 401 ? -0.157  156.583 9.104   1.00 48.89  ? 401 TRP A CE2   1 
ATOM 3830  C CE3   . TRP C 3 401 ? -1.270  158.547 9.971   1.00 47.78  ? 401 TRP A CE3   1 
ATOM 3831  C CZ2   . TRP C 3 401 ? -0.994  156.539 7.989   1.00 46.75  ? 401 TRP A CZ2   1 
ATOM 3832  C CZ3   . TRP C 3 401 ? -2.105  158.502 8.862   1.00 47.91  ? 401 TRP A CZ3   1 
ATOM 3833  C CH2   . TRP C 3 401 ? -1.960  157.500 7.885   1.00 47.52  ? 401 TRP A CH2   1 
ATOM 3834  N N     . TRP C 3 402 ? -0.467  155.647 13.784  1.00 52.30  ? 402 TRP A N     1 
ATOM 3835  C CA    . TRP C 3 402 ? -1.078  154.331 13.734  1.00 53.16  ? 402 TRP A CA    1 
ATOM 3836  C C     . TRP C 3 402 ? -2.247  154.203 14.692  1.00 50.61  ? 402 TRP A C     1 
ATOM 3837  O O     . TRP C 3 402 ? -3.310  153.719 14.306  1.00 49.41  ? 402 TRP A O     1 
ATOM 3838  C CB    . TRP C 3 402 ? -0.031  153.213 13.940  1.00 57.64  ? 402 TRP A CB    1 
ATOM 3839  C CG    . TRP C 3 402 ? 0.226   152.787 15.365  1.00 63.53  ? 402 TRP A CG    1 
ATOM 3840  C CD1   . TRP C 3 402 ? 1.001   153.427 16.288  1.00 65.10  ? 402 TRP A CD1   1 
ATOM 3841  C CD2   . TRP C 3 402 ? -0.326  151.643 16.033  1.00 63.63  ? 402 TRP A CD2   1 
ATOM 3842  N NE1   . TRP C 3 402 ? 0.955   152.763 17.496  1.00 65.42  ? 402 TRP A NE1   1 
ATOM 3843  C CE2   . TRP C 3 402 ? 0.149   151.666 17.367  1.00 64.85  ? 402 TRP A CE2   1 
ATOM 3844  C CE3   . TRP C 3 402 ? -1.179  150.609 15.635  1.00 65.04  ? 402 TRP A CE3   1 
ATOM 3845  C CZ2   . TRP C 3 402 ? -0.206  150.691 18.312  1.00 65.51  ? 402 TRP A CZ2   1 
ATOM 3846  C CZ3   . TRP C 3 402 ? -1.534  149.638 16.573  1.00 67.65  ? 402 TRP A CZ3   1 
ATOM 3847  C CH2   . TRP C 3 402 ? -1.045  149.688 17.900  1.00 66.81  ? 402 TRP A CH2   1 
ATOM 3848  N N     . THR C 3 403 ? -2.074  154.718 15.907  1.00 49.31  ? 403 THR A N     1 
ATOM 3849  C CA    . THR C 3 403 ? -3.110  154.627 16.929  1.00 48.60  ? 403 THR A CA    1 
ATOM 3850  C C     . THR C 3 403 ? -4.467  155.054 16.396  1.00 49.45  ? 403 THR A C     1 
ATOM 3851  O O     . THR C 3 403 ? -5.495  154.497 16.771  1.00 49.57  ? 403 THR A O     1 
ATOM 3852  C CB    . THR C 3 403 ? -2.759  155.449 18.170  1.00 45.80  ? 403 THR A CB    1 
ATOM 3853  O OG1   . THR C 3 403 ? -2.461  156.784 17.776  1.00 44.56  ? 403 THR A OG1   1 
ATOM 3854  C CG2   . THR C 3 403 ? -1.557  154.861 18.882  1.00 45.16  ? 403 THR A CG2   1 
ATOM 3855  N N     . GLU C 3 404 ? -4.455  156.013 15.480  1.00 50.31  ? 404 GLU A N     1 
ATOM 3856  C CA    . GLU C 3 404 ? -5.685  156.495 14.881  1.00 51.99  ? 404 GLU A CA    1 
ATOM 3857  C C     . GLU C 3 404 ? -6.013  155.644 13.663  1.00 52.14  ? 404 GLU A C     1 
ATOM 3858  O O     . GLU C 3 404 ? -7.138  155.175 13.522  1.00 51.81  ? 404 GLU A O     1 
ATOM 3859  C CB    . GLU C 3 404 ? -5.538  157.963 14.461  1.00 53.66  ? 404 GLU A CB    1 
ATOM 3860  C CG    . GLU C 3 404 ? -5.309  158.961 15.613  1.00 57.75  ? 404 GLU A CG    1 
ATOM 3861  C CD    . GLU C 3 404 ? -6.603  159.468 16.250  1.00 58.85  ? 404 GLU A CD    1 
ATOM 3862  O OE1   . GLU C 3 404 ? -7.018  158.912 17.296  1.00 58.58  ? 404 GLU A OE1   1 
ATOM 3863  O OE2   . GLU C 3 404 ? -7.192  160.431 15.699  1.00 59.80  ? 404 GLU A OE2   1 
ATOM 3864  N N     . TYR C 3 405 ? -5.007  155.413 12.820  1.00 52.13  ? 405 TYR A N     1 
ATOM 3865  C CA    . TYR C 3 405 ? -5.144  154.647 11.578  1.00 51.48  ? 405 TYR A CA    1 
ATOM 3866  C C     . TYR C 3 405 ? -5.652  153.225 11.752  1.00 52.31  ? 405 TYR A C     1 
ATOM 3867  O O     . TYR C 3 405 ? -4.875  152.341 12.096  1.00 53.75  ? 405 TYR A O     1 
ATOM 3868  C CB    . TYR C 3 405 ? -3.795  154.585 10.878  1.00 49.66  ? 405 TYR A CB    1 
ATOM 3869  C CG    . TYR C 3 405 ? -3.860  154.207 9.427   1.00 49.17  ? 405 TYR A CG    1 
ATOM 3870  C CD1   . TYR C 3 405 ? -5.079  154.069 8.771   1.00 47.44  ? 405 TYR A CD1   1 
ATOM 3871  C CD2   . TYR C 3 405 ? -2.690  154.071 8.685   1.00 50.56  ? 405 TYR A CD2   1 
ATOM 3872  C CE1   . TYR C 3 405 ? -5.130  153.816 7.406   1.00 49.48  ? 405 TYR A CE1   1 
ATOM 3873  C CE2   . TYR C 3 405 ? -2.721  153.819 7.318   1.00 50.50  ? 405 TYR A CE2   1 
ATOM 3874  C CZ    . TYR C 3 405 ? -3.944  153.696 6.677   1.00 50.44  ? 405 TYR A CZ    1 
ATOM 3875  O OH    . TYR C 3 405 ? -3.973  153.485 5.308   1.00 49.53  ? 405 TYR A OH    1 
ATOM 3876  N N     . TRP C 3 406 ? -6.933  152.996 11.456  1.00 53.12  ? 406 TRP A N     1 
ATOM 3877  C CA    . TRP C 3 406 ? -7.545  151.662 11.584  1.00 52.85  ? 406 TRP A CA    1 
ATOM 3878  C C     . TRP C 3 406 ? -7.145  150.796 10.401  1.00 50.33  ? 406 TRP A C     1 
ATOM 3879  O O     . TRP C 3 406 ? -7.956  150.477 9.530   1.00 49.87  ? 406 TRP A O     1 
ATOM 3880  C CB    . TRP C 3 406 ? -9.077  151.762 11.670  1.00 56.81  ? 406 TRP A CB    1 
ATOM 3881  C CG    . TRP C 3 406 ? -9.699  151.629 13.075  1.00 60.10  ? 406 TRP A CG    1 
ATOM 3882  C CD1   . TRP C 3 406 ? -10.962 151.166 13.366  1.00 62.07  ? 406 TRP A CD1   1 
ATOM 3883  C CD2   . TRP C 3 406 ? -9.119  152.013 14.341  1.00 61.85  ? 406 TRP A CD2   1 
ATOM 3884  N NE1   . TRP C 3 406 ? -11.201 151.247 14.720  1.00 62.90  ? 406 TRP A NE1   1 
ATOM 3885  C CE2   . TRP C 3 406 ? -10.092 151.761 15.342  1.00 63.30  ? 406 TRP A CE2   1 
ATOM 3886  C CE3   . TRP C 3 406 ? -7.878  152.547 14.728  1.00 62.15  ? 406 TRP A CE3   1 
ATOM 3887  C CZ2   . TRP C 3 406 ? -9.862  152.029 16.698  1.00 63.84  ? 406 TRP A CZ2   1 
ATOM 3888  C CZ3   . TRP C 3 406 ? -7.651  152.813 16.077  1.00 62.38  ? 406 TRP A CZ3   1 
ATOM 3889  C CH2   . TRP C 3 406 ? -8.639  152.552 17.045  1.00 63.30  ? 406 TRP A CH2   1 
ATOM 3890  N N     . GLN C 3 407 ? -5.868  150.444 10.382  1.00 48.39  ? 407 GLN A N     1 
ATOM 3891  C CA    . GLN C 3 407 ? -5.289  149.634 9.333   1.00 46.97  ? 407 GLN A CA    1 
ATOM 3892  C C     . GLN C 3 407 ? -3.823  149.351 9.712   1.00 44.58  ? 407 GLN A C     1 
ATOM 3893  O O     . GLN C 3 407 ? -3.016  150.273 9.902   1.00 44.09  ? 407 GLN A O     1 
ATOM 3894  C CB    . GLN C 3 407 ? -5.423  150.373 7.995   1.00 48.81  ? 407 GLN A CB    1 
ATOM 3895  C CG    . GLN C 3 407 ? -5.021  149.576 6.767   1.00 52.77  ? 407 GLN A CG    1 
ATOM 3896  C CD    . GLN C 3 407 ? -3.523  149.630 6.518   1.00 55.41  ? 407 GLN A CD    1 
ATOM 3897  O OE1   . GLN C 3 407 ? -2.944  150.713 6.397   1.00 56.80  ? 407 GLN A OE1   1 
ATOM 3898  N NE2   . GLN C 3 407 ? -2.884  148.464 6.466   1.00 56.30  ? 407 GLN A NE2   1 
ATOM 3899  N N     . ALA C 3 408 ? -3.506  148.063 9.848   1.00 41.11  ? 408 ALA A N     1 
ATOM 3900  C CA    . ALA C 3 408 ? -2.179  147.600 10.235  1.00 37.04  ? 408 ALA A CA    1 
ATOM 3901  C C     . ALA C 3 408 ? -1.026  148.156 9.434   1.00 35.38  ? 408 ALA A C     1 
ATOM 3902  O O     . ALA C 3 408 ? -1.023  148.122 8.208   1.00 34.96  ? 408 ALA A O     1 
ATOM 3903  C CB    . ALA C 3 408 ? -2.123  146.090 10.226  1.00 36.91  ? 408 ALA A CB    1 
ATOM 3904  N N     . THR C 3 409 ? -0.039  148.655 10.161  1.00 34.51  ? 409 THR A N     1 
ATOM 3905  C CA    . THR C 3 409 ? 1.175   149.221 9.594   1.00 35.19  ? 409 THR A CA    1 
ATOM 3906  C C     . THR C 3 409 ? 2.188   149.287 10.719  1.00 35.16  ? 409 THR A C     1 
ATOM 3907  O O     . THR C 3 409 ? 1.830   149.587 11.857  1.00 34.68  ? 409 THR A O     1 
ATOM 3908  C CB    . THR C 3 409 ? 0.937   150.635 8.977   1.00 36.18  ? 409 THR A CB    1 
ATOM 3909  O OG1   . THR C 3 409 ? 0.449   150.484 7.639   1.00 37.63  ? 409 THR A OG1   1 
ATOM 3910  C CG2   . THR C 3 409 ? 2.227   151.469 8.933   1.00 34.73  ? 409 THR A CG2   1 
ATOM 3911  N N     . TRP C 3 410 ? 3.443   148.971 10.405  1.00 35.13  ? 410 TRP A N     1 
ATOM 3912  C CA    . TRP C 3 410 ? 4.506   148.988 11.400  1.00 34.22  ? 410 TRP A CA    1 
ATOM 3913  C C     . TRP C 3 410 ? 5.882   149.280 10.780  1.00 32.13  ? 410 TRP A C     1 
ATOM 3914  O O     . TRP C 3 410 ? 6.011   149.422 9.569   1.00 28.78  ? 410 TRP A O     1 
ATOM 3915  C CB    . TRP C 3 410 ? 4.523   147.650 12.135  1.00 35.09  ? 410 TRP A CB    1 
ATOM 3916  C CG    . TRP C 3 410 ? 5.587   146.736 11.641  1.00 40.38  ? 410 TRP A CG    1 
ATOM 3917  C CD1   . TRP C 3 410 ? 5.696   146.172 10.390  1.00 40.94  ? 410 TRP A CD1   1 
ATOM 3918  C CD2   . TRP C 3 410 ? 6.741   146.330 12.366  1.00 41.56  ? 410 TRP A CD2   1 
ATOM 3919  N NE1   . TRP C 3 410 ? 6.860   145.440 10.299  1.00 41.43  ? 410 TRP A NE1   1 
ATOM 3920  C CE2   . TRP C 3 410 ? 7.521   145.520 11.498  1.00 42.68  ? 410 TRP A CE2   1 
ATOM 3921  C CE3   . TRP C 3 410 ? 7.197   146.571 13.668  1.00 39.21  ? 410 TRP A CE3   1 
ATOM 3922  C CZ2   . TRP C 3 410 ? 8.731   144.955 11.892  1.00 42.42  ? 410 TRP A CZ2   1 
ATOM 3923  C CZ3   . TRP C 3 410 ? 8.392   146.013 14.058  1.00 42.03  ? 410 TRP A CZ3   1 
ATOM 3924  C CH2   . TRP C 3 410 ? 9.151   145.209 13.171  1.00 43.75  ? 410 TRP A CH2   1 
ATOM 3925  N N     . ILE C 3 411 ? 6.910   149.326 11.621  1.00 32.15  ? 411 ILE A N     1 
ATOM 3926  C CA    . ILE C 3 411 ? 8.268   149.596 11.162  1.00 32.48  ? 411 ILE A CA    1 
ATOM 3927  C C     . ILE C 3 411 ? 9.277   148.836 12.010  1.00 34.69  ? 411 ILE A C     1 
ATOM 3928  O O     . ILE C 3 411 ? 9.133   148.764 13.229  1.00 34.04  ? 411 ILE A O     1 
ATOM 3929  C CB    . ILE C 3 411 ? 8.633   151.079 11.364  1.00 32.18  ? 411 ILE A CB    1 
ATOM 3930  C CG1   . ILE C 3 411 ? 7.543   151.990 10.824  1.00 34.01  ? 411 ILE A CG1   1 
ATOM 3931  C CG2   . ILE C 3 411 ? 9.959   151.402 10.702  1.00 29.90  ? 411 ILE A CG2   1 
ATOM 3932  C CD1   . ILE C 3 411 ? 7.687   153.425 11.298  1.00 36.74  ? 411 ILE A CD1   1 
ATOM 3933  N N     . PRO C 3 412 ? 10.313  148.257 11.381  1.00 36.11  ? 412 PRO A N     1 
ATOM 3934  C CA    . PRO C 3 412 ? 11.336  147.527 12.131  1.00 38.00  ? 412 PRO A CA    1 
ATOM 3935  C C     . PRO C 3 412 ? 12.077  148.532 12.982  1.00 41.74  ? 412 PRO A C     1 
ATOM 3936  O O     . PRO C 3 412 ? 11.936  149.736 12.779  1.00 41.41  ? 412 PRO A O     1 
ATOM 3937  C CB    . PRO C 3 412 ? 12.250  146.999 11.035  1.00 37.56  ? 412 PRO A CB    1 
ATOM 3938  C CG    . PRO C 3 412 ? 12.083  147.998 9.954   1.00 36.43  ? 412 PRO A CG    1 
ATOM 3939  C CD    . PRO C 3 412 ? 10.593  148.175 9.942   1.00 35.65  ? 412 PRO A CD    1 
ATOM 3940  N N     . GLU C 3 413 ? 12.902  148.033 13.896  1.00 47.26  ? 413 GLU A N     1 
ATOM 3941  C CA    . GLU C 3 413 ? 13.679  148.875 14.814  1.00 52.63  ? 413 GLU A CA    1 
ATOM 3942  C C     . GLU C 3 413 ? 14.189  150.193 14.227  1.00 53.19  ? 413 GLU A C     1 
ATOM 3943  O O     . GLU C 3 413 ? 14.839  150.226 13.175  1.00 52.87  ? 413 GLU A O     1 
ATOM 3944  C CB    . GLU C 3 413 ? 14.839  148.077 15.425  1.00 56.78  ? 413 GLU A CB    1 
ATOM 3945  C CG    . GLU C 3 413 ? 15.763  148.890 16.341  1.00 63.33  ? 413 GLU A CG    1 
ATOM 3946  C CD    . GLU C 3 413 ? 16.569  148.017 17.307  1.00 67.22  ? 413 GLU A CD    1 
ATOM 3947  O OE1   . GLU C 3 413 ? 16.780  148.445 18.468  1.00 68.93  ? 413 GLU A OE1   1 
ATOM 3948  O OE2   . GLU C 3 413 ? 16.989  146.903 16.913  1.00 69.09  ? 413 GLU A OE2   1 
ATOM 3949  N N     . TRP C 3 414 ? 13.884  151.278 14.930  1.00 53.32  ? 414 TRP A N     1 
ATOM 3950  C CA    . TRP C 3 414 ? 14.281  152.592 14.479  1.00 53.79  ? 414 TRP A CA    1 
ATOM 3951  C C     . TRP C 3 414 ? 14.435  153.540 15.640  1.00 54.38  ? 414 TRP A C     1 
ATOM 3952  O O     . TRP C 3 414 ? 13.671  153.491 16.602  1.00 54.40  ? 414 TRP A O     1 
ATOM 3953  C CB    . TRP C 3 414 ? 13.226  153.147 13.531  1.00 54.48  ? 414 TRP A CB    1 
ATOM 3954  C CG    . TRP C 3 414 ? 11.955  153.522 14.215  1.00 55.63  ? 414 TRP A CG    1 
ATOM 3955  C CD1   . TRP C 3 414 ? 10.916  152.697 14.539  1.00 56.31  ? 414 TRP A CD1   1 
ATOM 3956  C CD2   . TRP C 3 414 ? 11.589  154.829 14.663  1.00 56.53  ? 414 TRP A CD2   1 
ATOM 3957  N NE1   . TRP C 3 414 ? 9.920   153.414 15.165  1.00 57.32  ? 414 TRP A NE1   1 
ATOM 3958  C CE2   . TRP C 3 414 ? 10.308  154.725 15.255  1.00 56.18  ? 414 TRP A CE2   1 
ATOM 3959  C CE3   . TRP C 3 414 ? 12.217  156.079 14.622  1.00 55.42  ? 414 TRP A CE3   1 
ATOM 3960  C CZ2   . TRP C 3 414 ? 9.647   155.826 15.799  1.00 55.66  ? 414 TRP A CZ2   1 
ATOM 3961  C CZ3   . TRP C 3 414 ? 11.559  157.173 15.163  1.00 55.62  ? 414 TRP A CZ3   1 
ATOM 3962  C CH2   . TRP C 3 414 ? 10.286  157.039 15.744  1.00 55.60  ? 414 TRP A CH2   1 
ATOM 3963  N N     . GLU C 3 415 ? 15.421  154.416 15.536  1.00 55.51  ? 415 GLU A N     1 
ATOM 3964  C CA    . GLU C 3 415 ? 15.656  155.399 16.570  1.00 58.36  ? 415 GLU A CA    1 
ATOM 3965  C C     . GLU C 3 415 ? 15.322  156.766 15.995  1.00 61.78  ? 415 GLU A C     1 
ATOM 3966  O O     . GLU C 3 415 ? 15.164  156.924 14.774  1.00 61.83  ? 415 GLU A O     1 
ATOM 3967  C CB    . GLU C 3 415 ? 17.110  155.374 17.045  1.00 57.20  ? 415 GLU A CB    1 
ATOM 3968  C CG    . GLU C 3 415 ? 18.107  155.992 16.067  1.00 56.93  ? 415 GLU A CG    1 
ATOM 3969  C CD    . GLU C 3 415 ? 19.298  156.622 16.768  1.00 57.24  ? 415 GLU A CD    1 
ATOM 3970  O OE1   . GLU C 3 415 ? 20.435  156.477 16.267  1.00 56.93  ? 415 GLU A OE1   1 
ATOM 3971  O OE2   . GLU C 3 415 ? 19.094  157.264 17.822  1.00 57.63  ? 415 GLU A OE2   1 
ATOM 3972  N N     . PHE C 3 416 ? 15.218  157.748 16.887  1.00 65.27  ? 416 PHE A N     1 
ATOM 3973  C CA    . PHE C 3 416 ? 14.906  159.122 16.506  1.00 68.50  ? 416 PHE A CA    1 
ATOM 3974  C C     . PHE C 3 416 ? 16.145  159.934 16.115  1.00 69.93  ? 416 PHE A C     1 
ATOM 3975  O O     . PHE C 3 416 ? 17.241  159.767 16.672  1.00 70.27  ? 416 PHE A O     1 
ATOM 3976  C CB    . PHE C 3 416 ? 14.144  159.836 17.641  1.00 70.78  ? 416 PHE A CB    1 
ATOM 3977  C CG    . PHE C 3 416 ? 13.854  161.299 17.365  1.00 73.20  ? 416 PHE A CG    1 
ATOM 3978  C CD1   . PHE C 3 416 ? 12.864  161.671 16.454  1.00 71.74  ? 416 PHE A CD1   1 
ATOM 3979  C CD2   . PHE C 3 416 ? 14.599  162.304 17.994  1.00 73.60  ? 416 PHE A CD2   1 
ATOM 3980  C CE1   . PHE C 3 416 ? 12.622  163.017 16.170  1.00 71.30  ? 416 PHE A CE1   1 
ATOM 3981  C CE2   . PHE C 3 416 ? 14.364  163.652 17.717  1.00 72.92  ? 416 PHE A CE2   1 
ATOM 3982  C CZ    . PHE C 3 416 ? 13.374  164.008 16.800  1.00 72.55  ? 416 PHE A CZ    1 
ATOM 3983  N N     . VAL C 3 417 ? 15.938  160.833 15.161  1.00 70.71  ? 417 VAL A N     1 
ATOM 3984  C CA    . VAL C 3 417 ? 16.984  161.712 14.666  1.00 72.21  ? 417 VAL A CA    1 
ATOM 3985  C C     . VAL C 3 417 ? 16.390  163.106 14.477  1.00 73.25  ? 417 VAL A C     1 
ATOM 3986  O O     . VAL C 3 417 ? 15.349  163.264 13.832  1.00 74.16  ? 417 VAL A O     1 
ATOM 3987  C CB    . VAL C 3 417 ? 17.550  161.185 13.328  1.00 72.72  ? 417 VAL A CB    1 
ATOM 3988  C CG1   . VAL C 3 417 ? 18.360  162.257 12.613  1.00 73.17  ? 417 VAL A CG1   1 
ATOM 3989  C CG2   . VAL C 3 417 ? 18.418  159.975 13.596  1.00 72.76  ? 417 VAL A CG2   1 
ATOM 3990  N N     . ASN C 3 418 ? 17.029  164.109 15.070  1.00 72.96  ? 418 ASN A N     1 
ATOM 3991  C CA    . ASN C 3 418 ? 16.544  165.476 14.947  1.00 73.09  ? 418 ASN A CA    1 
ATOM 3992  C C     . ASN C 3 418 ? 17.422  166.268 13.994  1.00 72.02  ? 418 ASN A C     1 
ATOM 3993  O O     . ASN C 3 418 ? 18.468  166.770 14.404  1.00 72.35  ? 418 ASN A O     1 
ATOM 3994  C CB    . ASN C 3 418 ? 16.534  166.161 16.312  1.00 73.84  ? 418 ASN A CB    1 
ATOM 3995  C CG    . ASN C 3 418 ? 15.742  167.461 16.308  1.00 75.22  ? 418 ASN A CG    1 
ATOM 3996  O OD1   . ASN C 3 418 ? 15.197  167.883 15.271  1.00 75.89  ? 418 ASN A OD1   1 
ATOM 3997  N ND2   . ASN C 3 418 ? 15.660  168.098 17.474  1.00 75.17  ? 418 ASN A ND2   1 
ATOM 3998  N N     . THR C 3 419 ? 17.006  166.400 12.737  1.00 70.30  ? 419 THR A N     1 
ATOM 3999  C CA    . THR C 3 419 ? 17.824  167.146 11.790  1.00 70.27  ? 419 THR A CA    1 
ATOM 4000  C C     . THR C 3 419 ? 17.164  167.841 10.601  1.00 70.00  ? 419 THR A C     1 
ATOM 4001  O O     . THR C 3 419 ? 17.062  169.064 10.583  1.00 72.59  ? 419 THR A O     1 
ATOM 4002  C CB    . THR C 3 419 ? 19.020  166.307 11.254  1.00 69.47  ? 419 THR A CB    1 
ATOM 4003  O OG1   . THR C 3 419 ? 18.644  164.930 11.175  1.00 67.79  ? 419 THR A OG1   1 
ATOM 4004  C CG2   . THR C 3 419 ? 20.252  166.465 12.133  1.00 69.53  ? 419 THR A CG2   1 
ATOM 4005  N N     . PRO C 3 420 ? 16.653  167.077 9.624   1.00 68.73  ? 420 PRO A N     1 
ATOM 4006  C CA    . PRO C 3 420 ? 16.028  167.685 8.445   1.00 65.43  ? 420 PRO A CA    1 
ATOM 4007  C C     . PRO C 3 420 ? 14.624  168.213 8.687   1.00 61.23  ? 420 PRO A C     1 
ATOM 4008  O O     . PRO C 3 420 ? 14.189  168.345 9.831   1.00 58.73  ? 420 PRO A O     1 
ATOM 4009  C CB    . PRO C 3 420 ? 16.004  166.516 7.474   1.00 67.80  ? 420 PRO A CB    1 
ATOM 4010  C CG    . PRO C 3 420 ? 15.544  165.408 8.379   1.00 69.83  ? 420 PRO A CG    1 
ATOM 4011  C CD    . PRO C 3 420 ? 16.360  165.629 9.663   1.00 69.09  ? 420 PRO A CD    1 
ATOM 4012  N N     . PRO C 3 421 ? 13.936  168.621 7.608   1.00 59.24  ? 421 PRO A N     1 
ATOM 4013  C CA    . PRO C 3 421 ? 12.572  169.129 7.745   1.00 58.27  ? 421 PRO A CA    1 
ATOM 4014  C C     . PRO C 3 421 ? 11.706  167.987 8.268   1.00 57.11  ? 421 PRO A C     1 
ATOM 4015  O O     . PRO C 3 421 ? 10.981  167.345 7.509   1.00 55.78  ? 421 PRO A O     1 
ATOM 4016  C CB    . PRO C 3 421 ? 12.211  169.528 6.304   1.00 58.51  ? 421 PRO A CB    1 
ATOM 4017  C CG    . PRO C 3 421 ? 13.186  168.751 5.444   1.00 58.53  ? 421 PRO A CG    1 
ATOM 4018  C CD    . PRO C 3 421 ? 14.437  168.850 6.242   1.00 58.22  ? 421 PRO A CD    1 
ATOM 4019  N N     . LEU C 3 422 ? 11.817  167.752 9.576   1.00 56.84  ? 422 LEU A N     1 
ATOM 4020  C CA    . LEU C 3 422 ? 11.120  166.685 10.301  1.00 57.39  ? 422 LEU A CA    1 
ATOM 4021  C C     . LEU C 3 422 ? 9.707   166.353 9.800   1.00 57.76  ? 422 LEU A C     1 
ATOM 4022  O O     . LEU C 3 422 ? 8.862   167.235 9.636   1.00 58.79  ? 422 LEU A O     1 
ATOM 4023  C CB    . LEU C 3 422 ? 11.110  166.999 11.803  1.00 56.03  ? 422 LEU A CB    1 
ATOM 4024  C CG    . LEU C 3 422 ? 12.371  167.659 12.394  1.00 56.04  ? 422 LEU A CG    1 
ATOM 4025  C CD1   . LEU C 3 422 ? 12.161  167.868 13.879  1.00 55.14  ? 422 LEU A CD1   1 
ATOM 4026  C CD2   . LEU C 3 422 ? 13.643  166.848 12.157  1.00 54.71  ? 422 LEU A CD2   1 
ATOM 4027  N N     . VAL C 3 423 ? 9.469   165.072 9.542   1.00 57.24  ? 423 VAL A N     1 
ATOM 4028  C CA    . VAL C 3 423 ? 8.184   164.620 9.031   1.00 56.15  ? 423 VAL A CA    1 
ATOM 4029  C C     . VAL C 3 423 ? 7.133   164.608 10.110  1.00 56.35  ? 423 VAL A C     1 
ATOM 4030  O O     . VAL C 3 423 ? 7.391   164.178 11.233  1.00 55.81  ? 423 VAL A O     1 
ATOM 4031  C CB    . VAL C 3 423 ? 8.278   163.197 8.450   1.00 56.68  ? 423 VAL A CB    1 
ATOM 4032  C CG1   . VAL C 3 423 ? 6.953   162.804 7.794   1.00 56.17  ? 423 VAL A CG1   1 
ATOM 4033  C CG2   . VAL C 3 423 ? 9.425   163.108 7.450   1.00 56.93  ? 423 VAL A CG2   1 
ATOM 4034  N N     . LYS C 3 424 ? 5.947   165.087 9.756   1.00 57.27  ? 424 LYS A N     1 
ATOM 4035  C CA    . LYS C 3 424 ? 4.818   165.115 10.675  1.00 58.44  ? 424 LYS A CA    1 
ATOM 4036  C C     . LYS C 3 424 ? 3.520   165.391 9.934   1.00 58.47  ? 424 LYS A C     1 
ATOM 4037  O O     . LYS C 3 424 ? 3.516   165.920 8.812   1.00 58.58  ? 424 LYS A O     1 
ATOM 4038  C CB    . LYS C 3 424 ? 5.019   166.164 11.771  1.00 59.17  ? 424 LYS A CB    1 
ATOM 4039  C CG    . LYS C 3 424 ? 4.307   167.496 11.545  1.00 61.44  ? 424 LYS A CG    1 
ATOM 4040  C CD    . LYS C 3 424 ? 3.380   167.815 12.722  1.00 64.61  ? 424 LYS A CD    1 
ATOM 4041  C CE    . LYS C 3 424 ? 2.743   169.212 12.624  1.00 66.66  ? 424 LYS A CE    1 
ATOM 4042  N NZ    . LYS C 3 424 ? 3.704   170.355 12.788  1.00 68.00  ? 424 LYS A NZ    1 
ATOM 4043  N N     . LEU C 3 425 ? 2.418   165.017 10.568  1.00 57.33  ? 425 LEU A N     1 
ATOM 4044  C CA    . LEU C 3 425 ? 1.105   165.231 9.985   1.00 56.21  ? 425 LEU A CA    1 
ATOM 4045  C C     . LEU C 3 425 ? 0.618   166.623 10.343  1.00 54.60  ? 425 LEU A C     1 
ATOM 4046  O O     . LEU C 3 425 ? 0.842   167.097 11.454  1.00 53.92  ? 425 LEU A O     1 
ATOM 4047  C CB    . LEU C 3 425 ? 0.116   164.180 10.487  1.00 56.14  ? 425 LEU A CB    1 
ATOM 4048  C CG    . LEU C 3 425 ? 0.341   163.594 11.884  1.00 57.02  ? 425 LEU A CG    1 
ATOM 4049  C CD1   . LEU C 3 425 ? 0.660   164.670 12.931  1.00 56.52  ? 425 LEU A CD1   1 
ATOM 4050  C CD2   . LEU C 3 425 ? -0.900  162.804 12.266  1.00 57.71  ? 425 LEU A CD2   1 
ATOM 4051  N N     . TRP C 3 426 ? -0.060  167.266 9.403   1.00 52.76  ? 426 TRP A N     1 
ATOM 4052  C CA    . TRP C 3 426 ? -0.570  168.604 9.625   1.00 51.33  ? 426 TRP A CA    1 
ATOM 4053  C C     . TRP C 3 426 ? -1.869  168.598 10.381  1.00 51.43  ? 426 TRP A C     1 
ATOM 4054  O O     . TRP C 3 426 ? -1.883  168.630 11.614  1.00 51.36  ? 426 TRP A O     1 
ATOM 4055  C CB    . TRP C 3 426 ? -0.733  169.325 8.299   1.00 51.19  ? 426 TRP A CB    1 
ATOM 4056  C CG    . TRP C 3 426 ? 0.537   169.322 7.564   1.00 51.37  ? 426 TRP A CG    1 
ATOM 4057  C CD1   . TRP C 3 426 ? 0.736   168.950 6.272   1.00 52.51  ? 426 TRP A CD1   1 
ATOM 4058  C CD2   . TRP C 3 426 ? 1.822   169.641 8.094   1.00 53.00  ? 426 TRP A CD2   1 
ATOM 4059  N NE1   . TRP C 3 426 ? 2.073   169.009 5.960   1.00 52.45  ? 426 TRP A NE1   1 
ATOM 4060  C CE2   . TRP C 3 426 ? 2.763   169.432 7.064   1.00 52.27  ? 426 TRP A CE2   1 
ATOM 4061  C CE3   . TRP C 3 426 ? 2.274   170.085 9.343   1.00 53.99  ? 426 TRP A CE3   1 
ATOM 4062  C CZ2   . TRP C 3 426 ? 4.127   169.650 7.242   1.00 53.27  ? 426 TRP A CZ2   1 
ATOM 4063  C CZ3   . TRP C 3 426 ? 3.631   170.303 9.520   1.00 54.80  ? 426 TRP A CZ3   1 
ATOM 4064  C CH2   . TRP C 3 426 ? 4.543   170.084 8.474   1.00 54.25  ? 426 TRP A CH2   1 
ATOM 4065  N N     . TYR C 3 427 ? -2.962  168.505 9.642   1.00 51.09  ? 427 TYR A N     1 
ATOM 4066  C CA    . TYR C 3 427 ? -4.265  168.523 10.267  1.00 52.64  ? 427 TYR A CA    1 
ATOM 4067  C C     . TYR C 3 427 ? -4.708  167.202 10.861  1.00 53.67  ? 427 TYR A C     1 
ATOM 4068  O O     . TYR C 3 427 ? -4.375  166.143 10.343  1.00 54.22  ? 427 TYR A O     1 
ATOM 4069  C CB    . TYR C 3 427 ? -5.297  168.989 9.270   1.00 53.95  ? 427 TYR A CB    1 
ATOM 4070  C CG    . TYR C 3 427 ? -5.718  167.940 8.282   1.00 52.55  ? 427 TYR A CG    1 
ATOM 4071  C CD1   . TYR C 3 427 ? -5.093  167.836 7.044   1.00 53.13  ? 427 TYR A CD1   1 
ATOM 4072  C CD2   . TYR C 3 427 ? -6.813  167.120 8.546   1.00 53.46  ? 427 TYR A CD2   1 
ATOM 4073  C CE1   . TYR C 3 427 ? -5.556  166.954 6.090   1.00 53.95  ? 427 TYR A CE1   1 
ATOM 4074  C CE2   . TYR C 3 427 ? -7.281  166.235 7.603   1.00 54.55  ? 427 TYR A CE2   1 
ATOM 4075  C CZ    . TYR C 3 427 ? -6.654  166.160 6.373   1.00 54.42  ? 427 TYR A CZ    1 
ATOM 4076  O OH    . TYR C 3 427 ? -7.157  165.320 5.411   1.00 57.43  ? 427 TYR A OH    1 
ATOM 4077  N N     . GLN C 3 428 ? -5.522  167.279 11.906  1.00 54.74  ? 428 GLN A N     1 
ATOM 4078  C CA    . GLN C 3 428 ? -6.027  166.084 12.563  1.00 57.23  ? 428 GLN A CA    1 
ATOM 4079  C C     . GLN C 3 428 ? -7.421  166.304 13.159  1.00 57.77  ? 428 GLN A C     1 
ATOM 4080  O O     . GLN C 3 428 ? -7.579  167.029 14.147  1.00 57.99  ? 428 GLN A O     1 
ATOM 4081  C CB    . GLN C 3 428 ? -5.061  165.627 13.660  1.00 58.77  ? 428 GLN A CB    1 
ATOM 4082  C CG    . GLN C 3 428 ? -5.479  164.318 14.308  1.00 61.20  ? 428 GLN A CG    1 
ATOM 4083  C CD    . GLN C 3 428 ? -4.928  164.151 15.705  1.00 63.03  ? 428 GLN A CD    1 
ATOM 4084  O OE1   . GLN C 3 428 ? -5.152  164.991 16.583  1.00 64.01  ? 428 GLN A OE1   1 
ATOM 4085  N NE2   . GLN C 3 428 ? -4.213  163.056 15.926  1.00 64.19  ? 428 GLN A NE2   1 
ATOM 4086  N N     . LEU C 3 429 ? -8.422  165.650 12.571  1.00 57.45  ? 429 LEU A N     1 
ATOM 4087  C CA    . LEU C 3 429 ? -9.805  165.748 13.036  1.00 57.55  ? 429 LEU A CA    1 
ATOM 4088  C C     . LEU C 3 429 ? -9.900  165.544 14.548  1.00 58.58  ? 429 LEU A C     1 
ATOM 4089  O O     . LEU C 3 429 ? -9.045  164.891 15.157  1.00 58.00  ? 429 LEU A O     1 
ATOM 4090  C CB    . LEU C 3 429 ? -10.676 164.705 12.333  1.00 56.29  ? 429 LEU A CB    1 
ATOM 4091  C CG    . LEU C 3 429 ? -11.097 164.897 10.870  1.00 56.09  ? 429 LEU A CG    1 
ATOM 4092  C CD1   . LEU C 3 429 ? -12.406 165.675 10.779  1.00 57.13  ? 429 LEU A CD1   1 
ATOM 4093  C CD2   . LEU C 3 429 ? -9.986  165.554 10.065  1.00 55.24  ? 429 LEU A CD2   1 
ATOM 4094  N N     . GLU C 3 430 ? -10.939 166.121 15.147  1.00 60.41  ? 430 GLU A N     1 
ATOM 4095  C CA    . GLU C 3 430 ? -11.161 166.018 16.590  1.00 61.02  ? 430 GLU A CA    1 
ATOM 4096  C C     . GLU C 3 430 ? -12.009 164.792 16.944  1.00 61.44  ? 430 GLU A C     1 
ATOM 4097  O O     . GLU C 3 430 ? -12.821 164.319 16.138  1.00 61.60  ? 430 GLU A O     1 
ATOM 4098  C CB    . GLU C 3 430 ? -11.802 167.305 17.133  1.00 60.36  ? 430 GLU A CB    1 
ATOM 4099  C CG    . GLU C 3 430 ? -11.083 168.613 16.708  1.00 59.62  ? 430 GLU A CG    1 
ATOM 4100  C CD    . GLU C 3 430 ? -9.726  168.847 17.379  1.00 58.78  ? 430 GLU A CD    1 
ATOM 4101  O OE1   . GLU C 3 430 ? -9.025  169.807 16.982  1.00 56.00  ? 430 GLU A OE1   1 
ATOM 4102  O OE2   . GLU C 3 430 ? -9.368  168.096 18.313  1.00 60.03  ? 430 GLU A OE2   1 
ATOM 4103  N N     . LYS C 3 431 ? -11.812 164.306 18.167  1.00 61.36  ? 431 LYS A N     1 
ATOM 4104  C CA    . LYS C 3 431 ? -12.483 163.121 18.704  1.00 61.20  ? 431 LYS A CA    1 
ATOM 4105  C C     . LYS C 3 431 ? -14.010 163.212 18.861  1.00 60.34  ? 431 LYS A C     1 
ATOM 4106  O O     . LYS C 3 431 ? -14.761 162.454 18.236  1.00 58.42  ? 431 LYS A O     1 
ATOM 4107  C CB    . LYS C 3 431 ? -11.846 162.784 20.053  1.00 63.42  ? 431 LYS A CB    1 
ATOM 4108  C CG    . LYS C 3 431 ? -10.314 162.869 20.073  1.00 65.86  ? 431 LYS A CG    1 
ATOM 4109  C CD    . LYS C 3 431 ? -9.775  162.720 21.501  1.00 67.74  ? 431 LYS A CD    1 
ATOM 4110  C CE    . LYS C 3 431 ? -8.251  162.561 21.534  1.00 69.97  ? 431 LYS A CE    1 
ATOM 4111  N NZ    . LYS C 3 431 ? -7.754  162.180 22.899  1.00 68.79  ? 431 LYS A NZ    1 
ATOM 4112  N N     . GLU C 3 432 ? -14.445 164.095 19.759  1.00 60.97  ? 432 GLU A N     1 
ATOM 4113  C CA    . GLU C 3 432 ? -15.863 164.323 20.044  1.00 62.00  ? 432 GLU A CA    1 
ATOM 4114  C C     . GLU C 3 432 ? -16.341 165.644 19.460  1.00 61.19  ? 432 GLU A C     1 
ATOM 4115  O O     . GLU C 3 432 ? -15.654 166.662 19.576  1.00 61.42  ? 432 GLU A O     1 
ATOM 4116  C CB    . GLU C 3 432 ? -16.110 164.337 21.557  1.00 63.52  ? 432 GLU A CB    1 
ATOM 4117  C CG    . GLU C 3 432 ? -16.154 162.957 22.214  1.00 67.43  ? 432 GLU A CG    1 
ATOM 4118  C CD    . GLU C 3 432 ? -17.412 162.150 21.873  1.00 69.18  ? 432 GLU A CD    1 
ATOM 4119  O OE1   . GLU C 3 432 ? -18.300 162.043 22.757  1.00 69.23  ? 432 GLU A OE1   1 
ATOM 4120  O OE2   . GLU C 3 432 ? -17.498 161.610 20.738  1.00 69.60  ? 432 GLU A OE2   1 
ATOM 4121  N N     . PRO C 3 433 ? -17.560 165.660 18.883  1.00 60.22  ? 433 PRO A N     1 
ATOM 4122  C CA    . PRO C 3 433 ? -18.120 166.878 18.291  1.00 59.04  ? 433 PRO A CA    1 
ATOM 4123  C C     . PRO C 3 433 ? -18.077 167.998 19.316  1.00 58.76  ? 433 PRO A C     1 
ATOM 4124  O O     . PRO C 3 433 ? -18.899 168.054 20.239  1.00 58.02  ? 433 PRO A O     1 
ATOM 4125  C CB    . PRO C 3 433 ? -19.552 166.465 17.957  1.00 58.56  ? 433 PRO A CB    1 
ATOM 4126  C CG    . PRO C 3 433 ? -19.858 165.408 18.970  1.00 59.35  ? 433 PRO A CG    1 
ATOM 4127  C CD    . PRO C 3 433 ? -18.586 164.606 18.968  1.00 59.62  ? 433 PRO A CD    1 
ATOM 4128  N N     . ILE C 3 434 ? -17.062 168.849 19.189  1.00 58.77  ? 434 ILE A N     1 
ATOM 4129  C CA    . ILE C 3 434 ? -16.908 169.945 20.123  1.00 59.47  ? 434 ILE A CA    1 
ATOM 4130  C C     . ILE C 3 434 ? -18.087 170.891 20.083  1.00 59.94  ? 434 ILE A C     1 
ATOM 4131  O O     . ILE C 3 434 ? -18.747 171.076 19.054  1.00 60.29  ? 434 ILE A O     1 
ATOM 4132  C CB    . ILE C 3 434 ? -15.607 170.757 19.921  1.00 59.64  ? 434 ILE A CB    1 
ATOM 4133  C CG1   . ILE C 3 434 ? -15.358 171.621 21.168  1.00 59.32  ? 434 ILE A CG1   1 
ATOM 4134  C CG2   . ILE C 3 434 ? -15.714 171.664 18.684  1.00 58.62  ? 434 ILE A CG2   1 
ATOM 4135  C CD1   . ILE C 3 434 ? -15.414 170.835 22.496  1.00 58.47  ? 434 ILE A CD1   1 
ATOM 4136  N N     . VAL C 3 435 ? -18.327 171.492 21.234  1.00 59.75  ? 435 VAL A N     1 
ATOM 4137  C CA    . VAL C 3 435 ? -19.408 172.417 21.395  1.00 59.23  ? 435 VAL A CA    1 
ATOM 4138  C C     . VAL C 3 435 ? -18.932 173.852 21.269  1.00 59.66  ? 435 VAL A C     1 
ATOM 4139  O O     . VAL C 3 435 ? -17.824 174.199 21.708  1.00 60.04  ? 435 VAL A O     1 
ATOM 4140  C CB    . VAL C 3 435 ? -20.086 172.174 22.731  1.00 59.42  ? 435 VAL A CB    1 
ATOM 4141  C CG1   . VAL C 3 435 ? -21.291 173.082 22.873  1.00 59.88  ? 435 VAL A CG1   1 
ATOM 4142  C CG2   . VAL C 3 435 ? -20.478 170.694 22.838  1.00 57.60  ? 435 VAL A CG2   1 
ATOM 4143  N N     . GLY C 3 436 ? -19.771 174.665 20.630  1.00 58.95  ? 436 GLY A N     1 
ATOM 4144  C CA    . GLY C 3 436 ? -19.460 176.068 20.434  1.00 59.23  ? 436 GLY A CA    1 
ATOM 4145  C C     . GLY C 3 436 ? -19.163 176.358 18.982  1.00 59.22  ? 436 GLY A C     1 
ATOM 4146  O O     . GLY C 3 436 ? -18.500 177.342 18.649  1.00 58.37  ? 436 GLY A O     1 
ATOM 4147  N N     . ALA C 3 437 ? -19.647 175.479 18.114  1.00 59.72  ? 437 ALA A N     1 
ATOM 4148  C CA    . ALA C 3 437 ? -19.442 175.630 16.680  1.00 60.63  ? 437 ALA A CA    1 
ATOM 4149  C C     . ALA C 3 437 ? -20.661 175.113 15.917  1.00 60.82  ? 437 ALA A C     1 
ATOM 4150  O O     . ALA C 3 437 ? -21.407 174.260 16.423  1.00 60.57  ? 437 ALA A O     1 
ATOM 4151  C CB    . ALA C 3 437 ? -18.188 174.888 16.248  1.00 60.13  ? 437 ALA A CB    1 
ATOM 4152  N N     . GLU C 3 438 ? -20.847 175.615 14.695  1.00 59.87  ? 438 GLU A N     1 
ATOM 4153  C CA    . GLU C 3 438 ? -21.995 175.228 13.871  1.00 59.49  ? 438 GLU A CA    1 
ATOM 4154  C C     . GLU C 3 438 ? -21.919 173.852 13.209  1.00 58.58  ? 438 GLU A C     1 
ATOM 4155  O O     . GLU C 3 438 ? -20.979 173.547 12.465  1.00 58.79  ? 438 GLU A O     1 
ATOM 4156  C CB    . GLU C 3 438 ? -22.246 176.249 12.776  1.00 58.92  ? 438 GLU A CB    1 
ATOM 4157  C CG    . GLU C 3 438 ? -22.051 177.682 13.155  1.00 58.04  ? 438 GLU A CG    1 
ATOM 4158  C CD    . GLU C 3 438 ? -22.023 178.542 11.922  1.00 58.29  ? 438 GLU A CD    1 
ATOM 4159  O OE1   . GLU C 3 438 ? -22.771 178.203 10.977  1.00 56.74  ? 438 GLU A OE1   1 
ATOM 4160  O OE2   . GLU C 3 438 ? -21.236 179.515 11.878  1.00 58.98  ? 438 GLU A OE2   1 
ATOM 4161  N N     . THR C 3 439 ? -22.975 173.070 13.408  1.00 57.41  ? 439 THR A N     1 
ATOM 4162  C CA    . THR C 3 439 ? -23.060 171.733 12.842  1.00 55.88  ? 439 THR A CA    1 
ATOM 4163  C C     . THR C 3 439 ? -23.594 171.803 11.420  1.00 53.87  ? 439 THR A C     1 
ATOM 4164  O O     . THR C 3 439 ? -24.783 171.608 11.171  1.00 54.41  ? 439 THR A O     1 
ATOM 4165  C CB    . THR C 3 439 ? -23.921 170.759 13.744  1.00 57.52  ? 439 THR A CB    1 
ATOM 4166  O OG1   . THR C 3 439 ? -25.221 170.529 13.171  1.00 55.80  ? 439 THR A OG1   1 
ATOM 4167  C CG2   . THR C 3 439 ? -24.073 171.334 15.170  1.00 57.42  ? 439 THR A CG2   1 
ATOM 4168  N N     . PHE C 3 440 ? -22.713 172.121 10.482  1.00 51.22  ? 440 PHE A N     1 
ATOM 4169  C CA    . PHE C 3 440 ? -23.132 172.184 9.096   1.00 50.32  ? 440 PHE A CA    1 
ATOM 4170  C C     . PHE C 3 440 ? -23.737 170.834 8.655   1.00 48.59  ? 440 PHE A C     1 
ATOM 4171  O O     . PHE C 3 440 ? -23.700 169.844 9.391   1.00 48.17  ? 440 PHE A O     1 
ATOM 4172  C CB    . PHE C 3 440 ? -21.962 172.606 8.200   1.00 53.10  ? 440 PHE A CB    1 
ATOM 4173  C CG    . PHE C 3 440 ? -21.592 174.070 8.322   1.00 56.29  ? 440 PHE A CG    1 
ATOM 4174  C CD1   . PHE C 3 440 ? -22.579 175.064 8.293   1.00 57.97  ? 440 PHE A CD1   1 
ATOM 4175  C CD2   . PHE C 3 440 ? -20.258 174.460 8.455   1.00 57.56  ? 440 PHE A CD2   1 
ATOM 4176  C CE1   . PHE C 3 440 ? -22.245 176.428 8.398   1.00 57.59  ? 440 PHE A CE1   1 
ATOM 4177  C CE2   . PHE C 3 440 ? -19.909 175.821 8.561   1.00 58.25  ? 440 PHE A CE2   1 
ATOM 4178  C CZ    . PHE C 3 440 ? -20.905 176.805 8.531   1.00 58.22  ? 440 PHE A CZ    1 
ATOM 4179  N N     . TYR C 3 441 ? -24.329 170.823 7.468   1.00 45.98  ? 441 TYR A N     1 
ATOM 4180  C CA    . TYR C 3 441 ? -24.981 169.643 6.899   1.00 43.44  ? 441 TYR A CA    1 
ATOM 4181  C C     . TYR C 3 441 ? -24.733 169.691 5.380   1.00 43.37  ? 441 TYR A C     1 
ATOM 4182  O O     . TYR C 3 441 ? -25.473 170.344 4.632   1.00 43.73  ? 441 TYR A O     1 
ATOM 4183  C CB    . TYR C 3 441 ? -26.480 169.752 7.154   1.00 41.25  ? 441 TYR A CB    1 
ATOM 4184  C CG    . TYR C 3 441 ? -27.045 168.987 8.321   1.00 37.55  ? 441 TYR A CG    1 
ATOM 4185  C CD1   . TYR C 3 441 ? -26.646 169.238 9.638   1.00 36.22  ? 441 TYR A CD1   1 
ATOM 4186  C CD2   . TYR C 3 441 ? -28.050 168.050 8.100   1.00 36.98  ? 441 TYR A CD2   1 
ATOM 4187  C CE1   . TYR C 3 441 ? -27.260 168.568 10.707  1.00 36.95  ? 441 TYR A CE1   1 
ATOM 4188  C CE2   . TYR C 3 441 ? -28.655 167.383 9.135   1.00 36.99  ? 441 TYR A CE2   1 
ATOM 4189  C CZ    . TYR C 3 441 ? -28.279 167.629 10.438  1.00 37.85  ? 441 TYR A CZ    1 
ATOM 4190  O OH    . TYR C 3 441 ? -28.960 166.937 11.433  1.00 37.79  ? 441 TYR A OH    1 
ATOM 4191  N N     . VAL C 3 442 ? -23.719 168.981 4.907   1.00 42.81  ? 442 VAL A N     1 
ATOM 4192  C CA    . VAL C 3 442 ? -23.411 169.044 3.483   1.00 42.11  ? 442 VAL A CA    1 
ATOM 4193  C C     . VAL C 3 442 ? -24.219 168.123 2.568   1.00 43.03  ? 442 VAL A C     1 
ATOM 4194  O O     . VAL C 3 442 ? -25.003 167.276 3.021   1.00 41.46  ? 442 VAL A O     1 
ATOM 4195  C CB    . VAL C 3 442 ? -21.904 168.818 3.222   1.00 40.65  ? 442 VAL A CB    1 
ATOM 4196  C CG1   . VAL C 3 442 ? -21.500 169.518 1.969   1.00 37.08  ? 442 VAL A CG1   1 
ATOM 4197  C CG2   . VAL C 3 442 ? -21.071 169.303 4.390   1.00 38.47  ? 442 VAL A CG2   1 
ATOM 4198  N N     . ASP C 3 443 ? -24.027 168.339 1.269   1.00 43.65  ? 443 ASP A N     1 
ATOM 4199  C CA    . ASP C 3 443 ? -24.663 167.558 0.226   1.00 44.97  ? 443 ASP A CA    1 
ATOM 4200  C C     . ASP C 3 443 ? -24.230 168.069 -1.141  1.00 46.69  ? 443 ASP A C     1 
ATOM 4201  O O     . ASP C 3 443 ? -23.750 169.196 -1.270  1.00 47.78  ? 443 ASP A O     1 
ATOM 4202  C CB    . ASP C 3 443 ? -26.177 167.637 0.330   1.00 44.03  ? 443 ASP A CB    1 
ATOM 4203  C CG    . ASP C 3 443 ? -26.842 166.361 -0.095  1.00 43.80  ? 443 ASP A CG    1 
ATOM 4204  O OD1   . ASP C 3 443 ? -26.790 165.410 0.702   1.00 45.49  ? 443 ASP A OD1   1 
ATOM 4205  O OD2   . ASP C 3 443 ? -27.396 166.294 -1.214  1.00 42.95  ? 443 ASP A OD2   1 
ATOM 4206  N N     . GLY C 3 444 ? -24.437 167.233 -2.156  1.00 47.90  ? 444 GLY A N     1 
ATOM 4207  C CA    . GLY C 3 444 ? -24.089 167.555 -3.534  1.00 49.54  ? 444 GLY A CA    1 
ATOM 4208  C C     . GLY C 3 444 ? -24.654 166.465 -4.435  1.00 50.71  ? 444 GLY A C     1 
ATOM 4209  O O     . GLY C 3 444 ? -25.289 165.544 -3.917  1.00 52.28  ? 444 GLY A O     1 
ATOM 4210  N N     . ALA C 3 445 ? -24.466 166.573 -5.754  1.00 51.38  ? 445 ALA A N     1 
ATOM 4211  C CA    . ALA C 3 445 ? -24.965 165.569 -6.718  1.00 53.35  ? 445 ALA A CA    1 
ATOM 4212  C C     . ALA C 3 445 ? -24.998 166.058 -8.166  1.00 54.95  ? 445 ALA A C     1 
ATOM 4213  O O     . ALA C 3 445 ? -24.850 167.258 -8.434  1.00 55.79  ? 445 ALA A O     1 
ATOM 4214  C CB    . ALA C 3 445 ? -26.373 165.064 -6.328  1.00 51.92  ? 445 ALA A CB    1 
ATOM 4215  N N     . ALA C 3 446 ? -25.246 165.115 -9.082  1.00 55.61  ? 446 ALA A N     1 
ATOM 4216  C CA    . ALA C 3 446 ? -25.345 165.374 -10.525 1.00 55.84  ? 446 ALA A CA    1 
ATOM 4217  C C     . ALA C 3 446 ? -25.938 164.160 -11.242 1.00 56.47  ? 446 ALA A C     1 
ATOM 4218  O O     . ALA C 3 446 ? -26.352 163.191 -10.603 1.00 55.72  ? 446 ALA A O     1 
ATOM 4219  C CB    . ALA C 3 446 ? -23.971 165.700 -11.110 1.00 55.31  ? 446 ALA A CB    1 
ATOM 4220  N N     . ASN C 3 447 ? -25.997 164.232 -12.570 1.00 57.82  ? 447 ASN A N     1 
ATOM 4221  C CA    . ASN C 3 447 ? -26.511 163.133 -13.391 1.00 59.27  ? 447 ASN A CA    1 
ATOM 4222  C C     . ASN C 3 447 ? -25.571 162.863 -14.571 1.00 59.71  ? 447 ASN A C     1 
ATOM 4223  O O     . ASN C 3 447 ? -25.067 163.801 -15.198 1.00 59.30  ? 447 ASN A O     1 
ATOM 4224  C CB    . ASN C 3 447 ? -27.936 163.424 -13.889 1.00 58.68  ? 447 ASN A CB    1 
ATOM 4225  C CG    . ASN C 3 447 ? -28.284 162.652 -15.160 1.00 60.62  ? 447 ASN A CG    1 
ATOM 4226  O OD1   . ASN C 3 447 ? -28.008 163.114 -16.264 1.00 60.38  ? 447 ASN A OD1   1 
ATOM 4227  N ND2   . ASN C 3 447 ? -28.866 161.464 -15.004 1.00 60.59  ? 447 ASN A ND2   1 
ATOM 4228  N N     . ARG C 3 448 ? -25.356 161.576 -14.864 1.00 60.34  ? 448 ARG A N     1 
ATOM 4229  C CA    . ARG C 3 448 ? -24.479 161.127 -15.955 1.00 59.84  ? 448 ARG A CA    1 
ATOM 4230  C C     . ARG C 3 448 ? -24.593 162.017 -17.189 1.00 59.41  ? 448 ARG A C     1 
ATOM 4231  O O     . ARG C 3 448 ? -23.587 162.457 -17.758 1.00 60.60  ? 448 ARG A O     1 
ATOM 4232  C CB    . ARG C 3 448 ? -24.797 159.670 -16.321 1.00 59.98  ? 448 ARG A CB    1 
ATOM 4233  N N     . GLU C 3 449 ? -25.831 162.299 -17.576 1.00 58.08  ? 449 GLU A N     1 
ATOM 4234  C CA    . GLU C 3 449 ? -26.093 163.143 -18.723 1.00 57.09  ? 449 GLU A CA    1 
ATOM 4235  C C     . GLU C 3 449 ? -25.814 164.604 -18.390 1.00 56.72  ? 449 GLU A C     1 
ATOM 4236  O O     . GLU C 3 449 ? -25.223 165.319 -19.191 1.00 55.85  ? 449 GLU A O     1 
ATOM 4237  C CB    . GLU C 3 449 ? -27.528 162.964 -19.184 1.00 57.72  ? 449 GLU A CB    1 
ATOM 4238  N N     . THR C 3 450 ? -26.198 165.044 -17.199 1.00 56.63  ? 450 THR A N     1 
ATOM 4239  C CA    . THR C 3 450 ? -25.971 166.438 -16.839 1.00 57.39  ? 450 THR A CA    1 
ATOM 4240  C C     . THR C 3 450 ? -24.523 166.870 -17.011 1.00 56.87  ? 450 THR A C     1 
ATOM 4241  O O     . THR C 3 450 ? -24.232 167.780 -17.791 1.00 55.65  ? 450 THR A O     1 
ATOM 4242  C CB    . THR C 3 450 ? -26.383 166.775 -15.372 1.00 57.65  ? 450 THR A CB    1 
ATOM 4243  O OG1   . THR C 3 450 ? -25.556 166.058 -14.446 1.00 57.71  ? 450 THR A OG1   1 
ATOM 4244  C CG2   . THR C 3 450 ? -27.857 166.479 -15.118 1.00 58.81  ? 450 THR A CG2   1 
ATOM 4245  N N     . LYS C 3 451 ? -23.619 166.183 -16.310 1.00 57.45  ? 451 LYS A N     1 
ATOM 4246  C CA    . LYS C 3 451 ? -22.195 166.520 -16.309 1.00 59.41  ? 451 LYS A CA    1 
ATOM 4247  C C     . LYS C 3 451 ? -22.104 167.821 -15.503 1.00 60.65  ? 451 LYS A C     1 
ATOM 4248  O O     . LYS C 3 451 ? -21.016 168.355 -15.272 1.00 60.32  ? 451 LYS A O     1 
ATOM 4249  C CB    . LYS C 3 451 ? -21.678 166.767 -17.728 1.00 60.71  ? 451 LYS A CB    1 
ATOM 4250  C CG    . LYS C 3 451 ? -22.000 165.671 -18.725 1.00 62.46  ? 451 LYS A CG    1 
ATOM 4251  C CD    . LYS C 3 451 ? -22.284 166.282 -20.096 1.00 64.90  ? 451 LYS A CD    1 
ATOM 4252  C CE    . LYS C 3 451 ? -22.478 165.220 -21.185 1.00 67.25  ? 451 LYS A CE    1 
ATOM 4253  N NZ    . LYS C 3 451 ? -23.580 164.247 -20.893 1.00 69.01  ? 451 LYS A NZ    1 
ATOM 4254  N N     . LEU C 3 452 ? -23.279 168.291 -15.071 1.00 61.41  ? 452 LEU A N     1 
ATOM 4255  C CA    . LEU C 3 452 ? -23.482 169.514 -14.299 1.00 61.29  ? 452 LEU A CA    1 
ATOM 4256  C C     . LEU C 3 452 ? -24.369 169.219 -13.085 1.00 61.48  ? 452 LEU A C     1 
ATOM 4257  O O     . LEU C 3 452 ? -25.198 168.307 -13.121 1.00 61.16  ? 452 LEU A O     1 
ATOM 4258  C CB    . LEU C 3 452 ? -24.208 170.535 -15.163 1.00 61.51  ? 452 LEU A CB    1 
ATOM 4259  C CG    . LEU C 3 452 ? -25.635 170.116 -15.538 1.00 61.56  ? 452 LEU A CG    1 
ATOM 4260  C CD1   . LEU C 3 452 ? -26.650 171.081 -14.940 1.00 62.57  ? 452 LEU A CD1   1 
ATOM 4261  C CD2   . LEU C 3 452 ? -25.783 170.055 -17.044 1.00 61.84  ? 452 LEU A CD2   1 
ATOM 4262  N N     . GLY C 3 453 ? -24.241 170.040 -12.044 1.00 61.84  ? 453 GLY A N     1 
ATOM 4263  C CA    . GLY C 3 453 ? -25.027 169.851 -10.831 1.00 61.38  ? 453 GLY A CA    1 
ATOM 4264  C C     . GLY C 3 453 ? -24.663 170.876 -9.773  1.00 61.44  ? 453 GLY A C     1 
ATOM 4265  O O     . GLY C 3 453 ? -23.804 171.711 -10.009 1.00 60.49  ? 453 GLY A O     1 
ATOM 4266  N N     . LYS C 3 454 ? -25.306 170.822 -8.611  1.00 61.37  ? 454 LYS A N     1 
ATOM 4267  C CA    . LYS C 3 454 ? -25.023 171.787 -7.548  1.00 61.71  ? 454 LYS A CA    1 
ATOM 4268  C C     . LYS C 3 454 ? -24.313 171.145 -6.389  1.00 60.41  ? 454 LYS A C     1 
ATOM 4269  O O     . LYS C 3 454 ? -24.248 169.924 -6.298  1.00 62.55  ? 454 LYS A O     1 
ATOM 4270  C CB    . LYS C 3 454 ? -26.311 172.401 -7.022  1.00 62.93  ? 454 LYS A CB    1 
ATOM 4271  C CG    . LYS C 3 454 ? -27.212 172.918 -8.099  1.00 65.49  ? 454 LYS A CG    1 
ATOM 4272  C CD    . LYS C 3 454 ? -28.610 173.049 -7.576  1.00 67.47  ? 454 LYS A CD    1 
ATOM 4273  C CE    . LYS C 3 454 ? -29.558 173.457 -8.678  1.00 68.91  ? 454 LYS A CE    1 
ATOM 4274  N NZ    . LYS C 3 454 ? -30.973 173.440 -8.202  1.00 68.54  ? 454 LYS A NZ    1 
ATOM 4275  N N     . ALA C 3 455 ? -23.856 171.970 -5.458  1.00 58.64  ? 455 ALA A N     1 
ATOM 4276  C CA    . ALA C 3 455 ? -23.152 171.466 -4.292  1.00 57.40  ? 455 ALA A CA    1 
ATOM 4277  C C     . ALA C 3 455 ? -23.174 172.511 -3.202  1.00 56.41  ? 455 ALA A C     1 
ATOM 4278  O O     . ALA C 3 455 ? -22.483 173.525 -3.301  1.00 55.03  ? 455 ALA A O     1 
ATOM 4279  C CB    . ALA C 3 455 ? -21.713 171.120 -4.661  1.00 59.11  ? 455 ALA A CB    1 
ATOM 4280  N N     . GLY C 3 456 ? -23.956 172.259 -2.157  1.00 56.15  ? 456 GLY A N     1 
ATOM 4281  C CA    . GLY C 3 456 ? -24.033 173.224 -1.077  1.00 57.08  ? 456 GLY A CA    1 
ATOM 4282  C C     . GLY C 3 456 ? -24.331 172.703 0.314   1.00 57.03  ? 456 GLY A C     1 
ATOM 4283  O O     . GLY C 3 456 ? -24.058 171.538 0.641   1.00 57.64  ? 456 GLY A O     1 
ATOM 4284  N N     . TYR C 3 457 ? -24.914 173.578 1.134   1.00 56.57  ? 457 TYR A N     1 
ATOM 4285  C CA    . TYR C 3 457 ? -25.237 173.228 2.509   1.00 55.55  ? 457 TYR A CA    1 
ATOM 4286  C C     . TYR C 3 457 ? -26.217 174.141 3.222   1.00 53.45  ? 457 TYR A C     1 
ATOM 4287  O O     . TYR C 3 457 ? -26.671 175.154 2.686   1.00 53.60  ? 457 TYR A O     1 
ATOM 4288  C CB    . TYR C 3 457 ? -23.960 173.198 3.337   1.00 57.38  ? 457 TYR A CB    1 
ATOM 4289  C CG    . TYR C 3 457 ? -23.331 174.564 3.551   1.00 60.23  ? 457 TYR A CG    1 
ATOM 4290  C CD1   . TYR C 3 457 ? -22.572 174.823 4.696   1.00 60.27  ? 457 TYR A CD1   1 
ATOM 4291  C CD2   . TYR C 3 457 ? -23.458 175.581 2.597   1.00 59.74  ? 457 TYR A CD2   1 
ATOM 4292  C CE1   . TYR C 3 457 ? -21.950 176.050 4.887   1.00 61.04  ? 457 TYR A CE1   1 
ATOM 4293  C CE2   . TYR C 3 457 ? -22.843 176.808 2.781   1.00 60.34  ? 457 TYR A CE2   1 
ATOM 4294  C CZ    . TYR C 3 457 ? -22.087 177.036 3.926   1.00 61.81  ? 457 TYR A CZ    1 
ATOM 4295  O OH    . TYR C 3 457 ? -21.454 178.238 4.116   1.00 59.78  ? 457 TYR A OH    1 
ATOM 4296  N N     . VAL C 3 458 ? -26.448 173.778 4.480   1.00 51.60  ? 458 VAL A N     1 
ATOM 4297  C CA    . VAL C 3 458 ? -27.327 174.460 5.417   1.00 49.76  ? 458 VAL A CA    1 
ATOM 4298  C C     . VAL C 3 458 ? -26.491 174.587 6.693   1.00 49.27  ? 458 VAL A C     1 
ATOM 4299  O O     . VAL C 3 458 ? -25.271 174.461 6.663   1.00 50.27  ? 458 VAL A O     1 
ATOM 4300  C CB    . VAL C 3 458 ? -28.579 173.579 5.703   1.00 48.56  ? 458 VAL A CB    1 
ATOM 4301  C CG1   . VAL C 3 458 ? -29.567 174.282 6.613   1.00 47.91  ? 458 VAL A CG1   1 
ATOM 4302  C CG2   . VAL C 3 458 ? -29.261 173.208 4.404   1.00 48.96  ? 458 VAL A CG2   1 
ATOM 4303  N N     . THR C 3 459 ? -27.146 174.906 7.795   1.00 49.11  ? 459 THR A N     1 
ATOM 4304  C CA    . THR C 3 459 ? -26.516 175.015 9.098   1.00 49.40  ? 459 THR A CA    1 
ATOM 4305  C C     . THR C 3 459 ? -27.697 175.053 10.035  1.00 49.92  ? 459 THR A C     1 
ATOM 4306  O O     . THR C 3 459 ? -28.751 175.575 9.690   1.00 50.46  ? 459 THR A O     1 
ATOM 4307  C CB    . THR C 3 459 ? -25.651 176.307 9.281   1.00 48.77  ? 459 THR A CB    1 
ATOM 4308  O OG1   . THR C 3 459 ? -24.963 176.251 10.538  1.00 47.20  ? 459 THR A OG1   1 
ATOM 4309  C CG2   . THR C 3 459 ? -26.503 177.546 9.284   1.00 48.49  ? 459 THR A CG2   1 
ATOM 4310  N N     . ASN C 3 460 ? -27.546 174.418 11.184  1.00 51.36  ? 460 ASN A N     1 
ATOM 4311  C CA    . ASN C 3 460 ? -28.587 174.388 12.206  1.00 53.51  ? 460 ASN A CA    1 
ATOM 4312  C C     . ASN C 3 460 ? -29.187 175.791 12.331  1.00 54.45  ? 460 ASN A C     1 
ATOM 4313  O O     . ASN C 3 460 ? -30.393 175.961 12.565  1.00 55.04  ? 460 ASN A O     1 
ATOM 4314  C CB    . ASN C 3 460 ? -27.941 174.003 13.529  1.00 53.65  ? 460 ASN A CB    1 
ATOM 4315  C CG    . ASN C 3 460 ? -26.752 174.890 13.865  1.00 54.41  ? 460 ASN A CG    1 
ATOM 4316  O OD1   . ASN C 3 460 ? -25.866 175.119 13.031  1.00 54.07  ? 460 ASN A OD1   1 
ATOM 4317  N ND2   . ASN C 3 460 ? -26.757 175.438 15.070  1.00 55.61  ? 460 ASN A ND2   1 
ATOM 4318  N N     . LYS C 3 461 ? -28.314 176.782 12.136  1.00 54.20  ? 461 LYS A N     1 
ATOM 4319  C CA    . LYS C 3 461 ? -28.664 178.193 12.191  1.00 53.10  ? 461 LYS A CA    1 
ATOM 4320  C C     . LYS C 3 461 ? -29.418 178.578 10.930  1.00 50.87  ? 461 LYS A C     1 
ATOM 4321  O O     . LYS C 3 461 ? -29.108 179.601 10.332  1.00 50.18  ? 461 LYS A O     1 
ATOM 4322  C CB    . LYS C 3 461 ? -27.399 179.052 12.244  1.00 54.75  ? 461 LYS A CB    1 
ATOM 4323  C CG    . LYS C 3 461 ? -26.428 178.762 13.362  1.00 57.66  ? 461 LYS A CG    1 
ATOM 4324  C CD    . LYS C 3 461 ? -25.203 179.647 13.191  1.00 59.03  ? 461 LYS A CD    1 
ATOM 4325  C CE    . LYS C 3 461 ? -24.339 179.670 14.434  1.00 60.15  ? 461 LYS A CE    1 
ATOM 4326  N NZ    . LYS C 3 461 ? -23.163 180.570 14.245  1.00 59.96  ? 461 LYS A NZ    1 
ATOM 4327  N N     . GLY C 3 462 ? -30.340 177.724 10.491  1.00 48.44  ? 462 GLY A N     1 
ATOM 4328  C CA    . GLY C 3 462 ? -31.130 177.997 9.302   1.00 45.68  ? 462 GLY A CA    1 
ATOM 4329  C C     . GLY C 3 462 ? -30.406 178.368 8.015   1.00 44.23  ? 462 GLY A C     1 
ATOM 4330  O O     . GLY C 3 462 ? -30.926 178.105 6.929   1.00 44.29  ? 462 GLY A O     1 
ATOM 4331  N N     . ARG C 3 463 ? -29.219 178.969 8.121   1.00 42.46  ? 463 ARG A N     1 
ATOM 4332  C CA    . ARG C 3 463 ? -28.450 179.391 6.954   1.00 42.02  ? 463 ARG A CA    1 
ATOM 4333  C C     . ARG C 3 463 ? -28.205 178.301 5.944   1.00 41.64  ? 463 ARG A C     1 
ATOM 4334  O O     . ARG C 3 463 ? -28.107 177.125 6.279   1.00 42.66  ? 463 ARG A O     1 
ATOM 4335  C CB    . ARG C 3 463 ? -27.104 179.986 7.356   1.00 40.51  ? 463 ARG A CB    1 
ATOM 4336  C CG    . ARG C 3 463 ? -26.079 180.008 6.213   1.00 39.80  ? 463 ARG A CG    1 
ATOM 4337  C CD    . ARG C 3 463 ? -24.765 180.510 6.706   1.00 43.76  ? 463 ARG A CD    1 
ATOM 4338  N NE    . ARG C 3 463 ? -24.613 180.180 8.119   1.00 46.79  ? 463 ARG A NE    1 
ATOM 4339  C CZ    . ARG C 3 463 ? -23.611 180.591 8.888   1.00 48.58  ? 463 ARG A CZ    1 
ATOM 4340  N NH1   . ARG C 3 463 ? -22.632 181.345 8.389   1.00 47.93  ? 463 ARG A NH1   1 
ATOM 4341  N NH2   . ARG C 3 463 ? -23.646 180.329 10.184  1.00 47.32  ? 463 ARG A NH2   1 
ATOM 4342  N N     . GLN C 3 464 ? -28.074 178.717 4.699   1.00 40.72  ? 464 GLN A N     1 
ATOM 4343  C CA    . GLN C 3 464 ? -27.826 177.787 3.642   1.00 41.03  ? 464 GLN A CA    1 
ATOM 4344  C C     . GLN C 3 464 ? -26.827 178.360 2.660   1.00 40.24  ? 464 GLN A C     1 
ATOM 4345  O O     . GLN C 3 464 ? -26.005 179.205 3.015   1.00 38.92  ? 464 GLN A O     1 
ATOM 4346  C CB    . GLN C 3 464 ? -29.155 177.392 2.998   1.00 42.50  ? 464 GLN A CB    1 
ATOM 4347  C CG    . GLN C 3 464 ? -30.005 176.549 3.956   1.00 46.75  ? 464 GLN A CG    1 
ATOM 4348  C CD    . GLN C 3 464 ? -31.502 176.792 3.855   1.00 50.58  ? 464 GLN A CD    1 
ATOM 4349  O OE1   . GLN C 3 464 ? -32.085 176.718 2.771   1.00 52.97  ? 464 GLN A OE1   1 
ATOM 4350  N NE2   . GLN C 3 464 ? -32.140 177.048 4.997   1.00 51.48  ? 464 GLN A NE2   1 
ATOM 4351  N N     . LYS C 3 465 ? -26.842 177.783 1.468   1.00 39.76  ? 465 LYS A N     1 
ATOM 4352  C CA    . LYS C 3 465 ? -25.989 178.136 0.347   1.00 39.65  ? 465 LYS A CA    1 
ATOM 4353  C C     . LYS C 3 465 ? -26.027 176.922 -0.554  1.00 41.57  ? 465 LYS A C     1 
ATOM 4354  O O     . LYS C 3 465 ? -26.190 175.794 -0.081  1.00 41.62  ? 465 LYS A O     1 
ATOM 4355  C CB    . LYS C 3 465 ? -24.547 178.416 0.772   1.00 36.94  ? 465 LYS A CB    1 
ATOM 4356  C CG    . LYS C 3 465 ? -23.555 178.342 -0.384  1.00 35.79  ? 465 LYS A CG    1 
ATOM 4357  C CD    . LYS C 3 465 ? -22.546 179.497 -0.425  1.00 35.04  ? 465 LYS A CD    1 
ATOM 4358  C CE    . LYS C 3 465 ? -21.499 179.425 0.679   1.00 32.32  ? 465 LYS A CE    1 
ATOM 4359  N NZ    . LYS C 3 465 ? -22.118 179.577 2.020   1.00 30.51  ? 465 LYS A NZ    1 
ATOM 4360  N N     . VAL C 3 466 ? -25.922 177.169 -1.853  1.00 43.37  ? 466 VAL A N     1 
ATOM 4361  C CA    . VAL C 3 466 ? -25.945 176.121 -2.873  1.00 46.35  ? 466 VAL A CA    1 
ATOM 4362  C C     . VAL C 3 466 ? -25.109 176.649 -4.043  1.00 48.16  ? 466 VAL A C     1 
ATOM 4363  O O     . VAL C 3 466 ? -24.965 177.863 -4.185  1.00 49.86  ? 466 VAL A O     1 
ATOM 4364  C CB    . VAL C 3 466 ? -27.414 175.836 -3.364  1.00 46.10  ? 466 VAL A CB    1 
ATOM 4365  C CG1   . VAL C 3 466 ? -27.408 174.926 -4.590  1.00 46.60  ? 466 VAL A CG1   1 
ATOM 4366  C CG2   . VAL C 3 466 ? -28.250 175.200 -2.250  1.00 45.55  ? 466 VAL A CG2   1 
ATOM 4367  N N     . VAL C 3 467 ? -24.503 175.753 -4.827  1.00 49.13  ? 467 VAL A N     1 
ATOM 4368  C CA    . VAL C 3 467 ? -23.704 176.157 -5.981  1.00 49.47  ? 467 VAL A CA    1 
ATOM 4369  C C     . VAL C 3 467 ? -23.635 175.117 -7.072  1.00 50.15  ? 467 VAL A C     1 
ATOM 4370  O O     . VAL C 3 467 ? -23.035 174.054 -6.917  1.00 50.58  ? 467 VAL A O     1 
ATOM 4371  C CB    . VAL C 3 467 ? -22.217 176.506 -5.654  1.00 49.50  ? 467 VAL A CB    1 
ATOM 4372  C CG1   . VAL C 3 467 ? -21.486 176.893 -6.955  1.00 49.85  ? 467 VAL A CG1   1 
ATOM 4373  C CG2   . VAL C 3 467 ? -22.110 177.643 -4.642  1.00 49.82  ? 467 VAL A CG2   1 
ATOM 4374  N N     . PRO C 3 468 ? -24.323 175.377 -8.167  1.00 50.92  ? 468 PRO A N     1 
ATOM 4375  C CA    . PRO C 3 468 ? -24.303 174.454 -9.290  1.00 52.84  ? 468 PRO A CA    1 
ATOM 4376  C C     . PRO C 3 468 ? -22.987 174.681 -10.012 1.00 55.11  ? 468 PRO A C     1 
ATOM 4377  O O     . PRO C 3 468 ? -22.369 175.746 -9.895  1.00 54.53  ? 468 PRO A O     1 
ATOM 4378  C CB    . PRO C 3 468 ? -25.481 174.914 -10.132 1.00 53.13  ? 468 PRO A CB    1 
ATOM 4379  C CG    . PRO C 3 468 ? -25.590 176.357 -9.785  1.00 53.99  ? 468 PRO A CG    1 
ATOM 4380  C CD    . PRO C 3 468 ? -25.414 176.342 -8.305  1.00 51.74  ? 468 PRO A CD    1 
ATOM 4381  N N     . LEU C 3 469 ? -22.554 173.652 -10.725 1.00 58.31  ? 469 LEU A N     1 
ATOM 4382  C CA    . LEU C 3 469 ? -21.306 173.667 -11.476 1.00 60.88  ? 469 LEU A CA    1 
ATOM 4383  C C     . LEU C 3 469 ? -21.288 172.587 -12.553 1.00 61.36  ? 469 LEU A C     1 
ATOM 4384  O O     . LEU C 3 469 ? -22.277 171.869 -12.744 1.00 60.45  ? 469 LEU A O     1 
ATOM 4385  C CB    . LEU C 3 469 ? -20.092 173.505 -10.547 1.00 62.13  ? 469 LEU A CB    1 
ATOM 4386  C CG    . LEU C 3 469 ? -20.109 172.792 -9.183  1.00 63.59  ? 469 LEU A CG    1 
ATOM 4387  C CD1   . LEU C 3 469 ? -21.244 171.790 -8.987  1.00 63.02  ? 469 LEU A CD1   1 
ATOM 4388  C CD2   . LEU C 3 469 ? -18.755 172.109 -9.019  1.00 64.36  ? 469 LEU A CD2   1 
ATOM 4389  N N     . THR C 3 470 ? -20.154 172.469 -13.247 1.00 63.38  ? 470 THR A N     1 
ATOM 4390  C CA    . THR C 3 470 ? -20.023 171.493 -14.328 1.00 64.83  ? 470 THR A CA    1 
ATOM 4391  C C     . THR C 3 470 ? -18.629 170.900 -14.540 1.00 64.30  ? 470 THR A C     1 
ATOM 4392  O O     . THR C 3 470 ? -17.602 171.495 -14.166 1.00 62.78  ? 470 THR A O     1 
ATOM 4393  C CB    . THR C 3 470 ? -20.564 172.070 -15.651 1.00 66.62  ? 470 THR A CB    1 
ATOM 4394  O OG1   . THR C 3 470 ? -21.892 172.565 -15.430 1.00 67.52  ? 470 THR A OG1   1 
ATOM 4395  C CG2   . THR C 3 470 ? -20.613 170.996 -16.747 1.00 67.89  ? 470 THR A CG2   1 
ATOM 4396  N N     . ASN C 3 471 ? -18.635 169.739 -15.203 1.00 63.63  ? 471 ASN A N     1 
ATOM 4397  C CA    . ASN C 3 471 ? -17.458 168.937 -15.479 1.00 62.19  ? 471 ASN A CA    1 
ATOM 4398  C C     . ASN C 3 471 ? -17.078 168.364 -14.120 1.00 61.16  ? 471 ASN A C     1 
ATOM 4399  O O     . ASN C 3 471 ? -16.080 168.776 -13.527 1.00 61.75  ? 471 ASN A O     1 
ATOM 4400  C CB    . ASN C 3 471 ? -16.313 169.773 -16.075 1.00 64.09  ? 471 ASN A CB    1 
ATOM 4401  C CG    . ASN C 3 471 ? -16.428 169.935 -17.588 1.00 66.12  ? 471 ASN A CG    1 
ATOM 4402  O OD1   . ASN C 3 471 ? -17.067 169.119 -18.258 1.00 67.46  ? 471 ASN A OD1   1 
ATOM 4403  N ND2   . ASN C 3 471 ? -15.795 170.983 -18.135 1.00 65.04  ? 471 ASN A ND2   1 
ATOM 4404  N N     . THR C 3 472 ? -17.973 167.528 -13.577 1.00 58.81  ? 472 THR A N     1 
ATOM 4405  C CA    . THR C 3 472 ? -17.789 166.852 -12.279 1.00 56.52  ? 472 THR A CA    1 
ATOM 4406  C C     . THR C 3 472 ? -18.651 165.589 -12.179 1.00 55.94  ? 472 THR A C     1 
ATOM 4407  O O     . THR C 3 472 ? -19.179 165.120 -13.188 1.00 57.08  ? 472 THR A O     1 
ATOM 4408  C CB    . THR C 3 472 ? -18.161 167.732 -11.078 1.00 56.31  ? 472 THR A CB    1 
ATOM 4409  O OG1   . THR C 3 472 ? -19.499 168.196 -11.249 1.00 55.76  ? 472 THR A OG1   1 
ATOM 4410  C CG2   . THR C 3 472 ? -17.197 168.905 -10.907 1.00 55.02  ? 472 THR A CG2   1 
ATOM 4411  N N     . THR C 3 473 ? -18.811 165.058 -10.963 1.00 54.46  ? 473 THR A N     1 
ATOM 4412  C CA    . THR C 3 473 ? -19.601 163.840 -10.740 1.00 53.21  ? 473 THR A CA    1 
ATOM 4413  C C     . THR C 3 473 ? -20.205 163.749 -9.352  1.00 53.33  ? 473 THR A C     1 
ATOM 4414  O O     . THR C 3 473 ? -19.692 164.346 -8.408  1.00 52.18  ? 473 THR A O     1 
ATOM 4415  C CB    . THR C 3 473 ? -18.746 162.598 -10.827 1.00 53.33  ? 473 THR A CB    1 
ATOM 4416  O OG1   . THR C 3 473 ? -17.680 162.719 -9.876  1.00 51.61  ? 473 THR A OG1   1 
ATOM 4417  C CG2   . THR C 3 473 ? -18.207 162.390 -12.232 1.00 54.23  ? 473 THR A CG2   1 
ATOM 4418  N N     . ASN C 3 474 ? -21.202 162.867 -9.225  1.00 53.42  ? 474 ASN A N     1 
ATOM 4419  C CA    . ASN C 3 474 ? -21.906 162.619 -7.965  1.00 53.84  ? 474 ASN A CA    1 
ATOM 4420  C C     . ASN C 3 474 ? -20.875 162.494 -6.866  1.00 54.01  ? 474 ASN A C     1 
ATOM 4421  O O     . ASN C 3 474 ? -21.097 162.864 -5.716  1.00 53.97  ? 474 ASN A O     1 
ATOM 4422  C CB    . ASN C 3 474 ? -22.684 161.301 -8.030  1.00 54.75  ? 474 ASN A CB    1 
ATOM 4423  C CG    . ASN C 3 474 ? -23.874 161.353 -8.971  1.00 57.09  ? 474 ASN A CG    1 
ATOM 4424  O OD1   . ASN C 3 474 ? -24.969 160.901 -8.624  1.00 58.03  ? 474 ASN A OD1   1 
ATOM 4425  N ND2   . ASN C 3 474 ? -23.662 161.871 -10.176 1.00 57.91  ? 474 ASN A ND2   1 
ATOM 4426  N N     . GLN C 3 475 ? -19.736 161.948 -7.247  1.00 54.34  ? 475 GLN A N     1 
ATOM 4427  C CA    . GLN C 3 475 ? -18.649 161.761 -6.323  1.00 55.58  ? 475 GLN A CA    1 
ATOM 4428  C C     . GLN C 3 475 ? -17.979 163.107 -6.091  1.00 54.52  ? 475 GLN A C     1 
ATOM 4429  O O     . GLN C 3 475 ? -17.956 163.611 -4.967  1.00 54.27  ? 475 GLN A O     1 
ATOM 4430  C CB    . GLN C 3 475 ? -17.668 160.712 -6.876  1.00 58.71  ? 475 GLN A CB    1 
ATOM 4431  C CG    . GLN C 3 475 ? -18.187 159.240 -6.820  1.00 61.62  ? 475 GLN A CG    1 
ATOM 4432  C CD    . GLN C 3 475 ? -18.499 158.613 -8.193  1.00 62.77  ? 475 GLN A CD    1 
ATOM 4433  O OE1   . GLN C 3 475 ? -19.643 158.635 -8.668  1.00 63.86  ? 475 GLN A OE1   1 
ATOM 4434  N NE2   . GLN C 3 475 ? -17.482 158.015 -8.810  1.00 61.29  ? 475 GLN A NE2   1 
ATOM 4435  N N     . LYS C 3 476 ? -17.496 163.720 -7.164  1.00 53.52  ? 476 LYS A N     1 
ATOM 4436  C CA    . LYS C 3 476 ? -16.836 165.009 -7.044  1.00 53.52  ? 476 LYS A CA    1 
ATOM 4437  C C     . LYS C 3 476 ? -17.739 165.962 -6.301  1.00 52.48  ? 476 LYS A C     1 
ATOM 4438  O O     . LYS C 3 476 ? -17.317 166.601 -5.342  1.00 52.28  ? 476 LYS A O     1 
ATOM 4439  C CB    . LYS C 3 476 ? -16.534 165.594 -8.412  1.00 54.80  ? 476 LYS A CB    1 
ATOM 4440  C CG    . LYS C 3 476 ? -15.582 164.780 -9.220  1.00 56.81  ? 476 LYS A CG    1 
ATOM 4441  C CD    . LYS C 3 476 ? -15.451 165.376 -10.594 1.00 60.36  ? 476 LYS A CD    1 
ATOM 4442  C CE    . LYS C 3 476 ? -15.003 164.335 -11.605 1.00 62.69  ? 476 LYS A CE    1 
ATOM 4443  N NZ    . LYS C 3 476 ? -15.207 164.784 -13.015 1.00 65.06  ? 476 LYS A NZ    1 
ATOM 4444  N N     . THR C 3 477 ? -19.002 165.998 -6.718  1.00 51.02  ? 477 THR A N     1 
ATOM 4445  C CA    . THR C 3 477 ? -19.993 166.876 -6.115  1.00 49.88  ? 477 THR A CA    1 
ATOM 4446  C C     . THR C 3 477 ? -19.948 166.772 -4.599  1.00 49.77  ? 477 THR A C     1 
ATOM 4447  O O     . THR C 3 477 ? -19.648 167.750 -3.908  1.00 49.55  ? 477 THR A O     1 
ATOM 4448  C CB    . THR C 3 477 ? -21.422 166.545 -6.595  1.00 48.08  ? 477 THR A CB    1 
ATOM 4449  O OG1   . THR C 3 477 ? -21.792 165.251 -6.126  1.00 46.51  ? 477 THR A OG1   1 
ATOM 4450  C CG2   . THR C 3 477 ? -21.502 166.550 -8.100  1.00 47.23  ? 477 THR A CG2   1 
ATOM 4451  N N     . GLU C 3 478 ? -20.188 165.567 -4.093  1.00 49.91  ? 478 GLU A N     1 
ATOM 4452  C CA    . GLU C 3 478 ? -20.178 165.329 -2.658  1.00 50.61  ? 478 GLU A CA    1 
ATOM 4453  C C     . GLU C 3 478 ? -18.843 165.738 -2.039  1.00 49.79  ? 478 GLU A C     1 
ATOM 4454  O O     . GLU C 3 478 ? -18.779 166.230 -0.908  1.00 49.41  ? 478 GLU A O     1 
ATOM 4455  C CB    . GLU C 3 478 ? -20.479 163.856 -2.367  1.00 52.42  ? 478 GLU A CB    1 
ATOM 4456  C CG    . GLU C 3 478 ? -21.974 163.490 -2.373  1.00 56.31  ? 478 GLU A CG    1 
ATOM 4457  C CD    . GLU C 3 478 ? -22.664 163.606 -0.990  1.00 58.65  ? 478 GLU A CD    1 
ATOM 4458  O OE1   . GLU C 3 478 ? -22.010 164.003 0.011   1.00 59.59  ? 478 GLU A OE1   1 
ATOM 4459  O OE2   . GLU C 3 478 ? -23.875 163.277 -0.906  1.00 57.37  ? 478 GLU A OE2   1 
ATOM 4460  N N     . LEU C 3 479 ? -17.775 165.579 -2.801  1.00 48.80  ? 479 LEU A N     1 
ATOM 4461  C CA    . LEU C 3 479 ? -16.478 165.936 -2.288  1.00 48.14  ? 479 LEU A CA    1 
ATOM 4462  C C     . LEU C 3 479 ? -16.327 167.447 -2.308  1.00 46.24  ? 479 LEU A C     1 
ATOM 4463  O O     . LEU C 3 479 ? -15.848 168.046 -1.353  1.00 44.85  ? 479 LEU A O     1 
ATOM 4464  C CB    . LEU C 3 479 ? -15.395 165.244 -3.107  1.00 50.43  ? 479 LEU A CB    1 
ATOM 4465  C CG    . LEU C 3 479 ? -13.998 165.196 -2.482  1.00 52.63  ? 479 LEU A CG    1 
ATOM 4466  C CD1   . LEU C 3 479 ? -14.034 165.335 -0.969  1.00 52.82  ? 479 LEU A CD1   1 
ATOM 4467  C CD2   . LEU C 3 479 ? -13.339 163.894 -2.872  1.00 54.21  ? 479 LEU A CD2   1 
ATOM 4468  N N     . GLN C 3 480 ? -16.791 168.059 -3.388  1.00 45.44  ? 480 GLN A N     1 
ATOM 4469  C CA    . GLN C 3 480 ? -16.731 169.504 -3.547  1.00 45.38  ? 480 GLN A CA    1 
ATOM 4470  C C     . GLN C 3 480 ? -17.512 170.199 -2.433  1.00 44.24  ? 480 GLN A C     1 
ATOM 4471  O O     . GLN C 3 480 ? -17.003 171.101 -1.753  1.00 42.42  ? 480 GLN A O     1 
ATOM 4472  C CB    . GLN C 3 480 ? -17.309 169.892 -4.913  1.00 46.35  ? 480 GLN A CB    1 
ATOM 4473  C CG    . GLN C 3 480 ? -17.511 171.383 -5.112  1.00 47.92  ? 480 GLN A CG    1 
ATOM 4474  C CD    . GLN C 3 480 ? -16.231 172.184 -4.919  1.00 49.49  ? 480 GLN A CD    1 
ATOM 4475  O OE1   . GLN C 3 480 ? -15.533 172.504 -5.888  1.00 49.91  ? 480 GLN A OE1   1 
ATOM 4476  N NE2   . GLN C 3 480 ? -15.919 172.516 -3.666  1.00 50.53  ? 480 GLN A NE2   1 
ATOM 4477  N N     . ALA C 3 481 ? -18.746 169.747 -2.243  1.00 42.97  ? 481 ALA A N     1 
ATOM 4478  C CA    . ALA C 3 481 ? -19.624 170.301 -1.230  1.00 41.96  ? 481 ALA A CA    1 
ATOM 4479  C C     . ALA C 3 481 ? -18.961 170.344 0.147   1.00 41.55  ? 481 ALA A C     1 
ATOM 4480  O O     . ALA C 3 481 ? -19.383 171.087 1.029   1.00 41.34  ? 481 ALA A O     1 
ATOM 4481  C CB    . ALA C 3 481 ? -20.907 169.522 -1.185  1.00 40.52  ? 481 ALA A CB    1 
ATOM 4482  N N     . ILE C 3 482 ? -17.921 169.547 0.341   1.00 41.36  ? 482 ILE A N     1 
ATOM 4483  C CA    . ILE C 3 482 ? -17.229 169.569 1.618   1.00 41.63  ? 482 ILE A CA    1 
ATOM 4484  C C     . ILE C 3 482 ? -16.515 170.910 1.684   1.00 40.98  ? 482 ILE A C     1 
ATOM 4485  O O     . ILE C 3 482 ? -16.709 171.682 2.617   1.00 40.39  ? 482 ILE A O     1 
ATOM 4486  C CB    . ILE C 3 482 ? -16.199 168.420 1.718   1.00 41.68  ? 482 ILE A CB    1 
ATOM 4487  C CG1   . ILE C 3 482 ? -16.913 167.064 1.642   1.00 41.78  ? 482 ILE A CG1   1 
ATOM 4488  C CG2   . ILE C 3 482 ? -15.401 168.526 3.011   1.00 40.02  ? 482 ILE A CG2   1 
ATOM 4489  C CD1   . ILE C 3 482 ? -17.787 166.743 2.850   1.00 39.52  ? 482 ILE A CD1   1 
ATOM 4490  N N     . TYR C 3 483 ? -15.798 171.215 0.613   1.00 40.99  ? 483 TYR A N     1 
ATOM 4491  C CA    . TYR C 3 483 ? -15.027 172.435 0.484   1.00 43.08  ? 483 TYR A CA    1 
ATOM 4492  C C     . TYR C 3 483 ? -15.673 173.700 1.041   1.00 44.29  ? 483 TYR A C     1 
ATOM 4493  O O     . TYR C 3 483 ? -15.029 174.470 1.765   1.00 45.72  ? 483 TYR A O     1 
ATOM 4494  C CB    . TYR C 3 483 ? -14.682 172.653 -0.985  1.00 44.65  ? 483 TYR A CB    1 
ATOM 4495  C CG    . TYR C 3 483 ? -13.663 173.738 -1.225  1.00 47.29  ? 483 TYR A CG    1 
ATOM 4496  C CD1   . TYR C 3 483 ? -12.838 174.190 -0.190  1.00 48.72  ? 483 TYR A CD1   1 
ATOM 4497  C CD2   . TYR C 3 483 ? -13.498 174.296 -2.491  1.00 49.46  ? 483 TYR A CD2   1 
ATOM 4498  C CE1   . TYR C 3 483 ? -11.874 175.169 -0.406  1.00 51.87  ? 483 TYR A CE1   1 
ATOM 4499  C CE2   . TYR C 3 483 ? -12.533 175.281 -2.724  1.00 52.80  ? 483 TYR A CE2   1 
ATOM 4500  C CZ    . TYR C 3 483 ? -11.719 175.713 -1.675  1.00 53.37  ? 483 TYR A CZ    1 
ATOM 4501  O OH    . TYR C 3 483 ? -10.754 176.684 -1.885  1.00 55.23  ? 483 TYR A OH    1 
ATOM 4502  N N     . LEU C 3 484 ? -16.934 173.927 0.684   1.00 44.61  ? 484 LEU A N     1 
ATOM 4503  C CA    . LEU C 3 484 ? -17.651 175.122 1.125   1.00 42.80  ? 484 LEU A CA    1 
ATOM 4504  C C     . LEU C 3 484 ? -17.655 175.251 2.618   1.00 41.42  ? 484 LEU A C     1 
ATOM 4505  O O     . LEU C 3 484 ? -16.849 175.986 3.175   1.00 39.94  ? 484 LEU A O     1 
ATOM 4506  C CB    . LEU C 3 484 ? -19.088 175.109 0.618   1.00 43.39  ? 484 LEU A CB    1 
ATOM 4507  C CG    . LEU C 3 484 ? -19.121 174.962 -0.898  1.00 44.56  ? 484 LEU A CG    1 
ATOM 4508  C CD1   . LEU C 3 484 ? -20.559 174.978 -1.378  1.00 43.89  ? 484 LEU A CD1   1 
ATOM 4509  C CD2   . LEU C 3 484 ? -18.287 176.071 -1.544  1.00 45.16  ? 484 LEU A CD2   1 
ATOM 4510  N N     . ALA C 3 485 ? -18.542 174.492 3.252   1.00 41.19  ? 485 ALA A N     1 
ATOM 4511  C CA    . ALA C 3 485 ? -18.696 174.491 4.699   1.00 42.05  ? 485 ALA A CA    1 
ATOM 4512  C C     . ALA C 3 485 ? -17.363 174.678 5.385   1.00 42.24  ? 485 ALA A C     1 
ATOM 4513  O O     . ALA C 3 485 ? -17.248 175.401 6.365   1.00 40.85  ? 485 ALA A O     1 
ATOM 4514  C CB    . ALA C 3 485 ? -19.326 173.198 5.145   1.00 42.00  ? 485 ALA A CB    1 
ATOM 4515  N N     . LEU C 3 486 ? -16.350 174.035 4.826   1.00 44.88  ? 486 LEU A N     1 
ATOM 4516  C CA    . LEU C 3 486 ? -15.005 174.118 5.351   1.00 48.31  ? 486 LEU A CA    1 
ATOM 4517  C C     . LEU C 3 486 ? -14.598 175.565 5.291   1.00 49.21  ? 486 LEU A C     1 
ATOM 4518  O O     . LEU C 3 486 ? -14.347 176.211 6.308   1.00 48.82  ? 486 LEU A O     1 
ATOM 4519  C CB    . LEU C 3 486 ? -14.059 173.323 4.457   1.00 50.66  ? 486 LEU A CB    1 
ATOM 4520  C CG    . LEU C 3 486 ? -14.289 171.821 4.335   1.00 53.52  ? 486 LEU A CG    1 
ATOM 4521  C CD1   . LEU C 3 486 ? -13.387 171.251 3.239   1.00 54.34  ? 486 LEU A CD1   1 
ATOM 4522  C CD2   . LEU C 3 486 ? -14.028 171.159 5.682   1.00 52.77  ? 486 LEU A CD2   1 
ATOM 4523  N N     . GLN C 3 487 ? -14.557 176.058 4.064   1.00 51.04  ? 487 GLN A N     1 
ATOM 4524  C CA    . GLN C 3 487 ? -14.184 177.420 3.772   1.00 52.62  ? 487 GLN A CA    1 
ATOM 4525  C C     . GLN C 3 487 ? -14.923 178.402 4.688   1.00 51.84  ? 487 GLN A C     1 
ATOM 4526  O O     . GLN C 3 487 ? -14.310 179.252 5.334   1.00 51.61  ? 487 GLN A O     1 
ATOM 4527  C CB    . GLN C 3 487 ? -14.492 177.693 2.301   1.00 54.81  ? 487 GLN A CB    1 
ATOM 4528  C CG    . GLN C 3 487 ? -13.694 178.830 1.710   1.00 61.06  ? 487 GLN A CG    1 
ATOM 4529  C CD    . GLN C 3 487 ? -13.482 178.675 0.212   1.00 63.97  ? 487 GLN A CD    1 
ATOM 4530  O OE1   . GLN C 3 487 ? -14.244 177.969 -0.471  1.00 64.87  ? 487 GLN A OE1   1 
ATOM 4531  N NE2   . GLN C 3 487 ? -12.433 179.325 -0.311  1.00 64.29  ? 487 GLN A NE2   1 
ATOM 4532  N N     . ASP C 3 488 ? -16.222 178.182 4.840   1.00 51.45  ? 488 ASP A N     1 
ATOM 4533  C CA    . ASP C 3 488 ? -17.074 179.044 5.650   1.00 50.99  ? 488 ASP A CA    1 
ATOM 4534  C C     . ASP C 3 488 ? -17.128 178.665 7.136   1.00 51.41  ? 488 ASP A C     1 
ATOM 4535  O O     . ASP C 3 488 ? -18.198 178.632 7.747   1.00 50.89  ? 488 ASP A O     1 
ATOM 4536  C CB    . ASP C 3 488 ? -18.472 179.061 5.022   1.00 50.89  ? 488 ASP A CB    1 
ATOM 4537  C CG    . ASP C 3 488 ? -18.429 179.258 3.495   1.00 51.80  ? 488 ASP A CG    1 
ATOM 4538  O OD1   . ASP C 3 488 ? -17.429 179.805 2.974   1.00 51.96  ? 488 ASP A OD1   1 
ATOM 4539  O OD2   . ASP C 3 488 ? -19.387 178.854 2.805   1.00 52.36  ? 488 ASP A OD2   1 
ATOM 4540  N N     . SER C 3 489 ? -15.961 178.380 7.709   1.00 52.70  ? 489 SER A N     1 
ATOM 4541  C CA    . SER C 3 489 ? -15.853 178.006 9.119   1.00 53.48  ? 489 SER A CA    1 
ATOM 4542  C C     . SER C 3 489 ? -15.003 179.063 9.803   1.00 53.94  ? 489 SER A C     1 
ATOM 4543  O O     . SER C 3 489 ? -15.122 180.240 9.474   1.00 54.22  ? 489 SER A O     1 
ATOM 4544  C CB    . SER C 3 489 ? -15.195 176.630 9.264   1.00 53.87  ? 489 SER A CB    1 
ATOM 4545  O OG    . SER C 3 489 ? -15.956 175.627 8.617   1.00 52.99  ? 489 SER A OG    1 
ATOM 4546  N N     . GLY C 3 490 ? -14.131 178.647 10.725  1.00 53.92  ? 490 GLY A N     1 
ATOM 4547  C CA    . GLY C 3 490 ? -13.277 179.598 11.421  1.00 54.22  ? 490 GLY A CA    1 
ATOM 4548  C C     . GLY C 3 490 ? -12.360 179.031 12.495  1.00 54.37  ? 490 GLY A C     1 
ATOM 4549  O O     . GLY C 3 490 ? -11.191 178.748 12.246  1.00 54.09  ? 490 GLY A O     1 
ATOM 4550  N N     . LEU C 3 491 ? -12.874 178.919 13.714  1.00 55.02  ? 491 LEU A N     1 
ATOM 4551  C CA    . LEU C 3 491 ? -12.094 178.387 14.826  1.00 54.81  ? 491 LEU A CA    1 
ATOM 4552  C C     . LEU C 3 491 ? -12.478 176.941 15.106  1.00 53.27  ? 491 LEU A C     1 
ATOM 4553  O O     . LEU C 3 491 ? -11.736 176.207 15.743  1.00 53.28  ? 491 LEU A O     1 
ATOM 4554  C CB    . LEU C 3 491 ? -12.287 179.249 16.092  1.00 57.23  ? 491 LEU A CB    1 
ATOM 4555  C CG    . LEU C 3 491 ? -13.657 179.454 16.781  1.00 59.21  ? 491 LEU A CG    1 
ATOM 4556  C CD1   . LEU C 3 491 ? -13.453 180.132 18.146  1.00 58.74  ? 491 LEU A CD1   1 
ATOM 4557  C CD2   . LEU C 3 491 ? -14.618 180.280 15.907  1.00 59.85  ? 491 LEU A CD2   1 
ATOM 4558  N N     . GLU C 3 492 ? -13.640 176.538 14.610  1.00 52.28  ? 492 GLU A N     1 
ATOM 4559  C CA    . GLU C 3 492 ? -14.144 175.190 14.810  1.00 52.68  ? 492 GLU A CA    1 
ATOM 4560  C C     . GLU C 3 492 ? -15.180 174.879 13.737  1.00 52.20  ? 492 GLU A C     1 
ATOM 4561  O O     . GLU C 3 492 ? -15.410 175.713 12.856  1.00 52.25  ? 492 GLU A O     1 
ATOM 4562  C CB    . GLU C 3 492 ? -14.789 175.091 16.195  1.00 54.16  ? 492 GLU A CB    1 
ATOM 4563  C CG    . GLU C 3 492 ? -13.805 174.830 17.331  1.00 58.05  ? 492 GLU A CG    1 
ATOM 4564  C CD    . GLU C 3 492 ? -13.865 175.861 18.449  1.00 58.68  ? 492 GLU A CD    1 
ATOM 4565  O OE1   . GLU C 3 492 ? -13.079 176.833 18.395  1.00 57.86  ? 492 GLU A OE1   1 
ATOM 4566  O OE2   . GLU C 3 492 ? -14.673 175.679 19.393  1.00 58.86  ? 492 GLU A OE2   1 
ATOM 4567  N N     . VAL C 3 493 ? -15.734 173.657 13.775  1.00 51.90  ? 493 VAL A N     1 
ATOM 4568  C CA    . VAL C 3 493 ? -16.797 173.195 12.848  1.00 50.62  ? 493 VAL A CA    1 
ATOM 4569  C C     . VAL C 3 493 ? -17.212 171.706 12.880  1.00 48.72  ? 493 VAL A C     1 
ATOM 4570  O O     . VAL C 3 493 ? -16.371 170.798 12.839  1.00 49.56  ? 493 VAL A O     1 
ATOM 4571  C CB    . VAL C 3 493 ? -16.561 173.620 11.357  1.00 50.35  ? 493 VAL A CB    1 
ATOM 4572  C CG1   . VAL C 3 493 ? -15.264 173.036 10.810  1.00 51.49  ? 493 VAL A CG1   1 
ATOM 4573  C CG2   . VAL C 3 493 ? -17.759 173.208 10.497  1.00 49.94  ? 493 VAL A CG2   1 
ATOM 4574  N N     . ASN C 3 494 ? -18.525 171.486 12.962  1.00 45.60  ? 494 ASN A N     1 
ATOM 4575  C CA    . ASN C 3 494 ? -19.124 170.151 12.968  1.00 42.66  ? 494 ASN A CA    1 
ATOM 4576  C C     . ASN C 3 494 ? -19.705 169.931 11.591  1.00 40.82  ? 494 ASN A C     1 
ATOM 4577  O O     . ASN C 3 494 ? -20.754 170.479 11.262  1.00 41.92  ? 494 ASN A O     1 
ATOM 4578  C CB    . ASN C 3 494 ? -20.259 170.068 13.978  1.00 43.40  ? 494 ASN A CB    1 
ATOM 4579  C CG    . ASN C 3 494 ? -19.799 169.618 15.339  1.00 44.19  ? 494 ASN A CG    1 
ATOM 4580  O OD1   . ASN C 3 494 ? -18.867 170.181 15.930  1.00 42.99  ? 494 ASN A OD1   1 
ATOM 4581  N ND2   . ASN C 3 494 ? -20.469 168.599 15.864  1.00 45.45  ? 494 ASN A ND2   1 
ATOM 4582  N N     . ILE C 3 495 ? -19.030 169.122 10.790  1.00 37.71  ? 495 ILE A N     1 
ATOM 4583  C CA    . ILE C 3 495 ? -19.475 168.858 9.434   1.00 35.69  ? 495 ILE A CA    1 
ATOM 4584  C C     . ILE C 3 495 ? -20.264 167.581 9.344   1.00 35.88  ? 495 ILE A C     1 
ATOM 4585  O O     . ILE C 3 495 ? -20.013 166.645 10.088  1.00 35.80  ? 495 ILE A O     1 
ATOM 4586  C CB    . ILE C 3 495 ? -18.285 168.751 8.524   1.00 34.39  ? 495 ILE A CB    1 
ATOM 4587  C CG1   . ILE C 3 495 ? -17.425 169.995 8.716   1.00 33.00  ? 495 ILE A CG1   1 
ATOM 4588  C CG2   . ILE C 3 495 ? -18.738 168.557 7.086   1.00 33.28  ? 495 ILE A CG2   1 
ATOM 4589  C CD1   . ILE C 3 495 ? -16.084 169.907 8.096   1.00 32.61  ? 495 ILE A CD1   1 
ATOM 4590  N N     . VAL C 3 496 ? -21.212 167.530 8.422   1.00 36.28  ? 496 VAL A N     1 
ATOM 4591  C CA    . VAL C 3 496 ? -22.004 166.322 8.282   1.00 37.22  ? 496 VAL A CA    1 
ATOM 4592  C C     . VAL C 3 496 ? -22.184 165.865 6.840   1.00 38.72  ? 496 VAL A C     1 
ATOM 4593  O O     . VAL C 3 496 ? -22.817 166.563 6.023   1.00 38.13  ? 496 VAL A O     1 
ATOM 4594  C CB    . VAL C 3 496 ? -23.379 166.459 8.975   1.00 36.81  ? 496 VAL A CB    1 
ATOM 4595  C CG1   . VAL C 3 496 ? -24.291 165.288 8.596   1.00 36.36  ? 496 VAL A CG1   1 
ATOM 4596  C CG2   . VAL C 3 496 ? -23.191 166.507 10.491  1.00 36.99  ? 496 VAL A CG2   1 
ATOM 4597  N N     . THR C 3 497 ? -21.614 164.690 6.541   1.00 38.06  ? 497 THR A N     1 
ATOM 4598  C CA    . THR C 3 497 ? -21.708 164.092 5.209   1.00 35.18  ? 497 THR A CA    1 
ATOM 4599  C C     . THR C 3 497 ? -22.349 162.714 5.259   1.00 35.76  ? 497 THR A C     1 
ATOM 4600  O O     . THR C 3 497 ? -22.530 162.116 6.330   1.00 33.81  ? 497 THR A O     1 
ATOM 4601  C CB    . THR C 3 497 ? -20.335 163.924 4.516   1.00 32.71  ? 497 THR A CB    1 
ATOM 4602  O OG1   . THR C 3 497 ? -19.387 164.851 5.056   1.00 30.21  ? 497 THR A OG1   1 
ATOM 4603  C CG2   . THR C 3 497 ? -20.481 164.177 3.017   1.00 30.68  ? 497 THR A CG2   1 
ATOM 4604  N N     . ASP C 3 498 ? -22.726 162.248 4.077   1.00 36.77  ? 498 ASP A N     1 
ATOM 4605  C CA    . ASP C 3 498 ? -23.321 160.937 3.905   1.00 39.13  ? 498 ASP A CA    1 
ATOM 4606  C C     . ASP C 3 498 ? -22.449 160.130 2.928   1.00 41.07  ? 498 ASP A C     1 
ATOM 4607  O O     . ASP C 3 498 ? -22.644 158.922 2.744   1.00 41.43  ? 498 ASP A O     1 
ATOM 4608  C CB    . ASP C 3 498 ? -24.763 161.057 3.393   1.00 38.73  ? 498 ASP A CB    1 
ATOM 4609  C CG    . ASP C 3 498 ? -24.865 161.793 2.070   1.00 39.73  ? 498 ASP A CG    1 
ATOM 4610  O OD1   . ASP C 3 498 ? -25.755 161.427 1.268   1.00 39.95  ? 498 ASP A OD1   1 
ATOM 4611  O OD2   . ASP C 3 498 ? -24.074 162.740 1.842   1.00 38.06  ? 498 ASP A OD2   1 
ATOM 4612  N N     . SER C 3 499 ? -21.471 160.806 2.325   1.00 41.91  ? 499 SER A N     1 
ATOM 4613  C CA    . SER C 3 499 ? -20.562 160.170 1.379   1.00 43.13  ? 499 SER A CA    1 
ATOM 4614  C C     . SER C 3 499 ? -19.271 159.657 2.000   1.00 44.31  ? 499 SER A C     1 
ATOM 4615  O O     . SER C 3 499 ? -18.326 160.422 2.263   1.00 43.78  ? 499 SER A O     1 
ATOM 4616  C CB    . SER C 3 499 ? -20.212 161.106 0.230   1.00 43.27  ? 499 SER A CB    1 
ATOM 4617  O OG    . SER C 3 499 ? -19.074 160.616 -0.467  1.00 44.77  ? 499 SER A OG    1 
ATOM 4618  N N     . GLN C 3 500 ? -19.214 158.337 2.129   1.00 44.74  ? 500 GLN A N     1 
ATOM 4619  C CA    . GLN C 3 500 ? -18.061 157.652 2.680   1.00 42.99  ? 500 GLN A CA    1 
ATOM 4620  C C     . GLN C 3 500 ? -16.807 158.100 1.923   1.00 40.83  ? 500 GLN A C     1 
ATOM 4621  O O     . GLN C 3 500 ? -15.855 158.602 2.518   1.00 37.22  ? 500 GLN A O     1 
ATOM 4622  C CB    . GLN C 3 500 ? -18.271 156.145 2.519   1.00 44.89  ? 500 GLN A CB    1 
ATOM 4623  C CG    . GLN C 3 500 ? -17.835 155.310 3.720   1.00 49.68  ? 500 GLN A CG    1 
ATOM 4624  C CD    . GLN C 3 500 ? -18.775 154.133 3.990   1.00 52.62  ? 500 GLN A CD    1 
ATOM 4625  O OE1   . GLN C 3 500 ? -18.596 153.380 4.962   1.00 53.31  ? 500 GLN A OE1   1 
ATOM 4626  N NE2   . GLN C 3 500 ? -19.797 153.982 3.136   1.00 52.69  ? 500 GLN A NE2   1 
ATOM 4627  N N     . TYR C 3 501 ? -16.884 158.018 0.597   1.00 38.97  ? 501 TYR A N     1 
ATOM 4628  C CA    . TYR C 3 501 ? -15.777 158.370 -0.289  1.00 38.97  ? 501 TYR A CA    1 
ATOM 4629  C C     . TYR C 3 501 ? -14.933 159.548 0.152   1.00 36.70  ? 501 TYR A C     1 
ATOM 4630  O O     . TYR C 3 501 ? -13.754 159.411 0.489   1.00 34.54  ? 501 TYR A O     1 
ATOM 4631  C CB    . TYR C 3 501 ? -16.289 158.645 -1.697  1.00 40.64  ? 501 TYR A CB    1 
ATOM 4632  C CG    . TYR C 3 501 ? -15.216 159.195 -2.616  1.00 44.57  ? 501 TYR A CG    1 
ATOM 4633  C CD1   . TYR C 3 501 ? -14.136 158.405 -3.015  1.00 44.72  ? 501 TYR A CD1   1 
ATOM 4634  C CD2   . TYR C 3 501 ? -15.307 160.487 -3.125  1.00 45.35  ? 501 TYR A CD2   1 
ATOM 4635  C CE1   . TYR C 3 501 ? -13.184 158.885 -3.903  1.00 46.11  ? 501 TYR A CE1   1 
ATOM 4636  C CE2   . TYR C 3 501 ? -14.362 160.977 -4.013  1.00 46.53  ? 501 TYR A CE2   1 
ATOM 4637  C CZ    . TYR C 3 501 ? -13.307 160.173 -4.399  1.00 47.20  ? 501 TYR A CZ    1 
ATOM 4638  O OH    . TYR C 3 501 ? -12.372 160.662 -5.276  1.00 48.20  ? 501 TYR A OH    1 
ATOM 4639  N N     . ALA C 3 502 ? -15.533 160.721 0.041   1.00 35.83  ? 502 ALA A N     1 
ATOM 4640  C CA    . ALA C 3 502 ? -14.876 161.947 0.428   1.00 34.58  ? 502 ALA A CA    1 
ATOM 4641  C C     . ALA C 3 502 ? -14.462 161.734 1.859   1.00 32.44  ? 502 ALA A C     1 
ATOM 4642  O O     . ALA C 3 502 ? -13.272 161.767 2.178   1.00 29.96  ? 502 ALA A O     1 
ATOM 4643  C CB    . ALA C 3 502 ? -15.854 163.099 0.342   1.00 34.63  ? 502 ALA A CB    1 
ATOM 4644  N N     . LEU C 3 503 ? -15.463 161.379 2.668   1.00 30.77  ? 503 LEU A N     1 
ATOM 4645  C CA    . LEU C 3 503 ? -15.298 161.144 4.091   1.00 29.89  ? 503 LEU A CA    1 
ATOM 4646  C C     . LEU C 3 503 ? -14.005 160.432 4.315   1.00 28.98  ? 503 LEU A C     1 
ATOM 4647  O O     . LEU C 3 503 ? -13.132 160.894 5.051   1.00 29.43  ? 503 LEU A O     1 
ATOM 4648  C CB    . LEU C 3 503 ? -16.458 160.311 4.633   1.00 31.76  ? 503 LEU A CB    1 
ATOM 4649  C CG    . LEU C 3 503 ? -16.261 159.664 6.009   1.00 34.00  ? 503 LEU A CG    1 
ATOM 4650  C CD1   . LEU C 3 503 ? -17.533 159.713 6.832   1.00 33.36  ? 503 LEU A CD1   1 
ATOM 4651  C CD2   . LEU C 3 503 ? -15.794 158.230 5.833   1.00 35.84  ? 503 LEU A CD2   1 
ATOM 4652  N N     . GLY C 3 504 ? -13.849 159.339 3.594   1.00 27.13  ? 504 GLY A N     1 
ATOM 4653  C CA    . GLY C 3 504 ? -12.634 158.582 3.728   1.00 27.31  ? 504 GLY A CA    1 
ATOM 4654  C C     . GLY C 3 504 ? -11.418 159.360 3.265   1.00 25.68  ? 504 GLY A C     1 
ATOM 4655  O O     . GLY C 3 504 ? -10.496 159.598 4.058   1.00 24.78  ? 504 GLY A O     1 
ATOM 4656  N N     . ILE C 3 505 ? -11.447 159.818 2.013   1.00 23.03  ? 505 ILE A N     1 
ATOM 4657  C CA    . ILE C 3 505 ? -10.313 160.528 1.462   1.00 20.57  ? 505 ILE A CA    1 
ATOM 4658  C C     . ILE C 3 505 ? -9.750  161.515 2.454   1.00 22.36  ? 505 ILE A C     1 
ATOM 4659  O O     . ILE C 3 505 ? -8.550  161.711 2.519   1.00 22.68  ? 505 ILE A O     1 
ATOM 4660  C CB    . ILE C 3 505 ? -10.648 161.262 0.179   1.00 17.56  ? 505 ILE A CB    1 
ATOM 4661  C CG1   . ILE C 3 505 ? -11.453 160.371 -0.761  1.00 14.28  ? 505 ILE A CG1   1 
ATOM 4662  C CG2   . ILE C 3 505 ? -9.355  161.678 -0.499  1.00 16.30  ? 505 ILE A CG2   1 
ATOM 4663  C CD1   . ILE C 3 505 ? -11.377 160.817 -2.175  1.00 10.56  ? 505 ILE A CD1   1 
ATOM 4664  N N     . ILE C 3 506 ? -10.610 162.045 3.310   1.00 24.59  ? 506 ILE A N     1 
ATOM 4665  C CA    . ILE C 3 506 ? -10.164 163.009 4.302   1.00 27.04  ? 506 ILE A CA    1 
ATOM 4666  C C     . ILE C 3 506 ? -9.549  162.335 5.529   1.00 28.35  ? 506 ILE A C     1 
ATOM 4667  O O     . ILE C 3 506 ? -8.415  162.621 5.895   1.00 28.61  ? 506 ILE A O     1 
ATOM 4668  C CB    . ILE C 3 506 ? -11.320 163.929 4.760   1.00 27.35  ? 506 ILE A CB    1 
ATOM 4669  C CG1   . ILE C 3 506 ? -12.413 164.014 3.684   1.00 27.58  ? 506 ILE A CG1   1 
ATOM 4670  C CG2   . ILE C 3 506 ? -10.779 165.315 5.101   1.00 26.41  ? 506 ILE A CG2   1 
ATOM 4671  C CD1   . ILE C 3 506 ? -11.918 164.343 2.291   1.00 27.56  ? 506 ILE A CD1   1 
ATOM 4672  N N     . GLN C 3 507 ? -10.297 161.427 6.143   1.00 30.12  ? 507 GLN A N     1 
ATOM 4673  C CA    . GLN C 3 507 ? -9.864  160.703 7.344   1.00 33.82  ? 507 GLN A CA    1 
ATOM 4674  C C     . GLN C 3 507 ? -8.381  160.289 7.360   1.00 34.05  ? 507 GLN A C     1 
ATOM 4675  O O     . GLN C 3 507 ? -7.684  160.423 8.382   1.00 33.15  ? 507 GLN A O     1 
ATOM 4676  C CB    . GLN C 3 507 ? -10.729 159.453 7.485   1.00 37.55  ? 507 GLN A CB    1 
ATOM 4677  C CG    . GLN C 3 507 ? -11.310 159.207 8.865   1.00 43.82  ? 507 GLN A CG    1 
ATOM 4678  C CD    . GLN C 3 507 ? -12.682 158.516 8.787   1.00 48.45  ? 507 GLN A CD    1 
ATOM 4679  O OE1   . GLN C 3 507 ? -13.404 158.659 7.789   1.00 49.38  ? 507 GLN A OE1   1 
ATOM 4680  N NE2   . GLN C 3 507 ? -13.049 157.776 9.842   1.00 51.48  ? 507 GLN A NE2   1 
ATOM 4681  N N     . ALA C 3 508 ? -7.930  159.787 6.206   1.00 33.66  ? 508 ALA A N     1 
ATOM 4682  C CA    . ALA C 3 508 ? -6.569  159.304 5.973   1.00 31.60  ? 508 ALA A CA    1 
ATOM 4683  C C     . ALA C 3 508 ? -5.549  160.288 6.442   1.00 31.35  ? 508 ALA A C     1 
ATOM 4684  O O     . ALA C 3 508 ? -4.457  159.922 6.852   1.00 30.35  ? 508 ALA A O     1 
ATOM 4685  C CB    . ALA C 3 508 ? -6.363  159.072 4.495   1.00 31.31  ? 508 ALA A CB    1 
ATOM 4686  N N     . GLN C 3 509 ? -5.939  161.550 6.379   1.00 32.15  ? 509 GLN A N     1 
ATOM 4687  C CA    . GLN C 3 509 ? -5.078  162.651 6.745   1.00 33.09  ? 509 GLN A CA    1 
ATOM 4688  C C     . GLN C 3 509 ? -4.055  162.809 5.618   1.00 34.13  ? 509 GLN A C     1 
ATOM 4689  O O     . GLN C 3 509 ? -2.876  162.548 5.819   1.00 33.27  ? 509 GLN A O     1 
ATOM 4690  C CB    . GLN C 3 509 ? -4.373  162.363 8.069   1.00 30.75  ? 509 GLN A CB    1 
ATOM 4691  C CG    . GLN C 3 509 ? -5.300  162.004 9.196   1.00 28.93  ? 509 GLN A CG    1 
ATOM 4692  C CD    . GLN C 3 509 ? -4.588  162.067 10.512  1.00 30.18  ? 509 GLN A CD    1 
ATOM 4693  O OE1   . GLN C 3 509 ? -3.422  162.460 10.571  1.00 31.00  ? 509 GLN A OE1   1 
ATOM 4694  N NE2   . GLN C 3 509 ? -5.276  161.696 11.584  1.00 31.01  ? 509 GLN A NE2   1 
ATOM 4695  N N     . PRO C 3 510 ? -4.518  163.186 4.404   1.00 35.43  ? 510 PRO A N     1 
ATOM 4696  C CA    . PRO C 3 510 ? -3.735  163.399 3.175   1.00 37.87  ? 510 PRO A CA    1 
ATOM 4697  C C     . PRO C 3 510 ? -2.890  164.666 3.080   1.00 39.29  ? 510 PRO A C     1 
ATOM 4698  O O     . PRO C 3 510 ? -3.419  165.773 3.149   1.00 40.16  ? 510 PRO A O     1 
ATOM 4699  C CB    . PRO C 3 510 ? -4.812  163.419 2.094   1.00 37.61  ? 510 PRO A CB    1 
ATOM 4700  C CG    . PRO C 3 510 ? -5.895  162.587 2.685   1.00 37.34  ? 510 PRO A CG    1 
ATOM 4701  C CD    . PRO C 3 510 ? -5.948  163.121 4.063   1.00 35.66  ? 510 PRO A CD    1 
ATOM 4702  N N     . ASP C 3 511 ? -1.595  164.489 2.817   1.00 40.56  ? 511 ASP A N     1 
ATOM 4703  C CA    . ASP C 3 511 ? -0.661  165.600 2.692   1.00 40.65  ? 511 ASP A CA    1 
ATOM 4704  C C     . ASP C 3 511 ? -0.701  166.206 1.301   1.00 40.71  ? 511 ASP A C     1 
ATOM 4705  O O     . ASP C 3 511 ? -0.243  167.323 1.097   1.00 41.88  ? 511 ASP A O     1 
ATOM 4706  C CB    . ASP C 3 511 ? 0.761   165.155 2.996   1.00 42.70  ? 511 ASP A CB    1 
ATOM 4707  C CG    . ASP C 3 511 ? 1.744   166.298 2.923   1.00 44.26  ? 511 ASP A CG    1 
ATOM 4708  O OD1   . ASP C 3 511 ? 2.192   166.635 1.807   1.00 46.59  ? 511 ASP A OD1   1 
ATOM 4709  O OD2   . ASP C 3 511 ? 2.047   166.888 3.976   1.00 45.60  ? 511 ASP A OD2   1 
ATOM 4710  N N     . LYS C 3 512 ? -1.175  165.441 0.328   1.00 40.51  ? 512 LYS A N     1 
ATOM 4711  C CA    . LYS C 3 512 ? -1.277  165.952 -1.034  1.00 41.53  ? 512 LYS A CA    1 
ATOM 4712  C C     . LYS C 3 512 ? -2.284  165.162 -1.850  1.00 41.59  ? 512 LYS A C     1 
ATOM 4713  O O     . LYS C 3 512 ? -3.088  164.424 -1.285  1.00 41.49  ? 512 LYS A O     1 
ATOM 4714  C CB    . LYS C 3 512 ? 0.095   166.006 -1.714  1.00 42.50  ? 512 LYS A CB    1 
ATOM 4715  C CG    . LYS C 3 512 ? 1.156   165.136 -1.066  1.00 44.27  ? 512 LYS A CG    1 
ATOM 4716  C CD    . LYS C 3 512 ? 2.548   165.736 -1.238  1.00 46.72  ? 512 LYS A CD    1 
ATOM 4717  C CE    . LYS C 3 512 ? 3.629   164.800 -0.701  1.00 48.66  ? 512 LYS A CE    1 
ATOM 4718  N NZ    . LYS C 3 512 ? 3.316   164.292 0.674   1.00 49.75  ? 512 LYS A NZ    1 
ATOM 4719  N N     . SER C 3 513 ? -2.271  165.358 -3.164  1.00 42.32  ? 513 SER A N     1 
ATOM 4720  C CA    . SER C 3 513 ? -3.189  164.680 -4.079  1.00 45.36  ? 513 SER A CA    1 
ATOM 4721  C C     . SER C 3 513 ? -3.103  165.386 -5.418  1.00 48.67  ? 513 SER A C     1 
ATOM 4722  O O     . SER C 3 513 ? -3.148  166.611 -5.462  1.00 50.13  ? 513 SER A O     1 
ATOM 4723  C CB    . SER C 3 513 ? -4.631  164.777 -3.575  1.00 43.42  ? 513 SER A CB    1 
ATOM 4724  O OG    . SER C 3 513 ? -5.528  164.240 -4.526  1.00 42.13  ? 513 SER A OG    1 
ATOM 4725  N N     . GLU C 3 514 ? -3.022  164.633 -6.513  1.00 52.30  ? 514 GLU A N     1 
ATOM 4726  C CA    . GLU C 3 514 ? -2.939  165.257 -7.832  1.00 56.39  ? 514 GLU A CA    1 
ATOM 4727  C C     . GLU C 3 514 ? -4.150  166.162 -8.005  1.00 57.78  ? 514 GLU A C     1 
ATOM 4728  O O     . GLU C 3 514 ? -4.082  167.168 -8.712  1.00 58.68  ? 514 GLU A O     1 
ATOM 4729  C CB    . GLU C 3 514 ? -2.911  164.203 -8.952  1.00 59.52  ? 514 GLU A CB    1 
ATOM 4730  C CG    . GLU C 3 514 ? -2.410  164.705 -10.349 1.00 63.14  ? 514 GLU A CG    1 
ATOM 4731  C CD    . GLU C 3 514 ? -3.433  165.537 -11.170 1.00 64.65  ? 514 GLU A CD    1 
ATOM 4732  O OE1   . GLU C 3 514 ? -4.663  165.423 -10.934 1.00 66.06  ? 514 GLU A OE1   1 
ATOM 4733  O OE2   . GLU C 3 514 ? -2.995  166.294 -12.074 1.00 63.69  ? 514 GLU A OE2   1 
ATOM 4734  N N     . SER C 3 515 ? -5.250  165.814 -7.341  1.00 58.81  ? 515 SER A N     1 
ATOM 4735  C CA    . SER C 3 515 ? -6.467  166.613 -7.434  1.00 59.90  ? 515 SER A CA    1 
ATOM 4736  C C     . SER C 3 515 ? -6.435  167.884 -6.599  1.00 58.63  ? 515 SER A C     1 
ATOM 4737  O O     . SER C 3 515 ? -6.163  167.866 -5.398  1.00 57.24  ? 515 SER A O     1 
ATOM 4738  C CB    . SER C 3 515 ? -7.702  165.782 -7.095  1.00 62.32  ? 515 SER A CB    1 
ATOM 4739  O OG    . SER C 3 515 ? -7.950  164.820 -8.107  1.00 66.08  ? 515 SER A OG    1 
ATOM 4740  N N     . GLU C 3 516 ? -6.707  168.988 -7.281  1.00 58.34  ? 516 GLU A N     1 
ATOM 4741  C CA    . GLU C 3 516 ? -6.736  170.315 -6.691  1.00 58.59  ? 516 GLU A CA    1 
ATOM 4742  C C     . GLU C 3 516 ? -7.718  170.400 -5.539  1.00 57.01  ? 516 GLU A C     1 
ATOM 4743  O O     . GLU C 3 516 ? -7.345  170.713 -4.408  1.00 55.97  ? 516 GLU A O     1 
ATOM 4744  C CB    . GLU C 3 516 ? -7.148  171.326 -7.763  1.00 60.52  ? 516 GLU A CB    1 
ATOM 4745  C CG    . GLU C 3 516 ? -6.004  171.857 -8.577  1.00 63.50  ? 516 GLU A CG    1 
ATOM 4746  C CD    . GLU C 3 516 ? -5.047  172.653 -7.717  1.00 66.03  ? 516 GLU A CD    1 
ATOM 4747  O OE1   . GLU C 3 516 ? -5.414  173.778 -7.300  1.00 67.80  ? 516 GLU A OE1   1 
ATOM 4748  O OE2   . GLU C 3 516 ? -3.943  172.139 -7.433  1.00 67.04  ? 516 GLU A OE2   1 
ATOM 4749  N N     . LEU C 3 517 ? -8.977  170.117 -5.868  1.00 55.91  ? 517 LEU A N     1 
ATOM 4750  C CA    . LEU C 3 517 ? -10.110 170.153 -4.952  1.00 54.09  ? 517 LEU A CA    1 
ATOM 4751  C C     . LEU C 3 517 ? -9.760  169.613 -3.576  1.00 54.19  ? 517 LEU A C     1 
ATOM 4752  O O     . LEU C 3 517 ? -9.690  170.361 -2.593  1.00 52.35  ? 517 LEU A O     1 
ATOM 4753  C CB    . LEU C 3 517 ? -11.262 169.349 -5.563  1.00 52.39  ? 517 LEU A CB    1 
ATOM 4754  C CG    . LEU C 3 517 ? -12.673 169.529 -5.005  1.00 51.74  ? 517 LEU A CG    1 
ATOM 4755  C CD1   . LEU C 3 517 ? -12.871 168.802 -3.682  1.00 50.82  ? 517 LEU A CD1   1 
ATOM 4756  C CD2   . LEU C 3 517 ? -12.942 171.010 -4.865  1.00 51.53  ? 517 LEU A CD2   1 
ATOM 4757  N N     . VAL C 3 518 ? -9.534  168.301 -3.535  1.00 55.58  ? 518 VAL A N     1 
ATOM 4758  C CA    . VAL C 3 518 ? -9.176  167.582 -2.314  1.00 56.79  ? 518 VAL A CA    1 
ATOM 4759  C C     . VAL C 3 518 ? -7.865  168.093 -1.737  1.00 56.35  ? 518 VAL A C     1 
ATOM 4760  O O     . VAL C 3 518 ? -7.654  168.071 -0.525  1.00 55.52  ? 518 VAL A O     1 
ATOM 4761  C CB    . VAL C 3 518 ? -9.070  166.051 -2.550  1.00 57.40  ? 518 VAL A CB    1 
ATOM 4762  C CG1   . VAL C 3 518 ? -10.206 165.338 -1.831  1.00 58.00  ? 518 VAL A CG1   1 
ATOM 4763  C CG2   . VAL C 3 518 ? -9.103  165.726 -4.038  1.00 56.39  ? 518 VAL A CG2   1 
ATOM 4764  N N     . ASN C 3 519 ? -6.981  168.546 -2.614  1.00 56.16  ? 519 ASN A N     1 
ATOM 4765  C CA    . ASN C 3 519 ? -5.729  169.085 -2.155  1.00 55.86  ? 519 ASN A CA    1 
ATOM 4766  C C     . ASN C 3 519 ? -6.093  170.355 -1.400  1.00 55.27  ? 519 ASN A C     1 
ATOM 4767  O O     . ASN C 3 519 ? -5.573  170.619 -0.318  1.00 54.77  ? 519 ASN A O     1 
ATOM 4768  C CB    . ASN C 3 519 ? -4.819  169.407 -3.329  1.00 57.17  ? 519 ASN A CB    1 
ATOM 4769  C CG    . ASN C 3 519 ? -3.378  169.528 -2.912  1.00 59.73  ? 519 ASN A CG    1 
ATOM 4770  O OD1   . ASN C 3 519 ? -3.077  169.835 -1.755  1.00 61.87  ? 519 ASN A OD1   1 
ATOM 4771  N ND2   . ASN C 3 519 ? -2.471  169.260 -3.838  1.00 61.13  ? 519 ASN A ND2   1 
ATOM 4772  N N     . GLN C 3 520 ? -7.037  171.106 -1.957  1.00 54.00  ? 520 GLN A N     1 
ATOM 4773  C CA    . GLN C 3 520 ? -7.491  172.334 -1.339  1.00 53.80  ? 520 GLN A CA    1 
ATOM 4774  C C     . GLN C 3 520 ? -8.143  172.019 -0.005  1.00 52.40  ? 520 GLN A C     1 
ATOM 4775  O O     . GLN C 3 520 ? -7.725  172.546 1.022   1.00 52.03  ? 520 GLN A O     1 
ATOM 4776  C CB    . GLN C 3 520 ? -8.449  173.071 -2.269  1.00 55.47  ? 520 GLN A CB    1 
ATOM 4777  C CG    . GLN C 3 520 ? -7.771  173.516 -3.566  1.00 60.62  ? 520 GLN A CG    1 
ATOM 4778  C CD    . GLN C 3 520 ? -8.675  174.338 -4.481  1.00 62.19  ? 520 GLN A CD    1 
ATOM 4779  O OE1   . GLN C 3 520 ? -9.367  175.254 -4.032  1.00 63.06  ? 520 GLN A OE1   1 
ATOM 4780  N NE2   . GLN C 3 520 ? -8.653  174.024 -5.777  1.00 62.71  ? 520 GLN A NE2   1 
ATOM 4781  N N     . ILE C 3 521 ? -9.090  171.084 -0.012  1.00 51.47  ? 521 ILE A N     1 
ATOM 4782  C CA    . ILE C 3 521 ? -9.799  170.669 1.206   1.00 50.84  ? 521 ILE A CA    1 
ATOM 4783  C C     . ILE C 3 521 ? -8.842  170.422 2.364   1.00 50.69  ? 521 ILE A C     1 
ATOM 4784  O O     . ILE C 3 521 ? -9.190  170.555 3.535   1.00 50.51  ? 521 ILE A O     1 
ATOM 4785  C CB    . ILE C 3 521 ? -10.620 169.383 0.959   1.00 49.27  ? 521 ILE A CB    1 
ATOM 4786  C CG1   . ILE C 3 521 ? -11.768 169.689 -0.002  1.00 49.60  ? 521 ILE A CG1   1 
ATOM 4787  C CG2   . ILE C 3 521 ? -11.138 168.800 2.275   1.00 48.86  ? 521 ILE A CG2   1 
ATOM 4788  C CD1   . ILE C 3 521 ? -12.734 168.557 -0.202  1.00 50.32  ? 521 ILE A CD1   1 
ATOM 4789  N N     . ILE C 3 522 ? -7.618  170.078 2.018   1.00 51.60  ? 522 ILE A N     1 
ATOM 4790  C CA    . ILE C 3 522 ? -6.608  169.816 3.012   1.00 53.24  ? 522 ILE A CA    1 
ATOM 4791  C C     . ILE C 3 522 ? -6.221  171.110 3.724   1.00 53.29  ? 522 ILE A C     1 
ATOM 4792  O O     . ILE C 3 522 ? -6.398  171.244 4.932   1.00 51.74  ? 522 ILE A O     1 
ATOM 4793  C CB    . ILE C 3 522 ? -5.366  169.198 2.342   1.00 54.29  ? 522 ILE A CB    1 
ATOM 4794  C CG1   . ILE C 3 522 ? -5.778  167.990 1.495   1.00 52.83  ? 522 ILE A CG1   1 
ATOM 4795  C CG2   . ILE C 3 522 ? -4.362  168.770 3.395   1.00 56.37  ? 522 ILE A CG2   1 
ATOM 4796  C CD1   . ILE C 3 522 ? -4.686  167.442 0.625   1.00 51.97  ? 522 ILE A CD1   1 
ATOM 4797  N N     . GLU C 3 523 ? -5.719  172.061 2.943   1.00 54.76  ? 523 GLU A N     1 
ATOM 4798  C CA    . GLU C 3 523 ? -5.266  173.356 3.435   1.00 56.93  ? 523 GLU A CA    1 
ATOM 4799  C C     . GLU C 3 523 ? -6.179  174.061 4.413   1.00 55.45  ? 523 GLU A C     1 
ATOM 4800  O O     . GLU C 3 523 ? -5.705  174.769 5.300   1.00 54.28  ? 523 GLU A O     1 
ATOM 4801  C CB    . GLU C 3 523 ? -4.953  174.283 2.265   1.00 60.94  ? 523 GLU A CB    1 
ATOM 4802  C CG    . GLU C 3 523 ? -3.607  173.996 1.591   1.00 68.76  ? 523 GLU A CG    1 
ATOM 4803  C CD    . GLU C 3 523 ? -2.404  174.635 2.310   1.00 73.59  ? 523 GLU A CD    1 
ATOM 4804  O OE1   . GLU C 3 523 ? -2.525  174.997 3.508   1.00 77.05  ? 523 GLU A OE1   1 
ATOM 4805  O OE2   . GLU C 3 523 ? -1.335  174.784 1.663   1.00 76.63  ? 523 GLU A OE2   1 
ATOM 4806  N N     . GLN C 3 524 ? -7.484  173.890 4.228   1.00 54.72  ? 524 GLN A N     1 
ATOM 4807  C CA    . GLN C 3 524 ? -8.483  174.500 5.109   1.00 53.75  ? 524 GLN A CA    1 
ATOM 4808  C C     . GLN C 3 524 ? -8.379  173.806 6.451   1.00 52.34  ? 524 GLN A C     1 
ATOM 4809  O O     . GLN C 3 524 ? -8.376  174.443 7.513   1.00 50.40  ? 524 GLN A O     1 
ATOM 4810  C CB    . GLN C 3 524 ? -9.885  174.320 4.533   1.00 54.07  ? 524 GLN A CB    1 
ATOM 4811  N N     . LEU C 3 525 ? -8.317  172.481 6.378   1.00 50.90  ? 525 LEU A N     1 
ATOM 4812  C CA    . LEU C 3 525 ? -8.176  171.662 7.556   1.00 50.44  ? 525 LEU A CA    1 
ATOM 4813  C C     . LEU C 3 525 ? -6.827  172.090 8.115   1.00 51.00  ? 525 LEU A C     1 
ATOM 4814  O O     . LEU C 3 525 ? -6.671  172.283 9.316   1.00 51.50  ? 525 LEU A O     1 
ATOM 4815  C CB    . LEU C 3 525 ? -8.166  170.186 7.159   1.00 48.69  ? 525 LEU A CB    1 
ATOM 4816  C CG    . LEU C 3 525 ? -9.466  169.480 6.766   1.00 46.73  ? 525 LEU A CG    1 
ATOM 4817  C CD1   . LEU C 3 525 ? -10.505 170.458 6.297   1.00 44.87  ? 525 LEU A CD1   1 
ATOM 4818  C CD2   . LEU C 3 525 ? -9.177  168.461 5.683   1.00 46.73  ? 525 LEU A CD2   1 
ATOM 4819  N N     . ILE C 3 526 ? -5.880  172.333 7.219   1.00 52.06  ? 526 ILE A N     1 
ATOM 4820  C CA    . ILE C 3 526 ? -4.557  172.768 7.627   1.00 54.53  ? 526 ILE A CA    1 
ATOM 4821  C C     . ILE C 3 526 ? -4.653  174.109 8.338   1.00 56.12  ? 526 ILE A C     1 
ATOM 4822  O O     . ILE C 3 526 ? -3.916  174.377 9.288   1.00 56.31  ? 526 ILE A O     1 
ATOM 4823  C CB    . ILE C 3 526 ? -3.644  172.938 6.415   1.00 55.44  ? 526 ILE A CB    1 
ATOM 4824  C CG1   . ILE C 3 526 ? -3.461  171.592 5.713   1.00 54.51  ? 526 ILE A CG1   1 
ATOM 4825  C CG2   . ILE C 3 526 ? -2.319  173.574 6.840   1.00 55.46  ? 526 ILE A CG2   1 
ATOM 4826  C CD1   . ILE C 3 526 ? -2.609  171.655 4.459   1.00 53.76  ? 526 ILE A CD1   1 
ATOM 4827  N N     . LYS C 3 527 ? -5.573  174.944 7.870   1.00 58.58  ? 527 LYS A N     1 
ATOM 4828  C CA    . LYS C 3 527 ? -5.765  176.266 8.444   1.00 61.60  ? 527 LYS A CA    1 
ATOM 4829  C C     . LYS C 3 527 ? -6.585  176.243 9.743   1.00 62.25  ? 527 LYS A C     1 
ATOM 4830  O O     . LYS C 3 527 ? -6.055  176.587 10.804  1.00 63.42  ? 527 LYS A O     1 
ATOM 4831  C CB    . LYS C 3 527 ? -6.382  177.210 7.397   1.00 64.43  ? 527 LYS A CB    1 
ATOM 4832  C CG    . LYS C 3 527 ? -6.245  178.717 7.699   1.00 66.93  ? 527 LYS A CG    1 
ATOM 4833  C CD    . LYS C 3 527 ? -6.519  179.586 6.448   1.00 68.88  ? 527 LYS A CD    1 
ATOM 4834  C CE    . LYS C 3 527 ? -6.780  181.068 6.783   1.00 68.91  ? 527 LYS A CE    1 
ATOM 4835  N NZ    . LYS C 3 527 ? -5.627  181.815 7.375   1.00 69.25  ? 527 LYS A NZ    1 
ATOM 4836  N N     . LYS C 3 528 ? -7.836  175.784 9.673   1.00 61.29  ? 528 LYS A N     1 
ATOM 4837  C CA    . LYS C 3 528 ? -8.727  175.727 10.845  1.00 62.25  ? 528 LYS A CA    1 
ATOM 4838  C C     . LYS C 3 528 ? -8.131  175.322 12.200  1.00 62.61  ? 528 LYS A C     1 
ATOM 4839  O O     . LYS C 3 528 ? -7.080  174.687 12.276  1.00 62.96  ? 528 LYS A O     1 
ATOM 4840  C CB    . LYS C 3 528 ? -9.920  174.837 10.552  1.00 62.84  ? 528 LYS A CB    1 
ATOM 4841  C CG    . LYS C 3 528 ? -10.740 175.335 9.416   1.00 64.62  ? 528 LYS A CG    1 
ATOM 4842  C CD    . LYS C 3 528 ? -11.558 174.213 8.871   1.00 66.37  ? 528 LYS A CD    1 
ATOM 4843  C CE    . LYS C 3 528 ? -12.058 174.551 7.496   1.00 67.82  ? 528 LYS A CE    1 
ATOM 4844  N NZ    . LYS C 3 528 ? -12.169 173.321 6.678   1.00 65.38  ? 528 LYS A NZ    1 
ATOM 4845  N N     . GLU C 3 529 ? -8.832  175.692 13.268  1.00 62.83  ? 529 GLU A N     1 
ATOM 4846  C CA    . GLU C 3 529 ? -8.394  175.402 14.632  1.00 63.23  ? 529 GLU A CA    1 
ATOM 4847  C C     . GLU C 3 529 ? -8.941  174.079 15.109  1.00 60.57  ? 529 GLU A C     1 
ATOM 4848  O O     . GLU C 3 529 ? -8.403  173.460 16.024  1.00 60.40  ? 529 GLU A O     1 
ATOM 4849  C CB    . GLU C 3 529 ? -8.857  176.514 15.582  1.00 66.83  ? 529 GLU A CB    1 
ATOM 4850  C CG    . GLU C 3 529 ? -8.862  176.136 17.080  1.00 71.62  ? 529 GLU A CG    1 
ATOM 4851  C CD    . GLU C 3 529 ? -9.604  177.149 17.951  1.00 74.24  ? 529 GLU A CD    1 
ATOM 4852  O OE1   . GLU C 3 529 ? -10.374 176.728 18.849  1.00 74.15  ? 529 GLU A OE1   1 
ATOM 4853  O OE2   . GLU C 3 529 ? -9.415  178.368 17.735  1.00 76.52  ? 529 GLU A OE2   1 
ATOM 4854  N N     . LYS C 3 530 ? -10.046 173.669 14.518  1.00 58.09  ? 530 LYS A N     1 
ATOM 4855  C CA    . LYS C 3 530 ? -10.651 172.416 14.905  1.00 57.04  ? 530 LYS A CA    1 
ATOM 4856  C C     . LYS C 3 530 ? -11.716 172.045 13.901  1.00 55.42  ? 530 LYS A C     1 
ATOM 4857  O O     . LYS C 3 530 ? -12.471 172.894 13.420  1.00 56.54  ? 530 LYS A O     1 
ATOM 4858  C CB    . LYS C 3 530 ? -11.241 172.508 16.325  1.00 56.13  ? 530 LYS A CB    1 
ATOM 4859  N N     . VAL C 3 531 ? -11.690 170.779 13.514  1.00 53.05  ? 531 VAL A N     1 
ATOM 4860  C CA    . VAL C 3 531 ? -12.648 170.235 12.575  1.00 50.16  ? 531 VAL A CA    1 
ATOM 4861  C C     . VAL C 3 531 ? -13.011 168.875 13.101  1.00 47.91  ? 531 VAL A C     1 
ATOM 4862  O O     . VAL C 3 531 ? -12.299 168.280 13.906  1.00 48.69  ? 531 VAL A O     1 
ATOM 4863  C CB    . VAL C 3 531 ? -12.051 170.046 11.176  1.00 50.40  ? 531 VAL A CB    1 
ATOM 4864  C CG1   . VAL C 3 531 ? -13.110 169.491 10.231  1.00 49.11  ? 531 VAL A CG1   1 
ATOM 4865  C CG2   . VAL C 3 531 ? -11.482 171.356 10.656  1.00 50.57  ? 531 VAL A CG2   1 
ATOM 4866  N N     . TYR C 3 532 ? -14.121 168.376 12.620  1.00 44.36  ? 532 TYR A N     1 
ATOM 4867  C CA    . TYR C 3 532 ? -14.575 167.094 13.031  1.00 43.41  ? 532 TYR A CA    1 
ATOM 4868  C C     . TYR C 3 532 ? -15.499 166.753 11.897  1.00 42.51  ? 532 TYR A C     1 
ATOM 4869  O O     . TYR C 3 532 ? -15.841 167.620 11.101  1.00 42.19  ? 532 TYR A O     1 
ATOM 4870  C CB    . TYR C 3 532 ? -15.272 167.246 14.377  1.00 44.95  ? 532 TYR A CB    1 
ATOM 4871  C CG    . TYR C 3 532 ? -16.412 166.304 14.616  1.00 49.43  ? 532 TYR A CG    1 
ATOM 4872  C CD1   . TYR C 3 532 ? -16.360 165.364 15.644  1.00 50.75  ? 532 TYR A CD1   1 
ATOM 4873  C CD2   . TYR C 3 532 ? -17.558 166.349 13.807  1.00 50.04  ? 532 TYR A CD2   1 
ATOM 4874  C CE1   . TYR C 3 532 ? -17.418 164.493 15.851  1.00 52.48  ? 532 TYR A CE1   1 
ATOM 4875  C CE2   . TYR C 3 532 ? -18.603 165.491 13.997  1.00 51.06  ? 532 TYR A CE2   1 
ATOM 4876  C CZ    . TYR C 3 532 ? -18.539 164.568 15.016  1.00 52.42  ? 532 TYR A CZ    1 
ATOM 4877  O OH    . TYR C 3 532 ? -19.609 163.727 15.183  1.00 53.68  ? 532 TYR A OH    1 
ATOM 4878  N N     . LEU C 3 533 ? -15.912 165.499 11.822  1.00 42.65  ? 533 LEU A N     1 
ATOM 4879  C CA    . LEU C 3 533 ? -16.784 165.081 10.749  1.00 42.14  ? 533 LEU A CA    1 
ATOM 4880  C C     . LEU C 3 533 ? -17.479 163.768 11.063  1.00 41.93  ? 533 LEU A C     1 
ATOM 4881  O O     . LEU C 3 533 ? -16.855 162.841 11.559  1.00 43.44  ? 533 LEU A O     1 
ATOM 4882  C CB    . LEU C 3 533 ? -15.936 164.943 9.500   1.00 42.17  ? 533 LEU A CB    1 
ATOM 4883  C CG    . LEU C 3 533 ? -16.600 164.552 8.195   1.00 45.78  ? 533 LEU A CG    1 
ATOM 4884  C CD1   . LEU C 3 533 ? -18.031 165.088 8.083   1.00 47.37  ? 533 LEU A CD1   1 
ATOM 4885  C CD2   . LEU C 3 533 ? -15.708 165.090 7.083   1.00 47.05  ? 533 LEU A CD2   1 
ATOM 4886  N N     . ALA C 3 534 ? -18.776 163.692 10.789  1.00 42.10  ? 534 ALA A N     1 
ATOM 4887  C CA    . ALA C 3 534 ? -19.531 162.464 11.038  1.00 41.97  ? 534 ALA A CA    1 
ATOM 4888  C C     . ALA C 3 534 ? -20.238 161.990 9.783   1.00 42.42  ? 534 ALA A C     1 
ATOM 4889  O O     . ALA C 3 534 ? -20.460 162.754 8.833   1.00 41.93  ? 534 ALA A O     1 
ATOM 4890  C CB    . ALA C 3 534 ? -20.530 162.643 12.173  1.00 40.21  ? 534 ALA A CB    1 
ATOM 4891  N N     . TRP C 3 535 ? -20.605 160.719 9.791   1.00 42.92  ? 535 TRP A N     1 
ATOM 4892  C CA    . TRP C 3 535 ? -21.262 160.137 8.641   1.00 44.05  ? 535 TRP A CA    1 
ATOM 4893  C C     . TRP C 3 535 ? -22.694 159.788 8.949   1.00 45.13  ? 535 TRP A C     1 
ATOM 4894  O O     . TRP C 3 535 ? -23.013 159.353 10.056  1.00 46.24  ? 535 TRP A O     1 
ATOM 4895  C CB    . TRP C 3 535 ? -20.514 158.883 8.180   1.00 43.22  ? 535 TRP A CB    1 
ATOM 4896  C CG    . TRP C 3 535 ? -21.074 158.285 6.934   1.00 43.22  ? 535 TRP A CG    1 
ATOM 4897  C CD1   . TRP C 3 535 ? -20.693 158.552 5.648   1.00 42.84  ? 535 TRP A CD1   1 
ATOM 4898  C CD2   . TRP C 3 535 ? -22.141 157.338 6.849   1.00 43.00  ? 535 TRP A CD2   1 
ATOM 4899  N NE1   . TRP C 3 535 ? -21.464 157.834 4.767   1.00 42.84  ? 535 TRP A NE1   1 
ATOM 4900  C CE2   . TRP C 3 535 ? -22.362 157.081 5.478   1.00 43.24  ? 535 TRP A CE2   1 
ATOM 4901  C CE3   . TRP C 3 535 ? -22.933 156.680 7.801   1.00 42.32  ? 535 TRP A CE3   1 
ATOM 4902  C CZ2   . TRP C 3 535 ? -23.345 156.190 5.033   1.00 43.73  ? 535 TRP A CZ2   1 
ATOM 4903  C CZ3   . TRP C 3 535 ? -23.906 155.795 7.361   1.00 42.99  ? 535 TRP A CZ3   1 
ATOM 4904  C CH2   . TRP C 3 535 ? -24.106 155.559 5.988   1.00 43.68  ? 535 TRP A CH2   1 
ATOM 4905  N N     . VAL C 3 536 ? -23.551 159.955 7.948   1.00 45.54  ? 536 VAL A N     1 
ATOM 4906  C CA    . VAL C 3 536 ? -24.964 159.644 8.092   1.00 46.29  ? 536 VAL A CA    1 
ATOM 4907  C C     . VAL C 3 536 ? -25.434 159.037 6.785   1.00 47.47  ? 536 VAL A C     1 
ATOM 4908  O O     . VAL C 3 536 ? -24.945 159.402 5.721   1.00 46.31  ? 536 VAL A O     1 
ATOM 4909  C CB    . VAL C 3 536 ? -25.801 160.922 8.341   1.00 47.46  ? 536 VAL A CB    1 
ATOM 4910  C CG1   . VAL C 3 536 ? -27.246 160.567 8.684   1.00 46.76  ? 536 VAL A CG1   1 
ATOM 4911  C CG2   . VAL C 3 536 ? -25.180 161.763 9.439   1.00 47.74  ? 536 VAL A CG2   1 
ATOM 4912  N N     . PRO C 3 537 ? -26.331 158.042 6.850   1.00 49.34  ? 537 PRO A N     1 
ATOM 4913  C CA    . PRO C 3 537 ? -26.819 157.440 5.605   1.00 50.58  ? 537 PRO A CA    1 
ATOM 4914  C C     . PRO C 3 537 ? -27.593 158.500 4.828   1.00 53.69  ? 537 PRO A C     1 
ATOM 4915  O O     . PRO C 3 537 ? -27.822 159.586 5.348   1.00 54.04  ? 537 PRO A O     1 
ATOM 4916  C CB    . PRO C 3 537 ? -27.731 156.311 6.105   1.00 49.70  ? 537 PRO A CB    1 
ATOM 4917  C CG    . PRO C 3 537 ? -28.096 156.718 7.510   1.00 48.61  ? 537 PRO A CG    1 
ATOM 4918  C CD    . PRO C 3 537 ? -26.825 157.305 8.027   1.00 48.52  ? 537 PRO A CD    1 
ATOM 4919  N N     . ALA C 3 538 ? -27.980 158.213 3.590   1.00 57.10  ? 538 ALA A N     1 
ATOM 4920  C CA    . ALA C 3 538 ? -28.724 159.205 2.812   1.00 60.29  ? 538 ALA A CA    1 
ATOM 4921  C C     . ALA C 3 538 ? -30.253 159.000 2.744   1.00 62.21  ? 538 ALA A C     1 
ATOM 4922  O O     . ALA C 3 538 ? -31.002 159.610 3.516   1.00 62.74  ? 538 ALA A O     1 
ATOM 4923  C CB    . ALA C 3 538 ? -28.129 159.336 1.409   1.00 59.10  ? 538 ALA A CB    1 
ATOM 4924  N N     . HIS C 3 539 ? -30.696 158.118 1.846   1.00 64.31  ? 539 HIS A N     1 
ATOM 4925  C CA    . HIS C 3 539 ? -32.121 157.826 1.613   1.00 66.47  ? 539 HIS A CA    1 
ATOM 4926  C C     . HIS C 3 539 ? -32.990 157.335 2.776   1.00 66.04  ? 539 HIS A C     1 
ATOM 4927  O O     . HIS C 3 539 ? -34.151 156.956 2.581   1.00 65.48  ? 539 HIS A O     1 
ATOM 4928  C CB    . HIS C 3 539 ? -32.278 156.875 0.420   1.00 68.90  ? 539 HIS A CB    1 
ATOM 4929  C CG    . HIS C 3 539 ? -31.876 157.476 -0.892  1.00 73.67  ? 539 HIS A CG    1 
ATOM 4930  N ND1   . HIS C 3 539 ? -32.715 157.502 -1.987  1.00 74.28  ? 539 HIS A ND1   1 
ATOM 4931  C CD2   . HIS C 3 539 ? -30.724 158.072 -1.287  1.00 74.27  ? 539 HIS A CD2   1 
ATOM 4932  C CE1   . HIS C 3 539 ? -32.098 158.089 -2.997  1.00 75.34  ? 539 HIS A CE1   1 
ATOM 4933  N NE2   . HIS C 3 539 ? -30.888 158.444 -2.598  1.00 75.55  ? 539 HIS A NE2   1 
ATOM 4934  N N     . LYS C 3 540 ? -32.425 157.302 3.975   1.00 65.98  ? 540 LYS A N     1 
ATOM 4935  C CA    . LYS C 3 540 ? -33.192 156.895 5.138   1.00 66.16  ? 540 LYS A CA    1 
ATOM 4936  C C     . LYS C 3 540 ? -33.830 158.155 5.754   1.00 66.74  ? 540 LYS A C     1 
ATOM 4937  O O     . LYS C 3 540 ? -34.579 158.058 6.734   1.00 67.13  ? 540 LYS A O     1 
ATOM 4938  C CB    . LYS C 3 540 ? -32.290 156.186 6.147   1.00 64.95  ? 540 LYS A CB    1 
ATOM 4939  N N     . GLY C 3 541 ? -33.547 159.320 5.150   1.00 66.59  ? 541 GLY A N     1 
ATOM 4940  C CA    . GLY C 3 541 ? -34.069 160.601 5.623   1.00 66.17  ? 541 GLY A CA    1 
ATOM 4941  C C     . GLY C 3 541 ? -33.755 160.802 7.095   1.00 65.87  ? 541 GLY A C     1 
ATOM 4942  O O     . GLY C 3 541 ? -34.629 160.651 7.954   1.00 66.16  ? 541 GLY A O     1 
ATOM 4943  N N     . ILE C 3 542 ? -32.521 161.201 7.387   1.00 65.16  ? 542 ILE A N     1 
ATOM 4944  C CA    . ILE C 3 542 ? -32.081 161.338 8.775   1.00 64.94  ? 542 ILE A CA    1 
ATOM 4945  C C     . ILE C 3 542 ? -31.394 162.637 9.158   1.00 64.30  ? 542 ILE A C     1 
ATOM 4946  O O     . ILE C 3 542 ? -30.372 162.996 8.580   1.00 64.26  ? 542 ILE A O     1 
ATOM 4947  C CB    . ILE C 3 542 ? -31.131 160.183 9.164   1.00 64.85  ? 542 ILE A CB    1 
ATOM 4948  C CG1   . ILE C 3 542 ? -30.971 159.177 8.010   1.00 64.49  ? 542 ILE A CG1   1 
ATOM 4949  C CG2   . ILE C 3 542 ? -31.669 159.478 10.393  1.00 65.55  ? 542 ILE A CG2   1 
ATOM 4950  C CD1   . ILE C 3 542 ? -30.266 159.718 6.777   1.00 62.88  ? 542 ILE A CD1   1 
ATOM 4951  N N     . GLY C 3 543 ? -31.872 163.253 10.237  1.00 63.87  ? 543 GLY A N     1 
ATOM 4952  C CA    . GLY C 3 543 ? -31.309 164.521 10.667  1.00 63.00  ? 543 GLY A CA    1 
ATOM 4953  C C     . GLY C 3 543 ? -31.815 165.540 9.670   1.00 62.60  ? 543 GLY A C     1 
ATOM 4954  O O     . GLY C 3 543 ? -32.715 165.225 8.891   1.00 63.47  ? 543 GLY A O     1 
ATOM 4955  N N     . GLY C 3 544 ? -31.248 166.739 9.659   1.00 62.01  ? 544 GLY A N     1 
ATOM 4956  C CA    . GLY C 3 544 ? -31.697 167.742 8.705   1.00 62.66  ? 544 GLY A CA    1 
ATOM 4957  C C     . GLY C 3 544 ? -31.461 167.338 7.257   1.00 63.52  ? 544 GLY A C     1 
ATOM 4958  O O     . GLY C 3 544 ? -31.945 167.993 6.331   1.00 62.20  ? 544 GLY A O     1 
ATOM 4959  N N     . ASN C 3 545 ? -30.742 166.230 7.080   1.00 64.88  ? 545 ASN A N     1 
ATOM 4960  C CA    . ASN C 3 545 ? -30.396 165.666 5.771   1.00 66.79  ? 545 ASN A CA    1 
ATOM 4961  C C     . ASN C 3 545 ? -31.527 165.758 4.741   1.00 68.00  ? 545 ASN A C     1 
ATOM 4962  O O     . ASN C 3 545 ? -31.347 166.337 3.667   1.00 67.63  ? 545 ASN A O     1 
ATOM 4963  C CB    . ASN C 3 545 ? -29.964 164.197 5.941   1.00 66.78  ? 545 ASN A CB    1 
ATOM 4964  C CG    . ASN C 3 545 ? -29.198 163.648 4.734   1.00 66.66  ? 545 ASN A CG    1 
ATOM 4965  O OD1   . ASN C 3 545 ? -27.966 163.721 4.680   1.00 65.17  ? 545 ASN A OD1   1 
ATOM 4966  N ND2   . ASN C 3 545 ? -29.923 163.057 3.783   1.00 65.94  ? 545 ASN A ND2   1 
ATOM 4967  N N     . GLU C 3 546 ? -32.689 165.206 5.084   1.00 69.81  ? 546 GLU A N     1 
ATOM 4968  C CA    . GLU C 3 546 ? -33.859 165.205 4.201   1.00 71.71  ? 546 GLU A CA    1 
ATOM 4969  C C     . GLU C 3 546 ? -34.082 166.554 3.510   1.00 72.50  ? 546 GLU A C     1 
ATOM 4970  O O     . GLU C 3 546 ? -34.522 166.611 2.351   1.00 72.17  ? 546 GLU A O     1 
ATOM 4971  C CB    . GLU C 3 546 ? -35.104 164.804 4.988   1.00 71.49  ? 546 GLU A CB    1 
ATOM 4972  N N     . GLN C 3 547 ? -33.750 167.626 4.231   1.00 72.77  ? 547 GLN A N     1 
ATOM 4973  C CA    . GLN C 3 547 ? -33.890 168.993 3.736   1.00 73.07  ? 547 GLN A CA    1 
ATOM 4974  C C     . GLN C 3 547 ? -32.812 169.385 2.711   1.00 72.21  ? 547 GLN A C     1 
ATOM 4975  O O     . GLN C 3 547 ? -33.105 170.082 1.737   1.00 71.92  ? 547 GLN A O     1 
ATOM 4976  C CB    . GLN C 3 547 ? -33.899 169.980 4.917   1.00 72.68  ? 547 GLN A CB    1 
ATOM 4977  N N     . VAL C 3 548 ? -31.583 168.911 2.920   1.00 71.54  ? 548 VAL A N     1 
ATOM 4978  C CA    . VAL C 3 548 ? -30.458 169.220 2.031   1.00 70.77  ? 548 VAL A CA    1 
ATOM 4979  C C     . VAL C 3 548 ? -30.588 168.584 0.659   1.00 70.90  ? 548 VAL A C     1 
ATOM 4980  O O     . VAL C 3 548 ? -30.129 169.150 -0.330  1.00 69.51  ? 548 VAL A O     1 
ATOM 4981  C CB    . VAL C 3 548 ? -29.101 168.750 2.606   1.00 70.34  ? 548 VAL A CB    1 
ATOM 4982  C CG1   . VAL C 3 548 ? -27.978 169.618 2.050   1.00 69.56  ? 548 VAL A CG1   1 
ATOM 4983  C CG2   . VAL C 3 548 ? -29.115 168.767 4.131   1.00 70.67  ? 548 VAL A CG2   1 
ATOM 4984  N N     . ASP C 3 549 ? -31.179 167.392 0.613   1.00 71.80  ? 549 ASP A N     1 
ATOM 4985  C CA    . ASP C 3 549 ? -31.365 166.662 -0.645  1.00 73.21  ? 549 ASP A CA    1 
ATOM 4986  C C     . ASP C 3 549 ? -32.244 167.454 -1.612  1.00 73.72  ? 549 ASP A C     1 
ATOM 4987  O O     . ASP C 3 549 ? -31.823 167.800 -2.728  1.00 72.24  ? 549 ASP A O     1 
ATOM 4988  C CB    . ASP C 3 549 ? -32.015 165.297 -0.383  1.00 72.71  ? 549 ASP A CB    1 
ATOM 4989  C CG    . ASP C 3 549 ? -31.244 164.461 0.615   1.00 73.79  ? 549 ASP A CG    1 
ATOM 4990  O OD1   . ASP C 3 549 ? -30.250 163.805 0.213   1.00 73.68  ? 549 ASP A OD1   1 
ATOM 4991  O OD2   . ASP C 3 549 ? -31.646 164.457 1.798   1.00 72.24  ? 549 ASP A OD2   1 
ATOM 4992  N N     . LYS C 3 550 ? -33.475 167.708 -1.163  1.00 74.44  ? 550 LYS A N     1 
ATOM 4993  C CA    . LYS C 3 550 ? -34.472 168.459 -1.918  1.00 74.38  ? 550 LYS A CA    1 
ATOM 4994  C C     . LYS C 3 550 ? -33.905 169.841 -2.234  1.00 74.36  ? 550 LYS A C     1 
ATOM 4995  O O     . LYS C 3 550 ? -34.167 170.412 -3.299  1.00 74.75  ? 550 LYS A O     1 
ATOM 4996  C CB    . LYS C 3 550 ? -35.758 168.579 -1.099  1.00 73.60  ? 550 LYS A CB    1 
ATOM 4997  N N     . LEU C 3 551 ? -33.101 170.351 -1.301  1.00 74.51  ? 551 LEU A N     1 
ATOM 4998  C CA    . LEU C 3 551 ? -32.450 171.648 -1.433  1.00 74.03  ? 551 LEU A CA    1 
ATOM 4999  C C     . LEU C 3 551 ? -31.530 171.591 -2.643  1.00 73.64  ? 551 LEU A C     1 
ATOM 5000  O O     . LEU C 3 551 ? -31.406 172.568 -3.387  1.00 73.27  ? 551 LEU A O     1 
ATOM 5001  C CB    . LEU C 3 551 ? -31.627 171.951 -0.177  1.00 74.13  ? 551 LEU A CB    1 
ATOM 5002  C CG    . LEU C 3 551 ? -31.051 173.356 0.007   1.00 74.57  ? 551 LEU A CG    1 
ATOM 5003  C CD1   . LEU C 3 551 ? -32.176 174.371 0.189   1.00 74.50  ? 551 LEU A CD1   1 
ATOM 5004  C CD2   . LEU C 3 551 ? -30.138 173.367 1.218   1.00 74.74  ? 551 LEU A CD2   1 
ATOM 5005  N N     . VAL C 3 552 ? -30.905 170.429 -2.835  1.00 73.76  ? 552 VAL A N     1 
ATOM 5006  C CA    . VAL C 3 552 ? -29.994 170.212 -3.951  1.00 74.85  ? 552 VAL A CA    1 
ATOM 5007  C C     . VAL C 3 552 ? -30.734 169.749 -5.205  1.00 75.65  ? 552 VAL A C     1 
ATOM 5008  O O     . VAL C 3 552 ? -30.201 169.839 -6.314  1.00 75.93  ? 552 VAL A O     1 
ATOM 5009  C CB    . VAL C 3 552 ? -28.880 169.193 -3.596  1.00 74.63  ? 552 VAL A CB    1 
ATOM 5010  C CG1   . VAL C 3 552 ? -27.885 169.083 -4.749  1.00 75.03  ? 552 VAL A CG1   1 
ATOM 5011  C CG2   . VAL C 3 552 ? -28.139 169.630 -2.335  1.00 74.20  ? 552 VAL A CG2   1 
ATOM 5012  N N     . SER C 3 553 ? -31.972 169.291 -5.035  1.00 76.76  ? 553 SER A N     1 
ATOM 5013  C CA    . SER C 3 553 ? -32.765 168.820 -6.166  1.00 77.87  ? 553 SER A CA    1 
ATOM 5014  C C     . SER C 3 553 ? -34.255 168.680 -5.869  1.00 78.80  ? 553 SER A C     1 
ATOM 5015  O O     . SER C 3 553 ? -34.640 168.029 -4.895  1.00 78.13  ? 553 SER A O     1 
ATOM 5016  C CB    . SER C 3 553 ? -32.217 167.475 -6.683  1.00 77.18  ? 553 SER A CB    1 
ATOM 5017  O OG    . SER C 3 553 ? -32.245 166.461 -5.689  1.00 76.28  ? 553 SER A OG    1 
ATOM 5018  N N     . ALA C 3 554 ? -35.086 169.318 -6.691  1.00 80.63  ? 554 ALA A N     1 
ATOM 5019  C CA    . ALA C 3 554 ? -36.543 169.216 -6.550  1.00 82.69  ? 554 ALA A CA    1 
ATOM 5020  C C     . ALA C 3 554 ? -36.936 167.990 -7.390  1.00 83.66  ? 554 ALA A C     1 
ATOM 5021  O O     . ALA C 3 554 ? -37.609 168.107 -8.423  1.00 84.06  ? 554 ALA A O     1 
ATOM 5022  C CB    . ALA C 3 554 ? -37.228 170.487 -7.082  1.00 82.37  ? 554 ALA A CB    1 
ATOM 5023  N N     . GLY C 3 555 ? -36.491 166.817 -6.933  1.00 84.44  ? 555 GLY A N     1 
ATOM 5024  C CA    . GLY C 3 555 ? -36.717 165.572 -7.655  1.00 84.62  ? 555 GLY A CA    1 
ATOM 5025  C C     . GLY C 3 555 ? -35.624 165.501 -8.715  1.00 84.55  ? 555 GLY A C     1 
ATOM 5026  O O     . GLY C 3 555 ? -35.354 164.451 -9.316  1.00 84.49  ? 555 GLY A O     1 
ATOM 5027  N N     . ILE C 3 556 ? -34.982 166.658 -8.893  1.00 84.08  ? 556 ILE A N     1 
ATOM 5028  C CA    . ILE C 3 556 ? -33.905 166.910 -9.837  1.00 83.27  ? 556 ILE A CA    1 
ATOM 5029  C C     . ILE C 3 556 ? -33.528 168.390 -9.657  1.00 83.37  ? 556 ILE A C     1 
ATOM 5030  O O     . ILE C 3 556 ? -34.342 169.200 -9.205  1.00 82.83  ? 556 ILE A O     1 
ATOM 5031  C CB    . ILE C 3 556 ? -34.375 166.674 -11.292 1.00 83.16  ? 556 ILE A CB    1 
ATOM 5032  C CG1   . ILE C 3 556 ? -33.255 167.032 -12.270 1.00 83.21  ? 556 ILE A CG1   1 
ATOM 5033  C CG2   . ILE C 3 556 ? -35.661 167.462 -11.572 1.00 82.98  ? 556 ILE A CG2   1 
ATOM 5034  C CD1   . ILE C 3 556 ? -33.697 167.117 -13.720 1.00 83.78  ? 556 ILE A CD1   1 
ATOM 5035  N N     . ARG C 3 557 ? -32.290 168.734 -9.997  1.00 84.62  ? 557 ARG A N     1 
ATOM 5036  C CA    . ARG C 3 557 ? -31.805 170.107 -9.866  1.00 85.54  ? 557 ARG A CA    1 
ATOM 5037  C C     . ARG C 3 557 ? -31.770 170.883 -11.191 1.00 86.16  ? 557 ARG A C     1 
ATOM 5038  O O     . ARG C 3 557 ? -32.001 170.319 -12.267 1.00 85.61  ? 557 ARG A O     1 
ATOM 5039  C CB    . ARG C 3 557 ? -30.417 170.105 -9.222  1.00 84.77  ? 557 ARG A CB    1 
ATOM 5040  N N     . LYS C 3 558 ? -31.485 172.184 -11.089 1.00 87.54  ? 558 LYS A N     1 
ATOM 5041  C CA    . LYS C 3 558 ? -31.390 173.080 -12.247 1.00 88.19  ? 558 LYS A CA    1 
ATOM 5042  C C     . LYS C 3 558 ? -29.946 173.178 -12.759 1.00 88.07  ? 558 LYS A C     1 
ATOM 5043  O O     . LYS C 3 558 ? -29.007 173.082 -11.931 1.00 88.74  ? 558 LYS A O     1 
ATOM 5044  C CB    . LYS C 3 558 ? -31.926 174.483 -11.891 1.00 87.84  ? 558 LYS A CB    1 
ATOM 5045  O OXT   . LYS C 3 558 ? -29.774 173.346 -13.990 1.00 89.32  ? 558 LYS A OXT   1 
ATOM 5046  N N     . PRO D 4 1   ? 15.620  105.357 -0.269  1.00 59.82  ? 1   PRO B N     1 
ATOM 5047  C CA    . PRO D 4 1   ? 15.003  104.423 -1.243  1.00 58.54  ? 1   PRO B CA    1 
ATOM 5048  C C     . PRO D 4 1   ? 13.472  104.354 -1.190  1.00 56.34  ? 1   PRO B C     1 
ATOM 5049  O O     . PRO D 4 1   ? 12.860  103.590 -0.441  1.00 55.50  ? 1   PRO B O     1 
ATOM 5050  C CB    . PRO D 4 1   ? 15.644  103.054 -1.032  1.00 60.59  ? 1   PRO B CB    1 
ATOM 5051  C CG    . PRO D 4 1   ? 16.342  103.226 0.353   1.00 60.70  ? 1   PRO B CG    1 
ATOM 5052  C CD    . PRO D 4 1   ? 16.735  104.700 0.435   1.00 60.12  ? 1   PRO B CD    1 
ATOM 5053  N N     . ILE D 4 2   ? 12.869  105.191 -2.010  1.00 53.63  ? 2   ILE B N     1 
ATOM 5054  C CA    . ILE D 4 2   ? 11.433  105.287 -2.134  1.00 51.72  ? 2   ILE B CA    1 
ATOM 5055  C C     . ILE D 4 2   ? 10.738  103.947 -2.262  1.00 50.81  ? 2   ILE B C     1 
ATOM 5056  O O     . ILE D 4 2   ? 11.312  102.991 -2.783  1.00 51.06  ? 2   ILE B O     1 
ATOM 5057  C CB    . ILE D 4 2   ? 11.116  106.108 -3.358  1.00 52.73  ? 2   ILE B CB    1 
ATOM 5058  C CG1   . ILE D 4 2   ? 11.961  105.585 -4.535  1.00 53.27  ? 2   ILE B CG1   1 
ATOM 5059  C CG2   . ILE D 4 2   ? 11.412  107.553 -3.076  1.00 50.34  ? 2   ILE B CG2   1 
ATOM 5060  C CD1   . ILE D 4 2   ? 12.342  106.633 -5.578  1.00 55.24  ? 2   ILE B CD1   1 
ATOM 5061  N N     . SER D 4 3   ? 9.495   103.910 -1.794  1.00 49.75  ? 3   SER B N     1 
ATOM 5062  C CA    . SER D 4 3   ? 8.608   102.738 -1.854  1.00 48.63  ? 3   SER B CA    1 
ATOM 5063  C C     . SER D 4 3   ? 8.354   102.238 -3.310  1.00 47.59  ? 3   SER B C     1 
ATOM 5064  O O     . SER D 4 3   ? 8.354   103.029 -4.258  1.00 47.93  ? 3   SER B O     1 
ATOM 5065  C CB    . SER D 4 3   ? 7.274   103.114 -1.198  1.00 48.74  ? 3   SER B CB    1 
ATOM 5066  O OG    . SER D 4 3   ? 6.413   102.002 -1.083  1.00 47.19  ? 3   SER B OG    1 
ATOM 5067  N N     . PRO D 4 4   ? 8.091   100.924 -3.491  1.00 46.30  ? 4   PRO B N     1 
ATOM 5068  C CA    . PRO D 4 4   ? 7.837   100.296 -4.798  1.00 44.86  ? 4   PRO B CA    1 
ATOM 5069  C C     . PRO D 4 4   ? 6.382   100.369 -5.249  1.00 42.55  ? 4   PRO B C     1 
ATOM 5070  O O     . PRO D 4 4   ? 5.974   99.722  -6.219  1.00 43.73  ? 4   PRO B O     1 
ATOM 5071  C CB    . PRO D 4 4   ? 8.228   98.854  -4.537  1.00 45.23  ? 4   PRO B CB    1 
ATOM 5072  C CG    . PRO D 4 4   ? 7.631   98.646  -3.173  1.00 45.07  ? 4   PRO B CG    1 
ATOM 5073  C CD    . PRO D 4 4   ? 8.058   99.905  -2.423  1.00 46.04  ? 4   PRO B CD    1 
ATOM 5074  N N     . ILE D 4 5   ? 5.593   101.127 -4.510  1.00 39.92  ? 5   ILE B N     1 
ATOM 5075  C CA    . ILE D 4 5   ? 4.202   101.281 -4.834  1.00 38.24  ? 5   ILE B CA    1 
ATOM 5076  C C     . ILE D 4 5   ? 4.122   101.832 -6.242  1.00 37.29  ? 5   ILE B C     1 
ATOM 5077  O O     . ILE D 4 5   ? 5.021   102.553 -6.684  1.00 37.24  ? 5   ILE B O     1 
ATOM 5078  C CB    . ILE D 4 5   ? 3.554   102.274 -3.874  1.00 39.04  ? 5   ILE B CB    1 
ATOM 5079  C CG1   . ILE D 4 5   ? 3.745   101.798 -2.426  1.00 39.13  ? 5   ILE B CG1   1 
ATOM 5080  C CG2   . ILE D 4 5   ? 2.085   102.424 -4.211  1.00 41.11  ? 5   ILE B CG2   1 
ATOM 5081  C CD1   . ILE D 4 5   ? 3.240   102.749 -1.346  1.00 36.63  ? 5   ILE B CD1   1 
ATOM 5082  N N     . GLU D 4 6   ? 3.074   101.460 -6.969  1.00 36.86  ? 6   GLU B N     1 
ATOM 5083  C CA    . GLU D 4 6   ? 2.892   101.970 -8.323  1.00 37.48  ? 6   GLU B CA    1 
ATOM 5084  C C     . GLU D 4 6   ? 2.707   103.489 -8.192  1.00 36.42  ? 6   GLU B C     1 
ATOM 5085  O O     . GLU D 4 6   ? 2.836   104.044 -7.101  1.00 34.74  ? 6   GLU B O     1 
ATOM 5086  C CB    . GLU D 4 6   ? 1.661   101.320 -8.967  1.00 38.98  ? 6   GLU B CB    1 
ATOM 5087  C CG    . GLU D 4 6   ? 1.622   101.379 -10.514 1.00 42.86  ? 6   GLU B CG    1 
ATOM 5088  C CD    . GLU D 4 6   ? 0.474   100.546 -11.146 1.00 44.91  ? 6   GLU B CD    1 
ATOM 5089  O OE1   . GLU D 4 6   ? -0.421  100.076 -10.394 1.00 44.84  ? 6   GLU B OE1   1 
ATOM 5090  O OE2   . GLU D 4 6   ? 0.475   100.358 -12.396 1.00 44.67  ? 6   GLU B OE2   1 
ATOM 5091  N N     . THR D 4 7   ? 2.420   104.179 -9.283  1.00 36.29  ? 7   THR B N     1 
ATOM 5092  C CA    . THR D 4 7   ? 2.244   105.624 -9.176  1.00 36.78  ? 7   THR B CA    1 
ATOM 5093  C C     . THR D 4 7   ? 0.903   106.166 -9.667  1.00 36.30  ? 7   THR B C     1 
ATOM 5094  O O     . THR D 4 7   ? 0.377   105.722 -10.693 1.00 37.14  ? 7   THR B O     1 
ATOM 5095  C CB    . THR D 4 7   ? 3.357   106.382 -9.896  1.00 38.33  ? 7   THR B CB    1 
ATOM 5096  O OG1   . THR D 4 7   ? 3.109   107.791 -9.791  1.00 41.13  ? 7   THR B OG1   1 
ATOM 5097  C CG2   . THR D 4 7   ? 3.410   105.978 -11.369 1.00 39.66  ? 7   THR B CG2   1 
ATOM 5098  N N     . VAL D 4 8   ? 0.376   107.156 -8.941  1.00 34.32  ? 8   VAL B N     1 
ATOM 5099  C CA    . VAL D 4 8   ? -0.894  107.776 -9.286  1.00 30.29  ? 8   VAL B CA    1 
ATOM 5100  C C     . VAL D 4 8   ? -0.634  108.800 -10.374 1.00 33.70  ? 8   VAL B C     1 
ATOM 5101  O O     . VAL D 4 8   ? 0.366   109.518 -10.347 1.00 32.24  ? 8   VAL B O     1 
ATOM 5102  C CB    . VAL D 4 8   ? -1.564  108.438 -8.062  1.00 26.97  ? 8   VAL B CB    1 
ATOM 5103  C CG1   . VAL D 4 8   ? -1.162  109.878 -7.928  1.00 24.91  ? 8   VAL B CG1   1 
ATOM 5104  C CG2   . VAL D 4 8   ? -3.049  108.310 -8.154  1.00 25.43  ? 8   VAL B CG2   1 
ATOM 5105  N N     . PRO D 4 9   ? -1.486  108.806 -11.402 1.00 37.59  ? 9   PRO B N     1 
ATOM 5106  C CA    . PRO D 4 9   ? -1.373  109.736 -12.532 1.00 39.15  ? 9   PRO B CA    1 
ATOM 5107  C C     . PRO D 4 9   ? -1.916  111.132 -12.169 1.00 41.33  ? 9   PRO B C     1 
ATOM 5108  O O     . PRO D 4 9   ? -3.090  111.276 -11.771 1.00 40.89  ? 9   PRO B O     1 
ATOM 5109  C CB    . PRO D 4 9   ? -2.241  109.069 -13.613 1.00 40.26  ? 9   PRO B CB    1 
ATOM 5110  C CG    . PRO D 4 9   ? -2.401  107.621 -13.141 1.00 39.07  ? 9   PRO B CG    1 
ATOM 5111  C CD    . PRO D 4 9   ? -2.518  107.789 -11.662 1.00 37.65  ? 9   PRO B CD    1 
ATOM 5112  N N     . VAL D 4 10  ? -1.064  112.152 -12.281 1.00 41.19  ? 10  VAL B N     1 
ATOM 5113  C CA    . VAL D 4 10  ? -1.490  113.512 -11.970 1.00 39.44  ? 10  VAL B CA    1 
ATOM 5114  C C     . VAL D 4 10  ? -1.154  114.472 -13.081 1.00 39.52  ? 10  VAL B C     1 
ATOM 5115  O O     . VAL D 4 10  ? 0.021   114.719 -13.369 1.00 37.76  ? 10  VAL B O     1 
ATOM 5116  C CB    . VAL D 4 10  ? -0.891  114.049 -10.652 1.00 39.34  ? 10  VAL B CB    1 
ATOM 5117  C CG1   . VAL D 4 10  ? -1.336  115.493 -10.424 1.00 39.16  ? 10  VAL B CG1   1 
ATOM 5118  C CG2   . VAL D 4 10  ? -1.347  113.186 -9.482  1.00 38.99  ? 10  VAL B CG2   1 
ATOM 5119  N N     . LYS D 4 11  ? -2.215  114.981 -13.707 1.00 40.10  ? 11  LYS B N     1 
ATOM 5120  C CA    . LYS D 4 11  ? -2.125  115.955 -14.791 1.00 41.11  ? 11  LYS B CA    1 
ATOM 5121  C C     . LYS D 4 11  ? -3.097  117.086 -14.457 1.00 39.32  ? 11  LYS B C     1 
ATOM 5122  O O     . LYS D 4 11  ? -4.294  116.968 -14.696 1.00 40.50  ? 11  LYS B O     1 
ATOM 5123  C CB    . LYS D 4 11  ? -2.528  115.348 -16.144 1.00 44.30  ? 11  LYS B CB    1 
ATOM 5124  C CG    . LYS D 4 11  ? -2.346  113.853 -16.261 1.00 48.08  ? 11  LYS B CG    1 
ATOM 5125  C CD    . LYS D 4 11  ? -3.665  113.206 -16.660 1.00 50.27  ? 11  LYS B CD    1 
ATOM 5126  C CE    . LYS D 4 11  ? -3.944  111.954 -15.830 1.00 50.81  ? 11  LYS B CE    1 
ATOM 5127  N NZ    . LYS D 4 11  ? -3.990  112.259 -14.365 1.00 50.91  ? 11  LYS B NZ    1 
ATOM 5128  N N     . LEU D 4 12  ? -2.573  118.165 -13.884 1.00 36.54  ? 12  LEU B N     1 
ATOM 5129  C CA    . LEU D 4 12  ? -3.345  119.354 -13.510 1.00 33.54  ? 12  LEU B CA    1 
ATOM 5130  C C     . LEU D 4 12  ? -4.517  119.732 -14.420 1.00 33.56  ? 12  LEU B C     1 
ATOM 5131  O O     . LEU D 4 12  ? -4.645  119.253 -15.561 1.00 31.28  ? 12  LEU B O     1 
ATOM 5132  C CB    . LEU D 4 12  ? -2.394  120.553 -13.433 1.00 29.94  ? 12  LEU B CB    1 
ATOM 5133  C CG    . LEU D 4 12  ? -1.235  120.535 -14.440 1.00 26.42  ? 12  LEU B CG    1 
ATOM 5134  C CD1   . LEU D 4 12  ? -1.693  120.306 -15.883 1.00 25.79  ? 12  LEU B CD1   1 
ATOM 5135  C CD2   . LEU D 4 12  ? -0.475  121.811 -14.328 1.00 24.09  ? 12  LEU B CD2   1 
ATOM 5136  N N     . LYS D 4 13  ? -5.337  120.651 -13.923 1.00 34.85  ? 13  LYS B N     1 
ATOM 5137  C CA    . LYS D 4 13  ? -6.465  121.141 -14.686 1.00 37.66  ? 13  LYS B CA    1 
ATOM 5138  C C     . LYS D 4 13  ? -5.906  121.585 -16.040 1.00 40.10  ? 13  LYS B C     1 
ATOM 5139  O O     . LYS D 4 13  ? -4.735  121.967 -16.147 1.00 38.68  ? 13  LYS B O     1 
ATOM 5140  C CB    . LYS D 4 13  ? -7.113  122.297 -13.970 1.00 36.71  ? 13  LYS B CB    1 
ATOM 5141  N N     . PRO D 4 14  ? -6.724  121.506 -17.098 1.00 43.32  ? 14  PRO B N     1 
ATOM 5142  C CA    . PRO D 4 14  ? -6.330  121.886 -18.462 1.00 45.00  ? 14  PRO B CA    1 
ATOM 5143  C C     . PRO D 4 14  ? -6.042  123.381 -18.635 1.00 46.00  ? 14  PRO B C     1 
ATOM 5144  O O     . PRO D 4 14  ? -6.521  124.209 -17.846 1.00 46.87  ? 14  PRO B O     1 
ATOM 5145  C CB    . PRO D 4 14  ? -7.544  121.466 -19.287 1.00 44.61  ? 14  PRO B CB    1 
ATOM 5146  C CG    . PRO D 4 14  ? -8.678  121.786 -18.347 1.00 44.40  ? 14  PRO B CG    1 
ATOM 5147  C CD    . PRO D 4 14  ? -8.167  121.206 -17.036 1.00 43.75  ? 14  PRO B CD    1 
ATOM 5148  N N     . GLY D 4 15  ? -5.295  123.707 -19.694 1.00 46.10  ? 15  GLY B N     1 
ATOM 5149  C CA    . GLY D 4 15  ? -4.941  125.088 -19.991 1.00 45.43  ? 15  GLY B CA    1 
ATOM 5150  C C     . GLY D 4 15  ? -4.330  125.764 -18.781 1.00 45.23  ? 15  GLY B C     1 
ATOM 5151  O O     . GLY D 4 15  ? -4.715  126.880 -18.414 1.00 45.28  ? 15  GLY B O     1 
ATOM 5152  N N     . MET D 4 16  ? -3.387  125.065 -18.152 1.00 43.86  ? 16  MET B N     1 
ATOM 5153  C CA    . MET D 4 16  ? -2.723  125.558 -16.951 1.00 42.66  ? 16  MET B CA    1 
ATOM 5154  C C     . MET D 4 16  ? -1.228  125.258 -17.024 1.00 40.49  ? 16  MET B C     1 
ATOM 5155  O O     . MET D 4 16  ? -0.782  124.256 -16.485 1.00 41.28  ? 16  MET B O     1 
ATOM 5156  C CB    . MET D 4 16  ? -3.307  124.833 -15.733 1.00 44.61  ? 16  MET B CB    1 
ATOM 5157  C CG    . MET D 4 16  ? -4.825  124.801 -15.652 1.00 43.99  ? 16  MET B CG    1 
ATOM 5158  S SD    . MET D 4 16  ? -5.506  126.310 -15.005 1.00 46.81  ? 16  MET B SD    1 
ATOM 5159  C CE    . MET D 4 16  ? -5.932  125.747 -13.342 1.00 45.01  ? 16  MET B CE    1 
ATOM 5160  N N     . ASP D 4 17  ? -0.449  126.118 -17.667 1.00 37.97  ? 17  ASP B N     1 
ATOM 5161  C CA    . ASP D 4 17  ? 0.988   125.881 -17.788 1.00 36.21  ? 17  ASP B CA    1 
ATOM 5162  C C     . ASP D 4 17  ? 1.684   125.916 -16.423 1.00 33.28  ? 17  ASP B C     1 
ATOM 5163  O O     . ASP D 4 17  ? 2.689   126.611 -16.230 1.00 34.15  ? 17  ASP B O     1 
ATOM 5164  C CB    . ASP D 4 17  ? 1.612   126.904 -18.750 1.00 39.71  ? 17  ASP B CB    1 
ATOM 5165  C CG    . ASP D 4 17  ? 3.113   126.677 -18.977 1.00 42.37  ? 17  ASP B CG    1 
ATOM 5166  O OD1   . ASP D 4 17  ? 3.471   125.723 -19.712 1.00 43.21  ? 17  ASP B OD1   1 
ATOM 5167  O OD2   . ASP D 4 17  ? 3.928   127.462 -18.426 1.00 42.04  ? 17  ASP B OD2   1 
ATOM 5168  N N     . GLY D 4 18  ? 1.130   125.181 -15.467 1.00 28.12  ? 18  GLY B N     1 
ATOM 5169  C CA    . GLY D 4 18  ? 1.714   125.131 -14.149 1.00 24.44  ? 18  GLY B CA    1 
ATOM 5170  C C     . GLY D 4 18  ? 2.038   126.496 -13.588 1.00 23.38  ? 18  GLY B C     1 
ATOM 5171  O O     . GLY D 4 18  ? 1.593   127.511 -14.117 1.00 23.40  ? 18  GLY B O     1 
ATOM 5172  N N     . PRO D 4 19  ? 2.831   126.556 -12.513 1.00 22.55  ? 19  PRO B N     1 
ATOM 5173  C CA    . PRO D 4 19  ? 3.184   127.836 -11.911 1.00 20.95  ? 19  PRO B CA    1 
ATOM 5174  C C     . PRO D 4 19  ? 4.338   128.492 -12.610 1.00 18.46  ? 19  PRO B C     1 
ATOM 5175  O O     . PRO D 4 19  ? 4.966   127.894 -13.483 1.00 17.45  ? 19  PRO B O     1 
ATOM 5176  C CB    . PRO D 4 19  ? 3.558   127.442 -10.487 1.00 22.51  ? 19  PRO B CB    1 
ATOM 5177  C CG    . PRO D 4 19  ? 4.250   126.169 -10.694 1.00 24.61  ? 19  PRO B CG    1 
ATOM 5178  C CD    . PRO D 4 19  ? 3.338   125.447 -11.690 1.00 24.10  ? 19  PRO B CD    1 
ATOM 5179  N N     . LYS D 4 20  ? 4.602   129.728 -12.197 1.00 17.03  ? 20  LYS B N     1 
ATOM 5180  C CA    . LYS D 4 20  ? 5.682   130.530 -12.736 1.00 15.92  ? 20  LYS B CA    1 
ATOM 5181  C C     . LYS D 4 20  ? 5.903   131.730 -11.831 1.00 12.53  ? 20  LYS B C     1 
ATOM 5182  O O     . LYS D 4 20  ? 6.268   132.820 -12.260 1.00 12.53  ? 20  LYS B O     1 
ATOM 5183  C CB    . LYS D 4 20  ? 5.365   130.943 -14.170 1.00 20.20  ? 20  LYS B CB    1 
ATOM 5184  C CG    . LYS D 4 20  ? 6.442   130.501 -15.144 1.00 25.51  ? 20  LYS B CG    1 
ATOM 5185  C CD    . LYS D 4 20  ? 5.911   130.268 -16.556 1.00 30.45  ? 20  LYS B CD    1 
ATOM 5186  C CE    . LYS D 4 20  ? 7.075   129.907 -17.495 1.00 33.58  ? 20  LYS B CE    1 
ATOM 5187  N NZ    . LYS D 4 20  ? 6.686   129.679 -18.923 1.00 36.30  ? 20  LYS B NZ    1 
ATOM 5188  N N     . VAL D 4 21  ? 5.682   131.489 -10.553 1.00 8.67   ? 21  VAL B N     1 
ATOM 5189  C CA    . VAL D 4 21  ? 5.850   132.486 -9.529  1.00 6.49   ? 21  VAL B CA    1 
ATOM 5190  C C     . VAL D 4 21  ? 7.298   132.730 -9.288  1.00 6.32   ? 21  VAL B C     1 
ATOM 5191  O O     . VAL D 4 21  ? 8.099   131.817 -9.408  1.00 7.81   ? 21  VAL B O     1 
ATOM 5192  C CB    . VAL D 4 21  ? 5.325   131.970 -8.252  1.00 6.88   ? 21  VAL B CB    1 
ATOM 5193  C CG1   . VAL D 4 21  ? 5.587   132.963 -7.146  1.00 6.58   ? 21  VAL B CG1   1 
ATOM 5194  C CG2   . VAL D 4 21  ? 3.856   131.666 -8.416  1.00 11.00  ? 21  VAL B CG2   1 
ATOM 5195  N N     . LYS D 4 22  ? 7.616   133.931 -8.833  1.00 7.31   ? 22  LYS B N     1 
ATOM 5196  C CA    . LYS D 4 22  ? 8.998   134.285 -8.556  1.00 10.31  ? 22  LYS B CA    1 
ATOM 5197  C C     . LYS D 4 22  ? 9.387   134.151 -7.082  1.00 9.00   ? 22  LYS B C     1 
ATOM 5198  O O     . LYS D 4 22  ? 8.523   134.127 -6.205  1.00 8.77   ? 22  LYS B O     1 
ATOM 5199  C CB    . LYS D 4 22  ? 9.300   135.685 -9.078  1.00 15.30  ? 22  LYS B CB    1 
ATOM 5200  C CG    . LYS D 4 22  ? 10.745  136.071 -8.911  1.00 20.96  ? 22  LYS B CG    1 
ATOM 5201  C CD    . LYS D 4 22  ? 11.643  134.951 -9.444  1.00 25.44  ? 22  LYS B CD    1 
ATOM 5202  C CE    . LYS D 4 22  ? 13.021  135.044 -8.856  1.00 27.01  ? 22  LYS B CE    1 
ATOM 5203  N NZ    . LYS D 4 22  ? 12.884  135.335 -7.411  1.00 26.93  ? 22  LYS B NZ    1 
ATOM 5204  N N     . GLN D 4 23  ? 10.693  134.069 -6.826  1.00 7.03   ? 23  GLN B N     1 
ATOM 5205  C CA    . GLN D 4 23  ? 11.207  133.891 -5.477  1.00 8.21   ? 23  GLN B CA    1 
ATOM 5206  C C     . GLN D 4 23  ? 11.642  135.138 -4.752  1.00 6.77   ? 23  GLN B C     1 
ATOM 5207  O O     . GLN D 4 23  ? 12.758  135.627 -4.923  1.00 6.24   ? 23  GLN B O     1 
ATOM 5208  C CB    . GLN D 4 23  ? 12.358  132.867 -5.467  1.00 9.74   ? 23  GLN B CB    1 
ATOM 5209  C CG    . GLN D 4 23  ? 13.004  132.577 -4.089  1.00 12.32  ? 23  GLN B CG    1 
ATOM 5210  C CD    . GLN D 4 23  ? 12.171  131.656 -3.149  1.00 16.94  ? 23  GLN B CD    1 
ATOM 5211  O OE1   . GLN D 4 23  ? 11.251  130.949 -3.570  1.00 17.02  ? 23  GLN B OE1   1 
ATOM 5212  N NE2   . GLN D 4 23  ? 12.534  131.651 -1.871  1.00 19.46  ? 23  GLN B NE2   1 
ATOM 5213  N N     . TRP D 4 24  ? 10.783  135.601 -3.864  1.00 5.66   ? 24  TRP B N     1 
ATOM 5214  C CA    . TRP D 4 24  ? 11.131  136.757 -3.091  1.00 7.17   ? 24  TRP B CA    1 
ATOM 5215  C C     . TRP D 4 24  ? 12.431  136.501 -2.352  1.00 7.68   ? 24  TRP B C     1 
ATOM 5216  O O     . TRP D 4 24  ? 12.797  135.372 -2.080  1.00 6.54   ? 24  TRP B O     1 
ATOM 5217  C CB    . TRP D 4 24  ? 10.024  137.083 -2.112  1.00 10.54  ? 24  TRP B CB    1 
ATOM 5218  C CG    . TRP D 4 24  ? 9.594   135.975 -1.253  1.00 9.26   ? 24  TRP B CG    1 
ATOM 5219  C CD1   . TRP D 4 24  ? 10.176  135.567 -0.094  1.00 11.69  ? 24  TRP B CD1   1 
ATOM 5220  C CD2   . TRP D 4 24  ? 8.407   135.198 -1.408  1.00 9.86   ? 24  TRP B CD2   1 
ATOM 5221  N NE1   . TRP D 4 24  ? 9.409   134.592 0.503   1.00 12.66  ? 24  TRP B NE1   1 
ATOM 5222  C CE2   . TRP D 4 24  ? 8.317   134.343 -0.287  1.00 10.64  ? 24  TRP B CE2   1 
ATOM 5223  C CE3   . TRP D 4 24  ? 7.407   135.141 -2.381  1.00 9.92   ? 24  TRP B CE3   1 
ATOM 5224  C CZ2   . TRP D 4 24  ? 7.264   133.440 -0.112  1.00 8.75   ? 24  TRP B CZ2   1 
ATOM 5225  C CZ3   . TRP D 4 24  ? 6.363   134.247 -2.209  1.00 10.59  ? 24  TRP B CZ3   1 
ATOM 5226  C CH2   . TRP D 4 24  ? 6.301   133.405 -1.079  1.00 9.04   ? 24  TRP B CH2   1 
ATOM 5227  N N     . PRO D 4 25  ? 13.137  137.559 -1.997  1.00 8.86   ? 25  PRO B N     1 
ATOM 5228  C CA    . PRO D 4 25  ? 14.392  137.370 -1.290  1.00 9.69   ? 25  PRO B CA    1 
ATOM 5229  C C     . PRO D 4 25  ? 14.105  136.706 0.039   1.00 10.58  ? 25  PRO B C     1 
ATOM 5230  O O     . PRO D 4 25  ? 12.942  136.599 0.454   1.00 7.12   ? 25  PRO B O     1 
ATOM 5231  C CB    . PRO D 4 25  ? 14.868  138.798 -1.055  1.00 11.99  ? 25  PRO B CB    1 
ATOM 5232  C CG    . PRO D 4 25  ? 14.011  139.635 -1.984  1.00 11.49  ? 25  PRO B CG    1 
ATOM 5233  C CD    . PRO D 4 25  ? 12.713  138.959 -1.926  1.00 9.78   ? 25  PRO B CD    1 
ATOM 5234  N N     . LEU D 4 26  ? 15.190  136.315 0.708   1.00 13.03  ? 26  LEU B N     1 
ATOM 5235  C CA    . LEU D 4 26  ? 15.156  135.645 2.013   1.00 15.38  ? 26  LEU B CA    1 
ATOM 5236  C C     . LEU D 4 26  ? 16.389  136.061 2.781   1.00 15.34  ? 26  LEU B C     1 
ATOM 5237  O O     . LEU D 4 26  ? 17.393  136.384 2.169   1.00 16.31  ? 26  LEU B O     1 
ATOM 5238  C CB    . LEU D 4 26  ? 15.188  134.130 1.826   1.00 17.49  ? 26  LEU B CB    1 
ATOM 5239  C CG    . LEU D 4 26  ? 13.969  133.538 1.104   1.00 20.84  ? 26  LEU B CG    1 
ATOM 5240  C CD1   . LEU D 4 26  ? 14.253  132.128 0.589   1.00 19.95  ? 26  LEU B CD1   1 
ATOM 5241  C CD2   . LEU D 4 26  ? 12.760  133.562 2.044   1.00 22.49  ? 26  LEU B CD2   1 
ATOM 5242  N N     . THR D 4 27  ? 16.312  136.059 4.109   1.00 16.31  ? 27  THR B N     1 
ATOM 5243  C CA    . THR D 4 27  ? 17.439  136.448 4.963   1.00 18.66  ? 27  THR B CA    1 
ATOM 5244  C C     . THR D 4 27  ? 18.549  135.397 5.028   1.00 21.91  ? 27  THR B C     1 
ATOM 5245  O O     . THR D 4 27  ? 18.329  134.238 4.695   1.00 23.17  ? 27  THR B O     1 
ATOM 5246  C CB    . THR D 4 27  ? 16.950  136.771 6.401   1.00 18.55  ? 27  THR B CB    1 
ATOM 5247  O OG1   . THR D 4 27  ? 18.014  136.612 7.348   1.00 17.51  ? 27  THR B OG1   1 
ATOM 5248  C CG2   . THR D 4 27  ? 15.800  135.865 6.785   1.00 18.96  ? 27  THR B CG2   1 
ATOM 5249  N N     . GLU D 4 28  ? 19.745  135.818 5.441   1.00 25.59  ? 28  GLU B N     1 
ATOM 5250  C CA    . GLU D 4 28  ? 20.913  134.926 5.586   1.00 29.56  ? 28  GLU B CA    1 
ATOM 5251  C C     . GLU D 4 28  ? 20.501  133.719 6.408   1.00 29.43  ? 28  GLU B C     1 
ATOM 5252  O O     . GLU D 4 28  ? 20.569  132.555 5.969   1.00 27.12  ? 28  GLU B O     1 
ATOM 5253  C CB    . GLU D 4 28  ? 22.031  135.670 6.339   1.00 33.39  ? 28  GLU B CB    1 
ATOM 5254  C CG    . GLU D 4 28  ? 23.137  134.774 6.928   1.00 38.60  ? 28  GLU B CG    1 
ATOM 5255  C CD    . GLU D 4 28  ? 24.458  135.522 7.199   1.00 42.80  ? 28  GLU B CD    1 
ATOM 5256  O OE1   . GLU D 4 28  ? 25.076  136.011 6.222   1.00 43.86  ? 28  GLU B OE1   1 
ATOM 5257  O OE2   . GLU D 4 28  ? 24.895  135.601 8.377   1.00 45.87  ? 28  GLU B OE2   1 
ATOM 5258  N N     . GLU D 4 29  ? 20.062  134.067 7.614   1.00 30.46  ? 29  GLU B N     1 
ATOM 5259  C CA    . GLU D 4 29  ? 19.567  133.170 8.644   1.00 31.70  ? 29  GLU B CA    1 
ATOM 5260  C C     . GLU D 4 29  ? 18.645  132.113 8.034   1.00 30.22  ? 29  GLU B C     1 
ATOM 5261  O O     . GLU D 4 29  ? 18.516  131.005 8.559   1.00 30.61  ? 29  GLU B O     1 
ATOM 5262  C CB    . GLU D 4 29  ? 18.798  134.011 9.664   1.00 34.78  ? 29  GLU B CB    1 
ATOM 5263  C CG    . GLU D 4 29  ? 18.311  133.277 10.891  1.00 40.32  ? 29  GLU B CG    1 
ATOM 5264  C CD    . GLU D 4 29  ? 17.114  133.970 11.551  1.00 45.80  ? 29  GLU B CD    1 
ATOM 5265  O OE1   . GLU D 4 29  ? 16.601  133.422 12.558  1.00 48.13  ? 29  GLU B OE1   1 
ATOM 5266  O OE2   . GLU D 4 29  ? 16.682  135.050 11.057  1.00 48.57  ? 29  GLU B OE2   1 
ATOM 5267  N N     . LYS D 4 30  ? 17.995  132.473 6.933   1.00 27.52  ? 30  LYS B N     1 
ATOM 5268  C CA    . LYS D 4 30  ? 17.103  131.551 6.253   1.00 26.14  ? 30  LYS B CA    1 
ATOM 5269  C C     . LYS D 4 30  ? 17.860  130.742 5.218   1.00 24.04  ? 30  LYS B C     1 
ATOM 5270  O O     . LYS D 4 30  ? 17.822  129.513 5.239   1.00 23.11  ? 30  LYS B O     1 
ATOM 5271  C CB    . LYS D 4 30  ? 15.942  132.294 5.565   1.00 27.90  ? 30  LYS B CB    1 
ATOM 5272  C CG    . LYS D 4 30  ? 14.755  132.661 6.467   1.00 29.69  ? 30  LYS B CG    1 
ATOM 5273  C CD    . LYS D 4 30  ? 13.464  132.888 5.669   1.00 30.57  ? 30  LYS B CD    1 
ATOM 5274  C CE    . LYS D 4 30  ? 12.268  133.105 6.601   1.00 31.27  ? 30  LYS B CE    1 
ATOM 5275  N NZ    . LYS D 4 30  ? 10.946  133.037 5.899   1.00 31.74  ? 30  LYS B NZ    1 
ATOM 5276  N N     . ILE D 4 31  ? 18.572  131.435 4.335   1.00 22.23  ? 31  ILE B N     1 
ATOM 5277  C CA    . ILE D 4 31  ? 19.290  130.767 3.269   1.00 20.16  ? 31  ILE B CA    1 
ATOM 5278  C C     . ILE D 4 31  ? 20.010  129.551 3.798   1.00 20.63  ? 31  ILE B C     1 
ATOM 5279  O O     . ILE D 4 31  ? 19.606  128.420 3.524   1.00 19.15  ? 31  ILE B O     1 
ATOM 5280  C CB    . ILE D 4 31  ? 20.328  131.666 2.590   1.00 18.29  ? 31  ILE B CB    1 
ATOM 5281  C CG1   . ILE D 4 31  ? 19.748  133.035 2.270   1.00 18.19  ? 31  ILE B CG1   1 
ATOM 5282  C CG2   . ILE D 4 31  ? 20.766  131.026 1.290   1.00 17.25  ? 31  ILE B CG2   1 
ATOM 5283  C CD1   . ILE D 4 31  ? 20.553  133.781 1.220   1.00 19.42  ? 31  ILE B CD1   1 
ATOM 5284  N N     . LYS D 4 32  ? 20.999  129.800 4.651   1.00 21.39  ? 32  LYS B N     1 
ATOM 5285  C CA    . LYS D 4 32  ? 21.806  128.734 5.213   1.00 21.05  ? 32  LYS B CA    1 
ATOM 5286  C C     . LYS D 4 32  ? 20.961  127.536 5.542   1.00 16.49  ? 32  LYS B C     1 
ATOM 5287  O O     . LYS D 4 32  ? 21.100  126.477 4.933   1.00 14.67  ? 32  LYS B O     1 
ATOM 5288  C CB    . LYS D 4 32  ? 22.548  129.208 6.463   1.00 28.20  ? 32  LYS B CB    1 
ATOM 5289  C CG    . LYS D 4 32  ? 23.415  128.100 7.109   1.00 37.54  ? 32  LYS B CG    1 
ATOM 5290  C CD    . LYS D 4 32  ? 24.600  128.635 7.965   1.00 43.87  ? 32  LYS B CD    1 
ATOM 5291  C CE    . LYS D 4 32  ? 25.435  127.490 8.599   1.00 46.16  ? 32  LYS B CE    1 
ATOM 5292  N NZ    . LYS D 4 32  ? 26.675  127.966 9.308   1.00 47.68  ? 32  LYS B NZ    1 
ATOM 5293  N N     . ALA D 4 33  ? 20.028  127.739 6.455   1.00 13.08  ? 33  ALA B N     1 
ATOM 5294  C CA    . ALA D 4 33  ? 19.162  126.658 6.849   1.00 12.36  ? 33  ALA B CA    1 
ATOM 5295  C C     . ALA D 4 33  ? 18.543  126.027 5.607   1.00 11.47  ? 33  ALA B C     1 
ATOM 5296  O O     . ALA D 4 33  ? 18.930  124.928 5.215   1.00 12.16  ? 33  ALA B O     1 
ATOM 5297  C CB    . ALA D 4 33  ? 18.083  127.161 7.819   1.00 12.81  ? 33  ALA B CB    1 
ATOM 5298  N N     . LEU D 4 34  ? 17.688  126.783 4.924   1.00 10.98  ? 34  LEU B N     1 
ATOM 5299  C CA    . LEU D 4 34  ? 16.996  126.314 3.730   1.00 9.75   ? 34  LEU B CA    1 
ATOM 5300  C C     . LEU D 4 34  ? 17.906  125.523 2.816   1.00 10.16  ? 34  LEU B C     1 
ATOM 5301  O O     . LEU D 4 34  ? 17.493  124.571 2.157   1.00 8.31   ? 34  LEU B O     1 
ATOM 5302  C CB    . LEU D 4 34  ? 16.434  127.492 2.969   1.00 9.50   ? 34  LEU B CB    1 
ATOM 5303  C CG    . LEU D 4 34  ? 15.373  126.968 2.029   1.00 9.62   ? 34  LEU B CG    1 
ATOM 5304  C CD1   . LEU D 4 34  ? 14.159  126.537 2.840   1.00 10.14  ? 34  LEU B CD1   1 
ATOM 5305  C CD2   . LEU D 4 34  ? 15.000  128.037 1.042   1.00 13.53  ? 34  LEU B CD2   1 
ATOM 5306  N N     . VAL D 4 35  ? 19.165  125.931 2.812   1.00 11.72  ? 35  VAL B N     1 
ATOM 5307  C CA    . VAL D 4 35  ? 20.181  125.279 2.024   1.00 13.04  ? 35  VAL B CA    1 
ATOM 5308  C C     . VAL D 4 35  ? 20.394  123.875 2.570   1.00 12.82  ? 35  VAL B C     1 
ATOM 5309  O O     . VAL D 4 35  ? 20.019  122.902 1.926   1.00 10.32  ? 35  VAL B O     1 
ATOM 5310  C CB    . VAL D 4 35  ? 21.497  126.073 2.079   1.00 14.02  ? 35  VAL B CB    1 
ATOM 5311  C CG1   . VAL D 4 35  ? 22.557  125.365 1.270   1.00 17.00  ? 35  VAL B CG1   1 
ATOM 5312  C CG2   . VAL D 4 35  ? 21.290  127.480 1.539   1.00 11.78  ? 35  VAL B CG2   1 
ATOM 5313  N N     . GLU D 4 36  ? 20.955  123.796 3.778   1.00 15.17  ? 36  GLU B N     1 
ATOM 5314  C CA    . GLU D 4 36  ? 21.231  122.531 4.462   1.00 18.10  ? 36  GLU B CA    1 
ATOM 5315  C C     . GLU D 4 36  ? 20.113  121.543 4.219   1.00 16.60  ? 36  GLU B C     1 
ATOM 5316  O O     . GLU D 4 36  ? 20.248  120.584 3.465   1.00 15.98  ? 36  GLU B O     1 
ATOM 5317  C CB    . GLU D 4 36  ? 21.327  122.753 5.974   1.00 22.81  ? 36  GLU B CB    1 
ATOM 5318  C CG    . GLU D 4 36  ? 22.680  122.410 6.608   1.00 33.89  ? 36  GLU B CG    1 
ATOM 5319  C CD    . GLU D 4 36  ? 23.483  123.656 7.035   1.00 40.10  ? 36  GLU B CD    1 
ATOM 5320  O OE1   . GLU D 4 36  ? 23.756  124.518 6.160   1.00 43.32  ? 36  GLU B OE1   1 
ATOM 5321  O OE2   . GLU D 4 36  ? 23.833  123.773 8.244   1.00 42.59  ? 36  GLU B OE2   1 
ATOM 5322  N N     . ILE D 4 37  ? 18.982  121.823 4.840   1.00 15.64  ? 37  ILE B N     1 
ATOM 5323  C CA    . ILE D 4 37  ? 17.820  120.976 4.709   1.00 14.63  ? 37  ILE B CA    1 
ATOM 5324  C C     . ILE D 4 37  ? 17.542  120.659 3.258   1.00 12.89  ? 37  ILE B C     1 
ATOM 5325  O O     . ILE D 4 37  ? 17.118  119.566 2.907   1.00 11.29  ? 37  ILE B O     1 
ATOM 5326  C CB    . ILE D 4 37  ? 16.595  121.659 5.297   1.00 15.70  ? 37  ILE B CB    1 
ATOM 5327  C CG1   . ILE D 4 37  ? 15.324  120.900 4.872   1.00 19.58  ? 37  ILE B CG1   1 
ATOM 5328  C CG2   . ILE D 4 37  ? 16.577  123.115 4.873   1.00 14.09  ? 37  ILE B CG2   1 
ATOM 5329  C CD1   . ILE D 4 37  ? 14.036  121.238 5.669   1.00 22.98  ? 37  ILE B CD1   1 
ATOM 5330  N N     . CYS D 4 38  ? 17.800  121.610 2.392   1.00 13.45  ? 38  CYS B N     1 
ATOM 5331  C CA    . CYS D 4 38  ? 17.518  121.321 1.021   1.00 17.36  ? 38  CYS B CA    1 
ATOM 5332  C C     . CYS D 4 38  ? 18.529  120.356 0.437   1.00 16.14  ? 38  CYS B C     1 
ATOM 5333  O O     . CYS D 4 38  ? 18.180  119.496 -0.371  1.00 16.63  ? 38  CYS B O     1 
ATOM 5334  C CB    . CYS D 4 38  ? 17.469  122.596 0.205   1.00 21.66  ? 38  CYS B CB    1 
ATOM 5335  S SG    . CYS D 4 38  ? 16.612  122.358 -1.360  1.00 32.12  ? 38  CYS B SG    1 
ATOM 5336  N N     . THR D 4 39  ? 19.773  120.465 0.885   1.00 15.47  ? 39  THR B N     1 
ATOM 5337  C CA    . THR D 4 39  ? 20.818  119.611 0.353   1.00 14.75  ? 39  THR B CA    1 
ATOM 5338  C C     . THR D 4 39  ? 20.721  118.121 0.708   1.00 15.17  ? 39  THR B C     1 
ATOM 5339  O O     . THR D 4 39  ? 20.690  117.286 -0.194  1.00 13.38  ? 39  THR B O     1 
ATOM 5340  C CB    . THR D 4 39  ? 22.230  120.182 0.652   1.00 13.91  ? 39  THR B CB    1 
ATOM 5341  O OG1   . THR D 4 39  ? 23.160  119.629 -0.281  1.00 13.85  ? 39  THR B OG1   1 
ATOM 5342  C CG2   . THR D 4 39  ? 22.696  119.833 2.053   1.00 12.65  ? 39  THR B CG2   1 
ATOM 5343  N N     . GLU D 4 40  ? 20.611  117.775 1.991   1.00 16.03  ? 40  GLU B N     1 
ATOM 5344  C CA    . GLU D 4 40  ? 20.545  116.363 2.351   1.00 18.12  ? 40  GLU B CA    1 
ATOM 5345  C C     . GLU D 4 40  ? 19.299  115.679 1.809   1.00 19.00  ? 40  GLU B C     1 
ATOM 5346  O O     . GLU D 4 40  ? 19.206  114.464 1.824   1.00 20.31  ? 40  GLU B O     1 
ATOM 5347  C CB    . GLU D 4 40  ? 20.690  116.138 3.867   1.00 19.56  ? 40  GLU B CB    1 
ATOM 5348  C CG    . GLU D 4 40  ? 21.085  114.671 4.280   1.00 23.98  ? 40  GLU B CG    1 
ATOM 5349  C CD    . GLU D 4 40  ? 22.551  114.488 4.795   1.00 26.85  ? 40  GLU B CD    1 
ATOM 5350  O OE1   . GLU D 4 40  ? 23.230  113.483 4.408   1.00 24.58  ? 40  GLU B OE1   1 
ATOM 5351  O OE2   . GLU D 4 40  ? 22.998  115.331 5.620   1.00 25.92  ? 40  GLU B OE2   1 
ATOM 5352  N N     . MET D 4 41  ? 18.345  116.447 1.302   1.00 21.68  ? 41  MET B N     1 
ATOM 5353  C CA    . MET D 4 41  ? 17.137  115.844 0.732   1.00 25.00  ? 41  MET B CA    1 
ATOM 5354  C C     . MET D 4 41  ? 17.522  115.273 -0.625  1.00 25.60  ? 41  MET B C     1 
ATOM 5355  O O     . MET D 4 41  ? 16.936  114.308 -1.132  1.00 23.91  ? 41  MET B O     1 
ATOM 5356  C CB    . MET D 4 41  ? 16.035  116.890 0.586   1.00 28.61  ? 41  MET B CB    1 
ATOM 5357  C CG    . MET D 4 41  ? 15.175  117.053 1.825   1.00 30.79  ? 41  MET B CG    1 
ATOM 5358  S SD    . MET D 4 41  ? 13.845  118.215 1.530   1.00 37.24  ? 41  MET B SD    1 
ATOM 5359  C CE    . MET D 4 41  ? 12.752  117.291 0.415   1.00 34.43  ? 41  MET B CE    1 
ATOM 5360  N N     . GLU D 4 42  ? 18.515  115.930 -1.210  1.00 28.24  ? 42  GLU B N     1 
ATOM 5361  C CA    . GLU D 4 42  ? 19.095  115.540 -2.476  1.00 31.00  ? 42  GLU B CA    1 
ATOM 5362  C C     . GLU D 4 42  ? 19.782  114.202 -2.172  1.00 30.64  ? 42  GLU B C     1 
ATOM 5363  O O     . GLU D 4 42  ? 19.489  113.186 -2.814  1.00 32.01  ? 42  GLU B O     1 
ATOM 5364  C CB    . GLU D 4 42  ? 20.110  116.614 -2.913  1.00 35.88  ? 42  GLU B CB    1 
ATOM 5365  C CG    . GLU D 4 42  ? 21.420  116.113 -3.554  1.00 40.40  ? 42  GLU B CG    1 
ATOM 5366  C CD    . GLU D 4 42  ? 21.452  116.236 -5.087  1.00 43.99  ? 42  GLU B CD    1 
ATOM 5367  O OE1   . GLU D 4 42  ? 20.747  115.442 -5.769  1.00 44.66  ? 42  GLU B OE1   1 
ATOM 5368  O OE2   . GLU D 4 42  ? 22.201  117.112 -5.603  1.00 45.37  ? 42  GLU B OE2   1 
ATOM 5369  N N     . LYS D 4 43  ? 20.641  114.197 -1.147  1.00 28.28  ? 43  LYS B N     1 
ATOM 5370  C CA    . LYS D 4 43  ? 21.344  112.984 -0.743  1.00 25.69  ? 43  LYS B CA    1 
ATOM 5371  C C     . LYS D 4 43  ? 20.385  111.799 -0.621  1.00 24.70  ? 43  LYS B C     1 
ATOM 5372  O O     . LYS D 4 43  ? 20.406  110.929 -1.481  1.00 24.40  ? 43  LYS B O     1 
ATOM 5373  C CB    . LYS D 4 43  ? 22.131  113.192 0.561   1.00 25.84  ? 43  LYS B CB    1 
ATOM 5374  C CG    . LYS D 4 43  ? 23.472  113.928 0.382   1.00 26.53  ? 43  LYS B CG    1 
ATOM 5375  C CD    . LYS D 4 43  ? 24.262  114.013 1.705   1.00 26.42  ? 43  LYS B CD    1 
ATOM 5376  C CE    . LYS D 4 43  ? 25.570  114.829 1.602   1.00 24.98  ? 43  LYS B CE    1 
ATOM 5377  N NZ    . LYS D 4 43  ? 26.295  114.940 2.919   1.00 23.63  ? 43  LYS B NZ    1 
ATOM 5378  N N     . GLU D 4 44  ? 19.493  111.799 0.372   1.00 23.99  ? 44  GLU B N     1 
ATOM 5379  C CA    . GLU D 4 44  ? 18.554  110.688 0.548   1.00 23.33  ? 44  GLU B CA    1 
ATOM 5380  C C     . GLU D 4 44  ? 17.912  110.277 -0.758  1.00 21.47  ? 44  GLU B C     1 
ATOM 5381  O O     . GLU D 4 44  ? 17.513  109.131 -0.919  1.00 20.48  ? 44  GLU B O     1 
ATOM 5382  C CB    . GLU D 4 44  ? 17.473  111.016 1.572   1.00 26.21  ? 44  GLU B CB    1 
ATOM 5383  C CG    . GLU D 4 44  ? 17.885  110.817 3.036   1.00 32.69  ? 44  GLU B CG    1 
ATOM 5384  C CD    . GLU D 4 44  ? 18.009  112.138 3.823   1.00 37.03  ? 44  GLU B CD    1 
ATOM 5385  O OE1   . GLU D 4 44  ? 17.180  113.058 3.599   1.00 38.68  ? 44  GLU B OE1   1 
ATOM 5386  O OE2   . GLU D 4 44  ? 18.935  112.255 4.667   1.00 37.10  ? 44  GLU B OE2   1 
ATOM 5387  N N     . GLY D 4 45  ? 17.844  111.213 -1.698  1.00 19.72  ? 45  GLY B N     1 
ATOM 5388  C CA    . GLY D 4 45  ? 17.288  110.911 -3.003  1.00 19.82  ? 45  GLY B CA    1 
ATOM 5389  C C     . GLY D 4 45  ? 15.976  111.599 -3.287  1.00 20.27  ? 45  GLY B C     1 
ATOM 5390  O O     . GLY D 4 45  ? 15.489  111.624 -4.425  1.00 20.89  ? 45  GLY B O     1 
ATOM 5391  N N     . LYS D 4 46  ? 15.455  112.234 -2.249  1.00 19.44  ? 46  LYS B N     1 
ATOM 5392  C CA    . LYS D 4 46  ? 14.180  112.927 -2.296  1.00 18.27  ? 46  LYS B CA    1 
ATOM 5393  C C     . LYS D 4 46  ? 14.029  113.992 -3.373  1.00 15.45  ? 46  LYS B C     1 
ATOM 5394  O O     . LYS D 4 46  ? 13.040  114.009 -4.118  1.00 12.51  ? 46  LYS B O     1 
ATOM 5395  C CB    . LYS D 4 46  ? 13.911  113.489 -0.899  1.00 22.08  ? 46  LYS B CB    1 
ATOM 5396  C CG    . LYS D 4 46  ? 13.828  112.349 0.154   1.00 27.27  ? 46  LYS B CG    1 
ATOM 5397  C CD    . LYS D 4 46  ? 14.145  112.750 1.618   1.00 29.77  ? 46  LYS B CD    1 
ATOM 5398  C CE    . LYS D 4 46  ? 14.073  111.523 2.564   1.00 27.85  ? 46  LYS B CE    1 
ATOM 5399  N NZ    . LYS D 4 46  ? 14.530  111.768 3.974   1.00 26.71  ? 46  LYS B NZ    1 
ATOM 5400  N N     . ILE D 4 47  ? 15.056  114.825 -3.490  1.00 13.96  ? 47  ILE B N     1 
ATOM 5401  C CA    . ILE D 4 47  ? 15.075  115.922 -4.444  1.00 12.71  ? 47  ILE B CA    1 
ATOM 5402  C C     . ILE D 4 47  ? 16.241  115.808 -5.408  1.00 13.73  ? 47  ILE B C     1 
ATOM 5403  O O     . ILE D 4 47  ? 17.309  115.329 -5.022  1.00 13.61  ? 47  ILE B O     1 
ATOM 5404  C CB    . ILE D 4 47  ? 15.246  117.231 -3.696  1.00 10.57  ? 47  ILE B CB    1 
ATOM 5405  C CG1   . ILE D 4 47  ? 14.081  117.437 -2.735  1.00 10.42  ? 47  ILE B CG1   1 
ATOM 5406  C CG2   . ILE D 4 47  ? 15.381  118.359 -4.651  1.00 9.05   ? 47  ILE B CG2   1 
ATOM 5407  C CD1   . ILE D 4 47  ? 12.730  117.397 -3.388  1.00 8.63   ? 47  ILE B CD1   1 
ATOM 5408  N N     . SER D 4 48  ? 16.049  116.288 -6.640  1.00 13.52  ? 48  SER B N     1 
ATOM 5409  C CA    . SER D 4 48  ? 17.105  116.264 -7.665  1.00 14.29  ? 48  SER B CA    1 
ATOM 5410  C C     . SER D 4 48  ? 17.382  117.649 -8.241  1.00 14.11  ? 48  SER B C     1 
ATOM 5411  O O     . SER D 4 48  ? 16.456  118.424 -8.464  1.00 16.55  ? 48  SER B O     1 
ATOM 5412  C CB    . SER D 4 48  ? 16.732  115.320 -8.802  1.00 14.64  ? 48  SER B CB    1 
ATOM 5413  O OG    . SER D 4 48  ? 16.600  114.001 -8.320  1.00 16.20  ? 48  SER B OG    1 
ATOM 5414  N N     . LYS D 4 49  ? 18.647  117.962 -8.510  1.00 13.46  ? 49  LYS B N     1 
ATOM 5415  C CA    . LYS D 4 49  ? 18.980  119.280 -9.054  1.00 14.02  ? 49  LYS B CA    1 
ATOM 5416  C C     . LYS D 4 49  ? 18.456  119.354 -10.476 1.00 14.57  ? 49  LYS B C     1 
ATOM 5417  O O     . LYS D 4 49  ? 18.120  118.320 -11.048 1.00 16.13  ? 49  LYS B O     1 
ATOM 5418  C CB    . LYS D 4 49  ? 20.504  119.512 -9.067  1.00 13.27  ? 49  LYS B CB    1 
ATOM 5419  C CG    . LYS D 4 49  ? 21.197  119.198 -7.729  1.00 17.95  ? 49  LYS B CG    1 
ATOM 5420  C CD    . LYS D 4 49  ? 22.205  120.252 -7.279  1.00 18.68  ? 49  LYS B CD    1 
ATOM 5421  C CE    . LYS D 4 49  ? 23.565  120.072 -7.915  1.00 21.27  ? 49  LYS B CE    1 
ATOM 5422  N NZ    . LYS D 4 49  ? 24.391  121.271 -7.604  1.00 21.42  ? 49  LYS B NZ    1 
ATOM 5423  N N     . ILE D 4 50  ? 18.230  120.569 -10.973 1.00 14.62  ? 50  ILE B N     1 
ATOM 5424  C CA    . ILE D 4 50  ? 17.824  120.802 -12.375 1.00 14.27  ? 50  ILE B CA    1 
ATOM 5425  C C     . ILE D 4 50  ? 18.329  122.172 -12.740 1.00 16.24  ? 50  ILE B C     1 
ATOM 5426  O O     . ILE D 4 50  ? 18.785  122.937 -11.878 1.00 16.07  ? 50  ILE B O     1 
ATOM 5427  C CB    . ILE D 4 50  ? 16.300  120.792 -12.710 1.00 9.39   ? 50  ILE B CB    1 
ATOM 5428  C CG1   . ILE D 4 50  ? 15.536  121.741 -11.815 1.00 7.93   ? 50  ILE B CG1   1 
ATOM 5429  C CG2   . ILE D 4 50  ? 15.758  119.404 -12.695 1.00 11.56  ? 50  ILE B CG2   1 
ATOM 5430  C CD1   . ILE D 4 50  ? 15.503  121.297 -10.413 1.00 4.07   ? 50  ILE B CD1   1 
ATOM 5431  N N     . GLY D 4 51  ? 18.268  122.468 -14.030 1.00 17.99  ? 51  GLY B N     1 
ATOM 5432  C CA    . GLY D 4 51  ? 18.716  123.754 -14.490 1.00 17.26  ? 51  GLY B CA    1 
ATOM 5433  C C     . GLY D 4 51  ? 17.627  124.532 -15.193 1.00 16.94  ? 51  GLY B C     1 
ATOM 5434  O O     . GLY D 4 51  ? 16.449  124.157 -15.261 1.00 15.17  ? 51  GLY B O     1 
ATOM 5435  N N     . PRO D 4 52  ? 18.041  125.655 -15.751 1.00 17.48  ? 52  PRO B N     1 
ATOM 5436  C CA    . PRO D 4 52  ? 17.227  126.597 -16.491 1.00 15.49  ? 52  PRO B CA    1 
ATOM 5437  C C     . PRO D 4 52  ? 16.201  125.906 -17.345 1.00 12.84  ? 52  PRO B C     1 
ATOM 5438  O O     . PRO D 4 52  ? 15.040  126.264 -17.281 1.00 12.00  ? 52  PRO B O     1 
ATOM 5439  C CB    . PRO D 4 52  ? 18.266  127.305 -17.339 1.00 18.42  ? 52  PRO B CB    1 
ATOM 5440  C CG    . PRO D 4 52  ? 19.416  127.467 -16.343 1.00 18.72  ? 52  PRO B CG    1 
ATOM 5441  C CD    . PRO D 4 52  ? 19.434  126.126 -15.639 1.00 18.45  ? 52  PRO B CD    1 
ATOM 5442  N N     . GLU D 4 53  ? 16.611  124.864 -18.063 1.00 11.83  ? 53  GLU B N     1 
ATOM 5443  C CA    . GLU D 4 53  ? 15.704  124.142 -18.961 1.00 13.33  ? 53  GLU B CA    1 
ATOM 5444  C C     . GLU D 4 53  ? 14.240  124.017 -18.486 1.00 13.47  ? 53  GLU B C     1 
ATOM 5445  O O     . GLU D 4 53  ? 13.312  123.996 -19.304 1.00 12.49  ? 53  GLU B O     1 
ATOM 5446  C CB    . GLU D 4 53  ? 16.291  122.780 -19.385 1.00 13.28  ? 53  GLU B CB    1 
ATOM 5447  C CG    . GLU D 4 53  ? 16.331  121.690 -18.319 1.00 13.33  ? 53  GLU B CG    1 
ATOM 5448  C CD    . GLU D 4 53  ? 17.173  122.053 -17.114 1.00 13.50  ? 53  GLU B CD    1 
ATOM 5449  O OE1   . GLU D 4 53  ? 18.259  122.669 -17.278 1.00 11.42  ? 53  GLU B OE1   1 
ATOM 5450  O OE2   . GLU D 4 53  ? 16.728  121.711 -15.996 1.00 12.12  ? 53  GLU B OE2   1 
ATOM 5451  N N     . ASN D 4 54  ? 14.031  123.982 -17.171 1.00 12.71  ? 54  ASN B N     1 
ATOM 5452  C CA    . ASN D 4 54  ? 12.682  123.909 -16.631 1.00 11.48  ? 54  ASN B CA    1 
ATOM 5453  C C     . ASN D 4 54  ? 12.063  125.300 -16.564 1.00 11.94  ? 54  ASN B C     1 
ATOM 5454  O O     . ASN D 4 54  ? 12.490  126.146 -15.777 1.00 12.76  ? 54  ASN B O     1 
ATOM 5455  C CB    . ASN D 4 54  ? 12.682  123.318 -15.230 1.00 10.74  ? 54  ASN B CB    1 
ATOM 5456  C CG    . ASN D 4 54  ? 11.287  123.262 -14.617 1.00 12.05  ? 54  ASN B CG    1 
ATOM 5457  O OD1   . ASN D 4 54  ? 10.336  123.881 -15.112 1.00 11.67  ? 54  ASN B OD1   1 
ATOM 5458  N ND2   . ASN D 4 54  ? 11.156  122.506 -13.534 1.00 13.79  ? 54  ASN B ND2   1 
ATOM 5459  N N     . PRO D 4 55  ? 10.986  125.521 -17.327 1.00 11.41  ? 55  PRO B N     1 
ATOM 5460  C CA    . PRO D 4 55  ? 10.268  126.794 -17.382 1.00 9.28   ? 55  PRO B CA    1 
ATOM 5461  C C     . PRO D 4 55  ? 9.516   127.095 -16.104 1.00 8.52   ? 55  PRO B C     1 
ATOM 5462  O O     . PRO D 4 55  ? 9.544   128.220 -15.639 1.00 8.99   ? 55  PRO B O     1 
ATOM 5463  C CB    . PRO D 4 55  ? 9.294   126.574 -18.518 1.00 9.19   ? 55  PRO B CB    1 
ATOM 5464  C CG    . PRO D 4 55  ? 8.989   125.136 -18.412 1.00 9.36   ? 55  PRO B CG    1 
ATOM 5465  C CD    . PRO D 4 55  ? 10.337  124.519 -18.188 1.00 10.85  ? 55  PRO B CD    1 
ATOM 5466  N N     . TYR D 4 56  ? 8.846   126.085 -15.555 1.00 8.13   ? 56  TYR B N     1 
ATOM 5467  C CA    . TYR D 4 56  ? 8.060   126.192 -14.323 1.00 9.41   ? 56  TYR B CA    1 
ATOM 5468  C C     . TYR D 4 56  ? 8.857   126.602 -13.073 1.00 10.74  ? 56  TYR B C     1 
ATOM 5469  O O     . TYR D 4 56  ? 10.087  126.563 -13.100 1.00 11.76  ? 56  TYR B O     1 
ATOM 5470  C CB    . TYR D 4 56  ? 7.394   124.857 -14.071 1.00 10.51  ? 56  TYR B CB    1 
ATOM 5471  C CG    . TYR D 4 56  ? 6.468   124.460 -15.179 1.00 13.54  ? 56  TYR B CG    1 
ATOM 5472  C CD1   . TYR D 4 56  ? 5.091   124.550 -15.006 1.00 17.64  ? 56  TYR B CD1   1 
ATOM 5473  C CD2   . TYR D 4 56  ? 6.951   124.038 -16.413 1.00 12.61  ? 56  TYR B CD2   1 
ATOM 5474  C CE1   . TYR D 4 56  ? 4.208   124.237 -16.035 1.00 16.91  ? 56  TYR B CE1   1 
ATOM 5475  C CE2   . TYR D 4 56  ? 6.067   123.726 -17.464 1.00 13.90  ? 56  TYR B CE2   1 
ATOM 5476  C CZ    . TYR D 4 56  ? 4.689   123.830 -17.259 1.00 14.57  ? 56  TYR B CZ    1 
ATOM 5477  O OH    . TYR D 4 56  ? 3.766   123.549 -18.252 1.00 14.62  ? 56  TYR B OH    1 
ATOM 5478  N N     . ASN D 4 57  ? 8.158   127.003 -11.996 1.00 11.49  ? 57  ASN B N     1 
ATOM 5479  C CA    . ASN D 4 57  ? 8.785   127.424 -10.717 1.00 11.63  ? 57  ASN B CA    1 
ATOM 5480  C C     . ASN D 4 57  ? 7.830   127.919 -9.617  1.00 11.92  ? 57  ASN B C     1 
ATOM 5481  O O     . ASN D 4 57  ? 6.820   128.567 -9.909  1.00 13.22  ? 57  ASN B O     1 
ATOM 5482  C CB    . ASN D 4 57  ? 9.826   128.515 -10.931 1.00 10.69  ? 57  ASN B CB    1 
ATOM 5483  C CG    . ASN D 4 57  ? 10.543  128.881 -9.649  1.00 11.15  ? 57  ASN B CG    1 
ATOM 5484  O OD1   . ASN D 4 57  ? 11.536  128.244 -9.280  1.00 10.93  ? 57  ASN B OD1   1 
ATOM 5485  N ND2   . ASN D 4 57  ? 10.019  129.882 -8.936  1.00 9.40   ? 57  ASN B ND2   1 
ATOM 5486  N N     . THR D 4 58  ? 8.247   127.721 -8.359  1.00 10.21  ? 58  THR B N     1 
ATOM 5487  C CA    . THR D 4 58  ? 7.482   128.096 -7.162  1.00 8.67   ? 58  THR B CA    1 
ATOM 5488  C C     . THR D 4 58  ? 8.411   128.598 -6.049  1.00 7.78   ? 58  THR B C     1 
ATOM 5489  O O     . THR D 4 58  ? 9.613   128.429 -6.143  1.00 7.97   ? 58  THR B O     1 
ATOM 5490  C CB    . THR D 4 58  ? 6.675   126.886 -6.686  1.00 10.24  ? 58  THR B CB    1 
ATOM 5491  O OG1   . THR D 4 58  ? 5.752   126.504 -7.721  1.00 10.95  ? 58  THR B OG1   1 
ATOM 5492  C CG2   . THR D 4 58  ? 5.928   127.176 -5.383  1.00 9.15   ? 58  THR B CG2   1 
ATOM 5493  N N     . PRO D 4 59  ? 7.878   129.292 -5.024  1.00 8.56   ? 59  PRO B N     1 
ATOM 5494  C CA    . PRO D 4 59  ? 8.782   129.768 -3.977  1.00 9.43   ? 59  PRO B CA    1 
ATOM 5495  C C     . PRO D 4 59  ? 8.819   128.977 -2.702  1.00 8.71   ? 59  PRO B C     1 
ATOM 5496  O O     . PRO D 4 59  ? 7.819   128.399 -2.268  1.00 7.36   ? 59  PRO B O     1 
ATOM 5497  C CB    . PRO D 4 59  ? 8.286   131.189 -3.724  1.00 10.85  ? 59  PRO B CB    1 
ATOM 5498  C CG    . PRO D 4 59  ? 6.851   131.010 -3.775  1.00 11.57  ? 59  PRO B CG    1 
ATOM 5499  C CD    . PRO D 4 59  ? 6.653   130.111 -5.011  1.00 11.87  ? 59  PRO B CD    1 
ATOM 5500  N N     . VAL D 4 60  ? 9.963   129.094 -2.045  1.00 8.64   ? 60  VAL B N     1 
ATOM 5501  C CA    . VAL D 4 60  ? 10.232  128.382 -0.815  1.00 10.65  ? 60  VAL B CA    1 
ATOM 5502  C C     . VAL D 4 60  ? 10.849  129.255 0.258   1.00 10.60  ? 60  VAL B C     1 
ATOM 5503  O O     . VAL D 4 60  ? 11.424  130.291 -0.054  1.00 10.61  ? 60  VAL B O     1 
ATOM 5504  C CB    . VAL D 4 60  ? 11.230  127.228 -1.076  1.00 12.31  ? 60  VAL B CB    1 
ATOM 5505  C CG1   . VAL D 4 60  ? 10.518  126.044 -1.675  1.00 11.44  ? 60  VAL B CG1   1 
ATOM 5506  C CG2   . VAL D 4 60  ? 12.357  127.697 -2.020  1.00 11.22  ? 60  VAL B CG2   1 
ATOM 5507  N N     . PHE D 4 61  ? 10.741  128.826 1.517   1.00 10.19  ? 61  PHE B N     1 
ATOM 5508  C CA    . PHE D 4 61  ? 11.346  129.561 2.626   1.00 10.18  ? 61  PHE B CA    1 
ATOM 5509  C C     . PHE D 4 61  ? 11.391  128.875 3.978   1.00 10.44  ? 61  PHE B C     1 
ATOM 5510  O O     . PHE D 4 61  ? 10.514  128.082 4.359   1.00 7.66   ? 61  PHE B O     1 
ATOM 5511  C CB    . PHE D 4 61  ? 10.738  130.942 2.797   1.00 11.38  ? 61  PHE B CB    1 
ATOM 5512  C CG    . PHE D 4 61  ? 9.312   130.922 3.221   1.00 14.00  ? 61  PHE B CG    1 
ATOM 5513  C CD1   . PHE D 4 61  ? 8.936   131.454 4.447   1.00 14.57  ? 61  PHE B CD1   1 
ATOM 5514  C CD2   . PHE D 4 61  ? 8.330   130.393 2.384   1.00 14.28  ? 61  PHE B CD2   1 
ATOM 5515  C CE1   . PHE D 4 61  ? 7.593   131.466 4.836   1.00 16.50  ? 61  PHE B CE1   1 
ATOM 5516  C CE2   . PHE D 4 61  ? 6.977   130.398 2.759   1.00 14.54  ? 61  PHE B CE2   1 
ATOM 5517  C CZ    . PHE D 4 61  ? 6.607   130.932 3.979   1.00 15.14  ? 61  PHE B CZ    1 
ATOM 5518  N N     . ALA D 4 62  ? 12.433  129.252 4.710   1.00 11.69  ? 62  ALA B N     1 
ATOM 5519  C CA    . ALA D 4 62  ? 12.704  128.751 6.043   1.00 12.16  ? 62  ALA B CA    1 
ATOM 5520  C C     . ALA D 4 62  ? 11.637  129.271 6.959   1.00 12.80  ? 62  ALA B C     1 
ATOM 5521  O O     . ALA D 4 62  ? 10.772  130.041 6.546   1.00 14.41  ? 62  ALA B O     1 
ATOM 5522  C CB    . ALA D 4 62  ? 14.052  129.227 6.513   1.00 11.72  ? 62  ALA B CB    1 
ATOM 5523  N N     . ILE D 4 63  ? 11.709  128.854 8.211   1.00 12.00  ? 63  ILE B N     1 
ATOM 5524  C CA    . ILE D 4 63  ? 10.731  129.246 9.206   1.00 12.36  ? 63  ILE B CA    1 
ATOM 5525  C C     . ILE D 4 63  ? 11.202  128.678 10.538  1.00 15.02  ? 63  ILE B C     1 
ATOM 5526  O O     . ILE D 4 63  ? 10.814  127.583 10.951  1.00 14.43  ? 63  ILE B O     1 
ATOM 5527  C CB    . ILE D 4 63  ? 9.299   128.738 8.804   1.00 11.09  ? 63  ILE B CB    1 
ATOM 5528  C CG1   . ILE D 4 63  ? 8.444   128.471 10.045  1.00 13.08  ? 63  ILE B CG1   1 
ATOM 5529  C CG2   . ILE D 4 63  ? 9.369   127.530 7.870   1.00 9.28   ? 63  ILE B CG2   1 
ATOM 5530  C CD1   . ILE D 4 63  ? 7.080   127.833 9.765   1.00 14.20  ? 63  ILE B CD1   1 
ATOM 5531  N N     . LYS D 4 64  ? 12.071  129.417 11.207  1.00 18.14  ? 64  LYS B N     1 
ATOM 5532  C CA    . LYS D 4 64  ? 12.602  128.928 12.460  1.00 22.40  ? 64  LYS B CA    1 
ATOM 5533  C C     . LYS D 4 64  ? 11.515  128.534 13.456  1.00 24.42  ? 64  LYS B C     1 
ATOM 5534  O O     . LYS D 4 64  ? 11.033  129.370 14.215  1.00 25.53  ? 64  LYS B O     1 
ATOM 5535  C CB    . LYS D 4 64  ? 13.555  129.946 13.063  1.00 22.91  ? 64  LYS B CB    1 
ATOM 5536  C CG    . LYS D 4 64  ? 14.698  129.273 13.779  1.00 27.85  ? 64  LYS B CG    1 
ATOM 5537  C CD    . LYS D 4 64  ? 15.552  130.267 14.523  1.00 32.18  ? 64  LYS B CD    1 
ATOM 5538  C CE    . LYS D 4 64  ? 14.838  130.822 15.764  1.00 35.47  ? 64  LYS B CE    1 
ATOM 5539  N NZ    . LYS D 4 64  ? 13.633  131.668 15.468  1.00 34.65  ? 64  LYS B NZ    1 
ATOM 5540  N N     . LYS D 4 65  ? 11.113  127.265 13.429  1.00 26.24  ? 65  LYS B N     1 
ATOM 5541  C CA    . LYS D 4 65  ? 10.083  126.789 14.345  1.00 30.29  ? 65  LYS B CA    1 
ATOM 5542  C C     . LYS D 4 65  ? 10.662  126.479 15.735  1.00 32.45  ? 65  LYS B C     1 
ATOM 5543  O O     . LYS D 4 65  ? 11.705  125.819 15.848  1.00 33.31  ? 65  LYS B O     1 
ATOM 5544  C CB    . LYS D 4 65  ? 9.365   125.565 13.763  1.00 32.92  ? 65  LYS B CB    1 
ATOM 5545  C CG    . LYS D 4 65  ? 7.956   125.321 14.362  1.00 37.25  ? 65  LYS B CG    1 
ATOM 5546  C CD    . LYS D 4 65  ? 7.022   124.457 13.452  1.00 39.09  ? 65  LYS B CD    1 
ATOM 5547  C CE    . LYS D 4 65  ? 7.171   122.931 13.670  1.00 40.18  ? 65  LYS B CE    1 
ATOM 5548  N NZ    . LYS D 4 65  ? 6.154   122.089 12.939  1.00 38.93  ? 65  LYS B NZ    1 
ATOM 5549  N N     . LYS D 4 66  ? 9.981   126.958 16.783  1.00 33.80  ? 66  LYS B N     1 
ATOM 5550  C CA    . LYS D 4 66  ? 10.420  126.761 18.171  1.00 33.63  ? 66  LYS B CA    1 
ATOM 5551  C C     . LYS D 4 66  ? 10.221  125.329 18.624  1.00 32.44  ? 66  LYS B C     1 
ATOM 5552  O O     . LYS D 4 66  ? 9.151   124.969 19.140  1.00 31.58  ? 66  LYS B O     1 
ATOM 5553  C CB    . LYS D 4 66  ? 9.660   127.670 19.144  1.00 35.25  ? 66  LYS B CB    1 
ATOM 5554  C CG    . LYS D 4 66  ? 9.505   129.127 18.734  1.00 38.61  ? 66  LYS B CG    1 
ATOM 5555  C CD    . LYS D 4 66  ? 8.439   129.789 19.627  1.00 41.58  ? 66  LYS B CD    1 
ATOM 5556  C CE    . LYS D 4 66  ? 7.990   131.167 19.130  1.00 41.94  ? 66  LYS B CE    1 
ATOM 5557  N NZ    . LYS D 4 66  ? 6.808   131.673 19.898  1.00 42.00  ? 66  LYS B NZ    1 
ATOM 5558  N N     . ASP D 4 67  ? 11.256  124.519 18.421  1.00 31.41  ? 67  ASP B N     1 
ATOM 5559  C CA    . ASP D 4 67  ? 11.226  123.123 18.823  1.00 31.25  ? 67  ASP B CA    1 
ATOM 5560  C C     . ASP D 4 67  ? 12.516  122.391 18.490  1.00 29.54  ? 67  ASP B C     1 
ATOM 5561  O O     . ASP D 4 67  ? 13.377  122.935 17.811  1.00 26.97  ? 67  ASP B O     1 
ATOM 5562  C CB    . ASP D 4 67  ? 9.998   122.411 18.246  1.00 32.67  ? 67  ASP B CB    1 
ATOM 5563  C CG    . ASP D 4 67  ? 10.257  121.762 16.911  1.00 34.03  ? 67  ASP B CG    1 
ATOM 5564  O OD1   . ASP D 4 67  ? 10.698  122.451 15.956  1.00 33.46  ? 67  ASP B OD1   1 
ATOM 5565  O OD2   . ASP D 4 67  ? 9.997   120.543 16.837  1.00 34.47  ? 67  ASP B OD2   1 
ATOM 5566  N N     . SER D 4 68  ? 12.613  121.147 18.954  1.00 31.10  ? 68  SER B N     1 
ATOM 5567  C CA    . SER D 4 68  ? 13.800  120.306 18.777  1.00 32.80  ? 68  SER B CA    1 
ATOM 5568  C C     . SER D 4 68  ? 14.191  120.017 17.355  1.00 32.95  ? 68  SER B C     1 
ATOM 5569  O O     . SER D 4 68  ? 15.352  119.692 17.086  1.00 32.75  ? 68  SER B O     1 
ATOM 5570  C CB    . SER D 4 68  ? 13.694  118.999 19.572  1.00 33.94  ? 68  SER B CB    1 
ATOM 5571  O OG    . SER D 4 68  ? 12.462  118.354 19.343  1.00 33.85  ? 68  SER B OG    1 
ATOM 5572  N N     . THR D 4 69  ? 13.218  120.090 16.455  1.00 34.22  ? 69  THR B N     1 
ATOM 5573  C CA    . THR D 4 69  ? 13.493  119.889 15.038  1.00 35.66  ? 69  THR B CA    1 
ATOM 5574  C C     . THR D 4 69  ? 14.037  121.188 14.460  1.00 36.70  ? 69  THR B C     1 
ATOM 5575  O O     . THR D 4 69  ? 13.853  122.291 15.003  1.00 37.84  ? 69  THR B O     1 
ATOM 5576  C CB    . THR D 4 69  ? 12.224  119.467 14.228  1.00 35.23  ? 69  THR B CB    1 
ATOM 5577  O OG1   . THR D 4 69  ? 11.938  118.090 14.487  1.00 35.78  ? 69  THR B OG1   1 
ATOM 5578  C CG2   . THR D 4 69  ? 12.404  119.674 12.701  1.00 32.41  ? 69  THR B CG2   1 
ATOM 5579  N N     . LYS D 4 70  ? 14.756  121.025 13.369  1.00 37.58  ? 70  LYS B N     1 
ATOM 5580  C CA    . LYS D 4 70  ? 15.319  122.135 12.640  1.00 39.21  ? 70  LYS B CA    1 
ATOM 5581  C C     . LYS D 4 70  ? 14.191  123.068 12.152  1.00 36.31  ? 70  LYS B C     1 
ATOM 5582  O O     . LYS D 4 70  ? 13.010  122.911 12.510  1.00 35.08  ? 70  LYS B O     1 
ATOM 5583  C CB    . LYS D 4 70  ? 16.100  121.557 11.442  1.00 44.45  ? 70  LYS B CB    1 
ATOM 5584  C CG    . LYS D 4 70  ? 15.337  120.459 10.627  1.00 49.34  ? 70  LYS B CG    1 
ATOM 5585  C CD    . LYS D 4 70  ? 16.255  119.301 10.151  1.00 52.91  ? 70  LYS B CD    1 
ATOM 5586  C CE    . LYS D 4 70  ? 17.400  119.767 9.215   1.00 55.47  ? 70  LYS B CE    1 
ATOM 5587  N NZ    . LYS D 4 70  ? 18.524  120.524 9.890   1.00 55.92  ? 70  LYS B NZ    1 
ATOM 5588  N N     . TRP D 4 71  ? 14.576  124.063 11.358  1.00 31.73  ? 71  TRP B N     1 
ATOM 5589  C CA    . TRP D 4 71  ? 13.617  124.972 10.762  1.00 25.93  ? 71  TRP B CA    1 
ATOM 5590  C C     . TRP D 4 71  ? 12.830  124.071 9.811   1.00 22.76  ? 71  TRP B C     1 
ATOM 5591  O O     . TRP D 4 71  ? 13.130  122.886 9.658   1.00 23.11  ? 71  TRP B O     1 
ATOM 5592  C CB    . TRP D 4 71  ? 14.326  126.018 9.905   1.00 25.74  ? 71  TRP B CB    1 
ATOM 5593  C CG    . TRP D 4 71  ? 15.401  126.795 10.561  1.00 24.83  ? 71  TRP B CG    1 
ATOM 5594  C CD1   . TRP D 4 71  ? 16.457  126.308 11.248  1.00 26.51  ? 71  TRP B CD1   1 
ATOM 5595  C CD2   . TRP D 4 71  ? 15.550  128.209 10.540  1.00 25.49  ? 71  TRP B CD2   1 
ATOM 5596  N NE1   . TRP D 4 71  ? 17.268  127.333 11.659  1.00 25.98  ? 71  TRP B NE1   1 
ATOM 5597  C CE2   . TRP D 4 71  ? 16.731  128.514 11.236  1.00 24.51  ? 71  TRP B CE2   1 
ATOM 5598  C CE3   . TRP D 4 71  ? 14.798  129.253 10.002  1.00 24.51  ? 71  TRP B CE3   1 
ATOM 5599  C CZ2   . TRP D 4 71  ? 17.179  129.810 11.411  1.00 24.39  ? 71  TRP B CZ2   1 
ATOM 5600  C CZ3   . TRP D 4 71  ? 15.241  130.542 10.179  1.00 25.44  ? 71  TRP B CZ3   1 
ATOM 5601  C CH2   . TRP D 4 71  ? 16.420  130.810 10.878  1.00 24.81  ? 71  TRP B CH2   1 
ATOM 5602  N N     . ARG D 4 72  ? 11.880  124.650 9.103   1.00 19.04  ? 72  ARG B N     1 
ATOM 5603  C CA    . ARG D 4 72  ? 11.094  123.879 8.169   1.00 16.20  ? 72  ARG B CA    1 
ATOM 5604  C C     . ARG D 4 72  ? 11.194  124.486 6.789   1.00 16.02  ? 72  ARG B C     1 
ATOM 5605  O O     . ARG D 4 72  ? 11.306  125.712 6.634   1.00 14.00  ? 72  ARG B O     1 
ATOM 5606  C CB    . ARG D 4 72  ? 9.644   123.894 8.601   1.00 14.15  ? 72  ARG B CB    1 
ATOM 5607  C CG    . ARG D 4 72  ? 8.735   123.109 7.719   1.00 12.74  ? 72  ARG B CG    1 
ATOM 5608  C CD    . ARG D 4 72  ? 8.326   121.882 8.479   1.00 15.30  ? 72  ARG B CD    1 
ATOM 5609  N NE    . ARG D 4 72  ? 6.989   121.391 8.148   1.00 14.59  ? 72  ARG B NE    1 
ATOM 5610  C CZ    . ARG D 4 72  ? 6.535   121.169 6.919   1.00 13.24  ? 72  ARG B CZ    1 
ATOM 5611  N NH1   . ARG D 4 72  ? 7.303   121.418 5.852   1.00 12.30  ? 72  ARG B NH1   1 
ATOM 5612  N NH2   . ARG D 4 72  ? 5.353   120.581 6.777   1.00 8.54   ? 72  ARG B NH2   1 
ATOM 5613  N N     . LYS D 4 73  ? 11.202  123.633 5.777   1.00 16.88  ? 73  LYS B N     1 
ATOM 5614  C CA    . LYS D 4 73  ? 11.234  124.167 4.433   1.00 17.31  ? 73  LYS B CA    1 
ATOM 5615  C C     . LYS D 4 73  ? 9.763   124.417 4.165   1.00 16.61  ? 73  LYS B C     1 
ATOM 5616  O O     . LYS D 4 73  ? 8.886   123.707 4.700   1.00 15.57  ? 73  LYS B O     1 
ATOM 5617  C CB    . LYS D 4 73  ? 11.784  123.162 3.411   1.00 18.95  ? 73  LYS B CB    1 
ATOM 5618  C CG    . LYS D 4 73  ? 10.703  122.491 2.529   1.00 22.46  ? 73  LYS B CG    1 
ATOM 5619  C CD    . LYS D 4 73  ? 11.272  121.414 1.615   1.00 24.28  ? 73  LYS B CD    1 
ATOM 5620  C CE    . LYS D 4 73  ? 12.284  121.957 0.595   1.00 26.84  ? 73  LYS B CE    1 
ATOM 5621  N NZ    . LYS D 4 73  ? 11.803  121.862 -0.837  1.00 26.20  ? 73  LYS B NZ    1 
ATOM 5622  N N     . LEU D 4 74  ? 9.507   125.437 3.355   1.00 15.90  ? 74  LEU B N     1 
ATOM 5623  C CA    . LEU D 4 74  ? 8.157   125.799 2.974   1.00 14.10  ? 74  LEU B CA    1 
ATOM 5624  C C     . LEU D 4 74  ? 8.071   126.147 1.511   1.00 11.94  ? 74  LEU B C     1 
ATOM 5625  O O     . LEU D 4 74  ? 8.835   126.951 1.010   1.00 9.91   ? 74  LEU B O     1 
ATOM 5626  C CB    . LEU D 4 74  ? 7.660   126.962 3.816   1.00 17.16  ? 74  LEU B CB    1 
ATOM 5627  C CG    . LEU D 4 74  ? 6.767   126.438 4.937   1.00 18.88  ? 74  LEU B CG    1 
ATOM 5628  C CD1   . LEU D 4 74  ? 6.050   127.576 5.667   1.00 19.06  ? 74  LEU B CD1   1 
ATOM 5629  C CD2   . LEU D 4 74  ? 5.750   125.483 4.318   1.00 20.77  ? 74  LEU B CD2   1 
ATOM 5630  N N     . VAL D 4 75  ? 7.110   125.554 0.829   1.00 12.10  ? 75  VAL B N     1 
ATOM 5631  C CA    . VAL D 4 75  ? 6.957   125.819 -0.586  1.00 15.05  ? 75  VAL B CA    1 
ATOM 5632  C C     . VAL D 4 75  ? 5.563   126.340 -0.929  1.00 17.11  ? 75  VAL B C     1 
ATOM 5633  O O     . VAL D 4 75  ? 4.577   125.612 -0.828  1.00 18.50  ? 75  VAL B O     1 
ATOM 5634  C CB    . VAL D 4 75  ? 7.216   124.560 -1.371  1.00 14.81  ? 75  VAL B CB    1 
ATOM 5635  C CG1   . VAL D 4 75  ? 7.374   124.898 -2.829  1.00 14.71  ? 75  VAL B CG1   1 
ATOM 5636  C CG2   . VAL D 4 75  ? 8.428   123.848 -0.812  1.00 13.63  ? 75  VAL B CG2   1 
ATOM 5637  N N     . ASP D 4 76  ? 5.482   127.576 -1.396  1.00 17.22  ? 76  ASP B N     1 
ATOM 5638  C CA    . ASP D 4 76  ? 4.187   128.154 -1.705  1.00 18.63  ? 76  ASP B CA    1 
ATOM 5639  C C     . ASP D 4 76  ? 3.504   127.506 -2.916  1.00 18.05  ? 76  ASP B C     1 
ATOM 5640  O O     . ASP D 4 76  ? 3.393   128.106 -3.976  1.00 18.23  ? 76  ASP B O     1 
ATOM 5641  C CB    . ASP D 4 76  ? 4.353   129.659 -1.901  1.00 21.95  ? 76  ASP B CB    1 
ATOM 5642  C CG    . ASP D 4 76  ? 3.237   130.464 -1.256  1.00 25.05  ? 76  ASP B CG    1 
ATOM 5643  O OD1   . ASP D 4 76  ? 2.797   131.476 -1.860  1.00 25.57  ? 76  ASP B OD1   1 
ATOM 5644  O OD2   . ASP D 4 76  ? 2.817   130.087 -0.140  1.00 27.72  ? 76  ASP B OD2   1 
ATOM 5645  N N     . PHE D 4 77  ? 3.016   126.286 -2.763  1.00 17.89  ? 77  PHE B N     1 
ATOM 5646  C CA    . PHE D 4 77  ? 2.365   125.632 -3.892  1.00 18.52  ? 77  PHE B CA    1 
ATOM 5647  C C     . PHE D 4 77  ? 0.960   126.139 -4.117  1.00 17.89  ? 77  PHE B C     1 
ATOM 5648  O O     . PHE D 4 77  ? 0.227   125.575 -4.929  1.00 17.83  ? 77  PHE B O     1 
ATOM 5649  C CB    . PHE D 4 77  ? 2.332   124.114 -3.705  1.00 20.91  ? 77  PHE B CB    1 
ATOM 5650  C CG    . PHE D 4 77  ? 3.682   123.454 -3.863  1.00 22.02  ? 77  PHE B CG    1 
ATOM 5651  C CD1   . PHE D 4 77  ? 4.350   123.496 -5.081  1.00 22.46  ? 77  PHE B CD1   1 
ATOM 5652  C CD2   . PHE D 4 77  ? 4.289   122.806 -2.793  1.00 23.08  ? 77  PHE B CD2   1 
ATOM 5653  C CE1   . PHE D 4 77  ? 5.592   122.914 -5.236  1.00 19.56  ? 77  PHE B CE1   1 
ATOM 5654  C CE2   . PHE D 4 77  ? 5.529   122.221 -2.940  1.00 21.33  ? 77  PHE B CE2   1 
ATOM 5655  C CZ    . PHE D 4 77  ? 6.180   122.280 -4.175  1.00 20.41  ? 77  PHE B CZ    1 
ATOM 5656  N N     . ARG D 4 78  ? 0.585   127.184 -3.379  1.00 15.80  ? 78  ARG B N     1 
ATOM 5657  C CA    . ARG D 4 78  ? -0.743  127.780 -3.477  1.00 13.08  ? 78  ARG B CA    1 
ATOM 5658  C C     . ARG D 4 78  ? -1.235  127.782 -4.914  1.00 10.84  ? 78  ARG B C     1 
ATOM 5659  O O     . ARG D 4 78  ? -2.216  127.122 -5.247  1.00 6.36   ? 78  ARG B O     1 
ATOM 5660  C CB    . ARG D 4 78  ? -0.716  129.205 -2.920  1.00 14.68  ? 78  ARG B CB    1 
ATOM 5661  C CG    . ARG D 4 78  ? -0.527  129.273 -1.406  1.00 18.22  ? 78  ARG B CG    1 
ATOM 5662  C CD    . ARG D 4 78  ? -0.992  130.609 -0.784  1.00 19.64  ? 78  ARG B CD    1 
ATOM 5663  N NE    . ARG D 4 78  ? 0.140   131.445 -0.387  1.00 22.94  ? 78  ARG B NE    1 
ATOM 5664  C CZ    . ARG D 4 78  ? 0.051   132.619 0.233   1.00 24.10  ? 78  ARG B CZ    1 
ATOM 5665  N NH1   . ARG D 4 78  ? -1.136  133.129 0.551   1.00 23.86  ? 78  ARG B NH1   1 
ATOM 5666  N NH2   . ARG D 4 78  ? 1.166   133.277 0.545   1.00 23.16  ? 78  ARG B NH2   1 
ATOM 5667  N N     . GLU D 4 79  ? -0.492  128.463 -5.774  1.00 11.02  ? 79  GLU B N     1 
ATOM 5668  C CA    . GLU D 4 79  ? -0.858  128.510 -7.165  1.00 14.61  ? 79  GLU B CA    1 
ATOM 5669  C C     . GLU D 4 79  ? -0.872  127.118 -7.733  1.00 15.76  ? 79  GLU B C     1 
ATOM 5670  O O     . GLU D 4 79  ? -1.820  126.764 -8.415  1.00 16.40  ? 79  GLU B O     1 
ATOM 5671  C CB    . GLU D 4 79  ? 0.078   129.405 -7.963  1.00 16.89  ? 79  GLU B CB    1 
ATOM 5672  C CG    . GLU D 4 79  ? -0.385  130.869 -8.029  1.00 22.58  ? 79  GLU B CG    1 
ATOM 5673  C CD    . GLU D 4 79  ? -1.645  131.089 -8.893  1.00 25.19  ? 79  GLU B CD    1 
ATOM 5674  O OE1   . GLU D 4 79  ? -2.740  130.586 -8.549  1.00 27.66  ? 79  GLU B OE1   1 
ATOM 5675  O OE2   . GLU D 4 79  ? -1.539  131.782 -9.925  1.00 27.00  ? 79  GLU B OE2   1 
ATOM 5676  N N     . LEU D 4 80  ? 0.133   126.304 -7.406  1.00 18.01  ? 80  LEU B N     1 
ATOM 5677  C CA    . LEU D 4 80  ? 0.167   124.918 -7.909  1.00 19.49  ? 80  LEU B CA    1 
ATOM 5678  C C     . LEU D 4 80  ? -1.130  124.203 -7.580  1.00 18.81  ? 80  LEU B C     1 
ATOM 5679  O O     . LEU D 4 80  ? -1.789  123.629 -8.447  1.00 15.58  ? 80  LEU B O     1 
ATOM 5680  C CB    . LEU D 4 80  ? 1.314   124.097 -7.298  1.00 20.23  ? 80  LEU B CB    1 
ATOM 5681  C CG    . LEU D 4 80  ? 1.315   122.629 -7.785  1.00 19.80  ? 80  LEU B CG    1 
ATOM 5682  C CD1   . LEU D 4 80  ? 1.585   122.539 -9.297  1.00 16.06  ? 80  LEU B CD1   1 
ATOM 5683  C CD2   . LEU D 4 80  ? 2.331   121.793 -7.012  1.00 20.06  ? 80  LEU B CD2   1 
ATOM 5684  N N     . ASN D 4 81  ? -1.476  124.235 -6.307  1.00 20.82  ? 81  ASN B N     1 
ATOM 5685  C CA    . ASN D 4 81  ? -2.686  123.608 -5.859  1.00 25.04  ? 81  ASN B CA    1 
ATOM 5686  C C     . ASN D 4 81  ? -3.823  124.029 -6.721  1.00 28.54  ? 81  ASN B C     1 
ATOM 5687  O O     . ASN D 4 81  ? -4.600  123.200 -7.175  1.00 30.24  ? 81  ASN B O     1 
ATOM 5688  C CB    . ASN D 4 81  ? -2.962  124.010 -4.445  1.00 24.26  ? 81  ASN B CB    1 
ATOM 5689  C CG    . ASN D 4 81  ? -2.011  123.375 -3.511  1.00 26.47  ? 81  ASN B CG    1 
ATOM 5690  O OD1   . ASN D 4 81  ? -2.362  122.411 -2.832  1.00 27.92  ? 81  ASN B OD1   1 
ATOM 5691  N ND2   . ASN D 4 81  ? -0.764  123.841 -3.519  1.00 25.92  ? 81  ASN B ND2   1 
ATOM 5692  N N     . LYS D 4 82  ? -3.870  125.317 -7.024  1.00 31.98  ? 82  LYS B N     1 
ATOM 5693  C CA    . LYS D 4 82  ? -4.946  125.817 -7.847  1.00 34.71  ? 82  LYS B CA    1 
ATOM 5694  C C     . LYS D 4 82  ? -4.938  125.143 -9.227  1.00 34.71  ? 82  LYS B C     1 
ATOM 5695  O O     . LYS D 4 82  ? -5.954  124.619 -9.663  1.00 34.97  ? 82  LYS B O     1 
ATOM 5696  C CB    . LYS D 4 82  ? -4.897  127.354 -7.947  1.00 37.65  ? 82  LYS B CB    1 
ATOM 5697  C CG    . LYS D 4 82  ? -6.270  127.981 -8.270  1.00 42.48  ? 82  LYS B CG    1 
ATOM 5698  C CD    . LYS D 4 82  ? -6.275  129.516 -8.317  1.00 45.46  ? 82  LYS B CD    1 
ATOM 5699  C CE    . LYS D 4 82  ? -7.694  130.064 -8.589  1.00 47.37  ? 82  LYS B CE    1 
ATOM 5700  N NZ    . LYS D 4 82  ? -8.685  129.675 -7.522  1.00 47.01  ? 82  LYS B NZ    1 
ATOM 5701  N N     . ARG D 4 83  ? -3.775  125.041 -9.855  1.00 36.09  ? 83  ARG B N     1 
ATOM 5702  C CA    . ARG D 4 83  ? -3.708  124.444 -11.187 1.00 39.10  ? 83  ARG B CA    1 
ATOM 5703  C C     . ARG D 4 83  ? -4.086  122.957 -11.264 1.00 41.81  ? 83  ARG B C     1 
ATOM 5704  O O     . ARG D 4 83  ? -4.744  122.522 -12.215 1.00 41.18  ? 83  ARG B O     1 
ATOM 5705  C CB    . ARG D 4 83  ? -2.316  124.632 -11.792 1.00 39.98  ? 83  ARG B CB    1 
ATOM 5706  C CG    . ARG D 4 83  ? -1.746  126.049 -11.779 1.00 38.99  ? 83  ARG B CG    1 
ATOM 5707  C CD    . ARG D 4 83  ? -2.370  126.972 -12.806 1.00 38.55  ? 83  ARG B CD    1 
ATOM 5708  N NE    . ARG D 4 83  ? -1.655  128.247 -12.885 1.00 40.10  ? 83  ARG B NE    1 
ATOM 5709  C CZ    . ARG D 4 83  ? -1.317  129.010 -11.841 1.00 38.42  ? 83  ARG B CZ    1 
ATOM 5710  N NH1   . ARG D 4 83  ? -1.614  128.652 -10.598 1.00 36.33  ? 83  ARG B NH1   1 
ATOM 5711  N NH2   . ARG D 4 83  ? -0.673  130.149 -12.047 1.00 39.21  ? 83  ARG B NH2   1 
ATOM 5712  N N     . THR D 4 84  ? -3.635  122.180 -10.284 1.00 44.70  ? 84  THR B N     1 
ATOM 5713  C CA    . THR D 4 84  ? -3.902  120.746 -10.258 1.00 48.17  ? 84  THR B CA    1 
ATOM 5714  C C     . THR D 4 84  ? -5.360  120.391 -10.123 1.00 51.67  ? 84  THR B C     1 
ATOM 5715  O O     . THR D 4 84  ? -6.033  120.802 -9.180  1.00 50.91  ? 84  THR B O     1 
ATOM 5716  C CB    . THR D 4 84  ? -3.134  120.039 -9.147  1.00 47.88  ? 84  THR B CB    1 
ATOM 5717  O OG1   . THR D 4 84  ? -3.354  120.725 -7.912  1.00 46.65  ? 84  THR B OG1   1 
ATOM 5718  C CG2   . THR D 4 84  ? -1.647  120.012 -9.463  1.00 47.88  ? 84  THR B CG2   1 
ATOM 5719  N N     . GLN D 4 85  ? -5.815  119.596 -11.083 1.00 57.30  ? 85  GLN B N     1 
ATOM 5720  C CA    . GLN D 4 85  ? -7.188  119.103 -11.182 1.00 63.49  ? 85  GLN B CA    1 
ATOM 5721  C C     . GLN D 4 85  ? -7.761  118.648 -9.844  1.00 64.42  ? 85  GLN B C     1 
ATOM 5722  O O     . GLN D 4 85  ? -7.055  118.557 -8.832  1.00 64.15  ? 85  GLN B O     1 
ATOM 5723  C CB    . GLN D 4 85  ? -7.198  117.868 -12.071 1.00 67.95  ? 85  GLN B CB    1 
ATOM 5724  C CG    . GLN D 4 85  ? -6.770  116.626 -11.260 1.00 75.25  ? 85  GLN B CG    1 
ATOM 5725  C CD    . GLN D 4 85  ? -6.314  115.456 -12.101 1.00 79.81  ? 85  GLN B CD    1 
ATOM 5726  O OE1   . GLN D 4 85  ? -5.105  115.235 -12.274 1.00 81.90  ? 85  GLN B OE1   1 
ATOM 5727  N NE2   . GLN D 4 85  ? -7.274  114.672 -12.604 1.00 82.70  ? 85  GLN B NE2   1 
ATOM 5728  N N     . ASP D 4 86  ? -9.021  118.236 -9.891  1.00 65.49  ? 86  ASP B N     1 
ATOM 5729  C CA    . ASP D 4 86  ? -9.674  117.738 -8.705  1.00 67.81  ? 86  ASP B CA    1 
ATOM 5730  C C     . ASP D 4 86  ? -9.411  116.255 -8.563  1.00 68.67  ? 86  ASP B C     1 
ATOM 5731  O O     . ASP D 4 86  ? -9.295  115.517 -9.548  1.00 67.45  ? 86  ASP B O     1 
ATOM 5732  C CB    . ASP D 4 86  ? -11.180 118.003 -8.741  1.00 69.63  ? 86  ASP B CB    1 
ATOM 5733  C CG    . ASP D 4 86  ? -11.534 119.428 -8.350  1.00 69.92  ? 86  ASP B CG    1 
ATOM 5734  O OD1   . ASP D 4 86  ? -12.614 119.905 -8.773  1.00 71.11  ? 86  ASP B OD1   1 
ATOM 5735  O OD2   . ASP D 4 86  ? -10.739 120.065 -7.620  1.00 69.55  ? 86  ASP B OD2   1 
ATOM 5736  N N     . PHE D 4 87  ? -9.303  115.839 -7.311  1.00 70.00  ? 87  PHE B N     1 
ATOM 5737  C CA    . PHE D 4 87  ? -9.068  114.455 -6.970  1.00 71.43  ? 87  PHE B CA    1 
ATOM 5738  C C     . PHE D 4 87  ? -10.196 113.966 -6.056  1.00 73.21  ? 87  PHE B C     1 
ATOM 5739  O O     . PHE D 4 87  ? -10.571 114.654 -5.099  1.00 73.56  ? 87  PHE B O     1 
ATOM 5740  C CB    . PHE D 4 87  ? -7.715  114.333 -6.264  1.00 70.24  ? 87  PHE B CB    1 
ATOM 5741  C CG    . PHE D 4 87  ? -6.544  114.198 -7.202  1.00 69.32  ? 87  PHE B CG    1 
ATOM 5742  C CD1   . PHE D 4 87  ? -5.323  114.802 -6.907  1.00 69.23  ? 87  PHE B CD1   1 
ATOM 5743  C CD2   . PHE D 4 87  ? -6.640  113.410 -8.345  1.00 69.14  ? 87  PHE B CD2   1 
ATOM 5744  C CE1   . PHE D 4 87  ? -4.215  114.616 -7.737  1.00 68.68  ? 87  PHE B CE1   1 
ATOM 5745  C CE2   . PHE D 4 87  ? -5.538  113.220 -9.177  1.00 68.57  ? 87  PHE B CE2   1 
ATOM 5746  C CZ    . PHE D 4 87  ? -4.327  113.822 -8.870  1.00 67.78  ? 87  PHE B CZ    1 
ATOM 5747  N N     . TRP D 4 88  ? -10.765 112.806 -6.377  1.00 74.92  ? 88  TRP B N     1 
ATOM 5748  C CA    . TRP D 4 88  ? -11.837 112.227 -5.562  1.00 77.01  ? 88  TRP B CA    1 
ATOM 5749  C C     . TRP D 4 88  ? -11.289 111.707 -4.224  1.00 76.32  ? 88  TRP B C     1 
ATOM 5750  O O     . TRP D 4 88  ? -11.791 112.082 -3.163  1.00 76.20  ? 88  TRP B O     1 
ATOM 5751  C CB    . TRP D 4 88  ? -12.593 111.131 -6.356  1.00 80.30  ? 88  TRP B CB    1 
ATOM 5752  C CG    . TRP D 4 88  ? -12.876 109.774 -5.655  1.00 84.80  ? 88  TRP B CG    1 
ATOM 5753  C CD1   . TRP D 4 88  ? -11.946 108.867 -5.186  1.00 85.31  ? 88  TRP B CD1   1 
ATOM 5754  C CD2   . TRP D 4 88  ? -14.160 109.134 -5.492  1.00 87.80  ? 88  TRP B CD2   1 
ATOM 5755  N NE1   . TRP D 4 88  ? -12.569 107.715 -4.761  1.00 86.91  ? 88  TRP B NE1   1 
ATOM 5756  C CE2   . TRP D 4 88  ? -13.923 107.847 -4.936  1.00 88.20  ? 88  TRP B CE2   1 
ATOM 5757  C CE3   . TRP D 4 88  ? -15.487 109.517 -5.775  1.00 87.86  ? 88  TRP B CE3   1 
ATOM 5758  C CZ2   . TRP D 4 88  ? -14.967 106.938 -4.659  1.00 88.81  ? 88  TRP B CZ2   1 
ATOM 5759  C CZ3   . TRP D 4 88  ? -16.531 108.605 -5.500  1.00 88.30  ? 88  TRP B CZ3   1 
ATOM 5760  C CH2   . TRP D 4 88  ? -16.257 107.334 -4.947  1.00 88.77  ? 88  TRP B CH2   1 
ATOM 5761  N N     . GLU D 4 89  ? -10.213 110.914 -4.290  1.00 75.18  ? 89  GLU B N     1 
ATOM 5762  C CA    . GLU D 4 89  ? -9.576  110.316 -3.109  1.00 73.30  ? 89  GLU B CA    1 
ATOM 5763  C C     . GLU D 4 89  ? -9.191  111.372 -2.082  1.00 71.88  ? 89  GLU B C     1 
ATOM 5764  O O     . GLU D 4 89  ? -8.907  111.048 -0.930  1.00 70.88  ? 89  GLU B O     1 
ATOM 5765  C CB    . GLU D 4 89  ? -8.326  109.501 -3.491  1.00 73.36  ? 89  GLU B CB    1 
ATOM 5766  C CG    . GLU D 4 89  ? -8.402  108.746 -4.819  1.00 73.51  ? 89  GLU B CG    1 
ATOM 5767  C CD    . GLU D 4 89  ? -7.982  109.607 -6.003  1.00 74.46  ? 89  GLU B CD    1 
ATOM 5768  O OE1   . GLU D 4 89  ? -8.793  109.780 -6.943  1.00 74.34  ? 89  GLU B OE1   1 
ATOM 5769  O OE2   . GLU D 4 89  ? -6.837  110.112 -5.990  1.00 74.63  ? 89  GLU B OE2   1 
ATOM 5770  N N     . VAL D 4 90  ? -9.142  112.629 -2.527  1.00 70.67  ? 90  VAL B N     1 
ATOM 5771  C CA    . VAL D 4 90  ? -8.810  113.761 -1.665  1.00 70.09  ? 90  VAL B CA    1 
ATOM 5772  C C     . VAL D 4 90  ? -10.003 113.927 -0.759  1.00 69.00  ? 90  VAL B C     1 
ATOM 5773  O O     . VAL D 4 90  ? -9.981  113.542 0.408   1.00 67.05  ? 90  VAL B O     1 
ATOM 5774  C CB    . VAL D 4 90  ? -8.607  115.034 -2.503  1.00 70.58  ? 90  VAL B CB    1 
ATOM 5775  N N     . GLN D 4 91  ? -11.060 114.478 -1.336  1.00 68.28  ? 91  GLN B N     1 
ATOM 5776  C CA    . GLN D 4 91  ? -12.300 114.676 -0.627  1.00 68.23  ? 91  GLN B CA    1 
ATOM 5777  C C     . GLN D 4 91  ? -12.627 113.314 0.016   1.00 68.35  ? 91  GLN B C     1 
ATOM 5778  O O     . GLN D 4 91  ? -12.572 113.166 1.246   1.00 67.32  ? 91  GLN B O     1 
ATOM 5779  C CB    . GLN D 4 91  ? -13.374 115.098 -1.626  1.00 67.40  ? 91  GLN B CB    1 
ATOM 5780  N N     . LEU D 4 92  ? -12.817 112.302 -0.835  1.00 68.60  ? 92  LEU B N     1 
ATOM 5781  C CA    . LEU D 4 92  ? -13.122 110.938 -0.397  1.00 68.38  ? 92  LEU B CA    1 
ATOM 5782  C C     . LEU D 4 92  ? -12.213 110.513 0.748   1.00 66.61  ? 92  LEU B C     1 
ATOM 5783  O O     . LEU D 4 92  ? -12.654 110.349 1.881   1.00 66.73  ? 92  LEU B O     1 
ATOM 5784  C CB    . LEU D 4 92  ? -12.967 109.931 -1.558  1.00 69.73  ? 92  LEU B CB    1 
ATOM 5785  C CG    . LEU D 4 92  ? -12.788 108.448 -1.156  1.00 71.67  ? 92  LEU B CG    1 
ATOM 5786  C CD1   . LEU D 4 92  ? -14.083 107.655 -1.326  1.00 72.34  ? 92  LEU B CD1   1 
ATOM 5787  C CD2   . LEU D 4 92  ? -11.649 107.797 -1.940  1.00 70.88  ? 92  LEU B CD2   1 
ATOM 5788  N N     . GLY D 4 93  ? -10.934 110.351 0.443   1.00 64.37  ? 93  GLY B N     1 
ATOM 5789  C CA    . GLY D 4 93  ? -10.004 109.919 1.459   1.00 62.44  ? 93  GLY B CA    1 
ATOM 5790  C C     . GLY D 4 93  ? -9.836  110.911 2.583   1.00 60.96  ? 93  GLY B C     1 
ATOM 5791  O O     . GLY D 4 93  ? -9.296  110.576 3.640   1.00 61.30  ? 93  GLY B O     1 
ATOM 5792  N N     . ILE D 4 94  ? -10.308 112.131 2.387   1.00 57.82  ? 94  ILE B N     1 
ATOM 5793  C CA    . ILE D 4 94  ? -10.141 113.107 3.434   1.00 55.73  ? 94  ILE B CA    1 
ATOM 5794  C C     . ILE D 4 94  ? -11.424 113.866 3.683   1.00 55.17  ? 94  ILE B C     1 
ATOM 5795  O O     . ILE D 4 94  ? -11.561 115.016 3.273   1.00 56.35  ? 94  ILE B O     1 
ATOM 5796  C CB    . ILE D 4 94  ? -8.999  114.084 3.095   1.00 55.27  ? 94  ILE B CB    1 
ATOM 5797  C CG1   . ILE D 4 94  ? -7.831  113.328 2.456   1.00 54.82  ? 94  ILE B CG1   1 
ATOM 5798  C CG2   . ILE D 4 94  ? -8.492  114.745 4.363   1.00 55.63  ? 94  ILE B CG2   1 
ATOM 5799  C CD1   . ILE D 4 94  ? -6.989  114.166 1.538   1.00 55.12  ? 94  ILE B CD1   1 
ATOM 5800  N N     . PRO D 4 95  ? -12.419 113.200 4.293   1.00 54.11  ? 95  PRO B N     1 
ATOM 5801  C CA    . PRO D 4 95  ? -13.723 113.808 4.610   1.00 53.25  ? 95  PRO B CA    1 
ATOM 5802  C C     . PRO D 4 95  ? -13.673 114.527 5.978   1.00 52.15  ? 95  PRO B C     1 
ATOM 5803  O O     . PRO D 4 95  ? -12.893 114.143 6.851   1.00 53.80  ? 95  PRO B O     1 
ATOM 5804  C CB    . PRO D 4 95  ? -14.667 112.594 4.667   1.00 53.18  ? 95  PRO B CB    1 
ATOM 5805  C CG    . PRO D 4 95  ? -13.873 111.458 4.063   1.00 53.15  ? 95  PRO B CG    1 
ATOM 5806  C CD    . PRO D 4 95  ? -12.475 111.747 4.496   1.00 52.90  ? 95  PRO B CD    1 
ATOM 5807  N N     . HIS D 4 96  ? -14.512 115.541 6.185   1.00 48.89  ? 96  HIS B N     1 
ATOM 5808  C CA    . HIS D 4 96  ? -14.488 116.246 7.458   1.00 44.67  ? 96  HIS B CA    1 
ATOM 5809  C C     . HIS D 4 96  ? -15.462 115.713 8.511   1.00 43.46  ? 96  HIS B C     1 
ATOM 5810  O O     . HIS D 4 96  ? -16.602 115.368 8.218   1.00 44.19  ? 96  HIS B O     1 
ATOM 5811  C CB    . HIS D 4 96  ? -14.690 117.746 7.264   1.00 42.57  ? 96  HIS B CB    1 
ATOM 5812  C CG    . HIS D 4 96  ? -14.288 118.554 8.455   1.00 41.63  ? 96  HIS B CG    1 
ATOM 5813  N ND1   . HIS D 4 96  ? -13.081 119.215 8.530   1.00 40.91  ? 96  HIS B ND1   1 
ATOM 5814  C CD2   . HIS D 4 96  ? -14.891 118.737 9.653   1.00 40.17  ? 96  HIS B CD2   1 
ATOM 5815  C CE1   . HIS D 4 96  ? -12.953 119.760 9.725   1.00 40.43  ? 96  HIS B CE1   1 
ATOM 5816  N NE2   . HIS D 4 96  ? -14.038 119.483 10.428  1.00 39.66  ? 96  HIS B NE2   1 
ATOM 5817  N N     . PRO D 4 97  ? -14.982 115.585 9.750   1.00 42.71  ? 97  PRO B N     1 
ATOM 5818  C CA    . PRO D 4 97  ? -15.680 115.110 10.949  1.00 41.72  ? 97  PRO B CA    1 
ATOM 5819  C C     . PRO D 4 97  ? -16.262 116.238 11.793  1.00 40.09  ? 97  PRO B C     1 
ATOM 5820  O O     . PRO D 4 97  ? -15.626 117.276 12.000  1.00 40.12  ? 97  PRO B O     1 
ATOM 5821  C CB    . PRO D 4 97  ? -14.572 114.407 11.709  1.00 43.87  ? 97  PRO B CB    1 
ATOM 5822  C CG    . PRO D 4 97  ? -13.406 115.294 11.438  1.00 44.21  ? 97  PRO B CG    1 
ATOM 5823  C CD    . PRO D 4 97  ? -13.525 115.559 9.958   1.00 43.35  ? 97  PRO B CD    1 
ATOM 5824  N N     . ALA D 4 98  ? -17.423 115.976 12.376  1.00 38.12  ? 98  ALA B N     1 
ATOM 5825  C CA    . ALA D 4 98  ? -18.110 116.978 13.177  1.00 35.45  ? 98  ALA B CA    1 
ATOM 5826  C C     . ALA D 4 98  ? -17.653 117.056 14.614  1.00 33.01  ? 98  ALA B C     1 
ATOM 5827  O O     . ALA D 4 98  ? -17.041 118.055 15.034  1.00 29.02  ? 98  ALA B O     1 
ATOM 5828  C CB    . ALA D 4 98  ? -19.614 116.738 13.124  1.00 36.86  ? 98  ALA B CB    1 
ATOM 5829  N N     . GLY D 4 99  ? -17.953 115.979 15.348  1.00 31.59  ? 99  GLY B N     1 
ATOM 5830  C CA    . GLY D 4 99  ? -17.623 115.869 16.759  1.00 30.33  ? 99  GLY B CA    1 
ATOM 5831  C C     . GLY D 4 99  ? -16.266 116.458 16.999  1.00 28.82  ? 99  GLY B C     1 
ATOM 5832  O O     . GLY D 4 99  ? -15.908 116.814 18.113  1.00 27.68  ? 99  GLY B O     1 
ATOM 5833  N N     . LEU D 4 100 ? -15.504 116.492 15.914  1.00 28.52  ? 100 LEU B N     1 
ATOM 5834  C CA    . LEU D 4 100 ? -14.189 117.046 15.881  1.00 29.36  ? 100 LEU B CA    1 
ATOM 5835  C C     . LEU D 4 100 ? -14.218 118.373 16.616  1.00 30.63  ? 100 LEU B C     1 
ATOM 5836  O O     . LEU D 4 100 ? -13.581 118.514 17.658  1.00 31.87  ? 100 LEU B O     1 
ATOM 5837  C CB    . LEU D 4 100 ? -13.794 117.258 14.436  1.00 29.67  ? 100 LEU B CB    1 
ATOM 5838  C CG    . LEU D 4 100 ? -12.728 118.321 14.231  1.00 31.30  ? 100 LEU B CG    1 
ATOM 5839  C CD1   . LEU D 4 100 ? -11.434 117.950 14.960  1.00 30.97  ? 100 LEU B CD1   1 
ATOM 5840  C CD2   . LEU D 4 100 ? -12.492 118.485 12.753  1.00 32.47  ? 100 LEU B CD2   1 
ATOM 5841  N N     . LYS D 4 101 ? -15.019 119.310 16.116  1.00 30.29  ? 101 LYS B N     1 
ATOM 5842  C CA    . LYS D 4 101 ? -15.121 120.625 16.738  1.00 30.05  ? 101 LYS B CA    1 
ATOM 5843  C C     . LYS D 4 101 ? -15.547 120.547 18.200  1.00 28.85  ? 101 LYS B C     1 
ATOM 5844  O O     . LYS D 4 101 ? -15.183 121.389 19.031  1.00 26.18  ? 101 LYS B O     1 
ATOM 5845  C CB    . LYS D 4 101 ? -16.109 121.467 15.953  1.00 33.81  ? 101 LYS B CB    1 
ATOM 5846  C CG    . LYS D 4 101 ? -17.510 120.894 15.831  1.00 37.59  ? 101 LYS B CG    1 
ATOM 5847  C CD    . LYS D 4 101 ? -18.229 121.584 14.654  1.00 42.33  ? 101 LYS B CD    1 
ATOM 5848  C CE    . LYS D 4 101 ? -19.767 121.459 14.677  1.00 43.80  ? 101 LYS B CE    1 
ATOM 5849  N NZ    . LYS D 4 101 ? -20.456 122.442 15.591  1.00 44.75  ? 101 LYS B NZ    1 
ATOM 5850  N N     . LYS D 4 102 ? -16.258 119.465 18.497  1.00 28.71  ? 102 LYS B N     1 
ATOM 5851  C CA    . LYS D 4 102 ? -16.801 119.163 19.813  1.00 29.01  ? 102 LYS B CA    1 
ATOM 5852  C C     . LYS D 4 102 ? -15.878 118.254 20.618  1.00 27.37  ? 102 LYS B C     1 
ATOM 5853  O O     . LYS D 4 102 ? -15.995 117.031 20.579  1.00 27.38  ? 102 LYS B O     1 
ATOM 5854  C CB    . LYS D 4 102 ? -18.156 118.497 19.599  1.00 30.91  ? 102 LYS B CB    1 
ATOM 5855  C CG    . LYS D 4 102 ? -19.051 119.316 18.673  1.00 32.60  ? 102 LYS B CG    1 
ATOM 5856  C CD    . LYS D 4 102 ? -19.976 118.464 17.814  1.00 37.45  ? 102 LYS B CD    1 
ATOM 5857  C CE    . LYS D 4 102 ? -21.048 119.338 17.119  1.00 40.55  ? 102 LYS B CE    1 
ATOM 5858  N NZ    . LYS D 4 102 ? -21.939 118.635 16.114  1.00 42.97  ? 102 LYS B NZ    1 
ATOM 5859  N N     . LYS D 4 103 ? -14.980 118.858 21.376  1.00 26.51  ? 103 LYS B N     1 
ATOM 5860  C CA    . LYS D 4 103 ? -14.027 118.090 22.157  1.00 27.30  ? 103 LYS B CA    1 
ATOM 5861  C C     . LYS D 4 103 ? -13.415 118.926 23.249  1.00 27.82  ? 103 LYS B C     1 
ATOM 5862  O O     . LYS D 4 103 ? -13.519 120.141 23.225  1.00 26.79  ? 103 LYS B O     1 
ATOM 5863  C CB    . LYS D 4 103 ? -12.915 117.578 21.253  1.00 27.46  ? 103 LYS B CB    1 
ATOM 5864  C CG    . LYS D 4 103 ? -13.085 116.151 20.790  1.00 30.37  ? 103 LYS B CG    1 
ATOM 5865  C CD    . LYS D 4 103 ? -12.422 115.200 21.762  1.00 31.75  ? 103 LYS B CD    1 
ATOM 5866  C CE    . LYS D 4 103 ? -12.635 113.742 21.368  1.00 34.81  ? 103 LYS B CE    1 
ATOM 5867  N NZ    . LYS D 4 103 ? -11.940 112.772 22.271  1.00 34.31  ? 103 LYS B NZ    1 
ATOM 5868  N N     . LYS D 4 104 ? -12.745 118.282 24.196  1.00 30.23  ? 104 LYS B N     1 
ATOM 5869  C CA    . LYS D 4 104 ? -12.115 119.012 25.300  1.00 32.48  ? 104 LYS B CA    1 
ATOM 5870  C C     . LYS D 4 104 ? -10.745 119.595 24.902  1.00 33.29  ? 104 LYS B C     1 
ATOM 5871  O O     . LYS D 4 104 ? -10.282 120.592 25.487  1.00 33.42  ? 104 LYS B O     1 
ATOM 5872  C CB    . LYS D 4 104 ? -12.005 118.114 26.551  1.00 31.44  ? 104 LYS B CB    1 
ATOM 5873  C CG    . LYS D 4 104 ? -12.843 118.574 27.765  1.00 32.42  ? 104 LYS B CG    1 
ATOM 5874  C CD    . LYS D 4 104 ? -14.313 118.855 27.411  1.00 33.79  ? 104 LYS B CD    1 
ATOM 5875  C CE    . LYS D 4 104 ? -15.152 119.307 28.618  1.00 34.40  ? 104 LYS B CE    1 
ATOM 5876  N NZ    . LYS D 4 104 ? -15.728 118.194 29.441  1.00 34.01  ? 104 LYS B NZ    1 
ATOM 5877  N N     . SER D 4 105 ? -10.133 119.003 23.874  1.00 33.43  ? 105 SER B N     1 
ATOM 5878  C CA    . SER D 4 105 ? -8.827  119.438 23.373  1.00 32.60  ? 105 SER B CA    1 
ATOM 5879  C C     . SER D 4 105 ? -8.444  118.752 22.071  1.00 30.82  ? 105 SER B C     1 
ATOM 5880  O O     . SER D 4 105 ? -8.820  117.601 21.817  1.00 31.39  ? 105 SER B O     1 
ATOM 5881  C CB    . SER D 4 105 ? -7.724  119.176 24.406  1.00 33.93  ? 105 SER B CB    1 
ATOM 5882  O OG    . SER D 4 105 ? -7.787  120.099 25.479  1.00 37.26  ? 105 SER B OG    1 
ATOM 5883  N N     . VAL D 4 106 ? -7.663  119.464 21.266  1.00 27.56  ? 106 VAL B N     1 
ATOM 5884  C CA    . VAL D 4 106 ? -7.193  118.948 19.996  1.00 23.75  ? 106 VAL B CA    1 
ATOM 5885  C C     . VAL D 4 106 ? -5.745  119.323 19.796  1.00 21.75  ? 106 VAL B C     1 
ATOM 5886  O O     . VAL D 4 106 ? -5.305  120.389 20.228  1.00 18.87  ? 106 VAL B O     1 
ATOM 5887  C CB    . VAL D 4 106 ? -8.028  119.477 18.809  1.00 24.26  ? 106 VAL B CB    1 
ATOM 5888  C CG1   . VAL D 4 106 ? -8.096  120.993 18.840  1.00 22.73  ? 106 VAL B CG1   1 
ATOM 5889  C CG2   . VAL D 4 106 ? -7.442  118.974 17.472  1.00 24.06  ? 106 VAL B CG2   1 
ATOM 5890  N N     . THR D 4 107 ? -4.993  118.398 19.207  1.00 21.55  ? 107 THR B N     1 
ATOM 5891  C CA    . THR D 4 107 ? -3.592  118.643 18.920  1.00 21.83  ? 107 THR B CA    1 
ATOM 5892  C C     . THR D 4 107 ? -3.263  118.513 17.437  1.00 22.16  ? 107 THR B C     1 
ATOM 5893  O O     . THR D 4 107 ? -3.998  117.894 16.642  1.00 18.94  ? 107 THR B O     1 
ATOM 5894  C CB    . THR D 4 107 ? -2.644  117.778 19.746  1.00 21.38  ? 107 THR B CB    1 
ATOM 5895  O OG1   . THR D 4 107 ? -3.177  117.611 21.062  1.00 22.70  ? 107 THR B OG1   1 
ATOM 5896  C CG2   . THR D 4 107 ? -1.292  118.486 19.866  1.00 19.19  ? 107 THR B CG2   1 
ATOM 5897  N N     . VAL D 4 108 ? -2.126  119.102 17.089  1.00 22.82  ? 108 VAL B N     1 
ATOM 5898  C CA    . VAL D 4 108 ? -1.685  119.152 15.713  1.00 25.39  ? 108 VAL B CA    1 
ATOM 5899  C C     . VAL D 4 108 ? -0.289  118.596 15.473  1.00 24.91  ? 108 VAL B C     1 
ATOM 5900  O O     . VAL D 4 108 ? 0.695   119.074 16.064  1.00 26.01  ? 108 VAL B O     1 
ATOM 5901  C CB    . VAL D 4 108 ? -1.685  120.610 15.219  1.00 28.65  ? 108 VAL B CB    1 
ATOM 5902  C CG1   . VAL D 4 108 ? -2.092  120.656 13.751  1.00 31.65  ? 108 VAL B CG1   1 
ATOM 5903  C CG2   . VAL D 4 108 ? -2.586  121.510 16.106  1.00 29.40  ? 108 VAL B CG2   1 
ATOM 5904  N N     . LEU D 4 109 ? -0.200  117.628 14.560  1.00 23.05  ? 109 LEU B N     1 
ATOM 5905  C CA    . LEU D 4 109 ? 1.080   117.021 14.228  1.00 19.81  ? 109 LEU B CA    1 
ATOM 5906  C C     . LEU D 4 109 ? 1.532   117.307 12.827  1.00 18.71  ? 109 LEU B C     1 
ATOM 5907  O O     . LEU D 4 109 ? 0.750   117.242 11.864  1.00 17.49  ? 109 LEU B O     1 
ATOM 5908  C CB    . LEU D 4 109 ? 1.060   115.508 14.412  1.00 18.38  ? 109 LEU B CB    1 
ATOM 5909  C CG    . LEU D 4 109 ? 1.314   114.998 15.818  1.00 15.85  ? 109 LEU B CG    1 
ATOM 5910  C CD1   . LEU D 4 109 ? 2.116   116.064 16.581  1.00 15.44  ? 109 LEU B CD1   1 
ATOM 5911  C CD2   . LEU D 4 109 ? -0.017  114.686 16.487  1.00 13.84  ? 109 LEU B CD2   1 
ATOM 5912  N N     . ASP D 4 110 ? 2.815   117.625 12.732  1.00 17.25  ? 110 ASP B N     1 
ATOM 5913  C CA    . ASP D 4 110 ? 3.445   117.895 11.460  1.00 14.76  ? 110 ASP B CA    1 
ATOM 5914  C C     . ASP D 4 110 ? 3.781   116.480 11.017  1.00 14.14  ? 110 ASP B C     1 
ATOM 5915  O O     . ASP D 4 110 ? 4.730   115.905 11.531  1.00 16.28  ? 110 ASP B O     1 
ATOM 5916  C CB    . ASP D 4 110 ? 4.730   118.699 11.706  1.00 12.66  ? 110 ASP B CB    1 
ATOM 5917  C CG    . ASP D 4 110 ? 5.322   119.268 10.432  1.00 12.08  ? 110 ASP B CG    1 
ATOM 5918  O OD1   . ASP D 4 110 ? 4.858   118.903 9.319   1.00 11.34  ? 110 ASP B OD1   1 
ATOM 5919  O OD2   . ASP D 4 110 ? 6.252   120.097 10.558  1.00 9.69   ? 110 ASP B OD2   1 
ATOM 5920  N N     . VAL D 4 111 ? 2.955   115.859 10.181  1.00 12.01  ? 111 VAL B N     1 
ATOM 5921  C CA    . VAL D 4 111 ? 3.274   114.493 9.765   1.00 11.01  ? 111 VAL B CA    1 
ATOM 5922  C C     . VAL D 4 111 ? 3.695   114.393 8.322   1.00 11.66  ? 111 VAL B C     1 
ATOM 5923  O O     . VAL D 4 111 ? 3.497   113.362 7.683   1.00 10.65  ? 111 VAL B O     1 
ATOM 5924  C CB    . VAL D 4 111 ? 2.132   113.507 10.022  1.00 9.79   ? 111 VAL B CB    1 
ATOM 5925  C CG1   . VAL D 4 111 ? 1.812   113.463 11.490  1.00 10.75  ? 111 VAL B CG1   1 
ATOM 5926  C CG2   . VAL D 4 111 ? 0.926   113.886 9.223   1.00 7.80   ? 111 VAL B CG2   1 
ATOM 5927  N N     . GLY D 4 112 ? 4.366   115.440 7.850   1.00 13.30  ? 112 GLY B N     1 
ATOM 5928  C CA    . GLY D 4 112 ? 4.832   115.492 6.474   1.00 15.16  ? 112 GLY B CA    1 
ATOM 5929  C C     . GLY D 4 112 ? 5.574   114.269 5.958   1.00 16.42  ? 112 GLY B C     1 
ATOM 5930  O O     . GLY D 4 112 ? 5.080   113.566 5.075   1.00 18.55  ? 112 GLY B O     1 
ATOM 5931  N N     . ASP D 4 113 ? 6.749   114.011 6.524   1.00 15.37  ? 113 ASP B N     1 
ATOM 5932  C CA    . ASP D 4 113 ? 7.613   112.892 6.155   1.00 13.52  ? 113 ASP B CA    1 
ATOM 5933  C C     . ASP D 4 113 ? 6.883   111.704 5.577   1.00 10.38  ? 113 ASP B C     1 
ATOM 5934  O O     . ASP D 4 113 ? 7.373   111.046 4.664   1.00 8.07   ? 113 ASP B O     1 
ATOM 5935  C CB    . ASP D 4 113 ? 8.394   112.453 7.377   1.00 19.69  ? 113 ASP B CB    1 
ATOM 5936  C CG    . ASP D 4 113 ? 9.144   113.602 8.024   1.00 25.19  ? 113 ASP B CG    1 
ATOM 5937  O OD1   . ASP D 4 113 ? 8.823   114.778 7.721   1.00 27.97  ? 113 ASP B OD1   1 
ATOM 5938  O OD2   . ASP D 4 113 ? 10.059  113.331 8.839   1.00 31.59  ? 113 ASP B OD2   1 
ATOM 5939  N N     . ALA D 4 114 ? 5.706   111.434 6.121   1.00 7.15   ? 114 ALA B N     1 
ATOM 5940  C CA    . ALA D 4 114 ? 4.896   110.349 5.639   1.00 6.23   ? 114 ALA B CA    1 
ATOM 5941  C C     . ALA D 4 114 ? 4.934   110.379 4.120   1.00 6.35   ? 114 ALA B C     1 
ATOM 5942  O O     . ALA D 4 114 ? 5.156   109.356 3.504   1.00 5.23   ? 114 ALA B O     1 
ATOM 5943  C CB    . ALA D 4 114 ? 3.493   110.502 6.138   1.00 4.95   ? 114 ALA B CB    1 
ATOM 5944  N N     . TYR D 4 115 ? 4.894   111.582 3.544   1.00 8.39   ? 115 TYR B N     1 
ATOM 5945  C CA    . TYR D 4 115 ? 4.906   111.775 2.086   1.00 11.60  ? 115 TYR B CA    1 
ATOM 5946  C C     . TYR D 4 115 ? 6.223   111.444 1.435   1.00 12.13  ? 115 TYR B C     1 
ATOM 5947  O O     . TYR D 4 115 ? 6.288   111.171 0.223   1.00 10.91  ? 115 TYR B O     1 
ATOM 5948  C CB    . TYR D 4 115 ? 4.540   113.211 1.716   1.00 14.05  ? 115 TYR B CB    1 
ATOM 5949  C CG    . TYR D 4 115 ? 3.123   113.595 2.075   1.00 18.34  ? 115 TYR B CG    1 
ATOM 5950  C CD1   . TYR D 4 115 ? 2.066   113.365 1.195   1.00 17.75  ? 115 TYR B CD1   1 
ATOM 5951  C CD2   . TYR D 4 115 ? 2.834   114.168 3.314   1.00 20.01  ? 115 TYR B CD2   1 
ATOM 5952  C CE1   . TYR D 4 115 ? 0.763   113.697 1.544   1.00 18.91  ? 115 TYR B CE1   1 
ATOM 5953  C CE2   . TYR D 4 115 ? 1.536   114.505 3.670   1.00 21.48  ? 115 TYR B CE2   1 
ATOM 5954  C CZ    . TYR D 4 115 ? 0.507   114.267 2.784   1.00 20.80  ? 115 TYR B CZ    1 
ATOM 5955  O OH    . TYR D 4 115 ? -0.766  114.611 3.162   1.00 21.09  ? 115 TYR B OH    1 
ATOM 5956  N N     . PHE D 4 116 ? 7.272   111.508 2.241   1.00 13.02  ? 116 PHE B N     1 
ATOM 5957  C CA    . PHE D 4 116 ? 8.619   111.199 1.785   1.00 15.08  ? 116 PHE B CA    1 
ATOM 5958  C C     . PHE D 4 116 ? 8.826   109.766 1.259   1.00 14.83  ? 116 PHE B C     1 
ATOM 5959  O O     . PHE D 4 116 ? 9.674   109.536 0.400   1.00 14.00  ? 116 PHE B O     1 
ATOM 5960  C CB    . PHE D 4 116 ? 9.620   111.489 2.903   1.00 17.40  ? 116 PHE B CB    1 
ATOM 5961  C CG    . PHE D 4 116 ? 10.135  112.897 2.904   1.00 19.51  ? 116 PHE B CG    1 
ATOM 5962  C CD1   . PHE D 4 116 ? 9.917   113.732 1.803   1.00 19.22  ? 116 PHE B CD1   1 
ATOM 5963  C CD2   . PHE D 4 116 ? 10.902  113.371 3.973   1.00 20.08  ? 116 PHE B CD2   1 
ATOM 5964  C CE1   . PHE D 4 116 ? 10.461  115.021 1.762   1.00 20.29  ? 116 PHE B CE1   1 
ATOM 5965  C CE2   . PHE D 4 116 ? 11.455  114.661 3.946   1.00 20.78  ? 116 PHE B CE2   1 
ATOM 5966  C CZ    . PHE D 4 116 ? 11.237  115.486 2.836   1.00 20.77  ? 116 PHE B CZ    1 
ATOM 5967  N N     . SER D 4 117 ? 8.061   108.806 1.770   1.00 13.78  ? 117 SER B N     1 
ATOM 5968  C CA    . SER D 4 117 ? 8.200   107.423 1.334   1.00 11.25  ? 117 SER B CA    1 
ATOM 5969  C C     . SER D 4 117 ? 7.575   107.197 -0.012  1.00 9.37   ? 117 SER B C     1 
ATOM 5970  O O     . SER D 4 117 ? 8.253   106.770 -0.920  1.00 11.95  ? 117 SER B O     1 
ATOM 5971  C CB    . SER D 4 117 ? 7.613   106.464 2.356   1.00 11.78  ? 117 SER B CB    1 
ATOM 5972  O OG    . SER D 4 117 ? 6.291   106.822 2.691   1.00 12.78  ? 117 SER B OG    1 
ATOM 5973  N N     . VAL D 4 118 ? 6.288   107.482 -0.148  1.00 8.52   ? 118 VAL B N     1 
ATOM 5974  C CA    . VAL D 4 118 ? 5.616   107.314 -1.432  1.00 10.39  ? 118 VAL B CA    1 
ATOM 5975  C C     . VAL D 4 118 ? 6.319   108.197 -2.454  1.00 11.67  ? 118 VAL B C     1 
ATOM 5976  O O     . VAL D 4 118 ? 6.705   109.329 -2.150  1.00 11.01  ? 118 VAL B O     1 
ATOM 5977  C CB    . VAL D 4 118 ? 4.141   107.767 -1.373  1.00 13.58  ? 118 VAL B CB    1 
ATOM 5978  C CG1   . VAL D 4 118 ? 3.467   107.620 -2.742  1.00 11.23  ? 118 VAL B CG1   1 
ATOM 5979  C CG2   . VAL D 4 118 ? 3.382   106.992 -0.306  1.00 13.71  ? 118 VAL B CG2   1 
ATOM 5980  N N     . PRO D 4 119 ? 6.465   107.694 -3.685  1.00 11.68  ? 119 PRO B N     1 
ATOM 5981  C CA    . PRO D 4 119 ? 7.103   108.339 -4.828  1.00 14.03  ? 119 PRO B CA    1 
ATOM 5982  C C     . PRO D 4 119 ? 6.246   109.427 -5.398  1.00 17.09  ? 119 PRO B C     1 
ATOM 5983  O O     . PRO D 4 119 ? 5.430   110.014 -4.701  1.00 18.31  ? 119 PRO B O     1 
ATOM 5984  C CB    . PRO D 4 119 ? 7.177   107.207 -5.834  1.00 14.55  ? 119 PRO B CB    1 
ATOM 5985  C CG    . PRO D 4 119 ? 5.888   106.545 -5.617  1.00 13.99  ? 119 PRO B CG    1 
ATOM 5986  C CD    . PRO D 4 119 ? 5.931   106.390 -4.103  1.00 12.87  ? 119 PRO B CD    1 
ATOM 5987  N N     . LEU D 4 120 ? 6.412   109.641 -6.699  1.00 20.16  ? 120 LEU B N     1 
ATOM 5988  C CA    . LEU D 4 120 ? 5.664   110.644 -7.432  1.00 22.50  ? 120 LEU B CA    1 
ATOM 5989  C C     . LEU D 4 120 ? 5.903   110.542 -8.912  1.00 23.18  ? 120 LEU B C     1 
ATOM 5990  O O     . LEU D 4 120 ? 7.049   110.512 -9.363  1.00 21.14  ? 120 LEU B O     1 
ATOM 5991  C CB    . LEU D 4 120 ? 6.052   112.052 -7.010  1.00 24.48  ? 120 LEU B CB    1 
ATOM 5992  C CG    . LEU D 4 120 ? 5.399   113.097 -7.919  1.00 25.35  ? 120 LEU B CG    1 
ATOM 5993  C CD1   . LEU D 4 120 ? 3.887   112.977 -7.770  1.00 26.97  ? 120 LEU B CD1   1 
ATOM 5994  C CD2   . LEU D 4 120 ? 5.865   114.508 -7.605  1.00 23.77  ? 120 LEU B CD2   1 
ATOM 5995  N N     . ASP D 4 121 ? 4.798   110.585 -9.650  1.00 25.42  ? 121 ASP B N     1 
ATOM 5996  C CA    . ASP D 4 121 ? 4.783   110.523 -11.100 1.00 28.29  ? 121 ASP B CA    1 
ATOM 5997  C C     . ASP D 4 121 ? 5.994   111.253 -11.620 1.00 29.75  ? 121 ASP B C     1 
ATOM 5998  O O     . ASP D 4 121 ? 6.269   112.367 -11.193 1.00 29.57  ? 121 ASP B O     1 
ATOM 5999  C CB    . ASP D 4 121 ? 3.510   111.203 -11.607 1.00 30.48  ? 121 ASP B CB    1 
ATOM 6000  C CG    . ASP D 4 121 ? 3.476   111.355 -13.121 1.00 34.08  ? 121 ASP B CG    1 
ATOM 6001  O OD1   . ASP D 4 121 ? 2.575   110.763 -13.752 1.00 36.57  ? 121 ASP B OD1   1 
ATOM 6002  O OD2   . ASP D 4 121 ? 4.312   112.091 -13.682 1.00 34.10  ? 121 ASP B OD2   1 
ATOM 6003  N N     . GLU D 4 122 ? 6.730   110.609 -12.516 1.00 32.69  ? 122 GLU B N     1 
ATOM 6004  C CA    . GLU D 4 122 ? 7.918   111.219 -13.081 1.00 35.78  ? 122 GLU B CA    1 
ATOM 6005  C C     . GLU D 4 122 ? 7.572   112.519 -13.754 1.00 35.88  ? 122 GLU B C     1 
ATOM 6006  O O     . GLU D 4 122 ? 8.102   113.555 -13.389 1.00 36.79  ? 122 GLU B O     1 
ATOM 6007  C CB    . GLU D 4 122 ? 8.596   110.274 -14.059 1.00 40.10  ? 122 GLU B CB    1 
ATOM 6008  C CG    . GLU D 4 122 ? 9.359   109.148 -13.352 1.00 47.09  ? 122 GLU B CG    1 
ATOM 6009  C CD    . GLU D 4 122 ? 9.878   108.066 -14.303 1.00 50.99  ? 122 GLU B CD    1 
ATOM 6010  O OE1   . GLU D 4 122 ? 10.546  107.113 -13.818 1.00 53.58  ? 122 GLU B OE1   1 
ATOM 6011  O OE2   . GLU D 4 122 ? 9.612   108.169 -15.530 1.00 53.61  ? 122 GLU B OE2   1 
ATOM 6012  N N     . ASP D 4 123 ? 6.611   112.489 -14.663 1.00 35.89  ? 123 ASP B N     1 
ATOM 6013  C CA    . ASP D 4 123 ? 6.221   113.708 -15.352 1.00 37.10  ? 123 ASP B CA    1 
ATOM 6014  C C     . ASP D 4 123 ? 5.762   114.906 -14.516 1.00 35.04  ? 123 ASP B C     1 
ATOM 6015  O O     . ASP D 4 123 ? 6.452   115.932 -14.493 1.00 34.89  ? 123 ASP B O     1 
ATOM 6016  C CB    . ASP D 4 123 ? 5.193   113.397 -16.428 1.00 41.77  ? 123 ASP B CB    1 
ATOM 6017  C CG    . ASP D 4 123 ? 5.843   112.939 -17.715 1.00 47.52  ? 123 ASP B CG    1 
ATOM 6018  O OD1   . ASP D 4 123 ? 5.591   111.785 -18.142 1.00 49.52  ? 123 ASP B OD1   1 
ATOM 6019  O OD2   . ASP D 4 123 ? 6.635   113.734 -18.282 1.00 50.51  ? 123 ASP B OD2   1 
ATOM 6020  N N     . PHE D 4 124 ? 4.641   114.765 -13.803 1.00 32.21  ? 124 PHE B N     1 
ATOM 6021  C CA    . PHE D 4 124 ? 4.069   115.862 -13.004 1.00 30.00  ? 124 PHE B CA    1 
ATOM 6022  C C     . PHE D 4 124 ? 5.080   116.632 -12.162 1.00 27.94  ? 124 PHE B C     1 
ATOM 6023  O O     . PHE D 4 124 ? 4.832   117.771 -11.728 1.00 26.01  ? 124 PHE B O     1 
ATOM 6024  C CB    . PHE D 4 124 ? 2.893   115.369 -12.137 1.00 29.20  ? 124 PHE B CB    1 
ATOM 6025  C CG    . PHE D 4 124 ? 2.347   116.418 -11.202 1.00 29.81  ? 124 PHE B CG    1 
ATOM 6026  C CD1   . PHE D 4 124 ? 2.717   116.431 -9.859  1.00 30.40  ? 124 PHE B CD1   1 
ATOM 6027  C CD2   . PHE D 4 124 ? 1.525   117.427 -11.670 1.00 29.69  ? 124 PHE B CD2   1 
ATOM 6028  C CE1   . PHE D 4 124 ? 2.282   117.438 -8.995  1.00 30.40  ? 124 PHE B CE1   1 
ATOM 6029  C CE2   . PHE D 4 124 ? 1.083   118.440 -10.811 1.00 30.30  ? 124 PHE B CE2   1 
ATOM 6030  C CZ    . PHE D 4 124 ? 1.467   118.443 -9.472  1.00 30.68  ? 124 PHE B CZ    1 
ATOM 6031  N N     . ARG D 4 125 ? 6.262   116.050 -12.029 1.00 26.43  ? 125 ARG B N     1 
ATOM 6032  C CA    . ARG D 4 125 ? 7.307   116.662 -11.239 1.00 27.69  ? 125 ARG B CA    1 
ATOM 6033  C C     . ARG D 4 125 ? 7.688   118.104 -11.561 1.00 26.90  ? 125 ARG B C     1 
ATOM 6034  O O     . ARG D 4 125 ? 7.609   118.969 -10.678 1.00 27.97  ? 125 ARG B O     1 
ATOM 6035  C CB    . ARG D 4 125 ? 8.542   115.757 -11.166 1.00 27.42  ? 125 ARG B CB    1 
ATOM 6036  C CG    . ARG D 4 125 ? 8.285   114.514 -10.318 1.00 27.87  ? 125 ARG B CG    1 
ATOM 6037  C CD    . ARG D 4 125 ? 9.508   113.656 -10.129 1.00 27.58  ? 125 ARG B CD    1 
ATOM 6038  N NE    . ARG D 4 125 ? 9.196   112.244 -10.313 1.00 27.01  ? 125 ARG B NE    1 
ATOM 6039  C CZ    . ARG D 4 125 ? 9.989   111.256 -9.928  1.00 26.01  ? 125 ARG B CZ    1 
ATOM 6040  N NH1   . ARG D 4 125 ? 11.138  111.526 -9.324  1.00 24.07  ? 125 ARG B NH1   1 
ATOM 6041  N NH2   . ARG D 4 125 ? 9.651   110.003 -10.192 1.00 25.74  ? 125 ARG B NH2   1 
ATOM 6042  N N     . LYS D 4 126 ? 8.038   118.385 -12.812 1.00 24.14  ? 126 LYS B N     1 
ATOM 6043  C CA    . LYS D 4 126 ? 8.443   119.733 -13.177 1.00 22.34  ? 126 LYS B CA    1 
ATOM 6044  C C     . LYS D 4 126 ? 7.582   120.825 -12.575 1.00 20.21  ? 126 LYS B C     1 
ATOM 6045  O O     . LYS D 4 126 ? 7.977   121.972 -12.527 1.00 22.12  ? 126 LYS B O     1 
ATOM 6046  C CB    . LYS D 4 126 ? 8.504   119.891 -14.682 1.00 25.56  ? 126 LYS B CB    1 
ATOM 6047  C CG    . LYS D 4 126 ? 7.287   119.394 -15.426 1.00 29.99  ? 126 LYS B CG    1 
ATOM 6048  C CD    . LYS D 4 126 ? 7.338   119.905 -16.874 1.00 34.46  ? 126 LYS B CD    1 
ATOM 6049  C CE    . LYS D 4 126 ? 6.593   119.004 -17.884 1.00 36.70  ? 126 LYS B CE    1 
ATOM 6050  N NZ    . LYS D 4 126 ? 5.129   118.821 -17.617 1.00 37.56  ? 126 LYS B NZ    1 
ATOM 6051  N N     . TYR D 4 127 ? 6.424   120.463 -12.062 1.00 16.18  ? 127 TYR B N     1 
ATOM 6052  C CA    . TYR D 4 127 ? 5.560   121.444 -11.461 1.00 13.68  ? 127 TYR B CA    1 
ATOM 6053  C C     . TYR D 4 127 ? 5.807   121.649 -9.988  1.00 13.78  ? 127 TYR B C     1 
ATOM 6054  O O     . TYR D 4 127 ? 4.893   121.985 -9.246  1.00 14.74  ? 127 TYR B O     1 
ATOM 6055  C CB    . TYR D 4 127 ? 4.156   120.982 -11.625 1.00 14.22  ? 127 TYR B CB    1 
ATOM 6056  C CG    . TYR D 4 127 ? 3.832   120.723 -13.029 1.00 14.17  ? 127 TYR B CG    1 
ATOM 6057  C CD1   . TYR D 4 127 ? 2.674   120.060 -13.360 1.00 15.57  ? 127 TYR B CD1   1 
ATOM 6058  C CD2   . TYR D 4 127 ? 4.649   121.184 -14.039 1.00 13.14  ? 127 TYR B CD2   1 
ATOM 6059  C CE1   . TYR D 4 127 ? 2.319   119.865 -14.659 1.00 17.67  ? 127 TYR B CE1   1 
ATOM 6060  C CE2   . TYR D 4 127 ? 4.310   120.993 -15.344 1.00 16.39  ? 127 TYR B CE2   1 
ATOM 6061  C CZ    . TYR D 4 127 ? 3.133   120.331 -15.658 1.00 17.62  ? 127 TYR B CZ    1 
ATOM 6062  O OH    . TYR D 4 127 ? 2.738   120.143 -16.970 1.00 20.49  ? 127 TYR B OH    1 
ATOM 6063  N N     . THR D 4 128 ? 7.029   121.466 -9.539  1.00 12.48  ? 128 THR B N     1 
ATOM 6064  C CA    . THR D 4 128 ? 7.276   121.631 -8.120  1.00 12.45  ? 128 THR B CA    1 
ATOM 6065  C C     . THR D 4 128 ? 8.565   122.376 -7.970  1.00 11.70  ? 128 THR B C     1 
ATOM 6066  O O     . THR D 4 128 ? 8.992   122.728 -6.874  1.00 7.55   ? 128 THR B O     1 
ATOM 6067  C CB    . THR D 4 128 ? 7.411   120.267 -7.461  1.00 14.33  ? 128 THR B CB    1 
ATOM 6068  O OG1   . THR D 4 128 ? 8.603   119.635 -7.937  1.00 19.27  ? 128 THR B OG1   1 
ATOM 6069  C CG2   . THR D 4 128 ? 6.233   119.384 -7.836  1.00 16.08  ? 128 THR B CG2   1 
ATOM 6070  N N     . ALA D 4 129 ? 9.206   122.568 -9.106  1.00 13.10  ? 129 ALA B N     1 
ATOM 6071  C CA    . ALA D 4 129 ? 10.469  123.263 -9.168  1.00 15.35  ? 129 ALA B CA    1 
ATOM 6072  C C     . ALA D 4 129 ? 10.505  124.541 -8.325  1.00 14.54  ? 129 ALA B C     1 
ATOM 6073  O O     . ALA D 4 129 ? 9.595   125.377 -8.400  1.00 14.62  ? 129 ALA B O     1 
ATOM 6074  C CB    . ALA D 4 129 ? 10.789  123.582 -10.624 1.00 17.21  ? 129 ALA B CB    1 
ATOM 6075  N N     . PHE D 4 130 ? 11.570  124.677 -7.538  1.00 12.49  ? 130 PHE B N     1 
ATOM 6076  C CA    . PHE D 4 130 ? 11.769  125.846 -6.689  1.00 11.76  ? 130 PHE B CA    1 
ATOM 6077  C C     . PHE D 4 130 ? 13.187  126.319 -6.770  1.00 10.69  ? 130 PHE B C     1 
ATOM 6078  O O     . PHE D 4 130 ? 14.010  125.704 -7.446  1.00 10.16  ? 130 PHE B O     1 
ATOM 6079  C CB    . PHE D 4 130 ? 11.469  125.528 -5.247  1.00 12.30  ? 130 PHE B CB    1 
ATOM 6080  C CG    . PHE D 4 130 ? 12.133  124.301 -4.765  1.00 11.95  ? 130 PHE B CG    1 
ATOM 6081  C CD1   . PHE D 4 130 ? 11.682  123.054 -5.178  1.00 11.54  ? 130 PHE B CD1   1 
ATOM 6082  C CD2   . PHE D 4 130 ? 13.167  124.377 -3.851  1.00 11.48  ? 130 PHE B CD2   1 
ATOM 6083  C CE1   . PHE D 4 130 ? 12.246  121.896 -4.672  1.00 13.94  ? 130 PHE B CE1   1 
ATOM 6084  C CE2   . PHE D 4 130 ? 13.738  123.226 -3.340  1.00 12.19  ? 130 PHE B CE2   1 
ATOM 6085  C CZ    . PHE D 4 130 ? 13.277  121.984 -3.747  1.00 13.33  ? 130 PHE B CZ    1 
ATOM 6086  N N     . THR D 4 131 ? 13.493  127.381 -6.033  1.00 9.47   ? 131 THR B N     1 
ATOM 6087  C CA    . THR D 4 131 ? 14.838  127.894 -6.106  1.00 9.46   ? 131 THR B CA    1 
ATOM 6088  C C     . THR D 4 131 ? 15.420  128.609 -4.936  1.00 9.87   ? 131 THR B C     1 
ATOM 6089  O O     . THR D 4 131 ? 14.955  129.670 -4.536  1.00 9.31   ? 131 THR B O     1 
ATOM 6090  C CB    . THR D 4 131 ? 15.000  128.847 -7.242  1.00 8.69   ? 131 THR B CB    1 
ATOM 6091  O OG1   . THR D 4 131 ? 14.046  128.546 -8.271  1.00 10.29  ? 131 THR B OG1   1 
ATOM 6092  C CG2   . THR D 4 131 ? 16.429  128.739 -7.758  1.00 8.69   ? 131 THR B CG2   1 
ATOM 6093  N N     . ILE D 4 132 ? 16.519  128.070 -4.450  1.00 10.88  ? 132 ILE B N     1 
ATOM 6094  C CA    . ILE D 4 132 ? 17.197  128.706 -3.358  1.00 11.62  ? 132 ILE B CA    1 
ATOM 6095  C C     . ILE D 4 132 ? 18.093  129.783 -3.961  1.00 11.74  ? 132 ILE B C     1 
ATOM 6096  O O     . ILE D 4 132 ? 18.628  129.618 -5.061  1.00 13.29  ? 132 ILE B O     1 
ATOM 6097  C CB    . ILE D 4 132 ? 18.003  127.693 -2.541  1.00 9.89   ? 132 ILE B CB    1 
ATOM 6098  C CG1   . ILE D 4 132 ? 17.087  127.076 -1.485  1.00 10.47  ? 132 ILE B CG1   1 
ATOM 6099  C CG2   . ILE D 4 132 ? 19.234  128.344 -1.932  1.00 9.76   ? 132 ILE B CG2   1 
ATOM 6100  C CD1   . ILE D 4 132 ? 17.798  126.315 -0.391  1.00 9.73   ? 132 ILE B CD1   1 
ATOM 6101  N N     . PRO D 4 133 ? 18.098  130.964 -3.337  1.00 11.66  ? 133 PRO B N     1 
ATOM 6102  C CA    . PRO D 4 133 ? 18.878  132.146 -3.719  1.00 12.56  ? 133 PRO B CA    1 
ATOM 6103  C C     . PRO D 4 133 ? 20.052  132.395 -2.786  1.00 13.87  ? 133 PRO B C     1 
ATOM 6104  O O     . PRO D 4 133 ? 20.228  131.702 -1.784  1.00 10.93  ? 133 PRO B O     1 
ATOM 6105  C CB    . PRO D 4 133 ? 17.874  133.246 -3.584  1.00 11.62  ? 133 PRO B CB    1 
ATOM 6106  C CG    . PRO D 4 133 ? 17.171  132.806 -2.326  1.00 12.95  ? 133 PRO B CG    1 
ATOM 6107  C CD    . PRO D 4 133 ? 16.932  131.351 -2.527  1.00 9.70   ? 133 PRO B CD    1 
ATOM 6108  N N     . SER D 4 134 ? 20.780  133.471 -3.061  1.00 18.63  ? 134 SER B N     1 
ATOM 6109  C CA    . SER D 4 134 ? 21.978  133.799 -2.286  1.00 22.74  ? 134 SER B CA    1 
ATOM 6110  C C     . SER D 4 134 ? 22.160  135.257 -1.954  1.00 22.97  ? 134 SER B C     1 
ATOM 6111  O O     . SER D 4 134 ? 21.714  136.144 -2.683  1.00 24.73  ? 134 SER B O     1 
ATOM 6112  C CB    . SER D 4 134 ? 23.229  133.403 -3.078  1.00 24.17  ? 134 SER B CB    1 
ATOM 6113  O OG    . SER D 4 134 ? 23.416  134.270 -4.200  1.00 25.21  ? 134 SER B OG    1 
ATOM 6114  N N     . ILE D 4 135 ? 22.979  135.488 -0.941  1.00 22.14  ? 135 ILE B N     1 
ATOM 6115  C CA    . ILE D 4 135 ? 23.280  136.835 -0.545  1.00 22.12  ? 135 ILE B CA    1 
ATOM 6116  C C     . ILE D 4 135 ? 24.086  137.459 -1.663  1.00 21.31  ? 135 ILE B C     1 
ATOM 6117  O O     . ILE D 4 135 ? 24.883  136.795 -2.325  1.00 20.24  ? 135 ILE B O     1 
ATOM 6118  C CB    . ILE D 4 135 ? 24.120  136.850 0.711   1.00 23.93  ? 135 ILE B CB    1 
ATOM 6119  C CG1   . ILE D 4 135 ? 25.532  136.314 0.408   1.00 26.74  ? 135 ILE B CG1   1 
ATOM 6120  C CG2   . ILE D 4 135 ? 23.447  135.981 1.764   1.00 25.76  ? 135 ILE B CG2   1 
ATOM 6121  C CD1   . ILE D 4 135 ? 26.684  137.086 1.110   1.00 28.03  ? 135 ILE B CD1   1 
ATOM 6122  N N     . ASN D 4 136 ? 23.812  138.729 -1.907  1.00 23.48  ? 136 ASN B N     1 
ATOM 6123  C CA    . ASN D 4 136 ? 24.504  139.510 -2.923  1.00 25.99  ? 136 ASN B CA    1 
ATOM 6124  C C     . ASN D 4 136 ? 24.583  138.826 -4.275  1.00 24.85  ? 136 ASN B C     1 
ATOM 6125  O O     . ASN D 4 136 ? 25.273  139.305 -5.177  1.00 24.01  ? 136 ASN B O     1 
ATOM 6126  C CB    . ASN D 4 136 ? 25.918  139.866 -2.437  1.00 29.95  ? 136 ASN B CB    1 
ATOM 6127  C CG    . ASN D 4 136 ? 26.470  141.140 -3.092  1.00 33.53  ? 136 ASN B CG    1 
ATOM 6128  O OD1   . ASN D 4 136 ? 25.734  142.102 -3.350  1.00 36.49  ? 136 ASN B OD1   1 
ATOM 6129  N ND2   . ASN D 4 136 ? 27.775  141.152 -3.349  1.00 35.25  ? 136 ASN B ND2   1 
ATOM 6130  N N     . ASN D 4 137 ? 23.859  137.726 -4.427  1.00 23.94  ? 137 ASN B N     1 
ATOM 6131  C CA    . ASN D 4 137 ? 23.896  136.995 -5.676  1.00 25.48  ? 137 ASN B CA    1 
ATOM 6132  C C     . ASN D 4 137 ? 25.337  136.571 -5.987  1.00 27.12  ? 137 ASN B C     1 
ATOM 6133  O O     . ASN D 4 137 ? 25.841  136.815 -7.095  1.00 27.91  ? 137 ASN B O     1 
ATOM 6134  C CB    . ASN D 4 137 ? 23.365  137.866 -6.817  1.00 24.06  ? 137 ASN B CB    1 
ATOM 6135  C CG    . ASN D 4 137 ? 21.898  138.152 -6.693  1.00 23.28  ? 137 ASN B CG    1 
ATOM 6136  O OD1   . ASN D 4 137 ? 21.074  137.525 -7.353  1.00 22.45  ? 137 ASN B OD1   1 
ATOM 6137  N ND2   . ASN D 4 137 ? 21.561  139.116 -5.863  1.00 25.29  ? 137 ASN B ND2   1 
ATOM 6138  N N     . GLU D 4 138 ? 26.013  135.977 -5.002  1.00 27.60  ? 138 GLU B N     1 
ATOM 6139  C CA    . GLU D 4 138 ? 27.384  135.523 -5.203  1.00 27.91  ? 138 GLU B CA    1 
ATOM 6140  C C     . GLU D 4 138 ? 27.399  134.645 -6.439  1.00 26.02  ? 138 GLU B C     1 
ATOM 6141  O O     . GLU D 4 138 ? 28.314  134.703 -7.259  1.00 25.69  ? 138 GLU B O     1 
ATOM 6142  C CB    . GLU D 4 138 ? 27.891  134.728 -3.991  1.00 31.59  ? 138 GLU B CB    1 
ATOM 6143  C CG    . GLU D 4 138 ? 29.049  133.764 -4.350  1.00 39.47  ? 138 GLU B CG    1 
ATOM 6144  C CD    . GLU D 4 138 ? 29.935  133.345 -3.167  1.00 44.15  ? 138 GLU B CD    1 
ATOM 6145  O OE1   . GLU D 4 138 ? 31.157  133.137 -3.396  1.00 46.03  ? 138 GLU B OE1   1 
ATOM 6146  O OE2   . GLU D 4 138 ? 29.421  133.220 -2.026  1.00 47.84  ? 138 GLU B OE2   1 
ATOM 6147  N N     . THR D 4 139 ? 26.325  133.886 -6.589  1.00 23.62  ? 139 THR B N     1 
ATOM 6148  C CA    . THR D 4 139 ? 26.162  132.977 -7.703  1.00 23.81  ? 139 THR B CA    1 
ATOM 6149  C C     . THR D 4 139 ? 24.711  133.047 -8.118  1.00 23.37  ? 139 THR B C     1 
ATOM 6150  O O     . THR D 4 139 ? 23.916  133.709 -7.467  1.00 23.94  ? 139 THR B O     1 
ATOM 6151  C CB    . THR D 4 139 ? 26.407  131.534 -7.253  1.00 24.46  ? 139 THR B CB    1 
ATOM 6152  O OG1   . THR D 4 139 ? 25.388  131.158 -6.317  1.00 24.36  ? 139 THR B OG1   1 
ATOM 6153  C CG2   . THR D 4 139 ? 27.788  131.382 -6.604  1.00 26.09  ? 139 THR B CG2   1 
ATOM 6154  N N     . PRO D 4 140 ? 24.345  132.373 -9.214  1.00 23.70  ? 140 PRO B N     1 
ATOM 6155  C CA    . PRO D 4 140 ? 22.946  132.392 -9.659  1.00 23.01  ? 140 PRO B CA    1 
ATOM 6156  C C     . PRO D 4 140 ? 22.126  131.446 -8.806  1.00 21.95  ? 140 PRO B C     1 
ATOM 6157  O O     . PRO D 4 140 ? 22.657  130.676 -7.993  1.00 20.98  ? 140 PRO B O     1 
ATOM 6158  C CB    . PRO D 4 140 ? 23.022  131.881 -11.095 1.00 23.23  ? 140 PRO B CB    1 
ATOM 6159  C CG    . PRO D 4 140 ? 24.428  132.239 -11.503 1.00 26.42  ? 140 PRO B CG    1 
ATOM 6160  C CD    . PRO D 4 140 ? 25.220  131.869 -10.280 1.00 23.77  ? 140 PRO B CD    1 
ATOM 6161  N N     . GLY D 4 141 ? 20.819  131.504 -9.008  1.00 21.66  ? 141 GLY B N     1 
ATOM 6162  C CA    . GLY D 4 141 ? 19.923  130.660 -8.251  1.00 20.68  ? 141 GLY B CA    1 
ATOM 6163  C C     . GLY D 4 141 ? 20.249  129.210 -8.498  1.00 19.91  ? 141 GLY B C     1 
ATOM 6164  O O     . GLY D 4 141 ? 20.877  128.855 -9.502  1.00 20.27  ? 141 GLY B O     1 
ATOM 6165  N N     . ILE D 4 142 ? 19.854  128.371 -7.553  1.00 18.84  ? 142 ILE B N     1 
ATOM 6166  C CA    . ILE D 4 142 ? 20.099  126.942 -7.659  1.00 15.93  ? 142 ILE B CA    1 
ATOM 6167  C C     . ILE D 4 142 ? 18.764  126.238 -7.387  1.00 14.09  ? 142 ILE B C     1 
ATOM 6168  O O     . ILE D 4 142 ? 18.196  126.340 -6.301  1.00 14.57  ? 142 ILE B O     1 
ATOM 6169  C CB    . ILE D 4 142 ? 21.278  126.542 -6.735  1.00 13.92  ? 142 ILE B CB    1 
ATOM 6170  C CG1   . ILE D 4 142 ? 21.077  127.112 -5.338  1.00 12.11  ? 142 ILE B CG1   1 
ATOM 6171  C CG2   . ILE D 4 142 ? 22.587  127.164 -7.272  1.00 11.56  ? 142 ILE B CG2   1 
ATOM 6172  C CD1   . ILE D 4 142 ? 22.219  126.810 -4.419  1.00 11.90  ? 142 ILE B CD1   1 
ATOM 6173  N N     . ARG D 4 143 ? 18.231  125.599 -8.423  1.00 11.06  ? 143 ARG B N     1 
ATOM 6174  C CA    . ARG D 4 143 ? 16.916  124.972 -8.342  1.00 10.00  ? 143 ARG B CA    1 
ATOM 6175  C C     . ARG D 4 143 ? 16.828  123.472 -8.201  1.00 8.15   ? 143 ARG B C     1 
ATOM 6176  O O     . ARG D 4 143 ? 17.565  122.737 -8.837  1.00 9.64   ? 143 ARG B O     1 
ATOM 6177  C CB    . ARG D 4 143 ? 16.088  125.365 -9.561  1.00 11.13  ? 143 ARG B CB    1 
ATOM 6178  C CG    . ARG D 4 143 ? 16.691  126.459 -10.429 1.00 12.28  ? 143 ARG B CG    1 
ATOM 6179  C CD    . ARG D 4 143 ? 15.891  126.613 -11.707 1.00 13.09  ? 143 ARG B CD    1 
ATOM 6180  N NE    . ARG D 4 143 ? 14.471  126.729 -11.407 1.00 14.81  ? 143 ARG B NE    1 
ATOM 6181  C CZ    . ARG D 4 143 ? 13.500  126.573 -12.296 1.00 16.65  ? 143 ARG B CZ    1 
ATOM 6182  N NH1   . ARG D 4 143 ? 13.787  126.293 -13.564 1.00 15.19  ? 143 ARG B NH1   1 
ATOM 6183  N NH2   . ARG D 4 143 ? 12.239  126.670 -11.902 1.00 17.01  ? 143 ARG B NH2   1 
ATOM 6184  N N     . TYR D 4 144 ? 15.830  123.024 -7.454  1.00 6.45   ? 144 TYR B N     1 
ATOM 6185  C CA    . TYR D 4 144 ? 15.612  121.610 -7.238  1.00 5.26   ? 144 TYR B CA    1 
ATOM 6186  C C     . TYR D 4 144 ? 14.228  121.167 -7.679  1.00 6.57   ? 144 TYR B C     1 
ATOM 6187  O O     . TYR D 4 144 ? 13.368  121.971 -8.015  1.00 5.79   ? 144 TYR B O     1 
ATOM 6188  C CB    . TYR D 4 144 ? 15.721  121.306 -5.772  1.00 4.00   ? 144 TYR B CB    1 
ATOM 6189  C CG    . TYR D 4 144 ? 17.084  121.398 -5.198  1.00 6.51   ? 144 TYR B CG    1 
ATOM 6190  C CD1   . TYR D 4 144 ? 18.061  122.193 -5.773  1.00 9.55   ? 144 TYR B CD1   1 
ATOM 6191  C CD2   . TYR D 4 144 ? 17.400  120.693 -4.048  1.00 8.99   ? 144 TYR B CD2   1 
ATOM 6192  C CE1   . TYR D 4 144 ? 19.333  122.286 -5.213  1.00 12.41  ? 144 TYR B CE1   1 
ATOM 6193  C CE2   . TYR D 4 144 ? 18.654  120.772 -3.475  1.00 12.64  ? 144 TYR B CE2   1 
ATOM 6194  C CZ    . TYR D 4 144 ? 19.620  121.568 -4.058  1.00 12.41  ? 144 TYR B CZ    1 
ATOM 6195  O OH    . TYR D 4 144 ? 20.865  121.628 -3.477  1.00 15.56  ? 144 TYR B OH    1 
ATOM 6196  N N     . GLN D 4 145 ? 14.030  119.860 -7.653  1.00 8.69   ? 145 GLN B N     1 
ATOM 6197  C CA    . GLN D 4 145 ? 12.762  119.242 -7.995  1.00 11.33  ? 145 GLN B CA    1 
ATOM 6198  C C     . GLN D 4 145 ? 12.426  118.191 -6.926  1.00 13.45  ? 145 GLN B C     1 
ATOM 6199  O O     . GLN D 4 145 ? 13.307  117.591 -6.284  1.00 13.14  ? 145 GLN B O     1 
ATOM 6200  C CB    . GLN D 4 145 ? 12.834  118.519 -9.344  1.00 12.63  ? 145 GLN B CB    1 
ATOM 6201  C CG    . GLN D 4 145 ? 12.910  119.383 -10.582 1.00 16.38  ? 145 GLN B CG    1 
ATOM 6202  C CD    . GLN D 4 145 ? 12.554  118.620 -11.877 1.00 18.70  ? 145 GLN B CD    1 
ATOM 6203  O OE1   . GLN D 4 145 ? 12.821  119.097 -12.988 1.00 19.13  ? 145 GLN B OE1   1 
ATOM 6204  N NE2   . GLN D 4 145 ? 11.918  117.456 -11.733 1.00 18.68  ? 145 GLN B NE2   1 
ATOM 6205  N N     . TYR D 4 146 ? 11.134  117.944 -6.780  1.00 14.15  ? 146 TYR B N     1 
ATOM 6206  C CA    . TYR D 4 146 ? 10.641  116.951 -5.855  1.00 14.26  ? 146 TYR B CA    1 
ATOM 6207  C C     . TYR D 4 146 ? 10.465  115.663 -6.676  1.00 15.67  ? 146 TYR B C     1 
ATOM 6208  O O     . TYR D 4 146 ? 10.036  115.724 -7.849  1.00 14.32  ? 146 TYR B O     1 
ATOM 6209  C CB    . TYR D 4 146 ? 9.330   117.441 -5.252  1.00 14.25  ? 146 TYR B CB    1 
ATOM 6210  C CG    . TYR D 4 146 ? 9.502   117.970 -3.860  1.00 15.17  ? 146 TYR B CG    1 
ATOM 6211  C CD1   . TYR D 4 146 ? 9.986   119.252 -3.621  1.00 13.08  ? 146 TYR B CD1   1 
ATOM 6212  C CD2   . TYR D 4 146 ? 9.208   117.161 -2.767  1.00 18.12  ? 146 TYR B CD2   1 
ATOM 6213  C CE1   . TYR D 4 146 ? 10.169  119.711 -2.316  1.00 14.02  ? 146 TYR B CE1   1 
ATOM 6214  C CE2   . TYR D 4 146 ? 9.382   117.609 -1.460  1.00 16.42  ? 146 TYR B CE2   1 
ATOM 6215  C CZ    . TYR D 4 146 ? 9.860   118.872 -1.241  1.00 15.63  ? 146 TYR B CZ    1 
ATOM 6216  O OH    . TYR D 4 146 ? 10.014  119.264 0.064   1.00 15.18  ? 146 TYR B OH    1 
ATOM 6217  N N     . ASN D 4 147 ? 10.858  114.521 -6.093  1.00 15.60  ? 147 ASN B N     1 
ATOM 6218  C CA    . ASN D 4 147 ? 10.771  113.202 -6.760  1.00 14.75  ? 147 ASN B CA    1 
ATOM 6219  C C     . ASN D 4 147 ? 9.629   112.352 -6.231  1.00 13.21  ? 147 ASN B C     1 
ATOM 6220  O O     . ASN D 4 147 ? 9.051   111.496 -6.914  1.00 8.78   ? 147 ASN B O     1 
ATOM 6221  C CB    . ASN D 4 147 ? 12.059  112.428 -6.519  1.00 15.87  ? 147 ASN B CB    1 
ATOM 6222  C CG    . ASN D 4 147 ? 13.231  113.046 -7.207  1.00 18.06  ? 147 ASN B CG    1 
ATOM 6223  O OD1   . ASN D 4 147 ? 13.296  113.043 -8.437  1.00 19.19  ? 147 ASN B OD1   1 
ATOM 6224  N ND2   . ASN D 4 147 ? 14.172  113.588 -6.426  1.00 16.43  ? 147 ASN B ND2   1 
ATOM 6225  N N     . VAL D 4 148 ? 9.433   112.534 -4.942  1.00 13.66  ? 148 VAL B N     1 
ATOM 6226  C CA    . VAL D 4 148 ? 8.422   111.867 -4.167  1.00 15.71  ? 148 VAL B CA    1 
ATOM 6227  C C     . VAL D 4 148 ? 7.283   112.849 -3.988  1.00 15.04  ? 148 VAL B C     1 
ATOM 6228  O O     . VAL D 4 148 ? 6.977   113.642 -4.864  1.00 14.56  ? 148 VAL B O     1 
ATOM 6229  C CB    . VAL D 4 148 ? 8.984   111.580 -2.771  1.00 19.36  ? 148 VAL B CB    1 
ATOM 6230  C CG1   . VAL D 4 148 ? 9.459   110.170 -2.696  1.00 22.15  ? 148 VAL B CG1   1 
ATOM 6231  C CG2   . VAL D 4 148 ? 10.145  112.572 -2.441  1.00 18.87  ? 148 VAL B CG2   1 
ATOM 6232  N N     . LEU D 4 149 ? 6.668   112.799 -2.821  1.00 13.91  ? 149 LEU B N     1 
ATOM 6233  C CA    . LEU D 4 149 ? 5.606   113.714 -2.507  1.00 12.71  ? 149 LEU B CA    1 
ATOM 6234  C C     . LEU D 4 149 ? 6.194   114.950 -1.814  1.00 13.36  ? 149 LEU B C     1 
ATOM 6235  O O     . LEU D 4 149 ? 7.065   114.850 -0.942  1.00 13.83  ? 149 LEU B O     1 
ATOM 6236  C CB    . LEU D 4 149 ? 4.578   113.012 -1.632  1.00 10.09  ? 149 LEU B CB    1 
ATOM 6237  C CG    . LEU D 4 149 ? 4.014   111.808 -2.371  1.00 8.02   ? 149 LEU B CG    1 
ATOM 6238  C CD1   . LEU D 4 149 ? 2.960   111.129 -1.531  1.00 8.50   ? 149 LEU B CD1   1 
ATOM 6239  C CD2   . LEU D 4 149 ? 3.438   112.262 -3.701  1.00 4.32   ? 149 LEU B CD2   1 
ATOM 6240  N N     . PRO D 4 150 ? 5.826   116.137 -2.299  1.00 13.86  ? 150 PRO B N     1 
ATOM 6241  C CA    . PRO D 4 150 ? 6.322   117.370 -1.705  1.00 12.59  ? 150 PRO B CA    1 
ATOM 6242  C C     . PRO D 4 150 ? 5.485   117.687 -0.501  1.00 13.76  ? 150 PRO B C     1 
ATOM 6243  O O     . PRO D 4 150 ? 4.271   117.476 -0.500  1.00 10.78  ? 150 PRO B O     1 
ATOM 6244  C CB    . PRO D 4 150 ? 6.107   118.372 -2.813  1.00 13.19  ? 150 PRO B CB    1 
ATOM 6245  C CG    . PRO D 4 150 ? 4.840   117.869 -3.442  1.00 13.56  ? 150 PRO B CG    1 
ATOM 6246  C CD    . PRO D 4 150 ? 5.106   116.410 -3.552  1.00 13.13  ? 150 PRO B CD    1 
ATOM 6247  N N     . GLN D 4 151 ? 6.139   118.168 0.539   1.00 16.44  ? 151 GLN B N     1 
ATOM 6248  C CA    . GLN D 4 151 ? 5.435   118.496 1.769   1.00 21.02  ? 151 GLN B CA    1 
ATOM 6249  C C     . GLN D 4 151 ? 4.518   119.717 1.682   1.00 19.46  ? 151 GLN B C     1 
ATOM 6250  O O     . GLN D 4 151 ? 4.931   120.846 1.960   1.00 20.77  ? 151 GLN B O     1 
ATOM 6251  C CB    . GLN D 4 151 ? 6.434   118.631 2.913   1.00 27.40  ? 151 GLN B CB    1 
ATOM 6252  C CG    . GLN D 4 151 ? 7.752   119.287 2.509   1.00 38.20  ? 151 GLN B CG    1 
ATOM 6253  C CD    . GLN D 4 151 ? 8.923   118.853 3.390   1.00 44.24  ? 151 GLN B CD    1 
ATOM 6254  O OE1   . GLN D 4 151 ? 8.735   118.227 4.445   1.00 47.32  ? 151 GLN B OE1   1 
ATOM 6255  N NE2   . GLN D 4 151 ? 10.143  119.169 2.949   1.00 47.19  ? 151 GLN B NE2   1 
ATOM 6256  N N     . GLY D 4 152 ? 3.259   119.455 1.329   1.00 16.95  ? 152 GLY B N     1 
ATOM 6257  C CA    . GLY D 4 152 ? 2.259   120.501 1.190   1.00 12.69  ? 152 GLY B CA    1 
ATOM 6258  C C     . GLY D 4 152 ? 1.841   120.553 -0.256  1.00 10.95  ? 152 GLY B C     1 
ATOM 6259  O O     . GLY D 4 152 ? 2.590   121.050 -1.088  1.00 11.93  ? 152 GLY B O     1 
ATOM 6260  N N     . TRP D 4 153 ? 0.684   119.980 -0.565  1.00 8.95   ? 153 TRP B N     1 
ATOM 6261  C CA    . TRP D 4 153 ? 0.171   119.950 -1.931  1.00 8.46   ? 153 TRP B CA    1 
ATOM 6262  C C     . TRP D 4 153 ? -1.074  119.102 -2.016  1.00 9.16   ? 153 TRP B C     1 
ATOM 6263  O O     . TRP D 4 153 ? -1.015  117.924 -1.731  1.00 9.44   ? 153 TRP B O     1 
ATOM 6264  C CB    . TRP D 4 153 ? 1.184   119.347 -2.904  1.00 7.14   ? 153 TRP B CB    1 
ATOM 6265  C CG    . TRP D 4 153 ? 0.584   119.209 -4.230  1.00 8.96   ? 153 TRP B CG    1 
ATOM 6266  C CD1   . TRP D 4 153 ? -0.066  120.170 -4.889  1.00 10.46  ? 153 TRP B CD1   1 
ATOM 6267  C CD2   . TRP D 4 153 ? 0.520   118.041 -5.057  1.00 8.64   ? 153 TRP B CD2   1 
ATOM 6268  N NE1   . TRP D 4 153 ? -0.548  119.700 -6.084  1.00 11.89  ? 153 TRP B NE1   1 
ATOM 6269  C CE2   . TRP D 4 153 ? -0.198  118.389 -6.213  1.00 9.90   ? 153 TRP B CE2   1 
ATOM 6270  C CE3   . TRP D 4 153 ? 0.998   116.742 -4.935  1.00 10.90  ? 153 TRP B CE3   1 
ATOM 6271  C CZ2   . TRP D 4 153 ? -0.451  117.492 -7.244  1.00 9.33   ? 153 TRP B CZ2   1 
ATOM 6272  C CZ3   . TRP D 4 153 ? 0.744   115.847 -5.967  1.00 12.06  ? 153 TRP B CZ3   1 
ATOM 6273  C CH2   . TRP D 4 153 ? 0.026   116.228 -7.104  1.00 9.49   ? 153 TRP B CH2   1 
ATOM 6274  N N     . LYS D 4 154 ? -2.158  119.675 -2.528  1.00 12.53  ? 154 LYS B N     1 
ATOM 6275  C CA    . LYS D 4 154 ? -3.437  118.964 -2.685  1.00 15.44  ? 154 LYS B CA    1 
ATOM 6276  C C     . LYS D 4 154 ? -3.213  117.510 -3.013  1.00 14.85  ? 154 LYS B C     1 
ATOM 6277  O O     . LYS D 4 154 ? -3.470  116.631 -2.190  1.00 14.90  ? 154 LYS B O     1 
ATOM 6278  C CB    . LYS D 4 154 ? -4.283  119.548 -3.834  1.00 18.46  ? 154 LYS B CB    1 
ATOM 6279  C CG    . LYS D 4 154 ? -5.200  120.725 -3.481  1.00 20.10  ? 154 LYS B CG    1 
ATOM 6280  C CD    . LYS D 4 154 ? -6.442  120.774 -4.391  1.00 19.40  ? 154 LYS B CD    1 
ATOM 6281  C CE    . LYS D 4 154 ? -6.127  121.166 -5.836  1.00 18.96  ? 154 LYS B CE    1 
ATOM 6282  N NZ    . LYS D 4 154 ? -5.422  120.122 -6.643  1.00 20.09  ? 154 LYS B NZ    1 
ATOM 6283  N N     . GLY D 4 155 ? -2.644  117.294 -4.195  1.00 14.13  ? 155 GLY B N     1 
ATOM 6284  C CA    . GLY D 4 155 ? -2.379  115.958 -4.675  1.00 13.65  ? 155 GLY B CA    1 
ATOM 6285  C C     . GLY D 4 155 ? -1.720  115.045 -3.665  1.00 13.80  ? 155 GLY B C     1 
ATOM 6286  O O     . GLY D 4 155 ? -2.118  113.889 -3.520  1.00 15.04  ? 155 GLY B O     1 
ATOM 6287  N N     . SER D 4 156 ? -0.766  115.564 -2.910  1.00 12.22  ? 156 SER B N     1 
ATOM 6288  C CA    . SER D 4 156 ? -0.087  114.714 -1.953  1.00 12.95  ? 156 SER B CA    1 
ATOM 6289  C C     . SER D 4 156 ? -0.992  113.959 -0.967  1.00 13.76  ? 156 SER B C     1 
ATOM 6290  O O     . SER D 4 156 ? -1.161  112.741 -1.077  1.00 14.71  ? 156 SER B O     1 
ATOM 6291  C CB    . SER D 4 156 ? 1.022   115.484 -1.235  1.00 13.69  ? 156 SER B CB    1 
ATOM 6292  O OG    . SER D 4 156 ? 2.082   115.803 -2.122  1.00 14.12  ? 156 SER B OG    1 
ATOM 6293  N N     . PRO D 4 157 ? -1.625  114.662 -0.024  1.00 14.04  ? 157 PRO B N     1 
ATOM 6294  C CA    . PRO D 4 157 ? -2.479  113.926 0.911   1.00 13.43  ? 157 PRO B CA    1 
ATOM 6295  C C     . PRO D 4 157 ? -3.515  113.096 0.199   1.00 12.72  ? 157 PRO B C     1 
ATOM 6296  O O     . PRO D 4 157 ? -3.907  112.035 0.674   1.00 11.91  ? 157 PRO B O     1 
ATOM 6297  C CB    . PRO D 4 157 ? -3.129  115.041 1.722   1.00 15.62  ? 157 PRO B CB    1 
ATOM 6298  C CG    . PRO D 4 157 ? -3.123  116.236 0.752   1.00 16.51  ? 157 PRO B CG    1 
ATOM 6299  C CD    . PRO D 4 157 ? -1.757  116.115 0.173   1.00 15.67  ? 157 PRO B CD    1 
ATOM 6300  N N     . ALA D 4 158 ? -3.903  113.576 -0.973  1.00 13.10  ? 158 ALA B N     1 
ATOM 6301  C CA    . ALA D 4 158 ? -4.901  112.924 -1.795  1.00 15.20  ? 158 ALA B CA    1 
ATOM 6302  C C     . ALA D 4 158 ? -4.627  111.451 -2.030  1.00 17.19  ? 158 ALA B C     1 
ATOM 6303  O O     . ALA D 4 158 ? -5.540  110.621 -1.934  1.00 18.33  ? 158 ALA B O     1 
ATOM 6304  C CB    . ALA D 4 158 ? -5.010  113.630 -3.126  1.00 15.12  ? 158 ALA B CB    1 
ATOM 6305  N N     . ILE D 4 159 ? -3.369  111.140 -2.333  1.00 17.71  ? 159 ILE B N     1 
ATOM 6306  C CA    . ILE D 4 159 ? -2.938  109.773 -2.628  1.00 17.68  ? 159 ILE B CA    1 
ATOM 6307  C C     . ILE D 4 159 ? -2.588  108.894 -1.416  1.00 18.99  ? 159 ILE B C     1 
ATOM 6308  O O     . ILE D 4 159 ? -3.234  107.861 -1.160  1.00 19.62  ? 159 ILE B O     1 
ATOM 6309  C CB    . ILE D 4 159 ? -1.741  109.804 -3.552  1.00 14.56  ? 159 ILE B CB    1 
ATOM 6310  C CG1   . ILE D 4 159 ? -1.854  111.010 -4.471  1.00 11.99  ? 159 ILE B CG1   1 
ATOM 6311  C CG2   . ILE D 4 159 ? -1.734  108.560 -4.402  1.00 14.60  ? 159 ILE B CG2   1 
ATOM 6312  C CD1   . ILE D 4 159 ? -0.538  111.502 -4.917  1.00 12.66  ? 159 ILE B CD1   1 
ATOM 6313  N N     . PHE D 4 160 ? -1.562  109.312 -0.684  1.00 19.01  ? 160 PHE B N     1 
ATOM 6314  C CA    . PHE D 4 160 ? -1.076  108.597 0.496   1.00 19.01  ? 160 PHE B CA    1 
ATOM 6315  C C     . PHE D 4 160 ? -2.133  108.093 1.500   1.00 19.11  ? 160 PHE B C     1 
ATOM 6316  O O     . PHE D 4 160 ? -1.834  107.277 2.373   1.00 17.36  ? 160 PHE B O     1 
ATOM 6317  C CB    . PHE D 4 160 ? -0.071  109.494 1.204   1.00 17.36  ? 160 PHE B CB    1 
ATOM 6318  C CG    . PHE D 4 160 ? 0.578   108.867 2.389   1.00 14.44  ? 160 PHE B CG    1 
ATOM 6319  C CD1   . PHE D 4 160 ? 1.870   108.393 2.296   1.00 12.40  ? 160 PHE B CD1   1 
ATOM 6320  C CD2   . PHE D 4 160 ? -0.083  108.812 3.614   1.00 13.33  ? 160 PHE B CD2   1 
ATOM 6321  C CE1   . PHE D 4 160 ? 2.498   107.881 3.399   1.00 15.26  ? 160 PHE B CE1   1 
ATOM 6322  C CE2   . PHE D 4 160 ? 0.533   108.302 4.724   1.00 14.58  ? 160 PHE B CE2   1 
ATOM 6323  C CZ    . PHE D 4 160 ? 1.825   107.836 4.623   1.00 16.28  ? 160 PHE B CZ    1 
ATOM 6324  N N     . GLN D 4 161 ? -3.361  108.580 1.359   1.00 21.38  ? 161 GLN B N     1 
ATOM 6325  C CA    . GLN D 4 161 ? -4.485  108.226 2.234   1.00 23.95  ? 161 GLN B CA    1 
ATOM 6326  C C     . GLN D 4 161 ? -4.483  106.783 2.726   1.00 20.69  ? 161 GLN B C     1 
ATOM 6327  O O     . GLN D 4 161 ? -4.440  106.520 3.938   1.00 16.36  ? 161 GLN B O     1 
ATOM 6328  C CB    . GLN D 4 161 ? -5.810  108.503 1.511   1.00 29.15  ? 161 GLN B CB    1 
ATOM 6329  C CG    . GLN D 4 161 ? -7.017  108.654 2.460   1.00 36.32  ? 161 GLN B CG    1 
ATOM 6330  C CD    . GLN D 4 161 ? -7.835  107.376 2.643   1.00 38.68  ? 161 GLN B CD    1 
ATOM 6331  O OE1   . GLN D 4 161 ? -7.428  106.296 2.202   1.00 42.52  ? 161 GLN B OE1   1 
ATOM 6332  N NE2   . GLN D 4 161 ? -8.994  107.495 3.312   1.00 38.18  ? 161 GLN B NE2   1 
ATOM 6333  N N     . SER D 4 162 ? -4.596  105.879 1.749   1.00 19.08  ? 162 SER B N     1 
ATOM 6334  C CA    . SER D 4 162 ? -4.609  104.439 1.947   1.00 17.04  ? 162 SER B CA    1 
ATOM 6335  C C     . SER D 4 162 ? -3.633  104.168 3.057   1.00 16.18  ? 162 SER B C     1 
ATOM 6336  O O     . SER D 4 162 ? -4.013  103.770 4.157   1.00 16.42  ? 162 SER B O     1 
ATOM 6337  C CB    . SER D 4 162 ? -4.107  103.763 0.682   1.00 17.51  ? 162 SER B CB    1 
ATOM 6338  O OG    . SER D 4 162 ? -2.800  104.231 0.377   1.00 18.17  ? 162 SER B OG    1 
ATOM 6339  N N     . SER D 4 163 ? -2.378  104.497 2.779   1.00 13.92  ? 163 SER B N     1 
ATOM 6340  C CA    . SER D 4 163 ? -1.313  104.332 3.737   1.00 13.03  ? 163 SER B CA    1 
ATOM 6341  C C     . SER D 4 163 ? -1.688  105.055 5.022   1.00 12.66  ? 163 SER B C     1 
ATOM 6342  O O     . SER D 4 163 ? -1.971  104.418 6.030   1.00 10.70  ? 163 SER B O     1 
ATOM 6343  C CB    . SER D 4 163 ? -0.016  104.896 3.168   1.00 13.20  ? 163 SER B CB    1 
ATOM 6344  O OG    . SER D 4 163 ? -0.249  105.541 1.929   1.00 13.91  ? 163 SER B OG    1 
ATOM 6345  N N     . MET D 4 164 ? -1.807  106.375 4.944   1.00 13.81  ? 164 MET B N     1 
ATOM 6346  C CA    . MET D 4 164 ? -2.142  107.189 6.103   1.00 15.13  ? 164 MET B CA    1 
ATOM 6347  C C     . MET D 4 164 ? -3.161  106.586 7.037   1.00 16.36  ? 164 MET B C     1 
ATOM 6348  O O     . MET D 4 164 ? -2.944  106.480 8.240   1.00 13.63  ? 164 MET B O     1 
ATOM 6349  C CB    . MET D 4 164 ? -2.662  108.538 5.652   1.00 14.94  ? 164 MET B CB    1 
ATOM 6350  C CG    . MET D 4 164 ? -3.148  109.384 6.807   1.00 13.90  ? 164 MET B CG    1 
ATOM 6351  S SD    . MET D 4 164 ? -1.999  109.334 8.202   1.00 12.18  ? 164 MET B SD    1 
ATOM 6352  C CE    . MET D 4 164 ? -0.859  110.608 7.799   1.00 11.00  ? 164 MET B CE    1 
ATOM 6353  N N     . THR D 4 165 ? -4.271  106.177 6.455   1.00 20.12  ? 165 THR B N     1 
ATOM 6354  C CA    . THR D 4 165 ? -5.375  105.600 7.206   1.00 26.54  ? 165 THR B CA    1 
ATOM 6355  C C     . THR D 4 165 ? -5.105  104.298 7.954   1.00 27.90  ? 165 THR B C     1 
ATOM 6356  O O     . THR D 4 165 ? -5.264  104.214 9.179   1.00 27.46  ? 165 THR B O     1 
ATOM 6357  C CB    . THR D 4 165 ? -6.556  105.368 6.275   1.00 28.20  ? 165 THR B CB    1 
ATOM 6358  O OG1   . THR D 4 165 ? -6.267  104.277 5.385   1.00 30.48  ? 165 THR B OG1   1 
ATOM 6359  C CG2   . THR D 4 165 ? -6.808  106.627 5.472   1.00 28.96  ? 165 THR B CG2   1 
ATOM 6360  N N     . LYS D 4 166 ? -4.757  103.269 7.193   1.00 28.88  ? 166 LYS B N     1 
ATOM 6361  C CA    . LYS D 4 166 ? -4.492  101.964 7.757   1.00 30.83  ? 166 LYS B CA    1 
ATOM 6362  C C     . LYS D 4 166 ? -3.497  102.040 8.900   1.00 28.95  ? 166 LYS B C     1 
ATOM 6363  O O     . LYS D 4 166 ? -3.587  101.287 9.861   1.00 28.64  ? 166 LYS B O     1 
ATOM 6364  C CB    . LYS D 4 166 ? -4.010  101.021 6.663   1.00 34.63  ? 166 LYS B CB    1 
ATOM 6365  C CG    . LYS D 4 166 ? -2.877  101.570 5.809   1.00 41.47  ? 166 LYS B CG    1 
ATOM 6366  C CD    . LYS D 4 166 ? -1.499  101.096 6.298   1.00 47.66  ? 166 LYS B CD    1 
ATOM 6367  C CE    . LYS D 4 166 ? -0.341  101.544 5.364   1.00 51.31  ? 166 LYS B CE    1 
ATOM 6368  N NZ    . LYS D 4 166 ? -0.421  101.042 3.936   1.00 52.72  ? 166 LYS B NZ    1 
ATOM 6369  N N     . ILE D 4 167 ? -2.582  102.993 8.806   1.00 26.61  ? 167 ILE B N     1 
ATOM 6370  C CA    . ILE D 4 167 ? -1.581  103.193 9.829   1.00 24.93  ? 167 ILE B CA    1 
ATOM 6371  C C     . ILE D 4 167 ? -2.284  103.623 11.087  1.00 25.24  ? 167 ILE B C     1 
ATOM 6372  O O     . ILE D 4 167 ? -1.941  103.195 12.187  1.00 23.83  ? 167 ILE B O     1 
ATOM 6373  C CB    . ILE D 4 167 ? -0.676  104.338 9.460   1.00 24.43  ? 167 ILE B CB    1 
ATOM 6374  C CG1   . ILE D 4 167 ? -0.036  104.082 8.107   1.00 24.87  ? 167 ILE B CG1   1 
ATOM 6375  C CG2   . ILE D 4 167 ? 0.366   104.536 10.539  1.00 24.38  ? 167 ILE B CG2   1 
ATOM 6376  C CD1   . ILE D 4 167 ? 0.600   105.303 7.517   1.00 27.51  ? 167 ILE B CD1   1 
ATOM 6377  N N     . LEU D 4 168 ? -3.239  104.527 10.907  1.00 27.05  ? 168 LEU B N     1 
ATOM 6378  C CA    . LEU D 4 168 ? -4.014  105.086 12.007  1.00 28.82  ? 168 LEU B CA    1 
ATOM 6379  C C     . LEU D 4 168 ? -5.066  104.092 12.453  1.00 30.14  ? 168 LEU B C     1 
ATOM 6380  O O     . LEU D 4 168 ? -5.424  104.043 13.633  1.00 28.77  ? 168 LEU B O     1 
ATOM 6381  C CB    . LEU D 4 168 ? -4.646  106.410 11.566  1.00 28.51  ? 168 LEU B CB    1 
ATOM 6382  C CG    . LEU D 4 168 ? -3.659  107.430 10.961  1.00 29.03  ? 168 LEU B CG    1 
ATOM 6383  C CD1   . LEU D 4 168 ? -4.406  108.439 10.119  1.00 30.38  ? 168 LEU B CD1   1 
ATOM 6384  C CD2   . LEU D 4 168 ? -2.831  108.128 12.037  1.00 27.42  ? 168 LEU B CD2   1 
ATOM 6385  N N     . GLU D 4 169 ? -5.483  103.253 11.504  1.00 32.48  ? 169 GLU B N     1 
ATOM 6386  C CA    . GLU D 4 169 ? -6.473  102.206 11.715  1.00 35.19  ? 169 GLU B CA    1 
ATOM 6387  C C     . GLU D 4 169 ? -6.327  101.522 13.083  1.00 33.90  ? 169 GLU B C     1 
ATOM 6388  O O     . GLU D 4 169 ? -7.303  101.323 13.808  1.00 33.96  ? 169 GLU B O     1 
ATOM 6389  C CB    . GLU D 4 169 ? -6.368  101.189 10.580  1.00 38.69  ? 169 GLU B CB    1 
ATOM 6390  C CG    . GLU D 4 169 ? -6.828  99.779  10.928  1.00 49.43  ? 169 GLU B CG    1 
ATOM 6391  C CD    . GLU D 4 169 ? -8.352  99.633  11.022  1.00 55.73  ? 169 GLU B CD    1 
ATOM 6392  O OE1   . GLU D 4 169 ? -8.854  99.152  12.077  1.00 57.96  ? 169 GLU B OE1   1 
ATOM 6393  O OE2   . GLU D 4 169 ? -9.040  99.978  10.025  1.00 59.27  ? 169 GLU B OE2   1 
ATOM 6394  N N     . PRO D 4 170 ? -5.108  101.138 13.449  1.00 32.05  ? 170 PRO B N     1 
ATOM 6395  C CA    . PRO D 4 170 ? -4.956  100.497 14.746  1.00 32.65  ? 170 PRO B CA    1 
ATOM 6396  C C     . PRO D 4 170 ? -5.356  101.433 15.863  1.00 33.37  ? 170 PRO B C     1 
ATOM 6397  O O     . PRO D 4 170 ? -6.281  101.140 16.606  1.00 31.84  ? 170 PRO B O     1 
ATOM 6398  C CB    . PRO D 4 170 ? -3.470  100.222 14.796  1.00 32.55  ? 170 PRO B CB    1 
ATOM 6399  C CG    . PRO D 4 170 ? -3.162  99.932  13.372  1.00 33.45  ? 170 PRO B CG    1 
ATOM 6400  C CD    . PRO D 4 170 ? -3.865  101.037 12.676  1.00 31.90  ? 170 PRO B CD    1 
ATOM 6401  N N     . PHE D 4 171 ? -4.704  102.592 15.913  1.00 35.36  ? 171 PHE B N     1 
ATOM 6402  C CA    . PHE D 4 171 ? -4.938  103.593 16.956  1.00 37.62  ? 171 PHE B CA    1 
ATOM 6403  C C     . PHE D 4 171 ? -6.393  103.805 17.299  1.00 39.11  ? 171 PHE B C     1 
ATOM 6404  O O     . PHE D 4 171 ? -6.762  103.977 18.471  1.00 36.27  ? 171 PHE B O     1 
ATOM 6405  C CB    . PHE D 4 171 ? -4.332  104.940 16.569  1.00 37.52  ? 171 PHE B CB    1 
ATOM 6406  C CG    . PHE D 4 171 ? -4.048  105.812 17.744  1.00 37.59  ? 171 PHE B CG    1 
ATOM 6407  C CD1   . PHE D 4 171 ? -2.745  106.163 18.058  1.00 38.43  ? 171 PHE B CD1   1 
ATOM 6408  C CD2   . PHE D 4 171 ? -5.073  106.223 18.586  1.00 38.75  ? 171 PHE B CD2   1 
ATOM 6409  C CE1   . PHE D 4 171 ? -2.467  106.905 19.193  1.00 38.54  ? 171 PHE B CE1   1 
ATOM 6410  C CE2   . PHE D 4 171 ? -4.805  106.965 19.720  1.00 39.72  ? 171 PHE B CE2   1 
ATOM 6411  C CZ    . PHE D 4 171 ? -3.495  107.307 20.026  1.00 39.96  ? 171 PHE B CZ    1 
ATOM 6412  N N     . LYS D 4 172 ? -7.209  103.853 16.256  1.00 43.58  ? 172 LYS B N     1 
ATOM 6413  C CA    . LYS D 4 172 ? -8.632  104.048 16.455  1.00 49.19  ? 172 LYS B CA    1 
ATOM 6414  C C     . LYS D 4 172 ? -9.239  102.846 17.147  1.00 49.91  ? 172 LYS B C     1 
ATOM 6415  O O     . LYS D 4 172 ? -9.641  102.946 18.305  1.00 50.97  ? 172 LYS B O     1 
ATOM 6416  C CB    . LYS D 4 172 ? -9.386  104.401 15.146  1.00 53.30  ? 172 LYS B CB    1 
ATOM 6417  C CG    . LYS D 4 172 ? -8.956  103.720 13.827  1.00 55.90  ? 172 LYS B CG    1 
ATOM 6418  C CD    . LYS D 4 172 ? -9.957  104.011 12.671  1.00 59.50  ? 172 LYS B CD    1 
ATOM 6419  C CE    . LYS D 4 172 ? -10.199 105.527 12.429  1.00 62.03  ? 172 LYS B CE    1 
ATOM 6420  N NZ    . LYS D 4 172 ? -11.426 105.854 11.597  1.00 64.46  ? 172 LYS B NZ    1 
ATOM 6421  N N     . LYS D 4 173 ? -9.233  101.701 16.463  1.00 49.67  ? 173 LYS B N     1 
ATOM 6422  C CA    . LYS D 4 173 ? -9.778  100.473 17.020  1.00 48.44  ? 173 LYS B CA    1 
ATOM 6423  C C     . LYS D 4 173 ? -9.144  100.270 18.390  1.00 48.19  ? 173 LYS B C     1 
ATOM 6424  O O     . LYS D 4 173 ? -9.771  99.739  19.300  1.00 48.17  ? 173 LYS B O     1 
ATOM 6425  C CB    . LYS D 4 173 ? -9.474  99.302  16.100  1.00 47.66  ? 173 LYS B CB    1 
ATOM 6426  N N     . GLN D 4 174 ? -7.932  100.796 18.547  1.00 48.89  ? 174 GLN B N     1 
ATOM 6427  C CA    . GLN D 4 174 ? -7.189  100.707 19.796  1.00 50.20  ? 174 GLN B CA    1 
ATOM 6428  C C     . GLN D 4 174 ? -7.777  101.571 20.916  1.00 49.40  ? 174 GLN B C     1 
ATOM 6429  O O     . GLN D 4 174 ? -7.461  101.370 22.096  1.00 50.00  ? 174 GLN B O     1 
ATOM 6430  C CB    . GLN D 4 174 ? -5.725  101.074 19.563  1.00 53.26  ? 174 GLN B CB    1 
ATOM 6431  C CG    . GLN D 4 174 ? -4.762  99.917  19.789  1.00 55.94  ? 174 GLN B CG    1 
ATOM 6432  C CD    . GLN D 4 174 ? -4.848  99.349  21.203  1.00 57.87  ? 174 GLN B CD    1 
ATOM 6433  O OE1   . GLN D 4 174 ? -5.112  98.156  21.384  1.00 59.97  ? 174 GLN B OE1   1 
ATOM 6434  N NE2   . GLN D 4 174 ? -4.638  100.203 22.212  1.00 57.56  ? 174 GLN B NE2   1 
ATOM 6435  N N     . ASN D 4 175 ? -8.573  102.563 20.525  1.00 47.53  ? 175 ASN B N     1 
ATOM 6436  C CA    . ASN D 4 175 ? -9.265  103.463 21.439  1.00 46.75  ? 175 ASN B CA    1 
ATOM 6437  C C     . ASN D 4 175 ? -9.767  104.637 20.615  1.00 47.27  ? 175 ASN B C     1 
ATOM 6438  O O     . ASN D 4 175 ? -9.013  105.546 20.290  1.00 46.72  ? 175 ASN B O     1 
ATOM 6439  C CB    . ASN D 4 175 ? -8.369  103.894 22.608  1.00 46.06  ? 175 ASN B CB    1 
ATOM 6440  C CG    . ASN D 4 175 ? -7.385  104.959 22.238  1.00 44.06  ? 175 ASN B CG    1 
ATOM 6441  O OD1   . ASN D 4 175 ? -7.388  106.018 22.847  1.00 42.98  ? 175 ASN B OD1   1 
ATOM 6442  N ND2   . ASN D 4 175 ? -6.541  104.700 21.236  1.00 42.44  ? 175 ASN B ND2   1 
ATOM 6443  N N     . PRO D 4 176 ? -11.037 104.562 20.168  1.00 49.89  ? 176 PRO B N     1 
ATOM 6444  C CA    . PRO D 4 176 ? -11.727 105.571 19.353  1.00 51.77  ? 176 PRO B CA    1 
ATOM 6445  C C     . PRO D 4 176 ? -12.448 106.646 20.173  1.00 52.72  ? 176 PRO B C     1 
ATOM 6446  O O     . PRO D 4 176 ? -13.471 107.207 19.749  1.00 51.54  ? 176 PRO B O     1 
ATOM 6447  C CB    . PRO D 4 176 ? -12.694 104.727 18.526  1.00 51.37  ? 176 PRO B CB    1 
ATOM 6448  C CG    . PRO D 4 176 ? -13.151 103.721 19.529  1.00 52.59  ? 176 PRO B CG    1 
ATOM 6449  C CD    . PRO D 4 176 ? -11.886 103.368 20.334  1.00 51.44  ? 176 PRO B CD    1 
ATOM 6450  N N     . ASP D 4 177 ? -11.903 106.904 21.360  1.00 53.92  ? 177 ASP B N     1 
ATOM 6451  C CA    . ASP D 4 177 ? -12.407 107.930 22.282  1.00 54.21  ? 177 ASP B CA    1 
ATOM 6452  C C     . ASP D 4 177 ? -11.743 109.294 21.947  1.00 52.21  ? 177 ASP B C     1 
ATOM 6453  O O     . ASP D 4 177 ? -11.897 110.292 22.676  1.00 51.49  ? 177 ASP B O     1 
ATOM 6454  C CB    . ASP D 4 177 ? -12.155 107.508 23.758  1.00 56.29  ? 177 ASP B CB    1 
ATOM 6455  C CG    . ASP D 4 177 ? -10.772 106.841 23.987  1.00 59.45  ? 177 ASP B CG    1 
ATOM 6456  O OD1   . ASP D 4 177 ? -10.114 107.171 25.002  1.00 60.38  ? 177 ASP B OD1   1 
ATOM 6457  O OD2   . ASP D 4 177 ? -10.356 105.972 23.183  1.00 58.29  ? 177 ASP B OD2   1 
ATOM 6458  N N     . ILE D 4 178 ? -11.039 109.297 20.808  1.00 48.49  ? 178 ILE B N     1 
ATOM 6459  C CA    . ILE D 4 178 ? -10.296 110.430 20.246  1.00 43.64  ? 178 ILE B CA    1 
ATOM 6460  C C     . ILE D 4 178 ? -10.555 110.418 18.750  1.00 41.75  ? 178 ILE B C     1 
ATOM 6461  O O     . ILE D 4 178 ? -10.907 109.369 18.190  1.00 40.85  ? 178 ILE B O     1 
ATOM 6462  C CB    . ILE D 4 178 ? -8.799  110.193 20.385  1.00 42.23  ? 178 ILE B CB    1 
ATOM 6463  C CG1   . ILE D 4 178 ? -8.428  110.102 21.850  1.00 41.11  ? 178 ILE B CG1   1 
ATOM 6464  C CG2   . ILE D 4 178 ? -8.009  111.245 19.642  1.00 40.89  ? 178 ILE B CG2   1 
ATOM 6465  C CD1   . ILE D 4 178 ? -7.354  109.104 22.088  1.00 43.16  ? 178 ILE B CD1   1 
ATOM 6466  N N     . VAL D 4 179 ? -10.381 111.569 18.099  1.00 39.13  ? 179 VAL B N     1 
ATOM 6467  C CA    . VAL D 4 179 ? -10.580 111.621 16.657  1.00 36.25  ? 179 VAL B CA    1 
ATOM 6468  C C     . VAL D 4 179 ? -9.481  112.312 15.922  1.00 34.58  ? 179 VAL B C     1 
ATOM 6469  O O     . VAL D 4 179 ? -8.788  113.167 16.477  1.00 33.33  ? 179 VAL B O     1 
ATOM 6470  C CB    . VAL D 4 179 ? -11.887 112.246 16.227  1.00 36.43  ? 179 VAL B CB    1 
ATOM 6471  C CG1   . VAL D 4 179 ? -12.503 111.376 15.109  1.00 33.91  ? 179 VAL B CG1   1 
ATOM 6472  C CG2   . VAL D 4 179 ? -12.814 112.433 17.423  1.00 37.24  ? 179 VAL B CG2   1 
ATOM 6473  N N     . ILE D 4 180 ? -9.391  111.993 14.636  1.00 32.23  ? 180 ILE B N     1 
ATOM 6474  C CA    . ILE D 4 180 ? -8.329  112.523 13.822  1.00 32.01  ? 180 ILE B CA    1 
ATOM 6475  C C     . ILE D 4 180 ? -8.723  112.986 12.439  1.00 32.11  ? 180 ILE B C     1 
ATOM 6476  O O     . ILE D 4 180 ? -9.446  112.293 11.726  1.00 32.05  ? 180 ILE B O     1 
ATOM 6477  C CB    . ILE D 4 180 ? -7.225  111.465 13.676  1.00 33.21  ? 180 ILE B CB    1 
ATOM 6478  C CG1   . ILE D 4 180 ? -6.871  110.890 15.059  1.00 33.97  ? 180 ILE B CG1   1 
ATOM 6479  C CG2   . ILE D 4 180 ? -6.008  112.068 12.981  1.00 33.23  ? 180 ILE B CG2   1 
ATOM 6480  C CD1   . ILE D 4 180 ? -5.699  109.937 15.075  1.00 35.39  ? 180 ILE B CD1   1 
ATOM 6481  N N     . TYR D 4 181 ? -8.185  114.148 12.060  1.00 32.85  ? 181 TYR B N     1 
ATOM 6482  C CA    . TYR D 4 181 ? -8.414  114.757 10.745  1.00 33.04  ? 181 TYR B CA    1 
ATOM 6483  C C     . TYR D 4 181 ? -7.085  115.073 10.048  1.00 31.45  ? 181 TYR B C     1 
ATOM 6484  O O     . TYR D 4 181 ? -6.099  115.513 10.679  1.00 28.94  ? 181 TYR B O     1 
ATOM 6485  C CB    . TYR D 4 181 ? -9.250  116.063 10.841  1.00 35.13  ? 181 TYR B CB    1 
ATOM 6486  C CG    . TYR D 4 181 ? -9.595  116.705 9.479   1.00 37.32  ? 181 TYR B CG    1 
ATOM 6487  C CD1   . TYR D 4 181 ? -10.543 116.128 8.622   1.00 38.68  ? 181 TYR B CD1   1 
ATOM 6488  C CD2   . TYR D 4 181 ? -8.957  117.871 9.043   1.00 37.77  ? 181 TYR B CD2   1 
ATOM 6489  C CE1   . TYR D 4 181 ? -10.848 116.698 7.362   1.00 38.99  ? 181 TYR B CE1   1 
ATOM 6490  C CE2   . TYR D 4 181 ? -9.254  118.445 7.784   1.00 37.74  ? 181 TYR B CE2   1 
ATOM 6491  C CZ    . TYR D 4 181 ? -10.197 117.855 6.951   1.00 39.02  ? 181 TYR B CZ    1 
ATOM 6492  O OH    . TYR D 4 181 ? -10.479 118.419 5.716   1.00 39.88  ? 181 TYR B OH    1 
ATOM 6493  N N     . GLN D 4 182 ? -7.076  114.859 8.736   1.00 28.69  ? 182 GLN B N     1 
ATOM 6494  C CA    . GLN D 4 182 ? -5.897  115.158 7.952   1.00 26.92  ? 182 GLN B CA    1 
ATOM 6495  C C     . GLN D 4 182 ? -6.101  116.382 7.045   1.00 25.93  ? 182 GLN B C     1 
ATOM 6496  O O     . GLN D 4 182 ? -7.144  116.562 6.406   1.00 25.98  ? 182 GLN B O     1 
ATOM 6497  C CB    . GLN D 4 182 ? -5.460  113.947 7.118   1.00 25.67  ? 182 GLN B CB    1 
ATOM 6498  C CG    . GLN D 4 182 ? -4.055  114.135 6.544   1.00 25.00  ? 182 GLN B CG    1 
ATOM 6499  C CD    . GLN D 4 182 ? -3.620  113.065 5.556   1.00 25.09  ? 182 GLN B CD    1 
ATOM 6500  O OE1   . GLN D 4 182 ? -4.434  112.469 4.840   1.00 25.61  ? 182 GLN B OE1   1 
ATOM 6501  N NE2   . GLN D 4 182 ? -2.314  112.840 5.491   1.00 25.07  ? 182 GLN B NE2   1 
ATOM 6502  N N     . TYR D 4 183 ? -5.095  117.236 7.000   1.00 24.07  ? 183 TYR B N     1 
ATOM 6503  C CA    . TYR D 4 183 ? -5.175  118.399 6.154   1.00 21.65  ? 183 TYR B CA    1 
ATOM 6504  C C     . TYR D 4 183 ? -3.772  118.689 5.666   1.00 19.14  ? 183 TYR B C     1 
ATOM 6505  O O     . TYR D 4 183 ? -2.954  119.295 6.365   1.00 17.73  ? 183 TYR B O     1 
ATOM 6506  C CB    . TYR D 4 183 ? -5.758  119.571 6.933   1.00 24.77  ? 183 TYR B CB    1 
ATOM 6507  C CG    . TYR D 4 183 ? -6.021  120.778 6.071   1.00 27.68  ? 183 TYR B CG    1 
ATOM 6508  C CD1   . TYR D 4 183 ? -6.831  120.678 4.942   1.00 27.57  ? 183 TYR B CD1   1 
ATOM 6509  C CD2   . TYR D 4 183 ? -5.395  122.000 6.339   1.00 26.76  ? 183 TYR B CD2   1 
ATOM 6510  C CE1   . TYR D 4 183 ? -7.000  121.752 4.096   1.00 28.79  ? 183 TYR B CE1   1 
ATOM 6511  C CE2   . TYR D 4 183 ? -5.557  123.080 5.500   1.00 29.23  ? 183 TYR B CE2   1 
ATOM 6512  C CZ    . TYR D 4 183 ? -6.356  122.947 4.371   1.00 31.06  ? 183 TYR B CZ    1 
ATOM 6513  O OH    . TYR D 4 183 ? -6.460  123.979 3.466   1.00 35.71  ? 183 TYR B OH    1 
ATOM 6514  N N     . ILE D 4 184 ? -3.477  118.184 4.478   1.00 16.73  ? 184 ILE B N     1 
ATOM 6515  C CA    . ILE D 4 184 ? -2.167  118.372 3.890   1.00 16.72  ? 184 ILE B CA    1 
ATOM 6516  C C     . ILE D 4 184 ? -1.050  117.819 4.810   1.00 17.22  ? 184 ILE B C     1 
ATOM 6517  O O     . ILE D 4 184 ? -1.019  116.637 5.146   1.00 16.02  ? 184 ILE B O     1 
ATOM 6518  C CB    . ILE D 4 184 ? -1.935  119.862 3.607   1.00 16.81  ? 184 ILE B CB    1 
ATOM 6519  C CG1   . ILE D 4 184 ? -3.234  120.494 3.107   1.00 16.80  ? 184 ILE B CG1   1 
ATOM 6520  C CG2   . ILE D 4 184 ? -0.839  120.039 2.555   1.00 16.22  ? 184 ILE B CG2   1 
ATOM 6521  C CD1   . ILE D 4 184 ? -3.275  122.007 3.232   1.00 18.60  ? 184 ILE B CD1   1 
ATOM 6522  N N     . ASP D 4 185 ? -0.145  118.680 5.242   1.00 17.48  ? 185 ASP B N     1 
ATOM 6523  C CA    . ASP D 4 185 ? 0.948   118.238 6.086   1.00 18.25  ? 185 ASP B CA    1 
ATOM 6524  C C     . ASP D 4 185 ? 0.499   117.934 7.489   1.00 19.61  ? 185 ASP B C     1 
ATOM 6525  O O     . ASP D 4 185 ? 1.257   117.337 8.256   1.00 20.98  ? 185 ASP B O     1 
ATOM 6526  C CB    . ASP D 4 185 ? 2.040   119.319 6.166   1.00 17.64  ? 185 ASP B CB    1 
ATOM 6527  C CG    . ASP D 4 185 ? 2.752   119.539 4.836   1.00 19.18  ? 185 ASP B CG    1 
ATOM 6528  O OD1   . ASP D 4 185 ? 2.196   119.133 3.799   1.00 19.46  ? 185 ASP B OD1   1 
ATOM 6529  O OD2   . ASP D 4 185 ? 3.865   120.112 4.818   1.00 18.26  ? 185 ASP B OD2   1 
ATOM 6530  N N     . ASP D 4 186 ? -0.735  118.298 7.829   1.00 20.97  ? 186 ASP B N     1 
ATOM 6531  C CA    . ASP D 4 186 ? -1.153  118.126 9.211   1.00 22.94  ? 186 ASP B CA    1 
ATOM 6532  C C     . ASP D 4 186 ? -2.199  117.163 9.670   1.00 21.89  ? 186 ASP B C     1 
ATOM 6533  O O     . ASP D 4 186 ? -3.229  116.957 9.024   1.00 22.70  ? 186 ASP B O     1 
ATOM 6534  C CB    . ASP D 4 186 ? -1.402  119.484 9.851   1.00 27.60  ? 186 ASP B CB    1 
ATOM 6535  C CG    . ASP D 4 186 ? -0.136  120.331 9.914   1.00 31.50  ? 186 ASP B CG    1 
ATOM 6536  O OD1   . ASP D 4 186 ? 0.980   119.752 9.813   1.00 34.05  ? 186 ASP B OD1   1 
ATOM 6537  O OD2   . ASP D 4 186 ? -0.258  121.572 10.062  1.00 32.53  ? 186 ASP B OD2   1 
ATOM 6538  N N     . LEU D 4 187 ? -1.937  116.652 10.870  1.00 21.15  ? 187 LEU B N     1 
ATOM 6539  C CA    . LEU D 4 187 ? -2.800  115.684 11.514  1.00 20.79  ? 187 LEU B CA    1 
ATOM 6540  C C     . LEU D 4 187 ? -3.431  116.314 12.736  1.00 21.31  ? 187 LEU B C     1 
ATOM 6541  O O     . LEU D 4 187 ? -2.722  116.745 13.668  1.00 18.94  ? 187 LEU B O     1 
ATOM 6542  C CB    . LEU D 4 187 ? -1.995  114.452 11.926  1.00 20.21  ? 187 LEU B CB    1 
ATOM 6543  C CG    . LEU D 4 187 ? -2.678  113.092 11.773  1.00 17.35  ? 187 LEU B CG    1 
ATOM 6544  C CD1   . LEU D 4 187 ? -3.121  112.872 10.342  1.00 13.95  ? 187 LEU B CD1   1 
ATOM 6545  C CD2   . LEU D 4 187 ? -1.714  112.018 12.185  1.00 17.60  ? 187 LEU B CD2   1 
ATOM 6546  N N     . TYR D 4 188 ? -4.765  116.382 12.701  1.00 21.19  ? 188 TYR B N     1 
ATOM 6547  C CA    . TYR D 4 188 ? -5.561  116.954 13.784  1.00 21.90  ? 188 TYR B CA    1 
ATOM 6548  C C     . TYR D 4 188 ? -6.159  115.862 14.650  1.00 21.30  ? 188 TYR B C     1 
ATOM 6549  O O     . TYR D 4 188 ? -6.994  115.086 14.194  1.00 20.54  ? 188 TYR B O     1 
ATOM 6550  C CB    . TYR D 4 188 ? -6.645  117.891 13.230  1.00 22.73  ? 188 TYR B CB    1 
ATOM 6551  C CG    . TYR D 4 188 ? -6.167  119.334 13.120  1.00 22.17  ? 188 TYR B CG    1 
ATOM 6552  C CD1   . TYR D 4 188 ? -5.844  120.072 14.276  1.00 20.75  ? 188 TYR B CD1   1 
ATOM 6553  C CD2   . TYR D 4 188 ? -5.990  119.944 11.867  1.00 20.94  ? 188 TYR B CD2   1 
ATOM 6554  C CE1   . TYR D 4 188 ? -5.353  121.368 14.187  1.00 21.25  ? 188 TYR B CE1   1 
ATOM 6555  C CE2   . TYR D 4 188 ? -5.496  121.240 11.763  1.00 21.34  ? 188 TYR B CE2   1 
ATOM 6556  C CZ    . TYR D 4 188 ? -5.176  121.948 12.925  1.00 22.58  ? 188 TYR B CZ    1 
ATOM 6557  O OH    . TYR D 4 188 ? -4.633  123.214 12.820  1.00 24.00  ? 188 TYR B OH    1 
ATOM 6558  N N     . VAL D 4 189 ? -5.737  115.831 15.912  1.00 21.22  ? 189 VAL B N     1 
ATOM 6559  C CA    . VAL D 4 189 ? -6.174  114.802 16.846  1.00 22.90  ? 189 VAL B CA    1 
ATOM 6560  C C     . VAL D 4 189 ? -6.726  115.373 18.125  1.00 24.36  ? 189 VAL B C     1 
ATOM 6561  O O     . VAL D 4 189 ? -6.003  116.054 18.858  1.00 25.01  ? 189 VAL B O     1 
ATOM 6562  C CB    . VAL D 4 189 ? -4.999  113.876 17.219  1.00 22.98  ? 189 VAL B CB    1 
ATOM 6563  C CG1   . VAL D 4 189 ? -5.422  112.855 18.250  1.00 22.50  ? 189 VAL B CG1   1 
ATOM 6564  C CG2   . VAL D 4 189 ? -4.486  113.168 15.982  1.00 24.27  ? 189 VAL B CG2   1 
ATOM 6565  N N     . GLY D 4 190 ? -7.970  115.002 18.437  1.00 25.43  ? 190 GLY B N     1 
ATOM 6566  C CA    . GLY D 4 190 ? -8.612  115.494 19.646  1.00 26.36  ? 190 GLY B CA    1 
ATOM 6567  C C     . GLY D 4 190 ? -9.212  114.473 20.602  1.00 26.65  ? 190 GLY B C     1 
ATOM 6568  O O     . GLY D 4 190 ? -9.951  113.569 20.183  1.00 26.95  ? 190 GLY B O     1 
ATOM 6569  N N     . SER D 4 191 ? -8.901  114.645 21.890  1.00 25.30  ? 191 SER B N     1 
ATOM 6570  C CA    . SER D 4 191 ? -9.396  113.784 22.963  1.00 24.91  ? 191 SER B CA    1 
ATOM 6571  C C     . SER D 4 191 ? -10.120 114.606 24.023  1.00 25.10  ? 191 SER B C     1 
ATOM 6572  O O     . SER D 4 191 ? -9.534  115.485 24.658  1.00 25.78  ? 191 SER B O     1 
ATOM 6573  C CB    . SER D 4 191 ? -8.253  113.038 23.638  1.00 25.32  ? 191 SER B CB    1 
ATOM 6574  O OG    . SER D 4 191 ? -7.996  113.554 24.947  1.00 24.51  ? 191 SER B OG    1 
ATOM 6575  N N     . ASP D 4 192 ? -11.369 114.259 24.282  1.00 24.43  ? 192 ASP B N     1 
ATOM 6576  C CA    . ASP D 4 192 ? -12.152 114.969 25.269  1.00 23.21  ? 192 ASP B CA    1 
ATOM 6577  C C     . ASP D 4 192 ? -11.676 114.676 26.660  1.00 22.82  ? 192 ASP B C     1 
ATOM 6578  O O     . ASP D 4 192 ? -12.250 115.142 27.633  1.00 22.02  ? 192 ASP B O     1 
ATOM 6579  C CB    . ASP D 4 192 ? -13.594 114.554 25.164  1.00 23.54  ? 192 ASP B CB    1 
ATOM 6580  C CG    . ASP D 4 192 ? -14.455 115.668 24.693  1.00 27.39  ? 192 ASP B CG    1 
ATOM 6581  O OD1   . ASP D 4 192 ? -14.653 116.615 25.481  1.00 26.73  ? 192 ASP B OD1   1 
ATOM 6582  O OD2   . ASP D 4 192 ? -14.918 115.610 23.534  1.00 30.04  ? 192 ASP B OD2   1 
ATOM 6583  N N     . LEU D 4 193 ? -10.598 113.919 26.735  1.00 22.64  ? 193 LEU B N     1 
ATOM 6584  C CA    . LEU D 4 193 ? -10.026 113.502 27.989  1.00 24.45  ? 193 LEU B CA    1 
ATOM 6585  C C     . LEU D 4 193 ? -9.236  114.592 28.661  1.00 24.83  ? 193 LEU B C     1 
ATOM 6586  O O     . LEU D 4 193 ? -9.043  115.678 28.106  1.00 24.29  ? 193 LEU B O     1 
ATOM 6587  C CB    . LEU D 4 193 ? -9.104  112.325 27.736  1.00 27.43  ? 193 LEU B CB    1 
ATOM 6588  C CG    . LEU D 4 193 ? -9.381  111.540 26.447  1.00 31.06  ? 193 LEU B CG    1 
ATOM 6589  C CD1   . LEU D 4 193 ? -8.402  110.368 26.386  1.00 32.79  ? 193 LEU B CD1   1 
ATOM 6590  C CD2   . LEU D 4 193 ? -10.844 111.063 26.328  1.00 30.55  ? 193 LEU B CD2   1 
ATOM 6591  N N     . GLU D 4 194 ? -8.739  114.259 29.849  1.00 25.46  ? 194 GLU B N     1 
ATOM 6592  C CA    . GLU D 4 194 ? -7.924  115.158 30.651  1.00 26.43  ? 194 GLU B CA    1 
ATOM 6593  C C     . GLU D 4 194 ? -6.611  115.475 29.942  1.00 25.58  ? 194 GLU B C     1 
ATOM 6594  O O     . GLU D 4 194 ? -5.921  114.584 29.430  1.00 23.62  ? 194 GLU B O     1 
ATOM 6595  C CB    . GLU D 4 194 ? -7.644  114.531 32.025  1.00 28.15  ? 194 GLU B CB    1 
ATOM 6596  C CG    . GLU D 4 194 ? -6.813  115.399 32.997  1.00 31.71  ? 194 GLU B CG    1 
ATOM 6597  C CD    . GLU D 4 194 ? -5.294  115.218 32.869  1.00 34.95  ? 194 GLU B CD    1 
ATOM 6598  O OE1   . GLU D 4 194 ? -4.544  115.959 33.558  1.00 35.99  ? 194 GLU B OE1   1 
ATOM 6599  O OE2   . GLU D 4 194 ? -4.854  114.333 32.096  1.00 35.59  ? 194 GLU B OE2   1 
ATOM 6600  N N     . ILE D 4 195 ? -6.273  116.757 29.970  1.00 25.10  ? 195 ILE B N     1 
ATOM 6601  C CA    . ILE D 4 195 ? -5.067  117.306 29.359  1.00 26.47  ? 195 ILE B CA    1 
ATOM 6602  C C     . ILE D 4 195 ? -3.825  116.392 29.351  1.00 26.84  ? 195 ILE B C     1 
ATOM 6603  O O     . ILE D 4 195 ? -3.302  116.031 28.286  1.00 24.58  ? 195 ILE B O     1 
ATOM 6604  C CB    . ILE D 4 195 ? -4.721  118.658 30.045  1.00 25.70  ? 195 ILE B CB    1 
ATOM 6605  C CG1   . ILE D 4 195 ? -3.460  119.295 29.431  1.00 25.75  ? 195 ILE B CG1   1 
ATOM 6606  C CG2   . ILE D 4 195 ? -4.625  118.470 31.557  1.00 25.26  ? 195 ILE B CG2   1 
ATOM 6607  C CD1   . ILE D 4 195 ? -3.671  119.940 28.052  1.00 21.03  ? 195 ILE B CD1   1 
ATOM 6608  N N     . GLY D 4 196 ? -3.358  116.042 30.548  1.00 28.10  ? 196 GLY B N     1 
ATOM 6609  C CA    . GLY D 4 196 ? -2.191  115.190 30.692  1.00 29.36  ? 196 GLY B CA    1 
ATOM 6610  C C     . GLY D 4 196 ? -2.369  113.868 29.981  1.00 29.07  ? 196 GLY B C     1 
ATOM 6611  O O     . GLY D 4 196 ? -1.498  113.438 29.228  1.00 27.98  ? 196 GLY B O     1 
ATOM 6612  N N     . GLN D 4 197 ? -3.500  113.219 30.223  1.00 29.45  ? 197 GLN B N     1 
ATOM 6613  C CA    . GLN D 4 197 ? -3.785  111.957 29.570  1.00 32.35  ? 197 GLN B CA    1 
ATOM 6614  C C     . GLN D 4 197 ? -3.747  112.220 28.064  1.00 31.31  ? 197 GLN B C     1 
ATOM 6615  O O     . GLN D 4 197 ? -3.017  111.542 27.328  1.00 30.68  ? 197 GLN B O     1 
ATOM 6616  C CB    . GLN D 4 197 ? -5.169  111.448 29.981  1.00 37.06  ? 197 GLN B CB    1 
ATOM 6617  C CG    . GLN D 4 197 ? -5.575  110.063 29.396  1.00 41.92  ? 197 GLN B CG    1 
ATOM 6618  C CD    . GLN D 4 197 ? -4.845  108.856 30.029  1.00 42.91  ? 197 GLN B CD    1 
ATOM 6619  O OE1   . GLN D 4 197 ? -4.366  107.965 29.317  1.00 43.81  ? 197 GLN B OE1   1 
ATOM 6620  N NE2   . GLN D 4 197 ? -4.788  108.817 31.364  1.00 42.87  ? 197 GLN B NE2   1 
ATOM 6621  N N     . HIS D 4 198 ? -4.508  113.234 27.635  1.00 30.20  ? 198 HIS B N     1 
ATOM 6622  C CA    . HIS D 4 198 ? -4.585  113.635 26.230  1.00 28.69  ? 198 HIS B CA    1 
ATOM 6623  C C     . HIS D 4 198 ? -3.172  113.774 25.705  1.00 27.97  ? 198 HIS B C     1 
ATOM 6624  O O     . HIS D 4 198 ? -2.776  113.075 24.772  1.00 28.12  ? 198 HIS B O     1 
ATOM 6625  C CB    . HIS D 4 198 ? -5.311  114.979 26.083  1.00 29.90  ? 198 HIS B CB    1 
ATOM 6626  C CG    . HIS D 4 198 ? -5.409  115.468 24.665  1.00 27.93  ? 198 HIS B CG    1 
ATOM 6627  N ND1   . HIS D 4 198 ? -6.577  115.403 23.931  1.00 27.66  ? 198 HIS B ND1   1 
ATOM 6628  C CD2   . HIS D 4 198 ? -4.482  116.008 23.841  1.00 27.20  ? 198 HIS B CD2   1 
ATOM 6629  C CE1   . HIS D 4 198 ? -6.364  115.874 22.716  1.00 25.89  ? 198 HIS B CE1   1 
ATOM 6630  N NE2   . HIS D 4 198 ? -5.100  116.249 22.634  1.00 28.35  ? 198 HIS B NE2   1 
ATOM 6631  N N     . ARG D 4 199 ? -2.399  114.638 26.356  1.00 27.35  ? 199 ARG B N     1 
ATOM 6632  C CA    . ARG D 4 199 ? -1.009  114.876 25.971  1.00 28.50  ? 199 ARG B CA    1 
ATOM 6633  C C     . ARG D 4 199 ? -0.179  113.575 25.841  1.00 26.81  ? 199 ARG B C     1 
ATOM 6634  O O     . ARG D 4 199 ? 0.657   113.427 24.931  1.00 24.31  ? 199 ARG B O     1 
ATOM 6635  C CB    . ARG D 4 199 ? -0.342  115.838 26.968  1.00 30.90  ? 199 ARG B CB    1 
ATOM 6636  C CG    . ARG D 4 199 ? -0.988  117.215 27.091  1.00 31.15  ? 199 ARG B CG    1 
ATOM 6637  C CD    . ARG D 4 199 ? -0.046  118.181 27.796  1.00 33.65  ? 199 ARG B CD    1 
ATOM 6638  N NE    . ARG D 4 199 ? -0.730  119.415 28.170  1.00 38.20  ? 199 ARG B NE    1 
ATOM 6639  C CZ    . ARG D 4 199 ? -0.136  120.580 28.424  1.00 40.04  ? 199 ARG B CZ    1 
ATOM 6640  N NH1   . ARG D 4 199 ? 1.185   120.704 28.352  1.00 40.23  ? 199 ARG B NH1   1 
ATOM 6641  N NH2   . ARG D 4 199 ? -0.883  121.642 28.713  1.00 40.19  ? 199 ARG B NH2   1 
ATOM 6642  N N     . THR D 4 200 ? -0.424  112.649 26.766  1.00 25.16  ? 200 THR B N     1 
ATOM 6643  C CA    . THR D 4 200 ? 0.252   111.360 26.791  1.00 22.88  ? 200 THR B CA    1 
ATOM 6644  C C     . THR D 4 200 ? -0.236  110.520 25.623  1.00 21.62  ? 200 THR B C     1 
ATOM 6645  O O     . THR D 4 200 ? 0.565   110.108 24.785  1.00 20.92  ? 200 THR B O     1 
ATOM 6646  C CB    . THR D 4 200 ? 0.018   110.627 28.141  1.00 22.53  ? 200 THR B CB    1 
ATOM 6647  O OG1   . THR D 4 200 ? 1.001   111.062 29.089  1.00 21.54  ? 200 THR B OG1   1 
ATOM 6648  C CG2   . THR D 4 200 ? 0.100   109.119 27.983  1.00 22.25  ? 200 THR B CG2   1 
ATOM 6649  N N     . LYS D 4 201 ? -1.547  110.300 25.540  1.00 19.99  ? 201 LYS B N     1 
ATOM 6650  C CA    . LYS D 4 201 ? -2.098  109.516 24.442  1.00 19.25  ? 201 LYS B CA    1 
ATOM 6651  C C     . LYS D 4 201 ? -1.600  110.083 23.116  1.00 18.42  ? 201 LYS B C     1 
ATOM 6652  O O     . LYS D 4 201 ? -1.340  109.347 22.165  1.00 18.35  ? 201 LYS B O     1 
ATOM 6653  C CB    . LYS D 4 201 ? -3.624  109.507 24.484  1.00 20.30  ? 201 LYS B CB    1 
ATOM 6654  C CG    . LYS D 4 201 ? -4.285  108.841 23.268  1.00 21.57  ? 201 LYS B CG    1 
ATOM 6655  C CD    . LYS D 4 201 ? -4.089  107.306 23.177  1.00 23.83  ? 201 LYS B CD    1 
ATOM 6656  C CE    . LYS D 4 201 ? -4.943  106.491 24.172  1.00 25.09  ? 201 LYS B CE    1 
ATOM 6657  N NZ    . LYS D 4 201 ? -5.038  105.030 23.796  1.00 24.61  ? 201 LYS B NZ    1 
ATOM 6658  N N     . ILE D 4 202 ? -1.448  111.398 23.063  1.00 17.73  ? 202 ILE B N     1 
ATOM 6659  C CA    . ILE D 4 202 ? -0.933  112.032 21.868  1.00 18.41  ? 202 ILE B CA    1 
ATOM 6660  C C     . ILE D 4 202 ? 0.425   111.393 21.613  1.00 20.04  ? 202 ILE B C     1 
ATOM 6661  O O     . ILE D 4 202 ? 0.632   110.712 20.604  1.00 19.75  ? 202 ILE B O     1 
ATOM 6662  C CB    . ILE D 4 202 ? -0.788  113.558 22.084  1.00 17.63  ? 202 ILE B CB    1 
ATOM 6663  C CG1   . ILE D 4 202 ? -1.988  114.285 21.461  1.00 17.41  ? 202 ILE B CG1   1 
ATOM 6664  C CG2   . ILE D 4 202 ? 0.573   114.086 21.589  1.00 17.46  ? 202 ILE B CG2   1 
ATOM 6665  C CD1   . ILE D 4 202 ? -2.275  113.978 19.962  1.00 14.01  ? 202 ILE B CD1   1 
ATOM 6666  N N     . GLU D 4 203 ? 1.304   111.535 22.599  1.00 21.74  ? 203 GLU B N     1 
ATOM 6667  C CA    . GLU D 4 203 ? 2.648   110.990 22.542  1.00 23.26  ? 203 GLU B CA    1 
ATOM 6668  C C     . GLU D 4 203 ? 2.685   109.547 22.101  1.00 22.40  ? 203 GLU B C     1 
ATOM 6669  O O     . GLU D 4 203 ? 3.659   109.104 21.496  1.00 21.51  ? 203 GLU B O     1 
ATOM 6670  C CB    . GLU D 4 203 ? 3.293   111.127 23.898  1.00 26.94  ? 203 GLU B CB    1 
ATOM 6671  C CG    . GLU D 4 203 ? 3.866   112.497 24.119  1.00 31.84  ? 203 GLU B CG    1 
ATOM 6672  C CD    . GLU D 4 203 ? 5.247   112.616 23.525  1.00 35.08  ? 203 GLU B CD    1 
ATOM 6673  O OE1   . GLU D 4 203 ? 5.900   111.553 23.345  1.00 38.00  ? 203 GLU B OE1   1 
ATOM 6674  O OE2   . GLU D 4 203 ? 5.671   113.764 23.241  1.00 35.78  ? 203 GLU B OE2   1 
ATOM 6675  N N     . GLU D 4 204 ? 1.626   108.815 22.422  1.00 22.34  ? 204 GLU B N     1 
ATOM 6676  C CA    . GLU D 4 204 ? 1.530   107.429 22.008  1.00 23.19  ? 204 GLU B CA    1 
ATOM 6677  C C     . GLU D 4 204 ? 1.544   107.459 20.495  1.00 21.68  ? 204 GLU B C     1 
ATOM 6678  O O     . GLU D 4 204 ? 2.502   107.012 19.866  1.00 21.89  ? 204 GLU B O     1 
ATOM 6679  C CB    . GLU D 4 204 ? 0.218   106.786 22.477  1.00 26.67  ? 204 GLU B CB    1 
ATOM 6680  C CG    . GLU D 4 204 ? 0.131   106.454 23.978  1.00 29.63  ? 204 GLU B CG    1 
ATOM 6681  C CD    . GLU D 4 204 ? -0.868  105.314 24.305  1.00 31.48  ? 204 GLU B CD    1 
ATOM 6682  O OE1   . GLU D 4 204 ? -1.067  105.023 25.519  1.00 31.11  ? 204 GLU B OE1   1 
ATOM 6683  O OE2   . GLU D 4 204 ? -1.434  104.703 23.356  1.00 30.81  ? 204 GLU B OE2   1 
ATOM 6684  N N     . LEU D 4 205 ? 0.511   108.077 19.931  1.00 19.71  ? 205 LEU B N     1 
ATOM 6685  C CA    . LEU D 4 205 ? 0.360   108.193 18.494  1.00 19.93  ? 205 LEU B CA    1 
ATOM 6686  C C     . LEU D 4 205 ? 1.687   108.483 17.815  1.00 21.20  ? 205 LEU B C     1 
ATOM 6687  O O     . LEU D 4 205 ? 1.955   107.980 16.720  1.00 20.12  ? 205 LEU B O     1 
ATOM 6688  C CB    . LEU D 4 205 ? -0.631  109.295 18.178  1.00 19.99  ? 205 LEU B CB    1 
ATOM 6689  C CG    . LEU D 4 205 ? -1.485  108.981 16.957  1.00 20.53  ? 205 LEU B CG    1 
ATOM 6690  C CD1   . LEU D 4 205 ? -2.692  109.888 16.950  1.00 22.39  ? 205 LEU B CD1   1 
ATOM 6691  C CD2   . LEU D 4 205 ? -0.688  109.083 15.676  1.00 19.27  ? 205 LEU B CD2   1 
ATOM 6692  N N     . ARG D 4 206 ? 2.524   109.267 18.493  1.00 22.96  ? 206 ARG B N     1 
ATOM 6693  C CA    . ARG D 4 206 ? 3.846   109.619 17.981  1.00 25.71  ? 206 ARG B CA    1 
ATOM 6694  C C     . ARG D 4 206 ? 4.627   108.360 17.715  1.00 26.53  ? 206 ARG B C     1 
ATOM 6695  O O     . ARG D 4 206 ? 4.938   108.022 16.567  1.00 26.04  ? 206 ARG B O     1 
ATOM 6696  C CB    . ARG D 4 206 ? 4.632   110.399 19.015  1.00 27.07  ? 206 ARG B CB    1 
ATOM 6697  C CG    . ARG D 4 206 ? 4.075   111.721 19.329  1.00 32.11  ? 206 ARG B CG    1 
ATOM 6698  C CD    . ARG D 4 206 ? 4.988   112.416 20.302  1.00 37.73  ? 206 ARG B CD    1 
ATOM 6699  N NE    . ARG D 4 206 ? 6.382   112.508 19.848  1.00 43.56  ? 206 ARG B NE    1 
ATOM 6700  C CZ    . ARG D 4 206 ? 6.852   113.388 18.957  1.00 46.01  ? 206 ARG B CZ    1 
ATOM 6701  N NH1   . ARG D 4 206 ? 6.045   114.284 18.386  1.00 45.43  ? 206 ARG B NH1   1 
ATOM 6702  N NH2   . ARG D 4 206 ? 8.147   113.388 18.653  1.00 46.99  ? 206 ARG B NH2   1 
ATOM 6703  N N     . GLN D 4 207 ? 4.949   107.689 18.817  1.00 26.98  ? 207 GLN B N     1 
ATOM 6704  C CA    . GLN D 4 207 ? 5.704   106.458 18.802  1.00 27.83  ? 207 GLN B CA    1 
ATOM 6705  C C     . GLN D 4 207 ? 5.143   105.525 17.777  1.00 25.82  ? 207 GLN B C     1 
ATOM 6706  O O     . GLN D 4 207 ? 5.897   104.941 17.013  1.00 24.76  ? 207 GLN B O     1 
ATOM 6707  C CB    . GLN D 4 207 ? 5.656   105.791 20.169  1.00 32.11  ? 207 GLN B CB    1 
ATOM 6708  C CG    . GLN D 4 207 ? 6.635   106.370 21.196  1.00 41.05  ? 207 GLN B CG    1 
ATOM 6709  C CD    . GLN D 4 207 ? 7.986   105.639 21.216  1.00 45.81  ? 207 GLN B CD    1 
ATOM 6710  O OE1   . GLN D 4 207 ? 8.581   105.422 22.287  1.00 47.32  ? 207 GLN B OE1   1 
ATOM 6711  N NE2   . GLN D 4 207 ? 8.470   105.250 20.032  1.00 47.49  ? 207 GLN B NE2   1 
ATOM 6712  N N     . HIS D 4 208 ? 3.816   105.443 17.713  1.00 24.04  ? 208 HIS B N     1 
ATOM 6713  C CA    . HIS D 4 208 ? 3.174   104.556 16.762  1.00 22.12  ? 208 HIS B CA    1 
ATOM 6714  C C     . HIS D 4 208 ? 3.641   104.866 15.370  1.00 20.37  ? 208 HIS B C     1 
ATOM 6715  O O     . HIS D 4 208 ? 4.111   103.986 14.649  1.00 18.02  ? 208 HIS B O     1 
ATOM 6716  C CB    . HIS D 4 208 ? 1.660   104.685 16.808  1.00 23.50  ? 208 HIS B CB    1 
ATOM 6717  C CG    . HIS D 4 208 ? 0.959   103.855 15.775  1.00 27.68  ? 208 HIS B CG    1 
ATOM 6718  N ND1   . HIS D 4 208 ? 1.338   103.836 14.449  1.00 29.94  ? 208 HIS B ND1   1 
ATOM 6719  C CD2   . HIS D 4 208 ? -0.108  103.023 15.871  1.00 30.24  ? 208 HIS B CD2   1 
ATOM 6720  C CE1   . HIS D 4 208 ? 0.536   103.031 13.773  1.00 30.41  ? 208 HIS B CE1   1 
ATOM 6721  N NE2   . HIS D 4 208 ? -0.350  102.526 14.611  1.00 31.35  ? 208 HIS B NE2   1 
ATOM 6722  N N     . LEU D 4 209 ? 3.487   106.127 14.995  1.00 20.76  ? 209 LEU B N     1 
ATOM 6723  C CA    . LEU D 4 209 ? 3.883   106.578 13.672  1.00 22.40  ? 209 LEU B CA    1 
ATOM 6724  C C     . LEU D 4 209 ? 5.350   106.302 13.444  1.00 23.06  ? 209 LEU B C     1 
ATOM 6725  O O     . LEU D 4 209 ? 5.784   106.095 12.311  1.00 22.94  ? 209 LEU B O     1 
ATOM 6726  C CB    . LEU D 4 209 ? 3.589   108.064 13.509  1.00 21.07  ? 209 LEU B CB    1 
ATOM 6727  C CG    . LEU D 4 209 ? 2.104   108.414 13.532  1.00 20.97  ? 209 LEU B CG    1 
ATOM 6728  C CD1   . LEU D 4 209 ? 2.024   109.910 13.600  1.00 20.40  ? 209 LEU B CD1   1 
ATOM 6729  C CD2   . LEU D 4 209 ? 1.332   107.851 12.312  1.00 18.60  ? 209 LEU B CD2   1 
ATOM 6730  N N     . LEU D 4 210 ? 6.104   106.300 14.536  1.00 23.74  ? 210 LEU B N     1 
ATOM 6731  C CA    . LEU D 4 210 ? 7.522   106.034 14.482  1.00 24.88  ? 210 LEU B CA    1 
ATOM 6732  C C     . LEU D 4 210 ? 7.739   104.621 13.997  1.00 25.75  ? 210 LEU B C     1 
ATOM 6733  O O     . LEU D 4 210 ? 8.270   104.389 12.901  1.00 24.34  ? 210 LEU B O     1 
ATOM 6734  C CB    . LEU D 4 210 ? 8.118   106.196 15.867  1.00 26.02  ? 210 LEU B CB    1 
ATOM 6735  C CG    . LEU D 4 210 ? 8.955   107.453 15.981  1.00 29.66  ? 210 LEU B CG    1 
ATOM 6736  C CD1   . LEU D 4 210 ? 10.202  107.247 15.138  1.00 31.06  ? 210 LEU B CD1   1 
ATOM 6737  C CD2   . LEU D 4 210 ? 8.155   108.677 15.512  1.00 31.55  ? 210 LEU B CD2   1 
ATOM 6738  N N     . ARG D 4 211 ? 7.274   103.676 14.807  1.00 27.91  ? 211 ARG B N     1 
ATOM 6739  C CA    . ARG D 4 211 ? 7.423   102.282 14.451  1.00 30.38  ? 211 ARG B CA    1 
ATOM 6740  C C     . ARG D 4 211 ? 6.783   102.027 13.114  1.00 28.76  ? 211 ARG B C     1 
ATOM 6741  O O     . ARG D 4 211 ? 7.377   101.388 12.255  1.00 29.56  ? 211 ARG B O     1 
ATOM 6742  C CB    . ARG D 4 211 ? 6.912   101.318 15.537  1.00 34.90  ? 211 ARG B CB    1 
ATOM 6743  C CG    . ARG D 4 211 ? 5.824   101.813 16.459  1.00 41.65  ? 211 ARG B CG    1 
ATOM 6744  C CD    . ARG D 4 211 ? 5.890   101.058 17.800  1.00 49.02  ? 211 ARG B CD    1 
ATOM 6745  N NE    . ARG D 4 211 ? 7.212   101.172 18.443  1.00 56.82  ? 211 ARG B NE    1 
ATOM 6746  C CZ    . ARG D 4 211 ? 7.438   101.244 19.763  1.00 60.70  ? 211 ARG B CZ    1 
ATOM 6747  N NH1   . ARG D 4 211 ? 6.433   101.219 20.648  1.00 60.98  ? 211 ARG B NH1   1 
ATOM 6748  N NH2   . ARG D 4 211 ? 8.691   101.346 20.207  1.00 62.67  ? 211 ARG B NH2   1 
ATOM 6749  N N     . TRP D 4 212 ? 5.610   102.580 12.875  1.00 26.91  ? 212 TRP B N     1 
ATOM 6750  C CA    . TRP D 4 212 ? 5.061   102.329 11.572  1.00 25.36  ? 212 TRP B CA    1 
ATOM 6751  C C     . TRP D 4 212 ? 5.858   103.132 10.592  1.00 25.11  ? 212 TRP B C     1 
ATOM 6752  O O     . TRP D 4 212 ? 6.373   104.189 10.944  1.00 22.21  ? 212 TRP B O     1 
ATOM 6753  C CB    . TRP D 4 212 ? 3.617   102.731 11.454  1.00 23.59  ? 212 TRP B CB    1 
ATOM 6754  C CG    . TRP D 4 212 ? 3.019   101.997 10.349  1.00 22.79  ? 212 TRP B CG    1 
ATOM 6755  C CD1   . TRP D 4 212 ? 3.302   102.125 9.013   1.00 22.41  ? 212 TRP B CD1   1 
ATOM 6756  C CD2   . TRP D 4 212 ? 2.085   100.937 10.464  1.00 24.26  ? 212 TRP B CD2   1 
ATOM 6757  N NE1   . TRP D 4 212 ? 2.603   101.195 8.290   1.00 23.18  ? 212 TRP B NE1   1 
ATOM 6758  C CE2   . TRP D 4 212 ? 1.839   100.451 9.156   1.00 25.54  ? 212 TRP B CE2   1 
ATOM 6759  C CE3   . TRP D 4 212 ? 1.425   100.342 11.551  1.00 23.93  ? 212 TRP B CE3   1 
ATOM 6760  C CZ2   . TRP D 4 212 ? 0.951   99.393  8.902   1.00 27.59  ? 212 TRP B CZ2   1 
ATOM 6761  C CZ3   . TRP D 4 212 ? 0.542   99.293  11.304  1.00 27.04  ? 212 TRP B CZ3   1 
ATOM 6762  C CH2   . TRP D 4 212 ? 0.312   98.827  9.984   1.00 28.43  ? 212 TRP B CH2   1 
ATOM 6763  N N     . GLY D 4 213 ? 5.969   102.587 9.382   1.00 26.50  ? 213 GLY B N     1 
ATOM 6764  C CA    . GLY D 4 213 ? 6.686   103.215 8.287   1.00 29.49  ? 213 GLY B CA    1 
ATOM 6765  C C     . GLY D 4 213 ? 7.381   104.530 8.578   1.00 31.81  ? 213 GLY B C     1 
ATOM 6766  O O     . GLY D 4 213 ? 7.133   105.541 7.904   1.00 31.88  ? 213 GLY B O     1 
ATOM 6767  N N     . LEU D 4 214 ? 8.227   104.508 9.611   1.00 32.69  ? 214 LEU B N     1 
ATOM 6768  C CA    . LEU D 4 214 ? 9.007   105.659 10.048  1.00 34.52  ? 214 LEU B CA    1 
ATOM 6769  C C     . LEU D 4 214 ? 8.321   107.037 9.889   1.00 33.67  ? 214 LEU B C     1 
ATOM 6770  O O     . LEU D 4 214 ? 8.894   107.980 9.314   1.00 34.60  ? 214 LEU B O     1 
ATOM 6771  C CB    . LEU D 4 214 ? 10.391  105.637 9.356   1.00 37.91  ? 214 LEU B CB    1 
ATOM 6772  C CG    . LEU D 4 214 ? 11.410  104.518 9.692   1.00 41.74  ? 214 LEU B CG    1 
ATOM 6773  C CD1   . LEU D 4 214 ? 12.347  104.219 8.505   1.00 40.10  ? 214 LEU B CD1   1 
ATOM 6774  C CD2   . LEU D 4 214 ? 12.226  104.880 10.957  1.00 43.02  ? 214 LEU B CD2   1 
ATOM 6775  N N     . THR D 4 215 ? 7.076   107.145 10.345  1.00 29.41  ? 215 THR B N     1 
ATOM 6776  C CA    . THR D 4 215 ? 6.396   108.424 10.273  1.00 25.57  ? 215 THR B CA    1 
ATOM 6777  C C     . THR D 4 215 ? 6.888   109.153 11.503  1.00 23.60  ? 215 THR B C     1 
ATOM 6778  O O     . THR D 4 215 ? 6.539   108.811 12.626  1.00 21.81  ? 215 THR B O     1 
ATOM 6779  C CB    . THR D 4 215 ? 4.895   108.258 10.308  1.00 25.44  ? 215 THR B CB    1 
ATOM 6780  O OG1   . THR D 4 215 ? 4.527   107.294 9.323   1.00 26.10  ? 215 THR B OG1   1 
ATOM 6781  C CG2   . THR D 4 215 ? 4.204   109.562 9.963   1.00 27.71  ? 215 THR B CG2   1 
ATOM 6782  N N     . THR D 4 216 ? 7.768   110.115 11.275  1.00 23.43  ? 216 THR B N     1 
ATOM 6783  C CA    . THR D 4 216 ? 8.372   110.888 12.353  1.00 25.33  ? 216 THR B CA    1 
ATOM 6784  C C     . THR D 4 216 ? 7.923   112.349 12.501  1.00 27.07  ? 216 THR B C     1 
ATOM 6785  O O     . THR D 4 216 ? 8.219   113.177 11.642  1.00 30.01  ? 216 THR B O     1 
ATOM 6786  C CB    . THR D 4 216 ? 9.875   110.886 12.172  1.00 24.10  ? 216 THR B CB    1 
ATOM 6787  O OG1   . THR D 4 216 ? 10.183  111.012 10.775  1.00 21.62  ? 216 THR B OG1   1 
ATOM 6788  C CG2   . THR D 4 216 ? 10.438  109.609 12.693  1.00 23.83  ? 216 THR B CG2   1 
ATOM 6789  N N     . PRO D 4 217 ? 7.265   112.700 13.624  1.00 26.77  ? 217 PRO B N     1 
ATOM 6790  C CA    . PRO D 4 217 ? 6.804   114.079 13.843  1.00 27.03  ? 217 PRO B CA    1 
ATOM 6791  C C     . PRO D 4 217 ? 7.835   114.988 14.548  1.00 28.57  ? 217 PRO B C     1 
ATOM 6792  O O     . PRO D 4 217 ? 8.875   114.521 15.015  1.00 28.95  ? 217 PRO B O     1 
ATOM 6793  C CB    . PRO D 4 217 ? 5.585   113.864 14.720  1.00 26.62  ? 217 PRO B CB    1 
ATOM 6794  C CG    . PRO D 4 217 ? 6.050   112.747 15.617  1.00 24.83  ? 217 PRO B CG    1 
ATOM 6795  C CD    . PRO D 4 217 ? 6.741   111.795 14.667  1.00 25.49  ? 217 PRO B CD    1 
ATOM 6796  N N     . ASP D 4 218 ? 7.550   116.287 14.615  1.00 30.65  ? 218 ASP B N     1 
ATOM 6797  C CA    . ASP D 4 218 ? 8.442   117.218 15.311  1.00 35.07  ? 218 ASP B CA    1 
ATOM 6798  C C     . ASP D 4 218 ? 8.374   116.848 16.800  1.00 35.94  ? 218 ASP B C     1 
ATOM 6799  O O     . ASP D 4 218 ? 7.777   115.837 17.151  1.00 35.45  ? 218 ASP B O     1 
ATOM 6800  C CB    . ASP D 4 218 ? 7.970   118.674 15.113  1.00 40.11  ? 218 ASP B CB    1 
ATOM 6801  C CG    . ASP D 4 218 ? 8.728   119.417 13.984  1.00 43.53  ? 218 ASP B CG    1 
ATOM 6802  O OD1   . ASP D 4 218 ? 9.177   120.574 14.206  1.00 41.42  ? 218 ASP B OD1   1 
ATOM 6803  O OD2   . ASP D 4 218 ? 8.858   118.861 12.867  1.00 47.06  ? 218 ASP B OD2   1 
ATOM 6804  N N     . LYS D 4 219 ? 9.038   117.616 17.665  1.00 38.89  ? 219 LYS B N     1 
ATOM 6805  C CA    . LYS D 4 219 ? 9.026   117.368 19.121  1.00 42.69  ? 219 LYS B CA    1 
ATOM 6806  C C     . LYS D 4 219 ? 9.089   118.725 19.797  1.00 44.31  ? 219 LYS B C     1 
ATOM 6807  O O     . LYS D 4 219 ? 10.143  119.125 20.292  1.00 45.05  ? 219 LYS B O     1 
ATOM 6808  C CB    . LYS D 4 219 ? 10.248  116.569 19.610  1.00 43.67  ? 219 LYS B CB    1 
ATOM 6809  C CG    . LYS D 4 219 ? 10.566  115.268 18.907  1.00 46.39  ? 219 LYS B CG    1 
ATOM 6810  C CD    . LYS D 4 219 ? 11.006  115.448 17.434  1.00 48.85  ? 219 LYS B CD    1 
ATOM 6811  C CE    . LYS D 4 219 ? 12.108  116.508 17.218  1.00 49.53  ? 219 LYS B CE    1 
ATOM 6812  N NZ    . LYS D 4 219 ? 11.615  117.928 17.160  1.00 46.64  ? 219 LYS B NZ    1 
ATOM 6813  N N     . LYS D 4 220 ? 7.959   119.419 19.838  1.00 46.56  ? 220 LYS B N     1 
ATOM 6814  C CA    . LYS D 4 220 ? 7.895   120.754 20.430  1.00 48.77  ? 220 LYS B CA    1 
ATOM 6815  C C     . LYS D 4 220 ? 8.608   120.888 21.782  1.00 49.34  ? 220 LYS B C     1 
ATOM 6816  O O     . LYS D 4 220 ? 8.310   120.166 22.743  1.00 49.31  ? 220 LYS B O     1 
ATOM 6817  C CB    . LYS D 4 220 ? 6.437   121.234 20.518  1.00 50.37  ? 220 LYS B CB    1 
ATOM 6818  C CG    . LYS D 4 220 ? 5.682   121.289 19.160  1.00 51.17  ? 220 LYS B CG    1 
ATOM 6819  C CD    . LYS D 4 220 ? 6.340   122.248 18.142  1.00 50.69  ? 220 LYS B CD    1 
ATOM 6820  C CE    . LYS D 4 220 ? 5.595   122.285 16.792  1.00 49.22  ? 220 LYS B CE    1 
ATOM 6821  N NZ    . LYS D 4 220 ? 5.632   121.020 15.984  1.00 47.40  ? 220 LYS B NZ    1 
ATOM 6822  N N     . HIS D 4 221 ? 9.577   121.804 21.809  1.00 49.72  ? 221 HIS B N     1 
ATOM 6823  C CA    . HIS D 4 221 ? 10.403  122.112 22.982  1.00 50.79  ? 221 HIS B CA    1 
ATOM 6824  C C     . HIS D 4 221 ? 9.489   122.541 24.149  1.00 48.41  ? 221 HIS B C     1 
ATOM 6825  O O     . HIS D 4 221 ? 8.343   122.937 23.916  1.00 50.42  ? 221 HIS B O     1 
ATOM 6826  C CB    . HIS D 4 221 ? 11.371  123.252 22.596  1.00 56.80  ? 221 HIS B CB    1 
ATOM 6827  C CG    . HIS D 4 221 ? 12.619  123.342 23.435  1.00 62.96  ? 221 HIS B CG    1 
ATOM 6828  N ND1   . HIS D 4 221 ? 13.885  123.347 22.883  1.00 66.31  ? 221 HIS B ND1   1 
ATOM 6829  C CD2   . HIS D 4 221 ? 12.795  123.517 24.770  1.00 65.62  ? 221 HIS B CD2   1 
ATOM 6830  C CE1   . HIS D 4 221 ? 14.784  123.528 23.837  1.00 67.72  ? 221 HIS B CE1   1 
ATOM 6831  N NE2   . HIS D 4 221 ? 14.148  123.634 24.992  1.00 67.74  ? 221 HIS B NE2   1 
ATOM 6832  N N     . GLN D 4 222 ? 9.977   122.438 25.389  1.00 44.15  ? 222 GLN B N     1 
ATOM 6833  C CA    . GLN D 4 222 ? 9.209   122.824 26.581  1.00 39.82  ? 222 GLN B CA    1 
ATOM 6834  C C     . GLN D 4 222 ? 10.161  123.387 27.626  1.00 38.19  ? 222 GLN B C     1 
ATOM 6835  O O     . GLN D 4 222 ? 11.171  122.759 27.887  1.00 38.60  ? 222 GLN B O     1 
ATOM 6836  C CB    . GLN D 4 222 ? 8.499   121.594 27.135  1.00 38.32  ? 222 GLN B CB    1 
ATOM 6837  C CG    . GLN D 4 222 ? 7.439   121.066 26.189  1.00 36.61  ? 222 GLN B CG    1 
ATOM 6838  C CD    . GLN D 4 222 ? 7.479   119.574 26.031  1.00 37.37  ? 222 GLN B CD    1 
ATOM 6839  O OE1   . GLN D 4 222 ? 6.482   118.951 25.632  1.00 34.61  ? 222 GLN B OE1   1 
ATOM 6840  N NE2   . GLN D 4 222 ? 8.636   118.975 26.338  1.00 37.17  ? 222 GLN B NE2   1 
ATOM 6841  N N     . LYS D 4 223 ? 9.877   124.545 28.228  1.00 36.22  ? 223 LYS B N     1 
ATOM 6842  C CA    . LYS D 4 223 ? 10.827  125.078 29.224  1.00 35.63  ? 223 LYS B CA    1 
ATOM 6843  C C     . LYS D 4 223 ? 10.236  125.658 30.512  1.00 36.28  ? 223 LYS B C     1 
ATOM 6844  O O     . LYS D 4 223 ? 9.053   125.465 30.775  1.00 35.73  ? 223 LYS B O     1 
ATOM 6845  C CB    . LYS D 4 223 ? 11.781  126.076 28.564  1.00 33.75  ? 223 LYS B CB    1 
ATOM 6846  C CG    . LYS D 4 223 ? 13.181  126.092 29.156  1.00 30.92  ? 223 LYS B CG    1 
ATOM 6847  C CD    . LYS D 4 223 ? 14.156  126.598 28.121  1.00 29.25  ? 223 LYS B CD    1 
ATOM 6848  C CE    . LYS D 4 223 ? 15.581  126.489 28.615  1.00 29.51  ? 223 LYS B CE    1 
ATOM 6849  N NZ    . LYS D 4 223 ? 15.847  127.381 29.781  1.00 29.00  ? 223 LYS B NZ    1 
ATOM 6850  N N     . GLU D 4 224 ? 11.054  126.352 31.316  1.00 36.89  ? 224 GLU B N     1 
ATOM 6851  C CA    . GLU D 4 224 ? 10.583  126.922 32.593  1.00 37.95  ? 224 GLU B CA    1 
ATOM 6852  C C     . GLU D 4 224 ? 10.174  128.410 32.715  1.00 38.10  ? 224 GLU B C     1 
ATOM 6853  O O     . GLU D 4 224 ? 9.243   128.731 33.448  1.00 39.15  ? 224 GLU B O     1 
ATOM 6854  C CB    . GLU D 4 224 ? 11.524  126.540 33.757  1.00 39.20  ? 224 GLU B CB    1 
ATOM 6855  C CG    . GLU D 4 224 ? 11.169  127.147 35.176  1.00 38.82  ? 224 GLU B CG    1 
ATOM 6856  C CD    . GLU D 4 224 ? 9.936   126.535 35.887  1.00 37.97  ? 224 GLU B CD    1 
ATOM 6857  O OE1   . GLU D 4 224 ? 9.422   125.487 35.439  1.00 36.61  ? 224 GLU B OE1   1 
ATOM 6858  O OE2   . GLU D 4 224 ? 9.491   127.107 36.917  1.00 36.00  ? 224 GLU B OE2   1 
ATOM 6859  N N     . PRO D 4 225 ? 10.939  129.345 32.144  1.00 36.85  ? 225 PRO B N     1 
ATOM 6860  C CA    . PRO D 4 225 ? 10.427  130.724 32.338  1.00 34.17  ? 225 PRO B CA    1 
ATOM 6861  C C     . PRO D 4 225 ? 9.017   131.054 31.730  1.00 30.62  ? 225 PRO B C     1 
ATOM 6862  O O     . PRO D 4 225 ? 8.025   130.716 32.362  1.00 29.17  ? 225 PRO B O     1 
ATOM 6863  C CB    . PRO D 4 225 ? 11.605  131.607 31.911  1.00 35.64  ? 225 PRO B CB    1 
ATOM 6864  C CG    . PRO D 4 225 ? 12.602  130.611 31.205  1.00 37.12  ? 225 PRO B CG    1 
ATOM 6865  C CD    . PRO D 4 225 ? 12.392  129.319 31.902  1.00 35.18  ? 225 PRO B CD    1 
ATOM 6866  N N     . PRO D 4 226 ? 8.886   131.770 30.582  1.00 28.36  ? 226 PRO B N     1 
ATOM 6867  C CA    . PRO D 4 226 ? 7.462   131.929 30.224  1.00 27.10  ? 226 PRO B CA    1 
ATOM 6868  C C     . PRO D 4 226 ? 6.800   130.813 29.388  1.00 26.17  ? 226 PRO B C     1 
ATOM 6869  O O     . PRO D 4 226 ? 6.470   130.987 28.213  1.00 24.65  ? 226 PRO B O     1 
ATOM 6870  C CB    . PRO D 4 226 ? 7.416   133.308 29.556  1.00 25.83  ? 226 PRO B CB    1 
ATOM 6871  C CG    . PRO D 4 226 ? 8.734   133.418 28.935  1.00 25.98  ? 226 PRO B CG    1 
ATOM 6872  C CD    . PRO D 4 226 ? 9.676   132.854 29.967  1.00 27.03  ? 226 PRO B CD    1 
ATOM 6873  N N     . PHE D 4 227 ? 6.534   129.707 30.080  1.00 26.48  ? 227 PHE B N     1 
ATOM 6874  C CA    . PHE D 4 227 ? 5.899   128.465 29.590  1.00 27.87  ? 227 PHE B CA    1 
ATOM 6875  C C     . PHE D 4 227 ? 4.925   128.453 28.415  1.00 25.01  ? 227 PHE B C     1 
ATOM 6876  O O     . PHE D 4 227 ? 3.727   128.213 28.609  1.00 23.74  ? 227 PHE B O     1 
ATOM 6877  C CB    . PHE D 4 227 ? 5.130   127.830 30.731  1.00 33.20  ? 227 PHE B CB    1 
ATOM 6878  C CG    . PHE D 4 227 ? 5.893   127.738 32.008  1.00 39.59  ? 227 PHE B CG    1 
ATOM 6879  C CD1   . PHE D 4 227 ? 5.492   128.477 33.119  1.00 41.38  ? 227 PHE B CD1   1 
ATOM 6880  C CD2   . PHE D 4 227 ? 6.940   126.824 32.148  1.00 42.62  ? 227 PHE B CD2   1 
ATOM 6881  C CE1   . PHE D 4 227 ? 6.119   128.298 34.363  1.00 44.27  ? 227 PHE B CE1   1 
ATOM 6882  C CE2   . PHE D 4 227 ? 7.571   126.636 33.385  1.00 43.36  ? 227 PHE B CE2   1 
ATOM 6883  C CZ    . PHE D 4 227 ? 7.158   127.370 34.496  1.00 43.87  ? 227 PHE B CZ    1 
ATOM 6884  N N     . LEU D 4 228 ? 5.446   128.521 27.203  1.00 22.79  ? 228 LEU B N     1 
ATOM 6885  C CA    . LEU D 4 228 ? 4.587   128.529 26.033  1.00 22.49  ? 228 LEU B CA    1 
ATOM 6886  C C     . LEU D 4 228 ? 3.942   127.180 25.703  1.00 23.17  ? 228 LEU B C     1 
ATOM 6887  O O     . LEU D 4 228 ? 2.767   127.118 25.316  1.00 23.45  ? 228 LEU B O     1 
ATOM 6888  C CB    . LEU D 4 228 ? 5.372   129.018 24.824  1.00 21.86  ? 228 LEU B CB    1 
ATOM 6889  C CG    . LEU D 4 228 ? 4.557   129.852 23.831  1.00 21.59  ? 228 LEU B CG    1 
ATOM 6890  C CD1   . LEU D 4 228 ? 4.718   131.331 24.191  1.00 20.18  ? 228 LEU B CD1   1 
ATOM 6891  C CD2   . LEU D 4 228 ? 5.006   129.595 22.382  1.00 21.26  ? 228 LEU B CD2   1 
ATOM 6892  N N     . TRP D 4 229 ? 4.724   126.108 25.836  1.00 22.67  ? 229 TRP B N     1 
ATOM 6893  C CA    . TRP D 4 229 ? 4.278   124.747 25.520  1.00 20.81  ? 229 TRP B CA    1 
ATOM 6894  C C     . TRP D 4 229 ? 3.039   124.273 26.268  1.00 20.54  ? 229 TRP B C     1 
ATOM 6895  O O     . TRP D 4 229 ? 2.323   123.387 25.798  1.00 16.77  ? 229 TRP B O     1 
ATOM 6896  C CB    . TRP D 4 229 ? 5.426   123.770 25.747  1.00 20.37  ? 229 TRP B CB    1 
ATOM 6897  C CG    . TRP D 4 229 ? 5.838   123.715 27.159  1.00 20.85  ? 229 TRP B CG    1 
ATOM 6898  C CD1   . TRP D 4 229 ? 6.749   124.519 27.787  1.00 21.35  ? 229 TRP B CD1   1 
ATOM 6899  C CD2   . TRP D 4 229 ? 5.304   122.846 28.156  1.00 18.71  ? 229 TRP B CD2   1 
ATOM 6900  N NE1   . TRP D 4 229 ? 6.807   124.205 29.124  1.00 22.09  ? 229 TRP B NE1   1 
ATOM 6901  C CE2   . TRP D 4 229 ? 5.927   123.184 29.379  1.00 19.98  ? 229 TRP B CE2   1 
ATOM 6902  C CE3   . TRP D 4 229 ? 4.348   121.820 28.140  1.00 16.11  ? 229 TRP B CE3   1 
ATOM 6903  C CZ2   . TRP D 4 229 ? 5.622   122.531 30.575  1.00 18.63  ? 229 TRP B CZ2   1 
ATOM 6904  C CZ3   . TRP D 4 229 ? 4.046   121.176 29.322  1.00 15.51  ? 229 TRP B CZ3   1 
ATOM 6905  C CH2   . TRP D 4 229 ? 4.680   121.533 30.527  1.00 16.74  ? 229 TRP B CH2   1 
ATOM 6906  N N     . MET D 4 230 ? 2.845   124.830 27.464  1.00 22.69  ? 230 MET B N     1 
ATOM 6907  C CA    . MET D 4 230 ? 1.702   124.515 28.315  1.00 24.22  ? 230 MET B CA    1 
ATOM 6908  C C     . MET D 4 230 ? 0.450   124.892 27.564  1.00 22.18  ? 230 MET B C     1 
ATOM 6909  O O     . MET D 4 230 ? -0.625  124.343 27.801  1.00 21.22  ? 230 MET B O     1 
ATOM 6910  C CB    . MET D 4 230 ? 1.758   125.332 29.607  1.00 29.22  ? 230 MET B CB    1 
ATOM 6911  C CG    . MET D 4 230 ? 2.400   124.628 30.817  1.00 37.20  ? 230 MET B CG    1 
ATOM 6912  S SD    . MET D 4 230 ? 1.479   123.188 31.532  1.00 44.42  ? 230 MET B SD    1 
ATOM 6913  C CE    . MET D 4 230 ? -0.114  123.981 32.121  1.00 40.73  ? 230 MET B CE    1 
ATOM 6914  N N     . GLY D 4 231 ? 0.609   125.836 26.646  1.00 21.10  ? 231 GLY B N     1 
ATOM 6915  C CA    . GLY D 4 231 ? -0.511  126.292 25.857  1.00 22.24  ? 231 GLY B CA    1 
ATOM 6916  C C     . GLY D 4 231 ? -0.669  125.679 24.477  1.00 22.53  ? 231 GLY B C     1 
ATOM 6917  O O     . GLY D 4 231 ? -1.749  125.751 23.882  1.00 23.10  ? 231 GLY B O     1 
ATOM 6918  N N     . TYR D 4 232 ? 0.390   125.071 23.961  1.00 22.65  ? 232 TYR B N     1 
ATOM 6919  C CA    . TYR D 4 232 ? 0.336   124.467 22.636  1.00 23.05  ? 232 TYR B CA    1 
ATOM 6920  C C     . TYR D 4 232 ? -0.985  123.756 22.371  1.00 21.81  ? 232 TYR B C     1 
ATOM 6921  O O     . TYR D 4 232 ? -1.535  123.790 21.270  1.00 22.29  ? 232 TYR B O     1 
ATOM 6922  C CB    . TYR D 4 232 ? 1.496   123.505 22.483  1.00 25.56  ? 232 TYR B CB    1 
ATOM 6923  C CG    . TYR D 4 232 ? 2.850   124.183 22.456  1.00 26.64  ? 232 TYR B CG    1 
ATOM 6924  C CD1   . TYR D 4 232 ? 2.981   125.572 22.528  1.00 24.67  ? 232 TYR B CD1   1 
ATOM 6925  C CD2   . TYR D 4 232 ? 4.009   123.418 22.338  1.00 28.15  ? 232 TYR B CD2   1 
ATOM 6926  C CE1   . TYR D 4 232 ? 4.243   126.167 22.484  1.00 26.89  ? 232 TYR B CE1   1 
ATOM 6927  C CE2   . TYR D 4 232 ? 5.265   123.996 22.293  1.00 28.63  ? 232 TYR B CE2   1 
ATOM 6928  C CZ    . TYR D 4 232 ? 5.389   125.362 22.367  1.00 29.09  ? 232 TYR B CZ    1 
ATOM 6929  O OH    . TYR D 4 232 ? 6.673   125.879 22.350  1.00 30.99  ? 232 TYR B OH    1 
ATOM 6930  N N     . GLU D 4 233 ? -1.541  123.230 23.443  1.00 21.23  ? 233 GLU B N     1 
ATOM 6931  C CA    . GLU D 4 233 ? -2.799  122.518 23.417  1.00 23.81  ? 233 GLU B CA    1 
ATOM 6932  C C     . GLU D 4 233 ? -3.883  123.344 22.706  1.00 24.57  ? 233 GLU B C     1 
ATOM 6933  O O     . GLU D 4 233 ? -3.826  124.569 22.698  1.00 23.85  ? 233 GLU B O     1 
ATOM 6934  C CB    . GLU D 4 233 ? -3.195  122.199 24.864  1.00 25.96  ? 233 GLU B CB    1 
ATOM 6935  C CG    . GLU D 4 233 ? -2.015  122.176 25.889  1.00 25.53  ? 233 GLU B CG    1 
ATOM 6936  C CD    . GLU D 4 233 ? -0.810  121.307 25.465  1.00 26.67  ? 233 GLU B CD    1 
ATOM 6937  O OE1   . GLU D 4 233 ? -0.964  120.070 25.355  1.00 26.92  ? 233 GLU B OE1   1 
ATOM 6938  O OE2   . GLU D 4 233 ? 0.303   121.856 25.271  1.00 26.50  ? 233 GLU B OE2   1 
ATOM 6939  N N     . LEU D 4 234 ? -4.841  122.675 22.072  1.00 26.53  ? 234 LEU B N     1 
ATOM 6940  C CA    . LEU D 4 234 ? -5.904  123.382 21.362  1.00 28.76  ? 234 LEU B CA    1 
ATOM 6941  C C     . LEU D 4 234 ? -7.277  122.946 21.827  1.00 31.21  ? 234 LEU B C     1 
ATOM 6942  O O     . LEU D 4 234 ? -7.774  121.908 21.424  1.00 29.57  ? 234 LEU B O     1 
ATOM 6943  C CB    . LEU D 4 234 ? -5.781  123.161 19.861  1.00 27.80  ? 234 LEU B CB    1 
ATOM 6944  C CG    . LEU D 4 234 ? -6.709  124.018 19.013  1.00 25.95  ? 234 LEU B CG    1 
ATOM 6945  C CD1   . LEU D 4 234 ? -6.379  125.469 19.282  1.00 25.14  ? 234 LEU B CD1   1 
ATOM 6946  C CD2   . LEU D 4 234 ? -6.518  123.694 17.538  1.00 26.30  ? 234 LEU B CD2   1 
ATOM 6947  N N     . HIS D 4 235 ? -7.896  123.783 22.650  1.00 35.13  ? 235 HIS B N     1 
ATOM 6948  C CA    . HIS D 4 235 ? -9.214  123.510 23.210  1.00 39.87  ? 235 HIS B CA    1 
ATOM 6949  C C     . HIS D 4 235 ? -10.249 124.526 22.736  1.00 43.03  ? 235 HIS B C     1 
ATOM 6950  O O     . HIS D 4 235 ? -10.370 125.629 23.279  1.00 43.44  ? 235 HIS B O     1 
ATOM 6951  C CB    . HIS D 4 235 ? -9.141  123.469 24.738  1.00 40.30  ? 235 HIS B CB    1 
ATOM 6952  C CG    . HIS D 4 235 ? -7.849  123.983 25.294  1.00 45.03  ? 235 HIS B CG    1 
ATOM 6953  N ND1   . HIS D 4 235 ? -7.182  125.063 24.751  1.00 45.39  ? 235 HIS B ND1   1 
ATOM 6954  C CD2   . HIS D 4 235 ? -7.078  123.542 26.316  1.00 44.26  ? 235 HIS B CD2   1 
ATOM 6955  C CE1   . HIS D 4 235 ? -6.055  125.260 25.412  1.00 46.81  ? 235 HIS B CE1   1 
ATOM 6956  N NE2   . HIS D 4 235 ? -5.967  124.351 26.368  1.00 45.35  ? 235 HIS B NE2   1 
ATOM 6957  N N     . PRO D 4 236 ? -11.022 124.140 21.710  1.00 47.07  ? 236 PRO B N     1 
ATOM 6958  C CA    . PRO D 4 236 ? -12.094 124.860 21.017  1.00 50.01  ? 236 PRO B CA    1 
ATOM 6959  C C     . PRO D 4 236 ? -13.316 125.177 21.835  1.00 51.89  ? 236 PRO B C     1 
ATOM 6960  O O     . PRO D 4 236 ? -13.642 126.342 21.987  1.00 52.59  ? 236 PRO B O     1 
ATOM 6961  C CB    . PRO D 4 236 ? -12.469 123.908 19.884  1.00 50.87  ? 236 PRO B CB    1 
ATOM 6962  C CG    . PRO D 4 236 ? -12.247 122.574 20.495  1.00 49.89  ? 236 PRO B CG    1 
ATOM 6963  C CD    . PRO D 4 236 ? -10.884 122.790 21.140  1.00 49.36  ? 236 PRO B CD    1 
ATOM 6964  N N     . ASP D 4 237 ? -14.021 124.130 22.274  1.00 54.16  ? 237 ASP B N     1 
ATOM 6965  C CA    . ASP D 4 237 ? -15.250 124.237 23.064  1.00 57.85  ? 237 ASP B CA    1 
ATOM 6966  C C     . ASP D 4 237 ? -15.548 125.642 23.548  1.00 57.99  ? 237 ASP B C     1 
ATOM 6967  O O     . ASP D 4 237 ? -16.617 126.190 23.266  1.00 57.08  ? 237 ASP B O     1 
ATOM 6968  C CB    . ASP D 4 237 ? -15.236 123.244 24.229  1.00 61.61  ? 237 ASP B CB    1 
ATOM 6969  C CG    . ASP D 4 237 ? -15.963 121.934 23.892  1.00 65.12  ? 237 ASP B CG    1 
ATOM 6970  O OD1   . ASP D 4 237 ? -16.050 121.574 22.683  1.00 66.36  ? 237 ASP B OD1   1 
ATOM 6971  O OD2   . ASP D 4 237 ? -16.456 121.276 24.842  1.00 67.28  ? 237 ASP B OD2   1 
ATOM 6972  N N     . LYS D 4 238 ? -14.566 126.240 24.216  1.00 58.15  ? 238 LYS B N     1 
ATOM 6973  C CA    . LYS D 4 238 ? -14.694 127.605 24.687  1.00 58.33  ? 238 LYS B CA    1 
ATOM 6974  C C     . LYS D 4 238 ? -14.405 128.577 23.522  1.00 57.51  ? 238 LYS B C     1 
ATOM 6975  O O     . LYS D 4 238 ? -13.474 129.381 23.569  1.00 55.98  ? 238 LYS B O     1 
ATOM 6976  C CB    . LYS D 4 238 ? -13.750 127.838 25.864  1.00 59.10  ? 238 LYS B CB    1 
ATOM 6977  C CG    . LYS D 4 238 ? -14.217 128.963 26.756  1.00 60.92  ? 238 LYS B CG    1 
ATOM 6978  C CD    . LYS D 4 238 ? -13.634 128.855 28.148  1.00 63.25  ? 238 LYS B CD    1 
ATOM 6979  C CE    . LYS D 4 238 ? -14.304 129.854 29.092  1.00 64.05  ? 238 LYS B CE    1 
ATOM 6980  N NZ    . LYS D 4 238 ? -13.673 129.888 30.450  1.00 67.08  ? 238 LYS B NZ    1 
ATOM 6981  N N     . TRP D 4 239 ? -15.218 128.469 22.471  1.00 57.16  ? 239 TRP B N     1 
ATOM 6982  C CA    . TRP D 4 239 ? -15.100 129.291 21.267  1.00 58.41  ? 239 TRP B CA    1 
ATOM 6983  C C     . TRP D 4 239 ? -16.452 129.890 20.848  1.00 61.08  ? 239 TRP B C     1 
ATOM 6984  O O     . TRP D 4 239 ? -17.134 129.333 19.973  1.00 62.02  ? 239 TRP B O     1 
ATOM 6985  C CB    . TRP D 4 239 ? -14.593 128.437 20.105  1.00 55.08  ? 239 TRP B CB    1 
ATOM 6986  C CG    . TRP D 4 239 ? -13.110 128.240 20.026  1.00 53.69  ? 239 TRP B CG    1 
ATOM 6987  C CD1   . TRP D 4 239 ? -12.162 128.621 20.943  1.00 52.92  ? 239 TRP B CD1   1 
ATOM 6988  C CD2   . TRP D 4 239 ? -12.398 127.631 18.943  1.00 51.33  ? 239 TRP B CD2   1 
ATOM 6989  N NE1   . TRP D 4 239 ? -10.902 128.287 20.488  1.00 50.94  ? 239 TRP B NE1   1 
ATOM 6990  C CE2   . TRP D 4 239 ? -11.021 127.683 19.263  1.00 50.13  ? 239 TRP B CE2   1 
ATOM 6991  C CE3   . TRP D 4 239 ? -12.790 127.047 17.728  1.00 48.02  ? 239 TRP B CE3   1 
ATOM 6992  C CZ2   . TRP D 4 239 ? -10.042 127.180 18.412  1.00 48.24  ? 239 TRP B CZ2   1 
ATOM 6993  C CZ3   . TRP D 4 239 ? -11.814 126.546 16.884  1.00 46.04  ? 239 TRP B CZ3   1 
ATOM 6994  C CH2   . TRP D 4 239 ? -10.457 126.617 17.230  1.00 47.09  ? 239 TRP B CH2   1 
ATOM 6995  N N     . THR D 4 240 ? -16.823 131.031 21.441  1.00 63.37  ? 240 THR B N     1 
ATOM 6996  C CA    . THR D 4 240 ? -18.092 131.711 21.125  1.00 64.10  ? 240 THR B CA    1 
ATOM 6997  C C     . THR D 4 240 ? -17.942 132.781 20.037  1.00 64.80  ? 240 THR B C     1 
ATOM 6998  O O     . THR D 4 240 ? -16.836 133.282 19.776  1.00 63.85  ? 240 THR B O     1 
ATOM 6999  C CB    . THR D 4 240 ? -18.695 132.335 22.388  1.00 62.88  ? 240 THR B CB    1 
ATOM 7000  N N     . VAL D 4 241 ? -19.059 133.122 19.399  1.00 65.70  ? 241 VAL B N     1 
ATOM 7001  C CA    . VAL D 4 241 ? -19.049 134.140 18.357  1.00 66.86  ? 241 VAL B CA    1 
ATOM 7002  C C     . VAL D 4 241 ? -18.984 135.528 18.998  1.00 67.73  ? 241 VAL B C     1 
ATOM 7003  O O     . VAL D 4 241 ? -19.553 135.743 20.077  1.00 67.92  ? 241 VAL B O     1 
ATOM 7004  C CB    . VAL D 4 241 ? -20.273 134.010 17.473  1.00 66.79  ? 241 VAL B CB    1 
ATOM 7005  N N     . GLN D 4 242 ? -18.286 136.446 18.320  1.00 68.95  ? 242 GLN B N     1 
ATOM 7006  C CA    . GLN D 4 242 ? -18.065 137.838 18.752  1.00 69.63  ? 242 GLN B CA    1 
ATOM 7007  C C     . GLN D 4 242 ? -19.286 138.636 19.181  1.00 70.56  ? 242 GLN B C     1 
ATOM 7008  O O     . GLN D 4 242 ? -19.758 139.519 18.451  1.00 69.15  ? 242 GLN B O     1 
ATOM 7009  C CB    . GLN D 4 242 ? -17.321 138.608 17.677  1.00 69.86  ? 242 GLN B CB    1 
ATOM 7010  N N     . PRO D 4 243 ? -19.759 138.347 20.389  1.00 72.62  ? 243 PRO B N     1 
ATOM 7011  C CA    . PRO D 4 243 ? -20.910 139.032 20.958  1.00 73.56  ? 243 PRO B CA    1 
ATOM 7012  C C     . PRO D 4 243 ? -20.434 140.375 21.504  1.00 74.07  ? 243 PRO B C     1 
ATOM 7013  O O     . PRO D 4 243 ? -20.266 140.572 22.712  1.00 73.48  ? 243 PRO B O     1 
ATOM 7014  C CB    . PRO D 4 243 ? -21.563 138.184 22.054  1.00 73.71  ? 243 PRO B CB    1 
ATOM 7015  N N     . ILE D 4 244 ? -20.101 141.249 20.566  1.00 75.06  ? 244 ILE B N     1 
ATOM 7016  C CA    . ILE D 4 244 ? -19.659 142.593 20.868  1.00 76.13  ? 244 ILE B CA    1 
ATOM 7017  C C     . ILE D 4 244 ? -20.621 143.469 20.048  1.00 76.94  ? 244 ILE B C     1 
ATOM 7018  O O     . ILE D 4 244 ? -20.511 143.576 18.816  1.00 76.86  ? 244 ILE B O     1 
ATOM 7019  C CB    . ILE D 4 244 ? -18.210 142.780 20.441  1.00 75.97  ? 244 ILE B CB    1 
ATOM 7020  N N     . VAL D 4 245 ? -21.632 143.987 20.748  1.00 77.07  ? 245 VAL B N     1 
ATOM 7021  C CA    . VAL D 4 245 ? -22.679 144.824 20.169  1.00 76.49  ? 245 VAL B CA    1 
ATOM 7022  C C     . VAL D 4 245 ? -23.481 145.435 21.313  1.00 76.22  ? 245 VAL B C     1 
ATOM 7023  O O     . VAL D 4 245 ? -24.279 144.741 21.944  1.00 75.88  ? 245 VAL B O     1 
ATOM 7024  C CB    . VAL D 4 245 ? -23.597 143.971 19.312  1.00 74.43  ? 245 VAL B CB    1 
ATOM 7025  N N     . LEU D 4 246 ? -23.299 146.729 21.569  1.00 77.14  ? 246 LEU B N     1 
ATOM 7026  C CA    . LEU D 4 246 ? -24.034 147.371 22.660  1.00 78.13  ? 246 LEU B CA    1 
ATOM 7027  C C     . LEU D 4 246 ? -24.287 148.885 22.549  1.00 78.53  ? 246 LEU B C     1 
ATOM 7028  O O     . LEU D 4 246 ? -24.136 149.492 21.480  1.00 78.50  ? 246 LEU B O     1 
ATOM 7029  C CB    . LEU D 4 246 ? -23.355 147.046 23.997  1.00 77.97  ? 246 LEU B CB    1 
ATOM 7030  N N     . PRO D 4 247 ? -24.735 149.446 23.676  1.00 78.79  ? 247 PRO B N     1 
ATOM 7031  C CA    . PRO D 4 247 ? -25.047 150.863 23.877  1.00 77.82  ? 247 PRO B CA    1 
ATOM 7032  C C     . PRO D 4 247 ? -25.978 150.970 25.097  1.00 77.70  ? 247 PRO B C     1 
ATOM 7033  O O     . PRO D 4 247 ? -26.698 150.020 25.435  1.00 75.70  ? 247 PRO B O     1 
ATOM 7034  C CB    . PRO D 4 247 ? -25.711 151.472 22.634  1.00 77.20  ? 247 PRO B CB    1 
ATOM 7035  N N     . GLU D 4 248 ? -25.916 152.105 25.785  1.00 77.89  ? 248 GLU B N     1 
ATOM 7036  C CA    . GLU D 4 248 ? -26.748 152.371 26.960  1.00 77.75  ? 248 GLU B CA    1 
ATOM 7037  C C     . GLU D 4 248 ? -26.662 153.872 27.250  1.00 78.79  ? 248 GLU B C     1 
ATOM 7038  O O     . GLU D 4 248 ? -26.074 154.307 28.251  1.00 79.30  ? 248 GLU B O     1 
ATOM 7039  C CB    . GLU D 4 248 ? -26.270 151.555 28.160  1.00 76.11  ? 248 GLU B CB    1 
ATOM 7040  N N     . LYS D 4 249 ? -27.222 154.653 26.323  1.00 79.97  ? 249 LYS B N     1 
ATOM 7041  C CA    . LYS D 4 249 ? -27.237 156.116 26.403  1.00 80.73  ? 249 LYS B CA    1 
ATOM 7042  C C     . LYS D 4 249 ? -28.319 156.661 27.347  1.00 81.73  ? 249 LYS B C     1 
ATOM 7043  O O     . LYS D 4 249 ? -29.485 156.833 26.950  1.00 81.27  ? 249 LYS B O     1 
ATOM 7044  C CB    . LYS D 4 249 ? -27.395 156.719 25.000  1.00 80.49  ? 249 LYS B CB    1 
ATOM 7045  N N     . ASP D 4 250 ? -27.904 156.955 28.584  1.00 81.88  ? 250 ASP B N     1 
ATOM 7046  C CA    . ASP D 4 250 ? -28.785 157.489 29.634  1.00 81.23  ? 250 ASP B CA    1 
ATOM 7047  C C     . ASP D 4 250 ? -29.197 158.946 29.382  1.00 80.49  ? 250 ASP B C     1 
ATOM 7048  O O     . ASP D 4 250 ? -29.833 159.581 30.230  1.00 80.28  ? 250 ASP B O     1 
ATOM 7049  C CB    . ASP D 4 250 ? -28.108 157.363 31.002  1.00 80.53  ? 250 ASP B CB    1 
ATOM 7050  N N     . SER D 4 251 ? -28.808 159.456 28.213  1.00 79.43  ? 251 SER B N     1 
ATOM 7051  C CA    . SER D 4 251 ? -29.087 160.816 27.747  1.00 76.91  ? 251 SER B CA    1 
ATOM 7052  C C     . SER D 4 251 ? -28.434 160.889 26.367  1.00 74.60  ? 251 SER B C     1 
ATOM 7053  O O     . SER D 4 251 ? -27.388 161.516 26.183  1.00 75.10  ? 251 SER B O     1 
ATOM 7054  C CB    . SER D 4 251 ? -28.472 161.864 28.697  1.00 76.44  ? 251 SER B CB    1 
ATOM 7055  N N     . TRP D 4 252 ? -29.021 160.173 25.418  1.00 71.20  ? 252 TRP B N     1 
ATOM 7056  C CA    . TRP D 4 252 ? -28.496 160.132 24.066  1.00 68.83  ? 252 TRP B CA    1 
ATOM 7057  C C     . TRP D 4 252 ? -28.557 161.500 23.378  1.00 67.52  ? 252 TRP B C     1 
ATOM 7058  O O     . TRP D 4 252 ? -29.592 162.165 23.416  1.00 67.64  ? 252 TRP B O     1 
ATOM 7059  C CB    . TRP D 4 252 ? -29.264 159.109 23.276  1.00 69.24  ? 252 TRP B CB    1 
ATOM 7060  N N     . THR D 4 253 ? -27.443 161.928 22.779  1.00 65.27  ? 253 THR B N     1 
ATOM 7061  C CA    . THR D 4 253 ? -27.384 163.216 22.073  1.00 62.62  ? 253 THR B CA    1 
ATOM 7062  C C     . THR D 4 253 ? -27.614 163.026 20.580  1.00 62.19  ? 253 THR B C     1 
ATOM 7063  O O     . THR D 4 253 ? -27.647 161.896 20.093  1.00 62.57  ? 253 THR B O     1 
ATOM 7064  C CB    . THR D 4 253 ? -26.024 163.930 22.251  1.00 61.56  ? 253 THR B CB    1 
ATOM 7065  O OG1   . THR D 4 253 ? -25.114 163.528 21.216  1.00 61.31  ? 253 THR B OG1   1 
ATOM 7066  C CG2   . THR D 4 253 ? -25.433 163.609 23.603  1.00 60.88  ? 253 THR B CG2   1 
ATOM 7067  N N     . VAL D 4 254 ? -27.691 164.138 19.851  1.00 62.14  ? 254 VAL B N     1 
ATOM 7068  C CA    . VAL D 4 254 ? -27.919 164.118 18.400  1.00 62.54  ? 254 VAL B CA    1 
ATOM 7069  C C     . VAL D 4 254 ? -26.940 163.209 17.687  1.00 63.33  ? 254 VAL B C     1 
ATOM 7070  O O     . VAL D 4 254 ? -27.307 162.412 16.825  1.00 63.26  ? 254 VAL B O     1 
ATOM 7071  C CB    . VAL D 4 254 ? -27.745 165.505 17.768  1.00 61.72  ? 254 VAL B CB    1 
ATOM 7072  C CG1   . VAL D 4 254 ? -28.185 165.478 16.296  1.00 60.85  ? 254 VAL B CG1   1 
ATOM 7073  C CG2   . VAL D 4 254 ? -28.495 166.550 18.557  1.00 60.03  ? 254 VAL B CG2   1 
ATOM 7074  N N     . ASN D 4 255 ? -25.677 163.377 18.035  1.00 64.12  ? 255 ASN B N     1 
ATOM 7075  C CA    . ASN D 4 255 ? -24.627 162.591 17.445  1.00 63.50  ? 255 ASN B CA    1 
ATOM 7076  C C     . ASN D 4 255 ? -24.866 161.150 17.815  1.00 62.33  ? 255 ASN B C     1 
ATOM 7077  O O     . ASN D 4 255 ? -25.185 160.326 16.965  1.00 60.96  ? 255 ASN B O     1 
ATOM 7078  C CB    . ASN D 4 255 ? -23.294 163.040 18.008  1.00 64.56  ? 255 ASN B CB    1 
ATOM 7079  C CG    . ASN D 4 255 ? -22.143 162.539 17.201  1.00 66.47  ? 255 ASN B CG    1 
ATOM 7080  O OD1   . ASN D 4 255 ? -20.990 162.799 17.538  1.00 69.14  ? 255 ASN B OD1   1 
ATOM 7081  N ND2   . ASN D 4 255 ? -22.439 161.816 16.112  1.00 66.56  ? 255 ASN B ND2   1 
ATOM 7082  N N     . ASP D 4 256 ? -24.770 160.893 19.113  1.00 62.08  ? 256 ASP B N     1 
ATOM 7083  C CA    . ASP D 4 256 ? -24.955 159.573 19.681  1.00 63.11  ? 256 ASP B CA    1 
ATOM 7084  C C     . ASP D 4 256 ? -26.055 158.832 18.971  1.00 62.64  ? 256 ASP B C     1 
ATOM 7085  O O     . ASP D 4 256 ? -25.838 157.759 18.403  1.00 64.27  ? 256 ASP B O     1 
ATOM 7086  C CB    . ASP D 4 256 ? -25.286 159.685 21.168  1.00 64.69  ? 256 ASP B CB    1 
ATOM 7087  C CG    . ASP D 4 256 ? -24.114 160.193 21.990  1.00 67.48  ? 256 ASP B CG    1 
ATOM 7088  O OD1   . ASP D 4 256 ? -23.849 159.596 23.057  1.00 67.47  ? 256 ASP B OD1   1 
ATOM 7089  O OD2   . ASP D 4 256 ? -23.453 161.177 21.569  1.00 69.19  ? 256 ASP B OD2   1 
ATOM 7090  N N     . ILE D 4 257 ? -27.225 159.442 18.933  1.00 61.37  ? 257 ILE B N     1 
ATOM 7091  C CA    . ILE D 4 257 ? -28.334 158.794 18.281  1.00 62.02  ? 257 ILE B CA    1 
ATOM 7092  C C     . ILE D 4 257 ? -28.087 158.698 16.785  1.00 60.28  ? 257 ILE B C     1 
ATOM 7093  O O     . ILE D 4 257 ? -28.147 157.610 16.216  1.00 58.75  ? 257 ILE B O     1 
ATOM 7094  C CB    . ILE D 4 257 ? -29.669 159.515 18.572  1.00 64.96  ? 257 ILE B CB    1 
ATOM 7095  C CG1   . ILE D 4 257 ? -29.688 160.906 17.939  1.00 67.33  ? 257 ILE B CG1   1 
ATOM 7096  C CG2   . ILE D 4 257 ? -29.874 159.654 20.076  1.00 65.26  ? 257 ILE B CG2   1 
ATOM 7097  C CD1   . ILE D 4 257 ? -31.063 161.550 17.914  1.00 68.23  ? 257 ILE B CD1   1 
ATOM 7098  N N     . GLN D 4 258 ? -27.738 159.827 16.176  1.00 59.41  ? 258 GLN B N     1 
ATOM 7099  C CA    . GLN D 4 258 ? -27.493 159.886 14.748  1.00 60.07  ? 258 GLN B CA    1 
ATOM 7100  C C     . GLN D 4 258 ? -26.540 158.769 14.395  1.00 58.99  ? 258 GLN B C     1 
ATOM 7101  O O     . GLN D 4 258 ? -26.910 157.804 13.731  1.00 58.58  ? 258 GLN B O     1 
ATOM 7102  C CB    . GLN D 4 258 ? -26.892 161.236 14.369  1.00 62.39  ? 258 GLN B CB    1 
ATOM 7103  C CG    . GLN D 4 258 ? -26.858 161.491 12.881  1.00 66.79  ? 258 GLN B CG    1 
ATOM 7104  C CD    . GLN D 4 258 ? -27.150 162.937 12.535  1.00 69.49  ? 258 GLN B CD    1 
ATOM 7105  O OE1   . GLN D 4 258 ? -26.596 163.856 13.149  1.00 70.77  ? 258 GLN B OE1   1 
ATOM 7106  N NE2   . GLN D 4 258 ? -28.039 163.151 11.558  1.00 68.91  ? 258 GLN B NE2   1 
ATOM 7107  N N     . LYS D 4 259 ? -25.327 158.878 14.911  1.00 57.74  ? 259 LYS B N     1 
ATOM 7108  C CA    . LYS D 4 259 ? -24.303 157.881 14.691  1.00 55.93  ? 259 LYS B CA    1 
ATOM 7109  C C     . LYS D 4 259 ? -24.941 156.489 14.765  1.00 53.33  ? 259 LYS B C     1 
ATOM 7110  O O     . LYS D 4 259 ? -25.103 155.815 13.747  1.00 50.73  ? 259 LYS B O     1 
ATOM 7111  C CB    . LYS D 4 259 ? -23.247 158.040 15.777  1.00 58.06  ? 259 LYS B CB    1 
ATOM 7112  C CG    . LYS D 4 259 ? -22.048 157.178 15.599  1.00 62.41  ? 259 LYS B CG    1 
ATOM 7113  C CD    . LYS D 4 259 ? -21.223 157.155 16.868  1.00 67.21  ? 259 LYS B CD    1 
ATOM 7114  C CE    . LYS D 4 259 ? -19.986 156.276 16.682  1.00 72.35  ? 259 LYS B CE    1 
ATOM 7115  N NZ    . LYS D 4 259 ? -20.311 154.887 16.177  1.00 75.05  ? 259 LYS B NZ    1 
ATOM 7116  N N     . LEU D 4 260 ? -25.444 156.147 15.946  1.00 51.01  ? 260 LEU B N     1 
ATOM 7117  C CA    . LEU D 4 260 ? -26.061 154.856 16.170  1.00 49.57  ? 260 LEU B CA    1 
ATOM 7118  C C     . LEU D 4 260 ? -27.050 154.425 15.112  1.00 49.12  ? 260 LEU B C     1 
ATOM 7119  O O     . LEU D 4 260 ? -27.053 153.275 14.699  1.00 47.78  ? 260 LEU B O     1 
ATOM 7120  C CB    . LEU D 4 260 ? -26.743 154.821 17.530  1.00 49.12  ? 260 LEU B CB    1 
ATOM 7121  C CG    . LEU D 4 260 ? -27.511 153.525 17.806  1.00 50.20  ? 260 LEU B CG    1 
ATOM 7122  C CD1   . LEU D 4 260 ? -27.420 153.176 19.274  1.00 51.56  ? 260 LEU B CD1   1 
ATOM 7123  C CD2   . LEU D 4 260 ? -28.963 153.634 17.360  1.00 49.28  ? 260 LEU B CD2   1 
ATOM 7124  N N     . VAL D 4 261 ? -27.924 155.327 14.698  1.00 50.40  ? 261 VAL B N     1 
ATOM 7125  C CA    . VAL D 4 261 ? -28.920 154.949 13.705  1.00 52.70  ? 261 VAL B CA    1 
ATOM 7126  C C     . VAL D 4 261 ? -28.305 154.670 12.347  1.00 52.46  ? 261 VAL B C     1 
ATOM 7127  O O     . VAL D 4 261 ? -28.900 153.970 11.525  1.00 52.69  ? 261 VAL B O     1 
ATOM 7128  C CB    . VAL D 4 261 ? -30.067 155.983 13.580  1.00 54.90  ? 261 VAL B CB    1 
ATOM 7129  C CG1   . VAL D 4 261 ? -29.572 157.277 12.967  1.00 55.02  ? 261 VAL B CG1   1 
ATOM 7130  C CG2   . VAL D 4 261 ? -31.204 155.401 12.750  1.00 55.58  ? 261 VAL B CG2   1 
ATOM 7131  N N     . GLY D 4 262 ? -27.125 155.233 12.107  1.00 51.97  ? 262 GLY B N     1 
ATOM 7132  C CA    . GLY D 4 262 ? -26.451 154.984 10.849  1.00 52.39  ? 262 GLY B CA    1 
ATOM 7133  C C     . GLY D 4 262 ? -25.994 153.545 10.935  1.00 52.61  ? 262 GLY B C     1 
ATOM 7134  O O     . GLY D 4 262 ? -25.991 152.804 9.949   1.00 52.73  ? 262 GLY B O     1 
ATOM 7135  N N     . LYS D 4 263 ? -25.685 153.152 12.167  1.00 52.35  ? 263 LYS B N     1 
ATOM 7136  C CA    . LYS D 4 263 ? -25.221 151.819 12.517  1.00 51.77  ? 263 LYS B CA    1 
ATOM 7137  C C     . LYS D 4 263 ? -26.364 150.827 12.417  1.00 49.70  ? 263 LYS B C     1 
ATOM 7138  O O     . LYS D 4 263 ? -26.323 149.911 11.608  1.00 48.91  ? 263 LYS B O     1 
ATOM 7139  C CB    . LYS D 4 263 ? -24.653 151.865 13.940  1.00 54.56  ? 263 LYS B CB    1 
ATOM 7140  C CG    . LYS D 4 263 ? -24.144 150.562 14.526  1.00 58.06  ? 263 LYS B CG    1 
ATOM 7141  C CD    . LYS D 4 263 ? -23.256 150.852 15.756  1.00 61.72  ? 263 LYS B CD    1 
ATOM 7142  C CE    . LYS D 4 263 ? -22.709 149.566 16.409  1.00 64.68  ? 263 LYS B CE    1 
ATOM 7143  N NZ    . LYS D 4 263 ? -21.611 149.802 17.416  1.00 64.76  ? 263 LYS B NZ    1 
ATOM 7144  N N     . LEU D 4 264 ? -27.406 151.058 13.207  1.00 48.74  ? 264 LEU B N     1 
ATOM 7145  C CA    . LEU D 4 264 ? -28.585 150.203 13.234  1.00 49.51  ? 264 LEU B CA    1 
ATOM 7146  C C     . LEU D 4 264 ? -29.074 149.864 11.833  1.00 50.25  ? 264 LEU B C     1 
ATOM 7147  O O     . LEU D 4 264 ? -29.607 148.780 11.591  1.00 49.78  ? 264 LEU B O     1 
ATOM 7148  C CB    . LEU D 4 264 ? -29.712 150.910 13.987  1.00 51.32  ? 264 LEU B CB    1 
ATOM 7149  C CG    . LEU D 4 264 ? -30.276 150.250 15.246  1.00 51.64  ? 264 LEU B CG    1 
ATOM 7150  C CD1   . LEU D 4 264 ? -30.763 148.839 14.924  1.00 51.76  ? 264 LEU B CD1   1 
ATOM 7151  C CD2   . LEU D 4 264 ? -29.210 150.225 16.338  1.00 51.06  ? 264 LEU B CD2   1 
ATOM 7152  N N     . ASN D 4 265 ? -28.888 150.813 10.921  1.00 51.42  ? 265 ASN B N     1 
ATOM 7153  C CA    . ASN D 4 265 ? -29.303 150.677 9.529   1.00 54.10  ? 265 ASN B CA    1 
ATOM 7154  C C     . ASN D 4 265 ? -28.649 149.471 8.863   1.00 55.20  ? 265 ASN B C     1 
ATOM 7155  O O     . ASN D 4 265 ? -29.315 148.600 8.288   1.00 55.60  ? 265 ASN B O     1 
ATOM 7156  C CB    . ASN D 4 265 ? -28.924 151.957 8.770   1.00 55.29  ? 265 ASN B CB    1 
ATOM 7157  C CG    . ASN D 4 265 ? -29.221 151.875 7.278   1.00 57.34  ? 265 ASN B CG    1 
ATOM 7158  O OD1   . ASN D 4 265 ? -30.384 151.857 6.860   1.00 57.90  ? 265 ASN B OD1   1 
ATOM 7159  N ND2   . ASN D 4 265 ? -28.163 151.846 6.465   1.00 58.63  ? 265 ASN B ND2   1 
ATOM 7160  N N     . TRP D 4 266 ? -27.328 149.444 8.962   1.00 55.45  ? 266 TRP B N     1 
ATOM 7161  C CA    . TRP D 4 266 ? -26.498 148.402 8.389   1.00 54.97  ? 266 TRP B CA    1 
ATOM 7162  C C     . TRP D 4 266 ? -26.869 147.019 8.943   1.00 54.50  ? 266 TRP B C     1 
ATOM 7163  O O     . TRP D 4 266 ? -26.886 146.024 8.209   1.00 53.52  ? 266 TRP B O     1 
ATOM 7164  C CB    . TRP D 4 266 ? -25.045 148.752 8.701   1.00 54.77  ? 266 TRP B CB    1 
ATOM 7165  C CG    . TRP D 4 266 ? -24.056 148.114 7.828   1.00 56.35  ? 266 TRP B CG    1 
ATOM 7166  C CD1   . TRP D 4 266 ? -23.912 148.285 6.488   1.00 55.78  ? 266 TRP B CD1   1 
ATOM 7167  C CD2   . TRP D 4 266 ? -23.052 147.194 8.231   1.00 55.80  ? 266 TRP B CD2   1 
ATOM 7168  N NE1   . TRP D 4 266 ? -22.875 147.520 6.022   1.00 56.22  ? 266 TRP B NE1   1 
ATOM 7169  C CE2   . TRP D 4 266 ? -22.327 146.838 7.074   1.00 55.99  ? 266 TRP B CE2   1 
ATOM 7170  C CE3   . TRP D 4 266 ? -22.690 146.634 9.459   1.00 56.14  ? 266 TRP B CE3   1 
ATOM 7171  C CZ2   . TRP D 4 266 ? -21.264 145.942 7.108   1.00 57.88  ? 266 TRP B CZ2   1 
ATOM 7172  C CZ3   . TRP D 4 266 ? -21.641 145.749 9.496   1.00 57.70  ? 266 TRP B CZ3   1 
ATOM 7173  C CH2   . TRP D 4 266 ? -20.934 145.408 8.324   1.00 58.55  ? 266 TRP B CH2   1 
ATOM 7174  N N     . ALA D 4 267 ? -27.226 146.992 10.227  1.00 54.48  ? 267 ALA B N     1 
ATOM 7175  C CA    . ALA D 4 267 ? -27.607 145.767 10.926  1.00 55.07  ? 267 ALA B CA    1 
ATOM 7176  C C     . ALA D 4 267 ? -28.831 145.115 10.305  1.00 55.79  ? 267 ALA B C     1 
ATOM 7177  O O     . ALA D 4 267 ? -28.955 143.891 10.297  1.00 55.07  ? 267 ALA B O     1 
ATOM 7178  C CB    . ALA D 4 267 ? -27.857 146.061 12.389  1.00 53.69  ? 267 ALA B CB    1 
ATOM 7179  N N     . SER D 4 268 ? -29.720 145.948 9.771   1.00 57.59  ? 268 SER B N     1 
ATOM 7180  C CA    . SER D 4 268 ? -30.939 145.486 9.118   1.00 59.53  ? 268 SER B CA    1 
ATOM 7181  C C     . SER D 4 268 ? -30.605 144.511 8.004   1.00 60.47  ? 268 SER B C     1 
ATOM 7182  O O     . SER D 4 268 ? -31.449 143.717 7.577   1.00 60.26  ? 268 SER B O     1 
ATOM 7183  C CB    . SER D 4 268 ? -31.699 146.664 8.550   1.00 60.08  ? 268 SER B CB    1 
ATOM 7184  N N     . GLN D 4 269 ? -29.367 144.589 7.532   1.00 61.35  ? 269 GLN B N     1 
ATOM 7185  C CA    . GLN D 4 269 ? -28.900 143.722 6.472   1.00 63.35  ? 269 GLN B CA    1 
ATOM 7186  C C     . GLN D 4 269 ? -28.642 142.308 6.958   1.00 63.68  ? 269 GLN B C     1 
ATOM 7187  O O     . GLN D 4 269 ? -28.765 141.349 6.195   1.00 64.18  ? 269 GLN B O     1 
ATOM 7188  C CB    . GLN D 4 269 ? -27.662 144.315 5.835   1.00 64.59  ? 269 GLN B CB    1 
ATOM 7189  C CG    . GLN D 4 269 ? -27.984 145.580 5.091   1.00 67.54  ? 269 GLN B CG    1 
ATOM 7190  C CD    . GLN D 4 269 ? -26.756 146.390 4.783   1.00 69.55  ? 269 GLN B CD    1 
ATOM 7191  O OE1   . GLN D 4 269 ? -26.331 146.492 3.628   1.00 70.06  ? 269 GLN B OE1   1 
ATOM 7192  N NE2   . GLN D 4 269 ? -26.174 146.978 5.815   1.00 69.62  ? 269 GLN B NE2   1 
ATOM 7193  N N     . ILE D 4 270 ? -28.266 142.169 8.219   1.00 63.34  ? 270 ILE B N     1 
ATOM 7194  C CA    . ILE D 4 270 ? -28.050 140.838 8.745   1.00 64.98  ? 270 ILE B CA    1 
ATOM 7195  C C     . ILE D 4 270 ? -29.373 140.433 9.375   1.00 66.20  ? 270 ILE B C     1 
ATOM 7196  O O     . ILE D 4 270 ? -30.095 139.581 8.857   1.00 66.08  ? 270 ILE B O     1 
ATOM 7197  C CB    . ILE D 4 270 ? -26.975 140.821 9.834   1.00 64.46  ? 270 ILE B CB    1 
ATOM 7198  C CG1   . ILE D 4 270 ? -25.752 141.614 9.381   1.00 64.94  ? 270 ILE B CG1   1 
ATOM 7199  C CG2   . ILE D 4 270 ? -26.612 139.372 10.190  1.00 64.79  ? 270 ILE B CG2   1 
ATOM 7200  C CD1   . ILE D 4 270 ? -24.837 141.992 10.514  1.00 62.72  ? 270 ILE B CD1   1 
ATOM 7201  N N     . TYR D 4 271 ? -29.721 141.164 10.430  1.00 68.13  ? 271 TYR B N     1 
ATOM 7202  C CA    . TYR D 4 271 ? -30.921 140.952 11.235  1.00 69.84  ? 271 TYR B CA    1 
ATOM 7203  C C     . TYR D 4 271 ? -32.225 141.534 10.641  1.00 71.60  ? 271 TYR B C     1 
ATOM 7204  O O     . TYR D 4 271 ? -32.202 142.553 9.947   1.00 71.00  ? 271 TYR B O     1 
ATOM 7205  C CB    . TYR D 4 271 ? -30.660 141.515 12.643  1.00 70.04  ? 271 TYR B CB    1 
ATOM 7206  C CG    . TYR D 4 271 ? -29.364 141.025 13.303  1.00 69.33  ? 271 TYR B CG    1 
ATOM 7207  C CD1   . TYR D 4 271 ? -28.118 141.188 12.682  1.00 69.26  ? 271 TYR B CD1   1 
ATOM 7208  C CD2   . TYR D 4 271 ? -29.389 140.397 14.551  1.00 70.16  ? 271 TYR B CD2   1 
ATOM 7209  C CE1   . TYR D 4 271 ? -26.933 140.732 13.279  1.00 68.30  ? 271 TYR B CE1   1 
ATOM 7210  C CE2   . TYR D 4 271 ? -28.207 139.941 15.160  1.00 69.52  ? 271 TYR B CE2   1 
ATOM 7211  C CZ    . TYR D 4 271 ? -26.990 140.111 14.518  1.00 68.43  ? 271 TYR B CZ    1 
ATOM 7212  O OH    . TYR D 4 271 ? -25.844 139.646 15.124  1.00 67.55  ? 271 TYR B OH    1 
ATOM 7213  N N     . PRO D 4 272 ? -33.378 140.870 10.895  1.00 73.45  ? 272 PRO B N     1 
ATOM 7214  C CA    . PRO D 4 272 ? -34.720 141.260 10.418  1.00 74.85  ? 272 PRO B CA    1 
ATOM 7215  C C     . PRO D 4 272 ? -35.495 142.233 11.322  1.00 74.55  ? 272 PRO B C     1 
ATOM 7216  O O     . PRO D 4 272 ? -36.062 143.222 10.838  1.00 74.40  ? 272 PRO B O     1 
ATOM 7217  C CB    . PRO D 4 272 ? -35.442 139.915 10.324  1.00 75.79  ? 272 PRO B CB    1 
ATOM 7218  C CG    . PRO D 4 272 ? -34.917 139.191 11.541  1.00 75.82  ? 272 PRO B CG    1 
ATOM 7219  C CD    . PRO D 4 272 ? -33.420 139.533 11.526  1.00 74.78  ? 272 PRO B CD    1 
ATOM 7220  N N     . GLY D 4 273 ? -35.567 141.905 12.614  1.00 74.32  ? 273 GLY B N     1 
ATOM 7221  C CA    . GLY D 4 273 ? -36.261 142.739 13.582  1.00 74.45  ? 273 GLY B CA    1 
ATOM 7222  C C     . GLY D 4 273 ? -35.468 143.999 13.866  1.00 74.45  ? 273 GLY B C     1 
ATOM 7223  O O     . GLY D 4 273 ? -35.001 144.223 14.991  1.00 73.75  ? 273 GLY B O     1 
ATOM 7224  N N     . ILE D 4 274 ? -35.311 144.811 12.822  1.00 74.48  ? 274 ILE B N     1 
ATOM 7225  C CA    . ILE D 4 274 ? -34.570 146.064 12.882  1.00 73.95  ? 274 ILE B CA    1 
ATOM 7226  C C     . ILE D 4 274 ? -35.506 147.244 12.612  1.00 74.46  ? 274 ILE B C     1 
ATOM 7227  O O     . ILE D 4 274 ? -36.340 147.186 11.703  1.00 74.68  ? 274 ILE B O     1 
ATOM 7228  C CB    . ILE D 4 274 ? -33.435 146.084 11.835  1.00 73.49  ? 274 ILE B CB    1 
ATOM 7229  C CG1   . ILE D 4 274 ? -32.587 144.814 11.945  1.00 72.46  ? 274 ILE B CG1   1 
ATOM 7230  C CG2   . ILE D 4 274 ? -32.550 147.303 12.050  1.00 73.24  ? 274 ILE B CG2   1 
ATOM 7231  C CD1   . ILE D 4 274 ? -31.844 144.682 13.254  1.00 72.45  ? 274 ILE B CD1   1 
ATOM 7232  N N     . LYS D 4 275 ? -35.349 148.316 13.391  1.00 74.67  ? 275 LYS B N     1 
ATOM 7233  C CA    . LYS D 4 275 ? -36.183 149.510 13.238  1.00 74.40  ? 275 LYS B CA    1 
ATOM 7234  C C     . LYS D 4 275 ? -35.427 150.802 13.553  1.00 73.53  ? 275 LYS B C     1 
ATOM 7235  O O     . LYS D 4 275 ? -35.405 151.270 14.696  1.00 73.56  ? 275 LYS B O     1 
ATOM 7236  C CB    . LYS D 4 275 ? -37.429 149.395 14.115  1.00 74.42  ? 275 LYS B CB    1 
ATOM 7237  N N     . VAL D 4 276 ? -34.827 151.383 12.522  1.00 72.29  ? 276 VAL B N     1 
ATOM 7238  C CA    . VAL D 4 276 ? -34.067 152.616 12.669  1.00 71.77  ? 276 VAL B CA    1 
ATOM 7239  C C     . VAL D 4 276 ? -34.984 153.827 12.630  1.00 71.63  ? 276 VAL B C     1 
ATOM 7240  O O     . VAL D 4 276 ? -34.700 154.857 13.249  1.00 71.69  ? 276 VAL B O     1 
ATOM 7241  C CB    . VAL D 4 276 ? -33.033 152.720 11.564  1.00 72.25  ? 276 VAL B CB    1 
ATOM 7242  N N     . ARG D 4 277 ? -36.098 153.675 11.921  1.00 71.47  ? 277 ARG B N     1 
ATOM 7243  C CA    . ARG D 4 277 ? -37.088 154.737 11.737  1.00 71.55  ? 277 ARG B CA    1 
ATOM 7244  C C     . ARG D 4 277 ? -37.598 155.487 12.983  1.00 70.78  ? 277 ARG B C     1 
ATOM 7245  O O     . ARG D 4 277 ? -37.684 156.723 12.975  1.00 70.30  ? 277 ARG B O     1 
ATOM 7246  C CB    . ARG D 4 277 ? -38.263 154.203 10.912  1.00 70.92  ? 277 ARG B CB    1 
ATOM 7247  N N     . GLN D 4 278 ? -37.922 154.751 14.044  1.00 70.04  ? 278 GLN B N     1 
ATOM 7248  C CA    . GLN D 4 278 ? -38.434 155.345 15.284  1.00 69.20  ? 278 GLN B CA    1 
ATOM 7249  C C     . GLN D 4 278 ? -37.522 156.441 15.839  1.00 67.98  ? 278 GLN B C     1 
ATOM 7250  O O     . GLN D 4 278 ? -37.969 157.508 16.272  1.00 66.57  ? 278 GLN B O     1 
ATOM 7251  C CB    . GLN D 4 278 ? -38.622 154.253 16.333  1.00 70.09  ? 278 GLN B CB    1 
ATOM 7252  N N     . LEU D 4 279 ? -36.231 156.156 15.796  1.00 67.11  ? 279 LEU B N     1 
ATOM 7253  C CA    . LEU D 4 279 ? -35.205 157.046 16.301  1.00 66.16  ? 279 LEU B CA    1 
ATOM 7254  C C     . LEU D 4 279 ? -34.902 158.130 15.282  1.00 64.89  ? 279 LEU B C     1 
ATOM 7255  O O     . LEU D 4 279 ? -34.621 159.273 15.650  1.00 63.35  ? 279 LEU B O     1 
ATOM 7256  C CB    . LEU D 4 279 ? -33.958 156.219 16.609  1.00 67.13  ? 279 LEU B CB    1 
ATOM 7257  C CG    . LEU D 4 279 ? -34.256 154.730 16.884  1.00 69.51  ? 279 LEU B CG    1 
ATOM 7258  C CD1   . LEU D 4 279 ? -32.951 153.981 17.070  1.00 71.59  ? 279 LEU B CD1   1 
ATOM 7259  C CD2   . LEU D 4 279 ? -35.188 154.519 18.093  1.00 67.91  ? 279 LEU B CD2   1 
ATOM 7260  N N     . SER D 4 280 ? -34.979 157.757 14.003  1.00 64.54  ? 280 SER B N     1 
ATOM 7261  C CA    . SER D 4 280 ? -34.739 158.673 12.888  1.00 64.20  ? 280 SER B CA    1 
ATOM 7262  C C     . SER D 4 280 ? -35.622 159.896 13.080  1.00 64.56  ? 280 SER B C     1 
ATOM 7263  O O     . SER D 4 280 ? -35.273 161.007 12.657  1.00 64.02  ? 280 SER B O     1 
ATOM 7264  C CB    . SER D 4 280 ? -35.102 158.009 11.556  1.00 63.16  ? 280 SER B CB    1 
ATOM 7265  O OG    . SER D 4 280 ? -34.328 156.847 11.321  1.00 62.73  ? 280 SER B OG    1 
ATOM 7266  N N     . LYS D 4 281 ? -36.768 159.658 13.719  1.00 64.35  ? 281 LYS B N     1 
ATOM 7267  C CA    . LYS D 4 281 ? -37.756 160.689 14.020  1.00 63.03  ? 281 LYS B CA    1 
ATOM 7268  C C     . LYS D 4 281 ? -37.224 161.593 15.125  1.00 61.73  ? 281 LYS B C     1 
ATOM 7269  O O     . LYS D 4 281 ? -37.186 162.816 14.973  1.00 59.63  ? 281 LYS B O     1 
ATOM 7270  C CB    . LYS D 4 281 ? -39.076 160.046 14.442  1.00 62.23  ? 281 LYS B CB    1 
ATOM 7271  N N     . LEU D 4 282 ? -36.774 160.985 16.219  1.00 61.37  ? 282 LEU B N     1 
ATOM 7272  C CA    . LEU D 4 282 ? -36.222 161.750 17.326  1.00 61.96  ? 282 LEU B CA    1 
ATOM 7273  C C     . LEU D 4 282 ? -35.127 162.672 16.767  1.00 62.48  ? 282 LEU B C     1 
ATOM 7274  O O     . LEU D 4 282 ? -34.847 163.736 17.319  1.00 62.57  ? 282 LEU B O     1 
ATOM 7275  C CB    . LEU D 4 282 ? -35.654 160.804 18.389  1.00 60.93  ? 282 LEU B CB    1 
ATOM 7276  N N     . LEU D 4 283 ? -34.585 162.288 15.612  1.00 63.11  ? 283 LEU B N     1 
ATOM 7277  C CA    . LEU D 4 283 ? -33.527 163.034 14.945  1.00 64.39  ? 283 LEU B CA    1 
ATOM 7278  C C     . LEU D 4 283 ? -33.997 163.984 13.848  1.00 64.96  ? 283 LEU B C     1 
ATOM 7279  O O     . LEU D 4 283 ? -33.249 164.873 13.451  1.00 66.54  ? 283 LEU B O     1 
ATOM 7280  C CB    . LEU D 4 283 ? -32.505 162.058 14.360  1.00 65.43  ? 283 LEU B CB    1 
ATOM 7281  C CG    . LEU D 4 283 ? -31.396 162.622 13.464  1.00 66.05  ? 283 LEU B CG    1 
ATOM 7282  C CD1   . LEU D 4 283 ? -30.555 163.660 14.211  1.00 65.40  ? 283 LEU B CD1   1 
ATOM 7283  C CD2   . LEU D 4 283 ? -30.520 161.494 12.952  1.00 65.49  ? 283 LEU B CD2   1 
ATOM 7284  N N     . ARG D 4 284 ? -35.224 163.803 13.363  1.00 65.65  ? 284 ARG B N     1 
ATOM 7285  C CA    . ARG D 4 284 ? -35.789 164.639 12.284  1.00 66.39  ? 284 ARG B CA    1 
ATOM 7286  C C     . ARG D 4 284 ? -35.729 166.174 12.466  1.00 65.98  ? 284 ARG B C     1 
ATOM 7287  O O     . ARG D 4 284 ? -36.262 166.715 13.441  1.00 67.10  ? 284 ARG B O     1 
ATOM 7288  C CB    . ARG D 4 284 ? -37.231 164.208 11.992  1.00 66.66  ? 284 ARG B CB    1 
ATOM 7289  N N     . GLY D 4 285 ? -35.118 166.867 11.499  1.00 64.44  ? 285 GLY B N     1 
ATOM 7290  C CA    . GLY D 4 285 ? -35.001 168.319 11.567  1.00 62.59  ? 285 GLY B CA    1 
ATOM 7291  C C     . GLY D 4 285 ? -33.614 168.829 11.926  1.00 61.64  ? 285 GLY B C     1 
ATOM 7292  O O     . GLY D 4 285 ? -33.128 168.578 13.029  1.00 60.82  ? 285 GLY B O     1 
ATOM 7293  N N     . THR D 4 286 ? -33.038 169.609 11.008  1.00 61.07  ? 286 THR B N     1 
ATOM 7294  C CA    . THR D 4 286 ? -31.693 170.211 11.083  1.00 62.37  ? 286 THR B CA    1 
ATOM 7295  C C     . THR D 4 286 ? -31.187 170.730 12.438  1.00 61.50  ? 286 THR B C     1 
ATOM 7296  O O     . THR D 4 286 ? -30.695 171.860 12.543  1.00 60.60  ? 286 THR B O     1 
ATOM 7297  C CB    . THR D 4 286 ? -31.579 171.358 10.042  1.00 63.57  ? 286 THR B CB    1 
ATOM 7298  O OG1   . THR D 4 286 ? -32.173 170.934 8.807   1.00 64.85  ? 286 THR B OG1   1 
ATOM 7299  C CG2   . THR D 4 286 ? -30.110 171.742 9.788   1.00 64.85  ? 286 THR B CG2   1 
ATOM 7300  N N     . LYS D 4 287 ? -31.212 169.864 13.443  1.00 61.78  ? 287 LYS B N     1 
ATOM 7301  C CA    . LYS D 4 287 ? -30.788 170.225 14.786  1.00 62.55  ? 287 LYS B CA    1 
ATOM 7302  C C     . LYS D 4 287 ? -29.268 170.326 14.943  1.00 62.86  ? 287 LYS B C     1 
ATOM 7303  O O     . LYS D 4 287 ? -28.505 169.923 14.057  1.00 62.73  ? 287 LYS B O     1 
ATOM 7304  C CB    . LYS D 4 287 ? -31.379 169.239 15.799  1.00 63.07  ? 287 LYS B CB    1 
ATOM 7305  C CG    . LYS D 4 287 ? -31.147 169.628 17.244  1.00 64.17  ? 287 LYS B CG    1 
ATOM 7306  C CD    . LYS D 4 287 ? -32.417 169.481 18.045  1.00 66.33  ? 287 LYS B CD    1 
ATOM 7307  C CE    . LYS D 4 287 ? -32.222 169.949 19.479  1.00 66.77  ? 287 LYS B CE    1 
ATOM 7308  N NZ    . LYS D 4 287 ? -33.493 169.869 20.258  1.00 67.67  ? 287 LYS B NZ    1 
ATOM 7309  N N     . ALA D 4 288 ? -28.845 170.936 16.049  1.00 63.27  ? 288 ALA B N     1 
ATOM 7310  C CA    . ALA D 4 288 ? -27.432 171.100 16.356  1.00 63.71  ? 288 ALA B CA    1 
ATOM 7311  C C     . ALA D 4 288 ? -27.021 169.860 17.105  1.00 64.08  ? 288 ALA B C     1 
ATOM 7312  O O     . ALA D 4 288 ? -27.393 169.680 18.261  1.00 64.49  ? 288 ALA B O     1 
ATOM 7313  C CB    . ALA D 4 288 ? -27.212 172.328 17.230  1.00 64.23  ? 288 ALA B CB    1 
ATOM 7314  N N     . LEU D 4 289 ? -26.273 168.992 16.437  1.00 64.76  ? 289 LEU B N     1 
ATOM 7315  C CA    . LEU D 4 289 ? -25.833 167.757 17.062  1.00 65.32  ? 289 LEU B CA    1 
ATOM 7316  C C     . LEU D 4 289 ? -25.023 168.053 18.309  1.00 65.56  ? 289 LEU B C     1 
ATOM 7317  O O     . LEU D 4 289 ? -25.299 167.527 19.397  1.00 63.84  ? 289 LEU B O     1 
ATOM 7318  C CB    . LEU D 4 289 ? -25.039 166.898 16.070  1.00 66.62  ? 289 LEU B CB    1 
ATOM 7319  C CG    . LEU D 4 289 ? -23.536 167.071 15.825  1.00 67.91  ? 289 LEU B CG    1 
ATOM 7320  C CD1   . LEU D 4 289 ? -22.740 166.454 16.980  1.00 69.15  ? 289 LEU B CD1   1 
ATOM 7321  C CD2   . LEU D 4 289 ? -23.163 166.354 14.532  1.00 69.31  ? 289 LEU B CD2   1 
ATOM 7322  N N     . THR D 4 290 ? -24.045 168.933 18.121  1.00 66.02  ? 290 THR B N     1 
ATOM 7323  C CA    . THR D 4 290 ? -23.145 169.374 19.164  1.00 66.40  ? 290 THR B CA    1 
ATOM 7324  C C     . THR D 4 290 ? -23.935 169.732 20.398  1.00 65.89  ? 290 THR B C     1 
ATOM 7325  O O     . THR D 4 290 ? -24.868 170.534 20.346  1.00 64.06  ? 290 THR B O     1 
ATOM 7326  C CB    . THR D 4 290 ? -22.334 170.597 18.696  1.00 67.17  ? 290 THR B CB    1 
ATOM 7327  O OG1   . THR D 4 290 ? -21.205 170.162 17.934  1.00 69.66  ? 290 THR B OG1   1 
ATOM 7328  C CG2   . THR D 4 290 ? -21.861 171.411 19.862  1.00 66.76  ? 290 THR B CG2   1 
ATOM 7329  N N     . GLU D 4 291 ? -23.597 169.055 21.486  1.00 66.26  ? 291 GLU B N     1 
ATOM 7330  C CA    . GLU D 4 291 ? -24.225 169.263 22.785  1.00 67.12  ? 291 GLU B CA    1 
ATOM 7331  C C     . GLU D 4 291 ? -25.722 168.978 22.912  1.00 66.89  ? 291 GLU B C     1 
ATOM 7332  O O     . GLU D 4 291 ? -26.196 168.668 24.016  1.00 67.60  ? 291 GLU B O     1 
ATOM 7333  C CB    . GLU D 4 291 ? -23.925 170.668 23.295  1.00 67.46  ? 291 GLU B CB    1 
ATOM 7334  N N     . VAL D 4 292 ? -26.476 169.105 21.821  1.00 65.69  ? 292 VAL B N     1 
ATOM 7335  C CA    . VAL D 4 292 ? -27.906 168.859 21.916  1.00 63.95  ? 292 VAL B CA    1 
ATOM 7336  C C     . VAL D 4 292 ? -28.102 167.474 22.484  1.00 62.38  ? 292 VAL B C     1 
ATOM 7337  O O     . VAL D 4 292 ? -27.630 166.496 21.906  1.00 62.44  ? 292 VAL B O     1 
ATOM 7338  C CB    . VAL D 4 292 ? -28.571 168.978 20.573  1.00 64.26  ? 292 VAL B CB    1 
ATOM 7339  N N     . ILE D 4 293 ? -28.743 167.409 23.650  1.00 60.21  ? 293 ILE B N     1 
ATOM 7340  C CA    . ILE D 4 293 ? -29.018 166.152 24.333  1.00 58.01  ? 293 ILE B CA    1 
ATOM 7341  C C     . ILE D 4 293 ? -30.517 165.888 24.248  1.00 57.21  ? 293 ILE B C     1 
ATOM 7342  O O     . ILE D 4 293 ? -31.198 165.777 25.263  1.00 56.07  ? 293 ILE B O     1 
ATOM 7343  C CB    . ILE D 4 293 ? -28.580 166.251 25.777  1.00 58.24  ? 293 ILE B CB    1 
ATOM 7344  N N     . PRO D 4 294 ? -31.031 165.710 23.023  1.00 57.23  ? 294 PRO B N     1 
ATOM 7345  C CA    . PRO D 4 294 ? -32.435 165.459 22.696  1.00 58.50  ? 294 PRO B CA    1 
ATOM 7346  C C     . PRO D 4 294 ? -33.007 164.178 23.269  1.00 58.87  ? 294 PRO B C     1 
ATOM 7347  O O     . PRO D 4 294 ? -33.695 163.430 22.564  1.00 57.74  ? 294 PRO B O     1 
ATOM 7348  C CB    . PRO D 4 294 ? -32.413 165.400 21.164  1.00 59.21  ? 294 PRO B CB    1 
ATOM 7349  C CG    . PRO D 4 294 ? -31.148 166.146 20.799  1.00 58.30  ? 294 PRO B CG    1 
ATOM 7350  C CD    . PRO D 4 294 ? -30.231 165.570 21.803  1.00 57.22  ? 294 PRO B CD    1 
ATOM 7351  N N     . LEU D 4 295 ? -32.750 163.963 24.555  1.00 60.29  ? 295 LEU B N     1 
ATOM 7352  C CA    . LEU D 4 295 ? -33.220 162.789 25.264  1.00 62.66  ? 295 LEU B CA    1 
ATOM 7353  C C     . LEU D 4 295 ? -34.639 162.422 24.848  1.00 62.90  ? 295 LEU B C     1 
ATOM 7354  O O     . LEU D 4 295 ? -35.566 163.219 24.967  1.00 61.91  ? 295 LEU B O     1 
ATOM 7355  C CB    . LEU D 4 295 ? -33.147 163.032 26.769  1.00 64.30  ? 295 LEU B CB    1 
ATOM 7356  C CG    . LEU D 4 295 ? -33.716 161.912 27.642  1.00 66.87  ? 295 LEU B CG    1 
ATOM 7357  C CD1   . LEU D 4 295 ? -33.150 160.552 27.201  1.00 67.25  ? 295 LEU B CD1   1 
ATOM 7358  C CD2   . LEU D 4 295 ? -33.406 162.204 29.117  1.00 67.78  ? 295 LEU B CD2   1 
ATOM 7359  N N     . THR D 4 296 ? -34.786 161.216 24.321  1.00 64.79  ? 296 THR B N     1 
ATOM 7360  C CA    . THR D 4 296 ? -36.080 160.754 23.859  1.00 67.15  ? 296 THR B CA    1 
ATOM 7361  C C     . THR D 4 296 ? -36.357 159.359 24.413  1.00 68.45  ? 296 THR B C     1 
ATOM 7362  O O     . THR D 4 296 ? -35.720 158.376 24.013  1.00 69.09  ? 296 THR B O     1 
ATOM 7363  C CB    . THR D 4 296 ? -36.136 160.709 22.303  1.00 67.64  ? 296 THR B CB    1 
ATOM 7364  O OG1   . THR D 4 296 ? -35.612 161.928 21.750  1.00 66.93  ? 296 THR B OG1   1 
ATOM 7365  C CG2   . THR D 4 296 ? -37.575 160.515 21.831  1.00 68.82  ? 296 THR B CG2   1 
ATOM 7366  N N     . GLU D 4 297 ? -37.296 159.287 25.352  1.00 68.94  ? 297 GLU B N     1 
ATOM 7367  C CA    . GLU D 4 297 ? -37.683 158.019 25.960  1.00 69.56  ? 297 GLU B CA    1 
ATOM 7368  C C     . GLU D 4 297 ? -38.905 157.434 25.253  1.00 70.01  ? 297 GLU B C     1 
ATOM 7369  O O     . GLU D 4 297 ? -39.468 156.429 25.695  1.00 69.71  ? 297 GLU B O     1 
ATOM 7370  C CB    . GLU D 4 297 ? -37.969 158.203 27.450  1.00 70.42  ? 297 GLU B CB    1 
ATOM 7371  N N     . GLU D 4 298 ? -39.331 158.079 24.170  1.00 70.65  ? 298 GLU B N     1 
ATOM 7372  C CA    . GLU D 4 298 ? -40.482 157.603 23.404  1.00 72.87  ? 298 GLU B CA    1 
ATOM 7373  C C     . GLU D 4 298 ? -40.015 156.444 22.537  1.00 74.10  ? 298 GLU B C     1 
ATOM 7374  O O     . GLU D 4 298 ? -40.664 155.387 22.466  1.00 74.66  ? 298 GLU B O     1 
ATOM 7375  C CB    . GLU D 4 298 ? -41.034 158.720 22.528  1.00 74.16  ? 298 GLU B CB    1 
ATOM 7376  N N     . ALA D 4 299 ? -38.868 156.669 21.891  1.00 75.00  ? 299 ALA B N     1 
ATOM 7377  C CA    . ALA D 4 299 ? -38.234 155.692 21.015  1.00 75.51  ? 299 ALA B CA    1 
ATOM 7378  C C     . ALA D 4 299 ? -37.578 154.593 21.845  1.00 75.46  ? 299 ALA B C     1 
ATOM 7379  O O     . ALA D 4 299 ? -37.270 153.520 21.318  1.00 75.59  ? 299 ALA B O     1 
ATOM 7380  C CB    . ALA D 4 299 ? -37.196 156.379 20.121  1.00 74.61  ? 299 ALA B CB    1 
ATOM 7381  N N     . GLU D 4 300 ? -37.393 154.865 23.143  1.00 75.61  ? 300 GLU B N     1 
ATOM 7382  C CA    . GLU D 4 300 ? -36.785 153.918 24.082  1.00 75.99  ? 300 GLU B CA    1 
ATOM 7383  C C     . GLU D 4 300 ? -37.434 152.536 23.996  1.00 76.72  ? 300 GLU B C     1 
ATOM 7384  O O     . GLU D 4 300 ? -36.782 151.528 24.271  1.00 78.37  ? 300 GLU B O     1 
ATOM 7385  C CB    . GLU D 4 300 ? -36.849 154.452 25.526  1.00 73.21  ? 300 GLU B CB    1 
ATOM 7386  N N     . LEU D 4 301 ? -38.702 152.491 23.583  1.00 77.35  ? 301 LEU B N     1 
ATOM 7387  C CA    . LEU D 4 301 ? -39.417 151.221 23.447  1.00 77.72  ? 301 LEU B CA    1 
ATOM 7388  C C     . LEU D 4 301 ? -38.876 150.385 22.287  1.00 77.42  ? 301 LEU B C     1 
ATOM 7389  O O     . LEU D 4 301 ? -38.809 149.156 22.369  1.00 77.16  ? 301 LEU B O     1 
ATOM 7390  C CB    . LEU D 4 301 ? -40.924 151.446 23.257  1.00 78.38  ? 301 LEU B CB    1 
ATOM 7391  C CG    . LEU D 4 301 ? -41.761 150.164 23.087  1.00 78.77  ? 301 LEU B CG    1 
ATOM 7392  C CD1   . LEU D 4 301 ? -41.569 149.188 24.257  1.00 77.71  ? 301 LEU B CD1   1 
ATOM 7393  C CD2   . LEU D 4 301 ? -43.222 150.527 22.910  1.00 79.02  ? 301 LEU B CD2   1 
ATOM 7394  N N     . GLU D 4 302 ? -38.503 151.050 21.200  1.00 76.68  ? 302 GLU B N     1 
ATOM 7395  C CA    . GLU D 4 302 ? -37.985 150.336 20.046  1.00 75.92  ? 302 GLU B CA    1 
ATOM 7396  C C     . GLU D 4 302 ? -36.457 150.262 20.011  1.00 75.04  ? 302 GLU B C     1 
ATOM 7397  O O     . GLU D 4 302 ? -35.881 149.549 19.184  1.00 74.97  ? 302 GLU B O     1 
ATOM 7398  C CB    . GLU D 4 302 ? -38.558 150.937 18.762  1.00 76.30  ? 302 GLU B CB    1 
ATOM 7399  C CG    . GLU D 4 302 ? -40.094 150.977 18.754  1.00 76.84  ? 302 GLU B CG    1 
ATOM 7400  C CD    . GLU D 4 302 ? -40.739 149.638 19.132  1.00 76.71  ? 302 GLU B CD    1 
ATOM 7401  O OE1   . GLU D 4 302 ? -40.822 148.732 18.274  1.00 75.33  ? 302 GLU B OE1   1 
ATOM 7402  O OE2   . GLU D 4 302 ? -41.178 149.492 20.290  1.00 76.06  ? 302 GLU B OE2   1 
ATOM 7403  N N     . LEU D 4 303 ? -35.807 150.963 20.938  1.00 73.92  ? 303 LEU B N     1 
ATOM 7404  C CA    . LEU D 4 303 ? -34.351 150.959 21.005  1.00 73.00  ? 303 LEU B CA    1 
ATOM 7405  C C     . LEU D 4 303 ? -33.849 149.776 21.820  1.00 71.86  ? 303 LEU B C     1 
ATOM 7406  O O     . LEU D 4 303 ? -32.748 149.272 21.597  1.00 71.91  ? 303 LEU B O     1 
ATOM 7407  C CB    . LEU D 4 303 ? -33.833 152.259 21.604  1.00 74.03  ? 303 LEU B CB    1 
ATOM 7408  C CG    . LEU D 4 303 ? -32.316 152.390 21.463  1.00 75.36  ? 303 LEU B CG    1 
ATOM 7409  C CD1   . LEU D 4 303 ? -31.925 152.348 19.984  1.00 73.91  ? 303 LEU B CD1   1 
ATOM 7410  C CD2   . LEU D 4 303 ? -31.847 153.677 22.115  1.00 77.30  ? 303 LEU B CD2   1 
ATOM 7411  N N     . ALA D 4 304 ? -34.633 149.381 22.812  1.00 70.83  ? 304 ALA B N     1 
ATOM 7412  C CA    . ALA D 4 304 ? -34.285 148.227 23.618  1.00 71.00  ? 304 ALA B CA    1 
ATOM 7413  C C     . ALA D 4 304 ? -34.897 147.020 22.900  1.00 71.31  ? 304 ALA B C     1 
ATOM 7414  O O     . ALA D 4 304 ? -34.632 145.873 23.264  1.00 71.40  ? 304 ALA B O     1 
ATOM 7415  C CB    . ALA D 4 304 ? -34.852 148.363 25.025  1.00 71.43  ? 304 ALA B CB    1 
ATOM 7416  N N     . GLU D 4 305 ? -35.702 147.301 21.869  1.00 71.33  ? 305 GLU B N     1 
ATOM 7417  C CA    . GLU D 4 305 ? -36.373 146.276 21.058  1.00 71.29  ? 305 GLU B CA    1 
ATOM 7418  C C     . GLU D 4 305 ? -35.414 145.627 20.061  1.00 70.96  ? 305 GLU B C     1 
ATOM 7419  O O     . GLU D 4 305 ? -35.453 144.406 19.845  1.00 71.12  ? 305 GLU B O     1 
ATOM 7420  C CB    . GLU D 4 305 ? -37.561 146.879 20.324  1.00 72.24  ? 305 GLU B CB    1 
ATOM 7421  N N     . ASN D 4 306 ? -34.588 146.450 19.420  1.00 69.74  ? 306 ASN B N     1 
ATOM 7422  C CA    . ASN D 4 306 ? -33.603 145.931 18.485  1.00 69.54  ? 306 ASN B CA    1 
ATOM 7423  C C     . ASN D 4 306 ? -32.632 145.056 19.291  1.00 68.78  ? 306 ASN B C     1 
ATOM 7424  O O     . ASN D 4 306 ? -32.207 143.998 18.823  1.00 68.97  ? 306 ASN B O     1 
ATOM 7425  C CB    . ASN D 4 306 ? -32.862 147.078 17.773  1.00 70.52  ? 306 ASN B CB    1 
ATOM 7426  C CG    . ASN D 4 306 ? -33.541 147.503 16.466  1.00 70.59  ? 306 ASN B CG    1 
ATOM 7427  O OD1   . ASN D 4 306 ? -33.487 148.671 16.069  1.00 69.27  ? 306 ASN B OD1   1 
ATOM 7428  N ND2   . ASN D 4 306 ? -34.164 146.547 15.786  1.00 70.38  ? 306 ASN B ND2   1 
ATOM 7429  N N     . ARG D 4 307 ? -32.387 145.455 20.543  1.00 67.52  ? 307 ARG B N     1 
ATOM 7430  C CA    . ARG D 4 307 ? -31.487 144.743 21.453  1.00 66.74  ? 307 ARG B CA    1 
ATOM 7431  C C     . ARG D 4 307 ? -31.764 143.245 21.532  1.00 66.14  ? 307 ARG B C     1 
ATOM 7432  O O     . ARG D 4 307 ? -30.836 142.439 21.506  1.00 67.50  ? 307 ARG B O     1 
ATOM 7433  C CB    . ARG D 4 307 ? -31.525 145.369 22.852  1.00 66.66  ? 307 ARG B CB    1 
ATOM 7434  C CG    . ARG D 4 307 ? -31.100 146.830 22.867  1.00 67.44  ? 307 ARG B CG    1 
ATOM 7435  C CD    . ARG D 4 307 ? -30.416 147.229 24.171  1.00 68.31  ? 307 ARG B CD    1 
ATOM 7436  N NE    . ARG D 4 307 ? -29.707 148.503 24.035  1.00 69.95  ? 307 ARG B NE    1 
ATOM 7437  C CZ    . ARG D 4 307 ? -28.537 148.668 23.414  1.00 70.21  ? 307 ARG B CZ    1 
ATOM 7438  N NH1   . ARG D 4 307 ? -27.887 147.646 22.860  1.00 69.80  ? 307 ARG B NH1   1 
ATOM 7439  N NH2   . ARG D 4 307 ? -28.050 149.887 23.277  1.00 71.37  ? 307 ARG B NH2   1 
ATOM 7440  N N     . GLU D 4 308 ? -33.040 142.879 21.601  1.00 65.56  ? 308 GLU B N     1 
ATOM 7441  C CA    . GLU D 4 308 ? -33.444 141.478 21.658  1.00 65.47  ? 308 GLU B CA    1 
ATOM 7442  C C     . GLU D 4 308 ? -32.824 140.768 20.465  1.00 65.79  ? 308 GLU B C     1 
ATOM 7443  O O     . GLU D 4 308 ? -32.105 139.770 20.611  1.00 64.95  ? 308 GLU B O     1 
ATOM 7444  C CB    . GLU D 4 308 ? -34.963 141.374 21.588  1.00 64.83  ? 308 GLU B CB    1 
ATOM 7445  N N     . ILE D 4 309 ? -33.069 141.348 19.293  1.00 66.49  ? 309 ILE B N     1 
ATOM 7446  C CA    . ILE D 4 309 ? -32.572 140.832 18.022  1.00 67.43  ? 309 ILE B CA    1 
ATOM 7447  C C     . ILE D 4 309 ? -31.047 140.717 17.978  1.00 66.96  ? 309 ILE B C     1 
ATOM 7448  O O     . ILE D 4 309 ? -30.501 139.764 17.426  1.00 66.14  ? 309 ILE B O     1 
ATOM 7449  C CB    . ILE D 4 309 ? -33.078 141.712 16.873  1.00 67.73  ? 309 ILE B CB    1 
ATOM 7450  N N     . LEU D 4 310 ? -30.364 141.672 18.595  1.00 67.65  ? 310 LEU B N     1 
ATOM 7451  C CA    . LEU D 4 310 ? -28.909 141.670 18.608  1.00 69.07  ? 310 LEU B CA    1 
ATOM 7452  C C     . LEU D 4 310 ? -28.334 140.680 19.608  1.00 69.72  ? 310 LEU B C     1 
ATOM 7453  O O     . LEU D 4 310 ? -27.229 140.172 19.415  1.00 70.18  ? 310 LEU B O     1 
ATOM 7454  C CB    . LEU D 4 310 ? -28.382 143.068 18.904  1.00 69.19  ? 310 LEU B CB    1 
ATOM 7455  N N     . LYS D 4 311 ? -29.112 140.375 20.642  1.00 70.22  ? 311 LYS B N     1 
ATOM 7456  C CA    . LYS D 4 311 ? -28.683 139.475 21.708  1.00 71.11  ? 311 LYS B CA    1 
ATOM 7457  C C     . LYS D 4 311 ? -28.601 137.979 21.398  1.00 72.19  ? 311 LYS B C     1 
ATOM 7458  O O     . LYS D 4 311 ? -27.985 137.224 22.163  1.00 72.60  ? 311 LYS B O     1 
ATOM 7459  C CB    . LYS D 4 311 ? -29.553 139.693 22.931  1.00 70.61  ? 311 LYS B CB    1 
ATOM 7460  N N     . GLU D 4 312 ? -29.166 137.551 20.269  1.00 73.17  ? 312 GLU B N     1 
ATOM 7461  C CA    . GLU D 4 312 ? -29.173 136.124 19.939  1.00 72.65  ? 312 GLU B CA    1 
ATOM 7462  C C     . GLU D 4 312 ? -28.446 135.602 18.693  1.00 72.37  ? 312 GLU B C     1 
ATOM 7463  O O     . GLU D 4 312 ? -27.635 136.293 18.065  1.00 73.15  ? 312 GLU B O     1 
ATOM 7464  C CB    . GLU D 4 312 ? -30.601 135.618 19.945  1.00 72.66  ? 312 GLU B CB    1 
ATOM 7465  N N     . PRO D 4 313 ? -28.752 134.343 18.376  1.00 71.41  ? 313 PRO B N     1 
ATOM 7466  C CA    . PRO D 4 313 ? -28.181 133.628 17.244  1.00 69.76  ? 313 PRO B CA    1 
ATOM 7467  C C     . PRO D 4 313 ? -28.938 133.898 15.954  1.00 68.89  ? 313 PRO B C     1 
ATOM 7468  O O     . PRO D 4 313 ? -30.100 133.508 15.809  1.00 67.47  ? 313 PRO B O     1 
ATOM 7469  C CB    . PRO D 4 313 ? -28.162 132.134 17.536  1.00 69.17  ? 313 PRO B CB    1 
ATOM 7470  N N     . VAL D 4 314 ? -28.258 134.555 15.020  1.00 68.96  ? 314 VAL B N     1 
ATOM 7471  C CA    . VAL D 4 314 ? -28.832 134.891 13.722  1.00 70.17  ? 314 VAL B CA    1 
ATOM 7472  C C     . VAL D 4 314 ? -29.228 133.625 12.948  1.00 70.83  ? 314 VAL B C     1 
ATOM 7473  O O     . VAL D 4 314 ? -28.372 132.931 12.401  1.00 71.86  ? 314 VAL B O     1 
ATOM 7474  C CB    . VAL D 4 314 ? -27.835 135.734 12.913  1.00 69.56  ? 314 VAL B CB    1 
ATOM 7475  N N     . HIS D 4 315 ? -30.528 133.330 12.917  1.00 71.36  ? 315 HIS B N     1 
ATOM 7476  C CA    . HIS D 4 315 ? -31.047 132.146 12.224  1.00 71.66  ? 315 HIS B CA    1 
ATOM 7477  C C     . HIS D 4 315 ? -30.958 132.230 10.691  1.00 71.79  ? 315 HIS B C     1 
ATOM 7478  O O     . HIS D 4 315 ? -31.738 132.939 10.042  1.00 71.62  ? 315 HIS B O     1 
ATOM 7479  C CB    . HIS D 4 315 ? -32.488 131.871 12.660  1.00 70.84  ? 315 HIS B CB    1 
ATOM 7480  N N     . GLY D 4 316 ? -30.014 131.481 10.125  1.00 71.77  ? 316 GLY B N     1 
ATOM 7481  C CA    . GLY D 4 316 ? -29.822 131.470 8.684   1.00 71.11  ? 316 GLY B CA    1 
ATOM 7482  C C     . GLY D 4 316 ? -28.623 130.647 8.231   1.00 70.17  ? 316 GLY B C     1 
ATOM 7483  O O     . GLY D 4 316 ? -28.547 130.249 7.061   1.00 70.94  ? 316 GLY B O     1 
ATOM 7484  N N     . VAL D 4 317 ? -27.692 130.402 9.158   1.00 68.82  ? 317 VAL B N     1 
ATOM 7485  C CA    . VAL D 4 317 ? -26.471 129.621 8.913   1.00 66.89  ? 317 VAL B CA    1 
ATOM 7486  C C     . VAL D 4 317 ? -26.782 128.338 8.132   1.00 65.38  ? 317 VAL B C     1 
ATOM 7487  O O     . VAL D 4 317 ? -27.354 127.379 8.657   1.00 64.91  ? 317 VAL B O     1 
ATOM 7488  C CB    . VAL D 4 317 ? -25.756 129.267 10.252  1.00 67.58  ? 317 VAL B CB    1 
ATOM 7489  C CG1   . VAL D 4 317 ? -24.438 128.530 9.991   1.00 66.33  ? 317 VAL B CG1   1 
ATOM 7490  C CG2   . VAL D 4 317 ? -25.505 130.534 11.063  1.00 68.77  ? 317 VAL B CG2   1 
ATOM 7491  N N     . TYR D 4 318 ? -26.387 128.345 6.866   1.00 63.96  ? 318 TYR B N     1 
ATOM 7492  C CA    . TYR D 4 318 ? -26.629 127.237 5.955   1.00 61.94  ? 318 TYR B CA    1 
ATOM 7493  C C     . TYR D 4 318 ? -25.306 126.922 5.251   1.00 58.87  ? 318 TYR B C     1 
ATOM 7494  O O     . TYR D 4 318 ? -25.209 127.082 4.031   1.00 58.65  ? 318 TYR B O     1 
ATOM 7495  C CB    . TYR D 4 318 ? -27.680 127.709 4.936   1.00 65.36  ? 318 TYR B CB    1 
ATOM 7496  C CG    . TYR D 4 318 ? -28.254 126.665 4.002   1.00 69.27  ? 318 TYR B CG    1 
ATOM 7497  C CD1   . TYR D 4 318 ? -29.030 125.608 4.491   1.00 71.25  ? 318 TYR B CD1   1 
ATOM 7498  C CD2   . TYR D 4 318 ? -28.099 126.781 2.615   1.00 71.01  ? 318 TYR B CD2   1 
ATOM 7499  C CE1   . TYR D 4 318 ? -29.649 124.687 3.617   1.00 72.83  ? 318 TYR B CE1   1 
ATOM 7500  C CE2   . TYR D 4 318 ? -28.711 125.867 1.730   1.00 72.19  ? 318 TYR B CE2   1 
ATOM 7501  C CZ    . TYR D 4 318 ? -29.490 124.824 2.238   1.00 72.82  ? 318 TYR B CZ    1 
ATOM 7502  O OH    . TYR D 4 318 ? -30.118 123.932 1.381   1.00 72.26  ? 318 TYR B OH    1 
ATOM 7503  N N     . TYR D 4 319 ? -24.298 126.477 6.012   1.00 54.11  ? 319 TYR B N     1 
ATOM 7504  C CA    . TYR D 4 319 ? -22.981 126.173 5.440   1.00 48.74  ? 319 TYR B CA    1 
ATOM 7505  C C     . TYR D 4 319 ? -23.069 125.405 4.140   1.00 46.42  ? 319 TYR B C     1 
ATOM 7506  O O     . TYR D 4 319 ? -23.944 124.563 3.979   1.00 46.57  ? 319 TYR B O     1 
ATOM 7507  C CB    . TYR D 4 319 ? -22.095 125.390 6.404   1.00 46.53  ? 319 TYR B CB    1 
ATOM 7508  C CG    . TYR D 4 319 ? -20.823 124.900 5.729   1.00 45.46  ? 319 TYR B CG    1 
ATOM 7509  C CD1   . TYR D 4 319 ? -19.891 125.790 5.207   1.00 43.60  ? 319 TYR B CD1   1 
ATOM 7510  C CD2   . TYR D 4 319 ? -20.576 123.545 5.566   1.00 45.26  ? 319 TYR B CD2   1 
ATOM 7511  C CE1   . TYR D 4 319 ? -18.754 125.335 4.537   1.00 41.77  ? 319 TYR B CE1   1 
ATOM 7512  C CE2   . TYR D 4 319 ? -19.436 123.088 4.903   1.00 42.43  ? 319 TYR B CE2   1 
ATOM 7513  C CZ    . TYR D 4 319 ? -18.538 123.985 4.390   1.00 41.11  ? 319 TYR B CZ    1 
ATOM 7514  O OH    . TYR D 4 319 ? -17.437 123.523 3.715   1.00 39.19  ? 319 TYR B OH    1 
ATOM 7515  N N     . ASP D 4 320 ? -22.134 125.672 3.232   1.00 45.09  ? 320 ASP B N     1 
ATOM 7516  C CA    . ASP D 4 320 ? -22.128 125.016 1.929   1.00 44.36  ? 320 ASP B CA    1 
ATOM 7517  C C     . ASP D 4 320 ? -20.737 124.781 1.354   1.00 42.33  ? 320 ASP B C     1 
ATOM 7518  O O     . ASP D 4 320 ? -20.168 125.647 0.693   1.00 40.22  ? 320 ASP B O     1 
ATOM 7519  C CB    . ASP D 4 320 ? -22.979 125.815 0.937   1.00 45.99  ? 320 ASP B CB    1 
ATOM 7520  C CG    . ASP D 4 320 ? -23.090 125.147 -0.421  1.00 46.37  ? 320 ASP B CG    1 
ATOM 7521  O OD1   . ASP D 4 320 ? -23.659 125.795 -1.332  1.00 46.87  ? 320 ASP B OD1   1 
ATOM 7522  O OD2   . ASP D 4 320 ? -22.625 123.989 -0.576  1.00 45.19  ? 320 ASP B OD2   1 
ATOM 7523  N N     . PRO D 4 321 ? -20.260 123.536 1.456   1.00 41.58  ? 321 PRO B N     1 
ATOM 7524  C CA    . PRO D 4 321 ? -18.952 123.122 0.968   1.00 42.30  ? 321 PRO B CA    1 
ATOM 7525  C C     . PRO D 4 321 ? -18.789 123.445 -0.499  1.00 43.26  ? 321 PRO B C     1 
ATOM 7526  O O     . PRO D 4 321 ? -17.682 123.734 -0.942  1.00 44.78  ? 321 PRO B O     1 
ATOM 7527  C CB    . PRO D 4 321 ? -18.972 121.611 1.177   1.00 41.36  ? 321 PRO B CB    1 
ATOM 7528  C CG    . PRO D 4 321 ? -19.952 121.413 2.255   1.00 40.61  ? 321 PRO B CG    1 
ATOM 7529  C CD    . PRO D 4 321 ? -21.035 122.364 1.885   1.00 41.11  ? 321 PRO B CD    1 
ATOM 7530  N N     . SER D 4 322 ? -19.878 123.406 -1.262  1.00 43.24  ? 322 SER B N     1 
ATOM 7531  C CA    . SER D 4 322 ? -19.769 123.703 -2.690  1.00 44.13  ? 322 SER B CA    1 
ATOM 7532  C C     . SER D 4 322 ? -19.367 125.164 -2.944  1.00 42.81  ? 322 SER B C     1 
ATOM 7533  O O     . SER D 4 322 ? -19.032 125.549 -4.069  1.00 42.44  ? 322 SER B O     1 
ATOM 7534  C CB    . SER D 4 322 ? -21.070 123.366 -3.430  1.00 45.66  ? 322 SER B CB    1 
ATOM 7535  O OG    . SER D 4 322 ? -21.903 124.510 -3.566  1.00 47.01  ? 322 SER B OG    1 
ATOM 7536  N N     . LYS D 4 323 ? -19.403 125.981 -1.900  1.00 40.36  ? 323 LYS B N     1 
ATOM 7537  C CA    . LYS D 4 323 ? -19.019 127.369 -2.058  1.00 39.06  ? 323 LYS B CA    1 
ATOM 7538  C C     . LYS D 4 323 ? -17.765 127.684 -1.248  1.00 37.17  ? 323 LYS B C     1 
ATOM 7539  O O     . LYS D 4 323 ? -17.449 126.992 -0.279  1.00 36.50  ? 323 LYS B O     1 
ATOM 7540  C CB    . LYS D 4 323 ? -20.175 128.268 -1.651  1.00 40.31  ? 323 LYS B CB    1 
ATOM 7541  C CG    . LYS D 4 323 ? -21.464 128.026 -2.441  1.00 43.77  ? 323 LYS B CG    1 
ATOM 7542  C CD    . LYS D 4 323 ? -21.318 128.347 -3.935  1.00 45.19  ? 323 LYS B CD    1 
ATOM 7543  C CE    . LYS D 4 323 ? -22.630 128.896 -4.524  1.00 46.32  ? 323 LYS B CE    1 
ATOM 7544  N NZ    . LYS D 4 323 ? -23.820 127.987 -4.379  1.00 47.22  ? 323 LYS B NZ    1 
ATOM 7545  N N     . ASP D 4 324 ? -17.043 128.721 -1.649  1.00 34.58  ? 324 ASP B N     1 
ATOM 7546  C CA    . ASP D 4 324 ? -15.826 129.105 -0.941  1.00 32.93  ? 324 ASP B CA    1 
ATOM 7547  C C     . ASP D 4 324 ? -16.074 129.798 0.392   1.00 30.45  ? 324 ASP B C     1 
ATOM 7548  O O     . ASP D 4 324 ? -17.192 130.186 0.704   1.00 29.26  ? 324 ASP B O     1 
ATOM 7549  C CB    . ASP D 4 324 ? -14.969 130.012 -1.821  1.00 35.43  ? 324 ASP B CB    1 
ATOM 7550  C CG    . ASP D 4 324 ? -14.473 129.314 -3.072  1.00 38.78  ? 324 ASP B CG    1 
ATOM 7551  O OD1   . ASP D 4 324 ? -14.043 130.015 -4.019  1.00 40.66  ? 324 ASP B OD1   1 
ATOM 7552  O OD2   . ASP D 4 324 ? -14.502 128.065 -3.102  1.00 42.05  ? 324 ASP B OD2   1 
ATOM 7553  N N     . LEU D 4 325 ? -15.014 129.949 1.178   1.00 28.62  ? 325 LEU B N     1 
ATOM 7554  C CA    . LEU D 4 325 ? -15.118 130.613 2.470   1.00 27.29  ? 325 LEU B CA    1 
ATOM 7555  C C     . LEU D 4 325 ? -14.368 131.914 2.522   1.00 27.11  ? 325 LEU B C     1 
ATOM 7556  O O     . LEU D 4 325 ? -13.351 132.085 1.844   1.00 26.09  ? 325 LEU B O     1 
ATOM 7557  C CB    . LEU D 4 325 ? -14.663 129.721 3.609   1.00 25.03  ? 325 LEU B CB    1 
ATOM 7558  C CG    . LEU D 4 325 ? -15.929 129.240 4.299   1.00 23.48  ? 325 LEU B CG    1 
ATOM 7559  C CD1   . LEU D 4 325 ? -16.643 128.259 3.370   1.00 19.35  ? 325 LEU B CD1   1 
ATOM 7560  C CD2   . LEU D 4 325 ? -15.590 128.632 5.663   1.00 23.32  ? 325 LEU B CD2   1 
ATOM 7561  N N     . ILE D 4 326 ? -14.857 132.825 3.363   1.00 26.16  ? 326 ILE B N     1 
ATOM 7562  C CA    . ILE D 4 326 ? -14.247 134.137 3.457   1.00 22.87  ? 326 ILE B CA    1 
ATOM 7563  C C     . ILE D 4 326 ? -14.142 134.737 4.822   1.00 22.55  ? 326 ILE B C     1 
ATOM 7564  O O     . ILE D 4 326 ? -14.980 134.478 5.697   1.00 20.69  ? 326 ILE B O     1 
ATOM 7565  C CB    . ILE D 4 326 ? -14.968 135.129 2.613   1.00 21.03  ? 326 ILE B CB    1 
ATOM 7566  C CG1   . ILE D 4 326 ? -15.863 134.394 1.608   1.00 20.42  ? 326 ILE B CG1   1 
ATOM 7567  C CG2   . ILE D 4 326 ? -13.937 136.008 1.969   1.00 21.29  ? 326 ILE B CG2   1 
ATOM 7568  C CD1   . ILE D 4 326 ? -16.662 135.256 0.714   1.00 22.34  ? 326 ILE B CD1   1 
ATOM 7569  N N     . ALA D 4 327 ? -13.152 135.621 4.947   1.00 21.60  ? 327 ALA B N     1 
ATOM 7570  C CA    . ALA D 4 327 ? -12.865 136.285 6.206   1.00 22.52  ? 327 ALA B CA    1 
ATOM 7571  C C     . ALA D 4 327 ? -12.334 137.707 6.110   1.00 23.79  ? 327 ALA B C     1 
ATOM 7572  O O     . ALA D 4 327 ? -11.425 138.021 5.322   1.00 23.98  ? 327 ALA B O     1 
ATOM 7573  C CB    . ALA D 4 327 ? -11.914 135.451 7.017   1.00 21.83  ? 327 ALA B CB    1 
ATOM 7574  N N     . GLU D 4 328 ? -12.924 138.561 6.943   1.00 24.51  ? 328 GLU B N     1 
ATOM 7575  C CA    . GLU D 4 328 ? -12.549 139.957 7.028   1.00 24.15  ? 328 GLU B CA    1 
ATOM 7576  C C     . GLU D 4 328 ? -11.942 140.160 8.380   1.00 22.96  ? 328 GLU B C     1 
ATOM 7577  O O     . GLU D 4 328 ? -12.370 139.585 9.391   1.00 20.48  ? 328 GLU B O     1 
ATOM 7578  C CB    . GLU D 4 328 ? -13.755 140.900 6.918   1.00 26.29  ? 328 GLU B CB    1 
ATOM 7579  C CG    . GLU D 4 328 ? -14.360 141.086 5.524   1.00 28.84  ? 328 GLU B CG    1 
ATOM 7580  C CD    . GLU D 4 328 ? -15.157 142.378 5.402   1.00 29.58  ? 328 GLU B CD    1 
ATOM 7581  O OE1   . GLU D 4 328 ? -15.447 142.995 6.454   1.00 30.73  ? 328 GLU B OE1   1 
ATOM 7582  O OE2   . GLU D 4 328 ? -15.490 142.776 4.258   1.00 29.94  ? 328 GLU B OE2   1 
ATOM 7583  N N     . ILE D 4 329 ? -10.899 140.959 8.381   1.00 22.93  ? 329 ILE B N     1 
ATOM 7584  C CA    . ILE D 4 329 ? -10.244 141.270 9.615   1.00 22.86  ? 329 ILE B CA    1 
ATOM 7585  C C     . ILE D 4 329 ? -10.379 142.763 9.780   1.00 21.51  ? 329 ILE B C     1 
ATOM 7586  O O     . ILE D 4 329 ? -10.354 143.521 8.802   1.00 22.13  ? 329 ILE B O     1 
ATOM 7587  C CB    . ILE D 4 329 ? -8.774  140.821 9.597   1.00 24.99  ? 329 ILE B CB    1 
ATOM 7588  C CG1   . ILE D 4 329 ? -8.716  139.296 9.620   1.00 23.77  ? 329 ILE B CG1   1 
ATOM 7589  C CG2   . ILE D 4 329 ? -7.991  141.435 10.764  1.00 24.95  ? 329 ILE B CG2   1 
ATOM 7590  C CD1   . ILE D 4 329 ? -9.212  138.650 8.334   1.00 26.39  ? 329 ILE B CD1   1 
ATOM 7591  N N     . GLN D 4 330 ? -10.602 143.185 11.009  1.00 18.88  ? 330 GLN B N     1 
ATOM 7592  C CA    . GLN D 4 330 ? -10.746 144.595 11.240  1.00 18.57  ? 330 GLN B CA    1 
ATOM 7593  C C     . GLN D 4 330 ? -9.888  145.044 12.402  1.00 19.60  ? 330 GLN B C     1 
ATOM 7594  O O     . GLN D 4 330 ? -9.879  144.393 13.454  1.00 19.81  ? 330 GLN B O     1 
ATOM 7595  C CB    . GLN D 4 330 ? -12.220 144.913 11.440  1.00 17.95  ? 330 GLN B CB    1 
ATOM 7596  C CG    . GLN D 4 330 ? -13.041 144.725 10.161  1.00 11.19  ? 330 GLN B CG    1 
ATOM 7597  C CD    . GLN D 4 330 ? -13.871 143.493 10.203  1.00 7.96   ? 330 GLN B CD    1 
ATOM 7598  O OE1   . GLN D 4 330 ? -14.390 143.037 9.183   1.00 4.85   ? 330 GLN B OE1   1 
ATOM 7599  N NE2   . GLN D 4 330 ? -14.034 142.949 11.398  1.00 4.55   ? 330 GLN B NE2   1 
ATOM 7600  N N     . LYS D 4 331 ? -9.160  146.144 12.207  1.00 19.30  ? 331 LYS B N     1 
ATOM 7601  C CA    . LYS D 4 331 ? -8.269  146.663 13.243  1.00 22.05  ? 331 LYS B CA    1 
ATOM 7602  C C     . LYS D 4 331 ? -8.947  147.373 14.434  1.00 25.23  ? 331 LYS B C     1 
ATOM 7603  O O     . LYS D 4 331 ? -8.301  148.142 15.153  1.00 23.99  ? 331 LYS B O     1 
ATOM 7604  C CB    . LYS D 4 331 ? -7.242  147.593 12.607  1.00 20.59  ? 331 LYS B CB    1 
ATOM 7605  C CG    . LYS D 4 331 ? -6.139  147.981 13.553  1.00 19.96  ? 331 LYS B CG    1 
ATOM 7606  C CD    . LYS D 4 331 ? -5.302  149.108 13.019  1.00 20.79  ? 331 LYS B CD    1 
ATOM 7607  C CE    . LYS D 4 331 ? -4.165  149.448 13.984  1.00 21.96  ? 331 LYS B CE    1 
ATOM 7608  N NZ    . LYS D 4 331 ? -3.098  150.292 13.344  1.00 22.28  ? 331 LYS B NZ    1 
ATOM 7609  N N     . GLN D 4 332 ? -10.219 147.053 14.682  1.00 30.11  ? 332 GLN B N     1 
ATOM 7610  C CA    . GLN D 4 332 ? -11.009 147.677 15.758  1.00 34.34  ? 332 GLN B CA    1 
ATOM 7611  C C     . GLN D 4 332 ? -10.304 147.883 17.083  1.00 35.36  ? 332 GLN B C     1 
ATOM 7612  O O     . GLN D 4 332 ? -10.328 147.023 17.956  1.00 36.18  ? 332 GLN B O     1 
ATOM 7613  C CB    . GLN D 4 332 ? -12.336 146.937 16.002  1.00 36.32  ? 332 GLN B CB    1 
ATOM 7614  C CG    . GLN D 4 332 ? -13.464 147.271 14.999  1.00 43.80  ? 332 GLN B CG    1 
ATOM 7615  C CD    . GLN D 4 332 ? -13.847 148.769 14.943  1.00 46.85  ? 332 GLN B CD    1 
ATOM 7616  O OE1   . GLN D 4 332 ? -14.097 149.324 13.861  1.00 46.72  ? 332 GLN B OE1   1 
ATOM 7617  N NE2   . GLN D 4 332 ? -13.907 149.416 16.111  1.00 49.94  ? 332 GLN B NE2   1 
ATOM 7618  N N     . GLY D 4 333 ? -9.694  149.049 17.235  1.00 37.28  ? 333 GLY B N     1 
ATOM 7619  C CA    . GLY D 4 333 ? -8.999  149.346 18.469  1.00 40.75  ? 333 GLY B CA    1 
ATOM 7620  C C     . GLY D 4 333 ? -7.627  148.716 18.632  1.00 42.60  ? 333 GLY B C     1 
ATOM 7621  O O     . GLY D 4 333 ? -7.364  147.596 18.170  1.00 42.14  ? 333 GLY B O     1 
ATOM 7622  N N     . GLN D 4 334 ? -6.749  149.474 19.289  1.00 44.74  ? 334 GLN B N     1 
ATOM 7623  C CA    . GLN D 4 334 ? -5.383  149.059 19.588  1.00 46.75  ? 334 GLN B CA    1 
ATOM 7624  C C     . GLN D 4 334 ? -5.426  147.756 20.391  1.00 45.82  ? 334 GLN B C     1 
ATOM 7625  O O     . GLN D 4 334 ? -6.317  147.539 21.225  1.00 46.01  ? 334 GLN B O     1 
ATOM 7626  C CB    . GLN D 4 334 ? -4.654  150.180 20.351  1.00 51.04  ? 334 GLN B CB    1 
ATOM 7627  C CG    . GLN D 4 334 ? -5.505  150.827 21.468  1.00 58.38  ? 334 GLN B CG    1 
ATOM 7628  C CD    . GLN D 4 334 ? -5.302  152.354 21.627  1.00 62.49  ? 334 GLN B CD    1 
ATOM 7629  O OE1   . GLN D 4 334 ? -4.321  152.810 22.236  1.00 64.21  ? 334 GLN B OE1   1 
ATOM 7630  N NE2   . GLN D 4 334 ? -6.261  153.141 21.117  1.00 64.14  ? 334 GLN B NE2   1 
ATOM 7631  N N     . GLY D 4 335 ? -4.496  146.864 20.081  1.00 44.62  ? 335 GLY B N     1 
ATOM 7632  C CA    . GLY D 4 335 ? -4.468  145.578 20.745  1.00 41.53  ? 335 GLY B CA    1 
ATOM 7633  C C     . GLY D 4 335 ? -5.286  144.508 20.020  1.00 40.07  ? 335 GLY B C     1 
ATOM 7634  O O     . GLY D 4 335 ? -4.765  143.747 19.201  1.00 39.98  ? 335 GLY B O     1 
ATOM 7635  N N     . GLN D 4 336 ? -6.593  144.523 20.251  1.00 37.34  ? 336 GLN B N     1 
ATOM 7636  C CA    . GLN D 4 336 ? -7.524  143.534 19.708  1.00 34.17  ? 336 GLN B CA    1 
ATOM 7637  C C     . GLN D 4 336 ? -7.892  143.678 18.230  1.00 30.81  ? 336 GLN B C     1 
ATOM 7638  O O     . GLN D 4 336 ? -7.720  144.753 17.656  1.00 30.70  ? 336 GLN B O     1 
ATOM 7639  C CB    . GLN D 4 336 ? -8.758  143.561 20.601  1.00 36.07  ? 336 GLN B CB    1 
ATOM 7640  C CG    . GLN D 4 336 ? -8.361  143.968 22.035  1.00 39.20  ? 336 GLN B CG    1 
ATOM 7641  C CD    . GLN D 4 336 ? -9.490  143.938 23.036  1.00 41.19  ? 336 GLN B CD    1 
ATOM 7642  O OE1   . GLN D 4 336 ? -10.536 143.344 22.793  1.00 43.40  ? 336 GLN B OE1   1 
ATOM 7643  N NE2   . GLN D 4 336 ? -9.274  144.570 24.186  1.00 41.70  ? 336 GLN B NE2   1 
ATOM 7644  N N     . TRP D 4 337 ? -8.325  142.575 17.607  1.00 27.09  ? 337 TRP B N     1 
ATOM 7645  C CA    . TRP D 4 337 ? -8.722  142.557 16.184  1.00 24.86  ? 337 TRP B CA    1 
ATOM 7646  C C     . TRP D 4 337 ? -9.909  141.625 15.915  1.00 24.02  ? 337 TRP B C     1 
ATOM 7647  O O     . TRP D 4 337 ? -10.255 140.789 16.749  1.00 22.04  ? 337 TRP B O     1 
ATOM 7648  C CB    . TRP D 4 337 ? -7.572  142.126 15.269  1.00 24.34  ? 337 TRP B CB    1 
ATOM 7649  C CG    . TRP D 4 337 ? -6.243  142.824 15.481  1.00 27.01  ? 337 TRP B CG    1 
ATOM 7650  C CD1   . TRP D 4 337 ? -5.494  142.850 16.630  1.00 26.88  ? 337 TRP B CD1   1 
ATOM 7651  C CD2   . TRP D 4 337 ? -5.493  143.548 14.501  1.00 26.62  ? 337 TRP B CD2   1 
ATOM 7652  N NE1   . TRP D 4 337 ? -4.326  143.547 16.425  1.00 26.19  ? 337 TRP B NE1   1 
ATOM 7653  C CE2   . TRP D 4 337 ? -4.297  143.986 15.127  1.00 28.07  ? 337 TRP B CE2   1 
ATOM 7654  C CE3   . TRP D 4 337 ? -5.713  143.874 13.153  1.00 27.86  ? 337 TRP B CE3   1 
ATOM 7655  C CZ2   . TRP D 4 337 ? -3.321  144.736 14.447  1.00 28.75  ? 337 TRP B CZ2   1 
ATOM 7656  C CZ3   . TRP D 4 337 ? -4.747  144.621 12.474  1.00 29.10  ? 337 TRP B CZ3   1 
ATOM 7657  C CH2   . TRP D 4 337 ? -3.562  145.043 13.126  1.00 29.04  ? 337 TRP B CH2   1 
ATOM 7658  N N     . THR D 4 338 ? -10.467 141.691 14.706  1.00 24.78  ? 338 THR B N     1 
ATOM 7659  C CA    . THR D 4 338 ? -11.648 140.878 14.403  1.00 24.77  ? 338 THR B CA    1 
ATOM 7660  C C     . THR D 4 338 ? -11.767 140.054 13.159  1.00 24.98  ? 338 THR B C     1 
ATOM 7661  O O     . THR D 4 338 ? -11.451 140.493 12.050  1.00 22.80  ? 338 THR B O     1 
ATOM 7662  C CB    . THR D 4 338 ? -12.919 141.702 14.387  1.00 25.71  ? 338 THR B CB    1 
ATOM 7663  O OG1   . THR D 4 338 ? -12.709 142.902 13.615  1.00 25.30  ? 338 THR B OG1   1 
ATOM 7664  C CG2   . THR D 4 338 ? -13.377 141.982 15.801  1.00 24.80  ? 338 THR B CG2   1 
ATOM 7665  N N     . TYR D 4 339 ? -12.481 138.953 13.354  1.00 26.31  ? 339 TYR B N     1 
ATOM 7666  C CA    . TYR D 4 339 ? -12.740 137.991 12.301  1.00 26.63  ? 339 TYR B CA    1 
ATOM 7667  C C     . TYR D 4 339 ? -14.222 137.646 12.230  1.00 25.42  ? 339 TYR B C     1 
ATOM 7668  O O     . TYR D 4 339 ? -14.953 137.724 13.230  1.00 22.98  ? 339 TYR B O     1 
ATOM 7669  C CB    . TYR D 4 339 ? -11.856 136.721 12.449  1.00 27.38  ? 339 TYR B CB    1 
ATOM 7670  C CG    . TYR D 4 339 ? -11.965 135.957 13.759  1.00 27.51  ? 339 TYR B CG    1 
ATOM 7671  C CD1   . TYR D 4 339 ? -12.785 134.828 13.862  1.00 28.95  ? 339 TYR B CD1   1 
ATOM 7672  C CD2   . TYR D 4 339 ? -11.263 136.371 14.900  1.00 27.96  ? 339 TYR B CD2   1 
ATOM 7673  C CE1   . TYR D 4 339 ? -12.918 134.132 15.069  1.00 29.44  ? 339 TYR B CE1   1 
ATOM 7674  C CE2   . TYR D 4 339 ? -11.385 135.684 16.116  1.00 29.54  ? 339 TYR B CE2   1 
ATOM 7675  C CZ    . TYR D 4 339 ? -12.219 134.565 16.194  1.00 29.64  ? 339 TYR B CZ    1 
ATOM 7676  O OH    . TYR D 4 339 ? -12.392 133.905 17.395  1.00 29.59  ? 339 TYR B OH    1 
ATOM 7677  N N     . GLN D 4 340 ? -14.657 137.427 10.990  1.00 25.07  ? 340 GLN B N     1 
ATOM 7678  C CA    . GLN D 4 340 ? -16.030 137.081 10.633  1.00 25.01  ? 340 GLN B CA    1 
ATOM 7679  C C     . GLN D 4 340 ? -15.876 136.164 9.423   1.00 24.98  ? 340 GLN B C     1 
ATOM 7680  O O     . GLN D 4 340 ? -15.078 136.467 8.533   1.00 24.27  ? 340 GLN B O     1 
ATOM 7681  C CB    . GLN D 4 340 ? -16.797 138.336 10.198  1.00 24.68  ? 340 GLN B CB    1 
ATOM 7682  C CG    . GLN D 4 340 ? -16.552 139.584 11.049  1.00 25.32  ? 340 GLN B CG    1 
ATOM 7683  C CD    . GLN D 4 340 ? -15.163 140.182 10.872  1.00 24.69  ? 340 GLN B CD    1 
ATOM 7684  O OE1   . GLN D 4 340 ? -14.435 140.390 11.844  1.00 23.69  ? 340 GLN B OE1   1 
ATOM 7685  N NE2   . GLN D 4 340 ? -14.791 140.449 9.633   1.00 26.00  ? 340 GLN B NE2   1 
ATOM 7686  N N     . ILE D 4 341 ? -16.610 135.052 9.380   1.00 24.74  ? 341 ILE B N     1 
ATOM 7687  C CA    . ILE D 4 341 ? -16.486 134.129 8.250   1.00 24.34  ? 341 ILE B CA    1 
ATOM 7688  C C     . ILE D 4 341 ? -17.793 133.749 7.604   1.00 24.91  ? 341 ILE B C     1 
ATOM 7689  O O     . ILE D 4 341 ? -18.756 133.402 8.283   1.00 24.99  ? 341 ILE B O     1 
ATOM 7690  C CB    . ILE D 4 341 ? -15.827 132.819 8.638   1.00 23.42  ? 341 ILE B CB    1 
ATOM 7691  C CG1   . ILE D 4 341 ? -14.618 133.075 9.529   1.00 21.64  ? 341 ILE B CG1   1 
ATOM 7692  C CG2   . ILE D 4 341 ? -15.411 132.083 7.374   1.00 23.17  ? 341 ILE B CG2   1 
ATOM 7693  C CD1   . ILE D 4 341 ? -14.111 131.846 10.215  1.00 20.59  ? 341 ILE B CD1   1 
ATOM 7694  N N     . TYR D 4 342 ? -17.765 133.676 6.282   1.00 25.65  ? 342 TYR B N     1 
ATOM 7695  C CA    . TYR D 4 342 ? -18.953 133.340 5.529   1.00 28.84  ? 342 TYR B CA    1 
ATOM 7696  C C     . TYR D 4 342 ? -18.578 133.008 4.120   1.00 28.95  ? 342 TYR B C     1 
ATOM 7697  O O     . TYR D 4 342 ? -17.416 133.091 3.724   1.00 26.34  ? 342 TYR B O     1 
ATOM 7698  C CB    . TYR D 4 342 ? -19.882 134.536 5.451   1.00 32.78  ? 342 TYR B CB    1 
ATOM 7699  C CG    . TYR D 4 342 ? -19.242 135.669 4.683   1.00 39.72  ? 342 TYR B CG    1 
ATOM 7700  C CD1   . TYR D 4 342 ? -19.646 135.985 3.387   1.00 41.68  ? 342 TYR B CD1   1 
ATOM 7701  C CD2   . TYR D 4 342 ? -18.178 136.390 5.234   1.00 41.69  ? 342 TYR B CD2   1 
ATOM 7702  C CE1   . TYR D 4 342 ? -19.007 136.998 2.650   1.00 43.23  ? 342 TYR B CE1   1 
ATOM 7703  C CE2   . TYR D 4 342 ? -17.530 137.398 4.512   1.00 43.11  ? 342 TYR B CE2   1 
ATOM 7704  C CZ    . TYR D 4 342 ? -17.946 137.696 3.225   1.00 43.76  ? 342 TYR B CZ    1 
ATOM 7705  O OH    . TYR D 4 342 ? -17.289 138.690 2.529   1.00 44.93  ? 342 TYR B OH    1 
ATOM 7706  N N     . GLN D 4 343 ? -19.624 132.740 3.354   1.00 30.60  ? 343 GLN B N     1 
ATOM 7707  C CA    . GLN D 4 343 ? -19.521 132.404 1.957   1.00 34.36  ? 343 GLN B CA    1 
ATOM 7708  C C     . GLN D 4 343 ? -20.434 133.404 1.291   1.00 36.29  ? 343 GLN B C     1 
ATOM 7709  O O     . GLN D 4 343 ? -20.122 133.922 0.222   1.00 37.66  ? 343 GLN B O     1 
ATOM 7710  C CB    . GLN D 4 343 ? -20.027 130.981 1.707   1.00 36.46  ? 343 GLN B CB    1 
ATOM 7711  C CG    . GLN D 4 343 ? -19.448 129.934 2.681   1.00 42.50  ? 343 GLN B CG    1 
ATOM 7712  C CD    . GLN D 4 343 ? -19.809 128.479 2.340   1.00 44.58  ? 343 GLN B CD    1 
ATOM 7713  O OE1   . GLN D 4 343 ? -20.473 127.785 3.119   1.00 44.87  ? 343 GLN B OE1   1 
ATOM 7714  N NE2   . GLN D 4 343 ? -19.332 128.005 1.198   1.00 46.73  ? 343 GLN B NE2   1 
ATOM 7715  N N     . GLU D 4 344 ? -21.558 133.698 1.943   1.00 38.92  ? 344 GLU B N     1 
ATOM 7716  C CA    . GLU D 4 344 ? -22.516 134.666 1.409   1.00 42.05  ? 344 GLU B CA    1 
ATOM 7717  C C     . GLU D 4 344 ? -22.490 135.974 2.177   1.00 42.30  ? 344 GLU B C     1 
ATOM 7718  O O     . GLU D 4 344 ? -22.484 135.990 3.411   1.00 42.26  ? 344 GLU B O     1 
ATOM 7719  C CB    . GLU D 4 344 ? -23.936 134.103 1.363   1.00 44.00  ? 344 GLU B CB    1 
ATOM 7720  C CG    . GLU D 4 344 ? -24.349 133.677 -0.038  1.00 49.50  ? 344 GLU B CG    1 
ATOM 7721  C CD    . GLU D 4 344 ? -25.746 133.079 -0.098  1.00 54.37  ? 344 GLU B CD    1 
ATOM 7722  O OE1   . GLU D 4 344 ? -26.153 132.407 0.880   1.00 58.14  ? 344 GLU B OE1   1 
ATOM 7723  O OE2   . GLU D 4 344 ? -26.436 133.271 -1.131  1.00 54.69  ? 344 GLU B OE2   1 
ATOM 7724  N N     . PRO D 4 345 ? -22.456 137.093 1.446   1.00 42.48  ? 345 PRO B N     1 
ATOM 7725  C CA    . PRO D 4 345 ? -22.422 138.455 1.987   1.00 44.03  ? 345 PRO B CA    1 
ATOM 7726  C C     . PRO D 4 345 ? -23.391 138.749 3.125   1.00 44.85  ? 345 PRO B C     1 
ATOM 7727  O O     . PRO D 4 345 ? -24.573 138.378 3.079   1.00 43.75  ? 345 PRO B O     1 
ATOM 7728  C CB    . PRO D 4 345 ? -22.722 139.319 0.761   1.00 43.48  ? 345 PRO B CB    1 
ATOM 7729  C CG    . PRO D 4 345 ? -23.432 138.365 -0.199  1.00 42.68  ? 345 PRO B CG    1 
ATOM 7730  C CD    . PRO D 4 345 ? -22.621 137.119 -0.015  1.00 42.01  ? 345 PRO B CD    1 
ATOM 7731  N N     . PHE D 4 346 ? -22.852 139.393 4.158   1.00 46.94  ? 346 PHE B N     1 
ATOM 7732  C CA    . PHE D 4 346 ? -23.608 139.803 5.341   1.00 49.67  ? 346 PHE B CA    1 
ATOM 7733  C C     . PHE D 4 346 ? -24.284 138.651 6.029   1.00 50.62  ? 346 PHE B C     1 
ATOM 7734  O O     . PHE D 4 346 ? -25.043 138.831 6.980   1.00 51.62  ? 346 PHE B O     1 
ATOM 7735  C CB    . PHE D 4 346 ? -24.591 140.925 4.981   1.00 50.36  ? 346 PHE B CB    1 
ATOM 7736  C CG    . PHE D 4 346 ? -23.905 142.142 4.435   1.00 51.30  ? 346 PHE B CG    1 
ATOM 7737  C CD1   . PHE D 4 346 ? -23.435 142.154 3.120   1.00 51.14  ? 346 PHE B CD1   1 
ATOM 7738  C CD2   . PHE D 4 346 ? -23.583 143.210 5.271   1.00 50.73  ? 346 PHE B CD2   1 
ATOM 7739  C CE1   . PHE D 4 346 ? -22.647 143.198 2.651   1.00 51.01  ? 346 PHE B CE1   1 
ATOM 7740  C CE2   . PHE D 4 346 ? -22.794 144.261 4.810   1.00 50.34  ? 346 PHE B CE2   1 
ATOM 7741  C CZ    . PHE D 4 346 ? -22.321 144.253 3.501   1.00 51.11  ? 346 PHE B CZ    1 
ATOM 7742  N N     . LYS D 4 347 ? -23.967 137.457 5.551   1.00 52.29  ? 347 LYS B N     1 
ATOM 7743  C CA    . LYS D 4 347 ? -24.509 136.231 6.094   1.00 54.08  ? 347 LYS B CA    1 
ATOM 7744  C C     . LYS D 4 347 ? -23.321 135.397 6.563   1.00 53.27  ? 347 LYS B C     1 
ATOM 7745  O O     . LYS D 4 347 ? -22.844 134.496 5.871   1.00 53.53  ? 347 LYS B O     1 
ATOM 7746  C CB    . LYS D 4 347 ? -25.344 135.502 5.027   1.00 57.04  ? 347 LYS B CB    1 
ATOM 7747  C CG    . LYS D 4 347 ? -26.753 136.074 4.825   1.00 60.01  ? 347 LYS B CG    1 
ATOM 7748  C CD    . LYS D 4 347 ? -27.568 135.943 6.123   1.00 63.84  ? 347 LYS B CD    1 
ATOM 7749  C CE    . LYS D 4 347 ? -29.028 136.405 5.981   1.00 67.65  ? 347 LYS B CE    1 
ATOM 7750  N NZ    . LYS D 4 347 ? -29.840 136.185 7.236   1.00 68.31  ? 347 LYS B NZ    1 
ATOM 7751  N N     . ASN D 4 348 ? -22.784 135.783 7.711   1.00 52.60  ? 348 ASN B N     1 
ATOM 7752  C CA    . ASN D 4 348 ? -21.644 135.090 8.282   1.00 52.42  ? 348 ASN B CA    1 
ATOM 7753  C C     . ASN D 4 348 ? -22.100 133.831 9.004   1.00 52.07  ? 348 ASN B C     1 
ATOM 7754  O O     . ASN D 4 348 ? -23.283 133.704 9.352   1.00 52.39  ? 348 ASN B O     1 
ATOM 7755  C CB    . ASN D 4 348 ? -20.865 136.017 9.224   1.00 53.00  ? 348 ASN B CB    1 
ATOM 7756  C CG    . ASN D 4 348 ? -21.726 137.134 9.793   1.00 53.67  ? 348 ASN B CG    1 
ATOM 7757  O OD1   . ASN D 4 348 ? -22.501 136.921 10.733  1.00 54.08  ? 348 ASN B OD1   1 
ATOM 7758  N ND2   . ASN D 4 348 ? -21.603 138.332 9.217   1.00 52.63  ? 348 ASN B ND2   1 
ATOM 7759  N N     . LEU D 4 349 ? -21.174 132.881 9.154   1.00 49.90  ? 349 LEU B N     1 
ATOM 7760  C CA    . LEU D 4 349 ? -21.446 131.619 9.834   1.00 45.97  ? 349 LEU B CA    1 
ATOM 7761  C C     . LEU D 4 349 ? -20.896 131.660 11.242  1.00 44.03  ? 349 LEU B C     1 
ATOM 7762  O O     . LEU D 4 349 ? -21.338 130.903 12.109  1.00 44.39  ? 349 LEU B O     1 
ATOM 7763  C CB    . LEU D 4 349 ? -20.820 130.444 9.093   1.00 44.93  ? 349 LEU B CB    1 
ATOM 7764  C CG    . LEU D 4 349 ? -21.407 130.024 7.748   1.00 45.77  ? 349 LEU B CG    1 
ATOM 7765  C CD1   . LEU D 4 349 ? -20.954 130.986 6.655   1.00 44.95  ? 349 LEU B CD1   1 
ATOM 7766  C CD2   . LEU D 4 349 ? -20.963 128.594 7.432   1.00 45.22  ? 349 LEU B CD2   1 
ATOM 7767  N N     . LYS D 4 350 ? -19.894 132.512 11.444  1.00 42.07  ? 350 LYS B N     1 
ATOM 7768  C CA    . LYS D 4 350 ? -19.272 132.689 12.748  1.00 40.38  ? 350 LYS B CA    1 
ATOM 7769  C C     . LYS D 4 350 ? -18.454 133.966 12.743  1.00 39.38  ? 350 LYS B C     1 
ATOM 7770  O O     . LYS D 4 350 ? -18.057 134.461 11.684  1.00 38.64  ? 350 LYS B O     1 
ATOM 7771  C CB    . LYS D 4 350 ? -18.384 131.498 13.120  1.00 39.73  ? 350 LYS B CB    1 
ATOM 7772  C CG    . LYS D 4 350 ? -17.819 131.593 14.523  1.00 37.84  ? 350 LYS B CG    1 
ATOM 7773  C CD    . LYS D 4 350 ? -16.853 130.468 14.816  1.00 38.46  ? 350 LYS B CD    1 
ATOM 7774  C CE    . LYS D 4 350 ? -16.245 130.587 16.220  1.00 38.79  ? 350 LYS B CE    1 
ATOM 7775  N NZ    . LYS D 4 350 ? -15.321 131.750 16.385  1.00 37.87  ? 350 LYS B NZ    1 
ATOM 7776  N N     . THR D 4 351 ? -18.207 134.485 13.941  1.00 39.65  ? 351 THR B N     1 
ATOM 7777  C CA    . THR D 4 351 ? -17.454 135.718 14.133  1.00 40.66  ? 351 THR B CA    1 
ATOM 7778  C C     . THR D 4 351 ? -16.582 135.604 15.370  1.00 40.28  ? 351 THR B C     1 
ATOM 7779  O O     . THR D 4 351 ? -16.744 134.671 16.159  1.00 41.16  ? 351 THR B O     1 
ATOM 7780  C CB    . THR D 4 351 ? -18.408 136.910 14.364  1.00 42.68  ? 351 THR B CB    1 
ATOM 7781  O OG1   . THR D 4 351 ? -19.350 136.580 15.397  1.00 42.79  ? 351 THR B OG1   1 
ATOM 7782  C CG2   . THR D 4 351 ? -19.157 137.255 13.087  1.00 44.21  ? 351 THR B CG2   1 
ATOM 7783  N N     . GLY D 4 352 ? -15.693 136.575 15.567  1.00 39.18  ? 352 GLY B N     1 
ATOM 7784  C CA    . GLY D 4 352 ? -14.839 136.539 16.737  1.00 37.52  ? 352 GLY B CA    1 
ATOM 7785  C C     . GLY D 4 352 ? -13.826 137.653 16.834  1.00 37.10  ? 352 GLY B C     1 
ATOM 7786  O O     . GLY D 4 352 ? -13.738 138.536 15.970  1.00 36.46  ? 352 GLY B O     1 
ATOM 7787  N N     . LYS D 4 353 ? -12.994 137.543 17.861  1.00 38.53  ? 353 LYS B N     1 
ATOM 7788  C CA    . LYS D 4 353 ? -11.964 138.532 18.131  1.00 42.32  ? 353 LYS B CA    1 
ATOM 7789  C C     . LYS D 4 353 ? -10.631 137.974 18.600  1.00 42.83  ? 353 LYS B C     1 
ATOM 7790  O O     . LYS D 4 353 ? -10.550 137.356 19.656  1.00 43.65  ? 353 LYS B O     1 
ATOM 7791  C CB    . LYS D 4 353 ? -12.458 139.487 19.229  1.00 46.25  ? 353 LYS B CB    1 
ATOM 7792  C CG    . LYS D 4 353 ? -11.335 140.261 20.000  1.00 50.35  ? 353 LYS B CG    1 
ATOM 7793  C CD    . LYS D 4 353 ? -11.714 140.623 21.475  1.00 53.43  ? 353 LYS B CD    1 
ATOM 7794  C CE    . LYS D 4 353 ? -11.640 139.417 22.455  1.00 54.94  ? 353 LYS B CE    1 
ATOM 7795  N NZ    . LYS D 4 353 ? -12.023 139.724 23.887  1.00 53.92  ? 353 LYS B NZ    1 
ATOM 7796  N N     . TYR D 4 354 ? -9.579  138.157 17.824  1.00 43.45  ? 354 TYR B N     1 
ATOM 7797  C CA    . TYR D 4 354 ? -8.299  137.739 18.350  1.00 45.06  ? 354 TYR B CA    1 
ATOM 7798  C C     . TYR D 4 354 ? -7.812  139.033 18.966  1.00 45.81  ? 354 TYR B C     1 
ATOM 7799  O O     . TYR D 4 354 ? -7.735  140.069 18.308  1.00 45.06  ? 354 TYR B O     1 
ATOM 7800  C CB    . TYR D 4 354 ? -7.326  137.280 17.279  1.00 46.76  ? 354 TYR B CB    1 
ATOM 7801  C CG    . TYR D 4 354 ? -5.895  137.151 17.780  1.00 48.85  ? 354 TYR B CG    1 
ATOM 7802  C CD1   . TYR D 4 354 ? -5.615  136.696 19.075  1.00 48.35  ? 354 TYR B CD1   1 
ATOM 7803  C CD2   . TYR D 4 354 ? -4.817  137.475 16.947  1.00 48.84  ? 354 TYR B CD2   1 
ATOM 7804  C CE1   . TYR D 4 354 ? -4.303  136.571 19.520  1.00 48.71  ? 354 TYR B CE1   1 
ATOM 7805  C CE2   . TYR D 4 354 ? -3.502  137.350 17.381  1.00 49.03  ? 354 TYR B CE2   1 
ATOM 7806  C CZ    . TYR D 4 354 ? -3.250  136.896 18.661  1.00 49.92  ? 354 TYR B CZ    1 
ATOM 7807  O OH    . TYR D 4 354 ? -1.944  136.740 19.061  1.00 50.96  ? 354 TYR B OH    1 
ATOM 7808  N N     . ALA D 4 355 ? -7.556  139.001 20.254  1.00 47.70  ? 355 ALA B N     1 
ATOM 7809  C CA    . ALA D 4 355 ? -7.095  140.201 20.893  1.00 50.63  ? 355 ALA B CA    1 
ATOM 7810  C C     . ALA D 4 355 ? -5.579  140.184 21.067  1.00 53.41  ? 355 ALA B C     1 
ATOM 7811  O O     . ALA D 4 355 ? -4.847  139.486 20.360  1.00 52.01  ? 355 ALA B O     1 
ATOM 7812  C CB    . ALA D 4 355 ? -7.804  140.363 22.229  1.00 50.03  ? 355 ALA B CB    1 
ATOM 7813  N N     . ARG D 4 356 ? -5.132  141.020 21.991  1.00 58.32  ? 356 ARG B N     1 
ATOM 7814  C CA    . ARG D 4 356 ? -3.740  141.169 22.384  1.00 63.12  ? 356 ARG B CA    1 
ATOM 7815  C C     . ARG D 4 356 ? -3.207  139.797 22.789  1.00 65.87  ? 356 ARG B C     1 
ATOM 7816  O O     . ARG D 4 356 ? -3.990  138.911 23.150  1.00 65.97  ? 356 ARG B O     1 
ATOM 7817  C CB    . ARG D 4 356 ? -3.692  142.108 23.606  1.00 65.09  ? 356 ARG B CB    1 
ATOM 7818  C CG    . ARG D 4 356 ? -5.078  142.288 24.297  1.00 67.88  ? 356 ARG B CG    1 
ATOM 7819  C CD    . ARG D 4 356 ? -5.066  143.066 25.628  1.00 71.21  ? 356 ARG B CD    1 
ATOM 7820  N NE    . ARG D 4 356 ? -6.428  143.376 26.104  1.00 74.85  ? 356 ARG B NE    1 
ATOM 7821  C CZ    . ARG D 4 356 ? -6.846  143.301 27.375  1.00 76.18  ? 356 ARG B CZ    1 
ATOM 7822  N NH1   . ARG D 4 356 ? -6.017  142.919 28.347  1.00 76.73  ? 356 ARG B NH1   1 
ATOM 7823  N NH2   . ARG D 4 356 ? -8.107  143.608 27.680  1.00 75.62  ? 356 ARG B NH2   1 
ATOM 7824  N N     . MET D 4 357 ? -1.896  139.594 22.683  1.00 69.17  ? 357 MET B N     1 
ATOM 7825  C CA    . MET D 4 357 ? -1.331  138.317 23.108  1.00 72.47  ? 357 MET B CA    1 
ATOM 7826  C C     . MET D 4 357 ? -0.462  138.496 24.357  1.00 73.22  ? 357 MET B C     1 
ATOM 7827  O O     . MET D 4 357 ? 0.564   137.831 24.531  1.00 73.46  ? 357 MET B O     1 
ATOM 7828  C CB    . MET D 4 357 ? -0.577  137.607 21.977  1.00 74.67  ? 357 MET B CB    1 
ATOM 7829  C CG    . MET D 4 357 ? -0.247  136.131 22.294  1.00 77.46  ? 357 MET B CG    1 
ATOM 7830  S SD    . MET D 4 357 ? -1.596  135.201 23.124  1.00 81.31  ? 357 MET B SD    1 
ATOM 7831  C CE    . MET D 4 357 ? -1.027  135.121 24.897  1.00 79.61  ? 357 MET B CE    1 
ATOM 7832  N N     . ARG D 4 358 ? -0.923  139.393 25.232  1.00 74.41  ? 358 ARG B N     1 
ATOM 7833  C CA    . ARG D 4 358 ? -0.282  139.733 26.509  1.00 75.71  ? 358 ARG B CA    1 
ATOM 7834  C C     . ARG D 4 358 ? 1.261   139.707 26.510  1.00 75.67  ? 358 ARG B C     1 
ATOM 7835  O O     . ARG D 4 358 ? 1.895   139.334 27.504  1.00 76.66  ? 358 ARG B O     1 
ATOM 7836  C CB    . ARG D 4 358 ? -0.863  138.863 27.646  1.00 77.53  ? 358 ARG B CB    1 
ATOM 7837  C CG    . ARG D 4 358 ? -0.883  139.547 29.023  1.00 78.36  ? 358 ARG B CG    1 
ATOM 7838  C CD    . ARG D 4 358 ? -1.468  138.654 30.122  1.00 79.06  ? 358 ARG B CD    1 
ATOM 7839  N NE    . ARG D 4 358 ? -1.272  139.245 31.448  1.00 79.81  ? 358 ARG B NE    1 
ATOM 7840  C CZ    . ARG D 4 358 ? -1.601  138.667 32.604  1.00 79.70  ? 358 ARG B CZ    1 
ATOM 7841  N NH1   . ARG D 4 358 ? -2.159  137.463 32.630  1.00 79.29  ? 358 ARG B NH1   1 
ATOM 7842  N NH2   . ARG D 4 358 ? -1.362  139.300 33.744  1.00 79.05  ? 358 ARG B NH2   1 
ATOM 7843  N N     . GLY D 4 359 ? 1.852   140.115 25.387  1.00 74.85  ? 359 GLY B N     1 
ATOM 7844  C CA    . GLY D 4 359 ? 3.298   140.159 25.256  1.00 73.37  ? 359 GLY B CA    1 
ATOM 7845  C C     . GLY D 4 359 ? 3.698   141.498 24.663  1.00 72.58  ? 359 GLY B C     1 
ATOM 7846  O O     . GLY D 4 359 ? 3.046   141.986 23.730  1.00 72.20  ? 359 GLY B O     1 
ATOM 7847  N N     . ALA D 4 360 ? 4.767   142.092 25.194  1.00 71.54  ? 360 ALA B N     1 
ATOM 7848  C CA    . ALA D 4 360 ? 5.259   143.394 24.730  1.00 70.03  ? 360 ALA B CA    1 
ATOM 7849  C C     . ALA D 4 360 ? 5.596   143.432 23.234  1.00 68.97  ? 360 ALA B C     1 
ATOM 7850  O O     . ALA D 4 360 ? 6.053   144.460 22.718  1.00 68.77  ? 360 ALA B O     1 
ATOM 7851  C CB    . ALA D 4 360 ? 6.463   143.827 25.559  1.00 70.00  ? 360 ALA B CB    1 
ATOM 7852  N N     . HIS D 4 361 ? 5.377   142.297 22.562  1.00 67.38  ? 361 HIS B N     1 
ATOM 7853  C CA    . HIS D 4 361 ? 5.610   142.136 21.128  1.00 64.57  ? 361 HIS B CA    1 
ATOM 7854  C C     . HIS D 4 361 ? 4.563   142.941 20.353  1.00 61.90  ? 361 HIS B C     1 
ATOM 7855  O O     . HIS D 4 361 ? 3.597   142.409 19.790  1.00 60.95  ? 361 HIS B O     1 
ATOM 7856  C CB    . HIS D 4 361 ? 5.576   140.646 20.743  1.00 65.85  ? 361 HIS B CB    1 
ATOM 7857  C CG    . HIS D 4 361 ? 4.433   139.887 21.345  1.00 66.13  ? 361 HIS B CG    1 
ATOM 7858  N ND1   . HIS D 4 361 ? 3.116   140.140 21.024  1.00 67.52  ? 361 HIS B ND1   1 
ATOM 7859  C CD2   . HIS D 4 361 ? 4.410   138.889 22.259  1.00 66.61  ? 361 HIS B CD2   1 
ATOM 7860  C CE1   . HIS D 4 361 ? 2.332   139.334 21.715  1.00 67.85  ? 361 HIS B CE1   1 
ATOM 7861  N NE2   . HIS D 4 361 ? 3.093   138.565 22.472  1.00 67.58  ? 361 HIS B NE2   1 
ATOM 7862  N N     . THR D 4 362 ? 4.764   144.250 20.387  1.00 58.83  ? 362 THR B N     1 
ATOM 7863  C CA    . THR D 4 362 ? 3.898   145.217 19.731  1.00 56.23  ? 362 THR B CA    1 
ATOM 7864  C C     . THR D 4 362 ? 4.260   145.323 18.240  1.00 52.26  ? 362 THR B C     1 
ATOM 7865  O O     . THR D 4 362 ? 5.334   145.820 17.885  1.00 52.72  ? 362 THR B O     1 
ATOM 7866  C CB    . THR D 4 362 ? 4.017   146.601 20.452  1.00 57.80  ? 362 THR B CB    1 
ATOM 7867  O OG1   . THR D 4 362 ? 5.383   146.828 20.850  1.00 58.31  ? 362 THR B OG1   1 
ATOM 7868  C CG2   . THR D 4 362 ? 3.114   146.644 21.701  1.00 57.93  ? 362 THR B CG2   1 
ATOM 7869  N N     . ASN D 4 363 ? 3.384   144.822 17.372  1.00 46.90  ? 363 ASN B N     1 
ATOM 7870  C CA    . ASN D 4 363 ? 3.657   144.863 15.942  1.00 42.29  ? 363 ASN B CA    1 
ATOM 7871  C C     . ASN D 4 363 ? 2.451   144.528 15.107  1.00 39.65  ? 363 ASN B C     1 
ATOM 7872  O O     . ASN D 4 363 ? 2.198   143.361 14.802  1.00 37.65  ? 363 ASN B O     1 
ATOM 7873  C CB    . ASN D 4 363 ? 4.779   143.901 15.594  1.00 42.51  ? 363 ASN B CB    1 
ATOM 7874  C CG    . ASN D 4 363 ? 5.023   143.802 14.106  1.00 42.37  ? 363 ASN B CG    1 
ATOM 7875  O OD1   . ASN D 4 363 ? 4.094   143.657 13.303  1.00 40.82  ? 363 ASN B OD1   1 
ATOM 7876  N ND2   . ASN D 4 363 ? 6.288   143.843 13.730  1.00 43.43  ? 363 ASN B ND2   1 
ATOM 7877  N N     . ASP D 4 364 ? 1.782   145.575 14.647  1.00 38.67  ? 364 ASP B N     1 
ATOM 7878  C CA    . ASP D 4 364 ? 0.582   145.457 13.841  1.00 38.14  ? 364 ASP B CA    1 
ATOM 7879  C C     . ASP D 4 364 ? 0.460   144.179 13.051  1.00 36.10  ? 364 ASP B C     1 
ATOM 7880  O O     . ASP D 4 364 ? -0.349  143.313 13.362  1.00 35.74  ? 364 ASP B O     1 
ATOM 7881  C CB    . ASP D 4 364 ? 0.476   146.639 12.888  1.00 41.08  ? 364 ASP B CB    1 
ATOM 7882  C CG    . ASP D 4 364 ? -0.694  147.526 13.213  1.00 43.12  ? 364 ASP B CG    1 
ATOM 7883  O OD1   . ASP D 4 364 ? -1.536  147.103 14.041  1.00 43.94  ? 364 ASP B OD1   1 
ATOM 7884  O OD2   . ASP D 4 364 ? -0.769  148.642 12.650  1.00 43.81  ? 364 ASP B OD2   1 
ATOM 7885  N N     . VAL D 4 365 ? 1.336   144.044 12.072  1.00 34.24  ? 365 VAL B N     1 
ATOM 7886  C CA    . VAL D 4 365 ? 1.345   142.888 11.195  1.00 32.90  ? 365 VAL B CA    1 
ATOM 7887  C C     . VAL D 4 365 ? 1.323   141.586 11.949  1.00 31.46  ? 365 VAL B C     1 
ATOM 7888  O O     . VAL D 4 365 ? 0.408   140.772 11.779  1.00 28.94  ? 365 VAL B O     1 
ATOM 7889  C CB    . VAL D 4 365 ? 2.602   142.855 10.345  1.00 33.45  ? 365 VAL B CB    1 
ATOM 7890  C CG1   . VAL D 4 365 ? 2.271   142.305 8.974   1.00 34.37  ? 365 VAL B CG1   1 
ATOM 7891  C CG2   . VAL D 4 365 ? 3.233   144.226 10.275  1.00 34.16  ? 365 VAL B CG2   1 
ATOM 7892  N N     . LYS D 4 366 ? 2.380   141.397 12.739  1.00 30.40  ? 366 LYS B N     1 
ATOM 7893  C CA    . LYS D 4 366 ? 2.581   140.210 13.549  1.00 28.87  ? 366 LYS B CA    1 
ATOM 7894  C C     . LYS D 4 366 ? 1.219   139.727 13.997  1.00 28.05  ? 366 LYS B C     1 
ATOM 7895  O O     . LYS D 4 366 ? 0.806   138.607 13.699  1.00 28.98  ? 366 LYS B O     1 
ATOM 7896  C CB    . LYS D 4 366 ? 3.464   140.557 14.749  1.00 28.03  ? 366 LYS B CB    1 
ATOM 7897  C CG    . LYS D 4 366 ? 3.864   139.388 15.638  1.00 27.97  ? 366 LYS B CG    1 
ATOM 7898  C CD    . LYS D 4 366 ? 4.862   139.853 16.708  1.00 28.48  ? 366 LYS B CD    1 
ATOM 7899  C CE    . LYS D 4 366 ? 5.317   138.734 17.649  1.00 28.86  ? 366 LYS B CE    1 
ATOM 7900  N NZ    . LYS D 4 366 ? 4.277   138.288 18.637  1.00 28.85  ? 366 LYS B NZ    1 
ATOM 7901  N N     . GLN D 4 367 ? 0.448   140.644 14.553  1.00 26.25  ? 367 GLN B N     1 
ATOM 7902  C CA    . GLN D 4 367 ? -0.875  140.283 15.009  1.00 26.18  ? 367 GLN B CA    1 
ATOM 7903  C C     . GLN D 4 367 ? -1.749  139.821 13.855  1.00 20.69  ? 367 GLN B C     1 
ATOM 7904  O O     . GLN D 4 367 ? -2.283  138.723 13.870  1.00 18.38  ? 367 GLN B O     1 
ATOM 7905  C CB    . GLN D 4 367 ? -1.526  141.457 15.744  1.00 33.55  ? 367 GLN B CB    1 
ATOM 7906  C CG    . GLN D 4 367 ? -0.846  141.840 17.069  1.00 41.95  ? 367 GLN B CG    1 
ATOM 7907  C CD    . GLN D 4 367 ? 0.354   142.763 16.883  1.00 46.85  ? 367 GLN B CD    1 
ATOM 7908  O OE1   . GLN D 4 367 ? 0.190   143.928 16.508  1.00 50.04  ? 367 GLN B OE1   1 
ATOM 7909  N NE2   . GLN D 4 367 ? 1.565   142.252 17.148  1.00 47.99  ? 367 GLN B NE2   1 
ATOM 7910  N N     . LEU D 4 368 ? -1.836  140.651 12.833  1.00 16.99  ? 368 LEU B N     1 
ATOM 7911  C CA    . LEU D 4 368 ? -2.646  140.340 11.682  1.00 16.67  ? 368 LEU B CA    1 
ATOM 7912  C C     . LEU D 4 368 ? -2.389  138.915 11.231  1.00 16.52  ? 368 LEU B C     1 
ATOM 7913  O O     . LEU D 4 368 ? -3.307  138.096 11.067  1.00 15.34  ? 368 LEU B O     1 
ATOM 7914  C CB    . LEU D 4 368 ? -2.310  141.316 10.566  1.00 16.81  ? 368 LEU B CB    1 
ATOM 7915  C CG    . LEU D 4 368 ? -2.870  140.959 9.193   1.00 19.21  ? 368 LEU B CG    1 
ATOM 7916  C CD1   . LEU D 4 368 ? -4.349  140.623 9.279   1.00 20.06  ? 368 LEU B CD1   1 
ATOM 7917  C CD2   . LEU D 4 368 ? -2.626  142.114 8.258   1.00 18.89  ? 368 LEU B CD2   1 
ATOM 7918  N N     . THR D 4 369 ? -1.115  138.620 11.054  1.00 15.61  ? 369 THR B N     1 
ATOM 7919  C CA    . THR D 4 369 ? -0.707  137.304 10.628  1.00 13.86  ? 369 THR B CA    1 
ATOM 7920  C C     . THR D 4 369 ? -1.261  136.332 11.659  1.00 11.06  ? 369 THR B C     1 
ATOM 7921  O O     . THR D 4 369 ? -2.185  135.579 11.389  1.00 7.64   ? 369 THR B O     1 
ATOM 7922  C CB    . THR D 4 369 ? 0.831   137.228 10.592  1.00 16.59  ? 369 THR B CB    1 
ATOM 7923  O OG1   . THR D 4 369 ? 1.332   136.874 11.889  1.00 20.57  ? 369 THR B OG1   1 
ATOM 7924  C CG2   . THR D 4 369 ? 1.428   138.592 10.219  1.00 14.04  ? 369 THR B CG2   1 
ATOM 7925  N N     . GLU D 4 370 ? -0.786  136.484 12.885  1.00 9.91   ? 370 GLU B N     1 
ATOM 7926  C CA    . GLU D 4 370 ? -1.206  135.640 13.973  1.00 12.20  ? 370 GLU B CA    1 
ATOM 7927  C C     . GLU D 4 370 ? -2.706  135.473 13.893  1.00 11.82  ? 370 GLU B C     1 
ATOM 7928  O O     . GLU D 4 370 ? -3.234  134.369 14.013  1.00 11.57  ? 370 GLU B O     1 
ATOM 7929  C CB    . GLU D 4 370 ? -0.815  136.269 15.308  1.00 16.09  ? 370 GLU B CB    1 
ATOM 7930  C CG    . GLU D 4 370 ? 0.696   136.432 15.506  1.00 22.02  ? 370 GLU B CG    1 
ATOM 7931  C CD    . GLU D 4 370 ? 1.111   136.678 16.969  1.00 27.63  ? 370 GLU B CD    1 
ATOM 7932  O OE1   . GLU D 4 370 ? 2.301   136.448 17.301  1.00 30.15  ? 370 GLU B OE1   1 
ATOM 7933  O OE2   . GLU D 4 370 ? 0.261   137.087 17.798  1.00 29.40  ? 370 GLU B OE2   1 
ATOM 7934  N N     . ALA D 4 371 ? -3.368  136.565 13.545  1.00 11.80  ? 371 ALA B N     1 
ATOM 7935  C CA    . ALA D 4 371 ? -4.806  136.565 13.436  1.00 10.89  ? 371 ALA B CA    1 
ATOM 7936  C C     . ALA D 4 371 ? -5.212  135.521 12.457  1.00 10.35  ? 371 ALA B C     1 
ATOM 7937  O O     . ALA D 4 371 ? -5.731  134.476 12.848  1.00 9.66   ? 371 ALA B O     1 
ATOM 7938  C CB    . ALA D 4 371 ? -5.287  137.879 12.975  1.00 10.30  ? 371 ALA B CB    1 
ATOM 7939  N N     . VAL D 4 372 ? -4.890  135.765 11.195  1.00 9.60   ? 372 VAL B N     1 
ATOM 7940  C CA    . VAL D 4 372 ? -5.273  134.826 10.166  1.00 12.61  ? 372 VAL B CA    1 
ATOM 7941  C C     . VAL D 4 372 ? -4.974  133.400 10.560  1.00 14.57  ? 372 VAL B C     1 
ATOM 7942  O O     . VAL D 4 372 ? -5.857  132.551 10.544  1.00 13.84  ? 372 VAL B O     1 
ATOM 7943  C CB    . VAL D 4 372 ? -4.634  135.139 8.810   1.00 12.29  ? 372 VAL B CB    1 
ATOM 7944  C CG1   . VAL D 4 372 ? -5.332  136.291 8.184   1.00 12.74  ? 372 VAL B CG1   1 
ATOM 7945  C CG2   . VAL D 4 372 ? -3.179  135.483 8.965   1.00 12.15  ? 372 VAL B CG2   1 
ATOM 7946  N N     . GLN D 4 373 ? -3.769  133.171 11.056  1.00 17.05  ? 373 GLN B N     1 
ATOM 7947  C CA    . GLN D 4 373 ? -3.402  131.824 11.440  1.00 18.69  ? 373 GLN B CA    1 
ATOM 7948  C C     . GLN D 4 373 ? -4.448  131.259 12.392  1.00 17.61  ? 373 GLN B C     1 
ATOM 7949  O O     . GLN D 4 373 ? -5.309  130.474 11.966  1.00 14.78  ? 373 GLN B O     1 
ATOM 7950  C CB    . GLN D 4 373 ? -1.953  131.776 11.977  1.00 21.90  ? 373 GLN B CB    1 
ATOM 7951  C CG    . GLN D 4 373 ? -0.926  132.130 10.849  1.00 27.48  ? 373 GLN B CG    1 
ATOM 7952  C CD    . GLN D 4 373 ? 0.569   131.936 11.183  1.00 30.26  ? 373 GLN B CD    1 
ATOM 7953  O OE1   . GLN D 4 373 ? 1.025   130.816 11.446  1.00 32.14  ? 373 GLN B OE1   1 
ATOM 7954  N NE2   . GLN D 4 373 ? 1.348   133.021 11.079  1.00 29.16  ? 373 GLN B NE2   1 
ATOM 7955  N N     . LYS D 4 374 ? -4.496  131.791 13.610  1.00 18.84  ? 374 LYS B N     1 
ATOM 7956  C CA    . LYS D 4 374 ? -5.469  131.306 14.591  1.00 20.15  ? 374 LYS B CA    1 
ATOM 7957  C C     . LYS D 4 374 ? -6.903  131.367 14.050  1.00 18.85  ? 374 LYS B C     1 
ATOM 7958  O O     . LYS D 4 374 ? -7.773  130.581 14.440  1.00 18.57  ? 374 LYS B O     1 
ATOM 7959  C CB    . LYS D 4 374 ? -5.314  132.009 15.958  1.00 22.00  ? 374 LYS B CB    1 
ATOM 7960  C CG    . LYS D 4 374 ? -4.554  131.139 17.029  1.00 23.77  ? 374 LYS B CG    1 
ATOM 7961  C CD    . LYS D 4 374 ? -4.410  131.833 18.428  1.00 24.86  ? 374 LYS B CD    1 
ATOM 7962  C CE    . LYS D 4 374 ? -3.681  130.965 19.496  1.00 22.60  ? 374 LYS B CE    1 
ATOM 7963  N NZ    . LYS D 4 374 ? -3.414  131.695 20.780  1.00 14.74  ? 374 LYS B NZ    1 
ATOM 7964  N N     . ILE D 4 375 ? -7.134  132.254 13.099  1.00 17.00  ? 375 ILE B N     1 
ATOM 7965  C CA    . ILE D 4 375 ? -8.450  132.323 12.512  1.00 15.89  ? 375 ILE B CA    1 
ATOM 7966  C C     . ILE D 4 375 ? -8.601  131.046 11.701  1.00 15.71  ? 375 ILE B C     1 
ATOM 7967  O O     . ILE D 4 375 ? -9.461  130.210 11.967  1.00 15.98  ? 375 ILE B O     1 
ATOM 7968  C CB    . ILE D 4 375 ? -8.587  133.552 11.599  1.00 13.37  ? 375 ILE B CB    1 
ATOM 7969  C CG1   . ILE D 4 375 ? -8.729  134.800 12.459  1.00 11.35  ? 375 ILE B CG1   1 
ATOM 7970  C CG2   . ILE D 4 375 ? -9.769  133.403 10.664  1.00 9.65   ? 375 ILE B CG2   1 
ATOM 7971  C CD1   . ILE D 4 375 ? -8.637  136.051 11.685  1.00 11.82  ? 375 ILE B CD1   1 
ATOM 7972  N N     . THR D 4 376 ? -7.653  130.847 10.806  1.00 15.75  ? 376 THR B N     1 
ATOM 7973  C CA    . THR D 4 376 ? -7.659  129.701 9.915   1.00 17.30  ? 376 THR B CA    1 
ATOM 7974  C C     . THR D 4 376 ? -7.870  128.381 10.624  1.00 14.55  ? 376 THR B C     1 
ATOM 7975  O O     . THR D 4 376 ? -8.830  127.656 10.378  1.00 11.16  ? 376 THR B O     1 
ATOM 7976  C CB    . THR D 4 376 ? -6.335  129.619 9.148   1.00 19.82  ? 376 THR B CB    1 
ATOM 7977  O OG1   . THR D 4 376 ? -5.952  130.935 8.711   1.00 21.42  ? 376 THR B OG1   1 
ATOM 7978  C CG2   . THR D 4 376 ? -6.480  128.672 7.937   1.00 20.23  ? 376 THR B CG2   1 
ATOM 7979  N N     . THR D 4 377 ? -6.895  128.052 11.449  1.00 14.55  ? 377 THR B N     1 
ATOM 7980  C CA    . THR D 4 377 ? -6.895  126.835 12.236  1.00 16.93  ? 377 THR B CA    1 
ATOM 7981  C C     . THR D 4 377 ? -8.320  126.544 12.631  1.00 15.19  ? 377 THR B C     1 
ATOM 7982  O O     . THR D 4 377 ? -8.912  125.546 12.233  1.00 13.33  ? 377 THR B O     1 
ATOM 7983  C CB    . THR D 4 377 ? -6.092  127.083 13.500  1.00 17.53  ? 377 THR B CB    1 
ATOM 7984  O OG1   . THR D 4 377 ? -5.892  128.498 13.629  1.00 18.35  ? 377 THR B OG1   1 
ATOM 7985  C CG2   . THR D 4 377 ? -4.737  126.366 13.445  1.00 18.27  ? 377 THR B CG2   1 
ATOM 7986  N N     . GLU D 4 378 ? -8.891  127.541 13.279  1.00 16.05  ? 378 GLU B N     1 
ATOM 7987  C CA    . GLU D 4 378 ? -10.242 127.500 13.750  1.00 18.49  ? 378 GLU B CA    1 
ATOM 7988  C C     . GLU D 4 378 ? -11.168 127.059 12.634  1.00 17.35  ? 378 GLU B C     1 
ATOM 7989  O O     . GLU D 4 378 ? -11.895 126.085 12.771  1.00 17.40  ? 378 GLU B O     1 
ATOM 7990  C CB    . GLU D 4 378 ? -10.603 128.893 14.223  1.00 22.05  ? 378 GLU B CB    1 
ATOM 7991  C CG    . GLU D 4 378 ? -11.919 129.006 14.919  1.00 28.91  ? 378 GLU B CG    1 
ATOM 7992  C CD    . GLU D 4 378 ? -11.899 130.115 15.951  1.00 33.09  ? 378 GLU B CD    1 
ATOM 7993  O OE1   . GLU D 4 378 ? -11.133 129.977 16.935  1.00 33.93  ? 378 GLU B OE1   1 
ATOM 7994  O OE2   . GLU D 4 378 ? -12.631 131.120 15.774  1.00 35.60  ? 378 GLU B OE2   1 
ATOM 7995  N N     . SER D 4 379 ? -11.069 127.724 11.495  1.00 16.56  ? 379 SER B N     1 
ATOM 7996  C CA    . SER D 4 379 ? -11.918 127.395 10.360  1.00 16.66  ? 379 SER B CA    1 
ATOM 7997  C C     . SER D 4 379 ? -11.715 125.964 9.863   1.00 17.14  ? 379 SER B C     1 
ATOM 7998  O O     . SER D 4 379 ? -12.670 125.267 9.473   1.00 16.05  ? 379 SER B O     1 
ATOM 7999  C CB    . SER D 4 379 ? -11.644 128.371 9.217   1.00 16.52  ? 379 SER B CB    1 
ATOM 8000  O OG    . SER D 4 379 ? -10.341 128.196 8.682   1.00 14.29  ? 379 SER B OG    1 
ATOM 8001  N N     . ILE D 4 380 ? -10.457 125.540 9.870   1.00 18.35  ? 380 ILE B N     1 
ATOM 8002  C CA    . ILE D 4 380 ? -10.097 124.213 9.405   1.00 19.59  ? 380 ILE B CA    1 
ATOM 8003  C C     . ILE D 4 380 ? -10.847 123.164 10.189  1.00 18.85  ? 380 ILE B C     1 
ATOM 8004  O O     . ILE D 4 380 ? -11.529 122.307 9.620   1.00 16.67  ? 380 ILE B O     1 
ATOM 8005  C CB    . ILE D 4 380 ? -8.617  123.937 9.602   1.00 21.76  ? 380 ILE B CB    1 
ATOM 8006  C CG1   . ILE D 4 380 ? -7.774  125.108 9.092   1.00 24.32  ? 380 ILE B CG1   1 
ATOM 8007  C CG2   . ILE D 4 380 ? -8.247  122.687 8.856   1.00 22.02  ? 380 ILE B CG2   1 
ATOM 8008  C CD1   . ILE D 4 380 ? -6.268  124.877 9.226   1.00 26.64  ? 380 ILE B CD1   1 
ATOM 8009  N N     . VAL D 4 381 ? -10.729 123.282 11.510  1.00 19.42  ? 381 VAL B N     1 
ATOM 8010  C CA    . VAL D 4 381 ? -11.357 122.373 12.454  1.00 18.48  ? 381 VAL B CA    1 
ATOM 8011  C C     . VAL D 4 381 ? -12.838 122.279 12.205  1.00 19.27  ? 381 VAL B C     1 
ATOM 8012  O O     . VAL D 4 381 ? -13.439 121.235 12.439  1.00 18.60  ? 381 VAL B O     1 
ATOM 8013  C CB    . VAL D 4 381 ? -11.186 122.828 13.908  1.00 17.88  ? 381 VAL B CB    1 
ATOM 8014  C CG1   . VAL D 4 381 ? -11.655 121.716 14.832  1.00 18.16  ? 381 VAL B CG1   1 
ATOM 8015  C CG2   . VAL D 4 381 ? -9.733  123.243 14.199  1.00 15.23  ? 381 VAL B CG2   1 
ATOM 8016  N N     . ILE D 4 382 ? -13.431 123.380 11.754  1.00 20.82  ? 382 ILE B N     1 
ATOM 8017  C CA    . ILE D 4 382 ? -14.855 123.373 11.482  1.00 22.25  ? 382 ILE B CA    1 
ATOM 8018  C C     . ILE D 4 382 ? -15.152 122.842 10.103  1.00 23.81  ? 382 ILE B C     1 
ATOM 8019  O O     . ILE D 4 382 ? -14.882 121.686 9.839   1.00 25.29  ? 382 ILE B O     1 
ATOM 8020  C CB    . ILE D 4 382 ? -15.513 124.736 11.637  1.00 21.71  ? 382 ILE B CB    1 
ATOM 8021  C CG1   . ILE D 4 382 ? -14.955 125.475 12.864  1.00 21.86  ? 382 ILE B CG1   1 
ATOM 8022  C CG2   . ILE D 4 382 ? -17.014 124.537 11.739  1.00 20.47  ? 382 ILE B CG2   1 
ATOM 8023  C CD1   . ILE D 4 382 ? -15.031 124.717 14.172  1.00 19.04  ? 382 ILE B CD1   1 
ATOM 8024  N N     . TRP D 4 383 ? -15.617 123.692 9.193   1.00 25.06  ? 383 TRP B N     1 
ATOM 8025  C CA    . TRP D 4 383 ? -15.989 123.224 7.854   1.00 28.56  ? 383 TRP B CA    1 
ATOM 8026  C C     . TRP D 4 383 ? -14.883 122.537 7.071   1.00 29.52  ? 383 TRP B C     1 
ATOM 8027  O O     . TRP D 4 383 ? -15.114 122.049 5.965   1.00 29.50  ? 383 TRP B O     1 
ATOM 8028  C CB    . TRP D 4 383 ? -16.651 124.340 7.045   1.00 28.61  ? 383 TRP B CB    1 
ATOM 8029  C CG    . TRP D 4 383 ? -17.447 125.228 7.930   1.00 31.12  ? 383 TRP B CG    1 
ATOM 8030  C CD1   . TRP D 4 383 ? -18.773 125.117 8.239   1.00 30.74  ? 383 TRP B CD1   1 
ATOM 8031  C CD2   . TRP D 4 383 ? -16.935 126.305 8.726   1.00 32.51  ? 383 TRP B CD2   1 
ATOM 8032  N NE1   . TRP D 4 383 ? -19.117 126.049 9.190   1.00 31.33  ? 383 TRP B NE1   1 
ATOM 8033  C CE2   . TRP D 4 383 ? -18.006 126.792 9.508   1.00 33.49  ? 383 TRP B CE2   1 
ATOM 8034  C CE3   . TRP D 4 383 ? -15.669 126.904 8.857   1.00 33.16  ? 383 TRP B CE3   1 
ATOM 8035  C CZ2   . TRP D 4 383 ? -17.848 127.859 10.418  1.00 33.50  ? 383 TRP B CZ2   1 
ATOM 8036  C CZ3   . TRP D 4 383 ? -15.513 127.963 9.756   1.00 33.13  ? 383 TRP B CZ3   1 
ATOM 8037  C CH2   . TRP D 4 383 ? -16.598 128.426 10.526  1.00 33.00  ? 383 TRP B CH2   1 
ATOM 8038  N N     . GLY D 4 384 ? -13.697 122.463 7.669   1.00 30.63  ? 384 GLY B N     1 
ATOM 8039  C CA    . GLY D 4 384 ? -12.601 121.782 7.020   1.00 33.27  ? 384 GLY B CA    1 
ATOM 8040  C C     . GLY D 4 384 ? -11.644 122.641 6.237   1.00 35.03  ? 384 GLY B C     1 
ATOM 8041  O O     . GLY D 4 384 ? -10.514 122.862 6.664   1.00 37.12  ? 384 GLY B O     1 
ATOM 8042  N N     . LYS D 4 385 ? -12.111 123.154 5.109   1.00 34.61  ? 385 LYS B N     1 
ATOM 8043  C CA    . LYS D 4 385 ? -11.302 123.970 4.207   1.00 35.67  ? 385 LYS B CA    1 
ATOM 8044  C C     . LYS D 4 385 ? -10.719 125.320 4.692   1.00 33.95  ? 385 LYS B C     1 
ATOM 8045  O O     . LYS D 4 385 ? -10.799 125.656 5.877   1.00 33.50  ? 385 LYS B O     1 
ATOM 8046  C CB    . LYS D 4 385 ? -12.058 124.120 2.890   1.00 39.00  ? 385 LYS B CB    1 
ATOM 8047  C CG    . LYS D 4 385 ? -12.113 122.802 2.096   1.00 44.98  ? 385 LYS B CG    1 
ATOM 8048  C CD    . LYS D 4 385 ? -12.734 121.625 2.896   1.00 47.65  ? 385 LYS B CD    1 
ATOM 8049  C CE    . LYS D 4 385 ? -12.500 120.247 2.223   1.00 50.77  ? 385 LYS B CE    1 
ATOM 8050  N NZ    . LYS D 4 385 ? -13.056 120.069 0.820   1.00 51.96  ? 385 LYS B NZ    1 
ATOM 8051  N N     . THR D 4 386 ? -10.092 126.064 3.779   1.00 32.28  ? 386 THR B N     1 
ATOM 8052  C CA    . THR D 4 386 ? -9.481  127.349 4.123   1.00 31.85  ? 386 THR B CA    1 
ATOM 8053  C C     . THR D 4 386 ? -10.032 128.612 3.436   1.00 32.88  ? 386 THR B C     1 
ATOM 8054  O O     . THR D 4 386 ? -9.997  128.745 2.196   1.00 33.44  ? 386 THR B O     1 
ATOM 8055  C CB    . THR D 4 386 ? -7.955  127.266 3.985   1.00 31.16  ? 386 THR B CB    1 
ATOM 8056  O OG1   . THR D 4 386 ? -7.444  126.555 5.115   1.00 31.07  ? 386 THR B OG1   1 
ATOM 8057  C CG2   . THR D 4 386 ? -7.312  128.650 3.925   1.00 30.68  ? 386 THR B CG2   1 
ATOM 8058  N N     . PRO D 4 387 ? -10.449 129.602 4.256   1.00 31.50  ? 387 PRO B N     1 
ATOM 8059  C CA    . PRO D 4 387 ? -11.016 130.885 3.829   1.00 30.22  ? 387 PRO B CA    1 
ATOM 8060  C C     . PRO D 4 387 ? -10.048 131.810 3.113   1.00 29.87  ? 387 PRO B C     1 
ATOM 8061  O O     . PRO D 4 387 ? -8.836  131.735 3.294   1.00 28.83  ? 387 PRO B O     1 
ATOM 8062  C CB    . PRO D 4 387 ? -11.472 131.499 5.144   1.00 29.04  ? 387 PRO B CB    1 
ATOM 8063  C CG    . PRO D 4 387 ? -10.412 131.031 6.094   1.00 28.01  ? 387 PRO B CG    1 
ATOM 8064  C CD    . PRO D 4 387 ? -10.267 129.579 5.723   1.00 30.01  ? 387 PRO B CD    1 
ATOM 8065  N N     . LYS D 4 388 ? -10.609 132.682 2.287   1.00 30.65  ? 388 LYS B N     1 
ATOM 8066  C CA    . LYS D 4 388 ? -9.823  133.658 1.555   1.00 32.69  ? 388 LYS B CA    1 
ATOM 8067  C C     . LYS D 4 388 ? -9.741  134.843 2.498   1.00 31.60  ? 388 LYS B C     1 
ATOM 8068  O O     . LYS D 4 388 ? -10.661 135.091 3.289   1.00 31.13  ? 388 LYS B O     1 
ATOM 8069  C CB    . LYS D 4 388 ? -10.512 134.052 0.246   1.00 36.81  ? 388 LYS B CB    1 
ATOM 8070  C CG    . LYS D 4 388 ? -11.357 132.941 -0.388  1.00 42.47  ? 388 LYS B CG    1 
ATOM 8071  C CD    . LYS D 4 388 ? -10.626 131.581 -0.440  1.00 48.94  ? 388 LYS B CD    1 
ATOM 8072  C CE    . LYS D 4 388 ? -11.503 130.453 -1.037  1.00 51.03  ? 388 LYS B CE    1 
ATOM 8073  N NZ    . LYS D 4 388 ? -11.906 130.715 -2.465  1.00 54.07  ? 388 LYS B NZ    1 
ATOM 8074  N N     . PHE D 4 389 ? -8.654  135.592 2.420   1.00 30.79  ? 389 PHE B N     1 
ATOM 8075  C CA    . PHE D 4 389 ? -8.522  136.688 3.345   1.00 31.89  ? 389 PHE B CA    1 
ATOM 8076  C C     . PHE D 4 389 ? -8.420  138.116 2.864   1.00 32.55  ? 389 PHE B C     1 
ATOM 8077  O O     . PHE D 4 389 ? -7.362  138.573 2.416   1.00 32.49  ? 389 PHE B O     1 
ATOM 8078  C CB    . PHE D 4 389 ? -7.396  136.410 4.330   1.00 31.67  ? 389 PHE B CB    1 
ATOM 8079  C CG    . PHE D 4 389 ? -7.700  135.318 5.297   1.00 30.91  ? 389 PHE B CG    1 
ATOM 8080  C CD1   . PHE D 4 389 ? -7.872  134.009 4.859   1.00 31.19  ? 389 PHE B CD1   1 
ATOM 8081  C CD2   . PHE D 4 389 ? -7.759  135.589 6.651   1.00 30.15  ? 389 PHE B CD2   1 
ATOM 8082  C CE1   . PHE D 4 389 ? -8.088  132.984 5.757   1.00 30.48  ? 389 PHE B CE1   1 
ATOM 8083  C CE2   . PHE D 4 389 ? -7.972  134.579 7.563   1.00 30.68  ? 389 PHE B CE2   1 
ATOM 8084  C CZ    . PHE D 4 389 ? -8.138  133.265 7.115   1.00 31.95  ? 389 PHE B CZ    1 
ATOM 8085  N N     . LYS D 4 390 ? -9.520  138.839 3.051   1.00 31.71  ? 390 LYS B N     1 
ATOM 8086  C CA    . LYS D 4 390 ? -9.578  140.251 2.726   1.00 29.64  ? 390 LYS B CA    1 
ATOM 8087  C C     . LYS D 4 390 ? -8.664  140.880 3.801   1.00 27.33  ? 390 LYS B C     1 
ATOM 8088  O O     . LYS D 4 390 ? -9.060  141.057 4.970   1.00 25.62  ? 390 LYS B O     1 
ATOM 8089  C CB    . LYS D 4 390 ? -11.021 140.739 2.861   1.00 29.46  ? 390 LYS B CB    1 
ATOM 8090  C CG    . LYS D 4 390 ? -12.038 139.963 2.020   1.00 30.51  ? 390 LYS B CG    1 
ATOM 8091  C CD    . LYS D 4 390 ? -11.955 140.281 0.518   1.00 32.93  ? 390 LYS B CD    1 
ATOM 8092  C CE    . LYS D 4 390 ? -13.168 139.708 -0.261  1.00 33.65  ? 390 LYS B CE    1 
ATOM 8093  N NZ    . LYS D 4 390 ? -13.194 139.991 -1.745  1.00 34.85  ? 390 LYS B NZ    1 
ATOM 8094  N N     . LEU D 4 391 ? -7.417  141.123 3.403   1.00 24.02  ? 391 LEU B N     1 
ATOM 8095  C CA    . LEU D 4 391 ? -6.395  141.658 4.284   1.00 23.12  ? 391 LEU B CA    1 
ATOM 8096  C C     . LEU D 4 391 ? -6.261  143.153 4.481   1.00 21.95  ? 391 LEU B C     1 
ATOM 8097  O O     . LEU D 4 391 ? -5.849  143.888 3.578   1.00 19.75  ? 391 LEU B O     1 
ATOM 8098  C CB    . LEU D 4 391 ? -5.039  141.078 3.923   1.00 23.97  ? 391 LEU B CB    1 
ATOM 8099  C CG    . LEU D 4 391 ? -4.739  139.724 4.557   1.00 24.55  ? 391 LEU B CG    1 
ATOM 8100  C CD1   . LEU D 4 391 ? -3.280  139.335 4.281   1.00 25.19  ? 391 LEU B CD1   1 
ATOM 8101  C CD2   . LEU D 4 391 ? -4.984  139.819 6.051   1.00 22.13  ? 391 LEU B CD2   1 
ATOM 8102  N N     . PRO D 4 392 ? -6.511  143.599 5.723   1.00 21.19  ? 392 PRO B N     1 
ATOM 8103  C CA    . PRO D 4 392 ? -6.464  144.976 6.220   1.00 21.47  ? 392 PRO B CA    1 
ATOM 8104  C C     . PRO D 4 392 ? -5.044  145.473 6.316   1.00 19.99  ? 392 PRO B C     1 
ATOM 8105  O O     . PRO D 4 392 ? -4.614  145.983 7.351   1.00 18.75  ? 392 PRO B O     1 
ATOM 8106  C CB    . PRO D 4 392 ? -7.108  144.857 7.604   1.00 21.54  ? 392 PRO B CB    1 
ATOM 8107  C CG    . PRO D 4 392 ? -6.675  143.530 8.046   1.00 21.84  ? 392 PRO B CG    1 
ATOM 8108  C CD    . PRO D 4 392 ? -6.931  142.692 6.803   1.00 21.67  ? 392 PRO B CD    1 
ATOM 8109  N N     . ILE D 4 393 ? -4.328  145.343 5.210   1.00 19.31  ? 393 ILE B N     1 
ATOM 8110  C CA    . ILE D 4 393 ? -2.945  145.764 5.157   1.00 19.62  ? 393 ILE B CA    1 
ATOM 8111  C C     . ILE D 4 393 ? -2.572  145.975 3.708   1.00 19.47  ? 393 ILE B C     1 
ATOM 8112  O O     . ILE D 4 393 ? -3.132  145.336 2.827   1.00 20.61  ? 393 ILE B O     1 
ATOM 8113  C CB    . ILE D 4 393 ? -2.047  144.686 5.752   1.00 20.23  ? 393 ILE B CB    1 
ATOM 8114  C CG1   . ILE D 4 393 ? -0.570  145.054 5.578   1.00 19.92  ? 393 ILE B CG1   1 
ATOM 8115  C CG2   . ILE D 4 393 ? -2.408  143.330 5.146   1.00 20.91  ? 393 ILE B CG2   1 
ATOM 8116  C CD1   . ILE D 4 393 ? -0.046  145.949 6.635   1.00 17.74  ? 393 ILE B CD1   1 
ATOM 8117  N N     . GLN D 4 394 ? -1.626  146.871 3.467   1.00 19.00  ? 394 GLN B N     1 
ATOM 8118  C CA    . GLN D 4 394 ? -1.184  147.169 2.115   1.00 20.08  ? 394 GLN B CA    1 
ATOM 8119  C C     . GLN D 4 394 ? -0.171  146.142 1.645   1.00 18.58  ? 394 GLN B C     1 
ATOM 8120  O O     . GLN D 4 394 ? 0.742   145.776 2.387   1.00 15.10  ? 394 GLN B O     1 
ATOM 8121  C CB    . GLN D 4 394 ? -0.612  148.587 2.041   1.00 23.98  ? 394 GLN B CB    1 
ATOM 8122  C CG    . GLN D 4 394 ? 0.537   148.885 3.016   1.00 29.12  ? 394 GLN B CG    1 
ATOM 8123  C CD    . GLN D 4 394 ? 0.112   149.107 4.487   1.00 31.34  ? 394 GLN B CD    1 
ATOM 8124  O OE1   . GLN D 4 394 ? -0.445  148.218 5.144   1.00 29.64  ? 394 GLN B OE1   1 
ATOM 8125  N NE2   . GLN D 4 394 ? 0.424   150.294 5.010   1.00 31.94  ? 394 GLN B NE2   1 
ATOM 8126  N N     . LYS D 4 395 ? -0.359  145.688 0.406   1.00 19.44  ? 395 LYS B N     1 
ATOM 8127  C CA    . LYS D 4 395 ? 0.483   144.671 -0.229  1.00 20.85  ? 395 LYS B CA    1 
ATOM 8128  C C     . LYS D 4 395 ? 1.950   144.796 0.094   1.00 20.57  ? 395 LYS B C     1 
ATOM 8129  O O     . LYS D 4 395 ? 2.401   144.161 1.041   1.00 23.10  ? 395 LYS B O     1 
ATOM 8130  C CB    . LYS D 4 395 ? 0.274   144.644 -1.742  1.00 22.14  ? 395 LYS B CB    1 
ATOM 8131  C CG    . LYS D 4 395 ? 0.671   143.336 -2.412  1.00 23.60  ? 395 LYS B CG    1 
ATOM 8132  C CD    . LYS D 4 395 ? 0.063   143.255 -3.816  1.00 28.04  ? 395 LYS B CD    1 
ATOM 8133  C CE    . LYS D 4 395 ? 0.325   141.912 -4.512  1.00 31.26  ? 395 LYS B CE    1 
ATOM 8134  N NZ    . LYS D 4 395 ? 1.782   141.646 -4.804  1.00 33.94  ? 395 LYS B NZ    1 
ATOM 8135  N N     . GLU D 4 396 ? 2.688   145.590 -0.684  1.00 18.34  ? 396 GLU B N     1 
ATOM 8136  C CA    . GLU D 4 396 ? 4.125   145.817 -0.461  1.00 18.84  ? 396 GLU B CA    1 
ATOM 8137  C C     . GLU D 4 396 ? 4.538   145.521 0.995   1.00 17.95  ? 396 GLU B C     1 
ATOM 8138  O O     . GLU D 4 396 ? 5.442   144.726 1.253   1.00 16.56  ? 396 GLU B O     1 
ATOM 8139  C CB    . GLU D 4 396 ? 4.486   147.262 -0.832  1.00 21.65  ? 396 GLU B CB    1 
ATOM 8140  C CG    . GLU D 4 396 ? 3.294   148.128 -1.343  1.00 26.63  ? 396 GLU B CG    1 
ATOM 8141  C CD    . GLU D 4 396 ? 2.251   148.498 -0.253  1.00 28.50  ? 396 GLU B CD    1 
ATOM 8142  O OE1   . GLU D 4 396 ? 2.608   148.564 0.955   1.00 27.38  ? 396 GLU B OE1   1 
ATOM 8143  O OE2   . GLU D 4 396 ? 1.072   148.738 -0.622  1.00 27.63  ? 396 GLU B OE2   1 
ATOM 8144  N N     . THR D 4 397 ? 3.769   146.070 1.932   1.00 17.52  ? 397 THR B N     1 
ATOM 8145  C CA    . THR D 4 397 ? 3.986   145.884 3.358   1.00 17.70  ? 397 THR B CA    1 
ATOM 8146  C C     . THR D 4 397 ? 3.912   144.433 3.817   1.00 19.74  ? 397 THR B C     1 
ATOM 8147  O O     . THR D 4 397 ? 4.946   143.815 4.119   1.00 18.96  ? 397 THR B O     1 
ATOM 8148  C CB    . THR D 4 397 ? 2.971   146.695 4.132   1.00 16.54  ? 397 THR B CB    1 
ATOM 8149  O OG1   . THR D 4 397 ? 3.236   148.077 3.896   1.00 18.45  ? 397 THR B OG1   1 
ATOM 8150  C CG2   . THR D 4 397 ? 3.054   146.412 5.609   1.00 14.11  ? 397 THR B CG2   1 
ATOM 8151  N N     . TRP D 4 398 ? 2.679   143.913 3.882   1.00 21.70  ? 398 TRP B N     1 
ATOM 8152  C CA    . TRP D 4 398 ? 2.393   142.527 4.307   1.00 22.80  ? 398 TRP B CA    1 
ATOM 8153  C C     . TRP D 4 398 ? 3.469   141.598 3.813   1.00 23.06  ? 398 TRP B C     1 
ATOM 8154  O O     . TRP D 4 398 ? 4.013   140.785 4.563   1.00 23.91  ? 398 TRP B O     1 
ATOM 8155  C CB    . TRP D 4 398 ? 1.050   142.030 3.738   1.00 20.81  ? 398 TRP B CB    1 
ATOM 8156  C CG    . TRP D 4 398 ? 0.682   140.576 4.094   1.00 19.10  ? 398 TRP B CG    1 
ATOM 8157  C CD1   . TRP D 4 398 ? 0.492   139.532 3.223   1.00 18.40  ? 398 TRP B CD1   1 
ATOM 8158  C CD2   . TRP D 4 398 ? 0.358   140.064 5.391   1.00 17.47  ? 398 TRP B CD2   1 
ATOM 8159  N NE1   . TRP D 4 398 ? 0.052   138.420 3.894   1.00 16.54  ? 398 TRP B NE1   1 
ATOM 8160  C CE2   . TRP D 4 398 ? -0.039  138.721 5.225   1.00 16.62  ? 398 TRP B CE2   1 
ATOM 8161  C CE3   . TRP D 4 398 ? 0.351   140.615 6.675   1.00 15.56  ? 398 TRP B CE3   1 
ATOM 8162  C CZ2   . TRP D 4 398 ? -0.441  137.926 6.296   1.00 16.88  ? 398 TRP B CZ2   1 
ATOM 8163  C CZ3   . TRP D 4 398 ? -0.050  139.819 7.738   1.00 16.46  ? 398 TRP B CZ3   1 
ATOM 8164  C CH2   . TRP D 4 398 ? -0.441  138.492 7.541   1.00 15.88  ? 398 TRP B CH2   1 
ATOM 8165  N N     . GLU D 4 399 ? 3.774   141.752 2.536   1.00 22.67  ? 399 GLU B N     1 
ATOM 8166  C CA    . GLU D 4 399 ? 4.771   140.945 1.907   1.00 23.58  ? 399 GLU B CA    1 
ATOM 8167  C C     . GLU D 4 399 ? 6.054   140.963 2.726   1.00 23.45  ? 399 GLU B C     1 
ATOM 8168  O O     . GLU D 4 399 ? 6.244   140.092 3.569   1.00 25.62  ? 399 GLU B O     1 
ATOM 8169  C CB    . GLU D 4 399 ? 4.946   141.392 0.458   1.00 24.82  ? 399 GLU B CB    1 
ATOM 8170  C CG    . GLU D 4 399 ? 3.618   141.223 -0.318  1.00 28.02  ? 399 GLU B CG    1 
ATOM 8171  C CD    . GLU D 4 399 ? 3.730   141.406 -1.832  1.00 29.07  ? 399 GLU B CD    1 
ATOM 8172  O OE1   . GLU D 4 399 ? 4.191   142.474 -2.291  1.00 30.90  ? 399 GLU B OE1   1 
ATOM 8173  O OE2   . GLU D 4 399 ? 3.326   140.479 -2.570  1.00 29.86  ? 399 GLU B OE2   1 
ATOM 8174  N N     . THR D 4 400 ? 6.851   142.007 2.600   1.00 21.02  ? 400 THR B N     1 
ATOM 8175  C CA    . THR D 4 400 ? 8.115   142.084 3.316   1.00 19.72  ? 400 THR B CA    1 
ATOM 8176  C C     . THR D 4 400 ? 8.185   141.668 4.781   1.00 17.92  ? 400 THR B C     1 
ATOM 8177  O O     . THR D 4 400 ? 9.245   141.769 5.373   1.00 17.32  ? 400 THR B O     1 
ATOM 8178  C CB    . THR D 4 400 ? 8.640   143.472 3.270   1.00 21.82  ? 400 THR B CB    1 
ATOM 8179  O OG1   . THR D 4 400 ? 7.862   144.268 4.167   1.00 23.75  ? 400 THR B OG1   1 
ATOM 8180  C CG2   . THR D 4 400 ? 8.527   144.028 1.848   1.00 23.49  ? 400 THR B CG2   1 
ATOM 8181  N N     . TRP D 4 401 ? 7.081   141.297 5.413   1.00 17.79  ? 401 TRP B N     1 
ATOM 8182  C CA    . TRP D 4 401 ? 7.202   140.875 6.803   1.00 19.70  ? 401 TRP B CA    1 
ATOM 8183  C C     . TRP D 4 401 ? 6.398   139.662 7.253   1.00 20.55  ? 401 TRP B C     1 
ATOM 8184  O O     . TRP D 4 401 ? 6.591   139.208 8.381   1.00 21.45  ? 401 TRP B O     1 
ATOM 8185  C CB    . TRP D 4 401 ? 6.858   142.009 7.758   1.00 20.97  ? 401 TRP B CB    1 
ATOM 8186  C CG    . TRP D 4 401 ? 7.580   143.251 7.538   1.00 22.69  ? 401 TRP B CG    1 
ATOM 8187  C CD1   . TRP D 4 401 ? 7.132   144.338 6.856   1.00 23.72  ? 401 TRP B CD1   1 
ATOM 8188  C CD2   . TRP D 4 401 ? 8.886   143.572 8.007   1.00 25.24  ? 401 TRP B CD2   1 
ATOM 8189  N NE1   . TRP D 4 401 ? 8.085   145.327 6.863   1.00 25.82  ? 401 TRP B NE1   1 
ATOM 8190  C CE2   . TRP D 4 401 ? 9.175   144.883 7.563   1.00 25.94  ? 401 TRP B CE2   1 
ATOM 8191  C CE3   . TRP D 4 401 ? 9.843   142.883 8.760   1.00 24.26  ? 401 TRP B CE3   1 
ATOM 8192  C CZ2   . TRP D 4 401 ? 10.387  145.519 7.842   1.00 25.92  ? 401 TRP B CZ2   1 
ATOM 8193  C CZ3   . TRP D 4 401 ? 11.052  143.517 9.038   1.00 26.93  ? 401 TRP B CZ3   1 
ATOM 8194  C CH2   . TRP D 4 401 ? 11.310  144.824 8.578   1.00 26.95  ? 401 TRP B CH2   1 
ATOM 8195  N N     . TRP D 4 402 ? 5.506   139.127 6.417   1.00 20.84  ? 402 TRP B N     1 
ATOM 8196  C CA    . TRP D 4 402 ? 4.693   137.995 6.871   1.00 21.54  ? 402 TRP B CA    1 
ATOM 8197  C C     . TRP D 4 402 ? 5.472   136.710 7.208   1.00 21.90  ? 402 TRP B C     1 
ATOM 8198  O O     . TRP D 4 402 ? 5.268   136.119 8.276   1.00 20.71  ? 402 TRP B O     1 
ATOM 8199  C CB    . TRP D 4 402 ? 3.502   137.748 5.938   1.00 20.72  ? 402 TRP B CB    1 
ATOM 8200  C CG    . TRP D 4 402 ? 3.781   136.856 4.815   1.00 21.71  ? 402 TRP B CG    1 
ATOM 8201  C CD1   . TRP D 4 402 ? 4.287   137.208 3.620   1.00 21.65  ? 402 TRP B CD1   1 
ATOM 8202  C CD2   . TRP D 4 402 ? 3.511   135.455 4.749   1.00 22.33  ? 402 TRP B CD2   1 
ATOM 8203  N NE1   . TRP D 4 402 ? 4.344   136.120 2.792   1.00 23.62  ? 402 TRP B NE1   1 
ATOM 8204  C CE2   . TRP D 4 402 ? 3.873   135.027 3.462   1.00 22.64  ? 402 TRP B CE2   1 
ATOM 8205  C CE3   . TRP D 4 402 ? 2.985   134.519 5.648   1.00 22.40  ? 402 TRP B CE3   1 
ATOM 8206  C CZ2   . TRP D 4 402 ? 3.729   133.706 3.043   1.00 25.23  ? 402 TRP B CZ2   1 
ATOM 8207  C CZ3   . TRP D 4 402 ? 2.839   133.202 5.231   1.00 23.24  ? 402 TRP B CZ3   1 
ATOM 8208  C CH2   . TRP D 4 402 ? 3.210   132.813 3.941   1.00 25.66  ? 402 TRP B CH2   1 
ATOM 8209  N N     . THR D 4 403 ? 6.410   136.324 6.344   1.00 23.34  ? 403 THR B N     1 
ATOM 8210  C CA    . THR D 4 403 ? 7.242   135.138 6.586   1.00 24.76  ? 403 THR B CA    1 
ATOM 8211  C C     . THR D 4 403 ? 7.836   135.121 8.010   1.00 24.97  ? 403 THR B C     1 
ATOM 8212  O O     . THR D 4 403 ? 7.706   134.125 8.725   1.00 26.00  ? 403 THR B O     1 
ATOM 8213  C CB    . THR D 4 403 ? 8.409   135.050 5.573   1.00 24.94  ? 403 THR B CB    1 
ATOM 8214  O OG1   . THR D 4 403 ? 9.365   136.095 5.836   1.00 25.97  ? 403 THR B OG1   1 
ATOM 8215  C CG2   . THR D 4 403 ? 7.872   135.158 4.137   1.00 24.53  ? 403 THR B CG2   1 
ATOM 8216  N N     . GLU D 4 404 ? 8.436   136.238 8.427   1.00 23.49  ? 404 GLU B N     1 
ATOM 8217  C CA    . GLU D 4 404 ? 9.041   136.374 9.750   1.00 23.20  ? 404 GLU B CA    1 
ATOM 8218  C C     . GLU D 4 404 ? 8.197   135.955 10.927  1.00 21.83  ? 404 GLU B C     1 
ATOM 8219  O O     . GLU D 4 404 ? 8.693   135.950 12.046  1.00 22.97  ? 404 GLU B O     1 
ATOM 8220  C CB    . GLU D 4 404 ? 9.381   137.819 10.027  1.00 25.12  ? 404 GLU B CB    1 
ATOM 8221  C CG    . GLU D 4 404 ? 10.266  138.414 9.034   1.00 33.03  ? 404 GLU B CG    1 
ATOM 8222  C CD    . GLU D 4 404 ? 11.645  137.833 9.098   1.00 37.53  ? 404 GLU B CD    1 
ATOM 8223  O OE1   . GLU D 4 404 ? 12.187  137.664 10.229  1.00 37.27  ? 404 GLU B OE1   1 
ATOM 8224  O OE2   . GLU D 4 404 ? 12.180  137.564 8.000   1.00 42.95  ? 404 GLU B OE2   1 
ATOM 8225  N N     . TYR D 4 405 ? 6.911   135.708 10.723  1.00 19.56  ? 405 TYR B N     1 
ATOM 8226  C CA    . TYR D 4 405 ? 6.081   135.343 11.859  1.00 19.65  ? 405 TYR B CA    1 
ATOM 8227  C C     . TYR D 4 405 ? 5.131   134.190 11.598  1.00 18.85  ? 405 TYR B C     1 
ATOM 8228  O O     . TYR D 4 405 ? 4.463   133.712 12.519  1.00 18.92  ? 405 TYR B O     1 
ATOM 8229  C CB    . TYR D 4 405 ? 5.270   136.551 12.327  1.00 21.99  ? 405 TYR B CB    1 
ATOM 8230  C CG    . TYR D 4 405 ? 6.070   137.822 12.506  1.00 25.58  ? 405 TYR B CG    1 
ATOM 8231  C CD1   . TYR D 4 405 ? 6.435   138.272 13.771  1.00 25.46  ? 405 TYR B CD1   1 
ATOM 8232  C CD2   . TYR D 4 405 ? 6.443   138.590 11.406  1.00 26.44  ? 405 TYR B CD2   1 
ATOM 8233  C CE1   . TYR D 4 405 ? 7.148   139.457 13.930  1.00 25.81  ? 405 TYR B CE1   1 
ATOM 8234  C CE2   . TYR D 4 405 ? 7.160   139.773 11.556  1.00 25.93  ? 405 TYR B CE2   1 
ATOM 8235  C CZ    . TYR D 4 405 ? 7.509   140.200 12.816  1.00 25.42  ? 405 TYR B CZ    1 
ATOM 8236  O OH    . TYR D 4 405 ? 8.233   141.361 12.951  1.00 25.48  ? 405 TYR B OH    1 
ATOM 8237  N N     . TRP D 4 406 ? 5.052   133.751 10.346  1.00 16.42  ? 406 TRP B N     1 
ATOM 8238  C CA    . TRP D 4 406 ? 4.172   132.655 9.984   1.00 11.36  ? 406 TRP B CA    1 
ATOM 8239  C C     . TRP D 4 406 ? 4.561   131.452 10.794  1.00 9.20   ? 406 TRP B C     1 
ATOM 8240  O O     . TRP D 4 406 ? 5.678   131.395 11.279  1.00 8.82   ? 406 TRP B O     1 
ATOM 8241  C CB    . TRP D 4 406 ? 4.369   132.300 8.541   1.00 11.14  ? 406 TRP B CB    1 
ATOM 8242  C CG    . TRP D 4 406 ? 3.459   131.290 8.170   1.00 13.33  ? 406 TRP B CG    1 
ATOM 8243  C CD1   . TRP D 4 406 ? 3.711   129.972 8.011   1.00 15.37  ? 406 TRP B CD1   1 
ATOM 8244  C CD2   . TRP D 4 406 ? 2.093   131.481 7.918   1.00 16.27  ? 406 TRP B CD2   1 
ATOM 8245  N NE1   . TRP D 4 406 ? 2.562   129.314 7.664   1.00 17.80  ? 406 TRP B NE1   1 
ATOM 8246  C CE2   . TRP D 4 406 ? 1.548   130.228 7.598   1.00 15.99  ? 406 TRP B CE2   1 
ATOM 8247  C CE3   . TRP D 4 406 ? 1.263   132.598 7.926   1.00 18.10  ? 406 TRP B CE3   1 
ATOM 8248  C CZ2   . TRP D 4 406 ? 0.214   130.061 7.285   1.00 19.04  ? 406 TRP B CZ2   1 
ATOM 8249  C CZ3   . TRP D 4 406 ? -0.067  132.432 7.613   1.00 20.13  ? 406 TRP B CZ3   1 
ATOM 8250  C CH2   . TRP D 4 406 ? -0.580  131.169 7.296   1.00 20.75  ? 406 TRP B CH2   1 
ATOM 8251  N N     . GLN D 4 407 ? 3.686   130.462 10.887  1.00 7.57   ? 407 GLN B N     1 
ATOM 8252  C CA    . GLN D 4 407 ? 4.031   129.279 11.652  1.00 5.89   ? 407 GLN B CA    1 
ATOM 8253  C C     . GLN D 4 407 ? 3.192   128.073 11.332  1.00 4.52   ? 407 GLN B C     1 
ATOM 8254  O O     . GLN D 4 407 ? 3.176   127.106 12.072  1.00 4.59   ? 407 GLN B O     1 
ATOM 8255  C CB    . GLN D 4 407 ? 3.934   129.570 13.140  1.00 7.58   ? 407 GLN B CB    1 
ATOM 8256  C CG    . GLN D 4 407 ? 4.997   128.850 13.953  1.00 10.98  ? 407 GLN B CG    1 
ATOM 8257  C CD    . GLN D 4 407 ? 6.398   129.449 13.787  1.00 13.85  ? 407 GLN B CD    1 
ATOM 8258  O OE1   . GLN D 4 407 ? 6.806   129.824 12.688  1.00 15.35  ? 407 GLN B OE1   1 
ATOM 8259  N NE2   . GLN D 4 407 ? 7.145   129.527 14.889  1.00 14.43  ? 407 GLN B NE2   1 
ATOM 8260  N N     . ALA D 4 408 ? 2.440   128.142 10.257  1.00 4.38   ? 408 ALA B N     1 
ATOM 8261  C CA    . ALA D 4 408 ? 1.623   127.007 9.898   1.00 6.67   ? 408 ALA B CA    1 
ATOM 8262  C C     . ALA D 4 408 ? 2.368   126.213 8.873   1.00 8.21   ? 408 ALA B C     1 
ATOM 8263  O O     . ALA D 4 408 ? 3.485   126.562 8.490   1.00 8.69   ? 408 ALA B O     1 
ATOM 8264  C CB    . ALA D 4 408 ? 0.323   127.448 9.343   1.00 7.75   ? 408 ALA B CB    1 
ATOM 8265  N N     . THR D 4 409 ? 1.731   125.156 8.402   1.00 9.76   ? 409 THR B N     1 
ATOM 8266  C CA    . THR D 4 409 ? 2.351   124.303 7.416   1.00 12.29  ? 409 THR B CA    1 
ATOM 8267  C C     . THR D 4 409 ? 1.603   124.482 6.142   1.00 13.93  ? 409 THR B C     1 
ATOM 8268  O O     . THR D 4 409 ? 1.741   123.687 5.225   1.00 13.43  ? 409 THR B O     1 
ATOM 8269  C CB    . THR D 4 409 ? 2.318   122.836 7.836   1.00 14.49  ? 409 THR B CB    1 
ATOM 8270  O OG1   . THR D 4 409 ? 1.070   122.232 7.447   1.00 13.02  ? 409 THR B OG1   1 
ATOM 8271  C CG2   . THR D 4 409 ? 2.503   122.744 9.361   1.00 16.12  ? 409 THR B CG2   1 
ATOM 8272  N N     . TRP D 4 410 ? 0.707   125.458 6.138   1.00 16.42  ? 410 TRP B N     1 
ATOM 8273  C CA    . TRP D 4 410 ? -0.045  125.787 4.931   1.00 19.56  ? 410 TRP B CA    1 
ATOM 8274  C C     . TRP D 4 410 ? -0.067  127.296 4.871   1.00 19.02  ? 410 TRP B C     1 
ATOM 8275  O O     . TRP D 4 410 ? 0.413   127.969 5.788   1.00 17.91  ? 410 TRP B O     1 
ATOM 8276  C CB    . TRP D 4 410 ? -1.469  125.243 4.968   1.00 21.26  ? 410 TRP B CB    1 
ATOM 8277  C CG    . TRP D 4 410 ? -1.971  125.151 6.333   1.00 23.46  ? 410 TRP B CG    1 
ATOM 8278  C CD1   . TRP D 4 410 ? -2.170  124.017 7.032   1.00 26.81  ? 410 TRP B CD1   1 
ATOM 8279  C CD2   . TRP D 4 410 ? -2.261  126.232 7.222   1.00 25.76  ? 410 TRP B CD2   1 
ATOM 8280  N NE1   . TRP D 4 410 ? -2.557  124.309 8.315   1.00 28.82  ? 410 TRP B NE1   1 
ATOM 8281  C CE2   . TRP D 4 410 ? -2.620  125.665 8.461   1.00 27.16  ? 410 TRP B CE2   1 
ATOM 8282  C CE3   . TRP D 4 410 ? -2.255  127.621 7.093   1.00 27.45  ? 410 TRP B CE3   1 
ATOM 8283  C CZ2   . TRP D 4 410 ? -2.972  126.438 9.574   1.00 28.22  ? 410 TRP B CZ2   1 
ATOM 8284  C CZ3   . TRP D 4 410 ? -2.608  128.393 8.199   1.00 29.78  ? 410 TRP B CZ3   1 
ATOM 8285  C CH2   . TRP D 4 410 ? -2.960  127.794 9.428   1.00 28.31  ? 410 TRP B CH2   1 
ATOM 8286  N N     . ILE D 4 411 ? -0.534  127.825 3.754   1.00 16.70  ? 411 ILE B N     1 
ATOM 8287  C CA    . ILE D 4 411 ? -0.617  129.256 3.614   1.00 16.96  ? 411 ILE B CA    1 
ATOM 8288  C C     . ILE D 4 411 ? -1.886  129.477 2.829   1.00 17.28  ? 411 ILE B C     1 
ATOM 8289  O O     . ILE D 4 411 ? -2.012  129.033 1.701   1.00 16.91  ? 411 ILE B O     1 
ATOM 8290  C CB    . ILE D 4 411 ? 0.610   129.859 2.898   1.00 15.77  ? 411 ILE B CB    1 
ATOM 8291  C CG1   . ILE D 4 411 ? 1.891   129.554 3.680   1.00 14.52  ? 411 ILE B CG1   1 
ATOM 8292  C CG2   . ILE D 4 411 ? 0.482   131.354 2.876   1.00 16.57  ? 411 ILE B CG2   1 
ATOM 8293  C CD1   . ILE D 4 411 ? 3.163   129.906 2.932   1.00 13.07  ? 411 ILE B CD1   1 
ATOM 8294  N N     . PRO D 4 412 ? -2.883  130.090 3.468   1.00 17.78  ? 412 PRO B N     1 
ATOM 8295  C CA    . PRO D 4 412 ? -4.205  130.405 2.915   1.00 18.13  ? 412 PRO B CA    1 
ATOM 8296  C C     . PRO D 4 412 ? -4.111  131.500 1.894   1.00 18.10  ? 412 PRO B C     1 
ATOM 8297  O O     . PRO D 4 412 ? -3.089  132.184 1.804   1.00 16.91  ? 412 PRO B O     1 
ATOM 8298  C CB    . PRO D 4 412 ? -4.973  130.916 4.127   1.00 18.28  ? 412 PRO B CB    1 
ATOM 8299  C CG    . PRO D 4 412 ? -4.198  130.365 5.301   1.00 19.24  ? 412 PRO B CG    1 
ATOM 8300  C CD    . PRO D 4 412 ? -2.788  130.529 4.863   1.00 16.93  ? 412 PRO B CD    1 
ATOM 8301  N N     . GLU D 4 413 ? -5.200  131.666 1.144   1.00 19.72  ? 413 GLU B N     1 
ATOM 8302  C CA    . GLU D 4 413 ? -5.297  132.694 0.116   1.00 21.61  ? 413 GLU B CA    1 
ATOM 8303  C C     . GLU D 4 413 ? -5.702  134.025 0.721   1.00 23.73  ? 413 GLU B C     1 
ATOM 8304  O O     . GLU D 4 413 ? -6.614  134.106 1.554   1.00 25.11  ? 413 GLU B O     1 
ATOM 8305  C CB    . GLU D 4 413 ? -6.262  132.280 -0.994  1.00 19.55  ? 413 GLU B CB    1 
ATOM 8306  C CG    . GLU D 4 413 ? -5.550  131.522 -2.093  1.00 24.43  ? 413 GLU B CG    1 
ATOM 8307  C CD    . GLU D 4 413 ? -6.478  130.875 -3.118  1.00 29.09  ? 413 GLU B CD    1 
ATOM 8308  O OE1   . GLU D 4 413 ? -7.335  130.048 -2.713  1.00 30.38  ? 413 GLU B OE1   1 
ATOM 8309  O OE2   . GLU D 4 413 ? -6.322  131.165 -4.335  1.00 32.35  ? 413 GLU B OE2   1 
ATOM 8310  N N     . TRP D 4 414 ? -4.971  135.062 0.347   1.00 24.43  ? 414 TRP B N     1 
ATOM 8311  C CA    . TRP D 4 414 ? -5.257  136.370 0.865   1.00 24.96  ? 414 TRP B CA    1 
ATOM 8312  C C     . TRP D 4 414 ? -5.275  137.398 -0.260  1.00 29.33  ? 414 TRP B C     1 
ATOM 8313  O O     . TRP D 4 414 ? -4.774  137.126 -1.358  1.00 28.96  ? 414 TRP B O     1 
ATOM 8314  C CB    . TRP D 4 414 ? -4.226  136.716 1.938   1.00 21.47  ? 414 TRP B CB    1 
ATOM 8315  C CG    . TRP D 4 414 ? -2.806  136.705 1.477   1.00 19.92  ? 414 TRP B CG    1 
ATOM 8316  C CD1   . TRP D 4 414 ? -2.278  137.451 0.480   1.00 22.50  ? 414 TRP B CD1   1 
ATOM 8317  C CD2   . TRP D 4 414 ? -1.706  136.018 2.080   1.00 21.23  ? 414 TRP B CD2   1 
ATOM 8318  N NE1   . TRP D 4 414 ? -0.917  137.301 0.429   1.00 22.11  ? 414 TRP B NE1   1 
ATOM 8319  C CE2   . TRP D 4 414 ? -0.537  136.424 1.406   1.00 20.68  ? 414 TRP B CE2   1 
ATOM 8320  C CE3   . TRP D 4 414 ? -1.590  135.106 3.129   1.00 23.32  ? 414 TRP B CE3   1 
ATOM 8321  C CZ2   . TRP D 4 414 ? 0.733   135.956 1.748   1.00 21.71  ? 414 TRP B CZ2   1 
ATOM 8322  C CZ3   . TRP D 4 414 ? -0.318  134.637 3.469   1.00 22.78  ? 414 TRP B CZ3   1 
ATOM 8323  C CH2   . TRP D 4 414 ? 0.819   135.067 2.780   1.00 21.44  ? 414 TRP B CH2   1 
ATOM 8324  N N     . GLU D 4 415 ? -5.945  138.529 0.002   1.00 34.70  ? 415 GLU B N     1 
ATOM 8325  C CA    . GLU D 4 415 ? -6.059  139.685 -0.913  1.00 37.30  ? 415 GLU B CA    1 
ATOM 8326  C C     . GLU D 4 415 ? -6.152  140.966 -0.082  1.00 38.36  ? 415 GLU B C     1 
ATOM 8327  O O     . GLU D 4 415 ? -6.658  140.962 1.044   1.00 38.27  ? 415 GLU B O     1 
ATOM 8328  C CB    . GLU D 4 415 ? -7.267  139.586 -1.863  1.00 38.60  ? 415 GLU B CB    1 
ATOM 8329  C CG    . GLU D 4 415 ? -8.651  139.776 -1.240  1.00 40.24  ? 415 GLU B CG    1 
ATOM 8330  C CD    . GLU D 4 415 ? -9.765  139.742 -2.296  1.00 44.00  ? 415 GLU B CD    1 
ATOM 8331  O OE1   . GLU D 4 415 ? -9.941  140.758 -3.010  1.00 45.33  ? 415 GLU B OE1   1 
ATOM 8332  O OE2   . GLU D 4 415 ? -10.457 138.700 -2.424  1.00 45.29  ? 415 GLU B OE2   1 
ATOM 8333  N N     . PHE D 4 416 ? -5.657  142.061 -0.635  1.00 39.48  ? 416 PHE B N     1 
ATOM 8334  C CA    . PHE D 4 416 ? -5.674  143.317 0.087   1.00 41.55  ? 416 PHE B CA    1 
ATOM 8335  C C     . PHE D 4 416 ? -6.822  144.231 -0.294  1.00 44.31  ? 416 PHE B C     1 
ATOM 8336  O O     . PHE D 4 416 ? -7.192  144.320 -1.474  1.00 42.84  ? 416 PHE B O     1 
ATOM 8337  C CB    . PHE D 4 416 ? -4.337  143.996 -0.083  1.00 40.42  ? 416 PHE B CB    1 
ATOM 8338  C CG    . PHE D 4 416 ? -3.194  143.131 0.314   1.00 39.32  ? 416 PHE B CG    1 
ATOM 8339  C CD1   . PHE D 4 416 ? -2.253  142.729 -0.620  1.00 38.54  ? 416 PHE B CD1   1 
ATOM 8340  C CD2   . PHE D 4 416 ? -3.059  142.715 1.627   1.00 38.77  ? 416 PHE B CD2   1 
ATOM 8341  C CE1   . PHE D 4 416 ? -1.189  141.926 -0.253  1.00 37.15  ? 416 PHE B CE1   1 
ATOM 8342  C CE2   . PHE D 4 416 ? -1.999  141.913 2.004   1.00 38.42  ? 416 PHE B CE2   1 
ATOM 8343  C CZ    . PHE D 4 416 ? -1.058  141.519 1.058   1.00 38.58  ? 416 PHE B CZ    1 
ATOM 8344  N N     . VAL D 4 417 ? -7.348  144.934 0.717   1.00 48.07  ? 417 VAL B N     1 
ATOM 8345  C CA    . VAL D 4 417 ? -8.495  145.832 0.551   1.00 51.40  ? 417 VAL B CA    1 
ATOM 8346  C C     . VAL D 4 417 ? -8.645  146.925 1.624   1.00 52.99  ? 417 VAL B C     1 
ATOM 8347  O O     . VAL D 4 417 ? -8.368  146.686 2.803   1.00 53.01  ? 417 VAL B O     1 
ATOM 8348  C CB    . VAL D 4 417 ? -9.807  145.007 0.545   1.00 52.11  ? 417 VAL B CB    1 
ATOM 8349  C CG1   . VAL D 4 417 ? -9.948  144.241 1.866   1.00 50.57  ? 417 VAL B CG1   1 
ATOM 8350  C CG2   . VAL D 4 417 ? -11.021 145.916 0.298   1.00 53.93  ? 417 VAL B CG2   1 
ATOM 8351  N N     . ASN D 4 418 ? -9.124  148.104 1.206   1.00 55.68  ? 418 ASN B N     1 
ATOM 8352  C CA    . ASN D 4 418 ? -9.353  149.225 2.118   1.00 56.34  ? 418 ASN B CA    1 
ATOM 8353  C C     . ASN D 4 418 ? -10.650 149.103 2.915   1.00 58.28  ? 418 ASN B C     1 
ATOM 8354  O O     . ASN D 4 418 ? -11.655 148.542 2.459   1.00 55.34  ? 418 ASN B O     1 
ATOM 8355  C CB    . ASN D 4 418 ? -9.368  150.575 1.405   1.00 55.23  ? 418 ASN B CB    1 
ATOM 8356  C CG    . ASN D 4 418 ? -9.934  151.664 2.294   1.00 54.95  ? 418 ASN B CG    1 
ATOM 8357  O OD1   . ASN D 4 418 ? -9.237  152.167 3.180   1.00 54.04  ? 418 ASN B OD1   1 
ATOM 8358  N ND2   . ASN D 4 418 ? -11.250 151.900 2.188   1.00 53.70  ? 418 ASN B ND2   1 
ATOM 8359  N N     . THR D 4 419 ? -10.663 149.824 4.026   1.00 60.65  ? 419 THR B N     1 
ATOM 8360  C CA    . THR D 4 419 ? -11.783 149.782 4.929   1.00 62.17  ? 419 THR B CA    1 
ATOM 8361  C C     . THR D 4 419 ? -12.559 151.059 5.225   1.00 63.85  ? 419 THR B C     1 
ATOM 8362  O O     . THR D 4 419 ? -11.983 152.138 5.407   1.00 62.26  ? 419 THR B O     1 
ATOM 8363  C CB    . THR D 4 419 ? -11.325 149.231 6.288   1.00 62.92  ? 419 THR B CB    1 
ATOM 8364  O OG1   . THR D 4 419 ? -10.098 148.501 6.128   1.00 63.47  ? 419 THR B OG1   1 
ATOM 8365  C CG2   . THR D 4 419 ? -12.395 148.327 6.877   1.00 64.15  ? 419 THR B CG2   1 
ATOM 8366  N N     . PRO D 4 420 ? -13.894 150.954 5.167   1.00 66.06  ? 420 PRO B N     1 
ATOM 8367  C CA    . PRO D 4 420 ? -14.903 151.993 5.433   1.00 66.17  ? 420 PRO B CA    1 
ATOM 8368  C C     . PRO D 4 420 ? -15.440 151.795 6.886   1.00 68.14  ? 420 PRO B C     1 
ATOM 8369  O O     . PRO D 4 420 ? -15.244 150.732 7.489   1.00 67.62  ? 420 PRO B O     1 
ATOM 8370  C CB    . PRO D 4 420 ? -15.961 151.723 4.357   1.00 67.10  ? 420 PRO B CB    1 
ATOM 8371  C CG    . PRO D 4 420 ? -15.887 150.241 4.178   1.00 67.00  ? 420 PRO B CG    1 
ATOM 8372  C CD    . PRO D 4 420 ? -14.405 149.971 4.186   1.00 65.64  ? 420 PRO B CD    1 
ATOM 8373  N N     . PRO D 4 421 ? -16.112 152.812 7.464   1.00 70.03  ? 421 PRO B N     1 
ATOM 8374  C CA    . PRO D 4 421 ? -16.651 152.727 8.831   1.00 69.42  ? 421 PRO B CA    1 
ATOM 8375  C C     . PRO D 4 421 ? -17.887 151.845 9.021   1.00 71.00  ? 421 PRO B C     1 
ATOM 8376  O O     . PRO D 4 421 ? -18.228 151.503 10.150  1.00 70.28  ? 421 PRO B O     1 
ATOM 8377  C CB    . PRO D 4 421 ? -16.967 154.181 9.154   1.00 70.55  ? 421 PRO B CB    1 
ATOM 8378  C CG    . PRO D 4 421 ? -17.468 154.683 7.834   1.00 70.08  ? 421 PRO B CG    1 
ATOM 8379  C CD    . PRO D 4 421 ? -16.422 154.127 6.872   1.00 70.24  ? 421 PRO B CD    1 
ATOM 8380  N N     . LEU D 4 422 ? -18.559 151.512 7.919   1.00 72.32  ? 422 LEU B N     1 
ATOM 8381  C CA    . LEU D 4 422 ? -19.768 150.666 7.898   1.00 73.85  ? 422 LEU B CA    1 
ATOM 8382  C C     . LEU D 4 422 ? -19.722 149.465 8.850   1.00 74.84  ? 422 LEU B C     1 
ATOM 8383  O O     . LEU D 4 422 ? -20.721 149.090 9.480   1.00 73.05  ? 422 LEU B O     1 
ATOM 8384  C CB    . LEU D 4 422 ? -19.969 150.129 6.480   1.00 75.20  ? 422 LEU B CB    1 
ATOM 8385  C CG    . LEU D 4 422 ? -21.252 150.499 5.746   1.00 76.90  ? 422 LEU B CG    1 
ATOM 8386  C CD1   . LEU D 4 422 ? -21.419 152.012 5.745   1.00 77.93  ? 422 LEU B CD1   1 
ATOM 8387  C CD2   . LEU D 4 422 ? -21.211 149.939 4.323   1.00 78.47  ? 422 LEU B CD2   1 
ATOM 8388  N N     . VAL D 4 423 ? -18.564 148.815 8.853   1.00 75.73  ? 423 VAL B N     1 
ATOM 8389  C CA    . VAL D 4 423 ? -18.290 147.650 9.682   1.00 75.52  ? 423 VAL B CA    1 
ATOM 8390  C C     . VAL D 4 423 ? -17.539 148.162 10.917  1.00 75.90  ? 423 VAL B C     1 
ATOM 8391  O O     . VAL D 4 423 ? -17.686 147.619 12.020  1.00 75.60  ? 423 VAL B O     1 
ATOM 8392  C CB    . VAL D 4 423 ? -17.417 146.628 8.903   1.00 75.09  ? 423 VAL B CB    1 
ATOM 8393  C CG1   . VAL D 4 423 ? -17.466 145.273 9.564   1.00 73.86  ? 423 VAL B CG1   1 
ATOM 8394  C CG2   . VAL D 4 423 ? -17.868 146.532 7.441   1.00 74.04  ? 423 VAL B CG2   1 
ATOM 8395  N N     . LYS D 4 424 ? -16.789 149.257 10.726  1.00 75.96  ? 424 LYS B N     1 
ATOM 8396  C CA    . LYS D 4 424 ? -16.034 149.911 11.801  1.00 76.40  ? 424 LYS B CA    1 
ATOM 8397  C C     . LYS D 4 424 ? -17.044 150.320 12.865  1.00 76.97  ? 424 LYS B C     1 
ATOM 8398  O O     . LYS D 4 424 ? -16.703 150.836 13.932  1.00 76.18  ? 424 LYS B O     1 
ATOM 8399  C CB    . LYS D 4 424 ? -15.284 151.134 11.273  1.00 75.61  ? 424 LYS B CB    1 
ATOM 8400  N N     . LEU D 4 425 ? -18.302 150.067 12.525  1.00 78.61  ? 425 LEU B N     1 
ATOM 8401  C CA    . LEU D 4 425 ? -19.456 150.291 13.362  1.00 80.68  ? 425 LEU B CA    1 
ATOM 8402  C C     . LEU D 4 425 ? -19.400 149.171 14.399  1.00 81.35  ? 425 LEU B C     1 
ATOM 8403  O O     . LEU D 4 425 ? -20.430 148.694 14.863  1.00 80.08  ? 425 LEU B O     1 
ATOM 8404  C CB    . LEU D 4 425 ? -20.718 150.153 12.493  1.00 81.71  ? 425 LEU B CB    1 
ATOM 8405  C CG    . LEU D 4 425 ? -21.431 151.412 11.948  1.00 83.21  ? 425 LEU B CG    1 
ATOM 8406  C CD1   . LEU D 4 425 ? -20.437 152.515 11.629  1.00 83.56  ? 425 LEU B CD1   1 
ATOM 8407  C CD2   . LEU D 4 425 ? -22.309 151.082 10.728  1.00 81.84  ? 425 LEU B CD2   1 
ATOM 8408  N N     . TRP D 4 426 ? -18.181 148.723 14.701  1.00 83.75  ? 426 TRP B N     1 
ATOM 8409  C CA    . TRP D 4 426 ? -17.896 147.650 15.655  1.00 85.68  ? 426 TRP B CA    1 
ATOM 8410  C C     . TRP D 4 426 ? -18.626 146.368 15.297  1.00 85.85  ? 426 TRP B C     1 
ATOM 8411  O O     . TRP D 4 426 ? -18.266 145.275 15.746  1.00 84.17  ? 426 TRP B O     1 
ATOM 8412  C CB    . TRP D 4 426 ? -18.237 148.074 17.080  1.00 87.31  ? 426 TRP B CB    1 
ATOM 8413  C CG    . TRP D 4 426 ? -17.663 147.159 18.119  1.00 88.80  ? 426 TRP B CG    1 
ATOM 8414  C CD1   . TRP D 4 426 ? -18.140 145.932 18.487  1.00 88.06  ? 426 TRP B CD1   1 
ATOM 8415  C CD2   . TRP D 4 426 ? -16.520 147.410 18.950  1.00 89.12  ? 426 TRP B CD2   1 
ATOM 8416  N NE1   . TRP D 4 426 ? -17.371 145.407 19.494  1.00 88.50  ? 426 TRP B NE1   1 
ATOM 8417  C CE2   . TRP D 4 426 ? -16.370 146.292 19.801  1.00 89.84  ? 426 TRP B CE2   1 
ATOM 8418  C CE3   . TRP D 4 426 ? -15.611 148.478 19.062  1.00 90.28  ? 426 TRP B CE3   1 
ATOM 8419  C CZ2   . TRP D 4 426 ? -15.345 146.204 20.760  1.00 89.56  ? 426 TRP B CZ2   1 
ATOM 8420  C CZ3   . TRP D 4 426 ? -14.591 148.393 20.016  1.00 90.60  ? 426 TRP B CZ3   1 
ATOM 8421  C CH2   . TRP D 4 426 ? -14.469 147.260 20.851  1.00 89.84  ? 426 TRP B CH2   1 
ATOM 8422  N N     . TYR D 4 427 ? -19.685 146.522 14.517  1.00 87.15  ? 427 TYR B N     1 
ATOM 8423  C CA    . TYR D 4 427 ? -20.448 145.397 14.067  1.00 89.55  ? 427 TYR B CA    1 
ATOM 8424  C C     . TYR D 4 427 ? -19.645 144.860 12.910  1.00 89.62  ? 427 TYR B C     1 
ATOM 8425  O O     . TYR D 4 427 ? -19.852 145.238 11.761  1.00 90.92  ? 427 TYR B O     1 
ATOM 8426  C CB    . TYR D 4 427 ? -21.855 145.810 13.651  1.00 90.76  ? 427 TYR B CB    1 
ATOM 8427  C CG    . TYR D 4 427 ? -22.859 144.923 14.341  1.00 93.78  ? 427 TYR B CG    1 
ATOM 8428  C CD1   . TYR D 4 427 ? -22.688 144.592 15.691  1.00 94.13  ? 427 TYR B CD1   1 
ATOM 8429  C CD2   . TYR D 4 427 ? -23.921 144.341 13.645  1.00 93.81  ? 427 TYR B CD2   1 
ATOM 8430  C CE1   . TYR D 4 427 ? -23.534 143.710 16.329  1.00 94.97  ? 427 TYR B CE1   1 
ATOM 8431  C CE2   . TYR D 4 427 ? -24.788 143.446 14.286  1.00 95.92  ? 427 TYR B CE2   1 
ATOM 8432  C CZ    . TYR D 4 427 ? -24.580 143.136 15.634  1.00 96.65  ? 427 TYR B CZ    1 
ATOM 8433  O OH    . TYR D 4 427 ? -25.406 142.259 16.304  1.00 98.40  ? 427 TYR B OH    1 
ATOM 8434  N N     . GLN D 4 428 ? -18.656 144.047 13.262  1.00 88.88  ? 428 GLN B N     1 
ATOM 8435  C CA    . GLN D 4 428 ? -17.742 143.448 12.306  1.00 88.40  ? 428 GLN B CA    1 
ATOM 8436  C C     . GLN D 4 428 ? -18.406 142.580 11.241  1.00 88.24  ? 428 GLN B C     1 
ATOM 8437  O O     . GLN D 4 428 ? -17.821 142.338 10.175  1.00 87.65  ? 428 GLN B O     1 
ATOM 8438  C CB    . GLN D 4 428 ? -16.692 142.650 13.052  1.00 88.93  ? 428 GLN B CB    1 
ATOM 8439  N N     . LEU D 4 429 ? -19.636 142.151 11.519  1.00 87.76  ? 429 LEU B N     1 
ATOM 8440  C CA    . LEU D 4 429 ? -20.393 141.286 10.617  1.00 88.11  ? 429 LEU B CA    1 
ATOM 8441  C C     . LEU D 4 429 ? -20.582 141.842 9.200   1.00 88.04  ? 429 LEU B C     1 
ATOM 8442  O O     . LEU D 4 429 ? -21.575 142.516 8.915   1.00 89.33  ? 429 LEU B O     1 
ATOM 8443  C CB    . LEU D 4 429 ? -21.757 140.930 11.232  1.00 89.60  ? 429 LEU B CB    1 
ATOM 8444  C CG    . LEU D 4 429 ? -21.828 140.224 12.596  1.00 88.97  ? 429 LEU B CG    1 
ATOM 8445  C CD1   . LEU D 4 429 ? -21.612 141.232 13.722  1.00 89.53  ? 429 LEU B CD1   1 
ATOM 8446  C CD2   . LEU D 4 429 ? -23.183 139.531 12.765  1.00 87.65  ? 429 LEU B CD2   1 
ATOM 8447  N N     . GLU D 4 430 ? -19.625 141.539 8.319   1.00 86.82  ? 430 GLU B N     1 
ATOM 8448  C CA    . GLU D 4 430 ? -19.651 141.974 6.918   1.00 85.60  ? 430 GLU B CA    1 
ATOM 8449  C C     . GLU D 4 430 ? -20.582 141.125 6.056   1.00 85.54  ? 430 GLU B C     1 
ATOM 8450  O O     . GLU D 4 430 ? -20.778 139.930 6.367   1.00 85.64  ? 430 GLU B O     1 
ATOM 8451  C CB    . GLU D 4 430 ? -18.243 141.918 6.328   1.00 85.06  ? 430 GLU B CB    1 
ATOM 8452  C CG    . GLU D 4 430 ? -18.179 141.859 4.791   1.00 82.65  ? 430 GLU B CG    1 
ATOM 8453  C CD    . GLU D 4 430 ? -18.635 143.138 4.105   1.00 81.76  ? 430 GLU B CD    1 
ATOM 8454  O OE1   . GLU D 4 430 ? -19.122 143.055 2.957   1.00 80.43  ? 430 GLU B OE1   1 
ATOM 8455  O OE2   . GLU D 4 430 ? -18.504 144.223 4.706   1.00 82.06  ? 430 GLU B OE2   1 
ATOM 8456  O OXT   . GLU D 4 430 ? -21.065 141.659 5.040   1.00 85.35  ? 430 GLU B OXT   1 
ATOM 8457  N N     . ASP E 5 1   ? 20.452  133.340 37.771  1.00 54.62  ? 1   ASP L N     1 
ATOM 8458  C CA    . ASP E 5 1   ? 21.129  133.597 39.076  1.00 54.67  ? 1   ASP L CA    1 
ATOM 8459  C C     . ASP E 5 1   ? 20.846  135.017 39.538  1.00 53.87  ? 1   ASP L C     1 
ATOM 8460  O O     . ASP E 5 1   ? 21.667  135.923 39.360  1.00 53.92  ? 1   ASP L O     1 
ATOM 8461  C CB    . ASP E 5 1   ? 22.638  133.363 38.960  1.00 55.10  ? 1   ASP L CB    1 
ATOM 8462  C CG    . ASP E 5 1   ? 23.350  133.507 40.292  1.00 56.61  ? 1   ASP L CG    1 
ATOM 8463  O OD1   . ASP E 5 1   ? 23.913  134.597 40.537  1.00 58.20  ? 1   ASP L OD1   1 
ATOM 8464  O OD2   . ASP E 5 1   ? 23.333  132.542 41.093  1.00 56.87  ? 1   ASP L OD2   1 
ATOM 8465  N N     . ILE E 5 2   ? 19.683  135.187 40.159  1.00 52.50  ? 2   ILE L N     1 
ATOM 8466  C CA    . ILE E 5 2   ? 19.240  136.486 40.644  1.00 50.64  ? 2   ILE L CA    1 
ATOM 8467  C C     . ILE E 5 2   ? 19.628  136.750 42.108  1.00 51.54  ? 2   ILE L C     1 
ATOM 8468  O O     . ILE E 5 2   ? 19.861  135.818 42.886  1.00 52.70  ? 2   ILE L O     1 
ATOM 8469  C CB    . ILE E 5 2   ? 17.701  136.639 40.455  1.00 48.15  ? 2   ILE L CB    1 
ATOM 8470  C CG1   . ILE E 5 2   ? 17.309  136.350 38.999  1.00 44.04  ? 2   ILE L CG1   1 
ATOM 8471  C CG2   . ILE E 5 2   ? 17.246  138.042 40.856  1.00 47.11  ? 2   ILE L CG2   1 
ATOM 8472  C CD1   . ILE E 5 2   ? 17.214  134.885 38.667  1.00 42.00  ? 2   ILE L CD1   1 
ATOM 8473  N N     . GLN E 5 3   ? 19.761  138.028 42.452  1.00 51.21  ? 3   GLN L N     1 
ATOM 8474  C CA    . GLN E 5 3   ? 20.101  138.426 43.810  1.00 51.54  ? 3   GLN L CA    1 
ATOM 8475  C C     . GLN E 5 3   ? 18.813  138.719 44.564  1.00 50.09  ? 3   GLN L C     1 
ATOM 8476  O O     . GLN E 5 3   ? 18.183  139.772 44.385  1.00 48.24  ? 3   GLN L O     1 
ATOM 8477  C CB    . GLN E 5 3   ? 21.004  139.661 43.806  1.00 55.28  ? 3   GLN L CB    1 
ATOM 8478  C CG    . GLN E 5 3   ? 21.588  140.017 45.170  1.00 58.09  ? 3   GLN L CG    1 
ATOM 8479  C CD    . GLN E 5 3   ? 22.607  138.994 45.646  1.00 59.61  ? 3   GLN L CD    1 
ATOM 8480  O OE1   . GLN E 5 3   ? 23.769  139.329 45.899  1.00 59.97  ? 3   GLN L OE1   1 
ATOM 8481  N NE2   . GLN E 5 3   ? 22.180  137.733 45.753  1.00 60.52  ? 3   GLN L NE2   1 
ATOM 8482  N N     . MET E 5 4   ? 18.427  137.773 45.407  1.00 48.66  ? 4   MET L N     1 
ATOM 8483  C CA    . MET E 5 4   ? 17.212  137.914 46.170  1.00 48.52  ? 4   MET L CA    1 
ATOM 8484  C C     . MET E 5 4   ? 17.376  138.502 47.539  1.00 49.19  ? 4   MET L C     1 
ATOM 8485  O O     . MET E 5 4   ? 18.252  138.090 48.299  1.00 49.46  ? 4   MET L O     1 
ATOM 8486  C CB    . MET E 5 4   ? 16.479  136.598 46.201  1.00 47.88  ? 4   MET L CB    1 
ATOM 8487  C CG    . MET E 5 4   ? 15.904  136.342 44.843  1.00 50.35  ? 4   MET L CG    1 
ATOM 8488  S SD    . MET E 5 4   ? 15.361  137.943 44.199  1.00 50.98  ? 4   MET L SD    1 
ATOM 8489  C CE    . MET E 5 4   ? 13.886  138.244 45.259  1.00 50.77  ? 4   MET L CE    1 
ATOM 8490  N N     . THR E 5 5   ? 16.516  139.466 47.860  1.00 50.40  ? 5   THR L N     1 
ATOM 8491  C CA    . THR E 5 5   ? 16.625  140.135 49.146  1.00 51.70  ? 5   THR L CA    1 
ATOM 8492  C C     . THR E 5 5   ? 15.363  140.424 49.949  1.00 51.98  ? 5   THR L C     1 
ATOM 8493  O O     . THR E 5 5   ? 14.386  141.000 49.444  1.00 51.54  ? 5   THR L O     1 
ATOM 8494  C CB    . THR E 5 5   ? 17.436  141.441 49.013  1.00 52.44  ? 5   THR L CB    1 
ATOM 8495  O OG1   . THR E 5 5   ? 18.684  141.154 48.369  1.00 53.23  ? 5   THR L OG1   1 
ATOM 8496  C CG2   . THR E 5 5   ? 17.725  142.034 50.390  1.00 52.46  ? 5   THR L CG2   1 
ATOM 8497  N N     . GLN E 5 6   ? 15.435  140.015 51.219  1.00 51.38  ? 6   GLN L N     1 
ATOM 8498  C CA    . GLN E 5 6   ? 14.389  140.212 52.213  1.00 49.92  ? 6   GLN L CA    1 
ATOM 8499  C C     . GLN E 5 6   ? 15.058  141.072 53.273  1.00 49.72  ? 6   GLN L C     1 
ATOM 8500  O O     . GLN E 5 6   ? 15.725  140.566 54.167  1.00 48.77  ? 6   GLN L O     1 
ATOM 8501  C CB    . GLN E 5 6   ? 13.932  138.881 52.820  1.00 48.73  ? 6   GLN L CB    1 
ATOM 8502  C CG    . GLN E 5 6   ? 13.180  137.959 51.853  1.00 48.08  ? 6   GLN L CG    1 
ATOM 8503  C CD    . GLN E 5 6   ? 12.427  136.822 52.547  1.00 46.28  ? 6   GLN L CD    1 
ATOM 8504  O OE1   . GLN E 5 6   ? 12.016  136.937 53.703  1.00 41.32  ? 6   GLN L OE1   1 
ATOM 8505  N NE2   . GLN E 5 6   ? 12.233  135.725 51.828  1.00 46.67  ? 6   GLN L NE2   1 
ATOM 8506  N N     . THR E 5 7   ? 14.924  142.383 53.096  1.00 50.86  ? 7   THR L N     1 
ATOM 8507  C CA    . THR E 5 7   ? 15.499  143.427 53.953  1.00 51.49  ? 7   THR L CA    1 
ATOM 8508  C C     . THR E 5 7   ? 15.253  143.308 55.456  1.00 49.81  ? 7   THR L C     1 
ATOM 8509  O O     . THR E 5 7   ? 16.191  143.224 56.259  1.00 49.70  ? 7   THR L O     1 
ATOM 8510  C CB    . THR E 5 7   ? 14.969  144.817 53.516  1.00 53.73  ? 7   THR L CB    1 
ATOM 8511  O OG1   . THR E 5 7   ? 13.535  144.765 53.403  1.00 57.05  ? 7   THR L OG1   1 
ATOM 8512  C CG2   . THR E 5 7   ? 15.575  145.240 52.173  1.00 54.39  ? 7   THR L CG2   1 
ATOM 8513  N N     . THR E 5 8   ? 13.985  143.424 55.827  1.00 48.28  ? 8   THR L N     1 
ATOM 8514  C CA    . THR E 5 8   ? 13.577  143.344 57.213  1.00 46.41  ? 8   THR L CA    1 
ATOM 8515  C C     . THR E 5 8   ? 13.606  141.887 57.602  1.00 44.82  ? 8   THR L C     1 
ATOM 8516  O O     . THR E 5 8   ? 12.629  141.161 57.484  1.00 43.87  ? 8   THR L O     1 
ATOM 8517  C CB    . THR E 5 8   ? 12.191  143.962 57.400  1.00 47.26  ? 8   THR L CB    1 
ATOM 8518  O OG1   . THR E 5 8   ? 11.447  143.841 56.178  1.00 48.25  ? 8   THR L OG1   1 
ATOM 8519  C CG2   . THR E 5 8   ? 12.323  145.436 57.762  1.00 46.97  ? 8   THR L CG2   1 
ATOM 8520  N N     . SER E 5 9   ? 14.799  141.458 57.970  1.00 44.50  ? 9   SER L N     1 
ATOM 8521  C CA    . SER E 5 9   ? 15.073  140.090 58.373  1.00 44.91  ? 9   SER L CA    1 
ATOM 8522  C C     . SER E 5 9   ? 14.021  139.470 59.298  1.00 43.99  ? 9   SER L C     1 
ATOM 8523  O O     . SER E 5 9   ? 13.629  138.306 59.142  1.00 43.79  ? 9   SER L O     1 
ATOM 8524  C CB    . SER E 5 9   ? 16.442  140.063 59.054  1.00 46.17  ? 9   SER L CB    1 
ATOM 8525  O OG    . SER E 5 9   ? 16.588  141.168 59.934  1.00 47.63  ? 9   SER L OG    1 
ATOM 8526  N N     . SER E 5 10  ? 13.565  140.268 60.254  1.00 42.62  ? 10  SER L N     1 
ATOM 8527  C CA    . SER E 5 10  ? 12.591  139.821 61.232  1.00 39.91  ? 10  SER L CA    1 
ATOM 8528  C C     . SER E 5 10  ? 11.947  141.024 61.906  1.00 38.49  ? 10  SER L C     1 
ATOM 8529  O O     . SER E 5 10  ? 12.552  142.097 62.004  1.00 38.86  ? 10  SER L O     1 
ATOM 8530  C CB    . SER E 5 10  ? 13.294  138.953 62.269  1.00 39.07  ? 10  SER L CB    1 
ATOM 8531  O OG    . SER E 5 10  ? 14.552  139.510 62.604  1.00 39.36  ? 10  SER L OG    1 
ATOM 8532  N N     . LEU E 5 11  ? 10.718  140.837 62.369  1.00 35.34  ? 11  LEU L N     1 
ATOM 8533  C CA    . LEU E 5 11  ? 9.980   141.900 63.020  1.00 32.23  ? 11  LEU L CA    1 
ATOM 8534  C C     . LEU E 5 11  ? 9.060   141.306 64.061  1.00 31.22  ? 11  LEU L C     1 
ATOM 8535  O O     . LEU E 5 11  ? 8.706   140.133 63.996  1.00 31.98  ? 11  LEU L O     1 
ATOM 8536  C CB    . LEU E 5 11  ? 9.132   142.644 62.002  1.00 30.50  ? 11  LEU L CB    1 
ATOM 8537  C CG    . LEU E 5 11  ? 7.913   141.839 61.560  1.00 29.77  ? 11  LEU L CG    1 
ATOM 8538  C CD1   . LEU E 5 11  ? 6.878   142.767 60.997  1.00 30.27  ? 11  LEU L CD1   1 
ATOM 8539  C CD2   . LEU E 5 11  ? 8.304   140.786 60.559  1.00 28.68  ? 11  LEU L CD2   1 
ATOM 8540  N N     . SER E 5 12  ? 8.598   142.148 64.967  1.00 30.52  ? 12  SER L N     1 
ATOM 8541  C CA    . SER E 5 12  ? 7.715   141.694 66.019  1.00 29.77  ? 12  SER L CA    1 
ATOM 8542  C C     . SER E 5 12  ? 6.423   142.484 66.080  1.00 29.46  ? 12  SER L C     1 
ATOM 8543  O O     . SER E 5 12  ? 6.408   143.653 66.457  1.00 29.22  ? 12  SER L O     1 
ATOM 8544  C CB    . SER E 5 12  ? 8.437   141.752 67.362  1.00 29.11  ? 12  SER L CB    1 
ATOM 8545  O OG    . SER E 5 12  ? 9.211   142.935 67.466  1.00 29.02  ? 12  SER L OG    1 
ATOM 8546  N N     . ALA E 5 13  ? 5.334   141.839 65.690  1.00 29.45  ? 13  ALA L N     1 
ATOM 8547  C CA    . ALA E 5 13  ? 4.027   142.473 65.729  1.00 29.52  ? 13  ALA L CA    1 
ATOM 8548  C C     . ALA E 5 13  ? 3.164   141.832 66.808  1.00 29.06  ? 13  ALA L C     1 
ATOM 8549  O O     . ALA E 5 13  ? 3.650   141.053 67.632  1.00 30.12  ? 13  ALA L O     1 
ATOM 8550  C CB    . ALA E 5 13  ? 3.348   142.356 64.391  1.00 31.02  ? 13  ALA L CB    1 
ATOM 8551  N N     . SER E 5 14  ? 1.882   142.174 66.808  1.00 27.63  ? 14  SER L N     1 
ATOM 8552  C CA    . SER E 5 14  ? 0.968   141.621 67.784  1.00 27.34  ? 14  SER L CA    1 
ATOM 8553  C C     . SER E 5 14  ? -0.279  141.150 67.114  1.00 26.36  ? 14  SER L C     1 
ATOM 8554  O O     . SER E 5 14  ? -0.535  141.479 65.961  1.00 25.50  ? 14  SER L O     1 
ATOM 8555  C CB    . SER E 5 14  ? 0.634   142.633 68.871  1.00 29.81  ? 14  SER L CB    1 
ATOM 8556  O OG    . SER E 5 14  ? 1.552   142.511 69.946  1.00 34.56  ? 14  SER L OG    1 
ATOM 8557  N N     . LEU E 5 15  ? -1.050  140.363 67.850  1.00 26.58  ? 15  LEU L N     1 
ATOM 8558  C CA    . LEU E 5 15  ? -2.288  139.792 67.346  1.00 26.51  ? 15  LEU L CA    1 
ATOM 8559  C C     . LEU E 5 15  ? -3.218  140.809 66.718  1.00 25.53  ? 15  LEU L C     1 
ATOM 8560  O O     . LEU E 5 15  ? -3.580  141.806 67.340  1.00 24.22  ? 15  LEU L O     1 
ATOM 8561  C CB    . LEU E 5 15  ? -2.991  139.039 68.464  1.00 27.93  ? 15  LEU L CB    1 
ATOM 8562  C CG    . LEU E 5 15  ? -2.412  137.647 68.708  1.00 26.75  ? 15  LEU L CG    1 
ATOM 8563  C CD1   . LEU E 5 15  ? -2.162  137.391 70.204  1.00 26.00  ? 15  LEU L CD1   1 
ATOM 8564  C CD2   . LEU E 5 15  ? -3.376  136.641 68.095  1.00 24.94  ? 15  LEU L CD2   1 
ATOM 8565  N N     . GLY E 5 16  ? -3.582  140.551 65.469  1.00 25.48  ? 16  GLY L N     1 
ATOM 8566  C CA    . GLY E 5 16  ? -4.453  141.462 64.756  1.00 27.77  ? 16  GLY L CA    1 
ATOM 8567  C C     . GLY E 5 16  ? -3.709  142.473 63.890  1.00 29.13  ? 16  GLY L C     1 
ATOM 8568  O O     . GLY E 5 16  ? -4.299  143.081 62.991  1.00 30.30  ? 16  GLY L O     1 
ATOM 8569  N N     . ASP E 5 17  ? -2.419  142.666 64.142  1.00 28.35  ? 17  ASP L N     1 
ATOM 8570  C CA    . ASP E 5 17  ? -1.653  143.607 63.348  1.00 27.69  ? 17  ASP L CA    1 
ATOM 8571  C C     . ASP E 5 17  ? -1.681  143.144 61.905  1.00 27.89  ? 17  ASP L C     1 
ATOM 8572  O O     . ASP E 5 17  ? -1.812  141.955 61.621  1.00 25.47  ? 17  ASP L O     1 
ATOM 8573  C CB    . ASP E 5 17  ? -0.197  143.659 63.810  1.00 28.79  ? 17  ASP L CB    1 
ATOM 8574  C CG    . ASP E 5 17  ? -0.040  144.158 65.234  1.00 28.93  ? 17  ASP L CG    1 
ATOM 8575  O OD1   . ASP E 5 17  ? -0.995  144.067 66.033  1.00 29.27  ? 17  ASP L OD1   1 
ATOM 8576  O OD2   . ASP E 5 17  ? 1.067   144.625 65.567  1.00 29.34  ? 17  ASP L OD2   1 
ATOM 8577  N N     . ARG E 5 18  ? -1.627  144.110 60.999  1.00 30.30  ? 18  ARG L N     1 
ATOM 8578  C CA    . ARG E 5 18  ? -1.591  143.846 59.561  1.00 33.30  ? 18  ARG L CA    1 
ATOM 8579  C C     . ARG E 5 18  ? -0.123  143.946 59.193  1.00 33.24  ? 18  ARG L C     1 
ATOM 8580  O O     . ARG E 5 18  ? 0.516   144.948 59.518  1.00 34.11  ? 18  ARG L O     1 
ATOM 8581  C CB    . ARG E 5 18  ? -2.391  144.918 58.809  1.00 36.43  ? 18  ARG L CB    1 
ATOM 8582  C CG    . ARG E 5 18  ? -2.018  145.102 57.349  1.00 39.41  ? 18  ARG L CG    1 
ATOM 8583  C CD    . ARG E 5 18  ? -1.690  146.564 57.092  1.00 43.65  ? 18  ARG L CD    1 
ATOM 8584  N NE    . ARG E 5 18  ? -1.567  146.860 55.666  1.00 50.05  ? 18  ARG L NE    1 
ATOM 8585  C CZ    . ARG E 5 18  ? -0.538  147.496 55.104  1.00 53.04  ? 18  ARG L CZ    1 
ATOM 8586  N NH1   . ARG E 5 18  ? 0.487   147.909 55.849  1.00 54.61  ? 18  ARG L NH1   1 
ATOM 8587  N NH2   . ARG E 5 18  ? -0.542  147.748 53.792  1.00 54.07  ? 18  ARG L NH2   1 
ATOM 8588  N N     . VAL E 5 19  ? 0.438   142.928 58.551  1.00 31.72  ? 19  VAL L N     1 
ATOM 8589  C CA    . VAL E 5 19  ? 1.847   143.037 58.232  1.00 31.35  ? 19  VAL L CA    1 
ATOM 8590  C C     . VAL E 5 19  ? 2.195   142.852 56.797  1.00 31.19  ? 19  VAL L C     1 
ATOM 8591  O O     . VAL E 5 19  ? 1.719   141.940 56.137  1.00 28.58  ? 19  VAL L O     1 
ATOM 8592  C CB    . VAL E 5 19  ? 2.730   142.124 59.072  1.00 32.62  ? 19  VAL L CB    1 
ATOM 8593  C CG1   . VAL E 5 19  ? 4.185   142.592 58.947  1.00 32.59  ? 19  VAL L CG1   1 
ATOM 8594  C CG2   . VAL E 5 19  ? 2.268   142.120 60.531  1.00 31.69  ? 19  VAL L CG2   1 
ATOM 8595  N N     . THR E 5 20  ? 3.171   143.646 56.388  1.00 33.30  ? 20  THR L N     1 
ATOM 8596  C CA    . THR E 5 20  ? 3.626   143.674 55.022  1.00 36.74  ? 20  THR L CA    1 
ATOM 8597  C C     . THR E 5 20  ? 5.095   143.378 54.881  1.00 37.82  ? 20  THR L C     1 
ATOM 8598  O O     . THR E 5 20  ? 5.926   143.973 55.581  1.00 37.58  ? 20  THR L O     1 
ATOM 8599  C CB    . THR E 5 20  ? 3.403   145.064 54.461  1.00 38.36  ? 20  THR L CB    1 
ATOM 8600  O OG1   . THR E 5 20  ? 2.066   145.475 54.756  1.00 41.89  ? 20  THR L OG1   1 
ATOM 8601  C CG2   . THR E 5 20  ? 3.614   145.074 52.968  1.00 39.54  ? 20  THR L CG2   1 
ATOM 8602  N N     . ILE E 5 21  ? 5.418   142.506 53.929  1.00 38.66  ? 21  ILE L N     1 
ATOM 8603  C CA    . ILE E 5 21  ? 6.807   142.176 53.691  1.00 40.54  ? 21  ILE L CA    1 
ATOM 8604  C C     . ILE E 5 21  ? 7.325   142.444 52.279  1.00 42.02  ? 21  ILE L C     1 
ATOM 8605  O O     . ILE E 5 21  ? 6.754   142.030 51.258  1.00 40.28  ? 21  ILE L O     1 
ATOM 8606  C CB    . ILE E 5 21  ? 7.167   140.777 54.159  1.00 41.07  ? 21  ILE L CB    1 
ATOM 8607  C CG1   . ILE E 5 21  ? 6.579   140.536 55.551  1.00 41.85  ? 21  ILE L CG1   1 
ATOM 8608  C CG2   . ILE E 5 21  ? 8.689   140.668 54.274  1.00 41.37  ? 21  ILE L CG2   1 
ATOM 8609  C CD1   . ILE E 5 21  ? 7.094   139.287 56.223  1.00 41.83  ? 21  ILE L CD1   1 
ATOM 8610  N N     . SER E 5 22  ? 8.449   143.149 52.280  1.00 44.29  ? 22  SER L N     1 
ATOM 8611  C CA    . SER E 5 22  ? 9.162   143.605 51.096  1.00 46.51  ? 22  SER L CA    1 
ATOM 8612  C C     . SER E 5 22  ? 10.165  142.644 50.453  1.00 46.75  ? 22  SER L C     1 
ATOM 8613  O O     . SER E 5 22  ? 11.266  142.419 50.992  1.00 46.25  ? 22  SER L O     1 
ATOM 8614  C CB    . SER E 5 22  ? 9.888   144.909 51.457  1.00 47.68  ? 22  SER L CB    1 
ATOM 8615  O OG    . SER E 5 22  ? 10.612  144.761 52.676  1.00 47.50  ? 22  SER L OG    1 
ATOM 8616  N N     . CYS E 5 23  ? 9.818   142.130 49.274  1.00 46.13  ? 23  CYS L N     1 
ATOM 8617  C CA    . CYS E 5 23  ? 10.731  141.242 48.567  1.00 46.51  ? 23  CYS L CA    1 
ATOM 8618  C C     . CYS E 5 23  ? 11.379  141.936 47.377  1.00 46.17  ? 23  CYS L C     1 
ATOM 8619  O O     . CYS E 5 23  ? 10.683  142.496 46.522  1.00 44.37  ? 23  CYS L O     1 
ATOM 8620  C CB    . CYS E 5 23  ? 10.037  139.984 48.084  1.00 46.85  ? 23  CYS L CB    1 
ATOM 8621  S SG    . CYS E 5 23  ? 11.225  138.768 47.429  1.00 47.22  ? 23  CYS L SG    1 
ATOM 8622  N N     . SER E 5 24  ? 12.708  141.840 47.299  1.00 46.76  ? 24  SER L N     1 
ATOM 8623  C CA    . SER E 5 24  ? 13.447  142.477 46.218  1.00 47.01  ? 24  SER L CA    1 
ATOM 8624  C C     . SER E 5 24  ? 14.414  141.613 45.427  1.00 45.99  ? 24  SER L C     1 
ATOM 8625  O O     . SER E 5 24  ? 15.307  140.964 45.986  1.00 43.94  ? 24  SER L O     1 
ATOM 8626  C CB    . SER E 5 24  ? 14.195  143.708 46.722  1.00 49.17  ? 24  SER L CB    1 
ATOM 8627  O OG    . SER E 5 24  ? 14.728  144.433 45.620  1.00 51.71  ? 24  SER L OG    1 
ATOM 8628  N N     . ALA E 5 25  ? 14.264  141.715 44.105  1.00 45.21  ? 25  ALA L N     1 
ATOM 8629  C CA    . ALA E 5 25  ? 15.065  140.994 43.117  1.00 44.00  ? 25  ALA L CA    1 
ATOM 8630  C C     . ALA E 5 25  ? 16.116  141.908 42.515  1.00 42.49  ? 25  ALA L C     1 
ATOM 8631  O O     . ALA E 5 25  ? 16.212  143.078 42.888  1.00 43.59  ? 25  ALA L O     1 
ATOM 8632  C CB    . ALA E 5 25  ? 14.163  140.468 42.011  1.00 43.71  ? 25  ALA L CB    1 
ATOM 8633  N N     . SER E 5 26  ? 16.878  141.386 41.558  1.00 40.23  ? 26  SER L N     1 
ATOM 8634  C CA    . SER E 5 26  ? 17.907  142.189 40.911  1.00 38.55  ? 26  SER L CA    1 
ATOM 8635  C C     . SER E 5 26  ? 17.650  142.438 39.440  1.00 36.73  ? 26  SER L C     1 
ATOM 8636  O O     . SER E 5 26  ? 18.581  142.654 38.661  1.00 36.67  ? 26  SER L O     1 
ATOM 8637  C CB    . SER E 5 26  ? 19.307  141.623 41.153  1.00 38.89  ? 26  SER L CB    1 
ATOM 8638  O OG    . SER E 5 26  ? 19.776  142.000 42.441  1.00 39.25  ? 26  SER L OG    1 
ATOM 8639  N N     . GLN E 5 27  ? 16.373  142.369 39.080  1.00 35.18  ? 27  GLN L N     1 
ATOM 8640  C CA    . GLN E 5 27  ? 15.878  142.642 37.737  1.00 35.34  ? 27  GLN L CA    1 
ATOM 8641  C C     . GLN E 5 27  ? 14.434  142.251 37.657  1.00 35.22  ? 27  GLN L C     1 
ATOM 8642  O O     . GLN E 5 27  ? 13.917  141.570 38.540  1.00 33.30  ? 27  GLN L O     1 
ATOM 8643  C CB    . GLN E 5 27  ? 16.687  141.973 36.615  1.00 34.77  ? 27  GLN L CB    1 
ATOM 8644  C CG    . GLN E 5 27  ? 16.817  140.468 36.658  1.00 34.83  ? 27  GLN L CG    1 
ATOM 8645  C CD    . GLN E 5 27  ? 18.067  139.979 35.903  1.00 36.97  ? 27  GLN L CD    1 
ATOM 8646  O OE1   . GLN E 5 27  ? 17.958  139.294 34.885  1.00 36.59  ? 27  GLN L OE1   1 
ATOM 8647  N NE2   . GLN E 5 27  ? 19.260  140.349 36.398  1.00 35.74  ? 27  GLN L NE2   1 
ATOM 8648  N N     . ASP E 5 28  ? 13.768  142.793 36.648  1.00 36.62  ? 28  ASP L N     1 
ATOM 8649  C CA    . ASP E 5 28  ? 12.365  142.517 36.391  1.00 38.19  ? 28  ASP L CA    1 
ATOM 8650  C C     . ASP E 5 28  ? 12.248  141.000 36.400  1.00 37.29  ? 28  ASP L C     1 
ATOM 8651  O O     . ASP E 5 28  ? 13.127  140.320 35.880  1.00 38.51  ? 28  ASP L O     1 
ATOM 8652  C CB    . ASP E 5 28  ? 12.005  143.077 34.999  1.00 42.19  ? 28  ASP L CB    1 
ATOM 8653  C CG    . ASP E 5 28  ? 10.556  142.786 34.576  1.00 46.18  ? 28  ASP L CG    1 
ATOM 8654  O OD1   . ASP E 5 28  ? 9.824   143.754 34.230  1.00 47.07  ? 28  ASP L OD1   1 
ATOM 8655  O OD2   . ASP E 5 28  ? 10.166  141.592 34.544  1.00 48.11  ? 28  ASP L OD2   1 
ATOM 8656  N N     . ILE E 5 29  ? 11.216  140.468 37.044  1.00 35.36  ? 29  ILE L N     1 
ATOM 8657  C CA    . ILE E 5 29  ? 11.032  139.024 37.072  1.00 34.99  ? 29  ILE L CA    1 
ATOM 8658  C C     . ILE E 5 29  ? 9.683   138.664 36.488  1.00 34.98  ? 29  ILE L C     1 
ATOM 8659  O O     . ILE E 5 29  ? 9.420   137.500 36.203  1.00 34.57  ? 29  ILE L O     1 
ATOM 8660  C CB    . ILE E 5 29  ? 11.109  138.451 38.483  1.00 34.87  ? 29  ILE L CB    1 
ATOM 8661  C CG1   . ILE E 5 29  ? 9.909   138.932 39.298  1.00 35.41  ? 29  ILE L CG1   1 
ATOM 8662  C CG2   . ILE E 5 29  ? 12.453  138.799 39.119  1.00 33.82  ? 29  ILE L CG2   1 
ATOM 8663  C CD1   . ILE E 5 29  ? 9.497   138.003 40.415  1.00 34.92  ? 29  ILE L CD1   1 
ATOM 8664  N N     . SER E 5 30  ? 8.817   139.669 36.393  1.00 35.88  ? 30  SER L N     1 
ATOM 8665  C CA    . SER E 5 30  ? 7.471   139.562 35.827  1.00 36.61  ? 30  SER L CA    1 
ATOM 8666  C C     . SER E 5 30  ? 6.442   138.697 36.546  1.00 35.78  ? 30  SER L C     1 
ATOM 8667  O O     . SER E 5 30  ? 5.840   137.799 35.944  1.00 35.04  ? 30  SER L O     1 
ATOM 8668  C CB    . SER E 5 30  ? 7.533   139.183 34.338  1.00 37.95  ? 30  SER L CB    1 
ATOM 8669  O OG    . SER E 5 30  ? 8.112   137.904 34.132  1.00 39.36  ? 30  SER L OG    1 
ATOM 8670  N N     . SER E 5 31  ? 6.184   139.026 37.808  1.00 35.52  ? 31  SER L N     1 
ATOM 8671  C CA    . SER E 5 31  ? 5.200   138.290 38.603  1.00 37.68  ? 31  SER L CA    1 
ATOM 8672  C C     . SER E 5 31  ? 5.628   136.851 38.799  1.00 37.14  ? 31  SER L C     1 
ATOM 8673  O O     . SER E 5 31  ? 4.807   135.978 39.084  1.00 36.60  ? 31  SER L O     1 
ATOM 8674  C CB    . SER E 5 31  ? 3.830   138.291 37.910  1.00 39.32  ? 31  SER L CB    1 
ATOM 8675  O OG    . SER E 5 31  ? 3.329   139.603 37.739  1.00 43.83  ? 31  SER L OG    1 
ATOM 8676  N N     . TYR E 5 32  ? 6.924   136.610 38.655  1.00 36.32  ? 32  TYR L N     1 
ATOM 8677  C CA    . TYR E 5 32  ? 7.450   135.269 38.782  1.00 34.74  ? 32  TYR L CA    1 
ATOM 8678  C C     . TYR E 5 32  ? 8.042   134.974 40.138  1.00 33.29  ? 32  TYR L C     1 
ATOM 8679  O O     . TYR E 5 32  ? 9.192   134.541 40.261  1.00 33.36  ? 32  TYR L O     1 
ATOM 8680  C CB    . TYR E 5 32  ? 8.432   135.018 37.655  1.00 36.06  ? 32  TYR L CB    1 
ATOM 8681  C CG    . TYR E 5 32  ? 7.726   135.001 36.326  1.00 38.17  ? 32  TYR L CG    1 
ATOM 8682  C CD1   . TYR E 5 32  ? 8.437   134.935 35.131  1.00 40.43  ? 32  TYR L CD1   1 
ATOM 8683  C CD2   . TYR E 5 32  ? 6.331   135.002 36.268  1.00 39.01  ? 32  TYR L CD2   1 
ATOM 8684  C CE1   . TYR E 5 32  ? 7.775   134.855 33.910  1.00 42.11  ? 32  TYR L CE1   1 
ATOM 8685  C CE2   . TYR E 5 32  ? 5.662   134.928 35.065  1.00 41.06  ? 32  TYR L CE2   1 
ATOM 8686  C CZ    . TYR E 5 32  ? 6.384   134.849 33.888  1.00 42.33  ? 32  TYR L CZ    1 
ATOM 8687  O OH    . TYR E 5 32  ? 5.712   134.713 32.696  1.00 45.37  ? 32  TYR L OH    1 
ATOM 8688  N N     . LEU E 5 33  ? 7.207   135.142 41.154  1.00 31.05  ? 33  LEU L N     1 
ATOM 8689  C CA    . LEU E 5 33  ? 7.633   134.909 42.512  1.00 29.18  ? 33  LEU L CA    1 
ATOM 8690  C C     . LEU E 5 33  ? 6.637   134.055 43.279  1.00 28.63  ? 33  LEU L C     1 
ATOM 8691  O O     . LEU E 5 33  ? 5.494   133.874 42.848  1.00 28.77  ? 33  LEU L O     1 
ATOM 8692  C CB    . LEU E 5 33  ? 7.857   136.239 43.205  1.00 29.71  ? 33  LEU L CB    1 
ATOM 8693  C CG    . LEU E 5 33  ? 8.728   136.136 44.443  1.00 30.41  ? 33  LEU L CG    1 
ATOM 8694  C CD1   . LEU E 5 33  ? 9.961   137.009 44.281  1.00 30.70  ? 33  LEU L CD1   1 
ATOM 8695  C CD2   . LEU E 5 33  ? 7.909   136.545 45.645  1.00 31.87  ? 33  LEU L CD2   1 
ATOM 8696  N N     . ASN E 5 34  ? 7.095   133.499 44.398  1.00 27.71  ? 34  ASN L N     1 
ATOM 8697  C CA    . ASN E 5 34  ? 6.280   132.633 45.245  1.00 26.72  ? 34  ASN L CA    1 
ATOM 8698  C C     . ASN E 5 34  ? 6.540   132.905 46.729  1.00 25.90  ? 34  ASN L C     1 
ATOM 8699  O O     . ASN E 5 34  ? 7.625   133.378 47.122  1.00 25.29  ? 34  ASN L O     1 
ATOM 8700  C CB    . ASN E 5 34  ? 6.582   131.156 44.942  1.00 27.50  ? 34  ASN L CB    1 
ATOM 8701  C CG    . ASN E 5 34  ? 6.298   130.778 43.491  1.00 29.21  ? 34  ASN L CG    1 
ATOM 8702  O OD1   . ASN E 5 34  ? 5.260   131.148 42.930  1.00 31.09  ? 34  ASN L OD1   1 
ATOM 8703  N ND2   . ASN E 5 34  ? 7.220   130.035 42.877  1.00 26.48  ? 34  ASN L ND2   1 
ATOM 8704  N N     . TRP E 5 35  ? 5.536   132.612 47.553  1.00 23.58  ? 35  TRP L N     1 
ATOM 8705  C CA    . TRP E 5 35  ? 5.677   132.819 48.983  1.00 22.51  ? 35  TRP L CA    1 
ATOM 8706  C C     . TRP E 5 35  ? 5.402   131.588 49.831  1.00 22.98  ? 35  TRP L C     1 
ATOM 8707  O O     . TRP E 5 35  ? 4.285   131.054 49.884  1.00 20.03  ? 35  TRP L O     1 
ATOM 8708  C CB    . TRP E 5 35  ? 4.839   134.000 49.446  1.00 20.05  ? 35  TRP L CB    1 
ATOM 8709  C CG    . TRP E 5 35  ? 5.324   135.299 48.911  1.00 15.50  ? 35  TRP L CG    1 
ATOM 8710  C CD1   . TRP E 5 35  ? 4.838   135.969 47.834  1.00 15.80  ? 35  TRP L CD1   1 
ATOM 8711  C CD2   . TRP E 5 35  ? 6.369   136.108 49.446  1.00 12.87  ? 35  TRP L CD2   1 
ATOM 8712  N NE1   . TRP E 5 35  ? 5.505   137.156 47.666  1.00 13.05  ? 35  TRP L NE1   1 
ATOM 8713  C CE2   . TRP E 5 35  ? 6.452   137.267 48.646  1.00 12.26  ? 35  TRP L CE2   1 
ATOM 8714  C CE3   . TRP E 5 35  ? 7.238   135.971 50.527  1.00 13.67  ? 35  TRP L CE3   1 
ATOM 8715  C CZ2   . TRP E 5 35  ? 7.365   138.283 48.892  1.00 11.37  ? 35  TRP L CZ2   1 
ATOM 8716  C CZ3   . TRP E 5 35  ? 8.150   136.985 50.776  1.00 14.47  ? 35  TRP L CZ3   1 
ATOM 8717  C CH2   . TRP E 5 35  ? 8.204   138.130 49.959  1.00 13.26  ? 35  TRP L CH2   1 
ATOM 8718  N N     . TYR E 5 36  ? 6.474   131.133 50.469  1.00 24.99  ? 36  TYR L N     1 
ATOM 8719  C CA    . TYR E 5 36  ? 6.437   129.966 51.339  1.00 27.10  ? 36  TYR L CA    1 
ATOM 8720  C C     . TYR E 5 36  ? 6.555   130.458 52.778  1.00 27.66  ? 36  TYR L C     1 
ATOM 8721  O O     . TYR E 5 36  ? 7.074   131.551 53.027  1.00 27.75  ? 36  TYR L O     1 
ATOM 8722  C CB    . TYR E 5 36  ? 7.624   129.015 51.042  1.00 27.38  ? 36  TYR L CB    1 
ATOM 8723  C CG    . TYR E 5 36  ? 7.720   128.471 49.619  1.00 24.61  ? 36  TYR L CG    1 
ATOM 8724  C CD1   . TYR E 5 36  ? 6.655   127.778 49.036  1.00 25.02  ? 36  TYR L CD1   1 
ATOM 8725  C CD2   . TYR E 5 36  ? 8.877   128.663 48.856  1.00 23.58  ? 36  TYR L CD2   1 
ATOM 8726  C CE1   . TYR E 5 36  ? 6.738   127.297 47.736  1.00 24.42  ? 36  TYR L CE1   1 
ATOM 8727  C CE2   . TYR E 5 36  ? 8.968   128.187 47.555  1.00 23.52  ? 36  TYR L CE2   1 
ATOM 8728  C CZ    . TYR E 5 36  ? 7.894   127.509 47.004  1.00 24.40  ? 36  TYR L CZ    1 
ATOM 8729  O OH    . TYR E 5 36  ? 7.964   127.068 45.708  1.00 26.92  ? 36  TYR L OH    1 
ATOM 8730  N N     . GLN E 5 37  ? 6.042   129.669 53.716  1.00 27.66  ? 37  GLN L N     1 
ATOM 8731  C CA    . GLN E 5 37  ? 6.149   130.016 55.124  1.00 29.18  ? 37  GLN L CA    1 
ATOM 8732  C C     . GLN E 5 37  ? 6.696   128.803 55.833  1.00 29.16  ? 37  GLN L C     1 
ATOM 8733  O O     . GLN E 5 37  ? 6.142   127.709 55.726  1.00 29.33  ? 37  GLN L O     1 
ATOM 8734  C CB    . GLN E 5 37  ? 4.793   130.399 55.729  1.00 32.31  ? 37  GLN L CB    1 
ATOM 8735  C CG    . GLN E 5 37  ? 3.803   129.245 55.938  1.00 36.12  ? 37  GLN L CG    1 
ATOM 8736  C CD    . GLN E 5 37  ? 3.218   129.214 57.355  1.00 39.08  ? 37  GLN L CD    1 
ATOM 8737  O OE1   . GLN E 5 37  ? 2.065   129.599 57.577  1.00 41.61  ? 37  GLN L OE1   1 
ATOM 8738  N NE2   . GLN E 5 37  ? 4.015   128.753 58.316  1.00 40.35  ? 37  GLN L NE2   1 
ATOM 8739  N N     . GLN E 5 38  ? 7.832   128.956 56.488  1.00 28.83  ? 38  GLN L N     1 
ATOM 8740  C CA    . GLN E 5 38  ? 8.368   127.815 57.190  1.00 29.98  ? 38  GLN L CA    1 
ATOM 8741  C C     . GLN E 5 38  ? 7.894   127.892 58.623  1.00 31.05  ? 38  GLN L C     1 
ATOM 8742  O O     . GLN E 5 38  ? 7.933   128.964 59.232  1.00 32.82  ? 38  GLN L O     1 
ATOM 8743  C CB    . GLN E 5 38  ? 9.891   127.783 57.135  1.00 30.21  ? 38  GLN L CB    1 
ATOM 8744  C CG    . GLN E 5 38  ? 10.477  126.687 58.012  1.00 32.95  ? 38  GLN L CG    1 
ATOM 8745  C CD    . GLN E 5 38  ? 11.960  126.480 57.807  1.00 33.29  ? 38  GLN L CD    1 
ATOM 8746  O OE1   . GLN E 5 38  ? 12.370  125.511 57.155  1.00 32.22  ? 38  GLN L OE1   1 
ATOM 8747  N NE2   . GLN E 5 38  ? 12.779  127.371 58.385  1.00 31.69  ? 38  GLN L NE2   1 
ATOM 8748  N N     . LYS E 5 39  ? 7.378   126.775 59.130  1.00 31.02  ? 39  LYS L N     1 
ATOM 8749  C CA    . LYS E 5 39  ? 6.904   126.707 60.504  1.00 31.11  ? 39  LYS L CA    1 
ATOM 8750  C C     . LYS E 5 39  ? 8.124   126.324 61.346  1.00 31.55  ? 39  LYS L C     1 
ATOM 8751  O O     . LYS E 5 39  ? 8.955   125.533 60.909  1.00 30.20  ? 39  LYS L O     1 
ATOM 8752  C CB    . LYS E 5 39  ? 5.785   125.668 60.610  1.00 32.28  ? 39  LYS L CB    1 
ATOM 8753  C CG    . LYS E 5 39  ? 4.861   125.817 61.822  1.00 33.37  ? 39  LYS L CG    1 
ATOM 8754  C CD    . LYS E 5 39  ? 4.042   127.119 61.791  1.00 33.52  ? 39  LYS L CD    1 
ATOM 8755  C CE    . LYS E 5 39  ? 2.602   126.956 61.273  1.00 32.95  ? 39  LYS L CE    1 
ATOM 8756  N NZ    . LYS E 5 39  ? 2.497   126.664 59.821  1.00 31.20  ? 39  LYS L NZ    1 
ATOM 8757  N N     . PRO E 5 40  ? 8.261   126.907 62.549  1.00 33.47  ? 40  PRO L N     1 
ATOM 8758  C CA    . PRO E 5 40  ? 9.360   126.680 63.498  1.00 35.03  ? 40  PRO L CA    1 
ATOM 8759  C C     . PRO E 5 40  ? 9.499   125.228 63.836  1.00 36.36  ? 40  PRO L C     1 
ATOM 8760  O O     . PRO E 5 40  ? 10.449  124.835 64.507  1.00 37.03  ? 40  PRO L O     1 
ATOM 8761  C CB    . PRO E 5 40  ? 8.932   127.471 64.724  1.00 35.94  ? 40  PRO L CB    1 
ATOM 8762  C CG    . PRO E 5 40  ? 7.452   127.358 64.663  1.00 36.98  ? 40  PRO L CG    1 
ATOM 8763  C CD    . PRO E 5 40  ? 7.193   127.668 63.205  1.00 35.02  ? 40  PRO L CD    1 
ATOM 8764  N N     . GLU E 5 41  ? 8.488   124.454 63.458  1.00 38.18  ? 41  GLU L N     1 
ATOM 8765  C CA    . GLU E 5 41  ? 8.531   123.018 63.653  1.00 39.76  ? 41  GLU L CA    1 
ATOM 8766  C C     . GLU E 5 41  ? 9.170   122.425 62.370  1.00 38.70  ? 41  GLU L C     1 
ATOM 8767  O O     . GLU E 5 41  ? 8.970   121.251 62.038  1.00 39.79  ? 41  GLU L O     1 
ATOM 8768  C CB    . GLU E 5 41  ? 7.130   122.452 63.920  1.00 42.24  ? 41  GLU L CB    1 
ATOM 8769  C CG    . GLU E 5 41  ? 6.172   122.578 62.752  1.00 47.39  ? 41  GLU L CG    1 
ATOM 8770  C CD    . GLU E 5 41  ? 4.959   121.667 62.871  1.00 49.79  ? 41  GLU L CD    1 
ATOM 8771  O OE1   . GLU E 5 41  ? 3.852   122.115 62.482  1.00 51.66  ? 41  GLU L OE1   1 
ATOM 8772  O OE2   . GLU E 5 41  ? 5.117   120.507 63.334  1.00 51.32  ? 41  GLU L OE2   1 
ATOM 8773  N N     . GLY E 5 42  ? 9.896   123.286 61.642  1.00 36.33  ? 42  GLY L N     1 
ATOM 8774  C CA    . GLY E 5 42  ? 10.626  122.911 60.435  1.00 30.94  ? 42  GLY L CA    1 
ATOM 8775  C C     . GLY E 5 42  ? 9.904   122.887 59.112  1.00 27.12  ? 42  GLY L C     1 
ATOM 8776  O O     . GLY E 5 42  ? 10.472  123.222 58.071  1.00 24.77  ? 42  GLY L O     1 
ATOM 8777  N N     . THR E 5 43  ? 8.651   122.467 59.163  1.00 25.25  ? 43  THR L N     1 
ATOM 8778  C CA    . THR E 5 43  ? 7.802   122.351 57.989  1.00 24.76  ? 43  THR L CA    1 
ATOM 8779  C C     . THR E 5 43  ? 7.871   123.555 57.060  1.00 25.51  ? 43  THR L C     1 
ATOM 8780  O O     . THR E 5 43  ? 8.225   124.652 57.485  1.00 27.26  ? 43  THR L O     1 
ATOM 8781  C CB    . THR E 5 43  ? 6.363   122.152 58.436  1.00 24.50  ? 43  THR L CB    1 
ATOM 8782  O OG1   . THR E 5 43  ? 6.115   122.996 59.566  1.00 23.10  ? 43  THR L OG1   1 
ATOM 8783  C CG2   . THR E 5 43  ? 6.122   120.701 58.832  1.00 23.64  ? 43  THR L CG2   1 
ATOM 8784  N N     . VAL E 5 44  ? 7.535   123.345 55.791  1.00 24.42  ? 44  VAL L N     1 
ATOM 8785  C CA    . VAL E 5 44  ? 7.548   124.426 54.806  1.00 23.25  ? 44  VAL L CA    1 
ATOM 8786  C C     . VAL E 5 44  ? 6.355   124.364 53.856  1.00 25.16  ? 44  VAL L C     1 
ATOM 8787  O O     . VAL E 5 44  ? 6.289   123.481 53.004  1.00 26.73  ? 44  VAL L O     1 
ATOM 8788  C CB    . VAL E 5 44  ? 8.828   124.394 53.970  1.00 20.42  ? 44  VAL L CB    1 
ATOM 8789  C CG1   . VAL E 5 44  ? 8.677   125.282 52.752  1.00 17.64  ? 44  VAL L CG1   1 
ATOM 8790  C CG2   . VAL E 5 44  ? 10.001  124.837 54.818  1.00 18.67  ? 44  VAL L CG2   1 
ATOM 8791  N N     . LYS E 5 45  ? 5.449   125.334 53.946  1.00 25.59  ? 45  LYS L N     1 
ATOM 8792  C CA    . LYS E 5 45  ? 4.286   125.314 53.070  1.00 27.02  ? 45  LYS L CA    1 
ATOM 8793  C C     . LYS E 5 45  ? 4.171   126.457 52.066  1.00 25.28  ? 45  LYS L C     1 
ATOM 8794  O O     . LYS E 5 45  ? 4.632   127.574 52.311  1.00 23.93  ? 45  LYS L O     1 
ATOM 8795  C CB    . LYS E 5 45  ? 3.006   125.217 53.895  1.00 32.70  ? 45  LYS L CB    1 
ATOM 8796  C CG    . LYS E 5 45  ? 1.855   124.461 53.182  1.00 41.26  ? 45  LYS L CG    1 
ATOM 8797  C CD    . LYS E 5 45  ? 2.182   122.942 52.941  1.00 47.94  ? 45  LYS L CD    1 
ATOM 8798  C CE    . LYS E 5 45  ? 0.962   122.093 52.448  1.00 50.47  ? 45  LYS L CE    1 
ATOM 8799  N NZ    . LYS E 5 45  ? 1.161   120.587 52.498  1.00 49.22  ? 45  LYS L NZ    1 
ATOM 8800  N N     . LEU E 5 46  ? 3.520   126.150 50.943  1.00 25.03  ? 46  LEU L N     1 
ATOM 8801  C CA    . LEU E 5 46  ? 3.282   127.097 49.847  1.00 25.16  ? 46  LEU L CA    1 
ATOM 8802  C C     . LEU E 5 46  ? 2.012   127.938 49.999  1.00 25.17  ? 46  LEU L C     1 
ATOM 8803  O O     . LEU E 5 46  ? 0.885   127.424 49.938  1.00 24.21  ? 46  LEU L O     1 
ATOM 8804  C CB    . LEU E 5 46  ? 3.207   126.376 48.503  1.00 23.98  ? 46  LEU L CB    1 
ATOM 8805  C CG    . LEU E 5 46  ? 2.621   127.244 47.381  1.00 22.19  ? 46  LEU L CG    1 
ATOM 8806  C CD1   . LEU E 5 46  ? 3.634   128.235 46.841  1.00 21.61  ? 46  LEU L CD1   1 
ATOM 8807  C CD2   . LEU E 5 46  ? 2.140   126.349 46.290  1.00 24.89  ? 46  LEU L CD2   1 
ATOM 8808  N N     . LEU E 5 47  ? 2.209   129.248 50.038  1.00 23.56  ? 47  LEU L N     1 
ATOM 8809  C CA    . LEU E 5 47  ? 1.106   130.168 50.197  1.00 21.73  ? 47  LEU L CA    1 
ATOM 8810  C C     . LEU E 5 47  ? 0.575   130.717 48.890  1.00 21.75  ? 47  LEU L C     1 
ATOM 8811  O O     . LEU E 5 47  ? -0.610  130.599 48.580  1.00 19.24  ? 47  LEU L O     1 
ATOM 8812  C CB    . LEU E 5 47  ? 1.565   131.311 51.076  1.00 21.39  ? 47  LEU L CB    1 
ATOM 8813  C CG    . LEU E 5 47  ? 2.281   130.772 52.307  1.00 21.25  ? 47  LEU L CG    1 
ATOM 8814  C CD1   . LEU E 5 47  ? 3.034   131.883 53.004  1.00 23.06  ? 47  LEU L CD1   1 
ATOM 8815  C CD2   . LEU E 5 47  ? 1.269   130.113 53.224  1.00 20.91  ? 47  LEU L CD2   1 
ATOM 8816  N N     . ILE E 5 48  ? 1.483   131.289 48.111  1.00 24.08  ? 48  ILE L N     1 
ATOM 8817  C CA    . ILE E 5 48  ? 1.129   131.919 46.846  1.00 27.15  ? 48  ILE L CA    1 
ATOM 8818  C C     . ILE E 5 48  ? 2.157   131.860 45.723  1.00 28.69  ? 48  ILE L C     1 
ATOM 8819  O O     . ILE E 5 48  ? 3.365   132.070 45.913  1.00 27.65  ? 48  ILE L O     1 
ATOM 8820  C CB    . ILE E 5 48  ? 0.837   133.387 47.076  1.00 27.51  ? 48  ILE L CB    1 
ATOM 8821  C CG1   . ILE E 5 48  ? 1.846   133.928 48.104  1.00 25.58  ? 48  ILE L CG1   1 
ATOM 8822  C CG2   . ILE E 5 48  ? -0.624  133.577 47.427  1.00 28.38  ? 48  ILE L CG2   1 
ATOM 8823  C CD1   . ILE E 5 48  ? 1.467   135.221 48.753  1.00 26.82  ? 48  ILE L CD1   1 
ATOM 8824  N N     . TYR E 5 49  ? 1.619   131.724 44.525  1.00 29.75  ? 49  TYR L N     1 
ATOM 8825  C CA    . TYR E 5 49  ? 2.412   131.648 43.325  1.00 30.73  ? 49  TYR L CA    1 
ATOM 8826  C C     . TYR E 5 49  ? 2.056   132.800 42.446  1.00 30.11  ? 49  TYR L C     1 
ATOM 8827  O O     . TYR E 5 49  ? 1.043   133.466 42.655  1.00 29.58  ? 49  TYR L O     1 
ATOM 8828  C CB    . TYR E 5 49  ? 2.073   130.379 42.570  1.00 32.95  ? 49  TYR L CB    1 
ATOM 8829  C CG    . TYR E 5 49  ? 0.585   130.194 42.345  1.00 36.99  ? 49  TYR L CG    1 
ATOM 8830  C CD1   . TYR E 5 49  ? 0.052   130.175 41.056  1.00 37.54  ? 49  TYR L CD1   1 
ATOM 8831  C CD2   . TYR E 5 49  ? -0.275  129.958 43.418  1.00 37.39  ? 49  TYR L CD2   1 
ATOM 8832  C CE1   . TYR E 5 49  ? -1.309  129.914 40.835  1.00 39.87  ? 49  TYR L CE1   1 
ATOM 8833  C CE2   . TYR E 5 49  ? -1.632  129.698 43.218  1.00 41.18  ? 49  TYR L CE2   1 
ATOM 8834  C CZ    . TYR E 5 49  ? -2.152  129.671 41.924  1.00 42.09  ? 49  TYR L CZ    1 
ATOM 8835  O OH    . TYR E 5 49  ? -3.502  129.394 41.727  1.00 42.83  ? 49  TYR L OH    1 
ATOM 8836  N N     . TYR E 5 50  ? 2.858   132.976 41.408  1.00 30.56  ? 50  TYR L N     1 
ATOM 8837  C CA    . TYR E 5 50  ? 2.629   134.033 40.444  1.00 33.09  ? 50  TYR L CA    1 
ATOM 8838  C C     . TYR E 5 50  ? 2.579   135.406 41.094  1.00 34.11  ? 50  TYR L C     1 
ATOM 8839  O O     . TYR E 5 50  ? 1.991   136.350 40.562  1.00 33.73  ? 50  TYR L O     1 
ATOM 8840  C CB    . TYR E 5 50  ? 1.342   133.774 39.661  1.00 32.20  ? 50  TYR L CB    1 
ATOM 8841  C CG    . TYR E 5 50  ? 1.420   134.350 38.283  1.00 31.21  ? 50  TYR L CG    1 
ATOM 8842  C CD1   . TYR E 5 50  ? 2.481   135.191 37.928  1.00 29.91  ? 50  TYR L CD1   1 
ATOM 8843  C CD2   . TYR E 5 50  ? 0.472   134.039 37.326  1.00 30.66  ? 50  TYR L CD2   1 
ATOM 8844  C CE1   . TYR E 5 50  ? 2.602   135.703 36.674  1.00 31.51  ? 50  TYR L CE1   1 
ATOM 8845  C CE2   . TYR E 5 50  ? 0.577   134.550 36.055  1.00 32.75  ? 50  TYR L CE2   1 
ATOM 8846  C CZ    . TYR E 5 50  ? 1.648   135.383 35.733  1.00 34.33  ? 50  TYR L CZ    1 
ATOM 8847  O OH    . TYR E 5 50  ? 1.753   135.908 34.467  1.00 37.96  ? 50  TYR L OH    1 
ATOM 8848  N N     . THR E 5 51  ? 3.181   135.487 42.271  1.00 37.06  ? 51  THR L N     1 
ATOM 8849  C CA    . THR E 5 51  ? 3.256   136.722 43.034  1.00 39.92  ? 51  THR L CA    1 
ATOM 8850  C C     . THR E 5 51  ? 1.930   137.193 43.643  1.00 40.31  ? 51  THR L C     1 
ATOM 8851  O O     . THR E 5 51  ? 1.905   138.138 44.436  1.00 41.18  ? 51  THR L O     1 
ATOM 8852  C CB    . THR E 5 51  ? 3.878   137.850 42.175  1.00 41.15  ? 51  THR L CB    1 
ATOM 8853  O OG1   . THR E 5 51  ? 5.134   137.406 41.642  1.00 41.80  ? 51  THR L OG1   1 
ATOM 8854  C CG2   . THR E 5 51  ? 4.095   139.095 43.010  1.00 42.23  ? 51  THR L CG2   1 
ATOM 8855  N N     . SER E 5 52  ? 0.841   136.496 43.360  1.00 40.26  ? 52  SER L N     1 
ATOM 8856  C CA    . SER E 5 52  ? -0.433  136.939 43.900  1.00 41.31  ? 52  SER L CA    1 
ATOM 8857  C C     . SER E 5 52  ? -1.546  135.924 43.785  1.00 41.09  ? 52  SER L C     1 
ATOM 8858  O O     . SER E 5 52  ? -2.658  136.158 44.265  1.00 41.80  ? 52  SER L O     1 
ATOM 8859  C CB    . SER E 5 52  ? -0.844  138.231 43.201  1.00 43.15  ? 52  SER L CB    1 
ATOM 8860  O OG    . SER E 5 52  ? -0.416  138.203 41.847  1.00 44.92  ? 52  SER L OG    1 
ATOM 8861  N N     . SER E 5 53  ? -1.280  134.827 43.087  1.00 40.00  ? 53  SER L N     1 
ATOM 8862  C CA    . SER E 5 53  ? -2.295  133.815 42.961  1.00 38.02  ? 53  SER L CA    1 
ATOM 8863  C C     . SER E 5 53  ? -2.204  133.012 44.232  1.00 36.25  ? 53  SER L C     1 
ATOM 8864  O O     . SER E 5 53  ? -1.137  132.519 44.603  1.00 33.39  ? 53  SER L O     1 
ATOM 8865  C CB    . SER E 5 53  ? -2.071  132.953 41.736  1.00 39.19  ? 53  SER L CB    1 
ATOM 8866  O OG    . SER E 5 53  ? -3.313  132.386 41.346  1.00 44.05  ? 53  SER L OG    1 
ATOM 8867  N N     . LEU E 5 54  ? -3.325  132.957 44.932  1.00 36.91  ? 54  LEU L N     1 
ATOM 8868  C CA    . LEU E 5 54  ? -3.403  132.263 46.202  1.00 38.53  ? 54  LEU L CA    1 
ATOM 8869  C C     . LEU E 5 54  ? -3.454  130.759 46.096  1.00 37.96  ? 54  LEU L C     1 
ATOM 8870  O O     . LEU E 5 54  ? -4.279  130.182 45.368  1.00 37.87  ? 54  LEU L O     1 
ATOM 8871  C CB    . LEU E 5 54  ? -4.611  132.753 46.995  1.00 42.12  ? 54  LEU L CB    1 
ATOM 8872  C CG    . LEU E 5 54  ? -4.700  132.349 48.476  1.00 45.97  ? 54  LEU L CG    1 
ATOM 8873  C CD1   . LEU E 5 54  ? -3.561  132.998 49.302  1.00 44.95  ? 54  LEU L CD1   1 
ATOM 8874  C CD2   . LEU E 5 54  ? -6.077  132.763 49.025  1.00 48.06  ? 54  LEU L CD2   1 
ATOM 8875  N N     . HIS E 5 55  ? -2.594  130.115 46.870  1.00 37.27  ? 55  HIS L N     1 
ATOM 8876  C CA    . HIS E 5 55  ? -2.580  128.677 46.845  1.00 36.90  ? 55  HIS L CA    1 
ATOM 8877  C C     . HIS E 5 55  ? -3.764  128.096 47.570  1.00 35.92  ? 55  HIS L C     1 
ATOM 8878  O O     . HIS E 5 55  ? -3.899  128.273 48.783  1.00 35.69  ? 55  HIS L O     1 
ATOM 8879  C CB    . HIS E 5 55  ? -1.327  128.102 47.467  1.00 37.94  ? 55  HIS L CB    1 
ATOM 8880  C CG    . HIS E 5 55  ? -1.284  126.613 47.395  1.00 37.76  ? 55  HIS L CG    1 
ATOM 8881  N ND1   . HIS E 5 55  ? -0.539  125.842 48.259  1.00 37.44  ? 55  HIS L ND1   1 
ATOM 8882  C CD2   . HIS E 5 55  ? -1.920  125.750 46.564  1.00 35.95  ? 55  HIS L CD2   1 
ATOM 8883  C CE1   . HIS E 5 55  ? -0.719  124.567 47.965  1.00 38.03  ? 55  HIS L CE1   1 
ATOM 8884  N NE2   . HIS E 5 55  ? -1.552  124.485 46.942  1.00 37.09  ? 55  HIS L NE2   1 
ATOM 8885  N N     . SER E 5 56  ? -4.577  127.352 46.821  1.00 35.21  ? 56  SER L N     1 
ATOM 8886  C CA    . SER E 5 56  ? -5.756  126.681 47.362  1.00 32.89  ? 56  SER L CA    1 
ATOM 8887  C C     . SER E 5 56  ? -5.374  126.079 48.709  1.00 31.18  ? 56  SER L C     1 
ATOM 8888  O O     . SER E 5 56  ? -4.502  125.218 48.777  1.00 30.37  ? 56  SER L O     1 
ATOM 8889  C CB    . SER E 5 56  ? -6.202  125.564 46.404  1.00 32.16  ? 56  SER L CB    1 
ATOM 8890  O OG    . SER E 5 56  ? -7.177  124.724 47.002  1.00 29.67  ? 56  SER L OG    1 
ATOM 8891  N N     . GLY E 5 57  ? -5.942  126.615 49.782  1.00 29.88  ? 57  GLY L N     1 
ATOM 8892  C CA    . GLY E 5 57  ? -5.627  126.092 51.098  1.00 30.52  ? 57  GLY L CA    1 
ATOM 8893  C C     . GLY E 5 57  ? -5.105  127.131 52.069  1.00 31.06  ? 57  GLY L C     1 
ATOM 8894  O O     . GLY E 5 57  ? -5.187  126.965 53.291  1.00 32.95  ? 57  GLY L O     1 
ATOM 8895  N N     . VAL E 5 58  ? -4.541  128.204 51.536  1.00 30.12  ? 58  VAL L N     1 
ATOM 8896  C CA    . VAL E 5 58  ? -4.017  129.258 52.382  1.00 28.18  ? 58  VAL L CA    1 
ATOM 8897  C C     . VAL E 5 58  ? -5.172  130.195 52.748  1.00 27.75  ? 58  VAL L C     1 
ATOM 8898  O O     . VAL E 5 58  ? -6.036  130.482 51.924  1.00 26.88  ? 58  VAL L O     1 
ATOM 8899  C CB    . VAL E 5 58  ? -2.897  130.018 51.651  1.00 27.84  ? 58  VAL L CB    1 
ATOM 8900  C CG1   . VAL E 5 58  ? -2.185  130.962 52.599  1.00 27.57  ? 58  VAL L CG1   1 
ATOM 8901  C CG2   . VAL E 5 58  ? -1.922  129.024 51.012  1.00 25.90  ? 58  VAL L CG2   1 
ATOM 8902  N N     . PRO E 5 59  ? -5.243  130.611 54.017  1.00 27.88  ? 59  PRO L N     1 
ATOM 8903  C CA    . PRO E 5 59  ? -6.276  131.512 54.547  1.00 28.29  ? 59  PRO L CA    1 
ATOM 8904  C C     . PRO E 5 59  ? -6.314  132.815 53.773  1.00 27.96  ? 59  PRO L C     1 
ATOM 8905  O O     . PRO E 5 59  ? -5.268  133.422 53.518  1.00 28.25  ? 59  PRO L O     1 
ATOM 8906  C CB    . PRO E 5 59  ? -5.800  131.771 55.966  1.00 29.77  ? 59  PRO L CB    1 
ATOM 8907  C CG    . PRO E 5 59  ? -5.088  130.499 56.312  1.00 30.93  ? 59  PRO L CG    1 
ATOM 8908  C CD    . PRO E 5 59  ? -4.311  130.193 55.075  1.00 28.87  ? 59  PRO L CD    1 
ATOM 8909  N N     . SER E 5 60  ? -7.523  133.274 53.466  1.00 27.26  ? 60  SER L N     1 
ATOM 8910  C CA    . SER E 5 60  ? -7.704  134.499 52.696  1.00 27.23  ? 60  SER L CA    1 
ATOM 8911  C C     . SER E 5 60  ? -6.860  135.627 53.238  1.00 26.56  ? 60  SER L C     1 
ATOM 8912  O O     . SER E 5 60  ? -6.321  136.411 52.469  1.00 25.13  ? 60  SER L O     1 
ATOM 8913  C CB    . SER E 5 60  ? -9.171  134.914 52.670  1.00 27.94  ? 60  SER L CB    1 
ATOM 8914  O OG    . SER E 5 60  ? -9.501  135.467 51.409  1.00 28.35  ? 60  SER L OG    1 
ATOM 8915  N N     . ALA E 5 61  ? -6.694  135.639 54.559  1.00 27.26  ? 61  ALA L N     1 
ATOM 8916  C CA    . ALA E 5 61  ? -5.898  136.639 55.281  1.00 28.81  ? 61  ALA L CA    1 
ATOM 8917  C C     . ALA E 5 61  ? -4.578  137.006 54.590  1.00 28.44  ? 61  ALA L C     1 
ATOM 8918  O O     . ALA E 5 61  ? -3.988  138.060 54.847  1.00 28.19  ? 61  ALA L O     1 
ATOM 8919  C CB    . ALA E 5 61  ? -5.620  136.142 56.705  1.00 30.48  ? 61  ALA L CB    1 
ATOM 8920  N N     . PHE E 5 62  ? -4.115  136.112 53.730  1.00 27.90  ? 62  PHE L N     1 
ATOM 8921  C CA    . PHE E 5 62  ? -2.888  136.313 52.991  1.00 28.07  ? 62  PHE L CA    1 
ATOM 8922  C C     . PHE E 5 62  ? -3.178  136.945 51.643  1.00 29.28  ? 62  PHE L C     1 
ATOM 8923  O O     . PHE E 5 62  ? -4.121  136.533 50.963  1.00 30.86  ? 62  PHE L O     1 
ATOM 8924  C CB    . PHE E 5 62  ? -2.202  134.964 52.794  1.00 25.19  ? 62  PHE L CB    1 
ATOM 8925  C CG    . PHE E 5 62  ? -1.642  134.405 54.051  1.00 22.37  ? 62  PHE L CG    1 
ATOM 8926  C CD1   . PHE E 5 62  ? -0.435  134.894 54.559  1.00 20.72  ? 62  PHE L CD1   1 
ATOM 8927  C CD2   . PHE E 5 62  ? -2.334  133.436 54.759  1.00 19.91  ? 62  PHE L CD2   1 
ATOM 8928  C CE1   . PHE E 5 62  ? 0.091   134.435 55.758  1.00 19.26  ? 62  PHE L CE1   1 
ATOM 8929  C CE2   . PHE E 5 62  ? -1.829  132.959 55.960  1.00 21.01  ? 62  PHE L CE2   1 
ATOM 8930  C CZ    . PHE E 5 62  ? -0.603  133.467 56.467  1.00 21.56  ? 62  PHE L CZ    1 
ATOM 8931  N N     . SER E 5 63  ? -2.377  137.935 51.253  1.00 30.25  ? 63  SER L N     1 
ATOM 8932  C CA    . SER E 5 63  ? -2.575  138.574 49.958  1.00 31.71  ? 63  SER L CA    1 
ATOM 8933  C C     . SER E 5 63  ? -1.344  138.961 49.160  1.00 32.99  ? 63  SER L C     1 
ATOM 8934  O O     . SER E 5 63  ? -0.373  139.541 49.680  1.00 32.42  ? 63  SER L O     1 
ATOM 8935  C CB    . SER E 5 63  ? -3.535  139.747 50.058  1.00 32.00  ? 63  SER L CB    1 
ATOM 8936  O OG    . SER E 5 63  ? -4.867  139.277 49.943  1.00 31.95  ? 63  SER L OG    1 
ATOM 8937  N N     . GLY E 5 64  ? -1.433  138.648 47.869  1.00 34.19  ? 64  GLY L N     1 
ATOM 8938  C CA    . GLY E 5 64  ? -0.358  138.914 46.939  1.00 36.83  ? 64  GLY L CA    1 
ATOM 8939  C C     . GLY E 5 64  ? -0.398  140.247 46.212  1.00 38.05  ? 64  GLY L C     1 
ATOM 8940  O O     . GLY E 5 64  ? -1.470  140.769 45.868  1.00 37.64  ? 64  GLY L O     1 
ATOM 8941  N N     . SER E 5 65  ? 0.804   140.759 45.946  1.00 38.76  ? 65  SER L N     1 
ATOM 8942  C CA    . SER E 5 65  ? 1.016   142.027 45.259  1.00 39.09  ? 65  SER L CA    1 
ATOM 8943  C C     . SER E 5 65  ? 2.518   142.219 45.031  1.00 40.64  ? 65  SER L C     1 
ATOM 8944  O O     . SER E 5 65  ? 3.353   141.632 45.727  1.00 40.66  ? 65  SER L O     1 
ATOM 8945  C CB    . SER E 5 65  ? 0.516   143.163 46.132  1.00 38.32  ? 65  SER L CB    1 
ATOM 8946  O OG    . SER E 5 65  ? 1.200   143.118 47.374  1.00 36.17  ? 65  SER L OG    1 
ATOM 8947  N N     . GLY E 5 66  ? 2.850   143.093 44.090  1.00 42.17  ? 66  GLY L N     1 
ATOM 8948  C CA    . GLY E 5 66  ? 4.240   143.361 43.782  1.00 43.42  ? 66  GLY L CA    1 
ATOM 8949  C C     . GLY E 5 66  ? 4.429   143.434 42.278  1.00 44.52  ? 66  GLY L C     1 
ATOM 8950  O O     . GLY E 5 66  ? 3.497   143.147 41.504  1.00 44.18  ? 66  GLY L O     1 
ATOM 8951  N N     . SER E 5 67  ? 5.642   143.803 41.863  1.00 44.84  ? 67  SER L N     1 
ATOM 8952  C CA    . SER E 5 67  ? 5.968   143.921 40.443  1.00 44.48  ? 67  SER L CA    1 
ATOM 8953  C C     . SER E 5 67  ? 7.424   144.299 40.167  1.00 43.78  ? 67  SER L C     1 
ATOM 8954  O O     . SER E 5 67  ? 8.231   144.525 41.081  1.00 43.34  ? 67  SER L O     1 
ATOM 8955  C CB    . SER E 5 67  ? 5.048   144.944 39.771  1.00 44.84  ? 67  SER L CB    1 
ATOM 8956  O OG    . SER E 5 67  ? 5.133   146.199 40.433  1.00 47.08  ? 67  SER L OG    1 
ATOM 8957  N N     . GLY E 5 68  ? 7.746   144.319 38.878  1.00 43.29  ? 68  GLY L N     1 
ATOM 8958  C CA    . GLY E 5 68  ? 9.075   144.680 38.435  1.00 43.57  ? 68  GLY L CA    1 
ATOM 8959  C C     . GLY E 5 68  ? 10.169  143.907 39.118  1.00 42.77  ? 68  GLY L C     1 
ATOM 8960  O O     . GLY E 5 68  ? 10.460  142.771 38.754  1.00 42.43  ? 68  GLY L O     1 
ATOM 8961  N N     . THR E 5 69  ? 10.788  144.530 40.106  1.00 42.94  ? 69  THR L N     1 
ATOM 8962  C CA    . THR E 5 69  ? 11.850  143.853 40.817  1.00 45.95  ? 69  THR L CA    1 
ATOM 8963  C C     . THR E 5 69  ? 11.638  144.039 42.310  1.00 46.90  ? 69  THR L C     1 
ATOM 8964  O O     . THR E 5 69  ? 12.500  143.702 43.134  1.00 46.37  ? 69  THR L O     1 
ATOM 8965  C CB    . THR E 5 69  ? 13.234  144.361 40.364  1.00 46.97  ? 69  THR L CB    1 
ATOM 8966  O OG1   . THR E 5 69  ? 14.238  143.389 40.702  1.00 48.06  ? 69  THR L OG1   1 
ATOM 8967  C CG2   . THR E 5 69  ? 13.552  145.726 41.001  1.00 46.59  ? 69  THR L CG2   1 
ATOM 8968  N N     . ASP E 5 70  ? 10.465  144.570 42.641  1.00 48.37  ? 70  ASP L N     1 
ATOM 8969  C CA    . ASP E 5 70  ? 10.076  144.810 44.026  1.00 49.54  ? 70  ASP L CA    1 
ATOM 8970  C C     . ASP E 5 70  ? 8.658   144.276 44.239  1.00 48.16  ? 70  ASP L C     1 
ATOM 8971  O O     . ASP E 5 70  ? 7.706   144.701 43.575  1.00 45.97  ? 70  ASP L O     1 
ATOM 8972  C CB    . ASP E 5 70  ? 10.190  146.305 44.380  1.00 53.13  ? 70  ASP L CB    1 
ATOM 8973  C CG    . ASP E 5 70  ? 11.652  146.811 44.381  1.00 57.03  ? 70  ASP L CG    1 
ATOM 8974  O OD1   . ASP E 5 70  ? 12.512  146.170 45.032  1.00 56.62  ? 70  ASP L OD1   1 
ATOM 8975  O OD2   . ASP E 5 70  ? 11.942  147.846 43.731  1.00 59.47  ? 70  ASP L OD2   1 
ATOM 8976  N N     . TYR E 5 71  ? 8.548   143.302 45.142  1.00 46.91  ? 71  TYR L N     1 
ATOM 8977  C CA    . TYR E 5 71  ? 7.283   142.644 45.437  1.00 44.05  ? 71  TYR L CA    1 
ATOM 8978  C C     . TYR E 5 71  ? 6.945   142.596 46.931  1.00 42.70  ? 71  TYR L C     1 
ATOM 8979  O O     . TYR E 5 71  ? 7.825   142.718 47.794  1.00 39.63  ? 71  TYR L O     1 
ATOM 8980  C CB    . TYR E 5 71  ? 7.303   141.247 44.829  1.00 44.20  ? 71  TYR L CB    1 
ATOM 8981  C CG    . TYR E 5 71  ? 7.496   141.233 43.321  1.00 42.78  ? 71  TYR L CG    1 
ATOM 8982  C CD1   . TYR E 5 71  ? 8.720   141.550 42.741  1.00 42.99  ? 71  TYR L CD1   1 
ATOM 8983  C CD2   . TYR E 5 71  ? 6.452   140.875 42.484  1.00 44.02  ? 71  TYR L CD2   1 
ATOM 8984  C CE1   . TYR E 5 71  ? 8.889   141.508 41.363  1.00 44.22  ? 71  TYR L CE1   1 
ATOM 8985  C CE2   . TYR E 5 71  ? 6.601   140.821 41.112  1.00 45.28  ? 71  TYR L CE2   1 
ATOM 8986  C CZ    . TYR E 5 71  ? 7.818   141.139 40.549  1.00 45.97  ? 71  TYR L CZ    1 
ATOM 8987  O OH    . TYR E 5 71  ? 7.942   141.080 39.172  1.00 47.70  ? 71  TYR L OH    1 
ATOM 8988  N N     . SER E 5 72  ? 5.679   142.309 47.221  1.00 42.69  ? 72  SER L N     1 
ATOM 8989  C CA    . SER E 5 72  ? 5.192   142.326 48.598  1.00 44.25  ? 72  SER L CA    1 
ATOM 8990  C C     . SER E 5 72  ? 4.204   141.265 49.108  1.00 44.82  ? 72  SER L C     1 
ATOM 8991  O O     . SER E 5 72  ? 3.149   141.018 48.503  1.00 44.22  ? 72  SER L O     1 
ATOM 8992  C CB    . SER E 5 72  ? 4.565   143.688 48.819  1.00 45.88  ? 72  SER L CB    1 
ATOM 8993  O OG    . SER E 5 72  ? 3.892   144.087 47.627  1.00 46.06  ? 72  SER L OG    1 
ATOM 8994  N N     . LEU E 5 73  ? 4.515   140.732 50.291  1.00 45.52  ? 73  LEU L N     1 
ATOM 8995  C CA    . LEU E 5 73  ? 3.682   139.724 50.957  1.00 45.91  ? 73  LEU L CA    1 
ATOM 8996  C C     . LEU E 5 73  ? 3.047   140.326 52.206  1.00 45.44  ? 73  LEU L C     1 
ATOM 8997  O O     . LEU E 5 73  ? 3.739   140.921 53.048  1.00 44.52  ? 73  LEU L O     1 
ATOM 8998  C CB    . LEU E 5 73  ? 4.502   138.489 51.349  1.00 46.65  ? 73  LEU L CB    1 
ATOM 8999  C CG    . LEU E 5 73  ? 3.735   137.452 52.176  1.00 46.50  ? 73  LEU L CG    1 
ATOM 9000  C CD1   . LEU E 5 73  ? 2.441   137.100 51.459  1.00 46.40  ? 73  LEU L CD1   1 
ATOM 9001  C CD2   . LEU E 5 73  ? 4.579   136.207 52.427  1.00 46.18  ? 73  LEU L CD2   1 
ATOM 9002  N N     . THR E 5 74  ? 1.743   140.099 52.363  1.00 43.82  ? 74  THR L N     1 
ATOM 9003  C CA    . THR E 5 74  ? 1.030   140.671 53.494  1.00 42.01  ? 74  THR L CA    1 
ATOM 9004  C C     . THR E 5 74  ? -0.159  139.870 54.029  1.00 39.83  ? 74  THR L C     1 
ATOM 9005  O O     . THR E 5 74  ? -0.807  139.111 53.302  1.00 38.13  ? 74  THR L O     1 
ATOM 9006  C CB    . THR E 5 74  ? 0.559   142.120 53.127  1.00 42.82  ? 74  THR L CB    1 
ATOM 9007  O OG1   . THR E 5 74  ? 1.696   142.906 52.754  1.00 42.59  ? 74  THR L OG1   1 
ATOM 9008  C CG2   . THR E 5 74  ? -0.152  142.815 54.295  1.00 44.08  ? 74  THR L CG2   1 
ATOM 9009  N N     . ILE E 5 75  ? -0.415  140.045 55.324  1.00 37.95  ? 75  ILE L N     1 
ATOM 9010  C CA    . ILE E 5 75  ? -1.538  139.412 55.998  1.00 37.35  ? 75  ILE L CA    1 
ATOM 9011  C C     . ILE E 5 75  ? -2.277  140.488 56.779  1.00 38.28  ? 75  ILE L C     1 
ATOM 9012  O O     . ILE E 5 75  ? -1.659  141.413 57.316  1.00 38.05  ? 75  ILE L O     1 
ATOM 9013  C CB    . ILE E 5 75  ? -1.122  138.338 56.982  1.00 36.66  ? 75  ILE L CB    1 
ATOM 9014  C CG1   . ILE E 5 75  ? 0.290   137.838 56.676  1.00 37.54  ? 75  ILE L CG1   1 
ATOM 9015  C CG2   . ILE E 5 75  ? -2.148  137.219 56.957  1.00 34.61  ? 75  ILE L CG2   1 
ATOM 9016  C CD1   . ILE E 5 75  ? 1.379   138.780 57.138  1.00 38.33  ? 75  ILE L CD1   1 
ATOM 9017  N N     . SER E 5 76  ? -3.590  140.306 56.896  1.00 39.03  ? 76  SER L N     1 
ATOM 9018  C CA    . SER E 5 76  ? -4.488  141.245 57.567  1.00 38.90  ? 76  SER L CA    1 
ATOM 9019  C C     . SER E 5 76  ? -4.423  141.395 59.091  1.00 38.32  ? 76  SER L C     1 
ATOM 9020  O O     . SER E 5 76  ? -4.062  142.448 59.592  1.00 38.01  ? 76  SER L O     1 
ATOM 9021  C CB    . SER E 5 76  ? -5.929  140.934 57.165  1.00 39.30  ? 76  SER L CB    1 
ATOM 9022  O OG    . SER E 5 76  ? -6.343  139.686 57.699  1.00 40.56  ? 76  SER L OG    1 
ATOM 9023  N N     . ASN E 5 77  ? -4.863  140.377 59.821  1.00 37.99  ? 77  ASN L N     1 
ATOM 9024  C CA    . ASN E 5 77  ? -4.874  140.420 61.285  1.00 39.13  ? 77  ASN L CA    1 
ATOM 9025  C C     . ASN E 5 77  ? -4.180  139.183 61.803  1.00 39.69  ? 77  ASN L C     1 
ATOM 9026  O O     . ASN E 5 77  ? -4.442  138.093 61.322  1.00 40.66  ? 77  ASN L O     1 
ATOM 9027  C CB    . ASN E 5 77  ? -6.310  140.437 61.795  1.00 39.23  ? 77  ASN L CB    1 
ATOM 9028  C CG    . ASN E 5 77  ? -7.303  140.658 60.684  1.00 40.78  ? 77  ASN L CG    1 
ATOM 9029  O OD1   . ASN E 5 77  ? -7.549  141.797 60.280  1.00 39.50  ? 77  ASN L OD1   1 
ATOM 9030  N ND2   . ASN E 5 77  ? -7.826  139.564 60.128  1.00 40.99  ? 77  ASN L ND2   1 
ATOM 9031  N N     . LEU E 5 78  ? -3.355  139.340 62.830  1.00 39.87  ? 78  LEU L N     1 
ATOM 9032  C CA    . LEU E 5 78  ? -2.599  138.219 63.372  1.00 40.26  ? 78  LEU L CA    1 
ATOM 9033  C C     . LEU E 5 78  ? -3.269  137.218 64.310  1.00 40.76  ? 78  LEU L C     1 
ATOM 9034  O O     . LEU E 5 78  ? -3.970  137.591 65.261  1.00 42.13  ? 78  LEU L O     1 
ATOM 9035  C CB    . LEU E 5 78  ? -1.322  138.730 64.027  1.00 40.61  ? 78  LEU L CB    1 
ATOM 9036  C CG    . LEU E 5 78  ? -0.488  139.621 63.111  1.00 42.99  ? 78  LEU L CG    1 
ATOM 9037  C CD1   . LEU E 5 78  ? 0.807   140.027 63.802  1.00 42.99  ? 78  LEU L CD1   1 
ATOM 9038  C CD2   . LEU E 5 78  ? -0.198  138.887 61.808  1.00 44.81  ? 78  LEU L CD2   1 
ATOM 9039  N N     . GLU E 5 79  ? -3.017  135.940 64.007  1.00 39.46  ? 79  GLU L N     1 
ATOM 9040  C CA    . GLU E 5 79  ? -3.473  134.769 64.762  1.00 37.44  ? 79  GLU L CA    1 
ATOM 9041  C C     . GLU E 5 79  ? -2.212  133.883 64.844  1.00 35.36  ? 79  GLU L C     1 
ATOM 9042  O O     . GLU E 5 79  ? -1.662  133.462 63.830  1.00 36.31  ? 79  GLU L O     1 
ATOM 9043  C CB    . GLU E 5 79  ? -4.637  134.074 64.059  1.00 38.19  ? 79  GLU L CB    1 
ATOM 9044  C CG    . GLU E 5 79  ? -5.946  134.851 64.162  1.00 42.72  ? 79  GLU L CG    1 
ATOM 9045  C CD    . GLU E 5 79  ? -7.142  134.116 63.553  1.00 46.98  ? 79  GLU L CD    1 
ATOM 9046  O OE1   . GLU E 5 79  ? -7.314  132.902 63.816  1.00 50.43  ? 79  GLU L OE1   1 
ATOM 9047  O OE2   . GLU E 5 79  ? -7.930  134.762 62.823  1.00 48.62  ? 79  GLU L OE2   1 
ATOM 9048  N N     . PRO E 5 80  ? -1.752  133.595 66.068  1.00 33.33  ? 80  PRO L N     1 
ATOM 9049  C CA    . PRO E 5 80  ? -0.589  132.819 66.510  1.00 33.89  ? 80  PRO L CA    1 
ATOM 9050  C C     . PRO E 5 80  ? -0.021  131.691 65.662  1.00 34.79  ? 80  PRO L C     1 
ATOM 9051  O O     . PRO E 5 80  ? 0.994   131.098 66.016  1.00 35.02  ? 80  PRO L O     1 
ATOM 9052  C CB    . PRO E 5 80  ? -1.002  132.347 67.901  1.00 32.66  ? 80  PRO L CB    1 
ATOM 9053  C CG    . PRO E 5 80  ? -2.466  132.320 67.831  1.00 32.46  ? 80  PRO L CG    1 
ATOM 9054  C CD    . PRO E 5 80  ? -2.759  133.597 67.136  1.00 33.09  ? 80  PRO L CD    1 
ATOM 9055  N N     . GLU E 5 81  ? -0.649  131.391 64.542  1.00 36.60  ? 81  GLU L N     1 
ATOM 9056  C CA    . GLU E 5 81  ? -0.137  130.339 63.692  1.00 39.44  ? 81  GLU L CA    1 
ATOM 9057  C C     . GLU E 5 81  ? 0.821   130.991 62.729  1.00 39.60  ? 81  GLU L C     1 
ATOM 9058  O O     . GLU E 5 81  ? 1.800   130.392 62.315  1.00 40.54  ? 81  GLU L O     1 
ATOM 9059  C CB    . GLU E 5 81  ? -1.264  129.693 62.894  1.00 40.61  ? 81  GLU L CB    1 
ATOM 9060  C CG    . GLU E 5 81  ? -2.496  129.368 63.714  1.00 46.31  ? 81  GLU L CG    1 
ATOM 9061  C CD    . GLU E 5 81  ? -3.288  130.617 64.109  1.00 49.09  ? 81  GLU L CD    1 
ATOM 9062  O OE1   . GLU E 5 81  ? -3.826  131.281 63.200  1.00 48.93  ? 81  GLU L OE1   1 
ATOM 9063  O OE2   . GLU E 5 81  ? -3.370  130.939 65.317  1.00 50.21  ? 81  GLU L OE2   1 
ATOM 9064  N N     . ASP E 5 82  ? 0.577   132.260 62.447  1.00 39.16  ? 82  ASP L N     1 
ATOM 9065  C CA    . ASP E 5 82  ? 1.375   132.981 61.479  1.00 38.86  ? 82  ASP L CA    1 
ATOM 9066  C C     . ASP E 5 82  ? 2.713   133.518 61.862  1.00 38.83  ? 82  ASP L C     1 
ATOM 9067  O O     . ASP E 5 82  ? 3.485   133.912 60.997  1.00 38.35  ? 82  ASP L O     1 
ATOM 9068  C CB    . ASP E 5 82  ? 0.529   134.069 60.877  1.00 39.11  ? 82  ASP L CB    1 
ATOM 9069  C CG    . ASP E 5 82  ? -0.738  133.520 60.313  1.00 40.56  ? 82  ASP L CG    1 
ATOM 9070  O OD1   . ASP E 5 82  ? -0.630  132.491 59.604  1.00 40.69  ? 82  ASP L OD1   1 
ATOM 9071  O OD2   . ASP E 5 82  ? -1.824  134.064 60.620  1.00 38.81  ? 82  ASP L OD2   1 
ATOM 9072  N N     . PHE E 5 83  ? 3.006   133.543 63.147  1.00 40.64  ? 83  PHE L N     1 
ATOM 9073  C CA    . PHE E 5 83  ? 4.300   134.046 63.570  1.00 43.52  ? 83  PHE L CA    1 
ATOM 9074  C C     . PHE E 5 83  ? 5.397   133.109 63.117  1.00 43.49  ? 83  PHE L C     1 
ATOM 9075  O O     . PHE E 5 83  ? 5.859   132.262 63.869  1.00 43.55  ? 83  PHE L O     1 
ATOM 9076  C CB    . PHE E 5 83  ? 4.312   134.243 65.073  1.00 46.43  ? 83  PHE L CB    1 
ATOM 9077  C CG    . PHE E 5 83  ? 3.419   135.340 65.509  1.00 48.45  ? 83  PHE L CG    1 
ATOM 9078  C CD1   . PHE E 5 83  ? 2.037   135.183 65.437  1.00 48.74  ? 83  PHE L CD1   1 
ATOM 9079  C CD2   . PHE E 5 83  ? 3.951   136.558 65.909  1.00 49.43  ? 83  PHE L CD2   1 
ATOM 9080  C CE1   . PHE E 5 83  ? 1.200   136.222 65.747  1.00 50.35  ? 83  PHE L CE1   1 
ATOM 9081  C CE2   . PHE E 5 83  ? 3.130   137.608 66.224  1.00 51.00  ? 83  PHE L CE2   1 
ATOM 9082  C CZ    . PHE E 5 83  ? 1.745   137.444 66.144  1.00 52.86  ? 83  PHE L CZ    1 
ATOM 9083  N N     . ALA E 5 84  ? 5.802   133.271 61.865  1.00 44.79  ? 84  ALA L N     1 
ATOM 9084  C CA    . ALA E 5 84  ? 6.820   132.419 61.282  1.00 45.21  ? 84  ALA L CA    1 
ATOM 9085  C C     . ALA E 5 84  ? 7.720   133.145 60.306  1.00 45.72  ? 84  ALA L C     1 
ATOM 9086  O O     . ALA E 5 84  ? 7.502   134.315 59.960  1.00 45.98  ? 84  ALA L O     1 
ATOM 9087  C CB    . ALA E 5 84  ? 6.157   131.245 60.572  1.00 45.00  ? 84  ALA L CB    1 
ATOM 9088  N N     . THR E 5 85  ? 8.738   132.416 59.868  1.00 45.18  ? 85  THR L N     1 
ATOM 9089  C CA    . THR E 5 85  ? 9.701   132.899 58.900  1.00 43.59  ? 85  THR L CA    1 
ATOM 9090  C C     . THR E 5 85  ? 9.044   132.683 57.541  1.00 41.82  ? 85  THR L C     1 
ATOM 9091  O O     . THR E 5 85  ? 8.558   131.588 57.230  1.00 41.55  ? 85  THR L O     1 
ATOM 9092  C CB    . THR E 5 85  ? 10.988  132.098 59.000  1.00 44.89  ? 85  THR L CB    1 
ATOM 9093  O OG1   . THR E 5 85  ? 10.692  130.710 58.808  1.00 47.91  ? 85  THR L OG1   1 
ATOM 9094  C CG2   . THR E 5 85  ? 11.599  132.271 60.385  1.00 45.21  ? 85  THR L CG2   1 
ATOM 9095  N N     . TYR E 5 86  ? 8.933   133.760 56.781  1.00 39.08  ? 86  TYR L N     1 
ATOM 9096  C CA    . TYR E 5 86  ? 8.303   133.683 55.479  1.00 37.52  ? 86  TYR L CA    1 
ATOM 9097  C C     . TYR E 5 86  ? 9.332   133.901 54.390  1.00 38.77  ? 86  TYR L C     1 
ATOM 9098  O O     . TYR E 5 86  ? 10.041  134.916 54.395  1.00 40.36  ? 86  TYR L O     1 
ATOM 9099  C CB    . TYR E 5 86  ? 7.203   134.728 55.368  1.00 35.10  ? 86  TYR L CB    1 
ATOM 9100  C CG    . TYR E 5 86  ? 6.006   134.481 56.249  1.00 32.68  ? 86  TYR L CG    1 
ATOM 9101  C CD1   . TYR E 5 86  ? 6.142   134.305 57.622  1.00 30.27  ? 86  TYR L CD1   1 
ATOM 9102  C CD2   . TYR E 5 86  ? 4.732   134.470 55.710  1.00 32.08  ? 86  TYR L CD2   1 
ATOM 9103  C CE1   . TYR E 5 86  ? 5.041   134.128 58.435  1.00 30.33  ? 86  TYR L CE1   1 
ATOM 9104  C CE2   . TYR E 5 86  ? 3.626   134.298 56.506  1.00 33.21  ? 86  TYR L CE2   1 
ATOM 9105  C CZ    . TYR E 5 86  ? 3.779   134.129 57.869  1.00 33.48  ? 86  TYR L CZ    1 
ATOM 9106  O OH    . TYR E 5 86  ? 2.647   133.979 58.639  1.00 35.33  ? 86  TYR L OH    1 
ATOM 9107  N N     . TYR E 5 87  ? 9.408   132.950 53.457  1.00 39.23  ? 87  TYR L N     1 
ATOM 9108  C CA    . TYR E 5 87  ? 10.359  133.024 52.349  1.00 38.42  ? 87  TYR L CA    1 
ATOM 9109  C C     . TYR E 5 87  ? 9.757   133.383 50.975  1.00 38.74  ? 87  TYR L C     1 
ATOM 9110  O O     . TYR E 5 87  ? 8.686   132.900 50.567  1.00 36.94  ? 87  TYR L O     1 
ATOM 9111  C CB    . TYR E 5 87  ? 11.197  131.739 52.252  1.00 37.79  ? 87  TYR L CB    1 
ATOM 9112  C CG    . TYR E 5 87  ? 12.207  131.498 53.379  1.00 35.02  ? 87  TYR L CG    1 
ATOM 9113  C CD1   . TYR E 5 87  ? 11.813  130.927 54.593  1.00 35.12  ? 87  TYR L CD1   1 
ATOM 9114  C CD2   . TYR E 5 87  ? 13.569  131.742 53.192  1.00 34.57  ? 87  TYR L CD2   1 
ATOM 9115  C CE1   . TYR E 5 87  ? 12.746  130.591 55.584  1.00 33.93  ? 87  TYR L CE1   1 
ATOM 9116  C CE2   . TYR E 5 87  ? 14.511  131.409 54.182  1.00 34.79  ? 87  TYR L CE2   1 
ATOM 9117  C CZ    . TYR E 5 87  ? 14.087  130.835 55.372  1.00 34.17  ? 87  TYR L CZ    1 
ATOM 9118  O OH    . TYR E 5 87  ? 14.994  130.507 56.350  1.00 33.10  ? 87  TYR L OH    1 
ATOM 9119  N N     . CYS E 5 88  ? 10.508  134.232 50.276  1.00 39.27  ? 88  CYS L N     1 
ATOM 9120  C CA    . CYS E 5 88  ? 10.183  134.756 48.959  1.00 39.93  ? 88  CYS L CA    1 
ATOM 9121  C C     . CYS E 5 88  ? 10.916  133.970 47.868  1.00 39.26  ? 88  CYS L C     1 
ATOM 9122  O O     . CYS E 5 88  ? 12.148  133.875 47.907  1.00 39.53  ? 88  CYS L O     1 
ATOM 9123  C CB    . CYS E 5 88  ? 10.648  136.203 48.919  1.00 41.51  ? 88  CYS L CB    1 
ATOM 9124  S SG    . CYS E 5 88  ? 10.145  137.057 47.406  1.00 46.37  ? 88  CYS L SG    1 
ATOM 9125  N N     . GLN E 5 89  ? 10.191  133.466 46.865  1.00 37.41  ? 89  GLN L N     1 
ATOM 9126  C CA    . GLN E 5 89  ? 10.846  132.686 45.810  1.00 37.34  ? 89  GLN L CA    1 
ATOM 9127  C C     . GLN E 5 89  ? 10.552  133.053 44.358  1.00 38.73  ? 89  GLN L C     1 
ATOM 9128  O O     . GLN E 5 89  ? 9.401   133.102 43.938  1.00 37.58  ? 89  GLN L O     1 
ATOM 9129  C CB    . GLN E 5 89  ? 10.606  131.186 46.010  1.00 35.29  ? 89  GLN L CB    1 
ATOM 9130  C CG    . GLN E 5 89  ? 11.301  130.288 44.979  1.00 32.46  ? 89  GLN L CG    1 
ATOM 9131  C CD    . GLN E 5 89  ? 10.330  129.593 44.047  1.00 30.42  ? 89  GLN L CD    1 
ATOM 9132  O OE1   . GLN E 5 89  ? 9.141   129.483 44.339  1.00 28.04  ? 89  GLN L OE1   1 
ATOM 9133  N NE2   . GLN E 5 89  ? 10.837  129.107 42.923  1.00 29.27  ? 89  GLN L NE2   1 
ATOM 9134  N N     . GLN E 5 90  ? 11.632  133.195 43.588  1.00 40.44  ? 90  GLN L N     1 
ATOM 9135  C CA    . GLN E 5 90  ? 11.607  133.545 42.164  1.00 41.10  ? 90  GLN L CA    1 
ATOM 9136  C C     . GLN E 5 90  ? 11.786  132.304 41.273  1.00 43.81  ? 90  GLN L C     1 
ATOM 9137  O O     . GLN E 5 90  ? 12.468  131.363 41.669  1.00 45.79  ? 90  GLN L O     1 
ATOM 9138  C CB    . GLN E 5 90  ? 12.729  134.566 41.898  1.00 36.33  ? 90  GLN L CB    1 
ATOM 9139  C CG    . GLN E 5 90  ? 13.509  134.378 40.607  1.00 30.23  ? 90  GLN L CG    1 
ATOM 9140  C CD    . GLN E 5 90  ? 14.671  133.414 40.748  1.00 26.51  ? 90  GLN L CD    1 
ATOM 9141  O OE1   . GLN E 5 90  ? 15.292  133.327 41.812  1.00 22.18  ? 90  GLN L OE1   1 
ATOM 9142  N NE2   . GLN E 5 90  ? 14.976  132.691 39.669  1.00 21.81  ? 90  GLN L NE2   1 
ATOM 9143  N N     . TYR E 5 91  ? 11.164  132.286 40.093  1.00 45.81  ? 91  TYR L N     1 
ATOM 9144  C CA    . TYR E 5 91  ? 11.325  131.150 39.173  1.00 48.93  ? 91  TYR L CA    1 
ATOM 9145  C C     . TYR E 5 91  ? 11.493  131.607 37.726  1.00 50.20  ? 91  TYR L C     1 
ATOM 9146  O O     . TYR E 5 91  ? 10.907  131.062 36.771  1.00 48.56  ? 91  TYR L O     1 
ATOM 9147  C CB    . TYR E 5 91  ? 10.220  130.086 39.332  1.00 52.02  ? 91  TYR L CB    1 
ATOM 9148  C CG    . TYR E 5 91  ? 8.778   130.490 39.049  1.00 53.83  ? 91  TYR L CG    1 
ATOM 9149  C CD1   . TYR E 5 91  ? 7.933   129.632 38.340  1.00 55.17  ? 91  TYR L CD1   1 
ATOM 9150  C CD2   . TYR E 5 91  ? 8.231   131.678 39.555  1.00 55.49  ? 91  TYR L CD2   1 
ATOM 9151  C CE1   . TYR E 5 91  ? 6.573   129.940 38.148  1.00 54.93  ? 91  TYR L CE1   1 
ATOM 9152  C CE2   . TYR E 5 91  ? 6.863   131.996 39.366  1.00 55.17  ? 91  TYR L CE2   1 
ATOM 9153  C CZ    . TYR E 5 91  ? 6.045   131.119 38.664  1.00 54.22  ? 91  TYR L CZ    1 
ATOM 9154  O OH    . TYR E 5 91  ? 4.706   131.404 38.495  1.00 52.29  ? 91  TYR L OH    1 
ATOM 9155  N N     . SER E 5 92  ? 12.395  132.574 37.602  1.00 51.65  ? 92  SER L N     1 
ATOM 9156  C CA    . SER E 5 92  ? 12.749  133.238 36.353  1.00 53.10  ? 92  SER L CA    1 
ATOM 9157  C C     . SER E 5 92  ? 13.940  132.573 35.677  1.00 52.34  ? 92  SER L C     1 
ATOM 9158  O O     . SER E 5 92  ? 13.784  131.657 34.859  1.00 51.99  ? 92  SER L O     1 
ATOM 9159  C CB    . SER E 5 92  ? 13.109  134.684 36.696  1.00 55.37  ? 92  SER L CB    1 
ATOM 9160  O OG    . SER E 5 92  ? 13.993  134.714 37.816  1.00 54.40  ? 92  SER L OG    1 
ATOM 9161  N N     . LYS E 5 93  ? 15.117  133.137 35.949  1.00 51.89  ? 93  LYS L N     1 
ATOM 9162  C CA    . LYS E 5 93  ? 16.371  132.612 35.444  1.00 50.88  ? 93  LYS L CA    1 
ATOM 9163  C C     . LYS E 5 93  ? 16.566  131.406 36.363  1.00 48.48  ? 93  LYS L C     1 
ATOM 9164  O O     . LYS E 5 93  ? 16.636  131.539 37.602  1.00 47.31  ? 93  LYS L O     1 
ATOM 9165  C CB    . LYS E 5 93  ? 17.515  133.636 35.598  1.00 53.91  ? 93  LYS L CB    1 
ATOM 9166  C CG    . LYS E 5 93  ? 18.741  133.367 34.694  1.00 55.27  ? 93  LYS L CG    1 
ATOM 9167  C CD    . LYS E 5 93  ? 19.929  134.298 34.987  1.00 56.89  ? 93  LYS L CD    1 
ATOM 9168  C CE    . LYS E 5 93  ? 19.648  135.767 34.646  1.00 57.70  ? 93  LYS L CE    1 
ATOM 9169  N NZ    . LYS E 5 93  ? 20.716  136.693 35.148  1.00 57.36  ? 93  LYS L NZ    1 
ATOM 9170  N N     . PHE E 5 94  ? 16.640  130.233 35.734  1.00 46.20  ? 94  PHE L N     1 
ATOM 9171  C CA    . PHE E 5 94  ? 16.752  128.981 36.449  1.00 43.92  ? 94  PHE L CA    1 
ATOM 9172  C C     . PHE E 5 94  ? 17.539  128.940 37.729  1.00 41.38  ? 94  PHE L C     1 
ATOM 9173  O O     . PHE E 5 94  ? 17.282  128.067 38.553  1.00 44.75  ? 94  PHE L O     1 
ATOM 9174  C CB    . PHE E 5 94  ? 17.061  127.770 35.559  1.00 45.00  ? 94  PHE L CB    1 
ATOM 9175  C CG    . PHE E 5 94  ? 16.290  126.552 35.979  1.00 45.15  ? 94  PHE L CG    1 
ATOM 9176  C CD1   . PHE E 5 94  ? 16.788  125.706 36.968  1.00 45.22  ? 94  PHE L CD1   1 
ATOM 9177  C CD2   . PHE E 5 94  ? 14.974  126.374 35.544  1.00 45.27  ? 94  PHE L CD2   1 
ATOM 9178  C CE1   . PHE E 5 94  ? 15.984  124.723 37.524  1.00 46.78  ? 94  PHE L CE1   1 
ATOM 9179  C CE2   . PHE E 5 94  ? 14.164  125.396 36.091  1.00 45.43  ? 94  PHE L CE2   1 
ATOM 9180  C CZ    . PHE E 5 94  ? 14.663  124.571 37.085  1.00 47.37  ? 94  PHE L CZ    1 
ATOM 9181  N N     . PRO E 5 95  ? 18.593  129.759 37.866  1.00 37.39  ? 95  PRO L N     1 
ATOM 9182  C CA    . PRO E 5 95  ? 19.203  129.590 39.187  1.00 35.21  ? 95  PRO L CA    1 
ATOM 9183  C C     . PRO E 5 95  ? 18.211  130.214 40.171  1.00 33.16  ? 95  PRO L C     1 
ATOM 9184  O O     . PRO E 5 95  ? 18.245  131.405 40.489  1.00 34.09  ? 95  PRO L O     1 
ATOM 9185  C CB    . PRO E 5 95  ? 20.509  130.344 39.054  1.00 34.91  ? 95  PRO L CB    1 
ATOM 9186  C CG    . PRO E 5 95  ? 20.864  130.053 37.618  1.00 35.99  ? 95  PRO L CG    1 
ATOM 9187  C CD    . PRO E 5 95  ? 19.564  130.310 36.909  1.00 35.12  ? 95  PRO L CD    1 
ATOM 9188  N N     . TRP E 5 96  ? 17.214  129.391 40.475  1.00 29.78  ? 96  TRP L N     1 
ATOM 9189  C CA    . TRP E 5 96  ? 16.130  129.696 41.367  1.00 26.46  ? 96  TRP L CA    1 
ATOM 9190  C C     . TRP E 5 96  ? 16.793  130.102 42.649  1.00 26.23  ? 96  TRP L C     1 
ATOM 9191  O O     . TRP E 5 96  ? 17.742  129.459 43.094  1.00 25.37  ? 96  TRP L O     1 
ATOM 9192  C CB    . TRP E 5 96  ? 15.259  128.444 41.530  1.00 24.80  ? 96  TRP L CB    1 
ATOM 9193  C CG    . TRP E 5 96  ? 14.394  128.195 40.319  1.00 24.53  ? 96  TRP L CG    1 
ATOM 9194  C CD1   . TRP E 5 96  ? 14.380  128.927 39.162  1.00 23.40  ? 96  TRP L CD1   1 
ATOM 9195  C CD2   . TRP E 5 96  ? 13.380  127.194 40.162  1.00 22.89  ? 96  TRP L CD2   1 
ATOM 9196  N NE1   . TRP E 5 96  ? 13.421  128.453 38.301  1.00 22.90  ? 96  TRP L NE1   1 
ATOM 9197  C CE2   . TRP E 5 96  ? 12.789  127.391 38.888  1.00 23.07  ? 96  TRP L CE2   1 
ATOM 9198  C CE3   . TRP E 5 96  ? 12.903  126.158 40.972  1.00 22.62  ? 96  TRP L CE3   1 
ATOM 9199  C CZ2   . TRP E 5 96  ? 11.747  126.589 38.406  1.00 21.21  ? 96  TRP L CZ2   1 
ATOM 9200  C CZ3   . TRP E 5 96  ? 11.854  125.356 40.483  1.00 24.02  ? 96  TRP L CZ3   1 
ATOM 9201  C CH2   . TRP E 5 96  ? 11.290  125.585 39.210  1.00 21.35  ? 96  TRP L CH2   1 
ATOM 9202  N N     . THR E 5 97  ? 16.352  131.223 43.198  1.00 27.41  ? 97  THR L N     1 
ATOM 9203  C CA    . THR E 5 97  ? 16.944  131.730 44.430  1.00 28.09  ? 97  THR L CA    1 
ATOM 9204  C C     . THR E 5 97  ? 15.935  132.274 45.479  1.00 29.99  ? 97  THR L C     1 
ATOM 9205  O O     . THR E 5 97  ? 15.035  133.060 45.150  1.00 31.72  ? 97  THR L O     1 
ATOM 9206  C CB    . THR E 5 97  ? 18.018  132.768 44.069  1.00 25.67  ? 97  THR L CB    1 
ATOM 9207  O OG1   . THR E 5 97  ? 17.661  133.397 42.826  1.00 22.14  ? 97  THR L OG1   1 
ATOM 9208  C CG2   . THR E 5 97  ? 19.379  132.086 43.926  1.00 23.44  ? 97  THR L CG2   1 
ATOM 9209  N N     . PHE E 5 98  ? 16.044  131.775 46.714  1.00 29.67  ? 98  PHE L N     1 
ATOM 9210  C CA    . PHE E 5 98  ? 15.174  132.190 47.810  1.00 29.38  ? 98  PHE L CA    1 
ATOM 9211  C C     . PHE E 5 98  ? 15.882  133.319 48.521  1.00 30.08  ? 98  PHE L C     1 
ATOM 9212  O O     . PHE E 5 98  ? 17.070  133.208 48.836  1.00 30.50  ? 98  PHE L O     1 
ATOM 9213  C CB    . PHE E 5 98  ? 14.989  131.072 48.853  1.00 29.49  ? 98  PHE L CB    1 
ATOM 9214  C CG    . PHE E 5 98  ? 14.449  129.786 48.308  1.00 29.22  ? 98  PHE L CG    1 
ATOM 9215  C CD1   . PHE E 5 98  ? 13.155  129.707 47.815  1.00 29.68  ? 98  PHE L CD1   1 
ATOM 9216  C CD2   . PHE E 5 98  ? 15.233  128.637 48.317  1.00 28.89  ? 98  PHE L CD2   1 
ATOM 9217  C CE1   . PHE E 5 98  ? 12.646  128.489 47.333  1.00 30.94  ? 98  PHE L CE1   1 
ATOM 9218  C CE2   . PHE E 5 98  ? 14.742  127.423 47.844  1.00 29.21  ? 98  PHE L CE2   1 
ATOM 9219  C CZ    . PHE E 5 98  ? 13.443  127.348 47.349  1.00 29.52  ? 98  PHE L CZ    1 
ATOM 9220  N N     . GLY E 5 99  ? 15.158  134.400 48.774  1.00 31.28  ? 99  GLY L N     1 
ATOM 9221  C CA    . GLY E 5 99  ? 15.747  135.501 49.508  1.00 34.12  ? 99  GLY L CA    1 
ATOM 9222  C C     . GLY E 5 99  ? 15.784  135.045 50.955  1.00 36.78  ? 99  GLY L C     1 
ATOM 9223  O O     . GLY E 5 99  ? 15.119  134.062 51.303  1.00 37.79  ? 99  GLY L O     1 
ATOM 9224  N N     . GLY E 5 100 ? 16.560  135.728 51.797  1.00 38.06  ? 100 GLY L N     1 
ATOM 9225  C CA    . GLY E 5 100 ? 16.644  135.355 53.205  1.00 38.60  ? 100 GLY L CA    1 
ATOM 9226  C C     . GLY E 5 100 ? 15.345  135.630 53.943  1.00 38.19  ? 100 GLY L C     1 
ATOM 9227  O O     . GLY E 5 100 ? 15.068  136.770 54.295  1.00 39.15  ? 100 GLY L O     1 
ATOM 9228  N N     . GLY E 5 101 ? 14.551  134.588 54.176  1.00 37.82  ? 101 GLY L N     1 
ATOM 9229  C CA    . GLY E 5 101 ? 13.270  134.728 54.855  1.00 37.79  ? 101 GLY L CA    1 
ATOM 9230  C C     . GLY E 5 101 ? 13.122  135.746 55.976  1.00 38.92  ? 101 GLY L C     1 
ATOM 9231  O O     . GLY E 5 101 ? 14.096  136.291 56.502  1.00 38.85  ? 101 GLY L O     1 
ATOM 9232  N N     . THR E 5 102 ? 11.875  136.004 56.347  1.00 39.62  ? 102 THR L N     1 
ATOM 9233  C CA    . THR E 5 102 ? 11.586  136.955 57.408  1.00 39.84  ? 102 THR L CA    1 
ATOM 9234  C C     . THR E 5 102 ? 10.838  136.325 58.570  1.00 40.30  ? 102 THR L C     1 
ATOM 9235  O O     . THR E 5 102 ? 9.747   135.768 58.396  1.00 39.41  ? 102 THR L O     1 
ATOM 9236  C CB    . THR E 5 102 ? 10.785  138.165 56.881  1.00 39.75  ? 102 THR L CB    1 
ATOM 9237  O OG1   . THR E 5 102 ? 11.617  138.933 56.008  1.00 40.80  ? 102 THR L OG1   1 
ATOM 9238  C CG2   . THR E 5 102 ? 10.336  139.057 58.019  1.00 38.96  ? 102 THR L CG2   1 
ATOM 9239  N N     . LYS E 5 103 ? 11.456  136.402 59.749  1.00 40.84  ? 103 LYS L N     1 
ATOM 9240  C CA    . LYS E 5 103 ? 10.860  135.887 60.981  1.00 40.56  ? 103 LYS L CA    1 
ATOM 9241  C C     . LYS E 5 103 ? 9.719   136.845 61.308  1.00 39.53  ? 103 LYS L C     1 
ATOM 9242  O O     . LYS E 5 103 ? 9.780   138.033 60.981  1.00 40.07  ? 103 LYS L O     1 
ATOM 9243  C CB    . LYS E 5 103 ? 11.883  135.868 62.128  1.00 42.16  ? 103 LYS L CB    1 
ATOM 9244  C CG    . LYS E 5 103 ? 13.086  134.966 61.873  1.00 44.65  ? 103 LYS L CG    1 
ATOM 9245  C CD    . LYS E 5 103 ? 14.392  135.468 62.526  1.00 47.22  ? 103 LYS L CD    1 
ATOM 9246  C CE    . LYS E 5 103 ? 14.639  134.893 63.931  1.00 47.60  ? 103 LYS L CE    1 
ATOM 9247  N NZ    . LYS E 5 103 ? 16.057  135.108 64.384  1.00 48.45  ? 103 LYS L NZ    1 
ATOM 9248  N N     . LEU E 5 104 ? 8.693   136.335 61.972  1.00 37.26  ? 104 LEU L N     1 
ATOM 9249  C CA    . LEU E 5 104 ? 7.533   137.135 62.302  1.00 34.80  ? 104 LEU L CA    1 
ATOM 9250  C C     . LEU E 5 104 ? 7.181   136.894 63.752  1.00 34.61  ? 104 LEU L C     1 
ATOM 9251  O O     . LEU E 5 104 ? 6.141   136.332 64.063  1.00 33.58  ? 104 LEU L O     1 
ATOM 9252  C CB    . LEU E 5 104 ? 6.414   136.706 61.373  1.00 33.90  ? 104 LEU L CB    1 
ATOM 9253  C CG    . LEU E 5 104 ? 4.975   137.041 61.667  1.00 34.21  ? 104 LEU L CG    1 
ATOM 9254  C CD1   . LEU E 5 104 ? 4.854   138.446 62.200  1.00 34.03  ? 104 LEU L CD1   1 
ATOM 9255  C CD2   . LEU E 5 104 ? 4.221   136.845 60.379  1.00 35.83  ? 104 LEU L CD2   1 
ATOM 9256  N N     . GLU E 5 105 ? 8.053   137.366 64.635  1.00 35.27  ? 105 GLU L N     1 
ATOM 9257  C CA    . GLU E 5 105 ? 7.889   137.176 66.071  1.00 36.26  ? 105 GLU L CA    1 
ATOM 9258  C C     . GLU E 5 105 ? 6.841   138.028 66.781  1.00 35.26  ? 105 GLU L C     1 
ATOM 9259  O O     . GLU E 5 105 ? 6.476   139.106 66.326  1.00 34.26  ? 105 GLU L O     1 
ATOM 9260  C CB    . GLU E 5 105 ? 9.239   137.326 66.778  1.00 38.02  ? 105 GLU L CB    1 
ATOM 9261  C CG    . GLU E 5 105 ? 9.786   138.748 66.829  1.00 42.90  ? 105 GLU L CG    1 
ATOM 9262  C CD    . GLU E 5 105 ? 10.571  139.030 68.112  1.00 46.05  ? 105 GLU L CD    1 
ATOM 9263  O OE1   . GLU E 5 105 ? 11.793  138.755 68.156  1.00 48.65  ? 105 GLU L OE1   1 
ATOM 9264  O OE2   . GLU E 5 105 ? 9.960   139.518 69.089  1.00 47.91  ? 105 GLU L OE2   1 
ATOM 9265  N N     . ILE E 5 106 ? 6.364   137.510 67.907  1.00 35.68  ? 106 ILE L N     1 
ATOM 9266  C CA    . ILE E 5 106 ? 5.369   138.181 68.729  1.00 37.57  ? 106 ILE L CA    1 
ATOM 9267  C C     . ILE E 5 106 ? 5.989   139.345 69.478  1.00 38.87  ? 106 ILE L C     1 
ATOM 9268  O O     . ILE E 5 106 ? 7.142   139.275 69.903  1.00 39.91  ? 106 ILE L O     1 
ATOM 9269  C CB    . ILE E 5 106 ? 4.834   137.255 69.809  1.00 38.33  ? 106 ILE L CB    1 
ATOM 9270  C CG1   . ILE E 5 106 ? 4.326   135.958 69.203  1.00 38.36  ? 106 ILE L CG1   1 
ATOM 9271  C CG2   . ILE E 5 106 ? 3.734   137.951 70.592  1.00 37.79  ? 106 ILE L CG2   1 
ATOM 9272  C CD1   . ILE E 5 106 ? 3.983   134.923 70.261  1.00 41.36  ? 106 ILE L CD1   1 
ATOM 9273  N N     . LYS E 5 107 ? 5.188   140.378 69.708  1.00 39.56  ? 107 LYS L N     1 
ATOM 9274  C CA    . LYS E 5 107 ? 5.651   141.547 70.427  1.00 40.65  ? 107 LYS L CA    1 
ATOM 9275  C C     . LYS E 5 107 ? 5.211   141.452 71.891  1.00 39.69  ? 107 LYS L C     1 
ATOM 9276  O O     . LYS E 5 107 ? 4.035   141.192 72.174  1.00 39.43  ? 107 LYS L O     1 
ATOM 9277  C CB    . LYS E 5 107 ? 5.098   142.813 69.771  1.00 43.73  ? 107 LYS L CB    1 
ATOM 9278  C CG    . LYS E 5 107 ? 5.842   144.095 70.155  1.00 50.73  ? 107 LYS L CG    1 
ATOM 9279  C CD    . LYS E 5 107 ? 7.297   144.116 69.630  1.00 55.17  ? 107 LYS L CD    1 
ATOM 9280  C CE    . LYS E 5 107 ? 8.092   145.356 70.103  1.00 57.52  ? 107 LYS L CE    1 
ATOM 9281  N NZ    . LYS E 5 107 ? 9.497   145.403 69.564  1.00 57.51  ? 107 LYS L NZ    1 
ATOM 9282  N N     . ARG E 5 108 ? 6.165   141.643 72.808  1.00 38.83  ? 108 ARG L N     1 
ATOM 9283  C CA    . ARG E 5 108 ? 5.918   141.582 74.261  1.00 38.70  ? 108 ARG L CA    1 
ATOM 9284  C C     . ARG E 5 108 ? 6.635   142.692 75.043  1.00 38.83  ? 108 ARG L C     1 
ATOM 9285  O O     . ARG E 5 108 ? 7.828   142.923 74.854  1.00 39.77  ? 108 ARG L O     1 
ATOM 9286  C CB    . ARG E 5 108 ? 6.355   140.222 74.842  1.00 38.48  ? 108 ARG L CB    1 
ATOM 9287  C CG    . ARG E 5 108 ? 5.997   140.026 76.318  1.00 37.30  ? 108 ARG L CG    1 
ATOM 9288  C CD    . ARG E 5 108 ? 7.200   139.760 77.200  1.00 35.64  ? 108 ARG L CD    1 
ATOM 9289  N NE    . ARG E 5 108 ? 6.854   139.933 78.616  1.00 36.65  ? 108 ARG L NE    1 
ATOM 9290  C CZ    . ARG E 5 108 ? 6.310   138.995 79.395  1.00 36.76  ? 108 ARG L CZ    1 
ATOM 9291  N NH1   . ARG E 5 108 ? 6.044   137.796 78.907  1.00 38.63  ? 108 ARG L NH1   1 
ATOM 9292  N NH2   . ARG E 5 108 ? 6.020   139.250 80.668  1.00 35.05  ? 108 ARG L NH2   1 
ATOM 9293  N N     . ALA E 5 109 ? 5.914   143.342 75.957  1.00 38.18  ? 109 ALA L N     1 
ATOM 9294  C CA    . ALA E 5 109 ? 6.490   144.410 76.769  1.00 35.61  ? 109 ALA L CA    1 
ATOM 9295  C C     . ALA E 5 109 ? 7.736   143.883 77.415  1.00 34.24  ? 109 ALA L C     1 
ATOM 9296  O O     . ALA E 5 109 ? 7.713   142.943 78.201  1.00 32.16  ? 109 ALA L O     1 
ATOM 9297  C CB    . ALA E 5 109 ? 5.521   144.874 77.822  1.00 38.74  ? 109 ALA L CB    1 
ATOM 9298  N N     . ASP E 5 110 ? 8.835   144.466 76.998  1.00 34.83  ? 110 ASP L N     1 
ATOM 9299  C CA    . ASP E 5 110 ? 10.150  144.099 77.467  1.00 38.21  ? 110 ASP L CA    1 
ATOM 9300  C C     . ASP E 5 110 ? 10.325  143.795 78.940  1.00 37.04  ? 110 ASP L C     1 
ATOM 9301  O O     . ASP E 5 110 ? 9.416   143.990 79.759  1.00 34.23  ? 110 ASP L O     1 
ATOM 9302  C CB    . ASP E 5 110 ? 11.140  145.167 77.025  1.00 42.99  ? 110 ASP L CB    1 
ATOM 9303  C CG    . ASP E 5 110 ? 10.458  146.491 76.765  1.00 48.52  ? 110 ASP L CG    1 
ATOM 9304  O OD1   . ASP E 5 110 ? 10.561  147.387 77.635  1.00 52.56  ? 110 ASP L OD1   1 
ATOM 9305  O OD2   . ASP E 5 110 ? 9.767   146.606 75.718  1.00 50.64  ? 110 ASP L OD2   1 
ATOM 9306  N N     . ALA E 5 111 ? 11.516  143.293 79.246  1.00 37.56  ? 111 ALA L N     1 
ATOM 9307  C CA    . ALA E 5 111 ? 11.887  142.942 80.602  1.00 38.72  ? 111 ALA L CA    1 
ATOM 9308  C C     . ALA E 5 111 ? 13.335  142.483 80.704  1.00 38.74  ? 111 ALA L C     1 
ATOM 9309  O O     . ALA E 5 111 ? 13.877  141.859 79.788  1.00 38.27  ? 111 ALA L O     1 
ATOM 9310  C CB    . ALA E 5 111 ? 10.967  141.877 81.131  1.00 40.66  ? 111 ALA L CB    1 
ATOM 9311  N N     . ALA E 5 112 ? 13.934  142.789 81.851  1.00 39.79  ? 112 ALA L N     1 
ATOM 9312  C CA    . ALA E 5 112 ? 15.320  142.454 82.172  1.00 40.51  ? 112 ALA L CA    1 
ATOM 9313  C C     . ALA E 5 112 ? 15.489  140.969 82.437  1.00 40.32  ? 112 ALA L C     1 
ATOM 9314  O O     . ALA E 5 112 ? 14.690  140.357 83.135  1.00 41.59  ? 112 ALA L O     1 
ATOM 9315  C CB    . ALA E 5 112 ? 15.778  143.254 83.405  1.00 42.30  ? 112 ALA L CB    1 
ATOM 9316  N N     . PRO E 5 113 ? 16.586  140.392 81.954  1.00 39.96  ? 113 PRO L N     1 
ATOM 9317  C CA    . PRO E 5 113 ? 16.894  138.974 82.124  1.00 39.13  ? 113 PRO L CA    1 
ATOM 9318  C C     . PRO E 5 113 ? 17.327  138.637 83.528  1.00 38.98  ? 113 PRO L C     1 
ATOM 9319  O O     . PRO E 5 113 ? 18.052  139.397 84.172  1.00 37.01  ? 113 PRO L O     1 
ATOM 9320  C CB    . PRO E 5 113 ? 18.077  138.782 81.198  1.00 40.99  ? 113 PRO L CB    1 
ATOM 9321  C CG    . PRO E 5 113 ? 18.824  140.081 81.401  1.00 42.05  ? 113 PRO L CG    1 
ATOM 9322  C CD    . PRO E 5 113 ? 17.698  141.094 81.294  1.00 40.62  ? 113 PRO L CD    1 
ATOM 9323  N N     . THR E 5 114 ? 16.917  137.471 83.985  1.00 39.18  ? 114 THR L N     1 
ATOM 9324  C CA    . THR E 5 114 ? 17.325  137.033 85.296  1.00 40.00  ? 114 THR L CA    1 
ATOM 9325  C C     . THR E 5 114 ? 18.610  136.286 85.032  1.00 41.12  ? 114 THR L C     1 
ATOM 9326  O O     . THR E 5 114 ? 18.628  135.230 84.400  1.00 40.21  ? 114 THR L O     1 
ATOM 9327  C CB    . THR E 5 114 ? 16.307  136.138 85.883  1.00 39.82  ? 114 THR L CB    1 
ATOM 9328  O OG1   . THR E 5 114 ? 15.017  136.598 85.462  1.00 39.66  ? 114 THR L OG1   1 
ATOM 9329  C CG2   . THR E 5 114 ? 16.413  136.189 87.396  1.00 40.47  ? 114 THR L CG2   1 
ATOM 9330  N N     . VAL E 5 115 ? 19.695  136.887 85.480  1.00 42.33  ? 115 VAL L N     1 
ATOM 9331  C CA    . VAL E 5 115 ? 21.012  136.344 85.238  1.00 44.10  ? 115 VAL L CA    1 
ATOM 9332  C C     . VAL E 5 115 ? 21.570  135.496 86.353  1.00 44.83  ? 115 VAL L C     1 
ATOM 9333  O O     . VAL E 5 115 ? 21.434  135.830 87.523  1.00 45.70  ? 115 VAL L O     1 
ATOM 9334  C CB    . VAL E 5 115 ? 21.976  137.485 84.947  1.00 45.31  ? 115 VAL L CB    1 
ATOM 9335  C CG1   . VAL E 5 115 ? 23.297  136.953 84.404  1.00 46.37  ? 115 VAL L CG1   1 
ATOM 9336  C CG2   . VAL E 5 115 ? 21.319  138.465 83.976  1.00 45.88  ? 115 VAL L CG2   1 
ATOM 9337  N N     . SER E 5 116 ? 22.259  134.426 85.978  1.00 45.50  ? 116 SER L N     1 
ATOM 9338  C CA    . SER E 5 116 ? 22.839  133.535 86.961  1.00 47.44  ? 116 SER L CA    1 
ATOM 9339  C C     . SER E 5 116 ? 24.177  133.020 86.498  1.00 48.81  ? 116 SER L C     1 
ATOM 9340  O O     . SER E 5 116 ? 24.335  132.551 85.372  1.00 47.70  ? 116 SER L O     1 
ATOM 9341  C CB    . SER E 5 116 ? 21.912  132.361 87.222  1.00 49.01  ? 116 SER L CB    1 
ATOM 9342  O OG    . SER E 5 116 ? 20.571  132.800 87.303  1.00 52.30  ? 116 SER L OG    1 
ATOM 9343  N N     . ILE E 5 117 ? 25.135  133.085 87.406  1.00 51.00  ? 117 ILE L N     1 
ATOM 9344  C CA    . ILE E 5 117 ? 26.482  132.641 87.120  1.00 53.16  ? 117 ILE L CA    1 
ATOM 9345  C C     . ILE E 5 117 ? 26.810  131.453 88.024  1.00 53.61  ? 117 ILE L C     1 
ATOM 9346  O O     . ILE E 5 117 ? 26.603  131.489 89.243  1.00 53.60  ? 117 ILE L O     1 
ATOM 9347  C CB    . ILE E 5 117 ? 27.471  133.818 87.300  1.00 54.09  ? 117 ILE L CB    1 
ATOM 9348  C CG1   . ILE E 5 117 ? 28.828  133.489 86.678  1.00 55.19  ? 117 ILE L CG1   1 
ATOM 9349  C CG2   . ILE E 5 117 ? 27.569  134.209 88.766  1.00 54.50  ? 117 ILE L CG2   1 
ATOM 9350  C CD1   . ILE E 5 117 ? 29.767  134.692 86.586  1.00 55.77  ? 117 ILE L CD1   1 
ATOM 9351  N N     . PHE E 5 118 ? 27.261  130.372 87.405  1.00 54.12  ? 118 PHE L N     1 
ATOM 9352  C CA    . PHE E 5 118 ? 27.575  129.176 88.153  1.00 55.48  ? 118 PHE L CA    1 
ATOM 9353  C C     . PHE E 5 118 ? 29.031  128.800 88.106  1.00 55.10  ? 118 PHE L C     1 
ATOM 9354  O O     . PHE E 5 118 ? 29.653  128.736 87.044  1.00 54.64  ? 118 PHE L O     1 
ATOM 9355  C CB    . PHE E 5 118 ? 26.719  128.007 87.679  1.00 58.62  ? 118 PHE L CB    1 
ATOM 9356  C CG    . PHE E 5 118 ? 25.248  128.227 87.857  1.00 60.71  ? 118 PHE L CG    1 
ATOM 9357  C CD1   . PHE E 5 118 ? 24.554  129.092 87.011  1.00 60.58  ? 118 PHE L CD1   1 
ATOM 9358  C CD2   . PHE E 5 118 ? 24.550  127.557 88.858  1.00 61.72  ? 118 PHE L CD2   1 
ATOM 9359  C CE1   . PHE E 5 118 ? 23.186  129.281 87.159  1.00 60.64  ? 118 PHE L CE1   1 
ATOM 9360  C CE2   . PHE E 5 118 ? 23.176  127.737 89.017  1.00 61.37  ? 118 PHE L CE2   1 
ATOM 9361  C CZ    . PHE E 5 118 ? 22.493  128.602 88.163  1.00 61.31  ? 118 PHE L CZ    1 
ATOM 9362  N N     . PRO E 5 119 ? 29.580  128.482 89.274  1.00 54.31  ? 119 PRO L N     1 
ATOM 9363  C CA    . PRO E 5 119 ? 30.971  128.095 89.435  1.00 54.61  ? 119 PRO L CA    1 
ATOM 9364  C C     . PRO E 5 119 ? 31.199  126.704 88.883  1.00 55.25  ? 119 PRO L C     1 
ATOM 9365  O O     . PRO E 5 119 ? 30.263  126.006 88.490  1.00 54.48  ? 119 PRO L O     1 
ATOM 9366  C CB    . PRO E 5 119 ? 31.146  128.068 90.954  1.00 54.90  ? 119 PRO L CB    1 
ATOM 9367  C CG    . PRO E 5 119 ? 29.946  128.810 91.491  1.00 55.42  ? 119 PRO L CG    1 
ATOM 9368  C CD    . PRO E 5 119 ? 28.872  128.419 90.558  1.00 54.61  ? 119 PRO L CD    1 
ATOM 9369  N N     . PRO E 5 120 ? 32.470  126.342 88.730  1.00 56.72  ? 120 PRO L N     1 
ATOM 9370  C CA    . PRO E 5 120 ? 32.915  125.037 88.233  1.00 57.73  ? 120 PRO L CA    1 
ATOM 9371  C C     . PRO E 5 120 ? 32.834  123.986 89.364  1.00 57.68  ? 120 PRO L C     1 
ATOM 9372  O O     . PRO E 5 120 ? 33.201  124.260 90.518  1.00 56.71  ? 120 PRO L O     1 
ATOM 9373  C CB    . PRO E 5 120 ? 34.357  125.322 87.816  1.00 58.64  ? 120 PRO L CB    1 
ATOM 9374  C CG    . PRO E 5 120 ? 34.295  126.766 87.377  1.00 57.62  ? 120 PRO L CG    1 
ATOM 9375  C CD    . PRO E 5 120 ? 33.518  127.357 88.515  1.00 57.18  ? 120 PRO L CD    1 
ATOM 9376  N N     . SER E 5 121 ? 32.360  122.788 89.018  1.00 57.71  ? 121 SER L N     1 
ATOM 9377  C CA    . SER E 5 121 ? 32.191  121.695 89.983  1.00 57.58  ? 121 SER L CA    1 
ATOM 9378  C C     . SER E 5 121 ? 33.422  120.843 90.267  1.00 56.75  ? 121 SER L C     1 
ATOM 9379  O O     . SER E 5 121 ? 34.148  120.451 89.353  1.00 55.27  ? 121 SER L O     1 
ATOM 9380  C CB    . SER E 5 121 ? 31.063  120.754 89.541  1.00 58.66  ? 121 SER L CB    1 
ATOM 9381  O OG    . SER E 5 121 ? 31.529  119.786 88.608  1.00 57.80  ? 121 SER L OG    1 
ATOM 9382  N N     . SER E 5 122 ? 33.590  120.494 91.538  1.00 56.11  ? 122 SER L N     1 
ATOM 9383  C CA    . SER E 5 122 ? 34.693  119.651 91.981  1.00 56.05  ? 122 SER L CA    1 
ATOM 9384  C C     . SER E 5 122 ? 34.753  118.488 91.021  1.00 56.06  ? 122 SER L C     1 
ATOM 9385  O O     . SER E 5 122 ? 35.782  118.213 90.411  1.00 54.69  ? 122 SER L O     1 
ATOM 9386  C CB    . SER E 5 122 ? 34.377  119.093 93.367  1.00 56.89  ? 122 SER L CB    1 
ATOM 9387  O OG    . SER E 5 122 ? 33.236  118.243 93.320  1.00 54.80  ? 122 SER L OG    1 
ATOM 9388  N N     . GLU E 5 123 ? 33.580  117.893 90.838  1.00 57.01  ? 123 GLU L N     1 
ATOM 9389  C CA    . GLU E 5 123 ? 33.354  116.747 89.977  1.00 58.88  ? 123 GLU L CA    1 
ATOM 9390  C C     . GLU E 5 123 ? 34.129  116.819 88.669  1.00 58.89  ? 123 GLU L C     1 
ATOM 9391  O O     . GLU E 5 123 ? 34.777  115.846 88.279  1.00 59.21  ? 123 GLU L O     1 
ATOM 9392  C CB    . GLU E 5 123 ? 31.859  116.621 89.698  1.00 60.07  ? 123 GLU L CB    1 
ATOM 9393  C CG    . GLU E 5 123 ? 31.002  116.899 90.937  1.00 64.34  ? 123 GLU L CG    1 
ATOM 9394  C CD    . GLU E 5 123 ? 29.577  116.359 90.832  1.00 67.39  ? 123 GLU L CD    1 
ATOM 9395  O OE1   . GLU E 5 123 ? 28.664  116.915 91.496  1.00 69.05  ? 123 GLU L OE1   1 
ATOM 9396  O OE2   . GLU E 5 123 ? 29.373  115.360 90.105  1.00 68.32  ? 123 GLU L OE2   1 
ATOM 9397  N N     . GLN E 5 124 ? 34.078  117.975 88.010  1.00 58.65  ? 124 GLN L N     1 
ATOM 9398  C CA    . GLN E 5 124 ? 34.781  118.173 86.744  1.00 58.65  ? 124 GLN L CA    1 
ATOM 9399  C C     . GLN E 5 124 ? 36.220  118.603 86.976  1.00 59.60  ? 124 GLN L C     1 
ATOM 9400  O O     . GLN E 5 124 ? 37.156  118.021 86.427  1.00 59.44  ? 124 GLN L O     1 
ATOM 9401  C CB    . GLN E 5 124 ? 34.087  119.247 85.900  1.00 57.76  ? 124 GLN L CB    1 
ATOM 9402  C CG    . GLN E 5 124 ? 34.753  119.468 84.544  1.00 56.68  ? 124 GLN L CG    1 
ATOM 9403  C CD    . GLN E 5 124 ? 34.213  120.673 83.781  1.00 56.20  ? 124 GLN L CD    1 
ATOM 9404  O OE1   . GLN E 5 124 ? 33.948  121.730 84.359  1.00 54.80  ? 124 GLN L OE1   1 
ATOM 9405  N NE2   . GLN E 5 124 ? 34.089  120.526 82.464  1.00 55.24  ? 124 GLN L NE2   1 
ATOM 9406  N N     . LEU E 5 125 ? 36.366  119.658 87.770  1.00 60.80  ? 125 LEU L N     1 
ATOM 9407  C CA    . LEU E 5 125 ? 37.655  120.249 88.116  1.00 61.69  ? 125 LEU L CA    1 
ATOM 9408  C C     . LEU E 5 125 ? 38.741  119.212 88.333  1.00 61.58  ? 125 LEU L C     1 
ATOM 9409  O O     . LEU E 5 125 ? 39.841  119.321 87.780  1.00 60.94  ? 125 LEU L O     1 
ATOM 9410  C CB    . LEU E 5 125 ? 37.500  121.109 89.375  1.00 63.32  ? 125 LEU L CB    1 
ATOM 9411  C CG    . LEU E 5 125 ? 36.513  122.282 89.242  1.00 65.01  ? 125 LEU L CG    1 
ATOM 9412  C CD1   . LEU E 5 125 ? 36.183  122.869 90.612  1.00 66.57  ? 125 LEU L CD1   1 
ATOM 9413  C CD2   . LEU E 5 125 ? 37.071  123.353 88.295  1.00 64.79  ? 125 LEU L CD2   1 
ATOM 9414  N N     . THR E 5 126 ? 38.388  118.187 89.106  1.00 60.68  ? 126 THR L N     1 
ATOM 9415  C CA    . THR E 5 126 ? 39.274  117.082 89.460  1.00 59.74  ? 126 THR L CA    1 
ATOM 9416  C C     . THR E 5 126 ? 39.735  116.254 88.262  1.00 59.77  ? 126 THR L C     1 
ATOM 9417  O O     . THR E 5 126 ? 40.544  115.332 88.403  1.00 59.99  ? 126 THR L O     1 
ATOM 9418  C CB    . THR E 5 126 ? 38.577  116.152 90.441  1.00 58.57  ? 126 THR L CB    1 
ATOM 9419  O OG1   . THR E 5 126 ? 37.395  115.631 89.822  1.00 58.50  ? 126 THR L OG1   1 
ATOM 9420  C CG2   . THR E 5 126 ? 38.188  116.915 91.706  1.00 58.43  ? 126 THR L CG2   1 
ATOM 9421  N N     . SER E 5 127 ? 39.217  116.582 87.085  1.00 59.24  ? 127 SER L N     1 
ATOM 9422  C CA    . SER E 5 127 ? 39.585  115.873 85.869  1.00 58.63  ? 127 SER L CA    1 
ATOM 9423  C C     . SER E 5 127 ? 40.219  116.853 84.884  1.00 58.18  ? 127 SER L C     1 
ATOM 9424  O O     . SER E 5 127 ? 40.583  116.486 83.761  1.00 58.27  ? 127 SER L O     1 
ATOM 9425  C CB    . SER E 5 127 ? 38.344  115.227 85.264  1.00 58.81  ? 127 SER L CB    1 
ATOM 9426  O OG    . SER E 5 127 ? 37.594  114.568 86.272  1.00 58.59  ? 127 SER L OG    1 
ATOM 9427  N N     . GLY E 5 128 ? 40.354  118.099 85.330  1.00 56.74  ? 128 GLY L N     1 
ATOM 9428  C CA    . GLY E 5 128 ? 40.945  119.128 84.501  1.00 56.89  ? 128 GLY L CA    1 
ATOM 9429  C C     . GLY E 5 128 ? 39.919  120.125 84.004  1.00 57.13  ? 128 GLY L C     1 
ATOM 9430  O O     . GLY E 5 128 ? 40.197  121.327 83.896  1.00 57.76  ? 128 GLY L O     1 
ATOM 9431  N N     . GLY E 5 129 ? 38.726  119.632 83.689  1.00 56.78  ? 129 GLY L N     1 
ATOM 9432  C CA    . GLY E 5 129 ? 37.689  120.520 83.202  1.00 55.37  ? 129 GLY L CA    1 
ATOM 9433  C C     . GLY E 5 129 ? 37.387  121.675 84.146  1.00 53.76  ? 129 GLY L C     1 
ATOM 9434  O O     . GLY E 5 129 ? 37.240  121.492 85.358  1.00 52.75  ? 129 GLY L O     1 
ATOM 9435  N N     . ALA E 5 130 ? 37.356  122.880 83.593  1.00 52.37  ? 130 ALA L N     1 
ATOM 9436  C CA    . ALA E 5 130 ? 37.041  124.065 84.373  1.00 51.18  ? 130 ALA L CA    1 
ATOM 9437  C C     . ALA E 5 130 ? 36.143  124.904 83.482  1.00 50.12  ? 130 ALA L C     1 
ATOM 9438  O O     . ALA E 5 130 ? 36.584  125.813 82.770  1.00 50.24  ? 130 ALA L O     1 
ATOM 9439  C CB    . ALA E 5 130 ? 38.300  124.815 84.762  1.00 52.29  ? 130 ALA L CB    1 
ATOM 9440  N N     . SER E 5 131 ? 34.879  124.511 83.465  1.00 48.67  ? 131 SER L N     1 
ATOM 9441  C CA    . SER E 5 131 ? 33.880  125.179 82.664  1.00 47.94  ? 131 SER L CA    1 
ATOM 9442  C C     . SER E 5 131 ? 32.996  126.041 83.553  1.00 47.69  ? 131 SER L C     1 
ATOM 9443  O O     . SER E 5 131 ? 32.667  125.665 84.686  1.00 47.93  ? 131 SER L O     1 
ATOM 9444  C CB    . SER E 5 131 ? 33.042  124.132 81.947  1.00 47.54  ? 131 SER L CB    1 
ATOM 9445  O OG    . SER E 5 131 ? 33.858  123.037 81.571  1.00 48.26  ? 131 SER L OG    1 
ATOM 9446  N N     . VAL E 5 132 ? 32.631  127.214 83.053  1.00 46.85  ? 132 VAL L N     1 
ATOM 9447  C CA    . VAL E 5 132 ? 31.783  128.108 83.820  1.00 45.60  ? 132 VAL L CA    1 
ATOM 9448  C C     . VAL E 5 132 ? 30.643  128.579 82.951  1.00 45.01  ? 132 VAL L C     1 
ATOM 9449  O O     . VAL E 5 132 ? 30.825  128.884 81.776  1.00 44.81  ? 132 VAL L O     1 
ATOM 9450  C CB    . VAL E 5 132 ? 32.554  129.321 84.327  1.00 44.89  ? 132 VAL L CB    1 
ATOM 9451  C CG1   . VAL E 5 132 ? 31.845  129.924 85.520  1.00 44.18  ? 132 VAL L CG1   1 
ATOM 9452  C CG2   . VAL E 5 132 ? 33.959  128.923 84.693  1.00 44.82  ? 132 VAL L CG2   1 
ATOM 9453  N N     . VAL E 5 133 ? 29.460  128.645 83.538  1.00 44.95  ? 133 VAL L N     1 
ATOM 9454  C CA    . VAL E 5 133 ? 28.297  129.070 82.787  1.00 45.69  ? 133 VAL L CA    1 
ATOM 9455  C C     . VAL E 5 133 ? 27.576  130.241 83.440  1.00 45.52  ? 133 VAL L C     1 
ATOM 9456  O O     . VAL E 5 133 ? 27.695  130.487 84.642  1.00 45.83  ? 133 VAL L O     1 
ATOM 9457  C CB    . VAL E 5 133 ? 27.305  127.904 82.601  1.00 46.30  ? 133 VAL L CB    1 
ATOM 9458  C CG1   . VAL E 5 133 ? 26.673  127.528 83.943  1.00 46.74  ? 133 VAL L CG1   1 
ATOM 9459  C CG2   . VAL E 5 133 ? 26.239  128.264 81.563  1.00 45.03  ? 133 VAL L CG2   1 
ATOM 9460  N N     . CYS E 5 134 ? 26.789  130.929 82.633  1.00 45.40  ? 134 CYS L N     1 
ATOM 9461  C CA    . CYS E 5 134 ? 26.044  132.062 83.101  1.00 45.84  ? 134 CYS L CA    1 
ATOM 9462  C C     . CYS E 5 134 ? 24.709  132.103 82.382  1.00 43.48  ? 134 CYS L C     1 
ATOM 9463  O O     . CYS E 5 134 ? 24.624  132.398 81.186  1.00 43.25  ? 134 CYS L O     1 
ATOM 9464  C CB    . CYS E 5 134 ? 26.849  133.315 82.836  1.00 51.27  ? 134 CYS L CB    1 
ATOM 9465  S SG    . CYS E 5 134 ? 26.008  134.852 83.297  1.00 59.23  ? 134 CYS L SG    1 
ATOM 9466  N N     . PHE E 5 135 ? 23.662  131.786 83.125  1.00 41.10  ? 135 PHE L N     1 
ATOM 9467  C CA    . PHE E 5 135 ? 22.330  131.751 82.569  1.00 39.13  ? 135 PHE L CA    1 
ATOM 9468  C C     . PHE E 5 135 ? 21.638  133.096 82.578  1.00 38.20  ? 135 PHE L C     1 
ATOM 9469  O O     . PHE E 5 135 ? 21.426  133.705 83.621  1.00 37.62  ? 135 PHE L O     1 
ATOM 9470  C CB    . PHE E 5 135 ? 21.501  130.693 83.288  1.00 38.80  ? 135 PHE L CB    1 
ATOM 9471  C CG    . PHE E 5 135 ? 21.987  129.276 83.054  1.00 39.42  ? 135 PHE L CG    1 
ATOM 9472  C CD1   . PHE E 5 135 ? 22.134  128.775 81.759  1.00 38.98  ? 135 PHE L CD1   1 
ATOM 9473  C CD2   . PHE E 5 135 ? 22.252  128.427 84.128  1.00 38.77  ? 135 PHE L CD2   1 
ATOM 9474  C CE1   . PHE E 5 135 ? 22.530  127.447 81.537  1.00 39.59  ? 135 PHE L CE1   1 
ATOM 9475  C CE2   . PHE E 5 135 ? 22.648  127.102 83.917  1.00 38.60  ? 135 PHE L CE2   1 
ATOM 9476  C CZ    . PHE E 5 135 ? 22.785  126.613 82.616  1.00 39.04  ? 135 PHE L CZ    1 
ATOM 9477  N N     . LEU E 5 136 ? 21.330  133.560 81.377  1.00 38.11  ? 136 LEU L N     1 
ATOM 9478  C CA    . LEU E 5 136 ? 20.661  134.831 81.154  1.00 38.03  ? 136 LEU L CA    1 
ATOM 9479  C C     . LEU E 5 136 ? 19.335  134.405 80.580  1.00 38.17  ? 136 LEU L C     1 
ATOM 9480  O O     . LEU E 5 136 ? 19.272  133.895 79.456  1.00 36.95  ? 136 LEU L O     1 
ATOM 9481  C CB    . LEU E 5 136 ? 21.436  135.629 80.119  1.00 38.74  ? 136 LEU L CB    1 
ATOM 9482  C CG    . LEU E 5 136 ? 22.925  135.272 80.052  1.00 39.16  ? 136 LEU L CG    1 
ATOM 9483  C CD1   . LEU E 5 136 ? 23.588  136.069 78.956  1.00 40.49  ? 136 LEU L CD1   1 
ATOM 9484  C CD2   . LEU E 5 136 ? 23.608  135.531 81.380  1.00 37.79  ? 136 LEU L CD2   1 
ATOM 9485  N N     . ASN E 5 137 ? 18.268  134.640 81.333  1.00 39.08  ? 137 ASN L N     1 
ATOM 9486  C CA    . ASN E 5 137 ? 16.962  134.178 80.893  1.00 40.46  ? 137 ASN L CA    1 
ATOM 9487  C C     . ASN E 5 137 ? 15.816  135.137 80.936  1.00 40.63  ? 137 ASN L C     1 
ATOM 9488  O O     . ASN E 5 137 ? 15.825  136.113 81.691  1.00 39.96  ? 137 ASN L O     1 
ATOM 9489  C CB    . ASN E 5 137 ? 16.587  132.956 81.702  1.00 42.43  ? 137 ASN L CB    1 
ATOM 9490  C CG    . ASN E 5 137 ? 17.797  132.262 82.244  1.00 45.67  ? 137 ASN L CG    1 
ATOM 9491  O OD1   . ASN E 5 137 ? 18.447  131.495 81.537  1.00 46.81  ? 137 ASN L OD1   1 
ATOM 9492  N ND2   . ASN E 5 137 ? 18.189  132.626 83.462  1.00 48.87  ? 137 ASN L ND2   1 
ATOM 9493  N N     . ASN E 5 138 ? 14.788  134.756 80.176  1.00 41.40  ? 138 ASN L N     1 
ATOM 9494  C CA    . ASN E 5 138 ? 13.540  135.491 80.036  1.00 42.20  ? 138 ASN L CA    1 
ATOM 9495  C C     . ASN E 5 138 ? 13.813  136.983 79.936  1.00 43.59  ? 138 ASN L C     1 
ATOM 9496  O O     . ASN E 5 138 ? 13.919  137.662 80.955  1.00 45.11  ? 138 ASN L O     1 
ATOM 9497  C CB    . ASN E 5 138 ? 12.578  135.242 81.224  1.00 41.40  ? 138 ASN L CB    1 
ATOM 9498  C CG    . ASN E 5 138 ? 12.271  133.760 81.473  1.00 41.76  ? 138 ASN L CG    1 
ATOM 9499  O OD1   . ASN E 5 138 ? 13.172  132.922 81.540  1.00 42.73  ? 138 ASN L OD1   1 
ATOM 9500  N ND2   . ASN E 5 138 ? 10.996  133.455 81.701  1.00 39.49  ? 138 ASN L ND2   1 
ATOM 9501  N N     . PHE E 5 139 ? 14.058  137.470 78.728  1.00 43.82  ? 139 PHE L N     1 
ATOM 9502  C CA    . PHE E 5 139 ? 14.260  138.906 78.512  1.00 44.40  ? 139 PHE L CA    1 
ATOM 9503  C C     . PHE E 5 139 ? 13.558  139.208 77.212  1.00 43.55  ? 139 PHE L C     1 
ATOM 9504  O O     . PHE E 5 139 ? 13.469  138.324 76.351  1.00 43.19  ? 139 PHE L O     1 
ATOM 9505  C CB    . PHE E 5 139 ? 15.732  139.307 78.476  1.00 45.03  ? 139 PHE L CB    1 
ATOM 9506  C CG    . PHE E 5 139 ? 16.584  138.414 77.646  1.00 47.28  ? 139 PHE L CG    1 
ATOM 9507  C CD1   . PHE E 5 139 ? 16.658  138.594 76.265  1.00 47.10  ? 139 PHE L CD1   1 
ATOM 9508  C CD2   . PHE E 5 139 ? 17.346  137.412 78.255  1.00 46.42  ? 139 PHE L CD2   1 
ATOM 9509  C CE1   . PHE E 5 139 ? 17.482  137.793 75.498  1.00 49.86  ? 139 PHE L CE1   1 
ATOM 9510  C CE2   . PHE E 5 139 ? 18.176  136.602 77.510  1.00 48.44  ? 139 PHE L CE2   1 
ATOM 9511  C CZ    . PHE E 5 139 ? 18.251  136.788 76.122  1.00 50.95  ? 139 PHE L CZ    1 
ATOM 9512  N N     . TYR E 5 140 ? 13.072  140.434 77.041  1.00 42.46  ? 140 TYR L N     1 
ATOM 9513  C CA    . TYR E 5 140 ? 12.313  140.679 75.834  1.00 42.35  ? 140 TYR L CA    1 
ATOM 9514  C C     . TYR E 5 140 ? 12.931  140.809 74.471  1.00 43.57  ? 140 TYR L C     1 
ATOM 9515  O O     . TYR E 5 140 ? 12.631  140.013 73.578  1.00 45.46  ? 140 TYR L O     1 
ATOM 9516  C CB    . TYR E 5 140 ? 11.286  141.771 75.975  1.00 39.74  ? 140 TYR L CB    1 
ATOM 9517  C CG    . TYR E 5 140 ? 10.502  141.858 74.694  1.00 37.33  ? 140 TYR L CG    1 
ATOM 9518  C CD1   . TYR E 5 140 ? 9.703   140.796 74.288  1.00 35.33  ? 140 TYR L CD1   1 
ATOM 9519  C CD2   . TYR E 5 140 ? 10.646  142.939 73.829  1.00 36.57  ? 140 TYR L CD2   1 
ATOM 9520  C CE1   . TYR E 5 140 ? 9.075   140.802 73.054  1.00 34.73  ? 140 TYR L CE1   1 
ATOM 9521  C CE2   . TYR E 5 140 ? 10.016  142.953 72.586  1.00 35.44  ? 140 TYR L CE2   1 
ATOM 9522  C CZ    . TYR E 5 140 ? 9.230   141.880 72.209  1.00 34.09  ? 140 TYR L CZ    1 
ATOM 9523  O OH    . TYR E 5 140 ? 8.575   141.879 71.006  1.00 31.14  ? 140 TYR L OH    1 
ATOM 9524  N N     . PRO E 5 141 ? 13.643  141.902 74.222  1.00 43.03  ? 141 PRO L N     1 
ATOM 9525  C CA    . PRO E 5 141 ? 14.200  141.941 72.868  1.00 42.56  ? 141 PRO L CA    1 
ATOM 9526  C C     . PRO E 5 141 ? 15.299  140.897 72.802  1.00 42.68  ? 141 PRO L C     1 
ATOM 9527  O O     . PRO E 5 141 ? 16.008  140.683 73.797  1.00 42.63  ? 141 PRO L O     1 
ATOM 9528  C CB    . PRO E 5 141 ? 14.755  143.354 72.778  1.00 42.89  ? 141 PRO L CB    1 
ATOM 9529  C CG    . PRO E 5 141 ? 13.970  144.108 73.868  1.00 43.09  ? 141 PRO L CG    1 
ATOM 9530  C CD    . PRO E 5 141 ? 13.941  143.125 74.972  1.00 40.36  ? 141 PRO L CD    1 
ATOM 9531  N N     . LYS E 5 142 ? 15.368  140.150 71.705  1.00 41.80  ? 142 LYS L N     1 
ATOM 9532  C CA    . LYS E 5 142 ? 16.442  139.177 71.618  1.00 42.45  ? 142 LYS L CA    1 
ATOM 9533  C C     . LYS E 5 142 ? 17.706  140.002 71.883  1.00 43.06  ? 142 LYS L C     1 
ATOM 9534  O O     . LYS E 5 142 ? 18.493  139.678 72.772  1.00 40.82  ? 142 LYS L O     1 
ATOM 9535  C CB    . LYS E 5 142 ? 16.506  138.534 70.231  1.00 43.37  ? 142 LYS L CB    1 
ATOM 9536  C CG    . LYS E 5 142 ? 17.836  137.799 69.941  1.00 45.59  ? 142 LYS L CG    1 
ATOM 9537  C CD    . LYS E 5 142 ? 18.143  136.667 70.949  1.00 46.63  ? 142 LYS L CD    1 
ATOM 9538  C CE    . LYS E 5 142 ? 19.430  136.903 71.782  1.00 47.95  ? 142 LYS L CE    1 
ATOM 9539  N NZ    . LYS E 5 142 ? 20.738  136.741 71.066  1.00 44.70  ? 142 LYS L NZ    1 
ATOM 9540  N N     . ASP E 5 143 ? 17.776  141.151 71.203  1.00 44.64  ? 143 ASP L N     1 
ATOM 9541  C CA    . ASP E 5 143 ? 18.883  142.108 71.291  1.00 46.10  ? 143 ASP L CA    1 
ATOM 9542  C C     . ASP E 5 143 ? 19.487  142.214 72.678  1.00 45.24  ? 143 ASP L C     1 
ATOM 9543  O O     . ASP E 5 143 ? 18.857  142.730 73.601  1.00 45.93  ? 143 ASP L O     1 
ATOM 9544  C CB    . ASP E 5 143 ? 18.420  143.506 70.857  1.00 48.74  ? 143 ASP L CB    1 
ATOM 9545  C CG    . ASP E 5 143 ? 18.544  143.734 69.357  1.00 52.28  ? 143 ASP L CG    1 
ATOM 9546  O OD1   . ASP E 5 143 ? 19.625  143.453 68.785  1.00 54.91  ? 143 ASP L OD1   1 
ATOM 9547  O OD2   . ASP E 5 143 ? 17.563  144.228 68.757  1.00 53.85  ? 143 ASP L OD2   1 
ATOM 9548  N N     . ILE E 5 144 ? 20.727  141.761 72.814  1.00 43.74  ? 144 ILE L N     1 
ATOM 9549  C CA    . ILE E 5 144 ? 21.388  141.806 74.105  1.00 42.50  ? 144 ILE L CA    1 
ATOM 9550  C C     . ILE E 5 144 ? 22.814  141.323 73.990  1.00 40.77  ? 144 ILE L C     1 
ATOM 9551  O O     . ILE E 5 144 ? 23.235  140.821 72.946  1.00 39.79  ? 144 ILE L O     1 
ATOM 9552  C CB    . ILE E 5 144 ? 20.668  140.916 75.135  1.00 44.17  ? 144 ILE L CB    1 
ATOM 9553  C CG1   . ILE E 5 144 ? 21.141  141.275 76.543  1.00 45.44  ? 144 ILE L CG1   1 
ATOM 9554  C CG2   . ILE E 5 144 ? 20.901  139.426 74.820  1.00 44.66  ? 144 ILE L CG2   1 
ATOM 9555  C CD1   . ILE E 5 144 ? 20.902  140.188 77.565  1.00 48.21  ? 144 ILE L CD1   1 
ATOM 9556  N N     . ASN E 5 145 ? 23.533  141.419 75.096  1.00 39.46  ? 145 ASN L N     1 
ATOM 9557  C CA    . ASN E 5 145 ? 24.903  141.001 75.106  1.00 39.84  ? 145 ASN L CA    1 
ATOM 9558  C C     . ASN E 5 145 ? 25.483  140.684 76.451  1.00 39.66  ? 145 ASN L C     1 
ATOM 9559  O O     . ASN E 5 145 ? 25.347  141.421 77.429  1.00 38.73  ? 145 ASN L O     1 
ATOM 9560  C CB    . ASN E 5 145 ? 25.788  142.052 74.475  1.00 42.19  ? 145 ASN L CB    1 
ATOM 9561  C CG    . ASN E 5 145 ? 27.216  141.899 74.902  1.00 44.80  ? 145 ASN L CG    1 
ATOM 9562  O OD1   . ASN E 5 145 ? 27.956  141.122 74.305  1.00 47.29  ? 145 ASN L OD1   1 
ATOM 9563  N ND2   . ASN E 5 145 ? 27.576  142.522 76.031  1.00 45.77  ? 145 ASN L ND2   1 
ATOM 9564  N N     . VAL E 5 146 ? 26.364  139.713 76.387  1.00 39.92  ? 146 VAL L N     1 
ATOM 9565  C CA    . VAL E 5 146 ? 27.053  139.259 77.549  1.00 41.70  ? 146 VAL L CA    1 
ATOM 9566  C C     . VAL E 5 146 ? 28.520  139.531 77.367  1.00 41.70  ? 146 VAL L C     1 
ATOM 9567  O O     . VAL E 5 146 ? 29.044  139.492 76.261  1.00 41.31  ? 146 VAL L O     1 
ATOM 9568  C CB    . VAL E 5 146 ? 26.892  137.768 77.692  1.00 43.74  ? 146 VAL L CB    1 
ATOM 9569  C CG1   . VAL E 5 146 ? 27.345  137.071 76.394  1.00 44.67  ? 146 VAL L CG1   1 
ATOM 9570  C CG2   . VAL E 5 146 ? 27.693  137.277 78.900  1.00 45.25  ? 146 VAL L CG2   1 
ATOM 9571  N N     . ALA E 5 147 ? 29.190  139.774 78.474  1.00 42.99  ? 147 ALA L N     1 
ATOM 9572  C CA    . ALA E 5 147 ? 30.601  140.006 78.429  1.00 44.85  ? 147 ALA L CA    1 
ATOM 9573  C C     . ALA E 5 147 ? 31.207  139.125 79.484  1.00 47.55  ? 147 ALA L C     1 
ATOM 9574  O O     . ALA E 5 147 ? 30.890  139.241 80.671  1.00 47.20  ? 147 ALA L O     1 
ATOM 9575  C CB    . ALA E 5 147 ? 30.907  141.439 78.704  1.00 44.39  ? 147 ALA L CB    1 
ATOM 9576  N N     . TRP E 5 148 ? 31.942  138.128 79.019  1.00 51.22  ? 148 TRP L N     1 
ATOM 9577  C CA    . TRP E 5 148 ? 32.645  137.236 79.919  1.00 54.51  ? 148 TRP L CA    1 
ATOM 9578  C C     . TRP E 5 148 ? 33.944  137.983 80.125  1.00 55.40  ? 148 TRP L C     1 
ATOM 9579  O O     . TRP E 5 148 ? 34.576  138.412 79.157  1.00 55.50  ? 148 TRP L O     1 
ATOM 9580  C CB    . TRP E 5 148 ? 32.924  135.903 79.244  1.00 56.39  ? 148 TRP L CB    1 
ATOM 9581  C CG    . TRP E 5 148 ? 32.088  134.790 79.754  1.00 58.95  ? 148 TRP L CG    1 
ATOM 9582  C CD1   . TRP E 5 148 ? 31.171  134.064 79.051  1.00 58.30  ? 148 TRP L CD1   1 
ATOM 9583  C CD2   . TRP E 5 148 ? 32.126  134.232 81.066  1.00 59.69  ? 148 TRP L CD2   1 
ATOM 9584  N NE1   . TRP E 5 148 ? 30.637  133.075 79.844  1.00 59.29  ? 148 TRP L NE1   1 
ATOM 9585  C CE2   . TRP E 5 148 ? 31.205  133.154 81.086  1.00 59.42  ? 148 TRP L CE2   1 
ATOM 9586  C CE3   . TRP E 5 148 ? 32.851  134.528 82.225  1.00 59.40  ? 148 TRP L CE3   1 
ATOM 9587  C CZ2   . TRP E 5 148 ? 30.992  132.373 82.221  1.00 59.61  ? 148 TRP L CZ2   1 
ATOM 9588  C CZ3   . TRP E 5 148 ? 32.641  133.750 83.355  1.00 61.42  ? 148 TRP L CZ3   1 
ATOM 9589  C CH2   . TRP E 5 148 ? 31.716  132.682 83.342  1.00 61.29  ? 148 TRP L CH2   1 
ATOM 9590  N N     . ALA E 5 149 ? 34.310  138.203 81.377  1.00 57.17  ? 149 ALA L N     1 
ATOM 9591  C CA    . ALA E 5 149 ? 35.531  138.934 81.650  1.00 59.07  ? 149 ALA L CA    1 
ATOM 9592  C C     . ALA E 5 149 ? 36.050  138.645 83.039  1.00 60.76  ? 149 ALA L C     1 
ATOM 9593  O O     . ALA E 5 149 ? 35.294  138.601 84.014  1.00 62.36  ? 149 ALA L O     1 
ATOM 9594  C CB    . ALA E 5 149 ? 35.307  140.431 81.464  1.00 57.52  ? 149 ALA L CB    1 
ATOM 9595  N N     . ILE E 5 150 ? 37.346  138.393 83.110  1.00 61.94  ? 150 ILE L N     1 
ATOM 9596  C CA    . ILE E 5 150 ? 37.992  138.110 84.376  1.00 63.56  ? 150 ILE L CA    1 
ATOM 9597  C C     . ILE E 5 150 ? 38.812  139.343 84.726  1.00 63.27  ? 150 ILE L C     1 
ATOM 9598  O O     . ILE E 5 150 ? 39.181  140.102 83.816  1.00 63.87  ? 150 ILE L O     1 
ATOM 9599  C CB    . ILE E 5 150 ? 38.912  136.898 84.236  1.00 65.34  ? 150 ILE L CB    1 
ATOM 9600  C CG1   . ILE E 5 150 ? 38.146  135.756 83.571  1.00 65.69  ? 150 ILE L CG1   1 
ATOM 9601  C CG2   . ILE E 5 150 ? 39.422  136.456 85.598  1.00 65.96  ? 150 ILE L CG2   1 
ATOM 9602  C CD1   . ILE E 5 150 ? 39.032  134.622 83.129  1.00 66.79  ? 150 ILE L CD1   1 
ATOM 9603  N N     . ASP E 5 151 ? 39.053  139.539 86.032  1.00 62.07  ? 151 ASP L N     1 
ATOM 9604  C CA    . ASP E 5 151 ? 39.830  140.658 86.589  1.00 60.99  ? 151 ASP L CA    1 
ATOM 9605  C C     . ASP E 5 151 ? 40.680  141.216 85.469  1.00 60.90  ? 151 ASP L C     1 
ATOM 9606  O O     . ASP E 5 151 ? 41.647  140.588 85.037  1.00 59.08  ? 151 ASP L O     1 
ATOM 9607  C CB    . ASP E 5 151 ? 40.746  140.169 87.720  1.00 60.92  ? 151 ASP L CB    1 
ATOM 9608  C CG    . ASP E 5 151 ? 40.127  139.043 88.541  1.00 61.38  ? 151 ASP L CG    1 
ATOM 9609  O OD1   . ASP E 5 151 ? 40.752  137.958 88.658  1.00 59.72  ? 151 ASP L OD1   1 
ATOM 9610  O OD2   . ASP E 5 151 ? 39.013  139.247 89.066  1.00 61.02  ? 151 ASP L OD2   1 
ATOM 9611  N N     . GLY E 5 152 ? 40.207  142.302 84.881  1.00 61.27  ? 152 GLY L N     1 
ATOM 9612  C CA    . GLY E 5 152 ? 40.931  142.877 83.770  1.00 63.00  ? 152 GLY L CA    1 
ATOM 9613  C C     . GLY E 5 152 ? 40.087  142.817 82.514  1.00 63.74  ? 152 GLY L C     1 
ATOM 9614  O O     . GLY E 5 152 ? 40.582  142.490 81.433  1.00 63.68  ? 152 GLY L O     1 
ATOM 9615  N N     . SER E 5 153 ? 38.791  143.069 82.710  1.00 64.85  ? 153 SER L N     1 
ATOM 9616  C CA    . SER E 5 153 ? 37.739  143.130 81.678  1.00 66.30  ? 153 SER L CA    1 
ATOM 9617  C C     . SER E 5 153 ? 37.957  142.538 80.274  1.00 66.35  ? 153 SER L C     1 
ATOM 9618  O O     . SER E 5 153 ? 37.568  143.151 79.265  1.00 66.46  ? 153 SER L O     1 
ATOM 9619  C CB    . SER E 5 153 ? 37.289  144.591 81.517  1.00 66.38  ? 153 SER L CB    1 
ATOM 9620  O OG    . SER E 5 153 ? 38.251  145.351 80.795  1.00 66.97  ? 153 SER L OG    1 
ATOM 9621  N N     . ALA E 5 154 ? 38.507  141.335 80.190  1.00 66.22  ? 154 ALA L N     1 
ATOM 9622  C CA    . ALA E 5 154 ? 38.737  140.764 78.874  1.00 66.32  ? 154 ALA L CA    1 
ATOM 9623  C C     . ALA E 5 154 ? 37.804  139.619 78.562  1.00 66.05  ? 154 ALA L C     1 
ATOM 9624  O O     . ALA E 5 154 ? 37.530  138.778 79.421  1.00 66.39  ? 154 ALA L O     1 
ATOM 9625  C CB    . ALA E 5 154 ? 40.188  140.319 78.729  1.00 66.84  ? 154 ALA L CB    1 
ATOM 9626  N N     . ALA E 5 155 ? 37.288  139.618 77.335  1.00 65.59  ? 155 ALA L N     1 
ATOM 9627  C CA    . ALA E 5 155 ? 36.409  138.551 76.871  1.00 65.11  ? 155 ALA L CA    1 
ATOM 9628  C C     . ALA E 5 155 ? 37.316  137.432 76.354  1.00 64.60  ? 155 ALA L C     1 
ATOM 9629  O O     . ALA E 5 155 ? 37.366  137.151 75.148  1.00 64.06  ? 155 ALA L O     1 
ATOM 9630  C CB    . ALA E 5 155 ? 35.497  139.059 75.766  1.00 66.04  ? 155 ALA L CB    1 
ATOM 9631  N N     . ALA E 5 156 ? 38.049  136.821 77.287  1.00 63.82  ? 156 ALA L N     1 
ATOM 9632  C CA    . ALA E 5 156 ? 39.002  135.751 77.001  1.00 64.52  ? 156 ALA L CA    1 
ATOM 9633  C C     . ALA E 5 156 ? 38.507  134.698 76.010  1.00 65.49  ? 156 ALA L C     1 
ATOM 9634  O O     . ALA E 5 156 ? 37.314  134.614 75.705  1.00 64.34  ? 156 ALA L O     1 
ATOM 9635  C CB    . ALA E 5 156 ? 39.458  135.083 78.313  1.00 63.01  ? 156 ALA L CB    1 
ATOM 9636  N N     . ASN E 5 157 ? 39.451  133.935 75.467  1.00 67.83  ? 157 ASN L N     1 
ATOM 9637  C CA    . ASN E 5 157 ? 39.139  132.869 74.521  1.00 69.52  ? 157 ASN L CA    1 
ATOM 9638  C C     . ASN E 5 157 ? 38.567  131.675 75.293  1.00 68.96  ? 157 ASN L C     1 
ATOM 9639  O O     . ASN E 5 157 ? 39.206  131.157 76.220  1.00 69.13  ? 157 ASN L O     1 
ATOM 9640  C CB    . ASN E 5 157 ? 40.395  132.458 73.727  1.00 71.90  ? 157 ASN L CB    1 
ATOM 9641  C CG    . ASN E 5 157 ? 40.505  133.175 72.368  1.00 74.64  ? 157 ASN L CG    1 
ATOM 9642  O OD1   . ASN E 5 157 ? 39.661  134.010 72.021  1.00 76.78  ? 157 ASN L OD1   1 
ATOM 9643  N ND2   . ASN E 5 157 ? 41.538  132.831 71.590  1.00 75.18  ? 157 ASN L ND2   1 
ATOM 9644  N N     . GLY E 5 158 ? 37.346  131.278 74.925  1.00 68.06  ? 158 GLY L N     1 
ATOM 9645  C CA    . GLY E 5 158 ? 36.662  130.164 75.579  1.00 66.51  ? 158 GLY L CA    1 
ATOM 9646  C C     . GLY E 5 158 ? 35.192  130.483 75.836  1.00 64.76  ? 158 GLY L C     1 
ATOM 9647  O O     . GLY E 5 158 ? 34.569  129.982 76.788  1.00 64.28  ? 158 GLY L O     1 
ATOM 9648  N N     . VAL E 5 159 ? 34.640  131.304 74.945  1.00 62.04  ? 159 VAL L N     1 
ATOM 9649  C CA    . VAL E 5 159 ? 33.267  131.762 75.029  1.00 58.66  ? 159 VAL L CA    1 
ATOM 9650  C C     . VAL E 5 159 ? 32.351  131.031 74.083  1.00 56.96  ? 159 VAL L C     1 
ATOM 9651  O O     . VAL E 5 159 ? 32.388  131.249 72.874  1.00 56.76  ? 159 VAL L O     1 
ATOM 9652  C CB    . VAL E 5 159 ? 33.170  133.255 74.685  1.00 58.50  ? 159 VAL L CB    1 
ATOM 9653  C CG1   . VAL E 5 159 ? 31.767  133.759 74.926  1.00 59.65  ? 159 VAL L CG1   1 
ATOM 9654  C CG2   . VAL E 5 159 ? 34.174  134.049 75.490  1.00 58.77  ? 159 VAL L CG2   1 
ATOM 9655  N N     . LEU E 5 160 ? 31.535  130.149 74.635  1.00 55.29  ? 160 LEU L N     1 
ATOM 9656  C CA    . LEU E 5 160 ? 30.577  129.426 73.827  1.00 53.72  ? 160 LEU L CA    1 
ATOM 9657  C C     . LEU E 5 160 ? 29.231  129.808 74.371  1.00 52.35  ? 160 LEU L C     1 
ATOM 9658  O O     . LEU E 5 160 ? 29.069  129.920 75.582  1.00 50.50  ? 160 LEU L O     1 
ATOM 9659  C CB    . LEU E 5 160 ? 30.804  127.928 73.920  1.00 55.41  ? 160 LEU L CB    1 
ATOM 9660  C CG    . LEU E 5 160 ? 31.723  127.402 72.814  1.00 56.96  ? 160 LEU L CG    1 
ATOM 9661  C CD1   . LEU E 5 160 ? 33.133  127.966 72.960  1.00 56.79  ? 160 LEU L CD1   1 
ATOM 9662  C CD2   . LEU E 5 160 ? 31.734  125.882 72.858  1.00 58.51  ? 160 LEU L CD2   1 
ATOM 9663  N N     . ASN E 5 161 ? 28.283  130.070 73.475  1.00 52.52  ? 161 ASN L N     1 
ATOM 9664  C CA    . ASN E 5 161 ? 26.940  130.493 73.887  1.00 54.00  ? 161 ASN L CA    1 
ATOM 9665  C C     . ASN E 5 161 ? 25.877  130.490 72.796  1.00 53.66  ? 161 ASN L C     1 
ATOM 9666  O O     . ASN E 5 161 ? 26.164  130.834 71.651  1.00 55.30  ? 161 ASN L O     1 
ATOM 9667  C CB    . ASN E 5 161 ? 27.003  131.906 74.477  1.00 55.56  ? 161 ASN L CB    1 
ATOM 9668  C CG    . ASN E 5 161 ? 28.090  132.763 73.844  1.00 55.78  ? 161 ASN L CG    1 
ATOM 9669  O OD1   . ASN E 5 161 ? 29.271  132.610 74.161  1.00 55.09  ? 161 ASN L OD1   1 
ATOM 9670  N ND2   . ASN E 5 161 ? 27.697  133.665 72.949  1.00 56.35  ? 161 ASN L ND2   1 
ATOM 9671  N N     . SER E 5 162 ? 24.640  130.150 73.167  1.00 53.15  ? 162 SER L N     1 
ATOM 9672  C CA    . SER E 5 162 ? 23.518  130.132 72.218  1.00 53.00  ? 162 SER L CA    1 
ATOM 9673  C C     . SER E 5 162 ? 22.229  130.578 72.890  1.00 52.62  ? 162 SER L C     1 
ATOM 9674  O O     . SER E 5 162 ? 22.059  130.424 74.103  1.00 53.48  ? 162 SER L O     1 
ATOM 9675  C CB    . SER E 5 162 ? 23.297  128.739 71.608  1.00 54.01  ? 162 SER L CB    1 
ATOM 9676  O OG    . SER E 5 162 ? 22.461  127.926 72.423  1.00 53.79  ? 162 SER L OG    1 
ATOM 9677  N N     . TRP E 5 163 ? 21.322  131.123 72.088  1.00 51.40  ? 163 TRP L N     1 
ATOM 9678  C CA    . TRP E 5 163 ? 20.038  131.591 72.587  1.00 49.53  ? 163 TRP L CA    1 
ATOM 9679  C C     . TRP E 5 163 ? 18.940  130.794 71.952  1.00 47.78  ? 163 TRP L C     1 
ATOM 9680  O O     . TRP E 5 163 ? 19.046  130.299 70.826  1.00 46.64  ? 163 TRP L O     1 
ATOM 9681  C CB    . TRP E 5 163 ? 19.820  133.080 72.309  1.00 51.54  ? 163 TRP L CB    1 
ATOM 9682  C CG    . TRP E 5 163 ? 20.511  133.499 71.085  1.00 53.82  ? 163 TRP L CG    1 
ATOM 9683  C CD1   . TRP E 5 163 ? 19.994  133.544 69.821  1.00 54.57  ? 163 TRP L CD1   1 
ATOM 9684  C CD2   . TRP E 5 163 ? 21.908  133.773 70.967  1.00 54.78  ? 163 TRP L CD2   1 
ATOM 9685  N NE1   . TRP E 5 163 ? 20.995  133.805 68.915  1.00 55.79  ? 163 TRP L NE1   1 
ATOM 9686  C CE2   . TRP E 5 163 ? 22.182  133.951 69.591  1.00 56.96  ? 163 TRP L CE2   1 
ATOM 9687  C CE3   . TRP E 5 163 ? 22.964  133.873 71.891  1.00 55.76  ? 163 TRP L CE3   1 
ATOM 9688  C CZ2   . TRP E 5 163 ? 23.476  134.222 69.110  1.00 58.00  ? 163 TRP L CZ2   1 
ATOM 9689  C CZ3   . TRP E 5 163 ? 24.248  134.140 71.420  1.00 56.80  ? 163 TRP L CZ3   1 
ATOM 9690  C CH2   . TRP E 5 163 ? 24.494  134.312 70.037  1.00 57.69  ? 163 TRP L CH2   1 
ATOM 9691  N N     . THR E 5 164 ? 17.859  130.727 72.699  1.00 46.22  ? 164 THR L N     1 
ATOM 9692  C CA    . THR E 5 164 ? 16.677  129.995 72.328  1.00 45.79  ? 164 THR L CA    1 
ATOM 9693  C C     . THR E 5 164 ? 15.830  130.751 71.326  1.00 44.67  ? 164 THR L C     1 
ATOM 9694  O O     . THR E 5 164 ? 16.257  131.764 70.778  1.00 44.46  ? 164 THR L O     1 
ATOM 9695  C CB    . THR E 5 164 ? 15.857  129.768 73.587  1.00 46.29  ? 164 THR L CB    1 
ATOM 9696  O OG1   . THR E 5 164 ? 15.668  131.032 74.247  1.00 46.97  ? 164 THR L OG1   1 
ATOM 9697  C CG2   . THR E 5 164 ? 16.600  128.820 74.531  1.00 46.03  ? 164 THR L CG2   1 
ATOM 9698  N N     . ASP E 5 165 ? 14.650  130.204 71.055  1.00 43.88  ? 165 ASP L N     1 
ATOM 9699  C CA    . ASP E 5 165 ? 13.685  130.823 70.161  1.00 43.48  ? 165 ASP L CA    1 
ATOM 9700  C C     . ASP E 5 165 ? 12.728  131.568 71.064  1.00 41.27  ? 165 ASP L C     1 
ATOM 9701  O O     . ASP E 5 165 ? 12.858  131.539 72.284  1.00 39.70  ? 165 ASP L O     1 
ATOM 9702  C CB    . ASP E 5 165 ? 12.892  129.759 69.402  1.00 48.00  ? 165 ASP L CB    1 
ATOM 9703  C CG    . ASP E 5 165 ? 13.265  129.684 67.932  1.00 52.15  ? 165 ASP L CG    1 
ATOM 9704  O OD1   . ASP E 5 165 ? 14.470  129.499 67.638  1.00 55.69  ? 165 ASP L OD1   1 
ATOM 9705  O OD2   . ASP E 5 165 ? 12.348  129.786 67.075  1.00 54.35  ? 165 ASP L OD2   1 
ATOM 9706  N N     . GLN E 5 166 ? 11.753  132.235 70.475  1.00 41.20  ? 166 GLN L N     1 
ATOM 9707  C CA    . GLN E 5 166 ? 10.793  132.944 71.291  1.00 42.06  ? 166 GLN L CA    1 
ATOM 9708  C C     . GLN E 5 166 ? 9.942   131.878 71.938  1.00 41.36  ? 166 GLN L C     1 
ATOM 9709  O O     . GLN E 5 166 ? 9.249   131.135 71.238  1.00 41.90  ? 166 GLN L O     1 
ATOM 9710  C CB    . GLN E 5 166 ? 9.918   133.873 70.438  1.00 45.04  ? 166 GLN L CB    1 
ATOM 9711  C CG    . GLN E 5 166 ? 9.066   134.864 71.254  1.00 46.98  ? 166 GLN L CG    1 
ATOM 9712  C CD    . GLN E 5 166 ? 8.457   135.999 70.412  1.00 47.95  ? 166 GLN L CD    1 
ATOM 9713  O OE1   . GLN E 5 166 ? 8.365   135.903 69.184  1.00 47.48  ? 166 GLN L OE1   1 
ATOM 9714  N NE2   . GLN E 5 166 ? 8.034   137.076 71.081  1.00 46.17  ? 166 GLN L NE2   1 
ATOM 9715  N N     . ASP E 5 167 ? 10.107  131.713 73.248  1.00 40.23  ? 167 ASP L N     1 
ATOM 9716  C CA    . ASP E 5 167 ? 9.302   130.754 73.996  1.00 40.16  ? 167 ASP L CA    1 
ATOM 9717  C C     . ASP E 5 167 ? 7.866   131.123 73.658  1.00 39.93  ? 167 ASP L C     1 
ATOM 9718  O O     . ASP E 5 167 ? 7.371   132.145 74.124  1.00 40.77  ? 167 ASP L O     1 
ATOM 9719  C CB    . ASP E 5 167 ? 9.517   130.940 75.500  1.00 40.65  ? 167 ASP L CB    1 
ATOM 9720  C CG    . ASP E 5 167 ? 8.502   130.172 76.343  1.00 41.88  ? 167 ASP L CG    1 
ATOM 9721  O OD1   . ASP E 5 167 ? 7.756   129.328 75.797  1.00 42.23  ? 167 ASP L OD1   1 
ATOM 9722  O OD2   . ASP E 5 167 ? 8.458   130.404 77.565  1.00 43.03  ? 167 ASP L OD2   1 
ATOM 9723  N N     . SER E 5 168 ? 7.190   130.289 72.878  1.00 38.66  ? 168 SER L N     1 
ATOM 9724  C CA    . SER E 5 168 ? 5.824   130.592 72.482  1.00 38.02  ? 168 SER L CA    1 
ATOM 9725  C C     . SER E 5 168 ? 4.899   130.842 73.665  1.00 38.13  ? 168 SER L C     1 
ATOM 9726  O O     . SER E 5 168 ? 3.714   131.116 73.472  1.00 39.42  ? 168 SER L O     1 
ATOM 9727  C CB    . SER E 5 168 ? 5.275   129.498 71.567  1.00 37.23  ? 168 SER L CB    1 
ATOM 9728  O OG    . SER E 5 168 ? 6.000   128.291 71.747  1.00 37.60  ? 168 SER L OG    1 
ATOM 9729  N N     . LYS E 5 169 ? 5.448   130.761 74.881  1.00 37.66  ? 169 LYS L N     1 
ATOM 9730  C CA    . LYS E 5 169 ? 4.681   131.004 76.108  1.00 38.09  ? 169 LYS L CA    1 
ATOM 9731  C C     . LYS E 5 169 ? 4.759   132.453 76.573  1.00 36.48  ? 169 LYS L C     1 
ATOM 9732  O O     . LYS E 5 169 ? 3.810   133.224 76.378  1.00 36.19  ? 169 LYS L O     1 
ATOM 9733  C CB    . LYS E 5 169 ? 5.127   130.086 77.254  1.00 40.68  ? 169 LYS L CB    1 
ATOM 9734  C CG    . LYS E 5 169 ? 4.850   128.599 77.040  1.00 46.23  ? 169 LYS L CG    1 
ATOM 9735  C CD    . LYS E 5 169 ? 3.660   128.371 76.106  1.00 49.53  ? 169 LYS L CD    1 
ATOM 9736  C CE    . LYS E 5 169 ? 4.085   127.563 74.868  1.00 53.27  ? 169 LYS L CE    1 
ATOM 9737  N NZ    . LYS E 5 169 ? 5.416   127.983 74.278  1.00 53.61  ? 169 LYS L NZ    1 
ATOM 9738  N N     . ASP E 5 170 ? 5.872   132.813 77.214  1.00 33.27  ? 170 ASP L N     1 
ATOM 9739  C CA    . ASP E 5 170 ? 6.053   134.178 77.698  1.00 31.21  ? 170 ASP L CA    1 
ATOM 9740  C C     . ASP E 5 170 ? 6.742   135.081 76.665  1.00 29.95  ? 170 ASP L C     1 
ATOM 9741  O O     . ASP E 5 170 ? 7.217   136.180 76.969  1.00 28.85  ? 170 ASP L O     1 
ATOM 9742  C CB    . ASP E 5 170 ? 6.822   134.169 79.007  1.00 30.12  ? 170 ASP L CB    1 
ATOM 9743  C CG    . ASP E 5 170 ? 8.245   133.737 78.840  1.00 31.57  ? 170 ASP L CG    1 
ATOM 9744  O OD1   . ASP E 5 170 ? 8.661   133.375 77.708  1.00 29.64  ? 170 ASP L OD1   1 
ATOM 9745  O OD2   . ASP E 5 170 ? 8.948   133.777 79.871  1.00 33.12  ? 170 ASP L OD2   1 
ATOM 9746  N N     . SER E 5 171 ? 6.852   134.559 75.451  1.00 29.19  ? 171 SER L N     1 
ATOM 9747  C CA    . SER E 5 171 ? 7.443   135.272 74.333  1.00 27.25  ? 171 SER L CA    1 
ATOM 9748  C C     . SER E 5 171 ? 8.787   135.898 74.635  1.00 25.39  ? 171 SER L C     1 
ATOM 9749  O O     . SER E 5 171 ? 9.277   136.697 73.857  1.00 24.81  ? 171 SER L O     1 
ATOM 9750  C CB    . SER E 5 171 ? 6.467   136.330 73.811  1.00 27.68  ? 171 SER L CB    1 
ATOM 9751  O OG    . SER E 5 171 ? 5.255   135.734 73.373  1.00 27.65  ? 171 SER L OG    1 
ATOM 9752  N N     . THR E 5 172 ? 9.382   135.554 75.767  1.00 23.85  ? 172 THR L N     1 
ATOM 9753  C CA    . THR E 5 172 ? 10.683  136.114 76.087  1.00 24.92  ? 172 THR L CA    1 
ATOM 9754  C C     . THR E 5 172 ? 11.729  135.255 75.380  1.00 23.79  ? 172 THR L C     1 
ATOM 9755  O O     . THR E 5 172 ? 11.410  134.572 74.409  1.00 23.81  ? 172 THR L O     1 
ATOM 9756  C CB    . THR E 5 172 ? 10.940  136.147 77.617  1.00 25.64  ? 172 THR L CB    1 
ATOM 9757  O OG1   . THR E 5 172 ? 11.150  134.817 78.112  1.00 26.90  ? 172 THR L OG1   1 
ATOM 9758  C CG2   . THR E 5 172 ? 9.757   136.782 78.347  1.00 25.05  ? 172 THR L CG2   1 
ATOM 9759  N N     . TYR E 5 173 ? 12.974  135.319 75.844  1.00 23.87  ? 173 TYR L N     1 
ATOM 9760  C CA    . TYR E 5 173 ? 14.073  134.535 75.278  1.00 24.68  ? 173 TYR L CA    1 
ATOM 9761  C C     . TYR E 5 173 ? 15.104  134.314 76.368  1.00 25.00  ? 173 TYR L C     1 
ATOM 9762  O O     . TYR E 5 173 ? 14.970  134.834 77.477  1.00 24.96  ? 173 TYR L O     1 
ATOM 9763  C CB    . TYR E 5 173 ? 14.761  135.288 74.137  1.00 26.01  ? 173 TYR L CB    1 
ATOM 9764  C CG    . TYR E 5 173 ? 13.950  135.464 72.870  1.00 27.38  ? 173 TYR L CG    1 
ATOM 9765  C CD1   . TYR E 5 173 ? 13.056  136.522 72.729  1.00 28.27  ? 173 TYR L CD1   1 
ATOM 9766  C CD2   . TYR E 5 173 ? 14.116  134.604 71.793  1.00 27.26  ? 173 TYR L CD2   1 
ATOM 9767  C CE1   . TYR E 5 173 ? 12.349  136.722 71.544  1.00 29.11  ? 173 TYR L CE1   1 
ATOM 9768  C CE2   . TYR E 5 173 ? 13.420  134.794 70.608  1.00 28.07  ? 173 TYR L CE2   1 
ATOM 9769  C CZ    . TYR E 5 173 ? 12.535  135.854 70.486  1.00 29.28  ? 173 TYR L CZ    1 
ATOM 9770  O OH    . TYR E 5 173 ? 11.835  136.033 69.308  1.00 29.57  ? 173 TYR L OH    1 
ATOM 9771  N N     . SER E 5 174 ? 16.156  133.572 76.040  1.00 26.54  ? 174 SER L N     1 
ATOM 9772  C CA    . SER E 5 174 ? 17.240  133.311 76.993  1.00 29.79  ? 174 SER L CA    1 
ATOM 9773  C C     . SER E 5 174 ? 18.473  132.697 76.352  1.00 31.65  ? 174 SER L C     1 
ATOM 9774  O O     . SER E 5 174 ? 18.379  131.886 75.431  1.00 32.64  ? 174 SER L O     1 
ATOM 9775  C CB    . SER E 5 174 ? 16.773  132.448 78.164  1.00 28.17  ? 174 SER L CB    1 
ATOM 9776  O OG    . SER E 5 174 ? 15.573  131.775 77.855  1.00 28.53  ? 174 SER L OG    1 
ATOM 9777  N N     . MET E 5 175 ? 19.639  133.111 76.825  1.00 33.74  ? 175 MET L N     1 
ATOM 9778  C CA    . MET E 5 175 ? 20.873  132.594 76.273  1.00 36.83  ? 175 MET L CA    1 
ATOM 9779  C C     . MET E 5 175 ? 21.754  132.126 77.390  1.00 38.05  ? 175 MET L C     1 
ATOM 9780  O O     . MET E 5 175 ? 21.461  132.351 78.563  1.00 38.88  ? 175 MET L O     1 
ATOM 9781  C CB    . MET E 5 175 ? 21.608  133.660 75.458  1.00 40.73  ? 175 MET L CB    1 
ATOM 9782  C CG    . MET E 5 175 ? 22.898  134.168 76.105  1.00 44.38  ? 175 MET L CG    1 
ATOM 9783  S SD    . MET E 5 175 ? 23.927  135.105 75.003  1.00 49.15  ? 175 MET L SD    1 
ATOM 9784  C CE    . MET E 5 175 ? 23.413  136.840 75.443  1.00 47.18  ? 175 MET L CE    1 
ATOM 9785  N N     . SER E 5 176 ? 22.899  131.577 77.014  1.00 39.55  ? 176 SER L N     1 
ATOM 9786  C CA    . SER E 5 176 ? 23.812  131.068 77.998  1.00 42.21  ? 176 SER L CA    1 
ATOM 9787  C C     . SER E 5 176 ? 25.200  130.797 77.453  1.00 43.03  ? 176 SER L C     1 
ATOM 9788  O O     . SER E 5 176 ? 25.423  129.896 76.639  1.00 41.33  ? 176 SER L O     1 
ATOM 9789  C CB    . SER E 5 176 ? 23.211  129.807 78.602  1.00 44.13  ? 176 SER L CB    1 
ATOM 9790  O OG    . SER E 5 176 ? 22.445  129.125 77.618  1.00 45.58  ? 176 SER L OG    1 
ATOM 9791  N N     . SER E 5 177 ? 26.135  131.596 77.939  1.00 44.69  ? 177 SER L N     1 
ATOM 9792  C CA    . SER E 5 177 ? 27.523  131.479 77.548  1.00 47.16  ? 177 SER L CA    1 
ATOM 9793  C C     . SER E 5 177 ? 28.271  130.577 78.507  1.00 47.29  ? 177 SER L C     1 
ATOM 9794  O O     . SER E 5 177 ? 27.892  130.427 79.672  1.00 47.36  ? 177 SER L O     1 
ATOM 9795  C CB    . SER E 5 177 ? 28.167  132.856 77.520  1.00 47.44  ? 177 SER L CB    1 
ATOM 9796  O OG    . SER E 5 177 ? 27.915  133.527 78.742  1.00 50.30  ? 177 SER L OG    1 
ATOM 9797  N N     . THR E 5 178 ? 29.365  130.009 78.024  1.00 48.29  ? 178 THR L N     1 
ATOM 9798  C CA    . THR E 5 178 ? 30.146  129.121 78.855  1.00 50.15  ? 178 THR L CA    1 
ATOM 9799  C C     . THR E 5 178 ? 31.620  129.395 78.704  1.00 51.23  ? 178 THR L C     1 
ATOM 9800  O O     . THR E 5 178 ? 32.182  129.328 77.604  1.00 51.19  ? 178 THR L O     1 
ATOM 9801  C CB    . THR E 5 178 ? 29.891  127.642 78.521  1.00 50.86  ? 178 THR L CB    1 
ATOM 9802  O OG1   . THR E 5 178 ? 28.491  127.431 78.289  1.00 51.44  ? 178 THR L OG1   1 
ATOM 9803  C CG2   . THR E 5 178 ? 30.355  126.762 79.680  1.00 49.45  ? 178 THR L CG2   1 
ATOM 9804  N N     . LEU E 5 179 ? 32.243  129.712 79.828  1.00 52.31  ? 179 LEU L N     1 
ATOM 9805  C CA    . LEU E 5 179 ? 33.653  129.983 79.831  1.00 52.74  ? 179 LEU L CA    1 
ATOM 9806  C C     . LEU E 5 179 ? 34.381  128.685 80.060  1.00 53.04  ? 179 LEU L C     1 
ATOM 9807  O O     . LEU E 5 179 ? 34.041  127.907 80.950  1.00 51.49  ? 179 LEU L O     1 
ATOM 9808  C CB    . LEU E 5 179 ? 34.015  130.995 80.904  1.00 52.86  ? 179 LEU L CB    1 
ATOM 9809  C CG    . LEU E 5 179 ? 35.267  131.762 80.492  1.00 53.68  ? 179 LEU L CG    1 
ATOM 9810  C CD1   . LEU E 5 179 ? 35.052  132.375 79.111  1.00 52.51  ? 179 LEU L CD1   1 
ATOM 9811  C CD2   . LEU E 5 179 ? 35.584  132.832 81.511  1.00 55.56  ? 179 LEU L CD2   1 
ATOM 9812  N N     . THR E 5 180 ? 35.390  128.460 79.237  1.00 54.64  ? 180 THR L N     1 
ATOM 9813  C CA    . THR E 5 180 ? 36.171  127.248 79.320  1.00 56.80  ? 180 THR L CA    1 
ATOM 9814  C C     . THR E 5 180 ? 37.650  127.570 79.464  1.00 58.36  ? 180 THR L C     1 
ATOM 9815  O O     . THR E 5 180 ? 38.287  128.075 78.530  1.00 59.45  ? 180 THR L O     1 
ATOM 9816  C CB    . THR E 5 180 ? 35.985  126.419 78.058  1.00 56.94  ? 180 THR L CB    1 
ATOM 9817  O OG1   . THR E 5 180 ? 34.670  126.646 77.536  1.00 57.28  ? 180 THR L OG1   1 
ATOM 9818  C CG2   . THR E 5 180 ? 36.168  124.947 78.369  1.00 57.48  ? 180 THR L CG2   1 
ATOM 9819  N N     . LEU E 5 181 ? 38.193  127.279 80.638  1.00 58.52  ? 181 LEU L N     1 
ATOM 9820  C CA    . LEU E 5 181 ? 39.601  127.521 80.906  1.00 59.44  ? 181 LEU L CA    1 
ATOM 9821  C C     . LEU E 5 181 ? 40.155  126.296 81.599  1.00 60.28  ? 181 LEU L C     1 
ATOM 9822  O O     . LEU E 5 181 ? 39.390  125.484 82.113  1.00 61.03  ? 181 LEU L O     1 
ATOM 9823  C CB    . LEU E 5 181 ? 39.752  128.730 81.817  1.00 60.85  ? 181 LEU L CB    1 
ATOM 9824  C CG    . LEU E 5 181 ? 39.195  130.021 81.221  1.00 61.78  ? 181 LEU L CG    1 
ATOM 9825  C CD1   . LEU E 5 181 ? 38.902  130.994 82.340  1.00 62.99  ? 181 LEU L CD1   1 
ATOM 9826  C CD2   . LEU E 5 181 ? 40.169  130.614 80.189  1.00 63.18  ? 181 LEU L CD2   1 
ATOM 9827  N N     . THR E 5 182 ? 41.475  126.131 81.573  1.00 60.66  ? 182 THR L N     1 
ATOM 9828  C CA    . THR E 5 182 ? 42.094  124.989 82.245  1.00 60.98  ? 182 THR L CA    1 
ATOM 9829  C C     . THR E 5 182 ? 42.079  125.240 83.743  1.00 61.90  ? 182 THR L C     1 
ATOM 9830  O O     . THR E 5 182 ? 42.029  126.394 84.180  1.00 60.73  ? 182 THR L O     1 
ATOM 9831  C CB    . THR E 5 182 ? 43.556  124.781 81.827  1.00 60.13  ? 182 THR L CB    1 
ATOM 9832  O OG1   . THR E 5 182 ? 44.255  126.034 81.875  1.00 60.88  ? 182 THR L OG1   1 
ATOM 9833  C CG2   . THR E 5 182 ? 43.632  124.174 80.442  1.00 59.03  ? 182 THR L CG2   1 
ATOM 9834  N N     . ALA E 5 183 ? 42.115  124.160 84.522  1.00 63.63  ? 183 ALA L N     1 
ATOM 9835  C CA    . ALA E 5 183 ? 42.118  124.259 85.985  1.00 65.30  ? 183 ALA L CA    1 
ATOM 9836  C C     . ALA E 5 183 ? 43.282  125.145 86.413  1.00 65.88  ? 183 ALA L C     1 
ATOM 9837  O O     . ALA E 5 183 ? 43.192  125.891 87.394  1.00 65.62  ? 183 ALA L O     1 
ATOM 9838  C CB    . ALA E 5 183 ? 42.252  122.868 86.619  1.00 64.28  ? 183 ALA L CB    1 
ATOM 9839  N N     . ASP E 5 184 ? 44.364  125.061 85.641  1.00 66.71  ? 184 ASP L N     1 
ATOM 9840  C CA    . ASP E 5 184 ? 45.563  125.843 85.879  1.00 67.10  ? 184 ASP L CA    1 
ATOM 9841  C C     . ASP E 5 184 ? 45.147  127.308 85.899  1.00 66.23  ? 184 ASP L C     1 
ATOM 9842  O O     . ASP E 5 184 ? 45.571  128.067 86.775  1.00 66.48  ? 184 ASP L O     1 
ATOM 9843  C CB    . ASP E 5 184 ? 46.591  125.575 84.771  1.00 69.08  ? 184 ASP L CB    1 
ATOM 9844  C CG    . ASP E 5 184 ? 47.039  124.113 84.727  1.00 70.38  ? 184 ASP L CG    1 
ATOM 9845  O OD1   . ASP E 5 184 ? 46.427  123.327 83.965  1.00 71.64  ? 184 ASP L OD1   1 
ATOM 9846  O OD2   . ASP E 5 184 ? 47.993  123.754 85.462  1.00 70.59  ? 184 ASP L OD2   1 
ATOM 9847  N N     . GLU E 5 185 ? 44.261  127.676 84.974  1.00 65.01  ? 185 GLU L N     1 
ATOM 9848  C CA    . GLU E 5 185 ? 43.764  129.047 84.895  1.00 64.70  ? 185 GLU L CA    1 
ATOM 9849  C C     . GLU E 5 185 ? 42.690  129.310 85.963  1.00 63.17  ? 185 GLU L C     1 
ATOM 9850  O O     . GLU E 5 185 ? 42.697  130.368 86.609  1.00 62.06  ? 185 GLU L O     1 
ATOM 9851  C CB    . GLU E 5 185 ? 43.220  129.362 83.493  1.00 66.09  ? 185 GLU L CB    1 
ATOM 9852  C CG    . GLU E 5 185 ? 43.483  130.809 83.039  1.00 66.63  ? 185 GLU L CG    1 
ATOM 9853  C CD    . GLU E 5 185 ? 43.040  131.849 84.068  1.00 66.92  ? 185 GLU L CD    1 
ATOM 9854  O OE1   . GLU E 5 185 ? 41.814  132.064 84.198  1.00 67.00  ? 185 GLU L OE1   1 
ATOM 9855  O OE2   . GLU E 5 185 ? 43.911  132.431 84.757  1.00 66.29  ? 185 GLU L OE2   1 
ATOM 9856  N N     . TYR E 5 186 ? 41.771  128.357 86.142  1.00 61.44  ? 186 TYR L N     1 
ATOM 9857  C CA    . TYR E 5 186 ? 40.727  128.495 87.157  1.00 59.25  ? 186 TYR L CA    1 
ATOM 9858  C C     . TYR E 5 186 ? 41.410  128.792 88.482  1.00 58.81  ? 186 TYR L C     1 
ATOM 9859  O O     . TYR E 5 186 ? 40.856  129.456 89.352  1.00 57.83  ? 186 TYR L O     1 
ATOM 9860  C CB    . TYR E 5 186 ? 39.895  127.220 87.303  1.00 56.77  ? 186 TYR L CB    1 
ATOM 9861  C CG    . TYR E 5 186 ? 38.876  127.300 88.426  1.00 55.60  ? 186 TYR L CG    1 
ATOM 9862  C CD1   . TYR E 5 186 ? 37.722  128.071 88.291  1.00 54.53  ? 186 TYR L CD1   1 
ATOM 9863  C CD2   . TYR E 5 186 ? 39.070  126.615 89.624  1.00 54.06  ? 186 TYR L CD2   1 
ATOM 9864  C CE1   . TYR E 5 186 ? 36.789  128.151 89.321  1.00 53.28  ? 186 TYR L CE1   1 
ATOM 9865  C CE2   . TYR E 5 186 ? 38.144  126.691 90.657  1.00 52.03  ? 186 TYR L CE2   1 
ATOM 9866  C CZ    . TYR E 5 186 ? 37.005  127.456 90.497  1.00 52.44  ? 186 TYR L CZ    1 
ATOM 9867  O OH    . TYR E 5 186 ? 36.065  127.501 91.500  1.00 50.42  ? 186 TYR L OH    1 
ATOM 9868  N N     . GLU E 5 187 ? 42.617  128.265 88.625  1.00 59.08  ? 187 GLU L N     1 
ATOM 9869  C CA    . GLU E 5 187 ? 43.408  128.485 89.814  1.00 59.46  ? 187 GLU L CA    1 
ATOM 9870  C C     . GLU E 5 187 ? 44.069  129.866 89.728  1.00 60.17  ? 187 GLU L C     1 
ATOM 9871  O O     . GLU E 5 187 ? 43.969  130.671 90.658  1.00 60.17  ? 187 GLU L O     1 
ATOM 9872  C CB    . GLU E 5 187 ? 44.462  127.379 89.950  1.00 58.68  ? 187 GLU L CB    1 
ATOM 9873  C CG    . GLU E 5 187 ? 44.060  126.224 90.873  1.00 58.56  ? 187 GLU L CG    1 
ATOM 9874  C CD    . GLU E 5 187 ? 42.762  125.544 90.470  1.00 57.96  ? 187 GLU L CD    1 
ATOM 9875  O OE1   . GLU E 5 187 ? 41.686  126.048 90.851  1.00 57.41  ? 187 GLU L OE1   1 
ATOM 9876  O OE2   . GLU E 5 187 ? 42.819  124.494 89.794  1.00 56.56  ? 187 GLU L OE2   1 
ATOM 9877  N N     . ALA E 5 188 ? 44.679  130.162 88.582  1.00 60.87  ? 188 ALA L N     1 
ATOM 9878  C CA    . ALA E 5 188 ? 45.377  131.433 88.376  1.00 60.82  ? 188 ALA L CA    1 
ATOM 9879  C C     . ALA E 5 188 ? 44.516  132.684 88.572  1.00 60.31  ? 188 ALA L C     1 
ATOM 9880  O O     . ALA E 5 188 ? 44.688  133.413 89.555  1.00 60.19  ? 188 ALA L O     1 
ATOM 9881  C CB    . ALA E 5 188 ? 46.049  131.447 87.006  1.00 62.31  ? 188 ALA L CB    1 
ATOM 9882  N N     . ALA E 5 189 ? 43.600  132.936 87.640  1.00 59.58  ? 189 ALA L N     1 
ATOM 9883  C CA    . ALA E 5 189 ? 42.724  134.102 87.741  1.00 59.10  ? 189 ALA L CA    1 
ATOM 9884  C C     . ALA E 5 189 ? 41.975  134.024 89.055  1.00 58.23  ? 189 ALA L C     1 
ATOM 9885  O O     . ALA E 5 189 ? 41.744  132.938 89.566  1.00 56.34  ? 189 ALA L O     1 
ATOM 9886  C CB    . ALA E 5 189 ? 41.739  134.126 86.593  1.00 60.59  ? 189 ALA L CB    1 
ATOM 9887  N N     . ASN E 5 190 ? 41.596  135.168 89.601  1.00 58.14  ? 190 ASN L N     1 
ATOM 9888  C CA    . ASN E 5 190 ? 40.887  135.155 90.861  1.00 58.86  ? 190 ASN L CA    1 
ATOM 9889  C C     . ASN E 5 190 ? 39.394  135.151 90.682  1.00 58.79  ? 190 ASN L C     1 
ATOM 9890  O O     . ASN E 5 190 ? 38.766  134.098 90.783  1.00 58.96  ? 190 ASN L O     1 
ATOM 9891  C CB    . ASN E 5 190 ? 41.344  136.306 91.729  1.00 60.40  ? 190 ASN L CB    1 
ATOM 9892  C CG    . ASN E 5 190 ? 42.816  136.234 92.011  1.00 63.66  ? 190 ASN L CG    1 
ATOM 9893  O OD1   . ASN E 5 190 ? 43.625  136.238 91.080  1.00 65.00  ? 190 ASN L OD1   1 
ATOM 9894  N ND2   . ASN E 5 190 ? 43.181  136.099 93.289  1.00 65.08  ? 190 ASN L ND2   1 
ATOM 9895  N N     . SER E 5 191 ? 38.807  136.316 90.453  1.00 58.84  ? 191 SER L N     1 
ATOM 9896  C CA    . SER E 5 191 ? 37.367  136.349 90.257  1.00 60.59  ? 191 SER L CA    1 
ATOM 9897  C C     . SER E 5 191 ? 36.989  136.005 88.820  1.00 61.29  ? 191 SER L C     1 
ATOM 9898  O O     . SER E 5 191 ? 37.843  135.847 87.944  1.00 61.91  ? 191 SER L O     1 
ATOM 9899  C CB    . SER E 5 191 ? 36.775  137.703 90.645  1.00 61.11  ? 191 SER L CB    1 
ATOM 9900  O OG    . SER E 5 191 ? 35.357  137.637 90.678  1.00 61.60  ? 191 SER L OG    1 
ATOM 9901  N N     . TYR E 5 192 ? 35.696  135.826 88.605  1.00 61.08  ? 192 TYR L N     1 
ATOM 9902  C CA    . TYR E 5 192 ? 35.176  135.507 87.293  1.00 60.63  ? 192 TYR L CA    1 
ATOM 9903  C C     . TYR E 5 192 ? 33.846  136.197 87.252  1.00 59.74  ? 192 TYR L C     1 
ATOM 9904  O O     . TYR E 5 192 ? 33.027  136.053 88.168  1.00 58.60  ? 192 TYR L O     1 
ATOM 9905  C CB    . TYR E 5 192 ? 34.982  134.010 87.144  1.00 62.27  ? 192 TYR L CB    1 
ATOM 9906  C CG    . TYR E 5 192 ? 36.240  133.214 87.330  1.00 61.92  ? 192 TYR L CG    1 
ATOM 9907  C CD1   . TYR E 5 192 ? 36.608  132.740 88.592  1.00 61.55  ? 192 TYR L CD1   1 
ATOM 9908  C CD2   . TYR E 5 192 ? 37.050  132.914 86.243  1.00 62.04  ? 192 TYR L CD2   1 
ATOM 9909  C CE1   . TYR E 5 192 ? 37.753  131.987 88.760  1.00 62.84  ? 192 TYR L CE1   1 
ATOM 9910  C CE2   . TYR E 5 192 ? 38.195  132.164 86.398  1.00 63.08  ? 192 TYR L CE2   1 
ATOM 9911  C CZ    . TYR E 5 192 ? 38.540  131.702 87.656  1.00 64.07  ? 192 TYR L CZ    1 
ATOM 9912  O OH    . TYR E 5 192 ? 39.683  130.968 87.801  1.00 64.39  ? 192 TYR L OH    1 
ATOM 9913  N N     . THR E 5 193 ? 33.603  136.892 86.155  1.00 58.69  ? 193 THR L N     1 
ATOM 9914  C CA    . THR E 5 193 ? 32.382  137.645 86.056  1.00 58.70  ? 193 THR L CA    1 
ATOM 9915  C C     . THR E 5 193 ? 31.606  137.547 84.755  1.00 58.22  ? 193 THR L C     1 
ATOM 9916  O O     . THR E 5 193 ? 32.156  137.274 83.676  1.00 58.38  ? 193 THR L O     1 
ATOM 9917  C CB    . THR E 5 193 ? 32.679  139.107 86.347  1.00 59.30  ? 193 THR L CB    1 
ATOM 9918  O OG1   . THR E 5 193 ? 33.451  139.201 87.555  1.00 59.33  ? 193 THR L OG1   1 
ATOM 9919  C CG2   . THR E 5 193 ? 31.388  139.893 86.481  1.00 59.62  ? 193 THR L CG2   1 
ATOM 9920  N N     . CYS E 5 194 ? 30.312  137.815 84.888  1.00 57.28  ? 194 CYS L N     1 
ATOM 9921  C CA    . CYS E 5 194 ? 29.385  137.788 83.783  1.00 55.15  ? 194 CYS L CA    1 
ATOM 9922  C C     . CYS E 5 194 ? 28.750  139.168 83.709  1.00 52.27  ? 194 CYS L C     1 
ATOM 9923  O O     . CYS E 5 194 ? 28.190  139.660 84.695  1.00 50.41  ? 194 CYS L O     1 
ATOM 9924  C CB    . CYS E 5 194 ? 28.322  136.716 84.037  1.00 57.46  ? 194 CYS L CB    1 
ATOM 9925  S SG    . CYS E 5 194 ? 27.284  136.280 82.599  1.00 61.63  ? 194 CYS L SG    1 
ATOM 9926  N N     . ALA E 5 195 ? 28.883  139.799 82.547  1.00 49.90  ? 195 ALA L N     1 
ATOM 9927  C CA    . ALA E 5 195 ? 28.334  141.122 82.330  1.00 48.13  ? 195 ALA L CA    1 
ATOM 9928  C C     . ALA E 5 195 ? 27.254  141.124 81.275  1.00 47.21  ? 195 ALA L C     1 
ATOM 9929  O O     . ALA E 5 195 ? 27.516  141.097 80.072  1.00 45.43  ? 195 ALA L O     1 
ATOM 9930  C CB    . ALA E 5 195 ? 29.421  142.093 81.961  1.00 49.22  ? 195 ALA L CB    1 
ATOM 9931  N N     . ALA E 5 196 ? 26.021  141.135 81.749  1.00 47.93  ? 196 ALA L N     1 
ATOM 9932  C CA    . ALA E 5 196 ? 24.874  141.165 80.870  1.00 48.27  ? 196 ALA L CA    1 
ATOM 9933  C C     . ALA E 5 196 ? 24.416  142.612 80.775  1.00 47.65  ? 196 ALA L C     1 
ATOM 9934  O O     . ALA E 5 196 ? 24.313  143.325 81.774  1.00 46.70  ? 196 ALA L O     1 
ATOM 9935  C CB    . ALA E 5 196 ? 23.765  140.288 81.419  1.00 48.86  ? 196 ALA L CB    1 
ATOM 9936  N N     . THR E 5 197 ? 24.173  143.052 79.555  1.00 47.51  ? 197 THR L N     1 
ATOM 9937  C CA    . THR E 5 197 ? 23.745  144.414 79.344  1.00 48.70  ? 197 THR L CA    1 
ATOM 9938  C C     . THR E 5 197 ? 22.587  144.410 78.375  1.00 48.79  ? 197 THR L C     1 
ATOM 9939  O O     . THR E 5 197 ? 22.711  144.033 77.203  1.00 48.32  ? 197 THR L O     1 
ATOM 9940  C CB    . THR E 5 197 ? 24.883  145.247 78.823  1.00 50.23  ? 197 THR L CB    1 
ATOM 9941  O OG1   . THR E 5 197 ? 26.115  144.533 79.025  1.00 49.75  ? 197 THR L OG1   1 
ATOM 9942  C CG2   . THR E 5 197 ? 24.912  146.581 79.571  1.00 50.76  ? 197 THR L CG2   1 
ATOM 9943  N N     . HIS E 5 198 ? 21.454  144.857 78.883  1.00 48.93  ? 198 HIS L N     1 
ATOM 9944  C CA    . HIS E 5 198 ? 20.243  144.848 78.112  1.00 48.70  ? 198 HIS L CA    1 
ATOM 9945  C C     . HIS E 5 198 ? 19.591  146.196 78.151  1.00 49.02  ? 198 HIS L C     1 
ATOM 9946  O O     . HIS E 5 198 ? 19.968  147.056 78.950  1.00 46.32  ? 198 HIS L O     1 
ATOM 9947  C CB    . HIS E 5 198 ? 19.318  143.823 78.732  1.00 49.55  ? 198 HIS L CB    1 
ATOM 9948  C CG    . HIS E 5 198 ? 18.141  143.485 77.890  1.00 50.28  ? 198 HIS L CG    1 
ATOM 9949  N ND1   . HIS E 5 198 ? 16.848  143.602 78.353  1.00 52.84  ? 198 HIS L ND1   1 
ATOM 9950  C CD2   . HIS E 5 198 ? 18.055  142.972 76.643  1.00 51.21  ? 198 HIS L CD2   1 
ATOM 9951  C CE1   . HIS E 5 198 ? 16.014  143.164 77.426  1.00 53.66  ? 198 HIS L CE1   1 
ATOM 9952  N NE2   . HIS E 5 198 ? 16.720  142.775 76.379  1.00 53.51  ? 198 HIS L NE2   1 
ATOM 9953  N N     . LYS E 5 199 ? 18.582  146.352 77.300  1.00 51.31  ? 199 LYS L N     1 
ATOM 9954  C CA    . LYS E 5 199 ? 17.818  147.588 77.195  1.00 54.34  ? 199 LYS L CA    1 
ATOM 9955  C C     . LYS E 5 199 ? 17.038  147.775 78.489  1.00 56.24  ? 199 LYS L C     1 
ATOM 9956  O O     . LYS E 5 199 ? 15.865  148.150 78.473  1.00 57.24  ? 199 LYS L O     1 
ATOM 9957  C CB    . LYS E 5 199 ? 16.846  147.521 76.003  1.00 52.65  ? 199 LYS L CB    1 
ATOM 9958  C CG    . LYS E 5 199 ? 16.192  148.858 75.692  1.00 54.40  ? 199 LYS L CG    1 
ATOM 9959  C CD    . LYS E 5 199 ? 15.208  148.803 74.536  1.00 57.45  ? 199 LYS L CD    1 
ATOM 9960  C CE    . LYS E 5 199 ? 14.716  150.225 74.185  1.00 60.61  ? 199 LYS L CE    1 
ATOM 9961  N NZ    . LYS E 5 199 ? 13.738  150.305 73.045  1.00 62.96  ? 199 LYS L NZ    1 
ATOM 9962  N N     . THR E 5 200 ? 17.711  147.542 79.610  1.00 57.84  ? 200 THR L N     1 
ATOM 9963  C CA    . THR E 5 200 ? 17.091  147.639 80.916  1.00 60.21  ? 200 THR L CA    1 
ATOM 9964  C C     . THR E 5 200 ? 17.019  149.054 81.506  1.00 62.61  ? 200 THR L C     1 
ATOM 9965  O O     . THR E 5 200 ? 15.983  149.713 81.383  1.00 63.02  ? 200 THR L O     1 
ATOM 9966  C CB    . THR E 5 200 ? 17.727  146.612 81.865  1.00 59.18  ? 200 THR L CB    1 
ATOM 9967  O OG1   . THR E 5 200 ? 19.146  146.809 81.902  1.00 59.02  ? 200 THR L OG1   1 
ATOM 9968  C CG2   . THR E 5 200 ? 17.451  145.209 81.333  1.00 56.36  ? 200 THR L CG2   1 
ATOM 9969  N N     . SER E 5 201 ? 18.094  149.535 82.128  1.00 65.01  ? 201 SER L N     1 
ATOM 9970  C CA    . SER E 5 201 ? 18.084  150.889 82.702  1.00 67.49  ? 201 SER L CA    1 
ATOM 9971  C C     . SER E 5 201 ? 19.453  151.567 82.576  1.00 67.92  ? 201 SER L C     1 
ATOM 9972  O O     . SER E 5 201 ? 19.845  152.372 83.437  1.00 67.96  ? 201 SER L O     1 
ATOM 9973  C CB    . SER E 5 201 ? 17.633  150.856 84.180  1.00 68.00  ? 201 SER L CB    1 
ATOM 9974  O OG    . SER E 5 201 ? 18.590  150.226 85.027  1.00 67.90  ? 201 SER L OG    1 
ATOM 9975  N N     . THR E 5 202 ? 20.132  151.300 81.458  1.00 68.19  ? 202 THR L N     1 
ATOM 9976  C CA    . THR E 5 202 ? 21.482  151.821 81.213  1.00 69.00  ? 202 THR L CA    1 
ATOM 9977  C C     . THR E 5 202 ? 22.285  151.134 82.313  1.00 67.91  ? 202 THR L C     1 
ATOM 9978  O O     . THR E 5 202 ? 23.161  151.713 82.970  1.00 68.61  ? 202 THR L O     1 
ATOM 9979  C CB    . THR E 5 202 ? 21.561  153.357 81.391  1.00 70.66  ? 202 THR L CB    1 
ATOM 9980  O OG1   . THR E 5 202 ? 20.343  153.961 80.918  1.00 70.89  ? 202 THR L OG1   1 
ATOM 9981  C CG2   . THR E 5 202 ? 22.779  153.922 80.624  1.00 70.71  ? 202 THR L CG2   1 
ATOM 9982  N N     . SER E 5 203 ? 21.897  149.890 82.543  1.00 66.66  ? 203 SER L N     1 
ATOM 9983  C CA    . SER E 5 203 ? 22.495  149.092 83.569  1.00 66.20  ? 203 SER L CA    1 
ATOM 9984  C C     . SER E 5 203 ? 23.230  147.878 83.037  1.00 67.01  ? 203 SER L C     1 
ATOM 9985  O O     . SER E 5 203 ? 22.772  147.201 82.103  1.00 66.83  ? 203 SER L O     1 
ATOM 9986  C CB    . SER E 5 203 ? 21.429  148.672 84.595  1.00 65.82  ? 203 SER L CB    1 
ATOM 9987  O OG    . SER E 5 203 ? 20.308  148.047 83.985  1.00 62.19  ? 203 SER L OG    1 
ATOM 9988  N N     . PRO E 5 204 ? 24.473  147.713 83.500  1.00 66.25  ? 204 PRO L N     1 
ATOM 9989  C CA    . PRO E 5 204 ? 25.377  146.613 83.160  1.00 66.25  ? 204 PRO L CA    1 
ATOM 9990  C C     . PRO E 5 204 ? 25.179  145.524 84.229  1.00 64.83  ? 204 PRO L C     1 
ATOM 9991  O O     . PRO E 5 204 ? 25.941  145.436 85.204  1.00 64.81  ? 204 PRO L O     1 
ATOM 9992  C CB    . PRO E 5 204 ? 26.761  147.267 83.268  1.00 66.39  ? 204 PRO L CB    1 
ATOM 9993  C CG    . PRO E 5 204 ? 26.474  148.744 83.070  1.00 66.21  ? 204 PRO L CG    1 
ATOM 9994  C CD    . PRO E 5 204 ? 25.250  148.894 83.912  1.00 65.94  ? 204 PRO L CD    1 
ATOM 9995  N N     . ILE E 5 205 ? 24.111  144.741 84.071  1.00 62.75  ? 205 ILE L N     1 
ATOM 9996  C CA    . ILE E 5 205 ? 23.788  143.673 85.016  1.00 60.24  ? 205 ILE L CA    1 
ATOM 9997  C C     . ILE E 5 205 ? 24.936  142.684 85.113  1.00 58.16  ? 205 ILE L C     1 
ATOM 9998  O O     . ILE E 5 205 ? 25.303  142.000 84.157  1.00 56.52  ? 205 ILE L O     1 
ATOM 9999  C CB    . ILE E 5 205 ? 22.487  142.951 84.661  1.00 60.67  ? 205 ILE L CB    1 
ATOM 10000 C CG1   . ILE E 5 205 ? 21.385  143.978 84.348  1.00 60.28  ? 205 ILE L CG1   1 
ATOM 10001 C CG2   . ILE E 5 205 ? 22.085  142.043 85.817  1.00 59.40  ? 205 ILE L CG2   1 
ATOM 10002 C CD1   . ILE E 5 205 ? 21.438  144.551 82.912  1.00 59.58  ? 205 ILE L CD1   1 
ATOM 10003 N N     . VAL E 5 206 ? 25.486  142.600 86.304  1.00 56.49  ? 206 VAL L N     1 
ATOM 10004 C CA    . VAL E 5 206 ? 26.631  141.767 86.497  1.00 57.20  ? 206 VAL L CA    1 
ATOM 10005 C C     . VAL E 5 206 ? 26.563  140.857 87.688  1.00 57.61  ? 206 VAL L C     1 
ATOM 10006 O O     . VAL E 5 206 ? 26.055  141.232 88.739  1.00 58.27  ? 206 VAL L O     1 
ATOM 10007 C CB    . VAL E 5 206 ? 27.850  142.665 86.647  1.00 58.42  ? 206 VAL L CB    1 
ATOM 10008 C CG1   . VAL E 5 206 ? 29.031  141.895 87.208  1.00 58.60  ? 206 VAL L CG1   1 
ATOM 10009 C CG2   . VAL E 5 206 ? 28.182  143.296 85.305  1.00 60.16  ? 206 VAL L CG2   1 
ATOM 10010 N N     . LYS E 5 207 ? 27.092  139.654 87.511  1.00 57.58  ? 207 LYS L N     1 
ATOM 10011 C CA    . LYS E 5 207 ? 27.159  138.698 88.597  1.00 57.48  ? 207 LYS L CA    1 
ATOM 10012 C C     . LYS E 5 207 ? 28.559  138.158 88.513  1.00 56.36  ? 207 LYS L C     1 
ATOM 10013 O O     . LYS E 5 207 ? 29.110  137.996 87.421  1.00 52.98  ? 207 LYS L O     1 
ATOM 10014 C CB    . LYS E 5 207 ? 26.118  137.594 88.462  1.00 60.21  ? 207 LYS L CB    1 
ATOM 10015 C CG    . LYS E 5 207 ? 25.441  137.265 89.796  1.00 63.54  ? 207 LYS L CG    1 
ATOM 10016 C CD    . LYS E 5 207 ? 24.238  136.332 89.620  1.00 67.19  ? 207 LYS L CD    1 
ATOM 10017 C CE    . LYS E 5 207 ? 23.358  136.268 90.885  1.00 68.38  ? 207 LYS L CE    1 
ATOM 10018 N NZ    . LYS E 5 207 ? 24.002  135.601 92.064  1.00 69.87  ? 207 LYS L NZ    1 
ATOM 10019 N N     . SER E 5 208 ? 29.147  137.926 89.676  1.00 57.34  ? 208 SER L N     1 
ATOM 10020 C CA    . SER E 5 208 ? 30.520  137.463 89.730  1.00 59.25  ? 208 SER L CA    1 
ATOM 10021 C C     . SER E 5 208 ? 30.768  136.527 90.891  1.00 59.13  ? 208 SER L C     1 
ATOM 10022 O O     . SER E 5 208 ? 29.926  136.386 91.781  1.00 58.40  ? 208 SER L O     1 
ATOM 10023 C CB    . SER E 5 208 ? 31.450  138.668 89.889  1.00 60.94  ? 208 SER L CB    1 
ATOM 10024 O OG    . SER E 5 208 ? 30.875  139.843 89.338  1.00 63.11  ? 208 SER L OG    1 
ATOM 10025 N N     . PHE E 5 209 ? 31.962  135.938 90.896  1.00 59.59  ? 209 PHE L N     1 
ATOM 10026 C CA    . PHE E 5 209 ? 32.367  135.030 91.952  1.00 60.76  ? 209 PHE L CA    1 
ATOM 10027 C C     . PHE E 5 209 ? 33.870  134.882 92.017  1.00 60.88  ? 209 PHE L C     1 
ATOM 10028 O O     . PHE E 5 209 ? 34.570  134.999 91.007  1.00 59.21  ? 209 PHE L O     1 
ATOM 10029 C CB    . PHE E 5 209 ? 31.737  133.653 91.757  1.00 63.07  ? 209 PHE L CB    1 
ATOM 10030 C CG    . PHE E 5 209 ? 32.548  132.716 90.885  1.00 62.95  ? 209 PHE L CG    1 
ATOM 10031 C CD1   . PHE E 5 209 ? 33.274  131.666 91.456  1.00 63.65  ? 209 PHE L CD1   1 
ATOM 10032 C CD2   . PHE E 5 209 ? 32.530  132.837 89.499  1.00 63.98  ? 209 PHE L CD2   1 
ATOM 10033 C CE1   . PHE E 5 209 ? 33.961  130.751 90.664  1.00 63.57  ? 209 PHE L CE1   1 
ATOM 10034 C CE2   . PHE E 5 209 ? 33.214  131.923 88.700  1.00 64.14  ? 209 PHE L CE2   1 
ATOM 10035 C CZ    . PHE E 5 209 ? 33.928  130.879 89.284  1.00 63.37  ? 209 PHE L CZ    1 
ATOM 10036 N N     . ASN E 5 210 ? 34.339  134.515 93.201  1.00 62.39  ? 210 ASN L N     1 
ATOM 10037 C CA    . ASN E 5 210 ? 35.756  134.331 93.427  1.00 65.30  ? 210 ASN L CA    1 
ATOM 10038 C C     . ASN E 5 210 ? 36.056  133.116 94.330  1.00 66.67  ? 210 ASN L C     1 
ATOM 10039 O O     . ASN E 5 210 ? 35.744  133.118 95.529  1.00 66.94  ? 210 ASN L O     1 
ATOM 10040 C CB    . ASN E 5 210 ? 36.335  135.615 94.025  1.00 66.89  ? 210 ASN L CB    1 
ATOM 10041 C CG    . ASN E 5 210 ? 37.722  135.929 93.498  1.00 68.30  ? 210 ASN L CG    1 
ATOM 10042 O OD1   . ASN E 5 210 ? 38.031  137.083 93.189  1.00 69.16  ? 210 ASN L OD1   1 
ATOM 10043 N ND2   . ASN E 5 210 ? 38.565  134.903 93.381  1.00 68.93  ? 210 ASN L ND2   1 
ATOM 10044 N N     . ALA E 5 211 ? 36.650  132.081 93.730  1.00 67.58  ? 211 ALA L N     1 
ATOM 10045 C CA    . ALA E 5 211 ? 37.021  130.840 94.428  1.00 67.44  ? 211 ALA L CA    1 
ATOM 10046 C C     . ALA E 5 211 ? 37.820  129.935 93.474  1.00 67.00  ? 211 ALA L C     1 
ATOM 10047 O O     . ALA E 5 211 ? 37.248  129.188 92.682  1.00 66.04  ? 211 ALA L O     1 
ATOM 10048 C CB    . ALA E 5 211 ? 35.764  130.117 94.947  1.00 67.58  ? 211 ALA L CB    1 
ATOM 10049 N N     . ASN E 5 212 ? 39.148  130.038 93.546  1.00 66.85  ? 212 ASN L N     1 
ATOM 10050 C CA    . ASN E 5 212 ? 40.059  129.272 92.690  1.00 66.57  ? 212 ASN L CA    1 
ATOM 10051 C C     . ASN E 5 212 ? 40.457  127.953 93.324  1.00 66.34  ? 212 ASN L C     1 
ATOM 10052 O O     . ASN E 5 212 ? 41.524  127.413 93.020  1.00 64.40  ? 212 ASN L O     1 
ATOM 10053 C CB    . ASN E 5 212 ? 41.333  130.082 92.393  1.00 67.68  ? 212 ASN L CB    1 
ATOM 10054 C CG    . ASN E 5 212 ? 41.042  131.444 91.756  1.00 68.07  ? 212 ASN L CG    1 
ATOM 10055 O OD1   . ASN E 5 212 ? 41.718  132.442 92.049  1.00 66.16  ? 212 ASN L OD1   1 
ATOM 10056 N ND2   . ASN E 5 212 ? 40.049  131.486 90.866  1.00 67.94  ? 212 ASN L ND2   1 
ATOM 10057 N N     . GLU E 5 213 ? 39.633  127.481 94.258  1.00 67.99  ? 213 GLU L N     1 
ATOM 10058 C CA    . GLU E 5 213 ? 39.890  126.215 94.926  1.00 69.62  ? 213 GLU L CA    1 
ATOM 10059 C C     . GLU E 5 213 ? 39.818  125.149 93.835  1.00 71.79  ? 213 GLU L C     1 
ATOM 10060 O O     . GLU E 5 213 ? 39.005  125.249 92.908  1.00 71.79  ? 213 GLU L O     1 
ATOM 10061 C CB    . GLU E 5 213 ? 38.856  125.947 96.038  1.00 67.50  ? 213 GLU L CB    1 
ATOM 10062 C CG    . GLU E 5 213 ? 37.554  125.229 95.615  1.00 67.35  ? 213 GLU L CG    1 
ATOM 10063 C CD    . GLU E 5 213 ? 36.667  126.048 94.683  1.00 67.30  ? 213 GLU L CD    1 
ATOM 10064 O OE1   . GLU E 5 213 ? 36.636  127.286 94.825  1.00 67.38  ? 213 GLU L OE1   1 
ATOM 10065 O OE2   . GLU E 5 213 ? 35.995  125.450 93.810  1.00 67.38  ? 213 GLU L OE2   1 
ATOM 10066 N N     . CYS E 5 214 ? 40.732  124.187 93.896  1.00 74.26  ? 214 CYS L N     1 
ATOM 10067 C CA    . CYS E 5 214 ? 40.779  123.105 92.916  1.00 75.78  ? 214 CYS L CA    1 
ATOM 10068 C C     . CYS E 5 214 ? 40.088  121.838 93.455  1.00 77.37  ? 214 CYS L C     1 
ATOM 10069 O O     . CYS E 5 214 ? 40.310  121.501 94.646  1.00 77.98  ? 214 CYS L O     1 
ATOM 10070 C CB    . CYS E 5 214 ? 42.235  122.811 92.517  1.00 74.90  ? 214 CYS L CB    1 
ATOM 10071 S SG    . CYS E 5 214 ? 43.477  123.875 93.303  1.00 75.03  ? 214 CYS L SG    1 
ATOM 10072 O OXT   . CYS E 5 214 ? 39.310  121.210 92.690  1.00 79.18  ? 214 CYS L OXT   1 
ATOM 10073 N N     . GLN F 6 1   ? -3.786  112.990 50.289  1.00 55.96  ? 1   GLN H N     1 
ATOM 10074 C CA    . GLN F 6 1   ? -3.188  113.742 49.137  1.00 55.70  ? 1   GLN H CA    1 
ATOM 10075 C C     . GLN F 6 1   ? -1.719  113.321 48.897  1.00 53.70  ? 1   GLN H C     1 
ATOM 10076 O O     . GLN F 6 1   ? -1.141  112.520 49.650  1.00 53.80  ? 1   GLN H O     1 
ATOM 10077 C CB    . GLN F 6 1   ? -3.310  115.276 49.381  1.00 58.70  ? 1   GLN H CB    1 
ATOM 10078 C CG    . GLN F 6 1   ? -3.314  116.180 48.101  1.00 61.16  ? 1   GLN H CG    1 
ATOM 10079 C CD    . GLN F 6 1   ? -3.894  117.603 48.308  1.00 63.02  ? 1   GLN H CD    1 
ATOM 10080 O OE1   . GLN F 6 1   ? -4.026  118.378 47.343  1.00 64.31  ? 1   GLN H OE1   1 
ATOM 10081 N NE2   . GLN F 6 1   ? -4.255  117.938 49.553  1.00 63.74  ? 1   GLN H NE2   1 
ATOM 10082 N N     . ILE F 6 2   ? -1.137  113.842 47.822  1.00 49.13  ? 2   ILE H N     1 
ATOM 10083 C CA    . ILE F 6 2   ? 0.243   113.547 47.473  1.00 44.52  ? 2   ILE H CA    1 
ATOM 10084 C C     . ILE F 6 2   ? 1.199   114.011 48.573  1.00 40.31  ? 2   ILE H C     1 
ATOM 10085 O O     . ILE F 6 2   ? 1.019   115.078 49.176  1.00 38.23  ? 2   ILE H O     1 
ATOM 10086 C CB    . ILE F 6 2   ? 0.660   114.223 46.119  1.00 46.33  ? 2   ILE H CB    1 
ATOM 10087 C CG1   . ILE F 6 2   ? 0.937   115.726 46.316  1.00 48.58  ? 2   ILE H CG1   1 
ATOM 10088 C CG2   . ILE F 6 2   ? -0.430  114.012 45.039  1.00 44.83  ? 2   ILE H CG2   1 
ATOM 10089 C CD1   . ILE F 6 2   ? -0.286  116.567 46.693  1.00 48.77  ? 2   ILE H CD1   1 
ATOM 10090 N N     . THR F 6 3   ? 2.200   113.181 48.839  1.00 35.99  ? 3   THR H N     1 
ATOM 10091 C CA    . THR F 6 3   ? 3.218   113.481 49.835  1.00 31.79  ? 3   THR H CA    1 
ATOM 10092 C C     . THR F 6 3   ? 4.493   112.779 49.499  1.00 28.74  ? 3   THR H C     1 
ATOM 10093 O O     . THR F 6 3   ? 4.563   111.988 48.561  1.00 26.54  ? 3   THR H O     1 
ATOM 10094 C CB    . THR F 6 3   ? 2.849   113.009 51.207  1.00 31.17  ? 3   THR H CB    1 
ATOM 10095 O OG1   . THR F 6 3   ? 2.274   111.706 51.091  1.00 31.48  ? 3   THR H OG1   1 
ATOM 10096 C CG2   . THR F 6 3   ? 1.899   113.996 51.883  1.00 33.19  ? 3   THR H CG2   1 
ATOM 10097 N N     . LEU F 6 4   ? 5.487   113.014 50.333  1.00 27.12  ? 4   LEU H N     1 
ATOM 10098 C CA    . LEU F 6 4   ? 6.775   112.427 50.089  1.00 28.33  ? 4   LEU H CA    1 
ATOM 10099 C C     . LEU F 6 4   ? 7.700   112.590 51.269  1.00 29.30  ? 4   LEU H C     1 
ATOM 10100 O O     . LEU F 6 4   ? 7.694   113.635 51.931  1.00 30.31  ? 4   LEU H O     1 
ATOM 10101 C CB    . LEU F 6 4   ? 7.395   113.053 48.831  1.00 27.79  ? 4   LEU H CB    1 
ATOM 10102 C CG    . LEU F 6 4   ? 7.693   114.552 48.702  1.00 26.99  ? 4   LEU H CG    1 
ATOM 10103 C CD1   . LEU F 6 4   ? 8.051   114.827 47.259  1.00 26.52  ? 4   LEU H CD1   1 
ATOM 10104 C CD2   . LEU F 6 4   ? 6.517   115.417 49.099  1.00 26.77  ? 4   LEU H CD2   1 
ATOM 10105 N N     . LYS F 6 5   ? 8.456   111.527 51.547  1.00 29.55  ? 5   LYS H N     1 
ATOM 10106 C CA    . LYS F 6 5   ? 9.430   111.507 52.629  1.00 29.22  ? 5   LYS H CA    1 
ATOM 10107 C C     . LYS F 6 5   ? 10.809  111.178 52.090  1.00 28.79  ? 5   LYS H C     1 
ATOM 10108 O O     . LYS F 6 5   ? 10.973  110.291 51.248  1.00 28.47  ? 5   LYS H O     1 
ATOM 10109 C CB    . LYS F 6 5   ? 9.073   110.490 53.701  1.00 29.28  ? 5   LYS H CB    1 
ATOM 10110 C CG    . LYS F 6 5   ? 10.057  110.543 54.830  1.00 31.80  ? 5   LYS H CG    1 
ATOM 10111 C CD    . LYS F 6 5   ? 9.719   109.589 55.942  1.00 36.62  ? 5   LYS H CD    1 
ATOM 10112 C CE    . LYS F 6 5   ? 10.157  110.180 57.293  1.00 39.17  ? 5   LYS H CE    1 
ATOM 10113 N NZ    . LYS F 6 5   ? 9.471   111.501 57.625  1.00 40.08  ? 5   LYS H NZ    1 
ATOM 10114 N N     . GLU F 6 6   ? 11.798  111.885 52.622  1.00 28.51  ? 6   GLU H N     1 
ATOM 10115 C CA    . GLU F 6 6   ? 13.187  111.732 52.228  1.00 29.09  ? 6   GLU H CA    1 
ATOM 10116 C C     . GLU F 6 6   ? 13.934  110.874 53.233  1.00 28.90  ? 6   GLU H C     1 
ATOM 10117 O O     . GLU F 6 6   ? 13.471  110.670 54.346  1.00 29.02  ? 6   GLU H O     1 
ATOM 10118 C CB    . GLU F 6 6   ? 13.838  113.104 52.117  1.00 29.70  ? 6   GLU H CB    1 
ATOM 10119 C CG    . GLU F 6 6   ? 12.830  114.249 52.081  1.00 33.47  ? 6   GLU H CG    1 
ATOM 10120 C CD    . GLU F 6 6   ? 12.293  114.582 53.455  1.00 35.59  ? 6   GLU H CD    1 
ATOM 10121 O OE1   . GLU F 6 6   ? 13.082  115.151 54.230  1.00 36.45  ? 6   GLU H OE1   1 
ATOM 10122 O OE2   . GLU F 6 6   ? 11.115  114.268 53.764  1.00 35.72  ? 6   GLU H OE2   1 
ATOM 10123 N N     . SER F 6 7   ? 15.103  110.383 52.851  1.00 29.78  ? 7   SER H N     1 
ATOM 10124 C CA    . SER F 6 7   ? 15.862  109.517 53.739  1.00 30.09  ? 7   SER H CA    1 
ATOM 10125 C C     . SER F 6 7   ? 17.327  109.388 53.339  1.00 30.71  ? 7   SER H C     1 
ATOM 10126 O O     . SER F 6 7   ? 17.685  109.489 52.158  1.00 31.23  ? 7   SER H O     1 
ATOM 10127 C CB    . SER F 6 7   ? 15.205  108.135 53.774  1.00 29.86  ? 7   SER H CB    1 
ATOM 10128 O OG    . SER F 6 7   ? 14.769  107.750 52.474  1.00 28.77  ? 7   SER H OG    1 
ATOM 10129 N N     . GLY F 6 8   ? 18.169  109.136 54.331  1.00 29.76  ? 8   GLY H N     1 
ATOM 10130 C CA    . GLY F 6 8   ? 19.584  109.001 54.069  1.00 28.76  ? 8   GLY H CA    1 
ATOM 10131 C C     . GLY F 6 8   ? 20.323  108.611 55.327  1.00 28.89  ? 8   GLY H C     1 
ATOM 10132 O O     . GLY F 6 8   ? 19.716  108.053 56.244  1.00 30.54  ? 8   GLY H O     1 
ATOM 10133 N N     . PRO F 6 9   ? 21.630  108.920 55.407  1.00 28.12  ? 9   PRO H N     1 
ATOM 10134 C CA    . PRO F 6 9   ? 22.605  108.670 56.480  1.00 28.21  ? 9   PRO H CA    1 
ATOM 10135 C C     . PRO F 6 9   ? 22.571  109.509 57.770  1.00 28.25  ? 9   PRO H C     1 
ATOM 10136 O O     . PRO F 6 9   ? 22.952  109.029 58.845  1.00 27.13  ? 9   PRO H O     1 
ATOM 10137 C CB    . PRO F 6 9   ? 23.928  108.872 55.760  1.00 29.12  ? 9   PRO H CB    1 
ATOM 10138 C CG    . PRO F 6 9   ? 23.602  109.996 54.833  1.00 29.02  ? 9   PRO H CG    1 
ATOM 10139 C CD    . PRO F 6 9   ? 22.301  109.527 54.243  1.00 28.54  ? 9   PRO H CD    1 
ATOM 10140 N N     . GLY F 6 10  ? 22.174  110.768 57.679  1.00 28.47  ? 10  GLY H N     1 
ATOM 10141 C CA    . GLY F 6 10  ? 22.162  111.576 58.883  1.00 29.69  ? 10  GLY H CA    1 
ATOM 10142 C C     . GLY F 6 10  ? 23.570  111.933 59.342  1.00 30.00  ? 10  GLY H C     1 
ATOM 10143 O O     . GLY F 6 10  ? 23.811  113.058 59.797  1.00 30.80  ? 10  GLY H O     1 
ATOM 10144 N N     . ILE F 6 11  ? 24.500  110.986 59.214  1.00 28.72  ? 11  ILE H N     1 
ATOM 10145 C CA    . ILE F 6 11  ? 25.884  111.197 59.615  1.00 28.73  ? 11  ILE H CA    1 
ATOM 10146 C C     . ILE F 6 11  ? 26.872  110.650 58.615  1.00 29.62  ? 11  ILE H C     1 
ATOM 10147 O O     . ILE F 6 11  ? 26.859  109.460 58.310  1.00 31.14  ? 11  ILE H O     1 
ATOM 10148 C CB    . ILE F 6 11  ? 26.180  110.528 60.932  1.00 28.69  ? 11  ILE H CB    1 
ATOM 10149 C CG1   . ILE F 6 11  ? 25.412  111.243 62.037  1.00 28.74  ? 11  ILE H CG1   1 
ATOM 10150 C CG2   . ILE F 6 11  ? 27.686  110.516 61.182  1.00 27.04  ? 11  ILE H CG2   1 
ATOM 10151 C CD1   . ILE F 6 11  ? 25.700  110.726 63.420  1.00 30.94  ? 11  ILE H CD1   1 
ATOM 10152 N N     . VAL F 6 12  ? 27.803  111.500 58.199  1.00 30.68  ? 12  VAL H N     1 
ATOM 10153 C CA    . VAL F 6 12  ? 28.811  111.113 57.222  1.00 32.50  ? 12  VAL H CA    1 
ATOM 10154 C C     . VAL F 6 12  ? 30.157  111.797 57.398  1.00 34.89  ? 12  VAL H C     1 
ATOM 10155 O O     . VAL F 6 12  ? 30.268  113.028 57.363  1.00 35.11  ? 12  VAL H O     1 
ATOM 10156 C CB    . VAL F 6 12  ? 28.321  111.381 55.801  1.00 31.42  ? 12  VAL H CB    1 
ATOM 10157 C CG1   . VAL F 6 12  ? 29.486  111.333 54.819  1.00 31.74  ? 12  VAL H CG1   1 
ATOM 10158 C CG2   . VAL F 6 12  ? 27.256  110.365 55.423  1.00 31.19  ? 12  VAL H CG2   1 
ATOM 10159 N N     . GLN F 6 13  ? 31.196  110.977 57.503  1.00 38.34  ? 13  GLN H N     1 
ATOM 10160 C CA    . GLN F 6 13  ? 32.545  111.486 57.674  1.00 39.97  ? 13  GLN H CA    1 
ATOM 10161 C C     . GLN F 6 13  ? 32.829  112.431 56.514  1.00 38.99  ? 13  GLN H C     1 
ATOM 10162 O O     . GLN F 6 13  ? 32.338  112.226 55.409  1.00 38.78  ? 13  GLN H O     1 
ATOM 10163 C CB    . GLN F 6 13  ? 33.553  110.327 57.680  1.00 42.42  ? 13  GLN H CB    1 
ATOM 10164 C CG    . GLN F 6 13  ? 34.660  110.479 58.727  1.00 47.51  ? 13  GLN H CG    1 
ATOM 10165 C CD    . GLN F 6 13  ? 35.883  109.608 58.448  1.00 51.12  ? 13  GLN H CD    1 
ATOM 10166 O OE1   . GLN F 6 13  ? 37.027  110.051 58.635  1.00 52.24  ? 13  GLN H OE1   1 
ATOM 10167 N NE2   . GLN F 6 13  ? 35.652  108.366 58.002  1.00 51.86  ? 13  GLN H NE2   1 
ATOM 10168 N N     . PRO F 6 14  ? 33.561  113.520 56.767  1.00 38.77  ? 14  PRO H N     1 
ATOM 10169 C CA    . PRO F 6 14  ? 33.869  114.461 55.692  1.00 39.12  ? 14  PRO H CA    1 
ATOM 10170 C C     . PRO F 6 14  ? 34.494  113.775 54.474  1.00 39.92  ? 14  PRO H C     1 
ATOM 10171 O O     . PRO F 6 14  ? 34.786  112.570 54.497  1.00 38.18  ? 14  PRO H O     1 
ATOM 10172 C CB    . PRO F 6 14  ? 34.855  115.412 56.356  1.00 38.04  ? 14  PRO H CB    1 
ATOM 10173 C CG    . PRO F 6 14  ? 34.369  115.444 57.758  1.00 38.90  ? 14  PRO H CG    1 
ATOM 10174 C CD    . PRO F 6 14  ? 34.104  113.996 58.047  1.00 39.12  ? 14  PRO H CD    1 
ATOM 10175 N N     . SER F 6 15  ? 34.644  114.557 53.404  1.00 41.08  ? 15  SER H N     1 
ATOM 10176 C CA    . SER F 6 15  ? 35.228  114.123 52.130  1.00 40.64  ? 15  SER H CA    1 
ATOM 10177 C C     . SER F 6 15  ? 34.733  112.764 51.648  1.00 37.89  ? 15  SER H C     1 
ATOM 10178 O O     . SER F 6 15  ? 35.516  111.889 51.285  1.00 38.69  ? 15  SER H O     1 
ATOM 10179 C CB    . SER F 6 15  ? 36.769  114.154 52.188  1.00 42.60  ? 15  SER H CB    1 
ATOM 10180 O OG    . SER F 6 15  ? 37.300  113.154 53.055  1.00 46.76  ? 15  SER H OG    1 
ATOM 10181 N N     . GLN F 6 16  ? 33.427  112.573 51.699  1.00 33.97  ? 16  GLN H N     1 
ATOM 10182 C CA    . GLN F 6 16  ? 32.850  111.330 51.243  1.00 31.67  ? 16  GLN H CA    1 
ATOM 10183 C C     . GLN F 6 16  ? 31.623  111.705 50.474  1.00 30.08  ? 16  GLN H C     1 
ATOM 10184 O O     . GLN F 6 16  ? 31.356  112.873 50.241  1.00 29.89  ? 16  GLN H O     1 
ATOM 10185 C CB    . GLN F 6 16  ? 32.478  110.432 52.419  1.00 30.84  ? 16  GLN H CB    1 
ATOM 10186 C CG    . GLN F 6 16  ? 33.672  109.923 53.196  1.00 31.88  ? 16  GLN H CG    1 
ATOM 10187 C CD    . GLN F 6 16  ? 34.485  108.910 52.423  1.00 31.47  ? 16  GLN H CD    1 
ATOM 10188 O OE1   . GLN F 6 16  ? 33.933  108.014 51.786  1.00 32.22  ? 16  GLN H OE1   1 
ATOM 10189 N NE2   . GLN F 6 16  ? 35.805  109.031 52.494  1.00 31.82  ? 16  GLN H NE2   1 
ATOM 10190 N N     . PRO F 6 17  ? 30.922  110.711 49.962  1.00 29.31  ? 17  PRO H N     1 
ATOM 10191 C CA    . PRO F 6 17  ? 29.723  111.057 49.216  1.00 28.49  ? 17  PRO H CA    1 
ATOM 10192 C C     . PRO F 6 17  ? 28.547  110.496 49.976  1.00 27.70  ? 17  PRO H C     1 
ATOM 10193 O O     . PRO F 6 17  ? 28.736  109.724 50.920  1.00 27.43  ? 17  PRO H O     1 
ATOM 10194 C CB    . PRO F 6 17  ? 29.939  110.303 47.922  1.00 29.11  ? 17  PRO H CB    1 
ATOM 10195 C CG    . PRO F 6 17  ? 30.512  108.989 48.412  1.00 29.65  ? 17  PRO H CG    1 
ATOM 10196 C CD    . PRO F 6 17  ? 31.405  109.366 49.597  1.00 29.71  ? 17  PRO H CD    1 
ATOM 10197 N N     . PHE F 6 18  ? 27.340  110.891 49.591  1.00 26.85  ? 18  PHE H N     1 
ATOM 10198 C CA    . PHE F 6 18  ? 26.149  110.353 50.240  1.00 27.75  ? 18  PHE H CA    1 
ATOM 10199 C C     . PHE F 6 18  ? 24.964  110.332 49.302  1.00 27.17  ? 18  PHE H C     1 
ATOM 10200 O O     . PHE F 6 18  ? 24.931  111.081 48.312  1.00 28.11  ? 18  PHE H O     1 
ATOM 10201 C CB    . PHE F 6 18  ? 25.805  111.082 51.551  1.00 28.84  ? 18  PHE H CB    1 
ATOM 10202 C CG    . PHE F 6 18  ? 25.448  112.542 51.385  1.00 29.01  ? 18  PHE H CG    1 
ATOM 10203 C CD1   . PHE F 6 18  ? 24.289  112.931 50.714  1.00 30.58  ? 18  PHE H CD1   1 
ATOM 10204 C CD2   . PHE F 6 18  ? 26.251  113.531 51.936  1.00 28.05  ? 18  PHE H CD2   1 
ATOM 10205 C CE1   . PHE F 6 18  ? 23.942  114.277 50.602  1.00 29.81  ? 18  PHE H CE1   1 
ATOM 10206 C CE2   . PHE F 6 18  ? 25.903  114.879 51.825  1.00 28.14  ? 18  PHE H CE2   1 
ATOM 10207 C CZ    . PHE F 6 18  ? 24.754  115.248 51.160  1.00 28.57  ? 18  PHE H CZ    1 
ATOM 10208 N N     . ARG F 6 19  ? 23.990  109.486 49.628  1.00 25.52  ? 19  ARG H N     1 
ATOM 10209 C CA    . ARG F 6 19  ? 22.813  109.359 48.794  1.00 25.59  ? 19  ARG H CA    1 
ATOM 10210 C C     . ARG F 6 19  ? 21.503  109.523 49.538  1.00 25.32  ? 19  ARG H C     1 
ATOM 10211 O O     . ARG F 6 19  ? 21.173  108.738 50.439  1.00 25.03  ? 19  ARG H O     1 
ATOM 10212 C CB    . ARG F 6 19  ? 22.833  108.027 48.034  1.00 25.69  ? 19  ARG H CB    1 
ATOM 10213 C CG    . ARG F 6 19  ? 21.881  107.986 46.830  1.00 26.28  ? 19  ARG H CG    1 
ATOM 10214 C CD    . ARG F 6 19  ? 22.065  106.717 45.993  1.00 28.21  ? 19  ARG H CD    1 
ATOM 10215 N NE    . ARG F 6 19  ? 21.317  106.758 44.731  1.00 29.35  ? 19  ARG H NE    1 
ATOM 10216 C CZ    . ARG F 6 19  ? 20.385  105.873 44.365  1.00 30.36  ? 19  ARG H CZ    1 
ATOM 10217 N NH1   . ARG F 6 19  ? 20.064  104.847 45.160  1.00 29.12  ? 19  ARG H NH1   1 
ATOM 10218 N NH2   . ARG F 6 19  ? 19.751  106.031 43.203  1.00 27.87  ? 19  ARG H NH2   1 
ATOM 10219 N N     . LEU F 6 20  ? 20.769  110.561 49.144  1.00 25.73  ? 20  LEU H N     1 
ATOM 10220 C CA    . LEU F 6 20  ? 19.462  110.864 49.717  1.00 26.86  ? 20  LEU H CA    1 
ATOM 10221 C C     . LEU F 6 20  ? 18.368  110.427 48.765  1.00 27.51  ? 20  LEU H C     1 
ATOM 10222 O O     . LEU F 6 20  ? 18.467  110.614 47.552  1.00 27.77  ? 20  LEU H O     1 
ATOM 10223 C CB    . LEU F 6 20  ? 19.333  112.348 49.996  1.00 26.96  ? 20  LEU H CB    1 
ATOM 10224 C CG    . LEU F 6 20  ? 20.595  112.797 50.716  1.00 28.73  ? 20  LEU H CG    1 
ATOM 10225 C CD1   . LEU F 6 20  ? 20.474  114.258 51.117  1.00 30.65  ? 20  LEU H CD1   1 
ATOM 10226 C CD2   . LEU F 6 20  ? 20.839  111.904 51.931  1.00 28.53  ? 20  LEU H CD2   1 
ATOM 10227 N N     . THR F 6 21  ? 17.335  109.816 49.323  1.00 27.79  ? 21  THR H N     1 
ATOM 10228 C CA    . THR F 6 21  ? 16.238  109.326 48.518  1.00 29.17  ? 21  THR H CA    1 
ATOM 10229 C C     . THR F 6 21  ? 14.951  109.937 48.984  1.00 28.66  ? 21  THR H C     1 
ATOM 10230 O O     . THR F 6 21  ? 14.660  109.981 50.177  1.00 29.00  ? 21  THR H O     1 
ATOM 10231 C CB    . THR F 6 21  ? 16.113  107.794 48.597  1.00 31.15  ? 21  THR H CB    1 
ATOM 10232 O OG1   . THR F 6 21  ? 17.359  107.201 48.213  1.00 32.14  ? 21  THR H OG1   1 
ATOM 10233 C CG2   . THR F 6 21  ? 14.994  107.283 47.663  1.00 30.39  ? 21  THR H CG2   1 
ATOM 10234 N N     . CYS F 6 22  ? 14.165  110.357 48.007  1.00 28.89  ? 22  CYS H N     1 
ATOM 10235 C CA    . CYS F 6 22  ? 12.884  110.981 48.244  1.00 29.42  ? 22  CYS H CA    1 
ATOM 10236 C C     . CYS F 6 22  ? 11.807  110.085 47.681  1.00 28.62  ? 22  CYS H C     1 
ATOM 10237 O O     . CYS F 6 22  ? 11.742  109.885 46.472  1.00 30.51  ? 22  CYS H O     1 
ATOM 10238 C CB    . CYS F 6 22  ? 12.854  112.307 47.510  1.00 32.10  ? 22  CYS H CB    1 
ATOM 10239 S SG    . CYS F 6 22  ? 11.270  113.178 47.575  1.00 34.97  ? 22  CYS H SG    1 
ATOM 10240 N N     . THR F 6 23  ? 10.955  109.547 48.541  1.00 27.76  ? 23  THR H N     1 
ATOM 10241 C CA    . THR F 6 23  ? 9.902   108.664 48.056  1.00 28.26  ? 23  THR H CA    1 
ATOM 10242 C C     . THR F 6 23  ? 8.551   109.350 48.095  1.00 26.90  ? 23  THR H C     1 
ATOM 10243 O O     . THR F 6 23  ? 7.991   109.581 49.168  1.00 27.14  ? 23  THR H O     1 
ATOM 10244 C CB    . THR F 6 23  ? 9.808   107.376 48.882  1.00 30.57  ? 23  THR H CB    1 
ATOM 10245 O OG1   . THR F 6 23  ? 11.123  106.864 49.136  1.00 32.33  ? 23  THR H OG1   1 
ATOM 10246 C CG2   . THR F 6 23  ? 8.984   106.334 48.125  1.00 31.35  ? 23  THR H CG2   1 
ATOM 10247 N N     . PHE F 6 24  ? 7.988   109.600 46.922  1.00 24.60  ? 24  PHE H N     1 
ATOM 10248 C CA    . PHE F 6 24  ? 6.712   110.280 46.857  1.00 22.49  ? 24  PHE H CA    1 
ATOM 10249 C C     . PHE F 6 24  ? 5.518   109.413 46.605  1.00 22.85  ? 24  PHE H C     1 
ATOM 10250 O O     . PHE F 6 24  ? 5.618   108.390 45.932  1.00 22.90  ? 24  PHE H O     1 
ATOM 10251 C CB    . PHE F 6 24  ? 6.766   111.335 45.803  1.00 20.23  ? 24  PHE H CB    1 
ATOM 10252 C CG    . PHE F 6 24  ? 7.312   110.851 44.529  1.00 19.19  ? 24  PHE H CG    1 
ATOM 10253 C CD1   . PHE F 6 24  ? 6.458   110.503 43.495  1.00 18.50  ? 24  PHE H CD1   1 
ATOM 10254 C CD2   . PHE F 6 24  ? 8.693   110.822 44.325  1.00 20.16  ? 24  PHE H CD2   1 
ATOM 10255 C CE1   . PHE F 6 24  ? 6.967   110.138 42.251  1.00 21.35  ? 24  PHE H CE1   1 
ATOM 10256 C CE2   . PHE F 6 24  ? 9.228   110.459 43.089  1.00 20.28  ? 24  PHE H CE2   1 
ATOM 10257 C CZ    . PHE F 6 24  ? 8.362   110.118 42.042  1.00 21.33  ? 24  PHE H CZ    1 
ATOM 10258 N N     . SER F 6 25  ? 4.363   109.918 47.038  1.00 23.85  ? 25  SER H N     1 
ATOM 10259 C CA    . SER F 6 25  ? 3.094   109.202 46.912  1.00 25.65  ? 25  SER H CA    1 
ATOM 10260 C C     . SER F 6 25  ? 1.879   110.019 46.446  1.00 24.28  ? 25  SER H C     1 
ATOM 10261 O O     . SER F 6 25  ? 0.984   110.354 47.234  1.00 23.93  ? 25  SER H O     1 
ATOM 10262 C CB    . SER F 6 25  ? 2.759   108.548 48.248  1.00 28.02  ? 25  SER H CB    1 
ATOM 10263 O OG    . SER F 6 25  ? 2.673   109.543 49.258  1.00 31.16  ? 25  SER H OG    1 
ATOM 10264 N N     . GLY F 6 26  ? 1.816   110.282 45.151  1.00 23.71  ? 26  GLY H N     1 
ATOM 10265 C CA    . GLY F 6 26  ? 0.695   111.027 44.623  1.00 24.68  ? 26  GLY H CA    1 
ATOM 10266 C C     . GLY F 6 26  ? 0.806   111.139 43.128  1.00 24.30  ? 26  GLY H C     1 
ATOM 10267 O O     . GLY F 6 26  ? 0.166   110.402 42.382  1.00 26.05  ? 26  GLY H O     1 
ATOM 10268 N N     . PHE F 6 27  ? 1.620   112.086 42.698  1.00 22.77  ? 27  PHE H N     1 
ATOM 10269 C CA    . PHE F 6 27  ? 1.875   112.323 41.287  1.00 22.63  ? 27  PHE H CA    1 
ATOM 10270 C C     . PHE F 6 27  ? 2.828   111.251 40.818  1.00 22.59  ? 27  PHE H C     1 
ATOM 10271 O O     . PHE F 6 27  ? 3.315   110.451 41.602  1.00 22.57  ? 27  PHE H O     1 
ATOM 10272 C CB    . PHE F 6 27  ? 2.624   113.620 41.163  1.00 22.58  ? 27  PHE H CB    1 
ATOM 10273 C CG    . PHE F 6 27  ? 3.854   113.645 42.006  1.00 21.04  ? 27  PHE H CG    1 
ATOM 10274 C CD1   . PHE F 6 27  ? 3.750   113.764 43.391  1.00 20.55  ? 27  PHE H CD1   1 
ATOM 10275 C CD2   . PHE F 6 27  ? 5.107   113.515 41.431  1.00 20.04  ? 27  PHE H CD2   1 
ATOM 10276 C CE1   . PHE F 6 27  ? 4.872   113.759 44.185  1.00 20.65  ? 27  PHE H CE1   1 
ATOM 10277 C CE2   . PHE F 6 27  ? 6.236   113.511 42.215  1.00 20.80  ? 27  PHE H CE2   1 
ATOM 10278 C CZ    . PHE F 6 27  ? 6.120   113.634 43.597  1.00 20.96  ? 27  PHE H CZ    1 
ATOM 10279 N N     . SER F 6 28  ? 3.225   111.361 39.566  1.00 23.83  ? 28  SER H N     1 
ATOM 10280 C CA    . SER F 6 28  ? 4.161   110.420 38.991  1.00 26.00  ? 28  SER H CA    1 
ATOM 10281 C C     . SER F 6 28  ? 5.224   111.271 38.347  1.00 26.65  ? 28  SER H C     1 
ATOM 10282 O O     . SER F 6 28  ? 4.959   112.425 38.009  1.00 26.29  ? 28  SER H O     1 
ATOM 10283 C CB    . SER F 6 28  ? 3.479   109.655 37.882  1.00 27.31  ? 28  SER H CB    1 
ATOM 10284 O OG    . SER F 6 28  ? 3.193   110.564 36.826  1.00 29.02  ? 28  SER H OG    1 
ATOM 10285 N N     . LEU F 6 29  ? 6.401   110.697 38.124  1.00 26.85  ? 29  LEU H N     1 
ATOM 10286 C CA    . LEU F 6 29  ? 7.463   111.446 37.473  1.00 27.69  ? 29  LEU H CA    1 
ATOM 10287 C C     . LEU F 6 29  ? 7.401   111.277 35.969  1.00 26.89  ? 29  LEU H C     1 
ATOM 10288 O O     . LEU F 6 29  ? 8.400   111.413 35.266  1.00 27.66  ? 29  LEU H O     1 
ATOM 10289 C CB    . LEU F 6 29  ? 8.828   111.045 38.018  1.00 30.07  ? 29  LEU H CB    1 
ATOM 10290 C CG    . LEU F 6 29  ? 9.156   111.966 39.191  1.00 33.99  ? 29  LEU H CG    1 
ATOM 10291 C CD1   . LEU F 6 29  ? 10.460  111.582 39.875  1.00 37.06  ? 29  LEU H CD1   1 
ATOM 10292 C CD2   . LEU F 6 29  ? 9.229   113.392 38.667  1.00 34.75  ? 29  LEU H CD2   1 
ATOM 10293 N N     . SER F 6 30  ? 6.185   111.104 35.476  1.00 25.40  ? 30  SER H N     1 
ATOM 10294 C CA    . SER F 6 30  ? 5.955   110.892 34.061  1.00 24.79  ? 30  SER H CA    1 
ATOM 10295 C C     . SER F 6 30  ? 4.960   111.869 33.466  1.00 24.13  ? 30  SER H C     1 
ATOM 10296 O O     . SER F 6 30  ? 4.598   111.761 32.293  1.00 23.85  ? 30  SER H O     1 
ATOM 10297 C CB    . SER F 6 30  ? 5.438   109.477 33.882  1.00 26.84  ? 30  SER H CB    1 
ATOM 10298 O OG    . SER F 6 30  ? 4.578   109.141 34.960  1.00 27.92  ? 30  SER H OG    1 
ATOM 10299 N N     . THR F 6 31  ? 4.483   112.794 34.291  1.00 23.83  ? 31  THR H N     1 
ATOM 10300 C CA    . THR F 6 31  ? 3.516   113.783 33.837  1.00 21.86  ? 31  THR H CA    1 
ATOM 10301 C C     . THR F 6 31  ? 4.133   115.126 33.446  1.00 19.91  ? 31  THR H C     1 
ATOM 10302 O O     . THR F 6 31  ? 4.967   115.697 34.163  1.00 17.80  ? 31  THR H O     1 
ATOM 10303 C CB    . THR F 6 31  ? 2.426   114.011 34.870  1.00 21.96  ? 31  THR H CB    1 
ATOM 10304 O OG1   . THR F 6 31  ? 2.026   112.756 35.446  1.00 18.43  ? 31  THR H OG1   1 
ATOM 10305 C CG2   . THR F 6 31  ? 1.247   114.679 34.196  1.00 23.32  ? 31  THR H CG2   1 
ATOM 10306 N N     . SER F 6 32  ? 3.662   115.633 32.318  1.00 18.97  ? 32  SER H N     1 
ATOM 10307 C CA    . SER F 6 32  ? 4.136   116.879 31.734  1.00 21.66  ? 32  SER H CA    1 
ATOM 10308 C C     . SER F 6 32  ? 4.733   117.983 32.597  1.00 21.28  ? 32  SER H C     1 
ATOM 10309 O O     . SER F 6 32  ? 5.811   118.483 32.302  1.00 19.47  ? 32  SER H O     1 
ATOM 10310 C CB    . SER F 6 32  ? 3.057   117.468 30.844  1.00 23.80  ? 32  SER H CB    1 
ATOM 10311 O OG    . SER F 6 32  ? 2.854   116.632 29.721  1.00 28.19  ? 32  SER H OG    1 
ATOM 10312 N N     . GLY F 6 33  ? 4.029   118.392 33.640  1.00 22.17  ? 33  GLY H N     1 
ATOM 10313 C CA    . GLY F 6 33  ? 4.560   119.460 34.467  1.00 23.26  ? 33  GLY H CA    1 
ATOM 10314 C C     . GLY F 6 33  ? 5.104   119.060 35.824  1.00 23.64  ? 33  GLY H C     1 
ATOM 10315 O O     . GLY F 6 33  ? 5.448   119.922 36.635  1.00 24.93  ? 33  GLY H O     1 
ATOM 10316 N N     . ILE F 6 34  ? 5.214   117.765 36.083  1.00 22.46  ? 34  ILE H N     1 
ATOM 10317 C CA    . ILE F 6 34  ? 5.705   117.332 37.379  1.00 21.55  ? 34  ILE H CA    1 
ATOM 10318 C C     . ILE F 6 34  ? 7.243   117.435 37.474  1.00 20.73  ? 34  ILE H C     1 
ATOM 10319 O O     . ILE F 6 34  ? 7.932   117.718 36.484  1.00 21.49  ? 34  ILE H O     1 
ATOM 10320 C CB    . ILE F 6 34  ? 5.207   115.901 37.689  1.00 22.35  ? 34  ILE H CB    1 
ATOM 10321 C CG1   . ILE F 6 34  ? 3.698   115.769 37.384  1.00 22.74  ? 34  ILE H CG1   1 
ATOM 10322 C CG2   . ILE F 6 34  ? 5.468   115.554 39.129  1.00 22.74  ? 34  ILE H CG2   1 
ATOM 10323 C CD1   . ILE F 6 34  ? 2.722   116.143 38.497  1.00 19.44  ? 34  ILE H CD1   1 
ATOM 10324 N N     . GLY F 6 35  ? 7.764   117.282 38.688  1.00 18.57  ? 35  GLY H N     1 
ATOM 10325 C CA    . GLY F 6 35  ? 9.196   117.342 38.911  1.00 15.16  ? 35  GLY H CA    1 
ATOM 10326 C C     . GLY F 6 35  ? 9.486   117.247 40.394  1.00 14.11  ? 35  GLY H C     1 
ATOM 10327 O O     . GLY F 6 35  ? 8.585   117.390 41.219  1.00 14.52  ? 35  GLY H O     1 
ATOM 10328 N N     . VAL F 6 36  ? 10.724  116.948 40.745  1.00 13.04  ? 36  VAL H N     1 
ATOM 10329 C CA    . VAL F 6 36  ? 11.088  116.880 42.150  1.00 14.08  ? 36  VAL H CA    1 
ATOM 10330 C C     . VAL F 6 36  ? 12.300  117.750 42.381  1.00 14.36  ? 36  VAL H C     1 
ATOM 10331 O O     . VAL F 6 36  ? 13.266  117.740 41.617  1.00 13.53  ? 36  VAL H O     1 
ATOM 10332 C CB    . VAL F 6 36  ? 11.370  115.464 42.610  1.00 14.66  ? 36  VAL H CB    1 
ATOM 10333 C CG1   . VAL F 6 36  ? 10.060  114.676 42.735  1.00 12.95  ? 36  VAL H CG1   1 
ATOM 10334 C CG2   . VAL F 6 36  ? 12.302  114.812 41.625  1.00 17.67  ? 36  VAL H CG2   1 
ATOM 10335 N N     . THR F 6 37  ? 12.244  118.495 43.464  1.00 15.19  ? 37  THR H N     1 
ATOM 10336 C CA    . THR F 6 37  ? 13.302  119.412 43.778  1.00 16.56  ? 37  THR H CA    1 
ATOM 10337 C C     . THR F 6 37  ? 14.036  119.045 45.020  1.00 18.08  ? 37  THR H C     1 
ATOM 10338 O O     . THR F 6 37  ? 13.477  118.443 45.927  1.00 18.78  ? 37  THR H O     1 
ATOM 10339 C CB    . THR F 6 37  ? 12.717  120.756 44.043  1.00 16.64  ? 37  THR H CB    1 
ATOM 10340 O OG1   . THR F 6 37  ? 11.773  121.052 43.016  1.00 19.81  ? 37  THR H OG1   1 
ATOM 10341 C CG2   . THR F 6 37  ? 13.797  121.806 44.076  1.00 18.31  ? 37  THR H CG2   1 
ATOM 10342 N N     . TRP F 6 38  ? 15.276  119.501 45.087  1.00 19.62  ? 38  TRP H N     1 
ATOM 10343 C CA    . TRP F 6 38  ? 16.103  119.281 46.251  1.00 21.42  ? 38  TRP H CA    1 
ATOM 10344 C C     . TRP F 6 38  ? 16.584  120.623 46.829  1.00 22.05  ? 38  TRP H C     1 
ATOM 10345 O O     . TRP F 6 38  ? 17.037  121.519 46.097  1.00 22.33  ? 38  TRP H O     1 
ATOM 10346 C CB    . TRP F 6 38  ? 17.273  118.377 45.893  1.00 22.87  ? 38  TRP H CB    1 
ATOM 10347 C CG    . TRP F 6 38  ? 16.866  116.971 45.619  1.00 22.42  ? 38  TRP H CG    1 
ATOM 10348 C CD1   . TRP F 6 38  ? 16.729  116.384 44.402  1.00 23.34  ? 38  TRP H CD1   1 
ATOM 10349 C CD2   . TRP F 6 38  ? 16.569  115.962 46.587  1.00 23.38  ? 38  TRP H CD2   1 
ATOM 10350 N NE1   . TRP F 6 38  ? 16.371  115.068 44.547  1.00 23.68  ? 38  TRP H NE1   1 
ATOM 10351 C CE2   . TRP F 6 38  ? 16.265  114.784 45.880  1.00 23.43  ? 38  TRP H CE2   1 
ATOM 10352 C CE3   . TRP F 6 38  ? 16.531  115.942 47.985  1.00 24.21  ? 38  TRP H CE3   1 
ATOM 10353 C CZ2   . TRP F 6 38  ? 15.925  113.593 46.520  1.00 24.71  ? 38  TRP H CZ2   1 
ATOM 10354 C CZ3   . TRP F 6 38  ? 16.191  114.751 48.627  1.00 25.39  ? 38  TRP H CZ3   1 
ATOM 10355 C CH2   . TRP F 6 38  ? 15.894  113.595 47.891  1.00 25.48  ? 38  TRP H CH2   1 
ATOM 10356 N N     . ILE F 6 39  ? 16.394  120.775 48.138  1.00 22.09  ? 39  ILE H N     1 
ATOM 10357 C CA    . ILE F 6 39  ? 16.793  121.975 48.869  1.00 21.47  ? 39  ILE H CA    1 
ATOM 10358 C C     . ILE F 6 39  ? 17.565  121.580 50.118  1.00 23.15  ? 39  ILE H C     1 
ATOM 10359 O O     . ILE F 6 39  ? 17.386  120.497 50.677  1.00 21.35  ? 39  ILE H O     1 
ATOM 10360 C CB    . ILE F 6 39  ? 15.585  122.870 49.230  1.00 19.73  ? 39  ILE H CB    1 
ATOM 10361 C CG1   . ILE F 6 39  ? 15.044  123.520 47.956  1.00 18.41  ? 39  ILE H CG1   1 
ATOM 10362 C CG2   . ILE F 6 39  ? 15.977  123.936 50.254  1.00 17.06  ? 39  ILE H CG2   1 
ATOM 10363 C CD1   . ILE F 6 39  ? 13.599  123.215 47.707  1.00 16.81  ? 39  ILE H CD1   1 
ATOM 10364 N N     . ARG F 6 40  ? 18.438  122.479 50.540  1.00 25.25  ? 40  ARG H N     1 
ATOM 10365 C CA    . ARG F 6 40  ? 19.295  122.241 51.682  1.00 28.22  ? 40  ARG H CA    1 
ATOM 10366 C C     . ARG F 6 40  ? 19.172  123.445 52.618  1.00 29.81  ? 40  ARG H C     1 
ATOM 10367 O O     . ARG F 6 40  ? 19.332  124.584 52.176  1.00 31.02  ? 40  ARG H O     1 
ATOM 10368 C CB    . ARG F 6 40  ? 20.730  122.129 51.146  1.00 28.58  ? 40  ARG H CB    1 
ATOM 10369 C CG    . ARG F 6 40  ? 21.719  121.281 51.931  1.00 30.27  ? 40  ARG H CG    1 
ATOM 10370 C CD    . ARG F 6 40  ? 23.030  121.089 51.131  1.00 30.12  ? 40  ARG H CD    1 
ATOM 10371 N NE    . ARG F 6 40  ? 23.605  122.336 50.607  1.00 30.96  ? 40  ARG H NE    1 
ATOM 10372 C CZ    . ARG F 6 40  ? 24.863  122.729 50.809  1.00 30.68  ? 40  ARG H CZ    1 
ATOM 10373 N NH1   . ARG F 6 40  ? 25.683  121.973 51.530  1.00 28.95  ? 40  ARG H NH1   1 
ATOM 10374 N NH2   . ARG F 6 40  ? 25.306  123.871 50.284  1.00 29.81  ? 40  ARG H NH2   1 
ATOM 10375 N N     . GLN F 6 41  ? 18.808  123.203 53.880  1.00 30.35  ? 41  GLN H N     1 
ATOM 10376 C CA    . GLN F 6 41  ? 18.704  124.278 54.862  1.00 29.17  ? 41  GLN H CA    1 
ATOM 10377 C C     . GLN F 6 41  ? 19.706  124.001 55.944  1.00 28.86  ? 41  GLN H C     1 
ATOM 10378 O O     . GLN F 6 41  ? 19.554  123.075 56.744  1.00 28.64  ? 41  GLN H O     1 
ATOM 10379 C CB    . GLN F 6 41  ? 17.319  124.412 55.472  1.00 29.73  ? 41  GLN H CB    1 
ATOM 10380 C CG    . GLN F 6 41  ? 17.304  125.468 56.559  1.00 32.47  ? 41  GLN H CG    1 
ATOM 10381 C CD    . GLN F 6 41  ? 15.926  126.015 56.829  1.00 34.95  ? 41  GLN H CD    1 
ATOM 10382 O OE1   . GLN F 6 41  ? 15.092  125.348 57.444  1.00 36.45  ? 41  GLN H OE1   1 
ATOM 10383 N NE2   . GLN F 6 41  ? 15.677  127.244 56.379  1.00 36.38  ? 41  GLN H NE2   1 
ATOM 10384 N N     . PRO F 6 42  ? 20.738  124.835 55.993  1.00 29.06  ? 42  PRO H N     1 
ATOM 10385 C CA    . PRO F 6 42  ? 21.864  124.808 56.914  1.00 30.14  ? 42  PRO H CA    1 
ATOM 10386 C C     . PRO F 6 42  ? 21.556  125.203 58.326  1.00 31.96  ? 42  PRO H C     1 
ATOM 10387 O O     . PRO F 6 42  ? 20.405  125.409 58.722  1.00 31.76  ? 42  PRO H O     1 
ATOM 10388 C CB    . PRO F 6 42  ? 22.820  125.822 56.303  1.00 29.71  ? 42  PRO H CB    1 
ATOM 10389 C CG    . PRO F 6 42  ? 22.307  126.015 54.894  1.00 28.49  ? 42  PRO H CG    1 
ATOM 10390 C CD    . PRO F 6 42  ? 20.859  125.977 55.083  1.00 27.66  ? 42  PRO H CD    1 
ATOM 10391 N N     . SER F 6 43  ? 22.635  125.291 59.086  1.00 35.07  ? 43  SER H N     1 
ATOM 10392 C CA    . SER F 6 43  ? 22.554  125.693 60.466  1.00 38.93  ? 43  SER H CA    1 
ATOM 10393 C C     . SER F 6 43  ? 22.150  127.153 60.396  1.00 40.00  ? 43  SER H C     1 
ATOM 10394 O O     . SER F 6 43  ? 22.901  127.994 59.868  1.00 39.25  ? 43  SER H O     1 
ATOM 10395 C CB    . SER F 6 43  ? 23.919  125.552 61.147  1.00 40.94  ? 43  SER H CB    1 
ATOM 10396 O OG    . SER F 6 43  ? 24.303  124.187 61.269  1.00 44.21  ? 43  SER H OG    1 
ATOM 10397 N N     . GLY F 6 44  ? 20.902  127.406 60.794  1.00 40.93  ? 44  GLY H N     1 
ATOM 10398 C CA    . GLY F 6 44  ? 20.361  128.754 60.798  1.00 42.11  ? 44  GLY H CA    1 
ATOM 10399 C C     . GLY F 6 44  ? 20.202  129.469 59.461  1.00 42.15  ? 44  GLY H C     1 
ATOM 10400 O O     . GLY F 6 44  ? 19.329  130.336 59.333  1.00 41.64  ? 44  GLY H O     1 
ATOM 10401 N N     . LYS F 6 45  ? 21.059  129.165 58.483  1.00 41.82  ? 45  LYS H N     1 
ATOM 10402 C CA    . LYS F 6 45  ? 20.951  129.805 57.177  1.00 41.18  ? 45  LYS H CA    1 
ATOM 10403 C C     . LYS F 6 45  ? 19.567  129.511 56.571  1.00 39.67  ? 45  LYS H C     1 
ATOM 10404 O O     . LYS F 6 45  ? 18.825  128.679 57.097  1.00 40.28  ? 45  LYS H O     1 
ATOM 10405 C CB    . LYS F 6 45  ? 22.093  129.362 56.256  1.00 42.87  ? 45  LYS H CB    1 
ATOM 10406 C CG    . LYS F 6 45  ? 23.436  130.092 56.498  1.00 44.68  ? 45  LYS H CG    1 
ATOM 10407 C CD    . LYS F 6 45  ? 24.527  129.673 55.469  1.00 47.17  ? 45  LYS H CD    1 
ATOM 10408 C CE    . LYS F 6 45  ? 24.073  129.881 53.998  1.00 48.07  ? 45  LYS H CE    1 
ATOM 10409 N NZ    . LYS F 6 45  ? 24.998  129.333 52.941  1.00 48.30  ? 45  LYS H NZ    1 
ATOM 10410 N N     . GLY F 6 46  ? 19.217  130.207 55.492  1.00 37.44  ? 46  GLY H N     1 
ATOM 10411 C CA    . GLY F 6 46  ? 17.906  130.043 54.870  1.00 36.73  ? 46  GLY H CA    1 
ATOM 10412 C C     . GLY F 6 46  ? 17.592  128.852 53.975  1.00 35.89  ? 46  GLY H C     1 
ATOM 10413 O O     . GLY F 6 46  ? 17.644  127.701 54.400  1.00 35.52  ? 46  GLY H O     1 
ATOM 10414 N N     . LEU F 6 47  ? 17.160  129.138 52.753  1.00 35.12  ? 47  LEU H N     1 
ATOM 10415 C CA    . LEU F 6 47  ? 16.825  128.088 51.803  1.00 33.84  ? 47  LEU H CA    1 
ATOM 10416 C C     . LEU F 6 47  ? 17.691  128.165 50.568  1.00 34.20  ? 47  LEU H C     1 
ATOM 10417 O O     . LEU F 6 47  ? 17.642  129.147 49.832  1.00 34.29  ? 47  LEU H O     1 
ATOM 10418 C CB    . LEU F 6 47  ? 15.366  128.181 51.378  1.00 30.82  ? 47  LEU H CB    1 
ATOM 10419 C CG    . LEU F 6 47  ? 14.283  127.822 52.374  1.00 29.01  ? 47  LEU H CG    1 
ATOM 10420 C CD1   . LEU F 6 47  ? 13.130  127.252 51.571  1.00 27.76  ? 47  LEU H CD1   1 
ATOM 10421 C CD2   . LEU F 6 47  ? 14.791  126.799 53.371  1.00 26.56  ? 47  LEU H CD2   1 
ATOM 10422 N N     . GLU F 6 48  ? 18.465  127.111 50.337  1.00 35.28  ? 48  GLU H N     1 
ATOM 10423 C CA    . GLU F 6 48  ? 19.349  127.033 49.181  1.00 36.85  ? 48  GLU H CA    1 
ATOM 10424 C C     . GLU F 6 48  ? 18.777  125.969 48.233  1.00 35.75  ? 48  GLU H C     1 
ATOM 10425 O O     . GLU F 6 48  ? 18.203  124.967 48.673  1.00 34.35  ? 48  GLU H O     1 
ATOM 10426 C CB    . GLU F 6 48  ? 20.791  126.686 49.640  1.00 40.36  ? 48  GLU H CB    1 
ATOM 10427 C CG    . GLU F 6 48  ? 21.940  126.951 48.616  1.00 44.28  ? 48  GLU H CG    1 
ATOM 10428 C CD    . GLU F 6 48  ? 23.379  126.837 49.207  1.00 47.50  ? 48  GLU H CD    1 
ATOM 10429 O OE1   . GLU F 6 48  ? 24.327  127.374 48.580  1.00 47.94  ? 48  GLU H OE1   1 
ATOM 10430 O OE2   . GLU F 6 48  ? 23.577  126.213 50.280  1.00 49.12  ? 48  GLU H OE2   1 
ATOM 10431 N N     . TRP F 6 49  ? 18.867  126.233 46.935  1.00 35.30  ? 49  TRP H N     1 
ATOM 10432 C CA    . TRP F 6 49  ? 18.376  125.296 45.933  1.00 34.92  ? 49  TRP H CA    1 
ATOM 10433 C C     . TRP F 6 49  ? 19.500  124.437 45.404  1.00 33.99  ? 49  TRP H C     1 
ATOM 10434 O O     . TRP F 6 49  ? 20.440  124.934 44.787  1.00 32.91  ? 49  TRP H O     1 
ATOM 10435 C CB    . TRP F 6 49  ? 17.756  126.035 44.759  1.00 36.92  ? 49  TRP H CB    1 
ATOM 10436 C CG    . TRP F 6 49  ? 17.393  125.151 43.598  1.00 37.90  ? 49  TRP H CG    1 
ATOM 10437 C CD1   . TRP F 6 49  ? 16.224  124.486 43.426  1.00 38.61  ? 49  TRP H CD1   1 
ATOM 10438 C CD2   . TRP F 6 49  ? 18.162  124.929 42.406  1.00 41.19  ? 49  TRP H CD2   1 
ATOM 10439 N NE1   . TRP F 6 49  ? 16.197  123.879 42.197  1.00 40.83  ? 49  TRP H NE1   1 
ATOM 10440 C CE2   . TRP F 6 49  ? 17.374  124.134 41.547  1.00 41.57  ? 49  TRP H CE2   1 
ATOM 10441 C CE3   . TRP F 6 49  ? 19.436  125.331 41.977  1.00 41.62  ? 49  TRP H CE3   1 
ATOM 10442 C CZ2   . TRP F 6 49  ? 17.815  123.729 40.275  1.00 42.63  ? 49  TRP H CZ2   1 
ATOM 10443 C CZ3   . TRP F 6 49  ? 19.879  124.928 40.711  1.00 43.14  ? 49  TRP H CZ3   1 
ATOM 10444 C CH2   . TRP F 6 49  ? 19.065  124.135 39.877  1.00 43.77  ? 49  TRP H CH2   1 
ATOM 10445 N N     . LEU F 6 50  ? 19.380  123.137 45.609  1.00 33.15  ? 50  LEU H N     1 
ATOM 10446 C CA    . LEU F 6 50  ? 20.396  122.228 45.128  1.00 32.08  ? 50  LEU H CA    1 
ATOM 10447 C C     . LEU F 6 50  ? 20.081  121.979 43.686  1.00 30.42  ? 50  LEU H C     1 
ATOM 10448 O O     . LEU F 6 50  ? 20.867  122.343 42.823  1.00 31.82  ? 50  LEU H O     1 
ATOM 10449 C CB    . LEU F 6 50  ? 20.365  120.951 45.933  1.00 32.54  ? 50  LEU H CB    1 
ATOM 10450 C CG    . LEU F 6 50  ? 20.376  121.427 47.384  1.00 34.96  ? 50  LEU H CG    1 
ATOM 10451 C CD1   . LEU F 6 50  ? 20.221  120.257 48.328  1.00 36.88  ? 50  LEU H CD1   1 
ATOM 10452 C CD2   . LEU F 6 50  ? 21.660  122.218 47.662  1.00 36.26  ? 50  LEU H CD2   1 
ATOM 10453 N N     . ALA F 6 51  ? 18.891  121.457 43.418  1.00 27.94  ? 51  ALA H N     1 
ATOM 10454 C CA    . ALA F 6 51  ? 18.500  121.216 42.044  1.00 26.60  ? 51  ALA H CA    1 
ATOM 10455 C C     . ALA F 6 51  ? 17.080  120.709 41.865  1.00 26.18  ? 51  ALA H C     1 
ATOM 10456 O O     . ALA F 6 51  ? 16.315  120.618 42.828  1.00 25.00  ? 51  ALA H O     1 
ATOM 10457 C CB    . ALA F 6 51  ? 19.479  120.280 41.387  1.00 26.42  ? 51  ALA H CB    1 
ATOM 10458 N N     . THR F 6 52  ? 16.725  120.423 40.612  1.00 26.81  ? 52  THR H N     1 
ATOM 10459 C CA    . THR F 6 52  ? 15.404  119.901 40.289  1.00 27.81  ? 52  THR H CA    1 
ATOM 10460 C C     . THR F 6 52  ? 15.346  118.936 39.118  1.00 27.91  ? 52  THR H C     1 
ATOM 10461 O O     . THR F 6 52  ? 15.644  119.290 37.975  1.00 27.11  ? 52  THR H O     1 
ATOM 10462 C CB    . THR F 6 52  ? 14.424  121.007 40.044  1.00 27.64  ? 52  THR H CB    1 
ATOM 10463 O OG1   . THR F 6 52  ? 14.345  121.802 41.227  1.00 28.38  ? 52  THR H OG1   1 
ATOM 10464 C CG2   . THR F 6 52  ? 13.045  120.427 39.711  1.00 28.10  ? 52  THR H CG2   1 
ATOM 10465 N N     . ILE F 6 53  ? 14.889  117.728 39.421  1.00 29.41  ? 53  ILE H N     1 
ATOM 10466 C CA    . ILE F 6 53  ? 14.770  116.659 38.443  1.00 32.33  ? 53  ILE H CA    1 
ATOM 10467 C C     . ILE F 6 53  ? 13.455  116.824 37.722  1.00 33.26  ? 53  ILE H C     1 
ATOM 10468 O O     . ILE F 6 53  ? 12.411  116.864 38.376  1.00 34.49  ? 53  ILE H O     1 
ATOM 10469 C CB    . ILE F 6 53  ? 14.763  115.295 39.148  1.00 33.24  ? 53  ILE H CB    1 
ATOM 10470 C CG1   . ILE F 6 53  ? 15.881  115.266 40.203  1.00 32.84  ? 53  ILE H CG1   1 
ATOM 10471 C CG2   . ILE F 6 53  ? 14.889  114.165 38.115  1.00 33.17  ? 53  ILE H CG2   1 
ATOM 10472 C CD1   . ILE F 6 53  ? 16.010  113.969 40.974  1.00 33.44  ? 53  ILE H CD1   1 
ATOM 10473 N N     . TRP F 6 54  ? 13.497  116.906 36.391  1.00 34.16  ? 54  TRP H N     1 
ATOM 10474 C CA    . TRP F 6 54  ? 12.274  117.083 35.599  1.00 35.82  ? 54  TRP H CA    1 
ATOM 10475 C C     . TRP F 6 54  ? 11.788  115.835 34.876  1.00 34.61  ? 54  TRP H C     1 
ATOM 10476 O O     . TRP F 6 54  ? 12.576  115.010 34.439  1.00 34.60  ? 54  TRP H O     1 
ATOM 10477 C CB    . TRP F 6 54  ? 12.417  118.244 34.607  1.00 39.54  ? 54  TRP H CB    1 
ATOM 10478 C CG    . TRP F 6 54  ? 12.576  119.597 35.270  1.00 44.45  ? 54  TRP H CG    1 
ATOM 10479 C CD1   . TRP F 6 54  ? 13.743  120.165 35.726  1.00 45.40  ? 54  TRP H CD1   1 
ATOM 10480 C CD2   . TRP F 6 54  ? 11.535  120.542 35.560  1.00 44.17  ? 54  TRP H CD2   1 
ATOM 10481 N NE1   . TRP F 6 54  ? 13.487  121.400 36.280  1.00 45.44  ? 54  TRP H NE1   1 
ATOM 10482 C CE2   . TRP F 6 54  ? 12.142  121.658 36.190  1.00 45.17  ? 54  TRP H CE2   1 
ATOM 10483 C CE3   . TRP F 6 54  ? 10.148  120.555 35.351  1.00 44.86  ? 54  TRP H CE3   1 
ATOM 10484 C CZ2   . TRP F 6 54  ? 11.410  122.772 36.611  1.00 44.13  ? 54  TRP H CZ2   1 
ATOM 10485 C CZ3   . TRP F 6 54  ? 9.423   121.665 35.773  1.00 45.33  ? 54  TRP H CZ3   1 
ATOM 10486 C CH2   . TRP F 6 54  ? 10.057  122.758 36.394  1.00 44.06  ? 54  TRP H CH2   1 
ATOM 10487 N N     . TRP F 6 55  ? 10.473  115.749 34.716  1.00 34.21  ? 55  TRP H N     1 
ATOM 10488 C CA    . TRP F 6 55  ? 9.795   114.624 34.082  1.00 34.40  ? 55  TRP H CA    1 
ATOM 10489 C C     . TRP F 6 55  ? 10.337  114.173 32.741  1.00 34.40  ? 55  TRP H C     1 
ATOM 10490 O O     . TRP F 6 55  ? 10.545  112.993 32.534  1.00 34.45  ? 55  TRP H O     1 
ATOM 10491 C CB    . TRP F 6 55  ? 8.320   114.955 33.928  1.00 34.63  ? 55  TRP H CB    1 
ATOM 10492 C CG    . TRP F 6 55  ? 8.109   116.025 32.946  1.00 36.07  ? 55  TRP H CG    1 
ATOM 10493 C CD1   . TRP F 6 55  ? 8.536   117.326 33.025  1.00 35.93  ? 55  TRP H CD1   1 
ATOM 10494 C CD2   . TRP F 6 55  ? 7.507   115.874 31.677  1.00 36.65  ? 55  TRP H CD2   1 
ATOM 10495 N NE1   . TRP F 6 55  ? 8.242   117.990 31.863  1.00 33.89  ? 55  TRP H NE1   1 
ATOM 10496 C CE2   . TRP F 6 55  ? 7.608   117.121 31.017  1.00 36.51  ? 55  TRP H CE2   1 
ATOM 10497 C CE3   . TRP F 6 55  ? 6.886   114.802 31.025  1.00 37.87  ? 55  TRP H CE3   1 
ATOM 10498 C CZ2   . TRP F 6 55  ? 7.113   117.327 29.737  1.00 38.04  ? 55  TRP H CZ2   1 
ATOM 10499 C CZ3   . TRP F 6 55  ? 6.391   115.003 29.750  1.00 40.49  ? 55  TRP H CZ3   1 
ATOM 10500 C CH2   . TRP F 6 55  ? 6.506   116.263 29.116  1.00 40.45  ? 55  TRP H CH2   1 
ATOM 10501 N N     . ASP F 6 56  ? 10.553  115.104 31.827  1.00 36.29  ? 56  ASP H N     1 
ATOM 10502 C CA    . ASP F 6 56  ? 11.057  114.756 30.506  1.00 40.21  ? 56  ASP H CA    1 
ATOM 10503 C C     . ASP F 6 56  ? 12.530  114.363 30.534  1.00 40.87  ? 56  ASP H C     1 
ATOM 10504 O O     . ASP F 6 56  ? 13.126  114.097 29.492  1.00 41.13  ? 56  ASP H O     1 
ATOM 10505 C CB    . ASP F 6 56  ? 10.884  115.933 29.555  1.00 43.75  ? 56  ASP H CB    1 
ATOM 10506 C CG    . ASP F 6 56  ? 11.912  117.021 29.796  1.00 47.63  ? 56  ASP H CG    1 
ATOM 10507 O OD1   . ASP F 6 56  ? 12.126  117.386 30.972  1.00 49.90  ? 56  ASP H OD1   1 
ATOM 10508 O OD2   . ASP F 6 56  ? 12.530  117.487 28.815  1.00 51.49  ? 56  ASP H OD2   1 
ATOM 10509 N N     . ASP F 6 57  ? 13.116  114.387 31.725  1.00 42.64  ? 57  ASP H N     1 
ATOM 10510 C CA    . ASP F 6 57  ? 14.524  114.048 31.944  1.00 45.71  ? 57  ASP H CA    1 
ATOM 10511 C C     . ASP F 6 57  ? 15.502  115.237 31.799  1.00 45.40  ? 57  ASP H C     1 
ATOM 10512 O O     . ASP F 6 57  ? 16.721  115.061 31.740  1.00 46.00  ? 57  ASP H O     1 
ATOM 10513 C CB    . ASP F 6 57  ? 14.951  112.835 31.088  1.00 50.01  ? 57  ASP H CB    1 
ATOM 10514 C CG    . ASP F 6 57  ? 16.397  112.401 31.351  1.00 52.47  ? 57  ASP H CG    1 
ATOM 10515 O OD1   . ASP F 6 57  ? 16.797  112.331 32.544  1.00 55.20  ? 57  ASP H OD1   1 
ATOM 10516 O OD2   . ASP F 6 57  ? 17.135  112.152 30.361  1.00 51.93  ? 57  ASP H OD2   1 
ATOM 10517 N N     . ASP F 6 58  ? 14.973  116.452 31.769  1.00 44.11  ? 58  ASP H N     1 
ATOM 10518 C CA    . ASP F 6 58  ? 15.822  117.638 31.693  1.00 43.35  ? 58  ASP H CA    1 
ATOM 10519 C C     . ASP F 6 58  ? 16.194  118.076 33.128  1.00 42.48  ? 58  ASP H C     1 
ATOM 10520 O O     . ASP F 6 58  ? 15.410  118.727 33.813  1.00 41.53  ? 58  ASP H O     1 
ATOM 10521 C CB    . ASP F 6 58  ? 15.074  118.749 30.941  1.00 42.68  ? 58  ASP H CB    1 
ATOM 10522 C CG    . ASP F 6 58  ? 15.763  120.112 31.021  1.00 43.50  ? 58  ASP H CG    1 
ATOM 10523 O OD1   . ASP F 6 58  ? 16.903  120.231 31.541  1.00 42.57  ? 58  ASP H OD1   1 
ATOM 10524 O OD2   . ASP F 6 58  ? 15.129  121.079 30.547  1.00 43.33  ? 58  ASP H OD2   1 
ATOM 10525 N N     . ASN F 6 59  ? 17.387  117.722 33.589  1.00 41.58  ? 59  ASN H N     1 
ATOM 10526 C CA    . ASN F 6 59  ? 17.779  118.118 34.933  1.00 41.42  ? 59  ASN H CA    1 
ATOM 10527 C C     . ASN F 6 59  ? 18.596  119.398 34.932  1.00 39.62  ? 59  ASN H C     1 
ATOM 10528 O O     . ASN F 6 59  ? 19.313  119.674 33.974  1.00 40.30  ? 59  ASN H O     1 
ATOM 10529 C CB    . ASN F 6 59  ? 18.495  116.980 35.699  1.00 44.51  ? 59  ASN H CB    1 
ATOM 10530 C CG    . ASN F 6 59  ? 19.412  116.111 34.812  1.00 48.95  ? 59  ASN H CG    1 
ATOM 10531 O OD1   . ASN F 6 59  ? 20.645  116.118 34.962  1.00 49.12  ? 59  ASN H OD1   1 
ATOM 10532 N ND2   . ASN F 6 59  ? 18.802  115.299 33.945  1.00 50.83  ? 59  ASN H ND2   1 
ATOM 10533 N N     . ARG F 6 60  ? 18.405  120.219 35.965  1.00 38.08  ? 60  ARG H N     1 
ATOM 10534 C CA    . ARG F 6 60  ? 19.131  121.484 36.114  1.00 36.30  ? 60  ARG H CA    1 
ATOM 10535 C C     . ARG F 6 60  ? 19.742  121.511 37.507  1.00 35.48  ? 60  ARG H C     1 
ATOM 10536 O O     . ARG F 6 60  ? 19.023  121.502 38.513  1.00 33.49  ? 60  ARG H O     1 
ATOM 10537 C CB    . ARG F 6 60  ? 18.197  122.685 35.980  1.00 36.64  ? 60  ARG H CB    1 
ATOM 10538 C CG    . ARG F 6 60  ? 17.215  122.622 34.838  1.00 37.58  ? 60  ARG H CG    1 
ATOM 10539 C CD    . ARG F 6 60  ? 17.913  122.720 33.515  1.00 40.32  ? 60  ARG H CD    1 
ATOM 10540 N NE    . ARG F 6 60  ? 16.971  123.084 32.463  1.00 42.43  ? 60  ARG H NE    1 
ATOM 10541 C CZ    . ARG F 6 60  ? 16.908  124.289 31.897  1.00 44.52  ? 60  ARG H CZ    1 
ATOM 10542 N NH1   . ARG F 6 60  ? 17.744  125.253 32.283  1.00 45.42  ? 60  ARG H NH1   1 
ATOM 10543 N NH2   . ARG F 6 60  ? 15.994  124.538 30.961  1.00 44.12  ? 60  ARG H NH2   1 
ATOM 10544 N N     . TYR F 6 61  ? 21.071  121.555 37.550  1.00 35.29  ? 61  TYR H N     1 
ATOM 10545 C CA    . TYR F 6 61  ? 21.835  121.574 38.803  1.00 34.71  ? 61  TYR H CA    1 
ATOM 10546 C C     . TYR F 6 61  ? 22.253  122.981 39.209  1.00 33.28  ? 61  TYR H C     1 
ATOM 10547 O O     . TYR F 6 61  ? 22.202  123.905 38.411  1.00 34.56  ? 61  TYR H O     1 
ATOM 10548 C CB    . TYR F 6 61  ? 23.114  120.734 38.659  1.00 34.91  ? 61  TYR H CB    1 
ATOM 10549 C CG    . TYR F 6 61  ? 22.891  119.260 38.413  1.00 35.94  ? 61  TYR H CG    1 
ATOM 10550 C CD1   . TYR F 6 61  ? 22.140  118.813 37.314  1.00 37.48  ? 61  TYR H CD1   1 
ATOM 10551 C CD2   . TYR F 6 61  ? 23.398  118.311 39.293  1.00 36.82  ? 61  TYR H CD2   1 
ATOM 10552 C CE1   . TYR F 6 61  ? 21.895  117.446 37.103  1.00 38.79  ? 61  TYR H CE1   1 
ATOM 10553 C CE2   . TYR F 6 61  ? 23.158  116.954 39.093  1.00 38.27  ? 61  TYR H CE2   1 
ATOM 10554 C CZ    . TYR F 6 61  ? 22.405  116.517 37.999  1.00 39.21  ? 61  TYR H CZ    1 
ATOM 10555 O OH    . TYR F 6 61  ? 22.149  115.167 37.813  1.00 39.23  ? 61  TYR H OH    1 
ATOM 10556 N N     . ASN F 6 62  ? 22.669  123.150 40.454  1.00 31.84  ? 62  ASN H N     1 
ATOM 10557 C CA    . ASN F 6 62  ? 23.127  124.454 40.873  1.00 31.31  ? 62  ASN H CA    1 
ATOM 10558 C C     . ASN F 6 62  ? 24.493  124.662 40.240  1.00 30.76  ? 62  ASN H C     1 
ATOM 10559 O O     . ASN F 6 62  ? 25.315  123.745 40.214  1.00 30.27  ? 62  ASN H O     1 
ATOM 10560 C CB    . ASN F 6 62  ? 23.260  124.529 42.387  1.00 32.85  ? 62  ASN H CB    1 
ATOM 10561 C CG    . ASN F 6 62  ? 24.237  125.605 42.827  1.00 33.88  ? 62  ASN H CG    1 
ATOM 10562 O OD1   . ASN F 6 62  ? 24.172  126.752 42.378  1.00 34.12  ? 62  ASN H OD1   1 
ATOM 10563 N ND2   . ASN F 6 62  ? 25.170  125.228 43.682  1.00 34.04  ? 62  ASN H ND2   1 
ATOM 10564 N N     . PRO F 6 63  ? 24.740  125.864 39.697  1.00 30.80  ? 63  PRO H N     1 
ATOM 10565 C CA    . PRO F 6 63  ? 26.013  126.212 39.059  1.00 31.30  ? 63  PRO H CA    1 
ATOM 10566 C C     . PRO F 6 63  ? 27.158  126.088 40.046  1.00 31.17  ? 63  PRO H C     1 
ATOM 10567 O O     . PRO F 6 63  ? 28.299  125.797 39.680  1.00 32.97  ? 63  PRO H O     1 
ATOM 10568 C CB    . PRO F 6 63  ? 25.801  127.669 38.651  1.00 31.36  ? 63  PRO H CB    1 
ATOM 10569 C CG    . PRO F 6 63  ? 24.736  128.153 39.610  1.00 30.96  ? 63  PRO H CG    1 
ATOM 10570 C CD    . PRO F 6 63  ? 23.798  126.992 39.607  1.00 30.35  ? 63  PRO H CD    1 
ATOM 10571 N N     . SER F 6 64  ? 26.848  126.324 41.307  1.00 29.76  ? 64  SER H N     1 
ATOM 10572 C CA    . SER F 6 64  ? 27.867  126.215 42.309  1.00 31.25  ? 64  SER H CA    1 
ATOM 10573 C C     . SER F 6 64  ? 28.007  124.775 42.792  1.00 31.82  ? 64  SER H C     1 
ATOM 10574 O O     . SER F 6 64  ? 28.915  124.469 43.562  1.00 34.26  ? 64  SER H O     1 
ATOM 10575 C CB    . SER F 6 64  ? 27.547  127.143 43.473  1.00 32.46  ? 64  SER H CB    1 
ATOM 10576 O OG    . SER F 6 64  ? 28.500  127.010 44.518  1.00 34.72  ? 64  SER H OG    1 
ATOM 10577 N N     . LEU F 6 65  ? 27.147  123.873 42.324  1.00 31.86  ? 65  LEU H N     1 
ATOM 10578 C CA    . LEU F 6 65  ? 27.233  122.495 42.798  1.00 31.80  ? 65  LEU H CA    1 
ATOM 10579 C C     . LEU F 6 65  ? 27.307  121.394 41.783  1.00 29.91  ? 65  LEU H C     1 
ATOM 10580 O O     . LEU F 6 65  ? 27.989  120.408 42.025  1.00 26.62  ? 65  LEU H O     1 
ATOM 10581 C CB    . LEU F 6 65  ? 26.086  122.178 43.760  1.00 36.36  ? 65  LEU H CB    1 
ATOM 10582 C CG    . LEU F 6 65  ? 26.090  122.876 45.128  1.00 39.87  ? 65  LEU H CG    1 
ATOM 10583 C CD1   . LEU F 6 65  ? 24.885  122.402 45.961  1.00 40.65  ? 65  LEU H CD1   1 
ATOM 10584 C CD2   . LEU F 6 65  ? 27.424  122.628 45.872  1.00 40.86  ? 65  LEU H CD2   1 
ATOM 10585 N N     . LYS F 6 66  ? 26.571  121.544 40.683  1.00 30.74  ? 66  LYS H N     1 
ATOM 10586 C CA    . LYS F 6 66  ? 26.507  120.542 39.628  1.00 32.97  ? 66  LYS H CA    1 
ATOM 10587 C C     . LYS F 6 66  ? 27.727  119.677 39.623  1.00 33.36  ? 66  LYS H C     1 
ATOM 10588 O O     . LYS F 6 66  ? 27.638  118.461 39.740  1.00 33.28  ? 66  LYS H O     1 
ATOM 10589 C CB    . LYS F 6 66  ? 26.364  121.185 38.255  1.00 35.68  ? 66  LYS H CB    1 
ATOM 10590 C CG    . LYS F 6 66  ? 26.354  120.168 37.097  1.00 40.43  ? 66  LYS H CG    1 
ATOM 10591 C CD    . LYS F 6 66  ? 27.772  119.749 36.627  1.00 44.96  ? 66  LYS H CD    1 
ATOM 10592 C CE    . LYS F 6 66  ? 27.894  118.233 36.336  1.00 46.93  ? 66  LYS H CE    1 
ATOM 10593 N NZ    . LYS F 6 66  ? 27.574  117.350 37.519  1.00 48.99  ? 66  LYS H NZ    1 
ATOM 10594 N N     . SER F 6 67  ? 28.867  120.337 39.478  1.00 33.94  ? 67  SER H N     1 
ATOM 10595 C CA    . SER F 6 67  ? 30.162  119.686 39.458  1.00 36.35  ? 67  SER H CA    1 
ATOM 10596 C C     . SER F 6 67  ? 30.199  118.485 40.405  1.00 36.05  ? 67  SER H C     1 
ATOM 10597 O O     . SER F 6 67  ? 30.397  117.355 39.967  1.00 36.55  ? 67  SER H O     1 
ATOM 10598 C CB    . SER F 6 67  ? 31.218  120.709 39.847  1.00 38.37  ? 67  SER H CB    1 
ATOM 10599 O OG    . SER F 6 67  ? 30.743  121.480 40.939  1.00 43.34  ? 67  SER H OG    1 
ATOM 10600 N N     . ARG F 6 68  ? 29.981  118.719 41.694  1.00 35.52  ? 68  ARG H N     1 
ATOM 10601 C CA    . ARG F 6 68  ? 29.970  117.611 42.643  1.00 36.83  ? 68  ARG H CA    1 
ATOM 10602 C C     . ARG F 6 68  ? 28.536  117.215 43.016  1.00 36.73  ? 68  ARG H C     1 
ATOM 10603 O O     . ARG F 6 68  ? 28.274  116.644 44.087  1.00 37.46  ? 68  ARG H O     1 
ATOM 10604 C CB    . ARG F 6 68  ? 30.827  117.906 43.891  1.00 39.01  ? 68  ARG H CB    1 
ATOM 10605 C CG    . ARG F 6 68  ? 30.752  119.330 44.457  1.00 41.25  ? 68  ARG H CG    1 
ATOM 10606 C CD    . ARG F 6 68  ? 31.456  119.446 45.821  1.00 42.40  ? 68  ARG H CD    1 
ATOM 10607 N NE    . ARG F 6 68  ? 30.739  118.697 46.852  1.00 44.43  ? 68  ARG H NE    1 
ATOM 10608 C CZ    . ARG F 6 68  ? 30.311  119.211 48.004  1.00 45.53  ? 68  ARG H CZ    1 
ATOM 10609 N NH1   . ARG F 6 68  ? 30.529  120.491 48.296  1.00 45.34  ? 68  ARG H NH1   1 
ATOM 10610 N NH2   . ARG F 6 68  ? 29.645  118.442 48.860  1.00 44.86  ? 68  ARG H NH2   1 
ATOM 10611 N N     . LEU F 6 69  ? 27.616  117.471 42.094  1.00 34.66  ? 69  LEU H N     1 
ATOM 10612 C CA    . LEU F 6 69  ? 26.224  117.151 42.327  1.00 32.00  ? 69  LEU H CA    1 
ATOM 10613 C C     . LEU F 6 69  ? 25.622  116.348 41.185  1.00 30.92  ? 69  LEU H C     1 
ATOM 10614 O O     . LEU F 6 69  ? 25.952  116.553 40.007  1.00 30.00  ? 69  LEU H O     1 
ATOM 10615 C CB    . LEU F 6 69  ? 25.430  118.435 42.529  1.00 30.92  ? 69  LEU H CB    1 
ATOM 10616 C CG    . LEU F 6 69  ? 24.044  118.147 43.061  1.00 30.65  ? 69  LEU H CG    1 
ATOM 10617 C CD1   . LEU F 6 69  ? 24.212  117.399 44.378  1.00 32.06  ? 69  LEU H CD1   1 
ATOM 10618 C CD2   . LEU F 6 69  ? 23.272  119.441 43.237  1.00 29.95  ? 69  LEU H CD2   1 
ATOM 10619 N N     . THR F 6 70  ? 24.743  115.419 41.545  1.00 29.63  ? 70  THR H N     1 
ATOM 10620 C CA    . THR F 6 70  ? 24.081  114.599 40.552  1.00 28.94  ? 70  THR H CA    1 
ATOM 10621 C C     . THR F 6 70  ? 22.787  113.985 41.019  1.00 28.43  ? 70  THR H C     1 
ATOM 10622 O O     . THR F 6 70  ? 22.704  113.437 42.119  1.00 29.01  ? 70  THR H O     1 
ATOM 10623 C CB    . THR F 6 70  ? 24.973  113.506 40.011  1.00 29.10  ? 70  THR H CB    1 
ATOM 10624 O OG1   . THR F 6 70  ? 24.306  112.885 38.906  1.00 29.26  ? 70  THR H OG1   1 
ATOM 10625 C CG2   . THR F 6 70  ? 25.273  112.464 41.090  1.00 29.48  ? 70  THR H CG2   1 
ATOM 10626 N N     . VAL F 6 71  ? 21.788  114.046 40.148  1.00 28.44  ? 71  VAL H N     1 
ATOM 10627 C CA    . VAL F 6 71  ? 20.473  113.513 40.463  1.00 30.53  ? 71  VAL H CA    1 
ATOM 10628 C C     . VAL F 6 71  ? 20.058  112.346 39.610  1.00 31.67  ? 71  VAL H C     1 
ATOM 10629 O O     . VAL F 6 71  ? 20.663  112.061 38.576  1.00 31.18  ? 71  VAL H O     1 
ATOM 10630 C CB    . VAL F 6 71  ? 19.381  114.559 40.286  1.00 29.91  ? 71  VAL H CB    1 
ATOM 10631 C CG1   . VAL F 6 71  ? 19.653  115.745 41.163  1.00 31.56  ? 71  VAL H CG1   1 
ATOM 10632 C CG2   . VAL F 6 71  ? 19.270  114.954 38.820  1.00 29.19  ? 71  VAL H CG2   1 
ATOM 10633 N N     . SER F 6 72  ? 18.923  111.773 39.993  1.00 33.99  ? 72  SER H N     1 
ATOM 10634 C CA    . SER F 6 72  ? 18.348  110.633 39.302  1.00 36.26  ? 72  SER H CA    1 
ATOM 10635 C C     . SER F 6 72  ? 16.944  110.397 39.803  1.00 35.57  ? 72  SER H C     1 
ATOM 10636 O O     . SER F 6 72  ? 16.496  111.023 40.761  1.00 35.57  ? 72  SER H O     1 
ATOM 10637 C CB    . SER F 6 72  ? 19.150  109.377 39.607  1.00 39.74  ? 72  SER H CB    1 
ATOM 10638 O OG    . SER F 6 72  ? 18.802  108.866 40.888  1.00 42.69  ? 72  SER H OG    1 
ATOM 10639 N N     . LYS F 6 73  ? 16.304  109.386 39.239  1.00 34.89  ? 73  LYS H N     1 
ATOM 10640 C CA    . LYS F 6 73  ? 14.964  109.084 39.653  1.00 35.59  ? 73  LYS H CA    1 
ATOM 10641 C C     . LYS F 6 73  ? 14.456  107.788 39.098  1.00 34.80  ? 73  LYS H C     1 
ATOM 10642 O O     . LYS F 6 73  ? 14.189  107.684 37.904  1.00 34.86  ? 73  LYS H O     1 
ATOM 10643 C CB    . LYS F 6 73  ? 14.022  110.224 39.248  1.00 38.09  ? 73  LYS H CB    1 
ATOM 10644 C CG    . LYS F 6 73  ? 14.161  110.703 37.797  1.00 41.17  ? 73  LYS H CG    1 
ATOM 10645 C CD    . LYS F 6 73  ? 12.930  110.355 36.938  1.00 44.69  ? 73  LYS H CD    1 
ATOM 10646 C CE    . LYS F 6 73  ? 13.075  110.902 35.499  1.00 47.53  ? 73  LYS H CE    1 
ATOM 10647 N NZ    . LYS F 6 73  ? 12.046  110.415 34.516  1.00 47.25  ? 73  LYS H NZ    1 
ATOM 10648 N N     . ASP F 6 74  ? 14.388  106.768 39.941  1.00 34.56  ? 74  ASP H N     1 
ATOM 10649 C CA    . ASP F 6 74  ? 13.821  105.529 39.461  1.00 35.93  ? 74  ASP H CA    1 
ATOM 10650 C C     . ASP F 6 74  ? 12.367  105.906 39.295  1.00 35.86  ? 74  ASP H C     1 
ATOM 10651 O O     . ASP F 6 74  ? 11.592  105.913 40.250  1.00 34.02  ? 74  ASP H O     1 
ATOM 10652 C CB    . ASP F 6 74  ? 13.909  104.404 40.473  1.00 36.32  ? 74  ASP H CB    1 
ATOM 10653 C CG    . ASP F 6 74  ? 13.019  103.234 40.089  1.00 37.29  ? 74  ASP H CG    1 
ATOM 10654 O OD1   . ASP F 6 74  ? 11.800  103.279 40.364  1.00 35.90  ? 74  ASP H OD1   1 
ATOM 10655 O OD2   . ASP F 6 74  ? 13.524  102.298 39.446  1.00 38.10  ? 74  ASP H OD2   1 
ATOM 10656 N N     . THR F 6 75  ? 12.009  106.274 38.084  1.00 38.00  ? 75  THR H N     1 
ATOM 10657 C CA    . THR F 6 75  ? 10.656  106.685 37.844  1.00 42.22  ? 75  THR H CA    1 
ATOM 10658 C C     . THR F 6 75  ? 9.702   105.630 38.355  1.00 43.49  ? 75  THR H C     1 
ATOM 10659 O O     . THR F 6 75  ? 9.057   105.841 39.379  1.00 44.21  ? 75  THR H O     1 
ATOM 10660 C CB    . THR F 6 75  ? 10.409  106.955 36.355  1.00 44.35  ? 75  THR H CB    1 
ATOM 10661 O OG1   . THR F 6 75  ? 11.352  107.929 35.890  1.00 47.47  ? 75  THR H OG1   1 
ATOM 10662 C CG2   . THR F 6 75  ? 8.995   107.486 36.133  1.00 43.27  ? 75  THR H CG2   1 
ATOM 10663 N N     . SER F 6 76  ? 9.725   104.458 37.723  1.00 45.14  ? 76  SER H N     1 
ATOM 10664 C CA    . SER F 6 76  ? 8.825   103.336 38.063  1.00 47.13  ? 76  SER H CA    1 
ATOM 10665 C C     . SER F 6 76  ? 8.365   103.149 39.529  1.00 45.74  ? 76  SER H C     1 
ATOM 10666 O O     . SER F 6 76  ? 7.262   102.637 39.795  1.00 45.23  ? 76  SER H O     1 
ATOM 10667 C CB    . SER F 6 76  ? 9.396   102.013 37.526  1.00 48.56  ? 76  SER H CB    1 
ATOM 10668 O OG    . SER F 6 76  ? 10.645  101.716 38.124  1.00 50.44  ? 76  SER H OG    1 
ATOM 10669 N N     . ASN F 6 77  ? 9.199   103.553 40.479  1.00 43.49  ? 77  ASN H N     1 
ATOM 10670 C CA    . ASN F 6 77  ? 8.826   103.391 41.866  1.00 41.28  ? 77  ASN H CA    1 
ATOM 10671 C C     . ASN F 6 77  ? 8.719   104.672 42.658  1.00 39.37  ? 77  ASN H C     1 
ATOM 10672 O O     . ASN F 6 77  ? 8.829   104.669 43.880  1.00 39.46  ? 77  ASN H O     1 
ATOM 10673 C CB    . ASN F 6 77  ? 9.729   102.371 42.537  1.00 42.34  ? 77  ASN H CB    1 
ATOM 10674 C CG    . ASN F 6 77  ? 9.553   100.981 41.953  1.00 43.08  ? 77  AS