data_1J75
# 
_entry.id   1J75 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1J75         
NDB   PD0215       
RCSB  RCSB013443   
WWPDB D_1000013443 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1J75 
_pdbx_database_status.recvd_initial_deposition_date   2001-05-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schwartz, T.'   1 
'Behlke, J.'     2 
'Lowenhaupt, K.' 3 
'Heinemann, U.'  4 
'Rich, A.'       5 
# 
_citation.id                        primary 
_citation.title                     'Structure of the DLM-1-Z-DNA complex reveals a conserved family of Z-DNA-binding proteins.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            8 
_citation.page_first                761 
_citation.page_last                 765 
_citation.year                      2001 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11524677 
_citation.pdbx_database_id_DOI      10.1038/nsb0901-761 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Schwartz, T.'   1 
primary 'Behlke, J.'     2 
primary 'Lowenhaupt, K.' 3 
primary 'Heinemann, U.'  4 
primary 'Rich, A.'       5 
# 
_cell.entry_id           1J75 
_cell.length_a           63.611 
_cell.length_b           63.611 
_cell.length_c           72.238 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1J75 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*TP*CP*GP*CP*GP*CP*G)-3'"                       2114.398 1   ? ? ?                                       ? 
2 polymer man 'Tumor Stroma and Activated Macrophage Protein DLM-1' 7328.450 1   ? ? 'N-TERMINAL WINGED-HELIX DOMAIN ZALPHA' ? 
3 water   nat water                                                 18.015   102 ? ? ?                                       ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DC)(DG)(DC)(DG)(DC)(DG)'                                      TCGCGCG B ? 
2 'polypeptide(L)'        no no GSHMLSTGDNLEQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPEPATWSIGG 
GSHMLSTGDNLEQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPEPATWSIGG A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DT  n 
1 2  DC  n 
1 3  DG  n 
1 4  DC  n 
1 5  DG  n 
1 6  DC  n 
1 7  DG  n 
2 1  GLY n 
2 2  SER n 
2 3  HIS n 
2 4  MET n 
2 5  LEU n 
2 6  SER n 
2 7  THR n 
2 8  GLY n 
2 9  ASP n 
2 10 ASN n 
2 11 LEU n 
2 12 GLU n 
2 13 GLN n 
2 14 LYS n 
2 15 ILE n 
2 16 LEU n 
2 17 GLN n 
2 18 VAL n 
2 19 LEU n 
2 20 SER n 
2 21 ASP n 
2 22 ASP n 
2 23 GLY n 
2 24 GLY n 
2 25 PRO n 
2 26 VAL n 
2 27 LYS n 
2 28 ILE n 
2 29 GLY n 
2 30 GLN n 
2 31 LEU n 
2 32 VAL n 
2 33 LYS n 
2 34 LYS n 
2 35 CYS n 
2 36 GLN n 
2 37 VAL n 
2 38 PRO n 
2 39 LYS n 
2 40 LYS n 
2 41 THR n 
2 42 LEU n 
2 43 ASN n 
2 44 GLN n 
2 45 VAL n 
2 46 LEU n 
2 47 TYR n 
2 48 ARG n 
2 49 LEU n 
2 50 LYS n 
2 51 LYS n 
2 52 GLU n 
2 53 ASP n 
2 54 ARG n 
2 55 VAL n 
2 56 SER n 
2 57 SER n 
2 58 PRO n 
2 59 GLU n 
2 60 PRO n 
2 61 ALA n 
2 62 THR n 
2 63 TRP n 
2 64 SER n 
2 65 ILE n 
2 66 GLY n 
2 67 GLY n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Novablue (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP ZBP1_MOUSE 2 LSTGDNLEQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPEPATWSIGG 8 Q9QY24 ? 
2 PDB 1J75       1 ?                                                               ? 1J75   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1J75 A 5 ? 67 ? Q9QY24 8   ? 70  ? 108 170 
2 2 1J75 B 1 ? 7  ? 1J75   200 ? 206 ? 200 206 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1J75 GLY A 1 ? UNP Q9QY24 ? ? 'CLONING ARTIFACT' 104 1 
1 1J75 SER A 2 ? UNP Q9QY24 ? ? 'CLONING ARTIFACT' 105 2 
1 1J75 HIS A 3 ? UNP Q9QY24 ? ? 'CLONING ARTIFACT' 106 3 
1 1J75 MET A 4 ? UNP Q9QY24 ? ? 'CLONING ARTIFACT' 107 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1J75 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.59 
_exptl_crystal.density_percent_sol   52.2 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            297 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.00 
_exptl_crystal_grow.pdbx_details    
;15% PEG 4000, 0.1M ammonium hydrogen phosphate, 15% ethylene glycol, 0.1M MES pH 6.0, pH 6.00, VAPOR DIFFUSION, HANGING DROP, temperature 297K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 4000'                    ? ? ? 
1 2 1 'ammonium hydrogen phosphate' ? ? ? 
1 3 1 'ethylene glycol'             ? ? ? 
1 4 1 MES                           ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-08-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    MIRRORS 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9102 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X11' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, Hamburg' 
_diffrn_source.pdbx_synchrotron_beamline   X11 
_diffrn_source.pdbx_wavelength             0.9102 
_diffrn_source.pdbx_wavelength_list        0.9102 
# 
_reflns.entry_id                     1J75 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   0.000 
_reflns.d_resolution_low             32.0 
_reflns.d_resolution_high            1.85 
_reflns.number_obs                   7802 
_reflns.number_all                   7802 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.0660000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.7 
_reflns.B_iso_Wilson_estimate        37.6 
_reflns.pdbx_redundancy              23.4 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.85 
_reflns_shell.d_res_low              1.88 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           0.6130000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.9 
_reflns_shell.pdbx_redundancy        7.90 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1J75 
_refine.ls_number_reflns_obs                     7778 
_refine.ls_number_reflns_all                     7778 
_refine.pdbx_ls_sigma_I                          0.00 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             32.00 
_refine.ls_d_res_high                            1.85 
_refine.ls_percent_reflns_obs                    99.53 
_refine.ls_R_factor_obs                          0.2250000 
_refine.ls_R_factor_all                          0.2250000 
_refine.ls_R_factor_R_work                       0.2180000 
_refine.ls_R_factor_R_free                       0.2400000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.6 
_refine.ls_number_reflns_R_free                  826 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               21.3 
_refine.aniso_B[1][1]                            0.08 
_refine.aniso_B[2][2]                            0.08 
_refine.aniso_B[3][3]                            -0.12 
_refine.aniso_B[1][2]                            0.04 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    
'BABINET MODEL WITH MASK PARAMETERS FOR MASK CALCULATION VDW PROBE RADIUS : 1.40 ION PROBE RADIUS : 0.80 SHRINKAGE RADIUS : 0.80' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'CNS 1.0 and REFMAC5 used in refinement' 
_refine.pdbx_starting_model                      'PDB ENTRY 1QBJ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'RANDOM R VALUE (WORKING + TEST SET) : 0.22152' 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        444 
_refine_hist.pdbx_number_atoms_nucleic_acid   140 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             102 
_refine_hist.number_atoms_total               686 
_refine_hist.d_res_high                       1.85 
_refine_hist.d_res_low                        32.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d       0.019 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na    0.017 1.614 ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg    1.59  2.603 ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na 1.80  3.444 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it   2.60  5.549 ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it    1.61  ?     ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.85 
_refine_ls_shell.d_res_low                        1.88 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.2790000 
_refine_ls_shell.percent_reflns_obs               99.5 
_refine_ls_shell.R_factor_R_free                  0.3130000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             53 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1J75 
_struct.title                     'Crystal Structure of the DNA-Binding Domain Zalpha of DLM-1 Bound to Z-DNA' 
_struct.pdbx_descriptor           'DLM-1/Z-DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1J75 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM/DNA' 
_struct_keywords.text            'PROTEIN-Z-DNA COMPLEX, IMMUNE SYSTEM-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN B 10 ? GLY B 23 ? ASN A 113 GLY A 126 1 ? 14 
HELX_P HELX_P2 2 ILE B 28 ? GLN B 36 ? ILE A 131 GLN A 139 1 ? 9  
HELX_P HELX_P3 3 PRO B 38 ? GLU B 52 ? PRO A 141 GLU A 155 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DC 2 N3 ? ? ? 1_555 A DG 7 N1 ? ? B DC 201 B DG 206 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DC 2 N4 ? ? ? 1_555 A DG 7 O6 ? ? B DC 201 B DG 206 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DC 2 O2 ? ? ? 1_555 A DG 7 N2 ? ? B DC 201 B DG 206 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DG 3 N1 ? ? ? 1_555 A DC 6 N3 ? ? B DG 202 B DC 205 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DG 3 N2 ? ? ? 1_555 A DC 6 O2 ? ? B DG 202 B DC 205 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DG 3 O6 ? ? ? 1_555 A DC 6 N4 ? ? B DG 202 B DC 205 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DC 4 N3 ? ? ? 1_555 A DG 5 N1 ? ? B DC 203 B DG 204 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DC 4 N4 ? ? ? 1_555 A DG 5 O6 ? ? B DC 203 B DG 204 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DC 4 O2 ? ? ? 1_555 A DG 5 N2 ? ? B DC 203 B DG 204 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DG 5 N1 ? ? ? 1_555 A DC 4 N3 ? ? B DG 204 B DC 203 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DG 5 N2 ? ? ? 1_555 A DC 4 O2 ? ? B DG 204 B DC 203 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DG 5 O6 ? ? ? 1_555 A DC 4 N4 ? ? B DG 204 B DC 203 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DC 6 N3 ? ? ? 1_555 A DG 3 N1 ? ? B DC 205 B DG 202 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DC 6 N4 ? ? ? 1_555 A DG 3 O6 ? ? B DC 205 B DG 202 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DC 6 O2 ? ? ? 1_555 A DG 3 N2 ? ? B DC 205 B DG 202 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DG 7 N1 ? ? ? 1_555 A DC 2 N3 ? ? B DG 206 B DC 201 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DG 7 N2 ? ? ? 1_555 A DC 2 O2 ? ? B DG 206 B DC 201 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DG 7 O6 ? ? ? 1_555 A DC 2 N4 ? ? B DG 206 B DC 201 11_455 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL B 26 ? LYS B 27 ? VAL A 129 LYS A 130 
A 2 THR B 62 ? ILE B 65 ? THR A 165 ILE A 168 
A 3 VAL B 55 ? GLU B 59 ? VAL A 158 GLU A 162 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL B 26 ? O VAL A 129 N TRP B 63 ? N TRP A 166 
A 2 3 N SER B 64 ? N SER A 167 O SER B 56 ? O SER A 159 
# 
_database_PDB_matrix.entry_id          1J75 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1J75 
_atom_sites.fract_transf_matrix[1][1]   0.015721 
_atom_sites.fract_transf_matrix[1][2]   0.009076 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018153 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013843 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   O "O5'" . DT  A 1 1  ? -21.640 -23.611 27.469 1.00 85.12 ? 200 DT  B "O5'" 1 
ATOM   2   C "C5'" . DT  A 1 1  ? -22.733 -24.372 28.004 1.00 86.21 ? 200 DT  B "C5'" 1 
ATOM   3   C "C4'" . DT  A 1 1  ? -23.353 -25.324 26.988 1.00 85.74 ? 200 DT  B "C4'" 1 
ATOM   4   O "O4'" . DT  A 1 1  ? -22.613 -26.573 26.929 1.00 89.02 ? 200 DT  B "O4'" 1 
ATOM   5   C "C3'" . DT  A 1 1  ? -24.779 -25.732 27.330 1.00 82.47 ? 200 DT  B "C3'" 1 
ATOM   6   O "O3'" . DT  A 1 1  ? -25.554 -26.092 26.187 1.00 69.70 ? 200 DT  B "O3'" 1 
ATOM   7   C "C2'" . DT  A 1 1  ? -24.607 -26.982 28.168 1.00 86.89 ? 200 DT  B "C2'" 1 
ATOM   8   C "C1'" . DT  A 1 1  ? -23.289 -27.566 27.683 1.00 89.87 ? 200 DT  B "C1'" 1 
ATOM   9   N N1    . DT  A 1 1  ? -22.479 -27.970 28.865 1.00 94.52 ? 200 DT  B N1    1 
ATOM   10  C C2    . DT  A 1 1  ? -22.284 -29.307 29.146 1.00 96.61 ? 200 DT  B C2    1 
ATOM   11  O O2    . DT  A 1 1  ? -22.720 -30.221 28.464 1.00 99.33 ? 200 DT  B O2    1 
ATOM   12  N N3    . DT  A 1 1  ? -21.536 -29.526 30.273 1.00 97.08 ? 200 DT  B N3    1 
ATOM   13  C C4    . DT  A 1 1  ? -20.995 -28.579 31.138 1.00 97.83 ? 200 DT  B C4    1 
ATOM   14  O O4    . DT  A 1 1  ? -20.337 -28.888 32.137 1.00 97.90 ? 200 DT  B O4    1 
ATOM   15  C C5    . DT  A 1 1  ? -21.242 -27.202 30.785 1.00 97.92 ? 200 DT  B C5    1 
ATOM   16  C C7    . DT  A 1 1  ? -20.636 -26.086 31.597 1.00 98.00 ? 200 DT  B C7    1 
ATOM   17  C C6    . DT  A 1 1  ? -21.967 -26.968 29.682 1.00 96.36 ? 200 DT  B C6    1 
ATOM   18  P P     . DC  A 1 2  ? -27.091 -25.697 26.178 1.00 49.15 ? 201 DC  B P     1 
ATOM   19  O OP1   . DC  A 1 2  ? -27.538 -25.565 27.564 1.00 82.38 ? 201 DC  B OP1   1 
ATOM   20  O OP2   . DC  A 1 2  ? -27.784 -26.633 25.259 1.00 82.94 ? 201 DC  B OP2   1 
ATOM   21  O "O5'" . DC  A 1 2  ? -27.065 -24.214 25.579 1.00 42.48 ? 201 DC  B "O5'" 1 
ATOM   22  C "C5'" . DC  A 1 2  ? -26.567 -23.994 24.266 1.00 65.22 ? 201 DC  B "C5'" 1 
ATOM   23  C "C4'" . DC  A 1 2  ? -26.174 -22.542 24.118 1.00 53.54 ? 201 DC  B "C4'" 1 
ATOM   24  O "O4'" . DC  A 1 2  ? -27.366 -21.744 24.368 1.00 45.33 ? 201 DC  B "O4'" 1 
ATOM   25  C "C3'" . DC  A 1 2  ? -25.144 -22.086 25.138 1.00 48.05 ? 201 DC  B "C3'" 1 
ATOM   26  O "O3'" . DC  A 1 2  ? -24.362 -21.019 24.714 1.00 53.26 ? 201 DC  B "O3'" 1 
ATOM   27  C "C2'" . DC  A 1 2  ? -26.040 -21.620 26.266 1.00 44.72 ? 201 DC  B "C2'" 1 
ATOM   28  C "C1'" . DC  A 1 2  ? -27.127 -20.909 25.456 1.00 43.42 ? 201 DC  B "C1'" 1 
ATOM   29  N N1    . DC  A 1 2  ? -28.441 -20.745 26.134 1.00 16.50 ? 201 DC  B N1    1 
ATOM   30  C C2    . DC  A 1 2  ? -28.768 -19.535 26.729 1.00 35.69 ? 201 DC  B C2    1 
ATOM   31  O O2    . DC  A 1 2  ? -27.935 -18.613 26.730 1.00 40.87 ? 201 DC  B O2    1 
ATOM   32  N N3    . DC  A 1 2  ? -29.984 -19.398 27.321 1.00 39.55 ? 201 DC  B N3    1 
ATOM   33  C C4    . DC  A 1 2  ? -30.822 -20.412 27.314 1.00 38.37 ? 201 DC  B C4    1 
ATOM   34  N N4    . DC  A 1 2  ? -32.029 -20.272 27.908 1.00 46.27 ? 201 DC  B N4    1 
ATOM   35  C C5    . DC  A 1 2  ? -30.491 -21.678 26.680 1.00 40.81 ? 201 DC  B C5    1 
ATOM   36  C C6    . DC  A 1 2  ? -29.301 -21.791 26.126 1.00 44.42 ? 201 DC  B C6    1 
ATOM   37  P P     . DG  A 1 3  ? -22.902 -21.214 24.096 1.00 22.72 ? 202 DG  B P     1 
ATOM   38  O OP1   . DG  A 1 3  ? -22.168 -22.287 24.783 1.00 48.56 ? 202 DG  B OP1   1 
ATOM   39  O OP2   . DG  A 1 3  ? -22.357 -19.835 24.039 1.00 46.57 ? 202 DG  B OP2   1 
ATOM   40  O "O5'" . DG  A 1 3  ? -23.240 -21.770 22.683 1.00 26.47 ? 202 DG  B "O5'" 1 
ATOM   41  C "C5'" . DG  A 1 3  ? -23.954 -20.910 21.803 1.00 46.75 ? 202 DG  B "C5'" 1 
ATOM   42  C "C4'" . DG  A 1 3  ? -24.152 -21.658 20.525 1.00 53.99 ? 202 DG  B "C4'" 1 
ATOM   43  O "O4'" . DG  A 1 3  ? -24.919 -22.877 20.761 1.00 49.66 ? 202 DG  B "O4'" 1 
ATOM   44  C "C3'" . DG  A 1 3  ? -24.890 -20.835 19.501 1.00 53.40 ? 202 DG  B "C3'" 1 
ATOM   45  O "O3'" . DG  A 1 3  ? -24.041 -20.343 18.507 1.00 48.80 ? 202 DG  B "O3'" 1 
ATOM   46  C "C2'" . DG  A 1 3  ? -25.934 -21.786 18.929 1.00 55.05 ? 202 DG  B "C2'" 1 
ATOM   47  C "C1'" . DG  A 1 3  ? -25.990 -22.991 19.839 1.00 46.69 ? 202 DG  B "C1'" 1 
ATOM   48  N N9    . DG  A 1 3  ? -27.238 -23.070 20.582 1.00 23.42 ? 202 DG  B N9    1 
ATOM   49  C C8    . DG  A 1 3  ? -28.001 -24.189 20.819 1.00 54.30 ? 202 DG  B C8    1 
ATOM   50  N N7    . DG  A 1 3  ? -29.048 -23.955 21.553 1.00 46.13 ? 202 DG  B N7    1 
ATOM   51  C C5    . DG  A 1 3  ? -28.988 -22.617 21.810 1.00 43.85 ? 202 DG  B C5    1 
ATOM   52  C C6    . DG  A 1 3  ? -29.868 -21.813 22.561 1.00 43.33 ? 202 DG  B C6    1 
ATOM   53  O O6    . DG  A 1 3  ? -30.920 -22.140 23.154 1.00 43.41 ? 202 DG  B O6    1 
ATOM   54  N N1    . DG  A 1 3  ? -29.434 -20.503 22.596 1.00 37.56 ? 202 DG  B N1    1 
ATOM   55  C C2    . DG  A 1 3  ? -28.303 -20.017 21.998 1.00 40.80 ? 202 DG  B C2    1 
ATOM   56  N N2    . DG  A 1 3  ? -28.058 -18.736 22.164 1.00 36.74 ? 202 DG  B N2    1 
ATOM   57  N N3    . DG  A 1 3  ? -27.465 -20.768 21.304 1.00 41.01 ? 202 DG  B N3    1 
ATOM   58  C C4    . DG  A 1 3  ? -27.884 -22.050 21.250 1.00 42.50 ? 202 DG  B C4    1 
ATOM   59  P P     . DC  A 1 4  ? -24.046 -18.832 18.073 1.00 16.97 ? 203 DC  B P     1 
ATOM   60  O OP1   . DC  A 1 4  ? -22.982 -18.724 17.010 1.00 43.14 ? 203 DC  B OP1   1 
ATOM   61  O OP2   . DC  A 1 4  ? -23.973 -18.032 19.274 1.00 41.21 ? 203 DC  B OP2   1 
ATOM   62  O "O5'" . DC  A 1 4  ? -25.459 -18.627 17.377 1.00 17.55 ? 203 DC  B "O5'" 1 
ATOM   63  C "C5'" . DC  A 1 4  ? -25.634 -17.715 16.281 1.00 46.36 ? 203 DC  B "C5'" 1 
ATOM   64  C "C4'" . DC  A 1 4  ? -26.890 -16.877 16.483 1.00 42.77 ? 203 DC  B "C4'" 1 
ATOM   65  O "O4'" . DC  A 1 4  ? -28.014 -17.763 16.637 1.00 43.17 ? 203 DC  B "O4'" 1 
ATOM   66  C "C3'" . DC  A 1 4  ? -26.827 -15.988 17.703 1.00 42.82 ? 203 DC  B "C3'" 1 
ATOM   67  O "O3'" . DC  A 1 4  ? -27.408 -14.698 17.442 1.00 40.33 ? 203 DC  B "O3'" 1 
ATOM   68  C "C2'" . DC  A 1 4  ? -27.690 -16.735 18.730 1.00 46.41 ? 203 DC  B "C2'" 1 
ATOM   69  C "C1'" . DC  A 1 4  ? -28.741 -17.341 17.784 1.00 47.27 ? 203 DC  B "C1'" 1 
ATOM   70  N N1    . DC  A 1 4  ? -29.494 -18.465 18.363 1.00 16.82 ? 203 DC  B N1    1 
ATOM   71  C C2    . DC  A 1 4  ? -30.520 -18.164 19.251 1.00 42.45 ? 203 DC  B C2    1 
ATOM   72  O O2    . DC  A 1 4  ? -30.762 -16.961 19.525 1.00 38.67 ? 203 DC  B O2    1 
ATOM   73  N N3    . DC  A 1 4  ? -31.206 -19.186 19.785 1.00 41.80 ? 203 DC  B N3    1 
ATOM   74  C C4    . DC  A 1 4  ? -30.906 -20.442 19.460 1.00 44.03 ? 203 DC  B C4    1 
ATOM   75  N N4    . DC  A 1 4  ? -31.640 -21.433 20.010 1.00 46.28 ? 203 DC  B N4    1 
ATOM   76  C C5    . DC  A 1 4  ? -29.856 -20.744 18.558 1.00 45.34 ? 203 DC  B C5    1 
ATOM   77  C C6    . DC  A 1 4  ? -29.167 -19.739 18.049 1.00 36.59 ? 203 DC  B C6    1 
ATOM   78  P P     . DG  A 1 5  ? -26.584 -13.387 17.176 1.00 20.65 ? 204 DG  B P     1 
ATOM   79  O OP1   . DG  A 1 5  ? -25.309 -13.396 17.952 1.00 52.85 ? 204 DG  B OP1   1 
ATOM   80  O OP2   . DG  A 1 5  ? -27.451 -12.213 17.271 1.00 40.79 ? 204 DG  B OP2   1 
ATOM   81  O "O5'" . DG  A 1 5  ? -26.183 -13.603 15.655 1.00 17.41 ? 204 DG  B "O5'" 1 
ATOM   82  C "C5'" . DG  A 1 5  ? -27.182 -13.711 14.699 1.00 51.66 ? 204 DG  B "C5'" 1 
ATOM   83  C "C4'" . DG  A 1 5  ? -26.603 -13.939 13.343 1.00 43.63 ? 204 DG  B "C4'" 1 
ATOM   84  O "O4'" . DG  A 1 5  ? -25.971 -15.213 13.374 1.00 39.99 ? 204 DG  B "O4'" 1 
ATOM   85  C "C3'" . DG  A 1 5  ? -27.666 -13.977 12.253 1.00 40.21 ? 204 DG  B "C3'" 1 
ATOM   86  O "O3'" . DG  A 1 5  ? -27.599 -12.785 11.545 1.00 43.84 ? 204 DG  B "O3'" 1 
ATOM   87  C "C2'" . DG  A 1 5  ? -27.289 -15.181 11.388 1.00 38.05 ? 204 DG  B "C2'" 1 
ATOM   88  C "C1'" . DG  A 1 5  ? -26.307 -15.978 12.241 1.00 38.28 ? 204 DG  B "C1'" 1 
ATOM   89  N N9    . DG  A 1 5  ? -26.819 -17.238 12.702 1.00 13.28 ? 204 DG  B N9    1 
ATOM   90  C C8    . DG  A 1 5  ? -26.257 -18.463 12.573 1.00 37.31 ? 204 DG  B C8    1 
ATOM   91  N N7    . DG  A 1 5  ? -27.004 -19.443 13.089 1.00 41.86 ? 204 DG  B N7    1 
ATOM   92  C C5    . DG  A 1 5  ? -28.115 -18.806 13.603 1.00 41.47 ? 204 DG  B C5    1 
ATOM   93  C C6    . DG  A 1 5  ? -29.248 -19.321 14.277 1.00 45.57 ? 204 DG  B C6    1 
ATOM   94  O O6    . DG  A 1 5  ? -29.511 -20.486 14.572 1.00 46.88 ? 204 DG  B O6    1 
ATOM   95  N N1    . DG  A 1 5  ? -30.172 -18.319 14.609 1.00 43.78 ? 204 DG  B N1    1 
ATOM   96  C C2    . DG  A 1 5  ? -29.997 -17.007 14.320 1.00 42.96 ? 204 DG  B C2    1 
ATOM   97  N N2    . DG  A 1 5  ? -30.966 -16.185 14.721 1.00 41.02 ? 204 DG  B N2    1 
ATOM   98  N N3    . DG  A 1 5  ? -28.911 -16.511 13.698 1.00 42.57 ? 204 DG  B N3    1 
ATOM   99  C C4    . DG  A 1 5  ? -28.052 -17.461 13.363 1.00 41.37 ? 204 DG  B C4    1 
ATOM   100 P P     . DC  A 1 6  ? -28.954 -12.009 11.168 1.00 20.05 ? 205 DC  B P     1 
ATOM   101 O OP1   . DC  A 1 6  ? -28.562 -10.902 10.311 1.00 49.84 ? 205 DC  B OP1   1 
ATOM   102 O OP2   . DC  A 1 6  ? -29.673 -11.755 12.418 1.00 47.23 ? 205 DC  B OP2   1 
ATOM   103 O "O5'" . DC  A 1 6  ? -29.732 -13.188 10.392 1.00 19.50 ? 205 DC  B "O5'" 1 
ATOM   104 C "C5'" . DC  A 1 6  ? -30.679 -12.903 9.382  1.00 48.97 ? 205 DC  B "C5'" 1 
ATOM   105 C "C4'" . DC  A 1 6  ? -32.083 -13.352 9.765  1.00 44.47 ? 205 DC  B "C4'" 1 
ATOM   106 O "O4'" . DC  A 1 6  ? -32.150 -14.790 9.687  1.00 40.59 ? 205 DC  B "O4'" 1 
ATOM   107 C "C3'" . DC  A 1 6  ? -32.528 -12.984 11.205 1.00 45.58 ? 205 DC  B "C3'" 1 
ATOM   108 O "O3'" . DC  A 1 6  ? -33.893 -12.732 11.310 1.00 50.50 ? 205 DC  B "O3'" 1 
ATOM   109 C "C2'" . DC  A 1 6  ? -32.203 -14.245 11.958 1.00 49.68 ? 205 DC  B "C2'" 1 
ATOM   110 C "C1'" . DC  A 1 6  ? -32.598 -15.281 10.925 1.00 46.38 ? 205 DC  B "C1'" 1 
ATOM   111 N N1    . DC  A 1 6  ? -32.045 -16.642 11.092 1.00 16.01 ? 205 DC  B N1    1 
ATOM   112 C C2    . DC  A 1 6  ? -32.876 -17.569 11.727 1.00 38.11 ? 205 DC  B C2    1 
ATOM   113 O O2    . DC  A 1 6  ? -33.990 -17.179 12.056 1.00 39.83 ? 205 DC  B O2    1 
ATOM   114 N N3    . DC  A 1 6  ? -32.438 -18.856 11.887 1.00 38.45 ? 205 DC  B N3    1 
ATOM   115 C C4    . DC  A 1 6  ? -31.205 -19.162 11.442 1.00 40.09 ? 205 DC  B C4    1 
ATOM   116 N N4    . DC  A 1 6  ? -30.747 -20.395 11.612 1.00 42.08 ? 205 DC  B N4    1 
ATOM   117 C C5    . DC  A 1 6  ? -30.338 -18.203 10.839 1.00 38.34 ? 205 DC  B C5    1 
ATOM   118 C C6    . DC  A 1 6  ? -30.782 -16.960 10.675 1.00 41.05 ? 205 DC  B C6    1 
ATOM   119 P P     . DG  A 1 7  ? -34.525 -11.287 11.113 1.00 28.71 ? 206 DG  B P     1 
ATOM   120 O OP1   . DG  A 1 7  ? -33.708 -10.247 11.755 1.00 51.45 ? 206 DG  B OP1   1 
ATOM   121 O OP2   . DG  A 1 7  ? -35.987 -11.415 11.394 1.00 50.20 ? 206 DG  B OP2   1 
ATOM   122 O "O5'" . DG  A 1 7  ? -34.343 -11.030 9.563  1.00 29.27 ? 206 DG  B "O5'" 1 
ATOM   123 C "C5'" . DG  A 1 7  ? -35.284 -11.593 8.643  1.00 51.24 ? 206 DG  B "C5'" 1 
ATOM   124 C "C4'" . DG  A 1 7  ? -34.856 -11.184 7.271  1.00 63.18 ? 206 DG  B "C4'" 1 
ATOM   125 O "O4'" . DG  A 1 7  ? -33.513 -11.673 7.042  1.00 62.32 ? 206 DG  B "O4'" 1 
ATOM   126 C "C3'" . DG  A 1 7  ? -35.738 -11.683 6.160  1.00 72.87 ? 206 DG  B "C3'" 1 
ATOM   127 O "O3'" . DG  A 1 7  ? -36.086 -10.652 5.248  1.00 71.58 ? 206 DG  B "O3'" 1 
ATOM   128 C "C2'" . DG  A 1 7  ? -34.884 -12.751 5.506  1.00 76.73 ? 206 DG  B "C2'" 1 
ATOM   129 C "C1'" . DG  A 1 7  ? -33.453 -12.320 5.814  1.00 63.26 ? 206 DG  B "C1'" 1 
ATOM   130 N N9    . DG  A 1 7  ? -32.536 -13.414 5.982  1.00 23.68 ? 206 DG  B N9    1 
ATOM   131 C C8    . DG  A 1 7  ? -31.207 -13.522 5.632  1.00 54.91 ? 206 DG  B C8    1 
ATOM   132 N N7    . DG  A 1 7  ? -30.685 -14.678 5.947  1.00 46.06 ? 206 DG  B N7    1 
ATOM   133 C C5    . DG  A 1 7  ? -31.741 -15.346 6.554  1.00 45.22 ? 206 DG  B C5    1 
ATOM   134 C C6    . DG  A 1 7  ? -31.813 -16.640 7.103  1.00 46.86 ? 206 DG  B C6    1 
ATOM   135 O O6    . DG  A 1 7  ? -30.920 -17.494 7.196  1.00 40.50 ? 206 DG  B O6    1 
ATOM   136 N N1    . DG  A 1 7  ? -33.100 -16.903 7.594  1.00 48.04 ? 206 DG  B N1    1 
ATOM   137 C C2    . DG  A 1 7  ? -34.154 -16.032 7.549  1.00 49.10 ? 206 DG  B C2    1 
ATOM   138 N N2    . DG  A 1 7  ? -35.358 -16.413 8.094  1.00 46.80 ? 206 DG  B N2    1 
ATOM   139 N N3    . DG  A 1 7  ? -34.082 -14.837 7.035  1.00 44.53 ? 206 DG  B N3    1 
ATOM   140 C C4    . DG  A 1 7  ? -32.869 -14.583 6.571  1.00 48.18 ? 206 DG  B C4    1 
ATOM   141 N N     . ASN B 2 10 ? -13.113 -2.335  7.485  1.00 65.31 ? 113 ASN A N     1 
ATOM   142 C CA    . ASN B 2 10 ? -13.618 -3.698  7.174  1.00 62.38 ? 113 ASN A CA    1 
ATOM   143 C C     . ASN B 2 10 ? -13.524 -4.624  8.391  1.00 58.62 ? 113 ASN A C     1 
ATOM   144 O O     . ASN B 2 10 ? -12.438 -4.906  8.936  1.00 57.60 ? 113 ASN A O     1 
ATOM   145 C CB    . ASN B 2 10 ? -12.897 -4.316  6.000  1.00 63.50 ? 113 ASN A CB    1 
ATOM   146 C CG    . ASN B 2 10 ? -13.641 -5.491  5.438  1.00 64.94 ? 113 ASN A CG    1 
ATOM   147 O OD1   . ASN B 2 10 ? -14.700 -5.331  4.800  1.00 70.17 ? 113 ASN A OD1   1 
ATOM   148 N ND2   . ASN B 2 10 ? -13.130 -6.685  5.689  1.00 61.06 ? 113 ASN A ND2   1 
ATOM   149 N N     . LEU B 2 11 ? -14.686 -4.966  8.892  1.00 54.76 ? 114 LEU A N     1 
ATOM   150 C CA    . LEU B 2 11 ? -14.838 -5.912  9.950  1.00 51.62 ? 114 LEU A CA    1 
ATOM   151 C C     . LEU B 2 11 ? -14.275 -7.288  9.581  1.00 48.39 ? 114 LEU A C     1 
ATOM   152 O O     . LEU B 2 11 ? -13.629 -7.951  10.395 1.00 43.32 ? 114 LEU A O     1 
ATOM   153 C CB    . LEU B 2 11 ? -16.317 -6.017  10.279 1.00 51.08 ? 114 LEU A CB    1 
ATOM   154 C CG    . LEU B 2 11 ? -16.662 -6.895  11.477 1.00 47.55 ? 114 LEU A CG    1 
ATOM   155 C CD1   . LEU B 2 11 ? -15.868 -6.496  12.698 1.00 47.13 ? 114 LEU A CD1   1 
ATOM   156 C CD2   . LEU B 2 11 ? -18.177 -6.755  11.725 1.00 47.25 ? 114 LEU A CD2   1 
ATOM   157 N N     . GLU B 2 12 ? -14.534 -7.696  8.352  1.00 45.93 ? 115 GLU A N     1 
ATOM   158 C CA    . GLU B 2 12 ? -14.060 -8.981  7.865  1.00 45.80 ? 115 GLU A CA    1 
ATOM   159 C C     . GLU B 2 12 ? -12.526 -9.142  8.038  1.00 44.79 ? 115 GLU A C     1 
ATOM   160 O O     . GLU B 2 12 ? -12.054 -10.174 8.550  1.00 39.90 ? 115 GLU A O     1 
ATOM   161 C CB    . GLU B 2 12 ? -14.539 -9.177  6.437  1.00 47.28 ? 115 GLU A CB    1 
ATOM   162 C CG    . GLU B 2 12 ? -14.370 -10.568 5.858  1.00 51.77 ? 115 GLU A CG    1 
ATOM   163 C CD    . GLU B 2 12 ? -14.569 -10.598 4.355  1.00 56.52 ? 115 GLU A CD    1 
ATOM   164 O OE1   . GLU B 2 12 ? -15.669 -10.265 3.913  1.00 58.13 ? 115 GLU A OE1   1 
ATOM   165 O OE2   . GLU B 2 12 ? -13.598 -10.945 3.630  1.00 65.85 ? 115 GLU A OE2   1 
ATOM   166 N N     . GLN B 2 13 ? -11.753 -8.136  7.644  1.00 46.49 ? 116 GLN A N     1 
ATOM   167 C CA    . GLN B 2 13 ? -10.298 -8.217  7.763  1.00 49.25 ? 116 GLN A CA    1 
ATOM   168 C C     . GLN B 2 13 ? -9.882  -8.224  9.210  1.00 46.47 ? 116 GLN A C     1 
ATOM   169 O O     . GLN B 2 13 ? -8.961  -8.928  9.578  1.00 45.96 ? 116 GLN A O     1 
ATOM   170 C CB    . GLN B 2 13 ? -9.574  -7.118  6.990  1.00 52.88 ? 116 GLN A CB    1 
ATOM   171 C CG    . GLN B 2 13 ? -9.577  -7.341  5.470  1.00 56.82 ? 116 GLN A CG    1 
ATOM   172 C CD    . GLN B 2 13 ? -8.958  -8.691  5.067  1.00 65.28 ? 116 GLN A CD    1 
ATOM   173 O OE1   . GLN B 2 13 ? -7.907  -9.098  5.601  1.00 65.72 ? 116 GLN A OE1   1 
ATOM   174 N NE2   . GLN B 2 13 ? -9.622  -9.393  4.133  1.00 67.07 ? 116 GLN A NE2   1 
ATOM   175 N N     . LYS B 2 14 ? -10.576 -7.436  10.034 1.00 44.36 ? 117 LYS A N     1 
ATOM   176 C CA    . LYS B 2 14 ? -10.240 -7.371  11.447 1.00 44.08 ? 117 LYS A CA    1 
ATOM   177 C C     . LYS B 2 14 ? -10.483 -8.725  12.136 1.00 40.42 ? 117 LYS A C     1 
ATOM   178 O O     . LYS B 2 14 ? -9.736  -9.151  12.980 1.00 37.92 ? 117 LYS A O     1 
ATOM   179 C CB    . LYS B 2 14 ? -11.051 -6.282  12.123 1.00 45.72 ? 117 LYS A CB    1 
ATOM   180 C CG    . LYS B 2 14 ? -10.573 -6.013  13.534 1.00 51.81 ? 117 LYS A CG    1 
ATOM   181 C CD    . LYS B 2 14 ? -9.082  -5.661  13.571 1.00 57.83 ? 117 LYS A CD    1 
ATOM   182 C CE    . LYS B 2 14 ? -8.388  -6.116  14.847 1.00 63.65 ? 117 LYS A CE    1 
ATOM   183 N NZ    . LYS B 2 14 ? -8.663  -5.207  16.017 1.00 69.15 ? 117 LYS A NZ    1 
ATOM   184 N N     . ILE B 2 15 ? -11.578 -9.365  11.759 1.00 36.12 ? 118 ILE A N     1 
ATOM   185 C CA    . ILE B 2 15 ? -11.899 -10.686 12.330 1.00 34.29 ? 118 ILE A CA    1 
ATOM   186 C C     . ILE B 2 15 ? -10.823 -11.683 11.937 1.00 34.24 ? 118 ILE A C     1 
ATOM   187 O O     . ILE B 2 15 ? -10.304 -12.438 12.775 1.00 32.91 ? 118 ILE A O     1 
ATOM   188 C CB    . ILE B 2 15 ? -13.226 -11.147 11.792 1.00 34.32 ? 118 ILE A CB    1 
ATOM   189 C CG1   . ILE B 2 15 ? -14.342 -10.362 12.459 1.00 33.01 ? 118 ILE A CG1   1 
ATOM   190 C CG2   . ILE B 2 15 ? -13.426 -12.618 12.044 1.00 30.28 ? 118 ILE A CG2   1 
ATOM   191 C CD1   . ILE B 2 15 ? -15.699 -10.631 11.832 1.00 31.55 ? 118 ILE A CD1   1 
ATOM   192 N N     . LEU B 2 16 ? -10.469 -11.669 10.680 1.00 35.94 ? 119 LEU A N     1 
ATOM   193 C CA    . LEU B 2 16 ? -9.476  -12.605 10.181 1.00 38.32 ? 119 LEU A CA    1 
ATOM   194 C C     . LEU B 2 16 ? -8.123  -12.403 10.866 1.00 38.25 ? 119 LEU A C     1 
ATOM   195 O O     . LEU B 2 16 ? -7.444  -13.379 11.189 1.00 38.15 ? 119 LEU A O     1 
ATOM   196 C CB    . LEU B 2 16 ? -9.325  -12.474 8.695  1.00 40.38 ? 119 LEU A CB    1 
ATOM   197 C CG    . LEU B 2 16 ? -10.489 -12.993 7.884  1.00 41.50 ? 119 LEU A CG    1 
ATOM   198 C CD1   . LEU B 2 16 ? -10.261 -12.767 6.426  1.00 46.99 ? 119 LEU A CD1   1 
ATOM   199 C CD2   . LEU B 2 16 ? -10.766 -14.493 8.147  1.00 43.88 ? 119 LEU A CD2   1 
ATOM   200 N N     . GLN B 2 17 ? -7.764  -11.157 11.094 1.00 40.20 ? 120 GLN A N     1 
ATOM   201 C CA    . GLN B 2 17 ? -6.508  -10.820 11.748 1.00 42.28 ? 120 GLN A CA    1 
ATOM   202 C C     . GLN B 2 17 ? -6.492  -11.347 13.166 1.00 39.65 ? 120 GLN A C     1 
ATOM   203 O O     . GLN B 2 17 ? -5.541  -11.936 13.591 1.00 40.43 ? 120 GLN A O     1 
ATOM   204 C CB    . GLN B 2 17 ? -6.304  -9.307  11.774 1.00 43.41 ? 120 GLN A CB    1 
ATOM   205 C CG    . GLN B 2 17 ? -5.135  -8.781  12.625 1.00 49.63 ? 120 GLN A CG    1 
ATOM   206 C CD    . GLN B 2 17 ? -5.580  -8.085  13.926 1.00 51.07 ? 120 GLN A CD    1 
ATOM   207 O OE1   . GLN B 2 17 ? -6.198  -7.057  13.874 1.00 56.72 ? 120 GLN A OE1   1 
ATOM   208 N NE2   . GLN B 2 17 ? -5.232  -8.668  15.097 1.00 50.75 ? 120 GLN A NE2   1 
ATOM   209 N N     . VAL B 2 18 ? -7.563  -11.058 13.903 1.00 38.23 ? 121 VAL A N     1 
ATOM   210 C CA    . VAL B 2 18 ? -7.708  -11.520 15.252 1.00 35.74 ? 121 VAL A CA    1 
ATOM   211 C C     . VAL B 2 18 ? -7.541  -13.043 15.345 1.00 35.01 ? 121 VAL A C     1 
ATOM   212 O O     . VAL B 2 18 ? -6.740  -13.540 16.142 1.00 34.34 ? 121 VAL A O     1 
ATOM   213 C CB    . VAL B 2 18 ? -9.059  -11.055 15.902 1.00 35.20 ? 121 VAL A CB    1 
ATOM   214 C CG1   . VAL B 2 18 ? -9.217  -11.630 17.280 1.00 34.92 ? 121 VAL A CG1   1 
ATOM   215 C CG2   . VAL B 2 18 ? -9.119  -9.558  16.007 1.00 38.98 ? 121 VAL A CG2   1 
ATOM   216 N N     . LEU B 2 19 ? -8.260  -13.766 14.519 1.00 33.29 ? 122 LEU A N     1 
ATOM   217 C CA    . LEU B 2 19 ? -8.226  -15.216 14.490 1.00 33.10 ? 122 LEU A CA    1 
ATOM   218 C C     . LEU B 2 19 ? -6.867  -15.800 14.109 1.00 37.03 ? 122 LEU A C     1 
ATOM   219 O O     . LEU B 2 19 ? -6.401  -16.789 14.695 1.00 36.49 ? 122 LEU A O     1 
ATOM   220 C CB    . LEU B 2 19 ? -9.313  -15.765 13.562 1.00 34.68 ? 122 LEU A CB    1 
ATOM   221 C CG    . LEU B 2 19 ? -10.777 -15.542 13.926 1.00 33.91 ? 122 LEU A CG    1 
ATOM   222 C CD1   . LEU B 2 19 ? -11.653 -16.081 12.844 1.00 31.80 ? 122 LEU A CD1   1 
ATOM   223 C CD2   . LEU B 2 19 ? -11.204 -16.195 15.258 1.00 34.40 ? 122 LEU A CD2   1 
ATOM   224 N N     . SER B 2 20 ? -6.234  -15.166 13.136 1.00 37.39 ? 123 SER A N     1 
ATOM   225 C CA    . SER B 2 20 ? -4.919  -15.597 12.639 1.00 37.90 ? 123 SER A CA    1 
ATOM   226 C C     . SER B 2 20 ? -3.838  -15.365 13.681 1.00 38.74 ? 123 SER A C     1 
ATOM   227 O O     . SER B 2 20 ? -3.064  -16.249 13.984 1.00 41.69 ? 123 SER A O     1 
ATOM   228 C CB    . SER B 2 20 ? -4.623  -14.782 11.388 1.00 40.41 ? 123 SER A CB    1 
ATOM   229 O OG    . SER B 2 20 ? -5.436  -15.178 10.315 1.00 40.01 ? 123 SER A OG    1 
ATOM   230 N N     . ASP B 2 21 ? -3.825  -14.171 14.271 1.00 38.89 ? 124 ASP A N     1 
ATOM   231 C CA    . ASP B 2 21 ? -2.901  -13.841 15.338 1.00 41.63 ? 124 ASP A CA    1 
ATOM   232 C C     . ASP B 2 21 ? -3.055  -14.801 16.517 1.00 41.65 ? 124 ASP A C     1 
ATOM   233 O O     . ASP B 2 21 ? -2.054  -15.298 17.092 1.00 38.61 ? 124 ASP A O     1 
ATOM   234 C CB    . ASP B 2 21 ? -3.097  -12.408 15.808 1.00 41.86 ? 124 ASP A CB    1 
ATOM   235 C CG    . ASP B 2 21 ? -2.546  -11.394 14.847 1.00 45.53 ? 124 ASP A CG    1 
ATOM   236 O OD1   . ASP B 2 21 ? -1.952  -11.813 13.834 1.00 49.64 ? 124 ASP A OD1   1 
ATOM   237 O OD2   . ASP B 2 21 ? -2.661  -10.180 15.004 1.00 46.47 ? 124 ASP A OD2   1 
ATOM   238 N N     . ASP B 2 22 ? -4.286  -15.041 16.925 1.00 38.80 ? 125 ASP A N     1 
ATOM   239 C CA    . ASP B 2 22 ? -4.521  -15.976 18.025 1.00 38.30 ? 125 ASP A CA    1 
ATOM   240 C C     . ASP B 2 22 ? -4.003  -17.338 17.666 1.00 42.73 ? 125 ASP A C     1 
ATOM   241 O O     . ASP B 2 22 ? -3.231  -17.974 18.438 1.00 43.30 ? 125 ASP A O     1 
ATOM   242 C CB    . ASP B 2 22 ? -6.015  -16.092 18.342 1.00 37.54 ? 125 ASP A CB    1 
ATOM   243 C CG    . ASP B 2 22 ? -6.277  -16.919 19.598 1.00 35.31 ? 125 ASP A CG    1 
ATOM   244 O OD1   . ASP B 2 22 ? -6.117  -18.122 19.548 1.00 34.95 ? 125 ASP A OD1   1 
ATOM   245 O OD2   . ASP B 2 22 ? -6.655  -16.383 20.675 1.00 38.09 ? 125 ASP A OD2   1 
ATOM   246 N N     . GLY B 2 23 ? -4.428  -17.849 16.513 1.00 43.16 ? 126 GLY A N     1 
ATOM   247 C CA    . GLY B 2 23 ? -3.947  -19.176 16.077 1.00 45.01 ? 126 GLY A CA    1 
ATOM   248 C C     . GLY B 2 23 ? -4.807  -20.352 16.544 1.00 44.44 ? 126 GLY A C     1 
ATOM   249 O O     . GLY B 2 23 ? -4.746  -21.462 15.967 1.00 46.06 ? 126 GLY A O     1 
ATOM   250 N N     . GLY B 2 24 ? -5.608  -20.139 17.585 1.00 39.33 ? 127 GLY A N     1 
ATOM   251 C CA    . GLY B 2 24 ? -6.449  -21.188 18.096 1.00 37.55 ? 127 GLY A CA    1 
ATOM   252 C C     . GLY B 2 24 ? -7.921  -20.769 18.172 1.00 38.06 ? 127 GLY A C     1 
ATOM   253 O O     . GLY B 2 24 ? -8.316  -19.768 17.616 1.00 33.69 ? 127 GLY A O     1 
ATOM   254 N N     . PRO B 2 25 ? -8.718  -21.578 18.840 1.00 40.57 ? 128 PRO A N     1 
ATOM   255 C CA    . PRO B 2 25 ? -10.153 -21.351 18.968 1.00 38.99 ? 128 PRO A CA    1 
ATOM   256 C C     . PRO B 2 25 ? -10.393 -20.107 19.817 1.00 37.94 ? 128 PRO A C     1 
ATOM   257 O O     . PRO B 2 25 ? -9.816  -19.973 20.900 1.00 35.54 ? 128 PRO A O     1 
ATOM   258 C CB    . PRO B 2 25 ? -10.662 -22.612 19.643 1.00 41.59 ? 128 PRO A CB    1 
ATOM   259 C CG    . PRO B 2 25 ? -9.527  -23.642 19.489 1.00 42.42 ? 128 PRO A CG    1 
ATOM   260 C CD    . PRO B 2 25 ? -8.290  -22.884 19.441 1.00 42.23 ? 128 PRO A CD    1 
ATOM   261 N N     . VAL B 2 26 ? -11.191 -19.190 19.254 1.00 32.88 ? 129 VAL A N     1 
ATOM   262 C CA    . VAL B 2 26 ? -11.476 -17.921 19.904 1.00 32.28 ? 129 VAL A CA    1 
ATOM   263 C C     . VAL B 2 26 ? -12.957 -17.800 20.164 1.00 32.54 ? 129 VAL A C     1 
ATOM   264 O O     . VAL B 2 26 ? -13.787 -18.067 19.283 1.00 31.38 ? 129 VAL A O     1 
ATOM   265 C CB    . VAL B 2 26 ? -10.986 -16.760 19.016 1.00 30.27 ? 129 VAL A CB    1 
ATOM   266 C CG1   . VAL B 2 26 ? -11.253 -15.373 19.692 1.00 29.47 ? 129 VAL A CG1   1 
ATOM   267 C CG2   . VAL B 2 26 ? -9.506  -16.903 18.669 1.00 34.09 ? 129 VAL A CG2   1 
ATOM   268 N N     . LYS B 2 27 ? -13.311 -17.426 21.386 1.00 31.77 ? 130 LYS A N     1 
ATOM   269 C CA    . LYS B 2 27 ? -14.707 -17.258 21.769 1.00 34.15 ? 130 LYS A CA    1 
ATOM   270 C C     . LYS B 2 27 ? -15.313 -15.971 21.211 1.00 32.77 ? 130 LYS A C     1 
ATOM   271 O O     . LYS B 2 27 ? -14.594 -14.965 21.083 1.00 32.56 ? 130 LYS A O     1 
ATOM   272 C CB    . LYS B 2 27 ? -14.803 -17.223 23.269 1.00 35.87 ? 130 LYS A CB    1 
ATOM   273 C CG    . LYS B 2 27 ? -14.492 -18.585 23.966 1.00 42.87 ? 130 LYS A CG    1 
ATOM   274 C CD    . LYS B 2 27 ? -15.555 -19.571 23.585 1.00 50.72 ? 130 LYS A CD    1 
ATOM   275 C CE    . LYS B 2 27 ? -15.775 -20.638 24.609 1.00 55.73 ? 130 LYS A CE    1 
ATOM   276 N NZ    . LYS B 2 27 ? -14.911 -21.828 24.388 1.00 56.95 ? 130 LYS A NZ    1 
ATOM   277 N N     . ILE B 2 28 ? -16.599 -15.982 20.914 1.00 33.39 ? 131 ILE A N     1 
ATOM   278 C CA    . ILE B 2 28 ? -17.286 -14.797 20.365 1.00 31.29 ? 131 ILE A CA    1 
ATOM   279 C C     . ILE B 2 28 ? -17.073 -13.627 21.262 1.00 31.32 ? 131 ILE A C     1 
ATOM   280 O O     . ILE B 2 28 ? -16.813 -12.516 20.785 1.00 33.07 ? 131 ILE A O     1 
ATOM   281 C CB    . ILE B 2 28 ? -18.779 -15.063 20.067 1.00 32.59 ? 131 ILE A CB    1 
ATOM   282 C CG1   . ILE B 2 28 ? -19.429 -13.852 19.383 1.00 33.56 ? 131 ILE A CG1   1 
ATOM   283 C CG2   . ILE B 2 28 ? -19.556 -15.486 21.330 1.00 33.70 ? 131 ILE A CG2   1 
ATOM   284 C CD1   . ILE B 2 28 ? -18.906 -13.546 18.018 1.00 35.09 ? 131 ILE A CD1   1 
ATOM   285 N N     . GLY B 2 29 ? -17.115 -13.847 22.571 1.00 30.91 ? 132 GLY A N     1 
ATOM   286 C CA    . GLY B 2 29 ? -16.937 -12.814 23.549 1.00 35.50 ? 132 GLY A CA    1 
ATOM   287 C C     . GLY B 2 29 ? -15.554 -12.148 23.419 1.00 36.25 ? 132 GLY A C     1 
ATOM   288 O O     . GLY B 2 29 ? -15.406 -10.913 23.561 1.00 34.98 ? 132 GLY A O     1 
ATOM   289 N N     . GLN B 2 30 ? -14.564 -12.964 23.146 1.00 32.97 ? 133 GLN A N     1 
ATOM   290 C CA    . GLN B 2 30 ? -13.201 -12.425 22.969 1.00 34.43 ? 133 GLN A CA    1 
ATOM   291 C C     . GLN B 2 30 ? -13.107 -11.615 21.700 1.00 33.24 ? 133 GLN A C     1 
ATOM   292 O O     . GLN B 2 30 ? -12.338 -10.627 21.654 1.00 33.45 ? 133 GLN A O     1 
ATOM   293 C CB    . GLN B 2 30 ? -12.206 -13.581 22.979 1.00 35.70 ? 133 GLN A CB    1 
ATOM   294 C CG    . GLN B 2 30 ? -12.253 -14.401 24.262 1.00 35.05 ? 133 GLN A CG    1 
ATOM   295 C CD    . GLN B 2 30 ? -11.272 -15.583 24.230 1.00 37.86 ? 133 GLN A CD    1 
ATOM   296 O OE1   . GLN B 2 30 ? -11.255 -16.326 23.273 1.00 31.93 ? 133 GLN A OE1   1 
ATOM   297 N NE2   . GLN B 2 30 ? -10.477 -15.756 25.321 1.00 33.24 ? 133 GLN A NE2   1 
ATOM   298 N N     . LEU B 2 31 ? -13.832 -11.990 20.661 1.00 32.48 ? 134 LEU A N     1 
ATOM   299 C CA    . LEU B 2 31 ? -13.863 -11.200 19.419 1.00 32.79 ? 134 LEU A CA    1 
ATOM   300 C C     . LEU B 2 31 ? -14.536 -9.827  19.619 1.00 33.04 ? 134 LEU A C     1 
ATOM   301 O O     . LEU B 2 31 ? -14.135 -8.852  19.014 1.00 32.79 ? 134 LEU A O     1 
ATOM   302 C CB    . LEU B 2 31 ? -14.531 -11.978 18.273 1.00 33.37 ? 134 LEU A CB    1 
ATOM   303 C CG    . LEU B 2 31 ? -13.752 -13.188 17.752 1.00 33.01 ? 134 LEU A CG    1 
ATOM   304 C CD1   . LEU B 2 31 ? -14.651 -14.015 16.927 1.00 35.00 ? 134 LEU A CD1   1 
ATOM   305 C CD2   . LEU B 2 31 ? -12.596 -12.781 16.900 1.00 34.94 ? 134 LEU A CD2   1 
ATOM   306 N N     . VAL B 2 32 ? -15.584 -9.775  20.440 1.00 35.82 ? 135 VAL A N     1 
ATOM   307 C CA    . VAL B 2 32 ? -16.199 -8.480  20.787 1.00 37.33 ? 135 VAL A CA    1 
ATOM   308 C C     . VAL B 2 32 ? -15.182 -7.495  21.335 1.00 38.90 ? 135 VAL A C     1 
ATOM   309 O O     . VAL B 2 32 ? -15.110 -6.346  20.891 1.00 39.61 ? 135 VAL A O     1 
ATOM   310 C CB    . VAL B 2 32 ? -17.278 -8.629  21.877 1.00 40.16 ? 135 VAL A CB    1 
ATOM   311 C CG1   . VAL B 2 32 ? -17.841 -7.288  22.271 1.00 41.50 ? 135 VAL A CG1   1 
ATOM   312 C CG2   . VAL B 2 32 ? -18.374 -9.568  21.417 1.00 37.57 ? 135 VAL A CG2   1 
ATOM   313 N N     . LYS B 2 33 ? -14.367 -7.934  22.310 1.00 37.35 ? 136 LYS A N     1 
ATOM   314 C CA    . LYS B 2 33 ? -13.367 -7.024  22.876 1.00 41.54 ? 136 LYS A CA    1 
ATOM   315 C C     . LYS B 2 33 ? -12.369 -6.549  21.864 1.00 43.62 ? 136 LYS A C     1 
ATOM   316 O O     . LYS B 2 33 ? -11.943 -5.379  21.853 1.00 46.20 ? 136 LYS A O     1 
ATOM   317 C CB    . LYS B 2 33 ? -12.588 -7.697  24.037 1.00 41.55 ? 136 LYS A CB    1 
ATOM   318 C CG    . LYS B 2 33 ? -13.451 -7.944  25.253 1.00 45.08 ? 136 LYS A CG    1 
ATOM   319 C CD    . LYS B 2 33 ? -12.608 -8.388  26.464 1.00 49.71 ? 136 LYS A CD    1 
ATOM   320 C CE    . LYS B 2 33 ? -13.416 -8.538  27.711 1.00 54.14 ? 136 LYS A CE    1 
ATOM   321 N NZ    . LYS B 2 33 ? -14.477 -9.555  27.561 1.00 59.92 ? 136 LYS A NZ    1 
ATOM   322 N N     . LYS B 2 34 ? -11.949 -7.502  21.014 1.00 41.59 ? 137 LYS A N     1 
ATOM   323 C CA    . LYS B 2 34 ? -10.919 -7.271  20.043 1.00 43.02 ? 137 LYS A CA    1 
ATOM   324 C C     . LYS B 2 34 ? -11.407 -6.460  18.845 1.00 44.31 ? 137 LYS A C     1 
ATOM   325 O O     . LYS B 2 34 ? -10.667 -5.628  18.329 1.00 45.42 ? 137 LYS A O     1 
ATOM   326 C CB    . LYS B 2 34 ? -10.370 -8.642  19.587 1.00 42.81 ? 137 LYS A CB    1 
ATOM   327 C CG    . LYS B 2 34 ? -9.338  -9.253  20.523 1.00 46.34 ? 137 LYS A CG    1 
ATOM   328 C CD    . LYS B 2 34 ? -7.961  -8.618  20.354 1.00 52.36 ? 137 LYS A CD    1 
ATOM   329 C CE    . LYS B 2 34 ? -6.926  -9.230  21.275 1.00 58.67 ? 137 LYS A CE    1 
ATOM   330 N NZ    . LYS B 2 34 ? -5.518  -8.822  20.869 1.00 59.98 ? 137 LYS A NZ    1 
ATOM   331 N N     . CYS B 2 35 ? -12.660 -6.694  18.417 1.00 43.25 ? 138 CYS A N     1 
ATOM   332 C CA    . CYS B 2 35 ? -13.233 -6.021  17.268 1.00 42.79 ? 138 CYS A CA    1 
ATOM   333 C C     . CYS B 2 35 ? -14.133 -4.842  17.609 1.00 43.94 ? 138 CYS A C     1 
ATOM   334 O O     . CYS B 2 35 ? -14.467 -4.020  16.738 1.00 46.78 ? 138 CYS A O     1 
ATOM   335 C CB    . CYS B 2 35 ? -14.028 -7.013  16.415 1.00 40.74 ? 138 CYS A CB    1 
ATOM   336 S SG    . CYS B 2 35 ? -13.023 -8.401  15.839 1.00 37.83 ? 138 CYS A SG    1 
ATOM   337 N N     . GLN B 2 36 ? -14.558 -4.752  18.845 1.00 47.47 ? 139 GLN A N     1 
ATOM   338 C CA    . GLN B 2 36 ? -15.328 -3.576  19.313 1.00 49.50 ? 139 GLN A CA    1 
ATOM   339 C C     . GLN B 2 36 ? -16.636 -3.346  18.567 1.00 48.95 ? 139 GLN A C     1 
ATOM   340 O O     . GLN B 2 36 ? -17.013 -2.196  18.240 1.00 51.05 ? 139 GLN A O     1 
ATOM   341 C CB    . GLN B 2 36 ? -14.411 -2.343  19.310 1.00 50.94 ? 139 GLN A CB    1 
ATOM   342 C CG    . GLN B 2 36 ? -13.281 -2.523  20.327 1.00 54.68 ? 139 GLN A CG    1 
ATOM   343 C CD    . GLN B 2 36 ? -12.205 -1.461  20.257 1.00 62.77 ? 139 GLN A CD    1 
ATOM   344 O OE1   . GLN B 2 36 ? -11.163 -1.586  20.936 1.00 64.09 ? 139 GLN A OE1   1 
ATOM   345 N NE2   . GLN B 2 36 ? -12.441 -0.417  19.454 1.00 66.17 ? 139 GLN A NE2   1 
ATOM   346 N N     . VAL B 2 37 ? -17.350 -4.442  18.324 1.00 45.61 ? 140 VAL A N     1 
ATOM   347 C CA    . VAL B 2 37 ? -18.637 -4.461  17.719 1.00 47.65 ? 140 VAL A CA    1 
ATOM   348 C C     . VAL B 2 37 ? -19.379 -5.562  18.434 1.00 46.62 ? 140 VAL A C     1 
ATOM   349 O O     . VAL B 2 37 ? -18.781 -6.484  19.014 1.00 43.79 ? 140 VAL A O     1 
ATOM   350 C CB    . VAL B 2 37 ? -18.606 -4.737  16.180 1.00 47.09 ? 140 VAL A CB    1 
ATOM   351 C CG1   . VAL B 2 37 ? -17.734 -3.695  15.491 1.00 48.77 ? 140 VAL A CG1   1 
ATOM   352 C CG2   . VAL B 2 37 ? -18.119 -6.131  15.951 1.00 47.98 ? 140 VAL A CG2   1 
ATOM   353 N N     . PRO B 2 38 ? -20.681 -5.460  18.381 1.00 47.88 ? 141 PRO A N     1 
ATOM   354 C CA    . PRO B 2 38 ? -21.605 -6.405  19.007 1.00 48.21 ? 141 PRO A CA    1 
ATOM   355 C C     . PRO B 2 38 ? -21.555 -7.780  18.433 1.00 43.79 ? 141 PRO A C     1 
ATOM   356 O O     . PRO B 2 38 ? -21.181 -7.993  17.283 1.00 46.85 ? 141 PRO A O     1 
ATOM   357 C CB    . PRO B 2 38 ? -22.970 -5.779  18.656 1.00 49.62 ? 141 PRO A CB    1 
ATOM   358 C CG    . PRO B 2 38 ? -22.651 -4.403  18.471 1.00 51.87 ? 141 PRO A CG    1 
ATOM   359 C CD    . PRO B 2 38 ? -21.415 -4.358  17.744 1.00 49.98 ? 141 PRO A CD    1 
ATOM   360 N N     . LYS B 2 39 ? -21.959 -8.724  19.248 1.00 43.03 ? 142 LYS A N     1 
ATOM   361 C CA    . LYS B 2 39 ? -21.920 -10.152 18.885 1.00 42.67 ? 142 LYS A CA    1 
ATOM   362 C C     . LYS B 2 39 ? -22.718 -10.450 17.613 1.00 42.30 ? 142 LYS A C     1 
ATOM   363 O O     . LYS B 2 39 ? -22.265 -11.190 16.734 1.00 37.11 ? 142 LYS A O     1 
ATOM   364 C CB    . LYS B 2 39 ? -22.488 -10.933 20.040 1.00 43.64 ? 142 LYS A CB    1 
ATOM   365 C CG    . LYS B 2 39 ? -22.488 -12.422 19.870 1.00 46.82 ? 142 LYS A CG    1 
ATOM   366 N N     . LYS B 2 40 ? -23.949 -9.914  17.548 1.00 42.18 ? 143 LYS A N     1 
ATOM   367 C CA    . LYS B 2 40 ? -24.788 -10.128 16.364 1.00 42.83 ? 143 LYS A CA    1 
ATOM   368 C C     . LYS B 2 40 ? -24.034 -9.721  15.100 1.00 41.60 ? 143 LYS A C     1 
ATOM   369 O O     . LYS B 2 40 ? -24.021 -10.440 14.100 1.00 40.86 ? 143 LYS A O     1 
ATOM   370 C CB    . LYS B 2 40 ? -26.095 -9.313  16.514 1.00 44.57 ? 143 LYS A CB    1 
ATOM   371 C CG    . LYS B 2 40 ? -27.166 -9.579  15.413 1.00 50.88 ? 143 LYS A CG    1 
ATOM   372 C CD    . LYS B 2 40 ? -28.330 -8.458  15.457 1.00 55.24 ? 143 LYS A CD    1 
ATOM   373 C CE    . LYS B 2 40 ? -29.702 -8.850  14.848 1.00 64.27 ? 143 LYS A CE    1 
ATOM   374 N NZ    . LYS B 2 40 ? -30.863 -9.047  15.903 1.00 59.68 ? 143 LYS A NZ    1 
ATOM   375 N N     . THR B 2 41 ? -23.437 -8.547  15.122 1.00 41.73 ? 144 THR A N     1 
ATOM   376 C CA    . THR B 2 41 ? -22.687 -8.062  13.970 1.00 43.42 ? 144 THR A CA    1 
ATOM   377 C C     . THR B 2 41 ? -21.543 -8.975  13.589 1.00 39.36 ? 144 THR A C     1 
ATOM   378 O O     . THR B 2 41 ? -21.283 -9.202  12.430 1.00 37.97 ? 144 THR A O     1 
ATOM   379 C CB    . THR B 2 41 ? -22.123 -6.686  14.286 1.00 45.00 ? 144 THR A CB    1 
ATOM   380 O OG1   . THR B 2 41 ? -23.224 -5.800  14.576 1.00 49.48 ? 144 THR A OG1   1 
ATOM   381 C CG2   . THR B 2 41 ? -21.462 -6.072  13.071 1.00 45.73 ? 144 THR A CG2   1 
ATOM   382 N N     . LEU B 2 42 ? -20.847 -9.504  14.591 1.00 38.12 ? 145 LEU A N     1 
ATOM   383 C CA    . LEU B 2 42 ? -19.763 -10.434 14.337 1.00 37.20 ? 145 LEU A CA    1 
ATOM   384 C C     . LEU B 2 42 ? -20.274 -11.700 13.718 1.00 36.06 ? 145 LEU A C     1 
ATOM   385 O O     . LEU B 2 42 ? -19.706 -12.207 12.758 1.00 36.40 ? 145 LEU A O     1 
ATOM   386 C CB    . LEU B 2 42 ? -19.040 -10.791 15.632 1.00 36.63 ? 145 LEU A CB    1 
ATOM   387 C CG    . LEU B 2 42 ? -18.108 -9.672  16.139 1.00 37.05 ? 145 LEU A CG    1 
ATOM   388 C CD1   . LEU B 2 42 ? -17.556 -10.082 17.524 1.00 36.18 ? 145 LEU A CD1   1 
ATOM   389 C CD2   . LEU B 2 42 ? -17.021 -9.329  15.181 1.00 39.41 ? 145 LEU A CD2   1 
ATOM   390 N N     . ASN B 2 43 ? -21.348 -12.226 14.279 1.00 34.45 ? 146 ASN A N     1 
ATOM   391 C CA    . ASN B 2 43 ? -21.875 -13.499 13.794 1.00 35.16 ? 146 ASN A CA    1 
ATOM   392 C C     . ASN B 2 43 ? -22.378 -13.421 12.363 1.00 34.63 ? 146 ASN A C     1 
ATOM   393 O O     . ASN B 2 43 ? -22.186 -14.342 11.603 1.00 33.85 ? 146 ASN A O     1 
ATOM   394 C CB    . ASN B 2 43 ? -22.944 -14.059 14.741 1.00 35.36 ? 146 ASN A CB    1 
ATOM   395 C CG    . ASN B 2 43 ? -22.333 -14.743 15.943 1.00 36.77 ? 146 ASN A CG    1 
ATOM   396 O OD1   . ASN B 2 43 ? -21.281 -15.336 15.849 1.00 38.10 ? 146 ASN A OD1   1 
ATOM   397 N ND2   . ASN B 2 43 ? -23.032 -14.651 17.098 1.00 35.96 ? 146 ASN A ND2   1 
ATOM   398 N N     . GLN B 2 44 ? -22.956 -12.282 11.989 1.00 36.56 ? 147 GLN A N     1 
ATOM   399 C CA    . GLN B 2 44 ? -23.392 -12.155 10.587 1.00 38.87 ? 147 GLN A CA    1 
ATOM   400 C C     . GLN B 2 44 ? -22.185 -12.405 9.646  1.00 37.94 ? 147 GLN A C     1 
ATOM   401 O O     . GLN B 2 44 ? -22.281 -13.099 8.652  1.00 38.57 ? 147 GLN A O     1 
ATOM   402 C CB    . GLN B 2 44 ? -24.002 -10.790 10.312 1.00 41.44 ? 147 GLN A CB    1 
ATOM   403 C CG    . GLN B 2 44 ? -25.198 -10.406 11.199 1.00 43.96 ? 147 GLN A CG    1 
ATOM   404 C CD    . GLN B 2 44 ? -25.620 -8.954  10.995 1.00 47.54 ? 147 GLN A CD    1 
ATOM   405 O OE1   . GLN B 2 44 ? -24.786 -8.037  11.043 1.00 51.16 ? 147 GLN A OE1   1 
ATOM   406 N NE2   . GLN B 2 44 ? -26.916 -8.731  10.799 1.00 47.42 ? 147 GLN A NE2   1 
ATOM   407 N N     . VAL B 2 45 ? -21.047 -11.811 9.967  1.00 38.74 ? 148 VAL A N     1 
ATOM   408 C CA    . VAL B 2 45 ? -19.823 -11.966 9.173  1.00 39.07 ? 148 VAL A CA    1 
ATOM   409 C C     . VAL B 2 45 ? -19.211 -13.355 9.342  1.00 38.30 ? 148 VAL A C     1 
ATOM   410 O O     . VAL B 2 45 ? -18.893 -14.037 8.364  1.00 37.65 ? 148 VAL A O     1 
ATOM   411 C CB    . VAL B 2 45 ? -18.759 -10.912 9.554  1.00 39.76 ? 148 VAL A CB    1 
ATOM   412 C CG1   . VAL B 2 45 ? -17.469 -11.090 8.664  1.00 40.33 ? 148 VAL A CG1   1 
ATOM   413 C CG2   . VAL B 2 45 ? -19.289 -9.533  9.424  1.00 41.43 ? 148 VAL A CG2   1 
ATOM   414 N N     . LEU B 2 46 ? -19.081 -13.807 10.599 1.00 35.46 ? 149 LEU A N     1 
ATOM   415 C CA    . LEU B 2 46 ? -18.522 -15.134 10.881 1.00 34.28 ? 149 LEU A CA    1 
ATOM   416 C C     . LEU B 2 46 ? -19.211 -16.250 10.164 1.00 35.24 ? 149 LEU A C     1 
ATOM   417 O O     . LEU B 2 46 ? -18.563 -17.105 9.555  1.00 36.10 ? 149 LEU A O     1 
ATOM   418 C CB    . LEU B 2 46 ? -18.593 -15.435 12.368 1.00 33.19 ? 149 LEU A CB    1 
ATOM   419 C CG    . LEU B 2 46 ? -17.534 -14.703 13.205 1.00 33.62 ? 149 LEU A CG    1 
ATOM   420 C CD1   . LEU B 2 46 ? -17.847 -14.787 14.662 1.00 33.96 ? 149 LEU A CD1   1 
ATOM   421 C CD2   . LEU B 2 46 ? -16.121 -15.274 12.905 1.00 34.24 ? 149 LEU A CD2   1 
ATOM   422 N N     . TYR B 2 47 ? -20.555 -16.259 10.200 1.00 36.66 ? 150 TYR A N     1 
ATOM   423 C CA    . TYR B 2 47 ? -21.279 -17.332 9.554  1.00 37.01 ? 150 TYR A CA    1 
ATOM   424 C C     . TYR B 2 47 ? -21.143 -17.241 8.028  1.00 40.67 ? 150 TYR A C     1 
ATOM   425 O O     . TYR B 2 47 ? -21.157 -18.253 7.320  1.00 41.17 ? 150 TYR A O     1 
ATOM   426 C CB    . TYR B 2 47 ? -22.734 -17.395 9.991  1.00 38.30 ? 150 TYR A CB    1 
ATOM   427 C CG    . TYR B 2 47 ? -22.860 -18.085 11.343 1.00 35.27 ? 150 TYR A CG    1 
ATOM   428 C CD1   . TYR B 2 47 ? -22.840 -19.462 11.422 1.00 37.83 ? 150 TYR A CD1   1 
ATOM   429 C CD2   . TYR B 2 47 ? -22.896 -17.355 12.507 1.00 34.08 ? 150 TYR A CD2   1 
ATOM   430 C CE1   . TYR B 2 47 ? -22.888 -20.118 12.647 1.00 39.78 ? 150 TYR A CE1   1 
ATOM   431 C CE2   . TYR B 2 47 ? -22.978 -18.013 13.756 1.00 35.29 ? 150 TYR A CE2   1 
ATOM   432 C CZ    . TYR B 2 47 ? -22.970 -19.381 13.809 1.00 35.56 ? 150 TYR A CZ    1 
ATOM   433 O OH    . TYR B 2 47 ? -23.036 -20.021 15.014 1.00 41.58 ? 150 TYR A OH    1 
ATOM   434 N N     . ARG B 2 48 ? -21.003 -16.034 7.541  1.00 42.13 ? 151 ARG A N     1 
ATOM   435 C CA    . ARG B 2 48 ? -20.790 -15.885 6.119  1.00 45.55 ? 151 ARG A CA    1 
ATOM   436 C C     . ARG B 2 48 ? -19.413 -16.463 5.766  1.00 44.32 ? 151 ARG A C     1 
ATOM   437 O O     . ARG B 2 48 ? -19.290 -17.325 4.902  1.00 44.17 ? 151 ARG A O     1 
ATOM   438 C CB    . ARG B 2 48 ? -20.871 -14.439 5.695  1.00 45.79 ? 151 ARG A CB    1 
ATOM   439 C CG    . ARG B 2 48 ? -20.960 -14.397 4.212  1.00 51.78 ? 151 ARG A CG    1 
ATOM   440 C CD    . ARG B 2 48 ? -20.868 -13.058 3.552  1.00 57.30 ? 151 ARG A CD    1 
ATOM   441 N NE    . ARG B 2 48 ? -20.226 -11.963 4.245  1.00 58.77 ? 151 ARG A NE    1 
ATOM   442 C CZ    . ARG B 2 48 ? -18.929 -11.666 4.188  1.00 64.63 ? 151 ARG A CZ    1 
ATOM   443 N NH1   . ARG B 2 48 ? -18.484 -10.582 4.819  1.00 65.91 ? 151 ARG A NH1   1 
ATOM   444 N NH2   . ARG B 2 48 ? -18.065 -12.434 3.530  1.00 66.45 ? 151 ARG A NH2   1 
ATOM   445 N N     . LEU B 2 49 ? -18.396 -16.031 6.509  1.00 44.21 ? 152 LEU A N     1 
ATOM   446 C CA    . LEU B 2 49 ? -17.042 -16.534 6.293  1.00 44.59 ? 152 LEU A CA    1 
ATOM   447 C C     . LEU B 2 49 ? -17.026 -18.054 6.365  1.00 46.04 ? 152 LEU A C     1 
ATOM   448 O O     . LEU B 2 49 ? -16.346 -18.712 5.561  1.00 47.11 ? 152 LEU A O     1 
ATOM   449 C CB    . LEU B 2 49 ? -16.021 -15.920 7.261  1.00 44.19 ? 152 LEU A CB    1 
ATOM   450 C CG    . LEU B 2 49 ? -15.768 -14.429 7.107  1.00 44.45 ? 152 LEU A CG    1 
ATOM   451 C CD1   . LEU B 2 49 ? -14.843 -13.936 8.272  1.00 46.49 ? 152 LEU A CD1   1 
ATOM   452 C CD2   . LEU B 2 49 ? -15.141 -14.135 5.771  1.00 46.91 ? 152 LEU A CD2   1 
ATOM   453 N N     . LYS B 2 50 ? -17.800 -18.622 7.278  1.00 44.73 ? 153 LYS A N     1 
ATOM   454 C CA    . LYS B 2 50 ? -17.841 -20.055 7.455  1.00 47.99 ? 153 LYS A CA    1 
ATOM   455 C C     . LYS B 2 50 ? -18.425 -20.762 6.223  1.00 50.89 ? 153 LYS A C     1 
ATOM   456 O O     . LYS B 2 50 ? -17.943 -21.808 5.812  1.00 53.11 ? 153 LYS A O     1 
ATOM   457 C CB    . LYS B 2 50 ? -18.606 -20.476 8.709  1.00 47.14 ? 153 LYS A CB    1 
ATOM   458 C CG    . LYS B 2 50 ? -19.086 -21.903 8.663  1.00 51.50 ? 153 LYS A CG    1 
ATOM   459 C CD    . LYS B 2 50 ? -19.545 -22.441 9.988  1.00 54.02 ? 153 LYS A CD    1 
ATOM   460 C CE    . LYS B 2 50 ? -20.339 -23.730 9.791  1.00 58.95 ? 153 LYS A CE    1 
ATOM   461 N NZ    . LYS B 2 50 ? -19.849 -24.598 8.627  1.00 60.56 ? 153 LYS A NZ    1 
ATOM   462 N N     . LYS B 2 51 ? -19.446 -20.168 5.648  1.00 53.48 ? 154 LYS A N     1 
ATOM   463 C CA    . LYS B 2 51 ? -20.105 -20.732 4.492  1.00 57.00 ? 154 LYS A CA    1 
ATOM   464 C C     . LYS B 2 51 ? -19.159 -20.638 3.292  1.00 59.38 ? 154 LYS A C     1 
ATOM   465 O O     . LYS B 2 51 ? -19.326 -21.343 2.293  1.00 60.75 ? 154 LYS A O     1 
ATOM   466 C CB    . LYS B 2 51 ? -21.359 -19.954 4.192  1.00 58.67 ? 154 LYS A CB    1 
ATOM   467 C CG    . LYS B 2 51 ? -22.289 -20.622 3.212  1.00 64.72 ? 154 LYS A CG    1 
ATOM   468 C CD    . LYS B 2 51 ? -23.452 -19.718 2.915  1.00 71.26 ? 154 LYS A CD    1 
ATOM   469 C CE    . LYS B 2 51 ? -23.593 -19.490 1.436  1.00 77.48 ? 154 LYS A CE    1 
ATOM   470 N NZ    . LYS B 2 51 ? -23.783 -20.769 0.659  1.00 81.54 ? 154 LYS A NZ    1 
ATOM   471 N N     . GLU B 2 52 ? -18.190 -19.746 3.406  1.00 60.68 ? 155 GLU A N     1 
ATOM   472 C CA    . GLU B 2 52 ? -17.166 -19.557 2.401  1.00 62.93 ? 155 GLU A CA    1 
ATOM   473 C C     . GLU B 2 52 ? -15.941 -20.412 2.702  1.00 63.86 ? 155 GLU A C     1 
ATOM   474 O O     . GLU B 2 52 ? -14.914 -20.232 2.070  1.00 64.40 ? 155 GLU A O     1 
ATOM   475 C CB    . GLU B 2 52 ? -16.761 -18.073 2.325  1.00 62.39 ? 155 GLU A CB    1 
ATOM   476 C CG    . GLU B 2 52 ? -17.826 -17.107 1.834  1.00 63.94 ? 155 GLU A CG    1 
ATOM   477 C CD    . GLU B 2 52 ? -17.387 -15.647 1.897  1.00 63.48 ? 155 GLU A CD    1 
ATOM   478 O OE1   . GLU B 2 52 ? -16.190 -15.396 2.073  1.00 69.42 ? 155 GLU A OE1   1 
ATOM   479 O OE2   . GLU B 2 52 ? -18.230 -14.733 1.764  1.00 65.21 ? 155 GLU A OE2   1 
ATOM   480 N N     . ASP B 2 53 ? -16.037 -21.332 3.662  1.00 64.23 ? 156 ASP A N     1 
ATOM   481 C CA    . ASP B 2 53 ? -14.900 -22.189 4.047  1.00 64.96 ? 156 ASP A CA    1 
ATOM   482 C C     . ASP B 2 53 ? -13.659 -21.370 4.479  1.00 62.79 ? 156 ASP A C     1 
ATOM   483 O O     . ASP B 2 53 ? -12.531 -21.835 4.366  1.00 63.16 ? 156 ASP A O     1 
ATOM   484 C CB    . ASP B 2 53 ? -14.515 -23.154 2.908  1.00 67.28 ? 156 ASP A CB    1 
ATOM   485 C CG    . ASP B 2 53 ? -15.394 -24.396 2.850  1.00 72.45 ? 156 ASP A CG    1 
ATOM   486 O OD1   . ASP B 2 53 ? -16.167 -24.673 3.803  1.00 74.24 ? 156 ASP A OD1   1 
ATOM   487 O OD2   . ASP B 2 53 ? -15.379 -25.174 1.871  1.00 80.77 ? 156 ASP A OD2   1 
ATOM   488 N N     . ARG B 2 54 ? -13.879 -20.177 5.008  1.00 59.60 ? 157 ARG A N     1 
ATOM   489 C CA    . ARG B 2 54 ? -12.783 -19.281 5.415  1.00 56.63 ? 157 ARG A CA    1 
ATOM   490 C C     . ARG B 2 54 ? -12.521 -19.176 6.914  1.00 52.87 ? 157 ARG A C     1 
ATOM   491 O O     . ARG B 2 54 ? -11.539 -18.542 7.307  1.00 49.38 ? 157 ARG A O     1 
ATOM   492 C CB    . ARG B 2 54 ? -13.073 -17.907 4.880  1.00 56.77 ? 157 ARG A CB    1 
ATOM   493 C CG    . ARG B 2 54 ? -13.346 -17.944 3.416  1.00 61.53 ? 157 ARG A CG    1 
ATOM   494 C CD    . ARG B 2 54 ? -12.358 -17.187 2.602  1.00 68.76 ? 157 ARG A CD    1 
ATOM   495 N NE    . ARG B 2 54 ? -12.675 -15.764 2.670  1.00 70.92 ? 157 ARG A NE    1 
ATOM   496 C CZ    . ARG B 2 54 ? -11.838 -14.845 3.112  1.00 72.06 ? 157 ARG A CZ    1 
ATOM   497 N NH1   . ARG B 2 54 ? -10.591 -15.195 3.535  1.00 68.78 ? 157 ARG A NH1   1 
ATOM   498 N NH2   . ARG B 2 54 ? -12.230 -13.575 3.103  1.00 69.26 ? 157 ARG A NH2   1 
ATOM   499 N N     . VAL B 2 55 ? -13.445 -19.733 7.726  1.00 48.91 ? 158 VAL A N     1 
ATOM   500 C CA    . VAL B 2 55 ? -13.255 -19.905 9.132  1.00 46.42 ? 158 VAL A CA    1 
ATOM   501 C C     . VAL B 2 55 ? -13.994 -21.168 9.454  1.00 48.54 ? 158 VAL A C     1 
ATOM   502 O O     . VAL B 2 55 ? -14.708 -21.696 8.614  1.00 47.80 ? 158 VAL A O     1 
ATOM   503 C CB    . VAL B 2 55 ? -13.811 -18.706 9.940  1.00 44.16 ? 158 VAL A CB    1 
ATOM   504 C CG1   . VAL B 2 55 ? -12.962 -17.475 9.630  1.00 39.24 ? 158 VAL A CG1   1 
ATOM   505 C CG2   . VAL B 2 55 ? -15.216 -18.475 9.592  1.00 41.53 ? 158 VAL A CG2   1 
ATOM   506 N N     . SER B 2 56 ? -13.830 -21.676 10.665 1.00 48.20 ? 159 SER A N     1 
ATOM   507 C CA    . SER B 2 56 ? -14.518 -22.872 11.110 1.00 50.63 ? 159 SER A CA    1 
ATOM   508 C C     . SER B 2 56 ? -14.968 -22.612 12.502 1.00 48.50 ? 159 SER A C     1 
ATOM   509 O O     . SER B 2 56 ? -14.472 -21.680 13.147 1.00 46.04 ? 159 SER A O     1 
ATOM   510 C CB    . SER B 2 56 ? -13.570 -24.086 11.113 1.00 53.05 ? 159 SER A CB    1 
ATOM   511 O OG    . SER B 2 56 ? -12.543 -23.845 12.040 1.00 59.07 ? 159 SER A OG    1 
ATOM   512 N N     . SER B 2 57 ? -15.904 -23.423 12.963 1.00 49.73 ? 160 SER A N     1 
ATOM   513 C CA    . SER B 2 57 ? -16.421 -23.330 14.294 1.00 49.79 ? 160 SER A CA    1 
ATOM   514 C C     . SER B 2 57 ? -16.289 -24.706 14.872 1.00 51.80 ? 160 SER A C     1 
ATOM   515 O O     . SER B 2 57 ? -17.229 -25.519 14.750 1.00 52.87 ? 160 SER A O     1 
ATOM   516 C CB    . SER B 2 57 ? -17.889 -22.920 14.250 1.00 50.47 ? 160 SER A CB    1 
ATOM   517 O OG    . SER B 2 57 ? -18.322 -22.453 15.496 1.00 50.43 ? 160 SER A OG    1 
ATOM   518 N N     . PRO B 2 58 ? -15.149 -24.997 15.492 1.00 51.53 ? 161 PRO A N     1 
ATOM   519 C CA    . PRO B 2 58 ? -14.920 -26.324 16.062 1.00 54.58 ? 161 PRO A CA    1 
ATOM   520 C C     . PRO B 2 58 ? -15.796 -26.581 17.262 1.00 54.51 ? 161 PRO A C     1 
ATOM   521 O O     . PRO B 2 58 ? -15.957 -27.708 17.644 1.00 55.91 ? 161 PRO A O     1 
ATOM   522 C CB    . PRO B 2 58 ? -13.443 -26.270 16.486 1.00 52.82 ? 161 PRO A CB    1 
ATOM   523 C CG    . PRO B 2 58 ? -13.249 -24.852 16.793 1.00 52.43 ? 161 PRO A CG    1 
ATOM   524 C CD    . PRO B 2 58 ? -13.983 -24.141 15.677 1.00 50.72 ? 161 PRO A CD    1 
ATOM   525 N N     . GLU B 2 59 ? -16.296 -25.510 17.851 1.00 54.11 ? 162 GLU A N     1 
ATOM   526 C CA    . GLU B 2 59 ? -17.224 -25.558 18.964 1.00 56.02 ? 162 GLU A CA    1 
ATOM   527 C C     . GLU B 2 59 ? -18.222 -24.447 18.808 1.00 54.01 ? 162 GLU A C     1 
ATOM   528 O O     . GLU B 2 59 ? -17.985 -23.487 18.130 1.00 50.50 ? 162 GLU A O     1 
ATOM   529 C CB    . GLU B 2 59 ? -16.511 -25.230 20.244 1.00 56.20 ? 162 GLU A CB    1 
ATOM   530 C CG    . GLU B 2 59 ? -16.024 -26.371 21.053 1.00 63.46 ? 162 GLU A CG    1 
ATOM   531 C CD    . GLU B 2 59 ? -15.394 -25.875 22.328 1.00 66.89 ? 162 GLU A CD    1 
ATOM   532 O OE1   . GLU B 2 59 ? -16.081 -25.140 23.054 1.00 70.67 ? 162 GLU A OE1   1 
ATOM   533 O OE2   . GLU B 2 59 ? -14.215 -26.197 22.579 1.00 71.28 ? 162 GLU A OE2   1 
ATOM   534 N N     . PRO B 2 60 ? -19.328 -24.550 19.520 1.00 55.47 ? 163 PRO A N     1 
ATOM   535 C CA    . PRO B 2 60 ? -20.366 -23.526 19.424 1.00 52.54 ? 163 PRO A CA    1 
ATOM   536 C C     . PRO B 2 60 ? -19.868 -22.173 19.946 1.00 46.57 ? 163 PRO A C     1 
ATOM   537 O O     . PRO B 2 60 ? -19.242 -22.081 20.995 1.00 43.91 ? 163 PRO A O     1 
ATOM   538 C CB    . PRO B 2 60 ? -21.460 -24.086 20.306 1.00 56.45 ? 163 PRO A CB    1 
ATOM   539 C CG    . PRO B 2 60 ? -20.728 -24.924 21.268 1.00 58.31 ? 163 PRO A CG    1 
ATOM   540 C CD    . PRO B 2 60 ? -19.686 -25.614 20.467 1.00 57.62 ? 163 PRO A CD    1 
ATOM   541 N N     . ALA B 2 61 ? -20.153 -21.140 19.160 1.00 42.20 ? 164 ALA A N     1 
ATOM   542 C CA    . ALA B 2 61 ? -19.756 -19.762 19.456 1.00 38.85 ? 164 ALA A CA    1 
ATOM   543 C C     . ALA B 2 61 ? -18.252 -19.668 19.636 1.00 36.77 ? 164 ALA A C     1 
ATOM   544 O O     . ALA B 2 61 ? -17.768 -18.795 20.349 1.00 35.64 ? 164 ALA A O     1 
ATOM   545 C CB    . ALA B 2 61 ? -20.469 -19.212 20.634 1.00 39.96 ? 164 ALA A CB    1 
ATOM   546 N N     . THR B 2 62 ? -17.534 -20.580 19.014 1.00 35.99 ? 165 THR A N     1 
ATOM   547 C CA    . THR B 2 62 ? -16.061 -20.562 19.054 1.00 35.35 ? 165 THR A CA    1 
ATOM   548 C C     . THR B 2 62 ? -15.541 -20.627 17.648 1.00 35.43 ? 165 THR A C     1 
ATOM   549 O O     . THR B 2 62 ? -16.078 -21.379 16.822 1.00 34.55 ? 165 THR A O     1 
ATOM   550 C CB    . THR B 2 62 ? -15.549 -21.763 19.845 1.00 38.24 ? 165 THR A CB    1 
ATOM   551 O OG1   . THR B 2 62 ? -16.178 -21.750 21.142 1.00 38.53 ? 165 THR A OG1   1 
ATOM   552 C CG2   . THR B 2 62 ? -14.089 -21.601 20.141 1.00 37.58 ? 165 THR A CG2   1 
ATOM   553 N N     . TRP B 2 63 ? -14.498 -19.813 17.327 1.00 32.62 ? 166 TRP A N     1 
ATOM   554 C CA    . TRP B 2 63 ? -14.096 -19.659 15.947 1.00 33.06 ? 166 TRP A CA    1 
ATOM   555 C C     . TRP B 2 63 ? -12.596 -19.743 15.765 1.00 33.77 ? 166 TRP A C     1 
ATOM   556 O O     . TRP B 2 63 ? -11.833 -19.374 16.652 1.00 33.69 ? 166 TRP A O     1 
ATOM   557 C CB    . TRP B 2 63 ? -14.604 -18.303 15.432 1.00 33.42 ? 166 TRP A CB    1 
ATOM   558 C CG    . TRP B 2 63 ? -16.121 -18.207 15.512 1.00 31.99 ? 166 TRP A CG    1 
ATOM   559 C CD1   . TRP B 2 63 ? -16.861 -17.794 16.573 1.00 34.63 ? 166 TRP A CD1   1 
ATOM   560 C CD2   . TRP B 2 63 ? -17.045 -18.656 14.536 1.00 35.87 ? 166 TRP A CD2   1 
ATOM   561 N NE1   . TRP B 2 63 ? -18.199 -17.912 16.299 1.00 33.57 ? 166 TRP A NE1   1 
ATOM   562 C CE2   . TRP B 2 63 ? -18.345 -18.436 15.057 1.00 36.86 ? 166 TRP A CE2   1 
ATOM   563 C CE3   . TRP B 2 63 ? -16.932 -19.146 13.224 1.00 35.36 ? 166 TRP A CE3   1 
ATOM   564 C CZ2   . TRP B 2 63 ? -19.524 -18.708 14.306 1.00 39.91 ? 166 TRP A CZ2   1 
ATOM   565 C CZ3   . TRP B 2 63 ? -18.089 -19.428 12.529 1.00 38.42 ? 166 TRP A CZ3   1 
ATOM   566 C CH2   . TRP B 2 63 ? -19.354 -19.237 13.079 1.00 39.92 ? 166 TRP A CH2   1 
ATOM   567 N N     . SER B 2 64 ? -12.186 -20.280 14.620 1.00 34.52 ? 167 SER A N     1 
ATOM   568 C CA    . SER B 2 64 ? -10.764 -20.346 14.321 1.00 38.65 ? 167 SER A CA    1 
ATOM   569 C C     . SER B 2 64 ? -10.535 -20.187 12.814 1.00 40.16 ? 167 SER A C     1 
ATOM   570 O O     . SER B 2 64 ? -11.462 -20.261 12.037 1.00 42.23 ? 167 SER A O     1 
ATOM   571 C CB    . SER B 2 64 ? -10.164 -21.691 14.798 1.00 40.13 ? 167 SER A CB    1 
ATOM   572 O OG    . SER B 2 64 ? -10.725 -22.739 14.071 1.00 43.98 ? 167 SER A OG    1 
ATOM   573 N N     . ILE B 2 65 ? -9.289  -20.092 12.416 1.00 45.41 ? 168 ILE A N     1 
ATOM   574 C CA    . ILE B 2 65 ? -8.982  -19.888 11.017 1.00 47.33 ? 168 ILE A CA    1 
ATOM   575 C C     . ILE B 2 65 ? -9.115  -21.216 10.257 1.00 48.77 ? 168 ILE A C     1 
ATOM   576 O O     . ILE B 2 65 ? -8.676  -22.275 10.718 1.00 48.27 ? 168 ILE A O     1 
ATOM   577 C CB    . ILE B 2 65 ? -7.553  -19.351 10.812 1.00 48.75 ? 168 ILE A CB    1 
ATOM   578 C CG1   . ILE B 2 65 ? -7.453  -17.830 10.884 1.00 51.99 ? 168 ILE A CG1   1 
ATOM   579 C CG2   . ILE B 2 65 ? -7.091  -19.750 9.409  1.00 52.58 ? 168 ILE A CG2   1 
ATOM   580 C CD1   . ILE B 2 65 ? -8.017  -17.060 9.643  1.00 48.55 ? 168 ILE A CD1   1 
ATOM   581 N N     . GLY B 2 66 ? -9.691  -21.120 9.071  1.00 49.93 ? 169 GLY A N     1 
ATOM   582 C CA    . GLY B 2 66 ? -9.919  -22.254 8.219  1.00 53.51 ? 169 GLY A CA    1 
ATOM   583 C C     . GLY B 2 66 ? -11.303 -22.839 8.397  1.00 55.16 ? 169 GLY A C     1 
ATOM   584 O O     . GLY B 2 66 ? -11.595 -23.367 9.489  1.00 57.12 ? 169 GLY A O     1 
HETATM 585 O O     . HOH C 3 .  ? -28.323 -21.168 10.200 1.00 45.10 ? 304 HOH B O     1 
HETATM 586 O O     . HOH C 3 .  ? -25.595 -17.419 25.965 1.00 45.56 ? 305 HOH B O     1 
HETATM 587 O O     . HOH C 3 .  ? -26.754 -14.952 21.861 1.00 42.75 ? 306 HOH B O     1 
HETATM 588 O O     . HOH C 3 .  ? -25.517 -17.503 21.475 1.00 35.24 ? 307 HOH B O     1 
HETATM 589 O O     . HOH C 3 .  ? -28.020 -15.107 5.706  1.00 50.22 ? 321 HOH B O     1 
HETATM 590 O O     . HOH C 3 .  ? -22.866 -15.467 20.028 1.00 48.22 ? 329 HOH B O     1 
HETATM 591 O O     . HOH C 3 .  ? -30.821 -13.133 14.629 1.00 39.92 ? 332 HOH B O     1 
HETATM 592 O O     . HOH C 3 .  ? -26.281 -19.648 9.126  1.00 58.77 ? 333 HOH B O     1 
HETATM 593 O O     . HOH C 3 .  ? -29.968 -25.498 27.654 1.00 57.72 ? 340 HOH B O     1 
HETATM 594 O O     . HOH C 3 .  ? -37.173 -13.803 11.111 1.00 54.26 ? 342 HOH B O     1 
HETATM 595 O O     . HOH C 3 .  ? -37.789 -14.385 8.192  1.00 48.92 ? 343 HOH B O     1 
HETATM 596 O O     . HOH C 3 .  ? -23.970 -17.686 23.687 1.00 41.73 ? 344 HOH B O     1 
HETATM 597 O O     . HOH C 3 .  ? -18.976 -19.049 23.750 1.00 57.95 ? 345 HOH B O     1 
HETATM 598 O O     . HOH C 3 .  ? -31.457 -9.719  12.536 1.00 55.23 ? 349 HOH B O     1 
HETATM 599 O O     . HOH C 3 .  ? -26.730 -10.313 7.912  1.00 55.62 ? 354 HOH B O     1 
HETATM 600 O O     . HOH C 3 .  ? -24.244 -25.220 21.962 1.00 59.73 ? 355 HOH B O     1 
HETATM 601 O O     . HOH C 3 .  ? -31.309 -26.130 21.077 1.00 70.18 ? 361 HOH B O     1 
HETATM 602 O O     . HOH C 3 .  ? -34.515 -29.328 16.531 1.00 84.01 ? 362 HOH B O     1 
HETATM 603 O O     . HOH C 3 .  ? -29.786 -11.866 16.941 1.00 53.57 ? 373 HOH B O     1 
HETATM 604 O O     . HOH C 3 .  ? -39.795 -10.827 10.290 1.00 79.48 ? 388 HOH B O     1 
HETATM 605 O O     . HOH C 3 .  ? -37.986 -8.957  10.267 1.00 79.03 ? 389 HOH B O     1 
HETATM 606 O O     . HOH C 3 .  ? -26.890 -11.943 20.843 1.00 64.53 ? 390 HOH B O     1 
HETATM 607 O O     . HOH C 3 .  ? -31.803 -29.146 18.057 0.5  67.88 ? 391 HOH B O     1 
HETATM 608 O O     . HOH C 3 .  ? -34.490 -7.873  12.872 1.00 59.61 ? 395 HOH B O     1 
HETATM 609 O O     . HOH D 3 .  ? -7.853  -18.830 15.346 1.00 43.75 ? 301 HOH A O     1 
HETATM 610 O O     . HOH D 3 .  ? -4.370  -15.000 22.085 1.00 47.48 ? 302 HOH A O     1 
HETATM 611 O O     . HOH D 3 .  ? -20.583 -17.121 17.591 1.00 34.30 ? 303 HOH A O     1 
HETATM 612 O O     . HOH D 3 .  ? -5.995  -12.219 18.441 1.00 35.47 ? 308 HOH A O     1 
HETATM 613 O O     . HOH D 3 .  ? -7.631  -13.604 20.633 1.00 39.23 ? 309 HOH A O     1 
HETATM 614 O O     . HOH D 3 .  ? -7.157  -19.896 21.455 1.00 36.99 ? 310 HOH A O     1 
HETATM 615 O O     . HOH D 3 .  ? -10.254 -10.608 23.564 1.00 39.06 ? 311 HOH A O     1 
HETATM 616 O O     . HOH D 3 .  ? -22.557 -2.795  14.855 1.00 51.97 ? 312 HOH A O     1 
HETATM 617 O O     . HOH D 3 .  ? -22.369 -7.837  10.222 1.00 46.73 ? 313 HOH A O     1 
HETATM 618 O O     . HOH D 3 .  ? -7.410  -23.598 16.186 1.00 51.95 ? 314 HOH A O     1 
HETATM 619 O O     . HOH D 3 .  ? -3.725  -13.319 19.987 1.00 37.53 ? 315 HOH A O     1 
HETATM 620 O O     . HOH D 3 .  ? -5.113  -9.908  18.698 1.00 67.03 ? 316 HOH A O     1 
HETATM 621 O O     . HOH D 3 .  ? -24.334 -14.034 4.196  1.00 55.50 ? 317 HOH A O     1 
HETATM 622 O O     . HOH D 3 .  ? -8.920  -4.024  22.589 1.00 55.29 ? 318 HOH A O     1 
HETATM 623 O O     . HOH D 3 .  ? -8.816  -8.221  24.217 1.00 48.77 ? 319 HOH A O     1 
HETATM 624 O O     . HOH D 3 .  ? -26.786 -13.627 7.579  1.00 48.30 ? 320 HOH A O     1 
HETATM 625 O O     . HOH D 3 .  ? -8.456  -12.661 22.692 1.00 46.99 ? 322 HOH A O     1 
HETATM 626 O O     . HOH D 3 .  ? -1.321  -11.994 19.710 1.00 54.17 ? 323 HOH A O     1 
HETATM 627 O O     . HOH D 3 .  ? -16.181 -15.417 26.246 1.00 39.81 ? 324 HOH A O     1 
HETATM 628 O O     . HOH D 3 .  ? -22.038 -11.261 6.008  1.00 51.89 ? 325 HOH A O     1 
HETATM 629 O O     . HOH D 3 .  ? -17.996 -15.782 24.502 1.00 40.16 ? 326 HOH A O     1 
HETATM 630 O O     . HOH D 3 .  ? -14.106 -12.126 26.760 1.00 51.12 ? 327 HOH A O     1 
HETATM 631 O O     . HOH D 3 .  ? -22.544 -7.979  22.069 1.00 46.28 ? 328 HOH A O     1 
HETATM 632 O O     . HOH D 3 .  ? -9.253  -16.970 5.514  1.00 45.96 ? 330 HOH A O     1 
HETATM 633 O O     . HOH D 3 .  ? -20.943 -21.635 16.140 1.00 49.38 ? 331 HOH A O     1 
HETATM 634 O O     . HOH D 3 .  ? -17.176 -9.526  25.613 1.00 45.59 ? 334 HOH A O     1 
HETATM 635 O O     . HOH D 3 .  ? -15.337 -8.868  30.102 0.50 53.92 ? 335 HOH A O     1 
HETATM 636 O O     . HOH D 3 .  ? -15.725 -23.626 7.192  1.00 56.83 ? 336 HOH A O     1 
HETATM 637 O O     . HOH D 3 .  ? -18.319 -28.428 23.556 1.00 63.04 ? 337 HOH A O     1 
HETATM 638 O O     . HOH D 3 .  ? 0.028   -13.524 18.046 0.50 81.10 ? 338 HOH A O     1 
HETATM 639 O O     . HOH D 3 .  ? -11.191 -19.365 23.998 0.50 50.92 ? 339 HOH A O     1 
HETATM 640 O O     . HOH D 3 .  ? -11.583 -26.980 3.183  1.00 60.25 ? 341 HOH A O     1 
HETATM 641 O O     . HOH D 3 .  ? -10.250 -25.529 14.521 1.00 76.79 ? 346 HOH A O     1 
HETATM 642 O O     . HOH D 3 .  ? -24.485 -16.710 5.995  1.00 58.51 ? 347 HOH A O     1 
HETATM 643 O O     . HOH D 3 .  ? -24.644 -14.849 8.059  1.00 52.53 ? 348 HOH A O     1 
HETATM 644 O O     . HOH D 3 .  ? -26.313 -17.513 8.993  1.00 51.18 ? 350 HOH A O     1 
HETATM 645 O O     . HOH D 3 .  ? -4.168  -6.414  18.363 1.00 69.76 ? 351 HOH A O     1 
HETATM 646 O O     . HOH D 3 .  ? -8.981  -25.628 8.031  1.00 59.67 ? 352 HOH A O     1 
HETATM 647 O O     . HOH D 3 .  ? -25.140 -19.463 5.659  1.00 74.29 ? 353 HOH A O     1 
HETATM 648 O O     . HOH D 3 .  ? -22.212 -10.514 1.666  1.00 70.40 ? 356 HOH A O     1 
HETATM 649 O O     . HOH D 3 .  ? -19.914 -10.691 0.653  1.00 70.82 ? 357 HOH A O     1 
HETATM 650 O O     . HOH D 3 .  ? -19.341 -3.114  11.679 1.00 67.41 ? 358 HOH A O     1 
HETATM 651 O O     . HOH D 3 .  ? -19.478 -0.662  7.791  1.00 65.84 ? 359 HOH A O     1 
HETATM 652 O O     . HOH D 3 .  ? -20.941 -1.297  9.848  1.00 69.39 ? 360 HOH A O     1 
HETATM 653 O O     . HOH D 3 .  ? -18.622 -17.806 27.343 1.00 54.02 ? 363 HOH A O     1 
HETATM 654 O O     . HOH D 3 .  ? -16.589 -1.903  2.379  1.00 74.42 ? 364 HOH A O     1 
HETATM 655 O O     . HOH D 3 .  ? -15.506 -1.137  5.278  1.00 69.82 ? 365 HOH A O     1 
HETATM 656 O O     . HOH D 3 .  ? -14.573 3.558   7.123  1.00 79.89 ? 366 HOH A O     1 
HETATM 657 O O     . HOH D 3 .  ? -16.587 -3.402  7.909  1.00 55.00 ? 367 HOH A O     1 
HETATM 658 O O     . HOH D 3 .  ? -19.618 -25.775 16.175 1.00 68.65 ? 368 HOH A O     1 
HETATM 659 O O     . HOH D 3 .  ? -10.759 0.843   7.650  1.00 72.33 ? 369 HOH A O     1 
HETATM 660 O O     . HOH D 3 .  ? -1.105  -8.699  14.011 1.00 72.91 ? 370 HOH A O     1 
HETATM 661 O O     . HOH D 3 .  ? -22.469 -20.586 7.858  1.00 58.53 ? 371 HOH A O     1 
HETATM 662 O O     . HOH D 3 .  ? -6.774  -8.526  7.676  1.00 56.83 ? 372 HOH A O     1 
HETATM 663 O O     . HOH D 3 .  ? -25.209 -5.350  12.720 1.00 58.69 ? 374 HOH A O     1 
HETATM 664 O O     . HOH D 3 .  ? -23.272 -2.333  11.460 1.00 69.81 ? 375 HOH A O     1 
HETATM 665 O O     . HOH D 3 .  ? -28.163 -5.832  10.724 1.00 69.27 ? 376 HOH A O     1 
HETATM 666 O O     . HOH D 3 .  ? -21.829 -8.483  7.292  1.00 70.40 ? 377 HOH A O     1 
HETATM 667 O O     . HOH D 3 .  ? -14.651 -5.996  2.751  1.00 56.17 ? 378 HOH A O     1 
HETATM 668 O O     . HOH D 3 .  ? -11.919 3.757   6.842  1.00 70.89 ? 379 HOH A O     1 
HETATM 669 O O     . HOH D 3 .  ? -13.097 -3.006  14.467 1.00 69.59 ? 380 HOH A O     1 
HETATM 670 O O     . HOH D 3 .  ? -21.925 -22.866 -0.719 1.00 72.59 ? 381 HOH A O     1 
HETATM 671 O O     . HOH D 3 .  ? -16.410 -6.209  6.673  1.00 59.27 ? 382 HOH A O     1 
HETATM 672 O O     . HOH D 3 .  ? -12.970 -2.800  11.234 1.00 69.31 ? 383 HOH A O     1 
HETATM 673 O O     . HOH D 3 .  ? -10.224 -0.843  12.008 1.00 67.76 ? 384 HOH A O     1 
HETATM 674 O O     . HOH D 3 .  ? -10.591 1.967   12.463 1.00 85.66 ? 385 HOH A O     1 
HETATM 675 O O     . HOH D 3 .  ? -8.069  0.871   11.998 1.00 85.02 ? 386 HOH A O     1 
HETATM 676 O O     . HOH D 3 .  ? -4.928  -24.653 17.384 1.00 65.42 ? 387 HOH A O     1 
HETATM 677 O O     . HOH D 3 .  ? -16.850 -30.206 17.114 1.00 92.31 ? 392 HOH A O     1 
HETATM 678 O O     . HOH D 3 .  ? -14.227 -26.084 8.668  1.00 59.74 ? 393 HOH A O     1 
HETATM 679 O O     . HOH D 3 .  ? -9.945  -25.196 10.635 1.00 67.87 ? 394 HOH A O     1 
HETATM 680 O O     . HOH D 3 .  ? -16.610 -25.565 11.723 1.00 76.30 ? 396 HOH A O     1 
HETATM 681 O O     . HOH D 3 .  ? -19.163 -22.985 23.962 1.00 75.91 ? 397 HOH A O     1 
HETATM 682 O O     . HOH D 3 .  ? -2.181  -8.951  18.355 1.00 65.42 ? 398 HOH A O     1 
HETATM 683 O O     . HOH D 3 .  ? -22.154 -23.899 6.029  0.5  75.78 ? 399 HOH A O     1 
HETATM 684 O O     . HOH D 3 .  ? -26.150 -4.262  16.553 1.00 79.39 ? 400 HOH A O     1 
HETATM 685 O O     . HOH D 3 .  ? -19.648 -8.405  5.673  1.00 59.15 ? 401 HOH A O     1 
HETATM 686 O O     . HOH D 3 .  ? -19.149 -30.460 18.984 1.00 69.43 ? 402 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  DT  1  200 200 DT  T   B . n 
A 1 2  DC  2  201 201 DC  C   B . n 
A 1 3  DG  3  202 202 DG  G   B . n 
A 1 4  DC  4  203 203 DC  C   B . n 
A 1 5  DG  5  204 204 DG  G   B . n 
A 1 6  DC  6  205 205 DC  C   B . n 
A 1 7  DG  7  206 206 DG  G   B . n 
B 2 1  GLY 1  104 ?   ?   ?   A . n 
B 2 2  SER 2  105 ?   ?   ?   A . n 
B 2 3  HIS 3  106 ?   ?   ?   A . n 
B 2 4  MET 4  107 ?   ?   ?   A . n 
B 2 5  LEU 5  108 ?   ?   ?   A . n 
B 2 6  SER 6  109 ?   ?   ?   A . n 
B 2 7  THR 7  110 ?   ?   ?   A . n 
B 2 8  GLY 8  111 ?   ?   ?   A . n 
B 2 9  ASP 9  112 ?   ?   ?   A . n 
B 2 10 ASN 10 113 113 ASN ASN A . n 
B 2 11 LEU 11 114 114 LEU LEU A . n 
B 2 12 GLU 12 115 115 GLU GLU A . n 
B 2 13 GLN 13 116 116 GLN GLN A . n 
B 2 14 LYS 14 117 117 LYS LYS A . n 
B 2 15 ILE 15 118 118 ILE ILE A . n 
B 2 16 LEU 16 119 119 LEU LEU A . n 
B 2 17 GLN 17 120 120 GLN GLN A . n 
B 2 18 VAL 18 121 121 VAL VAL A . n 
B 2 19 LEU 19 122 122 LEU LEU A . n 
B 2 20 SER 20 123 123 SER SER A . n 
B 2 21 ASP 21 124 124 ASP ASP A . n 
B 2 22 ASP 22 125 125 ASP ASP A . n 
B 2 23 GLY 23 126 126 GLY GLY A . n 
B 2 24 GLY 24 127 127 GLY GLY A . n 
B 2 25 PRO 25 128 128 PRO PRO A . n 
B 2 26 VAL 26 129 129 VAL VAL A . n 
B 2 27 LYS 27 130 130 LYS LYS A . n 
B 2 28 ILE 28 131 131 ILE ILE A . n 
B 2 29 GLY 29 132 132 GLY GLY A . n 
B 2 30 GLN 30 133 133 GLN GLN A . n 
B 2 31 LEU 31 134 134 LEU LEU A . n 
B 2 32 VAL 32 135 135 VAL VAL A . n 
B 2 33 LYS 33 136 136 LYS LYS A . n 
B 2 34 LYS 34 137 137 LYS LYS A . n 
B 2 35 CYS 35 138 138 CYS CYS A . n 
B 2 36 GLN 36 139 139 GLN GLN A . n 
B 2 37 VAL 37 140 140 VAL VAL A . n 
B 2 38 PRO 38 141 141 PRO PRO A . n 
B 2 39 LYS 39 142 142 LYS LYS A . n 
B 2 40 LYS 40 143 143 LYS LYS A . n 
B 2 41 THR 41 144 144 THR THR A . n 
B 2 42 LEU 42 145 145 LEU LEU A . n 
B 2 43 ASN 43 146 146 ASN ASN A . n 
B 2 44 GLN 44 147 147 GLN GLN A . n 
B 2 45 VAL 45 148 148 VAL VAL A . n 
B 2 46 LEU 46 149 149 LEU LEU A . n 
B 2 47 TYR 47 150 150 TYR TYR A . n 
B 2 48 ARG 48 151 151 ARG ARG A . n 
B 2 49 LEU 49 152 152 LEU LEU A . n 
B 2 50 LYS 50 153 153 LYS LYS A . n 
B 2 51 LYS 51 154 154 LYS LYS A . n 
B 2 52 GLU 52 155 155 GLU GLU A . n 
B 2 53 ASP 53 156 156 ASP ASP A . n 
B 2 54 ARG 54 157 157 ARG ARG A . n 
B 2 55 VAL 55 158 158 VAL VAL A . n 
B 2 56 SER 56 159 159 SER SER A . n 
B 2 57 SER 57 160 160 SER SER A . n 
B 2 58 PRO 58 161 161 PRO PRO A . n 
B 2 59 GLU 59 162 162 GLU GLU A . n 
B 2 60 PRO 60 163 163 PRO PRO A . n 
B 2 61 ALA 61 164 164 ALA ALA A . n 
B 2 62 THR 62 165 165 THR THR A . n 
B 2 63 TRP 63 166 166 TRP TRP A . n 
B 2 64 SER 64 167 167 SER SER A . n 
B 2 65 ILE 65 168 168 ILE ILE A . n 
B 2 66 GLY 66 169 169 GLY GLY A . n 
B 2 67 GLY 67 170 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z           1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 11_455 -x+y-1,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 -63.6110000000 0.0000000000 
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 36.1190000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 B HOH 391 ? C HOH . 
2 1 A HOH 335 ? D HOH . 
3 1 A HOH 338 ? D HOH . 
4 1 A HOH 339 ? D HOH . 
5 1 A HOH 399 ? D HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-09-01 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-11-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Atomic model'              
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
EPMR      phasing          .   ? 1 
CNS       refinement       1.0 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 350 ? ? O B HOH 333 ? ? 2.14 
2 1 OD1 A ASN 113 ? ? O A HOH 378 ? ? 2.15 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" B DT 200 ? ? "C1'" B DT 200 ? ? N1 B DT 200 ? ? 110.66 108.30 2.36 0.30 N 
2 1 "O4'" B DC 203 ? ? "C1'" B DC 203 ? ? N1 B DC 203 ? ? 110.63 108.30 2.33 0.30 N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 142 ? CD ? B LYS 39 CD 
2 1 Y 1 A LYS 142 ? CE ? B LYS 39 CE 
3 1 Y 1 A LYS 142 ? NZ ? B LYS 39 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 104 ? B GLY 1  
2  1 Y 1 A SER 105 ? B SER 2  
3  1 Y 1 A HIS 106 ? B HIS 3  
4  1 Y 1 A MET 107 ? B MET 4  
5  1 Y 1 A LEU 108 ? B LEU 5  
6  1 Y 1 A SER 109 ? B SER 6  
7  1 Y 1 A THR 110 ? B THR 7  
8  1 Y 1 A GLY 111 ? B GLY 8  
9  1 Y 1 A ASP 112 ? B ASP 9  
10 1 Y 1 A GLY 170 ? B GLY 67 
# 
_ndb_struct_conf_na.entry_id   1J75 
_ndb_struct_conf_na.feature    'z-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 2 1_555 A DG 7 11_455 -0.170 -0.158 -0.068 0.732   -7.188 -5.122 1 B_DC201:DG206_B B 201 ? B 206 ? 19 1 
1 A DG 3 1_555 A DC 6 11_455 0.402  -0.184 0.225  3.584   -9.300 0.492  2 B_DG202:DC205_B B 202 ? B 205 ? 19 1 
1 A DC 4 1_555 A DG 5 11_455 -0.324 -0.048 -0.123 11.764  -6.146 -2.625 3 B_DC203:DG204_B B 203 ? B 204 ? 19 1 
1 A DG 5 1_555 A DC 4 11_455 0.324  -0.048 -0.123 -11.764 -6.146 -2.624 4 B_DG204:DC203_B B 204 ? B 203 ? 19 1 
1 A DC 6 1_555 A DG 3 11_455 -0.402 -0.184 0.225  -3.584  -9.300 0.492  5 B_DC205:DG202_B B 205 ? B 202 ? 19 1 
1 A DG 7 1_555 A DC 2 11_455 0.170  -0.158 -0.068 -0.732  -7.188 -5.122 6 B_DG206:DC201_B B 206 ? B 201 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 2 1_555 A DG 7 11_455 A DG 3 1_555 A DC 6 11_455 0.124  4.947  3.383 -2.426 -9.939  -9.082  -3.864 -3.609 5.861 47.126 
-11.504 -13.673 1 BB_DC201DG202:DC205DG206_BB B 201 ? B 206 ? B 202 ? B 205 ? 
1 A DG 3 1_555 A DC 6 11_455 A DC 4 1_555 A DG 5 11_455 0.157  -1.601 3.283 1.659  -10.177 -44.895 2.883  0.337  2.867 13.122 
2.139   -46.004 2 BB_DG202DC203:DG204DC205_BB B 202 ? B 205 ? B 203 ? B 204 ? 
1 A DC 4 1_555 A DG 5 11_455 A DG 5 1_555 A DC 4 11_455 0.000  5.580  3.917 0.000  -9.375  -10.923 -6.777 0.000  6.603 40.744 
0.000   -14.385 3 BB_DC203DG204:DC203DG204_BB B 203 ? B 204 ? B 204 ? B 203 ? 
1 A DG 5 1_555 A DC 4 11_455 A DC 6 1_555 A DG 3 11_455 -0.157 -1.601 3.283 -1.659 -10.177 -44.895 2.883  -0.337 2.867 13.122 
-2.139  -46.004 4 BB_DG204DC205:DG202DC203_BB B 204 ? B 203 ? B 205 ? B 202 ? 
1 A DC 6 1_555 A DG 3 11_455 A DG 7 1_555 A DC 2 11_455 -0.124 4.947  3.383 2.426  -9.939  -9.082  -3.864 3.610  5.861 47.126 
11.504  -13.673 5 BB_DC205DG206:DC201DG202_BB B 205 ? B 202 ? B 206 ? B 201 ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  304 304 HOH HOH B . 
C 3 HOH 2  305 305 HOH HOH B . 
C 3 HOH 3  306 306 HOH HOH B . 
C 3 HOH 4  307 307 HOH HOH B . 
C 3 HOH 5  321 321 HOH HOH B . 
C 3 HOH 6  329 329 HOH HOH B . 
C 3 HOH 7  332 332 HOH HOH B . 
C 3 HOH 8  333 333 HOH HOH B . 
C 3 HOH 9  340 340 HOH HOH B . 
C 3 HOH 10 342 342 HOH HOH B . 
C 3 HOH 11 343 343 HOH HOH B . 
C 3 HOH 12 344 344 HOH HOH B . 
C 3 HOH 13 345 345 HOH HOH B . 
C 3 HOH 14 349 349 HOH HOH B . 
C 3 HOH 15 354 354 HOH HOH B . 
C 3 HOH 16 355 355 HOH HOH B . 
C 3 HOH 17 361 361 HOH HOH B . 
C 3 HOH 18 362 362 HOH HOH B . 
C 3 HOH 19 373 373 HOH HOH B . 
C 3 HOH 20 388 388 HOH HOH B . 
C 3 HOH 21 389 389 HOH HOH B . 
C 3 HOH 22 390 390 HOH HOH B . 
C 3 HOH 23 391 391 HOH HOH B . 
C 3 HOH 24 395 395 HOH HOH B . 
D 3 HOH 1  301 301 HOH HOH A . 
D 3 HOH 2  302 302 HOH HOH A . 
D 3 HOH 3  303 303 HOH HOH A . 
D 3 HOH 4  308 308 HOH HOH A . 
D 3 HOH 5  309 309 HOH HOH A . 
D 3 HOH 6  310 310 HOH HOH A . 
D 3 HOH 7  311 311 HOH HOH A . 
D 3 HOH 8  312 312 HOH HOH A . 
D 3 HOH 9  313 313 HOH HOH A . 
D 3 HOH 10 314 314 HOH HOH A . 
D 3 HOH 11 315 315 HOH HOH A . 
D 3 HOH 12 316 316 HOH HOH A . 
D 3 HOH 13 317 317 HOH HOH A . 
D 3 HOH 14 318 318 HOH HOH A . 
D 3 HOH 15 319 319 HOH HOH A . 
D 3 HOH 16 320 320 HOH HOH A . 
D 3 HOH 17 322 322 HOH HOH A . 
D 3 HOH 18 323 323 HOH HOH A . 
D 3 HOH 19 324 324 HOH HOH A . 
D 3 HOH 20 325 325 HOH HOH A . 
D 3 HOH 21 326 326 HOH HOH A . 
D 3 HOH 22 327 327 HOH HOH A . 
D 3 HOH 23 328 328 HOH HOH A . 
D 3 HOH 24 330 330 HOH HOH A . 
D 3 HOH 25 331 331 HOH HOH A . 
D 3 HOH 26 334 334 HOH HOH A . 
D 3 HOH 27 335 335 HOH HOH A . 
D 3 HOH 28 336 336 HOH HOH A . 
D 3 HOH 29 337 337 HOH HOH A . 
D 3 HOH 30 338 338 HOH HOH A . 
D 3 HOH 31 339 339 HOH HOH A . 
D 3 HOH 32 341 341 HOH HOH A . 
D 3 HOH 33 346 346 HOH HOH A . 
D 3 HOH 34 347 347 HOH HOH A . 
D 3 HOH 35 348 348 HOH HOH A . 
D 3 HOH 36 350 350 HOH HOH A . 
D 3 HOH 37 351 351 HOH HOH A . 
D 3 HOH 38 352 352 HOH HOH A . 
D 3 HOH 39 353 353 HOH HOH A . 
D 3 HOH 40 356 356 HOH HOH A . 
D 3 HOH 41 357 357 HOH HOH A . 
D 3 HOH 42 358 358 HOH HOH A . 
D 3 HOH 43 359 359 HOH HOH A . 
D 3 HOH 44 360 360 HOH HOH A . 
D 3 HOH 45 363 363 HOH HOH A . 
D 3 HOH 46 364 364 HOH HOH A . 
D 3 HOH 47 365 365 HOH HOH A . 
D 3 HOH 48 366 366 HOH HOH A . 
D 3 HOH 49 367 367 HOH HOH A . 
D 3 HOH 50 368 368 HOH HOH A . 
D 3 HOH 51 369 369 HOH HOH A . 
D 3 HOH 52 370 370 HOH HOH A . 
D 3 HOH 53 371 371 HOH HOH A . 
D 3 HOH 54 372 372 HOH HOH A . 
D 3 HOH 55 374 374 HOH HOH A . 
D 3 HOH 56 375 375 HOH HOH A . 
D 3 HOH 57 376 376 HOH HOH A . 
D 3 HOH 58 377 377 HOH HOH A . 
D 3 HOH 59 378 378 HOH HOH A . 
D 3 HOH 60 379 379 HOH HOH A . 
D 3 HOH 61 380 380 HOH HOH A . 
D 3 HOH 62 381 381 HOH HOH A . 
D 3 HOH 63 382 382 HOH HOH A . 
D 3 HOH 64 383 383 HOH HOH A . 
D 3 HOH 65 384 384 HOH HOH A . 
D 3 HOH 66 385 385 HOH HOH A . 
D 3 HOH 67 386 386 HOH HOH A . 
D 3 HOH 68 387 387 HOH HOH A . 
D 3 HOH 69 392 392 HOH HOH A . 
D 3 HOH 70 393 393 HOH HOH A . 
D 3 HOH 71 394 394 HOH HOH A . 
D 3 HOH 72 396 396 HOH HOH A . 
D 3 HOH 73 397 397 HOH HOH A . 
D 3 HOH 74 398 398 HOH HOH A . 
D 3 HOH 75 399 399 HOH HOH A . 
D 3 HOH 76 400 400 HOH HOH A . 
D 3 HOH 77 401 401 HOH HOH A . 
D 3 HOH 78 402 402 HOH HOH A . 
#