data_1JBQ
# 
_entry.id   1JBQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JBQ         
RCSB  RCSB013595   
WWPDB D_1000013595 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1D6S 
_pdbx_database_related.details        
;Crystal Structure Of The K41A Mutant Of
O-Acetylserine Sulfhydrylase Complexed In External Aldimine Linkage With
Methionine
;
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JBQ 
_pdbx_database_status.recvd_initial_deposition_date   2001-06-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Meier, M.'    1 
'Janosik, M.'  2 
'Kery, V.'     3 
'Kraus, J.P.'  4 
'Burkhard, P.' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Structure of human cystathionine beta-synthase: a unique pyridoxal 5'-phosphate-dependent heme protein.
;
'EMBO J.'                  20 3910 3916 2001 EMJODG UK 0261-4189 0897 ? 11483494 10.1093/emboj/20.15.3910  
1       
;Crystallization and preliminary X-ray diffraction analysis of the active core of human recombinant cystathionine beta-synthase: an enzyme involved in vascular disease.
;
'Acta Crystallogr.,Sect.D' 57 289  291  2001 ABCRE6 DK 0907-4449 0766 ? ?        10.1107/S0907444900017893 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Meier, M.'        1  
primary 'Janosik, M.'      2  
primary 'Kery, V.'         3  
primary 'Kraus, J.P.'      4  
primary 'Burkhard, P.'     5  
1       'Janosik, M.'      6  
1       'Meier, M.'        7  
1       'Kery, V.'         8  
1       'Oliveriusova, J.' 9  
1       'Burkhard, P.'     10 
1       'Kraus, J.P.'      11 
# 
_cell.entry_id           1JBQ 
_cell.length_a           144.520 
_cell.length_b           144.520 
_cell.length_c           108.160 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JBQ 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     trigonal 
_symmetry.Int_Tables_number                144 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CYSTATHIONINE BETA-SYNTHASE'     47520.074 6   4.2.1.22 'DELETION 414-551, EXTRA 23 RESIDUES AT N-TERMINUS' 
'THE ACTIVE CORE' 'MINOR ISOFORM' 
2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   6   ?        ?                                                   ? ? 
3 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE"          247.142   6   ?        ?                                                   ? ? 
4 water       nat water                             18.015    154 ?        ?                                                   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CYSTATHIONINE-BETA-SYNTHASE; SERINE SULFHYDRASE; BETA-THIONASE' 
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.4.2.1.22 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GIPSETPQAEVGPTSACGVSLGIPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGR
PASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKP
GDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSH
ILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQ
TTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSV
RNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GIPSETPQAEVGPTSACGVSLGIPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGR
PASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKP
GDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSH
ILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQ
TTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSV
RNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLR
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ILE n 
1 3   PRO n 
1 4   SER n 
1 5   GLU n 
1 6   THR n 
1 7   PRO n 
1 8   GLN n 
1 9   ALA n 
1 10  GLU n 
1 11  VAL n 
1 12  GLY n 
1 13  PRO n 
1 14  THR n 
1 15  SER n 
1 16  ALA n 
1 17  CYS n 
1 18  GLY n 
1 19  VAL n 
1 20  SER n 
1 21  LEU n 
1 22  GLY n 
1 23  ILE n 
1 24  PRO n 
1 25  SER n 
1 26  GLU n 
1 27  THR n 
1 28  PRO n 
1 29  GLN n 
1 30  ALA n 
1 31  GLU n 
1 32  VAL n 
1 33  GLY n 
1 34  PRO n 
1 35  THR n 
1 36  GLY n 
1 37  CYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  SER n 
1 42  GLY n 
1 43  PRO n 
1 44  HIS n 
1 45  SER n 
1 46  ALA n 
1 47  LYS n 
1 48  GLY n 
1 49  SER n 
1 50  LEU n 
1 51  GLU n 
1 52  LYS n 
1 53  GLY n 
1 54  SER n 
1 55  PRO n 
1 56  GLU n 
1 57  ASP n 
1 58  LYS n 
1 59  GLU n 
1 60  ALA n 
1 61  LYS n 
1 62  GLU n 
1 63  PRO n 
1 64  LEU n 
1 65  TRP n 
1 66  ILE n 
1 67  ARG n 
1 68  PRO n 
1 69  ASP n 
1 70  ALA n 
1 71  PRO n 
1 72  SER n 
1 73  ARG n 
1 74  CYS n 
1 75  THR n 
1 76  TRP n 
1 77  GLN n 
1 78  LEU n 
1 79  GLY n 
1 80  ARG n 
1 81  PRO n 
1 82  ALA n 
1 83  SER n 
1 84  GLU n 
1 85  SER n 
1 86  PRO n 
1 87  HIS n 
1 88  HIS n 
1 89  HIS n 
1 90  THR n 
1 91  ALA n 
1 92  PRO n 
1 93  ALA n 
1 94  LYS n 
1 95  SER n 
1 96  PRO n 
1 97  LYS n 
1 98  ILE n 
1 99  LEU n 
1 100 PRO n 
1 101 ASP n 
1 102 ILE n 
1 103 LEU n 
1 104 LYS n 
1 105 LYS n 
1 106 ILE n 
1 107 GLY n 
1 108 ASP n 
1 109 THR n 
1 110 PRO n 
1 111 MET n 
1 112 VAL n 
1 113 ARG n 
1 114 ILE n 
1 115 ASN n 
1 116 LYS n 
1 117 ILE n 
1 118 GLY n 
1 119 LYS n 
1 120 LYS n 
1 121 PHE n 
1 122 GLY n 
1 123 LEU n 
1 124 LYS n 
1 125 CYS n 
1 126 GLU n 
1 127 LEU n 
1 128 LEU n 
1 129 ALA n 
1 130 LYS n 
1 131 CYS n 
1 132 GLU n 
1 133 PHE n 
1 134 PHE n 
1 135 ASN n 
1 136 ALA n 
1 137 GLY n 
1 138 GLY n 
1 139 SER n 
1 140 VAL n 
1 141 LYS n 
1 142 ASP n 
1 143 ARG n 
1 144 ILE n 
1 145 SER n 
1 146 LEU n 
1 147 ARG n 
1 148 MET n 
1 149 ILE n 
1 150 GLU n 
1 151 ASP n 
1 152 ALA n 
1 153 GLU n 
1 154 ARG n 
1 155 ASP n 
1 156 GLY n 
1 157 THR n 
1 158 LEU n 
1 159 LYS n 
1 160 PRO n 
1 161 GLY n 
1 162 ASP n 
1 163 THR n 
1 164 ILE n 
1 165 ILE n 
1 166 GLU n 
1 167 PRO n 
1 168 THR n 
1 169 SER n 
1 170 GLY n 
1 171 ASN n 
1 172 THR n 
1 173 GLY n 
1 174 ILE n 
1 175 GLY n 
1 176 LEU n 
1 177 ALA n 
1 178 LEU n 
1 179 ALA n 
1 180 ALA n 
1 181 ALA n 
1 182 VAL n 
1 183 ARG n 
1 184 GLY n 
1 185 TYR n 
1 186 ARG n 
1 187 CYS n 
1 188 ILE n 
1 189 ILE n 
1 190 VAL n 
1 191 MET n 
1 192 PRO n 
1 193 GLU n 
1 194 LYS n 
1 195 MET n 
1 196 SER n 
1 197 SER n 
1 198 GLU n 
1 199 LYS n 
1 200 VAL n 
1 201 ASP n 
1 202 VAL n 
1 203 LEU n 
1 204 ARG n 
1 205 ALA n 
1 206 LEU n 
1 207 GLY n 
1 208 ALA n 
1 209 GLU n 
1 210 ILE n 
1 211 VAL n 
1 212 ARG n 
1 213 THR n 
1 214 PRO n 
1 215 THR n 
1 216 ASN n 
1 217 ALA n 
1 218 ARG n 
1 219 PHE n 
1 220 ASP n 
1 221 SER n 
1 222 PRO n 
1 223 GLU n 
1 224 SER n 
1 225 HIS n 
1 226 VAL n 
1 227 GLY n 
1 228 VAL n 
1 229 ALA n 
1 230 TRP n 
1 231 ARG n 
1 232 LEU n 
1 233 LYS n 
1 234 ASN n 
1 235 GLU n 
1 236 ILE n 
1 237 PRO n 
1 238 ASN n 
1 239 SER n 
1 240 HIS n 
1 241 ILE n 
1 242 LEU n 
1 243 ASP n 
1 244 GLN n 
1 245 TYR n 
1 246 ARG n 
1 247 ASN n 
1 248 ALA n 
1 249 SER n 
1 250 ASN n 
1 251 PRO n 
1 252 LEU n 
1 253 ALA n 
1 254 HIS n 
1 255 TYR n 
1 256 ASP n 
1 257 THR n 
1 258 THR n 
1 259 ALA n 
1 260 ASP n 
1 261 GLU n 
1 262 ILE n 
1 263 LEU n 
1 264 GLN n 
1 265 GLN n 
1 266 CYS n 
1 267 ASP n 
1 268 GLY n 
1 269 LYS n 
1 270 LEU n 
1 271 ASP n 
1 272 MET n 
1 273 LEU n 
1 274 VAL n 
1 275 ALA n 
1 276 SER n 
1 277 VAL n 
1 278 GLY n 
1 279 THR n 
1 280 GLY n 
1 281 GLY n 
1 282 THR n 
1 283 ILE n 
1 284 THR n 
1 285 GLY n 
1 286 ILE n 
1 287 ALA n 
1 288 ARG n 
1 289 LYS n 
1 290 LEU n 
1 291 LYS n 
1 292 GLU n 
1 293 LYS n 
1 294 CYS n 
1 295 PRO n 
1 296 GLY n 
1 297 CYS n 
1 298 ARG n 
1 299 ILE n 
1 300 ILE n 
1 301 GLY n 
1 302 VAL n 
1 303 ASP n 
1 304 PRO n 
1 305 GLU n 
1 306 GLY n 
1 307 SER n 
1 308 ILE n 
1 309 LEU n 
1 310 ALA n 
1 311 GLU n 
1 312 PRO n 
1 313 GLU n 
1 314 GLU n 
1 315 LEU n 
1 316 ASN n 
1 317 GLN n 
1 318 THR n 
1 319 GLU n 
1 320 GLN n 
1 321 THR n 
1 322 THR n 
1 323 TYR n 
1 324 GLU n 
1 325 VAL n 
1 326 GLU n 
1 327 GLY n 
1 328 ILE n 
1 329 GLY n 
1 330 TYR n 
1 331 ASP n 
1 332 PHE n 
1 333 ILE n 
1 334 PRO n 
1 335 THR n 
1 336 VAL n 
1 337 LEU n 
1 338 ASP n 
1 339 ARG n 
1 340 THR n 
1 341 VAL n 
1 342 VAL n 
1 343 ASP n 
1 344 LYS n 
1 345 TRP n 
1 346 PHE n 
1 347 LYS n 
1 348 SER n 
1 349 ASN n 
1 350 ASP n 
1 351 GLU n 
1 352 GLU n 
1 353 ALA n 
1 354 PHE n 
1 355 THR n 
1 356 PHE n 
1 357 ALA n 
1 358 ARG n 
1 359 MET n 
1 360 LEU n 
1 361 ILE n 
1 362 ALA n 
1 363 GLN n 
1 364 GLU n 
1 365 GLY n 
1 366 LEU n 
1 367 LEU n 
1 368 CYS n 
1 369 GLY n 
1 370 GLY n 
1 371 SER n 
1 372 ALA n 
1 373 GLY n 
1 374 SER n 
1 375 THR n 
1 376 VAL n 
1 377 ALA n 
1 378 VAL n 
1 379 ALA n 
1 380 VAL n 
1 381 LYS n 
1 382 ALA n 
1 383 ALA n 
1 384 GLN n 
1 385 GLU n 
1 386 LEU n 
1 387 GLN n 
1 388 GLU n 
1 389 GLY n 
1 390 GLN n 
1 391 ARG n 
1 392 CYS n 
1 393 VAL n 
1 394 VAL n 
1 395 ILE n 
1 396 LEU n 
1 397 PRO n 
1 398 ASP n 
1 399 SER n 
1 400 VAL n 
1 401 ARG n 
1 402 ASN n 
1 403 TYR n 
1 404 MET n 
1 405 THR n 
1 406 LYS n 
1 407 PHE n 
1 408 LEU n 
1 409 SER n 
1 410 ASP n 
1 411 ARG n 
1 412 TRP n 
1 413 MET n 
1 414 LEU n 
1 415 GLN n 
1 416 LYS n 
1 417 GLY n 
1 418 PHE n 
1 419 LEU n 
1 420 LYS n 
1 421 GLU n 
1 422 GLU n 
1 423 ASP n 
1 424 LEU n 
1 425 THR n 
1 426 GLU n 
1 427 LYS n 
1 428 LYS n 
1 429 PRO n 
1 430 TRP n 
1 431 TRP n 
1 432 TRP n 
1 433 HIS n 
1 434 LEU n 
1 435 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'XL1-BLUE MRF' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGEX-5X-1HCBSD414-551 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CBS_HUMAN 
_struct_ref.pdbx_db_accession          P35520 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;PSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDIL
KKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVR
GYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEIL
QQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVD
KWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEED
LTEKKPWWWHLR
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JBQ A 24 ? 435 ? P35520 1 ? 412 ? 2 413 
2 1 1JBQ B 24 ? 435 ? P35520 1 ? 412 ? 2 413 
3 1 1JBQ C 24 ? 435 ? P35520 1 ? 412 ? 2 413 
4 1 1JBQ D 24 ? 435 ? P35520 1 ? 412 ? 2 413 
5 1 1JBQ E 24 ? 435 ? P35520 1 ? 412 ? 2 413 
6 1 1JBQ F 24 ? 435 ? P35520 1 ? 412 ? 2 413 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?                      'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?                      'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?                      'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?                      'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?                      'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ?                      'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?                      'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?                      'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME                   'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?                      'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?                      'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ?                      'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?                      'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?                      'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?                      'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?                      'C9 H11 N O2'      165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE"          'VITAMIN B6 Phosphate' 'C8 H10 N O6 P'    247.142 
PRO 'L-peptide linking' y PROLINE                           ?                      'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?                      'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?                      'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?                      'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?                      'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?                      'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1JBQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.29 
_exptl_crystal.density_percent_sol   46.19 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'PEG 1000, HEPES, pH 7.5 , VAPOR DIFFUSION, HANGING DROP at 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 'IMAGE PLATE' MARRESEARCH 1999-09-26 ? 
2 CCD           MARRESEARCH 2000-01-26 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'channel-cut monochromator Si (111)'     'SINGLE WAVELENGTH' x-ray 
2 1 M 'Double crystal focussing monochromator' MAD                 x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9700 1.0 
2 1.7400 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'ESRF BEAMLINE BM1A'               ESRF                 BM1A ? 0.9700 
2 SYNCHROTRON 'EMBL/DESY, HAMBURG BEAMLINE BW7A' 'EMBL/DESY, Hamburg' BW7A ? 1.7400 
# 
_reflns.entry_id                     1JBQ 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   63971 
_reflns.number_all                   87368 
_reflns.percent_possible_obs         82.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.076 
_reflns.pdbx_netI_over_sigmaI        10 
_reflns.B_iso_Wilson_estimate        29.2 
_reflns.pdbx_redundancy              3.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.69 
_reflns_shell.percent_possible_all   65.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.31 
_reflns_shell.meanI_over_sigI_obs    4 
_reflns_shell.pdbx_redundancy        2.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1,2 
# 
_refine.entry_id                                 1JBQ 
_refine.ls_number_reflns_obs                     63971 
_refine.ls_number_reflns_all                     87368 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               3036819.24 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             43.34 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    82.3 
_refine.ls_R_factor_obs                          0.257 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.257 
_refine.ls_R_factor_R_free                       0.296 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3219 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               37.4 
_refine.aniso_B[1][1]                            4.78 
_refine.aniso_B[2][2]                            4.78 
_refine.aniso_B[3][3]                            -9.55 
_refine.aniso_B[1][2]                            8.67 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.341 
_refine.solvent_model_param_bsol                 29.57 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'Residues THR 193 and GLU 201 are disordered in all chains.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1D6S' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1,2 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1JBQ 
_refine_analyze.Luzzati_coordinate_error_obs    0.37 
_refine_analyze.Luzzati_sigma_a_obs             0.29 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.46 
_refine_analyze.Luzzati_sigma_a_free            0.40 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16020 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         348 
_refine_hist.number_atoms_solvent             154 
_refine_hist.number_atoms_total               16522 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        43.34 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.96  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        3.67  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       5.44  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        5.70  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       7.29  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.66 
_refine_ls_shell.number_reflns_R_work             2991 
_refine_ls_shell.R_factor_R_work                  0.3 
_refine_ls_shell.percent_reflns_obs               21.4 
_refine_ls_shell.R_factor_R_free                  0.358 
_refine_ls_shell.R_factor_R_free_error            0.033 
_refine_ls_shell.percent_reflns_R_free            3.9 
_refine_ls_shell.number_reflns_R_free             121 
_refine_ls_shell.number_reflns_obs                2991 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 PLP_HEM.PARAM     PLP_HEM.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
4 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1JBQ 
_struct.title                     
;STRUCTURE OF HUMAN CYSTATHIONINE BETA-SYNTHASE: A UNIQUE PYRIDOXAL 5'-PHOSPHATE DEPENDENT HEMEPROTEIN
;
_struct.pdbx_descriptor           'cystathionine beta-synthase (E.C.4.2.1.22)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JBQ 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            'Fold type II of PLP enzymes, LYASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 3 ? 
K N N 2 ? 
L N N 3 ? 
M N N 2 ? 
N N N 3 ? 
O N N 2 ? 
P N N 3 ? 
Q N N 2 ? 
R N N 3 ? 
S N N 4 ? 
T N N 4 ? 
U N N 4 ? 
V N N 4 ? 
W N N 4 ? 
X N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
3 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   PRO A 81  ? SER A 85  ? PRO A 59  SER A 63  5 ? 5  
HELX_P HELX_P2   2   ASP A 101 ? ILE A 106 ? ASP A 79  ILE A 84  5 ? 6  
HELX_P HELX_P3   3   LYS A 116 ? PHE A 121 ? LYS A 94  PHE A 99  1 ? 6  
HELX_P HELX_P4   4   PHE A 133 ? ASN A 135 ? PHE A 111 ASN A 113 5 ? 3  
HELX_P HELX_P5   5   VAL A 140 ? ASP A 155 ? VAL A 118 ASP A 133 1 ? 16 
HELX_P HELX_P6   6   GLY A 170 ? GLY A 184 ? GLY A 148 GLY A 162 1 ? 15 
HELX_P HELX_P7   7   SER A 196 ? LEU A 206 ? SER A 174 LEU A 184 1 ? 11 
HELX_P HELX_P8   8   SER A 224 ? ILE A 236 ? SER A 202 ILE A 214 1 ? 13 
HELX_P HELX_P9   9   ALA A 248 ? THR A 257 ? ALA A 226 THR A 235 1 ? 10 
HELX_P HELX_P10  10  THR A 257 ? CYS A 266 ? THR A 235 CYS A 244 1 ? 10 
HELX_P HELX_P11  11  GLY A 280 ? CYS A 294 ? GLY A 258 CYS A 272 1 ? 15 
HELX_P HELX_P12  12  PRO A 312 ? GLN A 317 ? PRO A 290 GLN A 295 5 ? 6  
HELX_P HELX_P13  13  ASP A 338 ? VAL A 342 ? ASP A 316 VAL A 320 5 ? 5  
HELX_P HELX_P14  14  ASN A 349 ? GLU A 364 ? ASN A 327 GLU A 342 1 ? 16 
HELX_P HELX_P15  15  GLY A 369 ? ALA A 383 ? GLY A 347 ALA A 361 1 ? 15 
HELX_P HELX_P16  16  GLN A 384 ? LEU A 386 ? GLN A 362 LEU A 364 5 ? 3  
HELX_P HELX_P17  17  VAL A 400 ? MET A 404 ? VAL A 378 MET A 382 5 ? 5  
HELX_P HELX_P18  18  SER A 409 ? LYS A 416 ? SER A 387 LYS A 394 1 ? 8  
HELX_P HELX_P19  19  PRO B 81  ? SER B 85  ? PRO B 59  SER B 63  5 ? 5  
HELX_P HELX_P20  20  ASP B 101 ? ILE B 106 ? ASP B 79  ILE B 84  5 ? 6  
HELX_P HELX_P21  21  LYS B 116 ? PHE B 121 ? LYS B 94  PHE B 99  1 ? 6  
HELX_P HELX_P22  22  PHE B 133 ? ASN B 135 ? PHE B 111 ASN B 113 5 ? 3  
HELX_P HELX_P23  23  VAL B 140 ? ASP B 155 ? VAL B 118 ASP B 133 1 ? 16 
HELX_P HELX_P24  24  GLY B 170 ? GLY B 184 ? GLY B 148 GLY B 162 1 ? 15 
HELX_P HELX_P25  25  SER B 196 ? LEU B 206 ? SER B 174 LEU B 184 1 ? 11 
HELX_P HELX_P26  26  SER B 224 ? ILE B 236 ? SER B 202 ILE B 214 1 ? 13 
HELX_P HELX_P27  27  ALA B 248 ? THR B 257 ? ALA B 226 THR B 235 1 ? 10 
HELX_P HELX_P28  28  THR B 257 ? CYS B 266 ? THR B 235 CYS B 244 1 ? 10 
HELX_P HELX_P29  29  GLY B 280 ? CYS B 294 ? GLY B 258 CYS B 272 1 ? 15 
HELX_P HELX_P30  30  PRO B 312 ? GLN B 317 ? PRO B 290 GLN B 295 5 ? 6  
HELX_P HELX_P31  31  ASP B 338 ? VAL B 342 ? ASP B 316 VAL B 320 5 ? 5  
HELX_P HELX_P32  32  ASN B 349 ? GLU B 364 ? ASN B 327 GLU B 342 1 ? 16 
HELX_P HELX_P33  33  GLY B 369 ? ALA B 383 ? GLY B 347 ALA B 361 1 ? 15 
HELX_P HELX_P34  34  GLN B 384 ? LEU B 386 ? GLN B 362 LEU B 364 5 ? 3  
HELX_P HELX_P35  35  VAL B 400 ? MET B 404 ? VAL B 378 MET B 382 5 ? 5  
HELX_P HELX_P36  36  SER B 409 ? LYS B 416 ? SER B 387 LYS B 394 1 ? 8  
HELX_P HELX_P37  37  PRO C 81  ? SER C 85  ? PRO C 59  SER C 63  5 ? 5  
HELX_P HELX_P38  38  ASP C 101 ? ILE C 106 ? ASP C 79  ILE C 84  5 ? 6  
HELX_P HELX_P39  39  LYS C 116 ? PHE C 121 ? LYS C 94  PHE C 99  1 ? 6  
HELX_P HELX_P40  40  PHE C 133 ? ASN C 135 ? PHE C 111 ASN C 113 5 ? 3  
HELX_P HELX_P41  41  VAL C 140 ? ASP C 155 ? VAL C 118 ASP C 133 1 ? 16 
HELX_P HELX_P42  42  GLY C 170 ? GLY C 184 ? GLY C 148 GLY C 162 1 ? 15 
HELX_P HELX_P43  43  SER C 196 ? LEU C 206 ? SER C 174 LEU C 184 1 ? 11 
HELX_P HELX_P44  44  SER C 224 ? ILE C 236 ? SER C 202 ILE C 214 1 ? 13 
HELX_P HELX_P45  45  ALA C 248 ? THR C 257 ? ALA C 226 THR C 235 1 ? 10 
HELX_P HELX_P46  46  THR C 257 ? ASP C 267 ? THR C 235 ASP C 245 1 ? 11 
HELX_P HELX_P47  47  GLY C 280 ? CYS C 294 ? GLY C 258 CYS C 272 1 ? 15 
HELX_P HELX_P48  48  PRO C 312 ? GLN C 317 ? PRO C 290 GLN C 295 5 ? 6  
HELX_P HELX_P49  49  ASP C 338 ? VAL C 342 ? ASP C 316 VAL C 320 5 ? 5  
HELX_P HELX_P50  50  ASN C 349 ? GLU C 364 ? ASN C 327 GLU C 342 1 ? 16 
HELX_P HELX_P51  51  GLY C 369 ? ALA C 383 ? GLY C 347 ALA C 361 1 ? 15 
HELX_P HELX_P52  52  GLN C 384 ? LEU C 386 ? GLN C 362 LEU C 364 5 ? 3  
HELX_P HELX_P53  53  VAL C 400 ? MET C 404 ? VAL C 378 MET C 382 5 ? 5  
HELX_P HELX_P54  54  SER C 409 ? LYS C 416 ? SER C 387 LYS C 394 1 ? 8  
HELX_P HELX_P55  55  PRO D 81  ? SER D 85  ? PRO D 59  SER D 63  5 ? 5  
HELX_P HELX_P56  56  ASP D 101 ? ILE D 106 ? ASP D 79  ILE D 84  5 ? 6  
HELX_P HELX_P57  57  LYS D 116 ? PHE D 121 ? LYS D 94  PHE D 99  1 ? 6  
HELX_P HELX_P58  58  PHE D 133 ? ASN D 135 ? PHE D 111 ASN D 113 5 ? 3  
HELX_P HELX_P59  59  VAL D 140 ? ASP D 155 ? VAL D 118 ASP D 133 1 ? 16 
HELX_P HELX_P60  60  GLY D 170 ? GLY D 184 ? GLY D 148 GLY D 162 1 ? 15 
HELX_P HELX_P61  61  SER D 196 ? LEU D 206 ? SER D 174 LEU D 184 1 ? 11 
HELX_P HELX_P62  62  SER D 224 ? ILE D 236 ? SER D 202 ILE D 214 1 ? 13 
HELX_P HELX_P63  63  ALA D 248 ? THR D 257 ? ALA D 226 THR D 235 1 ? 10 
HELX_P HELX_P64  64  THR D 257 ? ASP D 267 ? THR D 235 ASP D 245 1 ? 11 
HELX_P HELX_P65  65  GLY D 280 ? CYS D 294 ? GLY D 258 CYS D 272 1 ? 15 
HELX_P HELX_P66  66  PRO D 312 ? GLN D 317 ? PRO D 290 GLN D 295 5 ? 6  
HELX_P HELX_P67  67  ASP D 338 ? VAL D 342 ? ASP D 316 VAL D 320 5 ? 5  
HELX_P HELX_P68  68  ASN D 349 ? GLU D 364 ? ASN D 327 GLU D 342 1 ? 16 
HELX_P HELX_P69  69  GLY D 369 ? ALA D 383 ? GLY D 347 ALA D 361 1 ? 15 
HELX_P HELX_P70  70  GLN D 384 ? LEU D 386 ? GLN D 362 LEU D 364 5 ? 3  
HELX_P HELX_P71  71  VAL D 400 ? MET D 404 ? VAL D 378 MET D 382 5 ? 5  
HELX_P HELX_P72  72  SER D 409 ? LYS D 416 ? SER D 387 LYS D 394 1 ? 8  
HELX_P HELX_P73  73  PRO E 81  ? SER E 85  ? PRO E 59  SER E 63  5 ? 5  
HELX_P HELX_P74  74  ASP E 101 ? ILE E 106 ? ASP E 79  ILE E 84  5 ? 6  
HELX_P HELX_P75  75  LYS E 116 ? PHE E 121 ? LYS E 94  PHE E 99  1 ? 6  
HELX_P HELX_P76  76  PHE E 133 ? ASN E 135 ? PHE E 111 ASN E 113 5 ? 3  
HELX_P HELX_P77  77  VAL E 140 ? ASP E 155 ? VAL E 118 ASP E 133 1 ? 16 
HELX_P HELX_P78  78  GLY E 170 ? GLY E 184 ? GLY E 148 GLY E 162 1 ? 15 
HELX_P HELX_P79  79  SER E 196 ? LEU E 206 ? SER E 174 LEU E 184 1 ? 11 
HELX_P HELX_P80  80  SER E 224 ? ILE E 236 ? SER E 202 ILE E 214 1 ? 13 
HELX_P HELX_P81  81  ALA E 248 ? THR E 257 ? ALA E 226 THR E 235 1 ? 10 
HELX_P HELX_P82  82  THR E 257 ? CYS E 266 ? THR E 235 CYS E 244 1 ? 10 
HELX_P HELX_P83  83  GLY E 280 ? CYS E 294 ? GLY E 258 CYS E 272 1 ? 15 
HELX_P HELX_P84  84  PRO E 312 ? GLN E 317 ? PRO E 290 GLN E 295 5 ? 6  
HELX_P HELX_P85  85  ASP E 338 ? VAL E 342 ? ASP E 316 VAL E 320 5 ? 5  
HELX_P HELX_P86  86  ASN E 349 ? GLU E 364 ? ASN E 327 GLU E 342 1 ? 16 
HELX_P HELX_P87  87  GLY E 369 ? ALA E 383 ? GLY E 347 ALA E 361 1 ? 15 
HELX_P HELX_P88  88  GLN E 384 ? LEU E 386 ? GLN E 362 LEU E 364 5 ? 3  
HELX_P HELX_P89  89  VAL E 400 ? MET E 404 ? VAL E 378 MET E 382 5 ? 5  
HELX_P HELX_P90  90  SER E 409 ? LYS E 416 ? SER E 387 LYS E 394 1 ? 8  
HELX_P HELX_P91  91  PRO F 81  ? SER F 85  ? PRO F 59  SER F 63  5 ? 5  
HELX_P HELX_P92  92  ASP F 101 ? ILE F 106 ? ASP F 79  ILE F 84  5 ? 6  
HELX_P HELX_P93  93  LYS F 116 ? PHE F 121 ? LYS F 94  PHE F 99  1 ? 6  
HELX_P HELX_P94  94  PHE F 133 ? ASN F 135 ? PHE F 111 ASN F 113 5 ? 3  
HELX_P HELX_P95  95  VAL F 140 ? ASP F 155 ? VAL F 118 ASP F 133 1 ? 16 
HELX_P HELX_P96  96  GLY F 170 ? GLY F 184 ? GLY F 148 GLY F 162 1 ? 15 
HELX_P HELX_P97  97  SER F 196 ? LEU F 206 ? SER F 174 LEU F 184 1 ? 11 
HELX_P HELX_P98  98  SER F 224 ? ILE F 236 ? SER F 202 ILE F 214 1 ? 13 
HELX_P HELX_P99  99  ALA F 248 ? THR F 257 ? ALA F 226 THR F 235 1 ? 10 
HELX_P HELX_P100 100 THR F 257 ? ASP F 267 ? THR F 235 ASP F 245 1 ? 11 
HELX_P HELX_P101 101 GLY F 280 ? CYS F 294 ? GLY F 258 CYS F 272 1 ? 15 
HELX_P HELX_P102 102 GLU F 313 ? GLN F 317 ? GLU F 291 GLN F 295 5 ? 5  
HELX_P HELX_P103 103 ASP F 338 ? VAL F 342 ? ASP F 316 VAL F 320 5 ? 5  
HELX_P HELX_P104 104 ASN F 349 ? GLU F 364 ? ASN F 327 GLU F 342 1 ? 16 
HELX_P HELX_P105 105 GLY F 369 ? ALA F 383 ? GLY F 347 ALA F 361 1 ? 15 
HELX_P HELX_P106 106 GLN F 384 ? LEU F 386 ? GLN F 362 LEU F 364 5 ? 3  
HELX_P HELX_P107 107 VAL F 400 ? MET F 404 ? VAL F 378 MET F 382 5 ? 5  
HELX_P HELX_P108 108 SER F 409 ? LYS F 416 ? SER F 387 LYS F 394 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 294 SG  ? ? ? 1_555 A CYS 297 SG  ? ? A CYS 272  A CYS 275 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf2  disulf ? ? B CYS 294 SG  ? ? ? 1_555 B CYS 297 SG  ? ? B CYS 272  B CYS 275 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf3  disulf ? ? C CYS 294 SG  ? ? ? 1_555 C CYS 297 SG  ? ? C CYS 272  C CYS 275 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf4  disulf ? ? D CYS 294 SG  ? ? ? 1_555 D CYS 297 SG  ? ? D CYS 272  D CYS 275 1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf5  disulf ? ? E CYS 294 SG  ? ? ? 1_555 E CYS 297 SG  ? ? E CYS 272  E CYS 275 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf6  disulf ? ? F CYS 294 SG  ? ? ? 1_555 F CYS 297 SG  ? ? F CYS 272  F CYS 275 1_555 ? ? ? ? ? ? ? 2.037 ? 
covale1  covale ? ? H PLP .   C4A ? ? ? 1_555 A LYS 141 NZ  ? ? A PLP 1001 A LYS 119 1_555 ? ? ? ? ? ? ? 1.269 ? 
covale2  covale ? ? J PLP .   C4A ? ? ? 1_555 B LYS 141 NZ  ? ? B PLP 1001 B LYS 119 1_555 ? ? ? ? ? ? ? 1.266 ? 
covale3  covale ? ? L PLP .   C4A ? ? ? 1_555 C LYS 141 NZ  ? ? C PLP 1001 C LYS 119 1_555 ? ? ? ? ? ? ? 1.269 ? 
covale4  covale ? ? N PLP .   C4A ? ? ? 1_555 D LYS 141 NZ  ? ? D PLP 1001 D LYS 119 1_555 ? ? ? ? ? ? ? 1.265 ? 
covale5  covale ? ? P PLP .   C4A ? ? ? 1_555 E LYS 141 NZ  ? ? E PLP 1001 E LYS 119 1_555 ? ? ? ? ? ? ? 1.263 ? 
covale6  covale ? ? R PLP .   C4A ? ? ? 1_555 F LYS 141 NZ  ? ? F PLP 1001 F LYS 119 1_555 ? ? ? ? ? ? ? 1.275 ? 
metalc1  metalc ? ? G HEM .   FE  ? ? ? 1_555 A HIS 87  NE2 ? ? A HEM 501  A HIS 65  1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc2  metalc ? ? G HEM .   FE  ? ? ? 1_555 A CYS 74  SG  ? ? A HEM 501  A CYS 52  1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc3  metalc ? ? I HEM .   FE  ? ? ? 1_555 B HIS 87  NE2 ? ? B HEM 501  B HIS 65  1_555 ? ? ? ? ? ? ? 2.210 ? 
metalc4  metalc ? ? I HEM .   FE  ? ? ? 1_555 B CYS 74  SG  ? ? B HEM 501  B CYS 52  1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc5  metalc ? ? K HEM .   FE  ? ? ? 1_555 C CYS 74  SG  ? ? C HEM 501  C CYS 52  1_555 ? ? ? ? ? ? ? 2.218 ? 
metalc6  metalc ? ? K HEM .   FE  ? ? ? 1_555 C HIS 87  NE2 ? ? C HEM 501  C HIS 65  1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc7  metalc ? ? M HEM .   FE  ? ? ? 1_555 D CYS 74  SG  ? ? D HEM 501  D CYS 52  1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc8  metalc ? ? M HEM .   FE  ? ? ? 1_555 D HIS 87  NE2 ? ? D HEM 501  D HIS 65  1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc9  metalc ? ? O HEM .   FE  ? ? ? 1_555 E CYS 74  SG  ? ? E HEM 501  E CYS 52  1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc10 metalc ? ? O HEM .   FE  ? ? ? 1_555 E HIS 87  NE2 ? ? E HEM 501  E HIS 65  1_555 ? ? ? ? ? ? ? 2.191 ? 
metalc11 metalc ? ? Q HEM .   FE  ? ? ? 1_555 F HIS 87  NE2 ? ? F HEM 501  F HIS 65  1_555 ? ? ? ? ? ? ? 2.217 ? 
metalc12 metalc ? ? Q HEM .   FE  ? ? ? 1_555 F CYS 74  SG  ? ? F HEM 501  F CYS 52  1_555 ? ? ? ? ? ? ? 2.309 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 311 A . ? GLU 289 A PRO 312 A ? PRO 290 A 1 -0.10 
2 GLU 311 B . ? GLU 289 B PRO 312 B ? PRO 290 B 1 -0.01 
3 GLU 311 C . ? GLU 289 C PRO 312 C ? PRO 290 C 1 -0.09 
4 GLU 311 D . ? GLU 289 D PRO 312 D ? PRO 290 D 1 -0.18 
5 GLU 311 E . ? GLU 289 E PRO 312 E ? PRO 290 E 1 -0.09 
6 GLU 311 F . ? GLU 289 F PRO 312 F ? PRO 290 F 1 0.14  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
C ? 4 ? 
D ? 4 ? 
E ? 7 ? 
F ? 7 ? 
G ? 4 ? 
H ? 4 ? 
I ? 7 ? 
J ? 7 ? 
K ? 4 ? 
L ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
B 6 7 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
E 6 7 ? parallel      
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? anti-parallel 
F 6 7 ? parallel      
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? parallel      
I 1 2 ? parallel      
I 2 3 ? anti-parallel 
I 3 4 ? parallel      
I 4 5 ? parallel      
I 5 6 ? parallel      
I 6 7 ? parallel      
J 1 2 ? parallel      
J 2 3 ? parallel      
J 3 4 ? parallel      
J 4 5 ? parallel      
J 5 6 ? anti-parallel 
J 6 7 ? parallel      
K 1 2 ? parallel      
K 2 3 ? parallel      
K 3 4 ? parallel      
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 98  ? LEU A 99  ? ILE A 76  LEU A 77  
A 2 MET B 111 ? ARG B 113 ? MET B 89  ARG B 91  
A 3 GLU B 126 ? CYS B 131 ? GLU B 104 CYS B 109 
A 4 ARG B 391 ? LEU B 396 ? ARG B 369 LEU B 374 
A 5 MET B 272 ? SER B 276 ? MET B 250 SER B 254 
A 6 ARG B 298 ? PRO B 304 ? ARG B 276 PRO B 282 
A 7 LYS B 344 ? SER B 348 ? LYS B 322 SER B 326 
B 1 LYS A 344 ? SER A 348 ? LYS A 322 SER A 326 
B 2 ARG A 298 ? PRO A 304 ? ARG A 276 PRO A 282 
B 3 MET A 272 ? SER A 276 ? MET A 250 SER A 254 
B 4 ARG A 391 ? LEU A 396 ? ARG A 369 LEU A 374 
B 5 GLU A 126 ? CYS A 131 ? GLU A 104 CYS A 109 
B 6 MET A 111 ? ARG A 113 ? MET A 89  ARG A 91  
B 7 ILE B 98  ? LEU B 99  ? ILE B 76  LEU B 77  
C 1 GLU A 209 ? ARG A 212 ? GLU A 187 ARG A 190 
C 2 ARG A 186 ? MET A 191 ? ARG A 164 MET A 169 
C 3 THR A 163 ? PRO A 167 ? THR A 141 PRO A 145 
C 4 SER A 239 ? HIS A 240 ? SER A 217 HIS A 218 
D 1 GLU B 209 ? ARG B 212 ? GLU B 187 ARG B 190 
D 2 ARG B 186 ? MET B 191 ? ARG B 164 MET B 169 
D 3 THR B 163 ? PRO B 167 ? THR B 141 PRO B 145 
D 4 SER B 239 ? HIS B 240 ? SER B 217 HIS B 218 
E 1 ILE C 98  ? LEU C 99  ? ILE C 76  LEU C 77  
E 2 MET D 111 ? ARG D 113 ? MET D 89  ARG D 91  
E 3 GLU D 126 ? CYS D 131 ? GLU D 104 CYS D 109 
E 4 ARG D 391 ? LEU D 396 ? ARG D 369 LEU D 374 
E 5 MET D 272 ? SER D 276 ? MET D 250 SER D 254 
E 6 ARG D 298 ? PRO D 304 ? ARG D 276 PRO D 282 
E 7 LYS D 344 ? SER D 348 ? LYS D 322 SER D 326 
F 1 LYS C 344 ? SER C 348 ? LYS C 322 SER C 326 
F 2 ARG C 298 ? PRO C 304 ? ARG C 276 PRO C 282 
F 3 MET C 272 ? SER C 276 ? MET C 250 SER C 254 
F 4 ARG C 391 ? LEU C 396 ? ARG C 369 LEU C 374 
F 5 GLU C 126 ? CYS C 131 ? GLU C 104 CYS C 109 
F 6 MET C 111 ? ARG C 113 ? MET C 89  ARG C 91  
F 7 ILE D 98  ? LEU D 99  ? ILE D 76  LEU D 77  
G 1 GLU C 209 ? ARG C 212 ? GLU C 187 ARG C 190 
G 2 ARG C 186 ? MET C 191 ? ARG C 164 MET C 169 
G 3 THR C 163 ? PRO C 167 ? THR C 141 PRO C 145 
G 4 SER C 239 ? HIS C 240 ? SER C 217 HIS C 218 
H 1 GLU D 209 ? ARG D 212 ? GLU D 187 ARG D 190 
H 2 ARG D 186 ? MET D 191 ? ARG D 164 MET D 169 
H 3 THR D 163 ? PRO D 167 ? THR D 141 PRO D 145 
H 4 SER D 239 ? HIS D 240 ? SER D 217 HIS D 218 
I 1 ILE E 98  ? LEU E 99  ? ILE E 76  LEU E 77  
I 2 MET F 111 ? ARG F 113 ? MET F 89  ARG F 91  
I 3 GLU F 126 ? CYS F 131 ? GLU F 104 CYS F 109 
I 4 ARG F 391 ? LEU F 396 ? ARG F 369 LEU F 374 
I 5 MET F 272 ? SER F 276 ? MET F 250 SER F 254 
I 6 ARG F 298 ? PRO F 304 ? ARG F 276 PRO F 282 
I 7 LYS F 344 ? SER F 348 ? LYS F 322 SER F 326 
J 1 LYS E 344 ? SER E 348 ? LYS E 322 SER E 326 
J 2 ARG E 298 ? PRO E 304 ? ARG E 276 PRO E 282 
J 3 MET E 272 ? SER E 276 ? MET E 250 SER E 254 
J 4 ARG E 391 ? LEU E 396 ? ARG E 369 LEU E 374 
J 5 GLU E 126 ? CYS E 131 ? GLU E 104 CYS E 109 
J 6 MET E 111 ? ARG E 113 ? MET E 89  ARG E 91  
J 7 ILE F 98  ? LEU F 99  ? ILE F 76  LEU F 77  
K 1 GLU E 209 ? ARG E 212 ? GLU E 187 ARG E 190 
K 2 ARG E 186 ? MET E 191 ? ARG E 164 MET E 169 
K 3 THR E 163 ? PRO E 167 ? THR E 141 PRO E 145 
K 4 SER E 239 ? HIS E 240 ? SER E 217 HIS E 218 
L 1 GLU F 209 ? ARG F 212 ? GLU F 187 ARG F 190 
L 2 ARG F 186 ? MET F 191 ? ARG F 164 MET F 169 
L 3 THR F 163 ? PRO F 167 ? THR F 141 PRO F 145 
L 4 SER F 239 ? HIS F 240 ? SER F 217 HIS F 218 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 99  ? N LEU A 77  O MET B 111 ? O MET B 89  
A 2 3 O VAL B 112 ? O VAL B 90  N ALA B 129 ? N ALA B 107 
A 3 4 O GLU B 126 ? O GLU B 104 N CYS B 392 ? N CYS B 370 
A 4 5 N VAL B 393 ? N VAL B 371 O MET B 272 ? O MET B 250 
A 5 6 N LEU B 273 ? N LEU B 251 O ARG B 298 ? O ARG B 276 
A 6 7 N GLY B 301 ? N GLY B 279 O LYS B 344 ? O LYS B 322 
B 1 2 N LYS A 344 ? N LYS A 322 O ILE A 299 ? O ILE A 277 
B 2 3 N ILE A 300 ? N ILE A 278 O LEU A 273 ? O LEU A 251 
B 3 4 N MET A 272 ? N MET A 250 O ARG A 391 ? O ARG A 369 
B 4 5 N CYS A 392 ? N CYS A 370 O GLU A 126 ? O GLU A 104 
B 5 6 N ALA A 129 ? N ALA A 107 O VAL A 112 ? O VAL A 90  
B 6 7 O MET A 111 ? O MET A 89  N LEU B 99  ? N LEU B 77  
C 1 2 N GLU A 209 ? N GLU A 187 O CYS A 187 ? O CYS A 165 
C 2 3 O ARG A 186 ? O ARG A 164 N ILE A 164 ? N ILE A 142 
C 3 4 N ILE A 165 ? N ILE A 143 O HIS A 240 ? O HIS A 218 
D 1 2 N GLU B 209 ? N GLU B 187 O CYS B 187 ? O CYS B 165 
D 2 3 O ARG B 186 ? O ARG B 164 N ILE B 164 ? N ILE B 142 
D 3 4 N ILE B 165 ? N ILE B 143 O HIS B 240 ? O HIS B 218 
E 1 2 N LEU C 99  ? N LEU C 77  O MET D 111 ? O MET D 89  
E 2 3 O VAL D 112 ? O VAL D 90  N ALA D 129 ? N ALA D 107 
E 3 4 O GLU D 126 ? O GLU D 104 N CYS D 392 ? N CYS D 370 
E 4 5 N VAL D 393 ? N VAL D 371 O MET D 272 ? O MET D 250 
E 5 6 N LEU D 273 ? N LEU D 251 O ARG D 298 ? O ARG D 276 
E 6 7 N GLY D 301 ? N GLY D 279 O LYS D 344 ? O LYS D 322 
F 1 2 N LYS C 344 ? N LYS C 322 O ILE C 299 ? O ILE C 277 
F 2 3 N ILE C 300 ? N ILE C 278 O LEU C 273 ? O LEU C 251 
F 3 4 N MET C 272 ? N MET C 250 O ARG C 391 ? O ARG C 369 
F 4 5 N CYS C 392 ? N CYS C 370 O GLU C 126 ? O GLU C 104 
F 5 6 N ALA C 129 ? N ALA C 107 O VAL C 112 ? O VAL C 90  
F 6 7 O MET C 111 ? O MET C 89  N LEU D 99  ? N LEU D 77  
G 1 2 N GLU C 209 ? N GLU C 187 O CYS C 187 ? O CYS C 165 
G 2 3 O ARG C 186 ? O ARG C 164 N ILE C 164 ? N ILE C 142 
G 3 4 N ILE C 165 ? N ILE C 143 O HIS C 240 ? O HIS C 218 
H 1 2 N GLU D 209 ? N GLU D 187 O CYS D 187 ? O CYS D 165 
H 2 3 O ARG D 186 ? O ARG D 164 N ILE D 164 ? N ILE D 142 
H 3 4 N ILE D 165 ? N ILE D 143 O HIS D 240 ? O HIS D 218 
I 1 2 N LEU E 99  ? N LEU E 77  O MET F 111 ? O MET F 89  
I 2 3 O VAL F 112 ? O VAL F 90  N ALA F 129 ? N ALA F 107 
I 3 4 O GLU F 126 ? O GLU F 104 N CYS F 392 ? N CYS F 370 
I 4 5 N VAL F 393 ? N VAL F 371 O MET F 272 ? O MET F 250 
I 5 6 N LEU F 273 ? N LEU F 251 O ARG F 298 ? O ARG F 276 
I 6 7 N GLY F 301 ? N GLY F 279 O LYS F 344 ? O LYS F 322 
J 1 2 N LYS E 344 ? N LYS E 322 O ILE E 299 ? O ILE E 277 
J 2 3 N ILE E 300 ? N ILE E 278 O LEU E 273 ? O LEU E 251 
J 3 4 N MET E 272 ? N MET E 250 O ARG E 391 ? O ARG E 369 
J 4 5 N CYS E 392 ? N CYS E 370 O GLU E 126 ? O GLU E 104 
J 5 6 N ALA E 129 ? N ALA E 107 O VAL E 112 ? O VAL E 90  
J 6 7 O MET E 111 ? O MET E 89  N LEU F 99  ? N LEU F 77  
K 1 2 N GLU E 209 ? N GLU E 187 O CYS E 187 ? O CYS E 165 
K 2 3 O ARG E 186 ? O ARG E 164 N ILE E 164 ? N ILE E 142 
K 3 4 N ILE E 165 ? N ILE E 143 O HIS E 240 ? O HIS E 218 
L 1 2 N GLU F 209 ? N GLU F 187 O CYS F 187 ? O CYS F 165 
L 2 3 O ARG F 186 ? O ARG F 164 N ILE F 164 ? N ILE F 142 
L 3 4 N ILE F 165 ? N ILE F 143 O HIS F 240 ? O HIS F 218 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE HEM A 501'  
AC2 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE HEM B 501'  
AC3 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE HEM C 501'  
AC4 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE HEM D 501'  
AC5 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM E 501'  
AC6 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE HEM F 501'  
AC7 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE PLP A 1001' 
AC8 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE PLP B 1001' 
AC9 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE PLP C 1001' 
BC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE PLP D 1001' 
BC2 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE PLP E 1001' 
BC3 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE PLP F 1001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 18 SER A 72  ? SER A 50   . ? 1_555 ? 
2   AC1 18 ARG A 73  ? ARG A 51   . ? 1_555 ? 
3   AC1 18 CYS A 74  ? CYS A 52   . ? 1_555 ? 
4   AC1 18 THR A 75  ? THR A 53   . ? 1_555 ? 
5   AC1 18 TRP A 76  ? TRP A 54   . ? 1_555 ? 
6   AC1 18 GLU A 84  ? GLU A 62   . ? 1_555 ? 
7   AC1 18 SER A 85  ? SER A 63   . ? 1_555 ? 
8   AC1 18 PRO A 86  ? PRO A 64   . ? 1_555 ? 
9   AC1 18 HIS A 87  ? HIS A 65   . ? 1_555 ? 
10  AC1 18 ARG A 246 ? ARG A 224  . ? 1_555 ? 
11  AC1 18 ALA A 248 ? ALA A 226  . ? 1_555 ? 
12  AC1 18 PRO A 251 ? PRO A 229  . ? 1_555 ? 
13  AC1 18 LEU A 252 ? LEU A 230  . ? 1_555 ? 
14  AC1 18 TYR A 255 ? TYR A 233  . ? 1_555 ? 
15  AC1 18 ARG A 288 ? ARG A 266  . ? 1_555 ? 
16  AC1 18 THR B 75  ? THR B 53   . ? 2_664 ? 
17  AC1 18 ARG B 80  ? ARG B 58   . ? 2_664 ? 
18  AC1 18 HEM I .   ? HEM B 501  . ? 2_664 ? 
19  AC2 18 THR A 75  ? THR A 53   . ? 3_565 ? 
20  AC2 18 ARG A 80  ? ARG A 58   . ? 3_565 ? 
21  AC2 18 HEM G .   ? HEM A 501  . ? 3_565 ? 
22  AC2 18 SER B 72  ? SER B 50   . ? 1_555 ? 
23  AC2 18 ARG B 73  ? ARG B 51   . ? 1_555 ? 
24  AC2 18 CYS B 74  ? CYS B 52   . ? 1_555 ? 
25  AC2 18 THR B 75  ? THR B 53   . ? 1_555 ? 
26  AC2 18 TRP B 76  ? TRP B 54   . ? 1_555 ? 
27  AC2 18 GLU B 84  ? GLU B 62   . ? 1_555 ? 
28  AC2 18 PRO B 86  ? PRO B 64   . ? 1_555 ? 
29  AC2 18 HIS B 87  ? HIS B 65   . ? 1_555 ? 
30  AC2 18 ARG B 246 ? ARG B 224  . ? 1_555 ? 
31  AC2 18 ALA B 248 ? ALA B 226  . ? 1_555 ? 
32  AC2 18 PRO B 251 ? PRO B 229  . ? 1_555 ? 
33  AC2 18 LEU B 252 ? LEU B 230  . ? 1_555 ? 
34  AC2 18 TYR B 255 ? TYR B 233  . ? 1_555 ? 
35  AC2 18 ARG B 288 ? ARG B 266  . ? 1_555 ? 
36  AC2 18 HOH T .   ? HOH B 1011 . ? 1_555 ? 
37  AC3 18 SER C 72  ? SER C 50   . ? 1_555 ? 
38  AC3 18 ARG C 73  ? ARG C 51   . ? 1_555 ? 
39  AC3 18 CYS C 74  ? CYS C 52   . ? 1_555 ? 
40  AC3 18 THR C 75  ? THR C 53   . ? 1_555 ? 
41  AC3 18 TRP C 76  ? TRP C 54   . ? 1_555 ? 
42  AC3 18 GLU C 84  ? GLU C 62   . ? 1_555 ? 
43  AC3 18 SER C 85  ? SER C 63   . ? 1_555 ? 
44  AC3 18 PRO C 86  ? PRO C 64   . ? 1_555 ? 
45  AC3 18 HIS C 87  ? HIS C 65   . ? 1_555 ? 
46  AC3 18 ARG C 246 ? ARG C 224  . ? 1_555 ? 
47  AC3 18 ALA C 248 ? ALA C 226  . ? 1_555 ? 
48  AC3 18 PRO C 251 ? PRO C 229  . ? 1_555 ? 
49  AC3 18 LEU C 252 ? LEU C 230  . ? 1_555 ? 
50  AC3 18 TYR C 255 ? TYR C 233  . ? 1_555 ? 
51  AC3 18 ARG C 288 ? ARG C 266  . ? 1_555 ? 
52  AC3 18 THR D 75  ? THR D 53   . ? 2_764 ? 
53  AC3 18 ARG D 80  ? ARG D 58   . ? 2_764 ? 
54  AC3 18 HEM M .   ? HEM D 501  . ? 2_764 ? 
55  AC4 18 THR C 75  ? THR C 53   . ? 3_675 ? 
56  AC4 18 ARG C 80  ? ARG C 58   . ? 3_675 ? 
57  AC4 18 HEM K .   ? HEM C 501  . ? 3_675 ? 
58  AC4 18 HOH U .   ? HOH C 1004 . ? 3_675 ? 
59  AC4 18 SER D 72  ? SER D 50   . ? 1_555 ? 
60  AC4 18 ARG D 73  ? ARG D 51   . ? 1_555 ? 
61  AC4 18 CYS D 74  ? CYS D 52   . ? 1_555 ? 
62  AC4 18 THR D 75  ? THR D 53   . ? 1_555 ? 
63  AC4 18 TRP D 76  ? TRP D 54   . ? 1_555 ? 
64  AC4 18 GLU D 84  ? GLU D 62   . ? 1_555 ? 
65  AC4 18 PRO D 86  ? PRO D 64   . ? 1_555 ? 
66  AC4 18 HIS D 87  ? HIS D 65   . ? 1_555 ? 
67  AC4 18 ARG D 246 ? ARG D 224  . ? 1_555 ? 
68  AC4 18 ALA D 248 ? ALA D 226  . ? 1_555 ? 
69  AC4 18 PRO D 251 ? PRO D 229  . ? 1_555 ? 
70  AC4 18 LEU D 252 ? LEU D 230  . ? 1_555 ? 
71  AC4 18 TYR D 255 ? TYR D 233  . ? 1_555 ? 
72  AC4 18 ARG D 288 ? ARG D 266  . ? 1_555 ? 
73  AC5 17 ARG E 73  ? ARG E 51   . ? 1_555 ? 
74  AC5 17 CYS E 74  ? CYS E 52   . ? 1_555 ? 
75  AC5 17 THR E 75  ? THR E 53   . ? 1_555 ? 
76  AC5 17 TRP E 76  ? TRP E 54   . ? 1_555 ? 
77  AC5 17 GLU E 84  ? GLU E 62   . ? 1_555 ? 
78  AC5 17 SER E 85  ? SER E 63   . ? 1_555 ? 
79  AC5 17 PRO E 86  ? PRO E 64   . ? 1_555 ? 
80  AC5 17 HIS E 87  ? HIS E 65   . ? 1_555 ? 
81  AC5 17 ARG E 246 ? ARG E 224  . ? 1_555 ? 
82  AC5 17 ALA E 248 ? ALA E 226  . ? 1_555 ? 
83  AC5 17 PRO E 251 ? PRO E 229  . ? 1_555 ? 
84  AC5 17 LEU E 252 ? LEU E 230  . ? 1_555 ? 
85  AC5 17 TYR E 255 ? TYR E 233  . ? 1_555 ? 
86  AC5 17 ARG E 288 ? ARG E 266  . ? 1_555 ? 
87  AC5 17 THR F 75  ? THR F 53   . ? 2_654 ? 
88  AC5 17 ARG F 80  ? ARG F 58   . ? 2_654 ? 
89  AC5 17 HEM Q .   ? HEM F 501  . ? 2_654 ? 
90  AC6 18 THR E 75  ? THR E 53   . ? 3_665 ? 
91  AC6 18 ARG E 80  ? ARG E 58   . ? 3_665 ? 
92  AC6 18 HEM O .   ? HEM E 501  . ? 3_665 ? 
93  AC6 18 SER F 72  ? SER F 50   . ? 1_555 ? 
94  AC6 18 ARG F 73  ? ARG F 51   . ? 1_555 ? 
95  AC6 18 CYS F 74  ? CYS F 52   . ? 1_555 ? 
96  AC6 18 THR F 75  ? THR F 53   . ? 1_555 ? 
97  AC6 18 TRP F 76  ? TRP F 54   . ? 1_555 ? 
98  AC6 18 GLU F 84  ? GLU F 62   . ? 1_555 ? 
99  AC6 18 SER F 85  ? SER F 63   . ? 1_555 ? 
100 AC6 18 PRO F 86  ? PRO F 64   . ? 1_555 ? 
101 AC6 18 HIS F 87  ? HIS F 65   . ? 1_555 ? 
102 AC6 18 ARG F 246 ? ARG F 224  . ? 1_555 ? 
103 AC6 18 ALA F 248 ? ALA F 226  . ? 1_555 ? 
104 AC6 18 PRO F 251 ? PRO F 229  . ? 1_555 ? 
105 AC6 18 LEU F 252 ? LEU F 230  . ? 1_555 ? 
106 AC6 18 TYR F 255 ? TYR F 233  . ? 1_555 ? 
107 AC6 18 ARG F 288 ? ARG F 266  . ? 1_555 ? 
108 AC7 17 LYS A 141 ? LYS A 119  . ? 1_555 ? 
109 AC7 17 ASN A 171 ? ASN A 149  . ? 1_555 ? 
110 AC7 17 SER A 276 ? SER A 254  . ? 1_555 ? 
111 AC7 17 VAL A 277 ? VAL A 255  . ? 1_555 ? 
112 AC7 17 GLY A 278 ? GLY A 256  . ? 1_555 ? 
113 AC7 17 THR A 279 ? THR A 257  . ? 1_555 ? 
114 AC7 17 GLY A 280 ? GLY A 258  . ? 1_555 ? 
115 AC7 17 GLY A 281 ? GLY A 259  . ? 1_555 ? 
116 AC7 17 THR A 282 ? THR A 260  . ? 1_555 ? 
117 AC7 17 GLY A 327 ? GLY A 305  . ? 1_555 ? 
118 AC7 17 ILE A 328 ? ILE A 306  . ? 1_555 ? 
119 AC7 17 SER A 371 ? SER A 349  . ? 1_555 ? 
120 AC7 17 PRO A 397 ? PRO A 375  . ? 1_555 ? 
121 AC7 17 ASP A 398 ? ASP A 376  . ? 1_555 ? 
122 AC7 17 TYR A 403 ? TYR A 381  . ? 1_555 ? 
123 AC7 17 HOH S .   ? HOH A 1020 . ? 1_555 ? 
124 AC7 17 HOH S .   ? HOH A 1021 . ? 1_555 ? 
125 AC8 16 LYS B 141 ? LYS B 119  . ? 1_555 ? 
126 AC8 16 ASN B 171 ? ASN B 149  . ? 1_555 ? 
127 AC8 16 SER B 276 ? SER B 254  . ? 1_555 ? 
128 AC8 16 VAL B 277 ? VAL B 255  . ? 1_555 ? 
129 AC8 16 GLY B 278 ? GLY B 256  . ? 1_555 ? 
130 AC8 16 THR B 279 ? THR B 257  . ? 1_555 ? 
131 AC8 16 GLY B 280 ? GLY B 258  . ? 1_555 ? 
132 AC8 16 GLY B 281 ? GLY B 259  . ? 1_555 ? 
133 AC8 16 THR B 282 ? THR B 260  . ? 1_555 ? 
134 AC8 16 GLY B 327 ? GLY B 305  . ? 1_555 ? 
135 AC8 16 ILE B 328 ? ILE B 306  . ? 1_555 ? 
136 AC8 16 SER B 371 ? SER B 349  . ? 1_555 ? 
137 AC8 16 PRO B 397 ? PRO B 375  . ? 1_555 ? 
138 AC8 16 ASP B 398 ? ASP B 376  . ? 1_555 ? 
139 AC8 16 TYR B 403 ? TYR B 381  . ? 1_555 ? 
140 AC8 16 HOH T .   ? HOH B 1029 . ? 1_555 ? 
141 AC9 19 LYS C 141 ? LYS C 119  . ? 1_555 ? 
142 AC9 19 ASN C 171 ? ASN C 149  . ? 1_555 ? 
143 AC9 19 SER C 276 ? SER C 254  . ? 1_555 ? 
144 AC9 19 VAL C 277 ? VAL C 255  . ? 1_555 ? 
145 AC9 19 GLY C 278 ? GLY C 256  . ? 1_555 ? 
146 AC9 19 THR C 279 ? THR C 257  . ? 1_555 ? 
147 AC9 19 GLY C 280 ? GLY C 258  . ? 1_555 ? 
148 AC9 19 GLY C 281 ? GLY C 259  . ? 1_555 ? 
149 AC9 19 THR C 282 ? THR C 260  . ? 1_555 ? 
150 AC9 19 GLU C 326 ? GLU C 304  . ? 1_555 ? 
151 AC9 19 GLY C 327 ? GLY C 305  . ? 1_555 ? 
152 AC9 19 ILE C 328 ? ILE C 306  . ? 1_555 ? 
153 AC9 19 SER C 371 ? SER C 349  . ? 1_555 ? 
154 AC9 19 PRO C 397 ? PRO C 375  . ? 1_555 ? 
155 AC9 19 ASP C 398 ? ASP C 376  . ? 1_555 ? 
156 AC9 19 TYR C 403 ? TYR C 381  . ? 1_555 ? 
157 AC9 19 HOH U .   ? HOH C 1006 . ? 1_555 ? 
158 AC9 19 HOH U .   ? HOH C 1024 . ? 1_555 ? 
159 AC9 19 HOH U .   ? HOH C 1025 . ? 1_555 ? 
160 BC1 17 LYS D 141 ? LYS D 119  . ? 1_555 ? 
161 BC1 17 ASN D 171 ? ASN D 149  . ? 1_555 ? 
162 BC1 17 SER D 276 ? SER D 254  . ? 1_555 ? 
163 BC1 17 VAL D 277 ? VAL D 255  . ? 1_555 ? 
164 BC1 17 GLY D 278 ? GLY D 256  . ? 1_555 ? 
165 BC1 17 THR D 279 ? THR D 257  . ? 1_555 ? 
166 BC1 17 GLY D 280 ? GLY D 258  . ? 1_555 ? 
167 BC1 17 GLY D 281 ? GLY D 259  . ? 1_555 ? 
168 BC1 17 THR D 282 ? THR D 260  . ? 1_555 ? 
169 BC1 17 GLY D 327 ? GLY D 305  . ? 1_555 ? 
170 BC1 17 ILE D 328 ? ILE D 306  . ? 1_555 ? 
171 BC1 17 SER D 371 ? SER D 349  . ? 1_555 ? 
172 BC1 17 PRO D 397 ? PRO D 375  . ? 1_555 ? 
173 BC1 17 ASP D 398 ? ASP D 376  . ? 1_555 ? 
174 BC1 17 TYR D 403 ? TYR D 381  . ? 1_555 ? 
175 BC1 17 HOH V .   ? HOH D 1023 . ? 1_555 ? 
176 BC1 17 HOH V .   ? HOH D 1024 . ? 1_555 ? 
177 BC2 18 LYS E 141 ? LYS E 119  . ? 1_555 ? 
178 BC2 18 ASN E 171 ? ASN E 149  . ? 1_555 ? 
179 BC2 18 SER E 276 ? SER E 254  . ? 1_555 ? 
180 BC2 18 VAL E 277 ? VAL E 255  . ? 1_555 ? 
181 BC2 18 GLY E 278 ? GLY E 256  . ? 1_555 ? 
182 BC2 18 THR E 279 ? THR E 257  . ? 1_555 ? 
183 BC2 18 GLY E 280 ? GLY E 258  . ? 1_555 ? 
184 BC2 18 GLY E 281 ? GLY E 259  . ? 1_555 ? 
185 BC2 18 THR E 282 ? THR E 260  . ? 1_555 ? 
186 BC2 18 GLY E 327 ? GLY E 305  . ? 1_555 ? 
187 BC2 18 SER E 371 ? SER E 349  . ? 1_555 ? 
188 BC2 18 PRO E 397 ? PRO E 375  . ? 1_555 ? 
189 BC2 18 ASP E 398 ? ASP E 376  . ? 1_555 ? 
190 BC2 18 TYR E 403 ? TYR E 381  . ? 1_555 ? 
191 BC2 18 HOH W .   ? HOH E 1006 . ? 1_555 ? 
192 BC2 18 HOH W .   ? HOH E 1028 . ? 1_555 ? 
193 BC2 18 HOH W .   ? HOH E 1029 . ? 1_555 ? 
194 BC2 18 HOH W .   ? HOH E 1030 . ? 1_555 ? 
195 BC3 17 LYS F 141 ? LYS F 119  . ? 1_555 ? 
196 BC3 17 ASN F 171 ? ASN F 149  . ? 1_555 ? 
197 BC3 17 SER F 276 ? SER F 254  . ? 1_555 ? 
198 BC3 17 VAL F 277 ? VAL F 255  . ? 1_555 ? 
199 BC3 17 GLY F 278 ? GLY F 256  . ? 1_555 ? 
200 BC3 17 THR F 279 ? THR F 257  . ? 1_555 ? 
201 BC3 17 GLY F 280 ? GLY F 258  . ? 1_555 ? 
202 BC3 17 GLY F 281 ? GLY F 259  . ? 1_555 ? 
203 BC3 17 THR F 282 ? THR F 260  . ? 1_555 ? 
204 BC3 17 GLY F 327 ? GLY F 305  . ? 1_555 ? 
205 BC3 17 ILE F 328 ? ILE F 306  . ? 1_555 ? 
206 BC3 17 SER F 371 ? SER F 349  . ? 1_555 ? 
207 BC3 17 PRO F 397 ? PRO F 375  . ? 1_555 ? 
208 BC3 17 ASP F 398 ? ASP F 376  . ? 1_555 ? 
209 BC3 17 TYR F 403 ? TYR F 381  . ? 1_555 ? 
210 BC3 17 HOH X .   ? HOH F 1020 . ? 1_555 ? 
211 BC3 17 HOH X .   ? HOH F 1021 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1JBQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JBQ 
_atom_sites.fract_transf_matrix[1][1]   0.006919 
_atom_sites.fract_transf_matrix[1][2]   0.003995 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007990 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009246 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . TRP A 1 65  ? -5.393  109.079 36.896  1.00 70.92  ? 43   TRP A N   1 
ATOM   2     C  CA  . TRP A 1 65  ? -6.611  109.115 37.785  1.00 75.95  ? 43   TRP A CA  1 
ATOM   3     C  C   . TRP A 1 65  ? -7.763  108.307 37.228  1.00 76.99  ? 43   TRP A C   1 
ATOM   4     O  O   . TRP A 1 65  ? -8.213  108.538 36.100  1.00 78.21  ? 43   TRP A O   1 
ATOM   5     C  CB  . TRP A 1 65  ? -7.133  110.559 37.981  1.00 74.80  ? 43   TRP A CB  1 
ATOM   6     C  CG  . TRP A 1 65  ? -8.103  110.747 39.193  1.00 79.67  ? 43   TRP A CG  1 
ATOM   7     C  CD1 . TRP A 1 65  ? -7.802  110.497 40.500  1.00 78.26  ? 43   TRP A CD1 1 
ATOM   8     C  CD2 . TRP A 1 65  ? -9.475  111.222 39.187  1.00 81.84  ? 43   TRP A CD2 1 
ATOM   9     N  NE1 . TRP A 1 65  ? -8.879  110.777 41.311  1.00 77.07  ? 43   TRP A NE1 1 
ATOM   10    C  CE2 . TRP A 1 65  ? -9.917  111.232 40.539  1.00 81.61  ? 43   TRP A CE2 1 
ATOM   11    C  CE3 . TRP A 1 65  ? -10.365 111.640 38.183  1.00 82.10  ? 43   TRP A CE3 1 
ATOM   12    C  CZ2 . TRP A 1 65  ? -11.208 111.646 40.909  1.00 78.70  ? 43   TRP A CZ2 1 
ATOM   13    C  CZ3 . TRP A 1 65  ? -11.661 112.055 38.557  1.00 80.75  ? 43   TRP A CZ3 1 
ATOM   14    C  CH2 . TRP A 1 65  ? -12.060 112.057 39.906  1.00 80.39  ? 43   TRP A CH2 1 
ATOM   15    N  N   . ILE A 1 66  ? -8.202  107.297 37.959  1.00 77.92  ? 44   ILE A N   1 
ATOM   16    C  CA  . ILE A 1 66  ? -9.434  106.663 37.514  1.00 77.46  ? 44   ILE A CA  1 
ATOM   17    C  C   . ILE A 1 66  ? -10.090 107.204 38.735  1.00 76.90  ? 44   ILE A C   1 
ATOM   18    O  O   . ILE A 1 66  ? -9.511  108.082 39.382  1.00 73.51  ? 44   ILE A O   1 
ATOM   19    C  CB  . ILE A 1 66  ? -9.409  105.108 37.457  1.00 77.50  ? 44   ILE A CB  1 
ATOM   20    C  CG1 . ILE A 1 66  ? -9.413  104.681 35.987  1.00 77.42  ? 44   ILE A CG1 1 
ATOM   21    C  CG2 . ILE A 1 66  ? -10.694 104.511 38.001  1.00 70.22  ? 44   ILE A CG2 1 
ATOM   22    C  CD1 . ILE A 1 66  ? -9.374  105.824 34.944  1.00 68.61  ? 44   ILE A CD1 1 
ATOM   23    N  N   . ARG A 1 67  ? -11.253 106.740 39.119  1.00 76.53  ? 45   ARG A N   1 
ATOM   24    C  CA  . ARG A 1 67  ? -11.750 107.356 40.314  1.00 75.75  ? 45   ARG A CA  1 
ATOM   25    C  C   . ARG A 1 67  ? -12.350 106.419 41.359  1.00 74.05  ? 45   ARG A C   1 
ATOM   26    O  O   . ARG A 1 67  ? -12.642 105.262 41.084  1.00 73.51  ? 45   ARG A O   1 
ATOM   27    C  CB  . ARG A 1 67  ? -12.774 108.403 39.935  1.00 76.04  ? 45   ARG A CB  1 
ATOM   28    C  CG  . ARG A 1 67  ? -13.910 107.765 39.243  1.00 81.06  ? 45   ARG A CG  1 
ATOM   29    C  CD  . ARG A 1 67  ? -14.741 108.776 38.560  1.00 85.28  ? 45   ARG A CD  1 
ATOM   30    N  NE  . ARG A 1 67  ? -15.962 108.183 38.038  1.00 83.32  ? 45   ARG A NE  1 
ATOM   31    C  CZ  . ARG A 1 67  ? -16.865 108.853 37.331  1.00 79.95  ? 45   ARG A CZ  1 
ATOM   32    N  NH1 . ARG A 1 67  ? -16.675 110.142 37.065  1.00 72.56  ? 45   ARG A NH1 1 
ATOM   33    N  NH2 . ARG A 1 67  ? -17.955 108.236 36.889  1.00 77.43  ? 45   ARG A NH2 1 
ATOM   34    N  N   . PRO A 1 68  ? -12.504 106.953 42.584  1.00 70.43  ? 46   PRO A N   1 
ATOM   35    C  CA  . PRO A 1 68  ? -13.070 106.293 43.760  1.00 67.61  ? 46   PRO A CA  1 
ATOM   36    C  C   . PRO A 1 68  ? -14.389 105.532 43.502  1.00 62.91  ? 46   PRO A C   1 
ATOM   37    O  O   . PRO A 1 68  ? -14.590 104.438 44.027  1.00 58.18  ? 46   PRO A O   1 
ATOM   38    C  CB  . PRO A 1 68  ? -13.259 107.471 44.737  1.00 65.65  ? 46   PRO A CB  1 
ATOM   39    C  CG  . PRO A 1 68  ? -11.989 108.219 44.561  1.00 68.25  ? 46   PRO A CG  1 
ATOM   40    C  CD  . PRO A 1 68  ? -11.763 108.175 43.019  1.00 69.31  ? 46   PRO A CD  1 
ATOM   41    N  N   . ASP A 1 69  ? -15.260 106.070 42.653  1.00 61.94  ? 47   ASP A N   1 
ATOM   42    C  CA  . ASP A 1 69  ? -16.560 105.419 42.412  1.00 61.30  ? 47   ASP A CA  1 
ATOM   43    C  C   . ASP A 1 69  ? -16.793 104.447 41.257  1.00 60.29  ? 47   ASP A C   1 
ATOM   44    O  O   . ASP A 1 69  ? -17.917 103.957 41.088  1.00 59.20  ? 47   ASP A O   1 
ATOM   45    C  CB  . ASP A 1 69  ? -17.660 106.474 42.359  1.00 61.31  ? 47   ASP A CB  1 
ATOM   46    C  CG  . ASP A 1 69  ? -17.275 107.649 41.513  1.00 56.08  ? 47   ASP A CG  1 
ATOM   47    O  OD1 . ASP A 1 69  ? -16.296 108.318 41.884  1.00 51.30  ? 47   ASP A OD1 1 
ATOM   48    O  OD2 . ASP A 1 69  ? -17.927 107.887 40.474  1.00 59.03  ? 47   ASP A OD2 1 
ATOM   49    N  N   . ALA A 1 70  ? -15.780 104.180 40.443  1.00 59.21  ? 48   ALA A N   1 
ATOM   50    C  CA  . ALA A 1 70  ? -15.974 103.246 39.341  1.00 58.50  ? 48   ALA A CA  1 
ATOM   51    C  C   . ALA A 1 70  ? -16.519 101.969 39.961  1.00 59.37  ? 48   ALA A C   1 
ATOM   52    O  O   . ALA A 1 70  ? -16.077 101.563 41.037  1.00 58.80  ? 48   ALA A O   1 
ATOM   53    C  CB  . ALA A 1 70  ? -14.653 102.966 38.646  1.00 58.61  ? 48   ALA A CB  1 
ATOM   54    N  N   . PRO A 1 71  ? -17.507 101.330 39.313  1.00 59.06  ? 49   PRO A N   1 
ATOM   55    C  CA  . PRO A 1 71  ? -18.066 100.092 39.862  1.00 56.10  ? 49   PRO A CA  1 
ATOM   56    C  C   . PRO A 1 71  ? -17.016 98.978  39.870  1.00 52.03  ? 49   PRO A C   1 
ATOM   57    O  O   . PRO A 1 71  ? -16.242 98.838  38.928  1.00 48.23  ? 49   PRO A O   1 
ATOM   58    C  CB  . PRO A 1 71  ? -19.235 99.801  38.921  1.00 53.85  ? 49   PRO A CB  1 
ATOM   59    C  CG  . PRO A 1 71  ? -18.736 100.321 37.619  1.00 55.39  ? 49   PRO A CG  1 
ATOM   60    C  CD  . PRO A 1 71  ? -18.139 101.655 38.024  1.00 60.16  ? 49   PRO A CD  1 
ATOM   61    N  N   . SER A 1 72  ? -16.987 98.200  40.944  1.00 51.87  ? 50   SER A N   1 
ATOM   62    C  CA  . SER A 1 72  ? -16.034 97.111  41.071  1.00 53.27  ? 50   SER A CA  1 
ATOM   63    C  C   . SER A 1 72  ? -16.282 96.047  39.996  1.00 52.88  ? 50   SER A C   1 
ATOM   64    O  O   . SER A 1 72  ? -17.435 95.725  39.704  1.00 52.59  ? 50   SER A O   1 
ATOM   65    C  CB  . SER A 1 72  ? -16.165 96.502  42.466  1.00 58.43  ? 50   SER A CB  1 
ATOM   66    O  OG  . SER A 1 72  ? -15.457 95.281  42.580  1.00 63.61  ? 50   SER A OG  1 
ATOM   67    N  N   . ARG A 1 73  ? -15.207 95.522  39.399  1.00 49.51  ? 51   ARG A N   1 
ATOM   68    C  CA  . ARG A 1 73  ? -15.308 94.476  38.377  1.00 43.74  ? 51   ARG A CA  1 
ATOM   69    C  C   . ARG A 1 73  ? -14.971 93.090  38.944  1.00 40.32  ? 51   ARG A C   1 
ATOM   70    O  O   . ARG A 1 73  ? -14.862 92.117  38.195  1.00 40.42  ? 51   ARG A O   1 
ATOM   71    C  CB  . ARG A 1 73  ? -14.372 94.763  37.189  1.00 47.99  ? 51   ARG A CB  1 
ATOM   72    C  CG  . ARG A 1 73  ? -14.775 95.936  36.301  1.00 31.88  ? 51   ARG A CG  1 
ATOM   73    C  CD  . ARG A 1 73  ? -13.778 97.072  36.442  1.00 42.04  ? 51   ARG A CD  1 
ATOM   74    N  NE  . ARG A 1 73  ? -12.417 96.644  36.116  1.00 39.54  ? 51   ARG A NE  1 
ATOM   75    C  CZ  . ARG A 1 73  ? -11.328 97.356  36.374  1.00 33.10  ? 51   ARG A CZ  1 
ATOM   76    N  NH1 . ARG A 1 73  ? -11.432 98.533  36.965  1.00 44.23  ? 51   ARG A NH1 1 
ATOM   77    N  NH2 . ARG A 1 73  ? -10.136 96.900  36.035  1.00 34.79  ? 51   ARG A NH2 1 
ATOM   78    N  N   . CYS A 1 74  ? -14.799 93.004  40.264  1.00 37.93  ? 52   CYS A N   1 
ATOM   79    C  CA  . CYS A 1 74  ? -14.481 91.737  40.931  1.00 33.51  ? 52   CYS A CA  1 
ATOM   80    C  C   . CYS A 1 74  ? -15.537 90.684  40.599  1.00 36.76  ? 52   CYS A C   1 
ATOM   81    O  O   . CYS A 1 74  ? -16.722 90.997  40.573  1.00 41.88  ? 52   CYS A O   1 
ATOM   82    C  CB  . CYS A 1 74  ? -14.426 91.945  42.446  1.00 32.74  ? 52   CYS A CB  1 
ATOM   83    S  SG  . CYS A 1 74  ? -13.928 90.476  43.389  1.00 37.92  ? 52   CYS A SG  1 
ATOM   84    N  N   . THR A 1 75  ? -15.125 89.439  40.368  1.00 34.56  ? 53   THR A N   1 
ATOM   85    C  CA  . THR A 1 75  ? -16.089 88.402  40.020  1.00 38.11  ? 53   THR A CA  1 
ATOM   86    C  C   . THR A 1 75  ? -16.451 87.412  41.130  1.00 37.80  ? 53   THR A C   1 
ATOM   87    O  O   . THR A 1 75  ? -17.091 86.387  40.866  1.00 42.21  ? 53   THR A O   1 
ATOM   88    C  CB  . THR A 1 75  ? -15.631 87.624  38.760  1.00 39.35  ? 53   THR A CB  1 
ATOM   89    O  OG1 . THR A 1 75  ? -14.309 87.107  38.953  1.00 44.01  ? 53   THR A OG1 1 
ATOM   90    C  CG2 . THR A 1 75  ? -15.624 88.550  37.564  1.00 41.30  ? 53   THR A CG2 1 
ATOM   91    N  N   . TRP A 1 76  ? -16.056 87.725  42.362  1.00 25.07  ? 54   TRP A N   1 
ATOM   92    C  CA  . TRP A 1 76  ? -16.361 86.890  43.521  1.00 22.67  ? 54   TRP A CA  1 
ATOM   93    C  C   . TRP A 1 76  ? -17.872 86.741  43.650  1.00 30.63  ? 54   TRP A C   1 
ATOM   94    O  O   . TRP A 1 76  ? -18.626 87.664  43.311  1.00 32.65  ? 54   TRP A O   1 
ATOM   95    C  CB  . TRP A 1 76  ? -15.833 87.556  44.797  1.00 24.51  ? 54   TRP A CB  1 
ATOM   96    C  CG  . TRP A 1 76  ? -16.212 86.877  46.095  1.00 17.32  ? 54   TRP A CG  1 
ATOM   97    C  CD1 . TRP A 1 76  ? -15.491 85.942  46.776  1.00 19.34  ? 54   TRP A CD1 1 
ATOM   98    C  CD2 . TRP A 1 76  ? -17.419 87.067  46.838  1.00 16.49  ? 54   TRP A CD2 1 
ATOM   99    N  NE1 . TRP A 1 76  ? -16.171 85.533  47.898  1.00 7.79   ? 54   TRP A NE1 1 
ATOM   100   C  CE2 . TRP A 1 76  ? -17.358 86.206  47.962  1.00 11.32  ? 54   TRP A CE2 1 
ATOM   101   C  CE3 . TRP A 1 76  ? -18.550 87.877  46.662  1.00 9.89   ? 54   TRP A CE3 1 
ATOM   102   C  CZ2 . TRP A 1 76  ? -18.382 86.129  48.906  1.00 17.51  ? 54   TRP A CZ2 1 
ATOM   103   C  CZ3 . TRP A 1 76  ? -19.574 87.798  47.601  1.00 25.97  ? 54   TRP A CZ3 1 
ATOM   104   C  CH2 . TRP A 1 76  ? -19.480 86.926  48.713  1.00 23.96  ? 54   TRP A CH2 1 
ATOM   105   N  N   . GLN A 1 77  ? -18.307 85.581  44.140  1.00 33.88  ? 55   GLN A N   1 
ATOM   106   C  CA  . GLN A 1 77  ? -19.724 85.291  44.356  1.00 36.97  ? 55   GLN A CA  1 
ATOM   107   C  C   . GLN A 1 77  ? -19.737 84.268  45.459  1.00 36.63  ? 55   GLN A C   1 
ATOM   108   O  O   . GLN A 1 77  ? -18.968 83.301  45.405  1.00 28.95  ? 55   GLN A O   1 
ATOM   109   C  CB  . GLN A 1 77  ? -20.382 84.695  43.107  1.00 44.54  ? 55   GLN A CB  1 
ATOM   110   C  CG  . GLN A 1 77  ? -20.398 85.616  41.881  1.00 60.47  ? 55   GLN A CG  1 
ATOM   111   C  CD  . GLN A 1 77  ? -21.289 85.093  40.754  1.00 68.38  ? 55   GLN A CD  1 
ATOM   112   O  OE1 . GLN A 1 77  ? -22.515 85.017  40.901  1.00 71.18  ? 55   GLN A OE1 1 
ATOM   113   N  NE2 . GLN A 1 77  ? -20.673 84.728  39.626  1.00 64.97  ? 55   GLN A NE2 1 
ATOM   114   N  N   . LEU A 1 78  ? -20.580 84.484  46.469  1.00 38.49  ? 56   LEU A N   1 
ATOM   115   C  CA  . LEU A 1 78  ? -20.654 83.539  47.582  1.00 42.92  ? 56   LEU A CA  1 
ATOM   116   C  C   . LEU A 1 78  ? -20.937 82.138  47.049  1.00 45.45  ? 56   LEU A C   1 
ATOM   117   O  O   . LEU A 1 78  ? -21.736 81.967  46.126  1.00 54.05  ? 56   LEU A O   1 
ATOM   118   C  CB  . LEU A 1 78  ? -21.747 83.945  48.574  1.00 37.62  ? 56   LEU A CB  1 
ATOM   119   C  CG  . LEU A 1 78  ? -21.975 82.971  49.739  1.00 36.06  ? 56   LEU A CG  1 
ATOM   120   C  CD1 . LEU A 1 78  ? -20.666 82.694  50.442  1.00 29.17  ? 56   LEU A CD1 1 
ATOM   121   C  CD2 . LEU A 1 78  ? -23.003 83.552  50.709  1.00 30.14  ? 56   LEU A CD2 1 
ATOM   122   N  N   . GLY A 1 79  ? -20.277 81.138  47.620  1.00 41.82  ? 57   GLY A N   1 
ATOM   123   C  CA  . GLY A 1 79  ? -20.481 79.774  47.168  1.00 43.84  ? 57   GLY A CA  1 
ATOM   124   C  C   . GLY A 1 79  ? -19.434 79.343  46.161  1.00 45.40  ? 57   GLY A C   1 
ATOM   125   O  O   . GLY A 1 79  ? -19.300 78.158  45.858  1.00 45.62  ? 57   GLY A O   1 
ATOM   126   N  N   . ARG A 1 80  ? -18.687 80.312  45.643  1.00 43.90  ? 58   ARG A N   1 
ATOM   127   C  CA  . ARG A 1 80  ? -17.634 80.035  44.670  1.00 45.15  ? 58   ARG A CA  1 
ATOM   128   C  C   . ARG A 1 80  ? -16.339 79.664  45.413  1.00 41.20  ? 58   ARG A C   1 
ATOM   129   O  O   . ARG A 1 80  ? -15.931 80.362  46.328  1.00 40.68  ? 58   ARG A O   1 
ATOM   130   C  CB  . ARG A 1 80  ? -17.433 81.267  43.797  1.00 45.13  ? 58   ARG A CB  1 
ATOM   131   C  CG  . ARG A 1 80  ? -16.630 80.997  42.573  1.00 50.53  ? 58   ARG A CG  1 
ATOM   132   C  CD  . ARG A 1 80  ? -16.556 82.211  41.662  1.00 52.17  ? 58   ARG A CD  1 
ATOM   133   N  NE  . ARG A 1 80  ? -15.507 82.000  40.667  1.00 57.95  ? 58   ARG A NE  1 
ATOM   134   C  CZ  . ARG A 1 80  ? -15.338 82.726  39.570  1.00 54.19  ? 58   ARG A CZ  1 
ATOM   135   N  NH1 . ARG A 1 80  ? -14.344 82.433  38.741  1.00 57.86  ? 58   ARG A NH1 1 
ATOM   136   N  NH2 . ARG A 1 80  ? -16.163 83.728  39.300  1.00 54.49  ? 58   ARG A NH2 1 
ATOM   137   N  N   . PRO A 1 81  ? -15.681 78.560  45.021  1.00 43.25  ? 59   PRO A N   1 
ATOM   138   C  CA  . PRO A 1 81  ? -14.441 78.082  45.653  1.00 45.43  ? 59   PRO A CA  1 
ATOM   139   C  C   . PRO A 1 81  ? -13.341 79.138  45.786  1.00 47.17  ? 59   PRO A C   1 
ATOM   140   O  O   . PRO A 1 81  ? -13.206 80.005  44.920  1.00 50.05  ? 59   PRO A O   1 
ATOM   141   C  CB  . PRO A 1 81  ? -14.013 76.919  44.754  1.00 46.05  ? 59   PRO A CB  1 
ATOM   142   C  CG  . PRO A 1 81  ? -15.310 76.437  44.187  1.00 51.66  ? 59   PRO A CG  1 
ATOM   143   C  CD  . PRO A 1 81  ? -16.018 77.727  43.857  1.00 42.93  ? 59   PRO A CD  1 
ATOM   144   N  N   . ALA A 1 82  ? -12.564 79.059  46.871  1.00 40.17  ? 60   ALA A N   1 
ATOM   145   C  CA  . ALA A 1 82  ? -11.476 80.000  47.105  1.00 36.59  ? 60   ALA A CA  1 
ATOM   146   C  C   . ALA A 1 82  ? -10.343 79.742  46.112  1.00 39.47  ? 60   ALA A C   1 
ATOM   147   O  O   . ALA A 1 82  ? -9.575  80.647  45.788  1.00 36.18  ? 60   ALA A O   1 
ATOM   148   C  CB  . ALA A 1 82  ? -10.965 79.869  48.517  1.00 32.93  ? 60   ALA A CB  1 
ATOM   149   N  N   . SER A 1 83  ? -10.250 78.507  45.627  1.00 38.79  ? 61   SER A N   1 
ATOM   150   C  CA  . SER A 1 83  ? -9.219  78.116  44.663  1.00 34.18  ? 61   SER A CA  1 
ATOM   151   C  C   . SER A 1 83  ? -9.331  78.949  43.397  1.00 32.75  ? 61   SER A C   1 
ATOM   152   O  O   . SER A 1 83  ? -8.378  79.067  42.624  1.00 29.29  ? 61   SER A O   1 
ATOM   153   C  CB  . SER A 1 83  ? -9.366  76.628  44.308  1.00 31.64  ? 61   SER A CB  1 
ATOM   154   O  OG  . SER A 1 83  ? -10.694 76.317  43.891  1.00 26.47  ? 61   SER A OG  1 
ATOM   155   N  N   . GLU A 1 84  ? -10.502 79.537  43.194  1.00 33.47  ? 62   GLU A N   1 
ATOM   156   C  CA  . GLU A 1 84  ? -10.743 80.342  42.007  1.00 37.10  ? 62   GLU A CA  1 
ATOM   157   C  C   . GLU A 1 84  ? -10.385 81.818  42.136  1.00 35.99  ? 62   GLU A C   1 
ATOM   158   O  O   . GLU A 1 84  ? -10.569 82.581  41.196  1.00 41.81  ? 62   GLU A O   1 
ATOM   159   C  CB  . GLU A 1 84  ? -12.201 80.195  41.576  1.00 37.08  ? 62   GLU A CB  1 
ATOM   160   C  CG  . GLU A 1 84  ? -12.502 78.851  40.968  1.00 32.66  ? 62   GLU A CG  1 
ATOM   161   C  CD  . GLU A 1 84  ? -13.939 78.738  40.542  1.00 47.41  ? 62   GLU A CD  1 
ATOM   162   O  OE1 . GLU A 1 84  ? -14.458 79.713  39.949  1.00 49.52  ? 62   GLU A OE1 1 
ATOM   163   O  OE2 . GLU A 1 84  ? -14.550 77.674  40.789  1.00 51.56  ? 62   GLU A OE2 1 
ATOM   164   N  N   . SER A 1 85  ? -9.873  82.227  43.288  1.00 32.68  ? 63   SER A N   1 
ATOM   165   C  CA  . SER A 1 85  ? -9.492  83.617  43.460  1.00 27.31  ? 63   SER A CA  1 
ATOM   166   C  C   . SER A 1 85  ? -8.206  83.849  42.709  1.00 25.13  ? 63   SER A C   1 
ATOM   167   O  O   . SER A 1 85  ? -7.330  83.002  42.732  1.00 26.77  ? 63   SER A O   1 
ATOM   168   C  CB  . SER A 1 85  ? -9.255  83.942  44.932  1.00 26.71  ? 63   SER A CB  1 
ATOM   169   O  OG  . SER A 1 85  ? -8.454  85.109  45.053  1.00 20.64  ? 63   SER A OG  1 
ATOM   170   N  N   . PRO A 1 86  ? -8.086  84.993  42.015  1.00 30.93  ? 64   PRO A N   1 
ATOM   171   C  CA  . PRO A 1 86  ? -6.905  85.383  41.244  1.00 32.12  ? 64   PRO A CA  1 
ATOM   172   C  C   . PRO A 1 86  ? -6.050  86.283  42.131  1.00 37.77  ? 64   PRO A C   1 
ATOM   173   O  O   . PRO A 1 86  ? -5.082  86.882  41.678  1.00 39.74  ? 64   PRO A O   1 
ATOM   174   C  CB  . PRO A 1 86  ? -7.510  86.167  40.094  1.00 36.89  ? 64   PRO A CB  1 
ATOM   175   C  CG  . PRO A 1 86  ? -8.554  86.957  40.810  1.00 38.14  ? 64   PRO A CG  1 
ATOM   176   C  CD  . PRO A 1 86  ? -9.210  85.882  41.682  1.00 32.96  ? 64   PRO A CD  1 
ATOM   177   N  N   . HIS A 1 87  ? -6.430  86.378  43.399  1.00 42.48  ? 65   HIS A N   1 
ATOM   178   C  CA  . HIS A 1 87  ? -5.726  87.223  44.353  1.00 47.98  ? 65   HIS A CA  1 
ATOM   179   C  C   . HIS A 1 87  ? -4.672  86.507  45.189  1.00 53.92  ? 65   HIS A C   1 
ATOM   180   O  O   . HIS A 1 87  ? -4.723  85.287  45.384  1.00 56.59  ? 65   HIS A O   1 
ATOM   181   C  CB  . HIS A 1 87  ? -6.735  87.880  45.296  1.00 43.95  ? 65   HIS A CB  1 
ATOM   182   C  CG  . HIS A 1 87  ? -7.719  88.763  44.600  1.00 41.53  ? 65   HIS A CG  1 
ATOM   183   N  ND1 . HIS A 1 87  ? -7.343  89.896  43.913  1.00 32.10  ? 65   HIS A ND1 1 
ATOM   184   C  CD2 . HIS A 1 87  ? -9.063  88.673  44.473  1.00 37.33  ? 65   HIS A CD2 1 
ATOM   185   C  CE1 . HIS A 1 87  ? -8.414  90.466  43.393  1.00 32.41  ? 65   HIS A CE1 1 
ATOM   186   N  NE2 . HIS A 1 87  ? -9.470  89.745  43.718  1.00 30.35  ? 65   HIS A NE2 1 
ATOM   187   N  N   . HIS A 1 88  ? -3.707  87.282  45.678  1.00 53.77  ? 66   HIS A N   1 
ATOM   188   C  CA  . HIS A 1 88  ? -2.674  86.726  46.531  1.00 51.52  ? 66   HIS A CA  1 
ATOM   189   C  C   . HIS A 1 88  ? -3.265  86.796  47.927  1.00 49.33  ? 66   HIS A C   1 
ATOM   190   O  O   . HIS A 1 88  ? -3.563  87.883  48.420  1.00 41.11  ? 66   HIS A O   1 
ATOM   191   C  CB  . HIS A 1 88  ? -1.393  87.558  46.493  1.00 53.34  ? 66   HIS A CB  1 
ATOM   192   C  CG  . HIS A 1 88  ? -0.318  87.028  47.392  1.00 59.47  ? 66   HIS A CG  1 
ATOM   193   N  ND1 . HIS A 1 88  ? 0.413   87.832  48.238  1.00 63.32  ? 66   HIS A ND1 1 
ATOM   194   C  CD2 . HIS A 1 88  ? 0.122   85.764  47.604  1.00 62.99  ? 66   HIS A CD2 1 
ATOM   195   C  CE1 . HIS A 1 88  ? 1.253   87.087  48.936  1.00 63.18  ? 66   HIS A CE1 1 
ATOM   196   N  NE2 . HIS A 1 88  ? 1.096   85.828  48.570  1.00 63.53  ? 66   HIS A NE2 1 
ATOM   197   N  N   . HIS A 1 89  ? -3.439  85.637  48.554  1.00 47.74  ? 67   HIS A N   1 
ATOM   198   C  CA  . HIS A 1 89  ? -4.014  85.578  49.885  1.00 44.01  ? 67   HIS A CA  1 
ATOM   199   C  C   . HIS A 1 89  ? -3.025  85.256  50.988  1.00 46.09  ? 67   HIS A C   1 
ATOM   200   O  O   . HIS A 1 89  ? -2.131  84.427  50.832  1.00 47.59  ? 67   HIS A O   1 
ATOM   201   C  CB  . HIS A 1 89  ? -5.177  84.592  49.894  1.00 39.43  ? 67   HIS A CB  1 
ATOM   202   C  CG  . HIS A 1 89  ? -6.373  85.083  49.138  1.00 38.11  ? 67   HIS A CG  1 
ATOM   203   N  ND1 . HIS A 1 89  ? -7.164  86.116  49.588  1.00 27.92  ? 67   HIS A ND1 1 
ATOM   204   C  CD2 . HIS A 1 89  ? -6.884  84.713  47.940  1.00 41.09  ? 67   HIS A CD2 1 
ATOM   205   C  CE1 . HIS A 1 89  ? -8.110  86.363  48.701  1.00 29.12  ? 67   HIS A CE1 1 
ATOM   206   N  NE2 . HIS A 1 89  ? -7.964  85.524  47.692  1.00 34.52  ? 67   HIS A NE2 1 
ATOM   207   N  N   . THR A 1 90  ? -3.211  85.935  52.111  1.00 49.02  ? 68   THR A N   1 
ATOM   208   C  CA  . THR A 1 90  ? -2.352  85.796  53.275  1.00 49.66  ? 68   THR A CA  1 
ATOM   209   C  C   . THR A 1 90  ? -3.092  85.198  54.461  1.00 45.99  ? 68   THR A C   1 
ATOM   210   O  O   . THR A 1 90  ? -4.310  85.328  54.578  1.00 45.44  ? 68   THR A O   1 
ATOM   211   C  CB  . THR A 1 90  ? -1.768  87.182  53.651  1.00 55.07  ? 68   THR A CB  1 
ATOM   212   O  OG1 . THR A 1 90  ? -0.641  87.454  52.810  1.00 59.16  ? 68   THR A OG1 1 
ATOM   213   C  CG2 . THR A 1 90  ? -1.351  87.244  55.107  1.00 49.58  ? 68   THR A CG2 1 
ATOM   214   N  N   . ALA A 1 91  ? -2.343  84.530  55.332  1.00 39.92  ? 69   ALA A N   1 
ATOM   215   C  CA  . ALA A 1 91  ? -2.917  83.912  56.518  1.00 39.05  ? 69   ALA A CA  1 
ATOM   216   C  C   . ALA A 1 91  ? -2.579  84.728  57.771  1.00 37.48  ? 69   ALA A C   1 
ATOM   217   O  O   . ALA A 1 91  ? -1.559  85.418  57.823  1.00 29.58  ? 69   ALA A O   1 
ATOM   218   C  CB  . ALA A 1 91  ? -2.393  82.488  56.657  1.00 42.22  ? 69   ALA A CB  1 
ATOM   219   N  N   . PRO A 1 92  ? -3.444  84.680  58.790  1.00 35.33  ? 70   PRO A N   1 
ATOM   220   C  CA  . PRO A 1 92  ? -3.146  85.441  60.006  1.00 40.65  ? 70   PRO A CA  1 
ATOM   221   C  C   . PRO A 1 92  ? -1.794  85.036  60.607  1.00 39.11  ? 70   PRO A C   1 
ATOM   222   O  O   . PRO A 1 92  ? -1.258  83.965  60.304  1.00 37.91  ? 70   PRO A O   1 
ATOM   223   C  CB  . PRO A 1 92  ? -4.317  85.092  60.924  1.00 38.45  ? 70   PRO A CB  1 
ATOM   224   C  CG  . PRO A 1 92  ? -5.442  84.914  59.956  1.00 45.02  ? 70   PRO A CG  1 
ATOM   225   C  CD  . PRO A 1 92  ? -4.800  84.111  58.844  1.00 38.57  ? 70   PRO A CD  1 
ATOM   226   N  N   . ALA A 1 93  ? -1.246  85.901  61.451  1.00 40.31  ? 71   ALA A N   1 
ATOM   227   C  CA  . ALA A 1 93  ? 0.027   85.629  62.105  1.00 48.43  ? 71   ALA A CA  1 
ATOM   228   C  C   . ALA A 1 93  ? -0.086  86.006  63.576  1.00 52.19  ? 71   ALA A C   1 
ATOM   229   O  O   . ALA A 1 93  ? -0.672  87.038  63.909  1.00 55.26  ? 71   ALA A O   1 
ATOM   230   C  CB  . ALA A 1 93  ? 1.132   86.430  61.447  1.00 47.67  ? 71   ALA A CB  1 
ATOM   231   N  N   . LYS A 1 94  ? 0.451   85.165  64.458  1.00 55.28  ? 72   LYS A N   1 
ATOM   232   C  CA  . LYS A 1 94  ? 0.406   85.454  65.886  1.00 56.27  ? 72   LYS A CA  1 
ATOM   233   C  C   . LYS A 1 94  ? 1.674   86.182  66.305  1.00 57.31  ? 72   LYS A C   1 
ATOM   234   O  O   . LYS A 1 94  ? 2.737   85.995  65.701  1.00 54.36  ? 72   LYS A O   1 
ATOM   235   C  CB  . LYS A 1 94  ? 0.253   84.170  66.702  1.00 59.31  ? 72   LYS A CB  1 
ATOM   236   C  CG  . LYS A 1 94  ? -1.182  83.663  66.822  1.00 66.87  ? 72   LYS A CG  1 
ATOM   237   C  CD  . LYS A 1 94  ? -1.293  82.566  67.878  1.00 71.97  ? 72   LYS A CD  1 
ATOM   238   C  CE  . LYS A 1 94  ? -2.732  82.128  68.110  1.00 73.52  ? 72   LYS A CE  1 
ATOM   239   N  NZ  . LYS A 1 94  ? -3.309  81.421  66.935  1.00 77.82  ? 72   LYS A NZ  1 
ATOM   240   N  N   . SER A 1 95  ? 1.549   87.018  67.335  1.00 55.03  ? 73   SER A N   1 
ATOM   241   C  CA  . SER A 1 95  ? 2.670   87.796  67.852  1.00 49.37  ? 73   SER A CA  1 
ATOM   242   C  C   . SER A 1 95  ? 3.802   86.925  68.390  1.00 48.96  ? 73   SER A C   1 
ATOM   243   O  O   . SER A 1 95  ? 3.588   86.042  69.224  1.00 43.00  ? 73   SER A O   1 
ATOM   244   C  CB  . SER A 1 95  ? 2.190   88.741  68.953  1.00 49.04  ? 73   SER A CB  1 
ATOM   245   O  OG  . SER A 1 95  ? 3.281   89.166  69.757  1.00 58.37  ? 73   SER A OG  1 
ATOM   246   N  N   . PRO A 1 96  ? 5.034   87.176  67.920  1.00 50.41  ? 74   PRO A N   1 
ATOM   247   C  CA  . PRO A 1 96  ? 6.216   86.418  68.347  1.00 47.24  ? 74   PRO A CA  1 
ATOM   248   C  C   . PRO A 1 96  ? 6.754   86.899  69.692  1.00 45.30  ? 74   PRO A C   1 
ATOM   249   O  O   . PRO A 1 96  ? 6.296   87.921  70.218  1.00 43.51  ? 74   PRO A O   1 
ATOM   250   C  CB  . PRO A 1 96  ? 7.198   86.664  67.205  1.00 48.84  ? 74   PRO A CB  1 
ATOM   251   C  CG  . PRO A 1 96  ? 6.887   88.088  66.825  1.00 44.52  ? 74   PRO A CG  1 
ATOM   252   C  CD  . PRO A 1 96  ? 5.372   88.113  66.829  1.00 47.89  ? 74   PRO A CD  1 
ATOM   253   N  N   . LYS A 1 97  ? 7.720   86.158  70.238  1.00 40.93  ? 75   LYS A N   1 
ATOM   254   C  CA  . LYS A 1 97  ? 8.353   86.501  71.515  1.00 31.87  ? 75   LYS A CA  1 
ATOM   255   C  C   . LYS A 1 97  ? 8.873   87.930  71.432  1.00 28.14  ? 75   LYS A C   1 
ATOM   256   O  O   . LYS A 1 97  ? 8.382   88.824  72.108  1.00 31.20  ? 75   LYS A O   1 
ATOM   257   C  CB  . LYS A 1 97  ? 9.547   85.576  71.793  1.00 37.63  ? 75   LYS A CB  1 
ATOM   258   C  CG  . LYS A 1 97  ? 9.393   84.606  72.956  1.00 32.11  ? 75   LYS A CG  1 
ATOM   259   C  CD  . LYS A 1 97  ? 10.754  84.045  73.344  1.00 30.62  ? 75   LYS A CD  1 
ATOM   260   C  CE  . LYS A 1 97  ? 10.642  82.774  74.175  1.00 35.98  ? 75   LYS A CE  1 
ATOM   261   N  NZ  . LYS A 1 97  ? 10.496  81.563  73.334  1.00 38.50  ? 75   LYS A NZ  1 
ATOM   262   N  N   . ILE A 1 98  ? 9.879   88.123  70.586  1.00 29.15  ? 76   ILE A N   1 
ATOM   263   C  CA  . ILE A 1 98  ? 10.504  89.417  70.382  1.00 26.11  ? 76   ILE A CA  1 
ATOM   264   C  C   . ILE A 1 98  ? 10.092  89.874  68.998  1.00 28.09  ? 76   ILE A C   1 
ATOM   265   O  O   . ILE A 1 98  ? 10.250  89.141  68.035  1.00 32.30  ? 76   ILE A O   1 
ATOM   266   C  CB  . ILE A 1 98  ? 12.057  89.289  70.444  1.00 32.50  ? 76   ILE A CB  1 
ATOM   267   C  CG1 . ILE A 1 98  ? 12.506  89.046  71.893  1.00 21.60  ? 76   ILE A CG1 1 
ATOM   268   C  CG2 . ILE A 1 98  ? 12.722  90.521  69.839  1.00 26.95  ? 76   ILE A CG2 1 
ATOM   269   C  CD1 . ILE A 1 98  ? 14.001  88.871  72.063  1.00 8.98   ? 76   ILE A CD1 1 
ATOM   270   N  N   . LEU A 1 99  ? 9.559   91.082  68.897  1.00 25.15  ? 77   LEU A N   1 
ATOM   271   C  CA  . LEU A 1 99  ? 9.141   91.613  67.605  1.00 20.83  ? 77   LEU A CA  1 
ATOM   272   C  C   . LEU A 1 99  ? 10.287  92.290  66.837  1.00 18.37  ? 77   LEU A C   1 
ATOM   273   O  O   . LEU A 1 99  ? 10.941  93.176  67.363  1.00 20.79  ? 77   LEU A O   1 
ATOM   274   C  CB  . LEU A 1 99  ? 7.997   92.618  67.806  1.00 17.37  ? 77   LEU A CB  1 
ATOM   275   C  CG  . LEU A 1 99  ? 6.630   92.030  68.158  1.00 15.15  ? 77   LEU A CG  1 
ATOM   276   C  CD1 . LEU A 1 99  ? 6.715   91.226  69.439  1.00 16.84  ? 77   LEU A CD1 1 
ATOM   277   C  CD2 . LEU A 1 99  ? 5.625   93.160  68.298  1.00 16.09  ? 77   LEU A CD2 1 
ATOM   278   N  N   . PRO A 1 100 ? 10.530  91.889  65.578  1.00 12.15  ? 78   PRO A N   1 
ATOM   279   C  CA  . PRO A 1 100 ? 11.594  92.473  64.752  1.00 14.75  ? 78   PRO A CA  1 
ATOM   280   C  C   . PRO A 1 100 ? 11.433  93.975  64.439  1.00 18.25  ? 78   PRO A C   1 
ATOM   281   O  O   . PRO A 1 100 ? 12.418  94.677  64.175  1.00 22.31  ? 78   PRO A O   1 
ATOM   282   C  CB  . PRO A 1 100 ? 11.593  91.587  63.505  1.00 2.96   ? 78   PRO A CB  1 
ATOM   283   C  CG  . PRO A 1 100 ? 10.234  91.098  63.444  1.00 5.25   ? 78   PRO A CG  1 
ATOM   284   C  CD  . PRO A 1 100 ? 9.877   90.787  64.864  1.00 5.63   ? 78   PRO A CD  1 
ATOM   285   N  N   . ASP A 1 101 ? 10.196  94.459  64.450  1.00 20.73  ? 79   ASP A N   1 
ATOM   286   C  CA  . ASP A 1 101 ? 9.909   95.879  64.237  1.00 21.35  ? 79   ASP A CA  1 
ATOM   287   C  C   . ASP A 1 101 ? 8.472   96.107  64.701  1.00 22.49  ? 79   ASP A C   1 
ATOM   288   O  O   . ASP A 1 101 ? 7.738   95.150  64.935  1.00 23.66  ? 79   ASP A O   1 
ATOM   289   C  CB  . ASP A 1 101 ? 10.134  96.303  62.772  1.00 24.48  ? 79   ASP A CB  1 
ATOM   290   C  CG  . ASP A 1 101 ? 9.087   95.774  61.818  1.00 27.97  ? 79   ASP A CG  1 
ATOM   291   O  OD1 . ASP A 1 101 ? 7.888   96.097  61.982  1.00 35.28  ? 79   ASP A OD1 1 
ATOM   292   O  OD2 . ASP A 1 101 ? 9.478   95.040  60.886  1.00 40.44  ? 79   ASP A OD2 1 
ATOM   293   N  N   . ILE A 1 102 ? 8.067   97.361  64.853  1.00 24.03  ? 80   ILE A N   1 
ATOM   294   C  CA  . ILE A 1 102 ? 6.730   97.657  65.350  1.00 17.34  ? 80   ILE A CA  1 
ATOM   295   C  C   . ILE A 1 102 ? 5.584   97.246  64.449  1.00 20.15  ? 80   ILE A C   1 
ATOM   296   O  O   . ILE A 1 102 ? 4.484   96.973  64.935  1.00 25.07  ? 80   ILE A O   1 
ATOM   297   C  CB  . ILE A 1 102 ? 6.578   99.162  65.682  1.00 12.87  ? 80   ILE A CB  1 
ATOM   298   C  CG1 . ILE A 1 102 ? 5.482   99.348  66.731  1.00 19.41  ? 80   ILE A CG1 1 
ATOM   299   C  CG2 . ILE A 1 102 ? 6.208   99.939  64.449  1.00 19.20  ? 80   ILE A CG2 1 
ATOM   300   C  CD1 . ILE A 1 102 ? 5.750   98.602  68.045  1.00 5.01   ? 80   ILE A CD1 1 
ATOM   301   N  N   . LEU A 1 103 ? 5.828   97.206  63.143  1.00 22.01  ? 81   LEU A N   1 
ATOM   302   C  CA  . LEU A 1 103 ? 4.781   96.838  62.201  1.00 20.84  ? 81   LEU A CA  1 
ATOM   303   C  C   . LEU A 1 103 ? 4.259   95.451  62.515  1.00 23.53  ? 81   LEU A C   1 
ATOM   304   O  O   . LEU A 1 103 ? 3.143   95.091  62.127  1.00 12.91  ? 81   LEU A O   1 
ATOM   305   C  CB  . LEU A 1 103 ? 5.304   96.914  60.768  1.00 26.37  ? 81   LEU A CB  1 
ATOM   306   C  CG  . LEU A 1 103 ? 5.718   98.345  60.416  1.00 31.09  ? 81   LEU A CG  1 
ATOM   307   C  CD1 . LEU A 1 103 ? 6.170   98.403  58.978  1.00 26.50  ? 81   LEU A CD1 1 
ATOM   308   C  CD2 . LEU A 1 103 ? 4.547   99.295  60.657  1.00 20.46  ? 81   LEU A CD2 1 
ATOM   309   N  N   . LYS A 1 104 ? 5.066   94.680  63.235  1.00 24.93  ? 82   LYS A N   1 
ATOM   310   C  CA  . LYS A 1 104 ? 4.652   93.345  63.627  1.00 28.45  ? 82   LYS A CA  1 
ATOM   311   C  C   . LYS A 1 104 ? 3.598   93.441  64.728  1.00 26.57  ? 82   LYS A C   1 
ATOM   312   O  O   . LYS A 1 104 ? 3.027   92.432  65.136  1.00 24.78  ? 82   LYS A O   1 
ATOM   313   C  CB  . LYS A 1 104 ? 5.860   92.510  64.086  1.00 34.32  ? 82   LYS A CB  1 
ATOM   314   C  CG  . LYS A 1 104 ? 6.356   91.513  63.026  1.00 37.74  ? 82   LYS A CG  1 
ATOM   315   C  CD  . LYS A 1 104 ? 6.440   92.185  61.664  1.00 41.10  ? 82   LYS A CD  1 
ATOM   316   C  CE  . LYS A 1 104 ? 6.421   91.186  60.517  1.00 43.44  ? 82   LYS A CE  1 
ATOM   317   N  NZ  . LYS A 1 104 ? 6.040   91.877  59.230  1.00 24.72  ? 82   LYS A NZ  1 
ATOM   318   N  N   . LYS A 1 105 ? 3.329   94.660  65.194  1.00 30.01  ? 83   LYS A N   1 
ATOM   319   C  CA  . LYS A 1 105 ? 2.310   94.869  66.225  1.00 30.04  ? 83   LYS A CA  1 
ATOM   320   C  C   . LYS A 1 105 ? 1.066   95.507  65.593  1.00 28.27  ? 83   LYS A C   1 
ATOM   321   O  O   . LYS A 1 105 ? 0.452   96.430  66.132  1.00 29.49  ? 83   LYS A O   1 
ATOM   322   C  CB  . LYS A 1 105 ? 2.851   95.738  67.371  1.00 31.11  ? 83   LYS A CB  1 
ATOM   323   C  CG  . LYS A 1 105 ? 1.900   95.853  68.572  1.00 40.53  ? 83   LYS A CG  1 
ATOM   324   C  CD  . LYS A 1 105 ? 1.314   94.499  68.988  1.00 31.99  ? 83   LYS A CD  1 
ATOM   325   C  CE  . LYS A 1 105 ? 0.558   94.560  70.323  1.00 34.52  ? 83   LYS A CE  1 
ATOM   326   N  NZ  . LYS A 1 105 ? -0.612  95.495  70.363  1.00 36.12  ? 83   LYS A NZ  1 
ATOM   327   N  N   . ILE A 1 106 ? 0.721   94.991  64.424  1.00 23.34  ? 84   ILE A N   1 
ATOM   328   C  CA  . ILE A 1 106 ? -0.439  95.417  63.659  1.00 21.90  ? 84   ILE A CA  1 
ATOM   329   C  C   . ILE A 1 106 ? -1.149  94.094  63.433  1.00 23.65  ? 84   ILE A C   1 
ATOM   330   O  O   . ILE A 1 106 ? -0.539  93.140  62.951  1.00 26.20  ? 84   ILE A O   1 
ATOM   331   C  CB  . ILE A 1 106 ? -0.010  96.022  62.307  1.00 24.53  ? 84   ILE A CB  1 
ATOM   332   C  CG1 . ILE A 1 106 ? 0.712   97.353  62.540  1.00 17.59  ? 84   ILE A CG1 1 
ATOM   333   C  CG2 . ILE A 1 106 ? -1.208  96.195  61.403  1.00 20.76  ? 84   ILE A CG2 1 
ATOM   334   C  CD1 . ILE A 1 106 ? 1.487   97.832  61.316  1.00 26.00  ? 84   ILE A CD1 1 
ATOM   335   N  N   . GLY A 1 107 ? -2.422  94.019  63.795  1.00 22.34  ? 85   GLY A N   1 
ATOM   336   C  CA  . GLY A 1 107 ? -3.142  92.770  63.646  1.00 16.69  ? 85   GLY A CA  1 
ATOM   337   C  C   . GLY A 1 107 ? -3.094  91.987  64.951  1.00 23.74  ? 85   GLY A C   1 
ATOM   338   O  O   . GLY A 1 107 ? -2.473  92.429  65.925  1.00 28.36  ? 85   GLY A O   1 
ATOM   339   N  N   . ASP A 1 108 ? -3.742  90.826  64.985  1.00 23.15  ? 86   ASP A N   1 
ATOM   340   C  CA  . ASP A 1 108 ? -3.771  90.016  66.193  1.00 26.59  ? 86   ASP A CA  1 
ATOM   341   C  C   . ASP A 1 108 ? -4.289  90.919  67.330  1.00 27.40  ? 86   ASP A C   1 
ATOM   342   O  O   . ASP A 1 108 ? -3.767  90.917  68.436  1.00 26.98  ? 86   ASP A O   1 
ATOM   343   C  CB  . ASP A 1 108 ? -2.359  89.490  66.500  1.00 27.75  ? 86   ASP A CB  1 
ATOM   344   C  CG  . ASP A 1 108 ? -2.346  88.424  67.577  1.00 28.88  ? 86   ASP A CG  1 
ATOM   345   O  OD1 . ASP A 1 108 ? -3.050  87.412  67.424  1.00 51.42  ? 86   ASP A OD1 1 
ATOM   346   O  OD2 . ASP A 1 108 ? -1.629  88.579  68.578  1.00 41.16  ? 86   ASP A OD2 1 
ATOM   347   N  N   . THR A 1 109 ? -5.321  91.699  67.033  1.00 24.68  ? 87   THR A N   1 
ATOM   348   C  CA  . THR A 1 109 ? -5.905  92.587  68.019  1.00 24.20  ? 87   THR A CA  1 
ATOM   349   C  C   . THR A 1 109 ? -6.815  91.815  68.964  1.00 22.22  ? 87   THR A C   1 
ATOM   350   O  O   . THR A 1 109 ? -7.374  90.791  68.597  1.00 25.67  ? 87   THR A O   1 
ATOM   351   C  CB  . THR A 1 109 ? -6.705  93.716  67.344  1.00 29.69  ? 87   THR A CB  1 
ATOM   352   O  OG1 . THR A 1 109 ? -7.747  93.161  66.529  1.00 21.01  ? 87   THR A OG1 1 
ATOM   353   C  CG2 . THR A 1 109 ? -5.786  94.546  66.480  1.00 28.99  ? 87   THR A CG2 1 
ATOM   354   N  N   . PRO A 1 110 ? -6.970  92.304  70.199  1.00 20.73  ? 88   PRO A N   1 
ATOM   355   C  CA  . PRO A 1 110 ? -7.804  91.669  71.217  1.00 20.45  ? 88   PRO A CA  1 
ATOM   356   C  C   . PRO A 1 110 ? -9.337  91.761  71.079  1.00 23.81  ? 88   PRO A C   1 
ATOM   357   O  O   . PRO A 1 110 ? -9.882  92.767  70.632  1.00 29.69  ? 88   PRO A O   1 
ATOM   358   C  CB  . PRO A 1 110 ? -7.287  92.306  72.513  1.00 23.11  ? 88   PRO A CB  1 
ATOM   359   C  CG  . PRO A 1 110 ? -6.857  93.664  72.082  1.00 19.40  ? 88   PRO A CG  1 
ATOM   360   C  CD  . PRO A 1 110 ? -6.167  93.399  70.774  1.00 21.72  ? 88   PRO A CD  1 
ATOM   361   N  N   . MET A 1 111 ? -10.013 90.680  71.457  1.00 22.05  ? 89   MET A N   1 
ATOM   362   C  CA  . MET A 1 111 ? -11.461 90.602  71.443  1.00 23.92  ? 89   MET A CA  1 
ATOM   363   C  C   . MET A 1 111 ? -11.882 90.747  72.900  1.00 28.26  ? 89   MET A C   1 
ATOM   364   O  O   . MET A 1 111 ? -11.621 89.862  73.730  1.00 32.34  ? 89   MET A O   1 
ATOM   365   C  CB  . MET A 1 111 ? -11.917 89.242  70.922  1.00 26.16  ? 89   MET A CB  1 
ATOM   366   C  CG  . MET A 1 111 ? -13.420 89.124  70.783  1.00 34.36  ? 89   MET A CG  1 
ATOM   367   S  SD  . MET A 1 111 ? -14.068 90.113  69.409  1.00 40.21  ? 89   MET A SD  1 
ATOM   368   C  CE  . MET A 1 111 ? -14.200 88.847  68.111  1.00 38.75  ? 89   MET A CE  1 
ATOM   369   N  N   . VAL A 1 112 ? -12.537 91.855  73.208  1.00 16.46  ? 90   VAL A N   1 
ATOM   370   C  CA  . VAL A 1 112 ? -12.956 92.115  74.570  1.00 12.02  ? 90   VAL A CA  1 
ATOM   371   C  C   . VAL A 1 112 ? -14.476 92.116  74.746  1.00 23.99  ? 90   VAL A C   1 
ATOM   372   O  O   . VAL A 1 112 ? -15.217 92.630  73.907  1.00 28.40  ? 90   VAL A O   1 
ATOM   373   C  CB  . VAL A 1 112 ? -12.395 93.463  75.039  1.00 7.22   ? 90   VAL A CB  1 
ATOM   374   C  CG1 . VAL A 1 112 ? -12.639 93.658  76.547  1.00 3.39   ? 90   VAL A CG1 1 
ATOM   375   C  CG2 . VAL A 1 112 ? -10.906 93.525  74.724  1.00 15.45  ? 90   VAL A CG2 1 
ATOM   376   N  N   . ARG A 1 113 ? -14.933 91.555  75.861  1.00 26.41  ? 91   ARG A N   1 
ATOM   377   C  CA  . ARG A 1 113 ? -16.359 91.474  76.157  1.00 28.94  ? 91   ARG A CA  1 
ATOM   378   C  C   . ARG A 1 113 ? -16.880 92.767  76.791  1.00 29.61  ? 91   ARG A C   1 
ATOM   379   O  O   . ARG A 1 113 ? -16.279 93.299  77.730  1.00 31.84  ? 91   ARG A O   1 
ATOM   380   C  CB  . ARG A 1 113 ? -16.625 90.291  77.104  1.00 24.78  ? 91   ARG A CB  1 
ATOM   381   C  CG  . ARG A 1 113 ? -18.098 89.956  77.314  1.00 21.24  ? 91   ARG A CG  1 
ATOM   382   C  CD  . ARG A 1 113 ? -18.289 89.287  78.657  1.00 20.50  ? 91   ARG A CD  1 
ATOM   383   N  NE  . ARG A 1 113 ? -17.452 88.100  78.829  1.00 20.91  ? 91   ARG A NE  1 
ATOM   384   C  CZ  . ARG A 1 113 ? -16.878 87.763  79.980  1.00 29.70  ? 91   ARG A CZ  1 
ATOM   385   N  NH1 . ARG A 1 113 ? -17.038 88.521  81.069  1.00 31.82  ? 91   ARG A NH1 1 
ATOM   386   N  NH2 . ARG A 1 113 ? -16.149 86.660  80.048  1.00 29.33  ? 91   ARG A NH2 1 
ATOM   387   N  N   . ILE A 1 114 ? -17.992 93.272  76.262  1.00 26.57  ? 92   ILE A N   1 
ATOM   388   C  CA  . ILE A 1 114 ? -18.629 94.478  76.787  1.00 23.23  ? 92   ILE A CA  1 
ATOM   389   C  C   . ILE A 1 114 ? -19.518 93.978  77.926  1.00 21.87  ? 92   ILE A C   1 
ATOM   390   O  O   . ILE A 1 114 ? -20.365 93.105  77.738  1.00 19.30  ? 92   ILE A O   1 
ATOM   391   C  CB  . ILE A 1 114 ? -19.483 95.145  75.704  1.00 27.18  ? 92   ILE A CB  1 
ATOM   392   C  CG1 . ILE A 1 114 ? -18.619 95.437  74.468  1.00 16.51  ? 92   ILE A CG1 1 
ATOM   393   C  CG2 . ILE A 1 114 ? -20.120 96.395  76.252  1.00 23.04  ? 92   ILE A CG2 1 
ATOM   394   C  CD1 . ILE A 1 114 ? -17.470 96.401  74.721  1.00 25.53  ? 92   ILE A CD1 1 
ATOM   395   N  N   . ASN A 1 115 ? -19.338 94.523  79.115  1.00 20.29  ? 93   ASN A N   1 
ATOM   396   C  CA  . ASN A 1 115 ? -20.110 94.020  80.244  1.00 25.23  ? 93   ASN A CA  1 
ATOM   397   C  C   . ASN A 1 115 ? -21.259 94.872  80.788  1.00 29.04  ? 93   ASN A C   1 
ATOM   398   O  O   . ASN A 1 115 ? -22.197 94.338  81.384  1.00 28.97  ? 93   ASN A O   1 
ATOM   399   C  CB  . ASN A 1 115 ? -19.151 93.665  81.387  1.00 16.77  ? 93   ASN A CB  1 
ATOM   400   C  CG  . ASN A 1 115 ? -18.113 92.647  80.976  1.00 8.67   ? 93   ASN A CG  1 
ATOM   401   O  OD1 . ASN A 1 115 ? -18.423 91.477  80.733  1.00 17.62  ? 93   ASN A OD1 1 
ATOM   402   N  ND2 . ASN A 1 115 ? -16.877 93.085  80.890  1.00 8.65   ? 93   ASN A ND2 1 
ATOM   403   N  N   . LYS A 1 116 ? -21.210 96.181  80.584  1.00 26.50  ? 94   LYS A N   1 
ATOM   404   C  CA  . LYS A 1 116 ? -22.266 97.021  81.108  1.00 29.60  ? 94   LYS A CA  1 
ATOM   405   C  C   . LYS A 1 116 ? -23.243 97.540  80.061  1.00 33.20  ? 94   LYS A C   1 
ATOM   406   O  O   . LYS A 1 116 ? -24.442 97.264  80.133  1.00 26.72  ? 94   LYS A O   1 
ATOM   407   C  CB  . LYS A 1 116 ? -21.659 98.192  81.888  1.00 36.18  ? 94   LYS A CB  1 
ATOM   408   C  CG  . LYS A 1 116 ? -20.834 97.767  83.094  1.00 42.51  ? 94   LYS A CG  1 
ATOM   409   C  CD  . LYS A 1 116 ? -20.143 98.960  83.737  1.00 46.19  ? 94   LYS A CD  1 
ATOM   410   C  CE  . LYS A 1 116 ? -19.186 98.521  84.829  1.00 56.10  ? 94   LYS A CE  1 
ATOM   411   N  NZ  . LYS A 1 116 ? -18.465 99.689  85.395  1.00 54.99  ? 94   LYS A NZ  1 
ATOM   412   N  N   . ILE A 1 117 ? -22.729 98.283  79.085  1.00 34.72  ? 95   ILE A N   1 
ATOM   413   C  CA  . ILE A 1 117 ? -23.557 98.876  78.026  1.00 29.36  ? 95   ILE A CA  1 
ATOM   414   C  C   . ILE A 1 117 ? -24.616 97.961  77.410  1.00 29.70  ? 95   ILE A C   1 
ATOM   415   O  O   . ILE A 1 117 ? -25.788 98.337  77.286  1.00 24.25  ? 95   ILE A O   1 
ATOM   416   C  CB  . ILE A 1 117 ? -22.672 99.433  76.885  1.00 27.30  ? 95   ILE A CB  1 
ATOM   417   C  CG1 . ILE A 1 117 ? -21.814 100.597 77.416  1.00 24.81  ? 95   ILE A CG1 1 
ATOM   418   C  CG2 . ILE A 1 117 ? -23.544 99.861  75.720  1.00 23.30  ? 95   ILE A CG2 1 
ATOM   419   C  CD1 . ILE A 1 117 ? -20.764 101.119 76.446  1.00 14.78  ? 95   ILE A CD1 1 
ATOM   420   N  N   . GLY A 1 118 ? -24.200 96.765  77.009  1.00 31.94  ? 96   GLY A N   1 
ATOM   421   C  CA  . GLY A 1 118 ? -25.131 95.833  76.401  1.00 24.80  ? 96   GLY A CA  1 
ATOM   422   C  C   . GLY A 1 118 ? -26.254 95.449  77.338  1.00 27.88  ? 96   GLY A C   1 
ATOM   423   O  O   . GLY A 1 118 ? -27.424 95.457  76.964  1.00 33.05  ? 96   GLY A O   1 
ATOM   424   N  N   . LYS A 1 119 ? -25.898 95.104  78.568  1.00 31.91  ? 97   LYS A N   1 
ATOM   425   C  CA  . LYS A 1 119 ? -26.886 94.709  79.562  1.00 29.09  ? 97   LYS A CA  1 
ATOM   426   C  C   . LYS A 1 119 ? -27.827 95.876  79.869  1.00 31.98  ? 97   LYS A C   1 
ATOM   427   O  O   . LYS A 1 119 ? -29.035 95.693  79.994  1.00 30.41  ? 97   LYS A O   1 
ATOM   428   C  CB  . LYS A 1 119 ? -26.180 94.255  80.840  1.00 27.47  ? 97   LYS A CB  1 
ATOM   429   C  CG  . LYS A 1 119 ? -25.153 93.126  80.655  1.00 26.96  ? 97   LYS A CG  1 
ATOM   430   C  CD  . LYS A 1 119 ? -25.798 91.831  80.211  1.00 25.35  ? 97   LYS A CD  1 
ATOM   431   C  CE  . LYS A 1 119 ? -24.865 90.649  80.420  1.00 25.51  ? 97   LYS A CE  1 
ATOM   432   N  NZ  . LYS A 1 119 ? -25.463 89.379  79.906  1.00 19.26  ? 97   LYS A NZ  1 
ATOM   433   N  N   . LYS A 1 120 ? -27.255 97.072  79.978  1.00 33.42  ? 98   LYS A N   1 
ATOM   434   C  CA  . LYS A 1 120 ? -28.006 98.283  80.271  1.00 32.61  ? 98   LYS A CA  1 
ATOM   435   C  C   . LYS A 1 120 ? -29.085 98.568  79.235  1.00 35.64  ? 98   LYS A C   1 
ATOM   436   O  O   . LYS A 1 120 ? -29.979 99.364  79.495  1.00 37.95  ? 98   LYS A O   1 
ATOM   437   C  CB  . LYS A 1 120 ? -27.042 99.477  80.371  1.00 36.54  ? 98   LYS A CB  1 
ATOM   438   C  CG  . LYS A 1 120 ? -27.707 100.839 80.455  1.00 39.77  ? 98   LYS A CG  1 
ATOM   439   C  CD  . LYS A 1 120 ? -26.675 101.953 80.616  1.00 41.20  ? 98   LYS A CD  1 
ATOM   440   C  CE  . LYS A 1 120 ? -27.318 103.340 80.449  1.00 30.26  ? 98   LYS A CE  1 
ATOM   441   N  NZ  . LYS A 1 120 ? -26.366 104.448 80.744  1.00 26.64  ? 98   LYS A NZ  1 
ATOM   442   N  N   . PHE A 1 121 ? -28.997 97.925  78.067  1.00 36.85  ? 99   PHE A N   1 
ATOM   443   C  CA  . PHE A 1 121 ? -29.975 98.123  76.991  1.00 33.89  ? 99   PHE A CA  1 
ATOM   444   C  C   . PHE A 1 121 ? -30.836 96.902  76.689  1.00 34.86  ? 99   PHE A C   1 
ATOM   445   O  O   . PHE A 1 121 ? -31.489 96.844  75.653  1.00 37.21  ? 99   PHE A O   1 
ATOM   446   C  CB  . PHE A 1 121 ? -29.298 98.571  75.694  1.00 25.45  ? 99   PHE A CB  1 
ATOM   447   C  CG  . PHE A 1 121 ? -28.859 99.999  75.700  1.00 26.94  ? 99   PHE A CG  1 
ATOM   448   C  CD1 . PHE A 1 121 ? -27.680 100.374 76.322  1.00 28.04  ? 99   PHE A CD1 1 
ATOM   449   C  CD2 . PHE A 1 121 ? -29.634 100.977 75.089  1.00 26.65  ? 99   PHE A CD2 1 
ATOM   450   C  CE1 . PHE A 1 121 ? -27.280 101.718 76.333  1.00 34.48  ? 99   PHE A CE1 1 
ATOM   451   C  CE2 . PHE A 1 121 ? -29.245 102.316 75.096  1.00 31.29  ? 99   PHE A CE2 1 
ATOM   452   C  CZ  . PHE A 1 121 ? -28.069 102.690 75.718  1.00 24.07  ? 99   PHE A CZ  1 
ATOM   453   N  N   . GLY A 1 122 ? -30.828 95.919  77.579  1.00 37.15  ? 100  GLY A N   1 
ATOM   454   C  CA  . GLY A 1 122 ? -31.664 94.752  77.369  1.00 36.11  ? 100  GLY A CA  1 
ATOM   455   C  C   . GLY A 1 122 ? -31.104 93.671  76.480  1.00 36.54  ? 100  GLY A C   1 
ATOM   456   O  O   . GLY A 1 122 ? -31.776 92.677  76.227  1.00 40.47  ? 100  GLY A O   1 
ATOM   457   N  N   . LEU A 1 123 ? -29.879 93.854  76.006  1.00 37.85  ? 101  LEU A N   1 
ATOM   458   C  CA  . LEU A 1 123 ? -29.243 92.864  75.145  1.00 37.33  ? 101  LEU A CA  1 
ATOM   459   C  C   . LEU A 1 123 ? -29.115 91.528  75.885  1.00 41.25  ? 101  LEU A C   1 
ATOM   460   O  O   . LEU A 1 123 ? -28.606 91.497  77.006  1.00 45.04  ? 101  LEU A O   1 
ATOM   461   C  CB  . LEU A 1 123 ? -27.858 93.369  74.741  1.00 34.40  ? 101  LEU A CB  1 
ATOM   462   C  CG  . LEU A 1 123 ? -27.568 93.579  73.254  1.00 34.89  ? 101  LEU A CG  1 
ATOM   463   C  CD1 . LEU A 1 123 ? -28.773 94.194  72.560  1.00 34.41  ? 101  LEU A CD1 1 
ATOM   464   C  CD2 . LEU A 1 123 ? -26.341 94.468  73.106  1.00 35.27  ? 101  LEU A CD2 1 
ATOM   465   N  N   . LYS A 1 124 ? -29.561 90.429  75.274  1.00 38.07  ? 102  LYS A N   1 
ATOM   466   C  CA  . LYS A 1 124 ? -29.467 89.112  75.921  1.00 37.27  ? 102  LYS A CA  1 
ATOM   467   C  C   . LYS A 1 124 ? -28.302 88.289  75.384  1.00 33.74  ? 102  LYS A C   1 
ATOM   468   O  O   . LYS A 1 124 ? -27.930 87.261  75.952  1.00 33.63  ? 102  LYS A O   1 
ATOM   469   C  CB  . LYS A 1 124 ? -30.769 88.326  75.735  1.00 38.17  ? 102  LYS A CB  1 
ATOM   470   C  CG  . LYS A 1 124 ? -31.979 89.046  76.287  1.00 48.37  ? 102  LYS A CG  1 
ATOM   471   C  CD  . LYS A 1 124 ? -33.259 88.557  75.643  1.00 52.58  ? 102  LYS A CD  1 
ATOM   472   C  CE  . LYS A 1 124 ? -34.314 89.650  75.691  1.00 55.93  ? 102  LYS A CE  1 
ATOM   473   N  NZ  . LYS A 1 124 ? -35.490 89.336  74.838  1.00 59.99  ? 102  LYS A NZ  1 
ATOM   474   N  N   . CYS A 1 125 ? -27.727 88.750  74.282  1.00 36.07  ? 103  CYS A N   1 
ATOM   475   C  CA  . CYS A 1 125 ? -26.593 88.067  73.664  1.00 33.70  ? 103  CYS A CA  1 
ATOM   476   C  C   . CYS A 1 125 ? -25.281 88.533  74.294  1.00 35.46  ? 103  CYS A C   1 
ATOM   477   O  O   . CYS A 1 125 ? -25.266 89.411  75.166  1.00 30.47  ? 103  CYS A O   1 
ATOM   478   C  CB  . CYS A 1 125 ? -26.545 88.391  72.172  1.00 31.56  ? 103  CYS A CB  1 
ATOM   479   S  SG  . CYS A 1 125 ? -26.218 90.155  71.829  1.00 23.51  ? 103  CYS A SG  1 
ATOM   480   N  N   . GLU A 1 126 ? -24.178 87.932  73.860  1.00 35.14  ? 104  GLU A N   1 
ATOM   481   C  CA  . GLU A 1 126 ? -22.870 88.351  74.353  1.00 35.18  ? 104  GLU A CA  1 
ATOM   482   C  C   . GLU A 1 126 ? -22.385 89.379  73.334  1.00 34.75  ? 104  GLU A C   1 
ATOM   483   O  O   . GLU A 1 126 ? -22.435 89.142  72.128  1.00 33.92  ? 104  GLU A O   1 
ATOM   484   C  CB  . GLU A 1 126 ? -21.887 87.176  74.428  1.00 36.83  ? 104  GLU A CB  1 
ATOM   485   C  CG  . GLU A 1 126 ? -20.430 87.610  74.591  1.00 36.47  ? 104  GLU A CG  1 
ATOM   486   C  CD  . GLU A 1 126 ? -19.479 86.446  74.865  1.00 48.55  ? 104  GLU A CD  1 
ATOM   487   O  OE1 . GLU A 1 126 ? -19.683 85.350  74.293  1.00 50.14  ? 104  GLU A OE1 1 
ATOM   488   O  OE2 . GLU A 1 126 ? -18.516 86.637  75.643  1.00 48.74  ? 104  GLU A OE2 1 
ATOM   489   N  N   . LEU A 1 127 ? -21.947 90.530  73.825  1.00 32.27  ? 105  LEU A N   1 
ATOM   490   C  CA  . LEU A 1 127 ? -21.468 91.605  72.971  1.00 32.53  ? 105  LEU A CA  1 
ATOM   491   C  C   . LEU A 1 127 ? -19.956 91.646  73.045  1.00 30.64  ? 105  LEU A C   1 
ATOM   492   O  O   . LEU A 1 127 ? -19.407 91.890  74.115  1.00 33.22  ? 105  LEU A O   1 
ATOM   493   C  CB  . LEU A 1 127 ? -22.011 92.940  73.465  1.00 28.03  ? 105  LEU A CB  1 
ATOM   494   C  CG  . LEU A 1 127 ? -22.609 93.943  72.483  1.00 34.20  ? 105  LEU A CG  1 
ATOM   495   C  CD1 . LEU A 1 127 ? -22.393 95.338  73.058  1.00 27.96  ? 105  LEU A CD1 1 
ATOM   496   C  CD2 . LEU A 1 127 ? -21.962 93.833  71.096  1.00 20.21  ? 105  LEU A CD2 1 
ATOM   497   N  N   . LEU A 1 128 ? -19.283 91.414  71.921  1.00 30.36  ? 106  LEU A N   1 
ATOM   498   C  CA  . LEU A 1 128 ? -17.823 91.439  71.902  1.00 27.65  ? 106  LEU A CA  1 
ATOM   499   C  C   . LEU A 1 128 ? -17.284 92.617  71.087  1.00 25.03  ? 106  LEU A C   1 
ATOM   500   O  O   . LEU A 1 128 ? -17.902 93.059  70.119  1.00 32.59  ? 106  LEU A O   1 
ATOM   501   C  CB  . LEU A 1 128 ? -17.280 90.114  71.349  1.00 22.02  ? 106  LEU A CB  1 
ATOM   502   C  CG  . LEU A 1 128 ? -17.706 88.853  72.103  1.00 24.74  ? 106  LEU A CG  1 
ATOM   503   C  CD1 . LEU A 1 128 ? -17.138 87.628  71.407  1.00 34.47  ? 106  LEU A CD1 1 
ATOM   504   C  CD2 . LEU A 1 128 ? -17.229 88.918  73.548  1.00 25.59  ? 106  LEU A CD2 1 
ATOM   505   N  N   . ALA A 1 129 ? -16.127 93.125  71.491  1.00 18.56  ? 107  ALA A N   1 
ATOM   506   C  CA  . ALA A 1 129 ? -15.498 94.243  70.805  1.00 21.50  ? 107  ALA A CA  1 
ATOM   507   C  C   . ALA A 1 129 ? -14.123 93.897  70.218  1.00 22.36  ? 107  ALA A C   1 
ATOM   508   O  O   . ALA A 1 129 ? -13.227 93.424  70.935  1.00 25.58  ? 107  ALA A O   1 
ATOM   509   C  CB  . ALA A 1 129 ? -15.370 95.433  71.765  1.00 3.36   ? 107  ALA A CB  1 
ATOM   510   N  N   . LYS A 1 130 ? -13.976 94.121  68.910  1.00 20.50  ? 108  LYS A N   1 
ATOM   511   C  CA  . LYS A 1 130 ? -12.710 93.896  68.207  1.00 23.95  ? 108  LYS A CA  1 
ATOM   512   C  C   . LYS A 1 130 ? -12.008 95.222  68.402  1.00 26.49  ? 108  LYS A C   1 
ATOM   513   O  O   . LYS A 1 130 ? -12.313 96.187  67.708  1.00 34.15  ? 108  LYS A O   1 
ATOM   514   C  CB  . LYS A 1 130 ? -12.938 93.700  66.703  1.00 20.37  ? 108  LYS A CB  1 
ATOM   515   C  CG  . LYS A 1 130 ? -12.358 92.420  66.118  1.00 22.53  ? 108  LYS A CG  1 
ATOM   516   C  CD  . LYS A 1 130 ? -10.857 92.324  66.203  1.00 14.23  ? 108  LYS A CD  1 
ATOM   517   C  CE  . LYS A 1 130 ? -10.450 90.855  66.120  1.00 21.08  ? 108  LYS A CE  1 
ATOM   518   N  NZ  . LYS A 1 130 ? -8.979  90.593  66.117  1.00 19.57  ? 108  LYS A NZ  1 
ATOM   519   N  N   . CYS A 1 131 ? -11.077 95.294  69.335  1.00 26.20  ? 109  CYS A N   1 
ATOM   520   C  CA  . CYS A 1 131 ? -10.418 96.567  69.575  1.00 29.18  ? 109  CYS A CA  1 
ATOM   521   C  C   . CYS A 1 131 ? -9.243  96.821  68.641  1.00 26.32  ? 109  CYS A C   1 
ATOM   522   O  O   . CYS A 1 131 ? -8.103  96.447  68.915  1.00 27.50  ? 109  CYS A O   1 
ATOM   523   C  CB  . CYS A 1 131 ? -9.996  96.648  71.039  1.00 20.60  ? 109  CYS A CB  1 
ATOM   524   S  SG  . CYS A 1 131 ? -11.382 96.226  72.091  1.00 32.08  ? 109  CYS A SG  1 
ATOM   525   N  N   . GLU A 1 132 ? -9.533  97.479  67.527  1.00 26.41  ? 110  GLU A N   1 
ATOM   526   C  CA  . GLU A 1 132 ? -8.496  97.776  66.559  1.00 25.29  ? 110  GLU A CA  1 
ATOM   527   C  C   . GLU A 1 132 ? -7.632  98.965  66.978  1.00 26.23  ? 110  GLU A C   1 
ATOM   528   O  O   . GLU A 1 132 ? -6.630  99.271  66.324  1.00 28.24  ? 110  GLU A O   1 
ATOM   529   C  CB  . GLU A 1 132 ? -9.116  98.035  65.190  1.00 22.58  ? 110  GLU A CB  1 
ATOM   530   C  CG  . GLU A 1 132 ? -8.438  97.277  64.075  1.00 25.44  ? 110  GLU A CG  1 
ATOM   531   C  CD  . GLU A 1 132 ? -8.644  95.805  64.208  1.00 25.96  ? 110  GLU A CD  1 
ATOM   532   O  OE1 . GLU A 1 132 ? -9.729  95.422  64.671  1.00 24.25  ? 110  GLU A OE1 1 
ATOM   533   O  OE2 . GLU A 1 132 ? -7.743  95.031  63.849  1.00 32.37  ? 110  GLU A OE2 1 
ATOM   534   N  N   . PHE A 1 133 ? -8.006  99.637  68.065  1.00 27.09  ? 111  PHE A N   1 
ATOM   535   C  CA  . PHE A 1 133 ? -7.204  100.765 68.522  1.00 26.30  ? 111  PHE A CA  1 
ATOM   536   C  C   . PHE A 1 133 ? -5.897  100.319 69.176  1.00 24.22  ? 111  PHE A C   1 
ATOM   537   O  O   . PHE A 1 133 ? -5.123  101.142 69.658  1.00 24.33  ? 111  PHE A O   1 
ATOM   538   C  CB  . PHE A 1 133 ? -8.008  101.681 69.460  1.00 20.59  ? 111  PHE A CB  1 
ATOM   539   C  CG  . PHE A 1 133 ? -8.696  100.968 70.588  1.00 22.34  ? 111  PHE A CG  1 
ATOM   540   C  CD1 . PHE A 1 133 ? -8.080  100.836 71.830  1.00 22.46  ? 111  PHE A CD1 1 
ATOM   541   C  CD2 . PHE A 1 133 ? -9.981  100.456 70.425  1.00 24.22  ? 111  PHE A CD2 1 
ATOM   542   C  CE1 . PHE A 1 133 ? -8.738  100.205 72.900  1.00 25.36  ? 111  PHE A CE1 1 
ATOM   543   C  CE2 . PHE A 1 133 ? -10.643 99.825  71.489  1.00 18.71  ? 111  PHE A CE2 1 
ATOM   544   C  CZ  . PHE A 1 133 ? -10.021 99.698  72.729  1.00 17.34  ? 111  PHE A CZ  1 
ATOM   545   N  N   . PHE A 1 134 ? -5.645  99.011  69.167  1.00 23.65  ? 112  PHE A N   1 
ATOM   546   C  CA  . PHE A 1 134 ? -4.413  98.474  69.733  1.00 22.49  ? 112  PHE A CA  1 
ATOM   547   C  C   . PHE A 1 134 ? -3.326  98.264  68.678  1.00 25.44  ? 112  PHE A C   1 
ATOM   548   O  O   . PHE A 1 134 ? -2.209  97.852  69.009  1.00 25.72  ? 112  PHE A O   1 
ATOM   549   C  CB  . PHE A 1 134 ? -4.666  97.153  70.480  1.00 24.37  ? 112  PHE A CB  1 
ATOM   550   C  CG  . PHE A 1 134 ? -5.255  97.326  71.870  1.00 32.35  ? 112  PHE A CG  1 
ATOM   551   C  CD1 . PHE A 1 134 ? -6.622  97.214  72.083  1.00 30.57  ? 112  PHE A CD1 1 
ATOM   552   C  CD2 . PHE A 1 134 ? -4.434  97.593  72.962  1.00 35.98  ? 112  PHE A CD2 1 
ATOM   553   C  CE1 . PHE A 1 134 ? -7.163  97.364  73.358  1.00 35.47  ? 112  PHE A CE1 1 
ATOM   554   C  CE2 . PHE A 1 134 ? -4.972  97.744  74.238  1.00 34.57  ? 112  PHE A CE2 1 
ATOM   555   C  CZ  . PHE A 1 134 ? -6.338  97.629  74.434  1.00 37.63  ? 112  PHE A CZ  1 
ATOM   556   N  N   . ASN A 1 135 ? -3.638  98.530  67.408  1.00 25.63  ? 113  ASN A N   1 
ATOM   557   C  CA  . ASN A 1 135 ? -2.620  98.382  66.366  1.00 18.95  ? 113  ASN A CA  1 
ATOM   558   C  C   . ASN A 1 135 ? -1.553  99.448  66.633  1.00 16.73  ? 113  ASN A C   1 
ATOM   559   O  O   . ASN A 1 135 ? -1.841  100.502 67.210  1.00 10.98  ? 113  ASN A O   1 
ATOM   560   C  CB  . ASN A 1 135 ? -3.212  98.565  64.962  1.00 17.95  ? 113  ASN A CB  1 
ATOM   561   C  CG  . ASN A 1 135 ? -4.008  97.353  64.488  1.00 18.95  ? 113  ASN A CG  1 
ATOM   562   O  OD1 . ASN A 1 135 ? -3.541  96.221  64.556  1.00 16.86  ? 113  ASN A OD1 1 
ATOM   563   N  ND2 . ASN A 1 135 ? -5.215  97.598  63.984  1.00 24.07  ? 113  ASN A ND2 1 
ATOM   564   N  N   . ALA A 1 136 ? -0.327  99.172  66.205  1.00 18.99  ? 114  ALA A N   1 
ATOM   565   C  CA  . ALA A 1 136 ? 0.807   100.069 66.437  1.00 19.94  ? 114  ALA A CA  1 
ATOM   566   C  C   . ALA A 1 136 ? 0.531   101.554 66.311  1.00 22.73  ? 114  ALA A C   1 
ATOM   567   O  O   . ALA A 1 136 ? 1.027   102.345 67.112  1.00 23.69  ? 114  ALA A O   1 
ATOM   568   C  CB  . ALA A 1 136 ? 1.973   99.683  65.534  1.00 16.21  ? 114  ALA A CB  1 
ATOM   569   N  N   . GLY A 1 137 ? -0.245  101.929 65.298  1.00 29.23  ? 115  GLY A N   1 
ATOM   570   C  CA  . GLY A 1 137 ? -0.562  103.331 65.070  1.00 28.02  ? 115  GLY A CA  1 
ATOM   571   C  C   . GLY A 1 137 ? -1.867  103.794 65.687  1.00 27.24  ? 115  GLY A C   1 
ATOM   572   O  O   . GLY A 1 137 ? -2.218  104.974 65.588  1.00 20.94  ? 115  GLY A O   1 
ATOM   573   N  N   . GLY A 1 138 ? -2.598  102.860 66.293  1.00 27.47  ? 116  GLY A N   1 
ATOM   574   C  CA  . GLY A 1 138 ? -3.840  103.207 66.955  1.00 25.18  ? 116  GLY A CA  1 
ATOM   575   C  C   . GLY A 1 138 ? -5.120  103.090 66.168  1.00 22.66  ? 116  GLY A C   1 
ATOM   576   O  O   . GLY A 1 138 ? -6.169  103.520 66.650  1.00 30.45  ? 116  GLY A O   1 
ATOM   577   N  N   . SER A 1 139 ? -5.065  102.523 64.969  1.00 21.26  ? 117  SER A N   1 
ATOM   578   C  CA  . SER A 1 139 ? -6.290  102.392 64.177  1.00 20.56  ? 117  SER A CA  1 
ATOM   579   C  C   . SER A 1 139 ? -6.335  101.119 63.333  1.00 22.24  ? 117  SER A C   1 
ATOM   580   O  O   . SER A 1 139 ? -5.316  100.456 63.125  1.00 17.19  ? 117  SER A O   1 
ATOM   581   C  CB  . SER A 1 139 ? -6.475  103.614 63.266  1.00 18.88  ? 117  SER A CB  1 
ATOM   582   O  OG  . SER A 1 139 ? -5.538  103.613 62.195  1.00 29.01  ? 117  SER A OG  1 
ATOM   583   N  N   . VAL A 1 140 ? -7.534  100.790 62.857  1.00 19.32  ? 118  VAL A N   1 
ATOM   584   C  CA  . VAL A 1 140 ? -7.744  99.622  62.016  1.00 14.90  ? 118  VAL A CA  1 
ATOM   585   C  C   . VAL A 1 140 ? -7.048  99.832  60.662  1.00 14.25  ? 118  VAL A C   1 
ATOM   586   O  O   . VAL A 1 140 ? -6.834  98.887  59.908  1.00 15.91  ? 118  VAL A O   1 
ATOM   587   C  CB  . VAL A 1 140 ? -9.260  99.382  61.787  1.00 18.64  ? 118  VAL A CB  1 
ATOM   588   C  CG1 . VAL A 1 140 ? -9.883  100.619 61.163  1.00 24.27  ? 118  VAL A CG1 1 
ATOM   589   C  CG2 . VAL A 1 140 ? -9.486  98.166  60.902  1.00 18.13  ? 118  VAL A CG2 1 
ATOM   590   N  N   . LYS A 1 141 ? -6.672  101.074 60.377  1.00 11.93  ? 119  LYS A N   1 
ATOM   591   C  CA  . LYS A 1 141 ? -6.033  101.407 59.111  1.00 17.23  ? 119  LYS A CA  1 
ATOM   592   C  C   . LYS A 1 141 ? -4.593  100.916 59.005  1.00 16.83  ? 119  LYS A C   1 
ATOM   593   O  O   . LYS A 1 141 ? -4.029  100.818 57.904  1.00 12.91  ? 119  LYS A O   1 
ATOM   594   C  CB  . LYS A 1 141 ? -6.065  102.923 58.887  1.00 21.01  ? 119  LYS A CB  1 
ATOM   595   C  CG  . LYS A 1 141 ? -7.442  103.494 58.627  1.00 20.45  ? 119  LYS A CG  1 
ATOM   596   C  CD  . LYS A 1 141 ? -8.014  102.946 57.350  1.00 16.68  ? 119  LYS A CD  1 
ATOM   597   C  CE  . LYS A 1 141 ? -9.298  103.660 56.978  1.00 14.43  ? 119  LYS A CE  1 
ATOM   598   N  NZ  . LYS A 1 141 ? -10.357 103.282 57.903  1.00 20.42  ? 119  LYS A NZ  1 
ATOM   599   N  N   . ASP A 1 142 ? -3.995  100.611 60.146  1.00 19.21  ? 120  ASP A N   1 
ATOM   600   C  CA  . ASP A 1 142 ? -2.624  100.148 60.142  1.00 20.59  ? 120  ASP A CA  1 
ATOM   601   C  C   . ASP A 1 142 ? -2.544  98.836  59.385  1.00 22.57  ? 120  ASP A C   1 
ATOM   602   O  O   . ASP A 1 142 ? -1.504  98.510  58.813  1.00 21.37  ? 120  ASP A O   1 
ATOM   603   C  CB  . ASP A 1 142 ? -2.107  99.982  61.567  1.00 28.38  ? 120  ASP A CB  1 
ATOM   604   C  CG  . ASP A 1 142 ? -2.205  101.260 62.371  1.00 28.97  ? 120  ASP A CG  1 
ATOM   605   O  OD1 . ASP A 1 142 ? -2.356  102.341 61.767  1.00 36.45  ? 120  ASP A OD1 1 
ATOM   606   O  OD2 . ASP A 1 142 ? -2.122  101.188 63.611  1.00 38.06  ? 120  ASP A OD2 1 
ATOM   607   N  N   . ARG A 1 143 ? -3.650  98.092  59.374  1.00 19.98  ? 121  ARG A N   1 
ATOM   608   C  CA  . ARG A 1 143 ? -3.703  96.830  58.642  1.00 15.32  ? 121  ARG A CA  1 
ATOM   609   C  C   . ARG A 1 143 ? -3.643  97.099  57.137  1.00 17.74  ? 121  ARG A C   1 
ATOM   610   O  O   . ARG A 1 143 ? -2.736  96.619  56.449  1.00 24.55  ? 121  ARG A O   1 
ATOM   611   C  CB  . ARG A 1 143 ? -4.999  96.065  58.937  1.00 27.51  ? 121  ARG A CB  1 
ATOM   612   C  CG  . ARG A 1 143 ? -5.082  95.301  60.260  1.00 26.65  ? 121  ARG A CG  1 
ATOM   613   C  CD  . ARG A 1 143 ? -6.467  94.636  60.356  1.00 31.27  ? 121  ARG A CD  1 
ATOM   614   N  NE  . ARG A 1 143 ? -6.786  94.085  61.672  1.00 32.49  ? 121  ARG A NE  1 
ATOM   615   C  CZ  . ARG A 1 143 ? -6.559  92.829  62.046  1.00 30.78  ? 121  ARG A CZ  1 
ATOM   616   N  NH1 . ARG A 1 143 ? -6.008  91.975  61.207  1.00 31.83  ? 121  ARG A NH1 1 
ATOM   617   N  NH2 . ARG A 1 143 ? -6.893  92.421  63.264  1.00 40.17  ? 121  ARG A NH2 1 
ATOM   618   N  N   . ILE A 1 144 ? -4.595  97.873  56.616  1.00 16.02  ? 122  ILE A N   1 
ATOM   619   C  CA  . ILE A 1 144 ? -4.598  98.126  55.177  1.00 19.90  ? 122  ILE A CA  1 
ATOM   620   C  C   . ILE A 1 144 ? -3.366  98.878  54.668  1.00 21.58  ? 122  ILE A C   1 
ATOM   621   O  O   . ILE A 1 144 ? -2.970  98.724  53.506  1.00 23.43  ? 122  ILE A O   1 
ATOM   622   C  CB  . ILE A 1 144 ? -5.900  98.868  54.692  1.00 13.23  ? 122  ILE A CB  1 
ATOM   623   C  CG1 . ILE A 1 144 ? -5.900  100.325 55.135  1.00 17.05  ? 122  ILE A CG1 1 
ATOM   624   C  CG2 . ILE A 1 144 ? -7.136  98.151  55.222  1.00 17.21  ? 122  ILE A CG2 1 
ATOM   625   C  CD1 . ILE A 1 144 ? -6.968  101.166 54.434  1.00 12.00  ? 122  ILE A CD1 1 
ATOM   626   N  N   . SER A 1 145 ? -2.753  99.685  55.526  1.00 23.13  ? 123  SER A N   1 
ATOM   627   C  CA  . SER A 1 145 ? -1.570  100.429 55.114  1.00 27.40  ? 123  SER A CA  1 
ATOM   628   C  C   . SER A 1 145 ? -0.437  99.434  54.916  1.00 28.79  ? 123  SER A C   1 
ATOM   629   O  O   . SER A 1 145 ? 0.210   99.402  53.868  1.00 32.73  ? 123  SER A O   1 
ATOM   630   C  CB  . SER A 1 145 ? -1.181  101.450 56.183  1.00 37.15  ? 123  SER A CB  1 
ATOM   631   O  OG  . SER A 1 145 ? -2.236  102.370 56.416  1.00 42.11  ? 123  SER A OG  1 
ATOM   632   N  N   . LEU A 1 146 ? -0.204  98.613  55.931  1.00 27.94  ? 124  LEU A N   1 
ATOM   633   C  CA  . LEU A 1 146 ? 0.844   97.610  55.857  1.00 23.04  ? 124  LEU A CA  1 
ATOM   634   C  C   . LEU A 1 146 ? 0.608   96.680  54.657  1.00 27.41  ? 124  LEU A C   1 
ATOM   635   O  O   . LEU A 1 146 ? 1.532   96.399  53.881  1.00 28.36  ? 124  LEU A O   1 
ATOM   636   C  CB  . LEU A 1 146 ? 0.880   96.792  57.152  1.00 10.48  ? 124  LEU A CB  1 
ATOM   637   C  CG  . LEU A 1 146 ? 1.861   95.626  57.167  1.00 7.93   ? 124  LEU A CG  1 
ATOM   638   C  CD1 . LEU A 1 146 ? 3.279   96.131  56.864  1.00 16.45  ? 124  LEU A CD1 1 
ATOM   639   C  CD2 . LEU A 1 146 ? 1.804   94.920  58.483  1.00 16.93  ? 124  LEU A CD2 1 
ATOM   640   N  N   . ARG A 1 147 ? -0.634  96.216  54.511  1.00 21.04  ? 125  ARG A N   1 
ATOM   641   C  CA  . ARG A 1 147 ? -1.009  95.318  53.427  1.00 19.08  ? 125  ARG A CA  1 
ATOM   642   C  C   . ARG A 1 147 ? -0.892  95.937  52.029  1.00 23.64  ? 125  ARG A C   1 
ATOM   643   O  O   . ARG A 1 147 ? -0.520  95.250  51.076  1.00 25.92  ? 125  ARG A O   1 
ATOM   644   C  CB  . ARG A 1 147 ? -2.436  94.801  53.635  1.00 21.04  ? 125  ARG A CB  1 
ATOM   645   C  CG  . ARG A 1 147 ? -2.882  93.739  52.622  1.00 20.71  ? 125  ARG A CG  1 
ATOM   646   C  CD  . ARG A 1 147 ? -1.973  92.520  52.654  1.00 24.58  ? 125  ARG A CD  1 
ATOM   647   N  NE  . ARG A 1 147 ? -2.340  91.529  51.645  1.00 24.11  ? 125  ARG A NE  1 
ATOM   648   C  CZ  . ARG A 1 147 ? -3.240  90.572  51.830  1.00 31.78  ? 125  ARG A CZ  1 
ATOM   649   N  NH1 . ARG A 1 147 ? -3.875  90.460  52.991  1.00 30.45  ? 125  ARG A NH1 1 
ATOM   650   N  NH2 . ARG A 1 147 ? -3.501  89.718  50.852  1.00 39.04  ? 125  ARG A NH2 1 
ATOM   651   N  N   . MET A 1 148 ? -1.220  97.218  51.890  1.00 23.70  ? 126  MET A N   1 
ATOM   652   C  CA  . MET A 1 148 ? -1.104  97.855  50.587  1.00 29.05  ? 126  MET A CA  1 
ATOM   653   C  C   . MET A 1 148 ? 0.370   98.031  50.257  1.00 23.51  ? 126  MET A C   1 
ATOM   654   O  O   . MET A 1 148 ? 0.778   97.914  49.105  1.00 25.75  ? 126  MET A O   1 
ATOM   655   C  CB  . MET A 1 148 ? -1.794  99.219  50.566  1.00 31.80  ? 126  MET A CB  1 
ATOM   656   C  CG  . MET A 1 148 ? -3.284  99.184  50.282  1.00 26.76  ? 126  MET A CG  1 
ATOM   657   S  SD  . MET A 1 148 ? -3.913  100.857 50.028  1.00 30.33  ? 126  MET A SD  1 
ATOM   658   C  CE  . MET A 1 148 ? -3.903  101.458 51.666  1.00 24.05  ? 126  MET A CE  1 
ATOM   659   N  N   . ILE A 1 149 ? 1.168   98.320  51.274  1.00 25.22  ? 127  ILE A N   1 
ATOM   660   C  CA  . ILE A 1 149 ? 2.595   98.486  51.061  1.00 24.28  ? 127  ILE A CA  1 
ATOM   661   C  C   . ILE A 1 149 ? 3.187   97.119  50.747  1.00 27.95  ? 127  ILE A C   1 
ATOM   662   O  O   . ILE A 1 149 ? 3.949   96.981  49.794  1.00 34.51  ? 127  ILE A O   1 
ATOM   663   C  CB  . ILE A 1 149 ? 3.302   99.080  52.310  1.00 15.88  ? 127  ILE A CB  1 
ATOM   664   C  CG1 . ILE A 1 149 ? 3.012   100.576 52.410  1.00 20.15  ? 127  ILE A CG1 1 
ATOM   665   C  CG2 . ILE A 1 149 ? 4.789   98.873  52.216  1.00 12.90  ? 127  ILE A CG2 1 
ATOM   666   C  CD1 . ILE A 1 149 ? 3.684   101.259 53.581  1.00 17.01  ? 127  ILE A CD1 1 
ATOM   667   N  N   . GLU A 1 150 ? 2.823   96.106  51.532  1.00 25.03  ? 128  GLU A N   1 
ATOM   668   C  CA  . GLU A 1 150 ? 3.353   94.764  51.314  1.00 30.87  ? 128  GLU A CA  1 
ATOM   669   C  C   . GLU A 1 150 ? 3.008   94.181  49.940  1.00 31.31  ? 128  GLU A C   1 
ATOM   670   O  O   . GLU A 1 150 ? 3.861   93.594  49.269  1.00 36.43  ? 128  GLU A O   1 
ATOM   671   C  CB  . GLU A 1 150 ? 2.883   93.813  52.426  1.00 23.18  ? 128  GLU A CB  1 
ATOM   672   C  CG  . GLU A 1 150 ? 3.794   93.812  53.648  1.00 33.08  ? 128  GLU A CG  1 
ATOM   673   C  CD  . GLU A 1 150 ? 3.274   92.969  54.800  1.00 35.77  ? 128  GLU A CD  1 
ATOM   674   O  OE1 . GLU A 1 150 ? 4.090   92.672  55.710  1.00 33.95  ? 128  GLU A OE1 1 
ATOM   675   O  OE2 . GLU A 1 150 ? 2.062   92.618  54.792  1.00 30.62  ? 128  GLU A OE2 1 
ATOM   676   N  N   . ASP A 1 151 ? 1.765   94.347  49.516  1.00 34.80  ? 129  ASP A N   1 
ATOM   677   C  CA  . ASP A 1 151 ? 1.349   93.827  48.224  1.00 31.25  ? 129  ASP A CA  1 
ATOM   678   C  C   . ASP A 1 151 ? 2.079   94.507  47.073  1.00 30.77  ? 129  ASP A C   1 
ATOM   679   O  O   . ASP A 1 151 ? 2.392   93.866  46.073  1.00 29.57  ? 129  ASP A O   1 
ATOM   680   C  CB  . ASP A 1 151 ? -0.163  93.976  48.058  1.00 30.28  ? 129  ASP A CB  1 
ATOM   681   C  CG  . ASP A 1 151 ? -0.926  92.892  48.778  1.00 25.90  ? 129  ASP A CG  1 
ATOM   682   O  OD1 . ASP A 1 151 ? -2.165  92.974  48.857  1.00 30.00  ? 129  ASP A OD1 1 
ATOM   683   O  OD2 . ASP A 1 151 ? -0.279  91.940  49.262  1.00 44.05  ? 129  ASP A OD2 1 
ATOM   684   N  N   . ALA A 1 152 ? 2.359   95.799  47.226  1.00 27.84  ? 130  ALA A N   1 
ATOM   685   C  CA  . ALA A 1 152 ? 3.062   96.566  46.201  1.00 23.80  ? 130  ALA A CA  1 
ATOM   686   C  C   . ALA A 1 152 ? 4.546   96.191  46.145  1.00 25.43  ? 130  ALA A C   1 
ATOM   687   O  O   . ALA A 1 152 ? 5.196   96.337  45.103  1.00 27.03  ? 130  ALA A O   1 
ATOM   688   C  CB  . ALA A 1 152 ? 2.905   98.052  46.476  1.00 25.35  ? 130  ALA A CB  1 
ATOM   689   N  N   . GLU A 1 153 ? 5.082   95.715  47.269  1.00 24.27  ? 131  GLU A N   1 
ATOM   690   C  CA  . GLU A 1 153 ? 6.485   95.305  47.342  1.00 21.31  ? 131  GLU A CA  1 
ATOM   691   C  C   . GLU A 1 153 ? 6.616   93.948  46.674  1.00 25.11  ? 131  GLU A C   1 
ATOM   692   O  O   . GLU A 1 153 ? 7.508   93.719  45.833  1.00 14.92  ? 131  GLU A O   1 
ATOM   693   C  CB  . GLU A 1 153 ? 6.936   95.198  48.797  1.00 20.02  ? 131  GLU A CB  1 
ATOM   694   C  CG  . GLU A 1 153 ? 7.115   96.536  49.487  1.00 23.13  ? 131  GLU A CG  1 
ATOM   695   C  CD  . GLU A 1 153 ? 7.310   96.387  50.981  1.00 30.92  ? 131  GLU A CD  1 
ATOM   696   O  OE1 . GLU A 1 153 ? 7.649   97.386  51.655  1.00 35.79  ? 131  GLU A OE1 1 
ATOM   697   O  OE2 . GLU A 1 153 ? 7.116   95.267  51.488  1.00 45.32  ? 131  GLU A OE2 1 
ATOM   698   N  N   . ARG A 1 154 ? 5.723   93.045  47.075  1.00 22.17  ? 132  ARG A N   1 
ATOM   699   C  CA  . ARG A 1 154 ? 5.690   91.706  46.511  1.00 35.13  ? 132  ARG A CA  1 
ATOM   700   C  C   . ARG A 1 154 ? 5.510   91.869  44.993  1.00 34.44  ? 132  ARG A C   1 
ATOM   701   O  O   . ARG A 1 154 ? 6.106   91.156  44.191  1.00 33.31  ? 132  ARG A O   1 
ATOM   702   C  CB  . ARG A 1 154 ? 4.503   90.941  47.100  1.00 36.67  ? 132  ARG A CB  1 
ATOM   703   C  CG  . ARG A 1 154 ? 4.600   89.436  46.990  1.00 48.30  ? 132  ARG A CG  1 
ATOM   704   C  CD  . ARG A 1 154 ? 3.285   88.776  47.350  1.00 56.25  ? 132  ARG A CD  1 
ATOM   705   N  NE  . ARG A 1 154 ? 2.213   89.147  46.425  1.00 70.80  ? 132  ARG A NE  1 
ATOM   706   C  CZ  . ARG A 1 154 ? 1.439   90.222  46.555  1.00 74.27  ? 132  ARG A CZ  1 
ATOM   707   N  NH1 . ARG A 1 154 ? 1.608   91.042  47.583  1.00 81.18  ? 132  ARG A NH1 1 
ATOM   708   N  NH2 . ARG A 1 154 ? 0.504   90.488  45.649  1.00 70.57  ? 132  ARG A NH2 1 
ATOM   709   N  N   . ASP A 1 155 ? 4.695   92.854  44.636  1.00 35.67  ? 133  ASP A N   1 
ATOM   710   C  CA  . ASP A 1 155 ? 4.342   93.192  43.264  1.00 36.89  ? 133  ASP A CA  1 
ATOM   711   C  C   . ASP A 1 155 ? 5.476   93.620  42.346  1.00 36.42  ? 133  ASP A C   1 
ATOM   712   O  O   . ASP A 1 155 ? 5.385   93.455  41.138  1.00 26.87  ? 133  ASP A O   1 
ATOM   713   C  CB  . ASP A 1 155 ? 3.302   94.307  43.289  1.00 40.81  ? 133  ASP A CB  1 
ATOM   714   C  CG  . ASP A 1 155 ? 2.092   93.982  42.464  1.00 51.87  ? 133  ASP A CG  1 
ATOM   715   O  OD1 . ASP A 1 155 ? 1.083   94.718  42.568  1.00 51.47  ? 133  ASP A OD1 1 
ATOM   716   O  OD2 . ASP A 1 155 ? 2.156   92.989  41.707  1.00 55.27  ? 133  ASP A OD2 1 
ATOM   717   N  N   . GLY A 1 156 ? 6.536   94.179  42.917  1.00 39.43  ? 134  GLY A N   1 
ATOM   718   C  CA  . GLY A 1 156 ? 7.649   94.651  42.110  1.00 31.22  ? 134  GLY A CA  1 
ATOM   719   C  C   . GLY A 1 156 ? 7.456   96.142  41.861  1.00 30.08  ? 134  GLY A C   1 
ATOM   720   O  O   . GLY A 1 156 ? 8.355   96.849  41.380  1.00 23.00  ? 134  GLY A O   1 
ATOM   721   N  N   . THR A 1 157 ? 6.258   96.607  42.207  1.00 22.66  ? 135  THR A N   1 
ATOM   722   C  CA  . THR A 1 157 ? 5.861   97.998  42.056  1.00 25.99  ? 135  THR A CA  1 
ATOM   723   C  C   . THR A 1 157 ? 6.610   98.966  42.963  1.00 23.88  ? 135  THR A C   1 
ATOM   724   O  O   . THR A 1 157 ? 7.216   99.922  42.491  1.00 30.38  ? 135  THR A O   1 
ATOM   725   C  CB  . THR A 1 157 ? 4.370   98.160  42.365  1.00 30.13  ? 135  THR A CB  1 
ATOM   726   O  OG1 . THR A 1 157 ? 3.610   97.383  41.441  1.00 34.94  ? 135  THR A OG1 1 
ATOM   727   C  CG2 . THR A 1 157 ? 3.949   99.628  42.296  1.00 21.70  ? 135  THR A CG2 1 
ATOM   728   N  N   . LEU A 1 158 ? 6.541   98.712  44.267  1.00 21.11  ? 136  LEU A N   1 
ATOM   729   C  CA  . LEU A 1 158 ? 7.163   99.567  45.281  1.00 21.87  ? 136  LEU A CA  1 
ATOM   730   C  C   . LEU A 1 158 ? 8.613   99.190  45.623  1.00 25.56  ? 136  LEU A C   1 
ATOM   731   O  O   . LEU A 1 158 ? 8.889   98.178  46.274  1.00 21.00  ? 136  LEU A O   1 
ATOM   732   C  CB  . LEU A 1 158 ? 6.298   99.543  46.534  1.00 15.56  ? 136  LEU A CB  1 
ATOM   733   C  CG  . LEU A 1 158 ? 6.636   100.473 47.678  1.00 19.55  ? 136  LEU A CG  1 
ATOM   734   C  CD1 . LEU A 1 158 ? 6.543   101.903 47.212  1.00 23.19  ? 136  LEU A CD1 1 
ATOM   735   C  CD2 . LEU A 1 158 ? 5.662   100.202 48.824  1.00 30.89  ? 136  LEU A CD2 1 
ATOM   736   N  N   . LYS A 1 159 ? 9.531   100.044 45.186  1.00 29.60  ? 137  LYS A N   1 
ATOM   737   C  CA  . LYS A 1 159 ? 10.959  99.836  45.371  1.00 26.48  ? 137  LYS A CA  1 
ATOM   738   C  C   . LYS A 1 159 ? 11.545  100.486 46.629  1.00 29.66  ? 137  LYS A C   1 
ATOM   739   O  O   . LYS A 1 159 ? 11.031  101.489 47.124  1.00 29.12  ? 137  LYS A O   1 
ATOM   740   C  CB  . LYS A 1 159 ? 11.693  100.385 44.148  1.00 23.06  ? 137  LYS A CB  1 
ATOM   741   C  CG  . LYS A 1 159 ? 11.089  99.974  42.796  1.00 25.81  ? 137  LYS A CG  1 
ATOM   742   C  CD  . LYS A 1 159 ? 11.803  100.645 41.619  1.00 17.04  ? 137  LYS A CD  1 
ATOM   743   C  CE  . LYS A 1 159 ? 11.558  102.159 41.613  1.00 19.64  ? 137  LYS A CE  1 
ATOM   744   N  NZ  . LYS A 1 159 ? 10.119  102.514 41.368  1.00 17.75  ? 137  LYS A NZ  1 
ATOM   745   N  N   . PRO A 1 160 ? 12.630  99.904  47.169  1.00 26.00  ? 138  PRO A N   1 
ATOM   746   C  CA  . PRO A 1 160 ? 13.218  100.514 48.356  1.00 24.87  ? 138  PRO A CA  1 
ATOM   747   C  C   . PRO A 1 160 ? 13.461  102.002 48.083  1.00 27.76  ? 138  PRO A C   1 
ATOM   748   O  O   . PRO A 1 160 ? 13.895  102.376 46.997  1.00 33.41  ? 138  PRO A O   1 
ATOM   749   C  CB  . PRO A 1 160 ? 14.516  99.723  48.532  1.00 18.64  ? 138  PRO A CB  1 
ATOM   750   C  CG  . PRO A 1 160 ? 14.093  98.332  48.111  1.00 2.61   ? 138  PRO A CG  1 
ATOM   751   C  CD  . PRO A 1 160 ? 13.258  98.599  46.874  1.00 18.73  ? 138  PRO A CD  1 
ATOM   752   N  N   . GLY A 1 161 ? 13.151  102.844 49.060  1.00 31.72  ? 139  GLY A N   1 
ATOM   753   C  CA  . GLY A 1 161 ? 13.361  104.270 48.899  1.00 35.44  ? 139  GLY A CA  1 
ATOM   754   C  C   . GLY A 1 161 ? 12.317  105.013 48.087  1.00 38.62  ? 139  GLY A C   1 
ATOM   755   O  O   . GLY A 1 161 ? 12.434  106.225 47.886  1.00 43.64  ? 139  GLY A O   1 
ATOM   756   N  N   . ASP A 1 162 ? 11.298  104.308 47.609  1.00 33.85  ? 140  ASP A N   1 
ATOM   757   C  CA  . ASP A 1 162 ? 10.260  104.961 46.826  1.00 28.81  ? 140  ASP A CA  1 
ATOM   758   C  C   . ASP A 1 162 ? 9.395   105.884 47.670  1.00 28.16  ? 140  ASP A C   1 
ATOM   759   O  O   . ASP A 1 162 ? 9.450   105.854 48.907  1.00 27.56  ? 140  ASP A O   1 
ATOM   760   C  CB  . ASP A 1 162 ? 9.399   103.925 46.116  1.00 22.03  ? 140  ASP A CB  1 
ATOM   761   C  CG  . ASP A 1 162 ? 10.000  103.488 44.798  1.00 28.51  ? 140  ASP A CG  1 
ATOM   762   O  OD1 . ASP A 1 162 ? 11.104  103.997 44.479  1.00 25.92  ? 140  ASP A OD1 1 
ATOM   763   O  OD2 . ASP A 1 162 ? 9.369   102.650 44.096  1.00 23.92  ? 140  ASP A OD2 1 
ATOM   764   N  N   . THR A 1 163 ? 8.595   106.704 46.999  1.00 24.45  ? 141  THR A N   1 
ATOM   765   C  CA  . THR A 1 163 ? 7.750   107.655 47.694  1.00 28.15  ? 141  THR A CA  1 
ATOM   766   C  C   . THR A 1 163 ? 6.296   107.261 47.629  1.00 28.75  ? 141  THR A C   1 
ATOM   767   O  O   . THR A 1 163 ? 5.809   106.828 46.582  1.00 29.65  ? 141  THR A O   1 
ATOM   768   C  CB  . THR A 1 163 ? 7.918   109.076 47.111  1.00 31.44  ? 141  THR A CB  1 
ATOM   769   O  OG1 . THR A 1 163 ? 9.272   109.519 47.304  1.00 36.98  ? 141  THR A OG1 1 
ATOM   770   C  CG2 . THR A 1 163 ? 6.978   110.046 47.796  1.00 31.45  ? 141  THR A CG2 1 
ATOM   771   N  N   . ILE A 1 164 ? 5.613   107.399 48.761  1.00 29.90  ? 142  ILE A N   1 
ATOM   772   C  CA  . ILE A 1 164 ? 4.200   107.070 48.852  1.00 30.90  ? 142  ILE A CA  1 
ATOM   773   C  C   . ILE A 1 164 ? 3.421   108.356 49.094  1.00 30.22  ? 142  ILE A C   1 
ATOM   774   O  O   . ILE A 1 164 ? 3.654   109.061 50.073  1.00 33.56  ? 142  ILE A O   1 
ATOM   775   C  CB  . ILE A 1 164 ? 3.933   106.073 50.004  1.00 34.29  ? 142  ILE A CB  1 
ATOM   776   C  CG1 . ILE A 1 164 ? 4.752   104.798 49.774  1.00 36.93  ? 142  ILE A CG1 1 
ATOM   777   C  CG2 . ILE A 1 164 ? 2.448   105.747 50.091  1.00 30.96  ? 142  ILE A CG2 1 
ATOM   778   C  CD1 . ILE A 1 164 ? 4.667   103.788 50.900  1.00 38.25  ? 142  ILE A CD1 1 
ATOM   779   N  N   . ILE A 1 165 ? 2.510   108.662 48.179  1.00 28.14  ? 143  ILE A N   1 
ATOM   780   C  CA  . ILE A 1 165 ? 1.670   109.848 48.259  1.00 24.03  ? 143  ILE A CA  1 
ATOM   781   C  C   . ILE A 1 165 ? 0.245   109.397 48.560  1.00 31.29  ? 143  ILE A C   1 
ATOM   782   O  O   . ILE A 1 165 ? -0.285  108.504 47.895  1.00 38.25  ? 143  ILE A O   1 
ATOM   783   C  CB  . ILE A 1 165 ? 1.652   110.611 46.911  1.00 24.62  ? 143  ILE A CB  1 
ATOM   784   C  CG1 . ILE A 1 165 ? 3.042   111.153 46.595  1.00 16.92  ? 143  ILE A CG1 1 
ATOM   785   C  CG2 . ILE A 1 165 ? 0.627   111.735 46.951  1.00 28.27  ? 143  ILE A CG2 1 
ATOM   786   C  CD1 . ILE A 1 165 ? 3.162   111.712 45.207  1.00 11.83  ? 143  ILE A CD1 1 
ATOM   787   N  N   . GLU A 1 166 ? -0.375  109.998 49.568  1.00 34.76  ? 144  GLU A N   1 
ATOM   788   C  CA  . GLU A 1 166 ? -1.747  109.644 49.894  1.00 35.70  ? 144  GLU A CA  1 
ATOM   789   C  C   . GLU A 1 166 ? -2.601  110.865 50.200  1.00 36.58  ? 144  GLU A C   1 
ATOM   790   O  O   . GLU A 1 166 ? -2.263  111.685 51.057  1.00 28.01  ? 144  GLU A O   1 
ATOM   791   C  CB  . GLU A 1 166 ? -1.816  108.687 51.082  1.00 32.34  ? 144  GLU A CB  1 
ATOM   792   C  CG  . GLU A 1 166 ? -3.222  108.151 51.332  1.00 30.66  ? 144  GLU A CG  1 
ATOM   793   C  CD  . GLU A 1 166 ? -3.721  107.264 50.199  1.00 42.55  ? 144  GLU A CD  1 
ATOM   794   O  OE1 . GLU A 1 166 ? -4.915  106.884 50.224  1.00 43.39  ? 144  GLU A OE1 1 
ATOM   795   O  OE2 . GLU A 1 166 ? -2.916  106.941 49.287  1.00 45.82  ? 144  GLU A OE2 1 
ATOM   796   N  N   . PRO A 1 167 ? -3.715  111.009 49.473  1.00 37.68  ? 145  PRO A N   1 
ATOM   797   C  CA  . PRO A 1 167 ? -4.623  112.131 49.676  1.00 39.69  ? 145  PRO A CA  1 
ATOM   798   C  C   . PRO A 1 167 ? -5.624  111.713 50.740  1.00 39.90  ? 145  PRO A C   1 
ATOM   799   O  O   . PRO A 1 167 ? -6.594  111.011 50.449  1.00 34.47  ? 145  PRO A O   1 
ATOM   800   C  CB  . PRO A 1 167 ? -5.267  112.293 48.304  1.00 44.06  ? 145  PRO A CB  1 
ATOM   801   C  CG  . PRO A 1 167 ? -5.411  110.873 47.857  1.00 40.63  ? 145  PRO A CG  1 
ATOM   802   C  CD  . PRO A 1 167 ? -4.074  110.258 48.253  1.00 40.04  ? 145  PRO A CD  1 
ATOM   803   N  N   . THR A 1 168 ? -5.378  112.113 51.983  1.00 45.81  ? 146  THR A N   1 
ATOM   804   C  CA  . THR A 1 168 ? -6.307  111.739 53.032  1.00 47.10  ? 146  THR A CA  1 
ATOM   805   C  C   . THR A 1 168 ? -6.073  112.446 54.352  1.00 46.36  ? 146  THR A C   1 
ATOM   806   O  O   . THR A 1 168 ? -4.933  112.712 54.750  1.00 45.89  ? 146  THR A O   1 
ATOM   807   C  CB  . THR A 1 168 ? -6.287  110.206 53.263  1.00 48.39  ? 146  THR A CB  1 
ATOM   808   O  OG1 . THR A 1 168 ? -7.441  109.816 54.025  1.00 36.57  ? 146  THR A OG1 1 
ATOM   809   C  CG2 . THR A 1 168 ? -5.015  109.793 53.997  1.00 48.26  ? 146  THR A CG2 1 
ATOM   810   N  N   . SER A 1 169 ? -7.180  112.745 55.022  1.00 46.24  ? 147  SER A N   1 
ATOM   811   C  CA  . SER A 1 169 ? -7.165  113.411 56.316  1.00 46.24  ? 147  SER A CA  1 
ATOM   812   C  C   . SER A 1 169 ? -7.546  112.396 57.396  1.00 44.87  ? 147  SER A C   1 
ATOM   813   O  O   . SER A 1 169 ? -7.986  112.761 58.490  1.00 44.08  ? 147  SER A O   1 
ATOM   814   C  CB  . SER A 1 169 ? -8.174  114.555 56.312  1.00 47.25  ? 147  SER A CB  1 
ATOM   815   O  OG  . SER A 1 169 ? -9.471  114.069 56.018  1.00 47.04  ? 147  SER A OG  1 
ATOM   816   N  N   . GLY A 1 170 ? -7.363  111.121 57.078  1.00 37.70  ? 148  GLY A N   1 
ATOM   817   C  CA  . GLY A 1 170 ? -7.713  110.079 58.015  1.00 33.43  ? 148  GLY A CA  1 
ATOM   818   C  C   . GLY A 1 170 ? -6.575  109.229 58.536  1.00 33.00  ? 148  GLY A C   1 
ATOM   819   O  O   . GLY A 1 170 ? -5.396  109.561 58.392  1.00 32.64  ? 148  GLY A O   1 
ATOM   820   N  N   . ASN A 1 171 ? -6.960  108.108 59.138  1.00 33.15  ? 149  ASN A N   1 
ATOM   821   C  CA  . ASN A 1 171 ? -6.041  107.144 59.726  1.00 32.19  ? 149  ASN A CA  1 
ATOM   822   C  C   . ASN A 1 171 ? -5.151  106.396 58.742  1.00 33.71  ? 149  ASN A C   1 
ATOM   823   O  O   . ASN A 1 171 ? -4.104  105.870 59.125  1.00 31.20  ? 149  ASN A O   1 
ATOM   824   C  CB  . ASN A 1 171 ? -6.836  106.150 60.564  1.00 24.65  ? 149  ASN A CB  1 
ATOM   825   C  CG  . ASN A 1 171 ? -7.378  106.778 61.808  1.00 26.44  ? 149  ASN A CG  1 
ATOM   826   O  OD1 . ASN A 1 171 ? -6.624  107.393 62.569  1.00 16.19  ? 149  ASN A OD1 1 
ATOM   827   N  ND2 . ASN A 1 171 ? -8.679  106.640 62.035  1.00 13.55  ? 149  ASN A ND2 1 
ATOM   828   N  N   . THR A 1 172 ? -5.557  106.336 57.481  1.00 32.63  ? 150  THR A N   1 
ATOM   829   C  CA  . THR A 1 172 ? -4.731  105.655 56.507  1.00 31.56  ? 150  THR A CA  1 
ATOM   830   C  C   . THR A 1 172 ? -3.470  106.490 56.312  1.00 32.46  ? 150  THR A C   1 
ATOM   831   O  O   . THR A 1 172 ? -2.389  105.964 56.027  1.00 33.57  ? 150  THR A O   1 
ATOM   832   C  CB  . THR A 1 172 ? -5.470  105.474 55.182  1.00 31.56  ? 150  THR A CB  1 
ATOM   833   O  OG1 . THR A 1 172 ? -6.554  104.553 55.372  1.00 24.63  ? 150  THR A OG1 1 
ATOM   834   C  CG2 . THR A 1 172 ? -4.530  104.934 54.125  1.00 21.45  ? 150  THR A CG2 1 
ATOM   835   N  N   . GLY A 1 173 ? -3.611  107.798 56.494  1.00 31.74  ? 151  GLY A N   1 
ATOM   836   C  CA  . GLY A 1 173 ? -2.470  108.680 56.356  1.00 30.60  ? 151  GLY A CA  1 
ATOM   837   C  C   . GLY A 1 173 ? -1.464  108.389 57.452  1.00 30.92  ? 151  GLY A C   1 
ATOM   838   O  O   . GLY A 1 173 ? -0.266  108.276 57.199  1.00 36.80  ? 151  GLY A O   1 
ATOM   839   N  N   . ILE A 1 174 ? -1.952  108.267 58.682  1.00 30.06  ? 152  ILE A N   1 
ATOM   840   C  CA  . ILE A 1 174 ? -1.086  107.978 59.821  1.00 25.30  ? 152  ILE A CA  1 
ATOM   841   C  C   . ILE A 1 174 ? -0.473  106.585 59.663  1.00 24.82  ? 152  ILE A C   1 
ATOM   842   O  O   . ILE A 1 174 ? 0.724   106.389 59.912  1.00 28.43  ? 152  ILE A O   1 
ATOM   843   C  CB  . ILE A 1 174 ? -1.884  108.055 61.151  1.00 27.50  ? 152  ILE A CB  1 
ATOM   844   C  CG1 . ILE A 1 174 ? -2.420  109.480 61.343  1.00 18.23  ? 152  ILE A CG1 1 
ATOM   845   C  CG2 . ILE A 1 174 ? -0.997  107.647 62.329  1.00 19.75  ? 152  ILE A CG2 1 
ATOM   846   C  CD1 . ILE A 1 174 ? -3.449  109.605 62.447  1.00 25.74  ? 152  ILE A CD1 1 
ATOM   847   N  N   . GLY A 1 175 ? -1.300  105.625 59.252  1.00 17.71  ? 153  GLY A N   1 
ATOM   848   C  CA  . GLY A 1 175 ? -0.825  104.268 59.042  1.00 19.89  ? 153  GLY A CA  1 
ATOM   849   C  C   . GLY A 1 175 ? 0.318   104.183 58.033  1.00 26.84  ? 153  GLY A C   1 
ATOM   850   O  O   . GLY A 1 175 ? 1.348   103.560 58.297  1.00 27.25  ? 153  GLY A O   1 
ATOM   851   N  N   . LEU A 1 176 ? 0.142   104.806 56.870  1.00 28.86  ? 154  LEU A N   1 
ATOM   852   C  CA  . LEU A 1 176 ? 1.174   104.795 55.841  1.00 27.57  ? 154  LEU A CA  1 
ATOM   853   C  C   . LEU A 1 176 ? 2.436   105.500 56.342  1.00 27.05  ? 154  LEU A C   1 
ATOM   854   O  O   . LEU A 1 176 ? 3.554   105.032 56.117  1.00 28.00  ? 154  LEU A O   1 
ATOM   855   C  CB  . LEU A 1 176 ? 0.665   105.486 54.570  1.00 23.36  ? 154  LEU A CB  1 
ATOM   856   C  CG  . LEU A 1 176 ? -0.462  104.774 53.830  1.00 20.72  ? 154  LEU A CG  1 
ATOM   857   C  CD1 . LEU A 1 176 ? -1.143  105.736 52.880  1.00 9.34   ? 154  LEU A CD1 1 
ATOM   858   C  CD2 . LEU A 1 176 ? 0.099   103.573 53.090  1.00 15.36  ? 154  LEU A CD2 1 
ATOM   859   N  N   . ALA A 1 177 ? 2.253   106.624 57.026  1.00 22.77  ? 155  ALA A N   1 
ATOM   860   C  CA  . ALA A 1 177 ? 3.389   107.370 57.544  1.00 22.63  ? 155  ALA A CA  1 
ATOM   861   C  C   . ALA A 1 177 ? 4.214   106.477 58.490  1.00 26.71  ? 155  ALA A C   1 
ATOM   862   O  O   . ALA A 1 177 ? 5.445   106.385 58.366  1.00 21.29  ? 155  ALA A O   1 
ATOM   863   C  CB  . ALA A 1 177 ? 2.905   108.611 58.261  1.00 10.98  ? 155  ALA A CB  1 
ATOM   864   N  N   . LEU A 1 178 ? 3.532   105.809 59.420  1.00 22.51  ? 156  LEU A N   1 
ATOM   865   C  CA  . LEU A 1 178 ? 4.205   104.923 60.373  1.00 30.04  ? 156  LEU A CA  1 
ATOM   866   C  C   . LEU A 1 178 ? 4.998   103.823 59.658  1.00 31.43  ? 156  LEU A C   1 
ATOM   867   O  O   . LEU A 1 178 ? 6.210   103.669 59.851  1.00 29.21  ? 156  LEU A O   1 
ATOM   868   C  CB  . LEU A 1 178 ? 3.172   104.299 61.318  1.00 25.62  ? 156  LEU A CB  1 
ATOM   869   C  CG  . LEU A 1 178 ? 3.557   103.131 62.231  1.00 26.48  ? 156  LEU A CG  1 
ATOM   870   C  CD1 . LEU A 1 178 ? 4.838   103.414 62.976  1.00 22.74  ? 156  LEU A CD1 1 
ATOM   871   C  CD2 . LEU A 1 178 ? 2.427   102.888 63.222  1.00 19.69  ? 156  LEU A CD2 1 
ATOM   872   N  N   . ALA A 1 179 ? 4.305   103.064 58.820  1.00 29.73  ? 157  ALA A N   1 
ATOM   873   C  CA  . ALA A 1 179 ? 4.943   101.995 58.081  1.00 26.35  ? 157  ALA A CA  1 
ATOM   874   C  C   . ALA A 1 179 ? 6.043   102.541 57.168  1.00 25.04  ? 157  ALA A C   1 
ATOM   875   O  O   . ALA A 1 179 ? 7.049   101.881 56.935  1.00 23.15  ? 157  ALA A O   1 
ATOM   876   C  CB  . ALA A 1 179 ? 3.909   101.243 57.273  1.00 26.94  ? 157  ALA A CB  1 
ATOM   877   N  N   . ALA A 1 180 ? 5.859   103.750 56.656  1.00 26.52  ? 158  ALA A N   1 
ATOM   878   C  CA  . ALA A 1 180 ? 6.860   104.343 55.772  1.00 28.58  ? 158  ALA A CA  1 
ATOM   879   C  C   . ALA A 1 180 ? 8.173   104.576 56.510  1.00 29.61  ? 158  ALA A C   1 
ATOM   880   O  O   . ALA A 1 180 ? 9.235   104.193 56.023  1.00 32.88  ? 158  ALA A O   1 
ATOM   881   C  CB  . ALA A 1 180 ? 6.339   105.669 55.186  1.00 23.31  ? 158  ALA A CB  1 
ATOM   882   N  N   . ALA A 1 181 ? 8.090   105.201 57.683  1.00 25.62  ? 159  ALA A N   1 
ATOM   883   C  CA  . ALA A 1 181 ? 9.274   105.485 58.469  1.00 24.77  ? 159  ALA A CA  1 
ATOM   884   C  C   . ALA A 1 181 ? 10.010  104.205 58.877  1.00 26.16  ? 159  ALA A C   1 
ATOM   885   O  O   . ALA A 1 181 ? 11.233  104.196 58.996  1.00 27.88  ? 159  ALA A O   1 
ATOM   886   C  CB  . ALA A 1 181 ? 8.901   106.302 59.706  1.00 28.36  ? 159  ALA A CB  1 
ATOM   887   N  N   . VAL A 1 182 ? 9.277   103.124 59.092  1.00 21.79  ? 160  VAL A N   1 
ATOM   888   C  CA  . VAL A 1 182 ? 9.935   101.895 59.487  1.00 24.58  ? 160  VAL A CA  1 
ATOM   889   C  C   . VAL A 1 182 ? 10.631  101.234 58.311  1.00 30.49  ? 160  VAL A C   1 
ATOM   890   O  O   . VAL A 1 182 ? 11.757  100.770 58.442  1.00 30.43  ? 160  VAL A O   1 
ATOM   891   C  CB  . VAL A 1 182 ? 8.949   100.866 60.089  1.00 30.58  ? 160  VAL A CB  1 
ATOM   892   C  CG1 . VAL A 1 182 ? 9.714   99.636  60.548  1.00 30.10  ? 160  VAL A CG1 1 
ATOM   893   C  CG2 . VAL A 1 182 ? 8.182   101.470 61.252  1.00 27.81  ? 160  VAL A CG2 1 
ATOM   894   N  N   . ARG A 1 183 ? 9.962   101.199 57.161  1.00 30.06  ? 161  ARG A N   1 
ATOM   895   C  CA  . ARG A 1 183 ? 10.512  100.548 55.973  1.00 32.91  ? 161  ARG A CA  1 
ATOM   896   C  C   . ARG A 1 183 ? 11.442  101.401 55.117  1.00 33.84  ? 161  ARG A C   1 
ATOM   897   O  O   . ARG A 1 183 ? 12.114  100.881 54.235  1.00 35.98  ? 161  ARG A O   1 
ATOM   898   C  CB  . ARG A 1 183 ? 9.379   100.017 55.096  1.00 34.52  ? 161  ARG A CB  1 
ATOM   899   C  CG  . ARG A 1 183 ? 8.281   99.323  55.874  1.00 37.56  ? 161  ARG A CG  1 
ATOM   900   C  CD  . ARG A 1 183 ? 8.648   97.918  56.323  1.00 35.43  ? 161  ARG A CD  1 
ATOM   901   N  NE  . ARG A 1 183 ? 8.041   96.911  55.460  1.00 38.51  ? 161  ARG A NE  1 
ATOM   902   C  CZ  . ARG A 1 183 ? 7.634   95.716  55.876  1.00 46.42  ? 161  ARG A CZ  1 
ATOM   903   N  NH1 . ARG A 1 183 ? 7.765   95.369  57.156  1.00 51.12  ? 161  ARG A NH1 1 
ATOM   904   N  NH2 . ARG A 1 183 ? 7.101   94.866  55.010  1.00 28.19  ? 161  ARG A NH2 1 
ATOM   905   N  N   . GLY A 1 184 ? 11.478  102.703 55.355  1.00 32.96  ? 162  GLY A N   1 
ATOM   906   C  CA  . GLY A 1 184 ? 12.371  103.546 54.582  1.00 28.20  ? 162  GLY A CA  1 
ATOM   907   C  C   . GLY A 1 184 ? 11.771  104.130 53.323  1.00 23.95  ? 162  GLY A C   1 
ATOM   908   O  O   . GLY A 1 184 ? 12.456  104.247 52.312  1.00 25.30  ? 162  GLY A O   1 
ATOM   909   N  N   . TYR A 1 185 ? 10.490  104.481 53.380  1.00 27.71  ? 163  TYR A N   1 
ATOM   910   C  CA  . TYR A 1 185 ? 9.805   105.074 52.235  1.00 30.18  ? 163  TYR A CA  1 
ATOM   911   C  C   . TYR A 1 185 ? 9.531   106.514 52.558  1.00 27.54  ? 163  TYR A C   1 
ATOM   912   O  O   . TYR A 1 185 ? 9.337   106.859 53.710  1.00 31.40  ? 163  TYR A O   1 
ATOM   913   C  CB  . TYR A 1 185 ? 8.462   104.395 51.963  1.00 26.25  ? 163  TYR A CB  1 
ATOM   914   C  CG  . TYR A 1 185 ? 8.580   102.978 51.490  1.00 21.22  ? 163  TYR A CG  1 
ATOM   915   C  CD1 . TYR A 1 185 ? 7.983   101.940 52.195  1.00 23.70  ? 163  TYR A CD1 1 
ATOM   916   C  CD2 . TYR A 1 185 ? 9.303   102.670 50.344  1.00 26.97  ? 163  TYR A CD2 1 
ATOM   917   C  CE1 . TYR A 1 185 ? 8.106   100.619 51.771  1.00 25.08  ? 163  TYR A CE1 1 
ATOM   918   C  CE2 . TYR A 1 185 ? 9.435   101.354 49.907  1.00 32.43  ? 163  TYR A CE2 1 
ATOM   919   C  CZ  . TYR A 1 185 ? 8.836   100.331 50.629  1.00 27.37  ? 163  TYR A CZ  1 
ATOM   920   O  OH  . TYR A 1 185 ? 9.003   99.028  50.221  1.00 23.11  ? 163  TYR A OH  1 
ATOM   921   N  N   . ARG A 1 186 ? 9.522   107.357 51.539  1.00 33.84  ? 164  ARG A N   1 
ATOM   922   C  CA  . ARG A 1 186 ? 9.230   108.764 51.739  1.00 31.12  ? 164  ARG A CA  1 
ATOM   923   C  C   . ARG A 1 186 ? 7.711   108.809 51.729  1.00 31.79  ? 164  ARG A C   1 
ATOM   924   O  O   . ARG A 1 186 ? 7.073   108.093 50.952  1.00 35.27  ? 164  ARG A O   1 
ATOM   925   C  CB  . ARG A 1 186 ? 9.785   109.596 50.589  1.00 33.68  ? 164  ARG A CB  1 
ATOM   926   C  CG  . ARG A 1 186 ? 9.572   111.089 50.745  1.00 42.91  ? 164  ARG A CG  1 
ATOM   927   C  CD  . ARG A 1 186 ? 9.817   111.787 49.431  1.00 51.59  ? 164  ARG A CD  1 
ATOM   928   N  NE  . ARG A 1 186 ? 9.645   113.232 49.525  1.00 60.87  ? 164  ARG A NE  1 
ATOM   929   C  CZ  . ARG A 1 186 ? 9.547   114.035 48.470  1.00 60.11  ? 164  ARG A CZ  1 
ATOM   930   N  NH1 . ARG A 1 186 ? 9.600   113.528 47.243  1.00 58.50  ? 164  ARG A NH1 1 
ATOM   931   N  NH2 . ARG A 1 186 ? 9.403   115.343 48.640  1.00 58.16  ? 164  ARG A NH2 1 
ATOM   932   N  N   . CYS A 1 187 ? 7.131   109.629 52.594  1.00 26.16  ? 165  CYS A N   1 
ATOM   933   C  CA  . CYS A 1 187 ? 5.689   109.717 52.671  1.00 26.03  ? 165  CYS A CA  1 
ATOM   934   C  C   . CYS A 1 187 ? 5.206   111.145 52.549  1.00 29.19  ? 165  CYS A C   1 
ATOM   935   O  O   . CYS A 1 187 ? 5.711   112.042 53.219  1.00 32.91  ? 165  CYS A O   1 
ATOM   936   C  CB  . CYS A 1 187 ? 5.208   109.130 53.994  1.00 26.50  ? 165  CYS A CB  1 
ATOM   937   S  SG  . CYS A 1 187 ? 3.434   108.969 54.073  1.00 21.64  ? 165  CYS A SG  1 
ATOM   938   N  N   . ILE A 1 188 ? 4.220   111.348 51.688  1.00 31.09  ? 166  ILE A N   1 
ATOM   939   C  CA  . ILE A 1 188 ? 3.653   112.667 51.467  1.00 31.06  ? 166  ILE A CA  1 
ATOM   940   C  C   . ILE A 1 188 ? 2.142   112.566 51.560  1.00 35.94  ? 166  ILE A C   1 
ATOM   941   O  O   . ILE A 1 188 ? 1.511   111.915 50.727  1.00 38.36  ? 166  ILE A O   1 
ATOM   942   C  CB  . ILE A 1 188 ? 4.005   113.201 50.064  1.00 31.08  ? 166  ILE A CB  1 
ATOM   943   C  CG1 . ILE A 1 188 ? 5.519   113.365 49.926  1.00 27.30  ? 166  ILE A CG1 1 
ATOM   944   C  CG2 . ILE A 1 188 ? 3.307   114.530 49.823  1.00 38.41  ? 166  ILE A CG2 1 
ATOM   945   C  CD1 . ILE A 1 188 ? 5.970   113.652 48.514  1.00 23.40  ? 166  ILE A CD1 1 
ATOM   946   N  N   . ILE A 1 189 ? 1.562   113.196 52.576  1.00 37.42  ? 167  ILE A N   1 
ATOM   947   C  CA  . ILE A 1 189 ? 0.113   113.186 52.737  1.00 39.22  ? 167  ILE A CA  1 
ATOM   948   C  C   . ILE A 1 189 ? -0.445  114.500 52.209  1.00 39.09  ? 167  ILE A C   1 
ATOM   949   O  O   . ILE A 1 189 ? 0.137   115.559 52.416  1.00 40.30  ? 167  ILE A O   1 
ATOM   950   C  CB  . ILE A 1 189 ? -0.302  113.005 54.218  1.00 39.25  ? 167  ILE A CB  1 
ATOM   951   C  CG1 . ILE A 1 189 ? -0.324  111.518 54.579  1.00 37.52  ? 167  ILE A CG1 1 
ATOM   952   C  CG2 . ILE A 1 189 ? -1.693  113.589 54.451  1.00 41.37  ? 167  ILE A CG2 1 
ATOM   953   C  CD1 . ILE A 1 189 ? 1.004   110.844 54.499  1.00 33.36  ? 167  ILE A CD1 1 
ATOM   954   N  N   . VAL A 1 190 ? -1.566  114.420 51.507  1.00 46.15  ? 168  VAL A N   1 
ATOM   955   C  CA  . VAL A 1 190 ? -2.196  115.606 50.954  1.00 52.32  ? 168  VAL A CA  1 
ATOM   956   C  C   . VAL A 1 190 ? -3.591  115.704 51.558  1.00 57.12  ? 168  VAL A C   1 
ATOM   957   O  O   . VAL A 1 190 ? -4.423  114.812 51.385  1.00 51.37  ? 168  VAL A O   1 
ATOM   958   C  CB  . VAL A 1 190 ? -2.276  115.526 49.411  1.00 50.23  ? 168  VAL A CB  1 
ATOM   959   C  CG1 . VAL A 1 190 ? -2.899  116.790 48.853  1.00 54.12  ? 168  VAL A CG1 1 
ATOM   960   C  CG2 . VAL A 1 190 ? -0.885  115.345 48.833  1.00 46.88  ? 168  VAL A CG2 1 
ATOM   961   N  N   . MET A 1 191 ? -3.828  116.795 52.281  1.00 65.21  ? 169  MET A N   1 
ATOM   962   C  CA  . MET A 1 191 ? -5.102  117.025 52.954  1.00 67.78  ? 169  MET A CA  1 
ATOM   963   C  C   . MET A 1 191 ? -5.542  118.480 52.826  1.00 70.26  ? 169  MET A C   1 
ATOM   964   O  O   . MET A 1 191 ? -4.741  119.351 52.482  1.00 67.34  ? 169  MET A O   1 
ATOM   965   C  CB  . MET A 1 191 ? -4.948  116.693 54.434  1.00 68.00  ? 169  MET A CB  1 
ATOM   966   C  CG  . MET A 1 191 ? -3.955  117.608 55.131  1.00 64.86  ? 169  MET A CG  1 
ATOM   967   S  SD  . MET A 1 191 ? -3.650  117.151 56.829  1.00 64.86  ? 169  MET A SD  1 
ATOM   968   C  CE  . MET A 1 191 ? -2.100  116.309 56.664  1.00 65.39  ? 169  MET A CE  1 
ATOM   969   N  N   . PRO A 1 192 ? -6.825  118.761 53.116  1.00 74.03  ? 170  PRO A N   1 
ATOM   970   C  CA  . PRO A 1 192 ? -7.374  120.121 53.042  1.00 77.46  ? 170  PRO A CA  1 
ATOM   971   C  C   . PRO A 1 192 ? -6.553  121.120 53.866  1.00 78.70  ? 170  PRO A C   1 
ATOM   972   O  O   . PRO A 1 192 ? -5.453  120.802 54.317  1.00 80.25  ? 170  PRO A O   1 
ATOM   973   C  CB  . PRO A 1 192 ? -8.788  119.942 53.579  1.00 76.71  ? 170  PRO A CB  1 
ATOM   974   C  CG  . PRO A 1 192 ? -9.145  118.570 53.070  1.00 75.23  ? 170  PRO A CG  1 
ATOM   975   C  CD  . PRO A 1 192 ? -7.893  117.778 53.377  1.00 71.90  ? 170  PRO A CD  1 
ATOM   976   N  N   . GLU A 1 193 ? -7.084  122.321 54.070  1.00 78.88  ? 171  GLU A N   1 
ATOM   977   C  CA  . GLU A 1 193 ? -6.356  123.333 54.833  1.00 78.35  ? 171  GLU A CA  1 
ATOM   978   C  C   . GLU A 1 193 ? -6.757  123.399 56.307  1.00 74.20  ? 171  GLU A C   1 
ATOM   979   O  O   . GLU A 1 193 ? -6.211  124.189 57.074  1.00 75.16  ? 171  GLU A O   1 
ATOM   980   C  CB  . GLU A 1 193 ? -6.517  124.714 54.182  1.00 81.29  ? 171  GLU A CB  1 
ATOM   981   C  CG  . GLU A 1 193 ? -7.945  125.249 54.120  1.00 89.38  ? 171  GLU A CG  1 
ATOM   982   C  CD  . GLU A 1 193 ? -8.039  126.579 53.376  1.00 93.66  ? 171  GLU A CD  1 
ATOM   983   O  OE1 . GLU A 1 193 ? -7.312  127.527 53.749  1.00 96.23  ? 171  GLU A OE1 1 
ATOM   984   O  OE2 . GLU A 1 193 ? -8.840  126.678 52.420  1.00 96.06  ? 171  GLU A OE2 1 
ATOM   985   N  N   . LYS A 1 194 ? -7.709  122.561 56.702  1.00 70.05  ? 172  LYS A N   1 
ATOM   986   C  CA  . LYS A 1 194 ? -8.157  122.526 58.089  1.00 67.58  ? 172  LYS A CA  1 
ATOM   987   C  C   . LYS A 1 194 ? -7.413  121.428 58.845  1.00 66.76  ? 172  LYS A C   1 
ATOM   988   O  O   . LYS A 1 194 ? -6.232  121.567 59.173  1.00 66.53  ? 172  LYS A O   1 
ATOM   989   C  CB  . LYS A 1 194 ? -9.658  122.258 58.156  1.00 67.60  ? 172  LYS A CB  1 
ATOM   990   C  CG  . LYS A 1 194 ? -10.540 123.201 57.347  1.00 72.28  ? 172  LYS A CG  1 
ATOM   991   C  CD  . LYS A 1 194 ? -10.458 122.924 55.848  1.00 75.35  ? 172  LYS A CD  1 
ATOM   992   C  CE  . LYS A 1 194 ? -11.377 123.854 55.066  1.00 77.69  ? 172  LYS A CE  1 
ATOM   993   N  NZ  . LYS A 1 194 ? -11.281 123.636 53.597  1.00 78.59  ? 172  LYS A NZ  1 
ATOM   994   N  N   . MET A 1 195 ? -8.115  120.336 59.123  1.00 65.54  ? 173  MET A N   1 
ATOM   995   C  CA  . MET A 1 195 ? -7.560  119.176 59.823  1.00 65.48  ? 173  MET A CA  1 
ATOM   996   C  C   . MET A 1 195 ? -6.974  119.361 61.213  1.00 62.58  ? 173  MET A C   1 
ATOM   997   O  O   . MET A 1 195 ? -6.130  120.220 61.451  1.00 63.98  ? 173  MET A O   1 
ATOM   998   C  CB  . MET A 1 195 ? -6.560  118.454 58.924  1.00 70.68  ? 173  MET A CB  1 
ATOM   999   C  CG  . MET A 1 195 ? -7.175  117.252 58.241  1.00 76.79  ? 173  MET A CG  1 
ATOM   1000  S  SD  . MET A 1 195 ? -8.955  117.495 57.940  1.00 85.78  ? 173  MET A SD  1 
ATOM   1001  C  CE  . MET A 1 195 ? -9.709  116.809 59.510  1.00 84.43  ? 173  MET A CE  1 
ATOM   1002  N  N   . SER A 1 196 ? -7.440  118.504 62.117  1.00 57.36  ? 174  SER A N   1 
ATOM   1003  C  CA  . SER A 1 196 ? -7.035  118.484 63.516  1.00 54.79  ? 174  SER A CA  1 
ATOM   1004  C  C   . SER A 1 196 ? -5.525  118.457 63.719  1.00 53.13  ? 174  SER A C   1 
ATOM   1005  O  O   . SER A 1 196 ? -4.786  117.931 62.889  1.00 46.42  ? 174  SER A O   1 
ATOM   1006  C  CB  . SER A 1 196 ? -7.653  117.266 64.192  1.00 56.66  ? 174  SER A CB  1 
ATOM   1007  O  OG  . SER A 1 196 ? -8.994  117.091 63.759  1.00 67.29  ? 174  SER A OG  1 
ATOM   1008  N  N   . SER A 1 197 ? -5.078  119.028 64.836  1.00 56.28  ? 175  SER A N   1 
ATOM   1009  C  CA  . SER A 1 197 ? -3.655  119.051 65.178  1.00 58.71  ? 175  SER A CA  1 
ATOM   1010  C  C   . SER A 1 197 ? -3.236  117.671 65.677  1.00 54.52  ? 175  SER A C   1 
ATOM   1011  O  O   . SER A 1 197 ? -2.093  117.250 65.494  1.00 46.31  ? 175  SER A O   1 
ATOM   1012  C  CB  . SER A 1 197 ? -3.378  120.092 66.266  1.00 62.78  ? 175  SER A CB  1 
ATOM   1013  O  OG  . SER A 1 197 ? -3.656  121.400 65.799  1.00 70.56  ? 175  SER A OG  1 
ATOM   1014  N  N   . GLU A 1 198 ? -4.173  116.979 66.319  1.00 55.39  ? 176  GLU A N   1 
ATOM   1015  C  CA  . GLU A 1 198 ? -3.918  115.642 66.830  1.00 53.85  ? 176  GLU A CA  1 
ATOM   1016  C  C   . GLU A 1 198 ? -3.328  114.804 65.712  1.00 49.45  ? 176  GLU A C   1 
ATOM   1017  O  O   . GLU A 1 198 ? -2.368  114.056 65.911  1.00 47.06  ? 176  GLU A O   1 
ATOM   1018  C  CB  . GLU A 1 198 ? -5.220  114.994 67.302  1.00 59.30  ? 176  GLU A CB  1 
ATOM   1019  C  CG  . GLU A 1 198 ? -5.477  115.081 68.800  1.00 69.40  ? 176  GLU A CG  1 
ATOM   1020  C  CD  . GLU A 1 198 ? -5.555  116.506 69.299  1.00 69.66  ? 176  GLU A CD  1 
ATOM   1021  O  OE1 . GLU A 1 198 ? -4.494  117.079 69.631  1.00 72.50  ? 176  GLU A OE1 1 
ATOM   1022  O  OE2 . GLU A 1 198 ? -6.678  117.052 69.350  1.00 64.55  ? 176  GLU A OE2 1 
ATOM   1023  N  N   . LYS A 1 199 ? -3.914  114.947 64.528  1.00 45.43  ? 177  LYS A N   1 
ATOM   1024  C  CA  . LYS A 1 199 ? -3.473  114.206 63.361  1.00 39.73  ? 177  LYS A CA  1 
ATOM   1025  C  C   . LYS A 1 199 ? -2.249  114.802 62.661  1.00 36.19  ? 177  LYS A C   1 
ATOM   1026  O  O   . LYS A 1 199 ? -1.338  114.065 62.292  1.00 45.17  ? 177  LYS A O   1 
ATOM   1027  C  CB  . LYS A 1 199 ? -4.643  114.059 62.383  1.00 32.74  ? 177  LYS A CB  1 
ATOM   1028  C  CG  . LYS A 1 199 ? -5.781  113.209 62.938  1.00 21.63  ? 177  LYS A CG  1 
ATOM   1029  C  CD  . LYS A 1 199 ? -6.967  113.142 61.987  1.00 21.16  ? 177  LYS A CD  1 
ATOM   1030  C  CE  . LYS A 1 199 ? -7.624  114.510 61.830  1.00 25.88  ? 177  LYS A CE  1 
ATOM   1031  N  NZ  . LYS A 1 199 ? -8.836  114.491 60.971  1.00 32.76  ? 177  LYS A NZ  1 
ATOM   1032  N  N   . VAL A 1 200 ? -2.201  116.120 62.499  1.00 28.36  ? 178  VAL A N   1 
ATOM   1033  C  CA  . VAL A 1 200 ? -1.069  116.730 61.817  1.00 29.36  ? 178  VAL A CA  1 
ATOM   1034  C  C   . VAL A 1 200 ? 0.247   116.555 62.555  1.00 36.81  ? 178  VAL A C   1 
ATOM   1035  O  O   . VAL A 1 200 ? 1.270   116.264 61.934  1.00 37.47  ? 178  VAL A O   1 
ATOM   1036  C  CB  . VAL A 1 200 ? -1.282  118.236 61.559  1.00 29.92  ? 178  VAL A CB  1 
ATOM   1037  C  CG1 . VAL A 1 200 ? 0.015   118.866 61.092  1.00 20.24  ? 178  VAL A CG1 1 
ATOM   1038  C  CG2 . VAL A 1 200 ? -2.353  118.444 60.498  1.00 26.34  ? 178  VAL A CG2 1 
ATOM   1039  N  N   . ASP A 1 201 ? 0.238   116.730 63.872  1.00 41.27  ? 179  ASP A N   1 
ATOM   1040  C  CA  . ASP A 1 201 ? 1.470   116.586 64.634  1.00 43.99  ? 179  ASP A CA  1 
ATOM   1041  C  C   . ASP A 1 201 ? 1.952   115.138 64.689  1.00 41.67  ? 179  ASP A C   1 
ATOM   1042  O  O   . ASP A 1 201 ? 3.156   114.883 64.754  1.00 42.83  ? 179  ASP A O   1 
ATOM   1043  C  CB  . ASP A 1 201 ? 1.300   117.169 66.041  1.00 54.16  ? 179  ASP A CB  1 
ATOM   1044  C  CG  . ASP A 1 201 ? 1.232   118.694 66.036  1.00 61.43  ? 179  ASP A CG  1 
ATOM   1045  O  OD1 . ASP A 1 201 ? 2.196   119.337 65.551  1.00 60.03  ? 179  ASP A OD1 1 
ATOM   1046  O  OD2 . ASP A 1 201 ? 0.215   119.247 66.516  1.00 66.07  ? 179  ASP A OD2 1 
ATOM   1047  N  N   . VAL A 1 202 ? 1.024   114.187 64.651  1.00 38.27  ? 180  VAL A N   1 
ATOM   1048  C  CA  . VAL A 1 202 ? 1.416   112.785 64.658  1.00 36.47  ? 180  VAL A CA  1 
ATOM   1049  C  C   . VAL A 1 202 ? 2.066   112.462 63.309  1.00 36.04  ? 180  VAL A C   1 
ATOM   1050  O  O   . VAL A 1 202 ? 3.080   111.759 63.251  1.00 43.20  ? 180  VAL A O   1 
ATOM   1051  C  CB  . VAL A 1 202 ? 0.206   111.847 64.906  1.00 34.98  ? 180  VAL A CB  1 
ATOM   1052  C  CG1 . VAL A 1 202 ? 0.589   110.397 64.590  1.00 20.46  ? 180  VAL A CG1 1 
ATOM   1053  C  CG2 . VAL A 1 202 ? -0.237  111.961 66.366  1.00 25.74  ? 180  VAL A CG2 1 
ATOM   1054  N  N   . LEU A 1 203 ? 1.490   112.980 62.226  1.00 29.55  ? 181  LEU A N   1 
ATOM   1055  C  CA  . LEU A 1 203 ? 2.048   112.764 60.888  1.00 26.38  ? 181  LEU A CA  1 
ATOM   1056  C  C   . LEU A 1 203 ? 3.457   113.342 60.784  1.00 22.58  ? 181  LEU A C   1 
ATOM   1057  O  O   . LEU A 1 203 ? 4.383   112.672 60.334  1.00 24.63  ? 181  LEU A O   1 
ATOM   1058  C  CB  . LEU A 1 203 ? 1.166   113.419 59.820  1.00 25.09  ? 181  LEU A CB  1 
ATOM   1059  C  CG  . LEU A 1 203 ? -0.086  112.645 59.424  1.00 27.65  ? 181  LEU A CG  1 
ATOM   1060  C  CD1 . LEU A 1 203 ? -0.920  113.464 58.459  1.00 26.45  ? 181  LEU A CD1 1 
ATOM   1061  C  CD2 . LEU A 1 203 ? 0.323   111.325 58.796  1.00 29.95  ? 181  LEU A CD2 1 
ATOM   1062  N  N   . ARG A 1 204 ? 3.609   114.596 61.196  1.00 25.75  ? 182  ARG A N   1 
ATOM   1063  C  CA  . ARG A 1 204 ? 4.903   115.259 61.147  1.00 31.70  ? 182  ARG A CA  1 
ATOM   1064  C  C   . ARG A 1 204 ? 5.925   114.522 62.014  1.00 36.62  ? 182  ARG A C   1 
ATOM   1065  O  O   . ARG A 1 204 ? 7.114   114.516 61.702  1.00 39.58  ? 182  ARG A O   1 
ATOM   1066  C  CB  . ARG A 1 204 ? 4.777   116.716 61.607  1.00 29.97  ? 182  ARG A CB  1 
ATOM   1067  C  CG  . ARG A 1 204 ? 3.787   117.554 60.804  1.00 37.46  ? 182  ARG A CG  1 
ATOM   1068  C  CD  . ARG A 1 204 ? 3.710   118.997 61.321  1.00 46.41  ? 182  ARG A CD  1 
ATOM   1069  N  NE  . ARG A 1 204 ? 4.887   119.789 60.961  1.00 55.80  ? 182  ARG A NE  1 
ATOM   1070  C  CZ  . ARG A 1 204 ? 5.069   120.381 59.779  1.00 60.13  ? 182  ARG A CZ  1 
ATOM   1071  N  NH1 . ARG A 1 204 ? 4.146   120.284 58.826  1.00 52.43  ? 182  ARG A NH1 1 
ATOM   1072  N  NH2 . ARG A 1 204 ? 6.183   121.067 59.543  1.00 58.30  ? 182  ARG A NH2 1 
ATOM   1073  N  N   . ALA A 1 205 ? 5.467   113.898 63.098  1.00 38.51  ? 183  ALA A N   1 
ATOM   1074  C  CA  . ALA A 1 205 ? 6.368   113.161 63.989  1.00 33.96  ? 183  ALA A CA  1 
ATOM   1075  C  C   . ALA A 1 205 ? 6.842   111.863 63.335  1.00 32.54  ? 183  ALA A C   1 
ATOM   1076  O  O   . ALA A 1 205 ? 7.943   111.373 63.606  1.00 28.83  ? 183  ALA A O   1 
ATOM   1077  C  CB  . ALA A 1 205 ? 5.671   112.854 65.315  1.00 31.70  ? 183  ALA A CB  1 
ATOM   1078  N  N   . LEU A 1 206 ? 5.995   111.293 62.486  1.00 30.75  ? 184  LEU A N   1 
ATOM   1079  C  CA  . LEU A 1 206 ? 6.356   110.063 61.791  1.00 26.94  ? 184  LEU A CA  1 
ATOM   1080  C  C   . LEU A 1 206 ? 7.240   110.391 60.575  1.00 26.28  ? 184  LEU A C   1 
ATOM   1081  O  O   . LEU A 1 206 ? 7.696   109.498 59.852  1.00 18.69  ? 184  LEU A O   1 
ATOM   1082  C  CB  . LEU A 1 206 ? 5.090   109.307 61.386  1.00 11.19  ? 184  LEU A CB  1 
ATOM   1083  C  CG  . LEU A 1 206 ? 4.340   108.751 62.591  1.00 20.11  ? 184  LEU A CG  1 
ATOM   1084  C  CD1 . LEU A 1 206 ? 2.939   108.333 62.188  1.00 23.32  ? 184  LEU A CD1 1 
ATOM   1085  C  CD2 . LEU A 1 206 ? 5.129   107.571 63.174  1.00 16.33  ? 184  LEU A CD2 1 
ATOM   1086  N  N   . GLY A 1 207 ? 7.490   111.684 60.374  1.00 27.71  ? 185  GLY A N   1 
ATOM   1087  C  CA  . GLY A 1 207 ? 8.344   112.121 59.281  1.00 30.38  ? 185  GLY A CA  1 
ATOM   1088  C  C   . GLY A 1 207 ? 7.635   112.341 57.959  1.00 34.90  ? 185  GLY A C   1 
ATOM   1089  O  O   . GLY A 1 207 ? 8.286   112.544 56.930  1.00 38.68  ? 185  GLY A O   1 
ATOM   1090  N  N   . ALA A 1 208 ? 6.307   112.324 57.988  1.00 30.91  ? 186  ALA A N   1 
ATOM   1091  C  CA  . ALA A 1 208 ? 5.513   112.505 56.782  1.00 31.44  ? 186  ALA A CA  1 
ATOM   1092  C  C   . ALA A 1 208 ? 5.428   113.953 56.333  1.00 34.41  ? 186  ALA A C   1 
ATOM   1093  O  O   . ALA A 1 208 ? 5.183   114.853 57.138  1.00 42.92  ? 186  ALA A O   1 
ATOM   1094  C  CB  . ALA A 1 208 ? 4.108   111.957 56.998  1.00 30.47  ? 186  ALA A CB  1 
ATOM   1095  N  N   . GLU A 1 209 ? 5.622   114.167 55.038  1.00 31.68  ? 187  GLU A N   1 
ATOM   1096  C  CA  . GLU A 1 209 ? 5.540   115.496 54.467  1.00 32.92  ? 187  GLU A CA  1 
ATOM   1097  C  C   . GLU A 1 209 ? 4.073   115.822 54.237  1.00 37.69  ? 187  GLU A C   1 
ATOM   1098  O  O   . GLU A 1 209 ? 3.328   115.024 53.659  1.00 41.72  ? 187  GLU A O   1 
ATOM   1099  C  CB  . GLU A 1 209 ? 6.293   115.547 53.144  1.00 30.20  ? 187  GLU A CB  1 
ATOM   1100  C  CG  . GLU A 1 209 ? 7.748   115.152 53.252  1.00 23.10  ? 187  GLU A CG  1 
ATOM   1101  C  CD  . GLU A 1 209 ? 8.497   115.353 51.945  1.00 38.10  ? 187  GLU A CD  1 
ATOM   1102  O  OE1 . GLU A 1 209 ? 9.703   115.034 51.900  1.00 34.14  ? 187  GLU A OE1 1 
ATOM   1103  O  OE2 . GLU A 1 209 ? 7.882   115.835 50.960  1.00 42.50  ? 187  GLU A OE2 1 
ATOM   1104  N  N   . ILE A 1 210 ? 3.652   116.995 54.688  1.00 40.30  ? 188  ILE A N   1 
ATOM   1105  C  CA  . ILE A 1 210 ? 2.263   117.383 54.523  1.00 43.28  ? 188  ILE A CA  1 
ATOM   1106  C  C   . ILE A 1 210 ? 2.088   118.458 53.468  1.00 44.15  ? 188  ILE A C   1 
ATOM   1107  O  O   . ILE A 1 210 ? 2.887   119.384 53.375  1.00 46.39  ? 188  ILE A O   1 
ATOM   1108  C  CB  . ILE A 1 210 ? 1.672   117.870 55.853  1.00 40.83  ? 188  ILE A CB  1 
ATOM   1109  C  CG1 . ILE A 1 210 ? 1.774   116.748 56.888  1.00 30.56  ? 188  ILE A CG1 1 
ATOM   1110  C  CG2 . ILE A 1 210 ? 0.222   118.297 55.655  1.00 42.37  ? 188  ILE A CG2 1 
ATOM   1111  C  CD1 . ILE A 1 210 ? 1.322   117.144 58.267  1.00 38.22  ? 188  ILE A CD1 1 
ATOM   1112  N  N   . VAL A 1 211 ? 1.041   118.311 52.665  1.00 44.92  ? 189  VAL A N   1 
ATOM   1113  C  CA  . VAL A 1 211 ? 0.727   119.255 51.606  1.00 41.65  ? 189  VAL A CA  1 
ATOM   1114  C  C   . VAL A 1 211 ? -0.692  119.747 51.833  1.00 45.19  ? 189  VAL A C   1 
ATOM   1115  O  O   . VAL A 1 211 ? -1.639  118.959 51.842  1.00 44.62  ? 189  VAL A O   1 
ATOM   1116  C  CB  . VAL A 1 211 ? 0.828   118.590 50.214  1.00 40.08  ? 189  VAL A CB  1 
ATOM   1117  C  CG1 . VAL A 1 211 ? 0.259   119.515 49.149  1.00 38.30  ? 189  VAL A CG1 1 
ATOM   1118  C  CG2 . VAL A 1 211 ? 2.287   118.256 49.901  1.00 29.04  ? 189  VAL A CG2 1 
ATOM   1119  N  N   . ARG A 1 212 ? -0.827  121.053 52.031  1.00 48.51  ? 190  ARG A N   1 
ATOM   1120  C  CA  . ARG A 1 212 ? -2.121  121.677 52.269  1.00 52.24  ? 190  ARG A CA  1 
ATOM   1121  C  C   . ARG A 1 212 ? -2.713  122.238 50.981  1.00 54.38  ? 190  ARG A C   1 
ATOM   1122  O  O   . ARG A 1 212 ? -2.024  122.911 50.213  1.00 57.30  ? 190  ARG A O   1 
ATOM   1123  C  CB  . ARG A 1 212 ? -1.959  122.802 53.288  1.00 58.48  ? 190  ARG A CB  1 
ATOM   1124  C  CG  . ARG A 1 212 ? -1.406  122.338 54.617  1.00 63.97  ? 190  ARG A CG  1 
ATOM   1125  C  CD  . ARG A 1 212 ? -2.495  121.747 55.500  1.00 72.80  ? 190  ARG A CD  1 
ATOM   1126  N  NE  . ARG A 1 212 ? -3.182  122.777 56.283  1.00 76.40  ? 190  ARG A NE  1 
ATOM   1127  C  CZ  . ARG A 1 212 ? -2.582  123.566 57.174  1.00 72.06  ? 190  ARG A CZ  1 
ATOM   1128  N  NH1 . ARG A 1 212 ? -1.280  123.450 57.401  1.00 64.70  ? 190  ARG A NH1 1 
ATOM   1129  N  NH2 . ARG A 1 212 ? -3.284  124.469 57.847  1.00 72.01  ? 190  ARG A NH2 1 
ATOM   1130  N  N   . THR A 1 213 ? -3.991  121.957 50.752  1.00 55.24  ? 191  THR A N   1 
ATOM   1131  C  CA  . THR A 1 213 ? -4.676  122.436 49.558  1.00 62.06  ? 191  THR A CA  1 
ATOM   1132  C  C   . THR A 1 213 ? -5.700  123.490 49.944  1.00 68.70  ? 191  THR A C   1 
ATOM   1133  O  O   . THR A 1 213 ? -6.280  123.431 51.026  1.00 70.18  ? 191  THR A O   1 
ATOM   1134  C  CB  . THR A 1 213 ? -5.416  121.300 48.833  1.00 60.73  ? 191  THR A CB  1 
ATOM   1135  O  OG1 . THR A 1 213 ? -6.488  120.821 49.657  1.00 55.48  ? 191  THR A OG1 1 
ATOM   1136  C  CG2 . THR A 1 213 ? -4.457  120.159 48.523  1.00 60.31  ? 191  THR A CG2 1 
ATOM   1137  N  N   . PRO A 1 214 ? -5.939  124.472 49.058  1.00 74.73  ? 192  PRO A N   1 
ATOM   1138  C  CA  . PRO A 1 214 ? -6.911  125.534 49.336  1.00 75.96  ? 192  PRO A CA  1 
ATOM   1139  C  C   . PRO A 1 214 ? -8.309  124.990 49.643  1.00 77.04  ? 192  PRO A C   1 
ATOM   1140  O  O   . PRO A 1 214 ? -8.653  124.790 50.806  1.00 75.51  ? 192  PRO A O   1 
ATOM   1141  C  CB  . PRO A 1 214 ? -6.866  126.386 48.064  1.00 77.53  ? 192  PRO A CB  1 
ATOM   1142  C  CG  . PRO A 1 214 ? -6.426  125.408 47.000  1.00 78.71  ? 192  PRO A CG  1 
ATOM   1143  C  CD  . PRO A 1 214 ? -5.354  124.631 47.715  1.00 77.12  ? 192  PRO A CD  1 
ATOM   1144  N  N   . THR A 1 215 ? -9.103  124.746 48.601  1.00 78.79  ? 193  THR A N   1 
ATOM   1145  C  CA  . THR A 1 215 ? -10.463 124.226 48.759  1.00 78.50  ? 193  THR A CA  1 
ATOM   1146  C  C   . THR A 1 215 ? -11.207 124.865 49.935  1.00 78.95  ? 193  THR A C   1 
ATOM   1147  O  O   . THR A 1 215 ? -11.351 124.266 51.003  1.00 73.50  ? 193  THR A O   1 
ATOM   1148  C  CB  . THR A 1 215 ? -10.427 122.702 48.929  1.00 78.15  ? 193  THR A CB  1 
ATOM   1149  N  N   . GLU A 1 223 ? -11.203 116.191 42.342  1.00 77.23  ? 201  GLU A N   1 
ATOM   1150  C  CA  . GLU A 1 223 ? -11.314 116.915 43.604  1.00 78.47  ? 201  GLU A CA  1 
ATOM   1151  C  C   . GLU A 1 223 ? -10.231 117.989 43.751  1.00 79.90  ? 201  GLU A C   1 
ATOM   1152  O  O   . GLU A 1 223 ? -9.615  118.402 42.759  1.00 79.48  ? 201  GLU A O   1 
ATOM   1153  C  CB  . GLU A 1 223 ? -11.238 115.934 44.781  1.00 80.41  ? 201  GLU A CB  1 
ATOM   1154  N  N   . SER A 1 224 ? -10.007 118.437 44.988  1.00 77.97  ? 202  SER A N   1 
ATOM   1155  C  CA  . SER A 1 224 ? -9.011  119.470 45.274  1.00 75.76  ? 202  SER A CA  1 
ATOM   1156  C  C   . SER A 1 224 ? -7.692  118.870 45.740  1.00 71.85  ? 202  SER A C   1 
ATOM   1157  O  O   . SER A 1 224 ? -6.677  118.986 45.050  1.00 70.60  ? 202  SER A O   1 
ATOM   1158  C  CB  . SER A 1 224 ? -9.534  120.444 46.336  1.00 78.93  ? 202  SER A CB  1 
ATOM   1159  O  OG  . SER A 1 224 ? -9.733  119.794 47.580  1.00 85.43  ? 202  SER A OG  1 
ATOM   1160  N  N   . HIS A 1 225 ? -7.699  118.238 46.912  1.00 68.85  ? 203  HIS A N   1 
ATOM   1161  C  CA  . HIS A 1 225 ? -6.484  117.621 47.431  1.00 63.31  ? 203  HIS A CA  1 
ATOM   1162  C  C   . HIS A 1 225 ? -6.174  116.344 46.652  1.00 61.94  ? 203  HIS A C   1 
ATOM   1163  O  O   . HIS A 1 225 ? -5.012  115.946 46.520  1.00 55.53  ? 203  HIS A O   1 
ATOM   1164  C  CB  . HIS A 1 225 ? -6.613  117.317 48.934  1.00 63.32  ? 203  HIS A CB  1 
ATOM   1165  C  CG  . HIS A 1 225 ? -7.736  116.389 49.287  1.00 65.42  ? 203  HIS A CG  1 
ATOM   1166  N  ND1 . HIS A 1 225 ? -7.803  115.739 50.500  1.00 65.17  ? 203  HIS A ND1 1 
ATOM   1167  C  CD2 . HIS A 1 225 ? -8.841  116.016 48.599  1.00 67.43  ? 203  HIS A CD2 1 
ATOM   1168  C  CE1 . HIS A 1 225 ? -8.899  115.003 50.544  1.00 67.09  ? 203  HIS A CE1 1 
ATOM   1169  N  NE2 . HIS A 1 225 ? -9.547  115.154 49.403  1.00 68.29  ? 203  HIS A NE2 1 
ATOM   1170  N  N   . VAL A 1 226 ? -7.220  115.715 46.123  1.00 58.46  ? 204  VAL A N   1 
ATOM   1171  C  CA  . VAL A 1 226 ? -7.063  114.496 45.343  1.00 58.46  ? 204  VAL A CA  1 
ATOM   1172  C  C   . VAL A 1 226 ? -6.343  114.845 44.042  1.00 58.91  ? 204  VAL A C   1 
ATOM   1173  O  O   . VAL A 1 226 ? -5.501  114.087 43.559  1.00 58.63  ? 204  VAL A O   1 
ATOM   1174  C  CB  . VAL A 1 226 ? -8.435  113.866 45.010  1.00 58.12  ? 204  VAL A CB  1 
ATOM   1175  C  CG1 . VAL A 1 226 ? -8.244  112.533 44.308  1.00 57.73  ? 204  VAL A CG1 1 
ATOM   1176  C  CG2 . VAL A 1 226 ? -9.240  113.682 46.280  1.00 59.62  ? 204  VAL A CG2 1 
ATOM   1177  N  N   . GLY A 1 227 ? -6.680  116.005 43.485  1.00 56.36  ? 205  GLY A N   1 
ATOM   1178  C  CA  . GLY A 1 227 ? -6.058  116.438 42.251  1.00 49.08  ? 205  GLY A CA  1 
ATOM   1179  C  C   . GLY A 1 227 ? -4.587  116.725 42.454  1.00 50.81  ? 205  GLY A C   1 
ATOM   1180  O  O   . GLY A 1 227 ? -3.757  116.406 41.593  1.00 48.37  ? 205  GLY A O   1 
ATOM   1181  N  N   . VAL A 1 228 ? -4.263  117.329 43.597  1.00 50.41  ? 206  VAL A N   1 
ATOM   1182  C  CA  . VAL A 1 228 ? -2.878  117.663 43.925  1.00 50.20  ? 206  VAL A CA  1 
ATOM   1183  C  C   . VAL A 1 228 ? -2.073  116.389 44.175  1.00 48.74  ? 206  VAL A C   1 
ATOM   1184  O  O   . VAL A 1 228 ? -0.877  116.313 43.875  1.00 46.84  ? 206  VAL A O   1 
ATOM   1185  C  CB  . VAL A 1 228 ? -2.800  118.565 45.171  1.00 52.35  ? 206  VAL A CB  1 
ATOM   1186  C  CG1 . VAL A 1 228 ? -1.346  118.950 45.442  1.00 50.44  ? 206  VAL A CG1 1 
ATOM   1187  C  CG2 . VAL A 1 228 ? -3.659  119.805 44.964  1.00 49.79  ? 206  VAL A CG2 1 
ATOM   1188  N  N   . ALA A 1 229 ? -2.736  115.389 44.736  1.00 47.43  ? 207  ALA A N   1 
ATOM   1189  C  CA  . ALA A 1 229 ? -2.078  114.123 44.986  1.00 47.27  ? 207  ALA A CA  1 
ATOM   1190  C  C   . ALA A 1 229 ? -1.607  113.603 43.627  1.00 47.66  ? 207  ALA A C   1 
ATOM   1191  O  O   . ALA A 1 229 ? -0.416  113.388 43.404  1.00 42.46  ? 207  ALA A O   1 
ATOM   1192  C  CB  . ALA A 1 229 ? -3.057  113.143 45.621  1.00 45.63  ? 207  ALA A CB  1 
ATOM   1193  N  N   . TRP A 1 230 ? -2.557  113.426 42.715  1.00 46.07  ? 208  TRP A N   1 
ATOM   1194  C  CA  . TRP A 1 230 ? -2.248  112.928 41.387  1.00 48.20  ? 208  TRP A CA  1 
ATOM   1195  C  C   . TRP A 1 230 ? -1.302  113.814 40.590  1.00 47.13  ? 208  TRP A C   1 
ATOM   1196  O  O   . TRP A 1 230 ? -0.572  113.326 39.730  1.00 50.09  ? 208  TRP A O   1 
ATOM   1197  C  CB  . TRP A 1 230 ? -3.540  112.680 40.610  1.00 51.94  ? 208  TRP A CB  1 
ATOM   1198  C  CG  . TRP A 1 230 ? -3.801  111.214 40.443  1.00 63.46  ? 208  TRP A CG  1 
ATOM   1199  C  CD1 . TRP A 1 230 ? -3.299  110.396 39.467  1.00 66.22  ? 208  TRP A CD1 1 
ATOM   1200  C  CD2 . TRP A 1 230 ? -4.538  110.365 41.336  1.00 67.24  ? 208  TRP A CD2 1 
ATOM   1201  N  NE1 . TRP A 1 230 ? -3.674  109.092 39.699  1.00 67.17  ? 208  TRP A NE1 1 
ATOM   1202  C  CE2 . TRP A 1 230 ? -4.435  109.045 40.838  1.00 67.85  ? 208  TRP A CE2 1 
ATOM   1203  C  CE3 . TRP A 1 230 ? -5.274  110.592 42.510  1.00 65.30  ? 208  TRP A CE3 1 
ATOM   1204  C  CZ2 . TRP A 1 230 ? -5.041  107.953 41.474  1.00 67.87  ? 208  TRP A CZ2 1 
ATOM   1205  C  CZ3 . TRP A 1 230 ? -5.877  109.506 43.143  1.00 69.68  ? 208  TRP A CZ3 1 
ATOM   1206  C  CH2 . TRP A 1 230 ? -5.755  108.202 42.620  1.00 70.34  ? 208  TRP A CH2 1 
ATOM   1207  N  N   . ARG A 1 231 ? -1.311  115.111 40.870  1.00 48.35  ? 209  ARG A N   1 
ATOM   1208  C  CA  . ARG A 1 231 ? -0.423  116.033 40.174  1.00 46.64  ? 209  ARG A CA  1 
ATOM   1209  C  C   . ARG A 1 231 ? 1.006   115.701 40.595  1.00 49.08  ? 209  ARG A C   1 
ATOM   1210  O  O   . ARG A 1 231 ? 1.889   115.508 39.757  1.00 49.23  ? 209  ARG A O   1 
ATOM   1211  C  CB  . ARG A 1 231 ? -0.751  117.480 40.561  1.00 50.31  ? 209  ARG A CB  1 
ATOM   1212  C  CG  . ARG A 1 231 ? 0.071   118.536 39.821  1.00 61.02  ? 209  ARG A CG  1 
ATOM   1213  C  CD  . ARG A 1 231 ? 0.122   119.861 40.589  1.00 68.87  ? 209  ARG A CD  1 
ATOM   1214  N  NE  . ARG A 1 231 ? 0.948   119.768 41.796  1.00 74.85  ? 209  ARG A NE  1 
ATOM   1215  C  CZ  . ARG A 1 231 ? 1.188   120.778 42.631  1.00 75.11  ? 209  ARG A CZ  1 
ATOM   1216  N  NH1 . ARG A 1 231 ? 0.663   121.974 42.397  1.00 74.89  ? 209  ARG A NH1 1 
ATOM   1217  N  NH2 . ARG A 1 231 ? 1.956   120.595 43.699  1.00 72.84  ? 209  ARG A NH2 1 
ATOM   1218  N  N   . LEU A 1 232 ? 1.213   115.630 41.909  1.00 49.75  ? 210  LEU A N   1 
ATOM   1219  C  CA  . LEU A 1 232 ? 2.518   115.335 42.497  1.00 49.39  ? 210  LEU A CA  1 
ATOM   1220  C  C   . LEU A 1 232 ? 3.078   113.984 42.074  1.00 46.03  ? 210  LEU A C   1 
ATOM   1221  O  O   . LEU A 1 232 ? 4.292   113.825 41.920  1.00 42.11  ? 210  LEU A O   1 
ATOM   1222  C  CB  . LEU A 1 232 ? 2.418   115.382 44.021  1.00 50.80  ? 210  LEU A CB  1 
ATOM   1223  C  CG  . LEU A 1 232 ? 2.096   116.750 44.619  1.00 54.58  ? 210  LEU A CG  1 
ATOM   1224  C  CD1 . LEU A 1 232 ? 1.580   116.584 46.040  1.00 54.89  ? 210  LEU A CD1 1 
ATOM   1225  C  CD2 . LEU A 1 232 ? 3.340   117.624 44.584  1.00 51.48  ? 210  LEU A CD2 1 
ATOM   1226  N  N   . LYS A 1 233 ? 2.193   113.009 41.902  1.00 46.52  ? 211  LYS A N   1 
ATOM   1227  C  CA  . LYS A 1 233 ? 2.623   111.677 41.511  1.00 48.28  ? 211  LYS A CA  1 
ATOM   1228  C  C   . LYS A 1 233 ? 3.344   111.718 40.174  1.00 50.16  ? 211  LYS A C   1 
ATOM   1229  O  O   . LYS A 1 233 ? 4.320   110.998 39.973  1.00 51.80  ? 211  LYS A O   1 
ATOM   1230  C  CB  . LYS A 1 233 ? 1.434   110.726 41.414  1.00 42.08  ? 211  LYS A CB  1 
ATOM   1231  C  CG  . LYS A 1 233 ? 1.853   109.339 40.970  1.00 44.70  ? 211  LYS A CG  1 
ATOM   1232  C  CD  . LYS A 1 233 ? 0.675   108.413 40.762  1.00 44.27  ? 211  LYS A CD  1 
ATOM   1233  C  CE  . LYS A 1 233 ? 1.160   107.045 40.314  1.00 43.64  ? 211  LYS A CE  1 
ATOM   1234  N  NZ  . LYS A 1 233 ? 1.974   107.147 39.061  1.00 43.26  ? 211  LYS A NZ  1 
ATOM   1235  N  N   . ASN A 1 234 ? 2.855   112.559 39.264  1.00 52.14  ? 212  ASN A N   1 
ATOM   1236  C  CA  . ASN A 1 234 ? 3.459   112.701 37.941  1.00 53.31  ? 212  ASN A CA  1 
ATOM   1237  C  C   . ASN A 1 234 ? 4.685   113.595 37.992  1.00 51.85  ? 212  ASN A C   1 
ATOM   1238  O  O   . ASN A 1 234 ? 5.530   113.544 37.106  1.00 52.12  ? 212  ASN A O   1 
ATOM   1239  C  CB  . ASN A 1 234 ? 2.463   113.300 36.947  1.00 51.19  ? 212  ASN A CB  1 
ATOM   1240  C  CG  . ASN A 1 234 ? 1.220   112.460 36.798  1.00 52.20  ? 212  ASN A CG  1 
ATOM   1241  O  OD1 . ASN A 1 234 ? 1.296   111.262 36.525  1.00 45.88  ? 212  ASN A OD1 1 
ATOM   1242  N  ND2 . ASN A 1 234 ? 0.062   113.084 36.975  1.00 52.60  ? 212  ASN A ND2 1 
ATOM   1243  N  N   . GLU A 1 235 ? 4.781   114.411 39.036  1.00 53.90  ? 213  GLU A N   1 
ATOM   1244  C  CA  . GLU A 1 235 ? 5.902   115.324 39.174  1.00 51.62  ? 213  GLU A CA  1 
ATOM   1245  C  C   . GLU A 1 235 ? 7.051   114.755 39.986  1.00 50.89  ? 213  GLU A C   1 
ATOM   1246  O  O   . GLU A 1 235 ? 8.165   115.267 39.924  1.00 54.13  ? 213  GLU A O   1 
ATOM   1247  C  CB  . GLU A 1 235 ? 5.426   116.633 39.795  1.00 54.66  ? 213  GLU A CB  1 
ATOM   1248  C  CG  . GLU A 1 235 ? 4.337   117.318 38.992  1.00 58.74  ? 213  GLU A CG  1 
ATOM   1249  C  CD  . GLU A 1 235 ? 3.982   118.687 39.534  1.00 65.73  ? 213  GLU A CD  1 
ATOM   1250  O  OE1 . GLU A 1 235 ? 3.134   119.365 38.912  1.00 65.42  ? 213  GLU A OE1 1 
ATOM   1251  O  OE2 . GLU A 1 235 ? 4.549   119.084 40.578  1.00 73.28  ? 213  GLU A OE2 1 
ATOM   1252  N  N   . ILE A 1 236 ? 6.791   113.694 40.742  1.00 47.49  ? 214  ILE A N   1 
ATOM   1253  C  CA  . ILE A 1 236 ? 7.842   113.100 41.560  1.00 43.96  ? 214  ILE A CA  1 
ATOM   1254  C  C   . ILE A 1 236 ? 8.191   111.678 41.142  1.00 43.02  ? 214  ILE A C   1 
ATOM   1255  O  O   . ILE A 1 236 ? 7.350   110.774 41.187  1.00 43.37  ? 214  ILE A O   1 
ATOM   1256  C  CB  . ILE A 1 236 ? 7.445   113.097 43.037  1.00 44.10  ? 214  ILE A CB  1 
ATOM   1257  C  CG1 . ILE A 1 236 ? 6.963   114.489 43.441  1.00 42.23  ? 214  ILE A CG1 1 
ATOM   1258  C  CG2 . ILE A 1 236 ? 8.633   112.682 43.885  1.00 41.38  ? 214  ILE A CG2 1 
ATOM   1259  C  CD1 . ILE A 1 236 ? 6.283   114.537 44.788  1.00 44.41  ? 214  ILE A CD1 1 
ATOM   1260  N  N   . PRO A 1 237 ? 9.450   111.461 40.735  1.00 40.77  ? 215  PRO A N   1 
ATOM   1261  C  CA  . PRO A 1 237 ? 9.917   110.139 40.304  1.00 38.97  ? 215  PRO A CA  1 
ATOM   1262  C  C   . PRO A 1 237 ? 9.742   109.131 41.441  1.00 33.30  ? 215  PRO A C   1 
ATOM   1263  O  O   . PRO A 1 237 ? 9.888   109.482 42.608  1.00 26.01  ? 215  PRO A O   1 
ATOM   1264  C  CB  . PRO A 1 237 ? 11.398  110.378 39.974  1.00 40.73  ? 215  PRO A CB  1 
ATOM   1265  C  CG  . PRO A 1 237 ? 11.478  111.856 39.707  1.00 36.59  ? 215  PRO A CG  1 
ATOM   1266  C  CD  . PRO A 1 237 ? 10.560  112.429 40.748  1.00 39.45  ? 215  PRO A CD  1 
ATOM   1267  N  N   . ASN A 1 238 ? 9.434   107.888 41.086  1.00 30.32  ? 216  ASN A N   1 
ATOM   1268  C  CA  . ASN A 1 238 ? 9.244   106.816 42.051  1.00 27.87  ? 216  ASN A CA  1 
ATOM   1269  C  C   . ASN A 1 238 ? 8.097   107.066 43.010  1.00 27.94  ? 216  ASN A C   1 
ATOM   1270  O  O   . ASN A 1 238 ? 8.169   106.702 44.186  1.00 28.20  ? 216  ASN A O   1 
ATOM   1271  C  CB  . ASN A 1 238 ? 10.532  106.572 42.849  1.00 30.88  ? 216  ASN A CB  1 
ATOM   1272  C  CG  . ASN A 1 238 ? 11.668  106.059 41.983  1.00 25.91  ? 216  ASN A CG  1 
ATOM   1273  O  OD1 . ASN A 1 238 ? 11.463  105.206 41.120  1.00 31.21  ? 216  ASN A OD1 1 
ATOM   1274  N  ND2 . ASN A 1 238 ? 12.874  106.563 42.221  1.00 13.12  ? 216  ASN A ND2 1 
ATOM   1275  N  N   . SER A 1 239 ? 7.038   107.685 42.502  1.00 25.82  ? 217  SER A N   1 
ATOM   1276  C  CA  . SER A 1 239 ? 5.862   107.973 43.308  1.00 24.04  ? 217  SER A CA  1 
ATOM   1277  C  C   . SER A 1 239 ? 4.771   106.935 43.112  1.00 28.28  ? 217  SER A C   1 
ATOM   1278  O  O   . SER A 1 239 ? 4.619   106.365 42.040  1.00 30.01  ? 217  SER A O   1 
ATOM   1279  C  CB  . SER A 1 239 ? 5.307   109.347 42.963  1.00 22.53  ? 217  SER A CB  1 
ATOM   1280  O  OG  . SER A 1 239 ? 6.102   110.358 43.545  1.00 35.06  ? 217  SER A OG  1 
ATOM   1281  N  N   . HIS A 1 240 ? 4.004   106.698 44.167  1.00 36.54  ? 218  HIS A N   1 
ATOM   1282  C  CA  . HIS A 1 240 ? 2.907   105.743 44.123  1.00 30.14  ? 218  HIS A CA  1 
ATOM   1283  C  C   . HIS A 1 240 ? 1.800   106.237 45.023  1.00 30.42  ? 218  HIS A C   1 
ATOM   1284  O  O   . HIS A 1 240 ? 2.049   106.664 46.147  1.00 35.92  ? 218  HIS A O   1 
ATOM   1285  C  CB  . HIS A 1 240 ? 3.356   104.383 44.640  1.00 27.21  ? 218  HIS A CB  1 
ATOM   1286  C  CG  . HIS A 1 240 ? 4.564   103.842 43.951  1.00 29.92  ? 218  HIS A CG  1 
ATOM   1287  N  ND1 . HIS A 1 240 ? 4.494   103.139 42.769  1.00 30.93  ? 218  HIS A ND1 1 
ATOM   1288  C  CD2 . HIS A 1 240 ? 5.876   103.914 44.271  1.00 29.93  ? 218  HIS A CD2 1 
ATOM   1289  C  CE1 . HIS A 1 240 ? 5.714   102.798 42.391  1.00 33.18  ? 218  HIS A CE1 1 
ATOM   1290  N  NE2 . HIS A 1 240 ? 6.571   103.256 43.285  1.00 29.09  ? 218  HIS A NE2 1 
ATOM   1291  N  N   . ILE A 1 241 ? 0.580   106.190 44.520  1.00 29.34  ? 219  ILE A N   1 
ATOM   1292  C  CA  . ILE A 1 241 ? -0.578  106.566 45.306  1.00 27.38  ? 219  ILE A CA  1 
ATOM   1293  C  C   . ILE A 1 241 ? -1.273  105.232 45.536  1.00 28.99  ? 219  ILE A C   1 
ATOM   1294  O  O   . ILE A 1 241 ? -1.877  104.670 44.622  1.00 24.17  ? 219  ILE A O   1 
ATOM   1295  C  CB  . ILE A 1 241 ? -1.504  107.515 44.538  1.00 24.55  ? 219  ILE A CB  1 
ATOM   1296  C  CG1 . ILE A 1 241 ? -0.833  108.885 44.412  1.00 27.28  ? 219  ILE A CG1 1 
ATOM   1297  C  CG2 . ILE A 1 241 ? -2.854  107.618 45.243  1.00 21.00  ? 219  ILE A CG2 1 
ATOM   1298  C  CD1 . ILE A 1 241 ? -1.527  109.832 43.449  1.00 27.39  ? 219  ILE A CD1 1 
ATOM   1299  N  N   . LEU A 1 242 ? -1.159  104.707 46.751  1.00 32.71  ? 220  LEU A N   1 
ATOM   1300  C  CA  . LEU A 1 242 ? -1.770  103.423 47.055  1.00 29.93  ? 220  LEU A CA  1 
ATOM   1301  C  C   . LEU A 1 242 ? -3.278  103.454 46.837  1.00 32.54  ? 220  LEU A C   1 
ATOM   1302  O  O   . LEU A 1 242 ? -3.809  102.587 46.159  1.00 37.79  ? 220  LEU A O   1 
ATOM   1303  C  CB  . LEU A 1 242 ? -1.386  102.993 48.472  1.00 22.18  ? 220  LEU A CB  1 
ATOM   1304  C  CG  . LEU A 1 242 ? 0.122   102.736 48.484  1.00 22.76  ? 220  LEU A CG  1 
ATOM   1305  C  CD1 . LEU A 1 242 ? 0.621   102.431 49.871  1.00 20.93  ? 220  LEU A CD1 1 
ATOM   1306  C  CD2 . LEU A 1 242 ? 0.433   101.593 47.534  1.00 19.03  ? 220  LEU A CD2 1 
ATOM   1307  N  N   . ASP A 1 243 ? -3.967  104.447 47.394  1.00 31.98  ? 221  ASP A N   1 
ATOM   1308  C  CA  . ASP A 1 243 ? -5.415  104.600 47.194  1.00 28.78  ? 221  ASP A CA  1 
ATOM   1309  C  C   . ASP A 1 243 ? -6.310  103.548 47.828  1.00 20.54  ? 221  ASP A C   1 
ATOM   1310  O  O   . ASP A 1 243 ? -6.679  102.575 47.189  1.00 22.63  ? 221  ASP A O   1 
ATOM   1311  C  CB  . ASP A 1 243 ? -5.718  104.682 45.688  1.00 25.83  ? 221  ASP A CB  1 
ATOM   1312  C  CG  . ASP A 1 243 ? -7.201  104.915 45.388  1.00 34.81  ? 221  ASP A CG  1 
ATOM   1313  O  OD1 . ASP A 1 243 ? -7.568  104.948 44.195  1.00 40.48  ? 221  ASP A OD1 1 
ATOM   1314  O  OD2 . ASP A 1 243 ? -8.006  105.068 46.330  1.00 33.14  ? 221  ASP A OD2 1 
ATOM   1315  N  N   . GLN A 1 244 ? -6.701  103.794 49.071  1.00 26.13  ? 222  GLN A N   1 
ATOM   1316  C  CA  . GLN A 1 244 ? -7.554  102.894 49.847  1.00 27.33  ? 222  GLN A CA  1 
ATOM   1317  C  C   . GLN A 1 244 ? -8.949  102.642 49.276  1.00 27.09  ? 222  GLN A C   1 
ATOM   1318  O  O   . GLN A 1 244 ? -9.579  101.635 49.585  1.00 24.84  ? 222  GLN A O   1 
ATOM   1319  C  CB  . GLN A 1 244 ? -7.694  103.457 51.262  1.00 28.08  ? 222  GLN A CB  1 
ATOM   1320  C  CG  . GLN A 1 244 ? -8.178  104.900 51.272  1.00 31.44  ? 222  GLN A CG  1 
ATOM   1321  C  CD  . GLN A 1 244 ? -8.109  105.540 52.645  1.00 31.26  ? 222  GLN A CD  1 
ATOM   1322  O  OE1 . GLN A 1 244 ? -7.796  106.718 52.768  1.00 35.51  ? 222  GLN A OE1 1 
ATOM   1323  N  NE2 . GLN A 1 244 ? -8.413  104.772 53.676  1.00 30.67  ? 222  GLN A NE2 1 
ATOM   1324  N  N   . TYR A 1 245 ? -9.439  103.557 48.452  1.00 32.33  ? 223  TYR A N   1 
ATOM   1325  C  CA  . TYR A 1 245 ? -10.780 103.416 47.893  1.00 33.85  ? 223  TYR A CA  1 
ATOM   1326  C  C   . TYR A 1 245 ? -10.911 102.417 46.745  1.00 36.05  ? 223  TYR A C   1 
ATOM   1327  O  O   . TYR A 1 245 ? -12.009 101.927 46.482  1.00 36.92  ? 223  TYR A O   1 
ATOM   1328  C  CB  . TYR A 1 245 ? -11.308 104.794 47.479  1.00 34.53  ? 223  TYR A CB  1 
ATOM   1329  C  CG  . TYR A 1 245 ? -11.647 105.677 48.668  1.00 38.21  ? 223  TYR A CG  1 
ATOM   1330  C  CD1 . TYR A 1 245 ? -12.815 105.466 49.404  1.00 42.80  ? 223  TYR A CD1 1 
ATOM   1331  C  CD2 . TYR A 1 245 ? -10.777 106.688 49.090  1.00 34.57  ? 223  TYR A CD2 1 
ATOM   1332  C  CE1 . TYR A 1 245 ? -13.114 106.234 50.531  1.00 42.98  ? 223  TYR A CE1 1 
ATOM   1333  C  CE2 . TYR A 1 245 ? -11.060 107.461 50.219  1.00 32.61  ? 223  TYR A CE2 1 
ATOM   1334  C  CZ  . TYR A 1 245 ? -12.231 107.227 50.934  1.00 47.14  ? 223  TYR A CZ  1 
ATOM   1335  O  OH  . TYR A 1 245 ? -12.518 107.976 52.060  1.00 51.07  ? 223  TYR A OH  1 
ATOM   1336  N  N   . ARG A 1 246 ? -9.802  102.101 46.072  1.00 37.86  ? 224  ARG A N   1 
ATOM   1337  C  CA  . ARG A 1 246 ? -9.834  101.149 44.959  1.00 32.27  ? 224  ARG A CA  1 
ATOM   1338  C  C   . ARG A 1 246 ? -8.894  99.957  45.105  1.00 26.00  ? 224  ARG A C   1 
ATOM   1339  O  O   . ARG A 1 246 ? -9.072  98.940  44.434  1.00 18.20  ? 224  ARG A O   1 
ATOM   1340  C  CB  . ARG A 1 246 ? -9.510  101.844 43.629  1.00 40.06  ? 224  ARG A CB  1 
ATOM   1341  C  CG  . ARG A 1 246 ? -10.549 102.836 43.150  1.00 46.80  ? 224  ARG A CG  1 
ATOM   1342  C  CD  . ARG A 1 246 ? -10.436 103.103 41.652  1.00 51.89  ? 224  ARG A CD  1 
ATOM   1343  N  NE  . ARG A 1 246 ? -10.932 101.996 40.832  1.00 53.67  ? 224  ARG A NE  1 
ATOM   1344  C  CZ  . ARG A 1 246 ? -10.170 101.241 40.046  1.00 56.73  ? 224  ARG A CZ  1 
ATOM   1345  N  NH1 . ARG A 1 246 ? -8.864  101.464 39.970  1.00 57.60  ? 224  ARG A NH1 1 
ATOM   1346  N  NH2 . ARG A 1 246 ? -10.718 100.270 39.324  1.00 57.21  ? 224  ARG A NH2 1 
ATOM   1347  N  N   . ASN A 1 247 ? -7.894  100.084 45.967  1.00 20.81  ? 225  ASN A N   1 
ATOM   1348  C  CA  . ASN A 1 247 ? -6.923  99.014  46.161  1.00 15.67  ? 225  ASN A CA  1 
ATOM   1349  C  C   . ASN A 1 247 ? -7.455  97.775  46.888  1.00 16.35  ? 225  ASN A C   1 
ATOM   1350  O  O   . ASN A 1 247 ? -7.776  97.825  48.077  1.00 18.62  ? 225  ASN A O   1 
ATOM   1351  C  CB  . ASN A 1 247 ? -5.709  99.546  46.910  1.00 9.16   ? 225  ASN A CB  1 
ATOM   1352  C  CG  . ASN A 1 247 ? -4.523  98.641  46.778  1.00 12.22  ? 225  ASN A CG  1 
ATOM   1353  O  OD1 . ASN A 1 247 ? -4.665  97.419  46.815  1.00 14.61  ? 225  ASN A OD1 1 
ATOM   1354  N  ND2 . ASN A 1 247 ? -3.338  99.226  46.630  1.00 20.06  ? 225  ASN A ND2 1 
ATOM   1355  N  N   . ALA A 1 248 ? -7.526  96.662  46.165  1.00 16.61  ? 226  ALA A N   1 
ATOM   1356  C  CA  . ALA A 1 248 ? -8.013  95.396  46.709  1.00 19.63  ? 226  ALA A CA  1 
ATOM   1357  C  C   . ALA A 1 248 ? -7.330  94.975  48.002  1.00 24.92  ? 226  ALA A C   1 
ATOM   1358  O  O   . ALA A 1 248 ? -7.908  94.240  48.816  1.00 25.56  ? 226  ALA A O   1 
ATOM   1359  C  CB  . ALA A 1 248 ? -7.858  94.297  45.676  1.00 16.24  ? 226  ALA A CB  1 
ATOM   1360  N  N   . SER A 1 249 ? -6.097  95.430  48.191  1.00 26.31  ? 227  SER A N   1 
ATOM   1361  C  CA  . SER A 1 249 ? -5.338  95.093  49.397  1.00 27.70  ? 227  SER A CA  1 
ATOM   1362  C  C   . SER A 1 249 ? -6.082  95.491  50.678  1.00 23.59  ? 227  SER A C   1 
ATOM   1363  O  O   . SER A 1 249 ? -5.863  94.916  51.742  1.00 19.00  ? 227  SER A O   1 
ATOM   1364  C  CB  . SER A 1 249 ? -3.975  95.788  49.358  1.00 27.44  ? 227  SER A CB  1 
ATOM   1365  O  OG  . SER A 1 249 ? -3.225  95.363  48.234  1.00 26.04  ? 227  SER A OG  1 
ATOM   1366  N  N   . ASN A 1 250 ? -6.950  96.490  50.563  1.00 20.63  ? 228  ASN A N   1 
ATOM   1367  C  CA  . ASN A 1 250 ? -7.729  96.955  51.694  1.00 27.61  ? 228  ASN A CA  1 
ATOM   1368  C  C   . ASN A 1 250 ? -8.725  95.877  52.139  1.00 27.98  ? 228  ASN A C   1 
ATOM   1369  O  O   . ASN A 1 250 ? -8.563  95.283  53.199  1.00 24.57  ? 228  ASN A O   1 
ATOM   1370  C  CB  . ASN A 1 250 ? -8.457  98.242  51.321  1.00 34.73  ? 228  ASN A CB  1 
ATOM   1371  C  CG  . ASN A 1 250 ? -9.390  98.716  52.400  1.00 39.55  ? 228  ASN A CG  1 
ATOM   1372  O  OD1 . ASN A 1 250 ? -9.621  98.025  53.395  1.00 47.15  ? 228  ASN A OD1 1 
ATOM   1373  N  ND2 . ASN A 1 250 ? -9.945  99.901  52.208  1.00 33.61  ? 228  ASN A ND2 1 
ATOM   1374  N  N   . PRO A 1 251 ? -9.768  95.607  51.337  1.00 25.31  ? 229  PRO A N   1 
ATOM   1375  C  CA  . PRO A 1 251 ? -10.707 94.572  51.775  1.00 24.07  ? 229  PRO A CA  1 
ATOM   1376  C  C   . PRO A 1 251 ? -10.045 93.218  51.951  1.00 24.36  ? 229  PRO A C   1 
ATOM   1377  O  O   . PRO A 1 251 ? -10.499 92.403  52.744  1.00 25.97  ? 229  PRO A O   1 
ATOM   1378  C  CB  . PRO A 1 251 ? -11.758 94.567  50.670  1.00 25.56  ? 229  PRO A CB  1 
ATOM   1379  C  CG  . PRO A 1 251 ? -10.967 94.955  49.450  1.00 23.76  ? 229  PRO A CG  1 
ATOM   1380  C  CD  . PRO A 1 251 ? -10.122 96.094  49.990  1.00 34.33  ? 229  PRO A CD  1 
ATOM   1381  N  N   . LEU A 1 252 ? -8.967  92.974  51.212  1.00 29.09  ? 230  LEU A N   1 
ATOM   1382  C  CA  . LEU A 1 252 ? -8.263  91.699  51.317  1.00 25.36  ? 230  LEU A CA  1 
ATOM   1383  C  C   . LEU A 1 252 ? -7.603  91.532  52.682  1.00 27.18  ? 230  LEU A C   1 
ATOM   1384  O  O   . LEU A 1 252 ? -7.611  90.433  53.249  1.00 21.55  ? 230  LEU A O   1 
ATOM   1385  C  CB  . LEU A 1 252 ? -7.221  91.568  50.203  1.00 27.65  ? 230  LEU A CB  1 
ATOM   1386  C  CG  . LEU A 1 252 ? -7.772  91.245  48.804  1.00 30.78  ? 230  LEU A CG  1 
ATOM   1387  C  CD1 . LEU A 1 252 ? -6.633  91.261  47.787  1.00 25.11  ? 230  LEU A CD1 1 
ATOM   1388  C  CD2 . LEU A 1 252 ? -8.467  89.878  48.809  1.00 30.19  ? 230  LEU A CD2 1 
ATOM   1389  N  N   . ALA A 1 253 ? -7.034  92.616  53.212  1.00 27.25  ? 231  ALA A N   1 
ATOM   1390  C  CA  . ALA A 1 253 ? -6.403  92.568  54.531  1.00 22.17  ? 231  ALA A CA  1 
ATOM   1391  C  C   . ALA A 1 253 ? -7.405  92.011  55.541  1.00 19.33  ? 231  ALA A C   1 
ATOM   1392  O  O   . ALA A 1 253 ? -7.091  91.094  56.307  1.00 23.57  ? 231  ALA A O   1 
ATOM   1393  C  CB  . ALA A 1 253 ? -5.954  93.956  54.956  1.00 17.30  ? 231  ALA A CB  1 
ATOM   1394  N  N   . HIS A 1 254 ? -8.620  92.553  55.505  1.00 24.47  ? 232  HIS A N   1 
ATOM   1395  C  CA  . HIS A 1 254 ? -9.702  92.157  56.404  1.00 14.56  ? 232  HIS A CA  1 
ATOM   1396  C  C   . HIS A 1 254 ? -10.295 90.790  56.146  1.00 18.51  ? 232  HIS A C   1 
ATOM   1397  O  O   . HIS A 1 254 ? -10.797 90.163  57.083  1.00 21.68  ? 232  HIS A O   1 
ATOM   1398  C  CB  . HIS A 1 254 ? -10.793 93.218  56.362  1.00 14.86  ? 232  HIS A CB  1 
ATOM   1399  C  CG  . HIS A 1 254 ? -10.328 94.561  56.827  1.00 21.69  ? 232  HIS A CG  1 
ATOM   1400  N  ND1 . HIS A 1 254 ? -9.839  94.774  58.098  1.00 20.04  ? 232  HIS A ND1 1 
ATOM   1401  C  CD2 . HIS A 1 254 ? -10.230 95.746  56.181  1.00 20.64  ? 232  HIS A CD2 1 
ATOM   1402  C  CE1 . HIS A 1 254 ? -9.457  96.032  58.213  1.00 25.53  ? 232  HIS A CE1 1 
ATOM   1403  N  NE2 . HIS A 1 254 ? -9.682  96.643  57.064  1.00 23.42  ? 232  HIS A NE2 1 
ATOM   1404  N  N   . TYR A 1 255 ? -10.250 90.329  54.891  1.00 16.80  ? 233  TYR A N   1 
ATOM   1405  C  CA  . TYR A 1 255 ? -10.784 89.010  54.535  1.00 18.94  ? 233  TYR A CA  1 
ATOM   1406  C  C   . TYR A 1 255 ? -9.782  87.949  54.955  1.00 21.63  ? 233  TYR A C   1 
ATOM   1407  O  O   . TYR A 1 255 ? -10.163 86.851  55.352  1.00 22.33  ? 233  TYR A O   1 
ATOM   1408  C  CB  . TYR A 1 255 ? -10.996 88.921  53.021  1.00 27.89  ? 233  TYR A CB  1 
ATOM   1409  C  CG  . TYR A 1 255 ? -11.382 87.553  52.459  1.00 25.80  ? 233  TYR A CG  1 
ATOM   1410  C  CD1 . TYR A 1 255 ? -12.708 87.086  52.528  1.00 19.70  ? 233  TYR A CD1 1 
ATOM   1411  C  CD2 . TYR A 1 255 ? -10.434 86.761  51.799  1.00 17.09  ? 233  TYR A CD2 1 
ATOM   1412  C  CE1 . TYR A 1 255 ? -13.082 85.871  51.945  1.00 19.62  ? 233  TYR A CE1 1 
ATOM   1413  C  CE2 . TYR A 1 255 ? -10.792 85.548  51.217  1.00 14.89  ? 233  TYR A CE2 1 
ATOM   1414  C  CZ  . TYR A 1 255 ? -12.116 85.106  51.289  1.00 25.71  ? 233  TYR A CZ  1 
ATOM   1415  O  OH  . TYR A 1 255 ? -12.469 83.907  50.699  1.00 35.38  ? 233  TYR A OH  1 
ATOM   1416  N  N   . ASP A 1 256 ? -8.499  88.307  54.878  1.00 23.67  ? 234  ASP A N   1 
ATOM   1417  C  CA  . ASP A 1 256 ? -7.392  87.412  55.202  1.00 12.25  ? 234  ASP A CA  1 
ATOM   1418  C  C   . ASP A 1 256 ? -6.988  87.331  56.662  1.00 14.04  ? 234  ASP A C   1 
ATOM   1419  O  O   . ASP A 1 256 ? -6.645  86.244  57.144  1.00 15.33  ? 234  ASP A O   1 
ATOM   1420  C  CB  . ASP A 1 256 ? -6.157  87.798  54.387  1.00 8.86   ? 234  ASP A CB  1 
ATOM   1421  C  CG  . ASP A 1 256 ? -6.243  87.357  52.952  1.00 11.36  ? 234  ASP A CG  1 
ATOM   1422  O  OD1 . ASP A 1 256 ? -7.116  86.530  52.627  1.00 22.95  ? 234  ASP A OD1 1 
ATOM   1423  O  OD2 . ASP A 1 256 ? -5.417  87.823  52.142  1.00 23.90  ? 234  ASP A OD2 1 
ATOM   1424  N  N   . THR A 1 257 ? -7.017  88.461  57.372  1.00 12.17  ? 235  THR A N   1 
ATOM   1425  C  CA  . THR A 1 257 ? -6.592  88.472  58.782  1.00 12.98  ? 235  THR A CA  1 
ATOM   1426  C  C   . THR A 1 257 ? -7.704  88.783  59.770  1.00 19.41  ? 235  THR A C   1 
ATOM   1427  O  O   . THR A 1 257 ? -8.049  87.939  60.597  1.00 26.17  ? 235  THR A O   1 
ATOM   1428  C  CB  . THR A 1 257 ? -5.486  89.479  59.008  1.00 9.39   ? 235  THR A CB  1 
ATOM   1429  O  OG1 . THR A 1 257 ? -6.008  90.798  58.783  1.00 31.78  ? 235  THR A OG1 1 
ATOM   1430  C  CG2 . THR A 1 257 ? -4.333  89.239  58.060  1.00 15.71  ? 235  THR A CG2 1 
ATOM   1431  N  N   . THR A 1 258 ? -8.263  89.988  59.689  1.00 17.05  ? 236  THR A N   1 
ATOM   1432  C  CA  . THR A 1 258 ? -9.333  90.409  60.603  1.00 20.60  ? 236  THR A CA  1 
ATOM   1433  C  C   . THR A 1 258 ? -10.500 89.426  60.699  1.00 21.95  ? 236  THR A C   1 
ATOM   1434  O  O   . THR A 1 258 ? -10.893 89.035  61.795  1.00 26.69  ? 236  THR A O   1 
ATOM   1435  C  CB  . THR A 1 258 ? -9.915  91.777  60.210  1.00 24.34  ? 236  THR A CB  1 
ATOM   1436  O  OG1 . THR A 1 258 ? -8.869  92.622  59.707  1.00 26.95  ? 236  THR A OG1 1 
ATOM   1437  C  CG2 . THR A 1 258 ? -10.535 92.448  61.434  1.00 26.77  ? 236  THR A CG2 1 
ATOM   1438  N  N   . ALA A 1 259 ? -11.070 89.041  59.563  1.00 19.42  ? 237  ALA A N   1 
ATOM   1439  C  CA  . ALA A 1 259 ? -12.172 88.082  59.563  1.00 20.78  ? 237  ALA A CA  1 
ATOM   1440  C  C   . ALA A 1 259 ? -11.731 86.788  60.223  1.00 23.63  ? 237  ALA A C   1 
ATOM   1441  O  O   . ALA A 1 259 ? -12.426 86.246  61.090  1.00 30.17  ? 237  ALA A O   1 
ATOM   1442  C  CB  . ALA A 1 259 ? -12.621 87.788  58.137  1.00 15.47  ? 237  ALA A CB  1 
ATOM   1443  N  N   . ASP A 1 260 ? -10.573 86.293  59.797  1.00 23.37  ? 238  ASP A N   1 
ATOM   1444  C  CA  . ASP A 1 260 ? -10.027 85.050  60.329  1.00 26.73  ? 238  ASP A CA  1 
ATOM   1445  C  C   . ASP A 1 260 ? -9.738  85.124  61.820  1.00 29.33  ? 238  ASP A C   1 
ATOM   1446  O  O   . ASP A 1 260 ? -10.047 84.182  62.541  1.00 32.90  ? 238  ASP A O   1 
ATOM   1447  C  CB  . ASP A 1 260 ? -8.767  84.639  59.556  1.00 27.77  ? 238  ASP A CB  1 
ATOM   1448  C  CG  . ASP A 1 260 ? -9.085  83.745  58.351  1.00 30.84  ? 238  ASP A CG  1 
ATOM   1449  O  OD1 . ASP A 1 260 ? -8.154  83.430  57.578  1.00 30.66  ? 238  ASP A OD1 1 
ATOM   1450  O  OD2 . ASP A 1 260 ? -10.266 83.352  58.180  1.00 13.32  ? 238  ASP A OD2 1 
ATOM   1451  N  N   . GLU A 1 261 ? -9.149  86.227  62.285  1.00 26.97  ? 239  GLU A N   1 
ATOM   1452  C  CA  . GLU A 1 261 ? -8.879  86.386  63.713  1.00 21.51  ? 239  GLU A CA  1 
ATOM   1453  C  C   . GLU A 1 261 ? -10.214 86.320  64.457  1.00 23.30  ? 239  GLU A C   1 
ATOM   1454  O  O   . GLU A 1 261 ? -10.349 85.598  65.449  1.00 27.61  ? 239  GLU A O   1 
ATOM   1455  C  CB  . GLU A 1 261 ? -8.196  87.732  64.006  1.00 16.37  ? 239  GLU A CB  1 
ATOM   1456  C  CG  . GLU A 1 261 ? -6.830  87.879  63.377  1.00 11.12  ? 239  GLU A CG  1 
ATOM   1457  C  CD  . GLU A 1 261 ? -6.194  89.236  63.611  1.00 18.40  ? 239  GLU A CD  1 
ATOM   1458  O  OE1 . GLU A 1 261 ? -5.175  89.525  62.931  1.00 19.28  ? 239  GLU A OE1 1 
ATOM   1459  O  OE2 . GLU A 1 261 ? -6.698  90.007  64.468  1.00 14.56  ? 239  GLU A OE2 1 
ATOM   1460  N  N   . ILE A 1 262 ? -11.204 87.064  63.968  1.00 21.32  ? 240  ILE A N   1 
ATOM   1461  C  CA  . ILE A 1 262 ? -12.517 87.077  64.599  1.00 19.49  ? 240  ILE A CA  1 
ATOM   1462  C  C   . ILE A 1 262 ? -13.076 85.669  64.783  1.00 19.69  ? 240  ILE A C   1 
ATOM   1463  O  O   . ILE A 1 262 ? -13.493 85.299  65.876  1.00 24.25  ? 240  ILE A O   1 
ATOM   1464  C  CB  . ILE A 1 262 ? -13.512 87.918  63.795  1.00 15.78  ? 240  ILE A CB  1 
ATOM   1465  C  CG1 . ILE A 1 262 ? -13.123 89.398  63.880  1.00 4.53   ? 240  ILE A CG1 1 
ATOM   1466  C  CG2 . ILE A 1 262 ? -14.930 87.705  64.331  1.00 9.87   ? 240  ILE A CG2 1 
ATOM   1467  C  CD1 . ILE A 1 262 ? -14.064 90.322  63.082  1.00 13.33  ? 240  ILE A CD1 1 
ATOM   1468  N  N   . LEU A 1 263 ? -13.074 84.877  63.722  1.00 21.12  ? 241  LEU A N   1 
ATOM   1469  C  CA  . LEU A 1 263 ? -13.581 83.511  63.812  1.00 17.29  ? 241  LEU A CA  1 
ATOM   1470  C  C   . LEU A 1 263 ? -12.790 82.680  64.823  1.00 23.62  ? 241  LEU A C   1 
ATOM   1471  O  O   . LEU A 1 263 ? -13.367 81.951  65.625  1.00 23.51  ? 241  LEU A O   1 
ATOM   1472  C  CB  . LEU A 1 263 ? -13.523 82.838  62.429  1.00 16.21  ? 241  LEU A CB  1 
ATOM   1473  C  CG  . LEU A 1 263 ? -14.405 83.449  61.327  1.00 13.65  ? 241  LEU A CG  1 
ATOM   1474  C  CD1 . LEU A 1 263 ? -14.002 82.944  59.981  1.00 7.59   ? 241  LEU A CD1 1 
ATOM   1475  C  CD2 . LEU A 1 263 ? -15.874 83.133  61.620  1.00 14.17  ? 241  LEU A CD2 1 
ATOM   1476  N  N   . GLN A 1 264 ? -11.466 82.794  64.778  1.00 23.26  ? 242  GLN A N   1 
ATOM   1477  C  CA  . GLN A 1 264 ? -10.590 82.057  65.677  1.00 24.15  ? 242  GLN A CA  1 
ATOM   1478  C  C   . GLN A 1 264 ? -10.892 82.382  67.141  1.00 25.97  ? 242  GLN A C   1 
ATOM   1479  O  O   . GLN A 1 264 ? -10.943 81.484  67.979  1.00 21.05  ? 242  GLN A O   1 
ATOM   1480  C  CB  . GLN A 1 264 ? -9.128  82.391  65.342  1.00 29.71  ? 242  GLN A CB  1 
ATOM   1481  C  CG  . GLN A 1 264 ? -8.104  81.999  66.404  1.00 44.57  ? 242  GLN A CG  1 
ATOM   1482  C  CD  . GLN A 1 264 ? -7.645  80.557  66.294  1.00 49.29  ? 242  GLN A CD  1 
ATOM   1483  O  OE1 . GLN A 1 264 ? -6.895  80.064  67.142  1.00 47.90  ? 242  GLN A OE1 1 
ATOM   1484  N  NE2 . GLN A 1 264 ? -8.083  79.873  65.241  1.00 57.32  ? 242  GLN A NE2 1 
ATOM   1485  N  N   . GLN A 1 265 ? -11.096 83.666  67.441  1.00 27.35  ? 243  GLN A N   1 
ATOM   1486  C  CA  . GLN A 1 265 ? -11.373 84.103  68.810  1.00 29.07  ? 243  GLN A CA  1 
ATOM   1487  C  C   . GLN A 1 265 ? -12.777 83.699  69.283  1.00 33.21  ? 243  GLN A C   1 
ATOM   1488  O  O   . GLN A 1 265 ? -13.065 83.680  70.489  1.00 27.83  ? 243  GLN A O   1 
ATOM   1489  C  CB  . GLN A 1 265 ? -11.191 85.623  68.929  1.00 26.72  ? 243  GLN A CB  1 
ATOM   1490  C  CG  . GLN A 1 265 ? -9.759  86.086  68.748  1.00 27.67  ? 243  GLN A CG  1 
ATOM   1491  C  CD  . GLN A 1 265 ? -9.618  87.595  68.528  1.00 31.90  ? 243  GLN A CD  1 
ATOM   1492  O  OE1 . GLN A 1 265 ? -10.220 88.177  67.616  1.00 30.31  ? 243  GLN A OE1 1 
ATOM   1493  N  NE2 . GLN A 1 265 ? -8.805  88.228  69.356  1.00 25.02  ? 243  GLN A NE2 1 
ATOM   1494  N  N   . CYS A 1 266 ? -13.639 83.360  68.329  1.00 31.34  ? 244  CYS A N   1 
ATOM   1495  C  CA  . CYS A 1 266 ? -15.004 82.960  68.641  1.00 27.66  ? 244  CYS A CA  1 
ATOM   1496  C  C   . CYS A 1 266 ? -15.203 81.476  68.441  1.00 17.99  ? 244  CYS A C   1 
ATOM   1497  O  O   . CYS A 1 266 ? -16.297 80.963  68.629  1.00 25.34  ? 244  CYS A O   1 
ATOM   1498  C  CB  . CYS A 1 266 ? -15.994 83.725  67.758  1.00 27.98  ? 244  CYS A CB  1 
ATOM   1499  S  SG  . CYS A 1 266 ? -15.980 85.493  68.035  1.00 23.03  ? 244  CYS A SG  1 
ATOM   1500  N  N   . ASP A 1 267 ? -14.142 80.781  68.078  1.00 18.97  ? 245  ASP A N   1 
ATOM   1501  C  CA  . ASP A 1 267 ? -14.230 79.341  67.835  1.00 29.89  ? 245  ASP A CA  1 
ATOM   1502  C  C   . ASP A 1 267 ? -15.274 79.009  66.756  1.00 32.09  ? 245  ASP A C   1 
ATOM   1503  O  O   . ASP A 1 267 ? -15.961 77.988  66.837  1.00 33.14  ? 245  ASP A O   1 
ATOM   1504  C  CB  . ASP A 1 267 ? -14.579 78.604  69.131  1.00 36.02  ? 245  ASP A CB  1 
ATOM   1505  C  CG  . ASP A 1 267 ? -13.488 78.700  70.168  1.00 42.73  ? 245  ASP A CG  1 
ATOM   1506  O  OD1 . ASP A 1 267 ? -12.407 78.135  69.927  1.00 49.41  ? 245  ASP A OD1 1 
ATOM   1507  O  OD2 . ASP A 1 267 ? -13.710 79.342  71.220  1.00 47.41  ? 245  ASP A OD2 1 
ATOM   1508  N  N   . GLY A 1 268 ? -15.400 79.886  65.761  1.00 29.40  ? 246  GLY A N   1 
ATOM   1509  C  CA  . GLY A 1 268 ? -16.339 79.655  64.677  1.00 30.58  ? 246  GLY A CA  1 
ATOM   1510  C  C   . GLY A 1 268 ? -17.794 79.942  64.983  1.00 33.14  ? 246  GLY A C   1 
ATOM   1511  O  O   . GLY A 1 268 ? -18.640 79.835  64.099  1.00 35.29  ? 246  GLY A O   1 
ATOM   1512  N  N   . LYS A 1 269 ? -18.090 80.298  66.227  1.00 32.45  ? 247  LYS A N   1 
ATOM   1513  C  CA  . LYS A 1 269 ? -19.453 80.608  66.624  1.00 38.57  ? 247  LYS A CA  1 
ATOM   1514  C  C   . LYS A 1 269 ? -19.616 82.123  66.748  1.00 37.53  ? 247  LYS A C   1 
ATOM   1515  O  O   . LYS A 1 269 ? -18.969 82.761  67.575  1.00 37.13  ? 247  LYS A O   1 
ATOM   1516  C  CB  . LYS A 1 269 ? -19.765 79.942  67.955  1.00 48.14  ? 247  LYS A CB  1 
ATOM   1517  C  CG  . LYS A 1 269 ? -19.375 78.477  68.019  1.00 57.52  ? 247  LYS A CG  1 
ATOM   1518  C  CD  . LYS A 1 269 ? -19.446 77.997  69.458  1.00 67.32  ? 247  LYS A CD  1 
ATOM   1519  C  CE  . LYS A 1 269 ? -18.921 76.582  69.627  1.00 71.14  ? 247  LYS A CE  1 
ATOM   1520  N  NZ  . LYS A 1 269 ? -19.047 76.162  71.056  1.00 79.80  ? 247  LYS A NZ  1 
ATOM   1521  N  N   . LEU A 1 270 ? -20.499 82.681  65.927  1.00 34.42  ? 248  LEU A N   1 
ATOM   1522  C  CA  . LEU A 1 270 ? -20.760 84.113  65.887  1.00 33.66  ? 248  LEU A CA  1 
ATOM   1523  C  C   . LEU A 1 270 ? -22.127 84.255  65.211  1.00 36.38  ? 248  LEU A C   1 
ATOM   1524  O  O   . LEU A 1 270 ? -22.459 83.472  64.318  1.00 40.20  ? 248  LEU A O   1 
ATOM   1525  C  CB  . LEU A 1 270 ? -19.667 84.770  65.044  1.00 36.16  ? 248  LEU A CB  1 
ATOM   1526  C  CG  . LEU A 1 270 ? -19.452 86.276  64.924  1.00 30.84  ? 248  LEU A CG  1 
ATOM   1527  C  CD1 . LEU A 1 270 ? -18.238 86.494  64.045  1.00 23.50  ? 248  LEU A CD1 1 
ATOM   1528  C  CD2 . LEU A 1 270 ? -20.661 86.954  64.328  1.00 38.05  ? 248  LEU A CD2 1 
ATOM   1529  N  N   . ASP A 1 271 ? -22.919 85.242  65.614  1.00 32.13  ? 249  ASP A N   1 
ATOM   1530  C  CA  . ASP A 1 271 ? -24.246 85.391  65.025  1.00 29.23  ? 249  ASP A CA  1 
ATOM   1531  C  C   . ASP A 1 271 ? -24.499 86.747  64.384  1.00 32.01  ? 249  ASP A C   1 
ATOM   1532  O  O   . ASP A 1 271 ? -25.480 86.935  63.653  1.00 29.24  ? 249  ASP A O   1 
ATOM   1533  C  CB  . ASP A 1 271 ? -25.311 85.141  66.092  1.00 29.36  ? 249  ASP A CB  1 
ATOM   1534  C  CG  . ASP A 1 271 ? -25.175 83.781  66.739  1.00 30.50  ? 249  ASP A CG  1 
ATOM   1535  O  OD1 . ASP A 1 271 ? -25.641 82.784  66.153  1.00 32.25  ? 249  ASP A OD1 1 
ATOM   1536  O  OD2 . ASP A 1 271 ? -24.587 83.709  67.834  1.00 31.03  ? 249  ASP A OD2 1 
ATOM   1537  N  N   . MET A 1 272 ? -23.622 87.701  64.659  1.00 29.73  ? 250  MET A N   1 
ATOM   1538  C  CA  . MET A 1 272 ? -23.805 89.026  64.101  1.00 30.57  ? 250  MET A CA  1 
ATOM   1539  C  C   . MET A 1 272 ? -22.529 89.842  64.122  1.00 31.28  ? 250  MET A C   1 
ATOM   1540  O  O   . MET A 1 272 ? -21.697 89.708  65.022  1.00 26.94  ? 250  MET A O   1 
ATOM   1541  C  CB  . MET A 1 272 ? -24.901 89.771  64.870  1.00 29.30  ? 250  MET A CB  1 
ATOM   1542  C  CG  . MET A 1 272 ? -25.251 91.120  64.278  1.00 31.30  ? 250  MET A CG  1 
ATOM   1543  S  SD  . MET A 1 272 ? -26.616 91.914  65.146  1.00 36.35  ? 250  MET A SD  1 
ATOM   1544  C  CE  . MET A 1 272 ? -27.999 90.908  64.545  1.00 35.05  ? 250  MET A CE  1 
ATOM   1545  N  N   . LEU A 1 273 ? -22.378 90.682  63.106  1.00 31.80  ? 251  LEU A N   1 
ATOM   1546  C  CA  . LEU A 1 273 ? -21.219 91.550  62.998  1.00 29.54  ? 251  LEU A CA  1 
ATOM   1547  C  C   . LEU A 1 273 ? -21.709 92.947  62.664  1.00 31.12  ? 251  LEU A C   1 
ATOM   1548  O  O   . LEU A 1 273 ? -22.414 93.159  61.675  1.00 25.25  ? 251  LEU A O   1 
ATOM   1549  C  CB  . LEU A 1 273 ? -20.271 91.072  61.902  1.00 27.12  ? 251  LEU A CB  1 
ATOM   1550  C  CG  . LEU A 1 273 ? -19.100 92.022  61.664  1.00 30.27  ? 251  LEU A CG  1 
ATOM   1551  C  CD1 . LEU A 1 273 ? -18.010 91.779  62.702  1.00 29.75  ? 251  LEU A CD1 1 
ATOM   1552  C  CD2 . LEU A 1 273 ? -18.561 91.800  60.274  1.00 36.44  ? 251  LEU A CD2 1 
ATOM   1553  N  N   . VAL A 1 274 ? -21.336 93.896  63.509  1.00 30.75  ? 252  VAL A N   1 
ATOM   1554  C  CA  . VAL A 1 274 ? -21.719 95.277  63.319  1.00 26.26  ? 252  VAL A CA  1 
ATOM   1555  C  C   . VAL A 1 274 ? -20.430 96.048  63.083  1.00 28.22  ? 252  VAL A C   1 
ATOM   1556  O  O   . VAL A 1 274 ? -19.512 95.974  63.887  1.00 32.18  ? 252  VAL A O   1 
ATOM   1557  C  CB  . VAL A 1 274 ? -22.459 95.815  64.569  1.00 21.45  ? 252  VAL A CB  1 
ATOM   1558  C  CG1 . VAL A 1 274 ? -22.789 97.295  64.397  1.00 18.34  ? 252  VAL A CG1 1 
ATOM   1559  C  CG2 . VAL A 1 274 ? -23.741 95.016  64.792  1.00 22.14  ? 252  VAL A CG2 1 
ATOM   1560  N  N   . ALA A 1 275 ? -20.356 96.761  61.965  1.00 29.36  ? 253  ALA A N   1 
ATOM   1561  C  CA  . ALA A 1 275 ? -19.177 97.542  61.629  1.00 28.10  ? 253  ALA A CA  1 
ATOM   1562  C  C   . ALA A 1 275 ? -19.582 98.851  60.945  1.00 31.05  ? 253  ALA A C   1 
ATOM   1563  O  O   . ALA A 1 275 ? -20.509 98.873  60.139  1.00 27.93  ? 253  ALA A O   1 
ATOM   1564  C  CB  . ALA A 1 275 ? -18.269 96.729  60.711  1.00 27.16  ? 253  ALA A CB  1 
ATOM   1565  N  N   . SER A 1 276 ? -18.900 99.944  61.278  1.00 31.08  ? 254  SER A N   1 
ATOM   1566  C  CA  . SER A 1 276 ? -19.204 101.227 60.657  1.00 30.47  ? 254  SER A CA  1 
ATOM   1567  C  C   . SER A 1 276 ? -18.483 101.234 59.309  1.00 34.75  ? 254  SER A C   1 
ATOM   1568  O  O   . SER A 1 276 ? -17.443 100.585 59.167  1.00 29.84  ? 254  SER A O   1 
ATOM   1569  C  CB  . SER A 1 276 ? -18.745 102.388 61.557  1.00 25.66  ? 254  SER A CB  1 
ATOM   1570  O  OG  . SER A 1 276 ? -17.371 102.315 61.897  1.00 17.43  ? 254  SER A OG  1 
ATOM   1571  N  N   . VAL A 1 277 ? -19.020 101.961 58.328  1.00 38.03  ? 255  VAL A N   1 
ATOM   1572  C  CA  . VAL A 1 277 ? -18.422 101.964 56.993  1.00 35.48  ? 255  VAL A CA  1 
ATOM   1573  C  C   . VAL A 1 277 ? -17.854 103.274 56.467  1.00 37.88  ? 255  VAL A C   1 
ATOM   1574  O  O   . VAL A 1 277 ? -18.495 104.318 56.559  1.00 40.30  ? 255  VAL A O   1 
ATOM   1575  C  CB  . VAL A 1 277 ? -19.433 101.439 55.955  1.00 32.73  ? 255  VAL A CB  1 
ATOM   1576  C  CG1 . VAL A 1 277 ? -18.723 101.159 54.625  1.00 21.57  ? 255  VAL A CG1 1 
ATOM   1577  C  CG2 . VAL A 1 277 ? -20.116 100.183 56.491  1.00 29.28  ? 255  VAL A CG2 1 
ATOM   1578  N  N   . GLY A 1 278 ? -16.648 103.191 55.899  1.00 39.88  ? 256  GLY A N   1 
ATOM   1579  C  CA  . GLY A 1 278 ? -15.975 104.351 55.327  1.00 37.75  ? 256  GLY A CA  1 
ATOM   1580  C  C   . GLY A 1 278 ? -15.575 104.042 53.891  1.00 38.72  ? 256  GLY A C   1 
ATOM   1581  O  O   . GLY A 1 278 ? -16.159 104.563 52.937  1.00 39.90  ? 256  GLY A O   1 
ATOM   1582  N  N   . THR A 1 279 ? -14.562 103.197 53.738  1.00 36.31  ? 257  THR A N   1 
ATOM   1583  C  CA  . THR A 1 279 ? -14.107 102.777 52.424  1.00 28.67  ? 257  THR A CA  1 
ATOM   1584  C  C   . THR A 1 279 ? -14.925 101.525 52.121  1.00 26.79  ? 257  THR A C   1 
ATOM   1585  O  O   . THR A 1 279 ? -15.221 101.210 50.967  1.00 24.29  ? 257  THR A O   1 
ATOM   1586  C  CB  . THR A 1 279 ? -12.615 102.386 52.426  1.00 30.40  ? 257  THR A CB  1 
ATOM   1587  O  OG1 . THR A 1 279 ? -12.412 101.282 53.311  1.00 35.18  ? 257  THR A OG1 1 
ATOM   1588  C  CG2 . THR A 1 279 ? -11.756 103.551 52.867  1.00 33.83  ? 257  THR A CG2 1 
ATOM   1589  N  N   . GLY A 1 280 ? -15.303 100.828 53.185  1.00 20.69  ? 258  GLY A N   1 
ATOM   1590  C  CA  . GLY A 1 280 ? -16.073 99.608  53.049  1.00 20.75  ? 258  GLY A CA  1 
ATOM   1591  C  C   . GLY A 1 280 ? -15.167 98.399  53.167  1.00 20.75  ? 258  GLY A C   1 
ATOM   1592  O  O   . GLY A 1 280 ? -15.629 97.254  53.151  1.00 15.63  ? 258  GLY A O   1 
ATOM   1593  N  N   . GLY A 1 281 ? -13.869 98.666  53.291  1.00 18.65  ? 259  GLY A N   1 
ATOM   1594  C  CA  . GLY A 1 281 ? -12.892 97.602  53.393  1.00 17.91  ? 259  GLY A CA  1 
ATOM   1595  C  C   . GLY A 1 281 ? -13.215 96.615  54.476  1.00 16.65  ? 259  GLY A C   1 
ATOM   1596  O  O   . GLY A 1 281 ? -13.413 95.436  54.211  1.00 31.22  ? 259  GLY A O   1 
ATOM   1597  N  N   . THR A 1 282 ? -13.296 97.106  55.703  1.00 22.05  ? 260  THR A N   1 
ATOM   1598  C  CA  . THR A 1 282 ? -13.572 96.266  56.855  1.00 16.02  ? 260  THR A CA  1 
ATOM   1599  C  C   . THR A 1 282 ? -14.812 95.392  56.734  1.00 9.11   ? 260  THR A C   1 
ATOM   1600  O  O   . THR A 1 282 ? -14.721 94.167  56.826  1.00 13.17  ? 260  THR A O   1 
ATOM   1601  C  CB  . THR A 1 282 ? -13.696 97.117  58.115  1.00 16.55  ? 260  THR A CB  1 
ATOM   1602  O  OG1 . THR A 1 282 ? -12.520 97.920  58.255  1.00 24.33  ? 260  THR A OG1 1 
ATOM   1603  C  CG2 . THR A 1 282 ? -13.838 96.225  59.349  1.00 18.11  ? 260  THR A CG2 1 
ATOM   1604  N  N   . ILE A 1 283 ? -15.971 96.003  56.523  1.00 14.84  ? 261  ILE A N   1 
ATOM   1605  C  CA  . ILE A 1 283 ? -17.193 95.219  56.448  1.00 15.89  ? 261  ILE A CA  1 
ATOM   1606  C  C   . ILE A 1 283 ? -17.235 94.285  55.247  1.00 20.25  ? 261  ILE A C   1 
ATOM   1607  O  O   . ILE A 1 283 ? -17.756 93.177  55.328  1.00 20.84  ? 261  ILE A O   1 
ATOM   1608  C  CB  . ILE A 1 283 ? -18.445 96.118  56.442  1.00 17.12  ? 261  ILE A CB  1 
ATOM   1609  C  CG1 . ILE A 1 283 ? -19.683 95.279  56.800  1.00 23.59  ? 261  ILE A CG1 1 
ATOM   1610  C  CG2 . ILE A 1 283 ? -18.634 96.764  55.084  1.00 27.27  ? 261  ILE A CG2 1 
ATOM   1611  C  CD1 . ILE A 1 283 ? -20.945 96.099  57.012  1.00 7.80   ? 261  ILE A CD1 1 
ATOM   1612  N  N   . THR A 1 284 ? -16.665 94.716  54.132  1.00 21.70  ? 262  THR A N   1 
ATOM   1613  C  CA  . THR A 1 284 ? -16.683 93.886  52.942  1.00 18.57  ? 262  THR A CA  1 
ATOM   1614  C  C   . THR A 1 284 ? -15.745 92.718  53.117  1.00 16.33  ? 262  THR A C   1 
ATOM   1615  O  O   . THR A 1 284 ? -16.073 91.584  52.760  1.00 26.24  ? 262  THR A O   1 
ATOM   1616  C  CB  . THR A 1 284 ? -16.251 94.673  51.679  1.00 24.21  ? 262  THR A CB  1 
ATOM   1617  O  OG1 . THR A 1 284 ? -17.096 95.822  51.495  1.00 16.53  ? 262  THR A OG1 1 
ATOM   1618  C  CG2 . THR A 1 284 ? -16.328 93.763  50.448  1.00 28.50  ? 262  THR A CG2 1 
ATOM   1619  N  N   . GLY A 1 285 ? -14.568 92.999  53.657  1.00 8.88   ? 263  GLY A N   1 
ATOM   1620  C  CA  . GLY A 1 285 ? -13.589 91.949  53.864  1.00 12.90  ? 263  GLY A CA  1 
ATOM   1621  C  C   . GLY A 1 285 ? -14.110 90.918  54.842  1.00 15.49  ? 263  GLY A C   1 
ATOM   1622  O  O   . GLY A 1 285 ? -14.172 89.730  54.525  1.00 22.80  ? 263  GLY A O   1 
ATOM   1623  N  N   . ILE A 1 286 ? -14.506 91.366  56.027  1.00 11.33  ? 264  ILE A N   1 
ATOM   1624  C  CA  . ILE A 1 286 ? -15.020 90.454  57.032  1.00 9.00   ? 264  ILE A CA  1 
ATOM   1625  C  C   . ILE A 1 286 ? -16.316 89.799  56.583  1.00 16.28  ? 264  ILE A C   1 
ATOM   1626  O  O   . ILE A 1 286 ? -16.506 88.595  56.789  1.00 21.29  ? 264  ILE A O   1 
ATOM   1627  C  CB  . ILE A 1 286 ? -15.255 91.178  58.363  1.00 14.38  ? 264  ILE A CB  1 
ATOM   1628  C  CG1 . ILE A 1 286 ? -13.954 91.808  58.844  1.00 9.21   ? 264  ILE A CG1 1 
ATOM   1629  C  CG2 . ILE A 1 286 ? -15.747 90.215  59.403  1.00 12.70  ? 264  ILE A CG2 1 
ATOM   1630  C  CD1 . ILE A 1 286 ? -14.139 92.722  60.016  1.00 13.29  ? 264  ILE A CD1 1 
ATOM   1631  N  N   . ALA A 1 287 ? -17.205 90.564  55.949  1.00 19.61  ? 265  ALA A N   1 
ATOM   1632  C  CA  . ALA A 1 287 ? -18.487 89.993  55.511  1.00 21.90  ? 265  ALA A CA  1 
ATOM   1633  C  C   . ALA A 1 287 ? -18.328 88.862  54.500  1.00 26.19  ? 265  ALA A C   1 
ATOM   1634  O  O   . ALA A 1 287 ? -19.012 87.836  54.606  1.00 25.21  ? 265  ALA A O   1 
ATOM   1635  C  CB  . ALA A 1 287 ? -19.394 91.077  54.938  1.00 21.74  ? 265  ALA A CB  1 
ATOM   1636  N  N   . ARG A 1 288 ? -17.435 89.050  53.522  1.00 21.69  ? 266  ARG A N   1 
ATOM   1637  C  CA  . ARG A 1 288 ? -17.207 88.024  52.520  1.00 19.50  ? 266  ARG A CA  1 
ATOM   1638  C  C   . ARG A 1 288 ? -16.590 86.765  53.126  1.00 25.04  ? 266  ARG A C   1 
ATOM   1639  O  O   . ARG A 1 288 ? -16.852 85.661  52.659  1.00 27.73  ? 266  ARG A O   1 
ATOM   1640  C  CB  . ARG A 1 288 ? -16.316 88.545  51.387  1.00 19.75  ? 266  ARG A CB  1 
ATOM   1641  C  CG  . ARG A 1 288 ? -17.066 89.288  50.293  1.00 20.33  ? 266  ARG A CG  1 
ATOM   1642  C  CD  . ARG A 1 288 ? -16.149 89.637  49.149  1.00 13.96  ? 266  ARG A CD  1 
ATOM   1643  N  NE  . ARG A 1 288 ? -16.833 90.407  48.115  1.00 19.43  ? 266  ARG A NE  1 
ATOM   1644  C  CZ  . ARG A 1 288 ? -16.265 90.801  46.978  1.00 32.87  ? 266  ARG A CZ  1 
ATOM   1645  N  NH1 . ARG A 1 288 ? -14.997 90.498  46.712  1.00 24.95  ? 266  ARG A NH1 1 
ATOM   1646  N  NH2 . ARG A 1 288 ? -16.960 91.519  46.112  1.00 33.26  ? 266  ARG A NH2 1 
ATOM   1647  N  N   . LYS A 1 289 ? -15.778 86.923  54.167  1.00 24.96  ? 267  LYS A N   1 
ATOM   1648  C  CA  . LYS A 1 289 ? -15.163 85.764  54.803  1.00 20.17  ? 267  LYS A CA  1 
ATOM   1649  C  C   . LYS A 1 289 ? -16.131 85.081  55.758  1.00 25.02  ? 267  LYS A C   1 
ATOM   1650  O  O   . LYS A 1 289 ? -16.057 83.873  55.961  1.00 27.33  ? 267  LYS A O   1 
ATOM   1651  C  CB  . LYS A 1 289 ? -13.907 86.164  55.566  1.00 17.22  ? 267  LYS A CB  1 
ATOM   1652  C  CG  . LYS A 1 289 ? -13.328 85.038  56.388  1.00 13.09  ? 267  LYS A CG  1 
ATOM   1653  C  CD  . LYS A 1 289 ? -13.065 83.826  55.522  1.00 12.23  ? 267  LYS A CD  1 
ATOM   1654  C  CE  . LYS A 1 289 ? -12.058 84.097  54.395  1.00 11.05  ? 267  LYS A CE  1 
ATOM   1655  N  NZ  . LYS A 1 289 ? -10.629 84.025  54.781  1.00 2.61   ? 267  LYS A NZ  1 
ATOM   1656  N  N   . LEU A 1 290 ? -17.041 85.851  56.343  1.00 24.67  ? 268  LEU A N   1 
ATOM   1657  C  CA  . LEU A 1 290 ? -18.008 85.283  57.274  1.00 28.96  ? 268  LEU A CA  1 
ATOM   1658  C  C   . LEU A 1 290 ? -19.125 84.526  56.559  1.00 30.42  ? 268  LEU A C   1 
ATOM   1659  O  O   . LEU A 1 290 ? -19.488 83.426  56.964  1.00 30.54  ? 268  LEU A O   1 
ATOM   1660  C  CB  . LEU A 1 290 ? -18.597 86.387  58.171  1.00 26.87  ? 268  LEU A CB  1 
ATOM   1661  C  CG  . LEU A 1 290 ? -18.172 86.429  59.656  1.00 32.50  ? 268  LEU A CG  1 
ATOM   1662  C  CD1 . LEU A 1 290 ? -16.747 85.926  59.848  1.00 22.66  ? 268  LEU A CD1 1 
ATOM   1663  C  CD2 . LEU A 1 290 ? -18.297 87.857  60.169  1.00 22.36  ? 268  LEU A CD2 1 
ATOM   1664  N  N   . LYS A 1 291 ? -19.666 85.105  55.495  1.00 28.78  ? 269  LYS A N   1 
ATOM   1665  C  CA  . LYS A 1 291 ? -20.734 84.435  54.768  1.00 32.18  ? 269  LYS A CA  1 
ATOM   1666  C  C   . LYS A 1 291 ? -20.258 83.103  54.193  1.00 31.80  ? 269  LYS A C   1 
ATOM   1667  O  O   . LYS A 1 291 ? -21.059 82.209  53.917  1.00 25.42  ? 269  LYS A O   1 
ATOM   1668  C  CB  . LYS A 1 291 ? -21.279 85.328  53.646  1.00 33.41  ? 269  LYS A CB  1 
ATOM   1669  C  CG  . LYS A 1 291 ? -22.150 86.452  54.148  1.00 26.83  ? 269  LYS A CG  1 
ATOM   1670  C  CD  . LYS A 1 291 ? -23.180 86.827  53.117  1.00 30.39  ? 269  LYS A CD  1 
ATOM   1671  C  CE  . LYS A 1 291 ? -24.254 87.702  53.735  1.00 41.54  ? 269  LYS A CE  1 
ATOM   1672  N  NZ  . LYS A 1 291 ? -24.885 87.013  54.901  1.00 41.01  ? 269  LYS A NZ  1 
ATOM   1673  N  N   . GLU A 1 292 ? -18.949 82.974  54.014  1.00 33.61  ? 270  GLU A N   1 
ATOM   1674  C  CA  . GLU A 1 292 ? -18.399 81.739  53.494  1.00 35.33  ? 270  GLU A CA  1 
ATOM   1675  C  C   . GLU A 1 292 ? -18.278 80.724  54.633  1.00 39.95  ? 270  GLU A C   1 
ATOM   1676  O  O   . GLU A 1 292 ? -18.720 79.585  54.492  1.00 37.02  ? 270  GLU A O   1 
ATOM   1677  C  CB  . GLU A 1 292 ? -17.028 81.985  52.835  1.00 33.12  ? 270  GLU A CB  1 
ATOM   1678  C  CG  . GLU A 1 292 ? -17.083 82.964  51.663  1.00 31.97  ? 270  GLU A CG  1 
ATOM   1679  C  CD  . GLU A 1 292 ? -15.824 82.973  50.805  1.00 36.17  ? 270  GLU A CD  1 
ATOM   1680  O  OE1 . GLU A 1 292 ? -14.713 82.880  51.356  1.00 44.61  ? 270  GLU A OE1 1 
ATOM   1681  O  OE2 . GLU A 1 292 ? -15.944 83.095  49.570  1.00 40.65  ? 270  GLU A OE2 1 
ATOM   1682  N  N   . LYS A 1 293 ? -17.708 81.145  55.765  1.00 42.06  ? 271  LYS A N   1 
ATOM   1683  C  CA  . LYS A 1 293 ? -17.531 80.253  56.913  1.00 43.95  ? 271  LYS A CA  1 
ATOM   1684  C  C   . LYS A 1 293 ? -18.732 80.217  57.867  1.00 47.90  ? 271  LYS A C   1 
ATOM   1685  O  O   . LYS A 1 293 ? -19.170 79.144  58.290  1.00 47.93  ? 271  LYS A O   1 
ATOM   1686  C  CB  . LYS A 1 293 ? -16.276 80.647  57.693  1.00 46.09  ? 271  LYS A CB  1 
ATOM   1687  C  CG  . LYS A 1 293 ? -15.001 80.683  56.864  1.00 43.31  ? 271  LYS A CG  1 
ATOM   1688  C  CD  . LYS A 1 293 ? -14.598 79.307  56.353  1.00 41.90  ? 271  LYS A CD  1 
ATOM   1689  C  CE  . LYS A 1 293 ? -13.301 79.390  55.577  1.00 45.51  ? 271  LYS A CE  1 
ATOM   1690  N  NZ  . LYS A 1 293 ? -12.797 78.049  55.187  1.00 52.63  ? 271  LYS A NZ  1 
ATOM   1691  N  N   . CYS A 1 294 ? -19.256 81.386  58.218  1.00 50.87  ? 272  CYS A N   1 
ATOM   1692  C  CA  . CYS A 1 294 ? -20.407 81.455  59.114  1.00 53.18  ? 272  CYS A CA  1 
ATOM   1693  C  C   . CYS A 1 294 ? -21.648 81.931  58.379  1.00 52.89  ? 272  CYS A C   1 
ATOM   1694  O  O   . CYS A 1 294 ? -21.995 83.112  58.417  1.00 50.77  ? 272  CYS A O   1 
ATOM   1695  C  CB  . CYS A 1 294 ? -20.128 82.384  60.295  1.00 52.94  ? 272  CYS A CB  1 
ATOM   1696  S  SG  . CYS A 1 294 ? -21.601 82.666  61.321  1.00 46.55  ? 272  CYS A SG  1 
ATOM   1697  N  N   . PRO A 1 295 ? -22.338 81.005  57.698  1.00 54.78  ? 273  PRO A N   1 
ATOM   1698  C  CA  . PRO A 1 295 ? -23.552 81.335  56.946  1.00 56.61  ? 273  PRO A CA  1 
ATOM   1699  C  C   . PRO A 1 295 ? -24.605 82.068  57.786  1.00 56.01  ? 273  PRO A C   1 
ATOM   1700  O  O   . PRO A 1 295 ? -25.142 83.099  57.366  1.00 53.84  ? 273  PRO A O   1 
ATOM   1701  C  CB  . PRO A 1 295 ? -24.028 79.967  56.442  1.00 52.92  ? 273  PRO A CB  1 
ATOM   1702  C  CG  . PRO A 1 295 ? -23.495 79.017  57.477  1.00 53.47  ? 273  PRO A CG  1 
ATOM   1703  C  CD  . PRO A 1 295 ? -22.111 79.550  57.714  1.00 51.02  ? 273  PRO A CD  1 
ATOM   1704  N  N   . GLY A 1 296 ? -24.883 81.543  58.977  1.00 53.47  ? 274  GLY A N   1 
ATOM   1705  C  CA  . GLY A 1 296 ? -25.872 82.157  59.846  1.00 53.60  ? 274  GLY A CA  1 
ATOM   1706  C  C   . GLY A 1 296 ? -25.497 83.508  60.438  1.00 52.79  ? 274  GLY A C   1 
ATOM   1707  O  O   . GLY A 1 296 ? -26.230 84.059  61.257  1.00 55.29  ? 274  GLY A O   1 
ATOM   1708  N  N   . CYS A 1 297 ? -24.360 84.053  60.028  1.00 51.75  ? 275  CYS A N   1 
ATOM   1709  C  CA  . CYS A 1 297 ? -23.915 85.341  60.536  1.00 45.51  ? 275  CYS A CA  1 
ATOM   1710  C  C   . CYS A 1 297 ? -24.564 86.524  59.832  1.00 43.90  ? 275  CYS A C   1 
ATOM   1711  O  O   . CYS A 1 297 ? -24.478 86.656  58.613  1.00 44.86  ? 275  CYS A O   1 
ATOM   1712  C  CB  . CYS A 1 297 ? -22.397 85.450  60.412  1.00 43.25  ? 275  CYS A CB  1 
ATOM   1713  S  SG  . CYS A 1 297 ? -21.486 84.642  61.762  1.00 48.61  ? 275  CYS A SG  1 
ATOM   1714  N  N   . ARG A 1 298 ? -25.223 87.385  60.602  1.00 41.52  ? 276  ARG A N   1 
ATOM   1715  C  CA  . ARG A 1 298 ? -25.843 88.569  60.028  1.00 37.83  ? 276  ARG A CA  1 
ATOM   1716  C  C   . ARG A 1 298 ? -24.848 89.724  59.998  1.00 35.45  ? 276  ARG A C   1 
ATOM   1717  O  O   . ARG A 1 298 ? -24.180 90.028  60.989  1.00 38.56  ? 276  ARG A O   1 
ATOM   1718  C  CB  . ARG A 1 298 ? -27.073 89.005  60.820  1.00 41.75  ? 276  ARG A CB  1 
ATOM   1719  C  CG  . ARG A 1 298 ? -28.326 88.192  60.568  1.00 47.35  ? 276  ARG A CG  1 
ATOM   1720  C  CD  . ARG A 1 298 ? -29.573 89.025  60.885  1.00 55.95  ? 276  ARG A CD  1 
ATOM   1721  N  NE  . ARG A 1 298 ? -29.972 89.882  59.766  1.00 57.85  ? 276  ARG A NE  1 
ATOM   1722  C  CZ  . ARG A 1 298 ? -30.794 90.922  59.872  1.00 63.45  ? 276  ARG A CZ  1 
ATOM   1723  N  NH1 . ARG A 1 298 ? -31.305 91.248  61.053  1.00 63.45  ? 276  ARG A NH1 1 
ATOM   1724  N  NH2 . ARG A 1 298 ? -31.122 91.625  58.795  1.00 65.76  ? 276  ARG A NH2 1 
ATOM   1725  N  N   . ILE A 1 299 ? -24.754 90.364  58.844  1.00 31.15  ? 277  ILE A N   1 
ATOM   1726  C  CA  . ILE A 1 299 ? -23.855 91.487  58.669  1.00 21.12  ? 277  ILE A CA  1 
ATOM   1727  C  C   . ILE A 1 299 ? -24.664 92.773  58.778  1.00 27.31  ? 277  ILE A C   1 
ATOM   1728  O  O   . ILE A 1 299 ? -25.678 92.944  58.092  1.00 29.66  ? 277  ILE A O   1 
ATOM   1729  C  CB  . ILE A 1 299 ? -23.173 91.433  57.288  1.00 19.79  ? 277  ILE A CB  1 
ATOM   1730  C  CG1 . ILE A 1 299 ? -22.408 90.117  57.132  1.00 23.07  ? 277  ILE A CG1 1 
ATOM   1731  C  CG2 . ILE A 1 299 ? -22.252 92.629  57.105  1.00 16.04  ? 277  ILE A CG2 1 
ATOM   1732  C  CD1 . ILE A 1 299 ? -21.383 89.833  58.217  1.00 10.35  ? 277  ILE A CD1 1 
ATOM   1733  N  N   . ILE A 1 300 ? -24.200 93.676  59.639  1.00 27.33  ? 278  ILE A N   1 
ATOM   1734  C  CA  . ILE A 1 300 ? -24.867 94.949  59.871  1.00 23.94  ? 278  ILE A CA  1 
ATOM   1735  C  C   . ILE A 1 300 ? -23.936 96.105  59.559  1.00 20.19  ? 278  ILE A C   1 
ATOM   1736  O  O   . ILE A 1 300 ? -22.848 96.181  60.105  1.00 19.20  ? 278  ILE A O   1 
ATOM   1737  C  CB  . ILE A 1 300 ? -25.309 95.085  61.347  1.00 23.60  ? 278  ILE A CB  1 
ATOM   1738  C  CG1 . ILE A 1 300 ? -26.116 93.859  61.769  1.00 18.83  ? 278  ILE A CG1 1 
ATOM   1739  C  CG2 . ILE A 1 300 ? -26.149 96.343  61.527  1.00 29.63  ? 278  ILE A CG2 1 
ATOM   1740  C  CD1 . ILE A 1 300 ? -27.394 93.654  60.989  1.00 27.92  ? 278  ILE A CD1 1 
ATOM   1741  N  N   . GLY A 1 301 ? -24.378 97.014  58.698  1.00 22.36  ? 279  GLY A N   1 
ATOM   1742  C  CA  . GLY A 1 301 ? -23.547 98.150  58.337  1.00 25.68  ? 279  GLY A CA  1 
ATOM   1743  C  C   . GLY A 1 301 ? -24.041 99.436  58.959  1.00 25.54  ? 279  GLY A C   1 
ATOM   1744  O  O   . GLY A 1 301 ? -25.238 99.707  58.967  1.00 35.33  ? 279  GLY A O   1 
ATOM   1745  N  N   . VAL A 1 302 ? -23.119 100.233 59.478  1.00 19.61  ? 280  VAL A N   1 
ATOM   1746  C  CA  . VAL A 1 302 ? -23.476 101.488 60.116  1.00 22.58  ? 280  VAL A CA  1 
ATOM   1747  C  C   . VAL A 1 302 ? -23.036 102.670 59.262  1.00 23.61  ? 280  VAL A C   1 
ATOM   1748  O  O   . VAL A 1 302 ? -21.838 102.861 59.018  1.00 23.15  ? 280  VAL A O   1 
ATOM   1749  C  CB  . VAL A 1 302 ? -22.835 101.580 61.526  1.00 21.30  ? 280  VAL A CB  1 
ATOM   1750  C  CG1 . VAL A 1 302 ? -23.000 102.980 62.106  1.00 26.26  ? 280  VAL A CG1 1 
ATOM   1751  C  CG2 . VAL A 1 302 ? -23.485 100.568 62.440  1.00 22.72  ? 280  VAL A CG2 1 
ATOM   1752  N  N   . ASP A 1 303 ? -24.009 103.464 58.816  1.00 20.34  ? 281  ASP A N   1 
ATOM   1753  C  CA  . ASP A 1 303 ? -23.731 104.624 57.962  1.00 21.92  ? 281  ASP A CA  1 
ATOM   1754  C  C   . ASP A 1 303 ? -24.229 105.903 58.634  1.00 21.87  ? 281  ASP A C   1 
ATOM   1755  O  O   . ASP A 1 303 ? -25.363 105.962 59.095  1.00 24.71  ? 281  ASP A O   1 
ATOM   1756  C  CB  . ASP A 1 303 ? -24.435 104.439 56.609  1.00 22.23  ? 281  ASP A CB  1 
ATOM   1757  C  CG  . ASP A 1 303 ? -23.945 105.409 55.542  1.00 30.44  ? 281  ASP A CG  1 
ATOM   1758  O  OD1 . ASP A 1 303 ? -24.767 105.795 54.689  1.00 29.42  ? 281  ASP A OD1 1 
ATOM   1759  O  OD2 . ASP A 1 303 ? -22.749 105.771 55.535  1.00 22.95  ? 281  ASP A OD2 1 
ATOM   1760  N  N   . PRO A 1 304 ? -23.390 106.946 58.689  1.00 23.18  ? 282  PRO A N   1 
ATOM   1761  C  CA  . PRO A 1 304 ? -23.773 108.220 59.316  1.00 31.22  ? 282  PRO A CA  1 
ATOM   1762  C  C   . PRO A 1 304 ? -24.687 109.077 58.440  1.00 33.27  ? 282  PRO A C   1 
ATOM   1763  O  O   . PRO A 1 304 ? -24.491 109.152 57.225  1.00 32.09  ? 282  PRO A O   1 
ATOM   1764  C  CB  . PRO A 1 304 ? -22.426 108.903 59.536  1.00 35.94  ? 282  PRO A CB  1 
ATOM   1765  C  CG  . PRO A 1 304 ? -21.686 108.526 58.283  1.00 29.83  ? 282  PRO A CG  1 
ATOM   1766  C  CD  . PRO A 1 304 ? -22.018 107.026 58.146  1.00 23.10  ? 282  PRO A CD  1 
ATOM   1767  N  N   . GLU A 1 305 ? -25.668 109.732 59.061  1.00 36.71  ? 283  GLU A N   1 
ATOM   1768  C  CA  . GLU A 1 305 ? -26.589 110.598 58.327  1.00 40.42  ? 283  GLU A CA  1 
ATOM   1769  C  C   . GLU A 1 305 ? -25.773 111.657 57.596  1.00 41.79  ? 283  GLU A C   1 
ATOM   1770  O  O   . GLU A 1 305 ? -24.930 112.323 58.196  1.00 43.06  ? 283  GLU A O   1 
ATOM   1771  C  CB  . GLU A 1 305 ? -27.578 111.273 59.280  1.00 40.54  ? 283  GLU A CB  1 
ATOM   1772  C  CG  . GLU A 1 305 ? -28.588 110.323 59.894  1.00 47.70  ? 283  GLU A CG  1 
ATOM   1773  C  CD  . GLU A 1 305 ? -29.504 111.015 60.887  1.00 54.85  ? 283  GLU A CD  1 
ATOM   1774  O  OE1 . GLU A 1 305 ? -30.356 110.328 61.496  1.00 61.73  ? 283  GLU A OE1 1 
ATOM   1775  O  OE2 . GLU A 1 305 ? -29.369 112.246 61.061  1.00 56.93  ? 283  GLU A OE2 1 
ATOM   1776  N  N   . GLY A 1 306 ? -26.027 111.806 56.300  1.00 41.18  ? 284  GLY A N   1 
ATOM   1777  C  CA  . GLY A 1 306 ? -25.286 112.768 55.509  1.00 39.67  ? 284  GLY A CA  1 
ATOM   1778  C  C   . GLY A 1 306 ? -24.396 112.005 54.552  1.00 41.96  ? 284  GLY A C   1 
ATOM   1779  O  O   . GLY A 1 306 ? -23.604 112.581 53.805  1.00 36.34  ? 284  GLY A O   1 
ATOM   1780  N  N   . SER A 1 307 ? -24.535 110.685 54.595  1.00 46.52  ? 285  SER A N   1 
ATOM   1781  C  CA  . SER A 1 307 ? -23.776 109.776 53.748  1.00 51.59  ? 285  SER A CA  1 
ATOM   1782  C  C   . SER A 1 307 ? -24.776 109.040 52.856  1.00 49.57  ? 285  SER A C   1 
ATOM   1783  O  O   . SER A 1 307 ? -25.966 108.972 53.172  1.00 48.90  ? 285  SER A O   1 
ATOM   1784  C  CB  . SER A 1 307 ? -22.999 108.775 54.614  1.00 55.06  ? 285  SER A CB  1 
ATOM   1785  O  OG  . SER A 1 307 ? -22.233 107.882 53.821  1.00 59.16  ? 285  SER A OG  1 
ATOM   1786  N  N   . ILE A 1 308 ? -24.294 108.483 51.749  1.00 46.47  ? 286  ILE A N   1 
ATOM   1787  C  CA  . ILE A 1 308 ? -25.160 107.773 50.809  1.00 40.35  ? 286  ILE A CA  1 
ATOM   1788  C  C   . ILE A 1 308 ? -24.892 106.278 50.775  1.00 35.03  ? 286  ILE A C   1 
ATOM   1789  O  O   . ILE A 1 308 ? -25.533 105.552 50.012  1.00 39.68  ? 286  ILE A O   1 
ATOM   1790  C  CB  . ILE A 1 308 ? -24.963 108.295 49.366  1.00 44.59  ? 286  ILE A CB  1 
ATOM   1791  C  CG1 . ILE A 1 308 ? -23.521 108.030 48.916  1.00 44.87  ? 286  ILE A CG1 1 
ATOM   1792  C  CG2 . ILE A 1 308 ? -25.281 109.781 49.296  1.00 40.59  ? 286  ILE A CG2 1 
ATOM   1793  C  CD1 . ILE A 1 308 ? -23.259 108.297 47.455  1.00 46.68  ? 286  ILE A CD1 1 
ATOM   1794  N  N   . LEU A 1 309 ? -23.945 105.820 51.590  1.00 31.22  ? 287  LEU A N   1 
ATOM   1795  C  CA  . LEU A 1 309 ? -23.574 104.404 51.617  1.00 28.53  ? 287  LEU A CA  1 
ATOM   1796  C  C   . LEU A 1 309 ? -24.687 103.406 51.932  1.00 25.34  ? 287  LEU A C   1 
ATOM   1797  O  O   . LEU A 1 309 ? -24.875 102.431 51.208  1.00 27.09  ? 287  LEU A O   1 
ATOM   1798  C  CB  . LEU A 1 309 ? -22.403 104.183 52.582  1.00 28.18  ? 287  LEU A CB  1 
ATOM   1799  C  CG  . LEU A 1 309 ? -21.114 104.949 52.267  1.00 25.66  ? 287  LEU A CG  1 
ATOM   1800  C  CD1 . LEU A 1 309 ? -19.997 104.434 53.148  1.00 18.24  ? 287  LEU A CD1 1 
ATOM   1801  C  CD2 . LEU A 1 309 ? -20.750 104.769 50.801  1.00 31.70  ? 287  LEU A CD2 1 
ATOM   1802  N  N   . ALA A 1 310 ? -25.431 103.644 53.000  1.00 28.63  ? 288  ALA A N   1 
ATOM   1803  C  CA  . ALA A 1 310 ? -26.494 102.724 53.384  1.00 32.32  ? 288  ALA A CA  1 
ATOM   1804  C  C   . ALA A 1 310 ? -27.537 102.454 52.302  1.00 34.68  ? 288  ALA A C   1 
ATOM   1805  O  O   . ALA A 1 310 ? -27.705 103.236 51.370  1.00 36.14  ? 288  ALA A O   1 
ATOM   1806  C  CB  . ALA A 1 310 ? -27.181 103.228 54.649  1.00 21.45  ? 288  ALA A CB  1 
ATOM   1807  N  N   . GLU A 1 311 ? -28.228 101.327 52.448  1.00 40.41  ? 289  GLU A N   1 
ATOM   1808  C  CA  . GLU A 1 311 ? -29.294 100.925 51.544  1.00 44.87  ? 289  GLU A CA  1 
ATOM   1809  C  C   . GLU A 1 311 ? -30.425 100.451 52.456  1.00 49.48  ? 289  GLU A C   1 
ATOM   1810  O  O   . GLU A 1 311 ? -30.169 99.944  53.546  1.00 53.55  ? 289  GLU A O   1 
ATOM   1811  C  CB  . GLU A 1 311 ? -28.849 99.769  50.651  1.00 42.31  ? 289  GLU A CB  1 
ATOM   1812  C  CG  . GLU A 1 311 ? -27.558 100.006 49.879  1.00 48.50  ? 289  GLU A CG  1 
ATOM   1813  C  CD  . GLU A 1 311 ? -27.283 98.911  48.851  1.00 46.79  ? 289  GLU A CD  1 
ATOM   1814  O  OE1 . GLU A 1 311 ? -27.886 98.938  47.761  1.00 43.67  ? 289  GLU A OE1 1 
ATOM   1815  O  OE2 . GLU A 1 311 ? -26.473 98.010  49.140  1.00 51.71  ? 289  GLU A OE2 1 
ATOM   1816  N  N   . PRO A 1 312 ? -31.692 100.620 52.037  1.00 51.37  ? 290  PRO A N   1 
ATOM   1817  C  CA  . PRO A 1 312 ? -32.149 101.221 50.779  1.00 49.92  ? 290  PRO A CA  1 
ATOM   1818  C  C   . PRO A 1 312 ? -31.964 102.739 50.718  1.00 51.75  ? 290  PRO A C   1 
ATOM   1819  O  O   . PRO A 1 312 ? -31.434 103.356 51.641  1.00 52.45  ? 290  PRO A O   1 
ATOM   1820  C  CB  . PRO A 1 312 ? -33.618 100.824 50.726  1.00 44.46  ? 290  PRO A CB  1 
ATOM   1821  C  CG  . PRO A 1 312 ? -33.646 99.539  51.499  1.00 51.83  ? 290  PRO A CG  1 
ATOM   1822  C  CD  . PRO A 1 312 ? -32.791 99.882  52.677  1.00 46.63  ? 290  PRO A CD  1 
ATOM   1823  N  N   . GLU A 1 313 ? -32.410 103.328 49.614  1.00 52.98  ? 291  GLU A N   1 
ATOM   1824  C  CA  . GLU A 1 313 ? -32.316 104.766 49.395  1.00 53.50  ? 291  GLU A CA  1 
ATOM   1825  C  C   . GLU A 1 313 ? -32.912 105.591 50.534  1.00 53.47  ? 291  GLU A C   1 
ATOM   1826  O  O   . GLU A 1 313 ? -32.268 106.506 51.049  1.00 53.71  ? 291  GLU A O   1 
ATOM   1827  C  CB  . GLU A 1 313 ? -33.023 105.129 48.086  1.00 55.51  ? 291  GLU A CB  1 
ATOM   1828  C  CG  . GLU A 1 313 ? -32.264 104.719 46.853  1.00 59.17  ? 291  GLU A CG  1 
ATOM   1829  C  CD  . GLU A 1 313 ? -31.115 105.656 46.569  1.00 65.86  ? 291  GLU A CD  1 
ATOM   1830  O  OE1 . GLU A 1 313 ? -30.419 106.052 47.538  1.00 62.10  ? 291  GLU A OE1 1 
ATOM   1831  O  OE2 . GLU A 1 313 ? -30.910 105.990 45.377  1.00 65.69  ? 291  GLU A OE2 1 
ATOM   1832  N  N   . GLU A 1 314 ? -34.147 105.267 50.909  1.00 51.31  ? 292  GLU A N   1 
ATOM   1833  C  CA  . GLU A 1 314 ? -34.855 105.972 51.977  1.00 54.42  ? 292  GLU A CA  1 
ATOM   1834  C  C   . GLU A 1 314 ? -33.940 106.355 53.130  1.00 52.74  ? 292  GLU A C   1 
ATOM   1835  O  O   . GLU A 1 314 ? -33.938 107.497 53.581  1.00 48.33  ? 292  GLU A O   1 
ATOM   1836  C  CB  . GLU A 1 314 ? -36.006 105.112 52.517  1.00 59.33  ? 292  GLU A CB  1 
ATOM   1837  C  CG  . GLU A 1 314 ? -37.034 104.684 51.468  1.00 63.36  ? 292  GLU A CG  1 
ATOM   1838  C  CD  . GLU A 1 314 ? -36.588 103.473 50.658  1.00 66.02  ? 292  GLU A CD  1 
ATOM   1839  O  OE1 . GLU A 1 314 ? -36.432 102.387 51.254  1.00 57.85  ? 292  GLU A OE1 1 
ATOM   1840  O  OE2 . GLU A 1 314 ? -36.395 103.605 49.428  1.00 68.56  ? 292  GLU A OE2 1 
ATOM   1841  N  N   . LEU A 1 315 ? -33.159 105.387 53.595  1.00 56.10  ? 293  LEU A N   1 
ATOM   1842  C  CA  . LEU A 1 315 ? -32.229 105.588 54.699  1.00 52.20  ? 293  LEU A CA  1 
ATOM   1843  C  C   . LEU A 1 315 ? -31.401 106.861 54.608  1.00 53.15  ? 293  LEU A C   1 
ATOM   1844  O  O   . LEU A 1 315 ? -31.082 107.461 55.633  1.00 56.64  ? 293  LEU A O   1 
ATOM   1845  C  CB  . LEU A 1 315 ? -31.289 104.387 54.809  1.00 53.37  ? 293  LEU A CB  1 
ATOM   1846  C  CG  . LEU A 1 315 ? -31.843 103.085 55.403  1.00 57.67  ? 293  LEU A CG  1 
ATOM   1847  C  CD1 . LEU A 1 315 ? -32.157 103.298 56.874  1.00 50.01  ? 293  LEU A CD1 1 
ATOM   1848  C  CD2 . LEU A 1 315 ? -33.088 102.631 54.640  1.00 53.29  ? 293  LEU A CD2 1 
ATOM   1849  N  N   . ASN A 1 316 ? -31.064 107.279 53.392  1.00 53.55  ? 294  ASN A N   1 
ATOM   1850  C  CA  . ASN A 1 316 ? -30.244 108.470 53.193  1.00 51.20  ? 294  ASN A CA  1 
ATOM   1851  C  C   . ASN A 1 316 ? -30.961 109.799 52.895  1.00 55.72  ? 294  ASN A C   1 
ATOM   1852  O  O   . ASN A 1 316 ? -30.328 110.730 52.387  1.00 54.66  ? 294  ASN A O   1 
ATOM   1853  C  CB  . ASN A 1 316 ? -29.229 108.203 52.076  1.00 45.54  ? 294  ASN A CB  1 
ATOM   1854  C  CG  . ASN A 1 316 ? -28.432 106.950 52.307  1.00 37.93  ? 294  ASN A CG  1 
ATOM   1855  O  OD1 . ASN A 1 316 ? -27.859 106.757 53.378  1.00 40.10  ? 294  ASN A OD1 1 
ATOM   1856  N  ND2 . ASN A 1 316 ? -28.379 106.093 51.305  1.00 35.06  ? 294  ASN A ND2 1 
ATOM   1857  N  N   . GLN A 1 317 ? -32.248 109.909 53.214  1.00 61.39  ? 295  GLN A N   1 
ATOM   1858  C  CA  . GLN A 1 317 ? -32.981 111.149 52.942  1.00 64.61  ? 295  GLN A CA  1 
ATOM   1859  C  C   . GLN A 1 317 ? -32.736 112.293 53.922  1.00 65.35  ? 295  GLN A C   1 
ATOM   1860  O  O   . GLN A 1 317 ? -33.319 112.312 55.006  1.00 69.25  ? 295  GLN A O   1 
ATOM   1861  C  CB  . GLN A 1 317 ? -34.482 110.881 52.907  1.00 68.87  ? 295  GLN A CB  1 
ATOM   1862  C  CG  . GLN A 1 317 ? -34.900 109.813 51.918  1.00 73.67  ? 295  GLN A CG  1 
ATOM   1863  C  CD  . GLN A 1 317 ? -36.404 109.594 51.877  1.00 76.01  ? 295  GLN A CD  1 
ATOM   1864  O  OE1 . GLN A 1 317 ? -37.048 109.508 52.920  1.00 72.91  ? 295  GLN A OE1 1 
ATOM   1865  N  NE2 . GLN A 1 317 ? -36.964 109.487 50.683  1.00 77.08  ? 295  GLN A NE2 1 
ATOM   1866  N  N   . THR A 1 318 ? -31.878 113.237 53.542  1.00 65.73  ? 296  THR A N   1 
ATOM   1867  C  CA  . THR A 1 318 ? -31.578 114.393 54.389  1.00 65.95  ? 296  THR A CA  1 
ATOM   1868  C  C   . THR A 1 318 ? -30.756 115.459 53.664  1.00 69.58  ? 296  THR A C   1 
ATOM   1869  O  O   . THR A 1 318 ? -30.225 115.224 52.570  1.00 69.12  ? 296  THR A O   1 
ATOM   1870  C  CB  . THR A 1 318 ? -30.800 113.986 55.666  1.00 63.94  ? 296  THR A CB  1 
ATOM   1871  O  OG1 . THR A 1 318 ? -31.506 112.952 56.358  1.00 69.84  ? 296  THR A OG1 1 
ATOM   1872  C  CG2 . THR A 1 318 ? -30.670 115.171 56.608  1.00 67.99  ? 296  THR A CG2 1 
ATOM   1873  N  N   . GLU A 1 319 ? -30.671 116.641 54.266  1.00 74.52  ? 297  GLU A N   1 
ATOM   1874  C  CA  . GLU A 1 319 ? -29.890 117.730 53.701  1.00 78.73  ? 297  GLU A CA  1 
ATOM   1875  C  C   . GLU A 1 319 ? -28.546 117.769 54.438  1.00 79.24  ? 297  GLU A C   1 
ATOM   1876  O  O   . GLU A 1 319 ? -27.590 118.391 53.963  1.00 82.82  ? 297  GLU A O   1 
ATOM   1877  C  CB  . GLU A 1 319 ? -30.639 119.066 53.864  1.00 81.63  ? 297  GLU A CB  1 
ATOM   1878  C  CG  . GLU A 1 319 ? -31.345 119.543 52.595  1.00 83.71  ? 297  GLU A CG  1 
ATOM   1879  C  CD  . GLU A 1 319 ? -30.392 120.192 51.599  1.00 86.06  ? 297  GLU A CD  1 
ATOM   1880  O  OE1 . GLU A 1 319 ? -29.794 121.232 51.951  1.00 88.34  ? 297  GLU A OE1 1 
ATOM   1881  O  OE2 . GLU A 1 319 ? -30.237 119.673 50.471  1.00 84.40  ? 297  GLU A OE2 1 
ATOM   1882  N  N   . GLN A 1 320 ? -28.484 117.100 55.593  1.00 77.56  ? 298  GLN A N   1 
ATOM   1883  C  CA  . GLN A 1 320 ? -27.243 117.018 56.356  1.00 74.03  ? 298  GLN A CA  1 
ATOM   1884  C  C   . GLN A 1 320 ? -26.259 116.507 55.349  1.00 73.51  ? 298  GLN A C   1 
ATOM   1885  O  O   . GLN A 1 320 ? -26.478 115.455 54.738  1.00 72.03  ? 298  GLN A O   1 
ATOM   1886  C  CB  . GLN A 1 320 ? -27.276 115.932 57.450  1.00 71.58  ? 298  GLN A CB  1 
ATOM   1887  C  CG  . GLN A 1 320 ? -28.337 116.076 58.504  1.00 67.63  ? 298  GLN A CG  1 
ATOM   1888  C  CD  . GLN A 1 320 ? -28.013 117.179 59.503  1.00 67.60  ? 298  GLN A CD  1 
ATOM   1889  O  OE1 . GLN A 1 320 ? -26.965 117.163 60.127  1.00 62.35  ? 298  GLN A OE1 1 
ATOM   1890  N  NE2 . GLN A 1 320 ? -28.905 118.150 59.634  1.00 66.33  ? 298  GLN A NE2 1 
ATOM   1891  N  N   . THR A 1 321 ? -25.172 117.225 55.166  1.00 74.57  ? 299  THR A N   1 
ATOM   1892  C  CA  . THR A 1 321 ? -24.183 116.760 54.216  1.00 75.32  ? 299  THR A CA  1 
ATOM   1893  C  C   . THR A 1 321 ? -22.919 116.592 55.045  1.00 70.63  ? 299  THR A C   1 
ATOM   1894  O  O   . THR A 1 321 ? -21.991 115.860 54.676  1.00 71.22  ? 299  THR A O   1 
ATOM   1895  C  CB  . THR A 1 321 ? -23.979 117.804 53.095  1.00 80.36  ? 299  THR A CB  1 
ATOM   1896  O  OG1 . THR A 1 321 ? -24.291 117.221 51.823  1.00 83.73  ? 299  THR A OG1 1 
ATOM   1897  C  CG2 . THR A 1 321 ? -22.540 118.336 53.090  1.00 80.80  ? 299  THR A CG2 1 
ATOM   1898  N  N   . THR A 1 322 ? -22.932 117.254 56.199  1.00 65.78  ? 300  THR A N   1 
ATOM   1899  C  CA  . THR A 1 322 ? -21.807 117.240 57.119  1.00 60.89  ? 300  THR A CA  1 
ATOM   1900  C  C   . THR A 1 322 ? -22.111 116.725 58.526  1.00 57.51  ? 300  THR A C   1 
ATOM   1901  O  O   . THR A 1 322 ? -23.211 116.924 59.058  1.00 54.38  ? 300  THR A O   1 
ATOM   1902  C  CB  . THR A 1 322 ? -21.211 118.647 57.254  1.00 58.65  ? 300  THR A CB  1 
ATOM   1903  O  OG1 . THR A 1 322 ? -22.253 119.564 57.612  1.00 57.60  ? 300  THR A OG1 1 
ATOM   1904  C  CG2 . THR A 1 322 ? -20.566 119.085 55.949  1.00 57.94  ? 300  THR A CG2 1 
ATOM   1905  N  N   . TYR A 1 323 ? -21.097 116.076 59.106  1.00 51.19  ? 301  TYR A N   1 
ATOM   1906  C  CA  . TYR A 1 323 ? -21.137 115.520 60.460  1.00 43.31  ? 301  TYR A CA  1 
ATOM   1907  C  C   . TYR A 1 323 ? -19.717 115.537 61.016  1.00 36.39  ? 301  TYR A C   1 
ATOM   1908  O  O   . TYR A 1 323 ? -18.759 115.622 60.256  1.00 28.63  ? 301  TYR A O   1 
ATOM   1909  C  CB  . TYR A 1 323 ? -21.687 114.088 60.456  1.00 48.28  ? 301  TYR A CB  1 
ATOM   1910  C  CG  . TYR A 1 323 ? -21.156 113.227 59.338  1.00 49.95  ? 301  TYR A CG  1 
ATOM   1911  C  CD1 . TYR A 1 323 ? -19.849 112.748 59.357  1.00 48.02  ? 301  TYR A CD1 1 
ATOM   1912  C  CD2 . TYR A 1 323 ? -21.951 112.928 58.237  1.00 50.46  ? 301  TYR A CD2 1 
ATOM   1913  C  CE1 . TYR A 1 323 ? -19.351 111.996 58.305  1.00 49.36  ? 301  TYR A CE1 1 
ATOM   1914  C  CE2 . TYR A 1 323 ? -21.465 112.183 57.183  1.00 48.90  ? 301  TYR A CE2 1 
ATOM   1915  C  CZ  . TYR A 1 323 ? -20.167 111.719 57.221  1.00 47.55  ? 301  TYR A CZ  1 
ATOM   1916  O  OH  . TYR A 1 323 ? -19.689 110.973 56.175  1.00 40.84  ? 301  TYR A OH  1 
ATOM   1917  N  N   . GLU A 1 324 ? -19.592 115.438 62.339  1.00 33.49  ? 302  GLU A N   1 
ATOM   1918  C  CA  . GLU A 1 324 ? -18.300 115.487 63.025  1.00 33.60  ? 302  GLU A CA  1 
ATOM   1919  C  C   . GLU A 1 324 ? -17.543 114.170 63.202  1.00 30.80  ? 302  GLU A C   1 
ATOM   1920  O  O   . GLU A 1 324 ? -16.335 114.200 63.441  1.00 25.66  ? 302  GLU A O   1 
ATOM   1921  C  CB  . GLU A 1 324 ? -18.481 116.120 64.404  1.00 40.50  ? 302  GLU A CB  1 
ATOM   1922  C  CG  . GLU A 1 324 ? -19.106 117.502 64.410  1.00 40.81  ? 302  GLU A CG  1 
ATOM   1923  C  CD  . GLU A 1 324 ? -18.185 118.563 63.847  1.00 43.79  ? 302  GLU A CD  1 
ATOM   1924  O  OE1 . GLU A 1 324 ? -16.956 118.353 63.879  1.00 46.73  ? 302  GLU A OE1 1 
ATOM   1925  O  OE2 . GLU A 1 324 ? -18.690 119.613 63.387  1.00 45.89  ? 302  GLU A OE2 1 
ATOM   1926  N  N   . VAL A 1 325 ? -18.235 113.029 63.123  1.00 28.85  ? 303  VAL A N   1 
ATOM   1927  C  CA  . VAL A 1 325 ? -17.565 111.735 63.280  1.00 26.45  ? 303  VAL A CA  1 
ATOM   1928  C  C   . VAL A 1 325 ? -16.647 111.462 62.115  1.00 24.72  ? 303  VAL A C   1 
ATOM   1929  O  O   . VAL A 1 325 ? -17.061 111.535 60.964  1.00 30.00  ? 303  VAL A O   1 
ATOM   1930  C  CB  . VAL A 1 325 ? -18.551 110.582 63.404  1.00 26.14  ? 303  VAL A CB  1 
ATOM   1931  C  CG1 . VAL A 1 325 ? -19.058 110.504 64.840  1.00 28.48  ? 303  VAL A CG1 1 
ATOM   1932  C  CG2 . VAL A 1 325 ? -19.693 110.784 62.440  1.00 24.38  ? 303  VAL A CG2 1 
ATOM   1933  N  N   . GLU A 1 326 ? -15.399 111.133 62.425  1.00 23.64  ? 304  GLU A N   1 
ATOM   1934  C  CA  . GLU A 1 326 ? -14.402 110.887 61.398  1.00 22.30  ? 304  GLU A CA  1 
ATOM   1935  C  C   . GLU A 1 326 ? -14.232 109.430 60.987  1.00 21.29  ? 304  GLU A C   1 
ATOM   1936  O  O   . GLU A 1 326 ? -14.450 108.521 61.782  1.00 18.44  ? 304  GLU A O   1 
ATOM   1937  C  CB  . GLU A 1 326 ? -13.061 111.447 61.862  1.00 23.70  ? 304  GLU A CB  1 
ATOM   1938  C  CG  . GLU A 1 326 ? -13.163 112.843 62.418  1.00 21.21  ? 304  GLU A CG  1 
ATOM   1939  C  CD  . GLU A 1 326 ? -11.821 113.412 62.813  1.00 32.96  ? 304  GLU A CD  1 
ATOM   1940  O  OE1 . GLU A 1 326 ? -11.774 114.167 63.804  1.00 34.36  ? 304  GLU A OE1 1 
ATOM   1941  O  OE2 . GLU A 1 326 ? -10.820 113.116 62.127  1.00 29.46  ? 304  GLU A OE2 1 
ATOM   1942  N  N   . GLY A 1 327 ? -13.861 109.233 59.724  1.00 20.43  ? 305  GLY A N   1 
ATOM   1943  C  CA  . GLY A 1 327 ? -13.627 107.902 59.192  1.00 19.27  ? 305  GLY A CA  1 
ATOM   1944  C  C   . GLY A 1 327 ? -14.780 107.136 58.566  1.00 20.96  ? 305  GLY A C   1 
ATOM   1945  O  O   . GLY A 1 327 ? -14.550 106.119 57.923  1.00 28.26  ? 305  GLY A O   1 
ATOM   1946  N  N   . ILE A 1 328 ? -16.011 107.595 58.744  1.00 23.50  ? 306  ILE A N   1 
ATOM   1947  C  CA  . ILE A 1 328 ? -17.143 106.877 58.181  1.00 26.48  ? 306  ILE A CA  1 
ATOM   1948  C  C   . ILE A 1 328 ? -18.020 107.709 57.257  1.00 29.85  ? 306  ILE A C   1 
ATOM   1949  O  O   . ILE A 1 328 ? -18.072 108.939 57.358  1.00 28.10  ? 306  ILE A O   1 
ATOM   1950  C  CB  . ILE A 1 328 ? -18.023 106.295 59.290  1.00 27.41  ? 306  ILE A CB  1 
ATOM   1951  C  CG1 . ILE A 1 328 ? -18.402 107.386 60.290  1.00 32.16  ? 306  ILE A CG1 1 
ATOM   1952  C  CG2 . ILE A 1 328 ? -17.284 105.183 59.997  1.00 35.33  ? 306  ILE A CG2 1 
ATOM   1953  C  CD1 . ILE A 1 328 ? -19.476 106.949 61.268  1.00 12.37  ? 306  ILE A CD1 1 
ATOM   1954  N  N   . GLY A 1 329 ? -18.719 107.021 56.359  1.00 29.96  ? 307  GLY A N   1 
ATOM   1955  C  CA  . GLY A 1 329 ? -19.588 107.695 55.420  1.00 31.00  ? 307  GLY A CA  1 
ATOM   1956  C  C   . GLY A 1 329 ? -18.804 108.180 54.219  1.00 32.26  ? 307  GLY A C   1 
ATOM   1957  O  O   . GLY A 1 329 ? -17.568 108.176 54.238  1.00 23.54  ? 307  GLY A O   1 
ATOM   1958  N  N   . TYR A 1 330 ? -19.521 108.607 53.181  1.00 32.81  ? 308  TYR A N   1 
ATOM   1959  C  CA  . TYR A 1 330 ? -18.898 109.093 51.954  1.00 36.20  ? 308  TYR A CA  1 
ATOM   1960  C  C   . TYR A 1 330 ? -20.010 109.514 51.004  1.00 37.29  ? 308  TYR A C   1 
ATOM   1961  O  O   . TYR A 1 330 ? -21.141 109.041 51.132  1.00 40.17  ? 308  TYR A O   1 
ATOM   1962  C  CB  . TYR A 1 330 ? -18.071 107.974 51.320  1.00 38.17  ? 308  TYR A CB  1 
ATOM   1963  C  CG  . TYR A 1 330 ? -16.874 108.434 50.510  1.00 44.34  ? 308  TYR A CG  1 
ATOM   1964  C  CD1 . TYR A 1 330 ? -15.851 109.182 51.098  1.00 40.48  ? 308  TYR A CD1 1 
ATOM   1965  C  CD2 . TYR A 1 330 ? -16.728 108.053 49.163  1.00 47.75  ? 308  TYR A CD2 1 
ATOM   1966  C  CE1 . TYR A 1 330 ? -14.712 109.531 50.369  1.00 49.51  ? 308  TYR A CE1 1 
ATOM   1967  C  CE2 . TYR A 1 330 ? -15.591 108.396 48.423  1.00 43.87  ? 308  TYR A CE2 1 
ATOM   1968  C  CZ  . TYR A 1 330 ? -14.589 109.129 49.033  1.00 49.60  ? 308  TYR A CZ  1 
ATOM   1969  O  OH  . TYR A 1 330 ? -13.453 109.430 48.320  1.00 47.37  ? 308  TYR A OH  1 
ATOM   1970  N  N   . ASP A 1 331 ? -19.704 110.408 50.065  1.00 39.69  ? 309  ASP A N   1 
ATOM   1971  C  CA  . ASP A 1 331 ? -20.705 110.867 49.097  1.00 46.04  ? 309  ASP A CA  1 
ATOM   1972  C  C   . ASP A 1 331 ? -20.574 110.136 47.764  1.00 46.48  ? 309  ASP A C   1 
ATOM   1973  O  O   . ASP A 1 331 ? -21.134 110.556 46.755  1.00 40.82  ? 309  ASP A O   1 
ATOM   1974  C  CB  . ASP A 1 331 ? -20.603 112.380 48.876  1.00 46.37  ? 309  ASP A CB  1 
ATOM   1975  C  CG  . ASP A 1 331 ? -19.211 112.919 49.134  1.00 54.32  ? 309  ASP A CG  1 
ATOM   1976  O  OD1 . ASP A 1 331 ? -18.240 112.410 48.530  1.00 57.89  ? 309  ASP A OD1 1 
ATOM   1977  O  OD2 . ASP A 1 331 ? -19.090 113.863 49.945  1.00 58.57  ? 309  ASP A OD2 1 
ATOM   1978  N  N   . PHE A 1 332 ? -19.822 109.038 47.791  1.00 49.52  ? 310  PHE A N   1 
ATOM   1979  C  CA  . PHE A 1 332 ? -19.586 108.186 46.632  1.00 53.34  ? 310  PHE A CA  1 
ATOM   1980  C  C   . PHE A 1 332 ? -19.494 106.748 47.126  1.00 52.33  ? 310  PHE A C   1 
ATOM   1981  O  O   . PHE A 1 332 ? -19.041 106.501 48.242  1.00 52.60  ? 310  PHE A O   1 
ATOM   1982  C  CB  . PHE A 1 332 ? -18.266 108.545 45.945  1.00 56.88  ? 310  PHE A CB  1 
ATOM   1983  C  CG  . PHE A 1 332 ? -18.281 109.874 45.254  1.00 63.30  ? 310  PHE A CG  1 
ATOM   1984  C  CD1 . PHE A 1 332 ? -17.454 110.901 45.689  1.00 62.44  ? 310  PHE A CD1 1 
ATOM   1985  C  CD2 . PHE A 1 332 ? -19.116 110.098 44.159  1.00 64.46  ? 310  PHE A CD2 1 
ATOM   1986  C  CE1 . PHE A 1 332 ? -17.456 112.137 45.041  1.00 68.84  ? 310  PHE A CE1 1 
ATOM   1987  C  CE2 . PHE A 1 332 ? -19.127 111.329 43.504  1.00 62.48  ? 310  PHE A CE2 1 
ATOM   1988  C  CZ  . PHE A 1 332 ? -18.298 112.349 43.944  1.00 64.04  ? 310  PHE A CZ  1 
ATOM   1989  N  N   . ILE A 1 333 ? -19.926 105.798 46.307  1.00 47.22  ? 311  ILE A N   1 
ATOM   1990  C  CA  . ILE A 1 333 ? -19.841 104.407 46.711  1.00 37.28  ? 311  ILE A CA  1 
ATOM   1991  C  C   . ILE A 1 333 ? -18.460 103.904 46.340  1.00 35.87  ? 311  ILE A C   1 
ATOM   1992  O  O   . ILE A 1 333 ? -18.166 103.694 45.161  1.00 27.83  ? 311  ILE A O   1 
ATOM   1993  C  CB  . ILE A 1 333 ? -20.908 103.570 46.026  1.00 26.87  ? 311  ILE A CB  1 
ATOM   1994  C  CG1 . ILE A 1 333 ? -22.276 104.137 46.391  1.00 18.43  ? 311  ILE A CG1 1 
ATOM   1995  C  CG2 . ILE A 1 333 ? -20.787 102.115 46.453  1.00 25.44  ? 311  ILE A CG2 1 
ATOM   1996  C  CD1 . ILE A 1 333 ? -23.420 103.271 45.981  1.00 22.33  ? 311  ILE A CD1 1 
ATOM   1997  N  N   . PRO A 1 334 ? -17.574 103.741 47.349  1.00 38.87  ? 312  PRO A N   1 
ATOM   1998  C  CA  . PRO A 1 334 ? -16.216 103.260 47.075  1.00 36.03  ? 312  PRO A CA  1 
ATOM   1999  C  C   . PRO A 1 334 ? -16.304 101.964 46.286  1.00 33.97  ? 312  PRO A C   1 
ATOM   2000  O  O   . PRO A 1 334 ? -17.243 101.191 46.464  1.00 33.16  ? 312  PRO A O   1 
ATOM   2001  C  CB  . PRO A 1 334 ? -15.623 103.067 48.476  1.00 36.31  ? 312  PRO A CB  1 
ATOM   2002  C  CG  . PRO A 1 334 ? -16.330 104.091 49.289  1.00 24.26  ? 312  PRO A CG  1 
ATOM   2003  C  CD  . PRO A 1 334 ? -17.762 103.957 48.799  1.00 36.38  ? 312  PRO A CD  1 
ATOM   2004  N  N   . THR A 1 335 ? -15.338 101.736 45.407  1.00 33.08  ? 313  THR A N   1 
ATOM   2005  C  CA  . THR A 1 335 ? -15.339 100.539 44.592  1.00 32.10  ? 313  THR A CA  1 
ATOM   2006  C  C   . THR A 1 335 ? -14.939 99.295  45.389  1.00 34.34  ? 313  THR A C   1 
ATOM   2007  O  O   . THR A 1 335 ? -15.314 98.174  45.015  1.00 32.35  ? 313  THR A O   1 
ATOM   2008  C  CB  . THR A 1 335 ? -14.414 100.723 43.369  1.00 32.97  ? 313  THR A CB  1 
ATOM   2009  O  OG1 . THR A 1 335 ? -13.668 99.524  43.139  1.00 39.20  ? 313  THR A OG1 1 
ATOM   2010  C  CG2 . THR A 1 335 ? -13.468 101.871 43.590  1.00 31.99  ? 313  THR A CG2 1 
ATOM   2011  N  N   . VAL A 1 336 ? -14.201 99.486  46.490  1.00 29.94  ? 314  VAL A N   1 
ATOM   2012  C  CA  . VAL A 1 336 ? -13.782 98.358  47.329  1.00 25.06  ? 314  VAL A CA  1 
ATOM   2013  C  C   . VAL A 1 336 ? -14.927 97.819  48.175  1.00 25.50  ? 314  VAL A C   1 
ATOM   2014  O  O   . VAL A 1 336 ? -14.832 96.718  48.730  1.00 21.84  ? 314  VAL A O   1 
ATOM   2015  C  CB  . VAL A 1 336 ? -12.626 98.724  48.285  1.00 23.81  ? 314  VAL A CB  1 
ATOM   2016  C  CG1 . VAL A 1 336 ? -11.354 99.029  47.487  1.00 20.88  ? 314  VAL A CG1 1 
ATOM   2017  C  CG2 . VAL A 1 336 ? -13.028 99.905  49.170  1.00 29.39  ? 314  VAL A CG2 1 
ATOM   2018  N  N   . LEU A 1 337 ? -16.012 98.589  48.250  1.00 23.93  ? 315  LEU A N   1 
ATOM   2019  C  CA  . LEU A 1 337 ? -17.192 98.210  49.023  1.00 28.79  ? 315  LEU A CA  1 
ATOM   2020  C  C   . LEU A 1 337 ? -18.176 97.348  48.233  1.00 29.55  ? 315  LEU A C   1 
ATOM   2021  O  O   . LEU A 1 337 ? -18.576 97.703  47.132  1.00 44.36  ? 315  LEU A O   1 
ATOM   2022  C  CB  . LEU A 1 337 ? -17.913 99.467  49.525  1.00 29.08  ? 315  LEU A CB  1 
ATOM   2023  C  CG  . LEU A 1 337 ? -19.365 99.314  50.001  1.00 34.65  ? 315  LEU A CG  1 
ATOM   2024  C  CD1 . LEU A 1 337 ? -19.427 98.362  51.199  1.00 28.38  ? 315  LEU A CD1 1 
ATOM   2025  C  CD2 . LEU A 1 337 ? -19.934 100.678 50.364  1.00 18.70  ? 315  LEU A CD2 1 
ATOM   2026  N  N   . ASP A 1 338 ? -18.562 96.217  48.807  1.00 24.04  ? 316  ASP A N   1 
ATOM   2027  C  CA  . ASP A 1 338 ? -19.516 95.318  48.191  1.00 24.41  ? 316  ASP A CA  1 
ATOM   2028  C  C   . ASP A 1 338 ? -20.769 95.364  49.077  1.00 33.85  ? 316  ASP A C   1 
ATOM   2029  O  O   . ASP A 1 338 ? -20.898 94.592  50.028  1.00 36.10  ? 316  ASP A O   1 
ATOM   2030  C  CB  . ASP A 1 338 ? -18.917 93.906  48.147  1.00 27.49  ? 316  ASP A CB  1 
ATOM   2031  C  CG  . ASP A 1 338 ? -19.871 92.856  47.559  1.00 38.02  ? 316  ASP A CG  1 
ATOM   2032  O  OD1 . ASP A 1 338 ? -19.415 91.701  47.345  1.00 24.21  ? 316  ASP A OD1 1 
ATOM   2033  O  OD2 . ASP A 1 338 ? -21.063 93.167  47.321  1.00 40.46  ? 316  ASP A OD2 1 
ATOM   2034  N  N   . ARG A 1 339 ? -21.686 96.279  48.781  1.00 34.70  ? 317  ARG A N   1 
ATOM   2035  C  CA  . ARG A 1 339 ? -22.909 96.411  49.584  1.00 36.31  ? 317  ARG A CA  1 
ATOM   2036  C  C   . ARG A 1 339 ? -23.779 95.156  49.565  1.00 37.04  ? 317  ARG A C   1 
ATOM   2037  O  O   . ARG A 1 339 ? -24.744 95.050  50.327  1.00 36.42  ? 317  ARG A O   1 
ATOM   2038  C  CB  . ARG A 1 339 ? -23.752 97.580  49.084  1.00 38.86  ? 317  ARG A CB  1 
ATOM   2039  C  CG  . ARG A 1 339 ? -23.093 98.946  49.138  1.00 47.42  ? 317  ARG A CG  1 
ATOM   2040  C  CD  . ARG A 1 339 ? -23.731 99.838  48.078  1.00 50.33  ? 317  ARG A CD  1 
ATOM   2041  N  NE  . ARG A 1 339 ? -24.376 101.027 48.629  1.00 52.74  ? 317  ARG A NE  1 
ATOM   2042  C  CZ  . ARG A 1 339 ? -25.218 101.794 47.942  1.00 50.94  ? 317  ARG A CZ  1 
ATOM   2043  N  NH1 . ARG A 1 339 ? -25.515 101.479 46.686  1.00 40.88  ? 317  ARG A NH1 1 
ATOM   2044  N  NH2 . ARG A 1 339 ? -25.742 102.886 48.496  1.00 48.85  ? 317  ARG A NH2 1 
ATOM   2045  N  N   . THR A 1 340 ? -23.433 94.213  48.691  1.00 38.03  ? 318  THR A N   1 
ATOM   2046  C  CA  . THR A 1 340 ? -24.177 92.967  48.529  1.00 34.28  ? 318  THR A CA  1 
ATOM   2047  C  C   . THR A 1 340 ? -24.130 92.029  49.717  1.00 26.86  ? 318  THR A C   1 
ATOM   2048  O  O   . THR A 1 340 ? -25.058 91.252  49.944  1.00 30.75  ? 318  THR A O   1 
ATOM   2049  C  CB  . THR A 1 340 ? -23.671 92.210  47.294  1.00 36.88  ? 318  THR A CB  1 
ATOM   2050  O  OG1 . THR A 1 340 ? -24.289 92.756  46.124  1.00 38.87  ? 318  THR A OG1 1 
ATOM   2051  C  CG2 . THR A 1 340 ? -23.981 90.722  47.398  1.00 40.34  ? 318  THR A CG2 1 
ATOM   2052  N  N   . VAL A 1 341 ? -23.052 92.101  50.477  1.00 24.91  ? 319  VAL A N   1 
ATOM   2053  C  CA  . VAL A 1 341 ? -22.890 91.237  51.624  1.00 22.17  ? 319  VAL A CA  1 
ATOM   2054  C  C   . VAL A 1 341 ? -23.375 91.849  52.934  1.00 25.59  ? 319  VAL A C   1 
ATOM   2055  O  O   . VAL A 1 341 ? -23.305 91.218  53.991  1.00 28.19  ? 319  VAL A O   1 
ATOM   2056  C  CB  . VAL A 1 341 ? -21.430 90.833  51.740  1.00 22.21  ? 319  VAL A CB  1 
ATOM   2057  C  CG1 . VAL A 1 341 ? -21.054 90.005  50.554  1.00 13.46  ? 319  VAL A CG1 1 
ATOM   2058  C  CG2 . VAL A 1 341 ? -20.552 92.063  51.772  1.00 12.46  ? 319  VAL A CG2 1 
ATOM   2059  N  N   . VAL A 1 342 ? -23.870 93.080  52.868  1.00 25.19  ? 320  VAL A N   1 
ATOM   2060  C  CA  . VAL A 1 342 ? -24.373 93.754  54.062  1.00 28.02  ? 320  VAL A CA  1 
ATOM   2061  C  C   . VAL A 1 342 ? -25.846 93.406  54.189  1.00 30.56  ? 320  VAL A C   1 
ATOM   2062  O  O   . VAL A 1 342 ? -26.646 93.807  53.354  1.00 28.45  ? 320  VAL A O   1 
ATOM   2063  C  CB  . VAL A 1 342 ? -24.233 95.295  53.959  1.00 27.00  ? 320  VAL A CB  1 
ATOM   2064  C  CG1 . VAL A 1 342 ? -24.811 95.959  55.211  1.00 22.25  ? 320  VAL A CG1 1 
ATOM   2065  C  CG2 . VAL A 1 342 ? -22.773 95.672  53.794  1.00 13.40  ? 320  VAL A CG2 1 
ATOM   2066  N  N   . ASP A 1 343 ? -26.204 92.665  55.233  1.00 33.83  ? 321  ASP A N   1 
ATOM   2067  C  CA  . ASP A 1 343 ? -27.588 92.254  55.421  1.00 32.70  ? 321  ASP A CA  1 
ATOM   2068  C  C   . ASP A 1 343 ? -28.567 93.357  55.795  1.00 35.95  ? 321  ASP A C   1 
ATOM   2069  O  O   . ASP A 1 343 ? -29.760 93.247  55.513  1.00 37.30  ? 321  ASP A O   1 
ATOM   2070  C  CB  . ASP A 1 343 ? -27.666 91.138  56.454  1.00 31.64  ? 321  ASP A CB  1 
ATOM   2071  C  CG  . ASP A 1 343 ? -27.046 89.850  55.955  1.00 38.46  ? 321  ASP A CG  1 
ATOM   2072  O  OD1 . ASP A 1 343 ? -27.359 89.457  54.806  1.00 31.41  ? 321  ASP A OD1 1 
ATOM   2073  O  OD2 . ASP A 1 343 ? -26.254 89.233  56.708  1.00 41.53  ? 321  ASP A OD2 1 
ATOM   2074  N  N   . LYS A 1 344 ? -28.079 94.416  56.430  1.00 36.61  ? 322  LYS A N   1 
ATOM   2075  C  CA  . LYS A 1 344 ? -28.958 95.503  56.821  1.00 31.88  ? 322  LYS A CA  1 
ATOM   2076  C  C   . LYS A 1 344 ? -28.161 96.694  57.295  1.00 35.55  ? 322  LYS A C   1 
ATOM   2077  O  O   . LYS A 1 344 ? -27.099 96.543  57.897  1.00 36.97  ? 322  LYS A O   1 
ATOM   2078  C  CB  . LYS A 1 344 ? -29.901 95.043  57.932  1.00 39.15  ? 322  LYS A CB  1 
ATOM   2079  C  CG  . LYS A 1 344 ? -30.875 96.105  58.420  1.00 39.39  ? 322  LYS A CG  1 
ATOM   2080  C  CD  . LYS A 1 344 ? -31.778 95.542  59.497  1.00 47.65  ? 322  LYS A CD  1 
ATOM   2081  C  CE  . LYS A 1 344 ? -32.668 96.618  60.098  1.00 52.65  ? 322  LYS A CE  1 
ATOM   2082  N  NZ  . LYS A 1 344 ? -33.479 96.092  61.243  1.00 50.70  ? 322  LYS A NZ  1 
ATOM   2083  N  N   . TRP A 1 345 ? -28.680 97.885  57.026  1.00 37.34  ? 323  TRP A N   1 
ATOM   2084  C  CA  . TRP A 1 345 ? -28.003 99.101  57.430  1.00 38.72  ? 323  TRP A CA  1 
ATOM   2085  C  C   . TRP A 1 345 ? -28.777 99.869  58.486  1.00 40.89  ? 323  TRP A C   1 
ATOM   2086  O  O   . TRP A 1 345 ? -29.981 99.669  58.671  1.00 42.56  ? 323  TRP A O   1 
ATOM   2087  C  CB  . TRP A 1 345 ? -27.783 100.027 56.232  1.00 37.18  ? 323  TRP A CB  1 
ATOM   2088  C  CG  . TRP A 1 345 ? -26.891 99.481  55.152  1.00 39.40  ? 323  TRP A CG  1 
ATOM   2089  C  CD1 . TRP A 1 345 ? -27.225 98.564  54.198  1.00 24.99  ? 323  TRP A CD1 1 
ATOM   2090  C  CD2 . TRP A 1 345 ? -25.534 99.875  54.879  1.00 36.28  ? 323  TRP A CD2 1 
ATOM   2091  N  NE1 . TRP A 1 345 ? -26.166 98.368  53.339  1.00 40.66  ? 323  TRP A NE1 1 
ATOM   2092  C  CE2 . TRP A 1 345 ? -25.115 99.158  53.733  1.00 32.98  ? 323  TRP A CE2 1 
ATOM   2093  C  CE3 . TRP A 1 345 ? -24.636 100.765 55.492  1.00 26.54  ? 323  TRP A CE3 1 
ATOM   2094  C  CZ2 . TRP A 1 345 ? -23.834 99.303  53.182  1.00 28.39  ? 323  TRP A CZ2 1 
ATOM   2095  C  CZ3 . TRP A 1 345 ? -23.362 100.911 54.944  1.00 28.50  ? 323  TRP A CZ3 1 
ATOM   2096  C  CH2 . TRP A 1 345 ? -22.974 100.183 53.799  1.00 27.08  ? 323  TRP A CH2 1 
ATOM   2097  N  N   . PHE A 1 346 ? -28.050 100.742 59.177  1.00 37.34  ? 324  PHE A N   1 
ATOM   2098  C  CA  . PHE A 1 346 ? -28.589 101.616 60.206  1.00 32.66  ? 324  PHE A CA  1 
ATOM   2099  C  C   . PHE A 1 346 ? -27.827 102.911 60.049  1.00 31.36  ? 324  PHE A C   1 
ATOM   2100  O  O   . PHE A 1 346 ? -26.627 102.902 59.777  1.00 34.30  ? 324  PHE A O   1 
ATOM   2101  C  CB  . PHE A 1 346 ? -28.324 101.088 61.619  1.00 34.09  ? 324  PHE A CB  1 
ATOM   2102  C  CG  . PHE A 1 346 ? -29.220 99.962  62.036  1.00 24.86  ? 324  PHE A CG  1 
ATOM   2103  C  CD1 . PHE A 1 346 ? -28.962 98.662  61.626  1.00 20.41  ? 324  PHE A CD1 1 
ATOM   2104  C  CD2 . PHE A 1 346 ? -30.310 100.200 62.862  1.00 25.05  ? 324  PHE A CD2 1 
ATOM   2105  C  CE1 . PHE A 1 346 ? -29.770 97.616  62.032  1.00 28.60  ? 324  PHE A CE1 1 
ATOM   2106  C  CE2 . PHE A 1 346 ? -31.123 99.159  63.272  1.00 32.03  ? 324  PHE A CE2 1 
ATOM   2107  C  CZ  . PHE A 1 346 ? -30.850 97.861  62.855  1.00 28.44  ? 324  PHE A CZ  1 
ATOM   2108  N  N   . LYS A 1 347 ? -28.519 104.028 60.206  1.00 31.77  ? 325  LYS A N   1 
ATOM   2109  C  CA  . LYS A 1 347 ? -27.865 105.316 60.107  1.00 29.24  ? 325  LYS A CA  1 
ATOM   2110  C  C   . LYS A 1 347 ? -27.605 105.747 61.544  1.00 31.57  ? 325  LYS A C   1 
ATOM   2111  O  O   . LYS A 1 347 ? -28.282 105.291 62.469  1.00 28.08  ? 325  LYS A O   1 
ATOM   2112  C  CB  . LYS A 1 347 ? -28.779 106.319 59.405  1.00 35.14  ? 325  LYS A CB  1 
ATOM   2113  C  CG  . LYS A 1 347 ? -29.222 105.896 58.003  1.00 39.10  ? 325  LYS A CG  1 
ATOM   2114  C  CD  . LYS A 1 347 ? -28.105 106.022 56.969  1.00 33.80  ? 325  LYS A CD  1 
ATOM   2115  C  CE  . LYS A 1 347 ? -27.678 107.469 56.787  1.00 37.62  ? 325  LYS A CE  1 
ATOM   2116  N  NZ  . LYS A 1 347 ? -26.749 107.640 55.641  1.00 34.35  ? 325  LYS A NZ  1 
ATOM   2117  N  N   . SER A 1 348 ? -26.610 106.598 61.743  1.00 30.81  ? 326  SER A N   1 
ATOM   2118  C  CA  . SER A 1 348 ? -26.309 107.080 63.082  1.00 29.42  ? 326  SER A CA  1 
ATOM   2119  C  C   . SER A 1 348 ? -26.058 108.571 62.973  1.00 28.59  ? 326  SER A C   1 
ATOM   2120  O  O   . SER A 1 348 ? -25.986 109.112 61.864  1.00 24.85  ? 326  SER A O   1 
ATOM   2121  C  CB  . SER A 1 348 ? -25.076 106.366 63.654  1.00 27.50  ? 326  SER A CB  1 
ATOM   2122  O  OG  . SER A 1 348 ? -23.906 106.668 62.916  1.00 30.27  ? 326  SER A OG  1 
ATOM   2123  N  N   . ASN A 1 349 ? -25.940 109.238 64.117  1.00 28.72  ? 327  ASN A N   1 
ATOM   2124  C  CA  . ASN A 1 349 ? -25.690 110.677 64.132  1.00 30.72  ? 327  ASN A CA  1 
ATOM   2125  C  C   . ASN A 1 349 ? -24.544 110.989 65.071  1.00 28.30  ? 327  ASN A C   1 
ATOM   2126  O  O   . ASN A 1 349 ? -24.158 110.151 65.879  1.00 24.32  ? 327  ASN A O   1 
ATOM   2127  C  CB  . ASN A 1 349 ? -26.951 111.446 64.559  1.00 31.75  ? 327  ASN A CB  1 
ATOM   2128  C  CG  . ASN A 1 349 ? -27.560 110.909 65.843  1.00 34.47  ? 327  ASN A CG  1 
ATOM   2129  O  OD1 . ASN A 1 349 ? -27.035 111.131 66.934  1.00 30.72  ? 327  ASN A OD1 1 
ATOM   2130  N  ND2 . ASN A 1 349 ? -28.671 110.185 65.715  1.00 30.27  ? 327  ASN A ND2 1 
ATOM   2131  N  N   . ASP A 1 350 ? -23.995 112.190 64.948  1.00 28.65  ? 328  ASP A N   1 
ATOM   2132  C  CA  . ASP A 1 350 ? -22.882 112.607 65.787  1.00 35.54  ? 328  ASP A CA  1 
ATOM   2133  C  C   . ASP A 1 350 ? -23.155 112.469 67.282  1.00 39.88  ? 328  ASP A C   1 
ATOM   2134  O  O   . ASP A 1 350 ? -22.374 111.853 68.015  1.00 34.83  ? 328  ASP A O   1 
ATOM   2135  C  CB  . ASP A 1 350 ? -22.512 114.061 65.488  1.00 37.16  ? 328  ASP A CB  1 
ATOM   2136  C  CG  . ASP A 1 350 ? -21.711 114.212 64.210  1.00 36.67  ? 328  ASP A CG  1 
ATOM   2137  O  OD1 . ASP A 1 350 ? -21.396 115.364 63.860  1.00 39.65  ? 328  ASP A OD1 1 
ATOM   2138  O  OD2 . ASP A 1 350 ? -21.394 113.191 63.562  1.00 37.93  ? 328  ASP A OD2 1 
ATOM   2139  N  N   . GLU A 1 351 ? -24.262 113.054 67.729  1.00 44.49  ? 329  GLU A N   1 
ATOM   2140  C  CA  . GLU A 1 351 ? -24.636 113.023 69.139  1.00 48.85  ? 329  GLU A CA  1 
ATOM   2141  C  C   . GLU A 1 351 ? -24.663 111.614 69.714  1.00 45.43  ? 329  GLU A C   1 
ATOM   2142  O  O   . GLU A 1 351 ? -24.089 111.352 70.774  1.00 41.04  ? 329  GLU A O   1 
ATOM   2143  C  CB  . GLU A 1 351 ? -25.997 113.693 69.329  1.00 53.53  ? 329  GLU A CB  1 
ATOM   2144  C  CG  . GLU A 1 351 ? -26.433 113.813 70.778  1.00 60.60  ? 329  GLU A CG  1 
ATOM   2145  C  CD  . GLU A 1 351 ? -27.335 115.008 71.004  1.00 65.30  ? 329  GLU A CD  1 
ATOM   2146  O  OE1 . GLU A 1 351 ? -27.934 115.102 72.092  1.00 70.48  ? 329  GLU A OE1 1 
ATOM   2147  O  OE2 . GLU A 1 351 ? -27.438 115.861 70.095  1.00 72.31  ? 329  GLU A OE2 1 
ATOM   2148  N  N   . GLU A 1 352 ? -25.343 110.717 69.008  1.00 44.76  ? 330  GLU A N   1 
ATOM   2149  C  CA  . GLU A 1 352 ? -25.466 109.318 69.405  1.00 42.28  ? 330  GLU A CA  1 
ATOM   2150  C  C   . GLU A 1 352 ? -24.055 108.715 69.468  1.00 42.47  ? 330  GLU A C   1 
ATOM   2151  O  O   . GLU A 1 352 ? -23.682 108.062 70.442  1.00 44.44  ? 330  GLU A O   1 
ATOM   2152  C  CB  . GLU A 1 352 ? -26.323 108.608 68.358  1.00 42.94  ? 330  GLU A CB  1 
ATOM   2153  C  CG  . GLU A 1 352 ? -26.862 107.248 68.713  1.00 41.91  ? 330  GLU A CG  1 
ATOM   2154  C  CD  . GLU A 1 352 ? -27.795 106.734 67.623  1.00 43.73  ? 330  GLU A CD  1 
ATOM   2155  O  OE1 . GLU A 1 352 ? -27.430 106.850 66.429  1.00 31.57  ? 330  GLU A OE1 1 
ATOM   2156  O  OE2 . GLU A 1 352 ? -28.886 106.219 67.958  1.00 47.34  ? 330  GLU A OE2 1 
ATOM   2157  N  N   . ALA A 1 353 ? -23.271 108.974 68.427  1.00 37.08  ? 331  ALA A N   1 
ATOM   2158  C  CA  . ALA A 1 353 ? -21.907 108.478 68.322  1.00 33.64  ? 331  ALA A CA  1 
ATOM   2159  C  C   . ALA A 1 353 ? -21.013 108.866 69.495  1.00 33.32  ? 331  ALA A C   1 
ATOM   2160  O  O   . ALA A 1 353 ? -20.445 108.007 70.162  1.00 34.29  ? 331  ALA A O   1 
ATOM   2161  C  CB  . ALA A 1 353 ? -21.286 108.972 67.032  1.00 28.04  ? 331  ALA A CB  1 
ATOM   2162  N  N   . PHE A 1 354 ? -20.879 110.166 69.730  1.00 32.68  ? 332  PHE A N   1 
ATOM   2163  C  CA  . PHE A 1 354 ? -20.034 110.675 70.799  1.00 32.78  ? 332  PHE A CA  1 
ATOM   2164  C  C   . PHE A 1 354 ? -20.501 110.311 72.211  1.00 37.53  ? 332  PHE A C   1 
ATOM   2165  O  O   . PHE A 1 354 ? -19.683 110.154 73.123  1.00 36.56  ? 332  PHE A O   1 
ATOM   2166  C  CB  . PHE A 1 354 ? -19.911 112.190 70.662  1.00 37.51  ? 332  PHE A CB  1 
ATOM   2167  C  CG  . PHE A 1 354 ? -19.272 112.624 69.375  1.00 41.92  ? 332  PHE A CG  1 
ATOM   2168  C  CD1 . PHE A 1 354 ? -19.816 113.663 68.626  1.00 40.61  ? 332  PHE A CD1 1 
ATOM   2169  C  CD2 . PHE A 1 354 ? -18.114 112.004 68.915  1.00 42.18  ? 332  PHE A CD2 1 
ATOM   2170  C  CE1 . PHE A 1 354 ? -19.210 114.080 67.432  1.00 39.05  ? 332  PHE A CE1 1 
ATOM   2171  C  CE2 . PHE A 1 354 ? -17.501 112.414 67.726  1.00 41.40  ? 332  PHE A CE2 1 
ATOM   2172  C  CZ  . PHE A 1 354 ? -18.051 113.455 66.983  1.00 34.42  ? 332  PHE A CZ  1 
ATOM   2173  N  N   . THR A 1 355 ? -21.808 110.174 72.402  1.00 35.74  ? 333  THR A N   1 
ATOM   2174  C  CA  . THR A 1 355 ? -22.315 109.823 73.716  1.00 35.55  ? 333  THR A CA  1 
ATOM   2175  C  C   . THR A 1 355 ? -21.941 108.382 74.021  1.00 35.26  ? 333  THR A C   1 
ATOM   2176  O  O   . THR A 1 355 ? -21.613 108.042 75.161  1.00 40.86  ? 333  THR A O   1 
ATOM   2177  C  CB  . THR A 1 355 ? -23.850 109.995 73.799  1.00 42.71  ? 333  THR A CB  1 
ATOM   2178  O  OG1 . THR A 1 355 ? -24.473 109.255 72.740  1.00 55.05  ? 333  THR A OG1 1 
ATOM   2179  C  CG2 . THR A 1 355 ? -24.231 111.477 73.684  1.00 43.62  ? 333  THR A CG2 1 
ATOM   2180  N  N   . PHE A 1 356 ? -21.988 107.526 73.005  1.00 32.16  ? 334  PHE A N   1 
ATOM   2181  C  CA  . PHE A 1 356 ? -21.629 106.133 73.211  1.00 32.73  ? 334  PHE A CA  1 
ATOM   2182  C  C   . PHE A 1 356 ? -20.123 105.967 73.318  1.00 34.24  ? 334  PHE A C   1 
ATOM   2183  O  O   . PHE A 1 356 ? -19.649 105.091 74.037  1.00 33.18  ? 334  PHE A O   1 
ATOM   2184  C  CB  . PHE A 1 356 ? -22.182 105.243 72.097  1.00 26.19  ? 334  PHE A CB  1 
ATOM   2185  C  CG  . PHE A 1 356 ? -23.563 104.742 72.371  1.00 19.14  ? 334  PHE A CG  1 
ATOM   2186  C  CD1 . PHE A 1 356 ? -24.667 105.582 72.234  1.00 21.65  ? 334  PHE A CD1 1 
ATOM   2187  C  CD2 . PHE A 1 356 ? -23.759 103.440 72.811  1.00 17.74  ? 334  PHE A CD2 1 
ATOM   2188  C  CE1 . PHE A 1 356 ? -25.951 105.121 72.538  1.00 30.48  ? 334  PHE A CE1 1 
ATOM   2189  C  CE2 . PHE A 1 356 ? -25.041 102.964 73.121  1.00 20.47  ? 334  PHE A CE2 1 
ATOM   2190  C  CZ  . PHE A 1 356 ? -26.137 103.802 72.986  1.00 20.25  ? 334  PHE A CZ  1 
ATOM   2191  N  N   . ALA A 1 357 ? -19.370 106.795 72.600  1.00 32.03  ? 335  ALA A N   1 
ATOM   2192  C  CA  . ALA A 1 357 ? -17.918 106.725 72.674  1.00 32.19  ? 335  ALA A CA  1 
ATOM   2193  C  C   . ALA A 1 357 ? -17.554 107.035 74.125  1.00 34.24  ? 335  ALA A C   1 
ATOM   2194  O  O   . ALA A 1 357 ? -16.702 106.370 74.726  1.00 37.22  ? 335  ALA A O   1 
ATOM   2195  C  CB  . ALA A 1 357 ? -17.276 107.753 71.738  1.00 25.89  ? 335  ALA A CB  1 
ATOM   2196  N  N   . ARG A 1 358 ? -18.217 108.041 74.690  1.00 32.12  ? 336  ARG A N   1 
ATOM   2197  C  CA  . ARG A 1 358 ? -17.969 108.440 76.072  1.00 29.41  ? 336  ARG A CA  1 
ATOM   2198  C  C   . ARG A 1 358 ? -18.390 107.363 77.063  1.00 27.13  ? 336  ARG A C   1 
ATOM   2199  O  O   . ARG A 1 358 ? -17.801 107.213 78.141  1.00 26.94  ? 336  ARG A O   1 
ATOM   2200  C  CB  . ARG A 1 358 ? -18.697 109.749 76.369  1.00 26.92  ? 336  ARG A CB  1 
ATOM   2201  C  CG  . ARG A 1 358 ? -17.850 110.965 76.110  1.00 18.89  ? 336  ARG A CG  1 
ATOM   2202  C  CD  . ARG A 1 358 ? -18.686 112.183 75.791  1.00 22.54  ? 336  ARG A CD  1 
ATOM   2203  N  NE  . ARG A 1 358 ? -17.864 113.384 75.855  1.00 27.33  ? 336  ARG A NE  1 
ATOM   2204  C  CZ  . ARG A 1 358 ? -17.629 114.060 76.972  1.00 28.59  ? 336  ARG A CZ  1 
ATOM   2205  N  NH1 . ARG A 1 358 ? -16.851 115.131 76.942  1.00 31.87  ? 336  ARG A NH1 1 
ATOM   2206  N  NH2 . ARG A 1 358 ? -18.200 113.683 78.114  1.00 29.32  ? 336  ARG A NH2 1 
ATOM   2207  N  N   . MET A 1 359 ? -19.408 106.608 76.675  1.00 23.92  ? 337  MET A N   1 
ATOM   2208  C  CA  . MET A 1 359 ? -19.940 105.533 77.506  1.00 30.61  ? 337  MET A CA  1 
ATOM   2209  C  C   . MET A 1 359 ? -18.984 104.330 77.551  1.00 31.46  ? 337  MET A C   1 
ATOM   2210  O  O   . MET A 1 359 ? -18.902 103.617 78.548  1.00 33.33  ? 337  MET A O   1 
ATOM   2211  C  CB  . MET A 1 359 ? -21.296 105.118 76.943  1.00 29.82  ? 337  MET A CB  1 
ATOM   2212  C  CG  . MET A 1 359 ? -22.214 104.450 77.923  1.00 34.48  ? 337  MET A CG  1 
ATOM   2213  S  SD  . MET A 1 359 ? -23.889 104.467 77.271  1.00 45.35  ? 337  MET A SD  1 
ATOM   2214  C  CE  . MET A 1 359 ? -23.974 102.894 76.546  1.00 50.06  ? 337  MET A CE  1 
ATOM   2215  N  N   . LEU A 1 360 ? -18.269 104.117 76.452  1.00 34.76  ? 338  LEU A N   1 
ATOM   2216  C  CA  . LEU A 1 360 ? -17.315 103.027 76.330  1.00 33.03  ? 338  LEU A CA  1 
ATOM   2217  C  C   . LEU A 1 360 ? -16.083 103.322 77.175  1.00 34.73  ? 338  LEU A C   1 
ATOM   2218  O  O   . LEU A 1 360 ? -15.476 102.417 77.740  1.00 27.65  ? 338  LEU A O   1 
ATOM   2219  C  CB  . LEU A 1 360 ? -16.903 102.853 74.866  1.00 31.14  ? 338  LEU A CB  1 
ATOM   2220  C  CG  . LEU A 1 360 ? -17.912 102.177 73.936  1.00 33.72  ? 338  LEU A CG  1 
ATOM   2221  C  CD1 . LEU A 1 360 ? -17.536 102.453 72.477  1.00 21.82  ? 338  LEU A CD1 1 
ATOM   2222  C  CD2 . LEU A 1 360 ? -17.941 100.684 74.231  1.00 22.89  ? 338  LEU A CD2 1 
ATOM   2223  N  N   . ILE A 1 361 ? -15.716 104.598 77.257  1.00 38.41  ? 339  ILE A N   1 
ATOM   2224  C  CA  . ILE A 1 361 ? -14.556 105.010 78.040  1.00 31.35  ? 339  ILE A CA  1 
ATOM   2225  C  C   . ILE A 1 361 ? -14.887 104.964 79.518  1.00 29.01  ? 339  ILE A C   1 
ATOM   2226  O  O   . ILE A 1 361 ? -14.097 104.489 80.324  1.00 33.69  ? 339  ILE A O   1 
ATOM   2227  C  CB  . ILE A 1 361 ? -14.130 106.439 77.693  1.00 34.43  ? 339  ILE A CB  1 
ATOM   2228  C  CG1 . ILE A 1 361 ? -13.728 106.522 76.210  1.00 34.88  ? 339  ILE A CG1 1 
ATOM   2229  C  CG2 . ILE A 1 361 ? -12.980 106.854 78.586  1.00 27.24  ? 339  ILE A CG2 1 
ATOM   2230  C  CD1 . ILE A 1 361 ? -13.439 107.933 75.718  1.00 31.02  ? 339  ILE A CD1 1 
ATOM   2231  N  N   . ALA A 1 362 ? -16.076 105.440 79.864  1.00 26.81  ? 340  ALA A N   1 
ATOM   2232  C  CA  . ALA A 1 362 ? -16.533 105.482 81.251  1.00 19.94  ? 340  ALA A CA  1 
ATOM   2233  C  C   . ALA A 1 362 ? -17.040 104.155 81.834  1.00 24.29  ? 340  ALA A C   1 
ATOM   2234  O  O   . ALA A 1 362 ? -16.841 103.874 83.017  1.00 24.94  ? 340  ALA A O   1 
ATOM   2235  C  CB  . ALA A 1 362 ? -17.610 106.529 81.381  1.00 16.25  ? 340  ALA A CB  1 
ATOM   2236  N  N   . GLN A 1 363 ? -17.694 103.332 81.026  1.00 21.97  ? 341  GLN A N   1 
ATOM   2237  C  CA  . GLN A 1 363 ? -18.203 102.087 81.565  1.00 19.74  ? 341  GLN A CA  1 
ATOM   2238  C  C   . GLN A 1 363 ? -17.398 100.823 81.240  1.00 21.32  ? 341  GLN A C   1 
ATOM   2239  O  O   . GLN A 1 363 ? -17.337 99.894  82.043  1.00 14.44  ? 341  GLN A O   1 
ATOM   2240  C  CB  . GLN A 1 363 ? -19.666 101.928 81.154  1.00 19.73  ? 341  GLN A CB  1 
ATOM   2241  C  CG  . GLN A 1 363 ? -20.593 102.856 81.934  1.00 30.39  ? 341  GLN A CG  1 
ATOM   2242  C  CD  . GLN A 1 363 ? -22.043 102.805 81.476  1.00 42.04  ? 341  GLN A CD  1 
ATOM   2243  O  OE1 . GLN A 1 363 ? -22.678 101.745 81.469  1.00 47.93  ? 341  GLN A OE1 1 
ATOM   2244  N  NE2 . GLN A 1 363 ? -22.579 103.962 81.097  1.00 46.37  ? 341  GLN A NE2 1 
ATOM   2245  N  N   . GLU A 1 364 ? -16.751 100.791 80.083  1.00 21.40  ? 342  GLU A N   1 
ATOM   2246  C  CA  . GLU A 1 364 ? -15.994 99.612  79.705  1.00 14.74  ? 342  GLU A CA  1 
ATOM   2247  C  C   . GLU A 1 364 ? -14.490 99.867  79.724  1.00 17.98  ? 342  GLU A C   1 
ATOM   2248  O  O   . GLU A 1 364 ? -13.689 98.950  79.534  1.00 17.55  ? 342  GLU A O   1 
ATOM   2249  C  CB  . GLU A 1 364 ? -16.415 99.149  78.307  1.00 13.12  ? 342  GLU A CB  1 
ATOM   2250  C  CG  . GLU A 1 364 ? -17.904 98.990  78.075  1.00 21.02  ? 342  GLU A CG  1 
ATOM   2251  C  CD  . GLU A 1 364 ? -18.515 97.829  78.846  1.00 20.79  ? 342  GLU A CD  1 
ATOM   2252  O  OE1 . GLU A 1 364 ? -17.829 96.803  78.995  1.00 22.67  ? 342  GLU A OE1 1 
ATOM   2253  O  OE2 . GLU A 1 364 ? -19.691 97.941  79.277  1.00 18.61  ? 342  GLU A OE2 1 
ATOM   2254  N  N   . GLY A 1 365 ? -14.103 101.117 79.940  1.00 21.51  ? 343  GLY A N   1 
ATOM   2255  C  CA  . GLY A 1 365 ? -12.686 101.456 79.977  1.00 21.54  ? 343  GLY A CA  1 
ATOM   2256  C  C   . GLY A 1 365 ? -11.915 101.281 78.670  1.00 22.72  ? 343  GLY A C   1 
ATOM   2257  O  O   . GLY A 1 365 ? -10.700 101.055 78.689  1.00 16.94  ? 343  GLY A O   1 
ATOM   2258  N  N   . LEU A 1 366 ? -12.615 101.409 77.542  1.00 21.50  ? 344  LEU A N   1 
ATOM   2259  C  CA  . LEU A 1 366 ? -12.016 101.256 76.222  1.00 14.63  ? 344  LEU A CA  1 
ATOM   2260  C  C   . LEU A 1 366 ? -11.769 102.634 75.642  1.00 16.67  ? 344  LEU A C   1 
ATOM   2261  O  O   . LEU A 1 366 ? -12.716 103.331 75.283  1.00 22.31  ? 344  LEU A O   1 
ATOM   2262  C  CB  . LEU A 1 366 ? -12.971 100.488 75.327  1.00 10.36  ? 344  LEU A CB  1 
ATOM   2263  C  CG  . LEU A 1 366 ? -13.518 99.195  75.934  1.00 14.83  ? 344  LEU A CG  1 
ATOM   2264  C  CD1 . LEU A 1 366 ? -14.834 98.758  75.232  1.00 19.19  ? 344  LEU A CD1 1 
ATOM   2265  C  CD2 . LEU A 1 366 ? -12.445 98.116  75.808  1.00 19.98  ? 344  LEU A CD2 1 
ATOM   2266  N  N   . LEU A 1 367 ? -10.499 103.023 75.537  1.00 17.67  ? 345  LEU A N   1 
ATOM   2267  C  CA  . LEU A 1 367 ? -10.140 104.335 75.017  1.00 10.59  ? 345  LEU A CA  1 
ATOM   2268  C  C   . LEU A 1 367 ? -10.200 104.366 73.501  1.00 18.18  ? 345  LEU A C   1 
ATOM   2269  O  O   . LEU A 1 367 ? -9.195  104.556 72.826  1.00 21.71  ? 345  LEU A O   1 
ATOM   2270  C  CB  . LEU A 1 367 ? -8.747  104.742 75.521  1.00 15.74  ? 345  LEU A CB  1 
ATOM   2271  C  CG  . LEU A 1 367 ? -8.661  104.795 77.058  1.00 30.76  ? 345  LEU A CG  1 
ATOM   2272  C  CD1 . LEU A 1 367 ? -7.216  104.832 77.517  1.00 28.65  ? 345  LEU A CD1 1 
ATOM   2273  C  CD2 . LEU A 1 367 ? -9.436  106.000 77.573  1.00 20.57  ? 345  LEU A CD2 1 
ATOM   2274  N  N   . CYS A 1 368 ? -11.413 104.202 72.984  1.00 21.84  ? 346  CYS A N   1 
ATOM   2275  C  CA  . CYS A 1 368 ? -11.699 104.190 71.555  1.00 24.10  ? 346  CYS A CA  1 
ATOM   2276  C  C   . CYS A 1 368 ? -12.141 105.561 71.044  1.00 27.64  ? 346  CYS A C   1 
ATOM   2277  O  O   . CYS A 1 368 ? -12.249 106.515 71.817  1.00 30.73  ? 346  CYS A O   1 
ATOM   2278  C  CB  . CYS A 1 368 ? -12.803 103.182 71.275  1.00 23.62  ? 346  CYS A CB  1 
ATOM   2279  S  SG  . CYS A 1 368 ? -14.316 103.585 72.158  1.00 31.25  ? 346  CYS A SG  1 
ATOM   2280  N  N   . GLY A 1 369 ? -12.419 105.638 69.742  1.00 21.98  ? 347  GLY A N   1 
ATOM   2281  C  CA  . GLY A 1 369 ? -12.829 106.889 69.130  1.00 21.82  ? 347  GLY A CA  1 
ATOM   2282  C  C   . GLY A 1 369 ? -14.306 107.027 68.808  1.00 21.35  ? 347  GLY A C   1 
ATOM   2283  O  O   . GLY A 1 369 ? -15.114 106.191 69.210  1.00 27.22  ? 347  GLY A O   1 
ATOM   2284  N  N   . GLY A 1 370 ? -14.646 108.089 68.073  1.00 20.88  ? 348  GLY A N   1 
ATOM   2285  C  CA  . GLY A 1 370 ? -16.026 108.365 67.700  1.00 23.05  ? 348  GLY A CA  1 
ATOM   2286  C  C   . GLY A 1 370 ? -16.742 107.303 66.890  1.00 26.09  ? 348  GLY A C   1 
ATOM   2287  O  O   . GLY A 1 370 ? -17.914 106.995 67.139  1.00 27.88  ? 348  GLY A O   1 
ATOM   2288  N  N   . SER A 1 371 ? -16.043 106.749 65.907  1.00 27.98  ? 349  SER A N   1 
ATOM   2289  C  CA  . SER A 1 371 ? -16.607 105.713 65.055  1.00 21.49  ? 349  SER A CA  1 
ATOM   2290  C  C   . SER A 1 371 ? -17.111 104.563 65.924  1.00 22.62  ? 349  SER A C   1 
ATOM   2291  O  O   . SER A 1 371 ? -18.178 103.996 65.672  1.00 19.23  ? 349  SER A O   1 
ATOM   2292  C  CB  . SER A 1 371 ? -15.534 105.212 64.094  1.00 12.46  ? 349  SER A CB  1 
ATOM   2293  O  OG  . SER A 1 371 ? -16.097 104.302 63.176  1.00 34.89  ? 349  SER A OG  1 
ATOM   2294  N  N   . ALA A 1 372 ? -16.322 104.235 66.946  1.00 24.02  ? 350  ALA A N   1 
ATOM   2295  C  CA  . ALA A 1 372 ? -16.633 103.160 67.886  1.00 24.38  ? 350  ALA A CA  1 
ATOM   2296  C  C   . ALA A 1 372 ? -17.981 103.401 68.550  1.00 25.57  ? 350  ALA A C   1 
ATOM   2297  O  O   . ALA A 1 372 ? -18.753 102.466 68.787  1.00 20.79  ? 350  ALA A O   1 
ATOM   2298  C  CB  . ALA A 1 372 ? -15.539 103.068 68.947  1.00 16.21  ? 350  ALA A CB  1 
ATOM   2299  N  N   . GLY A 1 373 ? -18.244 104.665 68.863  1.00 25.37  ? 351  GLY A N   1 
ATOM   2300  C  CA  . GLY A 1 373 ? -19.505 105.013 69.473  1.00 24.66  ? 351  GLY A CA  1 
ATOM   2301  C  C   . GLY A 1 373 ? -20.626 104.714 68.506  1.00 24.45  ? 351  GLY A C   1 
ATOM   2302  O  O   . GLY A 1 373 ? -21.618 104.096 68.886  1.00 28.52  ? 351  GLY A O   1 
ATOM   2303  N  N   . SER A 1 374 ? -20.471 105.146 67.255  1.00 26.10  ? 352  SER A N   1 
ATOM   2304  C  CA  . SER A 1 374 ? -21.488 104.914 66.221  1.00 25.00  ? 352  SER A CA  1 
ATOM   2305  C  C   . SER A 1 374 ? -21.853 103.439 66.122  1.00 23.46  ? 352  SER A C   1 
ATOM   2306  O  O   . SER A 1 374 ? -23.023 103.070 66.019  1.00 22.38  ? 352  SER A O   1 
ATOM   2307  C  CB  . SER A 1 374 ? -20.977 105.353 64.846  1.00 24.80  ? 352  SER A CB  1 
ATOM   2308  O  OG  . SER A 1 374 ? -20.721 106.742 64.777  1.00 32.10  ? 352  SER A OG  1 
ATOM   2309  N  N   . THR A 1 375 ? -20.822 102.606 66.153  1.00 24.70  ? 353  THR A N   1 
ATOM   2310  C  CA  . THR A 1 375 ? -20.976 101.166 66.022  1.00 28.83  ? 353  THR A CA  1 
ATOM   2311  C  C   . THR A 1 375 ? -21.671 100.478 67.191  1.00 29.67  ? 353  THR A C   1 
ATOM   2312  O  O   . THR A 1 375 ? -22.426 99.525  66.986  1.00 33.14  ? 353  THR A O   1 
ATOM   2313  C  CB  . THR A 1 375 ? -19.608 100.521 65.784  1.00 30.19  ? 353  THR A CB  1 
ATOM   2314  O  OG1 . THR A 1 375 ? -18.866 101.335 64.866  1.00 28.76  ? 353  THR A OG1 1 
ATOM   2315  C  CG2 . THR A 1 375 ? -19.768 99.133  65.190  1.00 38.10  ? 353  THR A CG2 1 
ATOM   2316  N  N   . VAL A 1 376 ? -21.428 100.943 68.413  1.00 25.78  ? 354  VAL A N   1 
ATOM   2317  C  CA  . VAL A 1 376 ? -22.074 100.315 69.552  1.00 30.43  ? 354  VAL A CA  1 
ATOM   2318  C  C   . VAL A 1 376 ? -23.490 100.852 69.686  1.00 35.71  ? 354  VAL A C   1 
ATOM   2319  O  O   . VAL A 1 376 ? -24.398 100.125 70.096  1.00 40.76  ? 354  VAL A O   1 
ATOM   2320  C  CB  . VAL A 1 376 ? -21.294 100.553 70.866  1.00 33.73  ? 354  VAL A CB  1 
ATOM   2321  C  CG1 . VAL A 1 376 ? -22.053 99.933  72.058  1.00 24.15  ? 354  VAL A CG1 1 
ATOM   2322  C  CG2 . VAL A 1 376 ? -19.906 99.936  70.755  1.00 36.98  ? 354  VAL A CG2 1 
ATOM   2323  N  N   . ALA A 1 377 ? -23.679 102.120 69.333  1.00 36.42  ? 355  ALA A N   1 
ATOM   2324  C  CA  . ALA A 1 377 ? -25.000 102.743 69.400  1.00 32.55  ? 355  ALA A CA  1 
ATOM   2325  C  C   . ALA A 1 377 ? -25.986 101.944 68.551  1.00 29.03  ? 355  ALA A C   1 
ATOM   2326  O  O   . ALA A 1 377 ? -27.127 101.721 68.961  1.00 31.22  ? 355  ALA A O   1 
ATOM   2327  C  CB  . ALA A 1 377 ? -24.932 104.184 68.904  1.00 33.17  ? 355  ALA A CB  1 
ATOM   2328  N  N   . VAL A 1 378 ? -25.543 101.513 67.370  1.00 25.66  ? 356  VAL A N   1 
ATOM   2329  C  CA  . VAL A 1 378 ? -26.388 100.720 66.479  1.00 21.68  ? 356  VAL A CA  1 
ATOM   2330  C  C   . VAL A 1 378 ? -26.552 99.292  66.982  1.00 23.99  ? 356  VAL A C   1 
ATOM   2331  O  O   . VAL A 1 378 ? -27.643 98.728  66.941  1.00 28.25  ? 356  VAL A O   1 
ATOM   2332  C  CB  . VAL A 1 378 ? -25.805 100.656 65.046  1.00 16.96  ? 356  VAL A CB  1 
ATOM   2333  C  CG1 . VAL A 1 378 ? -26.610 99.675  64.207  1.00 19.83  ? 356  VAL A CG1 1 
ATOM   2334  C  CG2 . VAL A 1 378 ? -25.843 102.033 64.399  1.00 17.28  ? 356  VAL A CG2 1 
ATOM   2335  N  N   . ALA A 1 379 ? -25.458 98.714  67.463  1.00 27.73  ? 357  ALA A N   1 
ATOM   2336  C  CA  . ALA A 1 379 ? -25.457 97.345  67.961  1.00 32.92  ? 357  ALA A CA  1 
ATOM   2337  C  C   . ALA A 1 379 ? -26.462 97.078  69.072  1.00 34.14  ? 357  ALA A C   1 
ATOM   2338  O  O   . ALA A 1 379 ? -27.129 96.046  69.061  1.00 35.45  ? 357  ALA A O   1 
ATOM   2339  C  CB  . ALA A 1 379 ? -24.056 96.962  68.423  1.00 34.93  ? 357  ALA A CB  1 
ATOM   2340  N  N   . VAL A 1 380 ? -26.575 97.991  70.032  1.00 34.07  ? 358  VAL A N   1 
ATOM   2341  C  CA  . VAL A 1 380 ? -27.516 97.775  71.121  1.00 37.66  ? 358  VAL A CA  1 
ATOM   2342  C  C   . VAL A 1 380 ? -28.943 97.733  70.582  1.00 39.41  ? 358  VAL A C   1 
ATOM   2343  O  O   . VAL A 1 380 ? -29.868 97.324  71.284  1.00 35.88  ? 358  VAL A O   1 
ATOM   2344  C  CB  . VAL A 1 380 ? -27.384 98.857  72.225  1.00 37.09  ? 358  VAL A CB  1 
ATOM   2345  C  CG1 . VAL A 1 380 ? -25.995 98.791  72.834  1.00 26.04  ? 358  VAL A CG1 1 
ATOM   2346  C  CG2 . VAL A 1 380 ? -27.656 100.240 71.660  1.00 42.67  ? 358  VAL A CG2 1 
ATOM   2347  N  N   . LYS A 1 381 ? -29.109 98.146  69.326  1.00 39.77  ? 359  LYS A N   1 
ATOM   2348  C  CA  . LYS A 1 381 ? -30.416 98.125  68.676  1.00 36.94  ? 359  LYS A CA  1 
ATOM   2349  C  C   . LYS A 1 381 ? -30.519 96.877  67.790  1.00 34.55  ? 359  LYS A C   1 
ATOM   2350  O  O   . LYS A 1 381 ? -31.428 96.061  67.925  1.00 33.49  ? 359  LYS A O   1 
ATOM   2351  C  CB  . LYS A 1 381 ? -30.606 99.351  67.786  1.00 37.10  ? 359  LYS A CB  1 
ATOM   2352  C  CG  . LYS A 1 381 ? -30.585 100.714 68.445  1.00 35.47  ? 359  LYS A CG  1 
ATOM   2353  C  CD  . LYS A 1 381 ? -30.807 101.778 67.349  1.00 41.32  ? 359  LYS A CD  1 
ATOM   2354  C  CE  . LYS A 1 381 ? -30.575 103.195 67.834  1.00 41.67  ? 359  LYS A CE  1 
ATOM   2355  N  NZ  . LYS A 1 381 ? -30.572 104.136 66.684  1.00 34.33  ? 359  LYS A NZ  1 
ATOM   2356  N  N   . ALA A 1 382 ? -29.565 96.737  66.881  1.00 36.86  ? 360  ALA A N   1 
ATOM   2357  C  CA  . ALA A 1 382 ? -29.547 95.618  65.952  1.00 37.18  ? 360  ALA A CA  1 
ATOM   2358  C  C   . ALA A 1 382 ? -29.459 94.235  66.600  1.00 38.96  ? 360  ALA A C   1 
ATOM   2359  O  O   . ALA A 1 382 ? -30.090 93.286  66.125  1.00 35.37  ? 360  ALA A O   1 
ATOM   2360  C  CB  . ALA A 1 382 ? -28.407 95.801  64.965  1.00 35.65  ? 360  ALA A CB  1 
ATOM   2361  N  N   . ALA A 1 383 ? -28.689 94.120  67.680  1.00 34.62  ? 361  ALA A N   1 
ATOM   2362  C  CA  . ALA A 1 383 ? -28.512 92.831  68.348  1.00 35.97  ? 361  ALA A CA  1 
ATOM   2363  C  C   . ALA A 1 383 ? -29.647 92.432  69.288  1.00 38.26  ? 361  ALA A C   1 
ATOM   2364  O  O   . ALA A 1 383 ? -29.567 91.404  69.962  1.00 39.80  ? 361  ALA A O   1 
ATOM   2365  C  CB  . ALA A 1 383 ? -27.182 92.807  69.102  1.00 33.07  ? 361  ALA A CB  1 
ATOM   2366  N  N   . GLN A 1 384 ? -30.703 93.236  69.335  1.00 38.07  ? 362  GLN A N   1 
ATOM   2367  C  CA  . GLN A 1 384 ? -31.831 92.934  70.200  1.00 38.32  ? 362  GLN A CA  1 
ATOM   2368  C  C   . GLN A 1 384 ? -32.424 91.577  69.850  1.00 39.53  ? 362  GLN A C   1 
ATOM   2369  O  O   . GLN A 1 384 ? -32.696 90.760  70.727  1.00 43.10  ? 362  GLN A O   1 
ATOM   2370  C  CB  . GLN A 1 384 ? -32.899 94.011  70.063  1.00 40.15  ? 362  GLN A CB  1 
ATOM   2371  C  CG  . GLN A 1 384 ? -32.575 95.309  70.767  1.00 38.45  ? 362  GLN A CG  1 
ATOM   2372  C  CD  . GLN A 1 384 ? -32.390 95.124  72.271  1.00 47.90  ? 362  GLN A CD  1 
ATOM   2373  O  OE1 . GLN A 1 384 ? -33.142 94.392  72.918  1.00 45.95  ? 362  GLN A OE1 1 
ATOM   2374  N  NE2 . GLN A 1 384 ? -31.395 95.802  72.833  1.00 34.34  ? 362  GLN A NE2 1 
ATOM   2375  N  N   . GLU A 1 385 ? -32.622 91.340  68.561  1.00 39.45  ? 363  GLU A N   1 
ATOM   2376  C  CA  . GLU A 1 385 ? -33.182 90.078  68.088  1.00 45.19  ? 363  GLU A CA  1 
ATOM   2377  C  C   . GLU A 1 385 ? -32.439 88.878  68.661  1.00 43.53  ? 363  GLU A C   1 
ATOM   2378  O  O   . GLU A 1 385 ? -33.025 87.810  68.859  1.00 44.96  ? 363  GLU A O   1 
ATOM   2379  C  CB  . GLU A 1 385 ? -33.133 90.020  66.554  1.00 50.45  ? 363  GLU A CB  1 
ATOM   2380  C  CG  . GLU A 1 385 ? -31.755 90.315  65.963  1.00 54.17  ? 363  GLU A CG  1 
ATOM   2381  C  CD  . GLU A 1 385 ? -31.678 90.047  64.467  1.00 58.21  ? 363  GLU A CD  1 
ATOM   2382  O  OE1 . GLU A 1 385 ? -31.761 88.867  64.067  1.00 66.34  ? 363  GLU A OE1 1 
ATOM   2383  O  OE2 . GLU A 1 385 ? -31.532 91.013  63.688  1.00 62.27  ? 363  GLU A OE2 1 
ATOM   2384  N  N   . LEU A 1 386 ? -31.147 89.059  68.924  1.00 41.07  ? 364  LEU A N   1 
ATOM   2385  C  CA  . LEU A 1 386 ? -30.310 87.995  69.463  1.00 40.04  ? 364  LEU A CA  1 
ATOM   2386  C  C   . LEU A 1 386 ? -30.675 87.546  70.872  1.00 44.09  ? 364  LEU A C   1 
ATOM   2387  O  O   . LEU A 1 386 ? -30.940 88.363  71.756  1.00 45.29  ? 364  LEU A O   1 
ATOM   2388  C  CB  . LEU A 1 386 ? -28.842 88.422  69.414  1.00 39.47  ? 364  LEU A CB  1 
ATOM   2389  C  CG  . LEU A 1 386 ? -27.994 87.937  68.224  1.00 35.76  ? 364  LEU A CG  1 
ATOM   2390  C  CD1 . LEU A 1 386 ? -28.808 87.913  66.954  1.00 20.58  ? 364  LEU A CD1 1 
ATOM   2391  C  CD2 . LEU A 1 386 ? -26.762 88.827  68.090  1.00 16.30  ? 364  LEU A CD2 1 
ATOM   2392  N  N   . GLN A 1 387 ? -30.678 86.228  71.055  1.00 46.78  ? 365  GLN A N   1 
ATOM   2393  C  CA  . GLN A 1 387 ? -31.003 85.590  72.330  1.00 50.94  ? 365  GLN A CA  1 
ATOM   2394  C  C   . GLN A 1 387 ? -29.750 85.091  73.036  1.00 48.55  ? 365  GLN A C   1 
ATOM   2395  O  O   . GLN A 1 387 ? -28.717 84.882  72.406  1.00 45.30  ? 365  GLN A O   1 
ATOM   2396  C  CB  . GLN A 1 387 ? -31.909 84.383  72.107  1.00 56.74  ? 365  GLN A CB  1 
ATOM   2397  C  CG  . GLN A 1 387 ? -33.271 84.673  71.536  1.00 63.39  ? 365  GLN A CG  1 
ATOM   2398  C  CD  . GLN A 1 387 ? -34.069 83.404  71.380  1.00 70.29  ? 365  GLN A CD  1 
ATOM   2399  O  OE1 . GLN A 1 387 ? -33.690 82.514  70.622  1.00 75.30  ? 365  GLN A OE1 1 
ATOM   2400  N  NE2 . GLN A 1 387 ? -35.173 83.301  72.111  1.00 77.14  ? 365  GLN A NE2 1 
ATOM   2401  N  N   . GLU A 1 388 ? -29.851 84.873  74.344  1.00 44.56  ? 366  GLU A N   1 
ATOM   2402  C  CA  . GLU A 1 388 ? -28.707 84.375  75.084  1.00 36.50  ? 366  GLU A CA  1 
ATOM   2403  C  C   . GLU A 1 388 ? -28.174 83.145  74.382  1.00 31.73  ? 366  GLU A C   1 
ATOM   2404  O  O   . GLU A 1 388 ? -28.928 82.369  73.805  1.00 35.02  ? 366  GLU A O   1 
ATOM   2405  C  CB  . GLU A 1 388 ? -29.093 84.054  76.522  1.00 37.96  ? 366  GLU A CB  1 
ATOM   2406  C  CG  . GLU A 1 388 ? -30.539 83.699  76.707  1.00 45.08  ? 366  GLU A CG  1 
ATOM   2407  C  CD  . GLU A 1 388 ? -30.979 83.896  78.138  1.00 44.45  ? 366  GLU A CD  1 
ATOM   2408  O  OE1 . GLU A 1 388 ? -30.360 83.278  79.036  1.00 43.42  ? 366  GLU A OE1 1 
ATOM   2409  O  OE2 . GLU A 1 388 ? -31.937 84.672  78.357  1.00 48.45  ? 366  GLU A OE2 1 
ATOM   2410  N  N   . GLY A 1 389 ? -26.861 82.978  74.421  1.00 30.40  ? 367  GLY A N   1 
ATOM   2411  C  CA  . GLY A 1 389 ? -26.250 81.855  73.745  1.00 21.24  ? 367  GLY A CA  1 
ATOM   2412  C  C   . GLY A 1 389 ? -25.686 82.371  72.432  1.00 25.19  ? 367  GLY A C   1 
ATOM   2413  O  O   . GLY A 1 389 ? -24.758 81.802  71.858  1.00 16.70  ? 367  GLY A O   1 
ATOM   2414  N  N   . GLN A 1 390 ? -26.243 83.472  71.949  1.00 26.08  ? 368  GLN A N   1 
ATOM   2415  C  CA  . GLN A 1 390 ? -25.772 84.035  70.701  1.00 29.80  ? 368  GLN A CA  1 
ATOM   2416  C  C   . GLN A 1 390 ? -24.700 85.077  70.960  1.00 32.07  ? 368  GLN A C   1 
ATOM   2417  O  O   . GLN A 1 390 ? -24.583 85.606  72.072  1.00 34.78  ? 368  GLN A O   1 
ATOM   2418  C  CB  . GLN A 1 390 ? -26.945 84.601  69.901  1.00 34.39  ? 368  GLN A CB  1 
ATOM   2419  C  CG  . GLN A 1 390 ? -27.832 83.501  69.339  1.00 32.67  ? 368  GLN A CG  1 
ATOM   2420  C  CD  . GLN A 1 390 ? -28.993 84.030  68.526  1.00 37.65  ? 368  GLN A CD  1 
ATOM   2421  O  OE1 . GLN A 1 390 ? -29.900 84.666  69.059  1.00 38.51  ? 368  GLN A OE1 1 
ATOM   2422  N  NE2 . GLN A 1 390 ? -28.969 83.770  67.223  1.00 36.16  ? 368  GLN A NE2 1 
ATOM   2423  N  N   . ARG A 1 391 ? -23.923 85.367  69.921  1.00 32.43  ? 369  ARG A N   1 
ATOM   2424  C  CA  . ARG A 1 391 ? -22.801 86.278  70.026  1.00 32.15  ? 369  ARG A CA  1 
ATOM   2425  C  C   . ARG A 1 391 ? -22.827 87.380  68.969  1.00 33.91  ? 369  ARG A C   1 
ATOM   2426  O  O   . ARG A 1 391 ? -23.056 87.121  67.788  1.00 36.90  ? 369  ARG A O   1 
ATOM   2427  C  CB  . ARG A 1 391 ? -21.518 85.445  69.899  1.00 31.16  ? 369  ARG A CB  1 
ATOM   2428  C  CG  . ARG A 1 391 ? -20.274 86.075  70.436  1.00 32.89  ? 369  ARG A CG  1 
ATOM   2429  C  CD  . ARG A 1 391 ? -19.566 85.142  71.417  1.00 41.50  ? 369  ARG A CD  1 
ATOM   2430  N  NE  . ARG A 1 391 ? -19.017 83.949  70.783  1.00 41.95  ? 369  ARG A NE  1 
ATOM   2431  C  CZ  . ARG A 1 391 ? -18.249 83.064  71.409  1.00 37.45  ? 369  ARG A CZ  1 
ATOM   2432  N  NH1 . ARG A 1 391 ? -17.948 83.243  72.686  1.00 41.23  ? 369  ARG A NH1 1 
ATOM   2433  N  NH2 . ARG A 1 391 ? -17.767 82.013  70.756  1.00 39.16  ? 369  ARG A NH2 1 
ATOM   2434  N  N   . CYS A 1 392 ? -22.595 88.612  69.398  1.00 31.73  ? 370  CYS A N   1 
ATOM   2435  C  CA  . CYS A 1 392 ? -22.567 89.733  68.475  1.00 33.48  ? 370  CYS A CA  1 
ATOM   2436  C  C   . CYS A 1 392 ? -21.213 90.429  68.574  1.00 34.57  ? 370  CYS A C   1 
ATOM   2437  O  O   . CYS A 1 392 ? -20.832 90.899  69.653  1.00 35.01  ? 370  CYS A O   1 
ATOM   2438  C  CB  . CYS A 1 392 ? -23.673 90.741  68.792  1.00 30.80  ? 370  CYS A CB  1 
ATOM   2439  S  SG  . CYS A 1 392 ? -23.613 92.211  67.723  1.00 29.07  ? 370  CYS A SG  1 
ATOM   2440  N  N   . VAL A 1 393 ? -20.490 90.486  67.453  1.00 28.57  ? 371  VAL A N   1 
ATOM   2441  C  CA  . VAL A 1 393 ? -19.185 91.128  67.420  1.00 24.66  ? 371  VAL A CA  1 
ATOM   2442  C  C   . VAL A 1 393 ? -19.235 92.492  66.769  1.00 24.81  ? 371  VAL A C   1 
ATOM   2443  O  O   . VAL A 1 393 ? -19.734 92.653  65.661  1.00 28.09  ? 371  VAL A O   1 
ATOM   2444  C  CB  . VAL A 1 393 ? -18.153 90.274  66.691  1.00 21.81  ? 371  VAL A CB  1 
ATOM   2445  C  CG1 . VAL A 1 393 ? -16.829 91.017  66.633  1.00 16.42  ? 371  VAL A CG1 1 
ATOM   2446  C  CG2 . VAL A 1 393 ? -17.977 88.944  67.427  1.00 19.51  ? 371  VAL A CG2 1 
ATOM   2447  N  N   . VAL A 1 394 ? -18.695 93.475  67.479  1.00 29.96  ? 372  VAL A N   1 
ATOM   2448  C  CA  . VAL A 1 394 ? -18.674 94.853  67.025  1.00 26.11  ? 372  VAL A CA  1 
ATOM   2449  C  C   . VAL A 1 394 ? -17.214 95.252  66.794  1.00 26.80  ? 372  VAL A C   1 
ATOM   2450  O  O   . VAL A 1 394 ? -16.316 94.741  67.466  1.00 25.64  ? 372  VAL A O   1 
ATOM   2451  C  CB  . VAL A 1 394 ? -19.341 95.752  68.093  1.00 25.37  ? 372  VAL A CB  1 
ATOM   2452  C  CG1 . VAL A 1 394 ? -18.332 96.155  69.153  1.00 12.98  ? 372  VAL A CG1 1 
ATOM   2453  C  CG2 . VAL A 1 394 ? -20.004 96.942  67.437  1.00 30.42  ? 372  VAL A CG2 1 
ATOM   2454  N  N   . ILE A 1 395 ? -16.979 96.149  65.838  1.00 23.09  ? 373  ILE A N   1 
ATOM   2455  C  CA  . ILE A 1 395 ? -15.630 96.603  65.508  1.00 20.24  ? 373  ILE A CA  1 
ATOM   2456  C  C   . ILE A 1 395 ? -15.364 98.033  65.960  1.00 23.75  ? 373  ILE A C   1 
ATOM   2457  O  O   . ILE A 1 395 ? -16.074 98.952  65.568  1.00 30.76  ? 373  ILE A O   1 
ATOM   2458  C  CB  . ILE A 1 395 ? -15.379 96.494  63.977  1.00 22.32  ? 373  ILE A CB  1 
ATOM   2459  C  CG1 . ILE A 1 395 ? -15.338 95.020  63.579  1.00 18.07  ? 373  ILE A CG1 1 
ATOM   2460  C  CG2 . ILE A 1 395 ? -14.072 97.183  63.590  1.00 17.42  ? 373  ILE A CG2 1 
ATOM   2461  C  CD1 . ILE A 1 395 ? -15.223 94.800  62.114  1.00 15.72  ? 373  ILE A CD1 1 
ATOM   2462  N  N   . LEU A 1 396 ? -14.343 98.213  66.791  1.00 24.37  ? 374  LEU A N   1 
ATOM   2463  C  CA  . LEU A 1 396 ? -13.979 99.538  67.287  1.00 22.68  ? 374  LEU A CA  1 
ATOM   2464  C  C   . LEU A 1 396 ? -12.707 99.888  66.524  1.00 23.63  ? 374  LEU A C   1 
ATOM   2465  O  O   . LEU A 1 396 ? -11.660 99.286  66.742  1.00 25.22  ? 374  LEU A O   1 
ATOM   2466  C  CB  . LEU A 1 396 ? -13.741 99.485  68.802  1.00 19.19  ? 374  LEU A CB  1 
ATOM   2467  C  CG  . LEU A 1 396 ? -14.824 98.740  69.604  1.00 22.28  ? 374  LEU A CG  1 
ATOM   2468  C  CD1 . LEU A 1 396 ? -14.632 99.020  71.091  1.00 20.38  ? 374  LEU A CD1 1 
ATOM   2469  C  CD2 . LEU A 1 396 ? -16.220 99.169  69.159  1.00 17.64  ? 374  LEU A CD2 1 
ATOM   2470  N  N   . PRO A 1 397 ? -12.797 100.863 65.604  1.00 23.25  ? 375  PRO A N   1 
ATOM   2471  C  CA  . PRO A 1 397 ? -11.732 101.368 64.724  1.00 22.20  ? 375  PRO A CA  1 
ATOM   2472  C  C   . PRO A 1 397 ? -10.474 102.073 65.228  1.00 23.34  ? 375  PRO A C   1 
ATOM   2473  O  O   . PRO A 1 397 ? -9.383  101.742 64.758  1.00 22.48  ? 375  PRO A O   1 
ATOM   2474  C  CB  . PRO A 1 397 ? -12.501 102.224 63.704  1.00 11.61  ? 375  PRO A CB  1 
ATOM   2475  C  CG  . PRO A 1 397 ? -13.857 101.582 63.698  1.00 26.20  ? 375  PRO A CG  1 
ATOM   2476  C  CD  . PRO A 1 397 ? -14.101 101.386 65.171  1.00 20.99  ? 375  PRO A CD  1 
ATOM   2477  N  N   . ASP A 1 398 ? -10.591 103.039 66.138  1.00 26.68  ? 376  ASP A N   1 
ATOM   2478  C  CA  . ASP A 1 398 ? -9.384  103.719 66.621  1.00 28.09  ? 376  ASP A CA  1 
ATOM   2479  C  C   . ASP A 1 398 ? -9.433  104.221 68.052  1.00 29.34  ? 376  ASP A C   1 
ATOM   2480  O  O   . ASP A 1 398 ? -10.438 104.078 68.732  1.00 33.78  ? 376  ASP A O   1 
ATOM   2481  C  CB  . ASP A 1 398 ? -9.009  104.880 65.695  1.00 28.90  ? 376  ASP A CB  1 
ATOM   2482  C  CG  . ASP A 1 398 ? -10.042 105.987 65.690  1.00 32.33  ? 376  ASP A CG  1 
ATOM   2483  O  OD1 . ASP A 1 398 ? -9.760  107.056 65.100  1.00 32.90  ? 376  ASP A OD1 1 
ATOM   2484  O  OD2 . ASP A 1 398 ? -11.133 105.789 66.266  1.00 34.10  ? 376  ASP A OD2 1 
ATOM   2485  N  N   . SER A 1 399 ? -8.332  104.818 68.499  1.00 34.11  ? 377  SER A N   1 
ATOM   2486  C  CA  . SER A 1 399 ? -8.218  105.327 69.866  1.00 28.79  ? 377  SER A CA  1 
ATOM   2487  C  C   . SER A 1 399 ? -8.714  106.754 70.027  1.00 26.07  ? 377  SER A C   1 
ATOM   2488  O  O   . SER A 1 399 ? -9.014  107.435 69.050  1.00 30.93  ? 377  SER A O   1 
ATOM   2489  C  CB  . SER A 1 399 ? -6.764  105.257 70.336  1.00 31.36  ? 377  SER A CB  1 
ATOM   2490  O  OG  . SER A 1 399 ? -6.020  106.368 69.863  1.00 30.56  ? 377  SER A OG  1 
ATOM   2491  N  N   . VAL A 1 400 ? -8.788  107.199 71.273  1.00 23.20  ? 378  VAL A N   1 
ATOM   2492  C  CA  . VAL A 1 400 ? -9.244  108.546 71.577  1.00 22.34  ? 378  VAL A CA  1 
ATOM   2493  C  C   . VAL A 1 400 ? -8.152  109.542 71.202  1.00 27.84  ? 378  VAL A C   1 
ATOM   2494  O  O   . VAL A 1 400 ? -8.406  110.740 71.120  1.00 25.68  ? 378  VAL A O   1 
ATOM   2495  C  CB  . VAL A 1 400 ? -9.538  108.739 73.101  1.00 25.02  ? 378  VAL A CB  1 
ATOM   2496  C  CG1 . VAL A 1 400 ? -10.748 107.941 73.525  1.00 20.21  ? 378  VAL A CG1 1 
ATOM   2497  C  CG2 . VAL A 1 400 ? -8.325  108.322 73.923  1.00 26.79  ? 378  VAL A CG2 1 
ATOM   2498  N  N   . ARG A 1 401 ? -6.937  109.050 70.970  1.00 25.54  ? 379  ARG A N   1 
ATOM   2499  C  CA  . ARG A 1 401 ? -5.825  109.936 70.649  1.00 27.74  ? 379  ARG A CA  1 
ATOM   2500  C  C   . ARG A 1 401 ? -6.120  111.017 69.614  1.00 32.35  ? 379  ARG A C   1 
ATOM   2501  O  O   . ARG A 1 401 ? -5.755  112.179 69.796  1.00 33.64  ? 379  ARG A O   1 
ATOM   2502  C  CB  . ARG A 1 401 ? -4.618  109.140 70.179  1.00 27.41  ? 379  ARG A CB  1 
ATOM   2503  C  CG  . ARG A 1 401 ? -3.321  109.953 70.235  1.00 27.44  ? 379  ARG A CG  1 
ATOM   2504  C  CD  . ARG A 1 401 ? -2.276  109.359 69.317  1.00 32.77  ? 379  ARG A CD  1 
ATOM   2505  N  NE  . ARG A 1 401 ? -2.787  109.343 67.951  1.00 38.16  ? 379  ARG A NE  1 
ATOM   2506  C  CZ  . ARG A 1 401 ? -2.576  108.356 67.094  1.00 46.55  ? 379  ARG A CZ  1 
ATOM   2507  N  NH1 . ARG A 1 401 ? -1.855  107.304 67.470  1.00 43.53  ? 379  ARG A NH1 1 
ATOM   2508  N  NH2 . ARG A 1 401 ? -3.099  108.413 65.873  1.00 47.28  ? 379  ARG A NH2 1 
ATOM   2509  N  N   . ASN A 1 402 ? -6.770  110.638 68.521  1.00 39.46  ? 380  ASN A N   1 
ATOM   2510  C  CA  . ASN A 1 402 ? -7.091  111.593 67.461  1.00 43.47  ? 380  ASN A CA  1 
ATOM   2511  C  C   . ASN A 1 402 ? -8.216  112.557 67.830  1.00 45.08  ? 380  ASN A C   1 
ATOM   2512  O  O   . ASN A 1 402 ? -8.552  113.458 67.054  1.00 44.30  ? 380  ASN A O   1 
ATOM   2513  C  CB  . ASN A 1 402 ? -7.473  110.848 66.179  1.00 44.27  ? 380  ASN A CB  1 
ATOM   2514  C  CG  . ASN A 1 402 ? -6.273  110.498 65.332  1.00 46.71  ? 380  ASN A CG  1 
ATOM   2515  O  OD1 . ASN A 1 402 ? -5.143  110.417 65.827  1.00 53.04  ? 380  ASN A OD1 1 
ATOM   2516  N  ND2 . ASN A 1 402 ? -6.509  110.277 64.046  1.00 43.34  ? 380  ASN A ND2 1 
ATOM   2517  N  N   . TYR A 1 403 ? -8.786  112.385 69.018  1.00 40.97  ? 381  TYR A N   1 
ATOM   2518  C  CA  . TYR A 1 403 ? -9.887  113.239 69.430  1.00 37.07  ? 381  TYR A CA  1 
ATOM   2519  C  C   . TYR A 1 403 ? -9.702  113.893 70.797  1.00 37.50  ? 381  TYR A C   1 
ATOM   2520  O  O   . TYR A 1 403 ? -10.680 114.255 71.450  1.00 33.42  ? 381  TYR A O   1 
ATOM   2521  C  CB  . TYR A 1 403 ? -11.179 112.421 69.409  1.00 32.21  ? 381  TYR A CB  1 
ATOM   2522  C  CG  . TYR A 1 403 ? -11.273 111.467 68.233  1.00 34.70  ? 381  TYR A CG  1 
ATOM   2523  C  CD1 . TYR A 1 403 ? -10.931 110.123 68.369  1.00 31.10  ? 381  TYR A CD1 1 
ATOM   2524  C  CD2 . TYR A 1 403 ? -11.712 111.913 66.984  1.00 31.67  ? 381  TYR A CD2 1 
ATOM   2525  C  CE1 . TYR A 1 403 ? -11.032 109.239 67.289  1.00 37.77  ? 381  TYR A CE1 1 
ATOM   2526  C  CE2 . TYR A 1 403 ? -11.816 111.044 65.899  1.00 35.38  ? 381  TYR A CE2 1 
ATOM   2527  C  CZ  . TYR A 1 403 ? -11.480 109.707 66.055  1.00 41.44  ? 381  TYR A CZ  1 
ATOM   2528  O  OH  . TYR A 1 403 ? -11.629 108.841 64.988  1.00 45.68  ? 381  TYR A OH  1 
ATOM   2529  N  N   . MET A 1 404 ? -8.451  114.058 71.223  1.00 36.91  ? 382  MET A N   1 
ATOM   2530  C  CA  . MET A 1 404 ? -8.159  114.666 72.520  1.00 32.66  ? 382  MET A CA  1 
ATOM   2531  C  C   . MET A 1 404 ? -8.892  115.981 72.709  1.00 34.49  ? 382  MET A C   1 
ATOM   2532  O  O   . MET A 1 404 ? -9.467  116.233 73.763  1.00 37.11  ? 382  MET A O   1 
ATOM   2533  C  CB  . MET A 1 404 ? -6.653  114.904 72.686  1.00 34.37  ? 382  MET A CB  1 
ATOM   2534  C  CG  . MET A 1 404 ? -5.829  113.629 72.682  1.00 31.72  ? 382  MET A CG  1 
ATOM   2535  S  SD  . MET A 1 404 ? -6.532  112.480 73.844  1.00 39.49  ? 382  MET A SD  1 
ATOM   2536  C  CE  . MET A 1 404 ? -5.620  112.865 75.293  1.00 19.99  ? 382  MET A CE  1 
ATOM   2537  N  N   . THR A 1 405 ? -8.879  116.819 71.682  1.00 37.70  ? 383  THR A N   1 
ATOM   2538  C  CA  . THR A 1 405 ? -9.539  118.117 71.759  1.00 38.86  ? 383  THR A CA  1 
ATOM   2539  C  C   . THR A 1 405 ? -10.934 118.154 71.132  1.00 38.86  ? 383  THR A C   1 
ATOM   2540  O  O   . THR A 1 405 ? -11.445 119.233 70.828  1.00 38.40  ? 383  THR A O   1 
ATOM   2541  C  CB  . THR A 1 405 ? -8.683  119.215 71.094  1.00 36.15  ? 383  THR A CB  1 
ATOM   2542  O  OG1 . THR A 1 405 ? -8.518  118.918 69.703  1.00 47.74  ? 383  THR A OG1 1 
ATOM   2543  C  CG2 . THR A 1 405 ? -7.314  119.286 71.743  1.00 44.70  ? 383  THR A CG2 1 
ATOM   2544  N  N   . LYS A 1 406 ? -11.551 116.990 70.936  1.00 34.17  ? 384  LYS A N   1 
ATOM   2545  C  CA  . LYS A 1 406 ? -12.888 116.953 70.358  1.00 28.80  ? 384  LYS A CA  1 
ATOM   2546  C  C   . LYS A 1 406 ? -13.906 116.316 71.312  1.00 27.65  ? 384  LYS A C   1 
ATOM   2547  O  O   . LYS A 1 406 ? -14.104 116.840 72.398  1.00 25.75  ? 384  LYS A O   1 
ATOM   2548  C  CB  . LYS A 1 406 ? -12.870 116.248 68.998  1.00 30.68  ? 384  LYS A CB  1 
ATOM   2549  C  CG  . LYS A 1 406 ? -12.057 117.002 67.935  1.00 25.70  ? 384  LYS A CG  1 
ATOM   2550  C  CD  . LYS A 1 406 ? -12.398 116.530 66.523  1.00 28.88  ? 384  LYS A CD  1 
ATOM   2551  C  CE  . LYS A 1 406 ? -11.669 117.342 65.448  1.00 32.47  ? 384  LYS A CE  1 
ATOM   2552  N  NZ  . LYS A 1 406 ? -12.109 116.984 64.055  1.00 33.55  ? 384  LYS A NZ  1 
ATOM   2553  N  N   . PHE A 1 407 ? -14.540 115.204 70.939  1.00 23.44  ? 385  PHE A N   1 
ATOM   2554  C  CA  . PHE A 1 407 ? -15.542 114.589 71.819  1.00 21.74  ? 385  PHE A CA  1 
ATOM   2555  C  C   . PHE A 1 407 ? -15.023 114.260 73.223  1.00 23.97  ? 385  PHE A C   1 
ATOM   2556  O  O   . PHE A 1 407 ? -15.804 114.075 74.156  1.00 22.46  ? 385  PHE A O   1 
ATOM   2557  C  CB  . PHE A 1 407 ? -16.143 113.327 71.169  1.00 24.84  ? 385  PHE A CB  1 
ATOM   2558  C  CG  . PHE A 1 407 ? -15.366 112.054 71.427  1.00 25.38  ? 385  PHE A CG  1 
ATOM   2559  C  CD1 . PHE A 1 407 ? -15.511 111.362 72.626  1.00 25.71  ? 385  PHE A CD1 1 
ATOM   2560  C  CD2 . PHE A 1 407 ? -14.504 111.540 70.463  1.00 28.06  ? 385  PHE A CD2 1 
ATOM   2561  C  CE1 . PHE A 1 407 ? -14.812 110.183 72.858  1.00 28.43  ? 385  PHE A CE1 1 
ATOM   2562  C  CE2 . PHE A 1 407 ? -13.797 110.357 70.683  1.00 28.91  ? 385  PHE A CE2 1 
ATOM   2563  C  CZ  . PHE A 1 407 ? -13.950 109.678 71.882  1.00 29.00  ? 385  PHE A CZ  1 
ATOM   2564  N  N   . LEU A 1 408 ? -13.708 114.200 73.374  1.00 25.86  ? 386  LEU A N   1 
ATOM   2565  C  CA  . LEU A 1 408 ? -13.110 113.887 74.660  1.00 35.23  ? 386  LEU A CA  1 
ATOM   2566  C  C   . LEU A 1 408 ? -13.016 115.143 75.528  1.00 39.62  ? 386  LEU A C   1 
ATOM   2567  O  O   . LEU A 1 408 ? -12.548 115.090 76.666  1.00 43.58  ? 386  LEU A O   1 
ATOM   2568  C  CB  . LEU A 1 408 ? -11.718 113.272 74.440  1.00 36.50  ? 386  LEU A CB  1 
ATOM   2569  C  CG  . LEU A 1 408 ? -11.044 112.384 75.496  1.00 32.62  ? 386  LEU A CG  1 
ATOM   2570  C  CD1 . LEU A 1 408 ? -10.147 113.202 76.373  1.00 30.53  ? 386  LEU A CD1 1 
ATOM   2571  C  CD2 . LEU A 1 408 ? -12.101 111.640 76.303  1.00 34.70  ? 386  LEU A CD2 1 
ATOM   2572  N  N   . SER A 1 409 ? -13.474 116.269 74.988  1.00 40.99  ? 387  SER A N   1 
ATOM   2573  C  CA  . SER A 1 409 ? -13.440 117.538 75.713  1.00 41.51  ? 387  SER A CA  1 
ATOM   2574  C  C   . SER A 1 409 ? -14.834 118.152 75.869  1.00 43.92  ? 387  SER A C   1 
ATOM   2575  O  O   . SER A 1 409 ? -15.544 118.363 74.886  1.00 40.08  ? 387  SER A O   1 
ATOM   2576  C  CB  . SER A 1 409 ? -12.525 118.527 74.991  1.00 39.91  ? 387  SER A CB  1 
ATOM   2577  O  OG  . SER A 1 409 ? -12.403 119.724 75.730  1.00 44.43  ? 387  SER A OG  1 
ATOM   2578  N  N   . ASP A 1 410 ? -15.221 118.438 77.110  1.00 49.03  ? 388  ASP A N   1 
ATOM   2579  C  CA  . ASP A 1 410 ? -16.531 119.025 77.382  1.00 51.07  ? 388  ASP A CA  1 
ATOM   2580  C  C   . ASP A 1 410 ? -16.715 120.359 76.667  1.00 52.45  ? 388  ASP A C   1 
ATOM   2581  O  O   . ASP A 1 410 ? -17.800 120.650 76.161  1.00 50.12  ? 388  ASP A O   1 
ATOM   2582  C  CB  . ASP A 1 410 ? -16.736 119.208 78.887  1.00 51.40  ? 388  ASP A CB  1 
ATOM   2583  C  CG  . ASP A 1 410 ? -16.768 117.890 79.633  1.00 52.94  ? 388  ASP A CG  1 
ATOM   2584  O  OD1 . ASP A 1 410 ? -17.245 117.871 80.788  1.00 58.48  ? 388  ASP A OD1 1 
ATOM   2585  O  OD2 . ASP A 1 410 ? -16.310 116.875 79.070  1.00 47.09  ? 388  ASP A OD2 1 
ATOM   2586  N  N   . ARG A 1 411 ? -15.657 121.168 76.634  1.00 55.45  ? 389  ARG A N   1 
ATOM   2587  C  CA  . ARG A 1 411 ? -15.707 122.461 75.955  1.00 57.63  ? 389  ARG A CA  1 
ATOM   2588  C  C   . ARG A 1 411 ? -16.224 122.239 74.539  1.00 55.50  ? 389  ARG A C   1 
ATOM   2589  O  O   . ARG A 1 411 ? -17.158 122.907 74.091  1.00 55.62  ? 389  ARG A O   1 
ATOM   2590  C  CB  . ARG A 1 411 ? -14.309 123.090 75.892  1.00 59.66  ? 389  ARG A CB  1 
ATOM   2591  C  CG  . ARG A 1 411 ? -13.794 123.637 77.216  1.00 66.36  ? 389  ARG A CG  1 
ATOM   2592  C  CD  . ARG A 1 411 ? -12.278 123.848 77.193  1.00 68.86  ? 389  ARG A CD  1 
ATOM   2593  N  NE  . ARG A 1 411 ? -11.558 122.573 77.192  1.00 77.77  ? 389  ARG A NE  1 
ATOM   2594  C  CZ  . ARG A 1 411 ? -10.234 122.452 77.246  1.00 78.09  ? 389  ARG A CZ  1 
ATOM   2595  N  NH1 . ARG A 1 411 ? -9.469  123.536 77.307  1.00 76.12  ? 389  ARG A NH1 1 
ATOM   2596  N  NH2 . ARG A 1 411 ? -9.676  121.245 77.238  1.00 79.61  ? 389  ARG A NH2 1 
ATOM   2597  N  N   . TRP A 1 412 ? -15.612 121.282 73.846  1.00 51.95  ? 390  TRP A N   1 
ATOM   2598  C  CA  . TRP A 1 412 ? -15.983 120.957 72.477  1.00 46.60  ? 390  TRP A CA  1 
ATOM   2599  C  C   . TRP A 1 412 ? -17.413 120.442 72.439  1.00 45.93  ? 390  TRP A C   1 
ATOM   2600  O  O   . TRP A 1 412 ? -18.241 120.941 71.680  1.00 45.87  ? 390  TRP A O   1 
ATOM   2601  C  CB  . TRP A 1 412 ? -15.036 119.893 71.920  1.00 39.24  ? 390  TRP A CB  1 
ATOM   2602  C  CG  . TRP A 1 412 ? -15.147 119.676 70.439  1.00 33.56  ? 390  TRP A CG  1 
ATOM   2603  C  CD1 . TRP A 1 412 ? -14.474 120.347 69.458  1.00 27.03  ? 390  TRP A CD1 1 
ATOM   2604  C  CD2 . TRP A 1 412 ? -15.945 118.682 69.775  1.00 29.37  ? 390  TRP A CD2 1 
ATOM   2605  N  NE1 . TRP A 1 412 ? -14.796 119.825 68.226  1.00 31.00  ? 390  TRP A NE1 1 
ATOM   2606  C  CE2 . TRP A 1 412 ? -15.696 118.803 68.391  1.00 26.88  ? 390  TRP A CE2 1 
ATOM   2607  C  CE3 . TRP A 1 412 ? -16.844 117.696 70.218  1.00 27.64  ? 390  TRP A CE3 1 
ATOM   2608  C  CZ2 . TRP A 1 412 ? -16.312 117.969 67.440  1.00 23.17  ? 390  TRP A CZ2 1 
ATOM   2609  C  CZ3 . TRP A 1 412 ? -17.461 116.862 69.263  1.00 15.74  ? 390  TRP A CZ3 1 
ATOM   2610  C  CH2 . TRP A 1 412 ? -17.187 117.008 67.900  1.00 9.76   ? 390  TRP A CH2 1 
ATOM   2611  N  N   . MET A 1 413 ? -17.699 119.441 73.263  1.00 47.24  ? 391  MET A N   1 
ATOM   2612  C  CA  . MET A 1 413 ? -19.034 118.861 73.314  1.00 44.71  ? 391  MET A CA  1 
ATOM   2613  C  C   . MET A 1 413 ? -20.095 119.942 73.522  1.00 45.83  ? 391  MET A C   1 
ATOM   2614  O  O   . MET A 1 413 ? -21.159 119.919 72.894  1.00 45.76  ? 391  MET A O   1 
ATOM   2615  C  CB  . MET A 1 413 ? -19.107 117.816 74.433  1.00 40.94  ? 391  MET A CB  1 
ATOM   2616  C  CG  . MET A 1 413 ? -18.325 116.534 74.157  1.00 34.32  ? 391  MET A CG  1 
ATOM   2617  S  SD  . MET A 1 413 ? -18.993 115.581 72.762  1.00 39.88  ? 391  MET A SD  1 
ATOM   2618  C  CE  . MET A 1 413 ? -20.361 114.689 73.550  1.00 31.33  ? 391  MET A CE  1 
ATOM   2619  N  N   . LEU A 1 414 ? -19.794 120.894 74.400  1.00 48.58  ? 392  LEU A N   1 
ATOM   2620  C  CA  . LEU A 1 414 ? -20.709 121.994 74.687  1.00 50.97  ? 392  LEU A CA  1 
ATOM   2621  C  C   . LEU A 1 414 ? -20.893 122.921 73.485  1.00 54.35  ? 392  LEU A C   1 
ATOM   2622  O  O   . LEU A 1 414 ? -22.017 123.132 73.028  1.00 56.19  ? 392  LEU A O   1 
ATOM   2623  C  CB  . LEU A 1 414 ? -20.203 122.799 75.889  1.00 46.16  ? 392  LEU A CB  1 
ATOM   2624  C  CG  . LEU A 1 414 ? -20.307 122.107 77.253  1.00 50.59  ? 392  LEU A CG  1 
ATOM   2625  C  CD1 . LEU A 1 414 ? -19.594 122.928 78.319  1.00 48.39  ? 392  LEU A CD1 1 
ATOM   2626  C  CD2 . LEU A 1 414 ? -21.773 121.917 77.619  1.00 48.34  ? 392  LEU A CD2 1 
ATOM   2627  N  N   . GLN A 1 415 ? -19.793 123.466 72.971  1.00 57.04  ? 393  GLN A N   1 
ATOM   2628  C  CA  . GLN A 1 415 ? -19.860 124.374 71.834  1.00 59.65  ? 393  GLN A CA  1 
ATOM   2629  C  C   . GLN A 1 415 ? -20.566 123.744 70.639  1.00 59.61  ? 393  GLN A C   1 
ATOM   2630  O  O   . GLN A 1 415 ? -21.312 124.418 69.930  1.00 62.91  ? 393  GLN A O   1 
ATOM   2631  C  CB  . GLN A 1 415 ? -18.451 124.826 71.419  1.00 65.73  ? 393  GLN A CB  1 
ATOM   2632  C  CG  . GLN A 1 415 ? -17.825 124.031 70.267  1.00 75.43  ? 393  GLN A CG  1 
ATOM   2633  C  CD  . GLN A 1 415 ? -17.832 124.783 68.939  1.00 74.39  ? 393  GLN A CD  1 
ATOM   2634  O  OE1 . GLN A 1 415 ? -18.850 125.351 68.534  1.00 76.25  ? 393  GLN A OE1 1 
ATOM   2635  N  NE2 . GLN A 1 415 ? -16.693 124.777 68.250  1.00 69.48  ? 393  GLN A NE2 1 
ATOM   2636  N  N   . LYS A 1 416 ? -20.337 122.456 70.413  1.00 57.35  ? 394  LYS A N   1 
ATOM   2637  C  CA  . LYS A 1 416 ? -20.961 121.780 69.279  1.00 59.41  ? 394  LYS A CA  1 
ATOM   2638  C  C   . LYS A 1 416 ? -22.418 121.433 69.565  1.00 59.89  ? 394  LYS A C   1 
ATOM   2639  O  O   . LYS A 1 416 ? -23.132 120.944 68.689  1.00 56.82  ? 394  LYS A O   1 
ATOM   2640  C  CB  . LYS A 1 416 ? -20.193 120.502 68.921  1.00 57.75  ? 394  LYS A CB  1 
ATOM   2641  C  CG  . LYS A 1 416 ? -18.706 120.701 68.632  1.00 60.14  ? 394  LYS A CG  1 
ATOM   2642  C  CD  . LYS A 1 416 ? -18.442 121.629 67.447  1.00 50.03  ? 394  LYS A CD  1 
ATOM   2643  C  CE  . LYS A 1 416 ? -18.948 121.047 66.143  1.00 51.67  ? 394  LYS A CE  1 
ATOM   2644  N  NZ  . LYS A 1 416 ? -18.571 121.908 64.990  1.00 53.30  ? 394  LYS A NZ  1 
ATOM   2645  N  N   . GLY A 1 417 ? -22.852 121.676 70.798  1.00 62.39  ? 395  GLY A N   1 
ATOM   2646  C  CA  . GLY A 1 417 ? -24.227 121.387 71.164  1.00 63.99  ? 395  GLY A CA  1 
ATOM   2647  C  C   . GLY A 1 417 ? -24.574 119.911 71.238  1.00 63.32  ? 395  GLY A C   1 
ATOM   2648  O  O   . GLY A 1 417 ? -25.682 119.504 70.888  1.00 58.58  ? 395  GLY A O   1 
ATOM   2649  N  N   . PHE A 1 418 ? -23.620 119.103 71.687  1.00 66.17  ? 396  PHE A N   1 
ATOM   2650  C  CA  . PHE A 1 418 ? -23.828 117.663 71.827  1.00 63.55  ? 396  PHE A CA  1 
ATOM   2651  C  C   . PHE A 1 418 ? -24.043 117.397 73.302  1.00 62.37  ? 396  PHE A C   1 
ATOM   2652  O  O   . PHE A 1 418 ? -24.723 116.450 73.697  1.00 61.54  ? 396  PHE A O   1 
ATOM   2653  C  CB  . PHE A 1 418 ? -22.592 116.887 71.368  1.00 63.37  ? 396  PHE A CB  1 
ATOM   2654  C  CG  . PHE A 1 418 ? -22.342 116.950 69.893  1.00 60.72  ? 396  PHE A CG  1 
ATOM   2655  C  CD1 . PHE A 1 418 ? -21.077 117.273 69.408  1.00 62.44  ? 396  PHE A CD1 1 
ATOM   2656  C  CD2 . PHE A 1 418 ? -23.360 116.668 68.988  1.00 61.05  ? 396  PHE A CD2 1 
ATOM   2657  C  CE1 . PHE A 1 418 ? -20.826 117.315 68.037  1.00 63.19  ? 396  PHE A CE1 1 
ATOM   2658  C  CE2 . PHE A 1 418 ? -23.124 116.705 67.615  1.00 60.84  ? 396  PHE A CE2 1 
ATOM   2659  C  CZ  . PHE A 1 418 ? -21.853 117.030 67.136  1.00 62.59  ? 396  PHE A CZ  1 
ATOM   2660  N  N   . LEU A 1 419 ? -23.442 118.252 74.114  1.00 64.06  ? 397  LEU A N   1 
ATOM   2661  C  CA  . LEU A 1 419 ? -23.547 118.123 75.554  1.00 63.81  ? 397  LEU A CA  1 
ATOM   2662  C  C   . LEU A 1 419 ? -24.120 119.410 76.155  1.00 65.40  ? 397  LEU A C   1 
ATOM   2663  O  O   . LEU A 1 419 ? -23.813 120.504 75.618  1.00 64.22  ? 397  LEU A O   1 
ATOM   2664  C  CB  . LEU A 1 419 ? -22.156 117.804 76.117  1.00 56.79  ? 397  LEU A CB  1 
ATOM   2665  C  CG  . LEU A 1 419 ? -22.025 117.388 77.573  1.00 44.29  ? 397  LEU A CG  1 
ATOM   2666  C  CD1 . LEU A 1 419 ? -21.993 118.619 78.446  1.00 47.07  ? 397  LEU A CD1 1 
ATOM   2667  C  CD2 . LEU A 1 419 ? -23.171 116.461 77.938  1.00 41.84  ? 397  LEU A CD2 1 
ATOM   2668  N  N   . TRP B 1 65  ? -1.278  110.773 107.673 1.00 78.64  ? 43   TRP B N   1 
ATOM   2669  C  CA  . TRP B 1 65  ? -0.154  110.978 106.721 1.00 79.67  ? 43   TRP B CA  1 
ATOM   2670  C  C   . TRP B 1 65  ? 1.235   110.596 107.198 1.00 80.68  ? 43   TRP B C   1 
ATOM   2671  O  O   . TRP B 1 65  ? 1.821   111.239 108.087 1.00 83.77  ? 43   TRP B O   1 
ATOM   2672  C  CB  . TRP B 1 65  ? -0.065  112.438 106.263 1.00 80.27  ? 43   TRP B CB  1 
ATOM   2673  C  CG  . TRP B 1 65  ? 0.945   112.593 105.139 1.00 82.00  ? 43   TRP B CG  1 
ATOM   2674  C  CD1 . TRP B 1 65  ? 0.807   112.138 103.862 1.00 85.52  ? 43   TRP B CD1 1 
ATOM   2675  C  CD2 . TRP B 1 65  ? 2.244   113.195 105.212 1.00 83.60  ? 43   TRP B CD2 1 
ATOM   2676  N  NE1 . TRP B 1 65  ? 1.936   112.419 103.130 1.00 85.35  ? 43   TRP B NE1 1 
ATOM   2677  C  CE2 . TRP B 1 65  ? 2.839   113.062 103.932 1.00 83.47  ? 43   TRP B CE2 1 
ATOM   2678  C  CE3 . TRP B 1 65  ? 2.968   113.830 106.229 1.00 85.39  ? 43   TRP B CE3 1 
ATOM   2679  C  CZ2 . TRP B 1 65  ? 4.122   113.536 103.645 1.00 81.05  ? 43   TRP B CZ2 1 
ATOM   2680  C  CZ3 . TRP B 1 65  ? 4.247   114.305 105.947 1.00 84.37  ? 43   TRP B CZ3 1 
ATOM   2681  C  CH2 . TRP B 1 65  ? 4.814   114.150 104.655 1.00 82.50  ? 43   TRP B CH2 1 
ATOM   2682  N  N   . ILE B 1 66  ? 1.768   109.558 106.573 1.00 77.56  ? 44   ILE B N   1 
ATOM   2683  C  CA  . ILE B 1 66  ? 3.086   109.077 106.902 1.00 74.99  ? 44   ILE B CA  1 
ATOM   2684  C  C   . ILE B 1 66  ? 3.970   109.330 105.669 1.00 74.45  ? 44   ILE B C   1 
ATOM   2685  O  O   . ILE B 1 66  ? 3.654   108.905 104.554 1.00 70.12  ? 44   ILE B O   1 
ATOM   2686  C  CB  . ILE B 1 66  ? 2.997   107.588 107.307 1.00 75.57  ? 44   ILE B CB  1 
ATOM   2687  C  CG1 . ILE B 1 66  ? 2.387   107.471 108.721 1.00 78.82  ? 44   ILE B CG1 1 
ATOM   2688  C  CG2 . ILE B 1 66  ? 4.371   106.932 107.195 1.00 76.68  ? 44   ILE B CG2 1 
ATOM   2689  C  CD1 . ILE B 1 66  ? 0.993   108.127 108.890 1.00 75.01  ? 44   ILE B CD1 1 
ATOM   2690  N  N   . ARG B 1 67  ? 5.065   110.058 105.881 1.00 74.68  ? 45   ARG B N   1 
ATOM   2691  C  CA  . ARG B 1 67  ? 6.011   110.410 104.828 1.00 72.67  ? 45   ARG B CA  1 
ATOM   2692  C  C   . ARG B 1 67  ? 6.214   109.315 103.799 1.00 73.03  ? 45   ARG B C   1 
ATOM   2693  O  O   . ARG B 1 67  ? 6.609   108.209 104.136 1.00 72.59  ? 45   ARG B O   1 
ATOM   2694  C  CB  . ARG B 1 67  ? 7.363   110.756 105.451 1.00 73.83  ? 45   ARG B CB  1 
ATOM   2695  C  CG  . ARG B 1 67  ? 7.320   111.886 106.445 1.00 72.31  ? 45   ARG B CG  1 
ATOM   2696  C  CD  . ARG B 1 67  ? 8.542   111.843 107.337 1.00 78.12  ? 45   ARG B CD  1 
ATOM   2697  N  NE  . ARG B 1 67  ? 8.546   110.657 108.191 1.00 77.55  ? 45   ARG B NE  1 
ATOM   2698  C  CZ  . ARG B 1 67  ? 9.323   109.596 108.003 1.00 81.66  ? 45   ARG B CZ  1 
ATOM   2699  N  NH1 . ARG B 1 67  ? 10.177  109.561 106.985 1.00 79.31  ? 45   ARG B NH1 1 
ATOM   2700  N  NH2 . ARG B 1 67  ? 9.245   108.569 108.838 1.00 87.30  ? 45   ARG B NH2 1 
ATOM   2701  N  N   . PRO B 1 68  ? 5.947   109.618 102.519 1.00 75.66  ? 46   PRO B N   1 
ATOM   2702  C  CA  . PRO B 1 68  ? 6.108   108.659 101.417 1.00 74.88  ? 46   PRO B CA  1 
ATOM   2703  C  C   . PRO B 1 68  ? 7.584   108.306 101.184 1.00 73.84  ? 46   PRO B C   1 
ATOM   2704  O  O   . PRO B 1 68  ? 7.912   107.549 100.269 1.00 71.96  ? 46   PRO B O   1 
ATOM   2705  C  CB  . PRO B 1 68  ? 5.513   109.404 100.220 1.00 76.61  ? 46   PRO B CB  1 
ATOM   2706  C  CG  . PRO B 1 68  ? 4.502   110.325 100.856 1.00 76.21  ? 46   PRO B CG  1 
ATOM   2707  C  CD  . PRO B 1 68  ? 5.253   110.833 102.054 1.00 75.41  ? 46   PRO B CD  1 
ATOM   2708  N  N   . ASP B 1 69  ? 8.467   108.876 102.005 1.00 73.53  ? 47   ASP B N   1 
ATOM   2709  C  CA  . ASP B 1 69  ? 9.905   108.619 101.898 1.00 71.65  ? 47   ASP B CA  1 
ATOM   2710  C  C   . ASP B 1 69  ? 10.532  107.964 103.140 1.00 68.70  ? 47   ASP B C   1 
ATOM   2711  O  O   . ASP B 1 69  ? 11.752  107.834 103.224 1.00 70.39  ? 47   ASP B O   1 
ATOM   2712  C  CB  . ASP B 1 69  ? 10.678  109.913 101.549 1.00 73.71  ? 47   ASP B CB  1 
ATOM   2713  C  CG  . ASP B 1 69  ? 10.132  111.153 102.257 1.00 73.21  ? 47   ASP B CG  1 
ATOM   2714  O  OD1 . ASP B 1 69  ? 9.109   111.700 101.783 1.00 71.77  ? 47   ASP B OD1 1 
ATOM   2715  O  OD2 . ASP B 1 69  ? 10.726  111.576 103.279 1.00 73.15  ? 47   ASP B OD2 1 
ATOM   2716  N  N   . ALA B 1 70  ? 9.706   107.554 104.098 1.00 63.65  ? 48   ALA B N   1 
ATOM   2717  C  CA  . ALA B 1 70  ? 10.207  106.904 105.305 1.00 59.56  ? 48   ALA B CA  1 
ATOM   2718  C  C   . ALA B 1 70  ? 11.090  105.718 104.886 1.00 60.42  ? 48   ALA B C   1 
ATOM   2719  O  O   . ALA B 1 70  ? 10.677  104.889 104.077 1.00 60.74  ? 48   ALA B O   1 
ATOM   2720  C  CB  . ALA B 1 70  ? 9.038   106.425 106.155 1.00 54.16  ? 48   ALA B CB  1 
ATOM   2721  N  N   . PRO B 1 71  ? 12.310  105.613 105.453 1.00 61.03  ? 49   PRO B N   1 
ATOM   2722  C  CA  . PRO B 1 71  ? 13.301  104.560 105.176 1.00 57.65  ? 49   PRO B CA  1 
ATOM   2723  C  C   . PRO B 1 71  ? 12.863  103.088 105.290 1.00 54.33  ? 49   PRO B C   1 
ATOM   2724  O  O   . PRO B 1 71  ? 12.941  102.491 106.364 1.00 56.25  ? 49   PRO B O   1 
ATOM   2725  C  CB  . PRO B 1 71  ? 14.432  104.908 106.142 1.00 57.01  ? 49   PRO B CB  1 
ATOM   2726  C  CG  . PRO B 1 71  ? 13.708  105.491 107.294 1.00 53.76  ? 49   PRO B CG  1 
ATOM   2727  C  CD  . PRO B 1 71  ? 12.739  106.417 106.613 1.00 57.40  ? 49   PRO B CD  1 
ATOM   2728  N  N   . SER B 1 72  ? 12.448  102.516 104.157 1.00 52.15  ? 50   SER B N   1 
ATOM   2729  C  CA  . SER B 1 72  ? 11.980  101.127 104.045 1.00 48.27  ? 50   SER B CA  1 
ATOM   2730  C  C   . SER B 1 72  ? 12.507  100.146 105.067 1.00 52.48  ? 50   SER B C   1 
ATOM   2731  O  O   . SER B 1 72  ? 13.650  100.236 105.517 1.00 55.13  ? 50   SER B O   1 
ATOM   2732  C  CB  . SER B 1 72  ? 12.278  100.556 102.650 1.00 42.14  ? 50   SER B CB  1 
ATOM   2733  O  OG  . SER B 1 72  ? 11.941  99.176  102.567 1.00 33.94  ? 50   SER B OG  1 
ATOM   2734  N  N   . ARG B 1 73  ? 11.662  99.177  105.397 1.00 53.99  ? 51   ARG B N   1 
ATOM   2735  C  CA  . ARG B 1 73  ? 12.014  98.161  106.373 1.00 59.30  ? 51   ARG B CA  1 
ATOM   2736  C  C   . ARG B 1 73  ? 12.046  96.746  105.788 1.00 57.47  ? 51   ARG B C   1 
ATOM   2737  O  O   . ARG B 1 73  ? 12.182  95.771  106.527 1.00 56.56  ? 51   ARG B O   1 
ATOM   2738  C  CB  . ARG B 1 73  ? 11.035  98.209  107.558 1.00 62.24  ? 51   ARG B CB  1 
ATOM   2739  C  CG  . ARG B 1 73  ? 11.122  99.469  108.421 1.00 60.14  ? 51   ARG B CG  1 
ATOM   2740  C  CD  . ARG B 1 73  ? 9.886   100.321 108.267 1.00 61.29  ? 51   ARG B CD  1 
ATOM   2741  N  NE  . ARG B 1 73  ? 8.678   99.576  108.603 1.00 65.22  ? 51   ARG B NE  1 
ATOM   2742  C  CZ  . ARG B 1 73  ? 7.442   99.998  108.347 1.00 70.98  ? 51   ARG B CZ  1 
ATOM   2743  N  NH1 . ARG B 1 73  ? 7.249   101.167 107.748 1.00 71.79  ? 51   ARG B NH1 1 
ATOM   2744  N  NH2 . ARG B 1 73  ? 6.394   99.254  108.686 1.00 73.93  ? 51   ARG B NH2 1 
ATOM   2745  N  N   . CYS B 1 74  ? 11.919  96.633  104.470 1.00 56.63  ? 52   CYS B N   1 
ATOM   2746  C  CA  . CYS B 1 74  ? 11.942  95.329  103.808 1.00 53.32  ? 52   CYS B CA  1 
ATOM   2747  C  C   . CYS B 1 74  ? 13.245  94.605  104.128 1.00 52.01  ? 52   CYS B C   1 
ATOM   2748  O  O   . CYS B 1 74  ? 14.310  95.220  104.127 1.00 49.22  ? 52   CYS B O   1 
ATOM   2749  C  CB  . CYS B 1 74  ? 11.821  95.507  102.291 1.00 53.86  ? 52   CYS B CB  1 
ATOM   2750  S  SG  . CYS B 1 74  ? 11.724  93.948  101.383 1.00 45.76  ? 52   CYS B SG  1 
ATOM   2751  N  N   . THR B 1 75  ? 13.177  93.300  104.375 1.00 53.40  ? 53   THR B N   1 
ATOM   2752  C  CA  . THR B 1 75  ? 14.385  92.550  104.723 1.00 56.38  ? 53   THR B CA  1 
ATOM   2753  C  C   . THR B 1 75  ? 15.004  91.698  103.617 1.00 57.78  ? 53   THR B C   1 
ATOM   2754  O  O   . THR B 1 75  ? 15.903  90.890  103.878 1.00 59.94  ? 53   THR B O   1 
ATOM   2755  C  CB  . THR B 1 75  ? 14.152  91.670  105.979 1.00 51.93  ? 53   THR B CB  1 
ATOM   2756  O  OG1 . THR B 1 75  ? 13.032  90.806  105.774 1.00 56.25  ? 53   THR B OG1 1 
ATOM   2757  C  CG2 . THR B 1 75  ? 13.877  92.547  107.181 1.00 53.27  ? 53   THR B CG2 1 
ATOM   2758  N  N   . TRP B 1 76  ? 14.531  91.893  102.386 1.00 56.33  ? 54   TRP B N   1 
ATOM   2759  C  CA  . TRP B 1 76  ? 15.048  91.167  101.225 1.00 52.06  ? 54   TRP B CA  1 
ATOM   2760  C  C   . TRP B 1 76  ? 16.553  91.406  101.089 1.00 50.86  ? 54   TRP B C   1 
ATOM   2761  O  O   . TRP B 1 76  ? 17.051  92.481  101.402 1.00 48.64  ? 54   TRP B O   1 
ATOM   2762  C  CB  . TRP B 1 76  ? 14.352  91.656  99.945  1.00 47.05  ? 54   TRP B CB  1 
ATOM   2763  C  CG  . TRP B 1 76  ? 14.907  91.080  98.651  1.00 37.72  ? 54   TRP B CG  1 
ATOM   2764  C  CD1 . TRP B 1 76  ? 14.449  89.979  97.968  1.00 37.79  ? 54   TRP B CD1 1 
ATOM   2765  C  CD2 . TRP B 1 76  ? 16.018  91.575  97.904  1.00 31.84  ? 54   TRP B CD2 1 
ATOM   2766  N  NE1 . TRP B 1 76  ? 15.209  89.761  96.844  1.00 28.33  ? 54   TRP B NE1 1 
ATOM   2767  C  CE2 . TRP B 1 76  ? 16.180  90.727  96.779  1.00 34.08  ? 54   TRP B CE2 1 
ATOM   2768  C  CE3 . TRP B 1 76  ? 16.897  92.652  98.073  1.00 27.80  ? 54   TRP B CE3 1 
ATOM   2769  C  CZ2 . TRP B 1 76  ? 17.189  90.928  95.826  1.00 31.69  ? 54   TRP B CZ2 1 
ATOM   2770  C  CZ3 . TRP B 1 76  ? 17.898  92.849  97.128  1.00 37.05  ? 54   TRP B CZ3 1 
ATOM   2771  C  CH2 . TRP B 1 76  ? 18.036  91.988  96.015  1.00 30.27  ? 54   TRP B CH2 1 
ATOM   2772  N  N   . GLN B 1 77  ? 17.265  90.390  100.624 1.00 49.90  ? 55   GLN B N   1 
ATOM   2773  C  CA  . GLN B 1 77  ? 18.699  90.481  100.397 1.00 51.29  ? 55   GLN B CA  1 
ATOM   2774  C  C   . GLN B 1 77  ? 18.989  89.494  99.275  1.00 47.49  ? 55   GLN B C   1 
ATOM   2775  O  O   . GLN B 1 77  ? 18.508  88.363  99.314  1.00 43.65  ? 55   GLN B O   1 
ATOM   2776  C  CB  . GLN B 1 77  ? 19.485  90.087  101.649 1.00 57.84  ? 55   GLN B CB  1 
ATOM   2777  C  CG  . GLN B 1 77  ? 19.244  90.983  102.856 1.00 71.66  ? 55   GLN B CG  1 
ATOM   2778  C  CD  . GLN B 1 77  ? 20.239  90.732  103.978 1.00 81.69  ? 55   GLN B CD  1 
ATOM   2779  O  OE1 . GLN B 1 77  ? 21.441  90.985  103.831 1.00 89.00  ? 55   GLN B OE1 1 
ATOM   2780  N  NE2 . GLN B 1 77  ? 19.744  90.228  105.106 1.00 82.90  ? 55   GLN B NE2 1 
ATOM   2781  N  N   . LEU B 1 78  ? 19.750  89.915  98.270  1.00 44.28  ? 56   LEU B N   1 
ATOM   2782  C  CA  . LEU B 1 78  ? 20.058  89.025  97.165  1.00 43.34  ? 56   LEU B CA  1 
ATOM   2783  C  C   . LEU B 1 78  ? 20.683  87.754  97.709  1.00 45.18  ? 56   LEU B C   1 
ATOM   2784  O  O   . LEU B 1 78  ? 21.486  87.803  98.643  1.00 44.80  ? 56   LEU B O   1 
ATOM   2785  C  CB  . LEU B 1 78  ? 21.020  89.694  96.178  1.00 46.38  ? 56   LEU B CB  1 
ATOM   2786  C  CG  . LEU B 1 78  ? 21.484  88.810  95.006  1.00 47.43  ? 56   LEU B CG  1 
ATOM   2787  C  CD1 . LEU B 1 78  ? 20.280  88.199  94.294  1.00 43.92  ? 56   LEU B CD1 1 
ATOM   2788  C  CD2 . LEU B 1 78  ? 22.316  89.639  94.038  1.00 43.40  ? 56   LEU B CD2 1 
ATOM   2789  N  N   . GLY B 1 79  ? 20.303  86.614  97.135  1.00 47.45  ? 57   GLY B N   1 
ATOM   2790  C  CA  . GLY B 1 79  ? 20.846  85.342  97.585  1.00 42.19  ? 57   GLY B CA  1 
ATOM   2791  C  C   . GLY B 1 79  ? 19.958  84.649  98.598  1.00 39.30  ? 57   GLY B C   1 
ATOM   2792  O  O   . GLY B 1 79  ? 20.159  83.478  98.922  1.00 31.84  ? 57   GLY B O   1 
ATOM   2793  N  N   . ARG B 1 80  ? 18.969  85.380  99.098  1.00 40.38  ? 58   ARG B N   1 
ATOM   2794  C  CA  . ARG B 1 80  ? 18.030  84.846  100.072 1.00 40.97  ? 58   ARG B CA  1 
ATOM   2795  C  C   . ARG B 1 80  ? 16.885  84.152  99.322  1.00 42.34  ? 58   ARG B C   1 
ATOM   2796  O  O   . ARG B 1 80  ? 16.303  84.715  98.397  1.00 42.60  ? 58   ARG B O   1 
ATOM   2797  C  CB  . ARG B 1 80  ? 17.509  85.989  100.940 1.00 38.44  ? 58   ARG B CB  1 
ATOM   2798  C  CG  . ARG B 1 80  ? 16.840  85.537  102.193 1.00 39.59  ? 58   ARG B CG  1 
ATOM   2799  C  CD  . ARG B 1 80  ? 16.444  86.696  103.082 1.00 39.02  ? 58   ARG B CD  1 
ATOM   2800  N  NE  . ARG B 1 80  ? 15.496  86.216  104.082 1.00 46.31  ? 58   ARG B NE  1 
ATOM   2801  C  CZ  . ARG B 1 80  ? 15.146  86.870  105.182 1.00 43.96  ? 58   ARG B CZ  1 
ATOM   2802  N  NH1 . ARG B 1 80  ? 14.269  86.319  106.010 1.00 47.43  ? 58   ARG B NH1 1 
ATOM   2803  N  NH2 . ARG B 1 80  ? 15.669  88.059  105.459 1.00 31.67  ? 58   ARG B NH2 1 
ATOM   2804  N  N   . PRO B 1 81  ? 16.549  82.916  99.713  1.00 44.70  ? 59   PRO B N   1 
ATOM   2805  C  CA  . PRO B 1 81  ? 15.480  82.131  99.080  1.00 46.96  ? 59   PRO B CA  1 
ATOM   2806  C  C   . PRO B 1 81  ? 14.142  82.859  98.952  1.00 48.68  ? 59   PRO B C   1 
ATOM   2807  O  O   . PRO B 1 81  ? 13.775  83.658  99.813  1.00 51.01  ? 59   PRO B O   1 
ATOM   2808  C  CB  . PRO B 1 81  ? 15.371  80.902  99.983  1.00 49.82  ? 59   PRO B CB  1 
ATOM   2809  C  CG  . PRO B 1 81  ? 16.742  80.778  100.560 1.00 46.63  ? 59   PRO B CG  1 
ATOM   2810  C  CD  . PRO B 1 81  ? 17.086  82.206  100.884 1.00 43.51  ? 59   PRO B CD  1 
ATOM   2811  N  N   . ALA B 1 82  ? 13.412  82.566  97.880  1.00 47.47  ? 60   ALA B N   1 
ATOM   2812  C  CA  . ALA B 1 82  ? 12.111  83.188  97.645  1.00 46.33  ? 60   ALA B CA  1 
ATOM   2813  C  C   . ALA B 1 82  ? 11.076  82.654  98.634  1.00 43.89  ? 60   ALA B C   1 
ATOM   2814  O  O   . ALA B 1 82  ? 10.081  83.317  98.931  1.00 36.46  ? 60   ALA B O   1 
ATOM   2815  C  CB  . ALA B 1 82  ? 11.652  82.917  96.215  1.00 45.64  ? 60   ALA B CB  1 
ATOM   2816  N  N   . SER B 1 83  ? 11.321  81.448  99.137  1.00 42.12  ? 61   SER B N   1 
ATOM   2817  C  CA  . SER B 1 83  ? 10.420  80.814  100.089 1.00 40.01  ? 61   SER B CA  1 
ATOM   2818  C  C   . SER B 1 83  ? 10.317  81.648  101.359 1.00 37.57  ? 61   SER B C   1 
ATOM   2819  O  O   . SER B 1 83  ? 9.377   81.503  102.135 1.00 39.58  ? 61   SER B O   1 
ATOM   2820  C  CB  . SER B 1 83  ? 10.932  79.417  100.429 1.00 39.63  ? 61   SER B CB  1 
ATOM   2821  O  OG  . SER B 1 83  ? 12.286  79.468  100.845 1.00 52.64  ? 61   SER B OG  1 
ATOM   2822  N  N   . GLU B 1 84  ? 11.289  82.526  101.561 1.00 33.29  ? 62   GLU B N   1 
ATOM   2823  C  CA  . GLU B 1 84  ? 11.308  83.369  102.740 1.00 28.95  ? 62   GLU B CA  1 
ATOM   2824  C  C   . GLU B 1 84  ? 10.569  84.695  102.608 1.00 22.76  ? 62   GLU B C   1 
ATOM   2825  O  O   . GLU B 1 84  ? 10.525  85.469  103.550 1.00 20.77  ? 62   GLU B O   1 
ATOM   2826  C  CB  . GLU B 1 84  ? 12.752  83.618  103.165 1.00 30.99  ? 62   GLU B CB  1 
ATOM   2827  C  CG  . GLU B 1 84  ? 13.397  82.420  103.790 1.00 31.49  ? 62   GLU B CG  1 
ATOM   2828  C  CD  . GLU B 1 84  ? 14.815  82.691  104.211 1.00 41.90  ? 62   GLU B CD  1 
ATOM   2829  O  OE1 . GLU B 1 84  ? 15.070  83.775  104.778 1.00 44.10  ? 62   GLU B OE1 1 
ATOM   2830  O  OE2 . GLU B 1 84  ? 15.672  81.811  103.988 1.00 48.68  ? 62   GLU B OE2 1 
ATOM   2831  N  N   . SER B 1 85  ? 9.992   84.971  101.451 1.00 27.97  ? 63   SER B N   1 
ATOM   2832  C  CA  . SER B 1 85  ? 9.243   86.213  101.284 1.00 31.34  ? 63   SER B CA  1 
ATOM   2833  C  C   . SER B 1 85  ? 7.932   86.108  102.049 1.00 29.86  ? 63   SER B C   1 
ATOM   2834  O  O   . SER B 1 85  ? 7.298   85.063  102.059 1.00 28.09  ? 63   SER B O   1 
ATOM   2835  C  CB  . SER B 1 85  ? 8.923   86.466  99.813  1.00 29.23  ? 63   SER B CB  1 
ATOM   2836  O  OG  . SER B 1 85  ? 7.886   87.427  99.686  1.00 31.81  ? 63   SER B OG  1 
ATOM   2837  N  N   . PRO B 1 86  ? 7.521   87.190  102.711 1.00 31.17  ? 64   PRO B N   1 
ATOM   2838  C  CA  . PRO B 1 86  ? 6.285   87.260  103.487 1.00 34.89  ? 64   PRO B CA  1 
ATOM   2839  C  C   . PRO B 1 86  ? 5.233   87.903  102.612 1.00 37.35  ? 64   PRO B C   1 
ATOM   2840  O  O   . PRO B 1 86  ? 4.143   88.233  103.075 1.00 35.72  ? 64   PRO B O   1 
ATOM   2841  C  CB  . PRO B 1 86  ? 6.663   88.175  104.634 1.00 38.04  ? 64   PRO B CB  1 
ATOM   2842  C  CG  . PRO B 1 86  ? 7.471   89.198  103.925 1.00 36.58  ? 64   PRO B CG  1 
ATOM   2843  C  CD  . PRO B 1 86  ? 8.375   88.342  103.025 1.00 32.04  ? 64   PRO B CD  1 
ATOM   2844  N  N   . HIS B 1 87  ? 5.581   88.082  101.342 1.00 40.82  ? 65   HIS B N   1 
ATOM   2845  C  CA  . HIS B 1 87  ? 4.693   88.713  100.377 1.00 41.28  ? 65   HIS B CA  1 
ATOM   2846  C  C   . HIS B 1 87  ? 3.859   87.753  99.546  1.00 44.68  ? 65   HIS B C   1 
ATOM   2847  O  O   . HIS B 1 87  ? 4.223   86.590  99.358  1.00 46.80  ? 65   HIS B O   1 
ATOM   2848  C  CB  . HIS B 1 87  ? 5.510   89.585  99.438  1.00 39.51  ? 65   HIS B CB  1 
ATOM   2849  C  CG  . HIS B 1 87  ? 6.231   90.696  100.130 1.00 39.63  ? 65   HIS B CG  1 
ATOM   2850  N  ND1 . HIS B 1 87  ? 5.574   91.700  100.803 1.00 34.02  ? 65   HIS B ND1 1 
ATOM   2851  C  CD2 . HIS B 1 87  ? 7.552   90.962  100.251 1.00 40.94  ? 65   HIS B CD2 1 
ATOM   2852  C  CE1 . HIS B 1 87  ? 6.459   92.538  101.311 1.00 36.60  ? 65   HIS B CE1 1 
ATOM   2853  N  NE2 . HIS B 1 87  ? 7.667   92.114  100.990 1.00 37.90  ? 65   HIS B NE2 1 
ATOM   2854  N  N   . HIS B 1 88  ? 2.726   88.249  99.058  1.00 45.50  ? 66   HIS B N   1 
ATOM   2855  C  CA  . HIS B 1 88  ? 1.869   87.437  98.212  1.00 50.19  ? 66   HIS B CA  1 
ATOM   2856  C  C   . HIS B 1 88  ? 2.418   87.646  96.821  1.00 46.64  ? 66   HIS B C   1 
ATOM   2857  O  O   . HIS B 1 88  ? 2.447   88.770  96.323  1.00 45.87  ? 66   HIS B O   1 
ATOM   2858  C  CB  . HIS B 1 88  ? 0.412   87.903  98.250  1.00 56.26  ? 66   HIS B CB  1 
ATOM   2859  C  CG  . HIS B 1 88  ? -0.485  87.108  97.351  1.00 65.01  ? 66   HIS B CG  1 
ATOM   2860  N  ND1 . HIS B 1 88  ? -1.398  87.694  96.499  1.00 68.37  ? 66   HIS B ND1 1 
ATOM   2861  C  CD2 . HIS B 1 88  ? -0.573  85.774  97.137  1.00 66.92  ? 66   HIS B CD2 1 
ATOM   2862  C  CE1 . HIS B 1 88  ? -2.003  86.754  95.794  1.00 71.23  ? 66   HIS B CE1 1 
ATOM   2863  N  NE2 . HIS B 1 88  ? -1.521  85.581  96.162  1.00 70.06  ? 66   HIS B NE2 1 
ATOM   2864  N  N   . HIS B 1 89  ? 2.861   86.568  96.194  1.00 42.99  ? 67   HIS B N   1 
ATOM   2865  C  CA  . HIS B 1 89  ? 3.429   86.675  94.865  1.00 43.63  ? 67   HIS B CA  1 
ATOM   2866  C  C   . HIS B 1 89  ? 2.555   86.106  93.766  1.00 40.84  ? 67   HIS B C   1 
ATOM   2867  O  O   . HIS B 1 89  ? 1.888   85.088  93.937  1.00 43.72  ? 67   HIS B O   1 
ATOM   2868  C  CB  . HIS B 1 89  ? 4.814   86.035  94.858  1.00 43.63  ? 67   HIS B CB  1 
ATOM   2869  C  CG  . HIS B 1 89  ? 5.828   86.818  95.631  1.00 40.09  ? 67   HIS B CG  1 
ATOM   2870  N  ND1 . HIS B 1 89  ? 6.329   88.023  95.187  1.00 37.06  ? 67   HIS B ND1 1 
ATOM   2871  C  CD2 . HIS B 1 89  ? 6.410   86.588  96.831  1.00 39.66  ? 67   HIS B CD2 1 
ATOM   2872  C  CE1 . HIS B 1 89  ? 7.178   88.499  96.079  1.00 36.79  ? 67   HIS B CE1 1 
ATOM   2873  N  NE2 . HIS B 1 89  ? 7.246   87.648  97.086  1.00 35.54  ? 67   HIS B NE2 1 
ATOM   2874  N  N   . THR B 1 90  ? 2.569   86.802  92.635  1.00 39.11  ? 68   THR B N   1 
ATOM   2875  C  CA  . THR B 1 90  ? 1.786   86.443  91.464  1.00 36.49  ? 68   THR B CA  1 
ATOM   2876  C  C   . THR B 1 90  ? 2.657   86.060  90.268  1.00 36.78  ? 68   THR B C   1 
ATOM   2877  O  O   . THR B 1 90  ? 3.792   86.529  90.129  1.00 38.92  ? 68   THR B O   1 
ATOM   2878  C  CB  . THR B 1 90  ? 0.863   87.611  91.103  1.00 34.93  ? 68   THR B CB  1 
ATOM   2879  O  OG1 . THR B 1 90  ? -0.299  87.549  91.938  1.00 43.99  ? 68   THR B OG1 1 
ATOM   2880  C  CG2 . THR B 1 90  ? 0.463   87.582  89.640  1.00 38.09  ? 68   THR B CG2 1 
ATOM   2881  N  N   . ALA B 1 91  ? 2.120   85.191  89.416  1.00 37.70  ? 69   ALA B N   1 
ATOM   2882  C  CA  . ALA B 1 91  ? 2.828   84.734  88.221  1.00 42.78  ? 69   ALA B CA  1 
ATOM   2883  C  C   . ALA B 1 91  ? 2.284   85.425  86.970  1.00 42.65  ? 69   ALA B C   1 
ATOM   2884  O  O   . ALA B 1 91  ? 1.112   85.791  86.910  1.00 48.06  ? 69   ALA B O   1 
ATOM   2885  C  CB  . ALA B 1 91  ? 2.688   83.225  88.084  1.00 42.75  ? 69   ALA B CB  1 
ATOM   2886  N  N   . PRO B 1 92  ? 3.131   85.623  85.955  1.00 39.17  ? 70   PRO B N   1 
ATOM   2887  C  CA  . PRO B 1 92  ? 2.642   86.279  84.741  1.00 38.60  ? 70   PRO B CA  1 
ATOM   2888  C  C   . PRO B 1 92  ? 1.447   85.536  84.138  1.00 38.57  ? 70   PRO B C   1 
ATOM   2889  O  O   . PRO B 1 92  ? 1.219   84.359  84.426  1.00 34.93  ? 70   PRO B O   1 
ATOM   2890  C  CB  . PRO B 1 92  ? 3.865   86.255  83.823  1.00 37.10  ? 70   PRO B CB  1 
ATOM   2891  C  CG  . PRO B 1 92  ? 5.000   86.365  84.779  1.00 42.81  ? 70   PRO B CG  1 
ATOM   2892  C  CD  . PRO B 1 92  ? 4.587   85.416  85.894  1.00 46.53  ? 70   PRO B CD  1 
ATOM   2893  N  N   . ALA B 1 93  ? 0.679   86.234  83.309  1.00 43.33  ? 71   ALA B N   1 
ATOM   2894  C  CA  . ALA B 1 93  ? -0.482  85.641  82.647  1.00 44.20  ? 71   ALA B CA  1 
ATOM   2895  C  C   . ALA B 1 93  ? -0.459  86.023  81.172  1.00 41.53  ? 71   ALA B C   1 
ATOM   2896  O  O   . ALA B 1 93  ? -0.144  87.163  80.832  1.00 43.49  ? 71   ALA B O   1 
ATOM   2897  C  CB  . ALA B 1 93  ? -1.772  86.139  83.295  1.00 40.21  ? 71   ALA B CB  1 
ATOM   2898  N  N   . LYS B 1 94  ? -0.767  85.069  80.299  1.00 41.85  ? 72   LYS B N   1 
ATOM   2899  C  CA  . LYS B 1 94  ? -0.792  85.353  78.867  1.00 45.33  ? 72   LYS B CA  1 
ATOM   2900  C  C   . LYS B 1 94  ? -2.210  85.741  78.440  1.00 46.95  ? 72   LYS B C   1 
ATOM   2901  O  O   . LYS B 1 94  ? -3.201  85.316  79.051  1.00 42.46  ? 72   LYS B O   1 
ATOM   2902  C  CB  . LYS B 1 94  ? -0.309  84.144  78.054  1.00 45.90  ? 72   LYS B CB  1 
ATOM   2903  C  CG  . LYS B 1 94  ? 1.208   84.019  77.937  1.00 53.90  ? 72   LYS B CG  1 
ATOM   2904  C  CD  . LYS B 1 94  ? 1.599   82.984  76.873  1.00 54.82  ? 72   LYS B CD  1 
ATOM   2905  C  CE  . LYS B 1 94  ? 3.108   82.940  76.624  1.00 52.11  ? 72   LYS B CE  1 
ATOM   2906  N  NZ  . LYS B 1 94  ? 3.876   82.414  77.795  1.00 53.74  ? 72   LYS B NZ  1 
ATOM   2907  N  N   . SER B 1 95  ? -2.295  86.560  77.397  1.00 47.40  ? 73   SER B N   1 
ATOM   2908  C  CA  . SER B 1 95  ? -3.574  87.018  76.882  1.00 50.64  ? 73   SER B CA  1 
ATOM   2909  C  C   . SER B 1 95  ? -4.445  85.878  76.354  1.00 52.52  ? 73   SER B C   1 
ATOM   2910  O  O   . SER B 1 95  ? -4.008  85.079  75.528  1.00 51.02  ? 73   SER B O   1 
ATOM   2911  C  CB  . SER B 1 95  ? -3.350  88.043  75.772  1.00 48.21  ? 73   SER B CB  1 
ATOM   2912  O  OG  . SER B 1 95  ? -4.516  88.191  74.974  1.00 53.21  ? 73   SER B OG  1 
ATOM   2913  N  N   . PRO B 1 96  ? -5.699  85.792  76.834  1.00 52.78  ? 74   PRO B N   1 
ATOM   2914  C  CA  . PRO B 1 96  ? -6.649  84.754  76.414  1.00 49.02  ? 74   PRO B CA  1 
ATOM   2915  C  C   . PRO B 1 96  ? -7.301  85.072  75.063  1.00 46.52  ? 74   PRO B C   1 
ATOM   2916  O  O   . PRO B 1 96  ? -7.126  86.167  74.519  1.00 49.73  ? 74   PRO B O   1 
ATOM   2917  C  CB  . PRO B 1 96  ? -7.661  84.745  77.551  1.00 46.01  ? 74   PRO B CB  1 
ATOM   2918  C  CG  . PRO B 1 96  ? -7.719  86.189  77.929  1.00 51.59  ? 74   PRO B CG  1 
ATOM   2919  C  CD  . PRO B 1 96  ? -6.258  86.593  77.939  1.00 50.52  ? 74   PRO B CD  1 
ATOM   2920  N  N   . LYS B 1 97  ? -8.049  84.108  74.530  1.00 39.81  ? 75   LYS B N   1 
ATOM   2921  C  CA  . LYS B 1 97  ? -8.736  84.269  73.253  1.00 36.68  ? 75   LYS B CA  1 
ATOM   2922  C  C   . LYS B 1 97  ? -9.619  85.505  73.316  1.00 39.19  ? 75   LYS B C   1 
ATOM   2923  O  O   . LYS B 1 97  ? -9.390  86.488  72.615  1.00 45.48  ? 75   LYS B O   1 
ATOM   2924  C  CB  . LYS B 1 97  ? -9.620  83.063  72.975  1.00 31.91  ? 75   LYS B CB  1 
ATOM   2925  C  CG  . LYS B 1 97  ? -9.184  82.180  71.825  1.00 19.57  ? 75   LYS B CG  1 
ATOM   2926  C  CD  . LYS B 1 97  ? -10.361 81.300  71.391  1.00 25.43  ? 75   LYS B CD  1 
ATOM   2927  C  CE  . LYS B 1 97  ? -9.910  80.084  70.612  1.00 24.71  ? 75   LYS B CE  1 
ATOM   2928  N  NZ  . LYS B 1 97  ? -9.478  78.985  71.527  1.00 21.08  ? 75   LYS B NZ  1 
ATOM   2929  N  N   . ILE B 1 98  ? -10.647 85.423  74.155  1.00 35.70  ? 76   ILE B N   1 
ATOM   2930  C  CA  . ILE B 1 98  ? -11.590 86.513  74.373  1.00 30.88  ? 76   ILE B CA  1 
ATOM   2931  C  C   . ILE B 1 98  ? -11.321 87.100  75.765  1.00 30.06  ? 76   ILE B C   1 
ATOM   2932  O  O   . ILE B 1 98  ? -11.290 86.369  76.747  1.00 38.75  ? 76   ILE B O   1 
ATOM   2933  C  CB  . ILE B 1 98  ? -13.029 85.987  74.315  1.00 24.21  ? 76   ILE B CB  1 
ATOM   2934  C  CG1 . ILE B 1 98  ? -13.387 85.654  72.863  1.00 27.17  ? 76   ILE B CG1 1 
ATOM   2935  C  CG2 . ILE B 1 98  ? -13.985 87.003  74.928  1.00 26.28  ? 76   ILE B CG2 1 
ATOM   2936  C  CD1 . ILE B 1 98  ? -14.785 85.084  72.684  1.00 6.28   ? 76   ILE B CD1 1 
ATOM   2937  N  N   . LEU B 1 99  ? -11.117 88.408  75.850  1.00 26.31  ? 77   LEU B N   1 
ATOM   2938  C  CA  . LEU B 1 99  ? -10.844 89.041  77.137  1.00 23.47  ? 77   LEU B CA  1 
ATOM   2939  C  C   . LEU B 1 99  ? -12.117 89.405  77.893  1.00 20.38  ? 77   LEU B C   1 
ATOM   2940  O  O   . LEU B 1 99  ? -12.992 90.081  77.365  1.00 19.46  ? 77   LEU B O   1 
ATOM   2941  C  CB  . LEU B 1 99  ? -9.981  90.297  76.947  1.00 21.01  ? 77   LEU B CB  1 
ATOM   2942  C  CG  . LEU B 1 99  ? -8.493  90.063  76.606  1.00 28.08  ? 77   LEU B CG  1 
ATOM   2943  C  CD1 . LEU B 1 99  ? -8.353  89.261  75.298  1.00 25.99  ? 77   LEU B CD1 1 
ATOM   2944  C  CD2 . LEU B 1 99  ? -7.776  91.397  76.486  1.00 16.60  ? 77   LEU B CD2 1 
ATOM   2945  N  N   . PRO B 1 100 ? -12.235 88.957  79.153  1.00 16.51  ? 78   PRO B N   1 
ATOM   2946  C  CA  . PRO B 1 100 ? -13.410 89.241  79.980  1.00 14.66  ? 78   PRO B CA  1 
ATOM   2947  C  C   . PRO B 1 100 ? -13.647 90.730  80.290  1.00 22.85  ? 78   PRO B C   1 
ATOM   2948  O  O   . PRO B 1 100 ? -14.787 91.145  80.565  1.00 26.33  ? 78   PRO B O   1 
ATOM   2949  C  CB  . PRO B 1 100 ? -13.165 88.390  81.232  1.00 2.61   ? 78   PRO B CB  1 
ATOM   2950  C  CG  . PRO B 1 100 ? -11.717 88.291  81.307  1.00 7.21   ? 78   PRO B CG  1 
ATOM   2951  C  CD  . PRO B 1 100 ? -11.298 88.081  79.869  1.00 12.67  ? 78   PRO B CD  1 
ATOM   2952  N  N   . ASP B 1 101 ? -12.574 91.517  80.283  1.00 24.73  ? 79   ASP B N   1 
ATOM   2953  C  CA  . ASP B 1 101 ? -12.651 92.962  80.497  1.00 23.03  ? 79   ASP B CA  1 
ATOM   2954  C  C   . ASP B 1 101 ? -11.317 93.548  80.063  1.00 19.17  ? 79   ASP B C   1 
ATOM   2955  O  O   . ASP B 1 101 ? -10.336 92.820  79.918  1.00 24.51  ? 79   ASP B O   1 
ATOM   2956  C  CB  . ASP B 1 101 ? -12.966 93.306  81.958  1.00 36.38  ? 79   ASP B CB  1 
ATOM   2957  C  CG  . ASP B 1 101 ? -11.814 93.037  82.886  1.00 38.21  ? 79   ASP B CG  1 
ATOM   2958  O  OD1 . ASP B 1 101 ? -10.725 93.610  82.660  1.00 43.60  ? 79   ASP B OD1 1 
ATOM   2959  O  OD2 . ASP B 1 101 ? -12.008 92.263  83.849  1.00 39.95  ? 79   ASP B OD2 1 
ATOM   2960  N  N   . ILE B 1 102 ? -11.268 94.857  79.864  1.00 15.33  ? 80   ILE B N   1 
ATOM   2961  C  CA  . ILE B 1 102 ? -10.045 95.495  79.375  1.00 12.96  ? 80   ILE B CA  1 
ATOM   2962  C  C   . ILE B 1 102 ? -8.834  95.410  80.287  1.00 13.97  ? 80   ILE B C   1 
ATOM   2963  O  O   . ILE B 1 102 ? -7.685  95.451  79.817  1.00 10.91  ? 80   ILE B O   1 
ATOM   2964  C  CB  . ILE B 1 102 ? -10.284 96.979  79.024  1.00 5.66   ? 80   ILE B CB  1 
ATOM   2965  C  CG1 . ILE B 1 102 ? -9.264  97.435  77.973  1.00 4.33   ? 80   ILE B CG1 1 
ATOM   2966  C  CG2 . ILE B 1 102 ? -10.179 97.837  80.279  1.00 7.83   ? 80   ILE B CG2 1 
ATOM   2967  C  CD1 . ILE B 1 102 ? -9.313  96.684  76.653  1.00 2.61   ? 80   ILE B CD1 1 
ATOM   2968  N  N   . LEU B 1 103 ? -9.085  95.279  81.582  1.00 7.39   ? 81   LEU B N   1 
ATOM   2969  C  CA  . LEU B 1 103 ? -7.997  95.198  82.524  1.00 21.38  ? 81   LEU B CA  1 
ATOM   2970  C  C   . LEU B 1 103 ? -7.123  94.004  82.213  1.00 21.19  ? 81   LEU B C   1 
ATOM   2971  O  O   . LEU B 1 103 ? -5.956  93.945  82.608  1.00 21.52  ? 81   LEU B O   1 
ATOM   2972  C  CB  . LEU B 1 103 ? -8.536  95.137  83.955  1.00 20.64  ? 81   LEU B CB  1 
ATOM   2973  C  CG  . LEU B 1 103 ? -9.314  96.421  84.288  1.00 30.74  ? 81   LEU B CG  1 
ATOM   2974  C  CD1 . LEU B 1 103 ? -9.797  96.372  85.735  1.00 21.64  ? 81   LEU B CD1 1 
ATOM   2975  C  CD2 . LEU B 1 103 ? -8.421  97.657  84.026  1.00 18.78  ? 81   LEU B CD2 1 
ATOM   2976  N  N   . LYS B 1 104 ? -7.696  93.052  81.497  1.00 24.19  ? 82   LYS B N   1 
ATOM   2977  C  CA  . LYS B 1 104 ? -6.950  91.882  81.108  1.00 26.16  ? 82   LYS B CA  1 
ATOM   2978  C  C   . LYS B 1 104 ? -5.935  92.270  80.020  1.00 22.52  ? 82   LYS B C   1 
ATOM   2979  O  O   . LYS B 1 104 ? -5.073  91.471  79.659  1.00 14.87  ? 82   LYS B O   1 
ATOM   2980  C  CB  . LYS B 1 104 ? -7.916  90.784  80.640  1.00 26.56  ? 82   LYS B CB  1 
ATOM   2981  C  CG  . LYS B 1 104 ? -8.118  89.706  81.697  1.00 38.54  ? 82   LYS B CG  1 
ATOM   2982  C  CD  . LYS B 1 104 ? -8.354  90.324  83.064  1.00 44.87  ? 82   LYS B CD  1 
ATOM   2983  C  CE  . LYS B 1 104 ? -8.096  89.340  84.206  1.00 49.20  ? 82   LYS B CE  1 
ATOM   2984  N  NZ  . LYS B 1 104 ? -7.910  90.088  85.507  1.00 45.89  ? 82   LYS B NZ  1 
ATOM   2985  N  N   . LYS B 1 105 ? -6.024  93.507  79.524  1.00 23.71  ? 83   LYS B N   1 
ATOM   2986  C  CA  . LYS B 1 105 ? -5.086  93.980  78.505  1.00 25.94  ? 83   LYS B CA  1 
ATOM   2987  C  C   . LYS B 1 105 ? -4.054  94.916  79.123  1.00 28.35  ? 83   LYS B C   1 
ATOM   2988  O  O   . LYS B 1 105 ? -3.722  95.959  78.573  1.00 32.27  ? 83   LYS B O   1 
ATOM   2989  C  CB  . LYS B 1 105 ? -5.822  94.677  77.356  1.00 26.01  ? 83   LYS B CB  1 
ATOM   2990  C  CG  . LYS B 1 105 ? -4.922  95.021  76.152  1.00 28.01  ? 83   LYS B CG  1 
ATOM   2991  C  CD  . LYS B 1 105 ? -4.020  93.852  75.734  1.00 31.24  ? 83   LYS B CD  1 
ATOM   2992  C  CE  . LYS B 1 105 ? -3.292  94.111  74.404  1.00 35.31  ? 83   LYS B CE  1 
ATOM   2993  N  NZ  . LYS B 1 105 ? -2.389  95.315  74.381  1.00 44.23  ? 83   LYS B NZ  1 
ATOM   2994  N  N   . ILE B 1 106 ? -3.574  94.515  80.297  1.00 33.88  ? 84   ILE B N   1 
ATOM   2995  C  CA  . ILE B 1 106 ? -2.554  95.217  81.073  1.00 25.44  ? 84   ILE B CA  1 
ATOM   2996  C  C   . ILE B 1 106 ? -1.527  94.106  81.294  1.00 27.69  ? 84   ILE B C   1 
ATOM   2997  O  O   . ILE B 1 106 ? -1.874  93.024  81.774  1.00 19.94  ? 84   ILE B O   1 
ATOM   2998  C  CB  . ILE B 1 106 ? -3.115  95.679  82.438  1.00 25.12  ? 84   ILE B CB  1 
ATOM   2999  C  CG1 . ILE B 1 106 ? -4.117  96.816  82.227  1.00 21.25  ? 84   ILE B CG1 1 
ATOM   3000  C  CG2 . ILE B 1 106 ? -1.996  96.106  83.359  1.00 17.01  ? 84   ILE B CG2 1 
ATOM   3001  C  CD1 . ILE B 1 106 ? -4.955  97.122  83.441  1.00 23.70  ? 84   ILE B CD1 1 
ATOM   3002  N  N   . GLY B 1 107 ? -0.280  94.362  80.914  1.00 23.23  ? 85   GLY B N   1 
ATOM   3003  C  CA  . GLY B 1 107 ? 0.751   93.357  81.060  1.00 25.86  ? 85   GLY B CA  1 
ATOM   3004  C  C   . GLY B 1 107 ? 0.909   92.588  79.763  1.00 30.31  ? 85   GLY B C   1 
ATOM   3005  O  O   . GLY B 1 107 ? 0.188   92.836  78.794  1.00 34.72  ? 85   GLY B O   1 
ATOM   3006  N  N   . ASP B 1 108 ? 1.846   91.648  79.735  1.00 31.47  ? 86   ASP B N   1 
ATOM   3007  C  CA  . ASP B 1 108 ? 2.085   90.856  78.533  1.00 32.33  ? 86   ASP B CA  1 
ATOM   3008  C  C   . ASP B 1 108 ? 2.358   91.844  77.397  1.00 32.61  ? 86   ASP B C   1 
ATOM   3009  O  O   . ASP B 1 108 ? 1.858   91.692  76.282  1.00 37.74  ? 86   ASP B O   1 
ATOM   3010  C  CB  . ASP B 1 108 ? 0.853   89.985  78.227  1.00 30.67  ? 86   ASP B CB  1 
ATOM   3011  C  CG  . ASP B 1 108 ? 1.123   88.925  77.173  1.00 25.16  ? 86   ASP B CG  1 
ATOM   3012  O  OD1 . ASP B 1 108 ? 2.061   88.127  77.351  1.00 28.99  ? 86   ASP B OD1 1 
ATOM   3013  O  OD2 . ASP B 1 108 ? 0.386   88.877  76.169  1.00 32.13  ? 86   ASP B OD2 1 
ATOM   3014  N  N   . THR B 1 109 ? 3.142   92.874  77.699  1.00 26.58  ? 87   THR B N   1 
ATOM   3015  C  CA  . THR B 1 109 ? 3.483   93.874  76.702  1.00 25.44  ? 87   THR B CA  1 
ATOM   3016  C  C   . THR B 1 109 ? 4.584   93.380  75.743  1.00 19.56  ? 87   THR B C   1 
ATOM   3017  O  O   . THR B 1 109 ? 5.442   92.585  76.102  1.00 16.45  ? 87   THR B O   1 
ATOM   3018  C  CB  . THR B 1 109 ? 3.937   95.189  77.367  1.00 29.47  ? 87   THR B CB  1 
ATOM   3019  O  OG1 . THR B 1 109 ? 5.074   94.942  78.195  1.00 25.24  ? 87   THR B OG1 1 
ATOM   3020  C  CG2 . THR B 1 109 ? 2.819   95.767  78.209  1.00 26.37  ? 87   THR B CG2 1 
ATOM   3021  N  N   . PRO B 1 110 ? 4.557   93.856  74.495  1.00 15.75  ? 88   PRO B N   1 
ATOM   3022  C  CA  . PRO B 1 110 ? 5.534   93.476  73.467  1.00 13.99  ? 88   PRO B CA  1 
ATOM   3023  C  C   . PRO B 1 110 ? 6.981   93.960  73.603  1.00 14.02  ? 88   PRO B C   1 
ATOM   3024  O  O   . PRO B 1 110 ? 7.252   95.097  74.009  1.00 14.83  ? 88   PRO B O   1 
ATOM   3025  C  CB  . PRO B 1 110 ? 4.894   93.996  72.183  1.00 8.21   ? 88   PRO B CB  1 
ATOM   3026  C  CG  . PRO B 1 110 ? 4.099   95.169  72.653  1.00 17.79  ? 88   PRO B CG  1 
ATOM   3027  C  CD  . PRO B 1 110 ? 3.491   94.708  73.928  1.00 7.14   ? 88   PRO B CD  1 
ATOM   3028  N  N   . MET B 1 111 ? 7.910   93.075  73.249  1.00 20.20  ? 89   MET B N   1 
ATOM   3029  C  CA  . MET B 1 111 ? 9.341   93.384  73.279  1.00 19.96  ? 89   MET B CA  1 
ATOM   3030  C  C   . MET B 1 111 ? 9.730   93.640  71.824  1.00 26.30  ? 89   MET B C   1 
ATOM   3031  O  O   . MET B 1 111 ? 9.722   92.717  70.999  1.00 27.45  ? 89   MET B O   1 
ATOM   3032  C  CB  . MET B 1 111 ? 10.141  92.209  73.825  1.00 14.47  ? 89   MET B CB  1 
ATOM   3033  C  CG  . MET B 1 111 ? 11.634  92.496  73.945  1.00 20.31  ? 89   MET B CG  1 
ATOM   3034  S  SD  . MET B 1 111 ? 12.016  93.636  75.313  1.00 25.15  ? 89   MET B SD  1 
ATOM   3035  C  CE  . MET B 1 111 ? 12.441  92.434  76.633  1.00 23.68  ? 89   MET B CE  1 
ATOM   3036  N  N   . VAL B 1 112 ? 10.064  94.892  71.519  1.00 26.85  ? 90   VAL B N   1 
ATOM   3037  C  CA  . VAL B 1 112 ? 10.413  95.277  70.161  1.00 29.67  ? 90   VAL B CA  1 
ATOM   3038  C  C   . VAL B 1 112 ? 11.882  95.674  69.983  1.00 33.33  ? 90   VAL B C   1 
ATOM   3039  O  O   . VAL B 1 112 ? 12.460  96.375  70.810  1.00 37.18  ? 90   VAL B O   1 
ATOM   3040  C  CB  . VAL B 1 112 ? 9.512   96.427  69.687  1.00 20.47  ? 90   VAL B CB  1 
ATOM   3041  C  CG1 . VAL B 1 112 ? 9.675   96.634  68.187  1.00 22.76  ? 90   VAL B CG1 1 
ATOM   3042  C  CG2 . VAL B 1 112 ? 8.067   96.114  70.016  1.00 20.64  ? 90   VAL B CG2 1 
ATOM   3043  N  N   . ARG B 1 113 ? 12.470  95.226  68.880  1.00 31.50  ? 91   ARG B N   1 
ATOM   3044  C  CA  . ARG B 1 113 ? 13.858  95.501  68.573  1.00 31.45  ? 91   ARG B CA  1 
ATOM   3045  C  C   . ARG B 1 113 ? 14.007  96.876  67.936  1.00 35.34  ? 91   ARG B C   1 
ATOM   3046  O  O   . ARG B 1 113 ? 13.261  97.225  67.015  1.00 36.75  ? 91   ARG B O   1 
ATOM   3047  C  CB  . ARG B 1 113 ? 14.397  94.435  67.615  1.00 29.37  ? 91   ARG B CB  1 
ATOM   3048  C  CG  . ARG B 1 113 ? 15.886  94.506  67.377  1.00 30.98  ? 91   ARG B CG  1 
ATOM   3049  C  CD  . ARG B 1 113 ? 16.239  93.916  66.036  1.00 31.90  ? 91   ARG B CD  1 
ATOM   3050  N  NE  . ARG B 1 113 ? 15.749  92.550  65.878  1.00 42.31  ? 91   ARG B NE  1 
ATOM   3051  C  CZ  . ARG B 1 113 ? 15.291  92.052  64.732  1.00 36.59  ? 91   ARG B CZ  1 
ATOM   3052  N  NH1 . ARG B 1 113 ? 15.258  92.807  63.640  1.00 29.31  ? 91   ARG B NH1 1 
ATOM   3053  N  NH2 . ARG B 1 113 ? 14.852  90.801  64.682  1.00 32.89  ? 91   ARG B NH2 1 
ATOM   3054  N  N   . ILE B 1 114 ? 14.958  97.655  68.451  1.00 35.86  ? 92   ILE B N   1 
ATOM   3055  C  CA  . ILE B 1 114 ? 15.258  98.988  67.933  1.00 35.66  ? 92   ILE B CA  1 
ATOM   3056  C  C   . ILE B 1 114 ? 16.240  98.726  66.790  1.00 27.67  ? 92   ILE B C   1 
ATOM   3057  O  O   . ILE B 1 114 ? 17.266  98.090  66.995  1.00 27.99  ? 92   ILE B O   1 
ATOM   3058  C  CB  . ILE B 1 114 ? 15.924  99.860  69.016  1.00 38.98  ? 92   ILE B CB  1 
ATOM   3059  C  CG1 . ILE B 1 114 ? 15.013  99.947  70.240  1.00 39.61  ? 92   ILE B CG1 1 
ATOM   3060  C  CG2 . ILE B 1 114 ? 16.215  101.241 68.465  1.00 40.30  ? 92   ILE B CG2 1 
ATOM   3061  C  CD1 . ILE B 1 114 ? 13.657  100.563 69.951  1.00 45.24  ? 92   ILE B CD1 1 
ATOM   3062  N  N   . ASN B 1 115 ? 15.938  99.211  65.595  1.00 21.43  ? 93   ASN B N   1 
ATOM   3063  C  CA  . ASN B 1 115 ? 16.810  98.917  64.459  1.00 30.11  ? 93   ASN B CA  1 
ATOM   3064  C  C   . ASN B 1 115 ? 17.695  100.031 63.917  1.00 32.16  ? 93   ASN B C   1 
ATOM   3065  O  O   . ASN B 1 115 ? 18.754  99.758  63.354  1.00 31.59  ? 93   ASN B O   1 
ATOM   3066  C  CB  . ASN B 1 115 ? 15.978  98.311  63.314  1.00 17.45  ? 93   ASN B CB  1 
ATOM   3067  C  CG  . ASN B 1 115 ? 15.249  97.028  63.741  1.00 27.24  ? 93   ASN B CG  1 
ATOM   3068  O  OD1 . ASN B 1 115 ? 15.867  95.987  64.022  1.00 19.10  ? 93   ASN B OD1 1 
ATOM   3069  N  ND2 . ASN B 1 115 ? 13.933  97.107  63.810  1.00 12.01  ? 93   ASN B ND2 1 
ATOM   3070  N  N   . LYS B 1 116 ? 17.284  101.282 64.093  1.00 34.51  ? 94   LYS B N   1 
ATOM   3071  C  CA  . LYS B 1 116 ? 18.079  102.388 63.589  1.00 33.30  ? 94   LYS B CA  1 
ATOM   3072  C  C   . LYS B 1 116 ? 18.889  103.162 64.632  1.00 37.19  ? 94   LYS B C   1 
ATOM   3073  O  O   . LYS B 1 116 ? 20.132  103.218 64.546  1.00 32.51  ? 94   LYS B O   1 
ATOM   3074  C  CB  . LYS B 1 116 ? 17.174  103.338 62.813  1.00 38.27  ? 94   LYS B CB  1 
ATOM   3075  C  CG  . LYS B 1 116 ? 16.507  102.684 61.612  1.00 27.89  ? 94   LYS B CG  1 
ATOM   3076  C  CD  . LYS B 1 116 ? 15.520  103.642 60.976  1.00 44.14  ? 94   LYS B CD  1 
ATOM   3077  C  CE  . LYS B 1 116 ? 14.732  102.975 59.863  1.00 41.68  ? 94   LYS B CE  1 
ATOM   3078  N  NZ  . LYS B 1 116 ? 13.733  103.907 59.274  1.00 33.78  ? 94   LYS B NZ  1 
ATOM   3079  N  N   . ILE B 1 117 ? 18.195  103.754 65.607  1.00 33.62  ? 95   ILE B N   1 
ATOM   3080  C  CA  . ILE B 1 117 ? 18.847  104.542 66.665  1.00 32.05  ? 95   ILE B CA  1 
ATOM   3081  C  C   . ILE B 1 117 ? 20.114  103.924 67.273  1.00 34.54  ? 95   ILE B C   1 
ATOM   3082  O  O   . ILE B 1 117 ? 21.152  104.582 67.355  1.00 32.53  ? 95   ILE B O   1 
ATOM   3083  C  CB  . ILE B 1 117 ? 17.856  104.848 67.804  1.00 27.33  ? 95   ILE B CB  1 
ATOM   3084  C  CG1 . ILE B 1 117 ? 16.737  105.748 67.274  1.00 18.73  ? 95   ILE B CG1 1 
ATOM   3085  C  CG2 . ILE B 1 117 ? 18.582  105.490 68.974  1.00 13.97  ? 95   ILE B CG2 1 
ATOM   3086  C  CD1 . ILE B 1 117 ? 15.620  105.957 68.251  1.00 28.55  ? 95   ILE B CD1 1 
ATOM   3087  N  N   . GLY B 1 118 ? 20.027  102.665 67.691  1.00 40.24  ? 96   GLY B N   1 
ATOM   3088  C  CA  . GLY B 1 118 ? 21.171  102.004 68.296  1.00 42.44  ? 96   GLY B CA  1 
ATOM   3089  C  C   . GLY B 1 118 ? 22.358  101.924 67.365  1.00 42.02  ? 96   GLY B C   1 
ATOM   3090  O  O   . GLY B 1 118 ? 23.481  102.239 67.753  1.00 42.32  ? 96   GLY B O   1 
ATOM   3091  N  N   . LYS B 1 119 ? 22.110  101.497 66.132  1.00 45.14  ? 97   LYS B N   1 
ATOM   3092  C  CA  . LYS B 1 119 ? 23.164  101.367 65.124  1.00 42.73  ? 97   LYS B CA  1 
ATOM   3093  C  C   . LYS B 1 119 ? 23.771  102.732 64.799  1.00 41.33  ? 97   LYS B C   1 
ATOM   3094  O  O   . LYS B 1 119 ? 24.983  102.862 64.618  1.00 34.20  ? 97   LYS B O   1 
ATOM   3095  C  CB  . LYS B 1 119 ? 22.590  100.746 63.846  1.00 41.90  ? 97   LYS B CB  1 
ATOM   3096  C  CG  . LYS B 1 119 ? 21.906  99.389  64.038  1.00 42.18  ? 97   LYS B CG  1 
ATOM   3097  C  CD  . LYS B 1 119 ? 22.890  98.309  64.465  1.00 35.90  ? 97   LYS B CD  1 
ATOM   3098  C  CE  . LYS B 1 119 ? 22.292  96.917  64.316  1.00 41.75  ? 97   LYS B CE  1 
ATOM   3099  N  NZ  . LYS B 1 119 ? 23.254  95.855  64.716  1.00 32.83  ? 97   LYS B NZ  1 
ATOM   3100  N  N   . LYS B 1 120 ? 22.906  103.741 64.729  1.00 41.56  ? 98   LYS B N   1 
ATOM   3101  C  CA  . LYS B 1 120 ? 23.311  105.111 64.447  1.00 42.69  ? 98   LYS B CA  1 
ATOM   3102  C  C   . LYS B 1 120 ? 24.275  105.684 65.496  1.00 45.34  ? 98   LYS B C   1 
ATOM   3103  O  O   . LYS B 1 120 ? 24.922  106.704 65.252  1.00 49.95  ? 98   LYS B O   1 
ATOM   3104  C  CB  . LYS B 1 120 ? 22.066  106.003 64.343  1.00 43.33  ? 98   LYS B CB  1 
ATOM   3105  C  CG  . LYS B 1 120 ? 22.351  107.495 64.246  1.00 45.51  ? 98   LYS B CG  1 
ATOM   3106  C  CD  . LYS B 1 120 ? 21.070  108.291 64.065  1.00 46.26  ? 98   LYS B CD  1 
ATOM   3107  C  CE  . LYS B 1 120 ? 21.329  109.790 64.188  1.00 52.92  ? 98   LYS B CE  1 
ATOM   3108  N  NZ  . LYS B 1 120 ? 20.117  110.606 63.880  1.00 49.32  ? 98   LYS B NZ  1 
ATOM   3109  N  N   . PHE B 1 121 ? 24.367  105.036 66.659  1.00 45.70  ? 99   PHE B N   1 
ATOM   3110  C  CA  . PHE B 1 121 ? 25.262  105.486 67.729  1.00 39.09  ? 99   PHE B CA  1 
ATOM   3111  C  C   . PHE B 1 121 ? 26.412  104.533 68.031  1.00 39.45  ? 99   PHE B C   1 
ATOM   3112  O  O   . PHE B 1 121 ? 27.044  104.648 69.076  1.00 38.22  ? 99   PHE B O   1 
ATOM   3113  C  CB  . PHE B 1 121 ? 24.489  105.730 69.028  1.00 35.93  ? 99   PHE B CB  1 
ATOM   3114  C  CG  . PHE B 1 121 ? 23.678  106.990 69.025  1.00 34.47  ? 99   PHE B CG  1 
ATOM   3115  C  CD1 . PHE B 1 121 ? 22.425  107.033 68.431  1.00 23.10  ? 99   PHE B CD1 1 
ATOM   3116  C  CD2 . PHE B 1 121 ? 24.180  108.146 69.608  1.00 36.09  ? 99   PHE B CD2 1 
ATOM   3117  C  CE1 . PHE B 1 121 ? 21.682  108.211 68.419  1.00 31.20  ? 99   PHE B CE1 1 
ATOM   3118  C  CE2 . PHE B 1 121 ? 23.448  109.327 69.603  1.00 34.57  ? 99   PHE B CE2 1 
ATOM   3119  C  CZ  . PHE B 1 121 ? 22.196  109.361 69.007  1.00 35.04  ? 99   PHE B CZ  1 
ATOM   3120  N  N   . GLY B 1 122 ? 26.672  103.585 67.137  1.00 40.10  ? 100  GLY B N   1 
ATOM   3121  C  CA  . GLY B 1 122 ? 27.773  102.657 67.352  1.00 39.07  ? 100  GLY B CA  1 
ATOM   3122  C  C   . GLY B 1 122 ? 27.511  101.466 68.254  1.00 35.43  ? 100  GLY B C   1 
ATOM   3123  O  O   . GLY B 1 122 ? 28.417  100.682 68.529  1.00 32.26  ? 100  GLY B O   1 
ATOM   3124  N  N   . LEU B 1 123 ? 26.277  101.323 68.719  1.00 34.91  ? 101  LEU B N   1 
ATOM   3125  C  CA  . LEU B 1 123 ? 25.918  100.203 69.580  1.00 27.68  ? 101  LEU B CA  1 
ATOM   3126  C  C   . LEU B 1 123 ? 26.164  98.883  68.837  1.00 30.98  ? 101  LEU B C   1 
ATOM   3127  O  O   . LEU B 1 123 ? 25.690  98.695  67.720  1.00 32.06  ? 101  LEU B O   1 
ATOM   3128  C  CB  . LEU B 1 123 ? 24.447  100.316 69.980  1.00 21.50  ? 101  LEU B CB  1 
ATOM   3129  C  CG  . LEU B 1 123 ? 24.112  100.457 71.456  1.00 22.73  ? 101  LEU B CG  1 
ATOM   3130  C  CD1 . LEU B 1 123 ? 25.100  101.376 72.141  1.00 28.03  ? 101  LEU B CD1 1 
ATOM   3131  C  CD2 . LEU B 1 123 ? 22.705  100.987 71.585  1.00 25.94  ? 101  LEU B CD2 1 
ATOM   3132  N  N   . LYS B 1 124 ? 26.911  97.975  69.458  1.00 32.76  ? 102  LYS B N   1 
ATOM   3133  C  CA  . LYS B 1 124 ? 27.220  96.672  68.863  1.00 29.89  ? 102  LYS B CA  1 
ATOM   3134  C  C   . LYS B 1 124 ? 26.219  95.592  69.325  1.00 30.89  ? 102  LYS B C   1 
ATOM   3135  O  O   . LYS B 1 124 ? 26.056  94.560  68.674  1.00 31.16  ? 102  LYS B O   1 
ATOM   3136  C  CB  . LYS B 1 124 ? 28.637  96.239  69.271  1.00 31.43  ? 102  LYS B CB  1 
ATOM   3137  C  CG  . LYS B 1 124 ? 29.728  97.221  68.891  1.00 39.95  ? 102  LYS B CG  1 
ATOM   3138  C  CD  . LYS B 1 124 ? 31.043  96.925  69.609  1.00 49.04  ? 102  LYS B CD  1 
ATOM   3139  C  CE  . LYS B 1 124 ? 32.122  97.952  69.224  1.00 54.93  ? 102  LYS B CE  1 
ATOM   3140  N  NZ  . LYS B 1 124 ? 33.386  97.829  70.020  1.00 52.42  ? 102  LYS B NZ  1 
ATOM   3141  N  N   . CYS B 1 125 ? 25.548  95.852  70.441  1.00 28.67  ? 103  CYS B N   1 
ATOM   3142  C  CA  . CYS B 1 125 ? 24.608  94.914  71.044  1.00 35.93  ? 103  CYS B CA  1 
ATOM   3143  C  C   . CYS B 1 125 ? 23.227  95.011  70.419  1.00 43.06  ? 103  CYS B C   1 
ATOM   3144  O  O   . CYS B 1 125 ? 22.996  95.849  69.547  1.00 46.41  ? 103  CYS B O   1 
ATOM   3145  C  CB  . CYS B 1 125 ? 24.476  95.218  72.541  1.00 34.68  ? 103  CYS B CB  1 
ATOM   3146  S  SG  . CYS B 1 125 ? 23.717  96.875  72.849  1.00 34.29  ? 103  CYS B SG  1 
ATOM   3147  N  N   . GLU B 1 126 ? 22.315  94.144  70.870  1.00 42.15  ? 104  GLU B N   1 
ATOM   3148  C  CA  . GLU B 1 126 ? 20.937  94.183  70.393  1.00 37.66  ? 104  GLU B CA  1 
ATOM   3149  C  C   . GLU B 1 126 ? 20.195  95.038  71.401  1.00 33.17  ? 104  GLU B C   1 
ATOM   3150  O  O   . GLU B 1 126 ? 20.281  94.790  72.600  1.00 25.69  ? 104  GLU B O   1 
ATOM   3151  C  CB  . GLU B 1 126 ? 20.301  92.787  70.340  1.00 36.86  ? 104  GLU B CB  1 
ATOM   3152  C  CG  . GLU B 1 126 ? 18.781  92.834  70.130  1.00 33.85  ? 104  GLU B CG  1 
ATOM   3153  C  CD  . GLU B 1 126 ? 18.159  91.466  69.894  1.00 45.08  ? 104  GLU B CD  1 
ATOM   3154  O  OE1 . GLU B 1 126 ? 18.661  90.469  70.459  1.00 44.24  ? 104  GLU B OE1 1 
ATOM   3155  O  OE2 . GLU B 1 126 ? 17.152  91.385  69.150  1.00 50.78  ? 104  GLU B OE2 1 
ATOM   3156  N  N   . LEU B 1 127 ? 19.478  96.045  70.907  1.00 29.67  ? 105  LEU B N   1 
ATOM   3157  C  CA  . LEU B 1 127 ? 18.738  96.967  71.763  1.00 26.34  ? 105  LEU B CA  1 
ATOM   3158  C  C   . LEU B 1 127 ? 17.276  96.616  71.690  1.00 28.86  ? 105  LEU B C   1 
ATOM   3159  O  O   . LEU B 1 127 ? 16.683  96.689  70.615  1.00 34.77  ? 105  LEU B O   1 
ATOM   3160  C  CB  . LEU B 1 127 ? 18.927  98.397  71.266  1.00 22.54  ? 105  LEU B CB  1 
ATOM   3161  C  CG  . LEU B 1 127 ? 19.288  99.525  72.242  1.00 25.53  ? 105  LEU B CG  1 
ATOM   3162  C  CD1 . LEU B 1 127 ? 18.731  100.828 71.686  1.00 20.31  ? 105  LEU B CD1 1 
ATOM   3163  C  CD2 . LEU B 1 127 ? 18.732  99.252  73.649  1.00 11.62  ? 105  LEU B CD2 1 
ATOM   3164  N  N   . LEU B 1 128 ? 16.686  96.239  72.820  1.00 26.89  ? 106  LEU B N   1 
ATOM   3165  C  CA  . LEU B 1 128 ? 15.270  95.869  72.827  1.00 22.67  ? 106  LEU B CA  1 
ATOM   3166  C  C   . LEU B 1 128 ? 14.450  96.842  73.643  1.00 22.31  ? 106  LEU B C   1 
ATOM   3167  O  O   . LEU B 1 128 ? 14.942  97.409  74.609  1.00 25.25  ? 106  LEU B O   1 
ATOM   3168  C  CB  . LEU B 1 128 ? 15.079  94.449  73.364  1.00 13.56  ? 106  LEU B CB  1 
ATOM   3169  C  CG  . LEU B 1 128 ? 15.834  93.347  72.619  1.00 21.51  ? 106  LEU B CG  1 
ATOM   3170  C  CD1 . LEU B 1 128 ? 15.586  92.016  73.314  1.00 29.70  ? 106  LEU B CD1 1 
ATOM   3171  C  CD2 . LEU B 1 128 ? 15.411  93.300  71.166  1.00 11.85  ? 106  LEU B CD2 1 
ATOM   3172  N  N   . ALA B 1 129 ? 13.196  97.039  73.240  1.00 23.07  ? 107  ALA B N   1 
ATOM   3173  C  CA  . ALA B 1 129 ? 12.312  97.957  73.932  1.00 21.91  ? 107  ALA B CA  1 
ATOM   3174  C  C   . ALA B 1 129 ? 11.085  97.259  74.486  1.00 21.33  ? 107  ALA B C   1 
ATOM   3175  O  O   . ALA B 1 129 ? 10.390  96.572  73.746  1.00 16.98  ? 107  ALA B O   1 
ATOM   3176  C  CB  . ALA B 1 129 ? 11.885  99.081  72.988  1.00 21.67  ? 107  ALA B CB  1 
ATOM   3177  N  N   . LYS B 1 130 ? 10.851  97.432  75.794  1.00 24.35  ? 108  LYS B N   1 
ATOM   3178  C  CA  . LYS B 1 130 ? 9.679   96.891  76.502  1.00 18.87  ? 108  LYS B CA  1 
ATOM   3179  C  C   . LYS B 1 130 ? 8.667   98.004  76.310  1.00 22.31  ? 108  LYS B C   1 
ATOM   3180  O  O   . LYS B 1 130 ? 8.730   99.013  77.007  1.00 23.43  ? 108  LYS B O   1 
ATOM   3181  C  CB  . LYS B 1 130 ? 9.962   96.765  78.001  1.00 23.14  ? 108  LYS B CB  1 
ATOM   3182  C  CG  . LYS B 1 130 ? 9.747   95.385  78.588  1.00 20.16  ? 108  LYS B CG  1 
ATOM   3183  C  CD  . LYS B 1 130 ? 8.304   94.925  78.546  1.00 4.72   ? 108  LYS B CD  1 
ATOM   3184  C  CE  . LYS B 1 130 ? 8.277   93.407  78.594  1.00 12.39  ? 108  LYS B CE  1 
ATOM   3185  N  NZ  . LYS B 1 130 ? 6.927   92.788  78.639  1.00 6.12   ? 108  LYS B NZ  1 
ATOM   3186  N  N   . CYS B 1 131 ? 7.742   97.850  75.376  1.00 21.50  ? 109  CYS B N   1 
ATOM   3187  C  CA  . CYS B 1 131 ? 6.785   98.926  75.123  1.00 22.72  ? 109  CYS B CA  1 
ATOM   3188  C  C   . CYS B 1 131 ? 5.593   98.873  76.037  1.00 26.60  ? 109  CYS B C   1 
ATOM   3189  O  O   . CYS B 1 131 ? 4.590   98.225  75.731  1.00 40.55  ? 109  CYS B O   1 
ATOM   3190  C  CB  . CYS B 1 131 ? 6.347   98.868  73.662  1.00 22.36  ? 109  CYS B CB  1 
ATOM   3191  S  SG  . CYS B 1 131 ? 7.789   98.809  72.556  1.00 39.04  ? 109  CYS B SG  1 
ATOM   3192  N  N   . GLU B 1 132 ? 5.693   99.567  77.163  1.00 28.09  ? 110  GLU B N   1 
ATOM   3193  C  CA  . GLU B 1 132 ? 4.610   99.566  78.137  1.00 22.79  ? 110  GLU B CA  1 
ATOM   3194  C  C   . GLU B 1 132 ? 3.479   100.473 77.724  1.00 26.47  ? 110  GLU B C   1 
ATOM   3195  O  O   . GLU B 1 132 ? 2.446   100.503 78.389  1.00 29.07  ? 110  GLU B O   1 
ATOM   3196  C  CB  . GLU B 1 132 ? 5.122   99.984  79.510  1.00 29.73  ? 110  GLU B CB  1 
ATOM   3197  C  CG  . GLU B 1 132 ? 4.670   99.067  80.645  1.00 30.38  ? 110  GLU B CG  1 
ATOM   3198  C  CD  . GLU B 1 132 ? 5.282   97.680  80.547  1.00 31.96  ? 110  GLU B CD  1 
ATOM   3199  O  OE1 . GLU B 1 132 ? 6.440   97.571  80.105  1.00 15.84  ? 110  GLU B OE1 1 
ATOM   3200  O  OE2 . GLU B 1 132 ? 4.614   96.700  80.922  1.00 35.14  ? 110  GLU B OE2 1 
ATOM   3201  N  N   . PHE B 1 133 ? 3.657   101.216 76.629  1.00 29.08  ? 111  PHE B N   1 
ATOM   3202  C  CA  . PHE B 1 133 ? 2.589   102.106 76.176  1.00 26.90  ? 111  PHE B CA  1 
ATOM   3203  C  C   . PHE B 1 133 ? 1.443   101.343 75.536  1.00 26.99  ? 111  PHE B C   1 
ATOM   3204  O  O   . PHE B 1 133 ? 0.478   101.940 75.072  1.00 28.05  ? 111  PHE B O   1 
ATOM   3205  C  CB  . PHE B 1 133 ? 3.118   103.209 75.230  1.00 27.18  ? 111  PHE B CB  1 
ATOM   3206  C  CG  . PHE B 1 133 ? 3.958   102.713 74.091  1.00 17.45  ? 111  PHE B CG  1 
ATOM   3207  C  CD1 . PHE B 1 133 ? 3.396   102.448 72.856  1.00 9.57   ? 111  PHE B CD1 1 
ATOM   3208  C  CD2 . PHE B 1 133 ? 5.326   102.516 74.259  1.00 27.40  ? 111  PHE B CD2 1 
ATOM   3209  C  CE1 . PHE B 1 133 ? 4.176   101.994 71.813  1.00 17.61  ? 111  PHE B CE1 1 
ATOM   3210  C  CE2 . PHE B 1 133 ? 6.123   102.060 73.215  1.00 18.71  ? 111  PHE B CE2 1 
ATOM   3211  C  CZ  . PHE B 1 133 ? 5.547   101.797 71.991  1.00 22.88  ? 111  PHE B CZ  1 
ATOM   3212  N  N   . PHE B 1 134 ? 1.545   100.013 75.530  1.00 28.63  ? 112  PHE B N   1 
ATOM   3213  C  CA  . PHE B 1 134 ? 0.489   99.177  74.968  1.00 26.31  ? 112  PHE B CA  1 
ATOM   3214  C  C   . PHE B 1 134 ? -0.511  98.692  76.028  1.00 28.81  ? 112  PHE B C   1 
ATOM   3215  O  O   . PHE B 1 134 ? -1.473  97.993  75.699  1.00 34.25  ? 112  PHE B O   1 
ATOM   3216  C  CB  . PHE B 1 134 ? 1.079   97.970  74.232  1.00 26.39  ? 112  PHE B CB  1 
ATOM   3217  C  CG  . PHE B 1 134 ? 1.609   98.284  72.851  1.00 30.59  ? 112  PHE B CG  1 
ATOM   3218  C  CD1 . PHE B 1 134 ? 2.968   98.514  72.641  1.00 34.67  ? 112  PHE B CD1 1 
ATOM   3219  C  CD2 . PHE B 1 134 ? 0.750   98.339  71.758  1.00 34.03  ? 112  PHE B CD2 1 
ATOM   3220  C  CE1 . PHE B 1 134 ? 3.455   98.787  71.369  1.00 28.41  ? 112  PHE B CE1 1 
ATOM   3221  C  CE2 . PHE B 1 134 ? 1.229   98.616  70.484  1.00 34.22  ? 112  PHE B CE2 1 
ATOM   3222  C  CZ  . PHE B 1 134 ? 2.586   98.839  70.291  1.00 33.59  ? 112  PHE B CZ  1 
ATOM   3223  N  N   . ASN B 1 135 ? -0.283  99.036  77.297  1.00 26.49  ? 113  ASN B N   1 
ATOM   3224  C  CA  . ASN B 1 135 ? -1.220  98.634  78.347  1.00 22.81  ? 113  ASN B CA  1 
ATOM   3225  C  C   . ASN B 1 135 ? -2.541  99.371  78.079  1.00 19.21  ? 113  ASN B C   1 
ATOM   3226  O  O   . ASN B 1 135 ? -2.544  100.451 77.479  1.00 16.33  ? 113  ASN B O   1 
ATOM   3227  C  CB  . ASN B 1 135 ? -0.689  98.985  79.744  1.00 14.97  ? 113  ASN B CB  1 
ATOM   3228  C  CG  . ASN B 1 135 ? 0.380   98.028  80.230  1.00 17.38  ? 113  ASN B CG  1 
ATOM   3229  O  OD1 . ASN B 1 135 ? 0.232   96.812  80.114  1.00 27.05  ? 113  ASN B OD1 1 
ATOM   3230  N  ND2 . ASN B 1 135 ? 1.457   98.572  80.802  1.00 12.17  ? 113  ASN B ND2 1 
ATOM   3231  N  N   . ALA B 1 136 ? -3.650  98.794  78.536  1.00 15.51  ? 114  ALA B N   1 
ATOM   3232  C  CA  . ALA B 1 136 ? -4.980  99.359  78.307  1.00 15.16  ? 114  ALA B CA  1 
ATOM   3233  C  C   . ALA B 1 136 ? -5.096  100.866 78.409  1.00 17.70  ? 114  ALA B C   1 
ATOM   3234  O  O   . ALA B 1 136 ? -5.748  101.507 77.580  1.00 21.60  ? 114  ALA B O   1 
ATOM   3235  C  CB  . ALA B 1 136 ? -5.950  98.734  79.217  1.00 11.09  ? 114  ALA B CB  1 
ATOM   3236  N  N   . GLY B 1 137 ? -4.468  101.434 79.427  1.00 23.18  ? 115  GLY B N   1 
ATOM   3237  C  CA  . GLY B 1 137 ? -4.513  102.877 79.613  1.00 23.11  ? 115  GLY B CA  1 
ATOM   3238  C  C   . GLY B 1 137 ? -3.366  103.656 78.991  1.00 23.86  ? 115  GLY B C   1 
ATOM   3239  O  O   . GLY B 1 137 ? -3.331  104.889 79.078  1.00 28.56  ? 115  GLY B O   1 
ATOM   3240  N  N   . GLY B 1 138 ? -2.412  102.949 78.390  1.00 25.14  ? 116  GLY B N   1 
ATOM   3241  C  CA  . GLY B 1 138 ? -1.297  103.622 77.746  1.00 25.98  ? 116  GLY B CA  1 
ATOM   3242  C  C   . GLY B 1 138 ? -0.027  103.842 78.545  1.00 30.20  ? 116  GLY B C   1 
ATOM   3243  O  O   . GLY B 1 138 ? 0.886   104.526 78.068  1.00 33.80  ? 116  GLY B O   1 
ATOM   3244  N  N   . SER B 1 139 ? 0.059   103.277 79.748  1.00 29.30  ? 117  SER B N   1 
ATOM   3245  C  CA  . SER B 1 139 ? 1.271   103.457 80.545  1.00 28.97  ? 117  SER B CA  1 
ATOM   3246  C  C   . SER B 1 139 ? 1.653   102.240 81.370  1.00 21.92  ? 117  SER B C   1 
ATOM   3247  O  O   . SER B 1 139 ? 0.866   101.322 81.550  1.00 21.78  ? 117  SER B O   1 
ATOM   3248  C  CB  . SER B 1 139 ? 1.123   104.665 81.472  1.00 32.41  ? 117  SER B CB  1 
ATOM   3249  O  OG  . SER B 1 139 ? 0.196   104.406 82.520  1.00 39.22  ? 117  SER B OG  1 
ATOM   3250  N  N   . VAL B 1 140 ? 2.878   102.251 81.873  1.00 22.50  ? 118  VAL B N   1 
ATOM   3251  C  CA  . VAL B 1 140 ? 3.386   101.166 82.695  1.00 22.15  ? 118  VAL B CA  1 
ATOM   3252  C  C   . VAL B 1 140 ? 2.671   101.177 84.035  1.00 23.28  ? 118  VAL B C   1 
ATOM   3253  O  O   . VAL B 1 140 ? 2.693   100.188 84.772  1.00 19.97  ? 118  VAL B O   1 
ATOM   3254  C  CB  . VAL B 1 140 ? 4.912   101.318 82.922  1.00 22.33  ? 118  VAL B CB  1 
ATOM   3255  C  CG1 . VAL B 1 140 ? 5.215   102.688 83.519  1.00 23.66  ? 118  VAL B CG1 1 
ATOM   3256  C  CG2 . VAL B 1 140 ? 5.430   100.210 83.833  1.00 13.46  ? 118  VAL B CG2 1 
ATOM   3257  N  N   . LYS B 1 141 ? 2.006   102.290 84.332  1.00 25.40  ? 119  LYS B N   1 
ATOM   3258  C  CA  . LYS B 1 141 ? 1.292   102.456 85.599  1.00 30.37  ? 119  LYS B CA  1 
ATOM   3259  C  C   . LYS B 1 141 ? 0.046   101.599 85.705  1.00 29.74  ? 119  LYS B C   1 
ATOM   3260  O  O   . LYS B 1 141 ? -0.447  101.340 86.811  1.00 36.47  ? 119  LYS B O   1 
ATOM   3261  C  CB  . LYS B 1 141 ? 0.911   103.935 85.814  1.00 32.07  ? 119  LYS B CB  1 
ATOM   3262  C  CG  . LYS B 1 141 ? 2.097   104.857 86.083  1.00 20.94  ? 119  LYS B CG  1 
ATOM   3263  C  CD  . LYS B 1 141 ? 2.792   104.452 87.367  1.00 27.10  ? 119  LYS B CD  1 
ATOM   3264  C  CE  . LYS B 1 141 ? 3.859   105.453 87.733  1.00 31.21  ? 119  LYS B CE  1 
ATOM   3265  N  NZ  . LYS B 1 141 ? 4.954   105.383 86.742  1.00 23.07  ? 119  LYS B NZ  1 
ATOM   3266  N  N   . ASP B 1 142 ? -0.474  101.166 84.563  1.00 23.00  ? 120  ASP B N   1 
ATOM   3267  C  CA  . ASP B 1 142 ? -1.672  100.339 84.571  1.00 22.71  ? 120  ASP B CA  1 
ATOM   3268  C  C   . ASP B 1 142 ? -1.416  99.058  85.344  1.00 19.18  ? 120  ASP B C   1 
ATOM   3269  O  O   . ASP B 1 142 ? -2.329  98.497  85.937  1.00 27.84  ? 120  ASP B O   1 
ATOM   3270  C  CB  . ASP B 1 142 ? -2.108  100.038 83.143  1.00 28.31  ? 120  ASP B CB  1 
ATOM   3271  C  CG  . ASP B 1 142 ? -2.341  101.304 82.333  1.00 27.74  ? 120  ASP B CG  1 
ATOM   3272  O  OD1 . ASP B 1 142 ? -2.450  102.398 82.927  1.00 31.26  ? 120  ASP B OD1 1 
ATOM   3273  O  OD2 . ASP B 1 142 ? -2.421  101.205 81.099  1.00 37.42  ? 120  ASP B OD2 1 
ATOM   3274  N  N   . ARG B 1 143 ? -0.164  98.612  85.348  1.00 23.52  ? 121  ARG B N   1 
ATOM   3275  C  CA  . ARG B 1 143 ? 0.215   97.414  86.082  1.00 29.25  ? 121  ARG B CA  1 
ATOM   3276  C  C   . ARG B 1 143 ? 0.077   97.664  87.582  1.00 31.60  ? 121  ARG B C   1 
ATOM   3277  O  O   . ARG B 1 143 ? -0.694  96.986  88.249  1.00 39.08  ? 121  ARG B O   1 
ATOM   3278  C  CB  . ARG B 1 143 ? 1.670   97.012  85.796  1.00 32.67  ? 121  ARG B CB  1 
ATOM   3279  C  CG  . ARG B 1 143 ? 1.959   96.313  84.460  1.00 37.62  ? 121  ARG B CG  1 
ATOM   3280  C  CD  . ARG B 1 143 ? 3.470   96.038  84.364  1.00 32.04  ? 121  ARG B CD  1 
ATOM   3281  N  NE  . ARG B 1 143 ? 3.918   95.588  83.050  1.00 34.99  ? 121  ARG B NE  1 
ATOM   3282  C  CZ  . ARG B 1 143 ? 3.998   94.315  82.676  1.00 30.80  ? 121  ARG B CZ  1 
ATOM   3283  N  NH1 . ARG B 1 143 ? 3.655   93.356  83.518  1.00 26.19  ? 121  ARG B NH1 1 
ATOM   3284  N  NH2 . ARG B 1 143 ? 4.437   94.000  81.466  1.00 21.90  ? 121  ARG B NH2 1 
ATOM   3285  N  N   . ILE B 1 144 ? 0.809   98.642  88.115  1.00 34.45  ? 122  ILE B N   1 
ATOM   3286  C  CA  . ILE B 1 144 ? 0.754   98.908  89.550  1.00 32.21  ? 122  ILE B CA  1 
ATOM   3287  C  C   . ILE B 1 144 ? -0.627  99.322  90.038  1.00 31.78  ? 122  ILE B C   1 
ATOM   3288  O  O   . ILE B 1 144 ? -0.976  99.057  91.182  1.00 39.85  ? 122  ILE B O   1 
ATOM   3289  C  CB  . ILE B 1 144 ? 1.825   99.973  90.020  1.00 36.13  ? 122  ILE B CB  1 
ATOM   3290  C  CG1 . ILE B 1 144 ? 1.451   101.384 89.562  1.00 37.64  ? 122  ILE B CG1 1 
ATOM   3291  C  CG2 . ILE B 1 144 ? 3.211   99.599  89.484  1.00 27.37  ? 122  ILE B CG2 1 
ATOM   3292  C  CD1 . ILE B 1 144 ? 2.257   102.472 90.262  1.00 32.61  ? 122  ILE B CD1 1 
ATOM   3293  N  N   . SER B 1 145 ? -1.422  99.961  89.187  1.00 29.76  ? 123  SER B N   1 
ATOM   3294  C  CA  . SER B 1 145 ? -2.767  100.364 89.599  1.00 27.95  ? 123  SER B CA  1 
ATOM   3295  C  C   . SER B 1 145 ? -3.598  99.106  89.789  1.00 21.76  ? 123  SER B C   1 
ATOM   3296  O  O   . SER B 1 145 ? -4.188  98.892  90.842  1.00 26.32  ? 123  SER B O   1 
ATOM   3297  C  CB  . SER B 1 145 ? -3.424  101.240 88.532  1.00 37.09  ? 123  SER B CB  1 
ATOM   3298  O  OG  . SER B 1 145 ? -2.668  102.413 88.296  1.00 48.61  ? 123  SER B OG  1 
ATOM   3299  N  N   . LEU B 1 146 ? -3.641  98.274  88.759  1.00 9.31   ? 124  LEU B N   1 
ATOM   3300  C  CA  . LEU B 1 146 ? -4.386  97.041  88.844  1.00 14.76  ? 124  LEU B CA  1 
ATOM   3301  C  C   . LEU B 1 146 ? -3.892  96.190  90.043  1.00 22.84  ? 124  LEU B C   1 
ATOM   3302  O  O   . LEU B 1 146 ? -4.705  95.663  90.811  1.00 22.44  ? 124  LEU B O   1 
ATOM   3303  C  CB  . LEU B 1 146 ? -4.249  96.267  87.522  1.00 4.51   ? 124  LEU B CB  1 
ATOM   3304  C  CG  . LEU B 1 146 ? -4.839  94.855  87.544  1.00 8.41   ? 124  LEU B CG  1 
ATOM   3305  C  CD1 . LEU B 1 146 ? -6.322  94.927  87.832  1.00 2.61   ? 124  LEU B CD1 1 
ATOM   3306  C  CD2 . LEU B 1 146 ? -4.558  94.149  86.249  1.00 6.40   ? 124  LEU B CD2 1 
ATOM   3307  N  N   . ARG B 1 147 ? -2.567  96.076  90.203  1.00 20.27  ? 125  ARG B N   1 
ATOM   3308  C  CA  . ARG B 1 147 ? -1.977  95.292  91.286  1.00 22.27  ? 125  ARG B CA  1 
ATOM   3309  C  C   . ARG B 1 147 ? -2.236  95.839  92.686  1.00 28.81  ? 125  ARG B C   1 
ATOM   3310  O  O   . ARG B 1 147 ? -2.387  95.054  93.626  1.00 32.50  ? 125  ARG B O   1 
ATOM   3311  C  CB  . ARG B 1 147 ? -0.477  95.136  91.082  1.00 17.93  ? 125  ARG B CB  1 
ATOM   3312  C  CG  . ARG B 1 147 ? 0.208   94.230  92.105  1.00 20.42  ? 125  ARG B CG  1 
ATOM   3313  C  CD  . ARG B 1 147 ? -0.345  92.821  92.081  1.00 17.98  ? 125  ARG B CD  1 
ATOM   3314  N  NE  . ARG B 1 147 ? 0.271   91.944  93.083  1.00 22.87  ? 125  ARG B NE  1 
ATOM   3315  C  CZ  . ARG B 1 147 ? 1.410   91.277  92.917  1.00 27.46  ? 125  ARG B CZ  1 
ATOM   3316  N  NH1 . ARG B 1 147 ? 2.090   91.375  91.781  1.00 31.47  ? 125  ARG B NH1 1 
ATOM   3317  N  NH2 . ARG B 1 147 ? 1.867   90.492  93.882  1.00 25.49  ? 125  ARG B NH2 1 
ATOM   3318  N  N   . MET B 1 148 ? -2.270  97.166  92.838  1.00 25.09  ? 126  MET B N   1 
ATOM   3319  C  CA  . MET B 1 148 ? -2.551  97.752  94.154  1.00 23.94  ? 126  MET B CA  1 
ATOM   3320  C  C   . MET B 1 148 ? -4.025  97.561  94.464  1.00 16.06  ? 126  MET B C   1 
ATOM   3321  O  O   . MET B 1 148 ? -4.404  97.421  95.613  1.00 14.40  ? 126  MET B O   1 
ATOM   3322  C  CB  . MET B 1 148 ? -2.238  99.250  94.209  1.00 26.52  ? 126  MET B CB  1 
ATOM   3323  C  CG  . MET B 1 148 ? -0.800  99.606  94.521  1.00 22.49  ? 126  MET B CG  1 
ATOM   3324  S  SD  . MET B 1 148 ? -0.685  101.383 94.755  1.00 36.72  ? 126  MET B SD  1 
ATOM   3325  C  CE  . MET B 1 148 ? -0.833  101.967 93.081  1.00 28.54  ? 126  MET B CE  1 
ATOM   3326  N  N   . ILE B 1 149 ? -4.858  97.573  93.433  1.00 16.18  ? 127  ILE B N   1 
ATOM   3327  C  CA  . ILE B 1 149 ? -6.276  97.382  93.648  1.00 21.38  ? 127  ILE B CA  1 
ATOM   3328  C  C   . ILE B 1 149 ? -6.509  95.914  93.977  1.00 27.78  ? 127  ILE B C   1 
ATOM   3329  O  O   . ILE B 1 149 ? -7.197  95.591  94.950  1.00 37.34  ? 127  ILE B O   1 
ATOM   3330  C  CB  . ILE B 1 149 ? -7.120  97.784  92.412  1.00 12.68  ? 127  ILE B CB  1 
ATOM   3331  C  CG1 . ILE B 1 149 ? -7.221  99.320  92.310  1.00 12.87  ? 127  ILE B CG1 1 
ATOM   3332  C  CG2 . ILE B 1 149 ? -8.517  97.166  92.522  1.00 17.87  ? 127  ILE B CG2 1 
ATOM   3333  C  CD1 . ILE B 1 149 ? -8.081  99.810  91.137  1.00 16.90  ? 127  ILE B CD1 1 
ATOM   3334  N  N   . GLU B 1 150 ? -5.915  95.024  93.189  1.00 30.74  ? 128  GLU B N   1 
ATOM   3335  C  CA  . GLU B 1 150 ? -6.075  93.590  93.417  1.00 29.51  ? 128  GLU B CA  1 
ATOM   3336  C  C   . GLU B 1 150 ? -5.567  93.130  94.786  1.00 31.21  ? 128  GLU B C   1 
ATOM   3337  O  O   . GLU B 1 150 ? -6.218  92.334  95.470  1.00 29.28  ? 128  GLU B O   1 
ATOM   3338  C  CB  . GLU B 1 150 ? -5.387  92.793  92.302  1.00 27.48  ? 128  GLU B CB  1 
ATOM   3339  C  CG  . GLU B 1 150 ? -6.281  92.535  91.082  1.00 22.34  ? 128  GLU B CG  1 
ATOM   3340  C  CD  . GLU B 1 150 ? -5.530  91.910  89.900  1.00 29.61  ? 128  GLU B CD  1 
ATOM   3341  O  OE1 . GLU B 1 150 ? -6.207  91.388  88.985  1.00 28.84  ? 128  GLU B OE1 1 
ATOM   3342  O  OE2 . GLU B 1 150 ? -4.273  91.950  89.870  1.00 21.43  ? 128  GLU B OE2 1 
ATOM   3343  N  N   . ASP B 1 151 ? -4.412  93.630  95.197  1.00 35.93  ? 129  ASP B N   1 
ATOM   3344  C  CA  . ASP B 1 151 ? -3.867  93.247  96.491  1.00 36.97  ? 129  ASP B CA  1 
ATOM   3345  C  C   . ASP B 1 151 ? -4.742  93.711  97.647  1.00 38.07  ? 129  ASP B C   1 
ATOM   3346  O  O   . ASP B 1 151 ? -4.866  93.008  98.647  1.00 41.15  ? 129  ASP B O   1 
ATOM   3347  C  CB  . ASP B 1 151 ? -2.446  93.794  96.651  1.00 29.72  ? 129  ASP B CB  1 
ATOM   3348  C  CG  . ASP B 1 151 ? -1.423  92.929  95.963  1.00 30.06  ? 129  ASP B CG  1 
ATOM   3349  O  OD1 . ASP B 1 151 ? -0.247  93.331  95.879  1.00 40.71  ? 129  ASP B OD1 1 
ATOM   3350  O  OD2 . ASP B 1 151 ? -1.804  91.836  95.507  1.00 26.64  ? 129  ASP B OD2 1 
ATOM   3351  N  N   . ALA B 1 152 ? -5.353  94.887  97.496  1.00 38.73  ? 130  ALA B N   1 
ATOM   3352  C  CA  . ALA B 1 152 ? -6.216  95.449  98.529  1.00 32.14  ? 130  ALA B CA  1 
ATOM   3353  C  C   . ALA B 1 152 ? -7.548  94.701  98.582  1.00 34.00  ? 130  ALA B C   1 
ATOM   3354  O  O   . ALA B 1 152 ? -8.201  94.671  99.623  1.00 34.94  ? 130  ALA B O   1 
ATOM   3355  C  CB  . ALA B 1 152 ? -6.439  96.943  98.276  1.00 19.20  ? 130  ALA B CB  1 
ATOM   3356  N  N   . GLU B 1 153 ? -7.943  94.098  97.460  1.00 36.08  ? 131  GLU B N   1 
ATOM   3357  C  CA  . GLU B 1 153 ? -9.187  93.334  97.389  1.00 35.91  ? 131  GLU B CA  1 
ATOM   3358  C  C   . GLU B 1 153 ? -8.971  91.995  98.074  1.00 36.99  ? 131  GLU B C   1 
ATOM   3359  O  O   . GLU B 1 153 ? -9.755  91.570  98.933  1.00 35.47  ? 131  GLU B O   1 
ATOM   3360  C  CB  . GLU B 1 153 ? -9.583  93.106  95.934  1.00 34.72  ? 131  GLU B CB  1 
ATOM   3361  C  CG  . GLU B 1 153 ? -10.039 94.366  95.226  1.00 36.33  ? 131  GLU B CG  1 
ATOM   3362  C  CD  . GLU B 1 153 ? -10.211 94.165  93.738  1.00 29.13  ? 131  GLU B CD  1 
ATOM   3363  O  OE1 . GLU B 1 153 ? -10.791 95.052  93.091  1.00 28.92  ? 131  GLU B OE1 1 
ATOM   3364  O  OE2 . GLU B 1 153 ? -9.758  93.126  93.219  1.00 34.35  ? 131  GLU B OE2 1 
ATOM   3365  N  N   . ARG B 1 154 ? -7.887  91.343  97.683  1.00 38.17  ? 132  ARG B N   1 
ATOM   3366  C  CA  . ARG B 1 154 ? -7.520  90.056  98.228  1.00 37.04  ? 132  ARG B CA  1 
ATOM   3367  C  C   . ARG B 1 154 ? -7.383  90.273  99.725  1.00 37.94  ? 132  ARG B C   1 
ATOM   3368  O  O   . ARG B 1 154 ? -7.768  89.427  100.537 1.00 36.66  ? 132  ARG B O   1 
ATOM   3369  C  CB  . ARG B 1 154 ? -6.176  89.629  97.628  1.00 42.10  ? 132  ARG B CB  1 
ATOM   3370  C  CG  . ARG B 1 154 ? -5.868  88.155  97.743  1.00 53.02  ? 132  ARG B CG  1 
ATOM   3371  C  CD  . ARG B 1 154 ? -4.424  87.850  97.383  1.00 53.63  ? 132  ARG B CD  1 
ATOM   3372  N  NE  . ARG B 1 154 ? -3.485  88.494  98.299  1.00 60.58  ? 132  ARG B NE  1 
ATOM   3373  C  CZ  . ARG B 1 154 ? -3.028  89.736  98.160  1.00 62.84  ? 132  ARG B CZ  1 
ATOM   3374  N  NH1 . ARG B 1 154 ? -3.421  90.472  97.127  1.00 62.68  ? 132  ARG B NH1 1 
ATOM   3375  N  NH2 . ARG B 1 154 ? -2.195  90.249  99.064  1.00 55.70  ? 132  ARG B NH2 1 
ATOM   3376  N  N   . ASP B 1 155 ? -6.852  91.444  100.064 1.00 32.66  ? 133  ASP B N   1 
ATOM   3377  C  CA  . ASP B 1 155 ? -6.596  91.861  101.437 1.00 34.20  ? 133  ASP B CA  1 
ATOM   3378  C  C   . ASP B 1 155 ? -7.799  91.976  102.369 1.00 37.95  ? 133  ASP B C   1 
ATOM   3379  O  O   . ASP B 1 155 ? -7.649  91.827  103.582 1.00 38.90  ? 133  ASP B O   1 
ATOM   3380  C  CB  . ASP B 1 155 ? -5.881  93.204  101.419 1.00 34.33  ? 133  ASP B CB  1 
ATOM   3381  C  CG  . ASP B 1 155 ? -4.637  93.203  102.259 1.00 41.86  ? 133  ASP B CG  1 
ATOM   3382  O  OD1 . ASP B 1 155 ? -3.865  94.181  102.180 1.00 49.29  ? 133  ASP B OD1 1 
ATOM   3383  O  OD2 . ASP B 1 155 ? -4.433  92.222  103.001 1.00 47.94  ? 133  ASP B OD2 1 
ATOM   3384  N  N   . GLY B 1 156 ? -8.977  92.247  101.810 1.00 34.52  ? 134  GLY B N   1 
ATOM   3385  C  CA  . GLY B 1 156 ? -10.166 92.409  102.623 1.00 30.53  ? 134  GLY B CA  1 
ATOM   3386  C  C   . GLY B 1 156 ? -10.373 93.888  102.880 1.00 32.16  ? 134  GLY B C   1 
ATOM   3387  O  O   . GLY B 1 156 ? -11.419 94.319  103.369 1.00 29.17  ? 134  GLY B O   1 
ATOM   3388  N  N   . THR B 1 157 ? -9.350  94.659  102.523 1.00 34.88  ? 135  THR B N   1 
ATOM   3389  C  CA  . THR B 1 157 ? -9.322  96.112  102.664 1.00 31.55  ? 135  THR B CA  1 
ATOM   3390  C  C   . THR B 1 157 ? -10.306 96.848  101.751 1.00 35.70  ? 135  THR B C   1 
ATOM   3391  O  O   . THR B 1 157 ? -11.139 97.630  102.209 1.00 34.81  ? 135  THR B O   1 
ATOM   3392  C  CB  . THR B 1 157 ? -7.921  96.645  102.327 1.00 30.20  ? 135  THR B CB  1 
ATOM   3393  O  OG1 . THR B 1 157 ? -6.971  96.116  103.252 1.00 37.12  ? 135  THR B OG1 1 
ATOM   3394  C  CG2 . THR B 1 157 ? -7.896  98.152  102.370 1.00 31.63  ? 135  THR B CG2 1 
ATOM   3395  N  N   . LEU B 1 158 ? -10.181 96.591  100.450 1.00 34.40  ? 136  LEU B N   1 
ATOM   3396  C  CA  . LEU B 1 158 ? -10.983 97.242  99.428  1.00 25.96  ? 136  LEU B CA  1 
ATOM   3397  C  C   . LEU B 1 158 ? -12.279 96.507  99.096  1.00 27.50  ? 136  LEU B C   1 
ATOM   3398  O  O   . LEU B 1 158 ? -12.265 95.462  98.449  1.00 27.18  ? 136  LEU B O   1 
ATOM   3399  C  CB  . LEU B 1 158 ? -10.124 97.404  98.180  1.00 20.24  ? 136  LEU B CB  1 
ATOM   3400  C  CG  . LEU B 1 158 ? -10.669 98.243  97.030  1.00 14.69  ? 136  LEU B CG  1 
ATOM   3401  C  CD1 . LEU B 1 158 ? -10.955 99.662  97.516  1.00 16.37  ? 136  LEU B CD1 1 
ATOM   3402  C  CD2 . LEU B 1 158 ? -9.643  98.233  95.902  1.00 13.53  ? 136  LEU B CD2 1 
ATOM   3403  N  N   . LYS B 1 159 ? -13.393 97.096  99.526  1.00 31.13  ? 137  LYS B N   1 
ATOM   3404  C  CA  . LYS B 1 159 ? -14.738 96.547  99.349  1.00 27.25  ? 137  LYS B CA  1 
ATOM   3405  C  C   . LYS B 1 159 ? -15.450 97.016  98.088  1.00 28.72  ? 137  LYS B C   1 
ATOM   3406  O  O   . LYS B 1 159 ? -15.198 98.108  97.581  1.00 20.45  ? 137  LYS B O   1 
ATOM   3407  C  CB  . LYS B 1 159 ? -15.599 96.920  100.561 1.00 26.47  ? 137  LYS B CB  1 
ATOM   3408  C  CG  . LYS B 1 159 ? -14.937 96.619  101.922 1.00 29.97  ? 137  LYS B CG  1 
ATOM   3409  C  CD  . LYS B 1 159 ? -15.787 97.094  103.109 1.00 17.46  ? 137  LYS B CD  1 
ATOM   3410  C  CE  . LYS B 1 159 ? -15.934 98.617  103.125 1.00 27.31  ? 137  LYS B CE  1 
ATOM   3411  N  NZ  . LYS B 1 159 ? -14.614 99.314  103.355 1.00 20.27  ? 137  LYS B NZ  1 
ATOM   3412  N  N   . PRO B 1 160 ? -16.349 96.177  97.551  1.00 31.67  ? 138  PRO B N   1 
ATOM   3413  C  CA  . PRO B 1 160 ? -17.063 96.599  96.344  1.00 28.63  ? 138  PRO B CA  1 
ATOM   3414  C  C   . PRO B 1 160 ? -17.689 97.972  96.613  1.00 28.79  ? 138  PRO B C   1 
ATOM   3415  O  O   . PRO B 1 160 ? -18.217 98.217  97.704  1.00 27.08  ? 138  PRO B O   1 
ATOM   3416  C  CB  . PRO B 1 160 ? -18.114 95.498  96.173  1.00 22.48  ? 138  PRO B CB  1 
ATOM   3417  C  CG  . PRO B 1 160 ? -17.410 94.295  96.637  1.00 20.20  ? 138  PRO B CG  1 
ATOM   3418  C  CD  . PRO B 1 160 ? -16.668 94.775  97.889  1.00 26.54  ? 138  PRO B CD  1 
ATOM   3419  N  N   . GLY B 1 161 ? -17.599 98.868  95.634  1.00 29.86  ? 139  GLY B N   1 
ATOM   3420  C  CA  . GLY B 1 161 ? -18.172 100.197 95.785  1.00 32.02  ? 139  GLY B CA  1 
ATOM   3421  C  C   . GLY B 1 161 ? -17.381 101.197 96.612  1.00 30.91  ? 139  GLY B C   1 
ATOM   3422  O  O   . GLY B 1 161 ? -17.826 102.326 96.815  1.00 31.75  ? 139  GLY B O   1 
ATOM   3423  N  N   . ASP B 1 162 ? -16.220 100.793 97.106  1.00 31.22  ? 140  ASP B N   1 
ATOM   3424  C  CA  . ASP B 1 162 ? -15.404 101.697 97.892  1.00 32.26  ? 140  ASP B CA  1 
ATOM   3425  C  C   . ASP B 1 162 ? -14.811 102.821 97.043  1.00 31.82  ? 140  ASP B C   1 
ATOM   3426  O  O   . ASP B 1 162 ? -14.880 102.805 95.812  1.00 28.36  ? 140  ASP B O   1 
ATOM   3427  C  CB  . ASP B 1 162 ? -14.296 100.922 98.614  1.00 38.47  ? 140  ASP B CB  1 
ATOM   3428  C  CG  . ASP B 1 162 ? -14.776 100.305 99.919  1.00 41.26  ? 140  ASP B CG  1 
ATOM   3429  O  OD1 . ASP B 1 162 ? -15.971 100.470 100.261 1.00 41.01  ? 140  ASP B OD1 1 
ATOM   3430  O  OD2 . ASP B 1 162 ? -13.958 99.662  100.601 1.00 38.08  ? 140  ASP B OD2 1 
ATOM   3431  N  N   . THR B 1 163 ? -14.227 103.804 97.708  1.00 33.87  ? 141  THR B N   1 
ATOM   3432  C  CA  . THR B 1 163 ? -13.654 104.930 97.003  1.00 29.07  ? 141  THR B CA  1 
ATOM   3433  C  C   . THR B 1 163 ? -12.128 104.911 97.052  1.00 33.14  ? 141  THR B C   1 
ATOM   3434  O  O   . THR B 1 163 ? -11.513 104.604 98.082  1.00 21.07  ? 141  THR B O   1 
ATOM   3435  C  CB  . THR B 1 163 ? -14.185 106.251 97.605  1.00 27.09  ? 141  THR B CB  1 
ATOM   3436  O  OG1 . THR B 1 163 ? -15.619 106.296 97.479  1.00 21.16  ? 141  THR B OG1 1 
ATOM   3437  C  CG2 . THR B 1 163 ? -13.548 107.451 96.913  1.00 28.97  ? 141  THR B CG2 1 
ATOM   3438  N  N   . ILE B 1 164 ? -11.520 105.227 95.915  1.00 32.15  ? 142  ILE B N   1 
ATOM   3439  C  CA  . ILE B 1 164 ? -10.069 105.279 95.834  1.00 33.45  ? 142  ILE B CA  1 
ATOM   3440  C  C   . ILE B 1 164 ? -9.629  106.720 95.601  1.00 35.97  ? 142  ILE B C   1 
ATOM   3441  O  O   . ILE B 1 164 ? -10.004 107.341 94.609  1.00 40.85  ? 142  ILE B O   1 
ATOM   3442  C  CB  . ILE B 1 164 ? -9.541  104.385 94.691  1.00 33.31  ? 142  ILE B CB  1 
ATOM   3443  C  CG1 . ILE B 1 164 ? -9.998  102.940 94.917  1.00 33.47  ? 142  ILE B CG1 1 
ATOM   3444  C  CG2 . ILE B 1 164 ? -8.019  104.463 94.626  1.00 22.82  ? 142  ILE B CG2 1 
ATOM   3445  C  CD1 . ILE B 1 164 ? -9.626  101.990 93.802  1.00 27.81  ? 142  ILE B CD1 1 
ATOM   3446  N  N   . ILE B 1 165 ? -8.847  107.253 96.532  1.00 35.55  ? 143  ILE B N   1 
ATOM   3447  C  CA  . ILE B 1 165 ? -8.341  108.619 96.444  1.00 37.20  ? 143  ILE B CA  1 
ATOM   3448  C  C   . ILE B 1 165 ? -6.846  108.559 96.133  1.00 41.19  ? 143  ILE B C   1 
ATOM   3449  O  O   . ILE B 1 165 ? -6.094  107.836 96.790  1.00 45.20  ? 143  ILE B O   1 
ATOM   3450  C  CB  . ILE B 1 165 ? -8.523  109.369 97.794  1.00 35.70  ? 143  ILE B CB  1 
ATOM   3451  C  CG1 . ILE B 1 165 ? -10.003 109.524 98.115  1.00 37.58  ? 143  ILE B CG1 1 
ATOM   3452  C  CG2 . ILE B 1 165 ? -7.841  110.721 97.746  1.00 31.81  ? 143  ILE B CG2 1 
ATOM   3453  C  CD1 . ILE B 1 165 ? -10.263 110.050 99.497  1.00 31.87  ? 143  ILE B CD1 1 
ATOM   3454  N  N   . GLU B 1 166 ? -6.407  109.306 95.130  1.00 40.95  ? 144  GLU B N   1 
ATOM   3455  C  CA  . GLU B 1 166 ? -4.991  109.312 94.803  1.00 44.61  ? 144  GLU B CA  1 
ATOM   3456  C  C   . GLU B 1 166 ? -4.487  110.712 94.503  1.00 45.62  ? 144  GLU B C   1 
ATOM   3457  O  O   . GLU B 1 166 ? -5.036  111.412 93.660  1.00 45.18  ? 144  GLU B O   1 
ATOM   3458  C  CB  . GLU B 1 166 ? -4.686  108.408 93.607  1.00 46.68  ? 144  GLU B CB  1 
ATOM   3459  C  CG  . GLU B 1 166 ? -3.196  108.245 93.356  1.00 51.50  ? 144  GLU B CG  1 
ATOM   3460  C  CD  . GLU B 1 166 ? -2.490  107.530 94.506  1.00 63.07  ? 144  GLU B CD  1 
ATOM   3461  O  OE1 . GLU B 1 166 ? -1.234  107.489 94.504  1.00 66.60  ? 144  GLU B OE1 1 
ATOM   3462  O  OE2 . GLU B 1 166 ? -3.193  107.001 95.409  1.00 62.73  ? 144  GLU B OE2 1 
ATOM   3463  N  N   . PRO B 1 167 ? -3.440  111.147 95.215  1.00 48.92  ? 145  PRO B N   1 
ATOM   3464  C  CA  . PRO B 1 167 ? -2.855  112.473 95.017  1.00 50.25  ? 145  PRO B CA  1 
ATOM   3465  C  C   . PRO B 1 167 ? -1.782  112.388 93.944  1.00 49.79  ? 145  PRO B C   1 
ATOM   3466  O  O   . PRO B 1 167 ? -0.680  111.907 94.190  1.00 52.37  ? 145  PRO B O   1 
ATOM   3467  C  CB  . PRO B 1 167 ? -2.286  112.798 96.387  1.00 52.74  ? 145  PRO B CB  1 
ATOM   3468  C  CG  . PRO B 1 167 ? -1.789  111.467 96.832  1.00 52.06  ? 145  PRO B CG  1 
ATOM   3469  C  CD  . PRO B 1 167 ? -2.909  110.521 96.437  1.00 47.75  ? 145  PRO B CD  1 
ATOM   3470  N  N   . THR B 1 168 ? -2.130  112.858 92.753  1.00 50.16  ? 146  THR B N   1 
ATOM   3471  C  CA  . THR B 1 168 ? -1.247  112.847 91.594  1.00 51.89  ? 146  THR B CA  1 
ATOM   3472  C  C   . THR B 1 168 ? -2.116  112.866 90.341  1.00 53.50  ? 146  THR B C   1 
ATOM   3473  O  O   . THR B 1 168 ? -3.144  112.194 90.267  1.00 54.67  ? 146  THR B O   1 
ATOM   3474  C  CB  . THR B 1 168 ? -0.363  111.581 91.563  1.00 51.65  ? 146  THR B CB  1 
ATOM   3475  O  OG1 . THR B 1 168 ? 0.718   111.786 90.652  1.00 55.76  ? 146  THR B OG1 1 
ATOM   3476  C  CG2 . THR B 1 168 ? -1.166  110.367 91.110  1.00 54.37  ? 146  THR B CG2 1 
ATOM   3477  N  N   . SER B 1 169 ? -1.710  113.644 89.354  1.00 59.11  ? 147  SER B N   1 
ATOM   3478  C  CA  . SER B 1 169 ? -2.466  113.735 88.111  1.00 65.42  ? 147  SER B CA  1 
ATOM   3479  C  C   . SER B 1 169 ? -1.758  112.892 87.061  1.00 64.04  ? 147  SER B C   1 
ATOM   3480  O  O   . SER B 1 169 ? -2.140  112.885 85.886  1.00 67.43  ? 147  SER B O   1 
ATOM   3481  C  CB  . SER B 1 169 ? -2.525  115.191 87.648  1.00 67.27  ? 147  SER B CB  1 
ATOM   3482  O  OG  . SER B 1 169 ? -1.225  115.758 87.621  1.00 67.25  ? 147  SER B OG  1 
ATOM   3483  N  N   . GLY B 1 170 ? -0.718  112.192 87.508  1.00 59.72  ? 148  GLY B N   1 
ATOM   3484  C  CA  . GLY B 1 170 ? 0.082   111.351 86.632  1.00 56.69  ? 148  GLY B CA  1 
ATOM   3485  C  C   . GLY B 1 170 ? -0.539  110.043 86.163  1.00 51.05  ? 148  GLY B C   1 
ATOM   3486  O  O   . GLY B 1 170 ? -1.721  109.770 86.397  1.00 48.71  ? 148  GLY B O   1 
ATOM   3487  N  N   . ASN B 1 171 ? 0.275   109.217 85.509  1.00 47.02  ? 149  ASN B N   1 
ATOM   3488  C  CA  . ASN B 1 171 ? -0.233  107.971 84.962  1.00 36.76  ? 149  ASN B CA  1 
ATOM   3489  C  C   . ASN B 1 171 ? -0.864  107.016 85.959  1.00 36.16  ? 149  ASN B C   1 
ATOM   3490  O  O   . ASN B 1 171 ? -1.723  106.210 85.590  1.00 34.35  ? 149  ASN B O   1 
ATOM   3491  C  CB  . ASN B 1 171 ? 0.853   107.277 84.159  1.00 26.94  ? 149  ASN B CB  1 
ATOM   3492  C  CG  . ASN B 1 171 ? 1.219   108.053 82.922  1.00 22.89  ? 149  ASN B CG  1 
ATOM   3493  O  OD1 . ASN B 1 171 ? 0.342   108.481 82.167  1.00 20.94  ? 149  ASN B OD1 1 
ATOM   3494  N  ND2 . ASN B 1 171 ? 2.508   108.241 82.699  1.00 14.62  ? 149  ASN B ND2 1 
ATOM   3495  N  N   . THR B 1 172 ? -0.456  107.093 87.220  1.00 29.72  ? 150  THR B N   1 
ATOM   3496  C  CA  . THR B 1 172 ? -1.071  106.223 88.204  1.00 29.68  ? 150  THR B CA  1 
ATOM   3497  C  C   . THR B 1 172 ? -2.516  106.694 88.416  1.00 25.72  ? 150  THR B C   1 
ATOM   3498  O  O   . THR B 1 172 ? -3.411  105.909 88.730  1.00 26.90  ? 150  THR B O   1 
ATOM   3499  C  CB  . THR B 1 172 ? -0.296  106.247 89.523  1.00 27.66  ? 150  THR B CB  1 
ATOM   3500  O  OG1 . THR B 1 172 ? 0.997   105.643 89.333  1.00 29.54  ? 150  THR B OG1 1 
ATOM   3501  C  CG2 . THR B 1 172 ? -1.062  105.490 90.579  1.00 26.16  ? 150  THR B CG2 1 
ATOM   3502  N  N   . GLY B 1 173 ? -2.735  107.988 88.214  1.00 26.72  ? 151  GLY B N   1 
ATOM   3503  C  CA  . GLY B 1 173 ? -4.059  108.544 88.354  1.00 16.71  ? 151  GLY B CA  1 
ATOM   3504  C  C   . GLY B 1 173 ? -4.946  108.012 87.255  1.00 14.56  ? 151  GLY B C   1 
ATOM   3505  O  O   . GLY B 1 173 ? -6.085  107.611 87.502  1.00 27.26  ? 151  GLY B O   1 
ATOM   3506  N  N   . ILE B 1 174 ? -4.429  107.999 86.035  1.00 8.98   ? 152  ILE B N   1 
ATOM   3507  C  CA  . ILE B 1 174 ? -5.190  107.502 84.893  1.00 15.06  ? 152  ILE B CA  1 
ATOM   3508  C  C   . ILE B 1 174 ? -5.428  106.014 85.058  1.00 12.16  ? 152  ILE B C   1 
ATOM   3509  O  O   . ILE B 1 174 ? -6.536  105.517 84.844  1.00 20.54  ? 152  ILE B O   1 
ATOM   3510  C  CB  . ILE B 1 174 ? -4.427  107.772 83.546  1.00 27.10  ? 152  ILE B CB  1 
ATOM   3511  C  CG1 . ILE B 1 174 ? -4.295  109.282 83.318  1.00 29.75  ? 152  ILE B CG1 1 
ATOM   3512  C  CG2 . ILE B 1 174 ? -5.177  107.144 82.368  1.00 28.63  ? 152  ILE B CG2 1 
ATOM   3513  C  CD1 . ILE B 1 174 ? -3.344  109.668 82.209  1.00 37.02  ? 152  ILE B CD1 1 
ATOM   3514  N  N   . GLY B 1 175 ? -4.376  105.303 85.443  1.00 16.73  ? 153  GLY B N   1 
ATOM   3515  C  CA  . GLY B 1 175 ? -4.487  103.871 85.658  1.00 14.45  ? 153  GLY B CA  1 
ATOM   3516  C  C   . GLY B 1 175 ? -5.568  103.494 86.672  1.00 24.00  ? 153  GLY B C   1 
ATOM   3517  O  O   . GLY B 1 175 ? -6.384  102.604 86.419  1.00 28.99  ? 153  GLY B O   1 
ATOM   3518  N  N   . LEU B 1 176 ? -5.576  104.161 87.825  1.00 22.96  ? 154  LEU B N   1 
ATOM   3519  C  CA  . LEU B 1 176 ? -6.566  103.870 88.858  1.00 20.34  ? 154  LEU B CA  1 
ATOM   3520  C  C   . LEU B 1 176 ? -7.951  104.222 88.360  1.00 24.51  ? 154  LEU B C   1 
ATOM   3521  O  O   . LEU B 1 176 ? -8.907  103.481 88.583  1.00 23.61  ? 154  LEU B O   1 
ATOM   3522  C  CB  . LEU B 1 176 ? -6.255  104.659 90.126  1.00 17.99  ? 154  LEU B CB  1 
ATOM   3523  C  CG  . LEU B 1 176 ? -4.981  104.252 90.869  1.00 15.45  ? 154  LEU B CG  1 
ATOM   3524  C  CD1 . LEU B 1 176 ? -4.534  105.372 91.809  1.00 16.55  ? 154  LEU B CD1 1 
ATOM   3525  C  CD2 . LEU B 1 176 ? -5.240  102.966 91.636  1.00 5.20   ? 154  LEU B CD2 1 
ATOM   3526  N  N   . ALA B 1 177 ? -8.055  105.355 87.671  1.00 26.45  ? 155  ALA B N   1 
ATOM   3527  C  CA  . ALA B 1 177 ? -9.337  105.788 87.133  1.00 27.78  ? 155  ALA B CA  1 
ATOM   3528  C  C   . ALA B 1 177 ? -9.922  104.710 86.208  1.00 27.26  ? 155  ALA B C   1 
ATOM   3529  O  O   . ALA B 1 177 ? -11.082 104.311 86.359  1.00 19.09  ? 155  ALA B O   1 
ATOM   3530  C  CB  . ALA B 1 177 ? -9.160  107.101 86.388  1.00 24.42  ? 155  ALA B CB  1 
ATOM   3531  N  N   . LEU B 1 178 ? -9.104  104.237 85.265  1.00 26.44  ? 156  LEU B N   1 
ATOM   3532  C  CA  . LEU B 1 178 ? -9.525  103.205 84.322  1.00 25.09  ? 156  LEU B CA  1 
ATOM   3533  C  C   . LEU B 1 178 ? -9.986  101.943 85.044  1.00 28.11  ? 156  LEU B C   1 
ATOM   3534  O  O   . LEU B 1 178 ? -11.105 101.475 84.840  1.00 34.49  ? 156  LEU B O   1 
ATOM   3535  C  CB  . LEU B 1 178 ? -8.373  102.869 83.373  1.00 29.77  ? 156  LEU B CB  1 
ATOM   3536  C  CG  . LEU B 1 178 ? -8.419  101.611 82.478  1.00 31.07  ? 156  LEU B CG  1 
ATOM   3537  C  CD1 . LEU B 1 178 ? -9.716  101.528 81.729  1.00 34.06  ? 156  LEU B CD1 1 
ATOM   3538  C  CD2 . LEU B 1 178 ? -7.266  101.659 81.484  1.00 34.37  ? 156  LEU B CD2 1 
ATOM   3539  N  N   . ALA B 1 179 ? -9.123  101.398 85.894  1.00 26.14  ? 157  ALA B N   1 
ATOM   3540  C  CA  . ALA B 1 179 ? -9.447  100.194 86.640  1.00 26.28  ? 157  ALA B CA  1 
ATOM   3541  C  C   . ALA B 1 179 ? -10.658 100.422 87.538  1.00 30.62  ? 157  ALA B C   1 
ATOM   3542  O  O   . ALA B 1 179 ? -11.447 99.501  87.769  1.00 22.43  ? 157  ALA B O   1 
ATOM   3543  C  CB  . ALA B 1 179 ? -8.253  99.759  87.473  1.00 24.51  ? 157  ALA B CB  1 
ATOM   3544  N  N   . ALA B 1 180 ? -10.815 101.651 88.031  1.00 35.29  ? 158  ALA B N   1 
ATOM   3545  C  CA  . ALA B 1 180 ? -11.942 101.975 88.912  1.00 32.02  ? 158  ALA B CA  1 
ATOM   3546  C  C   . ALA B 1 180 ? -13.263 101.857 88.172  1.00 29.69  ? 158  ALA B C   1 
ATOM   3547  O  O   . ALA B 1 180 ? -14.214 101.237 88.652  1.00 26.17  ? 158  ALA B O   1 
ATOM   3548  C  CB  . ALA B 1 180 ? -11.787 103.386 89.477  1.00 32.97  ? 158  ALA B CB  1 
ATOM   3549  N  N   . ALA B 1 181 ? -13.318 102.455 86.992  1.00 26.56  ? 159  ALA B N   1 
ATOM   3550  C  CA  . ALA B 1 181 ? -14.535 102.413 86.201  1.00 29.48  ? 159  ALA B CA  1 
ATOM   3551  C  C   . ALA B 1 181 ? -14.916 100.988 85.807  1.00 26.65  ? 159  ALA B C   1 
ATOM   3552  O  O   . ALA B 1 181 ? -16.086 100.656 85.688  1.00 29.63  ? 159  ALA B O   1 
ATOM   3553  C  CB  . ALA B 1 181 ? -14.379 103.276 84.966  1.00 23.87  ? 159  ALA B CB  1 
ATOM   3554  N  N   . VAL B 1 182 ? -13.938 100.128 85.609  1.00 29.12  ? 160  VAL B N   1 
ATOM   3555  C  CA  . VAL B 1 182 ? -14.277 98.776  85.228  1.00 29.12  ? 160  VAL B CA  1 
ATOM   3556  C  C   . VAL B 1 182 ? -14.791 97.980  86.406  1.00 32.23  ? 160  VAL B C   1 
ATOM   3557  O  O   . VAL B 1 182 ? -15.804 97.299  86.294  1.00 32.57  ? 160  VAL B O   1 
ATOM   3558  C  CB  . VAL B 1 182 ? -13.076 98.021  84.628  1.00 26.84  ? 160  VAL B CB  1 
ATOM   3559  C  CG1 . VAL B 1 182 ? -13.522 96.634  84.169  1.00 29.18  ? 160  VAL B CG1 1 
ATOM   3560  C  CG2 . VAL B 1 182 ? -12.498 98.799  83.453  1.00 28.15  ? 160  VAL B CG2 1 
ATOM   3561  N  N   . ARG B 1 183 ? -14.099 98.073  87.538  1.00 33.50  ? 161  ARG B N   1 
ATOM   3562  C  CA  . ARG B 1 183 ? -14.471 97.312  88.733  1.00 33.65  ? 161  ARG B CA  1 
ATOM   3563  C  C   . ARG B 1 183 ? -15.598 97.892  89.595  1.00 31.55  ? 161  ARG B C   1 
ATOM   3564  O  O   . ARG B 1 183 ? -16.101 97.219  90.492  1.00 29.21  ? 161  ARG B O   1 
ATOM   3565  C  CB  . ARG B 1 183 ? -13.241 97.103  89.608  1.00 40.43  ? 161  ARG B CB  1 
ATOM   3566  C  CG  . ARG B 1 183 ? -12.003 96.724  88.836  1.00 52.60  ? 161  ARG B CG  1 
ATOM   3567  C  CD  . ARG B 1 183 ? -11.993 95.276  88.387  1.00 59.05  ? 161  ARG B CD  1 
ATOM   3568  N  NE  . ARG B 1 183 ? -11.134 94.467  89.247  1.00 56.85  ? 161  ARG B NE  1 
ATOM   3569  C  CZ  . ARG B 1 183 ? -10.423 93.429  88.818  1.00 60.43  ? 161  ARG B CZ  1 
ATOM   3570  N  NH1 . ARG B 1 183 ? -10.471 93.082  87.534  1.00 47.36  ? 161  ARG B NH1 1 
ATOM   3571  N  NH2 . ARG B 1 183 ? -9.669  92.738  89.672  1.00 61.60  ? 161  ARG B NH2 1 
ATOM   3572  N  N   . GLY B 1 184 ? -15.991 99.132  89.336  1.00 33.05  ? 162  GLY B N   1 
ATOM   3573  C  CA  . GLY B 1 184 ? -17.057 99.723  90.122  1.00 33.76  ? 162  GLY B CA  1 
ATOM   3574  C  C   . GLY B 1 184 ? -16.625 100.447 91.390  1.00 33.94  ? 162  GLY B C   1 
ATOM   3575  O  O   . GLY B 1 184 ? -17.323 100.381 92.404  1.00 35.45  ? 162  GLY B O   1 
ATOM   3576  N  N   . TYR B 1 185 ? -15.480 101.126 91.334  1.00 27.53  ? 163  TYR B N   1 
ATOM   3577  C  CA  . TYR B 1 185 ? -14.974 101.882 92.469  1.00 29.41  ? 163  TYR B CA  1 
ATOM   3578  C  C   . TYR B 1 185 ? -15.062 103.352 92.128  1.00 28.94  ? 163  TYR B C   1 
ATOM   3579  O  O   . TYR B 1 185 ? -14.906 103.734 90.974  1.00 22.22  ? 163  TYR B O   1 
ATOM   3580  C  CB  . TYR B 1 185 ? -13.507 101.573 92.755  1.00 30.03  ? 163  TYR B CB  1 
ATOM   3581  C  CG  . TYR B 1 185 ? -13.248 100.194 93.243  1.00 30.93  ? 163  TYR B CG  1 
ATOM   3582  C  CD1 . TYR B 1 185 ? -12.426 99.334  92.520  1.00 36.79  ? 163  TYR B CD1 1 
ATOM   3583  C  CD2 . TYR B 1 185 ? -13.854 99.725  94.402  1.00 28.49  ? 163  TYR B CD2 1 
ATOM   3584  C  CE1 . TYR B 1 185 ? -12.214 98.029  92.931  1.00 48.11  ? 163  TYR B CE1 1 
ATOM   3585  C  CE2 . TYR B 1 185 ? -13.653 98.418  94.829  1.00 42.03  ? 163  TYR B CE2 1 
ATOM   3586  C  CZ  . TYR B 1 185 ? -12.832 97.573  94.085  1.00 42.97  ? 163  TYR B CZ  1 
ATOM   3587  O  OH  . TYR B 1 185 ? -12.648 96.271  94.480  1.00 49.00  ? 163  TYR B OH  1 
ATOM   3588  N  N   . ARG B 1 186 ? -15.313 104.169 93.137  1.00 30.53  ? 164  ARG B N   1 
ATOM   3589  C  CA  . ARG B 1 186 ? -15.368 105.605 92.937  1.00 33.73  ? 164  ARG B CA  1 
ATOM   3590  C  C   . ARG B 1 186 ? -13.908 106.037 92.950  1.00 32.71  ? 164  ARG B C   1 
ATOM   3591  O  O   . ARG B 1 186 ? -13.099 105.518 93.732  1.00 38.12  ? 164  ARG B O   1 
ATOM   3592  C  CB  . ARG B 1 186 ? -16.124 106.278 94.084  1.00 36.57  ? 164  ARG B CB  1 
ATOM   3593  C  CG  . ARG B 1 186 ? -16.298 107.768 93.926  1.00 40.60  ? 164  ARG B CG  1 
ATOM   3594  C  CD  . ARG B 1 186 ? -16.730 108.376 95.241  1.00 48.15  ? 164  ARG B CD  1 
ATOM   3595  N  NE  . ARG B 1 186 ? -16.944 109.811 95.146  1.00 52.32  ? 164  ARG B NE  1 
ATOM   3596  C  CZ  . ARG B 1 186 ? -17.056 110.614 96.200  1.00 65.71  ? 164  ARG B CZ  1 
ATOM   3597  N  NH1 . ARG B 1 186 ? -16.970 110.115 97.428  1.00 68.80  ? 164  ARG B NH1 1 
ATOM   3598  N  NH2 . ARG B 1 186 ? -17.259 111.916 96.029  1.00 68.78  ? 164  ARG B NH2 1 
ATOM   3599  N  N   . CYS B 1 187 ? -13.567 106.979 92.086  1.00 31.68  ? 165  CYS B N   1 
ATOM   3600  C  CA  . CYS B 1 187 ? -12.199 107.446 92.012  1.00 31.10  ? 165  CYS B CA  1 
ATOM   3601  C  C   . CYS B 1 187 ? -12.095 108.962 92.142  1.00 28.80  ? 165  CYS B C   1 
ATOM   3602  O  O   . CYS B 1 187 ? -12.802 109.712 91.477  1.00 34.26  ? 165  CYS B O   1 
ATOM   3603  C  CB  . CYS B 1 187 ? -11.575 106.987 90.690  1.00 33.98  ? 165  CYS B CB  1 
ATOM   3604  S  SG  . CYS B 1 187 ? -9.813  107.182 90.615  1.00 35.43  ? 165  CYS B SG  1 
ATOM   3605  N  N   . ILE B 1 188 ? -11.194 109.405 93.002  1.00 25.11  ? 166  ILE B N   1 
ATOM   3606  C  CA  . ILE B 1 188 ? -10.984 110.821 93.223  1.00 27.55  ? 166  ILE B CA  1 
ATOM   3607  C  C   . ILE B 1 188 ? -9.495  111.113 93.130  1.00 33.53  ? 166  ILE B C   1 
ATOM   3608  O  O   . ILE B 1 188 ? -8.705  110.640 93.956  1.00 29.55  ? 166  ILE B O   1 
ATOM   3609  C  CB  . ILE B 1 188 ? -11.462 111.249 94.629  1.00 29.25  ? 166  ILE B CB  1 
ATOM   3610  C  CG1 . ILE B 1 188 ? -12.964 110.987 94.780  1.00 25.44  ? 166  ILE B CG1 1 
ATOM   3611  C  CG2 . ILE B 1 188 ? -11.140 112.716 94.858  1.00 29.78  ? 166  ILE B CG2 1 
ATOM   3612  C  CD1 . ILE B 1 188 ? -13.467 111.166 96.191  1.00 18.24  ? 166  ILE B CD1 1 
ATOM   3613  N  N   . ILE B 1 189 ? -9.109  111.878 92.116  1.00 37.82  ? 167  ILE B N   1 
ATOM   3614  C  CA  . ILE B 1 189 ? -7.712  112.243 91.948  1.00 43.06  ? 167  ILE B CA  1 
ATOM   3615  C  C   . ILE B 1 189 ? -7.525  113.661 92.488  1.00 44.38  ? 167  ILE B C   1 
ATOM   3616  O  O   . ILE B 1 189 ? -8.381  114.526 92.304  1.00 46.12  ? 167  ILE B O   1 
ATOM   3617  C  CB  . ILE B 1 189 ? -7.279  112.183 90.454  1.00 43.14  ? 167  ILE B CB  1 
ATOM   3618  C  CG1 . ILE B 1 189 ? -6.862  110.757 90.088  1.00 49.00  ? 167  ILE B CG1 1 
ATOM   3619  C  CG2 . ILE B 1 189 ? -6.104  113.115 90.205  1.00 47.27  ? 167  ILE B CG2 1 
ATOM   3620  C  CD1 . ILE B 1 189 ? -7.973  109.764 90.144  1.00 51.24  ? 167  ILE B CD1 1 
ATOM   3621  N  N   . VAL B 1 190 ? -6.415  113.887 93.176  1.00 42.54  ? 168  VAL B N   1 
ATOM   3622  C  CA  . VAL B 1 190 ? -6.123  115.201 93.729  1.00 48.11  ? 168  VAL B CA  1 
ATOM   3623  C  C   . VAL B 1 190 ? -4.795  115.663 93.133  1.00 55.94  ? 168  VAL B C   1 
ATOM   3624  O  O   . VAL B 1 190 ? -3.747  115.035 93.333  1.00 55.48  ? 168  VAL B O   1 
ATOM   3625  C  CB  . VAL B 1 190 ? -6.034  115.149 95.269  1.00 38.54  ? 168  VAL B CB  1 
ATOM   3626  C  CG1 . VAL B 1 190 ? -5.759  116.517 95.810  1.00 39.30  ? 168  VAL B CG1 1 
ATOM   3627  C  CG2 . VAL B 1 190 ? -7.324  114.622 95.844  1.00 31.85  ? 168  VAL B CG2 1 
ATOM   3628  N  N   . MET B 1 191 ? -4.852  116.763 92.390  1.00 64.31  ? 169  MET B N   1 
ATOM   3629  C  CA  . MET B 1 191 ? -3.677  117.307 91.724  1.00 70.86  ? 169  MET B CA  1 
ATOM   3630  C  C   . MET B 1 191 ? -3.628  118.824 91.856  1.00 76.08  ? 169  MET B C   1 
ATOM   3631  O  O   . MET B 1 191 ? -4.623  119.451 92.215  1.00 75.66  ? 169  MET B O   1 
ATOM   3632  C  CB  . MET B 1 191 ? -3.741  116.953 90.249  1.00 73.28  ? 169  MET B CB  1 
ATOM   3633  C  CG  . MET B 1 191 ? -4.939  117.581 89.560  1.00 75.46  ? 169  MET B CG  1 
ATOM   3634  S  SD  . MET B 1 191 ? -5.128  117.084 87.847  1.00 88.66  ? 169  MET B SD  1 
ATOM   3635  C  CE  . MET B 1 191 ? -6.381  115.817 88.003  1.00 83.64  ? 169  MET B CE  1 
ATOM   3636  N  N   . PRO B 1 192 ? -2.462  119.432 91.564  1.00 81.76  ? 170  PRO B N   1 
ATOM   3637  C  CA  . PRO B 1 192 ? -2.282  120.889 91.642  1.00 86.70  ? 170  PRO B CA  1 
ATOM   3638  C  C   . PRO B 1 192 ? -3.336  121.639 90.813  1.00 90.41  ? 170  PRO B C   1 
ATOM   3639  O  O   . PRO B 1 192 ? -4.317  121.044 90.362  1.00 93.28  ? 170  PRO B O   1 
ATOM   3640  C  CB  . PRO B 1 192 ? -0.866  121.083 91.101  1.00 86.86  ? 170  PRO B CB  1 
ATOM   3641  C  CG  . PRO B 1 192 ? -0.164  119.852 91.595  1.00 83.95  ? 170  PRO B CG  1 
ATOM   3642  C  CD  . PRO B 1 192 ? -1.175  118.763 91.289  1.00 82.31  ? 170  PRO B CD  1 
ATOM   3643  N  N   . GLU B 1 193 ? -3.137  122.937 90.601  1.00 91.78  ? 171  GLU B N   1 
ATOM   3644  C  CA  . GLU B 1 193 ? -4.105  123.716 89.832  1.00 92.49  ? 171  GLU B CA  1 
ATOM   3645  C  C   . GLU B 1 193 ? -3.737  123.874 88.358  1.00 92.53  ? 171  GLU B C   1 
ATOM   3646  O  O   . GLU B 1 193 ? -4.479  124.488 87.588  1.00 95.41  ? 171  GLU B O   1 
ATOM   3647  C  CB  . GLU B 1 193 ? -4.306  125.097 90.473  1.00 92.46  ? 171  GLU B CB  1 
ATOM   3648  C  CG  . GLU B 1 193 ? -3.069  125.985 90.532  1.00 92.74  ? 171  GLU B CG  1 
ATOM   3649  C  CD  . GLU B 1 193 ? -3.329  127.294 91.272  1.00 94.69  ? 171  GLU B CD  1 
ATOM   3650  O  OE1 . GLU B 1 193 ? -4.271  128.024 90.894  1.00 95.87  ? 171  GLU B OE1 1 
ATOM   3651  O  OE2 . GLU B 1 193 ? -2.590  127.596 92.233  1.00 95.11  ? 171  GLU B OE2 1 
ATOM   3652  N  N   . LYS B 1 194 ? -2.600  123.310 87.961  1.00 90.58  ? 172  LYS B N   1 
ATOM   3653  C  CA  . LYS B 1 194 ? -2.154  123.396 86.574  1.00 88.85  ? 172  LYS B CA  1 
ATOM   3654  C  C   . LYS B 1 194 ? -2.599  122.148 85.812  1.00 87.66  ? 172  LYS B C   1 
ATOM   3655  O  O   . LYS B 1 194 ? -3.779  121.983 85.483  1.00 85.72  ? 172  LYS B O   1 
ATOM   3656  C  CB  . LYS B 1 194 ? -0.624  123.518 86.503  1.00 88.71  ? 172  LYS B CB  1 
ATOM   3657  C  CG  . LYS B 1 194 ? -0.014  124.666 87.307  1.00 85.76  ? 172  LYS B CG  1 
ATOM   3658  C  CD  . LYS B 1 194 ? -0.044  124.391 88.806  1.00 83.87  ? 172  LYS B CD  1 
ATOM   3659  C  CE  . LYS B 1 194 ? 0.596   125.531 89.589  1.00 84.22  ? 172  LYS B CE  1 
ATOM   3660  N  NZ  . LYS B 1 194 ? 0.588   125.285 91.063  1.00 83.08  ? 172  LYS B NZ  1 
ATOM   3661  N  N   . MET B 1 195 ? -1.631  121.281 85.535  1.00 86.14  ? 173  MET B N   1 
ATOM   3662  C  CA  . MET B 1 195 ? -1.850  120.022 84.835  1.00 85.34  ? 173  MET B CA  1 
ATOM   3663  C  C   . MET B 1 195 ? -2.467  120.032 83.449  1.00 84.13  ? 173  MET B C   1 
ATOM   3664  O  O   . MET B 1 195 ? -3.509  120.647 83.207  1.00 85.15  ? 173  MET B O   1 
ATOM   3665  C  CB  . MET B 1 195 ? -2.626  119.064 85.741  1.00 85.99  ? 173  MET B CB  1 
ATOM   3666  C  CG  . MET B 1 195 ? -1.717  118.061 86.395  1.00 86.12  ? 173  MET B CG  1 
ATOM   3667  S  SD  . MET B 1 195 ? -0.064  118.757 86.700  1.00 90.96  ? 173  MET B SD  1 
ATOM   3668  C  CE  . MET B 1 195 ? 0.826   118.260 85.164  1.00 87.03  ? 173  MET B CE  1 
ATOM   3669  N  N   . SER B 1 196 ? -1.797  119.308 82.556  1.00 80.24  ? 174  SER B N   1 
ATOM   3670  C  CA  . SER B 1 196 ? -2.186  119.178 81.160  1.00 77.08  ? 174  SER B CA  1 
ATOM   3671  C  C   . SER B 1 196 ? -3.636  118.747 80.944  1.00 72.15  ? 174  SER B C   1 
ATOM   3672  O  O   . SER B 1 196 ? -4.207  118.020 81.749  1.00 69.28  ? 174  SER B O   1 
ATOM   3673  C  CB  . SER B 1 196 ? -1.257  118.181 80.490  1.00 80.01  ? 174  SER B CB  1 
ATOM   3674  O  OG  . SER B 1 196 ? 0.076   118.369 80.954  1.00 86.03  ? 174  SER B OG  1 
ATOM   3675  N  N   . SER B 1 197 ? -4.217  119.200 79.839  1.00 73.06  ? 175  SER B N   1 
ATOM   3676  C  CA  . SER B 1 197 ? -5.589  118.859 79.502  1.00 73.80  ? 175  SER B CA  1 
ATOM   3677  C  C   . SER B 1 197 ? -5.631  117.415 79.019  1.00 69.01  ? 175  SER B C   1 
ATOM   3678  O  O   . SER B 1 197 ? -6.617  116.703 79.226  1.00 66.55  ? 175  SER B O   1 
ATOM   3679  C  CB  . SER B 1 197 ? -6.122  119.795 78.411  1.00 80.06  ? 175  SER B CB  1 
ATOM   3680  O  OG  . SER B 1 197 ? -6.215  121.135 78.873  1.00 84.95  ? 175  SER B OG  1 
ATOM   3681  N  N   . GLU B 1 198 ? -4.555  116.994 78.362  1.00 65.85  ? 176  GLU B N   1 
ATOM   3682  C  CA  . GLU B 1 198 ? -4.461  115.632 77.852  1.00 62.18  ? 176  GLU B CA  1 
ATOM   3683  C  C   . GLU B 1 198 ? -4.810  114.672 78.974  1.00 56.79  ? 176  GLU B C   1 
ATOM   3684  O  O   . GLU B 1 198 ? -5.540  113.707 78.780  1.00 53.76  ? 176  GLU B O   1 
ATOM   3685  C  CB  . GLU B 1 198 ? -3.040  115.335 77.366  1.00 66.34  ? 176  GLU B CB  1 
ATOM   3686  C  CG  . GLU B 1 198 ? -2.813  115.476 75.859  1.00 71.52  ? 176  GLU B CG  1 
ATOM   3687  C  CD  . GLU B 1 198 ? -3.102  116.867 75.340  1.00 73.96  ? 176  GLU B CD  1 
ATOM   3688  O  OE1 . GLU B 1 198 ? -4.276  117.144 74.995  1.00 68.84  ? 176  GLU B OE1 1 
ATOM   3689  O  OE2 . GLU B 1 198 ? -2.150  117.681 75.286  1.00 74.55  ? 176  GLU B OE2 1 
ATOM   3690  N  N   . LYS B 1 199 ? -4.286  114.962 80.158  1.00 52.53  ? 177  LYS B N   1 
ATOM   3691  C  CA  . LYS B 1 199 ? -4.514  114.126 81.316  1.00 43.87  ? 177  LYS B CA  1 
ATOM   3692  C  C   . LYS B 1 199 ? -5.840  114.397 82.023  1.00 44.08  ? 177  LYS B C   1 
ATOM   3693  O  O   . LYS B 1 199 ? -6.507  113.459 82.448  1.00 49.66  ? 177  LYS B O   1 
ATOM   3694  C  CB  . LYS B 1 199 ? -3.345  114.282 82.289  1.00 42.63  ? 177  LYS B CB  1 
ATOM   3695  C  CG  . LYS B 1 199 ? -2.030  113.746 81.744  1.00 41.03  ? 177  LYS B CG  1 
ATOM   3696  C  CD  . LYS B 1 199 ? -0.860  114.016 82.680  1.00 45.54  ? 177  LYS B CD  1 
ATOM   3697  C  CE  . LYS B 1 199 ? -0.570  115.514 82.810  1.00 49.87  ? 177  LYS B CE  1 
ATOM   3698  N  NZ  . LYS B 1 199 ? 0.609   115.802 83.684  1.00 42.81  ? 177  LYS B NZ  1 
ATOM   3699  N  N   . VAL B 1 200 ? -6.244  115.658 82.142  1.00 41.29  ? 178  VAL B N   1 
ATOM   3700  C  CA  . VAL B 1 200 ? -7.496  115.959 82.837  1.00 42.63  ? 178  VAL B CA  1 
ATOM   3701  C  C   . VAL B 1 200 ? -8.721  115.444 82.111  1.00 38.85  ? 178  VAL B C   1 
ATOM   3702  O  O   . VAL B 1 200 ? -9.635  114.908 82.736  1.00 35.97  ? 178  VAL B O   1 
ATOM   3703  C  CB  . VAL B 1 200 ? -7.675  117.478 83.094  1.00 46.13  ? 178  VAL B CB  1 
ATOM   3704  C  CG1 . VAL B 1 200 ? -9.103  117.769 83.536  1.00 46.16  ? 178  VAL B CG1 1 
ATOM   3705  C  CG2 . VAL B 1 200 ? -6.716  117.939 84.181  1.00 44.63  ? 178  VAL B CG2 1 
ATOM   3706  N  N   . ASP B 1 201 ? -8.751  115.602 80.794  1.00 43.20  ? 179  ASP B N   1 
ATOM   3707  C  CA  . ASP B 1 201 ? -9.906  115.138 80.026  1.00 46.19  ? 179  ASP B CA  1 
ATOM   3708  C  C   . ASP B 1 201 ? -10.007 113.617 79.967  1.00 40.42  ? 179  ASP B C   1 
ATOM   3709  O  O   . ASP B 1 201 ? -11.107 113.074 79.894  1.00 47.51  ? 179  ASP B O   1 
ATOM   3710  C  CB  . ASP B 1 201 ? -9.894  115.745 78.622  1.00 51.32  ? 179  ASP B CB  1 
ATOM   3711  C  CG  . ASP B 1 201 ? -10.206 117.236 78.635  1.00 56.97  ? 179  ASP B CG  1 
ATOM   3712  O  OD1 . ASP B 1 201 ? -11.303 117.606 79.113  1.00 60.21  ? 179  ASP B OD1 1 
ATOM   3713  O  OD2 . ASP B 1 201 ? -9.359  118.034 78.171  1.00 58.82  ? 179  ASP B OD2 1 
ATOM   3714  N  N   . VAL B 1 202 ? -8.868  112.928 80.004  1.00 37.11  ? 180  VAL B N   1 
ATOM   3715  C  CA  . VAL B 1 202 ? -8.878  111.469 80.009  1.00 29.75  ? 180  VAL B CA  1 
ATOM   3716  C  C   . VAL B 1 202 ? -9.419  110.995 81.363  1.00 33.97  ? 180  VAL B C   1 
ATOM   3717  O  O   . VAL B 1 202 ? -10.212 110.059 81.422  1.00 38.18  ? 180  VAL B O   1 
ATOM   3718  C  CB  . VAL B 1 202 ? -7.465  110.887 79.763  1.00 27.35  ? 180  VAL B CB  1 
ATOM   3719  C  CG1 . VAL B 1 202 ? -7.442  109.402 80.062  1.00 32.34  ? 180  VAL B CG1 1 
ATOM   3720  C  CG2 . VAL B 1 202 ? -7.081  111.090 78.306  1.00 29.39  ? 180  VAL B CG2 1 
ATOM   3721  N  N   . LEU B 1 203 ? -9.001  111.651 82.447  1.00 34.27  ? 181  LEU B N   1 
ATOM   3722  C  CA  . LEU B 1 203 ? -9.469  111.300 83.784  1.00 31.66  ? 181  LEU B CA  1 
ATOM   3723  C  C   . LEU B 1 203 ? -10.969 111.504 83.903  1.00 38.00  ? 181  LEU B C   1 
ATOM   3724  O  O   . LEU B 1 203 ? -11.688 110.625 84.392  1.00 39.08  ? 181  LEU B O   1 
ATOM   3725  C  CB  . LEU B 1 203 ? -8.779  112.152 84.844  1.00 33.04  ? 181  LEU B CB  1 
ATOM   3726  C  CG  . LEU B 1 203 ? -7.368  111.739 85.255  1.00 33.43  ? 181  LEU B CG  1 
ATOM   3727  C  CD1 . LEU B 1 203 ? -6.793  112.748 86.233  1.00 28.35  ? 181  LEU B CD1 1 
ATOM   3728  C  CD2 . LEU B 1 203 ? -7.427  110.361 85.873  1.00 32.50  ? 181  LEU B CD2 1 
ATOM   3729  N  N   . ARG B 1 204 ? -11.440 112.669 83.461  1.00 38.97  ? 182  ARG B N   1 
ATOM   3730  C  CA  . ARG B 1 204 ? -12.866 112.984 83.523  1.00 40.74  ? 182  ARG B CA  1 
ATOM   3731  C  C   . ARG B 1 204 ? -13.662 112.009 82.664  1.00 39.91  ? 182  ARG B C   1 
ATOM   3732  O  O   . ARG B 1 204 ? -14.813 111.703 82.974  1.00 43.06  ? 182  ARG B O   1 
ATOM   3733  C  CB  . ARG B 1 204 ? -13.123 114.426 83.057  1.00 42.56  ? 182  ARG B CB  1 
ATOM   3734  C  CG  . ARG B 1 204 ? -12.380 115.499 83.857  1.00 50.61  ? 182  ARG B CG  1 
ATOM   3735  C  CD  . ARG B 1 204 ? -12.678 116.908 83.344  1.00 54.86  ? 182  ARG B CD  1 
ATOM   3736  N  NE  . ARG B 1 204 ? -14.021 117.365 83.701  1.00 67.20  ? 182  ARG B NE  1 
ATOM   3737  C  CZ  . ARG B 1 204 ? -14.354 117.881 84.885  1.00 71.24  ? 182  ARG B CZ  1 
ATOM   3738  N  NH1 . ARG B 1 204 ? -13.441 118.012 85.841  1.00 69.55  ? 182  ARG B NH1 1 
ATOM   3739  N  NH2 . ARG B 1 204 ? -15.603 118.273 85.113  1.00 72.98  ? 182  ARG B NH2 1 
ATOM   3740  N  N   . ALA B 1 205 ? -13.047 111.514 81.590  1.00 36.82  ? 183  ALA B N   1 
ATOM   3741  C  CA  . ALA B 1 205 ? -13.719 110.571 80.695  1.00 36.77  ? 183  ALA B CA  1 
ATOM   3742  C  C   . ALA B 1 205 ? -13.862 109.212 81.359  1.00 33.03  ? 183  ALA B C   1 
ATOM   3743  O  O   . ALA B 1 205 ? -14.832 108.496 81.131  1.00 32.98  ? 183  ALA B O   1 
ATOM   3744  C  CB  . ALA B 1 205 ? -12.945 110.435 79.394  1.00 36.33  ? 183  ALA B CB  1 
ATOM   3745  N  N   . LEU B 1 206 ? -12.887 108.863 82.186  1.00 33.86  ? 184  LEU B N   1 
ATOM   3746  C  CA  . LEU B 1 206 ? -12.921 107.590 82.898  1.00 33.67  ? 184  LEU B CA  1 
ATOM   3747  C  C   . LEU B 1 206 ? -13.840 107.684 84.121  1.00 35.83  ? 184  LEU B C   1 
ATOM   3748  O  O   . LEU B 1 206 ? -13.991 106.717 84.871  1.00 39.53  ? 184  LEU B O   1 
ATOM   3749  C  CB  . LEU B 1 206 ? -11.504 107.184 83.306  1.00 29.82  ? 184  LEU B CB  1 
ATOM   3750  C  CG  . LEU B 1 206 ? -10.614 106.816 82.104  1.00 27.15  ? 184  LEU B CG  1 
ATOM   3751  C  CD1 . LEU B 1 206 ? -9.165  106.785 82.486  1.00 12.65  ? 184  LEU B CD1 1 
ATOM   3752  C  CD2 . LEU B 1 206 ? -11.037 105.469 81.556  1.00 23.04  ? 184  LEU B CD2 1 
ATOM   3753  N  N   . GLY B 1 207 ? -14.446 108.858 84.306  1.00 31.47  ? 185  GLY B N   1 
ATOM   3754  C  CA  . GLY B 1 207 ? -15.372 109.067 85.406  1.00 29.85  ? 185  GLY B CA  1 
ATOM   3755  C  C   . GLY B 1 207 ? -14.762 109.466 86.731  1.00 26.65  ? 185  GLY B C   1 
ATOM   3756  O  O   . GLY B 1 207 ? -15.455 109.508 87.747  1.00 16.25  ? 185  GLY B O   1 
ATOM   3757  N  N   . ALA B 1 208 ? -13.472 109.778 86.709  1.00 32.95  ? 186  ALA B N   1 
ATOM   3758  C  CA  . ALA B 1 208 ? -12.746 110.161 87.907  1.00 36.55  ? 186  ALA B CA  1 
ATOM   3759  C  C   . ALA B 1 208 ? -13.050 111.583 88.358  1.00 41.05  ? 186  ALA B C   1 
ATOM   3760  O  O   . ALA B 1 208 ? -13.072 112.511 87.546  1.00 44.58  ? 186  ALA B O   1 
ATOM   3761  C  CB  . ALA B 1 208 ? -11.244 110.008 87.665  1.00 40.70  ? 186  ALA B CB  1 
ATOM   3762  N  N   . GLU B 1 209 ? -13.273 111.746 89.659  1.00 41.72  ? 187  GLU B N   1 
ATOM   3763  C  CA  . GLU B 1 209 ? -13.542 113.051 90.236  1.00 43.83  ? 187  GLU B CA  1 
ATOM   3764  C  C   . GLU B 1 209 ? -12.210 113.751 90.459  1.00 46.61  ? 187  GLU B C   1 
ATOM   3765  O  O   . GLU B 1 209 ? -11.282 113.172 91.030  1.00 45.43  ? 187  GLU B O   1 
ATOM   3766  C  CB  . GLU B 1 209 ? -14.268 112.899 91.564  1.00 37.10  ? 187  GLU B CB  1 
ATOM   3767  C  CG  . GLU B 1 209 ? -15.567 112.150 91.448  1.00 41.86  ? 187  GLU B CG  1 
ATOM   3768  C  CD  . GLU B 1 209 ? -16.348 112.153 92.744  1.00 46.77  ? 187  GLU B CD  1 
ATOM   3769  O  OE1 . GLU B 1 209 ? -17.431 111.528 92.789  1.00 55.09  ? 187  GLU B OE1 1 
ATOM   3770  O  OE2 . GLU B 1 209 ? -15.880 112.784 93.716  1.00 40.01  ? 187  GLU B OE2 1 
ATOM   3771  N  N   . ILE B 1 210 ? -12.115 114.995 90.006  1.00 51.20  ? 188  ILE B N   1 
ATOM   3772  C  CA  . ILE B 1 210 ? -10.881 115.744 90.158  1.00 54.34  ? 188  ILE B CA  1 
ATOM   3773  C  C   . ILE B 1 210 ? -10.997 116.827 91.214  1.00 54.28  ? 188  ILE B C   1 
ATOM   3774  O  O   . ILE B 1 210 ? -12.010 117.511 91.306  1.00 56.53  ? 188  ILE B O   1 
ATOM   3775  C  CB  . ILE B 1 210 ? -10.456 116.373 88.825  1.00 50.79  ? 188  ILE B CB  1 
ATOM   3776  C  CG1 . ILE B 1 210 ? -10.249 115.263 87.793  1.00 53.94  ? 188  ILE B CG1 1 
ATOM   3777  C  CG2 . ILE B 1 210 ? -9.168  117.171 89.009  1.00 54.99  ? 188  ILE B CG2 1 
ATOM   3778  C  CD1 . ILE B 1 210 ? -9.905  115.762 86.412  1.00 63.53  ? 188  ILE B CD1 1 
ATOM   3779  N  N   . VAL B 1 211 ? -9.950  116.955 92.020  1.00 53.31  ? 189  VAL B N   1 
ATOM   3780  C  CA  . VAL B 1 211 ? -9.888  117.946 93.078  1.00 51.07  ? 189  VAL B CA  1 
ATOM   3781  C  C   . VAL B 1 211 ? -8.649  118.787 92.854  1.00 55.23  ? 189  VAL B C   1 
ATOM   3782  O  O   . VAL B 1 211 ? -7.527  118.272 92.863  1.00 55.80  ? 189  VAL B O   1 
ATOM   3783  C  CB  . VAL B 1 211 ? -9.798  117.276 94.460  1.00 53.36  ? 189  VAL B CB  1 
ATOM   3784  C  CG1 . VAL B 1 211 ? -9.483  118.312 95.531  1.00 52.00  ? 189  VAL B CG1 1 
ATOM   3785  C  CG2 . VAL B 1 211 ? -11.113 116.583 94.774  1.00 47.60  ? 189  VAL B CG2 1 
ATOM   3786  N  N   . ARG B 1 212 ? -8.863  120.082 92.644  1.00 62.64  ? 190  ARG B N   1 
ATOM   3787  C  CA  . ARG B 1 212 ? -7.775  121.031 92.408  1.00 68.14  ? 190  ARG B CA  1 
ATOM   3788  C  C   . ARG B 1 212 ? -7.354  121.728 93.704  1.00 71.95  ? 190  ARG B C   1 
ATOM   3789  O  O   . ARG B 1 212 ? -8.198  122.198 94.476  1.00 70.45  ? 190  ARG B O   1 
ATOM   3790  C  CB  . ARG B 1 212 ? -8.214  122.079 91.379  1.00 67.92  ? 190  ARG B CB  1 
ATOM   3791  C  CG  . ARG B 1 212 ? -8.622  121.484 90.044  1.00 72.64  ? 190  ARG B CG  1 
ATOM   3792  C  CD  . ARG B 1 212 ? -7.415  121.186 89.168  1.00 78.36  ? 190  ARG B CD  1 
ATOM   3793  N  NE  . ARG B 1 212 ? -7.011  122.354 88.390  1.00 78.40  ? 190  ARG B NE  1 
ATOM   3794  C  CZ  . ARG B 1 212 ? -7.791  122.954 87.496  1.00 80.77  ? 190  ARG B CZ  1 
ATOM   3795  N  NH1 . ARG B 1 212 ? -9.015  122.494 87.269  1.00 79.44  ? 190  ARG B NH1 1 
ATOM   3796  N  NH2 . ARG B 1 212 ? -7.347  124.010 86.827  1.00 83.51  ? 190  ARG B NH2 1 
ATOM   3797  N  N   . THR B 1 213 ? -6.045  121.786 93.939  1.00 75.01  ? 191  THR B N   1 
ATOM   3798  C  CA  . THR B 1 213 ? -5.506  122.428 95.131  1.00 77.80  ? 191  THR B CA  1 
ATOM   3799  C  C   . THR B 1 213 ? -4.790  123.710 94.732  1.00 81.66  ? 191  THR B C   1 
ATOM   3800  O  O   . THR B 1 213 ? -4.223  123.799 93.640  1.00 85.86  ? 191  THR B O   1 
ATOM   3801  C  CB  . THR B 1 213 ? -4.489  121.524 95.856  1.00 74.25  ? 191  THR B CB  1 
ATOM   3802  O  OG1 . THR B 1 213 ? -3.333  121.338 95.026  1.00 73.15  ? 191  THR B OG1 1 
ATOM   3803  C  CG2 . THR B 1 213 ? -5.108  120.175 96.165  1.00 72.48  ? 191  THR B CG2 1 
ATOM   3804  N  N   . PRO B 1 214 ? -4.811  124.724 95.611  1.00 82.63  ? 192  PRO B N   1 
ATOM   3805  C  CA  . PRO B 1 214 ? -4.148  126.001 95.329  1.00 85.19  ? 192  PRO B CA  1 
ATOM   3806  C  C   . PRO B 1 214 ? -2.651  125.841 95.015  1.00 89.92  ? 192  PRO B C   1 
ATOM   3807  O  O   . PRO B 1 214 ? -2.262  125.733 93.848  1.00 90.58  ? 192  PRO B O   1 
ATOM   3808  C  CB  . PRO B 1 214 ? -4.407  126.814 96.600  1.00 82.22  ? 192  PRO B CB  1 
ATOM   3809  C  CG  . PRO B 1 214 ? -4.581  125.754 97.666  1.00 82.62  ? 192  PRO B CG  1 
ATOM   3810  C  CD  . PRO B 1 214 ? -5.420  124.730 96.953  1.00 81.66  ? 192  PRO B CD  1 
ATOM   3811  N  N   . THR B 1 215 ? -1.819  125.820 96.056  1.00 93.59  ? 193  THR B N   1 
ATOM   3812  C  CA  . THR B 1 215 ? -0.370  125.670 95.896  1.00 93.68  ? 193  THR B CA  1 
ATOM   3813  C  C   . THR B 1 215 ? 0.171   126.478 94.716  1.00 90.82  ? 193  THR B C   1 
ATOM   3814  O  O   . THR B 1 215 ? 0.457   125.931 93.649  1.00 88.81  ? 193  THR B O   1 
ATOM   3815  C  CB  . THR B 1 215 ? -0.005  124.188 95.724  1.00 94.81  ? 193  THR B CB  1 
ATOM   3816  N  N   . GLU B 1 223 ? 2.445   118.126 102.339 1.00 68.31  ? 201  GLU B N   1 
ATOM   3817  C  CA  . GLU B 1 223 ? 2.360   118.845 101.070 1.00 73.00  ? 201  GLU B CA  1 
ATOM   3818  C  C   . GLU B 1 223 ? 1.034   119.595 100.916 1.00 79.38  ? 201  GLU B C   1 
ATOM   3819  O  O   . GLU B 1 223 ? 0.324   119.828 101.904 1.00 83.43  ? 201  GLU B O   1 
ATOM   3820  C  CB  . GLU B 1 223 ? 2.536   117.874 99.900  1.00 64.83  ? 201  GLU B CB  1 
ATOM   3821  N  N   . SER B 1 224 ? 0.706   119.965 99.676  1.00 78.92  ? 202  SER B N   1 
ATOM   3822  C  CA  . SER B 1 224 ? -0.530  120.696 99.389  1.00 78.13  ? 202  SER B CA  1 
ATOM   3823  C  C   . SER B 1 224 ? -1.653  119.767 98.930  1.00 77.28  ? 202  SER B C   1 
ATOM   3824  O  O   . SER B 1 224 ? -2.658  119.602 99.629  1.00 76.05  ? 202  SER B O   1 
ATOM   3825  C  CB  . SER B 1 224 ? -0.279  121.769 98.324  1.00 80.35  ? 202  SER B CB  1 
ATOM   3826  O  OG  . SER B 1 224 ? 0.108   121.189 97.090  1.00 84.17  ? 202  SER B OG  1 
ATOM   3827  N  N   . HIS B 1 225 ? -1.490  119.166 97.753  1.00 75.32  ? 203  HIS B N   1 
ATOM   3828  C  CA  . HIS B 1 225 ? -2.502  118.250 97.239  1.00 70.41  ? 203  HIS B CA  1 
ATOM   3829  C  C   . HIS B 1 225 ? -2.464  116.942 98.029  1.00 67.32  ? 203  HIS B C   1 
ATOM   3830  O  O   . HIS B 1 225 ? -3.481  116.261 98.174  1.00 69.49  ? 203  HIS B O   1 
ATOM   3831  C  CB  . HIS B 1 225 ? -2.302  117.978 95.736  1.00 67.17  ? 203  HIS B CB  1 
ATOM   3832  C  CG  . HIS B 1 225 ? -0.978  117.370 95.388  1.00 72.46  ? 203  HIS B CG  1 
ATOM   3833  N  ND1 . HIS B 1 225 ? -0.746  116.746 94.180  1.00 75.06  ? 203  HIS B ND1 1 
ATOM   3834  C  CD2 . HIS B 1 225 ? 0.191   117.310 96.071  1.00 74.35  ? 203  HIS B CD2 1 
ATOM   3835  C  CE1 . HIS B 1 225 ? 0.507   116.328 94.135  1.00 75.77  ? 203  HIS B CE1 1 
ATOM   3836  N  NE2 . HIS B 1 225 ? 1.097   116.658 95.270  1.00 75.04  ? 203  HIS B NE2 1 
ATOM   3837  N  N   . VAL B 1 226 ? -1.290  116.601 98.551  1.00 60.13  ? 204  VAL B N   1 
ATOM   3838  C  CA  . VAL B 1 226 ? -1.132  115.386 99.333  1.00 50.57  ? 204  VAL B CA  1 
ATOM   3839  C  C   . VAL B 1 226 ? -1.917  115.550 100.639 1.00 53.48  ? 204  VAL B C   1 
ATOM   3840  O  O   . VAL B 1 226 ? -2.547  114.606 101.125 1.00 53.67  ? 204  VAL B O   1 
ATOM   3841  C  CB  . VAL B 1 226 ? 0.351   115.123 99.654  1.00 44.50  ? 204  VAL B CB  1 
ATOM   3842  C  CG1 . VAL B 1 226 ? 0.499   113.792 100.364 1.00 41.24  ? 204  VAL B CG1 1 
ATOM   3843  C  CG2 . VAL B 1 226 ? 1.166   115.137 98.376  1.00 34.45  ? 204  VAL B CG2 1 
ATOM   3844  N  N   . GLY B 1 227 ? -1.887  116.759 101.192 1.00 49.40  ? 205  GLY B N   1 
ATOM   3845  C  CA  . GLY B 1 227 ? -2.600  117.020 102.423 1.00 47.96  ? 205  GLY B CA  1 
ATOM   3846  C  C   . GLY B 1 227 ? -4.099  116.921 102.219 1.00 52.43  ? 205  GLY B C   1 
ATOM   3847  O  O   . GLY B 1 227 ? -4.827  116.415 103.078 1.00 51.49  ? 205  GLY B O   1 
ATOM   3848  N  N   . VAL B 1 228 ? -4.567  117.408 101.075 1.00 55.05  ? 206  VAL B N   1 
ATOM   3849  C  CA  . VAL B 1 228 ? -5.991  117.374 100.755 1.00 56.03  ? 206  VAL B CA  1 
ATOM   3850  C  C   . VAL B 1 228 ? -6.431  115.939 100.516 1.00 58.40  ? 206  VAL B C   1 
ATOM   3851  O  O   . VAL B 1 228 ? -7.564  115.565 100.824 1.00 58.55  ? 206  VAL B O   1 
ATOM   3852  C  CB  . VAL B 1 228 ? -6.299  118.209 99.497  1.00 54.39  ? 206  VAL B CB  1 
ATOM   3853  C  CG1 . VAL B 1 228 ? -7.797  118.197 99.217  1.00 54.92  ? 206  VAL B CG1 1 
ATOM   3854  C  CG2 . VAL B 1 228 ? -5.800  119.629 99.689  1.00 42.16  ? 206  VAL B CG2 1 
ATOM   3855  N  N   . ALA B 1 229 ? -5.528  115.139 99.958  1.00 61.05  ? 207  ALA B N   1 
ATOM   3856  C  CA  . ALA B 1 229 ? -5.818  113.737 99.702  1.00 60.16  ? 207  ALA B CA  1 
ATOM   3857  C  C   . ALA B 1 229 ? -6.145  113.105 101.055 1.00 57.55  ? 207  ALA B C   1 
ATOM   3858  O  O   . ALA B 1 229 ? -7.244  112.579 101.271 1.00 54.00  ? 207  ALA B O   1 
ATOM   3859  C  CB  . ALA B 1 229 ? -4.601  113.054 99.075  1.00 54.38  ? 207  ALA B CB  1 
ATOM   3860  N  N   . TRP B 1 230 ? -5.184  113.188 101.971 1.00 55.91  ? 208  TRP B N   1 
ATOM   3861  C  CA  . TRP B 1 230 ? -5.357  112.626 103.304 1.00 54.51  ? 208  TRP B CA  1 
ATOM   3862  C  C   . TRP B 1 230 ? -6.510  113.244 104.095 1.00 51.67  ? 208  TRP B C   1 
ATOM   3863  O  O   . TRP B 1 230 ? -7.104  112.585 104.948 1.00 45.09  ? 208  TRP B O   1 
ATOM   3864  C  CB  . TRP B 1 230 ? -4.046  112.721 104.089 1.00 55.31  ? 208  TRP B CB  1 
ATOM   3865  C  CG  . TRP B 1 230 ? -3.417  111.386 104.253 1.00 58.31  ? 208  TRP B CG  1 
ATOM   3866  C  CD1 . TRP B 1 230 ? -3.688  110.476 105.224 1.00 60.02  ? 208  TRP B CD1 1 
ATOM   3867  C  CD2 . TRP B 1 230 ? -2.479  110.758 103.363 1.00 62.20  ? 208  TRP B CD2 1 
ATOM   3868  N  NE1 . TRP B 1 230 ? -2.986  109.316 104.999 1.00 62.75  ? 208  TRP B NE1 1 
ATOM   3869  C  CE2 . TRP B 1 230 ? -2.234  109.462 103.863 1.00 62.24  ? 208  TRP B CE2 1 
ATOM   3870  C  CE3 . TRP B 1 230 ? -1.823  111.166 102.190 1.00 64.22  ? 208  TRP B CE3 1 
ATOM   3871  C  CZ2 . TRP B 1 230 ? -1.359  108.562 103.231 1.00 63.87  ? 208  TRP B CZ2 1 
ATOM   3872  C  CZ3 . TRP B 1 230 ? -0.951  110.272 101.560 1.00 63.31  ? 208  TRP B CZ3 1 
ATOM   3873  C  CH2 . TRP B 1 230 ? -0.729  108.985 102.086 1.00 63.22  ? 208  TRP B CH2 1 
ATOM   3874  N  N   . ARG B 1 231 ? -6.838  114.499 103.808 1.00 49.52  ? 209  ARG B N   1 
ATOM   3875  C  CA  . ARG B 1 231 ? -7.943  115.154 104.497 1.00 47.42  ? 209  ARG B CA  1 
ATOM   3876  C  C   . ARG B 1 231 ? -9.234  114.455 104.077 1.00 45.33  ? 209  ARG B C   1 
ATOM   3877  O  O   . ARG B 1 231 ? -10.027 114.025 104.915 1.00 38.22  ? 209  ARG B O   1 
ATOM   3878  C  CB  . ARG B 1 231 ? -8.013  116.636 104.105 1.00 56.94  ? 209  ARG B CB  1 
ATOM   3879  C  CG  . ARG B 1 231 ? -9.080  117.441 104.850 1.00 57.36  ? 209  ARG B CG  1 
ATOM   3880  C  CD  . ARG B 1 231 ? -9.469  118.703 104.080 1.00 66.25  ? 209  ARG B CD  1 
ATOM   3881  N  NE  . ARG B 1 231 ? -10.241 118.392 102.875 1.00 72.47  ? 209  ARG B NE  1 
ATOM   3882  C  CZ  . ARG B 1 231 ? -10.735 119.300 102.036 1.00 76.25  ? 209  ARG B CZ  1 
ATOM   3883  N  NH1 . ARG B 1 231 ? -10.542 120.594 102.262 1.00 81.37  ? 209  ARG B NH1 1 
ATOM   3884  N  NH2 . ARG B 1 231 ? -11.429 118.913 100.972 1.00 75.83  ? 209  ARG B NH2 1 
ATOM   3885  N  N   . LEU B 1 232 ? -9.421  114.342 102.762 1.00 44.36  ? 210  LEU B N   1 
ATOM   3886  C  CA  . LEU B 1 232 ? -10.600 113.717 102.180 1.00 42.08  ? 210  LEU B CA  1 
ATOM   3887  C  C   . LEU B 1 232 ? -10.770 112.281 102.613 1.00 43.30  ? 210  LEU B C   1 
ATOM   3888  O  O   . LEU B 1 232 ? -11.894 111.817 102.794 1.00 47.68  ? 210  LEU B O   1 
ATOM   3889  C  CB  . LEU B 1 232 ? -10.523 113.769 100.660 1.00 35.29  ? 210  LEU B CB  1 
ATOM   3890  C  CG  . LEU B 1 232 ? -10.557 115.181 100.067 1.00 45.04  ? 210  LEU B CG  1 
ATOM   3891  C  CD1 . LEU B 1 232 ? -9.999  115.165 98.647  1.00 33.28  ? 210  LEU B CD1 1 
ATOM   3892  C  CD2 . LEU B 1 232 ? -11.987 115.723 100.114 1.00 41.74  ? 210  LEU B CD2 1 
ATOM   3893  N  N   . LYS B 1 233 ? -9.661  111.571 102.771 1.00 39.58  ? 211  LYS B N   1 
ATOM   3894  C  CA  . LYS B 1 233 ? -9.739  110.175 103.172 1.00 44.55  ? 211  LYS B CA  1 
ATOM   3895  C  C   . LYS B 1 233 ? -10.457 110.028 104.504 1.00 47.32  ? 211  LYS B C   1 
ATOM   3896  O  O   . LYS B 1 233 ? -11.223 109.083 104.698 1.00 45.04  ? 211  LYS B O   1 
ATOM   3897  C  CB  . LYS B 1 233 ? -8.344  109.560 103.279 1.00 40.84  ? 211  LYS B CB  1 
ATOM   3898  C  CG  . LYS B 1 233 ? -8.382  108.107 103.717 1.00 41.59  ? 211  LYS B CG  1 
ATOM   3899  C  CD  . LYS B 1 233 ? -6.994  107.532 103.938 1.00 40.26  ? 211  LYS B CD  1 
ATOM   3900  C  CE  . LYS B 1 233 ? -7.102  106.081 104.375 1.00 46.03  ? 211  LYS B CE  1 
ATOM   3901  N  NZ  . LYS B 1 233 ? -7.916  105.942 105.625 1.00 44.16  ? 211  LYS B NZ  1 
ATOM   3902  N  N   . ASN B 1 234 ? -10.204 110.966 105.417 1.00 51.44  ? 212  ASN B N   1 
ATOM   3903  C  CA  . ASN B 1 234 ? -10.824 110.944 106.741 1.00 54.18  ? 212  ASN B CA  1 
ATOM   3904  C  C   . ASN B 1 234 ? -12.238 111.491 106.690 1.00 56.63  ? 212  ASN B C   1 
ATOM   3905  O  O   . ASN B 1 234 ? -13.039 111.240 107.585 1.00 61.55  ? 212  ASN B O   1 
ATOM   3906  C  CB  . ASN B 1 234 ? -10.016 111.773 107.737 1.00 56.38  ? 212  ASN B CB  1 
ATOM   3907  C  CG  . ASN B 1 234 ? -8.597  111.274 107.897 1.00 64.84  ? 212  ASN B CG  1 
ATOM   3908  O  OD1 . ASN B 1 234 ? -8.373  110.098 108.189 1.00 73.17  ? 212  ASN B OD1 1 
ATOM   3909  N  ND2 . ASN B 1 234 ? -7.626  112.170 107.714 1.00 66.85  ? 212  ASN B ND2 1 
ATOM   3910  N  N   . GLU B 1 235 ? -12.546 112.237 105.638 1.00 58.57  ? 213  GLU B N   1 
ATOM   3911  C  CA  . GLU B 1 235 ? -13.864 112.826 105.508 1.00 61.51  ? 213  GLU B CA  1 
ATOM   3912  C  C   . GLU B 1 235 ? -14.821 111.985 104.695 1.00 57.45  ? 213  GLU B C   1 
ATOM   3913  O  O   . GLU B 1 235 ? -16.026 112.215 104.730 1.00 61.80  ? 213  GLU B O   1 
ATOM   3914  C  CB  . GLU B 1 235 ? -13.749 114.214 104.888 1.00 70.41  ? 213  GLU B CB  1 
ATOM   3915  C  CG  . GLU B 1 235 ? -12.873 115.166 105.690 1.00 80.35  ? 213  GLU B CG  1 
ATOM   3916  C  CD  . GLU B 1 235 ? -12.876 116.585 105.139 1.00 86.95  ? 213  GLU B CD  1 
ATOM   3917  O  OE1 . GLU B 1 235 ? -12.225 117.462 105.753 1.00 85.73  ? 213  GLU B OE1 1 
ATOM   3918  O  OE2 . GLU B 1 235 ? -13.528 116.822 104.094 1.00 90.46  ? 213  GLU B OE2 1 
ATOM   3919  N  N   . ILE B 1 236 ? -14.299 111.011 103.963 1.00 52.21  ? 214  ILE B N   1 
ATOM   3920  C  CA  . ILE B 1 236 ? -15.165 110.173 103.143 1.00 51.06  ? 214  ILE B CA  1 
ATOM   3921  C  C   . ILE B 1 236 ? -15.127 108.711 103.568 1.00 49.10  ? 214  ILE B C   1 
ATOM   3922  O  O   . ILE B 1 236 ? -14.076 108.071 103.544 1.00 50.67  ? 214  ILE B O   1 
ATOM   3923  C  CB  . ILE B 1 236 ? -14.783 110.264 101.660 1.00 50.70  ? 214  ILE B CB  1 
ATOM   3924  C  CG1 . ILE B 1 236 ? -14.660 111.733 101.247 1.00 55.20  ? 214  ILE B CG1 1 
ATOM   3925  C  CG2 . ILE B 1 236 ? -15.841 109.566 100.814 1.00 54.23  ? 214  ILE B CG2 1 
ATOM   3926  C  CD1 . ILE B 1 236 ? -14.003 111.948 99.888  1.00 49.49  ? 214  ILE B CD1 1 
ATOM   3927  N  N   . PRO B 1 237 ? -16.286 108.162 103.960 1.00 48.74  ? 215  PRO B N   1 
ATOM   3928  C  CA  . PRO B 1 237 ? -16.400 106.767 104.396 1.00 46.27  ? 215  PRO B CA  1 
ATOM   3929  C  C   . PRO B 1 237 ? -15.967 105.844 103.262 1.00 44.36  ? 215  PRO B C   1 
ATOM   3930  O  O   . PRO B 1 237 ? -16.200 106.152 102.096 1.00 38.39  ? 215  PRO B O   1 
ATOM   3931  C  CB  . PRO B 1 237 ? -17.892 106.617 104.702 1.00 52.47  ? 215  PRO B CB  1 
ATOM   3932  C  CG  . PRO B 1 237 ? -18.352 108.022 104.968 1.00 49.76  ? 215  PRO B CG  1 
ATOM   3933  C  CD  . PRO B 1 237 ? -17.607 108.812 103.936 1.00 48.86  ? 215  PRO B CD  1 
ATOM   3934  N  N   . ASN B 1 238 ? -15.347 104.719 103.611 1.00 42.00  ? 216  ASN B N   1 
ATOM   3935  C  CA  . ASN B 1 238 ? -14.868 103.729 102.635 1.00 40.21  ? 216  ASN B CA  1 
ATOM   3936  C  C   . ASN B 1 238 ? -13.835 104.271 101.664 1.00 35.87  ? 216  ASN B C   1 
ATOM   3937  O  O   . ASN B 1 238 ? -13.827 103.907 100.491 1.00 38.21  ? 216  ASN B O   1 
ATOM   3938  C  CB  . ASN B 1 238 ? -16.033 103.126 101.838 1.00 33.33  ? 216  ASN B CB  1 
ATOM   3939  C  CG  . ASN B 1 238 ? -17.004 102.364 102.718 1.00 31.84  ? 216  ASN B CG  1 
ATOM   3940  O  OD1 . ASN B 1 238 ? -16.594 101.600 103.589 1.00 15.03  ? 216  ASN B OD1 1 
ATOM   3941  N  ND2 . ASN B 1 238 ? -18.295 102.559 102.488 1.00 21.13  ? 216  ASN B ND2 1 
ATOM   3942  N  N   . SER B 1 239 ? -12.966 105.136 102.167 1.00 33.82  ? 217  SER B N   1 
ATOM   3943  C  CA  . SER B 1 239 ? -11.915 105.738 101.363 1.00 32.62  ? 217  SER B CA  1 
ATOM   3944  C  C   . SER B 1 239 ? -10.611 105.007 101.572 1.00 31.68  ? 217  SER B C   1 
ATOM   3945  O  O   . SER B 1 239 ? -10.357 104.474 102.657 1.00 29.71  ? 217  SER B O   1 
ATOM   3946  C  CB  . SER B 1 239 ? -11.712 107.210 101.741 1.00 30.04  ? 217  SER B CB  1 
ATOM   3947  O  OG  . SER B 1 239 ? -12.702 108.022 101.160 1.00 33.95  ? 217  SER B OG  1 
ATOM   3948  N  N   . HIS B 1 240 ? -9.790  105.001 100.526 1.00 30.40  ? 218  HIS B N   1 
ATOM   3949  C  CA  . HIS B 1 240 ? -8.490  104.354 100.567 1.00 33.61  ? 218  HIS B CA  1 
ATOM   3950  C  C   . HIS B 1 240 ? -7.553  105.122 99.673  1.00 32.16  ? 218  HIS B C   1 
ATOM   3951  O  O   . HIS B 1 240 ? -7.920  105.494 98.564  1.00 32.95  ? 218  HIS B O   1 
ATOM   3952  C  CB  . HIS B 1 240 ? -8.564  102.916 100.041 1.00 39.69  ? 218  HIS B CB  1 
ATOM   3953  C  CG  . HIS B 1 240 ? -9.584  102.063 100.727 1.00 43.61  ? 218  HIS B CG  1 
ATOM   3954  N  ND1 . HIS B 1 240 ? -9.334  101.405 101.913 1.00 49.55  ? 218  HIS B ND1 1 
ATOM   3955  C  CD2 . HIS B 1 240 ? -10.864 101.774 100.399 1.00 46.65  ? 218  HIS B CD2 1 
ATOM   3956  C  CE1 . HIS B 1 240 ? -10.418 100.747 102.284 1.00 43.63  ? 218  HIS B CE1 1 
ATOM   3957  N  NE2 . HIS B 1 240 ? -11.360 100.955 101.383 1.00 50.48  ? 218  HIS B NE2 1 
ATOM   3958  N  N   . ILE B 1 241 ? -6.348  105.369 100.169 1.00 36.13  ? 219  ILE B N   1 
ATOM   3959  C  CA  . ILE B 1 241 ? -5.332  106.043 99.390  1.00 34.25  ? 219  ILE B CA  1 
ATOM   3960  C  C   . ILE B 1 241 ? -4.317  104.946 99.170  1.00 39.09  ? 219  ILE B C   1 
ATOM   3961  O  O   . ILE B 1 241 ? -3.602  104.563 100.092 1.00 41.47  ? 219  ILE B O   1 
ATOM   3962  C  CB  . ILE B 1 241 ? -4.688  107.204 100.153 1.00 34.09  ? 219  ILE B CB  1 
ATOM   3963  C  CG1 . ILE B 1 241 ? -5.695  108.361 100.265 1.00 23.19  ? 219  ILE B CG1 1 
ATOM   3964  C  CG2 . ILE B 1 241 ? -3.404  107.637 99.436  1.00 21.93  ? 219  ILE B CG2 1 
ATOM   3965  C  CD1 . ILE B 1 241 ? -5.278  109.440 101.234 1.00 32.76  ? 219  ILE B CD1 1 
ATOM   3966  N  N   . LEU B 1 242 ? -4.281  104.417 97.952  1.00 40.62  ? 220  LEU B N   1 
ATOM   3967  C  CA  . LEU B 1 242 ? -3.362  103.341 97.641  1.00 40.03  ? 220  LEU B CA  1 
ATOM   3968  C  C   . LEU B 1 242 ? -1.911  103.762 97.860  1.00 38.72  ? 220  LEU B C   1 
ATOM   3969  O  O   . LEU B 1 242 ? -1.176  103.062 98.551  1.00 42.40  ? 220  LEU B O   1 
ATOM   3970  C  CB  . LEU B 1 242 ? -3.629  102.835 96.216  1.00 38.11  ? 220  LEU B CB  1 
ATOM   3971  C  CG  . LEU B 1 242 ? -5.020  102.195 96.224  1.00 23.57  ? 220  LEU B CG  1 
ATOM   3972  C  CD1 . LEU B 1 242 ? -5.441  101.774 94.852  1.00 22.75  ? 220  LEU B CD1 1 
ATOM   3973  C  CD2 . LEU B 1 242 ? -4.991  101.009 97.177  1.00 30.80  ? 220  LEU B CD2 1 
ATOM   3974  N  N   . ASP B 1 243 ? -1.499  104.894 97.290  1.00 35.79  ? 221  ASP B N   1 
ATOM   3975  C  CA  . ASP B 1 243 ? -0.134  105.415 97.493  1.00 38.63  ? 221  ASP B CA  1 
ATOM   3976  C  C   . ASP B 1 243 ? 1.010   104.622 96.853  1.00 36.05  ? 221  ASP B C   1 
ATOM   3977  O  O   . ASP B 1 243 ? 1.617   103.752 97.480  1.00 38.03  ? 221  ASP B O   1 
ATOM   3978  C  CB  . ASP B 1 243 ? 0.133   105.577 99.008  1.00 34.77  ? 221  ASP B CB  1 
ATOM   3979  C  CG  . ASP B 1 243 ? 1.501   106.187 99.315  1.00 31.38  ? 221  ASP B CG  1 
ATOM   3980  O  OD1 . ASP B 1 243 ? 1.855   106.323 100.519 1.00 18.80  ? 221  ASP B OD1 1 
ATOM   3981  O  OD2 . ASP B 1 243 ? 2.218   106.529 98.354  1.00 26.65  ? 221  ASP B OD2 1 
ATOM   3982  N  N   . GLN B 1 244 ? 1.324   104.972 95.613  1.00 36.06  ? 222  GLN B N   1 
ATOM   3983  C  CA  . GLN B 1 244 ? 2.376   104.323 94.836  1.00 34.41  ? 222  GLN B CA  1 
ATOM   3984  C  C   . GLN B 1 244 ? 3.789   104.445 95.396  1.00 34.65  ? 222  GLN B C   1 
ATOM   3985  O  O   . GLN B 1 244 ? 4.672   103.657 95.056  1.00 31.15  ? 222  GLN B O   1 
ATOM   3986  C  CB  . GLN B 1 244 ? 2.366   104.900 93.424  1.00 40.13  ? 222  GLN B CB  1 
ATOM   3987  C  CG  . GLN B 1 244 ? 2.443   106.417 93.421  1.00 41.76  ? 222  GLN B CG  1 
ATOM   3988  C  CD  . GLN B 1 244 ? 2.226   107.016 92.060  1.00 42.92  ? 222  GLN B CD  1 
ATOM   3989  O  OE1 . GLN B 1 244 ? 1.660   108.100 91.937  1.00 40.18  ? 222  GLN B OE1 1 
ATOM   3990  N  NE2 . GLN B 1 244 ? 2.681   106.320 91.024  1.00 41.90  ? 222  GLN B NE2 1 
ATOM   3991  N  N   . TYR B 1 245 ? 4.012   105.435 96.248  1.00 40.58  ? 223  TYR B N   1 
ATOM   3992  C  CA  . TYR B 1 245 ? 5.338   105.651 96.800  1.00 37.34  ? 223  TYR B CA  1 
ATOM   3993  C  C   . TYR B 1 245 ? 5.719   104.713 97.929  1.00 36.43  ? 223  TYR B C   1 
ATOM   3994  O  O   . TYR B 1 245 ? 6.908   104.485 98.158  1.00 36.29  ? 223  TYR B O   1 
ATOM   3995  C  CB  . TYR B 1 245 ? 5.482   107.122 97.223  1.00 41.08  ? 223  TYR B CB  1 
ATOM   3996  C  CG  . TYR B 1 245 ? 5.592   108.078 96.036  1.00 40.28  ? 223  TYR B CG  1 
ATOM   3997  C  CD1 . TYR B 1 245 ? 6.780   108.180 95.305  1.00 43.26  ? 223  TYR B CD1 1 
ATOM   3998  C  CD2 . TYR B 1 245 ? 4.491   108.824 95.606  1.00 34.15  ? 223  TYR B CD2 1 
ATOM   3999  C  CE1 . TYR B 1 245 ? 6.867   108.991 94.176  1.00 41.78  ? 223  TYR B CE1 1 
ATOM   4000  C  CE2 . TYR B 1 245 ? 4.566   109.635 94.485  1.00 37.51  ? 223  TYR B CE2 1 
ATOM   4001  C  CZ  . TYR B 1 245 ? 5.757   109.715 93.770  1.00 49.03  ? 223  TYR B CZ  1 
ATOM   4002  O  OH  . TYR B 1 245 ? 5.834   110.517 92.645  1.00 53.80  ? 223  TYR B OH  1 
ATOM   4003  N  N   . ARG B 1 246 ? 4.729   104.157 98.626  1.00 36.81  ? 224  ARG B N   1 
ATOM   4004  C  CA  . ARG B 1 246 ? 5.021   103.234 99.729  1.00 37.23  ? 224  ARG B CA  1 
ATOM   4005  C  C   . ARG B 1 246 ? 4.431   101.837 99.578  1.00 38.13  ? 224  ARG B C   1 
ATOM   4006  O  O   . ARG B 1 246 ? 4.888   100.895 100.232 1.00 37.42  ? 224  ARG B O   1 
ATOM   4007  C  CB  . ARG B 1 246 ? 4.545   103.808 101.070 1.00 35.71  ? 224  ARG B CB  1 
ATOM   4008  C  CG  . ARG B 1 246 ? 5.307   105.044 101.547 1.00 40.93  ? 224  ARG B CG  1 
ATOM   4009  C  CD  . ARG B 1 246 ? 5.135   105.289 103.045 1.00 45.98  ? 224  ARG B CD  1 
ATOM   4010  N  NE  . ARG B 1 246 ? 5.891   104.349 103.880 1.00 57.74  ? 224  ARG B NE  1 
ATOM   4011  C  CZ  . ARG B 1 246 ? 5.345   103.412 104.653 1.00 62.20  ? 224  ARG B CZ  1 
ATOM   4012  N  NH1 . ARG B 1 246 ? 4.025   103.273 104.704 1.00 66.70  ? 224  ARG B NH1 1 
ATOM   4013  N  NH2 . ARG B 1 246 ? 6.118   102.627 105.394 1.00 63.85  ? 224  ARG B NH2 1 
ATOM   4014  N  N   . ASN B 1 247 ? 3.423   101.699 98.719  1.00 34.43  ? 225  ASN B N   1 
ATOM   4015  C  CA  . ASN B 1 247 ? 2.765   100.408 98.526  1.00 28.09  ? 225  ASN B CA  1 
ATOM   4016  C  C   . ASN B 1 247 ? 3.597   99.348  97.796  1.00 24.51  ? 225  ASN B C   1 
ATOM   4017  O  O   . ASN B 1 247 ? 3.882   99.466  96.606  1.00 17.08  ? 225  ASN B O   1 
ATOM   4018  C  CB  . ASN B 1 247 ? 1.441   100.596 97.796  1.00 22.33  ? 225  ASN B CB  1 
ATOM   4019  C  CG  . ASN B 1 247 ? 0.527   99.400  97.943  1.00 23.35  ? 225  ASN B CG  1 
ATOM   4020  O  OD1 . ASN B 1 247 ? 0.967   98.252  97.875  1.00 28.71  ? 225  ASN B OD1 1 
ATOM   4021  N  ND2 . ASN B 1 247 ? -0.758  99.663  98.138  1.00 23.54  ? 225  ASN B ND2 1 
ATOM   4022  N  N   . ALA B 1 248 ? 3.951   98.298  98.529  1.00 22.70  ? 226  ALA B N   1 
ATOM   4023  C  CA  . ALA B 1 248 ? 4.744   97.198  98.005  1.00 29.13  ? 226  ALA B CA  1 
ATOM   4024  C  C   . ALA B 1 248 ? 4.212   96.605  96.707  1.00 31.98  ? 226  ALA B C   1 
ATOM   4025  O  O   . ALA B 1 248 ? 4.980   96.071  95.907  1.00 35.90  ? 226  ALA B O   1 
ATOM   4026  C  CB  . ALA B 1 248 ? 4.859   96.099  99.061  1.00 34.57  ? 226  ALA B CB  1 
ATOM   4027  N  N   . SER B 1 249 ? 2.899   96.687  96.507  1.00 30.53  ? 227  SER B N   1 
ATOM   4028  C  CA  . SER B 1 249 ? 2.273   96.146  95.305  1.00 24.93  ? 227  SER B CA  1 
ATOM   4029  C  C   . SER B 1 249 ? 2.917   96.726  94.043  1.00 19.81  ? 227  SER B C   1 
ATOM   4030  O  O   . SER B 1 249 ? 2.942   96.089  92.992  1.00 16.42  ? 227  SER B O   1 
ATOM   4031  C  CB  . SER B 1 249 ? 0.770   96.458  95.314  1.00 31.60  ? 227  SER B CB  1 
ATOM   4032  O  OG  . SER B 1 249 ? 0.132   95.881  96.437  1.00 30.27  ? 227  SER B OG  1 
ATOM   4033  N  N   . ASN B 1 250 ? 3.451   97.933  94.161  1.00 18.41  ? 228  ASN B N   1 
ATOM   4034  C  CA  . ASN B 1 250 ? 4.073   98.583  93.031  1.00 21.49  ? 228  ASN B CA  1 
ATOM   4035  C  C   . ASN B 1 250 ? 5.294   97.807  92.588  1.00 19.78  ? 228  ASN B C   1 
ATOM   4036  O  O   . ASN B 1 250 ? 5.277   97.176  91.540  1.00 19.20  ? 228  ASN B O   1 
ATOM   4037  C  CB  . ASN B 1 250 ? 4.441   100.028 93.392  1.00 27.17  ? 228  ASN B CB  1 
ATOM   4038  C  CG  . ASN B 1 250 ? 5.231   100.726 92.295  1.00 30.89  ? 228  ASN B CG  1 
ATOM   4039  O  OD1 . ASN B 1 250 ? 5.612   100.108 91.301  1.00 29.76  ? 228  ASN B OD1 1 
ATOM   4040  N  ND2 . ASN B 1 250 ? 5.485   102.020 92.476  1.00 25.18  ? 228  ASN B ND2 1 
ATOM   4041  N  N   . PRO B 1 251 ? 6.373   97.825  93.382  1.00 24.62  ? 229  PRO B N   1 
ATOM   4042  C  CA  . PRO B 1 251 ? 7.553   97.078  92.943  1.00 28.51  ? 229  PRO B CA  1 
ATOM   4043  C  C   . PRO B 1 251 ? 7.277   95.597  92.773  1.00 31.42  ? 229  PRO B C   1 
ATOM   4044  O  O   . PRO B 1 251 ? 7.935   94.929  91.980  1.00 31.98  ? 229  PRO B O   1 
ATOM   4045  C  CB  . PRO B 1 251 ? 8.563   97.365  94.039  1.00 23.40  ? 229  PRO B CB  1 
ATOM   4046  C  CG  . PRO B 1 251 ? 7.696   97.512  95.237  1.00 26.93  ? 229  PRO B CG  1 
ATOM   4047  C  CD  . PRO B 1 251 ? 6.586   98.379  94.724  1.00 20.51  ? 229  PRO B CD  1 
ATOM   4048  N  N   . LEU B 1 252 ? 6.296   95.082  93.510  1.00 35.22  ? 230  LEU B N   1 
ATOM   4049  C  CA  . LEU B 1 252 ? 5.952   93.662  93.409  1.00 32.70  ? 230  LEU B CA  1 
ATOM   4050  C  C   . LEU B 1 252 ? 5.365   93.328  92.052  1.00 29.30  ? 230  LEU B C   1 
ATOM   4051  O  O   . LEU B 1 252 ? 5.660   92.271  91.483  1.00 28.34  ? 230  LEU B O   1 
ATOM   4052  C  CB  . LEU B 1 252 ? 4.985   93.254  94.518  1.00 32.04  ? 230  LEU B CB  1 
ATOM   4053  C  CG  . LEU B 1 252 ? 5.611   93.109  95.922  1.00 33.79  ? 230  LEU B CG  1 
ATOM   4054  C  CD1 . LEU B 1 252 ? 4.532   92.810  96.955  1.00 25.75  ? 230  LEU B CD1 1 
ATOM   4055  C  CD2 . LEU B 1 252 ? 6.640   92.000  95.922  1.00 22.57  ? 230  LEU B CD2 1 
ATOM   4056  N  N   . ALA B 1 253 ? 4.538   94.227  91.528  1.00 26.09  ? 231  ALA B N   1 
ATOM   4057  C  CA  . ALA B 1 253 ? 3.949   94.013  90.208  1.00 25.98  ? 231  ALA B CA  1 
ATOM   4058  C  C   . ALA B 1 253 ? 5.080   93.728  89.207  1.00 19.85  ? 231  ALA B C   1 
ATOM   4059  O  O   . ALA B 1 253 ? 5.038   92.741  88.470  1.00 21.05  ? 231  ALA B O   1 
ATOM   4060  C  CB  . ALA B 1 253 ? 3.143   95.261  89.776  1.00 17.09  ? 231  ALA B CB  1 
ATOM   4061  N  N   . HIS B 1 254 ? 6.098   94.589  89.220  1.00 17.18  ? 232  HIS B N   1 
ATOM   4062  C  CA  . HIS B 1 254 ? 7.249   94.478  88.337  1.00 11.07  ? 232  HIS B CA  1 
ATOM   4063  C  C   . HIS B 1 254 ? 8.174   93.298  88.603  1.00 15.28  ? 232  HIS B C   1 
ATOM   4064  O  O   . HIS B 1 254 ? 8.799   92.778  87.682  1.00 27.11  ? 232  HIS B O   1 
ATOM   4065  C  CB  . HIS B 1 254 ? 8.033   95.788  88.368  1.00 17.19  ? 232  HIS B CB  1 
ATOM   4066  C  CG  . HIS B 1 254 ? 7.243   96.965  87.883  1.00 18.03  ? 232  HIS B CG  1 
ATOM   4067  N  ND1 . HIS B 1 254 ? 6.723   97.038  86.608  1.00 20.92  ? 232  HIS B ND1 1 
ATOM   4068  C  CD2 . HIS B 1 254 ? 6.846   98.094  88.514  1.00 24.57  ? 232  HIS B CD2 1 
ATOM   4069  C  CE1 . HIS B 1 254 ? 6.039   98.161  86.476  1.00 25.71  ? 232  HIS B CE1 1 
ATOM   4070  N  NE2 . HIS B 1 254 ? 6.098   98.821  87.618  1.00 26.80  ? 232  HIS B NE2 1 
ATOM   4071  N  N   . TYR B 1 255 ? 8.263   92.855  89.849  1.00 23.90  ? 233  TYR B N   1 
ATOM   4072  C  CA  . TYR B 1 255 ? 9.112   91.714  90.198  1.00 19.81  ? 233  TYR B CA  1 
ATOM   4073  C  C   . TYR B 1 255 ? 8.408   90.442  89.785  1.00 24.84  ? 233  TYR B C   1 
ATOM   4074  O  O   . TYR B 1 255 ? 9.058   89.470  89.409  1.00 29.98  ? 233  TYR B O   1 
ATOM   4075  C  CB  . TYR B 1 255 ? 9.344   91.689  91.712  1.00 27.04  ? 233  TYR B CB  1 
ATOM   4076  C  CG  . TYR B 1 255 ? 10.056  90.472  92.288  1.00 29.07  ? 233  TYR B CG  1 
ATOM   4077  C  CD1 . TYR B 1 255 ? 11.440  90.355  92.221  1.00 30.94  ? 233  TYR B CD1 1 
ATOM   4078  C  CD2 . TYR B 1 255 ? 9.341   89.473  92.961  1.00 31.01  ? 233  TYR B CD2 1 
ATOM   4079  C  CE1 . TYR B 1 255 ? 12.101  89.285  92.814  1.00 34.58  ? 233  TYR B CE1 1 
ATOM   4080  C  CE2 . TYR B 1 255 ? 9.990   88.393  93.557  1.00 35.89  ? 233  TYR B CE2 1 
ATOM   4081  C  CZ  . TYR B 1 255 ? 11.369  88.308  93.485  1.00 36.96  ? 233  TYR B CZ  1 
ATOM   4082  O  OH  . TYR B 1 255 ? 12.011  87.262  94.106  1.00 37.50  ? 233  TYR B OH  1 
ATOM   4083  N  N   . ASP B 1 256 ? 7.074   90.464  89.871  1.00 27.19  ? 234  ASP B N   1 
ATOM   4084  C  CA  . ASP B 1 256 ? 6.225   89.316  89.539  1.00 27.09  ? 234  ASP B CA  1 
ATOM   4085  C  C   . ASP B 1 256 ? 5.860   89.114  88.068  1.00 28.22  ? 234  ASP B C   1 
ATOM   4086  O  O   . ASP B 1 256 ? 5.827   87.973  87.581  1.00 23.98  ? 234  ASP B O   1 
ATOM   4087  C  CB  . ASP B 1 256 ? 4.919   89.368  90.341  1.00 21.42  ? 234  ASP B CB  1 
ATOM   4088  C  CG  . ASP B 1 256 ? 5.103   88.982  91.787  1.00 24.76  ? 234  ASP B CG  1 
ATOM   4089  O  OD1 . ASP B 1 256 ? 6.153   88.385  92.128  1.00 24.65  ? 234  ASP B OD1 1 
ATOM   4090  O  OD2 . ASP B 1 256 ? 4.178   89.263  92.578  1.00 26.31  ? 234  ASP B OD2 1 
ATOM   4091  N  N   . THR B 1 257 ? 5.576   90.209  87.367  1.00 26.92  ? 235  THR B N   1 
ATOM   4092  C  CA  . THR B 1 257 ? 5.185   90.120  85.965  1.00 25.45  ? 235  THR B CA  1 
ATOM   4093  C  C   . THR B 1 257 ? 6.190   90.699  84.968  1.00 23.75  ? 235  THR B C   1 
ATOM   4094  O  O   . THR B 1 257 ? 6.748   89.974  84.144  1.00 26.36  ? 235  THR B O   1 
ATOM   4095  C  CB  . THR B 1 257 ? 3.831   90.811  85.740  1.00 27.48  ? 235  THR B CB  1 
ATOM   4096  O  OG1 . THR B 1 257 ? 3.971   92.220  85.963  1.00 31.96  ? 235  THR B OG1 1 
ATOM   4097  C  CG2 . THR B 1 257 ? 2.790   90.267  86.697  1.00 22.81  ? 235  THR B CG2 1 
ATOM   4098  N  N   . THR B 1 258 ? 6.421   92.005  85.050  1.00 24.22  ? 236  THR B N   1 
ATOM   4099  C  CA  . THR B 1 258 ? 7.329   92.685  84.138  1.00 21.82  ? 236  THR B CA  1 
ATOM   4100  C  C   . THR B 1 258 ? 8.695   92.029  84.025  1.00 24.40  ? 236  THR B C   1 
ATOM   4101  O  O   . THR B 1 258 ? 9.159   91.739  82.929  1.00 23.24  ? 236  THR B O   1 
ATOM   4102  C  CB  . THR B 1 258 ? 7.539   94.154  84.541  1.00 21.89  ? 236  THR B CB  1 
ATOM   4103  O  OG1 . THR B 1 258 ? 6.320   94.684  85.071  1.00 27.94  ? 236  THR B OG1 1 
ATOM   4104  C  CG2 . THR B 1 258 ? 7.938   94.981  83.305  1.00 23.70  ? 236  THR B CG2 1 
ATOM   4105  N  N   . ALA B 1 259 ? 9.347   91.815  85.160  1.00 27.60  ? 237  ALA B N   1 
ATOM   4106  C  CA  . ALA B 1 259 ? 10.662  91.198  85.159  1.00 26.28  ? 237  ALA B CA  1 
ATOM   4107  C  C   . ALA B 1 259 ? 10.585  89.816  84.519  1.00 24.54  ? 237  ALA B C   1 
ATOM   4108  O  O   . ALA B 1 259 ? 11.412  89.456  83.673  1.00 24.05  ? 237  ALA B O   1 
ATOM   4109  C  CB  . ALA B 1 259 ? 11.190  91.096  86.586  1.00 26.92  ? 237  ALA B CB  1 
ATOM   4110  N  N   . ASP B 1 260 ? 9.578   89.052  84.930  1.00 25.10  ? 238  ASP B N   1 
ATOM   4111  C  CA  . ASP B 1 260 ? 9.385   87.707  84.419  1.00 25.62  ? 238  ASP B CA  1 
ATOM   4112  C  C   . ASP B 1 260 ? 9.097   87.694  82.923  1.00 24.67  ? 238  ASP B C   1 
ATOM   4113  O  O   . ASP B 1 260 ? 9.620   86.846  82.201  1.00 27.71  ? 238  ASP B O   1 
ATOM   4114  C  CB  . ASP B 1 260 ? 8.271   86.999  85.197  1.00 28.90  ? 238  ASP B CB  1 
ATOM   4115  C  CG  . ASP B 1 260 ? 8.801   86.201  86.389  1.00 32.87  ? 238  ASP B CG  1 
ATOM   4116  O  OD1 . ASP B 1 260 ? 7.978   85.657  87.156  1.00 43.48  ? 238  ASP B OD1 1 
ATOM   4117  O  OD2 . ASP B 1 260 ? 10.038  86.101  86.559  1.00 32.68  ? 238  ASP B OD2 1 
ATOM   4118  N  N   . GLU B 1 261 ? 8.270   88.630  82.461  1.00 16.55  ? 239  GLU B N   1 
ATOM   4119  C  CA  . GLU B 1 261 ? 7.956   88.710  81.047  1.00 18.36  ? 239  GLU B CA  1 
ATOM   4120  C  C   . GLU B 1 261 ? 9.243   88.973  80.290  1.00 23.16  ? 239  GLU B C   1 
ATOM   4121  O  O   . GLU B 1 261 ? 9.542   88.296  79.300  1.00 27.51  ? 239  GLU B O   1 
ATOM   4122  C  CB  . GLU B 1 261 ? 6.956   89.833  80.768  1.00 16.15  ? 239  GLU B CB  1 
ATOM   4123  C  CG  . GLU B 1 261 ? 5.584   89.596  81.395  1.00 20.08  ? 239  GLU B CG  1 
ATOM   4124  C  CD  . GLU B 1 261 ? 4.605   90.730  81.145  1.00 11.36  ? 239  GLU B CD  1 
ATOM   4125  O  OE1 . GLU B 1 261 ? 3.520   90.712  81.765  1.00 20.45  ? 239  GLU B OE1 1 
ATOM   4126  O  OE2 . GLU B 1 261 ? 4.918   91.628  80.335  1.00 16.35  ? 239  GLU B OE2 1 
ATOM   4127  N  N   . ILE B 1 262 ? 10.007  89.953  80.767  1.00 25.89  ? 240  ILE B N   1 
ATOM   4128  C  CA  . ILE B 1 262 ? 11.266  90.304  80.139  1.00 28.17  ? 240  ILE B CA  1 
ATOM   4129  C  C   . ILE B 1 262 ? 12.162  89.085  79.954  1.00 29.64  ? 240  ILE B C   1 
ATOM   4130  O  O   . ILE B 1 262 ? 12.655  88.847  78.859  1.00 29.88  ? 240  ILE B O   1 
ATOM   4131  C  CB  . ILE B 1 262 ? 12.024  91.366  80.955  1.00 27.39  ? 240  ILE B CB  1 
ATOM   4132  C  CG1 . ILE B 1 262 ? 11.280  92.696  80.876  1.00 30.14  ? 240  ILE B CG1 1 
ATOM   4133  C  CG2 . ILE B 1 262 ? 13.447  91.514  80.426  1.00 23.47  ? 240  ILE B CG2 1 
ATOM   4134  C  CD1 . ILE B 1 262 ? 11.971  93.838  81.605  1.00 29.02  ? 240  ILE B CD1 1 
ATOM   4135  N  N   . LEU B 1 263 ? 12.361  88.312  81.016  1.00 31.59  ? 241  LEU B N   1 
ATOM   4136  C  CA  . LEU B 1 263 ? 13.208  87.132  80.934  1.00 36.80  ? 241  LEU B CA  1 
ATOM   4137  C  C   . LEU B 1 263 ? 12.661  86.116  79.929  1.00 38.81  ? 241  LEU B C   1 
ATOM   4138  O  O   . LEU B 1 263 ? 13.409  85.546  79.136  1.00 43.03  ? 241  LEU B O   1 
ATOM   4139  C  CB  . LEU B 1 263 ? 13.348  86.485  82.316  1.00 39.32  ? 241  LEU B CB  1 
ATOM   4140  C  CG  . LEU B 1 263 ? 14.051  87.308  83.406  1.00 38.62  ? 241  LEU B CG  1 
ATOM   4141  C  CD1 . LEU B 1 263 ? 13.799  86.680  84.764  1.00 25.15  ? 241  LEU B CD1 1 
ATOM   4142  C  CD2 . LEU B 1 263 ? 15.545  87.402  83.102  1.00 23.93  ? 241  LEU B CD2 1 
ATOM   4143  N  N   . GLN B 1 264 ? 11.353  85.900  79.963  1.00 37.80  ? 242  GLN B N   1 
ATOM   4144  C  CA  . GLN B 1 264 ? 10.700  84.954  79.068  1.00 36.28  ? 242  GLN B CA  1 
ATOM   4145  C  C   . GLN B 1 264 ? 10.915  85.334  77.592  1.00 33.51  ? 242  GLN B C   1 
ATOM   4146  O  O   . GLN B 1 264 ? 11.211  84.482  76.747  1.00 29.35  ? 242  GLN B O   1 
ATOM   4147  C  CB  . GLN B 1 264 ? 9.200   84.897  79.403  1.00 40.01  ? 242  GLN B CB  1 
ATOM   4148  C  CG  . GLN B 1 264 ? 8.310   84.229  78.356  1.00 51.30  ? 242  GLN B CG  1 
ATOM   4149  C  CD  . GLN B 1 264 ? 8.266   82.714  78.460  1.00 56.91  ? 242  GLN B CD  1 
ATOM   4150  O  OE1 . GLN B 1 264 ? 7.697   82.042  77.598  1.00 60.87  ? 242  GLN B OE1 1 
ATOM   4151  N  NE2 . GLN B 1 264 ? 8.855   82.169  79.517  1.00 56.44  ? 242  GLN B NE2 1 
ATOM   4152  N  N   . GLN B 1 265 ? 10.782  86.619  77.286  1.00 30.97  ? 243  GLN B N   1 
ATOM   4153  C  CA  . GLN B 1 265 ? 10.947  87.106  75.919  1.00 26.89  ? 243  GLN B CA  1 
ATOM   4154  C  C   . GLN B 1 265 ? 12.416  87.081  75.465  1.00 28.21  ? 243  GLN B C   1 
ATOM   4155  O  O   . GLN B 1 265 ? 12.718  87.146  74.277  1.00 32.02  ? 243  GLN B O   1 
ATOM   4156  C  CB  . GLN B 1 265 ? 10.374  88.524  75.813  1.00 15.28  ? 243  GLN B CB  1 
ATOM   4157  C  CG  . GLN B 1 265 ? 8.872   88.598  75.970  1.00 10.36  ? 243  GLN B CG  1 
ATOM   4158  C  CD  . GLN B 1 265 ? 8.352   90.013  76.181  1.00 16.18  ? 243  GLN B CD  1 
ATOM   4159  O  OE1 . GLN B 1 265 ? 8.786   90.727  77.085  1.00 35.92  ? 243  GLN B OE1 1 
ATOM   4160  N  NE2 . GLN B 1 265 ? 7.409   90.416  75.360  1.00 20.82  ? 243  GLN B NE2 1 
ATOM   4161  N  N   . CYS B 1 266 ? 13.328  86.977  76.418  1.00 30.45  ? 244  CYS B N   1 
ATOM   4162  C  CA  . CYS B 1 266 ? 14.744  86.954  76.109  1.00 26.22  ? 244  CYS B CA  1 
ATOM   4163  C  C   . CYS B 1 266 ? 15.317  85.574  76.349  1.00 29.98  ? 244  CYS B C   1 
ATOM   4164  O  O   . CYS B 1 266 ? 16.520  85.372  76.219  1.00 33.27  ? 244  CYS B O   1 
ATOM   4165  C  CB  . CYS B 1 266 ? 15.485  87.963  76.976  1.00 31.22  ? 244  CYS B CB  1 
ATOM   4166  S  SG  . CYS B 1 266 ? 14.993  89.683  76.682  1.00 32.08  ? 244  CYS B SG  1 
ATOM   4167  N  N   . ASP B 1 267 ? 14.459  84.621  76.697  1.00 28.29  ? 245  ASP B N   1 
ATOM   4168  C  CA  . ASP B 1 267 ? 14.908  83.246  76.946  1.00 31.53  ? 245  ASP B CA  1 
ATOM   4169  C  C   . ASP B 1 267 ? 16.005  83.188  78.018  1.00 30.02  ? 245  ASP B C   1 
ATOM   4170  O  O   . ASP B 1 267 ? 16.897  82.343  77.947  1.00 23.16  ? 245  ASP B O   1 
ATOM   4171  C  CB  . ASP B 1 267 ? 15.439  82.608  75.651  1.00 33.99  ? 245  ASP B CB  1 
ATOM   4172  C  CG  . ASP B 1 267 ? 14.365  82.438  74.603  1.00 39.43  ? 245  ASP B CG  1 
ATOM   4173  O  OD1 . ASP B 1 267 ? 13.454  81.623  74.839  1.00 46.23  ? 245  ASP B OD1 1 
ATOM   4174  O  OD2 . ASP B 1 267 ? 14.419  83.118  73.550  1.00 55.01  ? 245  ASP B OD2 1 
ATOM   4175  N  N   . GLY B 1 268 ? 15.935  84.099  78.991  1.00 27.67  ? 246  GLY B N   1 
ATOM   4176  C  CA  . GLY B 1 268 ? 16.908  84.133  80.072  1.00 19.55  ? 246  GLY B CA  1 
ATOM   4177  C  C   . GLY B 1 268 ? 18.242  84.797  79.761  1.00 24.35  ? 246  GLY B C   1 
ATOM   4178  O  O   . GLY B 1 268 ? 19.090  84.938  80.635  1.00 20.87  ? 246  GLY B O   1 
ATOM   4179  N  N   . LYS B 1 269 ? 18.439  85.211  78.516  1.00 28.81  ? 247  LYS B N   1 
ATOM   4180  C  CA  . LYS B 1 269 ? 19.686  85.857  78.118  1.00 26.21  ? 247  LYS B CA  1 
ATOM   4181  C  C   . LYS B 1 269 ? 19.457  87.364  77.977  1.00 29.35  ? 247  LYS B C   1 
ATOM   4182  O  O   . LYS B 1 269 ? 18.683  87.823  77.133  1.00 32.12  ? 247  LYS B O   1 
ATOM   4183  C  CB  . LYS B 1 269 ? 20.161  85.283  76.790  1.00 37.02  ? 247  LYS B CB  1 
ATOM   4184  C  CG  . LYS B 1 269 ? 20.169  83.767  76.723  1.00 40.37  ? 247  LYS B CG  1 
ATOM   4185  C  CD  . LYS B 1 269 ? 20.334  83.332  75.286  1.00 41.78  ? 247  LYS B CD  1 
ATOM   4186  C  CE  . LYS B 1 269 ? 20.214  81.831  75.126  1.00 49.85  ? 247  LYS B CE  1 
ATOM   4187  N  NZ  . LYS B 1 269 ? 20.441  81.451  73.697  1.00 47.15  ? 247  LYS B NZ  1 
ATOM   4188  N  N   . LEU B 1 270 ? 20.157  88.131  78.799  1.00 24.78  ? 248  LEU B N   1 
ATOM   4189  C  CA  . LEU B 1 270 ? 20.025  89.577  78.822  1.00 18.83  ? 248  LEU B CA  1 
ATOM   4190  C  C   . LEU B 1 270 ? 21.302  90.047  79.513  1.00 24.70  ? 248  LEU B C   1 
ATOM   4191  O  O   . LEU B 1 270 ? 21.819  89.365  80.402  1.00 35.22  ? 248  LEU B O   1 
ATOM   4192  C  CB  . LEU B 1 270 ? 18.797  89.929  79.657  1.00 24.15  ? 248  LEU B CB  1 
ATOM   4193  C  CG  . LEU B 1 270 ? 18.218  91.322  79.790  1.00 16.15  ? 248  LEU B CG  1 
ATOM   4194  C  CD1 . LEU B 1 270 ? 16.973  91.239  80.656  1.00 22.45  ? 248  LEU B CD1 1 
ATOM   4195  C  CD2 . LEU B 1 270 ? 19.215  92.259  80.391  1.00 15.69  ? 248  LEU B CD2 1 
ATOM   4196  N  N   . ASP B 1 271 ? 21.811  91.205  79.129  1.00 20.77  ? 249  ASP B N   1 
ATOM   4197  C  CA  . ASP B 1 271 ? 23.044  91.697  79.724  1.00 28.55  ? 249  ASP B CA  1 
ATOM   4198  C  C   . ASP B 1 271 ? 22.932  93.082  80.354  1.00 34.95  ? 249  ASP B C   1 
ATOM   4199  O  O   . ASP B 1 271 ? 23.825  93.514  81.084  1.00 33.56  ? 249  ASP B O   1 
ATOM   4200  C  CB  . ASP B 1 271 ? 24.141  91.718  78.667  1.00 30.09  ? 249  ASP B CB  1 
ATOM   4201  C  CG  . ASP B 1 271 ? 24.339  90.376  78.026  1.00 35.07  ? 249  ASP B CG  1 
ATOM   4202  O  OD1 . ASP B 1 271 ? 25.017  89.521  78.630  1.00 28.87  ? 249  ASP B OD1 1 
ATOM   4203  O  OD2 . ASP B 1 271 ? 23.804  90.175  76.916  1.00 39.09  ? 249  ASP B OD2 1 
ATOM   4204  N  N   . MET B 1 272 ? 21.845  93.785  80.066  1.00 37.07  ? 250  MET B N   1 
ATOM   4205  C  CA  . MET B 1 272 ? 21.673  95.105  80.625  1.00 31.87  ? 250  MET B CA  1 
ATOM   4206  C  C   . MET B 1 272 ? 20.229  95.554  80.599  1.00 35.24  ? 250  MET B C   1 
ATOM   4207  O  O   . MET B 1 272 ? 19.467  95.206  79.692  1.00 33.42  ? 250  MET B O   1 
ATOM   4208  C  CB  . MET B 1 272 ? 22.533  96.105  79.856  1.00 31.45  ? 250  MET B CB  1 
ATOM   4209  C  CG  . MET B 1 272 ? 22.510  97.504  80.429  1.00 30.62  ? 250  MET B CG  1 
ATOM   4210  S  SD  . MET B 1 272 ? 23.632  98.606  79.576  1.00 37.95  ? 250  MET B SD  1 
ATOM   4211  C  CE  . MET B 1 272 ? 25.221  97.991  80.180  1.00 38.73  ? 250  MET B CE  1 
ATOM   4212  N  N   . LEU B 1 273 ? 19.853  96.319  81.617  1.00 37.32  ? 251  LEU B N   1 
ATOM   4213  C  CA  . LEU B 1 273 ? 18.511  96.869  81.715  1.00 28.77  ? 251  LEU B CA  1 
ATOM   4214  C  C   . LEU B 1 273 ? 18.636  98.346  82.055  1.00 32.59  ? 251  LEU B C   1 
ATOM   4215  O  O   . LEU B 1 273 ? 19.277  98.728  83.040  1.00 31.38  ? 251  LEU B O   1 
ATOM   4216  C  CB  . LEU B 1 273 ? 17.707  96.159  82.794  1.00 22.51  ? 251  LEU B CB  1 
ATOM   4217  C  CG  . LEU B 1 273 ? 16.324  96.775  83.035  1.00 22.38  ? 251  LEU B CG  1 
ATOM   4218  C  CD1 . LEU B 1 273 ? 15.347  96.270  82.013  1.00 21.99  ? 251  LEU B CD1 1 
ATOM   4219  C  CD2 . LEU B 1 273 ? 15.837  96.412  84.426  1.00 22.51  ? 251  LEU B CD2 1 
ATOM   4220  N  N   . VAL B 1 274 ? 18.029  99.170  81.221  1.00 30.28  ? 252  VAL B N   1 
ATOM   4221  C  CA  . VAL B 1 274 ? 18.042  100.607 81.410  1.00 35.66  ? 252  VAL B CA  1 
ATOM   4222  C  C   . VAL B 1 274 ? 16.597  101.036 81.628  1.00 37.30  ? 252  VAL B C   1 
ATOM   4223  O  O   . VAL B 1 274 ? 15.732  100.772 80.794  1.00 43.08  ? 252  VAL B O   1 
ATOM   4224  C  CB  . VAL B 1 274 ? 18.623  101.316 80.157  1.00 37.35  ? 252  VAL B CB  1 
ATOM   4225  C  CG1 . VAL B 1 274 ? 18.517  102.828 80.300  1.00 33.29  ? 252  VAL B CG1 1 
ATOM   4226  C  CG2 . VAL B 1 274 ? 20.076  100.901 79.961  1.00 32.28  ? 252  VAL B CG2 1 
ATOM   4227  N  N   . ALA B 1 275 ? 16.337  101.681 82.759  1.00 37.31  ? 253  ALA B N   1 
ATOM   4228  C  CA  . ALA B 1 275 ? 14.991  102.141 83.091  1.00 36.07  ? 253  ALA B CA  1 
ATOM   4229  C  C   . ALA B 1 275 ? 15.048  103.504 83.774  1.00 37.06  ? 253  ALA B C   1 
ATOM   4230  O  O   . ALA B 1 275 ? 15.941  103.751 84.584  1.00 36.06  ? 253  ALA B O   1 
ATOM   4231  C  CB  . ALA B 1 275 ? 14.313  101.130 84.010  1.00 34.82  ? 253  ALA B CB  1 
ATOM   4232  N  N   . SER B 1 276 ? 14.110  104.391 83.435  1.00 39.19  ? 254  SER B N   1 
ATOM   4233  C  CA  . SER B 1 276 ? 14.058  105.716 84.053  1.00 34.51  ? 254  SER B CA  1 
ATOM   4234  C  C   . SER B 1 276 ? 13.359  105.538 85.400  1.00 34.90  ? 254  SER B C   1 
ATOM   4235  O  O   . SER B 1 276 ? 12.528  104.650 85.547  1.00 35.55  ? 254  SER B O   1 
ATOM   4236  C  CB  . SER B 1 276 ? 13.298  106.702 83.158  1.00 38.28  ? 254  SER B CB  1 
ATOM   4237  O  OG  . SER B 1 276 ? 11.977  106.268 82.888  1.00 39.90  ? 254  SER B OG  1 
ATOM   4238  N  N   . VAL B 1 277 ? 13.686  106.373 86.382  1.00 35.26  ? 255  VAL B N   1 
ATOM   4239  C  CA  . VAL B 1 277 ? 13.108  106.209 87.719  1.00 29.72  ? 255  VAL B CA  1 
ATOM   4240  C  C   . VAL B 1 277 ? 12.219  107.333 88.249  1.00 31.18  ? 255  VAL B C   1 
ATOM   4241  O  O   . VAL B 1 277 ? 12.563  108.510 88.151  1.00 32.74  ? 255  VAL B O   1 
ATOM   4242  C  CB  . VAL B 1 277 ? 14.226  105.965 88.757  1.00 27.39  ? 255  VAL B CB  1 
ATOM   4243  C  CG1 . VAL B 1 277 ? 13.629  105.488 90.068  1.00 27.00  ? 255  VAL B CG1 1 
ATOM   4244  C  CG2 . VAL B 1 277 ? 15.219  104.950 88.228  1.00 26.91  ? 255  VAL B CG2 1 
ATOM   4245  N  N   . GLY B 1 278 ? 11.082  106.943 88.830  1.00 29.97  ? 256  GLY B N   1 
ATOM   4246  C  CA  . GLY B 1 278 ? 10.137  107.892 89.399  1.00 30.17  ? 256  GLY B CA  1 
ATOM   4247  C  C   . GLY B 1 278 ? 9.833   107.488 90.834  1.00 34.95  ? 256  GLY B C   1 
ATOM   4248  O  O   . GLY B 1 278 ? 10.279  108.117 91.797  1.00 33.07  ? 256  GLY B O   1 
ATOM   4249  N  N   . THR B 1 279 ? 9.060   106.420 90.975  1.00 35.61  ? 257  THR B N   1 
ATOM   4250  C  CA  . THR B 1 279 ? 8.722   105.890 92.282  1.00 31.03  ? 257  THR B CA  1 
ATOM   4251  C  C   . THR B 1 279 ? 9.829   104.906 92.611  1.00 26.19  ? 257  THR B C   1 
ATOM   4252  O  O   . THR B 1 279 ? 10.159  104.686 93.769  1.00 29.47  ? 257  THR B O   1 
ATOM   4253  C  CB  . THR B 1 279 ? 7.391   105.118 92.257  1.00 29.09  ? 257  THR B CB  1 
ATOM   4254  O  OG1 . THR B 1 279 ? 7.499   104.007 91.354  1.00 25.55  ? 257  THR B OG1 1 
ATOM   4255  C  CG2 . THR B 1 279 ? 6.263   106.024 91.809  1.00 23.56  ? 257  THR B CG2 1 
ATOM   4256  N  N   . GLY B 1 280 ? 10.389  104.315 91.562  1.00 27.20  ? 258  GLY B N   1 
ATOM   4257  C  CA  . GLY B 1 280 ? 11.443  103.327 91.714  1.00 25.71  ? 258  GLY B CA  1 
ATOM   4258  C  C   . GLY B 1 280 ? 10.870  101.922 91.575  1.00 26.00  ? 258  GLY B C   1 
ATOM   4259  O  O   . GLY B 1 280 ? 11.597  100.929 91.557  1.00 27.88  ? 258  GLY B O   1 
ATOM   4260  N  N   . GLY B 1 281 ? 9.551   101.842 91.471  1.00 25.01  ? 259  GLY B N   1 
ATOM   4261  C  CA  . GLY B 1 281 ? 8.899   100.556 91.339  1.00 26.83  ? 259  GLY B CA  1 
ATOM   4262  C  C   . GLY B 1 281 ? 9.478   99.688  90.244  1.00 29.89  ? 259  GLY B C   1 
ATOM   4263  O  O   . GLY B 1 281 ? 10.001  98.593  90.509  1.00 33.70  ? 259  GLY B O   1 
ATOM   4264  N  N   . THR B 1 282 ? 9.392   100.181 89.010  1.00 30.44  ? 260  THR B N   1 
ATOM   4265  C  CA  . THR B 1 282 ? 9.889   99.458  87.846  1.00 29.87  ? 260  THR B CA  1 
ATOM   4266  C  C   . THR B 1 282 ? 11.314  98.925  87.968  1.00 27.72  ? 260  THR B C   1 
ATOM   4267  O  O   . THR B 1 282 ? 11.535  97.711  87.912  1.00 19.35  ? 260  THR B O   1 
ATOM   4268  C  CB  . THR B 1 282 ? 9.813   100.330 86.594  1.00 35.41  ? 260  THR B CB  1 
ATOM   4269  O  OG1 . THR B 1 282 ? 8.468   100.793 86.421  1.00 41.46  ? 260  THR B OG1 1 
ATOM   4270  C  CG2 . THR B 1 282 ? 10.227  99.524  85.366  1.00 28.16  ? 260  THR B CG2 1 
ATOM   4271  N  N   . ILE B 1 283 ? 12.281  99.823  88.131  1.00 25.72  ? 261  ILE B N   1 
ATOM   4272  C  CA  . ILE B 1 283 ? 13.665  99.384  88.234  1.00 26.20  ? 261  ILE B CA  1 
ATOM   4273  C  C   . ILE B 1 283 ? 13.949  98.492  89.452  1.00 31.69  ? 261  ILE B C   1 
ATOM   4274  O  O   . ILE B 1 283 ? 14.728  97.547  89.354  1.00 30.27  ? 261  ILE B O   1 
ATOM   4275  C  CB  . ILE B 1 283 ? 14.644  100.580 88.243  1.00 18.58  ? 261  ILE B CB  1 
ATOM   4276  C  CG1 . ILE B 1 283 ? 16.056  100.083 87.923  1.00 19.84  ? 261  ILE B CG1 1 
ATOM   4277  C  CG2 . ILE B 1 283 ? 14.639  101.268 89.597  1.00 21.53  ? 261  ILE B CG2 1 
ATOM   4278  C  CD1 . ILE B 1 283 ? 17.063  101.191 87.688  1.00 11.46  ? 261  ILE B CD1 1 
ATOM   4279  N  N   . THR B 1 284 ? 13.315  98.776  90.590  1.00 34.00  ? 262  THR B N   1 
ATOM   4280  C  CA  . THR B 1 284 ? 13.547  97.963  91.782  1.00 32.84  ? 262  THR B CA  1 
ATOM   4281  C  C   . THR B 1 284 ? 12.921  96.590  91.614  1.00 33.00  ? 262  THR B C   1 
ATOM   4282  O  O   . THR B 1 284 ? 13.515  95.576  91.980  1.00 35.04  ? 262  THR B O   1 
ATOM   4283  C  CB  . THR B 1 284 ? 12.962  98.602  93.044  1.00 30.09  ? 262  THR B CB  1 
ATOM   4284  O  OG1 . THR B 1 284 ? 13.564  99.886  93.258  1.00 32.45  ? 262  THR B OG1 1 
ATOM   4285  C  CG2 . THR B 1 284 ? 13.240  97.722  94.243  1.00 29.09  ? 262  THR B CG2 1 
ATOM   4286  N  N   . GLY B 1 285 ? 11.715  96.558  91.058  1.00 35.78  ? 263  GLY B N   1 
ATOM   4287  C  CA  . GLY B 1 285 ? 11.048  95.287  90.857  1.00 34.91  ? 263  GLY B CA  1 
ATOM   4288  C  C   . GLY B 1 285 ? 11.826  94.411  89.894  1.00 32.90  ? 263  GLY B C   1 
ATOM   4289  O  O   . GLY B 1 285 ? 12.184  93.280  90.210  1.00 36.71  ? 263  GLY B O   1 
ATOM   4290  N  N   . ILE B 1 286 ? 12.102  94.946  88.711  1.00 32.25  ? 264  ILE B N   1 
ATOM   4291  C  CA  . ILE B 1 286 ? 12.831  94.205  87.702  1.00 25.51  ? 264  ILE B CA  1 
ATOM   4292  C  C   . ILE B 1 286 ? 14.254  93.916  88.142  1.00 28.74  ? 264  ILE B C   1 
ATOM   4293  O  O   . ILE B 1 286 ? 14.757  92.819  87.912  1.00 31.38  ? 264  ILE B O   1 
ATOM   4294  C  CB  . ILE B 1 286 ? 12.863  94.975  86.369  1.00 24.77  ? 264  ILE B CB  1 
ATOM   4295  C  CG1 . ILE B 1 286 ? 11.435  95.232  85.885  1.00 23.09  ? 264  ILE B CG1 1 
ATOM   4296  C  CG2 . ILE B 1 286 ? 13.622  94.182  85.324  1.00 15.33  ? 264  ILE B CG2 1 
ATOM   4297  C  CD1 . ILE B 1 286 ? 11.366  96.165  84.702  1.00 13.05  ? 264  ILE B CD1 1 
ATOM   4298  N  N   . ALA B 1 287 ? 14.907  94.884  88.780  1.00 30.20  ? 265  ALA B N   1 
ATOM   4299  C  CA  . ALA B 1 287 ? 16.293  94.681  89.218  1.00 33.54  ? 265  ALA B CA  1 
ATOM   4300  C  C   . ALA B 1 287 ? 16.437  93.561  90.243  1.00 34.05  ? 265  ALA B C   1 
ATOM   4301  O  O   . ALA B 1 287 ? 17.389  92.781  90.172  1.00 28.04  ? 265  ALA B O   1 
ATOM   4302  C  CB  . ALA B 1 287 ? 16.870  95.966  89.782  1.00 32.21  ? 265  ALA B CB  1 
ATOM   4303  N  N   . ARG B 1 288 ? 15.505  93.488  91.197  1.00 29.56  ? 266  ARG B N   1 
ATOM   4304  C  CA  . ARG B 1 288 ? 15.564  92.440  92.211  1.00 27.07  ? 266  ARG B CA  1 
ATOM   4305  C  C   . ARG B 1 288 ? 15.305  91.062  91.608  1.00 27.07  ? 266  ARG B C   1 
ATOM   4306  O  O   . ARG B 1 288 ? 15.854  90.056  92.073  1.00 20.84  ? 266  ARG B O   1 
ATOM   4307  C  CB  . ARG B 1 288 ? 14.569  92.707  93.348  1.00 22.51  ? 266  ARG B CB  1 
ATOM   4308  C  CG  . ARG B 1 288 ? 15.110  93.626  94.439  1.00 18.19  ? 266  ARG B CG  1 
ATOM   4309  C  CD  . ARG B 1 288 ? 14.158  93.686  95.609  1.00 19.87  ? 266  ARG B CD  1 
ATOM   4310  N  NE  . ARG B 1 288 ? 14.592  94.646  96.617  1.00 19.70  ? 266  ARG B NE  1 
ATOM   4311  C  CZ  . ARG B 1 288 ? 13.917  94.927  97.733  1.00 26.17  ? 266  ARG B CZ  1 
ATOM   4312  N  NH1 . ARG B 1 288 ? 12.768  94.326  97.997  1.00 24.50  ? 266  ARG B NH1 1 
ATOM   4313  N  NH2 . ARG B 1 288 ? 14.390  95.815  98.591  1.00 19.87  ? 266  ARG B NH2 1 
ATOM   4314  N  N   . LYS B 1 289 ? 14.485  91.011  90.563  1.00 26.08  ? 267  LYS B N   1 
ATOM   4315  C  CA  . LYS B 1 289 ? 14.189  89.733  89.931  1.00 26.24  ? 267  LYS B CA  1 
ATOM   4316  C  C   . LYS B 1 289 ? 15.303  89.307  88.986  1.00 31.54  ? 267  LYS B C   1 
ATOM   4317  O  O   . LYS B 1 289 ? 15.549  88.109  88.800  1.00 31.51  ? 267  LYS B O   1 
ATOM   4318  C  CB  . LYS B 1 289 ? 12.867  89.795  89.156  1.00 28.39  ? 267  LYS B CB  1 
ATOM   4319  C  CG  . LYS B 1 289 ? 12.556  88.526  88.342  1.00 20.29  ? 267  LYS B CG  1 
ATOM   4320  C  CD  . LYS B 1 289 ? 12.613  87.293  89.225  1.00 13.61  ? 267  LYS B CD  1 
ATOM   4321  C  CE  . LYS B 1 289 ? 11.617  87.324  90.372  1.00 12.48  ? 267  LYS B CE  1 
ATOM   4322  N  NZ  . LYS B 1 289 ? 10.230  86.975  89.989  1.00 20.36  ? 267  LYS B NZ  1 
ATOM   4323  N  N   . LEU B 1 290 ? 15.978  90.285  88.390  1.00 29.89  ? 268  LEU B N   1 
ATOM   4324  C  CA  . LEU B 1 290 ? 17.052  89.989  87.449  1.00 32.17  ? 268  LEU B CA  1 
ATOM   4325  C  C   . LEU B 1 290 ? 18.324  89.560  88.156  1.00 33.56  ? 268  LEU B C   1 
ATOM   4326  O  O   . LEU B 1 290 ? 18.965  88.603  87.745  1.00 39.26  ? 268  LEU B O   1 
ATOM   4327  C  CB  . LEU B 1 290 ? 17.317  91.207  86.558  1.00 30.72  ? 268  LEU B CB  1 
ATOM   4328  C  CG  . LEU B 1 290 ? 16.899  91.126  85.080  1.00 25.69  ? 268  LEU B CG  1 
ATOM   4329  C  CD1 . LEU B 1 290 ? 15.677  90.258  84.895  1.00 20.88  ? 268  LEU B CD1 1 
ATOM   4330  C  CD2 . LEU B 1 290 ? 16.645  92.538  84.562  1.00 19.92  ? 268  LEU B CD2 1 
ATOM   4331  N  N   . LYS B 1 291 ? 18.690  90.259  89.225  1.00 36.07  ? 269  LYS B N   1 
ATOM   4332  C  CA  . LYS B 1 291 ? 19.885  89.901  89.967  1.00 34.03  ? 269  LYS B CA  1 
ATOM   4333  C  C   . LYS B 1 291 ? 19.762  88.493  90.539  1.00 35.66  ? 269  LYS B C   1 
ATOM   4334  O  O   . LYS B 1 291 ? 20.767  87.838  90.812  1.00 32.34  ? 269  LYS B O   1 
ATOM   4335  C  CB  . LYS B 1 291 ? 20.148  90.910  91.091  1.00 38.56  ? 269  LYS B CB  1 
ATOM   4336  C  CG  . LYS B 1 291 ? 20.695  92.232  90.579  1.00 41.42  ? 269  LYS B CG  1 
ATOM   4337  C  CD  . LYS B 1 291 ? 21.592  92.882  91.600  1.00 50.15  ? 269  LYS B CD  1 
ATOM   4338  C  CE  . LYS B 1 291 ? 22.408  93.982  90.959  1.00 54.11  ? 269  LYS B CE  1 
ATOM   4339  N  NZ  . LYS B 1 291 ? 23.226  93.444  89.827  1.00 61.85  ? 269  LYS B NZ  1 
ATOM   4340  N  N   . GLU B 1 292 ? 18.530  88.026  90.716  1.00 32.03  ? 270  GLU B N   1 
ATOM   4341  C  CA  . GLU B 1 292 ? 18.316  86.697  91.238  1.00 29.20  ? 270  GLU B CA  1 
ATOM   4342  C  C   . GLU B 1 292 ? 18.456  85.680  90.114  1.00 34.53  ? 270  GLU B C   1 
ATOM   4343  O  O   . GLU B 1 292 ? 19.158  84.682  90.269  1.00 41.35  ? 270  GLU B O   1 
ATOM   4344  C  CB  . GLU B 1 292 ? 16.940  86.597  91.910  1.00 28.54  ? 270  GLU B CB  1 
ATOM   4345  C  CG  . GLU B 1 292 ? 16.762  87.557  93.094  1.00 29.90  ? 270  GLU B CG  1 
ATOM   4346  C  CD  . GLU B 1 292 ? 15.538  87.270  93.956  1.00 29.33  ? 270  GLU B CD  1 
ATOM   4347  O  OE1 . GLU B 1 292 ? 14.477  86.908  93.401  1.00 29.12  ? 270  GLU B OE1 1 
ATOM   4348  O  OE2 . GLU B 1 292 ? 15.629  87.429  95.196  1.00 27.90  ? 270  GLU B OE2 1 
ATOM   4349  N  N   . LYS B 1 293 ? 17.819  85.938  88.974  1.00 38.20  ? 271  LYS B N   1 
ATOM   4350  C  CA  . LYS B 1 293 ? 17.892  85.016  87.832  1.00 41.31  ? 271  LYS B CA  1 
ATOM   4351  C  C   . LYS B 1 293 ? 19.075  85.301  86.900  1.00 44.38  ? 271  LYS B C   1 
ATOM   4352  O  O   . LYS B 1 293 ? 19.809  84.386  86.523  1.00 46.68  ? 271  LYS B O   1 
ATOM   4353  C  CB  . LYS B 1 293 ? 16.586  85.053  87.023  1.00 37.63  ? 271  LYS B CB  1 
ATOM   4354  C  CG  . LYS B 1 293 ? 15.325  84.777  87.847  1.00 45.32  ? 271  LYS B CG  1 
ATOM   4355  C  CD  . LYS B 1 293 ? 15.287  83.355  88.380  1.00 51.44  ? 271  LYS B CD  1 
ATOM   4356  C  CE  . LYS B 1 293 ? 14.014  83.098  89.177  1.00 49.69  ? 271  LYS B CE  1 
ATOM   4357  N  NZ  . LYS B 1 293 ? 13.873  81.654  89.545  1.00 43.65  ? 271  LYS B NZ  1 
ATOM   4358  N  N   . CYS B 1 294 ? 19.256  86.563  86.522  1.00 48.48  ? 272  CYS B N   1 
ATOM   4359  C  CA  . CYS B 1 294 ? 20.357  86.934  85.630  1.00 52.35  ? 272  CYS B CA  1 
ATOM   4360  C  C   . CYS B 1 294 ? 21.433  87.713  86.370  1.00 53.60  ? 272  CYS B C   1 
ATOM   4361  O  O   . CYS B 1 294 ? 21.464  88.943  86.342  1.00 52.97  ? 272  CYS B O   1 
ATOM   4362  C  CB  . CYS B 1 294 ? 19.848  87.760  84.443  1.00 52.45  ? 272  CYS B CB  1 
ATOM   4363  S  SG  . CYS B 1 294 ? 21.173  88.442  83.375  1.00 61.98  ? 272  CYS B SG  1 
ATOM   4364  N  N   . PRO B 1 295 ? 22.344  86.994  87.037  1.00 55.49  ? 273  PRO B N   1 
ATOM   4365  C  CA  . PRO B 1 295 ? 23.425  87.632  87.789  1.00 57.38  ? 273  PRO B CA  1 
ATOM   4366  C  C   . PRO B 1 295 ? 24.250  88.618  86.965  1.00 57.31  ? 273  PRO B C   1 
ATOM   4367  O  O   . PRO B 1 295 ? 24.503  89.744  87.398  1.00 56.56  ? 273  PRO B O   1 
ATOM   4368  C  CB  . PRO B 1 295 ? 24.246  86.436  88.291  1.00 60.14  ? 273  PRO B CB  1 
ATOM   4369  C  CG  . PRO B 1 295 ? 23.976  85.365  87.259  1.00 53.10  ? 273  PRO B CG  1 
ATOM   4370  C  CD  . PRO B 1 295 ? 22.496  85.527  87.038  1.00 54.55  ? 273  PRO B CD  1 
ATOM   4371  N  N   . GLY B 1 296 ? 24.655  88.190  85.776  1.00 53.80  ? 274  GLY B N   1 
ATOM   4372  C  CA  . GLY B 1 296 ? 25.455  89.038  84.918  1.00 52.35  ? 274  GLY B CA  1 
ATOM   4373  C  C   . GLY B 1 296 ? 24.728  90.229  84.323  1.00 51.98  ? 274  GLY B C   1 
ATOM   4374  O  O   . GLY B 1 296 ? 25.288  90.942  83.487  1.00 55.90  ? 274  GLY B O   1 
ATOM   4375  N  N   . CYS B 1 297 ? 23.485  90.453  84.738  1.00 46.14  ? 275  CYS B N   1 
ATOM   4376  C  CA  . CYS B 1 297 ? 22.721  91.579  84.221  1.00 44.19  ? 275  CYS B CA  1 
ATOM   4377  C  C   . CYS B 1 297 ? 23.067  92.871  84.935  1.00 43.78  ? 275  CYS B C   1 
ATOM   4378  O  O   . CYS B 1 297 ? 22.936  92.975  86.150  1.00 46.34  ? 275  CYS B O   1 
ATOM   4379  C  CB  . CYS B 1 297 ? 21.228  91.317  84.343  1.00 44.37  ? 275  CYS B CB  1 
ATOM   4380  S  SG  . CYS B 1 297 ? 20.551  90.335  82.978  1.00 55.85  ? 275  CYS B SG  1 
ATOM   4381  N  N   . ARG B 1 298 ? 23.517  93.856  84.170  1.00 42.52  ? 276  ARG B N   1 
ATOM   4382  C  CA  . ARG B 1 298 ? 23.889  95.153  84.711  1.00 38.64  ? 276  ARG B CA  1 
ATOM   4383  C  C   . ARG B 1 298 ? 22.637  96.049  84.724  1.00 36.46  ? 276  ARG B C   1 
ATOM   4384  O  O   . ARG B 1 298 ? 21.974  96.206  83.703  1.00 37.47  ? 276  ARG B O   1 
ATOM   4385  C  CB  . ARG B 1 298 ? 25.002  95.750  83.833  1.00 37.84  ? 276  ARG B CB  1 
ATOM   4386  C  CG  . ARG B 1 298 ? 26.153  94.773  83.529  1.00 38.08  ? 276  ARG B CG  1 
ATOM   4387  C  CD  . ARG B 1 298 ? 26.917  95.163  82.235  1.00 56.45  ? 276  ARG B CD  1 
ATOM   4388  N  NE  . ARG B 1 298 ? 27.922  94.176  81.791  1.00 59.19  ? 276  ARG B NE  1 
ATOM   4389  C  CZ  . ARG B 1 298 ? 27.654  93.013  81.188  1.00 52.13  ? 276  ARG B CZ  1 
ATOM   4390  N  NH1 . ARG B 1 298 ? 26.406  92.653  80.936  1.00 58.79  ? 276  ARG B NH1 1 
ATOM   4391  N  NH2 . ARG B 1 298 ? 28.641  92.201  80.833  1.00 52.42  ? 276  ARG B NH2 1 
ATOM   4392  N  N   . ILE B 1 299 ? 22.306  96.611  85.885  1.00 36.90  ? 277  ILE B N   1 
ATOM   4393  C  CA  . ILE B 1 299 ? 21.137  97.488  86.039  1.00 39.79  ? 277  ILE B CA  1 
ATOM   4394  C  C   . ILE B 1 299 ? 21.550  98.959  85.921  1.00 41.32  ? 277  ILE B C   1 
ATOM   4395  O  O   . ILE B 1 299 ? 22.480  99.406  86.600  1.00 44.45  ? 277  ILE B O   1 
ATOM   4396  C  CB  . ILE B 1 299 ? 20.447  97.274  87.417  1.00 34.14  ? 277  ILE B CB  1 
ATOM   4397  C  CG1 . ILE B 1 299 ? 20.034  95.807  87.572  1.00 37.48  ? 277  ILE B CG1 1 
ATOM   4398  C  CG2 . ILE B 1 299 ? 19.236  98.192  87.555  1.00 27.50  ? 277  ILE B CG2 1 
ATOM   4399  C  CD1 . ILE B 1 299 ? 19.150  95.290  86.447  1.00 26.12  ? 277  ILE B CD1 1 
ATOM   4400  N  N   . ILE B 1 300 ? 20.851  99.704  85.065  1.00 34.35  ? 278  ILE B N   1 
ATOM   4401  C  CA  . ILE B 1 300 ? 21.152  101.115 84.841  1.00 26.64  ? 278  ILE B CA  1 
ATOM   4402  C  C   . ILE B 1 300 ? 19.947  101.999 85.150  1.00 29.46  ? 278  ILE B C   1 
ATOM   4403  O  O   . ILE B 1 300 ? 18.870  101.802 84.592  1.00 32.26  ? 278  ILE B O   1 
ATOM   4404  C  CB  . ILE B 1 300 ? 21.559  101.368 83.367  1.00 30.78  ? 278  ILE B CB  1 
ATOM   4405  C  CG1 . ILE B 1 300 ? 22.641  100.375 82.932  1.00 22.93  ? 278  ILE B CG1 1 
ATOM   4406  C  CG2 . ILE B 1 300 ? 22.036  102.796 83.203  1.00 27.04  ? 278  ILE B CG2 1 
ATOM   4407  C  CD1 . ILE B 1 300 ? 23.929  100.504 83.688  1.00 29.63  ? 278  ILE B CD1 1 
ATOM   4408  N  N   . GLY B 1 301 ? 20.139  102.982 86.024  1.00 25.23  ? 279  GLY B N   1 
ATOM   4409  C  CA  . GLY B 1 301 ? 19.052  103.870 86.388  1.00 21.36  ? 279  GLY B CA  1 
ATOM   4410  C  C   . GLY B 1 301 ? 19.193  105.238 85.753  1.00 27.04  ? 279  GLY B C   1 
ATOM   4411  O  O   . GLY B 1 301 ? 20.280  105.811 85.736  1.00 29.58  ? 279  GLY B O   1 
ATOM   4412  N  N   . VAL B 1 302 ? 18.092  105.773 85.239  1.00 26.26  ? 280  VAL B N   1 
ATOM   4413  C  CA  . VAL B 1 302 ? 18.109  107.071 84.586  1.00 27.30  ? 280  VAL B CA  1 
ATOM   4414  C  C   . VAL B 1 302 ? 17.370  108.089 85.428  1.00 29.45  ? 280  VAL B C   1 
ATOM   4415  O  O   . VAL B 1 302 ? 16.166  107.960 85.657  1.00 30.68  ? 280  VAL B O   1 
ATOM   4416  C  CB  . VAL B 1 302 ? 17.456  106.978 83.179  1.00 32.83  ? 280  VAL B CB  1 
ATOM   4417  C  CG1 . VAL B 1 302 ? 17.262  108.368 82.584  1.00 31.16  ? 280  VAL B CG1 1 
ATOM   4418  C  CG2 . VAL B 1 302 ? 18.336  106.136 82.262  1.00 27.65  ? 280  VAL B CG2 1 
ATOM   4419  N  N   . ASP B 1 303 ? 18.097  109.106 85.883  1.00 30.66  ? 281  ASP B N   1 
ATOM   4420  C  CA  . ASP B 1 303 ? 17.528  110.159 86.732  1.00 33.00  ? 281  ASP B CA  1 
ATOM   4421  C  C   . ASP B 1 303 ? 17.676  111.526 86.041  1.00 34.07  ? 281  ASP B C   1 
ATOM   4422  O  O   . ASP B 1 303 ? 18.746  111.867 85.540  1.00 36.08  ? 281  ASP B O   1 
ATOM   4423  C  CB  . ASP B 1 303 ? 18.253  110.158 88.093  1.00 31.92  ? 281  ASP B CB  1 
ATOM   4424  C  CG  . ASP B 1 303 ? 17.540  110.993 89.152  1.00 36.74  ? 281  ASP B CG  1 
ATOM   4425  O  OD1 . ASP B 1 303 ? 18.241  111.585 89.998  1.00 37.04  ? 281  ASP B OD1 1 
ATOM   4426  O  OD2 . ASP B 1 303 ? 16.290  111.047 89.160  1.00 27.02  ? 281  ASP B OD2 1 
ATOM   4427  N  N   . PRO B 1 304 ? 16.602  112.327 86.011  1.00 34.73  ? 282  PRO B N   1 
ATOM   4428  C  CA  . PRO B 1 304 ? 16.643  113.643 85.372  1.00 40.65  ? 282  PRO B CA  1 
ATOM   4429  C  C   . PRO B 1 304 ? 17.313  114.704 86.241  1.00 52.14  ? 282  PRO B C   1 
ATOM   4430  O  O   . PRO B 1 304 ? 17.129  114.720 87.464  1.00 53.50  ? 282  PRO B O   1 
ATOM   4431  C  CB  . PRO B 1 304 ? 15.169  113.945 85.152  1.00 36.42  ? 282  PRO B CB  1 
ATOM   4432  C  CG  . PRO B 1 304 ? 14.559  113.410 86.401  1.00 30.38  ? 282  PRO B CG  1 
ATOM   4433  C  CD  . PRO B 1 304 ? 15.258  112.060 86.552  1.00 34.64  ? 282  PRO B CD  1 
ATOM   4434  N  N   . GLU B 1 305 ? 18.086  115.590 85.613  1.00 57.86  ? 283  GLU B N   1 
ATOM   4435  C  CA  . GLU B 1 305 ? 18.751  116.668 86.344  1.00 58.10  ? 283  GLU B CA  1 
ATOM   4436  C  C   . GLU B 1 305 ? 17.695  117.497 87.078  1.00 57.68  ? 283  GLU B C   1 
ATOM   4437  O  O   . GLU B 1 305 ? 16.720  117.956 86.480  1.00 58.44  ? 283  GLU B O   1 
ATOM   4438  C  CB  . GLU B 1 305 ? 19.533  117.564 85.385  1.00 55.18  ? 283  GLU B CB  1 
ATOM   4439  C  CG  . GLU B 1 305 ? 20.744  116.897 84.770  1.00 57.47  ? 283  GLU B CG  1 
ATOM   4440  C  CD  . GLU B 1 305 ? 21.460  117.801 83.780  1.00 65.22  ? 283  GLU B CD  1 
ATOM   4441  O  OE1 . GLU B 1 305 ? 22.464  117.352 83.184  1.00 60.06  ? 283  GLU B OE1 1 
ATOM   4442  O  OE2 . GLU B 1 305 ? 21.014  118.960 83.598  1.00 68.30  ? 283  GLU B OE2 1 
ATOM   4443  N  N   . GLY B 1 306 ? 17.896  117.686 88.377  1.00 55.33  ? 284  GLY B N   1 
ATOM   4444  C  CA  . GLY B 1 306 ? 16.938  118.432 89.173  1.00 54.26  ? 284  GLY B CA  1 
ATOM   4445  C  C   . GLY B 1 306 ? 16.272  117.469 90.130  1.00 50.14  ? 284  GLY B C   1 
ATOM   4446  O  O   . GLY B 1 306 ? 15.370  117.829 90.884  1.00 50.81  ? 284  GLY B O   1 
ATOM   4447  N  N   . SER B 1 307 ? 16.735  116.225 90.081  1.00 50.18  ? 285  SER B N   1 
ATOM   4448  C  CA  . SER B 1 307 ? 16.233  115.153 90.929  1.00 49.79  ? 285  SER B CA  1 
ATOM   4449  C  C   . SER B 1 307 ? 17.390  114.717 91.817  1.00 44.44  ? 285  SER B C   1 
ATOM   4450  O  O   . SER B 1 307 ? 18.549  114.975 91.494  1.00 44.43  ? 285  SER B O   1 
ATOM   4451  C  CB  . SER B 1 307 ? 15.756  113.981 90.065  1.00 53.81  ? 285  SER B CB  1 
ATOM   4452  O  OG  . SER B 1 307 ? 15.277  112.915 90.863  1.00 54.54  ? 285  SER B OG  1 
ATOM   4453  N  N   . ILE B 1 308 ? 17.077  114.060 92.930  1.00 39.51  ? 286  ILE B N   1 
ATOM   4454  C  CA  . ILE B 1 308 ? 18.102  113.610 93.871  1.00 35.96  ? 286  ILE B CA  1 
ATOM   4455  C  C   . ILE B 1 308 ? 18.248  112.100 93.888  1.00 33.79  ? 286  ILE B C   1 
ATOM   4456  O  O   . ILE B 1 308 ? 19.018  111.551 94.678  1.00 30.84  ? 286  ILE B O   1 
ATOM   4457  C  CB  . ILE B 1 308 ? 17.764  114.047 95.307  1.00 35.69  ? 286  ILE B CB  1 
ATOM   4458  C  CG1 . ILE B 1 308 ? 16.435  113.411 95.740  1.00 38.25  ? 286  ILE B CG1 1 
ATOM   4459  C  CG2 . ILE B 1 308 ? 17.682  115.563 95.383  1.00 36.46  ? 286  ILE B CG2 1 
ATOM   4460  C  CD1 . ILE B 1 308 ? 16.094  113.612 97.194  1.00 37.02  ? 286  ILE B CD1 1 
ATOM   4461  N  N   . LEU B 1 309 ? 17.520  111.430 93.007  1.00 35.06  ? 287  LEU B N   1 
ATOM   4462  C  CA  . LEU B 1 309 ? 17.549  109.980 92.992  1.00 35.89  ? 287  LEU B CA  1 
ATOM   4463  C  C   . LEU B 1 309 ? 18.893  109.334 92.681  1.00 36.93  ? 287  LEU B C   1 
ATOM   4464  O  O   . LEU B 1 309 ? 19.351  108.460 93.422  1.00 34.03  ? 287  LEU B O   1 
ATOM   4465  C  CB  . LEU B 1 309 ? 16.470  109.443 92.044  1.00 31.26  ? 287  LEU B CB  1 
ATOM   4466  C  CG  . LEU B 1 309 ? 15.020  109.826 92.382  1.00 33.17  ? 287  LEU B CG  1 
ATOM   4467  C  CD1 . LEU B 1 309 ? 14.075  109.024 91.508  1.00 31.69  ? 287  LEU B CD1 1 
ATOM   4468  C  CD2 . LEU B 1 309 ? 14.718  109.551 93.843  1.00 28.49  ? 287  LEU B CD2 1 
ATOM   4469  N  N   . ALA B 1 310 ? 19.536  109.764 91.605  1.00 38.08  ? 288  ALA B N   1 
ATOM   4470  C  CA  . ALA B 1 310 ? 20.817  109.178 91.222  1.00 42.32  ? 288  ALA B CA  1 
ATOM   4471  C  C   . ALA B 1 310 ? 21.911  109.215 92.292  1.00 42.26  ? 288  ALA B C   1 
ATOM   4472  O  O   . ALA B 1 310 ? 21.879  110.017 93.222  1.00 41.16  ? 288  ALA B O   1 
ATOM   4473  C  CB  . ALA B 1 310 ? 21.324  109.834 89.961  1.00 39.81  ? 288  ALA B CB  1 
ATOM   4474  N  N   . GLU B 1 311 ? 22.875  108.317 92.144  1.00 42.69  ? 289  GLU B N   1 
ATOM   4475  C  CA  . GLU B 1 311 ? 24.013  108.232 93.042  1.00 46.82  ? 289  GLU B CA  1 
ATOM   4476  C  C   . GLU B 1 311 ? 25.225  108.076 92.126  1.00 52.16  ? 289  GLU B C   1 
ATOM   4477  O  O   . GLU B 1 311 ? 25.119  107.502 91.040  1.00 56.21  ? 289  GLU B O   1 
ATOM   4478  C  CB  . GLU B 1 311 ? 23.905  107.010 93.957  1.00 45.55  ? 289  GLU B CB  1 
ATOM   4479  C  CG  . GLU B 1 311 ? 22.599  106.880 94.712  1.00 50.26  ? 289  GLU B CG  1 
ATOM   4480  C  CD  . GLU B 1 311 ? 22.640  105.761 95.738  1.00 54.93  ? 289  GLU B CD  1 
ATOM   4481  O  OE1 . GLU B 1 311 ? 23.256  105.970 96.805  1.00 57.84  ? 289  GLU B OE1 1 
ATOM   4482  O  OE2 . GLU B 1 311 ? 22.069  104.674 95.475  1.00 57.34  ? 289  GLU B OE2 1 
ATOM   4483  N  N   . PRO B 1 312 ? 26.394  108.583 92.543  1.00 58.06  ? 290  PRO B N   1 
ATOM   4484  C  CA  . PRO B 1 312 ? 26.673  109.289 93.799  1.00 59.99  ? 290  PRO B CA  1 
ATOM   4485  C  C   . PRO B 1 312 ? 26.086  110.698 93.857  1.00 61.75  ? 290  PRO B C   1 
ATOM   4486  O  O   . PRO B 1 312 ? 25.417  111.144 92.931  1.00 65.04  ? 290  PRO B O   1 
ATOM   4487  C  CB  . PRO B 1 312 ? 28.198  109.306 93.848  1.00 59.23  ? 290  PRO B CB  1 
ATOM   4488  C  CG  . PRO B 1 312 ? 28.579  108.083 93.068  1.00 58.74  ? 290  PRO B CG  1 
ATOM   4489  C  CD  . PRO B 1 312 ? 27.651  108.182 91.892  1.00 58.13  ? 290  PRO B CD  1 
ATOM   4490  N  N   . GLU B 1 313 ? 26.351  111.389 94.960  1.00 64.01  ? 291  GLU B N   1 
ATOM   4491  C  CA  . GLU B 1 313 ? 25.870  112.751 95.176  1.00 62.77  ? 291  GLU B CA  1 
ATOM   4492  C  C   . GLU B 1 313 ? 26.202  113.713 94.036  1.00 61.59  ? 291  GLU B C   1 
ATOM   4493  O  O   . GLU B 1 313 ? 25.322  114.412 93.530  1.00 58.12  ? 291  GLU B O   1 
ATOM   4494  C  CB  . GLU B 1 313 ? 26.458  113.291 96.478  1.00 62.75  ? 291  GLU B CB  1 
ATOM   4495  C  CG  . GLU B 1 313 ? 25.837  112.687 97.710  1.00 62.69  ? 291  GLU B CG  1 
ATOM   4496  C  CD  . GLU B 1 313 ? 24.488  113.295 98.010  1.00 66.11  ? 291  GLU B CD  1 
ATOM   4497  O  OE1 . GLU B 1 313 ? 23.700  113.484 97.050  1.00 59.37  ? 291  GLU B OE1 1 
ATOM   4498  O  OE2 . GLU B 1 313 ? 24.224  113.577 99.206  1.00 61.74  ? 291  GLU B OE2 1 
ATOM   4499  N  N   . GLU B 1 314 ? 27.477  113.746 93.651  1.00 60.66  ? 292  GLU B N   1 
ATOM   4500  C  CA  . GLU B 1 314 ? 27.954  114.621 92.586  1.00 63.68  ? 292  GLU B CA  1 
ATOM   4501  C  C   . GLU B 1 314 ? 26.955  114.730 91.441  1.00 62.37  ? 292  GLU B C   1 
ATOM   4502  O  O   . GLU B 1 314 ? 26.625  115.831 90.993  1.00 63.59  ? 292  GLU B O   1 
ATOM   4503  C  CB  . GLU B 1 314 ? 29.294  114.116 92.033  1.00 69.75  ? 292  GLU B CB  1 
ATOM   4504  C  CG  . GLU B 1 314 ? 30.407  113.984 93.066  1.00 76.23  ? 292  GLU B CG  1 
ATOM   4505  C  CD  . GLU B 1 314 ? 30.319  112.697 93.873  1.00 80.20  ? 292  GLU B CD  1 
ATOM   4506  O  OE1 . GLU B 1 314 ? 30.468  111.611 93.271  1.00 79.63  ? 292  GLU B OE1 1 
ATOM   4507  O  OE2 . GLU B 1 314 ? 30.102  112.771 95.106  1.00 78.67  ? 292  GLU B OE2 1 
ATOM   4508  N  N   . LEU B 1 315 ? 26.476  113.579 90.979  1.00 59.18  ? 293  LEU B N   1 
ATOM   4509  C  CA  . LEU B 1 315 ? 25.525  113.515 89.877  1.00 57.93  ? 293  LEU B CA  1 
ATOM   4510  C  C   . LEU B 1 315 ? 24.377  114.519 89.968  1.00 56.88  ? 293  LEU B C   1 
ATOM   4511  O  O   . LEU B 1 315 ? 23.910  115.019 88.947  1.00 54.84  ? 293  LEU B O   1 
ATOM   4512  C  CB  . LEU B 1 315 ? 24.952  112.096 89.765  1.00 57.28  ? 293  LEU B CB  1 
ATOM   4513  C  CG  . LEU B 1 315 ? 25.830  110.987 89.164  1.00 58.46  ? 293  LEU B CG  1 
ATOM   4514  C  CD1 . LEU B 1 315 ? 26.072  111.280 87.697  1.00 56.77  ? 293  LEU B CD1 1 
ATOM   4515  C  CD2 . LEU B 1 315 ? 27.148  110.878 89.910  1.00 59.55  ? 293  LEU B CD2 1 
ATOM   4516  N  N   . ASN B 1 316 ? 23.944  114.831 91.184  1.00 57.47  ? 294  ASN B N   1 
ATOM   4517  C  CA  . ASN B 1 316 ? 22.817  115.744 91.383  1.00 61.67  ? 294  ASN B CA  1 
ATOM   4518  C  C   . ASN B 1 316 ? 23.139  117.210 91.678  1.00 65.13  ? 294  ASN B C   1 
ATOM   4519  O  O   . ASN B 1 316 ? 22.283  117.928 92.198  1.00 66.26  ? 294  ASN B O   1 
ATOM   4520  C  CB  . ASN B 1 316 ? 21.921  115.216 92.509  1.00 58.43  ? 294  ASN B CB  1 
ATOM   4521  C  CG  . ASN B 1 316 ? 21.502  113.777 92.297  1.00 59.85  ? 294  ASN B CG  1 
ATOM   4522  O  OD1 . ASN B 1 316 ? 20.995  113.418 91.238  1.00 60.63  ? 294  ASN B OD1 1 
ATOM   4523  N  ND2 . ASN B 1 316 ? 21.706  112.946 93.310  1.00 55.04  ? 294  ASN B ND2 1 
ATOM   4524  N  N   . GLN B 1 317 ? 24.343  117.668 91.341  1.00 70.28  ? 295  GLN B N   1 
ATOM   4525  C  CA  . GLN B 1 317 ? 24.721  119.058 91.620  1.00 73.41  ? 295  GLN B CA  1 
ATOM   4526  C  C   . GLN B 1 317 ? 24.158  120.095 90.643  1.00 74.76  ? 295  GLN B C   1 
ATOM   4527  O  O   . GLN B 1 317 ? 24.702  120.287 89.556  1.00 75.17  ? 295  GLN B O   1 
ATOM   4528  C  CB  . GLN B 1 317 ? 26.246  119.199 91.653  1.00 75.76  ? 295  GLN B CB  1 
ATOM   4529  C  CG  . GLN B 1 317 ? 26.946  118.319 92.658  1.00 80.29  ? 295  GLN B CG  1 
ATOM   4530  C  CD  . GLN B 1 317 ? 28.456  118.524 92.651  1.00 86.42  ? 295  GLN B CD  1 
ATOM   4531  O  OE1 . GLN B 1 317 ? 29.075  118.611 91.592  1.00 90.05  ? 295  GLN B OE1 1 
ATOM   4532  N  NE2 . GLN B 1 317 ? 29.051  118.590 93.835  1.00 87.51  ? 295  GLN B NE2 1 
ATOM   4533  N  N   . THR B 1 318 ? 23.076  120.767 91.035  1.00 77.54  ? 296  THR B N   1 
ATOM   4534  C  CA  . THR B 1 318 ? 22.467  121.799 90.192  1.00 80.66  ? 296  THR B CA  1 
ATOM   4535  C  C   . THR B 1 318 ? 21.381  122.589 90.921  1.00 84.84  ? 296  THR B C   1 
ATOM   4536  O  O   . THR B 1 318 ? 20.932  122.199 92.004  1.00 85.02  ? 296  THR B O   1 
ATOM   4537  C  CB  . THR B 1 318 ? 21.826  121.196 88.914  1.00 79.17  ? 296  THR B CB  1 
ATOM   4538  O  OG1 . THR B 1 318 ? 22.789  120.398 88.216  1.00 79.05  ? 296  THR B OG1 1 
ATOM   4539  C  CG2 . THR B 1 318 ? 21.359  122.302 87.977  1.00 76.99  ? 296  THR B CG2 1 
ATOM   4540  N  N   . GLU B 1 319 ? 20.980  123.711 90.329  1.00 89.34  ? 297  GLU B N   1 
ATOM   4541  C  CA  . GLU B 1 319 ? 19.930  124.544 90.891  1.00 90.09  ? 297  GLU B CA  1 
ATOM   4542  C  C   . GLU B 1 319 ? 18.616  124.207 90.168  1.00 88.92  ? 297  GLU B C   1 
ATOM   4543  O  O   . GLU B 1 319 ? 17.530  124.538 90.658  1.00 89.93  ? 297  GLU B O   1 
ATOM   4544  C  CB  . GLU B 1 319 ? 20.281  126.036 90.721  1.00 91.15  ? 297  GLU B CB  1 
ATOM   4545  C  CG  . GLU B 1 319 ? 20.835  126.695 91.994  1.00 90.31  ? 297  GLU B CG  1 
ATOM   4546  C  CD  . GLU B 1 319 ? 19.740  127.061 92.994  1.00 89.47  ? 297  GLU B CD  1 
ATOM   4547  O  OE1 . GLU B 1 319 ? 18.880  127.895 92.643  1.00 89.19  ? 297  GLU B OE1 1 
ATOM   4548  O  OE2 . GLU B 1 319 ? 19.737  126.520 94.124  1.00 89.76  ? 297  GLU B OE2 1 
ATOM   4549  N  N   . GLN B 1 320 ? 18.727  123.539 89.015  1.00 84.94  ? 298  GLN B N   1 
ATOM   4550  C  CA  . GLN B 1 320 ? 17.552  123.115 88.262  1.00 80.87  ? 298  GLN B CA  1 
ATOM   4551  C  C   . GLN B 1 320 ? 16.749  122.355 89.289  1.00 80.14  ? 298  GLN B C   1 
ATOM   4552  O  O   . GLN B 1 320 ? 17.258  121.418 89.914  1.00 79.37  ? 298  GLN B O   1 
ATOM   4553  C  CB  . GLN B 1 320 ? 17.885  122.095 87.165  1.00 81.65  ? 298  GLN B CB  1 
ATOM   4554  C  CG  . GLN B 1 320 ? 18.865  122.544 86.109  1.00 85.69  ? 298  GLN B CG  1 
ATOM   4555  C  CD  . GLN B 1 320 ? 18.241  123.502 85.106  1.00 88.69  ? 298  GLN B CD  1 
ATOM   4556  O  OE1 . GLN B 1 320 ? 17.222  123.191 84.509  1.00 89.83  ? 298  GLN B OE1 1 
ATOM   4557  N  NE2 . GLN B 1 320 ? 18.836  124.669 84.937  1.00 89.57  ? 298  GLN B NE2 1 
ATOM   4558  N  N   . THR B 1 321 ? 15.506  122.744 89.485  1.00 76.91  ? 299  THR B N   1 
ATOM   4559  C  CA  . THR B 1 321 ? 14.687  122.041 90.449  1.00 73.47  ? 299  THR B CA  1 
ATOM   4560  C  C   . THR B 1 321 ? 13.522  121.526 89.610  1.00 71.63  ? 299  THR B C   1 
ATOM   4561  O  O   . THR B 1 321 ? 12.832  120.558 89.966  1.00 71.64  ? 299  THR B O   1 
ATOM   4562  C  CB  . THR B 1 321 ? 14.227  123.023 91.578  1.00 73.63  ? 299  THR B CB  1 
ATOM   4563  O  OG1 . THR B 1 321 ? 14.682  122.538 92.856  1.00 73.23  ? 299  THR B OG1 1 
ATOM   4564  C  CG2 . THR B 1 321 ? 12.703  123.188 91.573  1.00 71.12  ? 299  THR B CG2 1 
ATOM   4565  N  N   . THR B 1 322 ? 13.353  122.175 88.458  1.00 68.30  ? 300  THR B N   1 
ATOM   4566  C  CA  . THR B 1 322 ? 12.285  121.844 87.536  1.00 61.23  ? 300  THR B CA  1 
ATOM   4567  C  C   . THR B 1 322 ? 12.732  121.430 86.135  1.00 57.79  ? 300  THR B C   1 
ATOM   4568  O  O   . THR B 1 322 ? 13.720  121.931 85.602  1.00 57.18  ? 300  THR B O   1 
ATOM   4569  C  CB  . THR B 1 322 ? 11.321  123.026 87.399  1.00 60.29  ? 300  THR B CB  1 
ATOM   4570  O  OG1 . THR B 1 322 ? 12.066  124.201 87.053  1.00 54.90  ? 300  THR B OG1 1 
ATOM   4571  C  CG2 . THR B 1 322 ? 10.573  123.265 88.704  1.00 61.97  ? 300  THR B CG2 1 
ATOM   4572  N  N   . TYR B 1 323 ? 11.976  120.499 85.560  1.00 54.88  ? 301  TYR B N   1 
ATOM   4573  C  CA  . TYR B 1 323 ? 12.195  119.991 84.212  1.00 47.32  ? 301  TYR B CA  1 
ATOM   4574  C  C   . TYR B 1 323 ? 10.821  119.648 83.650  1.00 42.08  ? 301  TYR B C   1 
ATOM   4575  O  O   . TYR B 1 323 ? 9.863   119.517 84.406  1.00 40.50  ? 301  TYR B O   1 
ATOM   4576  C  CB  . TYR B 1 323 ? 13.104  118.764 84.228  1.00 47.69  ? 301  TYR B CB  1 
ATOM   4577  C  CG  . TYR B 1 323 ? 12.812  117.807 85.350  1.00 50.50  ? 301  TYR B CG  1 
ATOM   4578  C  CD1 . TYR B 1 323 ? 11.672  117.011 85.339  1.00 50.31  ? 301  TYR B CD1 1 
ATOM   4579  C  CD2 . TYR B 1 323 ? 13.666  117.720 86.450  1.00 55.62  ? 301  TYR B CD2 1 
ATOM   4580  C  CE1 . TYR B 1 323 ? 11.389  116.153 86.396  1.00 55.31  ? 301  TYR B CE1 1 
ATOM   4581  C  CE2 . TYR B 1 323 ? 13.391  116.870 87.511  1.00 54.02  ? 301  TYR B CE2 1 
ATOM   4582  C  CZ  . TYR B 1 323 ? 12.253  116.092 87.478  1.00 55.11  ? 301  TYR B CZ  1 
ATOM   4583  O  OH  . TYR B 1 323 ? 11.979  115.275 88.545  1.00 53.96  ? 301  TYR B OH  1 
ATOM   4584  N  N   . GLU B 1 324 ? 10.736  119.496 82.330  1.00 38.49  ? 302  GLU B N   1 
ATOM   4585  C  CA  . GLU B 1 324 ? 9.480   119.219 81.647  1.00 36.92  ? 302  GLU B CA  1 
ATOM   4586  C  C   . GLU B 1 324 ? 9.089   117.754 81.484  1.00 34.76  ? 302  GLU B C   1 
ATOM   4587  O  O   . GLU B 1 324 ? 7.911   117.453 81.275  1.00 35.49  ? 302  GLU B O   1 
ATOM   4588  C  CB  . GLU B 1 324 ? 9.492   119.875 80.264  1.00 39.43  ? 302  GLU B CB  1 
ATOM   4589  C  CG  . GLU B 1 324 ? 9.730   121.378 80.248  1.00 43.99  ? 302  GLU B CG  1 
ATOM   4590  C  CD  . GLU B 1 324 ? 8.568   122.169 80.813  1.00 47.64  ? 302  GLU B CD  1 
ATOM   4591  O  OE1 . GLU B 1 324 ? 7.430   121.659 80.791  1.00 48.80  ? 302  GLU B OE1 1 
ATOM   4592  O  OE2 . GLU B 1 324 ? 8.789   123.310 81.264  1.00 52.26  ? 302  GLU B OE2 1 
ATOM   4593  N  N   . VAL B 1 325 ? 10.058  116.846 81.547  1.00 32.21  ? 303  VAL B N   1 
ATOM   4594  C  CA  . VAL B 1 325 ? 9.745   115.425 81.403  1.00 34.95  ? 303  VAL B CA  1 
ATOM   4595  C  C   . VAL B 1 325 ? 8.925   114.916 82.580  1.00 35.21  ? 303  VAL B C   1 
ATOM   4596  O  O   . VAL B 1 325 ? 9.309   115.080 83.739  1.00 30.50  ? 303  VAL B O   1 
ATOM   4597  C  CB  . VAL B 1 325 ? 11.012  114.561 81.272  1.00 35.18  ? 303  VAL B CB  1 
ATOM   4598  C  CG1 . VAL B 1 325 ? 11.523  114.610 79.850  1.00 32.33  ? 303  VAL B CG1 1 
ATOM   4599  C  CG2 . VAL B 1 325 ? 12.079  115.056 82.231  1.00 44.84  ? 303  VAL B CG2 1 
ATOM   4600  N  N   . GLU B 1 326 ? 7.799   114.282 82.267  1.00 35.42  ? 304  GLU B N   1 
ATOM   4601  C  CA  . GLU B 1 326 ? 6.899   113.767 83.285  1.00 36.06  ? 304  GLU B CA  1 
ATOM   4602  C  C   . GLU B 1 326 ? 7.116   112.317 83.722  1.00 35.10  ? 304  GLU B C   1 
ATOM   4603  O  O   . GLU B 1 326 ? 7.556   111.473 82.949  1.00 38.41  ? 304  GLU B O   1 
ATOM   4604  C  CB  . GLU B 1 326 ? 5.461   113.947 82.800  1.00 33.78  ? 304  GLU B CB  1 
ATOM   4605  C  CG  . GLU B 1 326 ? 5.190   115.337 82.256  1.00 38.05  ? 304  GLU B CG  1 
ATOM   4606  C  CD  . GLU B 1 326 ? 3.747   115.552 81.880  1.00 43.38  ? 304  GLU B CD  1 
ATOM   4607  O  OE1 . GLU B 1 326 ? 3.504   116.249 80.874  1.00 47.30  ? 304  GLU B OE1 1 
ATOM   4608  O  OE2 . GLU B 1 326 ? 2.855   115.032 82.591  1.00 48.30  ? 304  GLU B OE2 1 
ATOM   4609  N  N   . GLY B 1 327 ? 6.815   112.052 84.989  1.00 32.87  ? 305  GLY B N   1 
ATOM   4610  C  CA  . GLY B 1 327 ? 6.928   110.707 85.519  1.00 34.13  ? 305  GLY B CA  1 
ATOM   4611  C  C   . GLY B 1 327 ? 8.241   110.261 86.134  1.00 32.80  ? 305  GLY B C   1 
ATOM   4612  O  O   . GLY B 1 327 ? 8.283   109.218 86.770  1.00 24.37  ? 305  GLY B O   1 
ATOM   4613  N  N   . ILE B 1 328 ? 9.307   111.028 85.957  1.00 33.45  ? 306  ILE B N   1 
ATOM   4614  C  CA  . ILE B 1 328 ? 10.595  110.630 86.505  1.00 33.40  ? 306  ILE B CA  1 
ATOM   4615  C  C   . ILE B 1 328 ? 11.226  111.671 87.415  1.00 33.38  ? 306  ILE B C   1 
ATOM   4616  O  O   . ILE B 1 328 ? 10.948  112.863 87.305  1.00 31.21  ? 306  ILE B O   1 
ATOM   4617  C  CB  . ILE B 1 328 ? 11.597  110.293 85.385  1.00 35.67  ? 306  ILE B CB  1 
ATOM   4618  C  CG1 . ILE B 1 328 ? 11.665  111.443 84.376  1.00 29.43  ? 306  ILE B CG1 1 
ATOM   4619  C  CG2 . ILE B 1 328 ? 11.184  109.016 84.692  1.00 42.58  ? 306  ILE B CG2 1 
ATOM   4620  C  CD1 . ILE B 1 328 ? 12.813  111.324 83.407  1.00 15.75  ? 306  ILE B CD1 1 
ATOM   4621  N  N   . GLY B 1 329 ? 12.087  111.203 88.312  1.00 38.27  ? 307  GLY B N   1 
ATOM   4622  C  CA  . GLY B 1 329 ? 12.742  112.094 89.251  1.00 43.56  ? 307  GLY B CA  1 
ATOM   4623  C  C   . GLY B 1 329 ? 11.856  112.348 90.454  1.00 43.26  ? 307  GLY B C   1 
ATOM   4624  O  O   . GLY B 1 329 ? 10.671  112.016 90.433  1.00 46.85  ? 307  GLY B O   1 
ATOM   4625  N  N   . TYR B 1 330 ? 12.430  112.939 91.499  1.00 44.39  ? 308  TYR B N   1 
ATOM   4626  C  CA  . TYR B 1 330 ? 11.706  113.246 92.730  1.00 42.18  ? 308  TYR B CA  1 
ATOM   4627  C  C   . TYR B 1 330 ? 12.684  113.944 93.679  1.00 46.64  ? 308  TYR B C   1 
ATOM   4628  O  O   . TYR B 1 330 ? 13.904  113.782 93.550  1.00 42.06  ? 308  TYR B O   1 
ATOM   4629  C  CB  . TYR B 1 330 ? 11.201  111.951 93.370  1.00 40.92  ? 308  TYR B CB  1 
ATOM   4630  C  CG  . TYR B 1 330 ? 9.929   112.078 94.183  1.00 45.27  ? 308  TYR B CG  1 
ATOM   4631  C  CD1 . TYR B 1 330 ? 8.743   112.524 93.591  1.00 44.13  ? 308  TYR B CD1 1 
ATOM   4632  C  CD2 . TYR B 1 330 ? 9.894   111.685 95.539  1.00 40.13  ? 308  TYR B CD2 1 
ATOM   4633  C  CE1 . TYR B 1 330 ? 7.555   112.570 94.322  1.00 44.89  ? 308  TYR B CE1 1 
ATOM   4634  C  CE2 . TYR B 1 330 ? 8.715   111.726 96.276  1.00 31.75  ? 308  TYR B CE2 1 
ATOM   4635  C  CZ  . TYR B 1 330 ? 7.549   112.164 95.662  1.00 44.64  ? 308  TYR B CZ  1 
ATOM   4636  O  OH  . TYR B 1 330 ? 6.367   112.157 96.368  1.00 48.42  ? 308  TYR B OH  1 
ATOM   4637  N  N   . ASP B 1 331 ? 12.158  114.726 94.622  1.00 51.12  ? 309  ASP B N   1 
ATOM   4638  C  CA  . ASP B 1 331 ? 13.004  115.424 95.587  1.00 54.42  ? 309  ASP B CA  1 
ATOM   4639  C  C   . ASP B 1 331 ? 13.059  114.682 96.917  1.00 56.49  ? 309  ASP B C   1 
ATOM   4640  O  O   . ASP B 1 331 ? 13.478  115.229 97.933  1.00 57.80  ? 309  ASP B O   1 
ATOM   4641  C  CB  . ASP B 1 331 ? 12.514  116.858 95.805  1.00 53.89  ? 309  ASP B CB  1 
ATOM   4642  C  CG  . ASP B 1 331 ? 11.031  117.015 95.555  1.00 57.17  ? 309  ASP B CG  1 
ATOM   4643  O  OD1 . ASP B 1 331 ? 10.229  116.287 96.180  1.00 62.69  ? 309  ASP B OD1 1 
ATOM   4644  O  OD2 . ASP B 1 331 ? 10.667  117.876 94.728  1.00 53.76  ? 309  ASP B OD2 1 
ATOM   4645  N  N   . PHE B 1 332 ? 12.631  113.424 96.889  1.00 59.32  ? 310  PHE B N   1 
ATOM   4646  C  CA  . PHE B 1 332 ? 12.621  112.551 98.057  1.00 56.05  ? 310  PHE B CA  1 
ATOM   4647  C  C   . PHE B 1 332 ? 12.901  111.143 97.560  1.00 51.07  ? 310  PHE B C   1 
ATOM   4648  O  O   . PHE B 1 332 ? 12.526  110.790 96.449  1.00 41.59  ? 310  PHE B O   1 
ATOM   4649  C  CB  . PHE B 1 332 ? 11.251  112.556 98.740  1.00 59.06  ? 310  PHE B CB  1 
ATOM   4650  C  CG  . PHE B 1 332 ? 10.916  113.840 99.427  1.00 62.55  ? 310  PHE B CG  1 
ATOM   4651  C  CD1 . PHE B 1 332 ? 9.838   114.606 99.001  1.00 66.98  ? 310  PHE B CD1 1 
ATOM   4652  C  CD2 . PHE B 1 332 ? 11.667  114.278 100.517 1.00 61.24  ? 310  PHE B CD2 1 
ATOM   4653  C  CE1 . PHE B 1 332 ? 9.509   115.792 99.654  1.00 70.90  ? 310  PHE B CE1 1 
ATOM   4654  C  CE2 . PHE B 1 332 ? 11.347  115.463 101.178 1.00 61.50  ? 310  PHE B CE2 1 
ATOM   4655  C  CZ  . PHE B 1 332 ? 10.268  116.221 100.747 1.00 66.85  ? 310  PHE B CZ  1 
ATOM   4656  N  N   . ILE B 1 333 ? 13.566  110.337 98.376  1.00 49.27  ? 311  ILE B N   1 
ATOM   4657  C  CA  . ILE B 1 333 ? 13.835  108.967 97.972  1.00 47.58  ? 311  ILE B CA  1 
ATOM   4658  C  C   . ILE B 1 333 ? 12.626  108.109 98.349  1.00 48.09  ? 311  ILE B C   1 
ATOM   4659  O  O   . ILE B 1 333 ? 12.417  107.787 99.520  1.00 44.60  ? 311  ILE B O   1 
ATOM   4660  C  CB  . ILE B 1 333 ? 15.100  108.424 98.648  1.00 41.25  ? 311  ILE B CB  1 
ATOM   4661  C  CG1 . ILE B 1 333 ? 16.272  109.342 98.318  1.00 36.11  ? 311  ILE B CG1 1 
ATOM   4662  C  CG2 . ILE B 1 333 ? 15.383  107.001 98.167  1.00 29.17  ? 311  ILE B CG2 1 
ATOM   4663  C  CD1 . ILE B 1 333 ? 17.592  108.799 98.751  1.00 43.09  ? 311  ILE B CD1 1 
ATOM   4664  N  N   . PRO B 1 334 ? 11.792  107.755 97.352  1.00 51.04  ? 312  PRO B N   1 
ATOM   4665  C  CA  . PRO B 1 334 ? 10.612  106.935 97.635  1.00 47.65  ? 312  PRO B CA  1 
ATOM   4666  C  C   . PRO B 1 334 ? 11.040  105.710 98.422  1.00 47.30  ? 312  PRO B C   1 
ATOM   4667  O  O   . PRO B 1 334 ? 12.145  105.197 98.237  1.00 48.37  ? 312  PRO B O   1 
ATOM   4668  C  CB  . PRO B 1 334 ? 10.094  106.580 96.239  1.00 47.24  ? 312  PRO B CB  1 
ATOM   4669  C  CG  . PRO B 1 334 ? 10.505  107.766 95.416  1.00 44.34  ? 312  PRO B CG  1 
ATOM   4670  C  CD  . PRO B 1 334 ? 11.915  108.014 95.904  1.00 49.41  ? 312  PRO B CD  1 
ATOM   4671  N  N   . THR B 1 335 ? 10.172  105.251 99.309  1.00 45.02  ? 313  THR B N   1 
ATOM   4672  C  CA  . THR B 1 335 ? 10.472  104.080 100.114 1.00 40.62  ? 313  THR B CA  1 
ATOM   4673  C  C   . THR B 1 335 ? 10.420  102.772 99.310  1.00 38.42  ? 313  THR B C   1 
ATOM   4674  O  O   . THR B 1 335 ? 11.076  101.796 99.671  1.00 35.05  ? 313  THR B O   1 
ATOM   4675  C  CB  . THR B 1 335 ? 9.518   104.025 101.340 1.00 40.42  ? 313  THR B CB  1 
ATOM   4676  O  OG1 . THR B 1 335 ? 9.099   102.683 101.584 1.00 34.98  ? 313  THR B OG1 1 
ATOM   4677  C  CG2 . THR B 1 335 ? 8.316   104.889 101.110 1.00 38.25  ? 313  THR B CG2 1 
ATOM   4678  N  N   . VAL B 1 336 ? 9.659   102.758 98.213  1.00 39.50  ? 314  VAL B N   1 
ATOM   4679  C  CA  . VAL B 1 336 ? 9.559   101.562 97.371  1.00 34.69  ? 314  VAL B CA  1 
ATOM   4680  C  C   . VAL B 1 336 ? 10.806  101.345 96.521  1.00 31.54  ? 314  VAL B C   1 
ATOM   4681  O  O   . VAL B 1 336 ? 10.991  100.273 95.961  1.00 34.40  ? 314  VAL B O   1 
ATOM   4682  C  CB  . VAL B 1 336 ? 8.338   101.621 96.427  1.00 32.67  ? 314  VAL B CB  1 
ATOM   4683  C  CG1 . VAL B 1 336 ? 7.041   101.602 97.246  1.00 33.01  ? 314  VAL B CG1 1 
ATOM   4684  C  CG2 . VAL B 1 336 ? 8.413   102.869 95.546  1.00 38.10  ? 314  VAL B CG2 1 
ATOM   4685  N  N   . LEU B 1 337 ? 11.653  102.369 96.431  1.00 28.57  ? 315  LEU B N   1 
ATOM   4686  C  CA  . LEU B 1 337 ? 12.899  102.299 95.666  1.00 24.82  ? 315  LEU B CA  1 
ATOM   4687  C  C   . LEU B 1 337 ? 14.084  101.731 96.463  1.00 24.57  ? 315  LEU B C   1 
ATOM   4688  O  O   . LEU B 1 337 ? 14.395  102.196 97.557  1.00 30.70  ? 315  LEU B O   1 
ATOM   4689  C  CB  . LEU B 1 337 ? 13.274  103.693 95.160  1.00 16.12  ? 315  LEU B CB  1 
ATOM   4690  C  CG  . LEU B 1 337 ? 14.730  103.903 94.727  1.00 26.80  ? 315  LEU B CG  1 
ATOM   4691  C  CD1 . LEU B 1 337 ? 15.072  103.002 93.536  1.00 26.12  ? 315  LEU B CD1 1 
ATOM   4692  C  CD2 . LEU B 1 337 ? 14.943  105.362 94.360  1.00 36.96  ? 315  LEU B CD2 1 
ATOM   4693  N  N   . ASP B 1 338 ? 14.747  100.732 95.897  1.00 24.04  ? 316  ASP B N   1 
ATOM   4694  C  CA  . ASP B 1 338 ? 15.903  100.109 96.525  1.00 21.31  ? 316  ASP B CA  1 
ATOM   4695  C  C   . ASP B 1 338 ? 17.100  100.463 95.650  1.00 23.69  ? 316  ASP B C   1 
ATOM   4696  O  O   . ASP B 1 338 ? 17.430  99.735  94.718  1.00 26.01  ? 316  ASP B O   1 
ATOM   4697  C  CB  . ASP B 1 338 ? 15.687  98.592  96.575  1.00 28.11  ? 316  ASP B CB  1 
ATOM   4698  C  CG  . ASP B 1 338 ? 16.869  97.833  97.184  1.00 32.14  ? 316  ASP B CG  1 
ATOM   4699  O  OD1 . ASP B 1 338 ? 16.732  96.608  97.397  1.00 28.10  ? 316  ASP B OD1 1 
ATOM   4700  O  OD2 . ASP B 1 338 ? 17.926  98.443  97.445  1.00 24.80  ? 316  ASP B OD2 1 
ATOM   4701  N  N   . ARG B 1 339 ? 17.745  101.591 95.937  1.00 24.47  ? 317  ARG B N   1 
ATOM   4702  C  CA  . ARG B 1 339 ? 18.890  102.038 95.135  1.00 25.03  ? 317  ARG B CA  1 
ATOM   4703  C  C   . ARG B 1 339 ? 20.051  101.060 95.137  1.00 23.59  ? 317  ARG B C   1 
ATOM   4704  O  O   . ARG B 1 339 ? 20.994  101.208 94.363  1.00 20.74  ? 317  ARG B O   1 
ATOM   4705  C  CB  . ARG B 1 339 ? 19.399  103.389 95.636  1.00 31.45  ? 317  ARG B CB  1 
ATOM   4706  C  CG  . ARG B 1 339 ? 18.403  104.533 95.568  1.00 36.92  ? 317  ARG B CG  1 
ATOM   4707  C  CD  . ARG B 1 339 ? 18.798  105.555 96.623  1.00 45.14  ? 317  ARG B CD  1 
ATOM   4708  N  NE  . ARG B 1 339 ? 19.111  106.866 96.070  1.00 50.32  ? 317  ARG B NE  1 
ATOM   4709  C  CZ  . ARG B 1 339 ? 19.741  107.823 96.744  1.00 53.69  ? 317  ARG B CZ  1 
ATOM   4710  N  NH1 . ARG B 1 339 ? 20.131  107.607 97.993  1.00 48.57  ? 317  ARG B NH1 1 
ATOM   4711  N  NH2 . ARG B 1 339 ? 19.962  109.003 96.177  1.00 56.29  ? 317  ARG B NH2 1 
ATOM   4712  N  N   . THR B 1 340 ? 19.976  100.069 96.018  1.00 25.52  ? 318  THR B N   1 
ATOM   4713  C  CA  . THR B 1 340 ? 21.024  99.066  96.175  1.00 25.88  ? 318  THR B CA  1 
ATOM   4714  C  C   . THR B 1 340 ? 21.207  98.149  94.979  1.00 29.32  ? 318  THR B C   1 
ATOM   4715  O  O   . THR B 1 340 ? 22.301  97.640  94.741  1.00 29.99  ? 318  THR B O   1 
ATOM   4716  C  CB  . THR B 1 340 ? 20.756  98.195  97.426  1.00 21.87  ? 318  THR B CB  1 
ATOM   4717  O  OG1 . THR B 1 340 ? 21.232  98.868  98.594  1.00 21.62  ? 318  THR B OG1 1 
ATOM   4718  C  CG2 . THR B 1 340 ? 21.442  96.860  97.318  1.00 23.94  ? 318  THR B CG2 1 
ATOM   4719  N  N   . VAL B 1 341 ? 20.139  97.940  94.228  1.00 30.25  ? 319  VAL B N   1 
ATOM   4720  C  CA  . VAL B 1 341 ? 20.202  97.048  93.091  1.00 32.53  ? 319  VAL B CA  1 
ATOM   4721  C  C   . VAL B 1 341 ? 20.511  97.750  91.781  1.00 37.35  ? 319  VAL B C   1 
ATOM   4722  O  O   . VAL B 1 341 ? 20.610  97.104  90.733  1.00 37.40  ? 319  VAL B O   1 
ATOM   4723  C  CB  . VAL B 1 341 ? 18.890  96.256  92.969  1.00 35.23  ? 319  VAL B CB  1 
ATOM   4724  C  CG1 . VAL B 1 341 ? 18.761  95.310  94.156  1.00 34.14  ? 319  VAL B CG1 1 
ATOM   4725  C  CG2 . VAL B 1 341 ? 17.699  97.213  92.938  1.00 27.09  ? 319  VAL B CG2 1 
ATOM   4726  N  N   . VAL B 1 342 ? 20.661  99.072  91.837  1.00 36.55  ? 320  VAL B N   1 
ATOM   4727  C  CA  . VAL B 1 342 ? 20.982  99.846  90.640  1.00 32.65  ? 320  VAL B CA  1 
ATOM   4728  C  C   . VAL B 1 342 ? 22.504  99.886  90.527  1.00 32.90  ? 320  VAL B C   1 
ATOM   4729  O  O   . VAL B 1 342 ? 23.179  100.458 91.369  1.00 31.43  ? 320  VAL B O   1 
ATOM   4730  C  CB  . VAL B 1 342 ? 20.440  101.287 90.724  1.00 30.36  ? 320  VAL B CB  1 
ATOM   4731  C  CG1 . VAL B 1 342 ? 20.837  102.062 89.473  1.00 27.73  ? 320  VAL B CG1 1 
ATOM   4732  C  CG2 . VAL B 1 342 ? 18.928  101.267 90.872  1.00 34.18  ? 320  VAL B CG2 1 
ATOM   4733  N  N   . ASP B 1 343 ? 23.043  99.273  89.481  1.00 37.83  ? 321  ASP B N   1 
ATOM   4734  C  CA  . ASP B 1 343 ? 24.489  99.225  89.303  1.00 36.13  ? 321  ASP B CA  1 
ATOM   4735  C  C   . ASP B 1 343 ? 25.144  100.543 88.936  1.00 36.45  ? 321  ASP B C   1 
ATOM   4736  O  O   . ASP B 1 343 ? 26.320  100.746 89.230  1.00 35.26  ? 321  ASP B O   1 
ATOM   4737  C  CB  . ASP B 1 343 ? 24.858  98.165  88.263  1.00 29.02  ? 321  ASP B CB  1 
ATOM   4738  C  CG  . ASP B 1 343 ? 24.582  96.771  88.750  1.00 26.47  ? 321  ASP B CG  1 
ATOM   4739  O  OD1 . ASP B 1 343 ? 24.985  96.459  89.889  1.00 38.71  ? 321  ASP B OD1 1 
ATOM   4740  O  OD2 . ASP B 1 343 ? 23.971  95.985  88.003  1.00 34.32  ? 321  ASP B OD2 1 
ATOM   4741  N  N   . LYS B 1 344 ? 24.394  101.436 88.296  1.00 35.97  ? 322  LYS B N   1 
ATOM   4742  C  CA  . LYS B 1 344 ? 24.952  102.721 87.894  1.00 31.90  ? 322  LYS B CA  1 
ATOM   4743  C  C   . LYS B 1 344 ? 23.868  103.668 87.423  1.00 26.14  ? 322  LYS B C   1 
ATOM   4744  O  O   . LYS B 1 344 ? 22.876  103.256 86.841  1.00 22.67  ? 322  LYS B O   1 
ATOM   4745  C  CB  . LYS B 1 344 ? 25.983  102.513 86.776  1.00 40.36  ? 322  LYS B CB  1 
ATOM   4746  C  CG  . LYS B 1 344 ? 26.671  103.782 86.300  1.00 48.64  ? 322  LYS B CG  1 
ATOM   4747  C  CD  . LYS B 1 344 ? 27.683  103.463 85.216  1.00 55.26  ? 322  LYS B CD  1 
ATOM   4748  C  CE  . LYS B 1 344 ? 28.294  104.728 84.631  1.00 64.27  ? 322  LYS B CE  1 
ATOM   4749  N  NZ  . LYS B 1 344 ? 29.195  104.428 83.471  1.00 65.28  ? 322  LYS B NZ  1 
ATOM   4750  N  N   . TRP B 1 345 ? 24.060  104.948 87.681  1.00 29.39  ? 323  TRP B N   1 
ATOM   4751  C  CA  . TRP B 1 345 ? 23.085  105.936 87.274  1.00 27.82  ? 323  TRP B CA  1 
ATOM   4752  C  C   . TRP B 1 345 ? 23.645  106.872 86.218  1.00 33.25  ? 323  TRP B C   1 
ATOM   4753  O  O   . TRP B 1 345 ? 24.865  106.994 86.046  1.00 34.35  ? 323  TRP B O   1 
ATOM   4754  C  CB  . TRP B 1 345 ? 22.634  106.779 88.468  1.00 27.58  ? 323  TRP B CB  1 
ATOM   4755  C  CG  . TRP B 1 345 ? 21.920  106.033 89.562  1.00 26.06  ? 323  TRP B CG  1 
ATOM   4756  C  CD1 . TRP B 1 345 ? 22.486  105.252 90.529  1.00 26.18  ? 323  TRP B CD1 1 
ATOM   4757  C  CD2 . TRP B 1 345 ? 20.512  106.057 89.834  1.00 16.43  ? 323  TRP B CD2 1 
ATOM   4758  N  NE1 . TRP B 1 345 ? 21.516  104.796 91.395  1.00 28.25  ? 323  TRP B NE1 1 
ATOM   4759  C  CE2 . TRP B 1 345 ? 20.297  105.277 90.992  1.00 16.81  ? 323  TRP B CE2 1 
ATOM   4760  C  CE3 . TRP B 1 345 ? 19.414  106.666 89.213  1.00 18.76  ? 323  TRP B CE3 1 
ATOM   4761  C  CZ2 . TRP B 1 345 ? 19.023  105.091 91.549  1.00 16.21  ? 323  TRP B CZ2 1 
ATOM   4762  C  CZ3 . TRP B 1 345 ? 18.143  106.482 89.765  1.00 22.80  ? 323  TRP B CZ3 1 
ATOM   4763  C  CH2 . TRP B 1 345 ? 17.961  105.700 90.924  1.00 8.09   ? 323  TRP B CH2 1 
ATOM   4764  N  N   . PHE B 1 346 ? 22.720  107.522 85.516  1.00 31.55  ? 324  PHE B N   1 
ATOM   4765  C  CA  . PHE B 1 346 ? 23.015  108.511 84.485  1.00 32.15  ? 324  PHE B CA  1 
ATOM   4766  C  C   . PHE B 1 346 ? 21.943  109.571 84.640  1.00 33.00  ? 324  PHE B C   1 
ATOM   4767  O  O   . PHE B 1 346 ? 20.785  109.258 84.912  1.00 34.41  ? 324  PHE B O   1 
ATOM   4768  C  CB  . PHE B 1 346 ? 22.897  107.933 83.072  1.00 31.49  ? 324  PHE B CB  1 
ATOM   4769  C  CG  . PHE B 1 346 ? 24.051  107.077 82.659  1.00 27.95  ? 324  PHE B CG  1 
ATOM   4770  C  CD1 . PHE B 1 346 ? 24.149  105.761 83.091  1.00 32.09  ? 324  PHE B CD1 1 
ATOM   4771  C  CD2 . PHE B 1 346 ? 25.036  107.580 81.820  1.00 28.47  ? 324  PHE B CD2 1 
ATOM   4772  C  CE1 . PHE B 1 346 ? 25.221  104.952 82.686  1.00 26.06  ? 324  PHE B CE1 1 
ATOM   4773  C  CE2 . PHE B 1 346 ? 26.105  106.780 81.413  1.00 29.92  ? 324  PHE B CE2 1 
ATOM   4774  C  CZ  . PHE B 1 346 ? 26.195  105.463 81.847  1.00 20.54  ? 324  PHE B CZ  1 
ATOM   4775  N  N   . LYS B 1 347 ? 22.323  110.826 84.477  1.00 34.26  ? 325  LYS B N   1 
ATOM   4776  C  CA  . LYS B 1 347 ? 21.357  111.895 84.583  1.00 32.18  ? 325  LYS B CA  1 
ATOM   4777  C  C   . LYS B 1 347 ? 20.991  112.243 83.146  1.00 30.91  ? 325  LYS B C   1 
ATOM   4778  O  O   . LYS B 1 347 ? 21.768  111.984 82.220  1.00 31.01  ? 325  LYS B O   1 
ATOM   4779  C  CB  . LYS B 1 347 ? 21.987  113.103 85.285  1.00 38.69  ? 325  LYS B CB  1 
ATOM   4780  C  CG  . LYS B 1 347 ? 22.524  112.815 86.687  1.00 45.48  ? 325  LYS B CG  1 
ATOM   4781  C  CD  . LYS B 1 347 ? 21.414  112.662 87.721  1.00 44.91  ? 325  LYS B CD  1 
ATOM   4782  C  CE  . LYS B 1 347 ? 20.631  113.952 87.892  1.00 47.04  ? 325  LYS B CE  1 
ATOM   4783  N  NZ  . LYS B 1 347 ? 19.673  113.870 89.027  1.00 58.31  ? 325  LYS B NZ  1 
ATOM   4784  N  N   . SER B 1 348 ? 19.808  112.805 82.949  1.00 25.81  ? 326  SER B N   1 
ATOM   4785  C  CA  . SER B 1 348 ? 19.397  113.200 81.615  1.00 28.41  ? 326  SER B CA  1 
ATOM   4786  C  C   . SER B 1 348 ? 18.757  114.576 81.725  1.00 28.67  ? 326  SER B C   1 
ATOM   4787  O  O   . SER B 1 348 ? 18.508  115.067 82.824  1.00 21.93  ? 326  SER B O   1 
ATOM   4788  C  CB  . SER B 1 348 ? 18.396  112.192 81.027  1.00 31.61  ? 326  SER B CB  1 
ATOM   4789  O  OG  . SER B 1 348 ? 17.169  112.179 81.744  1.00 35.62  ? 326  SER B OG  1 
ATOM   4790  N  N   . ASN B 1 349 ? 18.493  115.198 80.582  1.00 40.10  ? 327  ASN B N   1 
ATOM   4791  C  CA  . ASN B 1 349 ? 17.868  116.514 80.564  1.00 43.23  ? 327  ASN B CA  1 
ATOM   4792  C  C   . ASN B 1 349 ? 16.673  116.504 79.628  1.00 43.12  ? 327  ASN B C   1 
ATOM   4793  O  O   . ASN B 1 349 ? 16.500  115.573 78.840  1.00 37.55  ? 327  ASN B O   1 
ATOM   4794  C  CB  . ASN B 1 349 ? 18.881  117.581 80.130  1.00 44.84  ? 327  ASN B CB  1 
ATOM   4795  C  CG  . ASN B 1 349 ? 19.614  117.211 78.858  1.00 44.25  ? 327  ASN B CG  1 
ATOM   4796  O  OD1 . ASN B 1 349 ? 19.052  117.264 77.765  1.00 51.01  ? 327  ASN B OD1 1 
ATOM   4797  N  ND2 . ASN B 1 349 ? 20.878  116.821 78.996  1.00 42.86  ? 327  ASN B ND2 1 
ATOM   4798  N  N   . ASP B 1 350 ? 15.847  117.540 79.729  1.00 46.12  ? 328  ASP B N   1 
ATOM   4799  C  CA  . ASP B 1 350 ? 14.658  117.650 78.891  1.00 50.54  ? 328  ASP B CA  1 
ATOM   4800  C  C   . ASP B 1 350 ? 14.956  117.581 77.394  1.00 51.24  ? 328  ASP B C   1 
ATOM   4801  O  O   . ASP B 1 350 ? 14.357  116.783 76.667  1.00 53.18  ? 328  ASP B O   1 
ATOM   4802  C  CB  . ASP B 1 350 ? 13.918  118.955 79.190  1.00 44.48  ? 328  ASP B CB  1 
ATOM   4803  C  CG  . ASP B 1 350 ? 13.087  118.882 80.451  1.00 43.85  ? 328  ASP B CG  1 
ATOM   4804  O  OD1 . ASP B 1 350 ? 12.460  119.904 80.789  1.00 45.91  ? 328  ASP B OD1 1 
ATOM   4805  O  OD2 . ASP B 1 350 ? 13.052  117.815 81.100  1.00 36.90  ? 328  ASP B OD2 1 
ATOM   4806  N  N   . GLU B 1 351 ? 15.877  118.425 76.940  1.00 52.12  ? 329  GLU B N   1 
ATOM   4807  C  CA  . GLU B 1 351 ? 16.242  118.481 75.529  1.00 54.02  ? 329  GLU B CA  1 
ATOM   4808  C  C   . GLU B 1 351 ? 16.636  117.120 74.965  1.00 52.18  ? 329  GLU B C   1 
ATOM   4809  O  O   . GLU B 1 351 ? 16.144  116.694 73.919  1.00 55.22  ? 329  GLU B O   1 
ATOM   4810  C  CB  . GLU B 1 351 ? 17.383  119.475 75.336  1.00 59.04  ? 329  GLU B CB  1 
ATOM   4811  C  CG  . GLU B 1 351 ? 17.766  119.706 73.888  1.00 70.73  ? 329  GLU B CG  1 
ATOM   4812  C  CD  . GLU B 1 351 ? 18.309  121.107 73.653  1.00 76.99  ? 329  GLU B CD  1 
ATOM   4813  O  OE1 . GLU B 1 351 ? 18.851  121.363 72.554  1.00 81.97  ? 329  GLU B OE1 1 
ATOM   4814  O  OE2 . GLU B 1 351 ? 18.183  121.957 74.566  1.00 75.20  ? 329  GLU B OE2 1 
ATOM   4815  N  N   . GLU B 1 352 ? 17.533  116.448 75.667  1.00 49.11  ? 330  GLU B N   1 
ATOM   4816  C  CA  . GLU B 1 352 ? 18.007  115.131 75.280  1.00 45.04  ? 330  GLU B CA  1 
ATOM   4817  C  C   . GLU B 1 352 ? 16.796  114.187 75.226  1.00 46.81  ? 330  GLU B C   1 
ATOM   4818  O  O   . GLU B 1 352 ? 16.599  113.455 74.250  1.00 51.70  ? 330  GLU B O   1 
ATOM   4819  C  CB  . GLU B 1 352 ? 19.022  114.675 76.331  1.00 44.33  ? 330  GLU B CB  1 
ATOM   4820  C  CG  . GLU B 1 352 ? 19.889  113.483 75.994  1.00 40.74  ? 330  GLU B CG  1 
ATOM   4821  C  CD  . GLU B 1 352 ? 20.925  113.233 77.087  1.00 46.69  ? 330  GLU B CD  1 
ATOM   4822  O  OE1 . GLU B 1 352 ? 20.549  113.266 78.280  1.00 49.10  ? 330  GLU B OE1 1 
ATOM   4823  O  OE2 . GLU B 1 352 ? 22.111  113.002 76.767  1.00 48.66  ? 330  GLU B OE2 1 
ATOM   4824  N  N   . ALA B 1 353 ? 15.976  114.235 76.275  1.00 40.56  ? 331  ALA B N   1 
ATOM   4825  C  CA  . ALA B 1 353 ? 14.784  113.392 76.385  1.00 35.87  ? 331  ALA B CA  1 
ATOM   4826  C  C   . ALA B 1 353 ? 13.819  113.532 75.209  1.00 33.31  ? 331  ALA B C   1 
ATOM   4827  O  O   . ALA B 1 353 ? 13.500  112.551 74.543  1.00 34.78  ? 331  ALA B O   1 
ATOM   4828  C  CB  . ALA B 1 353 ? 14.058  113.697 77.690  1.00 27.32  ? 331  ALA B CB  1 
ATOM   4829  N  N   . PHE B 1 354 ? 13.363  114.754 74.962  1.00 31.44  ? 332  PHE B N   1 
ATOM   4830  C  CA  . PHE B 1 354 ? 12.419  115.027 73.892  1.00 32.52  ? 332  PHE B CA  1 
ATOM   4831  C  C   . PHE B 1 354 ? 12.961  114.789 72.486  1.00 33.04  ? 332  PHE B C   1 
ATOM   4832  O  O   . PHE B 1 354 ? 12.218  114.401 71.584  1.00 35.50  ? 332  PHE B O   1 
ATOM   4833  C  CB  . PHE B 1 354 ? 11.918  116.457 74.033  1.00 38.33  ? 332  PHE B CB  1 
ATOM   4834  C  CG  . PHE B 1 354 ? 11.184  116.705 75.316  1.00 45.96  ? 332  PHE B CG  1 
ATOM   4835  C  CD1 . PHE B 1 354 ? 11.439  117.845 76.067  1.00 45.60  ? 332  PHE B CD1 1 
ATOM   4836  C  CD2 . PHE B 1 354 ? 10.212  115.809 75.763  1.00 50.58  ? 332  PHE B CD2 1 
ATOM   4837  C  CE1 . PHE B 1 354 ? 10.737  118.093 77.244  1.00 50.63  ? 332  PHE B CE1 1 
ATOM   4838  C  CE2 . PHE B 1 354 ? 9.504   116.048 76.938  1.00 49.15  ? 332  PHE B CE2 1 
ATOM   4839  C  CZ  . PHE B 1 354 ? 9.766   117.192 77.679  1.00 48.63  ? 332  PHE B CZ  1 
ATOM   4840  N  N   . THR B 1 355 ? 14.250  115.023 72.291  1.00 31.53  ? 333  THR B N   1 
ATOM   4841  C  CA  . THR B 1 355 ? 14.835  114.802 70.981  1.00 31.81  ? 333  THR B CA  1 
ATOM   4842  C  C   . THR B 1 355 ? 14.854  113.304 70.678  1.00 32.62  ? 333  THR B C   1 
ATOM   4843  O  O   . THR B 1 355 ? 14.640  112.890 69.535  1.00 30.93  ? 333  THR B O   1 
ATOM   4844  C  CB  . THR B 1 355 ? 16.273  115.373 70.893  1.00 31.86  ? 333  THR B CB  1 
ATOM   4845  O  OG1 . THR B 1 355 ? 17.073  114.833 71.946  1.00 34.01  ? 333  THR B OG1 1 
ATOM   4846  C  CG2 . THR B 1 355 ? 16.254  116.885 71.016  1.00 32.17  ? 333  THR B CG2 1 
ATOM   4847  N  N   . PHE B 1 356 ? 15.106  112.490 71.702  1.00 32.71  ? 334  PHE B N   1 
ATOM   4848  C  CA  . PHE B 1 356 ? 15.125  111.052 71.504  1.00 33.30  ? 334  PHE B CA  1 
ATOM   4849  C  C   . PHE B 1 356 ? 13.717  110.504 71.396  1.00 32.80  ? 334  PHE B C   1 
ATOM   4850  O  O   . PHE B 1 356 ? 13.489  109.540 70.674  1.00 34.33  ? 334  PHE B O   1 
ATOM   4851  C  CB  . PHE B 1 356 ? 15.892  110.342 72.617  1.00 30.62  ? 334  PHE B CB  1 
ATOM   4852  C  CG  . PHE B 1 356 ? 17.362  110.204 72.337  1.00 29.54  ? 334  PHE B CG  1 
ATOM   4853  C  CD1 . PHE B 1 356 ? 18.215  111.294 72.463  1.00 34.25  ? 334  PHE B CD1 1 
ATOM   4854  C  CD2 . PHE B 1 356 ? 17.888  108.993 71.914  1.00 25.01  ? 334  PHE B CD2 1 
ATOM   4855  C  CE1 . PHE B 1 356 ? 19.573  111.177 72.169  1.00 30.58  ? 334  PHE B CE1 1 
ATOM   4856  C  CE2 . PHE B 1 356 ? 19.243  108.862 71.616  1.00 23.41  ? 334  PHE B CE2 1 
ATOM   4857  C  CZ  . PHE B 1 356 ? 20.088  109.957 71.744  1.00 26.27  ? 334  PHE B CZ  1 
ATOM   4858  N  N   . ALA B 1 357 ? 12.769  111.120 72.095  1.00 31.79  ? 335  ALA B N   1 
ATOM   4859  C  CA  . ALA B 1 357 ? 11.390  110.662 72.018  1.00 35.42  ? 335  ALA B CA  1 
ATOM   4860  C  C   . ALA B 1 357 ? 10.955  110.845 70.566  1.00 37.41  ? 335  ALA B C   1 
ATOM   4861  O  O   . ALA B 1 357 ? 10.326  109.968 69.969  1.00 38.19  ? 335  ALA B O   1 
ATOM   4862  C  CB  . ALA B 1 357 ? 10.505  111.482 72.944  1.00 35.14  ? 335  ALA B CB  1 
ATOM   4863  N  N   . ARG B 1 358 ? 11.314  111.990 69.997  1.00 36.89  ? 336  ARG B N   1 
ATOM   4864  C  CA  . ARG B 1 358 ? 10.972  112.298 68.612  1.00 35.22  ? 336  ARG B CA  1 
ATOM   4865  C  C   . ARG B 1 358 ? 11.654  111.361 67.624  1.00 33.20  ? 336  ARG B C   1 
ATOM   4866  O  O   . ARG B 1 358 ? 11.107  111.050 66.572  1.00 26.50  ? 336  ARG B O   1 
ATOM   4867  C  CB  . ARG B 1 358 ? 11.343  113.748 68.298  1.00 34.58  ? 336  ARG B CB  1 
ATOM   4868  C  CG  . ARG B 1 358 ? 10.209  114.715 68.556  1.00 29.67  ? 336  ARG B CG  1 
ATOM   4869  C  CD  . ARG B 1 358 ? 10.689  116.113 68.885  1.00 31.84  ? 336  ARG B CD  1 
ATOM   4870  N  NE  . ARG B 1 358 ? 9.570   117.040 68.804  1.00 27.96  ? 336  ARG B NE  1 
ATOM   4871  C  CZ  . ARG B 1 358 ? 9.171   117.627 67.685  1.00 24.05  ? 336  ARG B CZ  1 
ATOM   4872  N  NH1 . ARG B 1 358 ? 8.128   118.438 67.704  1.00 28.60  ? 336  ARG B NH1 1 
ATOM   4873  N  NH2 . ARG B 1 358 ? 9.836   117.437 66.555  1.00 24.27  ? 336  ARG B NH2 1 
ATOM   4874  N  N   . MET B 1 359 ? 12.845  110.907 67.990  1.00 32.17  ? 337  MET B N   1 
ATOM   4875  C  CA  . MET B 1 359 ? 13.642  110.013 67.160  1.00 28.49  ? 337  MET B CA  1 
ATOM   4876  C  C   . MET B 1 359 ? 13.043  108.610 67.143  1.00 30.15  ? 337  MET B C   1 
ATOM   4877  O  O   . MET B 1 359 ? 13.164  107.876 66.160  1.00 30.71  ? 337  MET B O   1 
ATOM   4878  C  CB  . MET B 1 359 ? 15.057  109.979 67.716  1.00 33.03  ? 337  MET B CB  1 
ATOM   4879  C  CG  . MET B 1 359 ? 16.136  109.571 66.748  1.00 39.22  ? 337  MET B CG  1 
ATOM   4880  S  SD  . MET B 1 359 ? 17.753  110.027 67.452  1.00 45.85  ? 337  MET B SD  1 
ATOM   4881  C  CE  . MET B 1 359 ? 18.237  108.518 68.169  1.00 44.99  ? 337  MET B CE  1 
ATOM   4882  N  N   . LEU B 1 360 ? 12.393  108.242 68.241  1.00 29.92  ? 338  LEU B N   1 
ATOM   4883  C  CA  . LEU B 1 360 ? 11.768  106.931 68.371  1.00 29.61  ? 338  LEU B CA  1 
ATOM   4884  C  C   . LEU B 1 360 ? 10.513  106.890 67.523  1.00 30.29  ? 338  LEU B C   1 
ATOM   4885  O  O   . LEU B 1 360 ? 10.174  105.860 66.946  1.00 38.35  ? 338  LEU B O   1 
ATOM   4886  C  CB  . LEU B 1 360 ? 11.411  106.652 69.836  1.00 25.25  ? 338  LEU B CB  1 
ATOM   4887  C  CG  . LEU B 1 360 ? 12.574  106.280 70.759  1.00 24.12  ? 338  LEU B CG  1 
ATOM   4888  C  CD1 . LEU B 1 360 ? 12.152  106.471 72.205  1.00 27.87  ? 338  LEU B CD1 1 
ATOM   4889  C  CD2 . LEU B 1 360 ? 13.019  104.840 70.494  1.00 13.93  ? 338  LEU B CD2 1 
ATOM   4890  N  N   . ILE B 1 361 ? 9.824   108.019 67.451  1.00 27.94  ? 339  ILE B N   1 
ATOM   4891  C  CA  . ILE B 1 361 ? 8.607   108.094 66.673  1.00 24.19  ? 339  ILE B CA  1 
ATOM   4892  C  C   . ILE B 1 361 ? 8.967   108.101 65.193  1.00 30.30  ? 339  ILE B C   1 
ATOM   4893  O  O   . ILE B 1 361 ? 8.377   107.378 64.394  1.00 31.47  ? 339  ILE B O   1 
ATOM   4894  C  CB  . ILE B 1 361 ? 7.818   109.377 67.008  1.00 21.70  ? 339  ILE B CB  1 
ATOM   4895  C  CG1 . ILE B 1 361 ? 7.384   109.357 68.481  1.00 23.46  ? 339  ILE B CG1 1 
ATOM   4896  C  CG2 . ILE B 1 361 ? 6.613   109.508 66.093  1.00 24.20  ? 339  ILE B CG2 1 
ATOM   4897  C  CD1 . ILE B 1 361 ? 6.752   110.667 68.963  1.00 18.35  ? 339  ILE B CD1 1 
ATOM   4898  N  N   . ALA B 1 362 ? 9.961   108.908 64.841  1.00 31.99  ? 340  ALA B N   1 
ATOM   4899  C  CA  . ALA B 1 362 ? 10.390  109.049 63.455  1.00 31.05  ? 340  ALA B CA  1 
ATOM   4900  C  C   . ALA B 1 362 ? 11.221  107.911 62.884  1.00 29.28  ? 340  ALA B C   1 
ATOM   4901  O  O   . ALA B 1 362 ? 11.103  107.588 61.708  1.00 34.55  ? 340  ALA B O   1 
ATOM   4902  C  CB  . ALA B 1 362 ? 11.146  110.355 63.282  1.00 30.12  ? 340  ALA B CB  1 
ATOM   4903  N  N   . GLN B 1 363 ? 12.061  107.294 63.695  1.00 26.82  ? 341  GLN B N   1 
ATOM   4904  C  CA  . GLN B 1 363 ? 12.885  106.229 63.163  1.00 30.28  ? 341  GLN B CA  1 
ATOM   4905  C  C   . GLN B 1 363 ? 12.462  104.805 63.489  1.00 27.96  ? 341  GLN B C   1 
ATOM   4906  O  O   . GLN B 1 363 ? 12.702  103.882 62.707  1.00 30.59  ? 341  GLN B O   1 
ATOM   4907  C  CB  . GLN B 1 363 ? 14.343  106.468 63.572  1.00 41.08  ? 341  GLN B CB  1 
ATOM   4908  C  CG  . GLN B 1 363 ? 14.981  107.626 62.799  1.00 49.57  ? 341  GLN B CG  1 
ATOM   4909  C  CD  . GLN B 1 363 ? 16.391  107.950 63.239  1.00 50.96  ? 341  GLN B CD  1 
ATOM   4910  O  OE1 . GLN B 1 363 ? 17.267  107.083 63.249  1.00 60.44  ? 341  GLN B OE1 1 
ATOM   4911  N  NE2 . GLN B 1 363 ? 16.624  109.211 63.598  1.00 52.31  ? 341  GLN B NE2 1 
ATOM   4912  N  N   . GLU B 1 364 ? 11.819  104.616 64.631  1.00 30.49  ? 342  GLU B N   1 
ATOM   4913  C  CA  . GLU B 1 364 ? 11.389  103.278 65.017  1.00 27.55  ? 342  GLU B CA  1 
ATOM   4914  C  C   . GLU B 1 364 ? 9.865   103.115 64.957  1.00 22.84  ? 342  GLU B C   1 
ATOM   4915  O  O   . GLU B 1 364 ? 9.339   101.994 65.043  1.00 20.02  ? 342  GLU B O   1 
ATOM   4916  C  CB  . GLU B 1 364 ? 11.901  102.961 66.425  1.00 23.77  ? 342  GLU B CB  1 
ATOM   4917  C  CG  . GLU B 1 364 ? 13.392  103.183 66.642  1.00 15.19  ? 342  GLU B CG  1 
ATOM   4918  C  CD  . GLU B 1 364 ? 14.254  102.220 65.869  1.00 18.16  ? 342  GLU B CD  1 
ATOM   4919  O  OE1 . GLU B 1 364 ? 13.869  101.048 65.731  1.00 13.90  ? 342  GLU B OE1 1 
ATOM   4920  O  OE2 . GLU B 1 364 ? 15.339  102.626 65.411  1.00 34.45  ? 342  GLU B OE2 1 
ATOM   4921  N  N   . GLY B 1 365 ? 9.162   104.236 64.803  1.00 14.77  ? 343  GLY B N   1 
ATOM   4922  C  CA  . GLY B 1 365 ? 7.712   104.198 64.734  1.00 16.35  ? 343  GLY B CA  1 
ATOM   4923  C  C   . GLY B 1 365 ? 7.025   103.835 66.039  1.00 17.33  ? 343  GLY B C   1 
ATOM   4924  O  O   . GLY B 1 365 ? 5.914   103.310 66.024  1.00 23.88  ? 343  GLY B O   1 
ATOM   4925  N  N   . LEU B 1 366 ? 7.677   104.114 67.165  1.00 15.94  ? 344  LEU B N   1 
ATOM   4926  C  CA  . LEU B 1 366 ? 7.125   103.822 68.491  1.00 18.78  ? 344  LEU B CA  1 
ATOM   4927  C  C   . LEU B 1 366 ? 6.497   105.090 69.087  1.00 20.51  ? 344  LEU B C   1 
ATOM   4928  O  O   . LEU B 1 366 ? 7.210   106.016 69.485  1.00 25.12  ? 344  LEU B O   1 
ATOM   4929  C  CB  . LEU B 1 366 ? 8.241   103.323 69.411  1.00 20.59  ? 344  LEU B CB  1 
ATOM   4930  C  CG  . LEU B 1 366 ? 9.099   102.201 68.823  1.00 17.74  ? 344  LEU B CG  1 
ATOM   4931  C  CD1 . LEU B 1 366 ? 10.446  102.125 69.524  1.00 27.13  ? 344  LEU B CD1 1 
ATOM   4932  C  CD2 . LEU B 1 366 ? 8.359   100.898 68.966  1.00 21.12  ? 344  LEU B CD2 1 
ATOM   4933  N  N   . LEU B 1 367 ? 5.171   105.132 69.165  1.00 16.77  ? 345  LEU B N   1 
ATOM   4934  C  CA  . LEU B 1 367 ? 4.493   106.312 69.680  1.00 15.35  ? 345  LEU B CA  1 
ATOM   4935  C  C   . LEU B 1 367 ? 4.542   106.413 71.206  1.00 19.80  ? 345  LEU B C   1 
ATOM   4936  O  O   . LEU B 1 367 ? 3.509   106.422 71.894  1.00 22.26  ? 345  LEU B O   1 
ATOM   4937  C  CB  . LEU B 1 367 ? 3.050   106.339 69.161  1.00 17.32  ? 345  LEU B CB  1 
ATOM   4938  C  CG  . LEU B 1 367 ? 2.966   106.355 67.620  1.00 26.12  ? 345  LEU B CG  1 
ATOM   4939  C  CD1 . LEU B 1 367 ? 1.544   106.069 67.157  1.00 26.10  ? 345  LEU B CD1 1 
ATOM   4940  C  CD2 . LEU B 1 367 ? 3.438   107.693 67.095  1.00 30.41  ? 345  LEU B CD2 1 
ATOM   4941  N  N   . CYS B 1 368 ? 5.765   106.535 71.709  1.00 11.58  ? 346  CYS B N   1 
ATOM   4942  C  CA  . CYS B 1 368 ? 6.044   106.615 73.130  1.00 17.19  ? 346  CYS B CA  1 
ATOM   4943  C  C   . CYS B 1 368 ? 6.117   108.034 73.641  1.00 21.96  ? 346  CYS B C   1 
ATOM   4944  O  O   . CYS B 1 368 ? 6.006   108.969 72.870  1.00 24.83  ? 346  CYS B O   1 
ATOM   4945  C  CB  . CYS B 1 368 ? 7.369   105.922 73.426  1.00 26.22  ? 346  CYS B CB  1 
ATOM   4946  S  SG  . CYS B 1 368 ? 8.761   106.676 72.551  1.00 23.11  ? 346  CYS B SG  1 
ATOM   4947  N  N   . GLY B 1 369 ? 6.333   108.177 74.951  1.00 28.21  ? 347  GLY B N   1 
ATOM   4948  C  CA  . GLY B 1 369 ? 6.413   109.488 75.578  1.00 27.00  ? 347  GLY B CA  1 
ATOM   4949  C  C   . GLY B 1 369 ? 7.805   110.005 75.891  1.00 26.79  ? 347  GLY B C   1 
ATOM   4950  O  O   . GLY B 1 369 ? 8.811   109.415 75.492  1.00 28.84  ? 347  GLY B O   1 
ATOM   4951  N  N   . GLY B 1 370 ? 7.853   111.114 76.627  1.00 26.44  ? 348  GLY B N   1 
ATOM   4952  C  CA  . GLY B 1 370 ? 9.118   111.740 76.987  1.00 27.73  ? 348  GLY B CA  1 
ATOM   4953  C  C   . GLY B 1 370 ? 10.082  110.906 77.809  1.00 27.15  ? 348  GLY B C   1 
ATOM   4954  O  O   . GLY B 1 370 ? 11.295  110.920 77.571  1.00 25.68  ? 348  GLY B O   1 
ATOM   4955  N  N   . SER B 1 371 ? 9.544   110.197 78.796  1.00 30.89  ? 349  SER B N   1 
ATOM   4956  C  CA  . SER B 1 371 ? 10.359  109.340 79.652  1.00 30.50  ? 349  SER B CA  1 
ATOM   4957  C  C   . SER B 1 371 ? 11.152  108.356 78.782  1.00 26.71  ? 349  SER B C   1 
ATOM   4958  O  O   . SER B 1 371 ? 12.326  108.097 79.032  1.00 19.22  ? 349  SER B O   1 
ATOM   4959  C  CB  . SER B 1 371 ? 9.452   108.570 80.612  1.00 30.86  ? 349  SER B CB  1 
ATOM   4960  O  OG  . SER B 1 371 ? 10.227  107.847 81.552  1.00 43.70  ? 349  SER B OG  1 
ATOM   4961  N  N   . ALA B 1 372 ? 10.482  107.827 77.758  1.00 31.55  ? 350  ALA B N   1 
ATOM   4962  C  CA  . ALA B 1 372 ? 11.063  106.873 76.824  1.00 32.52  ? 350  ALA B CA  1 
ATOM   4963  C  C   . ALA B 1 372 ? 12.306  107.471 76.163  1.00 34.02  ? 350  ALA B C   1 
ATOM   4964  O  O   . ALA B 1 372 ? 13.325  106.796 75.963  1.00 32.87  ? 350  ALA B O   1 
ATOM   4965  C  CB  . ALA B 1 372 ? 10.025  106.496 75.776  1.00 25.25  ? 350  ALA B CB  1 
ATOM   4966  N  N   . GLY B 1 373 ? 12.217  108.746 75.820  1.00 32.89  ? 351  GLY B N   1 
ATOM   4967  C  CA  . GLY B 1 373 ? 13.358  109.397 75.212  1.00 35.63  ? 351  GLY B CA  1 
ATOM   4968  C  C   . GLY B 1 373 ? 14.540  109.407 76.169  1.00 34.74  ? 351  GLY B C   1 
ATOM   4969  O  O   . GLY B 1 373 ? 15.666  109.097 75.775  1.00 30.51  ? 351  GLY B O   1 
ATOM   4970  N  N   . SER B 1 374 ? 14.277  109.768 77.426  1.00 32.65  ? 352  SER B N   1 
ATOM   4971  C  CA  . SER B 1 374 ? 15.310  109.825 78.456  1.00 29.29  ? 352  SER B CA  1 
ATOM   4972  C  C   . SER B 1 374 ? 16.046  108.494 78.544  1.00 31.50  ? 352  SER B C   1 
ATOM   4973  O  O   . SER B 1 374 ? 17.280  108.433 78.587  1.00 30.84  ? 352  SER B O   1 
ATOM   4974  C  CB  . SER B 1 374 ? 14.691  110.125 79.835  1.00 32.04  ? 352  SER B CB  1 
ATOM   4975  O  OG  . SER B 1 374 ? 14.072  111.401 79.902  1.00 33.87  ? 352  SER B OG  1 
ATOM   4976  N  N   . THR B 1 375 ? 15.264  107.426 78.566  1.00 30.73  ? 353  THR B N   1 
ATOM   4977  C  CA  . THR B 1 375 ? 15.790  106.076 78.690  1.00 29.06  ? 353  THR B CA  1 
ATOM   4978  C  C   . THR B 1 375 ? 16.629  105.592 77.510  1.00 29.35  ? 353  THR B C   1 
ATOM   4979  O  O   . THR B 1 375 ? 17.618  104.881 77.699  1.00 26.80  ? 353  THR B O   1 
ATOM   4980  C  CB  . THR B 1 375 ? 14.644  105.099 78.941  1.00 31.91  ? 353  THR B CB  1 
ATOM   4981  O  OG1 . THR B 1 375 ? 13.724  105.692 79.873  1.00 29.59  ? 353  THR B OG1 1 
ATOM   4982  C  CG2 . THR B 1 375 ? 15.175  103.798 79.533  1.00 32.23  ? 353  THR B CG2 1 
ATOM   4983  N  N   . VAL B 1 376 ? 16.254  105.961 76.292  1.00 27.53  ? 354  VAL B N   1 
ATOM   4984  C  CA  . VAL B 1 376 ? 17.056  105.532 75.152  1.00 27.11  ? 354  VAL B CA  1 
ATOM   4985  C  C   . VAL B 1 376 ? 18.290  106.425 75.025  1.00 25.23  ? 354  VAL B C   1 
ATOM   4986  O  O   . VAL B 1 376 ? 19.355  105.965 74.622  1.00 25.84  ? 354  VAL B O   1 
ATOM   4987  C  CB  . VAL B 1 376 ? 16.247  105.563 73.829  1.00 29.03  ? 354  VAL B CB  1 
ATOM   4988  C  CG1 . VAL B 1 376 ? 17.141  105.141 72.656  1.00 33.29  ? 354  VAL B CG1 1 
ATOM   4989  C  CG2 . VAL B 1 376 ? 15.068  104.619 73.927  1.00 28.27  ? 354  VAL B CG2 1 
ATOM   4990  N  N   . ALA B 1 377 ? 18.140  107.700 75.379  1.00 25.99  ? 355  ALA B N   1 
ATOM   4991  C  CA  . ALA B 1 377 ? 19.249  108.645 75.310  1.00 23.79  ? 355  ALA B CA  1 
ATOM   4992  C  C   . ALA B 1 377 ? 20.406  108.120 76.149  1.00 20.56  ? 355  ALA B C   1 
ATOM   4993  O  O   . ALA B 1 377 ? 21.556  108.155 75.721  1.00 24.61  ? 355  ALA B O   1 
ATOM   4994  C  CB  . ALA B 1 377 ? 18.805  110.019 75.815  1.00 21.73  ? 355  ALA B CB  1 
ATOM   4995  N  N   . VAL B 1 378 ? 20.099  107.622 77.342  1.00 20.73  ? 356  VAL B N   1 
ATOM   4996  C  CA  . VAL B 1 378 ? 21.130  107.080 78.223  1.00 24.26  ? 356  VAL B CA  1 
ATOM   4997  C  C   . VAL B 1 378 ? 21.666  105.748 77.728  1.00 28.67  ? 356  VAL B C   1 
ATOM   4998  O  O   . VAL B 1 378 ? 22.875  105.500 77.793  1.00 27.66  ? 356  VAL B O   1 
ATOM   4999  C  CB  . VAL B 1 378 ? 20.597  106.862 79.643  1.00 22.48  ? 356  VAL B CB  1 
ATOM   5000  C  CG1 . VAL B 1 378 ? 21.639  106.123 80.474  1.00 26.58  ? 356  VAL B CG1 1 
ATOM   5001  C  CG2 . VAL B 1 378 ? 20.251  108.204 80.283  1.00 26.46  ? 356  VAL B CG2 1 
ATOM   5002  N  N   . ALA B 1 379 ? 20.758  104.900 77.242  1.00 30.00  ? 357  ALA B N   1 
ATOM   5003  C  CA  . ALA B 1 379 ? 21.108  103.570 76.746  1.00 34.21  ? 357  ALA B CA  1 
ATOM   5004  C  C   . ALA B 1 379 ? 22.151  103.564 75.634  1.00 35.73  ? 357  ALA B C   1 
ATOM   5005  O  O   . ALA B 1 379 ? 23.068  102.744 75.659  1.00 40.24  ? 357  ALA B O   1 
ATOM   5006  C  CB  . ALA B 1 379 ? 19.854  102.837 76.281  1.00 36.54  ? 357  ALA B CB  1 
ATOM   5007  N  N   . VAL B 1 380 ? 22.023  104.460 74.660  1.00 35.99  ? 358  VAL B N   1 
ATOM   5008  C  CA  . VAL B 1 380 ? 22.991  104.496 73.571  1.00 36.39  ? 358  VAL B CA  1 
ATOM   5009  C  C   . VAL B 1 380 ? 24.378  104.822 74.105  1.00 40.34  ? 358  VAL B C   1 
ATOM   5010  O  O   . VAL B 1 380 ? 25.374  104.651 73.402  1.00 39.87  ? 358  VAL B O   1 
ATOM   5011  C  CB  . VAL B 1 380 ? 22.588  105.519 72.471  1.00 41.57  ? 358  VAL B CB  1 
ATOM   5012  C  CG1 . VAL B 1 380 ? 21.275  105.096 71.844  1.00 36.67  ? 358  VAL B CG1 1 
ATOM   5013  C  CG2 . VAL B 1 380 ? 22.474  106.922 73.046  1.00 38.18  ? 358  VAL B CG2 1 
ATOM   5014  N  N   . LYS B 1 381 ? 24.435  105.281 75.357  1.00 45.17  ? 359  LYS B N   1 
ATOM   5015  C  CA  . LYS B 1 381 ? 25.702  105.600 76.017  1.00 42.28  ? 359  LYS B CA  1 
ATOM   5016  C  C   . LYS B 1 381 ? 26.117  104.420 76.906  1.00 42.99  ? 359  LYS B C   1 
ATOM   5017  O  O   . LYS B 1 381 ? 27.217  103.868 76.769  1.00 42.03  ? 359  LYS B O   1 
ATOM   5018  C  CB  . LYS B 1 381 ? 25.569  106.832 76.915  1.00 42.33  ? 359  LYS B CB  1 
ATOM   5019  C  CG  . LYS B 1 381 ? 25.193  108.140 76.256  1.00 39.71  ? 359  LYS B CG  1 
ATOM   5020  C  CD  . LYS B 1 381 ? 25.137  109.226 77.342  1.00 44.33  ? 359  LYS B CD  1 
ATOM   5021  C  CE  . LYS B 1 381 ? 24.524  110.531 76.852  1.00 54.25  ? 359  LYS B CE  1 
ATOM   5022  N  NZ  . LYS B 1 381 ? 24.275  111.461 77.995  1.00 52.15  ? 359  LYS B NZ  1 
ATOM   5023  N  N   . ALA B 1 382 ? 25.224  104.043 77.821  1.00 37.38  ? 360  ALA B N   1 
ATOM   5024  C  CA  . ALA B 1 382 ? 25.491  102.953 78.756  1.00 35.13  ? 360  ALA B CA  1 
ATOM   5025  C  C   . ALA B 1 382 ? 25.768  101.601 78.111  1.00 36.38  ? 360  ALA B C   1 
ATOM   5026  O  O   . ALA B 1 382 ? 26.633  100.861 78.578  1.00 38.21  ? 360  ALA B O   1 
ATOM   5027  C  CB  . ALA B 1 382 ? 24.340  102.818 79.742  1.00 21.17  ? 360  ALA B CB  1 
ATOM   5028  N  N   . ALA B 1 383 ? 25.043  101.280 77.038  1.00 36.22  ? 361  ALA B N   1 
ATOM   5029  C  CA  . ALA B 1 383 ? 25.209  99.993  76.359  1.00 31.15  ? 361  ALA B CA  1 
ATOM   5030  C  C   . ALA B 1 383 ? 26.416  99.895  75.429  1.00 33.72  ? 361  ALA B C   1 
ATOM   5031  O  O   . ALA B 1 383 ? 26.607  98.867  74.781  1.00 32.51  ? 361  ALA B O   1 
ATOM   5032  C  CB  . ALA B 1 383 ? 23.942  99.647  75.595  1.00 29.20  ? 361  ALA B CB  1 
ATOM   5033  N  N   . GLN B 1 384 ? 27.225  100.954 75.363  1.00 34.03  ? 362  GLN B N   1 
ATOM   5034  C  CA  . GLN B 1 384 ? 28.409  100.957 74.517  1.00 34.14  ? 362  GLN B CA  1 
ATOM   5035  C  C   . GLN B 1 384 ? 29.326  99.799  74.863  1.00 35.63  ? 362  GLN B C   1 
ATOM   5036  O  O   . GLN B 1 384 ? 29.796  99.084  73.980  1.00 36.23  ? 362  GLN B O   1 
ATOM   5037  C  CB  . GLN B 1 384 ? 29.169  102.270 74.670  1.00 29.24  ? 362  GLN B CB  1 
ATOM   5038  C  CG  . GLN B 1 384 ? 28.508  103.444 73.960  1.00 36.32  ? 362  GLN B CG  1 
ATOM   5039  C  CD  . GLN B 1 384 ? 28.348  103.210 72.464  1.00 36.42  ? 362  GLN B CD  1 
ATOM   5040  O  OE1 . GLN B 1 384 ? 29.266  102.717 71.798  1.00 41.86  ? 362  GLN B OE1 1 
ATOM   5041  N  NE2 . GLN B 1 384 ? 27.187  103.574 71.928  1.00 23.63  ? 362  GLN B NE2 1 
ATOM   5042  N  N   . GLU B 1 385 ? 29.572  99.616  76.156  1.00 38.99  ? 363  GLU B N   1 
ATOM   5043  C  CA  . GLU B 1 385 ? 30.439  98.544  76.633  1.00 43.95  ? 363  GLU B CA  1 
ATOM   5044  C  C   . GLU B 1 385 ? 30.030  97.186  76.065  1.00 46.02  ? 363  GLU B C   1 
ATOM   5045  O  O   . GLU B 1 385 ? 30.865  96.302  75.881  1.00 48.99  ? 363  GLU B O   1 
ATOM   5046  C  CB  . GLU B 1 385 ? 30.412  98.485  78.164  1.00 51.64  ? 363  GLU B CB  1 
ATOM   5047  C  CG  . GLU B 1 385 ? 29.008  98.400  78.755  1.00 59.12  ? 363  GLU B CG  1 
ATOM   5048  C  CD  . GLU B 1 385 ? 29.007  98.120  80.255  1.00 66.47  ? 363  GLU B CD  1 
ATOM   5049  O  OE1 . GLU B 1 385 ? 29.403  97.001  80.658  1.00 63.67  ? 363  GLU B OE1 1 
ATOM   5050  O  OE2 . GLU B 1 385 ? 28.608  99.020  81.032  1.00 69.59  ? 363  GLU B OE2 1 
ATOM   5051  N  N   . LEU B 1 386 ? 28.740  97.024  75.789  1.00 45.25  ? 364  LEU B N   1 
ATOM   5052  C  CA  . LEU B 1 386 ? 28.216  95.771  75.257  1.00 36.75  ? 364  LEU B CA  1 
ATOM   5053  C  C   . LEU B 1 386 ? 28.674  95.462  73.842  1.00 37.50  ? 364  LEU B C   1 
ATOM   5054  O  O   . LEU B 1 386 ? 28.703  96.333  72.971  1.00 38.39  ? 364  LEU B O   1 
ATOM   5055  C  CB  . LEU B 1 386 ? 26.687  95.788  75.309  1.00 36.87  ? 364  LEU B CB  1 
ATOM   5056  C  CG  . LEU B 1 386 ? 25.994  95.122  76.510  1.00 34.88  ? 364  LEU B CG  1 
ATOM   5057  C  CD1 . LEU B 1 386 ? 26.777  95.322  77.790  1.00 19.52  ? 364  LEU B CD1 1 
ATOM   5058  C  CD2 . LEU B 1 386 ? 24.591  95.692  76.649  1.00 30.45  ? 364  LEU B CD2 1 
ATOM   5059  N  N   . GLN B 1 387 ? 29.023  94.203  73.621  1.00 37.11  ? 365  GLN B N   1 
ATOM   5060  C  CA  . GLN B 1 387 ? 29.467  93.750  72.318  1.00 42.93  ? 365  GLN B CA  1 
ATOM   5061  C  C   . GLN B 1 387 ? 28.390  92.922  71.623  1.00 43.20  ? 365  GLN B C   1 
ATOM   5062  O  O   . GLN B 1 387 ? 27.384  92.540  72.230  1.00 40.05  ? 365  GLN B O   1 
ATOM   5063  C  CB  . GLN B 1 387 ? 30.743  92.927  72.468  1.00 45.27  ? 365  GLN B CB  1 
ATOM   5064  C  CG  . GLN B 1 387 ? 31.988  93.779  72.595  1.00 52.46  ? 365  GLN B CG  1 
ATOM   5065  C  CD  . GLN B 1 387 ? 33.234  92.961  72.879  1.00 58.01  ? 365  GLN B CD  1 
ATOM   5066  O  OE1 . GLN B 1 387 ? 33.427  92.457  73.992  1.00 53.78  ? 365  GLN B OE1 1 
ATOM   5067  N  NE2 . GLN B 1 387 ? 34.087  92.819  71.866  1.00 58.77  ? 365  GLN B NE2 1 
ATOM   5068  N  N   . GLU B 1 388 ? 28.598  92.638  70.345  1.00 38.67  ? 366  GLU B N   1 
ATOM   5069  C  CA  . GLU B 1 388 ? 27.618  91.855  69.619  1.00 42.26  ? 366  GLU B CA  1 
ATOM   5070  C  C   . GLU B 1 388 ? 27.415  90.543  70.335  1.00 41.54  ? 366  GLU B C   1 
ATOM   5071  O  O   . GLU B 1 388 ? 28.353  90.001  70.925  1.00 42.81  ? 366  GLU B O   1 
ATOM   5072  C  CB  . GLU B 1 388 ? 28.075  91.622  68.186  1.00 45.95  ? 366  GLU B CB  1 
ATOM   5073  C  CG  . GLU B 1 388 ? 29.559  91.647  68.021  1.00 57.44  ? 366  GLU B CG  1 
ATOM   5074  C  CD  . GLU B 1 388 ? 29.936  91.979  66.611  1.00 57.71  ? 366  GLU B CD  1 
ATOM   5075  O  OE1 . GLU B 1 388 ? 29.476  91.249  65.711  1.00 50.69  ? 366  GLU B OE1 1 
ATOM   5076  O  OE2 . GLU B 1 388 ? 30.682  92.962  66.408  1.00 62.31  ? 366  GLU B OE2 1 
ATOM   5077  N  N   . GLY B 1 389 ? 26.183  90.045  70.293  1.00 38.95  ? 367  GLY B N   1 
ATOM   5078  C  CA  . GLY B 1 389 ? 25.872  88.810  70.977  1.00 35.61  ? 367  GLY B CA  1 
ATOM   5079  C  C   . GLY B 1 389 ? 25.236  89.149  72.306  1.00 36.30  ? 367  GLY B C   1 
ATOM   5080  O  O   . GLY B 1 389 ? 24.549  88.326  72.905  1.00 36.17  ? 367  GLY B O   1 
ATOM   5081  N  N   . GLN B 1 390 ? 25.473  90.368  72.783  1.00 36.88  ? 368  GLN B N   1 
ATOM   5082  C  CA  . GLN B 1 390 ? 24.869  90.794  74.036  1.00 36.52  ? 368  GLN B CA  1 
ATOM   5083  C  C   . GLN B 1 390 ? 23.545  91.506  73.781  1.00 34.57  ? 368  GLN B C   1 
ATOM   5084  O  O   . GLN B 1 390 ? 23.264  91.960  72.674  1.00 33.65  ? 368  GLN B O   1 
ATOM   5085  C  CB  . GLN B 1 390 ? 25.837  91.661  74.836  1.00 39.14  ? 368  GLN B CB  1 
ATOM   5086  C  CG  . GLN B 1 390 ? 26.974  90.828  75.427  1.00 44.85  ? 368  GLN B CG  1 
ATOM   5087  C  CD  . GLN B 1 390 ? 27.954  91.650  76.249  1.00 47.55  ? 368  GLN B CD  1 
ATOM   5088  O  OE1 . GLN B 1 390 ? 28.662  92.509  75.721  1.00 44.45  ? 368  GLN B OE1 1 
ATOM   5089  N  NE2 . GLN B 1 390 ? 27.996  91.390  77.554  1.00 46.67  ? 368  GLN B NE2 1 
ATOM   5090  N  N   . ARG B 1 391 ? 22.734  91.599  74.824  1.00 37.60  ? 369  ARG B N   1 
ATOM   5091  C  CA  . ARG B 1 391 ? 21.406  92.175  74.712  1.00 31.86  ? 369  ARG B CA  1 
ATOM   5092  C  C   . ARG B 1 391 ? 21.138  93.245  75.766  1.00 28.56  ? 369  ARG B C   1 
ATOM   5093  O  O   . ARG B 1 391 ? 21.401  93.042  76.947  1.00 29.80  ? 369  ARG B O   1 
ATOM   5094  C  CB  . ARG B 1 391 ? 20.391  91.036  74.843  1.00 30.15  ? 369  ARG B CB  1 
ATOM   5095  C  CG  . ARG B 1 391 ? 19.021  91.319  74.300  1.00 32.42  ? 369  ARG B CG  1 
ATOM   5096  C  CD  . ARG B 1 391 ? 18.592  90.232  73.321  1.00 30.86  ? 369  ARG B CD  1 
ATOM   5097  N  NE  . ARG B 1 391 ? 18.391  88.940  73.959  1.00 34.90  ? 369  ARG B NE  1 
ATOM   5098  C  CZ  . ARG B 1 391 ? 17.871  87.880  73.345  1.00 38.78  ? 369  ARG B CZ  1 
ATOM   5099  N  NH1 . ARG B 1 391 ? 17.505  87.958  72.077  1.00 47.01  ? 369  ARG B NH1 1 
ATOM   5100  N  NH2 . ARG B 1 391 ? 17.694  86.744  74.004  1.00 42.20  ? 369  ARG B NH2 1 
ATOM   5101  N  N   . CYS B 1 392 ? 20.610  94.386  75.336  1.00 26.23  ? 370  CYS B N   1 
ATOM   5102  C  CA  . CYS B 1 392 ? 20.293  95.468  76.253  1.00 26.34  ? 370  CYS B CA  1 
ATOM   5103  C  C   . CYS B 1 392 ? 18.802  95.799  76.162  1.00 24.27  ? 370  CYS B C   1 
ATOM   5104  O  O   . CYS B 1 392 ? 18.300  96.162  75.094  1.00 27.94  ? 370  CYS B O   1 
ATOM   5105  C  CB  . CYS B 1 392 ? 21.122  96.716  75.946  1.00 24.45  ? 370  CYS B CB  1 
ATOM   5106  S  SG  . CYS B 1 392 ? 20.699  98.111  77.049  1.00 33.39  ? 370  CYS B SG  1 
ATOM   5107  N  N   . VAL B 1 393 ? 18.101  95.672  77.289  1.00 21.72  ? 371  VAL B N   1 
ATOM   5108  C  CA  . VAL B 1 393 ? 16.669  95.943  77.324  1.00 20.98  ? 371  VAL B CA  1 
ATOM   5109  C  C   . VAL B 1 393 ? 16.350  97.272  77.977  1.00 18.91  ? 371  VAL B C   1 
ATOM   5110  O  O   . VAL B 1 393 ? 16.776  97.555  79.085  1.00 26.02  ? 371  VAL B O   1 
ATOM   5111  C  CB  . VAL B 1 393 ? 15.885  94.835  78.049  1.00 18.03  ? 371  VAL B CB  1 
ATOM   5112  C  CG1 . VAL B 1 393 ? 14.408  95.209  78.103  1.00 9.91   ? 371  VAL B CG1 1 
ATOM   5113  C  CG2 . VAL B 1 393 ? 16.061  93.504  77.316  1.00 5.93   ? 371  VAL B CG2 1 
ATOM   5114  N  N   . VAL B 1 394 ? 15.578  98.077  77.266  1.00 21.23  ? 372  VAL B N   1 
ATOM   5115  C  CA  . VAL B 1 394 ? 15.201  99.398  77.712  1.00 21.16  ? 372  VAL B CA  1 
ATOM   5116  C  C   . VAL B 1 394 ? 13.686  99.423  77.917  1.00 21.53  ? 372  VAL B C   1 
ATOM   5117  O  O   . VAL B 1 394 ? 12.944  98.737  77.215  1.00 26.64  ? 372  VAL B O   1 
ATOM   5118  C  CB  . VAL B 1 394 ? 15.636  100.428 76.640  1.00 22.40  ? 372  VAL B CB  1 
ATOM   5119  C  CG1 . VAL B 1 394 ? 14.542  100.592 75.588  1.00 23.95  ? 372  VAL B CG1 1 
ATOM   5120  C  CG2 . VAL B 1 394 ? 16.001  101.730 77.290  1.00 23.34  ? 372  VAL B CG2 1 
ATOM   5121  N  N   . ILE B 1 395 ? 13.230  100.212 78.879  1.00 18.82  ? 373  ILE B N   1 
ATOM   5122  C  CA  . ILE B 1 395 ? 11.806  100.299 79.192  1.00 18.82  ? 373  ILE B CA  1 
ATOM   5123  C  C   . ILE B 1 395 ? 11.173  101.610 78.720  1.00 18.29  ? 373  ILE B C   1 
ATOM   5124  O  O   . ILE B 1 395 ? 11.611  102.697 79.083  1.00 25.97  ? 373  ILE B O   1 
ATOM   5125  C  CB  . ILE B 1 395 ? 11.594  100.123 80.732  1.00 23.73  ? 373  ILE B CB  1 
ATOM   5126  C  CG1 . ILE B 1 395 ? 11.910  98.680  81.115  1.00 19.04  ? 373  ILE B CG1 1 
ATOM   5127  C  CG2 . ILE B 1 395 ? 10.175  100.486 81.149  1.00 15.75  ? 373  ILE B CG2 1 
ATOM   5128  C  CD1 . ILE B 1 395 ? 11.817  98.426  82.570  1.00 32.65  ? 373  ILE B CD1 1 
ATOM   5129  N  N   . LEU B 1 396 ? 10.148  101.505 77.892  1.00 17.34  ? 374  LEU B N   1 
ATOM   5130  C  CA  . LEU B 1 396 ? 9.451   102.683 77.413  1.00 16.75  ? 374  LEU B CA  1 
ATOM   5131  C  C   . LEU B 1 396 ? 8.129   102.701 78.183  1.00 17.17  ? 374  LEU B C   1 
ATOM   5132  O  O   . LEU B 1 396 ? 7.273   101.862 77.952  1.00 17.87  ? 374  LEU B O   1 
ATOM   5133  C  CB  . LEU B 1 396 ? 9.222   102.557 75.916  1.00 15.34  ? 374  LEU B CB  1 
ATOM   5134  C  CG  . LEU B 1 396 ? 10.462  102.129 75.131  1.00 20.85  ? 374  LEU B CG  1 
ATOM   5135  C  CD1 . LEU B 1 396 ? 10.202  102.358 73.640  1.00 20.10  ? 374  LEU B CD1 1 
ATOM   5136  C  CD2 . LEU B 1 396 ? 11.701  102.917 75.585  1.00 17.56  ? 374  LEU B CD2 1 
ATOM   5137  N  N   . PRO B 1 397 ? 7.959   103.662 79.112  1.00 23.38  ? 375  PRO B N   1 
ATOM   5138  C  CA  . PRO B 1 397 ? 6.796   103.883 79.992  1.00 26.48  ? 375  PRO B CA  1 
ATOM   5139  C  C   . PRO B 1 397 ? 5.396   104.239 79.485  1.00 29.54  ? 375  PRO B C   1 
ATOM   5140  O  O   . PRO B 1 397 ? 4.416   103.650 79.964  1.00 33.72  ? 375  PRO B O   1 
ATOM   5141  C  CB  . PRO B 1 397 ? 7.306   104.923 80.990  1.00 19.21  ? 375  PRO B CB  1 
ATOM   5142  C  CG  . PRO B 1 397 ? 8.806   104.672 81.008  1.00 25.58  ? 375  PRO B CG  1 
ATOM   5143  C  CD  . PRO B 1 397 ? 9.084   104.514 79.531  1.00 23.66  ? 375  PRO B CD  1 
ATOM   5144  N  N   . ASP B 1 398 ? 5.264   105.198 78.568  1.00 30.92  ? 376  ASP B N   1 
ATOM   5145  C  CA  . ASP B 1 398 ? 3.915   105.553 78.075  1.00 28.56  ? 376  ASP B CA  1 
ATOM   5146  C  C   . ASP B 1 398 ? 3.840   106.055 76.640  1.00 24.36  ? 376  ASP B C   1 
ATOM   5147  O  O   . ASP B 1 398 ? 4.852   106.177 75.960  1.00 22.17  ? 376  ASP B O   1 
ATOM   5148  C  CB  . ASP B 1 398 ? 3.240   106.578 78.989  1.00 24.92  ? 376  ASP B CB  1 
ATOM   5149  C  CG  . ASP B 1 398 ? 3.948   107.902 78.999  1.00 22.60  ? 376  ASP B CG  1 
ATOM   5150  O  OD1 . ASP B 1 398 ? 3.414   108.842 79.605  1.00 32.86  ? 376  ASP B OD1 1 
ATOM   5151  O  OD2 . ASP B 1 398 ? 5.040   108.005 78.408  1.00 38.33  ? 376  ASP B OD2 1 
ATOM   5152  N  N   . SER B 1 399 ? 2.623   106.341 76.191  1.00 23.19  ? 377  SER B N   1 
ATOM   5153  C  CA  . SER B 1 399 ? 2.382   106.783 74.822  1.00 25.20  ? 377  SER B CA  1 
ATOM   5154  C  C   . SER B 1 399 ? 2.477   108.280 74.658  1.00 28.48  ? 377  SER B C   1 
ATOM   5155  O  O   . SER B 1 399 ? 2.546   109.015 75.641  1.00 32.33  ? 377  SER B O   1 
ATOM   5156  C  CB  . SER B 1 399 ? 0.992   106.325 74.340  1.00 31.25  ? 377  SER B CB  1 
ATOM   5157  O  OG  . SER B 1 399 ? -0.056  107.163 74.824  1.00 14.01  ? 377  SER B OG  1 
ATOM   5158  N  N   . VAL B 1 400 ? 2.476   108.723 73.403  1.00 29.40  ? 378  VAL B N   1 
ATOM   5159  C  CA  . VAL B 1 400 ? 2.534   110.145 73.099  1.00 25.06  ? 378  VAL B CA  1 
ATOM   5160  C  C   . VAL B 1 400 ? 1.221   110.834 73.496  1.00 29.12  ? 378  VAL B C   1 
ATOM   5161  O  O   . VAL B 1 400 ? 1.168   112.054 73.637  1.00 28.83  ? 378  VAL B O   1 
ATOM   5162  C  CB  . VAL B 1 400 ? 2.759   110.405 71.582  1.00 31.84  ? 378  VAL B CB  1 
ATOM   5163  C  CG1 . VAL B 1 400 ? 4.147   109.984 71.164  1.00 28.11  ? 378  VAL B CG1 1 
ATOM   5164  C  CG2 . VAL B 1 400 ? 1.710   109.677 70.772  1.00 28.45  ? 378  VAL B CG2 1 
ATOM   5165  N  N   . ARG B 1 401 ? 0.167   110.051 73.692  1.00 32.74  ? 379  ARG B N   1 
ATOM   5166  C  CA  . ARG B 1 401 ? -1.135  110.611 74.025  1.00 33.80  ? 379  ARG B CA  1 
ATOM   5167  C  C   . ARG B 1 401 ? -1.117  111.710 75.073  1.00 35.79  ? 379  ARG B C   1 
ATOM   5168  O  O   . ARG B 1 401 ? -1.768  112.736 74.901  1.00 39.65  ? 379  ARG B O   1 
ATOM   5169  C  CB  . ARG B 1 401 ? -2.096  109.524 74.475  1.00 34.41  ? 379  ARG B CB  1 
ATOM   5170  C  CG  . ARG B 1 401 ? -3.548  109.964 74.428  1.00 34.53  ? 379  ARG B CG  1 
ATOM   5171  C  CD  . ARG B 1 401 ? -4.390  109.121 75.364  1.00 40.60  ? 379  ARG B CD  1 
ATOM   5172  N  NE  . ARG B 1 401 ? -3.894  109.244 76.730  1.00 38.77  ? 379  ARG B NE  1 
ATOM   5173  C  CZ  . ARG B 1 401 ? -3.826  108.241 77.593  1.00 37.69  ? 379  ARG B CZ  1 
ATOM   5174  N  NH1 . ARG B 1 401 ? -4.223  107.024 77.233  1.00 32.14  ? 379  ARG B NH1 1 
ATOM   5175  N  NH2 . ARG B 1 401 ? -3.354  108.459 78.813  1.00 26.14  ? 379  ARG B NH2 1 
ATOM   5176  N  N   . ASN B 1 402 ? -0.384  111.507 76.157  1.00 36.26  ? 380  ASN B N   1 
ATOM   5177  C  CA  . ASN B 1 402 ? -0.327  112.517 77.213  1.00 45.71  ? 380  ASN B CA  1 
ATOM   5178  C  C   . ASN B 1 402 ? 0.510   113.743 76.847  1.00 48.16  ? 380  ASN B C   1 
ATOM   5179  O  O   . ASN B 1 402 ? 0.608   114.697 77.625  1.00 49.47  ? 380  ASN B O   1 
ATOM   5180  C  CB  . ASN B 1 402 ? 0.225   111.903 78.501  1.00 47.61  ? 380  ASN B CB  1 
ATOM   5181  C  CG  . ASN B 1 402 ? -0.852  111.273 79.352  1.00 50.10  ? 380  ASN B CG  1 
ATOM   5182  O  OD1 . ASN B 1 402 ? -1.901  110.869 78.850  1.00 54.85  ? 380  ASN B OD1 1 
ATOM   5183  N  ND2 . ASN B 1 402 ? -0.592  111.173 80.652  1.00 54.19  ? 380  ASN B ND2 1 
ATOM   5184  N  N   . TYR B 1 403 ? 1.099   113.733 75.658  1.00 45.28  ? 381  TYR B N   1 
ATOM   5185  C  CA  . TYR B 1 403 ? 1.936   114.849 75.259  1.00 44.09  ? 381  TYR B CA  1 
ATOM   5186  C  C   . TYR B 1 403 ? 1.584   115.419 73.889  1.00 46.64  ? 381  TYR B C   1 
ATOM   5187  O  O   . TYR B 1 403 ? 2.443   115.993 73.218  1.00 43.37  ? 381  TYR B O   1 
ATOM   5188  C  CB  . TYR B 1 403 ? 3.397   114.408 75.279  1.00 40.83  ? 381  TYR B CB  1 
ATOM   5189  C  CG  . TYR B 1 403 ? 3.750   113.516 76.457  1.00 49.01  ? 381  TYR B CG  1 
ATOM   5190  C  CD1 . TYR B 1 403 ? 3.790   112.132 76.323  1.00 50.52  ? 381  TYR B CD1 1 
ATOM   5191  C  CD2 . TYR B 1 403 ? 4.049   114.059 77.703  1.00 51.11  ? 381  TYR B CD2 1 
ATOM   5192  C  CE1 . TYR B 1 403 ? 4.126   111.311 77.401  1.00 55.02  ? 381  TYR B CE1 1 
ATOM   5193  C  CE2 . TYR B 1 403 ? 4.382   113.251 78.785  1.00 45.88  ? 381  TYR B CE2 1 
ATOM   5194  C  CZ  . TYR B 1 403 ? 4.425   111.880 78.632  1.00 51.58  ? 381  TYR B CZ  1 
ATOM   5195  O  OH  . TYR B 1 403 ? 4.799   111.078 79.698  1.00 43.08  ? 381  TYR B OH  1 
ATOM   5196  N  N   . MET B 1 404 ? 0.323   115.272 73.483  1.00 44.66  ? 382  MET B N   1 
ATOM   5197  C  CA  . MET B 1 404 ? -0.118  115.768 72.187  1.00 43.77  ? 382  MET B CA  1 
ATOM   5198  C  C   . MET B 1 404 ? 0.254   117.226 71.989  1.00 46.05  ? 382  MET B C   1 
ATOM   5199  O  O   . MET B 1 404 ? 0.754   117.612 70.926  1.00 50.28  ? 382  MET B O   1 
ATOM   5200  C  CB  . MET B 1 404 ? -1.629  115.601 72.037  1.00 38.32  ? 382  MET B CB  1 
ATOM   5201  C  CG  . MET B 1 404 ? -2.066  114.157 72.009  1.00 41.78  ? 382  MET B CG  1 
ATOM   5202  S  SD  . MET B 1 404 ? -1.057  113.259 70.851  1.00 44.51  ? 382  MET B SD  1 
ATOM   5203  C  CE  . MET B 1 404 ? -2.053  113.399 69.386  1.00 42.28  ? 382  MET B CE  1 
ATOM   5204  N  N   . THR B 1 405 ? 0.025   118.035 73.021  1.00 45.43  ? 383  THR B N   1 
ATOM   5205  C  CA  . THR B 1 405 ? 0.326   119.460 72.947  1.00 41.50  ? 383  THR B CA  1 
ATOM   5206  C  C   . THR B 1 405 ? 1.664   119.867 73.566  1.00 40.34  ? 383  THR B C   1 
ATOM   5207  O  O   . THR B 1 405 ? 1.880   121.040 73.864  1.00 40.69  ? 383  THR B O   1 
ATOM   5208  C  CB  . THR B 1 405 ? -0.790  120.289 73.599  1.00 38.50  ? 383  THR B CB  1 
ATOM   5209  O  OG1 . THR B 1 405 ? -0.890  119.944 74.985  1.00 36.39  ? 383  THR B OG1 1 
ATOM   5210  C  CG2 . THR B 1 405 ? -2.121  120.014 72.922  1.00 40.87  ? 383  THR B CG2 1 
ATOM   5211  N  N   . LYS B 1 406 ? 2.564   118.907 73.755  1.00 39.36  ? 384  LYS B N   1 
ATOM   5212  C  CA  . LYS B 1 406 ? 3.872   119.218 74.317  1.00 36.35  ? 384  LYS B CA  1 
ATOM   5213  C  C   . LYS B 1 406 ? 5.016   118.862 73.360  1.00 35.36  ? 384  LYS B C   1 
ATOM   5214  O  O   . LYS B 1 406 ? 5.072   119.408 72.264  1.00 38.28  ? 384  LYS B O   1 
ATOM   5215  C  CB  . LYS B 1 406 ? 4.046   118.541 75.679  1.00 34.27  ? 384  LYS B CB  1 
ATOM   5216  C  CG  . LYS B 1 406 ? 3.075   119.070 76.741  1.00 36.41  ? 384  LYS B CG  1 
ATOM   5217  C  CD  . LYS B 1 406 ? 3.516   118.697 78.163  1.00 36.38  ? 384  LYS B CD  1 
ATOM   5218  C  CE  . LYS B 1 406 ? 2.577   119.264 79.223  1.00 32.40  ? 384  LYS B CE  1 
ATOM   5219  N  NZ  . LYS B 1 406 ? 3.064   118.997 80.601  1.00 35.90  ? 384  LYS B NZ  1 
ATOM   5220  N  N   . PHE B 1 407 ? 5.912   117.955 73.738  1.00 32.80  ? 385  PHE B N   1 
ATOM   5221  C  CA  . PHE B 1 407 ? 7.040   117.622 72.862  1.00 32.69  ? 385  PHE B CA  1 
ATOM   5222  C  C   . PHE B 1 407 ? 6.635   117.162 71.464  1.00 35.33  ? 385  PHE B C   1 
ATOM   5223  O  O   . PHE B 1 407 ? 7.450   117.165 70.545  1.00 40.25  ? 385  PHE B O   1 
ATOM   5224  C  CB  . PHE B 1 407 ? 7.958   116.567 73.523  1.00 36.39  ? 385  PHE B CB  1 
ATOM   5225  C  CG  . PHE B 1 407 ? 7.558   115.128 73.268  1.00 40.47  ? 385  PHE B CG  1 
ATOM   5226  C  CD1 . PHE B 1 407 ? 7.889   114.491 72.069  1.00 42.06  ? 385  PHE B CD1 1 
ATOM   5227  C  CD2 . PHE B 1 407 ? 6.847   114.411 74.225  1.00 41.32  ? 385  PHE B CD2 1 
ATOM   5228  C  CE1 . PHE B 1 407 ? 7.513   113.160 71.826  1.00 35.47  ? 385  PHE B CE1 1 
ATOM   5229  C  CE2 . PHE B 1 407 ? 6.468   113.081 73.991  1.00 42.09  ? 385  PHE B CE2 1 
ATOM   5230  C  CZ  . PHE B 1 407 ? 6.802   112.460 72.790  1.00 34.33  ? 385  PHE B CZ  1 
ATOM   5231  N  N   . LEU B 1 408 ? 5.378   116.771 71.300  1.00 36.44  ? 386  LEU B N   1 
ATOM   5232  C  CA  . LEU B 1 408 ? 4.886   116.301 70.011  1.00 39.60  ? 386  LEU B CA  1 
ATOM   5233  C  C   . LEU B 1 408 ? 4.469   117.491 69.146  1.00 47.38  ? 386  LEU B C   1 
ATOM   5234  O  O   . LEU B 1 408 ? 4.035   117.318 68.009  1.00 55.68  ? 386  LEU B O   1 
ATOM   5235  C  CB  . LEU B 1 408 ? 3.700   115.344 70.234  1.00 33.29  ? 386  LEU B CB  1 
ATOM   5236  C  CG  . LEU B 1 408 ? 3.273   114.302 69.198  1.00 30.64  ? 386  LEU B CG  1 
ATOM   5237  C  CD1 . LEU B 1 408 ? 2.190   114.864 68.309  1.00 21.79  ? 386  LEU B CD1 1 
ATOM   5238  C  CD2 . LEU B 1 408 ? 4.480   113.840 68.408  1.00 19.23  ? 386  LEU B CD2 1 
ATOM   5239  N  N   . SER B 1 409 ? 4.614   118.701 69.683  1.00 50.16  ? 387  SER B N   1 
ATOM   5240  C  CA  . SER B 1 409 ? 4.247   119.915 68.952  1.00 48.42  ? 387  SER B CA  1 
ATOM   5241  C  C   . SER B 1 409 ? 5.434   120.858 68.793  1.00 53.01  ? 387  SER B C   1 
ATOM   5242  O  O   . SER B 1 409 ? 6.070   121.237 69.775  1.00 55.09  ? 387  SER B O   1 
ATOM   5243  C  CB  . SER B 1 409 ? 3.115   120.642 69.678  1.00 42.93  ? 387  SER B CB  1 
ATOM   5244  O  OG  . SER B 1 409 ? 2.666   121.757 68.931  1.00 36.84  ? 387  SER B OG  1 
ATOM   5245  N  N   . ASP B 1 410 ? 5.728   121.243 67.554  1.00 58.99  ? 388  ASP B N   1 
ATOM   5246  C  CA  . ASP B 1 410 ? 6.845   122.145 67.291  1.00 62.28  ? 388  ASP B CA  1 
ATOM   5247  C  C   . ASP B 1 410 ? 6.678   123.480 68.010  1.00 63.74  ? 388  ASP B C   1 
ATOM   5248  O  O   . ASP B 1 410 ? 7.646   124.032 68.528  1.00 65.40  ? 388  ASP B O   1 
ATOM   5249  C  CB  . ASP B 1 410 ? 7.000   122.377 65.787  1.00 64.12  ? 388  ASP B CB  1 
ATOM   5250  C  CG  . ASP B 1 410 ? 7.363   121.109 65.036  1.00 64.80  ? 388  ASP B CG  1 
ATOM   5251  O  OD1 . ASP B 1 410 ? 7.817   121.210 63.875  1.00 72.55  ? 388  ASP B OD1 1 
ATOM   5252  O  OD2 . ASP B 1 410 ? 7.187   120.013 65.603  1.00 62.82  ? 388  ASP B OD2 1 
ATOM   5253  N  N   . ARG B 1 411 ? 5.451   123.998 68.033  1.00 65.69  ? 389  ARG B N   1 
ATOM   5254  C  CA  . ARG B 1 411 ? 5.158   125.261 68.714  1.00 66.73  ? 389  ARG B CA  1 
ATOM   5255  C  C   . ARG B 1 411 ? 5.714   125.192 70.131  1.00 62.42  ? 389  ARG B C   1 
ATOM   5256  O  O   . ARG B 1 411 ? 6.435   126.082 70.574  1.00 62.70  ? 389  ARG B O   1 
ATOM   5257  C  CB  . ARG B 1 411 ? 3.643   125.499 68.776  1.00 70.98  ? 389  ARG B CB  1 
ATOM   5258  C  CG  . ARG B 1 411 ? 3.001   125.884 67.451  1.00 76.55  ? 389  ARG B CG  1 
ATOM   5259  C  CD  . ARG B 1 411 ? 1.484   125.695 67.479  1.00 81.81  ? 389  ARG B CD  1 
ATOM   5260  N  NE  . ARG B 1 411 ? 1.116   124.278 67.494  1.00 87.15  ? 389  ARG B NE  1 
ATOM   5261  C  CZ  . ARG B 1 411 ? -0.131  123.819 67.433  1.00 86.10  ? 389  ARG B CZ  1 
ATOM   5262  N  NH1 . ARG B 1 411 ? -1.152  124.665 67.352  1.00 82.27  ? 389  ARG B NH1 1 
ATOM   5263  N  NH2 . ARG B 1 411 ? -0.357  122.510 67.455  1.00 85.90  ? 389  ARG B NH2 1 
ATOM   5264  N  N   . TRP B 1 412 ? 5.369   124.117 70.830  1.00 59.50  ? 390  TRP B N   1 
ATOM   5265  C  CA  . TRP B 1 412 ? 5.815   123.895 72.199  1.00 55.74  ? 390  TRP B CA  1 
ATOM   5266  C  C   . TRP B 1 412 ? 7.331   123.761 72.227  1.00 55.24  ? 390  TRP B C   1 
ATOM   5267  O  O   . TRP B 1 412 ? 8.006   124.462 72.976  1.00 58.91  ? 390  TRP B O   1 
ATOM   5268  C  CB  . TRP B 1 412 ? 5.181   122.617 72.753  1.00 53.13  ? 390  TRP B CB  1 
ATOM   5269  C  CG  . TRP B 1 412 ? 5.335   122.420 74.233  1.00 45.60  ? 390  TRP B CG  1 
ATOM   5270  C  CD1 . TRP B 1 412 ? 4.508   122.885 75.213  1.00 45.02  ? 390  TRP B CD1 1 
ATOM   5271  C  CD2 . TRP B 1 412 ? 6.363   121.677 74.897  1.00 39.74  ? 390  TRP B CD2 1 
ATOM   5272  N  NE1 . TRP B 1 412 ? 4.953   122.475 76.448  1.00 44.55  ? 390  TRP B NE1 1 
ATOM   5273  C  CE2 . TRP B 1 412 ? 6.093   121.734 76.282  1.00 38.77  ? 390  TRP B CE2 1 
ATOM   5274  C  CE3 . TRP B 1 412 ? 7.486   120.968 74.456  1.00 33.49  ? 390  TRP B CE3 1 
ATOM   5275  C  CZ2 . TRP B 1 412 ? 6.905   121.108 77.231  1.00 36.96  ? 390  TRP B CZ2 1 
ATOM   5276  C  CZ3 . TRP B 1 412 ? 8.294   120.346 75.399  1.00 37.27  ? 390  TRP B CZ3 1 
ATOM   5277  C  CH2 . TRP B 1 412 ? 7.998   120.421 76.773  1.00 35.77  ? 390  TRP B CH2 1 
ATOM   5278  N  N   . MET B 1 413 ? 7.865   122.853 71.416  1.00 49.18  ? 391  MET B N   1 
ATOM   5279  C  CA  . MET B 1 413 ? 9.307   122.649 71.365  1.00 52.28  ? 391  MET B CA  1 
ATOM   5280  C  C   . MET B 1 413 ? 10.049  123.972 71.138  1.00 53.95  ? 391  MET B C   1 
ATOM   5281  O  O   . MET B 1 413 ? 11.094  124.221 71.744  1.00 55.99  ? 391  MET B O   1 
ATOM   5282  C  CB  . MET B 1 413 ? 9.668   121.656 70.252  1.00 51.35  ? 391  MET B CB  1 
ATOM   5283  C  CG  . MET B 1 413 ? 9.270   120.213 70.526  1.00 41.51  ? 391  MET B CG  1 
ATOM   5284  S  SD  . MET B 1 413 ? 10.150  119.472 71.915  1.00 43.64  ? 391  MET B SD  1 
ATOM   5285  C  CE  . MET B 1 413 ? 11.674  118.926 71.137  1.00 27.13  ? 391  MET B CE  1 
ATOM   5286  N  N   . LEU B 1 414 ? 9.505   124.815 70.266  1.00 54.69  ? 392  LEU B N   1 
ATOM   5287  C  CA  . LEU B 1 414 ? 10.116  126.108 69.970  1.00 56.15  ? 392  LEU B CA  1 
ATOM   5288  C  C   . LEU B 1 414 ? 10.058  127.055 71.167  1.00 54.73  ? 392  LEU B C   1 
ATOM   5289  O  O   . LEU B 1 414 ? 11.085  127.520 71.646  1.00 45.93  ? 392  LEU B O   1 
ATOM   5290  C  CB  . LEU B 1 414 ? 9.427   126.755 68.763  1.00 58.03  ? 392  LEU B CB  1 
ATOM   5291  C  CG  . LEU B 1 414 ? 9.698   126.097 67.404  1.00 57.65  ? 392  LEU B CG  1 
ATOM   5292  C  CD1 . LEU B 1 414 ? 8.797   126.700 66.333  1.00 52.43  ? 392  LEU B CD1 1 
ATOM   5293  C  CD2 . LEU B 1 414 ? 11.162  126.280 67.042  1.00 53.20  ? 392  LEU B CD2 1 
ATOM   5294  N  N   . GLN B 1 415 ? 8.856   127.339 71.649  1.00 57.36  ? 393  GLN B N   1 
ATOM   5295  C  CA  . GLN B 1 415 ? 8.698   128.231 72.783  1.00 59.28  ? 393  GLN B CA  1 
ATOM   5296  C  C   . GLN B 1 415 ? 9.568   127.793 73.969  1.00 62.65  ? 393  GLN B C   1 
ATOM   5297  O  O   . GLN B 1 415 ? 10.206  128.627 74.611  1.00 65.99  ? 393  GLN B O   1 
ATOM   5298  C  CB  . GLN B 1 415 ? 7.221   128.287 73.182  1.00 61.37  ? 393  GLN B CB  1 
ATOM   5299  C  CG  . GLN B 1 415 ? 6.910   127.783 74.582  1.00 63.81  ? 393  GLN B CG  1 
ATOM   5300  C  CD  . GLN B 1 415 ? 7.120   128.842 75.652  1.00 69.41  ? 393  GLN B CD  1 
ATOM   5301  O  OE1 . GLN B 1 415 ? 8.185   129.466 75.739  1.00 67.37  ? 393  GLN B OE1 1 
ATOM   5302  N  NE2 . GLN B 1 415 ? 6.100   129.045 76.482  1.00 73.22  ? 393  GLN B NE2 1 
ATOM   5303  N  N   . LYS B 1 416 ? 9.610   126.492 74.252  1.00 62.44  ? 394  LYS B N   1 
ATOM   5304  C  CA  . LYS B 1 416 ? 10.398  125.991 75.377  1.00 59.84  ? 394  LYS B CA  1 
ATOM   5305  C  C   . LYS B 1 416 ? 11.894  126.033 75.095  1.00 59.49  ? 394  LYS B C   1 
ATOM   5306  O  O   . LYS B 1 416 ? 12.703  125.756 75.980  1.00 62.67  ? 394  LYS B O   1 
ATOM   5307  C  CB  . LYS B 1 416 ? 9.995   124.556 75.736  1.00 59.14  ? 394  LYS B CB  1 
ATOM   5308  C  CG  . LYS B 1 416 ? 8.514   124.351 76.032  1.00 60.67  ? 394  LYS B CG  1 
ATOM   5309  C  CD  . LYS B 1 416 ? 8.018   125.188 77.206  1.00 55.32  ? 394  LYS B CD  1 
ATOM   5310  C  CE  . LYS B 1 416 ? 8.669   124.787 78.509  1.00 53.60  ? 394  LYS B CE  1 
ATOM   5311  N  NZ  . LYS B 1 416 ? 8.066   125.527 79.647  1.00 45.32  ? 394  LYS B NZ  1 
ATOM   5312  N  N   . GLY B 1 417 ? 12.259  126.368 73.863  1.00 56.37  ? 395  GLY B N   1 
ATOM   5313  C  CA  . GLY B 1 417 ? 13.662  126.450 73.509  1.00 53.46  ? 395  GLY B CA  1 
ATOM   5314  C  C   . GLY B 1 417 ? 14.373  125.118 73.433  1.00 58.43  ? 395  GLY B C   1 
ATOM   5315  O  O   . GLY B 1 417 ? 15.546  125.014 73.785  1.00 57.38  ? 395  GLY B O   1 
ATOM   5316  N  N   . PHE B 1 418 ? 13.664  124.090 72.980  1.00 63.84  ? 396  PHE B N   1 
ATOM   5317  C  CA  . PHE B 1 418 ? 14.244  122.752 72.838  1.00 63.48  ? 396  PHE B CA  1 
ATOM   5318  C  C   . PHE B 1 418 ? 14.522  122.548 71.359  1.00 65.16  ? 396  PHE B C   1 
ATOM   5319  O  O   . PHE B 1 418 ? 15.429  121.811 70.966  1.00 64.76  ? 396  PHE B O   1 
ATOM   5320  C  CB  . PHE B 1 418 ? 13.256  121.677 73.301  1.00 60.94  ? 396  PHE B CB  1 
ATOM   5321  C  CG  . PHE B 1 418 ? 12.995  121.678 74.776  1.00 57.14  ? 396  PHE B CG  1 
ATOM   5322  C  CD1 . PHE B 1 418 ? 11.693  121.677 75.259  1.00 57.36  ? 396  PHE B CD1 1 
ATOM   5323  C  CD2 . PHE B 1 418 ? 14.045  121.653 75.681  1.00 55.15  ? 396  PHE B CD2 1 
ATOM   5324  C  CE1 . PHE B 1 418 ? 11.440  121.649 76.629  1.00 54.22  ? 396  PHE B CE1 1 
ATOM   5325  C  CE2 . PHE B 1 418 ? 13.804  121.626 77.051  1.00 52.16  ? 396  PHE B CE2 1 
ATOM   5326  C  CZ  . PHE B 1 418 ? 12.497  121.624 77.525  1.00 52.11  ? 396  PHE B CZ  1 
ATOM   5327  N  N   . LEU B 1 419 ? 13.721  123.219 70.541  1.00 67.47  ? 397  LEU B N   1 
ATOM   5328  C  CA  . LEU B 1 419 ? 13.849  123.115 69.102  1.00 67.61  ? 397  LEU B CA  1 
ATOM   5329  C  C   . LEU B 1 419 ? 14.027  124.491 68.475  1.00 68.49  ? 397  LEU B C   1 
ATOM   5330  O  O   . LEU B 1 419 ? 13.526  125.479 69.057  1.00 68.12  ? 397  LEU B O   1 
ATOM   5331  C  CB  . LEU B 1 419 ? 12.603  122.426 68.547  1.00 65.63  ? 397  LEU B CB  1 
ATOM   5332  C  CG  . LEU B 1 419 ? 12.589  121.994 67.082  1.00 67.85  ? 397  LEU B CG  1 
ATOM   5333  C  CD1 . LEU B 1 419 ? 12.238  123.178 66.194  1.00 66.38  ? 397  LEU B CD1 1 
ATOM   5334  C  CD2 . LEU B 1 419 ? 13.940  121.392 66.719  1.00 62.80  ? 397  LEU B CD2 1 
ATOM   5335  N  N   . TRP C 1 65  ? 52.560  106.843 22.058  1.00 74.12  ? 43   TRP C N   1 
ATOM   5336  C  CA  . TRP C 1 65  ? 53.213  105.839 22.938  1.00 80.10  ? 43   TRP C CA  1 
ATOM   5337  C  C   . TRP C 1 65  ? 54.535  105.406 22.387  1.00 82.03  ? 43   TRP C C   1 
ATOM   5338  O  O   . TRP C 1 65  ? 54.581  104.898 21.271  1.00 85.28  ? 43   TRP C O   1 
ATOM   5339  C  CB  . TRP C 1 65  ? 52.386  104.540 23.044  1.00 80.76  ? 43   TRP C CB  1 
ATOM   5340  C  CG  . TRP C 1 65  ? 52.950  103.501 24.053  1.00 80.77  ? 43   TRP C CG  1 
ATOM   5341  C  CD1 . TRP C 1 65  ? 53.030  103.662 25.412  1.00 82.78  ? 43   TRP C CD1 1 
ATOM   5342  C  CD2 . TRP C 1 65  ? 53.385  102.143 23.790  1.00 80.87  ? 43   TRP C CD2 1 
ATOM   5343  N  NE1 . TRP C 1 65  ? 53.458  102.497 26.010  1.00 83.54  ? 43   TRP C NE1 1 
ATOM   5344  C  CE2 . TRP C 1 65  ? 53.689  101.552 25.046  1.00 82.46  ? 43   TRP C CE2 1 
ATOM   5345  C  CE3 . TRP C 1 65  ? 53.538  101.372 22.626  1.00 75.67  ? 43   TRP C CE3 1 
ATOM   5346  C  CZ2 . TRP C 1 65  ? 54.140  100.231 25.169  1.00 79.60  ? 43   TRP C CZ2 1 
ATOM   5347  C  CZ3 . TRP C 1 65  ? 53.988  100.046 22.753  1.00 73.16  ? 43   TRP C CZ3 1 
ATOM   5348  C  CH2 . TRP C 1 65  ? 54.283  99.497  24.018  1.00 75.23  ? 43   TRP C CH2 1 
ATOM   5349  N  N   . ILE C 1 66  ? 55.617  105.632 23.109  1.00 81.40  ? 44   ILE C N   1 
ATOM   5350  C  CA  . ILE C 1 66  ? 56.823  105.074 22.595  1.00 79.25  ? 44   ILE C CA  1 
ATOM   5351  C  C   . ILE C 1 66  ? 57.150  104.043 23.647  1.00 77.97  ? 44   ILE C C   1 
ATOM   5352  O  O   . ILE C 1 66  ? 57.219  104.345 24.845  1.00 73.49  ? 44   ILE C O   1 
ATOM   5353  C  CB  . ILE C 1 66  ? 57.988  106.050 22.429  1.00 78.40  ? 44   ILE C CB  1 
ATOM   5354  C  CG1 . ILE C 1 66  ? 59.227  105.216 22.126  1.00 77.67  ? 44   ILE C CG1 1 
ATOM   5355  C  CG2 . ILE C 1 66  ? 58.142  106.925 23.670  1.00 66.18  ? 44   ILE C CG2 1 
ATOM   5356  C  CD1 . ILE C 1 66  ? 60.265  105.876 21.338  1.00 77.51  ? 44   ILE C CD1 1 
ATOM   5357  N  N   . ARG C 1 67  ? 57.301  102.812 23.189  1.00 77.90  ? 45   ARG C N   1 
ATOM   5358  C  CA  . ARG C 1 67  ? 57.607  101.724 24.073  1.00 76.75  ? 45   ARG C CA  1 
ATOM   5359  C  C   . ARG C 1 67  ? 58.686  102.243 25.051  1.00 73.15  ? 45   ARG C C   1 
ATOM   5360  O  O   . ARG C 1 67  ? 59.647  102.907 24.643  1.00 73.10  ? 45   ARG C O   1 
ATOM   5361  C  CB  . ARG C 1 67  ? 58.171  100.576 23.266  1.00 79.88  ? 45   ARG C CB  1 
ATOM   5362  C  CG  . ARG C 1 67  ? 59.454  100.916 22.533  1.00 81.84  ? 45   ARG C CG  1 
ATOM   5363  C  CD  . ARG C 1 67  ? 60.176  99.656  22.170  1.00 74.42  ? 45   ARG C CD  1 
ATOM   5364  N  NE  . ARG C 1 67  ? 61.373  99.864  21.369  1.00 67.02  ? 45   ARG C NE  1 
ATOM   5365  C  CZ  . ARG C 1 67  ? 62.236  98.895  21.084  1.00 72.78  ? 45   ARG C CZ  1 
ATOM   5366  N  NH1 . ARG C 1 67  ? 62.036  97.662  21.540  1.00 71.55  ? 45   ARG C NH1 1 
ATOM   5367  N  NH2 . ARG C 1 67  ? 63.294  99.149  20.328  1.00 76.73  ? 45   ARG C NH2 1 
ATOM   5368  N  N   . PRO C 1 68  ? 58.446  102.022 26.359  1.00 69.25  ? 46   PRO C N   1 
ATOM   5369  C  CA  . PRO C 1 68  ? 59.249  102.343 27.543  1.00 70.11  ? 46   PRO C CA  1 
ATOM   5370  C  C   . PRO C 1 68  ? 60.562  101.542 27.462  1.00 69.81  ? 46   PRO C C   1 
ATOM   5371  O  O   . PRO C 1 68  ? 61.584  101.908 28.061  1.00 67.64  ? 46   PRO C O   1 
ATOM   5372  C  CB  . PRO C 1 68  ? 58.342  101.906 28.690  1.00 70.66  ? 46   PRO C CB  1 
ATOM   5373  C  CG  . PRO C 1 68  ? 57.002  102.361 28.202  1.00 66.76  ? 46   PRO C CG  1 
ATOM   5374  C  CD  . PRO C 1 68  ? 57.008  102.036 26.703  1.00 68.04  ? 46   PRO C CD  1 
ATOM   5375  N  N   . ASP C 1 69  ? 60.527  100.458 26.686  1.00 70.51  ? 47   ASP C N   1 
ATOM   5376  C  CA  . ASP C 1 69  ? 61.697  99.595  26.514  1.00 68.28  ? 47   ASP C CA  1 
ATOM   5377  C  C   . ASP C 1 69  ? 62.658  99.976  25.388  1.00 66.56  ? 47   ASP C C   1 
ATOM   5378  O  O   . ASP C 1 69  ? 63.680  99.310  25.191  1.00 65.84  ? 47   ASP C O   1 
ATOM   5379  C  CB  . ASP C 1 69  ? 61.287  98.122  26.333  1.00 65.57  ? 47   ASP C CB  1 
ATOM   5380  C  CG  . ASP C 1 69  ? 60.022  97.949  25.507  1.00 62.55  ? 47   ASP C CG  1 
ATOM   5381  O  OD1 . ASP C 1 69  ? 58.928  97.936  26.106  1.00 63.71  ? 47   ASP C OD1 1 
ATOM   5382  O  OD2 . ASP C 1 69  ? 60.116  97.820  24.267  1.00 68.02  ? 47   ASP C OD2 1 
ATOM   5383  N  N   . ALA C 1 70  ? 62.338  101.033 24.650  1.00 64.24  ? 48   ALA C N   1 
ATOM   5384  C  CA  . ALA C 1 70  ? 63.204  101.463 23.564  1.00 59.33  ? 48   ALA C CA  1 
ATOM   5385  C  C   . ALA C 1 70  ? 64.616  101.579 24.121  1.00 56.23  ? 48   ALA C C   1 
ATOM   5386  O  O   . ALA C 1 70  ? 64.812  102.140 25.196  1.00 49.33  ? 48   ALA C O   1 
ATOM   5387  C  CB  . ALA C 1 70  ? 62.738  102.801 23.032  1.00 59.60  ? 48   ALA C CB  1 
ATOM   5388  N  N   . PRO C 1 71  ? 65.614  101.011 23.418  1.00 59.16  ? 49   PRO C N   1 
ATOM   5389  C  CA  . PRO C 1 71  ? 67.010  101.081 23.877  1.00 58.07  ? 49   PRO C CA  1 
ATOM   5390  C  C   . PRO C 1 71  ? 67.601  102.496 23.752  1.00 56.13  ? 49   PRO C C   1 
ATOM   5391  O  O   . PRO C 1 71  ? 67.656  103.067 22.666  1.00 56.34  ? 49   PRO C O   1 
ATOM   5392  C  CB  . PRO C 1 71  ? 67.719  100.050 22.990  1.00 56.37  ? 49   PRO C CB  1 
ATOM   5393  C  CG  . PRO C 1 71  ? 66.895  100.044 21.738  1.00 54.02  ? 49   PRO C CG  1 
ATOM   5394  C  CD  . PRO C 1 71  ? 65.483  100.098 22.266  1.00 59.82  ? 49   PRO C CD  1 
ATOM   5395  N  N   . SER C 1 72  ? 68.037  103.054 24.876  1.00 57.41  ? 50   SER C N   1 
ATOM   5396  C  CA  . SER C 1 72  ? 68.600  104.402 24.920  1.00 60.04  ? 50   SER C CA  1 
ATOM   5397  C  C   . SER C 1 72  ? 69.580  104.738 23.796  1.00 61.29  ? 50   SER C C   1 
ATOM   5398  O  O   . SER C 1 72  ? 70.171  103.844 23.186  1.00 65.30  ? 50   SER C O   1 
ATOM   5399  C  CB  . SER C 1 72  ? 69.287  104.624 26.270  1.00 58.19  ? 50   SER C CB  1 
ATOM   5400  O  OG  . SER C 1 72  ? 69.953  105.874 26.304  1.00 58.71  ? 50   SER C OG  1 
ATOM   5401  N  N   . ARG C 1 73  ? 69.737  106.034 23.523  1.00 60.55  ? 51   ARG C N   1 
ATOM   5402  C  CA  . ARG C 1 73  ? 70.668  106.512 22.497  1.00 55.74  ? 51   ARG C CA  1 
ATOM   5403  C  C   . ARG C 1 73  ? 71.676  107.507 23.075  1.00 48.89  ? 51   ARG C C   1 
ATOM   5404  O  O   . ARG C 1 73  ? 72.450  108.107 22.336  1.00 49.01  ? 51   ARG C O   1 
ATOM   5405  C  CB  . ARG C 1 73  ? 69.923  107.175 21.325  1.00 55.07  ? 51   ARG C CB  1 
ATOM   5406  C  CG  . ARG C 1 73  ? 69.132  106.216 20.443  1.00 48.31  ? 51   ARG C CG  1 
ATOM   5407  C  CD  . ARG C 1 73  ? 67.648  106.469 20.582  1.00 54.54  ? 51   ARG C CD  1 
ATOM   5408  N  NE  . ARG C 1 73  ? 67.311  107.855 20.261  1.00 56.43  ? 51   ARG C NE  1 
ATOM   5409  C  CZ  . ARG C 1 73  ? 66.130  108.414 20.503  1.00 52.08  ? 51   ARG C CZ  1 
ATOM   5410  N  NH1 . ARG C 1 73  ? 65.166  107.709 21.074  1.00 54.91  ? 51   ARG C NH1 1 
ATOM   5411  N  NH2 . ARG C 1 73  ? 65.904  109.673 20.167  1.00 51.89  ? 51   ARG C NH2 1 
ATOM   5412  N  N   . CYS C 1 74  ? 71.661  107.679 24.393  1.00 45.24  ? 52   CYS C N   1 
ATOM   5413  C  CA  . CYS C 1 74  ? 72.577  108.596 25.065  1.00 39.96  ? 52   CYS C CA  1 
ATOM   5414  C  C   . CYS C 1 74  ? 74.019  108.213 24.735  1.00 41.01  ? 52   CYS C C   1 
ATOM   5415  O  O   . CYS C 1 74  ? 74.349  107.023 24.697  1.00 38.32  ? 52   CYS C O   1 
ATOM   5416  C  CB  . CYS C 1 74  ? 72.357  108.534 26.582  1.00 39.95  ? 52   CYS C CB  1 
ATOM   5417  S  SG  . CYS C 1 74  ? 73.273  109.763 27.506  1.00 28.68  ? 52   CYS C SG  1 
ATOM   5418  N  N   . THR C 1 75  ? 74.880  109.208 24.517  1.00 37.84  ? 53   THR C N   1 
ATOM   5419  C  CA  . THR C 1 75  ? 76.268  108.916 24.163  1.00 39.07  ? 53   THR C CA  1 
ATOM   5420  C  C   . THR C 1 75  ? 77.316  109.098 25.267  1.00 42.72  ? 53   THR C C   1 
ATOM   5421  O  O   . THR C 1 75  ? 78.525  109.047 25.005  1.00 40.68  ? 53   THR C O   1 
ATOM   5422  C  CB  . THR C 1 75  ? 76.694  109.717 22.914  1.00 30.67  ? 53   THR C CB  1 
ATOM   5423  O  OG1 . THR C 1 75  ? 76.435  111.105 23.122  1.00 39.18  ? 53   THR C OG1 1 
ATOM   5424  C  CG2 . THR C 1 75  ? 75.913  109.266 21.718  1.00 20.59  ? 53   THR C CG2 1 
ATOM   5425  N  N   . TRP C 1 76  ? 76.843  109.286 26.499  1.00 44.37  ? 54   TRP C N   1 
ATOM   5426  C  CA  . TRP C 1 76  ? 77.716  109.445 27.663  1.00 42.71  ? 54   TRP C CA  1 
ATOM   5427  C  C   . TRP C 1 76  ? 78.626  108.226 27.792  1.00 42.93  ? 54   TRP C C   1 
ATOM   5428  O  O   . TRP C 1 76  ? 78.227  107.113 27.453  1.00 48.33  ? 54   TRP C O   1 
ATOM   5429  C  CB  . TRP C 1 76  ? 76.865  109.565 28.942  1.00 42.98  ? 54   TRP C CB  1 
ATOM   5430  C  CG  . TRP C 1 76  ? 77.654  109.584 30.236  1.00 33.59  ? 54   TRP C CG  1 
ATOM   5431  C  CD1 . TRP C 1 76  ? 78.097  110.683 30.914  1.00 32.31  ? 54   TRP C CD1 1 
ATOM   5432  C  CD2 . TRP C 1 76  ? 78.098  108.448 30.987  1.00 30.67  ? 54   TRP C CD2 1 
ATOM   5433  N  NE1 . TRP C 1 76  ? 78.787  110.305 32.040  1.00 33.33  ? 54   TRP C NE1 1 
ATOM   5434  C  CE2 . TRP C 1 76  ? 78.803  108.939 32.109  1.00 24.74  ? 54   TRP C CE2 1 
ATOM   5435  C  CE3 . TRP C 1 76  ? 77.969  107.066 30.819  1.00 19.66  ? 54   TRP C CE3 1 
ATOM   5436  C  CZ2 . TRP C 1 76  ? 79.373  108.103 33.055  1.00 27.37  ? 54   TRP C CZ2 1 
ATOM   5437  C  CZ3 . TRP C 1 76  ? 78.536  106.233 31.760  1.00 30.31  ? 54   TRP C CZ3 1 
ATOM   5438  C  CH2 . TRP C 1 76  ? 79.231  106.753 32.868  1.00 35.54  ? 54   TRP C CH2 1 
ATOM   5439  N  N   . GLN C 1 77  ? 79.843  108.446 28.275  1.00 42.49  ? 55   GLN C N   1 
ATOM   5440  C  CA  . GLN C 1 77  ? 80.808  107.377 28.503  1.00 43.56  ? 55   GLN C CA  1 
ATOM   5441  C  C   . GLN C 1 77  ? 81.687  107.890 29.622  1.00 46.89  ? 55   GLN C C   1 
ATOM   5442  O  O   . GLN C 1 77  ? 82.116  109.042 29.586  1.00 50.07  ? 55   GLN C O   1 
ATOM   5443  C  CB  . GLN C 1 77  ? 81.658  107.112 27.266  1.00 48.45  ? 55   GLN C CB  1 
ATOM   5444  C  CG  . GLN C 1 77  ? 80.874  106.635 26.048  1.00 70.71  ? 55   GLN C CG  1 
ATOM   5445  C  CD  . GLN C 1 77  ? 81.779  106.130 24.924  1.00 78.15  ? 55   GLN C CD  1 
ATOM   5446  O  OE1 . GLN C 1 77  ? 82.459  105.109 25.070  1.00 81.84  ? 55   GLN C OE1 1 
ATOM   5447  N  NE2 . GLN C 1 77  ? 81.791  106.848 23.800  1.00 77.31  ? 55   GLN C NE2 1 
ATOM   5448  N  N   . LEU C 1 78  ? 81.940  107.063 30.630  1.00 45.47  ? 56   LEU C N   1 
ATOM   5449  C  CA  . LEU C 1 78  ? 82.773  107.495 31.743  1.00 43.17  ? 56   LEU C CA  1 
ATOM   5450  C  C   . LEU C 1 78  ? 84.110  107.962 31.208  1.00 46.76  ? 56   LEU C C   1 
ATOM   5451  O  O   . LEU C 1 78  ? 84.658  107.362 30.287  1.00 43.88  ? 56   LEU C O   1 
ATOM   5452  C  CB  . LEU C 1 78  ? 82.992  106.350 32.738  1.00 45.98  ? 56   LEU C CB  1 
ATOM   5453  C  CG  . LEU C 1 78  ? 83.934  106.650 33.921  1.00 45.82  ? 56   LEU C CG  1 
ATOM   5454  C  CD1 . LEU C 1 78  ? 83.470  107.921 34.646  1.00 32.76  ? 56   LEU C CD1 1 
ATOM   5455  C  CD2 . LEU C 1 78  ? 83.970  105.454 34.888  1.00 33.45  ? 56   LEU C CD2 1 
ATOM   5456  N  N   . GLY C 1 79  ? 84.631  109.038 31.786  1.00 51.06  ? 57   GLY C N   1 
ATOM   5457  C  CA  . GLY C 1 79  ? 85.911  109.566 31.344  1.00 50.28  ? 57   GLY C CA  1 
ATOM   5458  C  C   . GLY C 1 79  ? 85.753  110.691 30.341  1.00 49.98  ? 57   GLY C C   1 
ATOM   5459  O  O   . GLY C 1 79  ? 86.710  111.401 30.037  1.00 52.91  ? 57   GLY C O   1 
ATOM   5460  N  N   . ARG C 1 80  ? 84.539  110.849 29.829  1.00 47.17  ? 58   ARG C N   1 
ATOM   5461  C  CA  . ARG C 1 80  ? 84.240  111.888 28.860  1.00 50.08  ? 58   ARG C CA  1 
ATOM   5462  C  C   . ARG C 1 80  ? 83.899  113.188 29.616  1.00 52.11  ? 58   ARG C C   1 
ATOM   5463  O  O   . ARG C 1 80  ? 83.095  113.186 30.551  1.00 51.75  ? 58   ARG C O   1 
ATOM   5464  C  CB  . ARG C 1 80  ? 83.077  111.427 27.979  1.00 45.72  ? 58   ARG C CB  1 
ATOM   5465  C  CG  . ARG C 1 80  ? 82.916  112.232 26.731  1.00 49.08  ? 58   ARG C CG  1 
ATOM   5466  C  CD  . ARG C 1 80  ? 81.822  111.691 25.832  1.00 52.62  ? 58   ARG C CD  1 
ATOM   5467  N  NE  . ARG C 1 80  ? 81.482  112.701 24.829  1.00 55.80  ? 58   ARG C NE  1 
ATOM   5468  C  CZ  . ARG C 1 80  ? 80.774  112.474 23.730  1.00 53.62  ? 58   ARG C CZ  1 
ATOM   5469  N  NH1 . ARG C 1 80  ? 80.527  113.473 22.890  1.00 45.61  ? 58   ARG C NH1 1 
ATOM   5470  N  NH2 . ARG C 1 80  ? 80.324  111.252 23.472  1.00 56.06  ? 58   ARG C NH2 1 
ATOM   5471  N  N   . PRO C 1 81  ? 84.516  114.317 29.219  1.00 53.53  ? 59   PRO C N   1 
ATOM   5472  C  CA  . PRO C 1 81  ? 84.293  115.625 29.857  1.00 51.87  ? 59   PRO C CA  1 
ATOM   5473  C  C   . PRO C 1 81  ? 82.825  116.028 29.979  1.00 53.43  ? 59   PRO C C   1 
ATOM   5474  O  O   . PRO C 1 81  ? 82.016  115.711 29.105  1.00 55.88  ? 59   PRO C O   1 
ATOM   5475  C  CB  . PRO C 1 81  ? 85.070  116.585 28.960  1.00 52.24  ? 59   PRO C CB  1 
ATOM   5476  C  CG  . PRO C 1 81  ? 86.153  115.714 28.386  1.00 55.13  ? 59   PRO C CG  1 
ATOM   5477  C  CD  . PRO C 1 81  ? 85.408  114.451 28.054  1.00 51.48  ? 59   PRO C CD  1 
ATOM   5478  N  N   . ALA C 1 82  ? 82.493  116.740 31.056  1.00 53.72  ? 60   ALA C N   1 
ATOM   5479  C  CA  . ALA C 1 82  ? 81.120  117.195 31.289  1.00 53.43  ? 60   ALA C CA  1 
ATOM   5480  C  C   . ALA C 1 82  ? 80.750  118.304 30.310  1.00 52.41  ? 60   ALA C C   1 
ATOM   5481  O  O   . ALA C 1 82  ? 79.577  118.522 30.017  1.00 50.68  ? 60   ALA C O   1 
ATOM   5482  C  CB  . ALA C 1 82  ? 80.963  117.689 32.719  1.00 49.83  ? 60   ALA C CB  1 
ATOM   5483  N  N   . SER C 1 83  ? 81.764  119.001 29.807  1.00 54.84  ? 61   SER C N   1 
ATOM   5484  C  CA  . SER C 1 83  ? 81.566  120.086 28.851  1.00 50.16  ? 61   SER C CA  1 
ATOM   5485  C  C   . SER C 1 83  ? 80.915  119.561 27.584  1.00 49.46  ? 61   SER C C   1 
ATOM   5486  O  O   . SER C 1 83  ? 80.335  120.319 26.806  1.00 54.17  ? 61   SER C O   1 
ATOM   5487  C  CB  . SER C 1 83  ? 82.912  120.722 28.498  1.00 52.05  ? 61   SER C CB  1 
ATOM   5488  O  OG  . SER C 1 83  ? 83.842  119.737 28.068  1.00 47.52  ? 61   SER C OG  1 
ATOM   5489  N  N   . GLU C 1 84  ? 81.008  118.255 27.381  1.00 44.34  ? 62   GLU C N   1 
ATOM   5490  C  CA  . GLU C 1 84  ? 80.443  117.644 26.195  1.00 41.48  ? 62   GLU C CA  1 
ATOM   5491  C  C   . GLU C 1 84  ? 78.990  117.206 26.313  1.00 40.61  ? 62   GLU C C   1 
ATOM   5492  O  O   . GLU C 1 84  ? 78.431  116.679 25.361  1.00 50.30  ? 62   GLU C O   1 
ATOM   5493  C  CB  . GLU C 1 84  ? 81.313  116.465 25.768  1.00 46.95  ? 62   GLU C CB  1 
ATOM   5494  C  CG  . GLU C 1 84  ? 82.623  116.888 25.130  1.00 45.43  ? 62   GLU C CG  1 
ATOM   5495  C  CD  . GLU C 1 84  ? 83.456  115.711 24.713  1.00 48.93  ? 62   GLU C CD  1 
ATOM   5496  O  OE1 . GLU C 1 84  ? 82.888  114.749 24.151  1.00 51.77  ? 62   GLU C OE1 1 
ATOM   5497  O  OE2 . GLU C 1 84  ? 84.679  115.751 24.938  1.00 51.74  ? 62   GLU C OE2 1 
ATOM   5498  N  N   . SER C 1 85  ? 78.371  117.415 27.467  1.00 37.82  ? 63   SER C N   1 
ATOM   5499  C  CA  . SER C 1 85  ? 76.978  117.032 27.630  1.00 32.85  ? 63   SER C CA  1 
ATOM   5500  C  C   . SER C 1 85  ? 76.109  118.020 26.876  1.00 33.87  ? 63   SER C C   1 
ATOM   5501  O  O   . SER C 1 85  ? 76.373  119.212 26.884  1.00 35.04  ? 63   SER C O   1 
ATOM   5502  C  CB  . SER C 1 85  ? 76.577  117.043 29.103  1.00 33.22  ? 63   SER C CB  1 
ATOM   5503  O  OG  . SER C 1 85  ? 75.161  117.089 29.238  1.00 29.23  ? 63   SER C OG  1 
ATOM   5504  N  N   . PRO C 1 86  ? 75.073  117.529 26.190  1.00 37.14  ? 64   PRO C N   1 
ATOM   5505  C  CA  . PRO C 1 86  ? 74.136  118.345 25.420  1.00 37.96  ? 64   PRO C CA  1 
ATOM   5506  C  C   . PRO C 1 86  ? 72.926  118.600 26.304  1.00 40.84  ? 64   PRO C C   1 
ATOM   5507  O  O   . PRO C 1 86  ? 71.899  119.096 25.839  1.00 39.13  ? 64   PRO C O   1 
ATOM   5508  C  CB  . PRO C 1 86  ? 73.774  117.430 24.271  1.00 34.40  ? 64   PRO C CB  1 
ATOM   5509  C  CG  . PRO C 1 86  ? 73.633  116.130 24.987  1.00 30.11  ? 64   PRO C CG  1 
ATOM   5510  C  CD  . PRO C 1 86  ? 74.893  116.110 25.845  1.00 33.64  ? 64   PRO C CD  1 
ATOM   5511  N  N   . HIS C 1 87  ? 73.056  118.244 27.578  1.00 40.64  ? 65   HIS C N   1 
ATOM   5512  C  CA  . HIS C 1 87  ? 71.964  118.399 28.527  1.00 45.16  ? 65   HIS C CA  1 
ATOM   5513  C  C   . HIS C 1 87  ? 72.040  119.661 29.366  1.00 44.62  ? 65   HIS C C   1 
ATOM   5514  O  O   . HIS C 1 87  ? 73.116  120.228 29.569  1.00 40.49  ? 65   HIS C O   1 
ATOM   5515  C  CB  . HIS C 1 87  ? 71.917  117.191 29.466  1.00 50.08  ? 65   HIS C CB  1 
ATOM   5516  C  CG  . HIS C 1 87  ? 71.675  115.891 28.765  1.00 51.50  ? 65   HIS C CG  1 
ATOM   5517  N  ND1 . HIS C 1 87  ? 70.517  115.628 28.067  1.00 54.95  ? 65   HIS C ND1 1 
ATOM   5518  C  CD2 . HIS C 1 87  ? 72.441  114.780 28.653  1.00 45.14  ? 65   HIS C CD2 1 
ATOM   5519  C  CE1 . HIS C 1 87  ? 70.581  114.413 27.554  1.00 46.58  ? 65   HIS C CE1 1 
ATOM   5520  N  NE2 . HIS C 1 87  ? 71.738  113.877 27.896  1.00 44.86  ? 65   HIS C NE2 1 
ATOM   5521  N  N   . HIS C 1 88  ? 70.879  120.099 29.845  1.00 45.59  ? 66   HIS C N   1 
ATOM   5522  C  CA  . HIS C 1 88  ? 70.823  121.268 30.702  1.00 47.66  ? 66   HIS C CA  1 
ATOM   5523  C  C   . HIS C 1 88  ? 71.066  120.719 32.098  1.00 47.25  ? 66   HIS C C   1 
ATOM   5524  O  O   . HIS C 1 88  ? 70.301  119.888 32.594  1.00 39.92  ? 66   HIS C O   1 
ATOM   5525  C  CB  . HIS C 1 88  ? 69.452  121.947 30.654  1.00 51.36  ? 66   HIS C CB  1 
ATOM   5526  C  CG  . HIS C 1 88  ? 69.351  123.127 31.569  1.00 63.27  ? 66   HIS C CG  1 
ATOM   5527  N  ND1 . HIS C 1 88  ? 68.283  123.330 32.417  1.00 68.22  ? 66   HIS C ND1 1 
ATOM   5528  C  CD2 . HIS C 1 88  ? 70.214  124.145 31.799  1.00 65.96  ? 66   HIS C CD2 1 
ATOM   5529  C  CE1 . HIS C 1 88  ? 68.496  124.420 33.134  1.00 73.03  ? 66   HIS C CE1 1 
ATOM   5530  N  NE2 . HIS C 1 88  ? 69.660  124.932 32.778  1.00 74.27  ? 66   HIS C NE2 1 
ATOM   5531  N  N   . HIS C 1 89  ? 72.136  121.175 32.730  1.00 48.40  ? 67   HIS C N   1 
ATOM   5532  C  CA  . HIS C 1 89  ? 72.463  120.702 34.060  1.00 49.12  ? 67   HIS C CA  1 
ATOM   5533  C  C   . HIS C 1 89  ? 72.218  121.719 35.164  1.00 52.08  ? 67   HIS C C   1 
ATOM   5534  O  O   . HIS C 1 89  ? 72.436  122.920 35.004  1.00 55.52  ? 67   HIS C O   1 
ATOM   5535  C  CB  . HIS C 1 89  ? 73.905  120.207 34.078  1.00 45.95  ? 67   HIS C CB  1 
ATOM   5536  C  CG  . HIS C 1 89  ? 74.102  118.941 33.305  1.00 50.18  ? 67   HIS C CG  1 
ATOM   5537  N  ND1 . HIS C 1 89  ? 73.640  117.722 33.752  1.00 47.39  ? 67   HIS C ND1 1 
ATOM   5538  C  CD2 . HIS C 1 89  ? 74.660  118.712 32.091  1.00 49.76  ? 67   HIS C CD2 1 
ATOM   5539  C  CE1 . HIS C 1 89  ? 73.903  116.796 32.847  1.00 48.37  ? 67   HIS C CE1 1 
ATOM   5540  N  NE2 . HIS C 1 89  ? 74.522  117.371 31.830  1.00 52.62  ? 67   HIS C NE2 1 
ATOM   5541  N  N   . THR C 1 90  ? 71.752  121.203 36.291  1.00 56.96  ? 68   THR C N   1 
ATOM   5542  C  CA  . THR C 1 90  ? 71.434  122.005 37.458  1.00 59.91  ? 68   THR C CA  1 
ATOM   5543  C  C   . THR C 1 90  ? 72.327  121.668 38.656  1.00 56.78  ? 68   THR C C   1 
ATOM   5544  O  O   . THR C 1 90  ? 72.826  120.548 38.784  1.00 54.53  ? 68   THR C O   1 
ATOM   5545  C  CB  . THR C 1 90  ? 69.941  121.801 37.824  1.00 64.10  ? 68   THR C CB  1 
ATOM   5546  O  OG1 . THR C 1 90  ? 69.133  122.630 36.975  1.00 65.87  ? 68   THR C OG1 1 
ATOM   5547  C  CG2 . THR C 1 90  ? 69.673  122.122 39.286  1.00 60.85  ? 68   THR C CG2 1 
ATOM   5548  N  N   . ALA C 1 91  ? 72.530  122.657 39.522  1.00 52.36  ? 69   ALA C N   1 
ATOM   5549  C  CA  . ALA C 1 91  ? 73.351  122.487 40.715  1.00 46.69  ? 69   ALA C CA  1 
ATOM   5550  C  C   . ALA C 1 91  ? 72.471  122.361 41.956  1.00 43.58  ? 69   ALA C C   1 
ATOM   5551  O  O   . ALA C 1 91  ? 71.368  122.897 42.007  1.00 44.94  ? 69   ALA C O   1 
ATOM   5552  C  CB  . ALA C 1 91  ? 74.293  123.672 40.865  1.00 42.44  ? 69   ALA C CB  1 
ATOM   5553  N  N   . PRO C 1 92  ? 72.941  121.632 42.971  1.00 42.96  ? 70   PRO C N   1 
ATOM   5554  C  CA  . PRO C 1 92  ? 72.129  121.494 44.184  1.00 46.72  ? 70   PRO C CA  1 
ATOM   5555  C  C   . PRO C 1 92  ? 71.794  122.858 44.797  1.00 48.15  ? 70   PRO C C   1 
ATOM   5556  O  O   . PRO C 1 92  ? 72.465  123.863 44.526  1.00 41.63  ? 70   PRO C O   1 
ATOM   5557  C  CB  . PRO C 1 92  ? 73.020  120.655 45.097  1.00 44.18  ? 70   PRO C CB  1 
ATOM   5558  C  CG  . PRO C 1 92  ? 73.748  119.789 44.122  1.00 46.92  ? 70   PRO C CG  1 
ATOM   5559  C  CD  . PRO C 1 92  ? 74.124  120.762 43.027  1.00 41.25  ? 70   PRO C CD  1 
ATOM   5560  N  N   . ALA C 1 93  ? 70.749  122.885 45.619  1.00 52.11  ? 71   ALA C N   1 
ATOM   5561  C  CA  . ALA C 1 93  ? 70.326  124.113 46.283  1.00 56.03  ? 71   ALA C CA  1 
ATOM   5562  C  C   . ALA C 1 93  ? 70.070  123.817 47.755  1.00 61.55  ? 71   ALA C C   1 
ATOM   5563  O  O   . ALA C 1 93  ? 69.501  122.774 48.088  1.00 65.13  ? 71   ALA C O   1 
ATOM   5564  C  CB  . ALA C 1 93  ? 69.067  124.651 45.632  1.00 46.88  ? 71   ALA C CB  1 
ATOM   5565  N  N   . LYS C 1 94  ? 70.507  124.716 48.637  1.00 64.98  ? 72   LYS C N   1 
ATOM   5566  C  CA  . LYS C 1 94  ? 70.289  124.524 50.070  1.00 65.25  ? 72   LYS C CA  1 
ATOM   5567  C  C   . LYS C 1 94  ? 69.006  125.228 50.490  1.00 64.07  ? 72   LYS C C   1 
ATOM   5568  O  O   . LYS C 1 94  ? 68.607  126.225 49.884  1.00 66.17  ? 72   LYS C O   1 
ATOM   5569  C  CB  . LYS C 1 94  ? 71.472  125.059 50.888  1.00 66.83  ? 72   LYS C CB  1 
ATOM   5570  C  CG  . LYS C 1 94  ? 72.651  124.086 51.013  1.00 69.99  ? 72   LYS C CG  1 
ATOM   5571  C  CD  . LYS C 1 94  ? 73.649  124.555 52.069  1.00 67.08  ? 72   LYS C CD  1 
ATOM   5572  C  CE  . LYS C 1 94  ? 74.766  123.550 52.300  1.00 65.19  ? 72   LYS C CE  1 
ATOM   5573  N  NZ  . LYS C 1 94  ? 75.658  123.408 51.123  1.00 59.67  ? 72   LYS C NZ  1 
ATOM   5574  N  N   . SER C 1 95  ? 68.358  124.689 51.518  1.00 59.98  ? 73   SER C N   1 
ATOM   5575  C  CA  . SER C 1 95  ? 67.113  125.251 52.032  1.00 55.93  ? 73   SER C CA  1 
ATOM   5576  C  C   . SER C 1 95  ? 67.275  126.665 52.578  1.00 52.21  ? 73   SER C C   1 
ATOM   5577  O  O   . SER C 1 95  ? 68.136  126.924 53.420  1.00 49.02  ? 73   SER C O   1 
ATOM   5578  C  CB  . SER C 1 95  ? 66.554  124.358 53.136  1.00 60.02  ? 73   SER C CB  1 
ATOM   5579  O  OG  . SER C 1 95  ? 65.642  125.081 53.948  1.00 69.94  ? 73   SER C OG  1 
ATOM   5580  N  N   . PRO C 1 96  ? 66.432  127.600 52.106  1.00 51.49  ? 74   PRO C N   1 
ATOM   5581  C  CA  . PRO C 1 96  ? 66.470  129.004 52.541  1.00 45.63  ? 74   PRO C CA  1 
ATOM   5582  C  C   . PRO C 1 96  ? 65.771  129.224 53.882  1.00 39.20  ? 74   PRO C C   1 
ATOM   5583  O  O   . PRO C 1 96  ? 65.113  128.320 54.400  1.00 40.12  ? 74   PRO C O   1 
ATOM   5584  C  CB  . PRO C 1 96  ? 65.766  129.728 51.399  1.00 46.07  ? 74   PRO C CB  1 
ATOM   5585  C  CG  . PRO C 1 96  ? 64.719  128.731 50.999  1.00 44.94  ? 74   PRO C CG  1 
ATOM   5586  C  CD  . PRO C 1 96  ? 65.485  127.423 50.988  1.00 45.27  ? 74   PRO C CD  1 
ATOM   5587  N  N   . LYS C 1 97  ? 65.933  130.422 54.434  1.00 29.67  ? 75   LYS C N   1 
ATOM   5588  C  CA  . LYS C 1 97  ? 65.312  130.787 55.694  1.00 25.79  ? 75   LYS C CA  1 
ATOM   5589  C  C   . LYS C 1 97  ? 63.831  130.490 55.597  1.00 26.30  ? 75   LYS C C   1 
ATOM   5590  O  O   . LYS C 1 97  ? 63.327  129.583 56.251  1.00 29.99  ? 75   LYS C O   1 
ATOM   5591  C  CB  . LYS C 1 97  ? 65.486  132.284 55.966  1.00 30.32  ? 75   LYS C CB  1 
ATOM   5592  C  CG  . LYS C 1 97  ? 66.400  132.643 57.141  1.00 37.65  ? 75   LYS C CG  1 
ATOM   5593  C  CD  . LYS C 1 97  ? 66.170  134.093 57.566  1.00 30.80  ? 75   LYS C CD  1 
ATOM   5594  C  CE  . LYS C 1 97  ? 67.335  134.655 58.373  1.00 38.37  ? 75   LYS C CE  1 
ATOM   5595  N  NZ  . LYS C 1 97  ? 68.453  135.123 57.490  1.00 46.21  ? 75   LYS C NZ  1 
ATOM   5596  N  N   . ILE C 1 98  ? 63.144  131.283 54.777  1.00 33.52  ? 76   ILE C N   1 
ATOM   5597  C  CA  . ILE C 1 98  ? 61.703  131.164 54.548  1.00 33.80  ? 76   ILE C CA  1 
ATOM   5598  C  C   . ILE C 1 98  ? 61.498  130.580 53.160  1.00 36.02  ? 76   ILE C C   1 
ATOM   5599  O  O   . ILE C 1 98  ? 62.033  131.101 52.190  1.00 44.66  ? 76   ILE C O   1 
ATOM   5600  C  CB  . ILE C 1 98  ? 61.028  132.543 54.611  1.00 30.63  ? 76   ILE C CB  1 
ATOM   5601  C  CG1 . ILE C 1 98  ? 61.003  133.042 56.056  1.00 24.49  ? 76   ILE C CG1 1 
ATOM   5602  C  CG2 . ILE C 1 98  ? 59.630  132.468 54.034  1.00 33.84  ? 76   ILE C CG2 1 
ATOM   5603  C  CD1 . ILE C 1 98  ? 60.410  134.440 56.207  1.00 17.10  ? 76   ILE C CD1 1 
ATOM   5604  N  N   . LEU C 1 99  ? 60.727  129.502 53.064  1.00 34.40  ? 77   LEU C N   1 
ATOM   5605  C  CA  . LEU C 1 99  ? 60.495  128.842 51.778  1.00 27.61  ? 77   LEU C CA  1 
ATOM   5606  C  C   . LEU C 1 99  ? 59.336  129.459 51.017  1.00 27.20  ? 77   LEU C C   1 
ATOM   5607  O  O   . LEU C 1 99  ? 58.235  129.559 51.544  1.00 28.16  ? 77   LEU C O   1 
ATOM   5608  C  CB  . LEU C 1 99  ? 60.243  127.340 51.991  1.00 31.44  ? 77   LEU C CB  1 
ATOM   5609  C  CG  . LEU C 1 99  ? 61.467  126.466 52.343  1.00 21.85  ? 77   LEU C CG  1 
ATOM   5610  C  CD1 . LEU C 1 99  ? 62.147  126.950 53.601  1.00 13.98  ? 77   LEU C CD1 1 
ATOM   5611  C  CD2 . LEU C 1 99  ? 61.020  125.028 52.505  1.00 9.45   ? 77   LEU C CD2 1 
ATOM   5612  N  N   . PRO C 1 100 ? 59.569  129.875 49.755  1.00 23.54  ? 78   PRO C N   1 
ATOM   5613  C  CA  . PRO C 1 100 ? 58.521  130.495 48.932  1.00 23.99  ? 78   PRO C CA  1 
ATOM   5614  C  C   . PRO C 1 100 ? 57.309  129.603 48.628  1.00 23.34  ? 78   PRO C C   1 
ATOM   5615  O  O   . PRO C 1 100 ? 56.191  130.095 48.406  1.00 20.16  ? 78   PRO C O   1 
ATOM   5616  C  CB  . PRO C 1 100 ? 59.290  130.963 47.682  1.00 24.47  ? 78   PRO C CB  1 
ATOM   5617  C  CG  . PRO C 1 100 ? 60.443  130.024 47.600  1.00 21.73  ? 78   PRO C CG  1 
ATOM   5618  C  CD  . PRO C 1 100 ? 60.860  129.870 49.042  1.00 25.36  ? 78   PRO C CD  1 
ATOM   5619  N  N   . ASP C 1 101 ? 57.542  128.294 48.606  1.00 24.89  ? 79   ASP C N   1 
ATOM   5620  C  CA  . ASP C 1 101 ? 56.481  127.312 48.393  1.00 22.65  ? 79   ASP C CA  1 
ATOM   5621  C  C   . ASP C 1 101 ? 57.023  125.962 48.837  1.00 18.43  ? 79   ASP C C   1 
ATOM   5622  O  O   . ASP C 1 101 ? 58.220  125.820 49.019  1.00 21.73  ? 79   ASP C O   1 
ATOM   5623  C  CB  . ASP C 1 101 ? 56.014  127.284 46.938  1.00 24.03  ? 79   ASP C CB  1 
ATOM   5624  C  CG  . ASP C 1 101 ? 57.022  126.669 46.001  1.00 35.35  ? 79   ASP C CG  1 
ATOM   5625  O  OD1 . ASP C 1 101 ? 57.402  125.492 46.203  1.00 51.98  ? 79   ASP C OD1 1 
ATOM   5626  O  OD2 . ASP C 1 101 ? 57.421  127.362 45.044  1.00 43.10  ? 79   ASP C OD2 1 
ATOM   5627  N  N   . ILE C 1 102 ? 56.153  124.976 49.014  1.00 18.15  ? 80   ILE C N   1 
ATOM   5628  C  CA  . ILE C 1 102 ? 56.589  123.676 49.498  1.00 16.79  ? 80   ILE C CA  1 
ATOM   5629  C  C   . ILE C 1 102 ? 57.525  122.907 48.590  1.00 23.67  ? 80   ILE C C   1 
ATOM   5630  O  O   . ILE C 1 102 ? 58.338  122.099 49.064  1.00 24.41  ? 80   ILE C O   1 
ATOM   5631  C  CB  . ILE C 1 102 ? 55.386  122.769 49.835  1.00 19.72  ? 80   ILE C CB  1 
ATOM   5632  C  CG1 . ILE C 1 102 ? 55.798  121.755 50.904  1.00 18.56  ? 80   ILE C CG1 1 
ATOM   5633  C  CG2 . ILE C 1 102 ? 54.914  122.034 48.598  1.00 18.55  ? 80   ILE C CG2 1 
ATOM   5634  C  CD1 . ILE C 1 102 ? 56.284  122.404 52.210  1.00 4.14   ? 80   ILE C CD1 1 
ATOM   5635  N  N   . LEU C 1 103 ? 57.412  123.140 47.288  1.00 24.36  ? 81   LEU C N   1 
ATOM   5636  C  CA  . LEU C 1 103 ? 58.277  122.450 46.351  1.00 26.60  ? 81   LEU C CA  1 
ATOM   5637  C  C   . LEU C 1 103 ? 59.731  122.709 46.678  1.00 23.82  ? 81   LEU C C   1 
ATOM   5638  O  O   . LEU C 1 103 ? 60.605  121.942 46.290  1.00 29.57  ? 81   LEU C O   1 
ATOM   5639  C  CB  . LEU C 1 103 ? 57.963  122.877 44.925  1.00 24.57  ? 81   LEU C CB  1 
ATOM   5640  C  CG  . LEU C 1 103 ? 56.524  122.487 44.567  1.00 26.44  ? 81   LEU C CG  1 
ATOM   5641  C  CD1 . LEU C 1 103 ? 56.233  122.876 43.121  1.00 13.73  ? 81   LEU C CD1 1 
ATOM   5642  C  CD2 . LEU C 1 103 ? 56.320  120.997 44.778  1.00 8.66   ? 81   LEU C CD2 1 
ATOM   5643  N  N   . LYS C 1 104 ? 59.981  123.789 47.404  1.00 21.95  ? 82   LYS C N   1 
ATOM   5644  C  CA  . LYS C 1 104 ? 61.328  124.119 47.807  1.00 26.11  ? 82   LYS C CA  1 
ATOM   5645  C  C   . LYS C 1 104 ? 61.787  123.159 48.896  1.00 26.64  ? 82   LYS C C   1 
ATOM   5646  O  O   . LYS C 1 104 ? 62.949  123.181 49.291  1.00 24.16  ? 82   LYS C O   1 
ATOM   5647  C  CB  . LYS C 1 104 ? 61.413  125.577 48.280  1.00 30.40  ? 82   LYS C CB  1 
ATOM   5648  C  CG  . LYS C 1 104 ? 62.040  126.505 47.231  1.00 42.66  ? 82   LYS C CG  1 
ATOM   5649  C  CD  . LYS C 1 104 ? 61.450  126.229 45.842  1.00 52.66  ? 82   LYS C CD  1 
ATOM   5650  C  CE  . LYS C 1 104 ? 62.346  126.736 44.707  1.00 53.39  ? 82   LYS C CE  1 
ATOM   5651  N  NZ  . LYS C 1 104 ? 61.970  126.094 43.414  1.00 37.04  ? 82   LYS C NZ  1 
ATOM   5652  N  N   . LYS C 1 105 ? 60.878  122.301 49.366  1.00 33.19  ? 83   LYS C N   1 
ATOM   5653  C  CA  . LYS C 1 105 ? 61.222  121.306 50.390  1.00 35.27  ? 83   LYS C CA  1 
ATOM   5654  C  C   . LYS C 1 105 ? 61.302  119.916 49.743  1.00 33.64  ? 83   LYS C C   1 
ATOM   5655  O  O   . LYS C 1 105 ? 60.788  118.922 50.243  1.00 38.48  ? 83   LYS C O   1 
ATOM   5656  C  CB  . LYS C 1 105 ? 60.203  121.318 51.541  1.00 38.24  ? 83   LYS C CB  1 
ATOM   5657  C  CG  . LYS C 1 105 ? 60.607  120.451 52.732  1.00 38.14  ? 83   LYS C CG  1 
ATOM   5658  C  CD  . LYS C 1 105 ? 62.070  120.663 53.148  1.00 42.18  ? 83   LYS C CD  1 
ATOM   5659  C  CE  . LYS C 1 105 ? 62.415  119.980 54.483  1.00 51.47  ? 83   LYS C CE  1 
ATOM   5660  N  NZ  . LYS C 1 105 ? 62.224  118.493 54.510  1.00 55.51  ? 83   LYS C NZ  1 
ATOM   5661  N  N   . ILE C 1 106 ? 61.957  119.887 48.598  1.00 33.62  ? 84   ILE C N   1 
ATOM   5662  C  CA  . ILE C 1 106 ? 62.189  118.688 47.823  1.00 33.12  ? 84   ILE C CA  1 
ATOM   5663  C  C   . ILE C 1 106 ? 63.703  118.765 47.601  1.00 34.35  ? 84   ILE C C   1 
ATOM   5664  O  O   . ILE C 1 106 ? 64.219  119.781 47.121  1.00 31.40  ? 84   ILE C O   1 
ATOM   5665  C  CB  . ILE C 1 106 ? 61.461  118.766 46.459  1.00 37.46  ? 84   ILE C CB  1 
ATOM   5666  C  CG1 . ILE C 1 106 ? 59.946  118.722 46.680  1.00 32.17  ? 84   ILE C CG1 1 
ATOM   5667  C  CG2 . ILE C 1 106 ? 61.937  117.638 45.548  1.00 42.22  ? 84   ILE C CG2 1 
ATOM   5668  C  CD1 . ILE C 1 106 ? 59.137  119.115 45.479  1.00 31.95  ? 84   ILE C CD1 1 
ATOM   5669  N  N   . GLY C 1 107 ? 64.413  117.709 47.970  1.00 26.63  ? 85   GLY C N   1 
ATOM   5670  C  CA  . GLY C 1 107 ? 65.848  117.716 47.816  1.00 23.97  ? 85   GLY C CA  1 
ATOM   5671  C  C   . GLY C 1 107 ? 66.480  118.158 49.112  1.00 27.21  ? 85   GLY C C   1 
ATOM   5672  O  O   . GLY C 1 107 ? 65.769  118.458 50.067  1.00 27.46  ? 85   GLY C O   1 
ATOM   5673  N  N   . ASP C 1 108 ? 67.809  118.204 49.153  1.00 27.05  ? 86   ASP C N   1 
ATOM   5674  C  CA  . ASP C 1 108 ? 68.521  118.599 50.361  1.00 27.92  ? 86   ASP C CA  1 
ATOM   5675  C  C   . ASP C 1 108 ? 68.023  117.690 51.496  1.00 27.94  ? 86   ASP C C   1 
ATOM   5676  O  O   . ASP C 1 108 ? 67.751  118.151 52.608  1.00 21.52  ? 86   ASP C O   1 
ATOM   5677  C  CB  . ASP C 1 108 ? 68.242  120.077 50.671  1.00 33.80  ? 86   ASP C CB  1 
ATOM   5678  C  CG  . ASP C 1 108 ? 69.159  120.640 51.747  1.00 42.32  ? 86   ASP C CG  1 
ATOM   5679  O  OD1 . ASP C 1 108 ? 70.390  120.542 51.591  1.00 52.98  ? 86   ASP C OD1 1 
ATOM   5680  O  OD2 . ASP C 1 108 ? 68.656  121.194 52.745  1.00 42.76  ? 86   ASP C OD2 1 
ATOM   5681  N  N   . THR C 1 109 ? 67.890  116.398 51.196  1.00 20.59  ? 87   THR C N   1 
ATOM   5682  C  CA  . THR C 1 109 ? 67.435  115.437 52.178  1.00 19.12  ? 87   THR C CA  1 
ATOM   5683  C  C   . THR C 1 109 ? 68.568  115.041 53.129  1.00 22.09  ? 87   THR C C   1 
ATOM   5684  O  O   . THR C 1 109 ? 69.745  115.064 52.770  1.00 30.04  ? 87   THR C O   1 
ATOM   5685  C  CB  . THR C 1 109 ? 66.869  114.181 51.503  1.00 22.11  ? 87   THR C CB  1 
ATOM   5686  O  OG1 . THR C 1 109 ? 67.878  113.563 50.699  1.00 27.09  ? 87   THR C OG1 1 
ATOM   5687  C  CG2 . THR C 1 109 ? 65.705  114.546 50.638  1.00 26.73  ? 87   THR C CG2 1 
ATOM   5688  N  N   . PRO C 1 110 ? 68.219  114.677 54.365  1.00 16.41  ? 88   PRO C N   1 
ATOM   5689  C  CA  . PRO C 1 110 ? 69.184  114.276 55.390  1.00 16.58  ? 88   PRO C CA  1 
ATOM   5690  C  C   . PRO C 1 110 ? 69.883  112.913 55.255  1.00 19.43  ? 88   PRO C C   1 
ATOM   5691  O  O   . PRO C 1 110 ? 69.296  111.924 54.837  1.00 21.15  ? 88   PRO C O   1 
ATOM   5692  C  CB  . PRO C 1 110 ? 68.367  114.377 56.682  1.00 12.98  ? 88   PRO C CB  1 
ATOM   5693  C  CG  . PRO C 1 110 ? 66.981  114.063 56.240  1.00 14.91  ? 88   PRO C CG  1 
ATOM   5694  C  CD  . PRO C 1 110 ? 66.861  114.800 54.926  1.00 9.53   ? 88   PRO C CD  1 
ATOM   5695  N  N   . MET C 1 111 ? 71.153  112.893 55.630  1.00 24.06  ? 89   MET C N   1 
ATOM   5696  C  CA  . MET C 1 111 ? 71.959  111.685 55.609  1.00 32.27  ? 89   MET C CA  1 
ATOM   5697  C  C   . MET C 1 111 ? 72.043  111.232 57.068  1.00 41.22  ? 89   MET C C   1 
ATOM   5698  O  O   . MET C 1 111 ? 72.647  111.912 57.920  1.00 43.64  ? 89   MET C O   1 
ATOM   5699  C  CB  . MET C 1 111 ? 73.368  111.987 55.083  1.00 33.45  ? 89   MET C CB  1 
ATOM   5700  C  CG  . MET C 1 111 ? 74.257  110.754 54.923  1.00 37.82  ? 89   MET C CG  1 
ATOM   5701  S  SD  . MET C 1 111 ? 73.740  109.668 53.557  1.00 42.99  ? 89   MET C SD  1 
ATOM   5702  C  CE  . MET C 1 111 ? 74.897  110.239 52.262  1.00 28.76  ? 89   MET C CE  1 
ATOM   5703  N  N   . VAL C 1 112 ? 71.438  110.086 57.357  1.00 35.28  ? 90   VAL C N   1 
ATOM   5704  C  CA  . VAL C 1 112 ? 71.425  109.579 58.719  1.00 32.40  ? 90   VAL C CA  1 
ATOM   5705  C  C   . VAL C 1 112 ? 72.200  108.269 58.902  1.00 31.86  ? 90   VAL C C   1 
ATOM   5706  O  O   . VAL C 1 112 ? 72.123  107.359 58.078  1.00 29.66  ? 90   VAL C O   1 
ATOM   5707  C  CB  . VAL C 1 112 ? 69.971  109.390 59.192  1.00 28.98  ? 90   VAL C CB  1 
ATOM   5708  C  CG1 . VAL C 1 112 ? 69.929  109.088 60.691  1.00 25.47  ? 90   VAL C CG1 1 
ATOM   5709  C  CG2 . VAL C 1 112 ? 69.163  110.647 58.868  1.00 28.12  ? 90   VAL C CG2 1 
ATOM   5710  N  N   . ARG C 1 113 ? 72.941  108.185 60.001  1.00 28.64  ? 91   ARG C N   1 
ATOM   5711  C  CA  . ARG C 1 113 ? 73.738  107.005 60.317  1.00 28.24  ? 91   ARG C CA  1 
ATOM   5712  C  C   . ARG C 1 113 ? 72.892  105.900 60.936  1.00 30.87  ? 91   ARG C C   1 
ATOM   5713  O  O   . ARG C 1 113 ? 72.121  106.138 61.871  1.00 36.26  ? 91   ARG C O   1 
ATOM   5714  C  CB  . ARG C 1 113 ? 74.859  107.368 61.294  1.00 23.02  ? 91   ARG C CB  1 
ATOM   5715  C  CG  . ARG C 1 113 ? 75.927  106.303 61.474  1.00 17.86  ? 91   ARG C CG  1 
ATOM   5716  C  CD  . ARG C 1 113 ? 76.612  106.468 62.808  1.00 25.98  ? 91   ARG C CD  1 
ATOM   5717  N  NE  . ARG C 1 113 ? 77.178  107.803 62.991  1.00 42.00  ? 91   ARG C NE  1 
ATOM   5718  C  CZ  . ARG C 1 113 ? 77.143  108.486 64.137  1.00 45.37  ? 91   ARG C CZ  1 
ATOM   5719  N  NH1 . ARG C 1 113 ? 76.568  107.968 65.218  1.00 45.90  ? 91   ARG C NH1 1 
ATOM   5720  N  NH2 . ARG C 1 113 ? 77.674  109.697 64.200  1.00 39.70  ? 91   ARG C NH2 1 
ATOM   5721  N  N   . ILE C 1 114 ? 73.025  104.695 60.390  1.00 32.44  ? 92   ILE C N   1 
ATOM   5722  C  CA  . ILE C 1 114 ? 72.325  103.527 60.911  1.00 30.12  ? 92   ILE C CA  1 
ATOM   5723  C  C   . ILE C 1 114 ? 73.209  103.023 62.067  1.00 30.08  ? 92   ILE C C   1 
ATOM   5724  O  O   . ILE C 1 114 ? 74.400  102.740 61.866  1.00 26.95  ? 92   ILE C O   1 
ATOM   5725  C  CB  . ILE C 1 114 ? 72.210  102.451 59.830  1.00 27.74  ? 92   ILE C CB  1 
ATOM   5726  C  CG1 . ILE C 1 114 ? 71.511  103.042 58.610  1.00 28.60  ? 92   ILE C CG1 1 
ATOM   5727  C  CG2 . ILE C 1 114 ? 71.451  101.248 60.368  1.00 32.25  ? 92   ILE C CG2 1 
ATOM   5728  C  CD1 . ILE C 1 114 ? 70.097  103.534 58.885  1.00 35.91  ? 92   ILE C CD1 1 
ATOM   5729  N  N   . ASN C 1 115 ? 72.644  102.899 63.266  1.00 20.47  ? 93   ASN C N   1 
ATOM   5730  C  CA  . ASN C 1 115 ? 73.468  102.485 64.404  1.00 26.17  ? 93   ASN C CA  1 
ATOM   5731  C  C   . ASN C 1 115 ? 73.327  101.078 64.944  1.00 22.71  ? 93   ASN C C   1 
ATOM   5732  O  O   . ASN C 1 115 ? 74.262  100.558 65.530  1.00 25.53  ? 93   ASN C O   1 
ATOM   5733  C  CB  . ASN C 1 115 ? 73.294  103.481 65.554  1.00 22.31  ? 93   ASN C CB  1 
ATOM   5734  C  CG  . ASN C 1 115 ? 73.661  104.901 65.148  1.00 17.81  ? 93   ASN C CG  1 
ATOM   5735  O  OD1 . ASN C 1 115 ? 74.827  105.204 64.884  1.00 26.27  ? 93   ASN C OD1 1 
ATOM   5736  N  ND2 . ASN C 1 115 ? 72.658  105.775 65.072  1.00 22.77  ? 93   ASN C ND2 1 
ATOM   5737  N  N   . LYS C 1 116 ? 72.183  100.446 64.736  1.00 31.50  ? 94   LYS C N   1 
ATOM   5738  C  CA  . LYS C 1 116 ? 71.990  99.095  65.251  1.00 27.11  ? 94   LYS C CA  1 
ATOM   5739  C  C   . LYS C 1 116 ? 72.034  97.989  64.201  1.00 24.85  ? 94   LYS C C   1 
ATOM   5740  O  O   . LYS C 1 116 ? 72.888  97.093  64.282  1.00 17.70  ? 94   LYS C O   1 
ATOM   5741  C  CB  . LYS C 1 116 ? 70.673  99.020  66.033  1.00 25.83  ? 94   LYS C CB  1 
ATOM   5742  C  CG  . LYS C 1 116 ? 70.628  99.941  67.241  1.00 21.82  ? 94   LYS C CG  1 
ATOM   5743  C  CD  . LYS C 1 116 ? 69.260  99.936  67.871  1.00 32.52  ? 94   LYS C CD  1 
ATOM   5744  C  CE  . LYS C 1 116 ? 69.157  100.993 68.957  1.00 39.48  ? 94   LYS C CE  1 
ATOM   5745  N  NZ  . LYS C 1 116 ? 67.784  100.996 69.552  1.00 44.97  ? 94   LYS C NZ  1 
ATOM   5746  N  N   . ILE C 1 117 ? 71.126  98.049  63.223  1.00 31.48  ? 95   ILE C N   1 
ATOM   5747  C  CA  . ILE C 1 117 ? 71.049  97.031  62.162  1.00 31.63  ? 95   ILE C CA  1 
ATOM   5748  C  C   . ILE C 1 117 ? 72.392  96.613  61.547  1.00 36.98  ? 95   ILE C C   1 
ATOM   5749  O  O   . ILE C 1 117 ? 72.698  95.418  61.474  1.00 38.60  ? 95   ILE C O   1 
ATOM   5750  C  CB  . ILE C 1 117 ? 70.131  97.484  61.030  1.00 29.48  ? 95   ILE C CB  1 
ATOM   5751  C  CG1 . ILE C 1 117 ? 68.701  97.640  61.559  1.00 25.07  ? 95   ILE C CG1 1 
ATOM   5752  C  CG2 . ILE C 1 117 ? 70.204  96.483  59.886  1.00 10.27  ? 95   ILE C CG2 1 
ATOM   5753  C  CD1 . ILE C 1 117 ? 67.740  98.305  60.577  1.00 24.82  ? 95   ILE C CD1 1 
ATOM   5754  N  N   . GLY C 1 118 ? 73.189  97.586  61.113  1.00 35.77  ? 96   GLY C N   1 
ATOM   5755  C  CA  . GLY C 1 118 ? 74.476  97.270  60.525  1.00 31.16  ? 96   GLY C CA  1 
ATOM   5756  C  C   . GLY C 1 118 ? 75.376  96.490  61.459  1.00 32.53  ? 96   GLY C C   1 
ATOM   5757  O  O   . GLY C 1 118 ? 75.950  95.472  61.079  1.00 36.21  ? 96   GLY C O   1 
ATOM   5758  N  N   . LYS C 1 119 ? 75.504  96.969  62.690  1.00 36.49  ? 97   LYS C N   1 
ATOM   5759  C  CA  . LYS C 1 119 ? 76.345  96.316  63.693  1.00 31.87  ? 97   LYS C CA  1 
ATOM   5760  C  C   . LYS C 1 119 ? 75.821  94.915  63.999  1.00 30.15  ? 97   LYS C C   1 
ATOM   5761  O  O   . LYS C 1 119 ? 76.595  93.968  64.141  1.00 26.09  ? 97   LYS C O   1 
ATOM   5762  C  CB  . LYS C 1 119 ? 76.368  97.152  64.982  1.00 39.75  ? 97   LYS C CB  1 
ATOM   5763  C  CG  . LYS C 1 119 ? 76.807  98.624  64.822  1.00 30.34  ? 97   LYS C CG  1 
ATOM   5764  C  CD  . LYS C 1 119 ? 78.249  98.726  64.377  1.00 27.38  ? 97   LYS C CD  1 
ATOM   5765  C  CE  . LYS C 1 119 ? 78.777  100.120 64.552  1.00 18.70  ? 97   LYS C CE  1 
ATOM   5766  N  NZ  . LYS C 1 119 ? 80.197  100.238 64.106  1.00 29.00  ? 97   LYS C NZ  1 
ATOM   5767  N  N   . LYS C 1 120 ? 74.502  94.798  64.106  1.00 27.18  ? 98   LYS C N   1 
ATOM   5768  C  CA  . LYS C 1 120 ? 73.850  93.523  64.385  1.00 29.90  ? 98   LYS C CA  1 
ATOM   5769  C  C   . LYS C 1 120 ? 74.174  92.443  63.342  1.00 32.31  ? 98   LYS C C   1 
ATOM   5770  O  O   . LYS C 1 120 ? 73.990  91.257  63.600  1.00 26.93  ? 98   LYS C O   1 
ATOM   5771  C  CB  . LYS C 1 120 ? 72.337  93.735  64.461  1.00 34.14  ? 98   LYS C CB  1 
ATOM   5772  C  CG  . LYS C 1 120 ? 71.514  92.456  64.541  1.00 40.88  ? 98   LYS C CG  1 
ATOM   5773  C  CD  . LYS C 1 120 ? 70.032  92.773  64.728  1.00 46.54  ? 98   LYS C CD  1 
ATOM   5774  C  CE  . LYS C 1 120 ? 69.172  91.515  64.606  1.00 50.73  ? 98   LYS C CE  1 
ATOM   5775  N  NZ  . LYS C 1 120 ? 67.730  91.765  64.924  1.00 49.93  ? 98   LYS C NZ  1 
ATOM   5776  N  N   . PHE C 1 121 ? 74.655  92.858  62.168  1.00 34.95  ? 99   PHE C N   1 
ATOM   5777  C  CA  . PHE C 1 121 ? 75.000  91.917  61.099  1.00 34.94  ? 99   PHE C CA  1 
ATOM   5778  C  C   . PHE C 1 121 ? 76.493  91.788  60.799  1.00 36.95  ? 99   PHE C C   1 
ATOM   5779  O  O   . PHE C 1 121 ? 76.872  91.257  59.759  1.00 39.69  ? 99   PHE C O   1 
ATOM   5780  C  CB  . PHE C 1 121 ? 74.271  92.268  59.801  1.00 26.90  ? 99   PHE C CB  1 
ATOM   5781  C  CG  . PHE C 1 121 ? 72.817  91.902  59.806  1.00 30.60  ? 99   PHE C CG  1 
ATOM   5782  C  CD1 . PHE C 1 121 ? 71.886  92.712  60.435  1.00 28.66  ? 99   PHE C CD1 1 
ATOM   5783  C  CD2 . PHE C 1 121 ? 72.381  90.738  59.196  1.00 22.06  ? 99   PHE C CD2 1 
ATOM   5784  C  CE1 . PHE C 1 121 ? 70.530  92.362  60.457  1.00 32.95  ? 99   PHE C CE1 1 
ATOM   5785  C  CE2 . PHE C 1 121 ? 71.033  90.378  59.212  1.00 26.93  ? 99   PHE C CE2 1 
ATOM   5786  C  CZ  . PHE C 1 121 ? 70.105  91.187  59.842  1.00 24.25  ? 99   PHE C CZ  1 
ATOM   5787  N  N   . GLY C 1 122 ? 77.338  92.271  61.700  1.00 35.36  ? 100  GLY C N   1 
ATOM   5788  C  CA  . GLY C 1 122 ? 78.766  92.156  61.475  1.00 36.19  ? 100  GLY C CA  1 
ATOM   5789  C  C   . GLY C 1 122 ? 79.402  93.212  60.592  1.00 37.36  ? 100  GLY C C   1 
ATOM   5790  O  O   . GLY C 1 122 ? 80.604  93.148  60.340  1.00 34.21  ? 100  GLY C O   1 
ATOM   5791  N  N   . LEU C 1 123 ? 78.610  94.175  60.125  1.00 37.20  ? 101  LEU C N   1 
ATOM   5792  C  CA  . LEU C 1 123 ? 79.121  95.245  59.278  1.00 37.75  ? 101  LEU C CA  1 
ATOM   5793  C  C   . LEU C 1 123 ? 80.214  96.034  60.012  1.00 38.96  ? 101  LEU C C   1 
ATOM   5794  O  O   . LEU C 1 123 ? 79.988  96.509  61.122  1.00 43.65  ? 101  LEU C O   1 
ATOM   5795  C  CB  . LEU C 1 123 ? 77.971  96.171  58.887  1.00 31.72  ? 101  LEU C CB  1 
ATOM   5796  C  CG  . LEU C 1 123 ? 77.664  96.293  57.392  1.00 34.15  ? 101  LEU C CG  1 
ATOM   5797  C  CD1 . LEU C 1 123 ? 77.774  94.935  56.723  1.00 33.23  ? 101  LEU C CD1 1 
ATOM   5798  C  CD2 . LEU C 1 123 ? 76.277  96.879  57.205  1.00 28.36  ? 101  LEU C CD2 1 
ATOM   5799  N  N   . LYS C 1 124 ? 81.394  96.165  59.401  1.00 36.14  ? 102  LYS C N   1 
ATOM   5800  C  CA  . LYS C 1 124 ? 82.505  96.894  60.015  1.00 33.87  ? 102  LYS C CA  1 
ATOM   5801  C  C   . LYS C 1 124 ? 82.624  98.320  59.476  1.00 34.12  ? 102  LYS C C   1 
ATOM   5802  O  O   . LYS C 1 124 ? 83.386  99.121  60.006  1.00 31.43  ? 102  LYS C O   1 
ATOM   5803  C  CB  . LYS C 1 124 ? 83.834  96.156  59.783  1.00 33.53  ? 102  LYS C CB  1 
ATOM   5804  C  CG  . LYS C 1 124 ? 83.882  94.744  60.349  1.00 43.59  ? 102  LYS C CG  1 
ATOM   5805  C  CD  . LYS C 1 124 ? 85.275  94.100  60.219  1.00 45.16  ? 102  LYS C CD  1 
ATOM   5806  C  CE  . LYS C 1 124 ? 85.542  93.492  58.833  1.00 40.26  ? 102  LYS C CE  1 
ATOM   5807  N  NZ  . LYS C 1 124 ? 85.727  94.495  57.751  1.00 34.14  ? 102  LYS C NZ  1 
ATOM   5808  N  N   . CYS C 1 125 ? 81.872  98.634  58.425  1.00 34.15  ? 103  CYS C N   1 
ATOM   5809  C  CA  . CYS C 1 125 ? 81.902  99.964  57.818  1.00 32.18  ? 103  CYS C CA  1 
ATOM   5810  C  C   . CYS C 1 125 ? 80.846  100.870 58.448  1.00 34.33  ? 103  CYS C C   1 
ATOM   5811  O  O   . CYS C 1 125 ? 80.107  100.444 59.340  1.00 28.33  ? 103  CYS C O   1 
ATOM   5812  C  CB  . CYS C 1 125 ? 81.607  99.850  56.320  1.00 30.93  ? 103  CYS C CB  1 
ATOM   5813  S  SG  . CYS C 1 125 ? 79.929  99.236  55.950  1.00 32.38  ? 103  CYS C SG  1 
ATOM   5814  N  N   . GLU C 1 126 ? 80.787  102.123 57.997  1.00 34.79  ? 104  GLU C N   1 
ATOM   5815  C  CA  . GLU C 1 126 ? 79.759  103.042 58.479  1.00 35.61  ? 104  GLU C CA  1 
ATOM   5816  C  C   . GLU C 1 126 ? 78.623  102.933 57.460  1.00 33.71  ? 104  GLU C C   1 
ATOM   5817  O  O   . GLU C 1 126 ? 78.847  103.027 56.247  1.00 28.17  ? 104  GLU C O   1 
ATOM   5818  C  CB  . GLU C 1 126 ? 80.265  104.491 58.546  1.00 37.19  ? 104  GLU C CB  1 
ATOM   5819  C  CG  . GLU C 1 126 ? 79.134  105.509 58.731  1.00 38.38  ? 104  GLU C CG  1 
ATOM   5820  C  CD  . GLU C 1 126 ? 79.629  106.926 58.992  1.00 49.12  ? 104  GLU C CD  1 
ATOM   5821  O  OE1 . GLU C 1 126 ? 80.672  107.304 58.423  1.00 54.73  ? 104  GLU C OE1 1 
ATOM   5822  O  OE2 . GLU C 1 126 ? 78.971  107.670 59.755  1.00 48.77  ? 104  GLU C OE2 1 
ATOM   5823  N  N   . LEU C 1 127 ? 77.411  102.713 57.956  1.00 30.92  ? 105  LEU C N   1 
ATOM   5824  C  CA  . LEU C 1 127 ? 76.238  102.576 57.105  1.00 29.80  ? 105  LEU C CA  1 
ATOM   5825  C  C   . LEU C 1 127 ? 75.421  103.852 57.181  1.00 36.37  ? 105  LEU C C   1 
ATOM   5826  O  O   . LEU C 1 127 ? 74.898  104.188 58.251  1.00 41.42  ? 105  LEU C O   1 
ATOM   5827  C  CB  . LEU C 1 127 ? 75.376  101.426 57.603  1.00 32.62  ? 105  LEU C CB  1 
ATOM   5828  C  CG  . LEU C 1 127 ? 74.846  100.378 56.622  1.00 39.63  ? 105  LEU C CG  1 
ATOM   5829  C  CD1 . LEU C 1 127 ? 73.538  99.834  57.196  1.00 39.08  ? 105  LEU C CD1 1 
ATOM   5830  C  CD2 . LEU C 1 127 ? 74.625  100.973 55.232  1.00 26.51  ? 105  LEU C CD2 1 
ATOM   5831  N  N   . LEU C 1 128 ? 75.298  104.563 56.061  1.00 31.17  ? 106  LEU C N   1 
ATOM   5832  C  CA  . LEU C 1 128 ? 74.524  105.801 56.053  1.00 28.84  ? 106  LEU C CA  1 
ATOM   5833  C  C   . LEU C 1 128 ? 73.248  105.663 55.230  1.00 28.71  ? 106  LEU C C   1 
ATOM   5834  O  O   . LEU C 1 128 ? 73.205  104.911 54.265  1.00 34.94  ? 106  LEU C O   1 
ATOM   5835  C  CB  . LEU C 1 128 ? 75.376  106.951 55.518  1.00 18.03  ? 106  LEU C CB  1 
ATOM   5836  C  CG  . LEU C 1 128 ? 76.679  107.200 56.267  1.00 19.74  ? 106  LEU C CG  1 
ATOM   5837  C  CD1 . LEU C 1 128 ? 77.446  108.311 55.580  1.00 15.21  ? 106  LEU C CD1 1 
ATOM   5838  C  CD2 . LEU C 1 128 ? 76.392  107.568 57.720  1.00 13.38  ? 106  LEU C CD2 1 
ATOM   5839  N  N   . ALA C 1 129 ? 72.206  106.388 55.624  1.00 26.16  ? 107  ALA C N   1 
ATOM   5840  C  CA  . ALA C 1 129 ? 70.929  106.335 54.922  1.00 26.24  ? 107  ALA C CA  1 
ATOM   5841  C  C   . ALA C 1 129 ? 70.511  107.699 54.364  1.00 27.79  ? 107  ALA C C   1 
ATOM   5842  O  O   . ALA C 1 129 ? 70.459  108.697 55.103  1.00 30.09  ? 107  ALA C O   1 
ATOM   5843  C  CB  . ALA C 1 129 ? 69.839  105.795 55.860  1.00 18.63  ? 107  ALA C CB  1 
ATOM   5844  N  N   . LYS C 1 130 ? 70.235  107.726 53.056  1.00 23.05  ? 108  LYS C N   1 
ATOM   5845  C  CA  . LYS C 1 130 ? 69.781  108.924 52.355  1.00 21.41  ? 108  LYS C CA  1 
ATOM   5846  C  C   . LYS C 1 130 ? 68.283  108.844 52.546  1.00 22.75  ? 108  LYS C C   1 
ATOM   5847  O  O   . LYS C 1 130 ? 67.618  108.097 51.847  1.00 20.83  ? 108  LYS C O   1 
ATOM   5848  C  CB  . LYS C 1 130 ? 70.074  108.822 50.857  1.00 21.47  ? 108  LYS C CB  1 
ATOM   5849  C  CG  . LYS C 1 130 ? 70.867  109.992 50.260  1.00 29.41  ? 108  LYS C CG  1 
ATOM   5850  C  CD  . LYS C 1 130 ? 70.152  111.349 50.311  1.00 14.56  ? 108  LYS C CD  1 
ATOM   5851  C  CE  . LYS C 1 130 ? 71.191  112.454 50.261  1.00 19.98  ? 108  LYS C CE  1 
ATOM   5852  N  NZ  . LYS C 1 130 ? 70.645  113.819 50.364  1.00 18.43  ? 108  LYS C NZ  1 
ATOM   5853  N  N   . CYS C 1 131 ? 67.745  109.596 53.487  1.00 22.37  ? 109  CYS C N   1 
ATOM   5854  C  CA  . CYS C 1 131 ? 66.319  109.519 53.727  1.00 30.27  ? 109  CYS C CA  1 
ATOM   5855  C  C   . CYS C 1 131 ? 65.503  110.401 52.792  1.00 34.38  ? 109  CYS C C   1 
ATOM   5856  O  O   . CYS C 1 131 ? 65.248  111.576 53.069  1.00 37.55  ? 109  CYS C O   1 
ATOM   5857  C  CB  . CYS C 1 131 ? 66.038  109.855 55.186  1.00 19.79  ? 109  CYS C CB  1 
ATOM   5858  S  SG  . CYS C 1 131 ? 67.097  108.886 56.204  1.00 28.55  ? 109  CYS C SG  1 
ATOM   5859  N  N   . GLU C 1 132 ? 65.084  109.819 51.677  1.00 33.77  ? 110  GLU C N   1 
ATOM   5860  C  CA  . GLU C 1 132 ? 64.300  110.566 50.707  1.00 32.72  ? 110  GLU C CA  1 
ATOM   5861  C  C   . GLU C 1 132 ? 62.827  110.700 51.115  1.00 36.83  ? 110  GLU C C   1 
ATOM   5862  O  O   . GLU C 1 132 ? 62.050  111.410 50.453  1.00 31.95  ? 110  GLU C O   1 
ATOM   5863  C  CB  . GLU C 1 132 ? 64.405  109.908 49.335  1.00 26.82  ? 110  GLU C CB  1 
ATOM   5864  C  CG  . GLU C 1 132 ? 64.693  110.892 48.217  1.00 27.43  ? 110  GLU C CG  1 
ATOM   5865  C  CD  . GLU C 1 132 ? 66.073  111.458 48.311  1.00 23.53  ? 110  GLU C CD  1 
ATOM   5866  O  OE1 . GLU C 1 132 ? 66.966  110.725 48.772  1.00 23.36  ? 110  GLU C OE1 1 
ATOM   5867  O  OE2 . GLU C 1 132 ? 66.276  112.620 47.918  1.00 22.03  ? 110  GLU C OE2 1 
ATOM   5868  N  N   . PHE C 1 133 ? 62.438  110.027 52.200  1.00 34.47  ? 111  PHE C N   1 
ATOM   5869  C  CA  . PHE C 1 133 ? 61.059  110.122 52.663  1.00 28.44  ? 111  PHE C CA  1 
ATOM   5870  C  C   . PHE C 1 133 ? 60.768  111.469 53.332  1.00 27.86  ? 111  PHE C C   1 
ATOM   5871  O  O   . PHE C 1 133 ? 59.656  111.712 53.819  1.00 22.37  ? 111  PHE C O   1 
ATOM   5872  C  CB  . PHE C 1 133 ? 60.696  108.944 53.585  1.00 27.05  ? 111  PHE C CB  1 
ATOM   5873  C  CG  . PHE C 1 133 ? 61.655  108.716 54.724  1.00 27.89  ? 111  PHE C CG  1 
ATOM   5874  C  CD1 . PHE C 1 133 ? 61.448  109.309 55.965  1.00 24.73  ? 111  PHE C CD1 1 
ATOM   5875  C  CD2 . PHE C 1 133 ? 62.750  107.875 54.564  1.00 24.73  ? 111  PHE C CD2 1 
ATOM   5876  C  CE1 . PHE C 1 133 ? 62.316  109.064 57.032  1.00 26.06  ? 111  PHE C CE1 1 
ATOM   5877  C  CE2 . PHE C 1 133 ? 63.617  107.631 55.623  1.00 16.97  ? 111  PHE C CE2 1 
ATOM   5878  C  CZ  . PHE C 1 133 ? 63.399  108.226 56.857  1.00 18.92  ? 111  PHE C CZ  1 
ATOM   5879  N  N   . PHE C 1 134 ? 61.766  112.353 53.329  1.00 28.45  ? 112  PHE C N   1 
ATOM   5880  C  CA  . PHE C 1 134 ? 61.594  113.688 53.893  1.00 31.23  ? 112  PHE C CA  1 
ATOM   5881  C  C   . PHE C 1 134 ? 61.213  114.729 52.838  1.00 31.96  ? 112  PHE C C   1 
ATOM   5882  O  O   . PHE C 1 134 ? 60.981  115.891 53.180  1.00 38.71  ? 112  PHE C O   1 
ATOM   5883  C  CB  . PHE C 1 134 ? 62.853  114.152 54.638  1.00 27.57  ? 112  PHE C CB  1 
ATOM   5884  C  CG  . PHE C 1 134 ? 63.002  113.556 56.023  1.00 29.38  ? 112  PHE C CG  1 
ATOM   5885  C  CD1 . PHE C 1 134 ? 63.804  112.438 56.237  1.00 27.16  ? 112  PHE C CD1 1 
ATOM   5886  C  CD2 . PHE C 1 134 ? 62.332  114.111 57.111  1.00 33.63  ? 112  PHE C CD2 1 
ATOM   5887  C  CE1 . PHE C 1 134 ? 63.940  111.887 57.501  1.00 25.35  ? 112  PHE C CE1 1 
ATOM   5888  C  CE2 . PHE C 1 134 ? 62.462  113.563 58.381  1.00 30.05  ? 112  PHE C CE2 1 
ATOM   5889  C  CZ  . PHE C 1 134 ? 63.270  112.448 58.574  1.00 31.30  ? 112  PHE C CZ  1 
ATOM   5890  N  N   . ASN C 1 135 ? 61.156  114.333 51.564  1.00 27.53  ? 113  ASN C N   1 
ATOM   5891  C  CA  . ASN C 1 135 ? 60.762  115.280 50.520  1.00 21.85  ? 113  ASN C CA  1 
ATOM   5892  C  C   . ASN C 1 135 ? 59.303  115.655 50.789  1.00 19.53  ? 113  ASN C C   1 
ATOM   5893  O  O   . ASN C 1 135 ? 58.549  114.858 51.351  1.00 15.62  ? 113  ASN C O   1 
ATOM   5894  C  CB  . ASN C 1 135 ? 60.914  114.671 49.106  1.00 27.32  ? 113  ASN C CB  1 
ATOM   5895  C  CG  . ASN C 1 135 ? 62.381  114.604 48.634  1.00 25.89  ? 113  ASN C CG  1 
ATOM   5896  O  OD1 . ASN C 1 135 ? 63.121  115.567 48.760  1.00 26.04  ? 113  ASN C OD1 1 
ATOM   5897  N  ND2 . ASN C 1 135 ? 62.786  113.467 48.078  1.00 27.41  ? 113  ASN C ND2 1 
ATOM   5898  N  N   . ALA C 1 136 ? 58.916  116.866 50.391  1.00 16.90  ? 114  ALA C N   1 
ATOM   5899  C  CA  . ALA C 1 136 ? 57.561  117.371 50.614  1.00 19.49  ? 114  ALA C CA  1 
ATOM   5900  C  C   . ALA C 1 136 ? 56.427  116.357 50.488  1.00 24.04  ? 114  ALA C C   1 
ATOM   5901  O  O   . ALA C 1 136 ? 55.506  116.362 51.304  1.00 23.27  ? 114  ALA C O   1 
ATOM   5902  C  CB  . ALA C 1 136 ? 57.295  118.548 49.699  1.00 11.96  ? 114  ALA C CB  1 
ATOM   5903  N  N   . GLY C 1 137 ? 56.487  115.504 49.464  1.00 28.99  ? 115  GLY C N   1 
ATOM   5904  C  CA  . GLY C 1 137 ? 55.446  114.510 49.246  1.00 26.56  ? 115  GLY C CA  1 
ATOM   5905  C  C   . GLY C 1 137 ? 55.724  113.150 49.862  1.00 29.57  ? 115  GLY C C   1 
ATOM   5906  O  O   . GLY C 1 137 ? 54.899  112.245 49.773  1.00 25.56  ? 115  GLY C O   1 
ATOM   5907  N  N   . GLY C 1 138 ? 56.904  112.989 50.456  1.00 34.03  ? 116  GLY C N   1 
ATOM   5908  C  CA  . GLY C 1 138 ? 57.239  111.738 51.108  1.00 25.10  ? 116  GLY C CA  1 
ATOM   5909  C  C   . GLY C 1 138 ? 57.992  110.697 50.321  1.00 29.44  ? 116  GLY C C   1 
ATOM   5910  O  O   . GLY C 1 138 ? 58.139  109.569 50.799  1.00 29.97  ? 116  GLY C O   1 
ATOM   5911  N  N   . SER C 1 139 ? 58.475  111.041 49.132  1.00 30.36  ? 117  SER C N   1 
ATOM   5912  C  CA  . SER C 1 139 ? 59.210  110.067 48.327  1.00 27.81  ? 117  SER C CA  1 
ATOM   5913  C  C   . SER C 1 139 ? 60.319  110.681 47.487  1.00 30.51  ? 117  SER C C   1 
ATOM   5914  O  O   . SER C 1 139 ? 60.365  111.896 47.283  1.00 33.75  ? 117  SER C O   1 
ATOM   5915  C  CB  . SER C 1 139 ? 58.254  109.305 47.399  1.00 36.31  ? 117  SER C CB  1 
ATOM   5916  O  OG  . SER C 1 139 ? 57.806  110.116 46.320  1.00 48.23  ? 117  SER C OG  1 
ATOM   5917  N  N   . VAL C 1 140 ? 61.212  109.824 47.002  1.00 24.30  ? 118  VAL C N   1 
ATOM   5918  C  CA  . VAL C 1 140 ? 62.316  110.256 46.157  1.00 22.36  ? 118  VAL C CA  1 
ATOM   5919  C  C   . VAL C 1 140 ? 61.778  110.756 44.800  1.00 25.46  ? 118  VAL C C   1 
ATOM   5920  O  O   . VAL C 1 140 ? 62.475  111.463 44.054  1.00 21.56  ? 118  VAL C O   1 
ATOM   5921  C  CB  . VAL C 1 140 ? 63.311  109.092 45.916  1.00 23.15  ? 118  VAL C CB  1 
ATOM   5922  C  CG1 . VAL C 1 140 ? 62.583  107.896 45.317  1.00 25.79  ? 118  VAL C CG1 1 
ATOM   5923  C  CG2 . VAL C 1 140 ? 64.442  109.546 45.016  1.00 4.51   ? 118  VAL C CG2 1 
ATOM   5924  N  N   . LYS C 1 141 ? 60.528  110.403 44.502  1.00 14.76  ? 119  LYS C N   1 
ATOM   5925  C  CA  . LYS C 1 141 ? 59.913  110.796 43.244  1.00 23.73  ? 119  LYS C CA  1 
ATOM   5926  C  C   . LYS C 1 141 ? 59.603  112.291 43.139  1.00 26.55  ? 119  LYS C C   1 
ATOM   5927  O  O   . LYS C 1 141 ? 59.425  112.828 42.038  1.00 24.88  ? 119  LYS C O   1 
ATOM   5928  C  CB  . LYS C 1 141 ? 58.633  109.994 43.014  1.00 26.72  ? 119  LYS C CB  1 
ATOM   5929  C  CG  . LYS C 1 141 ? 58.857  108.530 42.742  1.00 19.84  ? 119  LYS C CG  1 
ATOM   5930  C  CD  . LYS C 1 141 ? 59.589  108.337 41.442  1.00 16.95  ? 119  LYS C CD  1 
ATOM   5931  C  CE  . LYS C 1 141 ? 59.680  106.864 41.067  1.00 13.77  ? 119  LYS C CE  1 
ATOM   5932  N  NZ  . LYS C 1 141 ? 60.552  106.151 42.013  1.00 17.04  ? 119  LYS C NZ  1 
ATOM   5933  N  N   . ASP C 1 142 ? 59.540  112.963 44.282  1.00 26.69  ? 120  ASP C N   1 
ATOM   5934  C  CA  . ASP C 1 142 ? 59.241  114.381 44.284  1.00 20.39  ? 120  ASP C CA  1 
ATOM   5935  C  C   . ASP C 1 142 ? 60.319  115.115 43.521  1.00 22.12  ? 120  ASP C C   1 
ATOM   5936  O  O   . ASP C 1 142 ? 60.057  116.176 42.932  1.00 23.38  ? 120  ASP C O   1 
ATOM   5937  C  CB  . ASP C 1 142 ? 59.139  114.901 45.714  1.00 27.89  ? 120  ASP C CB  1 
ATOM   5938  C  CG  . ASP C 1 142 ? 58.103  114.154 46.533  1.00 25.11  ? 120  ASP C CG  1 
ATOM   5939  O  OD1 . ASP C 1 142 ? 57.271  113.438 45.944  1.00 29.87  ? 120  ASP C OD1 1 
ATOM   5940  O  OD2 . ASP C 1 142 ? 58.115  114.289 47.769  1.00 30.82  ? 120  ASP C OD2 1 
ATOM   5941  N  N   . ARG C 1 143 ? 61.523  114.539 43.514  1.00 20.11  ? 121  ARG C N   1 
ATOM   5942  C  CA  . ARG C 1 143 ? 62.648  115.147 42.796  1.00 24.75  ? 121  ARG C CA  1 
ATOM   5943  C  C   . ARG C 1 143 ? 62.390  115.088 41.292  1.00 22.37  ? 121  ARG C C   1 
ATOM   5944  O  O   . ARG C 1 143 ? 62.322  116.123 40.622  1.00 28.49  ? 121  ARG C O   1 
ATOM   5945  C  CB  . ARG C 1 143 ? 63.975  114.435 43.096  1.00 14.22  ? 121  ARG C CB  1 
ATOM   5946  C  CG  . ARG C 1 143 ? 64.656  114.771 44.399  1.00 15.35  ? 121  ARG C CG  1 
ATOM   5947  C  CD  . ARG C 1 143 ? 65.953  113.940 44.516  1.00 28.77  ? 121  ARG C CD  1 
ATOM   5948  N  NE  . ARG C 1 143 ? 66.570  113.946 45.852  1.00 19.52  ? 121  ARG C NE  1 
ATOM   5949  C  CZ  . ARG C 1 143 ? 67.536  114.771 46.243  1.00 18.53  ? 121  ARG C CZ  1 
ATOM   5950  N  NH1 . ARG C 1 143 ? 68.013  115.672 45.414  1.00 10.58  ? 121  ARG C NH1 1 
ATOM   5951  N  NH2 . ARG C 1 143 ? 68.045  114.685 47.467  1.00 21.78  ? 121  ARG C NH2 1 
ATOM   5952  N  N   . ILE C 1 144 ? 62.224  113.886 40.761  1.00 20.70  ? 122  ILE C N   1 
ATOM   5953  C  CA  . ILE C 1 144 ? 62.005  113.759 39.317  1.00 22.41  ? 122  ILE C CA  1 
ATOM   5954  C  C   . ILE C 1 144 ? 60.724  114.428 38.823  1.00 18.12  ? 122  ILE C C   1 
ATOM   5955  O  O   . ILE C 1 144 ? 60.651  114.872 37.688  1.00 21.76  ? 122  ILE C O   1 
ATOM   5956  C  CB  . ILE C 1 144 ? 62.037  112.246 38.832  1.00 22.26  ? 122  ILE C CB  1 
ATOM   5957  C  CG1 . ILE C 1 144 ? 60.799  111.478 39.308  1.00 22.75  ? 122  ILE C CG1 1 
ATOM   5958  C  CG2 . ILE C 1 144 ? 63.293  111.556 39.352  1.00 19.17  ? 122  ILE C CG2 1 
ATOM   5959  C  CD1 . ILE C 1 144 ? 60.634  110.113 38.641  1.00 25.04  ? 122  ILE C CD1 1 
ATOM   5960  N  N   . SER C 1 145 ? 59.710  114.508 39.671  1.00 24.03  ? 123  SER C N   1 
ATOM   5961  C  CA  . SER C 1 145 ? 58.475  115.143 39.260  1.00 30.96  ? 123  SER C CA  1 
ATOM   5962  C  C   . SER C 1 145 ? 58.753  116.624 39.058  1.00 34.31  ? 123  SER C C   1 
ATOM   5963  O  O   . SER C 1 145 ? 58.430  117.188 38.014  1.00 39.27  ? 123  SER C O   1 
ATOM   5964  C  CB  . SER C 1 145 ? 57.405  114.975 40.333  1.00 34.77  ? 123  SER C CB  1 
ATOM   5965  O  OG  . SER C 1 145 ? 57.162  113.607 40.569  1.00 47.20  ? 123  SER C OG  1 
ATOM   5966  N  N   . LEU C 1 146 ? 59.354  117.248 40.068  1.00 29.22  ? 124  LEU C N   1 
ATOM   5967  C  CA  . LEU C 1 146 ? 59.663  118.666 40.001  1.00 23.95  ? 124  LEU C CA  1 
ATOM   5968  C  C   . LEU C 1 146 ? 60.579  118.952 38.815  1.00 23.55  ? 124  LEU C C   1 
ATOM   5969  O  O   . LEU C 1 146 ? 60.364  119.906 38.047  1.00 16.17  ? 124  LEU C O   1 
ATOM   5970  C  CB  . LEU C 1 146 ? 60.327  119.124 41.309  1.00 24.23  ? 124  LEU C CB  1 
ATOM   5971  C  CG  . LEU C 1 146 ? 60.828  120.570 41.349  1.00 13.64  ? 124  LEU C CG  1 
ATOM   5972  C  CD1 . LEU C 1 146 ? 59.672  121.530 41.079  1.00 30.36  ? 124  LEU C CD1 1 
ATOM   5973  C  CD2 . LEU C 1 146 ? 61.481  120.864 42.663  1.00 11.09  ? 124  LEU C CD2 1 
ATOM   5974  N  N   . ARG C 1 147 ? 61.593  118.106 38.660  1.00 23.64  ? 125  ARG C N   1 
ATOM   5975  C  CA  . ARG C 1 147 ? 62.563  118.264 37.578  1.00 29.22  ? 125  ARG C CA  1 
ATOM   5976  C  C   . ARG C 1 147 ? 61.980  118.066 36.173  1.00 31.65  ? 125  ARG C C   1 
ATOM   5977  O  O   . ARG C 1 147 ? 62.398  118.745 35.227  1.00 33.73  ? 125  ARG C O   1 
ATOM   5978  C  CB  . ARG C 1 147 ? 63.746  117.304 37.774  1.00 21.22  ? 125  ARG C CB  1 
ATOM   5979  C  CG  . ARG C 1 147 ? 64.888  117.477 36.761  1.00 24.89  ? 125  ARG C CG  1 
ATOM   5980  C  CD  . ARG C 1 147 ? 65.472  118.878 36.815  1.00 23.35  ? 125  ARG C CD  1 
ATOM   5981  N  NE  . ARG C 1 147 ? 66.516  119.079 35.815  1.00 30.45  ? 125  ARG C NE  1 
ATOM   5982  C  CZ  . ARG C 1 147 ? 67.800  118.780 35.994  1.00 33.17  ? 125  ARG C CZ  1 
ATOM   5983  N  NH1 . ARG C 1 147 ? 68.209  118.263 37.147  1.00 35.59  ? 125  ARG C NH1 1 
ATOM   5984  N  NH2 . ARG C 1 147 ? 68.680  119.009 35.024  1.00 30.39  ? 125  ARG C NH2 1 
ATOM   5985  N  N   . MET C 1 148 ? 61.044  117.130 36.023  1.00 30.86  ? 126  MET C N   1 
ATOM   5986  C  CA  . MET C 1 148 ? 60.442  116.903 34.707  1.00 30.31  ? 126  MET C CA  1 
ATOM   5987  C  C   . MET C 1 148 ? 59.533  118.073 34.390  1.00 28.10  ? 126  MET C C   1 
ATOM   5988  O  O   . MET C 1 148 ? 59.411  118.479 33.246  1.00 31.70  ? 126  MET C O   1 
ATOM   5989  C  CB  . MET C 1 148 ? 59.623  115.611 34.670  1.00 32.75  ? 126  MET C CB  1 
ATOM   5990  C  CG  . MET C 1 148 ? 60.420  114.340 34.395  1.00 30.33  ? 126  MET C CG  1 
ATOM   5991  S  SD  . MET C 1 148 ? 59.318  112.919 34.157  1.00 28.44  ? 126  MET C SD  1 
ATOM   5992  C  CE  . MET C 1 148 ? 58.828  112.635 35.825  1.00 11.42  ? 126  MET C CE  1 
ATOM   5993  N  N   . ILE C 1 149 ? 58.892  118.614 35.413  1.00 30.02  ? 127  ILE C N   1 
ATOM   5994  C  CA  . ILE C 1 149 ? 58.019  119.748 35.214  1.00 25.68  ? 127  ILE C CA  1 
ATOM   5995  C  C   . ILE C 1 149 ? 58.883  120.962 34.897  1.00 27.90  ? 127  ILE C C   1 
ATOM   5996  O  O   . ILE C 1 149 ? 58.617  121.671 33.930  1.00 35.49  ? 127  ILE C O   1 
ATOM   5997  C  CB  . ILE C 1 149 ? 57.148  120.033 36.475  1.00 17.57  ? 127  ILE C CB  1 
ATOM   5998  C  CG1 . ILE C 1 149 ? 56.020  119.006 36.577  1.00 17.03  ? 127  ILE C CG1 1 
ATOM   5999  C  CG2 . ILE C 1 149 ? 56.557  121.427 36.395  1.00 9.07   ? 127  ILE C CG2 1 
ATOM   6000  C  CD1 . ILE C 1 149 ? 55.063  119.268 37.717  1.00 21.15  ? 127  ILE C CD1 1 
ATOM   6001  N  N   . GLU C 1 150 ? 59.919  121.191 35.699  1.00 25.20  ? 128  GLU C N   1 
ATOM   6002  C  CA  . GLU C 1 150 ? 60.802  122.328 35.482  1.00 23.08  ? 128  GLU C CA  1 
ATOM   6003  C  C   . GLU C 1 150 ? 61.494  122.328 34.121  1.00 28.39  ? 128  GLU C C   1 
ATOM   6004  O  O   . GLU C 1 150 ? 61.591  123.363 33.475  1.00 35.23  ? 128  GLU C O   1 
ATOM   6005  C  CB  . GLU C 1 150 ? 61.850  122.405 36.595  1.00 21.44  ? 128  GLU C CB  1 
ATOM   6006  C  CG  . GLU C 1 150 ? 61.387  123.183 37.834  1.00 27.29  ? 128  GLU C CG  1 
ATOM   6007  C  CD  . GLU C 1 150 ? 62.384  123.138 38.999  1.00 29.86  ? 128  GLU C CD  1 
ATOM   6008  O  OE1 . GLU C 1 150 ? 62.239  123.959 39.926  1.00 30.38  ? 128  GLU C OE1 1 
ATOM   6009  O  OE2 . GLU C 1 150 ? 63.303  122.283 39.002  1.00 32.93  ? 128  GLU C OE2 1 
ATOM   6010  N  N   . ASP C 1 151 ? 61.984  121.176 33.682  1.00 35.92  ? 129  ASP C N   1 
ATOM   6011  C  CA  . ASP C 1 151 ? 62.657  121.096 32.390  1.00 30.44  ? 129  ASP C CA  1 
ATOM   6012  C  C   . ASP C 1 151 ? 61.698  121.378 31.238  1.00 29.39  ? 129  ASP C C   1 
ATOM   6013  O  O   . ASP C 1 151 ? 62.083  121.983 30.238  1.00 23.52  ? 129  ASP C O   1 
ATOM   6014  C  CB  . ASP C 1 151 ? 63.303  119.723 32.220  1.00 32.84  ? 129  ASP C CB  1 
ATOM   6015  C  CG  . ASP C 1 151 ? 64.612  119.618 32.951  1.00 29.56  ? 129  ASP C CG  1 
ATOM   6016  O  OD1 . ASP C 1 151 ? 65.160  118.505 33.080  1.00 35.71  ? 129  ASP C OD1 1 
ATOM   6017  O  OD2 . ASP C 1 151 ? 65.102  120.665 33.392  1.00 35.36  ? 129  ASP C OD2 1 
ATOM   6018  N  N   . ALA C 1 152 ? 60.449  120.945 31.389  1.00 28.99  ? 130  ALA C N   1 
ATOM   6019  C  CA  . ALA C 1 152 ? 59.431  121.151 30.367  1.00 31.04  ? 130  ALA C CA  1 
ATOM   6020  C  C   . ALA C 1 152 ? 58.991  122.614 30.317  1.00 31.81  ? 130  ALA C C   1 
ATOM   6021  O  O   . ALA C 1 152 ? 58.541  123.097 29.276  1.00 33.46  ? 130  ALA C O   1 
ATOM   6022  C  CB  . ALA C 1 152 ? 58.223  120.243 30.632  1.00 36.79  ? 130  ALA C CB  1 
ATOM   6023  N  N   . GLU C 1 153 ? 59.108  123.311 31.443  1.00 28.78  ? 131  GLU C N   1 
ATOM   6024  C  CA  . GLU C 1 153 ? 58.746  124.722 31.513  1.00 28.74  ? 131  GLU C CA  1 
ATOM   6025  C  C   . GLU C 1 153 ? 59.846  125.529 30.854  1.00 31.97  ? 131  GLU C C   1 
ATOM   6026  O  O   . GLU C 1 153 ? 59.588  126.409 30.029  1.00 39.40  ? 131  GLU C O   1 
ATOM   6027  C  CB  . GLU C 1 153 ? 58.606  125.165 32.960  1.00 27.93  ? 131  GLU C CB  1 
ATOM   6028  C  CG  . GLU C 1 153 ? 57.397  124.586 33.664  1.00 39.88  ? 131  GLU C CG  1 
ATOM   6029  C  CD  . GLU C 1 153 ? 57.414  124.848 35.165  1.00 40.97  ? 131  GLU C CD  1 
ATOM   6030  O  OE1 . GLU C 1 153 ? 56.369  124.637 35.823  1.00 39.76  ? 131  GLU C OE1 1 
ATOM   6031  O  OE2 . GLU C 1 153 ? 58.473  125.256 35.685  1.00 43.12  ? 131  GLU C OE2 1 
ATOM   6032  N  N   . ARG C 1 154 ? 61.080  125.230 31.242  1.00 27.62  ? 132  ARG C N   1 
ATOM   6033  C  CA  . ARG C 1 154 ? 62.249  125.891 30.690  1.00 26.91  ? 132  ARG C CA  1 
ATOM   6034  C  C   . ARG C 1 154 ? 62.224  125.648 29.177  1.00 26.05  ? 132  ARG C C   1 
ATOM   6035  O  O   . ARG C 1 154 ? 62.576  126.524 28.376  1.00 17.25  ? 132  ARG C O   1 
ATOM   6036  C  CB  . ARG C 1 154 ? 63.509  125.274 31.297  1.00 31.76  ? 132  ARG C CB  1 
ATOM   6037  C  CG  . ARG C 1 154 ? 64.758  126.130 31.188  1.00 33.33  ? 132  ARG C CG  1 
ATOM   6038  C  CD  . ARG C 1 154 ? 66.003  125.329 31.531  1.00 43.41  ? 132  ARG C CD  1 
ATOM   6039  N  NE  . ARG C 1 154 ? 66.223  124.218 30.601  1.00 54.38  ? 132  ARG C NE  1 
ATOM   6040  C  CZ  . ARG C 1 154 ? 65.685  123.004 30.721  1.00 58.41  ? 132  ARG C CZ  1 
ATOM   6041  N  NH1 . ARG C 1 154 ? 64.890  122.720 31.747  1.00 59.73  ? 132  ARG C NH1 1 
ATOM   6042  N  NH2 . ARG C 1 154 ? 65.925  122.078 29.800  1.00 46.51  ? 132  ARG C NH2 1 
ATOM   6043  N  N   . ASP C 1 155 ? 61.776  124.443 28.824  1.00 22.12  ? 133  ASP C N   1 
ATOM   6044  C  CA  . ASP C 1 155 ? 61.652  123.962 27.453  1.00 24.52  ? 133  ASP C CA  1 
ATOM   6045  C  C   . ASP C 1 155 ? 60.703  124.718 26.524  1.00 27.25  ? 133  ASP C C   1 
ATOM   6046  O  O   . ASP C 1 155 ? 60.902  124.709 25.317  1.00 30.75  ? 133  ASP C O   1 
ATOM   6047  C  CB  . ASP C 1 155 ? 61.222  122.505 27.476  1.00 27.24  ? 133  ASP C CB  1 
ATOM   6048  C  CG  . ASP C 1 155 ? 62.108  121.643 26.641  1.00 41.44  ? 133  ASP C CG  1 
ATOM   6049  O  OD1 . ASP C 1 155 ? 61.970  120.408 26.723  1.00 48.36  ? 133  ASP C OD1 1 
ATOM   6050  O  OD2 . ASP C 1 155 ? 62.949  122.201 25.903  1.00 51.28  ? 133  ASP C OD2 1 
ATOM   6051  N  N   . GLY C 1 156 ? 59.679  125.358 27.080  1.00 27.95  ? 134  GLY C N   1 
ATOM   6052  C  CA  . GLY C 1 156 ? 58.717  126.085 26.280  1.00 22.61  ? 134  GLY C CA  1 
ATOM   6053  C  C   . GLY C 1 156 ? 57.542  125.158 26.049  1.00 33.16  ? 134  GLY C C   1 
ATOM   6054  O  O   . GLY C 1 156 ? 56.470  125.575 25.605  1.00 35.59  ? 134  GLY C O   1 
ATOM   6055  N  N   . THR C 1 157 ? 57.761  123.886 26.374  1.00 34.51  ? 135  THR C N   1 
ATOM   6056  C  CA  . THR C 1 157 ? 56.767  122.821 26.220  1.00 35.08  ? 135  THR C CA  1 
ATOM   6057  C  C   . THR C 1 157 ? 55.551  122.956 27.113  1.00 31.31  ? 135  THR C C   1 
ATOM   6058  O  O   . THR C 1 157 ? 54.428  122.964 26.629  1.00 28.21  ? 135  THR C O   1 
ATOM   6059  C  CB  . THR C 1 157 ? 57.387  121.457 26.537  1.00 38.17  ? 135  THR C CB  1 
ATOM   6060  O  OG1 . THR C 1 157 ? 58.446  121.192 25.615  1.00 46.70  ? 135  THR C OG1 1 
ATOM   6061  C  CG2 . THR C 1 157 ? 56.343  120.361 26.465  1.00 41.11  ? 135  THR C CG2 1 
ATOM   6062  N  N   . LEU C 1 158 ? 55.800  123.041 28.421  1.00 31.38  ? 136  LEU C N   1 
ATOM   6063  C  CA  . LEU C 1 158 ? 54.755  123.134 29.430  1.00 23.07  ? 136  LEU C CA  1 
ATOM   6064  C  C   . LEU C 1 158 ? 54.330  124.561 29.777  1.00 21.24  ? 136  LEU C C   1 
ATOM   6065  O  O   . LEU C 1 158 ? 55.051  125.295 30.451  1.00 16.58  ? 136  LEU C O   1 
ATOM   6066  C  CB  . LEU C 1 158 ? 55.228  122.406 30.674  1.00 18.83  ? 136  LEU C CB  1 
ATOM   6067  C  CG  . LEU C 1 158 ? 54.240  122.192 31.814  1.00 33.09  ? 136  LEU C CG  1 
ATOM   6068  C  CD1 . LEU C 1 158 ? 53.052  121.334 31.335  1.00 29.34  ? 136  LEU C CD1 1 
ATOM   6069  C  CD2 . LEU C 1 158 ? 54.990  121.508 32.972  1.00 40.13  ? 136  LEU C CD2 1 
ATOM   6070  N  N   . LYS C 1 159 ? 53.123  124.916 29.338  1.00 24.74  ? 137  LYS C N   1 
ATOM   6071  C  CA  . LYS C 1 159 ? 52.545  126.245 29.535  1.00 20.70  ? 137  LYS C CA  1 
ATOM   6072  C  C   . LYS C 1 159 ? 51.704  126.413 30.798  1.00 17.74  ? 137  LYS C C   1 
ATOM   6073  O  O   . LYS C 1 159 ? 51.142  125.459 31.328  1.00 12.61  ? 137  LYS C O   1 
ATOM   6074  C  CB  . LYS C 1 159 ? 51.684  126.594 28.318  1.00 26.75  ? 137  LYS C CB  1 
ATOM   6075  C  CG  . LYS C 1 159 ? 52.371  126.325 26.966  1.00 31.86  ? 137  LYS C CG  1 
ATOM   6076  C  CD  . LYS C 1 159 ? 51.431  126.577 25.779  1.00 29.91  ? 137  LYS C CD  1 
ATOM   6077  C  CE  . LYS C 1 159 ? 50.248  125.591 25.745  1.00 30.71  ? 137  LYS C CE  1 
ATOM   6078  N  NZ  . LYS C 1 159 ? 50.692  124.172 25.555  1.00 29.81  ? 137  LYS C NZ  1 
ATOM   6079  N  N   . PRO C 1 160 ? 51.621  127.645 31.308  1.00 14.32  ? 138  PRO C N   1 
ATOM   6080  C  CA  . PRO C 1 160 ? 50.814  127.830 32.506  1.00 16.24  ? 138  PRO C CA  1 
ATOM   6081  C  C   . PRO C 1 160 ? 49.425  127.270 32.242  1.00 23.84  ? 138  PRO C C   1 
ATOM   6082  O  O   . PRO C 1 160 ? 48.881  127.439 31.144  1.00 26.91  ? 138  PRO C O   1 
ATOM   6083  C  CB  . PRO C 1 160 ? 50.813  129.348 32.678  1.00 10.85  ? 138  PRO C CB  1 
ATOM   6084  C  CG  . PRO C 1 160 ? 52.189  129.712 32.236  1.00 2.61   ? 138  PRO C CG  1 
ATOM   6085  C  CD  . PRO C 1 160 ? 52.364  128.874 30.977  1.00 12.28  ? 138  PRO C CD  1 
ATOM   6086  N  N   . GLY C 1 161 ? 48.866  126.582 33.230  1.00 27.51  ? 139  GLY C N   1 
ATOM   6087  C  CA  . GLY C 1 161 ? 47.534  126.018 33.077  1.00 33.65  ? 139  GLY C CA  1 
ATOM   6088  C  C   . GLY C 1 161 ? 47.416  124.740 32.262  1.00 36.98  ? 139  GLY C C   1 
ATOM   6089  O  O   . GLY C 1 161 ? 46.308  124.215 32.083  1.00 34.36  ? 139  GLY C O   1 
ATOM   6090  N  N   . ASP C 1 162 ? 48.543  124.231 31.768  1.00 34.98  ? 140  ASP C N   1 
ATOM   6091  C  CA  . ASP C 1 162 ? 48.519  123.010 30.974  1.00 31.47  ? 140  ASP C CA  1 
ATOM   6092  C  C   . ASP C 1 162 ? 48.161  121.793 31.817  1.00 32.22  ? 140  ASP C C   1 
ATOM   6093  O  O   . ASP C 1 162 ? 48.160  121.860 33.044  1.00 32.01  ? 140  ASP C O   1 
ATOM   6094  C  CB  . ASP C 1 162 ? 49.863  122.802 30.271  1.00 23.78  ? 140  ASP C CB  1 
ATOM   6095  C  CG  . ASP C 1 162 ? 49.942  123.542 28.940  1.00 24.71  ? 140  ASP C CG  1 
ATOM   6096  O  OD1 . ASP C 1 162 ? 48.964  124.251 28.604  1.00 23.10  ? 140  ASP C OD1 1 
ATOM   6097  O  OD2 . ASP C 1 162 ? 50.978  123.410 28.241  1.00 17.21  ? 140  ASP C OD2 1 
ATOM   6098  N  N   . THR C 1 163 ? 47.850  120.685 31.149  1.00 32.49  ? 141  THR C N   1 
ATOM   6099  C  CA  . THR C 1 163 ? 47.476  119.466 31.836  1.00 31.14  ? 141  THR C CA  1 
ATOM   6100  C  C   . THR C 1 163 ? 48.566  118.409 31.777  1.00 34.59  ? 141  THR C C   1 
ATOM   6101  O  O   . THR C 1 163 ? 49.178  118.191 30.736  1.00 39.49  ? 141  THR C O   1 
ATOM   6102  C  CB  . THR C 1 163 ? 46.178  118.895 31.252  1.00 31.19  ? 141  THR C CB  1 
ATOM   6103  O  OG1 . THR C 1 163 ? 45.118  119.838 31.448  1.00 21.55  ? 141  THR C OG1 1 
ATOM   6104  C  CG2 . THR C 1 163 ? 45.812  117.586 31.935  1.00 30.35  ? 141  THR C CG2 1 
ATOM   6105  N  N   . ILE C 1 164 ? 48.806  117.762 32.911  1.00 33.48  ? 142  ILE C N   1 
ATOM   6106  C  CA  . ILE C 1 164 ? 49.821  116.728 33.001  1.00 31.84  ? 142  ILE C CA  1 
ATOM   6107  C  C   . ILE C 1 164 ? 49.159  115.379 33.247  1.00 27.82  ? 142  ILE C C   1 
ATOM   6108  O  O   . ILE C 1 164 ? 48.529  115.181 34.278  1.00 22.67  ? 142  ILE C O   1 
ATOM   6109  C  CB  . ILE C 1 164 ? 50.810  117.014 34.138  1.00 29.14  ? 142  ILE C CB  1 
ATOM   6110  C  CG1 . ILE C 1 164 ? 51.492  118.358 33.897  1.00 33.28  ? 142  ILE C CG1 1 
ATOM   6111  C  CG2 . ILE C 1 164 ? 51.858  115.913 34.207  1.00 32.78  ? 142  ILE C CG2 1 
ATOM   6112  C  CD1 . ILE C 1 164 ? 52.412  118.783 35.024  1.00 41.81  ? 142  ILE C CD1 1 
ATOM   6113  N  N   . ILE C 1 165 ? 49.316  114.463 32.291  1.00 25.78  ? 143  ILE C N   1 
ATOM   6114  C  CA  . ILE C 1 165 ? 48.743  113.127 32.371  1.00 28.20  ? 143  ILE C CA  1 
ATOM   6115  C  C   . ILE C 1 165 ? 49.854  112.140 32.663  1.00 26.58  ? 143  ILE C C   1 
ATOM   6116  O  O   . ILE C 1 165 ? 50.871  112.150 31.987  1.00 30.49  ? 143  ILE C O   1 
ATOM   6117  C  CB  . ILE C 1 165 ? 48.085  112.717 31.035  1.00 31.23  ? 143  ILE C CB  1 
ATOM   6118  C  CG1 . ILE C 1 165 ? 46.905  113.634 30.729  1.00 25.49  ? 143  ILE C CG1 1 
ATOM   6119  C  CG2 . ILE C 1 165 ? 47.625  111.264 31.091  1.00 27.25  ? 143  ILE C CG2 1 
ATOM   6120  C  CD1 . ILE C 1 165 ? 46.356  113.453 29.352  1.00 20.99  ? 143  ILE C CD1 1 
ATOM   6121  N  N   . GLU C 1 166 ? 49.671  111.301 33.679  1.00 35.43  ? 144  GLU C N   1 
ATOM   6122  C  CA  . GLU C 1 166 ? 50.680  110.304 34.014  1.00 36.43  ? 144  GLU C CA  1 
ATOM   6123  C  C   . GLU C 1 166 ? 50.072  108.943 34.322  1.00 38.77  ? 144  GLU C C   1 
ATOM   6124  O  O   . GLU C 1 166 ? 49.204  108.808 35.191  1.00 36.14  ? 144  GLU C O   1 
ATOM   6125  C  CB  . GLU C 1 166 ? 51.532  110.752 35.201  1.00 30.84  ? 144  GLU C CB  1 
ATOM   6126  C  CG  . GLU C 1 166 ? 52.701  109.818 35.455  1.00 35.86  ? 144  GLU C CG  1 
ATOM   6127  C  CD  . GLU C 1 166 ? 53.714  109.833 34.318  1.00 50.42  ? 144  GLU C CD  1 
ATOM   6128  O  OE1 . GLU C 1 166 ? 54.639  108.985 34.333  1.00 53.96  ? 144  GLU C OE1 1 
ATOM   6129  O  OE2 . GLU C 1 166 ? 53.589  110.699 33.414  1.00 51.00  ? 144  GLU C OE2 1 
ATOM   6130  N  N   . PRO C 1 167 ? 50.510  107.916 33.587  1.00 42.08  ? 145  PRO C N   1 
ATOM   6131  C  CA  . PRO C 1 167 ? 50.014  106.556 33.787  1.00 48.59  ? 145  PRO C CA  1 
ATOM   6132  C  C   . PRO C 1 167 ? 50.882  105.872 34.838  1.00 52.09  ? 145  PRO C C   1 
ATOM   6133  O  O   . PRO C 1 167 ? 51.988  105.419 34.541  1.00 50.01  ? 145  PRO C O   1 
ATOM   6134  C  CB  . PRO C 1 167 ? 50.184  105.935 32.409  1.00 48.60  ? 145  PRO C CB  1 
ATOM   6135  C  CG  . PRO C 1 167 ? 51.476  106.544 31.955  1.00 45.01  ? 145  PRO C CG  1 
ATOM   6136  C  CD  . PRO C 1 167 ? 51.330  108.002 32.364  1.00 40.78  ? 145  PRO C CD  1 
ATOM   6137  N  N   . THR C 1 168 ? 50.399  105.803 36.070  1.00 56.73  ? 146  THR C N   1 
ATOM   6138  C  CA  . THR C 1 168 ? 51.195  105.163 37.106  1.00 55.99  ? 146  THR C CA  1 
ATOM   6139  C  C   . THR C 1 168 ? 50.478  105.077 38.444  1.00 56.12  ? 146  THR C C   1 
ATOM   6140  O  O   . THR C 1 168 ? 49.704  105.966 38.822  1.00 51.70  ? 146  THR C O   1 
ATOM   6141  C  CB  . THR C 1 168 ? 52.548  105.902 37.301  1.00 55.28  ? 146  THR C CB  1 
ATOM   6142  O  OG1 . THR C 1 168 ? 53.434  105.086 38.078  1.00 47.08  ? 146  THR C OG1 1 
ATOM   6143  C  CG2 . THR C 1 168 ? 52.334  107.233 38.010  1.00 51.05  ? 146  THR C CG2 1 
ATOM   6144  N  N   . SER C 1 169 ? 50.748  103.984 39.148  1.00 56.17  ? 147  SER C N   1 
ATOM   6145  C  CA  . SER C 1 169 ? 50.161  103.732 40.453  1.00 56.67  ? 147  SER C CA  1 
ATOM   6146  C  C   . SER C 1 169 ? 51.250  103.913 41.502  1.00 55.31  ? 147  SER C C   1 
ATOM   6147  O  O   . SER C 1 169 ? 51.152  103.387 42.613  1.00 54.34  ? 147  SER C O   1 
ATOM   6148  C  CB  . SER C 1 169 ? 49.617  102.303 40.508  1.00 56.06  ? 147  SER C CB  1 
ATOM   6149  O  OG  . SER C 1 169 ? 50.639  101.365 40.223  1.00 56.24  ? 147  SER C OG  1 
ATOM   6150  N  N   . GLY C 1 170 ? 52.285  104.669 41.139  1.00 51.47  ? 148  GLY C N   1 
ATOM   6151  C  CA  . GLY C 1 170 ? 53.397  104.900 42.044  1.00 50.51  ? 148  GLY C CA  1 
ATOM   6152  C  C   . GLY C 1 170 ? 53.555  106.316 42.569  1.00 47.77  ? 148  GLY C C   1 
ATOM   6153  O  O   . GLY C 1 170 ? 52.694  107.167 42.380  1.00 53.37  ? 148  GLY C O   1 
ATOM   6154  N  N   . ASN C 1 171 ? 54.676  106.563 43.237  1.00 47.23  ? 149  ASN C N   1 
ATOM   6155  C  CA  . ASN C 1 171 ? 54.993  107.858 43.836  1.00 37.63  ? 149  ASN C CA  1 
ATOM   6156  C  C   . ASN C 1 171 ? 55.184  109.010 42.855  1.00 36.29  ? 149  ASN C C   1 
ATOM   6157  O  O   . ASN C 1 171 ? 55.102  110.184 43.240  1.00 35.84  ? 149  ASN C O   1 
ATOM   6158  C  CB  . ASN C 1 171 ? 56.237  107.710 44.712  1.00 32.82  ? 149  ASN C CB  1 
ATOM   6159  C  CG  . ASN C 1 171 ? 55.963  106.888 45.953  1.00 32.64  ? 149  ASN C CG  1 
ATOM   6160  O  OD1 . ASN C 1 171 ? 55.028  107.186 46.706  1.00 26.11  ? 149  ASN C OD1 1 
ATOM   6161  N  ND2 . ASN C 1 171 ? 56.764  105.852 46.179  1.00 18.78  ? 149  ASN C ND2 1 
ATOM   6162  N  N   . THR C 1 172 ? 55.442  108.689 41.593  1.00 26.15  ? 150  THR C N   1 
ATOM   6163  C  CA  . THR C 1 172 ? 55.615  109.748 40.632  1.00 25.00  ? 150  THR C CA  1 
ATOM   6164  C  C   . THR C 1 172 ? 54.258  110.413 40.443  1.00 25.17  ? 150  THR C C   1 
ATOM   6165  O  O   . THR C 1 172 ? 54.160  111.605 40.171  1.00 22.98  ? 150  THR C O   1 
ATOM   6166  C  CB  . THR C 1 172 ? 56.156  109.209 39.295  1.00 32.39  ? 150  THR C CB  1 
ATOM   6167  O  OG1 . THR C 1 172 ? 57.508  108.747 39.467  1.00 13.58  ? 150  THR C OG1 1 
ATOM   6168  C  CG2 . THR C 1 172 ? 56.129  110.305 38.245  1.00 19.97  ? 150  THR C CG2 1 
ATOM   6169  N  N   . GLY C 1 173 ? 53.204  109.632 40.628  1.00 28.63  ? 151  GLY C N   1 
ATOM   6170  C  CA  . GLY C 1 173 ? 51.860  110.164 40.484  1.00 31.55  ? 151  GLY C CA  1 
ATOM   6171  C  C   . GLY C 1 173 ? 51.576  111.169 41.580  1.00 30.61  ? 151  GLY C C   1 
ATOM   6172  O  O   . GLY C 1 173 ? 51.038  112.244 41.333  1.00 27.68  ? 151  GLY C O   1 
ATOM   6173  N  N   . ILE C 1 174 ? 51.934  110.812 42.807  1.00 34.22  ? 152  ILE C N   1 
ATOM   6174  C  CA  . ILE C 1 174 ? 51.726  111.697 43.951  1.00 29.77  ? 152  ILE C CA  1 
ATOM   6175  C  C   . ILE C 1 174 ? 52.615  112.923 43.804  1.00 24.90  ? 152  ILE C C   1 
ATOM   6176  O  O   . ILE C 1 174 ? 52.185  114.038 44.085  1.00 20.41  ? 152  ILE C O   1 
ATOM   6177  C  CB  . ILE C 1 174 ? 52.070  110.976 45.283  1.00 35.52  ? 152  ILE C CB  1 
ATOM   6178  C  CG1 . ILE C 1 174 ? 51.125  109.782 45.484  1.00 32.85  ? 152  ILE C CG1 1 
ATOM   6179  C  CG2 . ILE C 1 174 ? 51.970  111.955 46.447  1.00 35.04  ? 152  ILE C CG2 1 
ATOM   6180  C  CD1 . ILE C 1 174 ? 51.531  108.834 46.601  1.00 32.18  ? 152  ILE C CD1 1 
ATOM   6181  N  N   . GLY C 1 175 ? 53.856  112.702 43.364  1.00 16.96  ? 153  GLY C N   1 
ATOM   6182  C  CA  . GLY C 1 175 ? 54.779  113.809 43.177  1.00 22.88  ? 153  GLY C CA  1 
ATOM   6183  C  C   . GLY C 1 175 ? 54.275  114.849 42.180  1.00 24.52  ? 153  GLY C C   1 
ATOM   6184  O  O   . GLY C 1 175 ? 54.299  116.049 42.455  1.00 28.07  ? 153  GLY C O   1 
ATOM   6185  N  N   . LEU C 1 176 ? 53.823  114.392 41.017  1.00 18.76  ? 154  LEU C N   1 
ATOM   6186  C  CA  . LEU C 1 176 ? 53.314  115.280 39.989  1.00 18.31  ? 154  LEU C CA  1 
ATOM   6187  C  C   . LEU C 1 176 ? 52.060  115.979 40.484  1.00 21.17  ? 154  LEU C C   1 
ATOM   6188  O  O   . LEU C 1 176 ? 51.866  117.170 40.258  1.00 20.34  ? 154  LEU C O   1 
ATOM   6189  C  CB  . LEU C 1 176 ? 53.001  114.487 38.728  1.00 19.53  ? 154  LEU C CB  1 
ATOM   6190  C  CG  . LEU C 1 176 ? 54.209  113.900 37.993  1.00 24.80  ? 154  LEU C CG  1 
ATOM   6191  C  CD1 . LEU C 1 176 ? 53.731  112.822 37.017  1.00 27.47  ? 154  LEU C CD1 1 
ATOM   6192  C  CD2 . LEU C 1 176 ? 54.964  114.995 37.263  1.00 16.23  ? 154  LEU C CD2 1 
ATOM   6193  N  N   . ALA C 1 177 ? 51.199  115.239 41.168  1.00 24.58  ? 155  ALA C N   1 
ATOM   6194  C  CA  . ALA C 1 177 ? 49.969  115.832 41.692  1.00 31.71  ? 155  ALA C CA  1 
ATOM   6195  C  C   . ALA C 1 177 ? 50.292  117.018 42.627  1.00 35.03  ? 155  ALA C C   1 
ATOM   6196  O  O   . ALA C 1 177 ? 49.742  118.120 42.474  1.00 34.87  ? 155  ALA C O   1 
ATOM   6197  C  CB  . ALA C 1 177 ? 49.162  114.775 42.423  1.00 17.07  ? 155  ALA C CB  1 
ATOM   6198  N  N   . LEU C 1 178 ? 51.190  116.782 43.584  1.00 35.24  ? 156  LEU C N   1 
ATOM   6199  C  CA  . LEU C 1 178 ? 51.615  117.811 44.535  1.00 32.25  ? 156  LEU C CA  1 
ATOM   6200  C  C   . LEU C 1 178 ? 52.155  119.041 43.817  1.00 31.33  ? 156  LEU C C   1 
ATOM   6201  O  O   . LEU C 1 178 ? 51.667  120.152 44.012  1.00 33.97  ? 156  LEU C O   1 
ATOM   6202  C  CB  . LEU C 1 178 ? 52.694  117.244 45.467  1.00 36.22  ? 156  LEU C CB  1 
ATOM   6203  C  CG  . LEU C 1 178 ? 53.515  118.154 46.387  1.00 31.41  ? 156  LEU C CG  1 
ATOM   6204  C  CD1 . LEU C 1 178 ? 52.626  119.128 47.134  1.00 34.74  ? 156  LEU C CD1 1 
ATOM   6205  C  CD2 . LEU C 1 178 ? 54.268  117.279 47.376  1.00 32.71  ? 156  LEU C CD2 1 
ATOM   6206  N  N   . ALA C 1 179 ? 53.168  118.838 42.979  1.00 33.14  ? 157  ALA C N   1 
ATOM   6207  C  CA  . ALA C 1 179 ? 53.760  119.940 42.231  1.00 26.69  ? 157  ALA C CA  1 
ATOM   6208  C  C   . ALA C 1 179 ? 52.721  120.605 41.316  1.00 20.81  ? 157  ALA C C   1 
ATOM   6209  O  O   . ALA C 1 179 ? 52.770  121.809 41.063  1.00 21.01  ? 157  ALA C O   1 
ATOM   6210  C  CB  . ALA C 1 179 ? 54.940  119.438 41.421  1.00 24.96  ? 157  ALA C CB  1 
ATOM   6211  N  N   . ALA C 1 180 ? 51.764  119.822 40.841  1.00 16.72  ? 158  ALA C N   1 
ATOM   6212  C  CA  . ALA C 1 180 ? 50.752  120.365 39.959  1.00 18.56  ? 158  ALA C CA  1 
ATOM   6213  C  C   . ALA C 1 180 ? 49.889  121.372 40.708  1.00 21.36  ? 158  ALA C C   1 
ATOM   6214  O  O   . ALA C 1 180 ? 49.660  122.500 40.246  1.00 19.97  ? 158  ALA C O   1 
ATOM   6215  C  CB  . ALA C 1 180 ? 49.883  119.243 39.379  1.00 5.34   ? 158  ALA C CB  1 
ATOM   6216  N  N   . ALA C 1 181 ? 49.404  120.960 41.866  1.00 21.55  ? 159  ALA C N   1 
ATOM   6217  C  CA  . ALA C 1 181 ? 48.565  121.832 42.663  1.00 30.10  ? 159  ALA C CA  1 
ATOM   6218  C  C   . ALA C 1 181 ? 49.279  123.129 43.063  1.00 33.53  ? 159  ALA C C   1 
ATOM   6219  O  O   . ALA C 1 181 ? 48.655  124.184 43.164  1.00 38.80  ? 159  ALA C O   1 
ATOM   6220  C  CB  . ALA C 1 181 ? 48.086  121.096 43.901  1.00 37.07  ? 159  ALA C CB  1 
ATOM   6221  N  N   . VAL C 1 182 ? 50.579  123.067 43.301  1.00 33.03  ? 160  VAL C N   1 
ATOM   6222  C  CA  . VAL C 1 182 ? 51.291  124.280 43.669  1.00 32.86  ? 160  VAL C CA  1 
ATOM   6223  C  C   . VAL C 1 182 ? 51.494  125.231 42.481  1.00 36.92  ? 160  VAL C C   1 
ATOM   6224  O  O   . VAL C 1 182 ? 51.286  126.436 42.601  1.00 33.79  ? 160  VAL C O   1 
ATOM   6225  C  CB  . VAL C 1 182 ? 52.677  123.969 44.249  1.00 35.45  ? 160  VAL C CB  1 
ATOM   6226  C  CG1 . VAL C 1 182 ? 53.340  125.267 44.703  1.00 35.33  ? 160  VAL C CG1 1 
ATOM   6227  C  CG2 . VAL C 1 182 ? 52.554  122.991 45.395  1.00 39.56  ? 160  VAL C CG2 1 
ATOM   6228  N  N   . ARG C 1 183 ? 51.907  124.681 41.343  1.00 34.57  ? 161  ARG C N   1 
ATOM   6229  C  CA  . ARG C 1 183 ? 52.175  125.481 40.159  1.00 42.19  ? 161  ARG C CA  1 
ATOM   6230  C  C   . ARG C 1 183 ? 50.954  125.848 39.300  1.00 43.60  ? 161  ARG C C   1 
ATOM   6231  O  O   . ARG C 1 183 ? 51.056  126.693 38.413  1.00 45.99  ? 161  ARG C O   1 
ATOM   6232  C  CB  . ARG C 1 183 ? 53.202  124.761 39.285  1.00 42.67  ? 161  ARG C CB  1 
ATOM   6233  C  CG  . ARG C 1 183 ? 54.346  124.184 40.068  1.00 41.53  ? 161  ARG C CG  1 
ATOM   6234  C  CD  . ARG C 1 183 ? 55.361  125.230 40.509  1.00 50.35  ? 161  ARG C CD  1 
ATOM   6235  N  NE  . ARG C 1 183 ? 56.548  125.215 39.652  1.00 54.49  ? 161  ARG C NE  1 
ATOM   6236  C  CZ  . ARG C 1 183 ? 57.788  125.463 40.068  1.00 57.93  ? 161  ARG C CZ  1 
ATOM   6237  N  NH1 . ARG C 1 183 ? 58.020  125.749 41.345  1.00 57.08  ? 161  ARG C NH1 1 
ATOM   6238  N  NH2 . ARG C 1 183 ? 58.800  125.417 39.204  1.00 52.30  ? 161  ARG C NH2 1 
ATOM   6239  N  N   . GLY C 1 184 ? 49.810  125.215 39.540  1.00 45.56  ? 162  GLY C N   1 
ATOM   6240  C  CA  . GLY C 1 184 ? 48.629  125.538 38.748  1.00 44.76  ? 162  GLY C CA  1 
ATOM   6241  C  C   . GLY C 1 184 ? 48.429  124.726 37.474  1.00 44.14  ? 162  GLY C C   1 
ATOM   6242  O  O   . GLY C 1 184 ? 47.947  125.245 36.461  1.00 34.97  ? 162  GLY C O   1 
ATOM   6243  N  N   . TYR C 1 185 ? 48.804  123.452 37.522  1.00 42.45  ? 163  TYR C N   1 
ATOM   6244  C  CA  . TYR C 1 185 ? 48.644  122.571 36.380  1.00 43.84  ? 163  TYR C CA  1 
ATOM   6245  C  C   . TYR C 1 185 ? 47.542  121.594 36.707  1.00 46.28  ? 163  TYR C C   1 
ATOM   6246  O  O   . TYR C 1 185 ? 47.335  121.254 37.870  1.00 51.73  ? 163  TYR C O   1 
ATOM   6247  C  CB  . TYR C 1 185 ? 49.919  121.772 36.108  1.00 40.23  ? 163  TYR C CB  1 
ATOM   6248  C  CG  . TYR C 1 185 ? 51.080  122.594 35.634  1.00 36.64  ? 163  TYR C CG  1 
ATOM   6249  C  CD1 . TYR C 1 185 ? 52.271  122.621 36.350  1.00 41.20  ? 163  TYR C CD1 1 
ATOM   6250  C  CD2 . TYR C 1 185 ? 50.979  123.375 34.486  1.00 39.19  ? 163  TYR C CD2 1 
ATOM   6251  C  CE1 . TYR C 1 185 ? 53.329  123.412 35.938  1.00 39.44  ? 163  TYR C CE1 1 
ATOM   6252  C  CE2 . TYR C 1 185 ? 52.028  124.170 34.066  1.00 30.43  ? 163  TYR C CE2 1 
ATOM   6253  C  CZ  . TYR C 1 185 ? 53.195  124.188 34.795  1.00 36.19  ? 163  TYR C CZ  1 
ATOM   6254  O  OH  . TYR C 1 185 ? 54.220  125.007 34.402  1.00 34.44  ? 163  TYR C OH  1 
ATOM   6255  N  N   . ARG C 1 186 ? 46.833  121.147 35.684  1.00 43.80  ? 164  ARG C N   1 
ATOM   6256  C  CA  . ARG C 1 186 ? 45.785  120.168 35.880  1.00 46.66  ? 164  ARG C CA  1 
ATOM   6257  C  C   . ARG C 1 186 ? 46.522  118.831 35.876  1.00 49.74  ? 164  ARG C C   1 
ATOM   6258  O  O   . ARG C 1 186 ? 47.454  118.636 35.094  1.00 51.58  ? 164  ARG C O   1 
ATOM   6259  C  CB  . ARG C 1 186 ? 44.785  120.218 34.730  1.00 49.46  ? 164  ARG C CB  1 
ATOM   6260  C  CG  . ARG C 1 186 ? 43.617  119.260 34.880  1.00 57.34  ? 164  ARG C CG  1 
ATOM   6261  C  CD  . ARG C 1 186 ? 42.889  119.121 33.564  1.00 65.02  ? 164  ARG C CD  1 
ATOM   6262  N  NE  . ARG C 1 186 ? 41.736  118.235 33.658  1.00 71.97  ? 164  ARG C NE  1 
ATOM   6263  C  CZ  . ARG C 1 186 ? 41.098  117.739 32.604  1.00 77.37  ? 164  ARG C CZ  1 
ATOM   6264  N  NH1 . ARG C 1 186 ? 41.508  118.045 31.380  1.00 81.14  ? 164  ARG C NH1 1 
ATOM   6265  N  NH2 . ARG C 1 186 ? 40.054  116.939 32.772  1.00 78.12  ? 164  ARG C NH2 1 
ATOM   6266  N  N   . CYS C 1 187 ? 46.118  117.917 36.748  1.00 48.11  ? 165  CYS C N   1 
ATOM   6267  C  CA  . CYS C 1 187 ? 46.782  116.628 36.820  1.00 44.63  ? 165  CYS C CA  1 
ATOM   6268  C  C   . CYS C 1 187 ? 45.799  115.477 36.704  1.00 44.00  ? 165  CYS C C   1 
ATOM   6269  O  O   . CYS C 1 187 ? 44.782  115.443 37.385  1.00 44.66  ? 165  CYS C O   1 
ATOM   6270  C  CB  . CYS C 1 187 ? 47.549  116.515 38.137  1.00 47.12  ? 165  CYS C CB  1 
ATOM   6271  S  SG  . CYS C 1 187 ? 48.695  115.128 38.207  1.00 42.78  ? 165  CYS C SG  1 
ATOM   6272  N  N   . ILE C 1 188 ? 46.118  114.536 35.830  1.00 42.03  ? 166  ILE C N   1 
ATOM   6273  C  CA  . ILE C 1 188 ? 45.287  113.370 35.606  1.00 45.81  ? 166  ILE C CA  1 
ATOM   6274  C  C   . ILE C 1 188 ? 46.156  112.123 35.691  1.00 50.04  ? 166  ILE C C   1 
ATOM   6275  O  O   . ILE C 1 188 ? 47.041  111.912 34.858  1.00 50.24  ? 166  ILE C O   1 
ATOM   6276  C  CB  . ILE C 1 188 ? 44.653  113.396 34.207  1.00 48.23  ? 166  ILE C CB  1 
ATOM   6277  C  CG1 . ILE C 1 188 ? 43.745  114.615 34.061  1.00 49.59  ? 166  ILE C CG1 1 
ATOM   6278  C  CG2 . ILE C 1 188 ? 43.869  112.118 33.974  1.00 47.40  ? 166  ILE C CG2 1 
ATOM   6279  C  CD1 . ILE C 1 188 ? 43.255  114.833 32.647  1.00 52.67  ? 166  ILE C CD1 1 
ATOM   6280  N  N   . ILE C 1 189 ? 45.914  111.300 36.703  1.00 50.85  ? 167  ILE C N   1 
ATOM   6281  C  CA  . ILE C 1 189 ? 46.665  110.063 36.855  1.00 51.31  ? 167  ILE C CA  1 
ATOM   6282  C  C   . ILE C 1 189 ? 45.814  108.918 36.314  1.00 50.38  ? 167  ILE C C   1 
ATOM   6283  O  O   . ILE C 1 189 ? 44.598  108.887 36.501  1.00 47.71  ? 167  ILE C O   1 
ATOM   6284  C  CB  . ILE C 1 189 ? 47.029  109.788 38.342  1.00 52.12  ? 167  ILE C CB  1 
ATOM   6285  C  CG1 . ILE C 1 189 ? 48.317  110.532 38.710  1.00 57.56  ? 167  ILE C CG1 1 
ATOM   6286  C  CG2 . ILE C 1 189 ? 47.232  108.293 38.581  1.00 49.52  ? 167  ILE C CG2 1 
ATOM   6287  C  CD1 . ILE C 1 189 ? 48.209  112.033 38.645  1.00 54.24  ? 167  ILE C CD1 1 
ATOM   6288  N  N   . VAL C 1 190 ? 46.462  107.990 35.624  1.00 52.10  ? 168  VAL C N   1 
ATOM   6289  C  CA  . VAL C 1 190 ? 45.773  106.843 35.066  1.00 58.65  ? 168  VAL C CA  1 
ATOM   6290  C  C   . VAL C 1 190 ? 46.406  105.595 35.665  1.00 61.78  ? 168  VAL C C   1 
ATOM   6291  O  O   . VAL C 1 190 ? 47.600  105.340 35.486  1.00 56.71  ? 168  VAL C O   1 
ATOM   6292  C  CB  . VAL C 1 190 ? 45.889  106.818 33.525  1.00 57.96  ? 168  VAL C CB  1 
ATOM   6293  C  CG1 . VAL C 1 190 ? 45.130  105.632 32.965  1.00 58.33  ? 168  VAL C CG1 1 
ATOM   6294  C  CG2 . VAL C 1 190 ? 45.333  108.111 32.946  1.00 59.45  ? 168  VAL C CG2 1 
ATOM   6295  N  N   . MET C 1 191 ? 45.590  104.827 36.383  1.00 68.03  ? 169  MET C N   1 
ATOM   6296  C  CA  . MET C 1 191 ? 46.047  103.612 37.050  1.00 72.67  ? 169  MET C CA  1 
ATOM   6297  C  C   . MET C 1 191 ? 45.025  102.490 36.916  1.00 72.00  ? 169  MET C C   1 
ATOM   6298  O  O   . MET C 1 191 ? 43.874  102.729 36.555  1.00 68.50  ? 169  MET C O   1 
ATOM   6299  C  CB  . MET C 1 191 ? 46.250  103.905 38.533  1.00 77.44  ? 169  MET C CB  1 
ATOM   6300  C  CG  . MET C 1 191 ? 44.949  104.279 39.231  1.00 78.65  ? 169  MET C CG  1 
ATOM   6301  S  SD  . MET C 1 191 ? 45.161  104.768 40.935  1.00 77.26  ? 169  MET C SD  1 
ATOM   6302  C  CE  . MET C 1 191 ? 45.127  106.553 40.776  1.00 79.44  ? 169  MET C CE  1 
ATOM   6303  N  N   . PRO C 1 192 ? 45.437  101.248 37.216  1.00 73.24  ? 170  PRO C N   1 
ATOM   6304  C  CA  . PRO C 1 192 ? 44.554  100.079 37.136  1.00 74.65  ? 170  PRO C CA  1 
ATOM   6305  C  C   . PRO C 1 192 ? 43.280  100.272 37.964  1.00 75.32  ? 170  PRO C C   1 
ATOM   6306  O  O   . PRO C 1 192 ? 42.991  101.380 38.418  1.00 73.12  ? 170  PRO C O   1 
ATOM   6307  C  CB  . PRO C 1 192 ? 45.433  98.957  37.670  1.00 76.12  ? 170  PRO C CB  1 
ATOM   6308  C  CG  . PRO C 1 192 ? 46.797  99.356  37.167  1.00 76.40  ? 170  PRO C CG  1 
ATOM   6309  C  CD  . PRO C 1 192 ? 46.828  100.837 37.483  1.00 74.80  ? 170  PRO C CD  1 
ATOM   6310  N  N   . GLU C 1 193 ? 42.520  99.199  38.166  1.00 75.86  ? 171  GLU C N   1 
ATOM   6311  C  CA  . GLU C 1 193 ? 41.280  99.301  38.934  1.00 77.06  ? 171  GLU C CA  1 
ATOM   6312  C  C   . GLU C 1 193 ? 41.430  98.921  40.405  1.00 74.86  ? 171  GLU C C   1 
ATOM   6313  O  O   . GLU C 1 193 ? 40.475  98.993  41.174  1.00 74.82  ? 171  GLU C O   1 
ATOM   6314  C  CB  . GLU C 1 193 ? 40.176  98.453  38.284  1.00 81.83  ? 171  GLU C CB  1 
ATOM   6315  C  CG  . GLU C 1 193 ? 40.450  96.951  38.214  1.00 90.98  ? 171  GLU C CG  1 
ATOM   6316  C  CD  . GLU C 1 193 ? 39.357  96.191  37.465  1.00 95.39  ? 171  GLU C CD  1 
ATOM   6317  O  OE1 . GLU C 1 193 ? 38.169  96.326  37.842  1.00 96.03  ? 171  GLU C OE1 1 
ATOM   6318  O  OE2 . GLU C 1 193 ? 39.687  95.459  36.503  1.00 95.79  ? 171  GLU C OE2 1 
ATOM   6319  N  N   . LYS C 1 194 ? 42.633  98.527  40.799  1.00 73.86  ? 172  LYS C N   1 
ATOM   6320  C  CA  . LYS C 1 194 ? 42.887  98.150  42.184  1.00 71.69  ? 172  LYS C CA  1 
ATOM   6321  C  C   . LYS C 1 194 ? 43.437  99.359  42.945  1.00 70.77  ? 172  LYS C C   1 
ATOM   6322  O  O   . LYS C 1 194 ? 42.704  100.292 43.271  1.00 69.09  ? 172  LYS C O   1 
ATOM   6323  C  CB  . LYS C 1 194 ? 43.904  97.005  42.245  1.00 74.16  ? 172  LYS C CB  1 
ATOM   6324  C  CG  . LYS C 1 194 ? 43.538  95.764  41.441  1.00 78.11  ? 172  LYS C CG  1 
ATOM   6325  C  CD  . LYS C 1 194 ? 43.721  95.979  39.938  1.00 84.84  ? 172  LYS C CD  1 
ATOM   6326  C  CE  . LYS C 1 194 ? 43.396  94.713  39.148  1.00 83.05  ? 172  LYS C CE  1 
ATOM   6327  N  NZ  . LYS C 1 194 ? 43.538  94.912  37.680  1.00 84.68  ? 172  LYS C NZ  1 
ATOM   6328  N  N   . MET C 1 195 ? 44.738  99.322  43.220  1.00 71.86  ? 173  MET C N   1 
ATOM   6329  C  CA  . MET C 1 195 ? 45.457  100.385 43.920  1.00 73.72  ? 173  MET C CA  1 
ATOM   6330  C  C   . MET C 1 195 ? 44.995  100.801 45.306  1.00 72.48  ? 173  MET C C   1 
ATOM   6331  O  O   . MET C 1 195 ? 43.823  101.087 45.541  1.00 72.86  ? 173  MET C O   1 
ATOM   6332  C  CB  . MET C 1 195 ? 45.573  101.618 43.024  1.00 77.25  ? 173  MET C CB  1 
ATOM   6333  C  CG  . MET C 1 195 ? 46.931  101.717 42.352  1.00 81.68  ? 173  MET C CG  1 
ATOM   6334  S  SD  . MET C 1 195 ? 47.673  100.091 42.041  1.00 93.06  ? 173  MET C SD  1 
ATOM   6335  C  CE  . MET C 1 195 ? 48.564  99.804  43.609  1.00 87.83  ? 173  MET C CE  1 
ATOM   6336  N  N   . SER C 1 196 ? 45.968  100.841 46.211  1.00 72.32  ? 174  SER C N   1 
ATOM   6337  C  CA  . SER C 1 196 ? 45.777  101.193 47.614  1.00 69.28  ? 174  SER C CA  1 
ATOM   6338  C  C   . SER C 1 196 ? 45.033  102.506 47.832  1.00 64.22  ? 174  SER C C   1 
ATOM   6339  O  O   . SER C 1 196 ? 45.120  103.423 47.020  1.00 61.76  ? 174  SER C O   1 
ATOM   6340  C  CB  . SER C 1 196 ? 47.144  101.265 48.296  1.00 72.74  ? 174  SER C CB  1 
ATOM   6341  O  OG  . SER C 1 196 ? 47.993  100.227 47.826  1.00 80.09  ? 174  SER C OG  1 
ATOM   6342  N  N   . SER C 1 197 ? 44.305  102.585 48.941  1.00 61.84  ? 175  SER C N   1 
ATOM   6343  C  CA  . SER C 1 197 ? 43.555  103.788 49.282  1.00 63.84  ? 175  SER C CA  1 
ATOM   6344  C  C   . SER C 1 197 ? 44.524  104.853 49.778  1.00 59.33  ? 175  SER C C   1 
ATOM   6345  O  O   . SER C 1 197 ? 44.306  106.051 49.583  1.00 52.88  ? 175  SER C O   1 
ATOM   6346  C  CB  . SER C 1 197 ? 42.519  103.485 50.369  1.00 66.39  ? 175  SER C CB  1 
ATOM   6347  O  OG  . SER C 1 197 ? 41.525  102.592 49.896  1.00 73.66  ? 175  SER C OG  1 
ATOM   6348  N  N   . GLU C 1 198 ? 45.590  104.402 50.432  1.00 58.13  ? 176  GLU C N   1 
ATOM   6349  C  CA  . GLU C 1 198 ? 46.609  105.306 50.944  1.00 57.76  ? 176  GLU C CA  1 
ATOM   6350  C  C   . GLU C 1 198 ? 47.036  106.246 49.824  1.00 55.81  ? 176  GLU C C   1 
ATOM   6351  O  O   . GLU C 1 198 ? 47.211  107.451 50.027  1.00 56.62  ? 176  GLU C O   1 
ATOM   6352  C  CB  . GLU C 1 198 ? 47.830  104.519 51.420  1.00 57.47  ? 176  GLU C CB  1 
ATOM   6353  C  CG  . GLU C 1 198 ? 47.889  104.256 52.913  1.00 65.94  ? 176  GLU C CG  1 
ATOM   6354  C  CD  . GLU C 1 198 ? 46.705  103.462 53.426  1.00 68.55  ? 176  GLU C CD  1 
ATOM   6355  O  OE1 . GLU C 1 198 ? 45.671  104.078 53.761  1.00 63.76  ? 176  GLU C OE1 1 
ATOM   6356  O  OE2 . GLU C 1 198 ? 46.812  102.217 53.487  1.00 69.42  ? 176  GLU C OE2 1 
ATOM   6357  N  N   . LYS C 1 199 ? 47.197  105.679 48.634  1.00 49.45  ? 177  LYS C N   1 
ATOM   6358  C  CA  . LYS C 1 199 ? 47.621  106.446 47.477  1.00 45.28  ? 177  LYS C CA  1 
ATOM   6359  C  C   . LYS C 1 199 ? 46.483  107.185 46.764  1.00 42.85  ? 177  LYS C C   1 
ATOM   6360  O  O   . LYS C 1 199 ? 46.650  108.336 46.359  1.00 43.43  ? 177  LYS C O   1 
ATOM   6361  C  CB  . LYS C 1 199 ? 48.364  105.523 46.507  1.00 43.50  ? 177  LYS C CB  1 
ATOM   6362  C  CG  . LYS C 1 199 ? 49.669  104.976 47.068  1.00 41.73  ? 177  LYS C CG  1 
ATOM   6363  C  CD  . LYS C 1 199 ? 50.330  103.969 46.130  1.00 43.06  ? 177  LYS C CD  1 
ATOM   6364  C  CE  . LYS C 1 199 ? 49.500  102.704 45.985  1.00 44.32  ? 177  LYS C CE  1 
ATOM   6365  N  NZ  . LYS C 1 199 ? 50.159  101.675 45.133  1.00 51.83  ? 177  LYS C NZ  1 
ATOM   6366  N  N   . VAL C 1 200 ? 45.323  106.547 46.624  1.00 41.06  ? 178  VAL C N   1 
ATOM   6367  C  CA  . VAL C 1 200 ? 44.214  107.198 45.939  1.00 42.52  ? 178  VAL C CA  1 
ATOM   6368  C  C   . VAL C 1 200 ? 43.693  108.425 46.673  1.00 45.53  ? 178  VAL C C   1 
ATOM   6369  O  O   . VAL C 1 200 ? 43.422  109.450 46.050  1.00 49.25  ? 178  VAL C O   1 
ATOM   6370  C  CB  . VAL C 1 200 ? 43.030  106.234 45.695  1.00 41.71  ? 178  VAL C CB  1 
ATOM   6371  C  CG1 . VAL C 1 200 ? 41.806  107.023 45.233  1.00 37.10  ? 178  VAL C CG1 1 
ATOM   6372  C  CG2 . VAL C 1 200 ? 43.405  105.204 44.633  1.00 44.85  ? 178  VAL C CG2 1 
ATOM   6373  N  N   . ASP C 1 201 ? 43.550  108.329 47.990  1.00 46.69  ? 179  ASP C N   1 
ATOM   6374  C  CA  . ASP C 1 201 ? 43.041  109.458 48.752  1.00 45.25  ? 179  ASP C CA  1 
ATOM   6375  C  C   . ASP C 1 201 ? 44.034  110.615 48.815  1.00 44.21  ? 179  ASP C C   1 
ATOM   6376  O  O   . ASP C 1 201 ? 43.636  111.781 48.892  1.00 40.58  ? 179  ASP C O   1 
ATOM   6377  C  CB  . ASP C 1 201 ? 42.626  109.002 50.154  1.00 54.19  ? 179  ASP C CB  1 
ATOM   6378  C  CG  . ASP C 1 201 ? 41.351  108.157 50.140  1.00 59.80  ? 179  ASP C CG  1 
ATOM   6379  O  OD1 . ASP C 1 201 ? 40.300  108.660 49.671  1.00 57.71  ? 179  ASP C OD1 1 
ATOM   6380  O  OD2 . ASP C 1 201 ? 41.400  106.992 50.596  1.00 66.46  ? 179  ASP C OD2 1 
ATOM   6381  N  N   . VAL C 1 202 ? 45.325  110.304 48.768  1.00 42.68  ? 180  VAL C N   1 
ATOM   6382  C  CA  . VAL C 1 202 ? 46.329  111.361 48.782  1.00 45.19  ? 180  VAL C CA  1 
ATOM   6383  C  C   . VAL C 1 202 ? 46.275  112.086 47.437  1.00 41.68  ? 180  VAL C C   1 
ATOM   6384  O  O   . VAL C 1 202 ? 46.365  113.313 47.379  1.00 46.62  ? 180  VAL C O   1 
ATOM   6385  C  CB  . VAL C 1 202 ? 47.751  110.805 49.017  1.00 43.44  ? 180  VAL C CB  1 
ATOM   6386  C  CG1 . VAL C 1 202 ? 48.793  111.888 48.715  1.00 43.17  ? 180  VAL C CG1 1 
ATOM   6387  C  CG2 . VAL C 1 202 ? 47.889  110.357 50.472  1.00 50.96  ? 180  VAL C CG2 1 
ATOM   6388  N  N   . LEU C 1 203 ? 46.122  111.324 46.356  1.00 39.33  ? 181  LEU C N   1 
ATOM   6389  C  CA  . LEU C 1 203 ? 46.032  111.914 45.022  1.00 37.77  ? 181  LEU C CA  1 
ATOM   6390  C  C   . LEU C 1 203 ? 44.816  112.835 44.926  1.00 36.92  ? 181  LEU C C   1 
ATOM   6391  O  O   . LEU C 1 203 ? 44.929  113.989 44.507  1.00 28.57  ? 181  LEU C O   1 
ATOM   6392  C  CB  . LEU C 1 203 ? 45.926  110.821 43.958  1.00 34.00  ? 181  LEU C CB  1 
ATOM   6393  C  CG  . LEU C 1 203 ? 47.232  110.149 43.562  1.00 37.19  ? 181  LEU C CG  1 
ATOM   6394  C  CD1 . LEU C 1 203 ? 46.955  109.016 42.592  1.00 42.31  ? 181  LEU C CD1 1 
ATOM   6395  C  CD2 . LEU C 1 203 ? 48.148  111.182 42.935  1.00 42.27  ? 181  LEU C CD2 1 
ATOM   6396  N  N   . ARG C 1 204 ? 43.658  112.316 45.323  1.00 37.85  ? 182  ARG C N   1 
ATOM   6397  C  CA  . ARG C 1 204 ? 42.425  113.087 45.280  1.00 42.80  ? 182  ARG C CA  1 
ATOM   6398  C  C   . ARG C 1 204 ? 42.528  114.342 46.148  1.00 43.18  ? 182  ARG C C   1 
ATOM   6399  O  O   . ARG C 1 204 ? 41.919  115.369 45.842  1.00 47.76  ? 182  ARG C O   1 
ATOM   6400  C  CB  . ARG C 1 204 ? 41.242  112.225 45.741  1.00 45.41  ? 182  ARG C CB  1 
ATOM   6401  C  CG  . ARG C 1 204 ? 41.020  110.957 44.919  1.00 50.29  ? 182  ARG C CG  1 
ATOM   6402  C  CD  . ARG C 1 204 ? 39.822  110.153 45.445  1.00 59.14  ? 182  ARG C CD  1 
ATOM   6403  N  NE  . ARG C 1 204 ? 38.531  110.748 45.089  1.00 60.02  ? 182  ARG C NE  1 
ATOM   6404  C  CZ  . ARG C 1 204 ? 37.935  110.608 43.904  1.00 65.36  ? 182  ARG C CZ  1 
ATOM   6405  N  NH1 . ARG C 1 204 ? 38.505  109.887 42.944  1.00 66.87  ? 182  ARG C NH1 1 
ATOM   6406  N  NH2 . ARG C 1 204 ? 36.766  111.193 43.672  1.00 64.25  ? 182  ARG C NH2 1 
ATOM   6407  N  N   . ALA C 1 205 ? 43.304  114.262 47.225  1.00 40.38  ? 183  ALA C N   1 
ATOM   6408  C  CA  . ALA C 1 205 ? 43.464  115.407 48.118  1.00 37.36  ? 183  ALA C CA  1 
ATOM   6409  C  C   . ALA C 1 205 ? 44.317  116.477 47.463  1.00 37.39  ? 183  ALA C C   1 
ATOM   6410  O  O   . ALA C 1 205 ? 44.160  117.670 47.735  1.00 37.38  ? 183  ALA C O   1 
ATOM   6411  C  CB  . ALA C 1 205 ? 44.102  114.972 49.438  1.00 32.59  ? 183  ALA C CB  1 
ATOM   6412  N  N   . LEU C 1 206 ? 45.241  116.045 46.613  1.00 38.69  ? 184  LEU C N   1 
ATOM   6413  C  CA  . LEU C 1 206 ? 46.112  116.981 45.923  1.00 36.19  ? 184  LEU C CA  1 
ATOM   6414  C  C   . LEU C 1 206 ? 45.388  117.583 44.708  1.00 33.80  ? 184  LEU C C   1 
ATOM   6415  O  O   . LEU C 1 206 ? 45.942  118.422 43.988  1.00 32.27  ? 184  LEU C O   1 
ATOM   6416  C  CB  . LEU C 1 206 ? 47.402  116.271 45.521  1.00 36.10  ? 184  LEU C CB  1 
ATOM   6417  C  CG  . LEU C 1 206 ? 48.265  115.919 46.734  1.00 34.69  ? 184  LEU C CG  1 
ATOM   6418  C  CD1 . LEU C 1 206 ? 49.338  114.921 46.351  1.00 37.44  ? 184  LEU C CD1 1 
ATOM   6419  C  CD2 . LEU C 1 206 ? 48.880  117.201 47.290  1.00 38.45  ? 184  LEU C CD2 1 
ATOM   6420  N  N   . GLY C 1 207 ? 44.140  117.151 44.510  1.00 28.78  ? 185  GLY C N   1 
ATOM   6421  C  CA  . GLY C 1 207 ? 43.316  117.646 43.419  1.00 27.62  ? 185  GLY C CA  1 
ATOM   6422  C  C   . GLY C 1 207 ? 43.500  116.938 42.093  1.00 32.73  ? 185  GLY C C   1 
ATOM   6423  O  O   . GLY C 1 207 ? 43.013  117.404 41.056  1.00 28.21  ? 185  GLY C O   1 
ATOM   6424  N  N   . ALA C 1 208 ? 44.197  115.806 42.126  1.00 35.04  ? 186  ALA C N   1 
ATOM   6425  C  CA  . ALA C 1 208 ? 44.461  115.032 40.922  1.00 37.41  ? 186  ALA C CA  1 
ATOM   6426  C  C   . ALA C 1 208 ? 43.272  114.213 40.461  1.00 42.31  ? 186  ALA C C   1 
ATOM   6427  O  O   . ALA C 1 208 ? 42.630  113.525 41.254  1.00 48.19  ? 186  ALA C O   1 
ATOM   6428  C  CB  . ALA C 1 208 ? 45.637  114.113 41.153  1.00 33.98  ? 186  ALA C CB  1 
ATOM   6429  N  N   . GLU C 1 209 ? 42.989  114.287 39.166  1.00 43.96  ? 187  GLU C N   1 
ATOM   6430  C  CA  . GLU C 1 209 ? 41.901  113.527 38.578  1.00 44.86  ? 187  GLU C CA  1 
ATOM   6431  C  C   . GLU C 1 209 ? 42.382  112.100 38.350  1.00 49.30  ? 187  GLU C C   1 
ATOM   6432  O  O   . GLU C 1 209 ? 43.444  111.877 37.767  1.00 50.25  ? 187  GLU C O   1 
ATOM   6433  C  CB  . GLU C 1 209 ? 41.485  114.140 37.246  1.00 38.32  ? 187  GLU C CB  1 
ATOM   6434  C  CG  . GLU C 1 209 ? 41.034  115.572 37.360  1.00 33.19  ? 187  GLU C CG  1 
ATOM   6435  C  CD  . GLU C 1 209 ? 40.488  116.108 36.052  1.00 37.18  ? 187  GLU C CD  1 
ATOM   6436  O  OE1 . GLU C 1 209 ? 40.136  117.309 36.013  1.00 33.85  ? 187  GLU C OE1 1 
ATOM   6437  O  OE2 . GLU C 1 209 ? 40.412  115.325 35.065  1.00 30.31  ? 187  GLU C OE2 1 
ATOM   6438  N  N   . ILE C 1 210 ? 41.597  111.134 38.807  1.00 55.28  ? 188  ILE C N   1 
ATOM   6439  C  CA  . ILE C 1 210 ? 41.970  109.740 38.642  1.00 59.03  ? 188  ILE C CA  1 
ATOM   6440  C  C   . ILE C 1 210 ? 41.133  109.038 37.581  1.00 61.75  ? 188  ILE C C   1 
ATOM   6441  O  O   . ILE C 1 210 ? 39.918  109.226 37.496  1.00 65.34  ? 188  ILE C O   1 
ATOM   6442  C  CB  . ILE C 1 210 ? 41.843  108.986 39.971  1.00 57.19  ? 188  ILE C CB  1 
ATOM   6443  C  CG1 . ILE C 1 210 ? 42.742  109.655 41.011  1.00 48.06  ? 188  ILE C CG1 1 
ATOM   6444  C  CG2 . ILE C 1 210 ? 42.219  107.520 39.778  1.00 54.99  ? 188  ILE C CG2 1 
ATOM   6445  C  CD1 . ILE C 1 210 ? 42.646  109.051 42.382  1.00 59.53  ? 188  ILE C CD1 1 
ATOM   6446  N  N   . VAL C 1 211 ? 41.805  108.233 36.767  1.00 63.76  ? 189  VAL C N   1 
ATOM   6447  C  CA  . VAL C 1 211 ? 41.155  107.478 35.706  1.00 64.82  ? 189  VAL C CA  1 
ATOM   6448  C  C   . VAL C 1 211 ? 41.454  106.004 35.933  1.00 67.26  ? 189  VAL C C   1 
ATOM   6449  O  O   . VAL C 1 211 ? 42.615  105.591 35.949  1.00 63.94  ? 189  VAL C O   1 
ATOM   6450  C  CB  . VAL C 1 211 ? 41.681  107.903 34.315  1.00 65.45  ? 189  VAL C CB  1 
ATOM   6451  C  CG1 . VAL C 1 211 ? 41.193  106.933 33.250  1.00 65.09  ? 189  VAL C CG1 1 
ATOM   6452  C  CG2 . VAL C 1 211 ? 41.211  109.321 33.997  1.00 60.90  ? 189  VAL C CG2 1 
ATOM   6453  N  N   . ARG C 1 212 ? 40.396  105.223 36.121  1.00 71.71  ? 190  ARG C N   1 
ATOM   6454  C  CA  . ARG C 1 212 ? 40.519  103.789 36.358  1.00 76.85  ? 190  ARG C CA  1 
ATOM   6455  C  C   . ARG C 1 212 ? 40.345  102.998 35.065  1.00 78.16  ? 190  ARG C C   1 
ATOM   6456  O  O   . ARG C 1 212 ? 39.413  103.246 34.298  1.00 80.53  ? 190  ARG C O   1 
ATOM   6457  C  CB  . ARG C 1 212 ? 39.467  103.348 37.375  1.00 79.93  ? 190  ARG C CB  1 
ATOM   6458  C  CG  . ARG C 1 212 ? 39.587  104.050 38.716  1.00 78.29  ? 190  ARG C CG  1 
ATOM   6459  C  CD  . ARG C 1 212 ? 40.662  103.408 39.592  1.00 81.55  ? 190  ARG C CD  1 
ATOM   6460  N  NE  . ARG C 1 212 ? 40.139  102.288 40.375  1.00 78.45  ? 190  ARG C NE  1 
ATOM   6461  C  CZ  . ARG C 1 212 ? 39.161  102.399 41.272  1.00 77.84  ? 190  ARG C CZ  1 
ATOM   6462  N  NH1 . ARG C 1 212 ? 38.595  103.579 41.500  1.00 79.17  ? 190  ARG C NH1 1 
ATOM   6463  N  NH2 . ARG C 1 212 ? 38.749  101.333 41.944  1.00 73.72  ? 190  ARG C NH2 1 
ATOM   6464  N  N   . THR C 1 213 ? 41.247  102.049 34.830  1.00 78.50  ? 191  THR C N   1 
ATOM   6465  C  CA  . THR C 1 213 ? 41.189  101.219 33.634  1.00 81.72  ? 191  THR C CA  1 
ATOM   6466  C  C   . THR C 1 213 ? 40.813  99.799  34.021  1.00 83.48  ? 191  THR C C   1 
ATOM   6467  O  O   . THR C 1 213 ? 41.161  99.335  35.106  1.00 82.77  ? 191  THR C O   1 
ATOM   6468  C  CB  . THR C 1 213 ? 42.546  101.165 32.909  1.00 82.99  ? 191  THR C CB  1 
ATOM   6469  O  OG1 . THR C 1 213 ? 43.505  100.486 33.730  1.00 82.29  ? 191  THR C OG1 1 
ATOM   6470  C  CG2 . THR C 1 213 ? 43.041  102.566 32.610  1.00 85.64  ? 191  THR C CG2 1 
ATOM   6471  N  N   . PRO C 1 214 ? 40.096  99.088  33.134  1.00 85.76  ? 192  PRO C N   1 
ATOM   6472  C  CA  . PRO C 1 214 ? 39.684  97.707  33.409  1.00 86.88  ? 192  PRO C CA  1 
ATOM   6473  C  C   . PRO C 1 214 ? 40.869  96.783  33.718  1.00 88.68  ? 192  PRO C C   1 
ATOM   6474  O  O   . PRO C 1 214 ? 41.223  96.588  34.886  1.00 90.16  ? 192  PRO C O   1 
ATOM   6475  C  CB  . PRO C 1 214 ? 38.926  97.311  32.136  1.00 86.33  ? 192  PRO C CB  1 
ATOM   6476  C  CG  . PRO C 1 214 ? 39.534  98.195  31.078  1.00 85.40  ? 192  PRO C CG  1 
ATOM   6477  C  CD  . PRO C 1 214 ? 39.652  99.511  31.794  1.00 85.48  ? 192  PRO C CD  1 
ATOM   6478  N  N   . THR C 1 215 ? 41.482  96.226  32.675  1.00 87.86  ? 193  THR C N   1 
ATOM   6479  C  CA  . THR C 1 215 ? 42.625  95.327  32.835  1.00 88.00  ? 193  THR C CA  1 
ATOM   6480  C  C   . THR C 1 215 ? 42.452  94.362  34.013  1.00 88.05  ? 193  THR C C   1 
ATOM   6481  O  O   . THR C 1 215 ? 43.029  94.553  35.087  1.00 84.54  ? 193  THR C O   1 
ATOM   6482  C  CB  . THR C 1 215 ? 43.915  96.139  33.009  1.00 88.09  ? 193  THR C CB  1 
ATOM   6483  N  N   . GLU C 1 223 ? 49.912  98.836  26.432  1.00 77.57  ? 201  GLU C N   1 
ATOM   6484  C  CA  . GLU C 1 223 ? 49.341  98.372  27.695  1.00 81.75  ? 201  GLU C CA  1 
ATOM   6485  C  C   . GLU C 1 223 ? 47.862  98.749  27.846  1.00 82.61  ? 201  GLU C C   1 
ATOM   6486  O  O   . GLU C 1 223 ? 47.191  99.069  26.860  1.00 84.61  ? 201  GLU C O   1 
ATOM   6487  C  CB  . GLU C 1 223 ? 50.143  98.933  28.875  1.00 81.55  ? 201  GLU C CB  1 
ATOM   6488  N  N   . SER C 1 224 ? 47.360  98.700  29.082  1.00 80.60  ? 202  SER C N   1 
ATOM   6489  C  CA  . SER C 1 224 ? 45.962  99.023  29.366  1.00 78.88  ? 202  SER C CA  1 
ATOM   6490  C  C   . SER C 1 224 ? 45.802  100.462 29.834  1.00 78.37  ? 202  SER C C   1 
ATOM   6491  O  O   . SER C 1 224 ? 45.190  101.279 29.142  1.00 77.61  ? 202  SER C O   1 
ATOM   6492  C  CB  . SER C 1 224 ? 45.397  98.080  30.430  1.00 79.57  ? 202  SER C CB  1 
ATOM   6493  O  OG  . SER C 1 224 ? 46.048  98.260  31.675  1.00 81.94  ? 202  SER C OG  1 
ATOM   6494  N  N   . HIS C 1 225 ? 46.343  100.769 31.012  1.00 76.76  ? 203  HIS C N   1 
ATOM   6495  C  CA  . HIS C 1 225 ? 46.253  102.126 31.536  1.00 72.70  ? 203  HIS C CA  1 
ATOM   6496  C  C   . HIS C 1 225 ? 47.192  103.046 30.755  1.00 70.33  ? 203  HIS C C   1 
ATOM   6497  O  O   . HIS C 1 225 ? 46.934  104.244 30.617  1.00 72.16  ? 203  HIS C O   1 
ATOM   6498  C  CB  . HIS C 1 225 ? 46.580  102.168 33.042  1.00 69.40  ? 203  HIS C CB  1 
ATOM   6499  C  CG  . HIS C 1 225 ? 47.954  101.680 33.395  1.00 68.33  ? 203  HIS C CG  1 
ATOM   6500  N  ND1 . HIS C 1 225 ? 48.547  101.955 34.609  1.00 65.11  ? 203  HIS C ND1 1 
ATOM   6501  C  CD2 . HIS C 1 225 ? 48.844  100.927 32.705  1.00 66.97  ? 203  HIS C CD2 1 
ATOM   6502  C  CE1 . HIS C 1 225 ? 49.742  101.395 34.652  1.00 64.10  ? 203  HIS C CE1 1 
ATOM   6503  N  NE2 . HIS C 1 225 ? 49.947  100.765 33.509  1.00 69.19  ? 203  HIS C NE2 1 
ATOM   6504  N  N   . VAL C 1 226 ? 48.275  102.476 30.234  1.00 63.55  ? 204  VAL C N   1 
ATOM   6505  C  CA  . VAL C 1 226 ? 49.233  103.244 29.455  1.00 61.34  ? 204  VAL C CA  1 
ATOM   6506  C  C   . VAL C 1 226 ? 48.566  103.686 28.156  1.00 59.39  ? 204  VAL C C   1 
ATOM   6507  O  O   . VAL C 1 226 ? 48.790  104.801 27.673  1.00 59.36  ? 204  VAL C O   1 
ATOM   6508  C  CB  . VAL C 1 226 ? 50.479  102.403 29.120  1.00 61.14  ? 204  VAL C CB  1 
ATOM   6509  C  CG1 . VAL C 1 226 ? 51.519  103.260 28.417  1.00 54.20  ? 204  VAL C CG1 1 
ATOM   6510  C  CG2 . VAL C 1 226 ? 51.050  101.810 30.393  1.00 67.38  ? 204  VAL C CG2 1 
ATOM   6511  N  N   . GLY C 1 227 ? 47.739  102.805 27.600  1.00 54.77  ? 205  GLY C N   1 
ATOM   6512  C  CA  . GLY C 1 227 ? 47.048  103.123 26.365  1.00 55.17  ? 205  GLY C CA  1 
ATOM   6513  C  C   . GLY C 1 227 ? 46.050  104.245 26.559  1.00 53.04  ? 205  GLY C C   1 
ATOM   6514  O  O   . GLY C 1 227 ? 45.900  105.126 25.707  1.00 49.49  ? 205  GLY C O   1 
ATOM   6515  N  N   . VAL C 1 228 ? 45.363  104.209 27.693  1.00 53.10  ? 206  VAL C N   1 
ATOM   6516  C  CA  . VAL C 1 228 ? 44.371  105.226 28.013  1.00 57.56  ? 206  VAL C CA  1 
ATOM   6517  C  C   . VAL C 1 228 ? 45.058  106.568 28.259  1.00 58.46  ? 206  VAL C C   1 
ATOM   6518  O  O   . VAL C 1 228 ? 44.518  107.630 27.937  1.00 58.63  ? 206  VAL C O   1 
ATOM   6519  C  CB  . VAL C 1 228 ? 43.553  104.828 29.264  1.00 58.61  ? 206  VAL C CB  1 
ATOM   6520  C  CG1 . VAL C 1 228 ? 42.476  105.876 29.545  1.00 54.78  ? 206  VAL C CG1 1 
ATOM   6521  C  CG2 . VAL C 1 228 ? 42.935  103.451 29.054  1.00 53.05  ? 206  VAL C CG2 1 
ATOM   6522  N  N   . ALA C 1 229 ? 46.252  106.515 28.840  1.00 56.28  ? 207  ALA C N   1 
ATOM   6523  C  CA  . ALA C 1 229 ? 47.004  107.723 29.109  1.00 50.74  ? 207  ALA C CA  1 
ATOM   6524  C  C   . ALA C 1 229 ? 47.215  108.394 27.762  1.00 52.44  ? 207  ALA C C   1 
ATOM   6525  O  O   . ALA C 1 229 ? 46.794  109.526 27.553  1.00 47.47  ? 207  ALA C O   1 
ATOM   6526  C  CB  . ALA C 1 229 ? 48.337  107.380 29.743  1.00 45.61  ? 207  ALA C CB  1 
ATOM   6527  N  N   . TRP C 1 230 ? 47.847  107.671 26.843  1.00 56.31  ? 208  TRP C N   1 
ATOM   6528  C  CA  . TRP C 1 230 ? 48.118  108.197 25.514  1.00 61.36  ? 208  TRP C CA  1 
ATOM   6529  C  C   . TRP C 1 230 ? 46.870  108.548 24.713  1.00 63.87  ? 208  TRP C C   1 
ATOM   6530  O  O   . TRP C 1 230 ? 46.917  109.420 23.843  1.00 67.07  ? 208  TRP C O   1 
ATOM   6531  C  CB  . TRP C 1 230 ? 48.996  107.223 24.730  1.00 62.32  ? 208  TRP C CB  1 
ATOM   6532  C  CG  . TRP C 1 230 ? 50.376  107.757 24.575  1.00 69.89  ? 208  TRP C CG  1 
ATOM   6533  C  CD1 . TRP C 1 230 ? 50.820  108.610 23.604  1.00 72.45  ? 208  TRP C CD1 1 
ATOM   6534  C  CD2 . TRP C 1 230 ? 51.482  107.555 25.467  1.00 74.11  ? 208  TRP C CD2 1 
ATOM   6535  N  NE1 . TRP C 1 230 ? 52.131  108.954 23.834  1.00 70.05  ? 208  TRP C NE1 1 
ATOM   6536  C  CE2 . TRP C 1 230 ? 52.564  108.322 24.971  1.00 74.89  ? 208  TRP C CE2 1 
ATOM   6537  C  CE3 . TRP C 1 230 ? 51.664  106.802 26.641  1.00 74.54  ? 208  TRP C CE3 1 
ATOM   6538  C  CZ2 . TRP C 1 230 ? 53.816  108.358 25.606  1.00 76.01  ? 208  TRP C CZ2 1 
ATOM   6539  C  CZ3 . TRP C 1 230 ? 52.910  106.837 27.274  1.00 73.77  ? 208  TRP C CZ3 1 
ATOM   6540  C  CH2 . TRP C 1 230 ? 53.969  107.612 26.751  1.00 78.85  ? 208  TRP C CH2 1 
ATOM   6541  N  N   . ARG C 1 231 ? 45.757  107.882 25.000  1.00 63.04  ? 209  ARG C N   1 
ATOM   6542  C  CA  . ARG C 1 231 ? 44.508  108.174 24.302  1.00 64.85  ? 209  ARG C CA  1 
ATOM   6543  C  C   . ARG C 1 231 ? 44.048  109.574 24.714  1.00 62.92  ? 209  ARG C C   1 
ATOM   6544  O  O   . ARG C 1 231 ? 43.755  110.425 23.874  1.00 59.83  ? 209  ARG C O   1 
ATOM   6545  C  CB  . ARG C 1 231 ? 43.430  107.157 24.687  1.00 69.81  ? 209  ARG C CB  1 
ATOM   6546  C  CG  . ARG C 1 231 ? 42.106  107.330 23.942  1.00 75.06  ? 209  ARG C CG  1 
ATOM   6547  C  CD  . ARG C 1 231 ? 40.946  106.690 24.704  1.00 74.27  ? 209  ARG C CD  1 
ATOM   6548  N  NE  . ARG C 1 231 ? 40.610  107.436 25.919  1.00 77.20  ? 209  ARG C NE  1 
ATOM   6549  C  CZ  . ARG C 1 231 ? 39.617  107.120 26.750  1.00 78.74  ? 209  ARG C CZ  1 
ATOM   6550  N  NH1 . ARG C 1 231 ? 38.849  106.066 26.509  1.00 79.13  ? 209  ARG C NH1 1 
ATOM   6551  N  NH2 . ARG C 1 231 ? 39.384  107.863 27.824  1.00 77.05  ? 209  ARG C NH2 1 
ATOM   6552  N  N   . LEU C 1 232 ? 43.997  109.793 26.026  1.00 61.86  ? 210  LEU C N   1 
ATOM   6553  C  CA  . LEU C 1 232 ? 43.579  111.067 26.613  1.00 55.46  ? 210  LEU C CA  1 
ATOM   6554  C  C   . LEU C 1 232 ? 44.460  112.237 26.199  1.00 51.11  ? 210  LEU C C   1 
ATOM   6555  O  O   . LEU C 1 232 ? 43.979  113.355 26.046  1.00 44.40  ? 210  LEU C O   1 
ATOM   6556  C  CB  . LEU C 1 232 ? 43.586  110.954 28.137  1.00 55.10  ? 210  LEU C CB  1 
ATOM   6557  C  CG  . LEU C 1 232 ? 42.584  109.965 28.729  1.00 52.38  ? 210  LEU C CG  1 
ATOM   6558  C  CD1 . LEU C 1 232 ? 42.992  109.606 30.144  1.00 56.86  ? 210  LEU C CD1 1 
ATOM   6559  C  CD2 . LEU C 1 232 ? 41.197  110.565 28.693  1.00 50.55  ? 210  LEU C CD2 1 
ATOM   6560  N  N   . LYS C 1 233 ? 45.753  111.978 26.037  1.00 52.03  ? 211  LYS C N   1 
ATOM   6561  C  CA  . LYS C 1 233 ? 46.678  113.027 25.643  1.00 53.03  ? 211  LYS C CA  1 
ATOM   6562  C  C   . LYS C 1 233 ? 46.271  113.625 24.304  1.00 54.12  ? 211  LYS C C   1 
ATOM   6563  O  O   . LYS C 1 233 ? 46.386  114.830 24.101  1.00 54.24  ? 211  LYS C O   1 
ATOM   6564  C  CB  . LYS C 1 233 ? 48.107  112.493 25.539  1.00 47.79  ? 211  LYS C CB  1 
ATOM   6565  C  CG  . LYS C 1 233 ? 49.092  113.572 25.118  1.00 47.85  ? 211  LYS C CG  1 
ATOM   6566  C  CD  . LYS C 1 233 ? 50.494  113.041 24.898  1.00 47.79  ? 211  LYS C CD  1 
ATOM   6567  C  CE  . LYS C 1 233 ? 51.419  114.180 24.473  1.00 35.50  ? 211  LYS C CE  1 
ATOM   6568  N  NZ  . LYS C 1 233 ? 50.921  114.858 23.236  1.00 24.46  ? 211  LYS C NZ  1 
ATOM   6569  N  N   . ASN C 1 234 ? 45.804  112.775 23.393  1.00 56.60  ? 212  ASN C N   1 
ATOM   6570  C  CA  . ASN C 1 234 ? 45.379  113.222 22.072  1.00 58.82  ? 212  ASN C CA  1 
ATOM   6571  C  C   . ASN C 1 234 ? 43.979  113.809 22.120  1.00 58.77  ? 212  ASN C C   1 
ATOM   6572  O  O   . ASN C 1 234 ? 43.579  114.550 21.227  1.00 60.51  ? 212  ASN C O   1 
ATOM   6573  C  CB  . ASN C 1 234 ? 45.385  112.058 21.081  1.00 62.08  ? 212  ASN C CB  1 
ATOM   6574  C  CG  . ASN C 1 234 ? 46.750  111.428 20.935  1.00 66.21  ? 212  ASN C CG  1 
ATOM   6575  O  OD1 . ASN C 1 234 ? 47.737  112.115 20.671  1.00 62.82  ? 212  ASN C OD1 1 
ATOM   6576  N  ND2 . ASN C 1 234 ? 46.814  110.109 21.100  1.00 67.13  ? 212  ASN C ND2 1 
ATOM   6577  N  N   . GLU C 1 235 ? 43.235  113.479 23.167  1.00 55.75  ? 213  GLU C N   1 
ATOM   6578  C  CA  . GLU C 1 235 ? 41.876  113.971 23.297  1.00 57.19  ? 213  GLU C CA  1 
ATOM   6579  C  C   . GLU C 1 235 ? 41.773  115.252 24.115  1.00 56.13  ? 213  GLU C C   1 
ATOM   6580  O  O   . GLU C 1 235 ? 40.760  115.954 24.063  1.00 56.96  ? 213  GLU C O   1 
ATOM   6581  C  CB  . GLU C 1 235 ? 40.996  112.887 23.918  1.00 60.70  ? 213  GLU C CB  1 
ATOM   6582  C  CG  . GLU C 1 235 ? 40.976  111.599 23.123  1.00 58.99  ? 213  GLU C CG  1 
ATOM   6583  C  CD  . GLU C 1 235 ? 39.975  110.600 23.655  1.00 66.25  ? 213  GLU C CD  1 
ATOM   6584  O  OE1 . GLU C 1 235 ? 39.834  109.521 23.034  1.00 71.25  ? 213  GLU C OE1 1 
ATOM   6585  O  OE2 . GLU C 1 235 ? 39.329  110.894 24.687  1.00 71.84  ? 213  GLU C OE2 1 
ATOM   6586  N  N   . ILE C 1 236 ? 42.818  115.568 24.868  1.00 53.12  ? 214  ILE C N   1 
ATOM   6587  C  CA  . ILE C 1 236 ? 42.786  116.773 25.686  1.00 46.56  ? 214  ILE C CA  1 
ATOM   6588  C  C   . ILE C 1 236 ? 43.821  117.802 25.268  1.00 39.18  ? 214  ILE C C   1 
ATOM   6589  O  O   . ILE C 1 236 ? 45.019  117.543 25.318  1.00 38.46  ? 214  ILE C O   1 
ATOM   6590  C  CB  . ILE C 1 236 ? 42.991  116.436 27.167  1.00 47.02  ? 214  ILE C CB  1 
ATOM   6591  C  CG1 . ILE C 1 236 ? 42.038  115.308 27.572  1.00 49.07  ? 214  ILE C CG1 1 
ATOM   6592  C  CG2 . ILE C 1 236 ? 42.738  117.669 28.010  1.00 46.09  ? 214  ILE C CG2 1 
ATOM   6593  C  CD1 . ILE C 1 236 ? 42.322  114.708 28.924  1.00 52.15  ? 214  ILE C CD1 1 
ATOM   6594  N  N   . PRO C 1 237 ? 43.364  118.992 24.850  1.00 32.55  ? 215  PRO C N   1 
ATOM   6595  C  CA  . PRO C 1 237 ? 44.256  120.066 24.422  1.00 31.25  ? 215  PRO C CA  1 
ATOM   6596  C  C   . PRO C 1 237 ? 45.223  120.424 25.564  1.00 31.43  ? 215  PRO C C   1 
ATOM   6597  O  O   . PRO C 1 237 ? 44.854  120.346 26.740  1.00 39.04  ? 215  PRO C O   1 
ATOM   6598  C  CB  . PRO C 1 237 ? 43.290  121.212 24.119  1.00 32.36  ? 215  PRO C CB  1 
ATOM   6599  C  CG  . PRO C 1 237 ? 41.976  120.539 23.891  1.00 29.18  ? 215  PRO C CG  1 
ATOM   6600  C  CD  . PRO C 1 237 ? 41.973  119.466 24.905  1.00 29.83  ? 215  PRO C CD  1 
ATOM   6601  N  N   . ASN C 1 238 ? 46.445  120.820 25.214  1.00 25.82  ? 216  ASN C N   1 
ATOM   6602  C  CA  . ASN C 1 238 ? 47.461  121.196 26.192  1.00 19.82  ? 216  ASN C CA  1 
ATOM   6603  C  C   . ASN C 1 238 ? 47.839  120.072 27.151  1.00 24.78  ? 216  ASN C C   1 
ATOM   6604  O  O   . ASN C 1 238 ? 48.101  120.314 28.338  1.00 20.55  ? 216  ASN C O   1 
ATOM   6605  C  CB  . ASN C 1 238 ? 47.004  122.415 26.996  1.00 23.78  ? 216  ASN C CB  1 
ATOM   6606  C  CG  . ASN C 1 238 ? 46.866  123.655 26.140  1.00 27.33  ? 216  ASN C CG  1 
ATOM   6607  O  OD1 . ASN C 1 238 ? 47.697  123.903 25.253  1.00 29.32  ? 216  ASN C OD1 1 
ATOM   6608  N  ND2 . ASN C 1 238 ? 45.828  124.457 26.407  1.00 14.68  ? 216  ASN C ND2 1 
ATOM   6609  N  N   . SER C 1 239 ? 47.868  118.845 26.634  1.00 22.12  ? 217  SER C N   1 
ATOM   6610  C  CA  . SER C 1 239 ? 48.215  117.688 27.447  1.00 24.75  ? 217  SER C CA  1 
ATOM   6611  C  C   . SER C 1 239 ? 49.642  117.278 27.227  1.00 24.68  ? 217  SER C C   1 
ATOM   6612  O  O   . SER C 1 239 ? 50.179  117.425 26.130  1.00 18.70  ? 217  SER C O   1 
ATOM   6613  C  CB  . SER C 1 239 ? 47.322  116.493 27.137  1.00 23.08  ? 217  SER C CB  1 
ATOM   6614  O  OG  . SER C 1 239 ? 46.088  116.624 27.799  1.00 29.80  ? 217  SER C OG  1 
ATOM   6615  N  N   . HIS C 1 240 ? 50.243  116.755 28.290  1.00 29.10  ? 218  HIS C N   1 
ATOM   6616  C  CA  . HIS C 1 240 ? 51.619  116.291 28.264  1.00 24.48  ? 218  HIS C CA  1 
ATOM   6617  C  C   . HIS C 1 240 ? 51.773  115.088 29.172  1.00 21.41  ? 218  HIS C C   1 
ATOM   6618  O  O   . HIS C 1 240 ? 51.325  115.095 30.318  1.00 21.56  ? 218  HIS C O   1 
ATOM   6619  C  CB  . HIS C 1 240 ? 52.576  117.376 28.768  1.00 32.24  ? 218  HIS C CB  1 
ATOM   6620  C  CG  . HIS C 1 240 ? 52.423  118.696 28.082  1.00 34.10  ? 218  HIS C CG  1 
ATOM   6621  N  ND1 . HIS C 1 240 ? 53.051  118.995 26.892  1.00 28.23  ? 218  HIS C ND1 1 
ATOM   6622  C  CD2 . HIS C 1 240 ? 51.708  119.796 28.422  1.00 35.38  ? 218  HIS C CD2 1 
ATOM   6623  C  CE1 . HIS C 1 240 ? 52.730  120.225 26.532  1.00 42.51  ? 218  HIS C CE1 1 
ATOM   6624  N  NE2 . HIS C 1 240 ? 51.916  120.733 27.442  1.00 37.16  ? 218  HIS C NE2 1 
ATOM   6625  N  N   . ILE C 1 241 ? 52.410  114.059 28.652  1.00 17.89  ? 219  ILE C N   1 
ATOM   6626  C  CA  . ILE C 1 241 ? 52.695  112.884 29.435  1.00 27.99  ? 219  ILE C CA  1 
ATOM   6627  C  C   . ILE C 1 241 ? 54.193  112.976 29.675  1.00 30.46  ? 219  ILE C C   1 
ATOM   6628  O  O   . ILE C 1 241 ? 54.987  112.761 28.754  1.00 31.59  ? 219  ILE C O   1 
ATOM   6629  C  CB  . ILE C 1 241 ? 52.373  111.618 28.664  1.00 30.05  ? 219  ILE C CB  1 
ATOM   6630  C  CG1 . ILE C 1 241 ? 50.854  111.493 28.518  1.00 30.12  ? 219  ILE C CG1 1 
ATOM   6631  C  CG2 . ILE C 1 241 ? 52.964  110.422 29.384  1.00 34.74  ? 219  ILE C CG2 1 
ATOM   6632  C  CD1 . ILE C 1 241 ? 50.414  110.412 27.531  1.00 36.73  ? 219  ILE C CD1 1 
ATOM   6633  N  N   . LEU C 1 242 ? 54.582  113.332 30.897  1.00 27.12  ? 220  LEU C N   1 
ATOM   6634  C  CA  . LEU C 1 242 ? 55.995  113.464 31.209  1.00 19.50  ? 220  LEU C CA  1 
ATOM   6635  C  C   . LEU C 1 242 ? 56.756  112.163 30.993  1.00 24.43  ? 220  LEU C C   1 
ATOM   6636  O  O   . LEU C 1 242 ? 57.772  112.157 30.311  1.00 33.60  ? 220  LEU C O   1 
ATOM   6637  C  CB  . LEU C 1 242 ? 56.162  114.014 32.618  1.00 9.33   ? 220  LEU C CB  1 
ATOM   6638  C  CG  . LEU C 1 242 ? 55.626  115.453 32.640  1.00 14.93  ? 220  LEU C CG  1 
ATOM   6639  C  CD1 . LEU C 1 242 ? 55.673  116.018 34.040  1.00 6.70   ? 220  LEU C CD1 1 
ATOM   6640  C  CD2 . LEU C 1 242 ? 56.465  116.343 31.661  1.00 9.15   ? 220  LEU C CD2 1 
ATOM   6641  N  N   . ASP C 1 243 ? 56.278  111.068 31.567  1.00 29.19  ? 221  ASP C N   1 
ATOM   6642  C  CA  . ASP C 1 243 ? 56.893  109.761 31.357  1.00 31.64  ? 221  ASP C CA  1 
ATOM   6643  C  C   . ASP C 1 243 ? 58.248  109.559 31.997  1.00 27.99  ? 221  ASP C C   1 
ATOM   6644  O  O   . ASP C 1 243 ? 59.286  109.805 31.395  1.00 35.21  ? 221  ASP C O   1 
ATOM   6645  C  CB  . ASP C 1 243 ? 56.971  109.466 29.839  1.00 37.94  ? 221  ASP C CB  1 
ATOM   6646  C  CG  . ASP C 1 243 ? 57.520  108.078 29.523  1.00 47.19  ? 221  ASP C CG  1 
ATOM   6647  O  OD1 . ASP C 1 243 ? 57.675  107.758 28.323  1.00 52.95  ? 221  ASP C OD1 1 
ATOM   6648  O  OD2 . ASP C 1 243 ? 57.800  107.308 30.466  1.00 51.43  ? 221  ASP C OD2 1 
ATOM   6649  N  N   . GLN C 1 244 ? 58.224  109.051 33.216  1.00 33.48  ? 222  GLN C N   1 
ATOM   6650  C  CA  . GLN C 1 244 ? 59.431  108.777 33.988  1.00 36.97  ? 222  GLN C CA  1 
ATOM   6651  C  C   . GLN C 1 244 ? 60.368  107.709 33.408  1.00 38.64  ? 222  GLN C C   1 
ATOM   6652  O  O   . GLN C 1 244 ? 61.557  107.684 33.723  1.00 37.92  ? 222  GLN C O   1 
ATOM   6653  C  CB  . GLN C 1 244 ? 59.025  108.350 35.398  1.00 40.44  ? 222  GLN C CB  1 
ATOM   6654  C  CG  . GLN C 1 244 ? 58.011  107.214 35.404  1.00 41.84  ? 222  GLN C CG  1 
ATOM   6655  C  CD  . GLN C 1 244 ? 57.431  106.950 36.777  1.00 42.72  ? 222  GLN C CD  1 
ATOM   6656  O  OE1 . GLN C 1 244 ? 56.260  106.603 36.905  1.00 39.37  ? 222  GLN C OE1 1 
ATOM   6657  N  NE2 . GLN C 1 244 ? 58.249  107.106 37.808  1.00 33.63  ? 222  GLN C NE2 1 
ATOM   6658  N  N   . TYR C 1 245 ? 59.837  106.824 32.573  1.00 40.10  ? 223  TYR C N   1 
ATOM   6659  C  CA  . TYR C 1 245 ? 60.640  105.748 32.012  1.00 40.86  ? 223  TYR C CA  1 
ATOM   6660  C  C   . TYR C 1 245 ? 61.560  106.153 30.874  1.00 42.91  ? 223  TYR C C   1 
ATOM   6661  O  O   . TYR C 1 245 ? 62.553  105.471 30.613  1.00 48.34  ? 223  TYR C O   1 
ATOM   6662  C  CB  . TYR C 1 245 ? 59.730  104.590 31.597  1.00 42.41  ? 223  TYR C CB  1 
ATOM   6663  C  CG  . TYR C 1 245 ? 59.150  103.843 32.791  1.00 51.69  ? 223  TYR C CG  1 
ATOM   6664  C  CD1 . TYR C 1 245 ? 59.936  102.948 33.529  1.00 54.64  ? 223  TYR C CD1 1 
ATOM   6665  C  CD2 . TYR C 1 245 ? 57.835  104.060 33.212  1.00 50.04  ? 223  TYR C CD2 1 
ATOM   6666  C  CE1 . TYR C 1 245 ? 59.430  102.293 34.651  1.00 53.10  ? 223  TYR C CE1 1 
ATOM   6667  C  CE2 . TYR C 1 245 ? 57.318  103.407 34.337  1.00 55.31  ? 223  TYR C CE2 1 
ATOM   6668  C  CZ  . TYR C 1 245 ? 58.123  102.526 35.050  1.00 57.12  ? 223  TYR C CZ  1 
ATOM   6669  O  OH  . TYR C 1 245 ? 57.626  101.884 36.164  1.00 61.83  ? 223  TYR C OH  1 
ATOM   6670  N  N   . ARG C 1 246 ? 61.258  107.267 30.211  1.00 41.02  ? 224  ARG C N   1 
ATOM   6671  C  CA  . ARG C 1 246 ? 62.105  107.725 29.109  1.00 35.81  ? 224  ARG C CA  1 
ATOM   6672  C  C   . ARG C 1 246 ? 62.636  109.145 29.269  1.00 28.22  ? 224  ARG C C   1 
ATOM   6673  O  O   . ARG C 1 246 ? 63.601  109.527 28.602  1.00 20.59  ? 224  ARG C O   1 
ATOM   6674  C  CB  . ARG C 1 246 ? 61.360  107.639 27.761  1.00 44.01  ? 224  ARG C CB  1 
ATOM   6675  C  CG  . ARG C 1 246 ? 61.043  106.228 27.280  1.00 40.10  ? 224  ARG C CG  1 
ATOM   6676  C  CD  . ARG C 1 246 ? 60.763  106.187 25.781  1.00 45.36  ? 224  ARG C CD  1 
ATOM   6677  N  NE  . ARG C 1 246 ? 61.971  106.351 24.965  1.00 54.98  ? 224  ARG C NE  1 
ATOM   6678  C  CZ  . ARG C 1 246 ? 62.223  107.399 24.178  1.00 51.51  ? 224  ARG C CZ  1 
ATOM   6679  N  NH1 . ARG C 1 246 ? 61.353  108.396 24.089  1.00 58.24  ? 224  ARG C NH1 1 
ATOM   6680  N  NH2 . ARG C 1 246 ? 63.343  107.447 23.471  1.00 47.47  ? 224  ARG C NH2 1 
ATOM   6681  N  N   . ASN C 1 247 ? 62.016  109.923 30.148  1.00 24.53  ? 225  ASN C N   1 
ATOM   6682  C  CA  . ASN C 1 247 ? 62.427  111.309 30.336  1.00 20.80  ? 225  ASN C CA  1 
ATOM   6683  C  C   . ASN C 1 247 ? 63.760  111.503 31.048  1.00 19.33  ? 225  ASN C C   1 
ATOM   6684  O  O   . ASN C 1 247 ? 63.878  111.222 32.229  1.00 22.85  ? 225  ASN C O   1 
ATOM   6685  C  CB  . ASN C 1 247 ? 61.344  112.069 31.084  1.00 9.88   ? 225  ASN C CB  1 
ATOM   6686  C  CG  . ASN C 1 247 ? 61.508  113.562 30.955  1.00 15.56  ? 225  ASN C CG  1 
ATOM   6687  O  OD1 . ASN C 1 247 ? 62.628  114.075 31.025  1.00 14.06  ? 225  ASN C OD1 1 
ATOM   6688  N  ND2 . ASN C 1 247 ? 60.394  114.274 30.774  1.00 6.50   ? 225  ASN C ND2 1 
ATOM   6689  N  N   . ALA C 1 248 ? 64.749  112.015 30.323  1.00 23.73  ? 226  ALA C N   1 
ATOM   6690  C  CA  . ALA C 1 248 ? 66.092  112.258 30.857  1.00 28.95  ? 226  ALA C CA  1 
ATOM   6691  C  C   . ALA C 1 248 ? 66.126  113.037 32.160  1.00 28.44  ? 226  ALA C C   1 
ATOM   6692  O  O   . ALA C 1 248 ? 67.055  112.880 32.954  1.00 36.06  ? 226  ALA C O   1 
ATOM   6693  C  CB  . ALA C 1 248 ? 66.945  112.984 29.810  1.00 23.80  ? 226  ALA C CB  1 
ATOM   6694  N  N   . SER C 1 249 ? 65.121  113.886 32.367  1.00 30.57  ? 227  SER C N   1 
ATOM   6695  C  CA  . SER C 1 249 ? 65.029  114.704 33.577  1.00 25.67  ? 227  SER C CA  1 
ATOM   6696  C  C   . SER C 1 249 ? 65.061  113.857 34.847  1.00 22.72  ? 227  SER C C   1 
ATOM   6697  O  O   . SER C 1 249 ? 65.457  114.330 35.905  1.00 20.90  ? 227  SER C O   1 
ATOM   6698  C  CB  . SER C 1 249 ? 63.746  115.527 33.551  1.00 24.40  ? 227  SER C CB  1 
ATOM   6699  O  OG  . SER C 1 249 ? 63.707  116.349 32.403  1.00 25.24  ? 227  SER C OG  1 
ATOM   6700  N  N   . ASN C 1 250 ? 64.635  112.605 34.731  1.00 21.12  ? 228  ASN C N   1 
ATOM   6701  C  CA  . ASN C 1 250 ? 64.626  111.686 35.860  1.00 27.83  ? 228  ASN C CA  1 
ATOM   6702  C  C   . ASN C 1 250 ? 66.057  111.366 36.301  1.00 28.18  ? 228  ASN C C   1 
ATOM   6703  O  O   . ASN C 1 250 ? 66.485  111.778 37.379  1.00 21.06  ? 228  ASN C O   1 
ATOM   6704  C  CB  . ASN C 1 250 ? 63.878  110.402 35.483  1.00 29.32  ? 228  ASN C CB  1 
ATOM   6705  C  CG  . ASN C 1 250 ? 63.955  109.350 36.553  1.00 34.50  ? 228  ASN C CG  1 
ATOM   6706  O  OD1 . ASN C 1 250 ? 64.666  109.509 37.545  1.00 43.75  ? 228  ASN C OD1 1 
ATOM   6707  N  ND2 . ASN C 1 250 ? 63.232  108.253 36.357  1.00 33.06  ? 228  ASN C ND2 1 
ATOM   6708  N  N   . PRO C 1 251 ? 66.818  110.626 35.476  1.00 26.47  ? 229  PRO C N   1 
ATOM   6709  C  CA  . PRO C 1 251 ? 68.179  110.338 35.918  1.00 27.58  ? 229  PRO C CA  1 
ATOM   6710  C  C   . PRO C 1 251 ? 68.989  111.607 36.096  1.00 23.00  ? 229  PRO C C   1 
ATOM   6711  O  O   . PRO C 1 251 ? 69.923  111.637 36.893  1.00 20.55  ? 229  PRO C O   1 
ATOM   6712  C  CB  . PRO C 1 251 ? 68.720  109.453 34.804  1.00 29.09  ? 229  PRO C CB  1 
ATOM   6713  C  CG  . PRO C 1 251 ? 67.999  109.966 33.596  1.00 29.82  ? 229  PRO C CG  1 
ATOM   6714  C  CD  . PRO C 1 251 ? 66.594  110.082 34.127  1.00 29.12  ? 229  PRO C CD  1 
ATOM   6715  N  N   . LEU C 1 252 ? 68.630  112.657 35.362  1.00 18.49  ? 230  LEU C N   1 
ATOM   6716  C  CA  . LEU C 1 252 ? 69.365  113.911 35.478  1.00 20.31  ? 230  LEU C CA  1 
ATOM   6717  C  C   . LEU C 1 252 ? 69.194  114.554 36.852  1.00 23.93  ? 230  LEU C C   1 
ATOM   6718  O  O   . LEU C 1 252 ? 70.149  115.102 37.424  1.00 26.81  ? 230  LEU C O   1 
ATOM   6719  C  CB  . LEU C 1 252 ? 68.943  114.879 34.384  1.00 18.40  ? 230  LEU C CB  1 
ATOM   6720  C  CG  . LEU C 1 252 ? 69.532  114.594 33.002  1.00 22.67  ? 230  LEU C CG  1 
ATOM   6721  C  CD1 . LEU C 1 252 ? 68.928  115.561 32.009  1.00 13.66  ? 230  LEU C CD1 1 
ATOM   6722  C  CD2 . LEU C 1 252 ? 71.066  114.703 33.042  1.00 18.17  ? 230  LEU C CD2 1 
ATOM   6723  N  N   . ALA C 1 253 ? 67.980  114.483 37.390  1.00 24.14  ? 231  ALA C N   1 
ATOM   6724  C  CA  . ALA C 1 253 ? 67.716  115.051 38.709  1.00 21.40  ? 231  ALA C CA  1 
ATOM   6725  C  C   . ALA C 1 253 ? 68.725  114.480 39.706  1.00 24.86  ? 231  ALA C C   1 
ATOM   6726  O  O   . ALA C 1 253 ? 69.368  115.220 40.471  1.00 27.42  ? 231  ALA C O   1 
ATOM   6727  C  CB  . ALA C 1 253 ? 66.283  114.722 39.158  1.00 15.95  ? 231  ALA C CB  1 
ATOM   6728  N  N   . HIS C 1 254 ? 68.864  113.155 39.678  1.00 31.06  ? 232  HIS C N   1 
ATOM   6729  C  CA  . HIS C 1 254 ? 69.766  112.424 40.564  1.00 21.73  ? 232  HIS C CA  1 
ATOM   6730  C  C   . HIS C 1 254 ? 71.246  112.625 40.293  1.00 24.84  ? 232  HIS C C   1 
ATOM   6731  O  O   . HIS C 1 254 ? 72.050  112.545 41.217  1.00 27.89  ? 232  HIS C O   1 
ATOM   6732  C  CB  . HIS C 1 254 ? 69.423  110.940 40.521  1.00 25.10  ? 232  HIS C CB  1 
ATOM   6733  C  CG  . HIS C 1 254 ? 68.029  110.645 40.982  1.00 29.31  ? 232  HIS C CG  1 
ATOM   6734  N  ND1 . HIS C 1 254 ? 67.594  110.947 42.254  1.00 33.05  ? 232  HIS C ND1 1 
ATOM   6735  C  CD2 . HIS C 1 254 ? 66.964  110.116 40.333  1.00 32.00  ? 232  HIS C CD2 1 
ATOM   6736  C  CE1 . HIS C 1 254 ? 66.320  110.618 42.368  1.00 36.25  ? 232  HIS C CE1 1 
ATOM   6737  N  NE2 . HIS C 1 254 ? 65.914  110.111 41.217  1.00 37.89  ? 232  HIS C NE2 1 
ATOM   6738  N  N   . TYR C 1 255 ? 71.614  112.890 39.042  1.00 23.62  ? 233  TYR C N   1 
ATOM   6739  C  CA  . TYR C 1 255 ? 73.016  113.116 38.688  1.00 24.21  ? 233  TYR C CA  1 
ATOM   6740  C  C   . TYR C 1 255 ? 73.402  114.521 39.115  1.00 26.69  ? 233  TYR C C   1 
ATOM   6741  O  O   . TYR C 1 255 ? 74.539  114.767 39.518  1.00 25.27  ? 233  TYR C O   1 
ATOM   6742  C  CB  . TYR C 1 255 ? 73.194  112.989 37.176  1.00 32.13  ? 233  TYR C CB  1 
ATOM   6743  C  CG  . TYR C 1 255 ? 74.562  113.364 36.611  1.00 28.34  ? 233  TYR C CG  1 
ATOM   6744  C  CD1 . TYR C 1 255 ? 75.645  112.474 36.684  1.00 20.97  ? 233  TYR C CD1 1 
ATOM   6745  C  CD2 . TYR C 1 255 ? 74.755  114.589 35.960  1.00 24.66  ? 233  TYR C CD2 1 
ATOM   6746  C  CE1 . TYR C 1 255 ? 76.877  112.789 36.118  1.00 25.70  ? 233  TYR C CE1 1 
ATOM   6747  C  CE2 . TYR C 1 255 ? 75.992  114.916 35.390  1.00 26.21  ? 233  TYR C CE2 1 
ATOM   6748  C  CZ  . TYR C 1 255 ? 77.047  114.011 35.471  1.00 30.79  ? 233  TYR C CZ  1 
ATOM   6749  O  OH  . TYR C 1 255 ? 78.260  114.315 34.895  1.00 28.79  ? 233  TYR C OH  1 
ATOM   6750  N  N   . ASP C 1 256 ? 72.432  115.430 39.021  1.00 29.01  ? 234  ASP C N   1 
ATOM   6751  C  CA  . ASP C 1 256 ? 72.622  116.839 39.360  1.00 29.95  ? 234  ASP C CA  1 
ATOM   6752  C  C   . ASP C 1 256 ? 72.480  117.232 40.827  1.00 31.44  ? 234  ASP C C   1 
ATOM   6753  O  O   . ASP C 1 256 ? 73.227  118.083 41.306  1.00 39.25  ? 234  ASP C O   1 
ATOM   6754  C  CB  . ASP C 1 256 ? 71.662  117.709 38.541  1.00 25.61  ? 234  ASP C CB  1 
ATOM   6755  C  CG  . ASP C 1 256 ? 72.092  117.861 37.103  1.00 24.17  ? 234  ASP C CG  1 
ATOM   6756  O  OD1 . ASP C 1 256 ? 73.262  117.550 36.794  1.00 33.32  ? 234  ASP C OD1 1 
ATOM   6757  O  OD2 . ASP C 1 256 ? 71.266  118.310 36.277  1.00 24.73  ? 234  ASP C OD2 1 
ATOM   6758  N  N   . THR C 1 257 ? 71.519  116.635 41.531  1.00 30.77  ? 235  THR C N   1 
ATOM   6759  C  CA  . THR C 1 257 ? 71.291  116.976 42.935  1.00 32.33  ? 235  THR C CA  1 
ATOM   6760  C  C   . THR C 1 257 ? 71.604  115.851 43.929  1.00 36.21  ? 235  THR C C   1 
ATOM   6761  O  O   . THR C 1 257 ? 72.499  115.987 44.760  1.00 39.18  ? 235  THR C O   1 
ATOM   6762  C  CB  . THR C 1 257 ? 69.840  117.409 43.151  1.00 29.13  ? 235  THR C CB  1 
ATOM   6763  O  OG1 . THR C 1 257 ? 68.971  116.301 42.881  1.00 32.56  ? 235  THR C OG1 1 
ATOM   6764  C  CG2 . THR C 1 257 ? 69.482  118.537 42.220  1.00 26.46  ? 235  THR C CG2 1 
ATOM   6765  N  N   . THR C 1 258 ? 70.873  114.744 43.836  1.00 31.32  ? 236  THR C N   1 
ATOM   6766  C  CA  . THR C 1 258 ? 71.056  113.621 44.749  1.00 27.02  ? 236  THR C CA  1 
ATOM   6767  C  C   . THR C 1 258 ? 72.496  113.141 44.880  1.00 30.64  ? 236  THR C C   1 
ATOM   6768  O  O   . THR C 1 258 ? 73.023  113.007 45.989  1.00 30.53  ? 236  THR C O   1 
ATOM   6769  C  CB  . THR C 1 258 ? 70.193  112.409 44.338  1.00 25.76  ? 236  THR C CB  1 
ATOM   6770  O  OG1 . THR C 1 258 ? 68.938  112.864 43.815  1.00 22.64  ? 236  THR C OG1 1 
ATOM   6771  C  CG2 . THR C 1 258 ? 69.925  111.520 45.571  1.00 24.62  ? 236  THR C CG2 1 
ATOM   6772  N  N   . ALA C 1 259 ? 73.125  112.862 43.745  1.00 32.27  ? 237  ALA C N   1 
ATOM   6773  C  CA  . ALA C 1 259 ? 74.504  112.397 43.740  1.00 28.07  ? 237  ALA C CA  1 
ATOM   6774  C  C   . ALA C 1 259 ? 75.398  113.442 44.383  1.00 28.80  ? 237  ALA C C   1 
ATOM   6775  O  O   . ALA C 1 259 ? 76.235  113.123 45.235  1.00 35.80  ? 237  ALA C O   1 
ATOM   6776  C  CB  . ALA C 1 259 ? 74.962  112.128 42.318  1.00 24.77  ? 237  ALA C CB  1 
ATOM   6777  N  N   . ASP C 1 260 ? 75.212  114.694 43.972  1.00 25.04  ? 238  ASP C N   1 
ATOM   6778  C  CA  . ASP C 1 260 ? 76.008  115.792 44.500  1.00 27.71  ? 238  ASP C CA  1 
ATOM   6779  C  C   . ASP C 1 260 ? 75.802  115.985 45.998  1.00 31.10  ? 238  ASP C C   1 
ATOM   6780  O  O   . ASP C 1 260 ? 76.768  116.170 46.730  1.00 36.41  ? 238  ASP C O   1 
ATOM   6781  C  CB  . ASP C 1 260 ? 75.709  117.086 43.741  1.00 23.23  ? 238  ASP C CB  1 
ATOM   6782  C  CG  . ASP C 1 260 ? 76.626  117.279 42.535  1.00 32.46  ? 238  ASP C CG  1 
ATOM   6783  O  OD1 . ASP C 1 260 ? 76.414  118.240 41.761  1.00 32.09  ? 238  ASP C OD1 1 
ATOM   6784  O  OD2 . ASP C 1 260 ? 77.568  116.472 42.363  1.00 28.74  ? 238  ASP C OD2 1 
ATOM   6785  N  N   . GLU C 1 261 ? 74.555  115.938 46.456  1.00 30.58  ? 239  GLU C N   1 
ATOM   6786  C  CA  . GLU C 1 261 ? 74.271  116.084 47.876  1.00 25.73  ? 239  GLU C CA  1 
ATOM   6787  C  C   . GLU C 1 261 ? 75.019  114.976 48.619  1.00 29.95  ? 239  GLU C C   1 
ATOM   6788  O  O   . GLU C 1 261 ? 75.717  115.237 49.608  1.00 28.47  ? 239  GLU C O   1 
ATOM   6789  C  CB  . GLU C 1 261 ? 72.762  115.962 48.148  1.00 18.09  ? 239  GLU C CB  1 
ATOM   6790  C  CG  . GLU C 1 261 ? 71.932  117.075 47.538  1.00 12.60  ? 239  GLU C CG  1 
ATOM   6791  C  CD  . GLU C 1 261 ? 70.438  116.942 47.791  1.00 20.89  ? 239  GLU C CD  1 
ATOM   6792  O  OE1 . GLU C 1 261 ? 69.674  117.707 47.148  1.00 29.82  ? 239  GLU C OE1 1 
ATOM   6793  O  OE2 . GLU C 1 261 ? 70.019  116.094 48.618  1.00 11.80  ? 239  GLU C OE2 1 
ATOM   6794  N  N   . ILE C 1 262 ? 74.880  113.744 48.129  1.00 27.28  ? 240  ILE C N   1 
ATOM   6795  C  CA  . ILE C 1 262 ? 75.544  112.611 48.756  1.00 21.95  ? 240  ILE C CA  1 
ATOM   6796  C  C   . ILE C 1 262 ? 77.035  112.863 48.942  1.00 22.88  ? 240  ILE C C   1 
ATOM   6797  O  O   . ILE C 1 262 ? 77.568  112.689 50.038  1.00 29.02  ? 240  ILE C O   1 
ATOM   6798  C  CB  . ILE C 1 262 ? 75.351  111.327 47.938  1.00 17.56  ? 240  ILE C CB  1 
ATOM   6799  C  CG1 . ILE C 1 262 ? 73.889  110.885 48.024  1.00 17.11  ? 240  ILE C CG1 1 
ATOM   6800  C  CG2 . ILE C 1 262 ? 76.271  110.241 48.454  1.00 6.13   ? 240  ILE C CG2 1 
ATOM   6801  C  CD1 . ILE C 1 262 ? 73.579  109.612 47.244  1.00 30.74  ? 240  ILE C CD1 1 
ATOM   6802  N  N   . LEU C 1 263 ? 77.710  113.287 47.881  1.00 21.92  ? 241  LEU C N   1 
ATOM   6803  C  CA  . LEU C 1 263 ? 79.145  113.537 47.973  1.00 24.77  ? 241  LEU C CA  1 
ATOM   6804  C  C   . LEU C 1 263 ? 79.454  114.641 48.983  1.00 29.44  ? 241  LEU C C   1 
ATOM   6805  O  O   . LEU C 1 263 ? 80.385  114.521 49.782  1.00 31.96  ? 241  LEU C O   1 
ATOM   6806  C  CB  . LEU C 1 263 ? 79.718  113.911 46.599  1.00 16.33  ? 241  LEU C CB  1 
ATOM   6807  C  CG  . LEU C 1 263 ? 79.665  112.835 45.509  1.00 15.55  ? 241  LEU C CG  1 
ATOM   6808  C  CD1 . LEU C 1 263 ? 79.943  113.451 44.160  1.00 8.30   ? 241  LEU C CD1 1 
ATOM   6809  C  CD2 . LEU C 1 263 ? 80.650  111.732 45.823  1.00 9.96   ? 241  LEU C CD2 1 
ATOM   6810  N  N   . GLN C 1 264 ? 78.667  115.709 48.946  1.00 27.92  ? 242  GLN C N   1 
ATOM   6811  C  CA  . GLN C 1 264 ? 78.847  116.833 49.849  1.00 29.35  ? 242  GLN C CA  1 
ATOM   6812  C  C   . GLN C 1 264 ? 78.741  116.394 51.325  1.00 30.19  ? 242  GLN C C   1 
ATOM   6813  O  O   . GLN C 1 264 ? 79.571  116.775 52.161  1.00 18.24  ? 242  GLN C O   1 
ATOM   6814  C  CB  . GLN C 1 264 ? 77.799  117.910 49.522  1.00 35.81  ? 242  GLN C CB  1 
ATOM   6815  C  CG  . GLN C 1 264 ? 77.614  118.999 50.583  1.00 47.54  ? 242  GLN C CG  1 
ATOM   6816  C  CD  . GLN C 1 264 ? 78.624  120.129 50.482  1.00 51.29  ? 242  GLN C CD  1 
ATOM   6817  O  OE1 . GLN C 1 264 ? 78.663  121.019 51.336  1.00 53.15  ? 242  GLN C OE1 1 
ATOM   6818  N  NE2 . GLN C 1 264 ? 79.437  120.107 49.435  1.00 56.08  ? 242  GLN C NE2 1 
ATOM   6819  N  N   . GLN C 1 265 ? 77.727  115.584 51.629  1.00 27.35  ? 243  GLN C N   1 
ATOM   6820  C  CA  . GLN C 1 265 ? 77.498  115.102 52.987  1.00 29.34  ? 243  GLN C CA  1 
ATOM   6821  C  C   . GLN C 1 265 ? 78.571  114.096 53.449  1.00 34.34  ? 243  GLN C C   1 
ATOM   6822  O  O   . GLN C 1 265 ? 78.732  113.844 54.650  1.00 30.77  ? 243  GLN C O   1 
ATOM   6823  C  CB  . GLN C 1 265 ? 76.097  114.470 53.091  1.00 24.43  ? 243  GLN C CB  1 
ATOM   6824  C  CG  . GLN C 1 265 ? 74.963  115.467 52.892  1.00 20.50  ? 243  GLN C CG  1 
ATOM   6825  C  CD  . GLN C 1 265 ? 73.592  114.821 52.687  1.00 30.01  ? 243  GLN C CD  1 
ATOM   6826  O  OE1 . GLN C 1 265 ? 73.407  113.984 51.795  1.00 38.34  ? 243  GLN C OE1 1 
ATOM   6827  N  NE2 . GLN C 1 265 ? 72.621  115.224 53.495  1.00 10.53  ? 243  GLN C NE2 1 
ATOM   6828  N  N   . CYS C 1 266 ? 79.307  113.533 52.498  1.00 29.97  ? 244  CYS C N   1 
ATOM   6829  C  CA  . CYS C 1 266 ? 80.345  112.567 52.819  1.00 26.77  ? 244  CYS C CA  1 
ATOM   6830  C  C   . CYS C 1 266 ? 81.721  113.175 52.636  1.00 26.14  ? 244  CYS C C   1 
ATOM   6831  O  O   . CYS C 1 266 ? 82.726  112.514 52.875  1.00 28.58  ? 244  CYS C O   1 
ATOM   6832  C  CB  . CYS C 1 266 ? 80.216  111.330 51.922  1.00 27.15  ? 244  CYS C CB  1 
ATOM   6833  S  SG  . CYS C 1 266 ? 78.767  110.353 52.241  1.00 27.48  ? 244  CYS C SG  1 
ATOM   6834  N  N   . ASP C 1 267 ? 81.771  114.436 52.222  1.00 22.63  ? 245  ASP C N   1 
ATOM   6835  C  CA  . ASP C 1 267 ? 83.045  115.106 51.997  1.00 25.06  ? 245  ASP C CA  1 
ATOM   6836  C  C   . ASP C 1 267 ? 83.869  114.386 50.911  1.00 27.84  ? 245  ASP C C   1 
ATOM   6837  O  O   . ASP C 1 267 ? 85.095  114.343 50.965  1.00 22.37  ? 245  ASP C O   1 
ATOM   6838  C  CB  . ASP C 1 267 ? 83.842  115.167 53.300  1.00 32.92  ? 245  ASP C CB  1 
ATOM   6839  C  CG  . ASP C 1 267 ? 83.185  116.040 54.341  1.00 47.75  ? 245  ASP C CG  1 
ATOM   6840  O  OD1 . ASP C 1 267 ? 83.091  117.267 54.120  1.00 61.51  ? 245  ASP C OD1 1 
ATOM   6841  O  OD2 . ASP C 1 267 ? 82.756  115.500 55.382  1.00 56.35  ? 245  ASP C OD2 1 
ATOM   6842  N  N   . GLY C 1 268 ? 83.186  113.817 49.925  1.00 30.75  ? 246  GLY C N   1 
ATOM   6843  C  CA  . GLY C 1 268 ? 83.874  113.122 48.850  1.00 33.07  ? 246  GLY C CA  1 
ATOM   6844  C  C   . GLY C 1 268 ? 84.366  111.713 49.154  1.00 36.26  ? 246  GLY C C   1 
ATOM   6845  O  O   . GLY C 1 268 ? 84.881  111.021 48.269  1.00 39.53  ? 246  GLY C O   1 
ATOM   6846  N  N   . LYS C 1 269 ? 84.212  111.280 50.398  1.00 34.16  ? 247  LYS C N   1 
ATOM   6847  C  CA  . LYS C 1 269 ? 84.652  109.955 50.799  1.00 32.05  ? 247  LYS C CA  1 
ATOM   6848  C  C   . LYS C 1 269 ? 83.451  109.033 50.927  1.00 29.04  ? 247  LYS C C   1 
ATOM   6849  O  O   . LYS C 1 269 ? 82.581  109.244 51.767  1.00 30.80  ? 247  LYS C O   1 
ATOM   6850  C  CB  . LYS C 1 269 ? 85.375  110.040 52.132  1.00 39.87  ? 247  LYS C CB  1 
ATOM   6851  C  CG  . LYS C 1 269 ? 86.426  111.124 52.205  1.00 40.88  ? 247  LYS C CG  1 
ATOM   6852  C  CD  . LYS C 1 269 ? 86.873  111.293 53.647  1.00 48.83  ? 247  LYS C CD  1 
ATOM   6853  C  CE  . LYS C 1 269 ? 87.838  112.449 53.817  1.00 48.95  ? 247  LYS C CE  1 
ATOM   6854  N  NZ  . LYS C 1 269 ? 88.267  112.532 55.243  1.00 46.57  ? 247  LYS C NZ  1 
ATOM   6855  N  N   . LEU C 1 270 ? 83.425  108.001 50.095  1.00 28.30  ? 248  LEU C N   1 
ATOM   6856  C  CA  . LEU C 1 270 ? 82.323  107.040 50.060  1.00 27.74  ? 248  LEU C CA  1 
ATOM   6857  C  C   . LEU C 1 270 ? 82.904  105.805 49.372  1.00 30.49  ? 248  LEU C C   1 
ATOM   6858  O  O   . LEU C 1 270 ? 83.755  105.935 48.489  1.00 30.79  ? 248  LEU C O   1 
ATOM   6859  C  CB  . LEU C 1 270 ? 81.185  107.645 49.231  1.00 30.99  ? 248  LEU C CB  1 
ATOM   6860  C  CG  . LEU C 1 270 ? 79.793  107.057 49.093  1.00 16.81  ? 248  LEU C CG  1 
ATOM   6861  C  CD1 . LEU C 1 270 ? 78.992  107.982 48.222  1.00 23.64  ? 248  LEU C CD1 1 
ATOM   6862  C  CD2 . LEU C 1 270 ? 79.851  105.681 48.475  1.00 32.17  ? 248  LEU C CD2 1 
ATOM   6863  N  N   . ASP C 1 271 ? 82.455  104.615 49.759  1.00 26.03  ? 249  ASP C N   1 
ATOM   6864  C  CA  . ASP C 1 271 ? 83.007  103.392 49.173  1.00 26.31  ? 249  ASP C CA  1 
ATOM   6865  C  C   . ASP C 1 271 ? 81.975  102.478 48.547  1.00 26.40  ? 249  ASP C C   1 
ATOM   6866  O  O   . ASP C 1 271 ? 82.320  101.523 47.859  1.00 26.53  ? 249  ASP C O   1 
ATOM   6867  C  CB  . ASP C 1 271 ? 83.772  102.610 50.237  1.00 18.68  ? 249  ASP C CB  1 
ATOM   6868  C  CG  . ASP C 1 271 ? 84.855  103.428 50.873  1.00 27.49  ? 249  ASP C CG  1 
ATOM   6869  O  OD1 . ASP C 1 271 ? 85.938  103.558 50.261  1.00 29.67  ? 249  ASP C OD1 1 
ATOM   6870  O  OD2 . ASP C 1 271 ? 84.609  103.960 51.980  1.00 23.24  ? 249  ASP C OD2 1 
ATOM   6871  N  N   . MET C 1 272 ? 80.707  102.757 48.791  1.00 24.68  ? 250  MET C N   1 
ATOM   6872  C  CA  . MET C 1 272 ? 79.677  101.912 48.237  1.00 27.52  ? 250  MET C CA  1 
ATOM   6873  C  C   . MET C 1 272 ? 78.314  102.581 48.276  1.00 31.83  ? 250  MET C C   1 
ATOM   6874  O  O   . MET C 1 272 ? 77.994  103.330 49.207  1.00 28.55  ? 250  MET C O   1 
ATOM   6875  C  CB  . MET C 1 272 ? 79.622  100.580 48.993  1.00 17.22  ? 250  MET C CB  1 
ATOM   6876  C  CG  . MET C 1 272 ? 78.637  99.593  48.406  1.00 24.81  ? 250  MET C CG  1 
ATOM   6877  S  SD  . MET C 1 272 ? 78.673  98.015  49.248  1.00 32.06  ? 250  MET C SD  1 
ATOM   6878  C  CE  . MET C 1 272 ? 80.233  97.376  48.679  1.00 34.02  ? 250  MET C CE  1 
ATOM   6879  N  N   . LEU C 1 273 ? 77.521  102.304 47.244  1.00 31.09  ? 251  LEU C N   1 
ATOM   6880  C  CA  . LEU C 1 273 ? 76.182  102.842 47.142  1.00 30.11  ? 251  LEU C CA  1 
ATOM   6881  C  C   . LEU C 1 273 ? 75.248  101.696 46.805  1.00 33.20  ? 251  LEU C C   1 
ATOM   6882  O  O   . LEU C 1 273 ? 75.465  100.967 45.835  1.00 28.78  ? 251  LEU C O   1 
ATOM   6883  C  CB  . LEU C 1 273 ? 76.100  103.906 46.050  1.00 26.32  ? 251  LEU C CB  1 
ATOM   6884  C  CG  . LEU C 1 273 ? 74.689  104.434 45.809  1.00 23.89  ? 251  LEU C CG  1 
ATOM   6885  C  CD1 . LEU C 1 273 ? 74.339  105.485 46.848  1.00 20.29  ? 251  LEU C CD1 1 
ATOM   6886  C  CD2 . LEU C 1 273 ? 74.616  105.010 44.417  1.00 29.39  ? 251  LEU C CD2 1 
ATOM   6887  N  N   . VAL C 1 274 ? 74.218  101.544 47.629  1.00 29.73  ? 252  VAL C N   1 
ATOM   6888  C  CA  . VAL C 1 274 ? 73.226  100.509 47.445  1.00 27.96  ? 252  VAL C CA  1 
ATOM   6889  C  C   . VAL C 1 274 ? 71.888  101.212 47.220  1.00 32.29  ? 252  VAL C C   1 
ATOM   6890  O  O   . VAL C 1 274 ? 71.451  102.005 48.053  1.00 32.82  ? 252  VAL C O   1 
ATOM   6891  C  CB  . VAL C 1 274 ? 73.151  99.588  48.701  1.00 29.64  ? 252  VAL C CB  1 
ATOM   6892  C  CG1 . VAL C 1 274 ? 72.050  98.543  48.539  1.00 26.68  ? 252  VAL C CG1 1 
ATOM   6893  C  CG2 . VAL C 1 274 ? 74.501  98.911  48.922  1.00 24.42  ? 252  VAL C CG2 1 
ATOM   6894  N  N   . ALA C 1 275 ? 71.258  100.935 46.082  1.00 29.10  ? 253  ALA C N   1 
ATOM   6895  C  CA  . ALA C 1 275 ? 69.974  101.535 45.744  1.00 32.35  ? 253  ALA C CA  1 
ATOM   6896  C  C   . ALA C 1 275 ? 69.063  100.512 45.068  1.00 36.96  ? 253  ALA C C   1 
ATOM   6897  O  O   . ALA C 1 275 ? 69.528  99.688  44.280  1.00 37.24  ? 253  ALA C O   1 
ATOM   6898  C  CB  . ALA C 1 275 ? 70.187  102.720 44.814  1.00 32.37  ? 253  ALA C CB  1 
ATOM   6899  N  N   . SER C 1 276 ? 67.769  100.554 45.380  1.00 35.58  ? 254  SER C N   1 
ATOM   6900  C  CA  . SER C 1 276 ? 66.825  99.624  44.766  1.00 38.44  ? 254  SER C CA  1 
ATOM   6901  C  C   . SER C 1 276 ? 66.456  100.234 43.424  1.00 39.88  ? 254  SER C C   1 
ATOM   6902  O  O   . SER C 1 276 ? 66.479  101.457 43.288  1.00 38.80  ? 254  SER C O   1 
ATOM   6903  C  CB  . SER C 1 276 ? 65.584  99.429  45.650  1.00 35.49  ? 254  SER C CB  1 
ATOM   6904  O  OG  . SER C 1 276 ? 64.910  100.645 45.913  1.00 26.36  ? 254  SER C OG  1 
ATOM   6905  N  N   . VAL C 1 277 ? 66.118  99.400  42.439  1.00 40.86  ? 255  VAL C N   1 
ATOM   6906  C  CA  . VAL C 1 277 ? 65.814  99.907  41.102  1.00 37.62  ? 255  VAL C CA  1 
ATOM   6907  C  C   . VAL C 1 277 ? 64.394  99.719  40.579  1.00 40.19  ? 255  VAL C C   1 
ATOM   6908  O  O   . VAL C 1 277 ? 63.829  98.630  40.659  1.00 41.24  ? 255  VAL C O   1 
ATOM   6909  C  CB  . VAL C 1 277 ? 66.781  99.305  40.062  1.00 36.97  ? 255  VAL C CB  1 
ATOM   6910  C  CG1 . VAL C 1 277 ? 66.677  100.071 38.752  1.00 41.40  ? 255  VAL C CG1 1 
ATOM   6911  C  CG2 . VAL C 1 277 ? 68.209  99.339  40.592  1.00 36.33  ? 255  VAL C CG2 1 
ATOM   6912  N  N   . GLY C 1 278 ? 63.839  100.802 40.027  1.00 42.16  ? 256  GLY C N   1 
ATOM   6913  C  CA  . GLY C 1 278 ? 62.497  100.791 39.461  1.00 39.83  ? 256  GLY C CA  1 
ATOM   6914  C  C   . GLY C 1 278 ? 62.565  101.290 38.024  1.00 39.04  ? 256  GLY C C   1 
ATOM   6915  O  O   . GLY C 1 278 ? 62.426  100.516 37.070  1.00 31.66  ? 256  GLY C O   1 
ATOM   6916  N  N   . THR C 1 279 ? 62.776  102.595 37.880  1.00 36.52  ? 257  THR C N   1 
ATOM   6917  C  CA  . THR C 1 279 ? 62.910  103.218 36.573  1.00 32.28  ? 257  THR C CA  1 
ATOM   6918  C  C   . THR C 1 279 ? 64.402  103.149 36.261  1.00 31.51  ? 257  THR C C   1 
ATOM   6919  O  O   . THR C 1 279 ? 64.825  103.051 35.102  1.00 33.87  ? 257  THR C O   1 
ATOM   6920  C  CB  . THR C 1 279 ? 62.475  104.712 36.598  1.00 28.75  ? 257  THR C CB  1 
ATOM   6921  O  OG1 . THR C 1 279 ? 63.308  105.449 37.503  1.00 29.37  ? 257  THR C OG1 1 
ATOM   6922  C  CG2 . THR C 1 279 ? 61.044  104.844 37.042  1.00 32.72  ? 257  THR C CG2 1 
ATOM   6923  N  N   . GLY C 1 280 ? 65.198  103.197 37.323  1.00 32.62  ? 258  GLY C N   1 
ATOM   6924  C  CA  . GLY C 1 280 ? 66.641  103.162 37.181  1.00 27.12  ? 258  GLY C CA  1 
ATOM   6925  C  C   . GLY C 1 280 ? 67.197  104.570 37.301  1.00 22.62  ? 258  GLY C C   1 
ATOM   6926  O  O   . GLY C 1 280 ? 68.412  104.795 37.288  1.00 12.26  ? 258  GLY C O   1 
ATOM   6927  N  N   . GLY C 1 281 ? 66.291  105.531 37.420  1.00 17.20  ? 259  GLY C N   1 
ATOM   6928  C  CA  . GLY C 1 281 ? 66.720  106.907 37.527  1.00 20.52  ? 259  GLY C CA  1 
ATOM   6929  C  C   . GLY C 1 281 ? 67.743  107.127 38.620  1.00 22.36  ? 259  GLY C C   1 
ATOM   6930  O  O   . GLY C 1 281 ? 68.876  107.543 38.361  1.00 24.93  ? 259  GLY C O   1 
ATOM   6931  N  N   . THR C 1 282 ? 67.343  106.824 39.849  1.00 23.92  ? 260  THR C N   1 
ATOM   6932  C  CA  . THR C 1 282 ? 68.199  106.996 41.007  1.00 22.52  ? 260  THR C CA  1 
ATOM   6933  C  C   . THR C 1 282 ? 69.581  106.395 40.877  1.00 19.76  ? 260  THR C C   1 
ATOM   6934  O  O   . THR C 1 282 ? 70.581  107.119 40.944  1.00 15.85  ? 260  THR C O   1 
ATOM   6935  C  CB  . THR C 1 282 ? 67.545  106.420 42.256  1.00 23.60  ? 260  THR C CB  1 
ATOM   6936  O  OG1 . THR C 1 282 ? 66.233  106.983 42.406  1.00 29.89  ? 260  THR C OG1 1 
ATOM   6937  C  CG2 . THR C 1 282 ? 68.376  106.761 43.484  1.00 22.30  ? 260  THR C CG2 1 
ATOM   6938  N  N   . ILE C 1 283 ? 69.651  105.080 40.673  1.00 23.76  ? 261  ILE C N   1 
ATOM   6939  C  CA  . ILE C 1 283 ? 70.944  104.424 40.583  1.00 25.83  ? 261  ILE C CA  1 
ATOM   6940  C  C   . ILE C 1 283 ? 71.773  104.869 39.397  1.00 23.74  ? 261  ILE C C   1 
ATOM   6941  O  O   . ILE C 1 283 ? 72.988  104.999 39.514  1.00 28.52  ? 261  ILE C O   1 
ATOM   6942  C  CB  . ILE C 1 283 ? 70.818  102.877 40.568  1.00 30.58  ? 261  ILE C CB  1 
ATOM   6943  C  CG1 . ILE C 1 283 ? 72.177  102.245 40.920  1.00 31.63  ? 261  ILE C CG1 1 
ATOM   6944  C  CG2 . ILE C 1 283 ? 70.369  102.395 39.196  1.00 31.08  ? 261  ILE C CG2 1 
ATOM   6945  C  CD1 . ILE C 1 283 ? 72.121  100.756 41.122  1.00 22.17  ? 261  ILE C CD1 1 
ATOM   6946  N  N   . THR C 1 284 ? 71.130  105.119 38.265  1.00 28.08  ? 262  THR C N   1 
ATOM   6947  C  CA  . THR C 1 284 ? 71.860  105.548 37.074  1.00 30.46  ? 262  THR C CA  1 
ATOM   6948  C  C   . THR C 1 284 ? 72.384  106.961 37.246  1.00 31.64  ? 262  THR C C   1 
ATOM   6949  O  O   . THR C 1 284 ? 73.526  107.254 36.892  1.00 30.63  ? 262  THR C O   1 
ATOM   6950  C  CB  . THR C 1 284 ? 70.972  105.522 35.812  1.00 31.14  ? 262  THR C CB  1 
ATOM   6951  O  OG1 . THR C 1 284 ? 70.472  104.197 35.594  1.00 32.82  ? 262  THR C OG1 1 
ATOM   6952  C  CG2 . THR C 1 284 ? 71.774  105.958 34.604  1.00 28.34  ? 262  THR C CG2 1 
ATOM   6953  N  N   . GLY C 1 285 ? 71.539  107.839 37.783  1.00 32.51  ? 263  GLY C N   1 
ATOM   6954  C  CA  . GLY C 1 285 ? 71.947  109.219 37.994  1.00 32.28  ? 263  GLY C CA  1 
ATOM   6955  C  C   . GLY C 1 285 ? 73.095  109.304 38.984  1.00 33.64  ? 263  GLY C C   1 
ATOM   6956  O  O   . GLY C 1 285 ? 74.145  109.882 38.689  1.00 29.27  ? 263  GLY C O   1 
ATOM   6957  N  N   . ILE C 1 286 ? 72.908  108.713 40.161  1.00 29.14  ? 264  ILE C N   1 
ATOM   6958  C  CA  . ILE C 1 286 ? 73.943  108.744 41.177  1.00 20.26  ? 264  ILE C CA  1 
ATOM   6959  C  C   . ILE C 1 286 ? 75.175  107.963 40.740  1.00 21.01  ? 264  ILE C C   1 
ATOM   6960  O  O   . ILE C 1 286 ? 76.297  108.398 40.986  1.00 24.63  ? 264  ILE C O   1 
ATOM   6961  C  CB  . ILE C 1 286 ? 73.427  108.176 42.506  1.00 19.89  ? 264  ILE C CB  1 
ATOM   6962  C  CG1 . ILE C 1 286 ? 72.233  108.992 42.992  1.00 17.60  ? 264  ILE C CG1 1 
ATOM   6963  C  CG2 . ILE C 1 286 ? 74.515  108.209 43.548  1.00 20.44  ? 264  ILE C CG2 1 
ATOM   6964  C  CD1 . ILE C 1 286 ? 71.529  108.368 44.173  1.00 20.05  ? 264  ILE C CD1 1 
ATOM   6965  N  N   . ALA C 1 287 ? 74.980  106.819 40.082  1.00 25.29  ? 265  ALA C N   1 
ATOM   6966  C  CA  . ALA C 1 287 ? 76.121  106.005 39.645  1.00 25.98  ? 265  ALA C CA  1 
ATOM   6967  C  C   . ALA C 1 287 ? 77.011  106.712 38.635  1.00 29.72  ? 265  ALA C C   1 
ATOM   6968  O  O   . ALA C 1 287 ? 78.240  106.628 38.731  1.00 30.26  ? 265  ALA C O   1 
ATOM   6969  C  CB  . ALA C 1 287 ? 75.651  104.672 39.078  1.00 20.01  ? 265  ALA C CB  1 
ATOM   6970  N  N   . ARG C 1 288 ? 76.400  107.399 37.668  1.00 29.80  ? 266  ARG C N   1 
ATOM   6971  C  CA  . ARG C 1 288 ? 77.169  108.123 36.664  1.00 27.62  ? 266  ARG C CA  1 
ATOM   6972  C  C   . ARG C 1 288 ? 77.923  109.299 37.277  1.00 29.37  ? 266  ARG C C   1 
ATOM   6973  O  O   . ARG C 1 288 ? 78.997  109.661 36.801  1.00 25.75  ? 266  ARG C O   1 
ATOM   6974  C  CB  . ARG C 1 288 ? 76.272  108.633 35.536  1.00 29.92  ? 266  ARG C CB  1 
ATOM   6975  C  CG  . ARG C 1 288 ? 76.003  107.614 34.439  1.00 36.19  ? 266  ARG C CG  1 
ATOM   6976  C  CD  . ARG C 1 288 ? 75.242  108.250 33.278  1.00 19.76  ? 266  ARG C CD  1 
ATOM   6977  N  NE  . ARG C 1 288 ? 74.928  107.254 32.257  1.00 38.39  ? 266  ARG C NE  1 
ATOM   6978  C  CZ  . ARG C 1 288 ? 74.278  107.513 31.124  1.00 40.99  ? 266  ARG C CZ  1 
ATOM   6979  N  NH1 . ARG C 1 288 ? 73.871  108.745 30.861  1.00 41.86  ? 266  ARG C NH1 1 
ATOM   6980  N  NH2 . ARG C 1 288 ? 74.026  106.539 30.260  1.00 26.64  ? 266  ARG C NH2 1 
ATOM   6981  N  N   . LYS C 1 289 ? 77.367  109.899 38.327  1.00 26.30  ? 267  LYS C N   1 
ATOM   6982  C  CA  . LYS C 1 289 ? 78.040  111.018 38.974  1.00 26.86  ? 267  LYS C CA  1 
ATOM   6983  C  C   . LYS C 1 289 ? 79.138  110.548 39.913  1.00 28.56  ? 267  LYS C C   1 
ATOM   6984  O  O   . LYS C 1 289 ? 80.144  111.233 40.082  1.00 30.16  ? 267  LYS C O   1 
ATOM   6985  C  CB  . LYS C 1 289 ? 77.050  111.871 39.764  1.00 29.23  ? 267  LYS C CB  1 
ATOM   6986  C  CG  . LYS C 1 289 ? 77.706  112.995 40.566  1.00 21.36  ? 267  LYS C CG  1 
ATOM   6987  C  CD  . LYS C 1 289 ? 78.625  113.854 39.704  1.00 22.04  ? 267  LYS C CD  1 
ATOM   6988  C  CE  . LYS C 1 289 ? 77.884  114.547 38.556  1.00 17.65  ? 267  LYS C CE  1 
ATOM   6989  N  NZ  . LYS C 1 289 ? 77.120  115.756 38.936  1.00 6.19   ? 267  LYS C NZ  1 
ATOM   6990  N  N   . LEU C 1 290 ? 78.942  109.385 40.529  1.00 28.79  ? 268  LEU C N   1 
ATOM   6991  C  CA  . LEU C 1 290 ? 79.928  108.833 41.454  1.00 29.31  ? 268  LEU C CA  1 
ATOM   6992  C  C   . LEU C 1 290 ? 81.134  108.258 40.733  1.00 32.85  ? 268  LEU C C   1 
ATOM   6993  O  O   . LEU C 1 290 ? 82.258  108.500 41.144  1.00 34.77  ? 268  LEU C O   1 
ATOM   6994  C  CB  . LEU C 1 290 ? 79.282  107.758 42.333  1.00 36.43  ? 268  LEU C CB  1 
ATOM   6995  C  CG  . LEU C 1 290 ? 79.006  108.083 43.811  1.00 36.30  ? 268  LEU C CG  1 
ATOM   6996  C  CD1 . LEU C 1 290 ? 78.721  109.567 44.015  1.00 37.89  ? 268  LEU C CD1 1 
ATOM   6997  C  CD2 . LEU C 1 290 ? 77.828  107.242 44.277  1.00 26.10  ? 268  LEU C CD2 1 
ATOM   6998  N  N   . LYS C 1 291 ? 80.912  107.501 39.660  1.00 36.08  ? 269  LYS C N   1 
ATOM   6999  C  CA  . LYS C 1 291 ? 82.029  106.929 38.914  1.00 36.98  ? 269  LYS C CA  1 
ATOM   7000  C  C   . LYS C 1 291 ? 82.915  108.018 38.346  1.00 39.06  ? 269  LYS C C   1 
ATOM   7001  O  O   . LYS C 1 291 ? 84.080  107.782 38.050  1.00 43.70  ? 269  LYS C O   1 
ATOM   7002  C  CB  . LYS C 1 291 ? 81.538  106.027 37.786  1.00 31.90  ? 269  LYS C CB  1 
ATOM   7003  C  CG  . LYS C 1 291 ? 81.017  104.710 38.288  1.00 35.82  ? 269  LYS C CG  1 
ATOM   7004  C  CD  . LYS C 1 291 ? 81.220  103.614 37.265  1.00 43.45  ? 269  LYS C CD  1 
ATOM   7005  C  CE  . LYS C 1 291 ? 81.028  102.236 37.893  1.00 45.67  ? 269  LYS C CE  1 
ATOM   7006  N  NZ  . LYS C 1 291 ? 81.954  102.049 39.047  1.00 52.77  ? 269  LYS C NZ  1 
ATOM   7007  N  N   . GLU C 1 292 ? 82.366  109.216 38.195  1.00 38.83  ? 270  GLU C N   1 
ATOM   7008  C  CA  . GLU C 1 292 ? 83.148  110.318 37.674  1.00 37.14  ? 270  GLU C CA  1 
ATOM   7009  C  C   . GLU C 1 292 ? 83.954  110.946 38.808  1.00 40.15  ? 270  GLU C C   1 
ATOM   7010  O  O   . GLU C 1 292 ? 85.152  111.164 38.668  1.00 43.32  ? 270  GLU C O   1 
ATOM   7011  C  CB  . GLU C 1 292 ? 82.237  111.356 37.006  1.00 35.30  ? 270  GLU C CB  1 
ATOM   7012  C  CG  . GLU C 1 292 ? 81.422  110.798 35.841  1.00 37.87  ? 270  GLU C CG  1 
ATOM   7013  C  CD  . GLU C 1 292 ? 80.756  111.874 34.980  1.00 41.49  ? 270  GLU C CD  1 
ATOM   7014  O  OE1 . GLU C 1 292 ? 80.238  112.869 35.535  1.00 42.62  ? 270  GLU C OE1 1 
ATOM   7015  O  OE2 . GLU C 1 292 ? 80.737  111.713 33.742  1.00 38.07  ? 270  GLU C OE2 1 
ATOM   7016  N  N   . LYS C 1 293 ? 83.308  111.213 39.940  1.00 39.80  ? 271  LYS C N   1 
ATOM   7017  C  CA  . LYS C 1 293 ? 83.992  111.820 41.080  1.00 41.85  ? 271  LYS C CA  1 
ATOM   7018  C  C   . LYS C 1 293 ? 84.641  110.796 42.024  1.00 45.91  ? 271  LYS C C   1 
ATOM   7019  O  O   . LYS C 1 293 ? 85.793  110.950 42.424  1.00 43.78  ? 271  LYS C O   1 
ATOM   7020  C  CB  . LYS C 1 293 ? 83.014  112.693 41.873  1.00 47.09  ? 271  LYS C CB  1 
ATOM   7021  C  CG  . LYS C 1 293 ? 82.321  113.770 41.052  1.00 43.24  ? 271  LYS C CG  1 
ATOM   7022  C  CD  . LYS C 1 293 ? 83.294  114.834 40.571  1.00 41.71  ? 271  LYS C CD  1 
ATOM   7023  C  CE  . LYS C 1 293 ? 82.558  115.889 39.749  1.00 44.81  ? 271  LYS C CE  1 
ATOM   7024  N  NZ  . LYS C 1 293 ? 83.433  117.029 39.378  1.00 31.62  ? 271  LYS C NZ  1 
ATOM   7025  N  N   . CYS C 1 294 ? 83.902  109.757 42.391  1.00 48.76  ? 272  CYS C N   1 
ATOM   7026  C  CA  . CYS C 1 294 ? 84.432  108.732 43.288  1.00 50.73  ? 272  CYS C CA  1 
ATOM   7027  C  C   . CYS C 1 294 ? 84.658  107.425 42.551  1.00 50.29  ? 272  CYS C C   1 
ATOM   7028  O  O   . CYS C 1 294 ? 83.820  106.519 42.585  1.00 50.82  ? 272  CYS C O   1 
ATOM   7029  C  CB  . CYS C 1 294 ? 83.483  108.505 44.465  1.00 49.03  ? 272  CYS C CB  1 
ATOM   7030  S  SG  . CYS C 1 294 ? 83.960  107.100 45.509  1.00 54.37  ? 272  CYS C SG  1 
ATOM   7031  N  N   . PRO C 1 295 ? 85.810  107.307 41.881  1.00 51.91  ? 273  PRO C N   1 
ATOM   7032  C  CA  . PRO C 1 295 ? 86.150  106.101 41.126  1.00 56.21  ? 273  PRO C CA  1 
ATOM   7033  C  C   . PRO C 1 295 ? 86.048  104.823 41.949  1.00 57.16  ? 273  PRO C C   1 
ATOM   7034  O  O   . PRO C 1 295 ? 85.417  103.847 41.528  1.00 60.89  ? 273  PRO C O   1 
ATOM   7035  C  CB  . PRO C 1 295 ? 87.574  106.389 40.640  1.00 56.21  ? 273  PRO C CB  1 
ATOM   7036  C  CG  . PRO C 1 295 ? 88.112  107.335 41.674  1.00 46.43  ? 273  PRO C CG  1 
ATOM   7037  C  CD  . PRO C 1 295 ? 86.942  108.249 41.895  1.00 49.27  ? 273  PRO C CD  1 
ATOM   7038  N  N   . GLY C 1 296 ? 86.656  104.840 43.128  1.00 53.73  ? 274  GLY C N   1 
ATOM   7039  C  CA  . GLY C 1 296 ? 86.627  103.667 43.985  1.00 57.06  ? 274  GLY C CA  1 
ATOM   7040  C  C   . GLY C 1 296 ? 85.274  103.311 44.580  1.00 54.23  ? 274  GLY C C   1 
ATOM   7041  O  O   . GLY C 1 296 ? 85.179  102.407 45.409  1.00 55.64  ? 274  GLY C O   1 
ATOM   7042  N  N   . CYS C 1 297 ? 84.223  104.013 44.166  1.00 54.15  ? 275  CYS C N   1 
ATOM   7043  C  CA  . CYS C 1 297 ? 82.884  103.747 44.678  1.00 47.08  ? 275  CYS C CA  1 
ATOM   7044  C  C   . CYS C 1 297 ? 82.219  102.580 43.986  1.00 43.16  ? 275  CYS C C   1 
ATOM   7045  O  O   . CYS C 1 297 ? 82.073  102.562 42.767  1.00 47.40  ? 275  CYS C O   1 
ATOM   7046  C  CB  . CYS C 1 297 ? 82.005  104.980 44.539  1.00 38.84  ? 275  CYS C CB  1 
ATOM   7047  S  SG  . CYS C 1 297 ? 82.206  106.153 45.907  1.00 49.52  ? 275  CYS C SG  1 
ATOM   7048  N  N   . ARG C 1 298 ? 81.814  101.602 44.780  1.00 41.42  ? 276  ARG C N   1 
ATOM   7049  C  CA  . ARG C 1 298 ? 81.157  100.424 44.254  1.00 41.67  ? 276  ARG C CA  1 
ATOM   7050  C  C   . ARG C 1 298 ? 79.641  100.651 44.200  1.00 39.60  ? 276  ARG C C   1 
ATOM   7051  O  O   . ARG C 1 298 ? 79.031  101.042 45.197  1.00 41.89  ? 276  ARG C O   1 
ATOM   7052  C  CB  . ARG C 1 298 ? 81.523  99.219  45.128  1.00 41.83  ? 276  ARG C CB  1 
ATOM   7053  C  CG  . ARG C 1 298 ? 82.987  98.772  44.955  1.00 42.39  ? 276  ARG C CG  1 
ATOM   7054  C  CD  . ARG C 1 298 ? 83.743  98.560  46.281  1.00 53.63  ? 276  ARG C CD  1 
ATOM   7055  N  NE  . ARG C 1 298 ? 84.312  99.800  46.822  1.00 52.80  ? 276  ARG C NE  1 
ATOM   7056  C  CZ  . ARG C 1 298 ? 85.323  99.857  47.690  1.00 44.83  ? 276  ARG C CZ  1 
ATOM   7057  N  NH1 . ARG C 1 298 ? 85.892  98.744  48.131  1.00 44.75  ? 276  ARG C NH1 1 
ATOM   7058  N  NH2 . ARG C 1 298 ? 85.780  101.034 48.106  1.00 39.70  ? 276  ARG C NH2 1 
ATOM   7059  N  N   . ILE C 1 299 ? 79.052  100.433 43.022  1.00 35.46  ? 277  ILE C N   1 
ATOM   7060  C  CA  . ILE C 1 299 ? 77.617  100.611 42.821  1.00 31.38  ? 277  ILE C CA  1 
ATOM   7061  C  C   . ILE C 1 299 ? 76.914  99.264  42.922  1.00 32.28  ? 277  ILE C C   1 
ATOM   7062  O  O   . ILE C 1 299 ? 77.289  98.309  42.238  1.00 35.42  ? 277  ILE C O   1 
ATOM   7063  C  CB  . ILE C 1 299 ? 77.309  101.221 41.431  1.00 28.10  ? 277  ILE C CB  1 
ATOM   7064  C  CG1 . ILE C 1 299 ? 78.020  102.568 41.277  1.00 36.77  ? 277  ILE C CG1 1 
ATOM   7065  C  CG2 . ILE C 1 299 ? 75.809  101.384 41.255  1.00 28.99  ? 277  ILE C CG2 1 
ATOM   7066  C  CD1 . ILE C 1 299 ? 77.715  103.581 42.376  1.00 23.48  ? 277  ILE C CD1 1 
ATOM   7067  N  N   . ILE C 1 300 ? 75.891  99.202  43.772  1.00 29.44  ? 278  ILE C N   1 
ATOM   7068  C  CA  . ILE C 1 300 ? 75.127  97.982  43.992  1.00 24.89  ? 278  ILE C CA  1 
ATOM   7069  C  C   . ILE C 1 300 ? 73.652  98.185  43.668  1.00 25.15  ? 278  ILE C C   1 
ATOM   7070  O  O   . ILE C 1 300 ? 73.013  99.090  44.196  1.00 25.97  ? 278  ILE C O   1 
ATOM   7071  C  CB  . ILE C 1 300 ? 75.235  97.522  45.459  1.00 21.30  ? 278  ILE C CB  1 
ATOM   7072  C  CG1 . ILE C 1 300 ? 76.699  97.470  45.887  1.00 23.69  ? 278  ILE C CG1 1 
ATOM   7073  C  CG2 . ILE C 1 300 ? 74.610  96.145  45.612  1.00 28.41  ? 278  ILE C CG2 1 
ATOM   7074  C  CD1 . ILE C 1 300 ? 77.543  96.483  45.095  1.00 25.59  ? 278  ILE C CD1 1 
ATOM   7075  N  N   . GLY C 1 301 ? 73.109  97.335  42.807  1.00 25.88  ? 279  GLY C N   1 
ATOM   7076  C  CA  . GLY C 1 301 ? 71.709  97.464  42.441  1.00 23.92  ? 279  GLY C CA  1 
ATOM   7077  C  C   . GLY C 1 301 ? 70.851  96.382  43.061  1.00 21.38  ? 279  GLY C C   1 
ATOM   7078  O  O   . GLY C 1 301 ? 71.228  95.211  43.057  1.00 33.81  ? 279  GLY C O   1 
ATOM   7079  N  N   . VAL C 1 302 ? 69.692  96.762  43.580  1.00 13.05  ? 280  VAL C N   1 
ATOM   7080  C  CA  . VAL C 1 302 ? 68.805  95.813  44.227  1.00 17.67  ? 280  VAL C CA  1 
ATOM   7081  C  C   . VAL C 1 302 ? 67.567  95.586  43.379  1.00 24.41  ? 280  VAL C C   1 
ATOM   7082  O  O   . VAL C 1 302 ? 66.795  96.518  43.145  1.00 26.76  ? 280  VAL C O   1 
ATOM   7083  C  CB  . VAL C 1 302 ? 68.390  96.325  45.629  1.00 20.40  ? 280  VAL C CB  1 
ATOM   7084  C  CG1 . VAL C 1 302 ? 67.285  95.450  46.205  1.00 25.18  ? 280  VAL C CG1 1 
ATOM   7085  C  CG2 . VAL C 1 302 ? 69.599  96.322  46.559  1.00 27.00  ? 280  VAL C CG2 1 
ATOM   7086  N  N   . ASP C 1 303 ? 67.384  94.346  42.920  1.00 23.87  ? 281  ASP C N   1 
ATOM   7087  C  CA  . ASP C 1 303 ? 66.250  93.986  42.066  1.00 29.14  ? 281  ASP C CA  1 
ATOM   7088  C  C   . ASP C 1 303 ? 65.406  92.903  42.741  1.00 26.05  ? 281  ASP C C   1 
ATOM   7089  O  O   . ASP C 1 303 ? 65.936  91.909  43.224  1.00 30.30  ? 281  ASP C O   1 
ATOM   7090  C  CB  . ASP C 1 303 ? 66.771  93.476  40.713  1.00 34.23  ? 281  ASP C CB  1 
ATOM   7091  C  CG  . ASP C 1 303 ? 65.686  93.393  39.655  1.00 36.01  ? 281  ASP C CG  1 
ATOM   7092  O  OD1 . ASP C 1 303 ? 65.779  92.505  38.789  1.00 40.74  ? 281  ASP C OD1 1 
ATOM   7093  O  OD2 . ASP C 1 303 ? 64.750  94.220  39.677  1.00 32.76  ? 281  ASP C OD2 1 
ATOM   7094  N  N   . PRO C 1 304 ? 64.078  93.081  42.776  1.00 24.14  ? 282  PRO C N   1 
ATOM   7095  C  CA  . PRO C 1 304 ? 63.187  92.103  43.404  1.00 28.78  ? 282  PRO C CA  1 
ATOM   7096  C  C   . PRO C 1 304 ? 62.930  90.875  42.526  1.00 38.61  ? 282  PRO C C   1 
ATOM   7097  O  O   . PRO C 1 304 ? 62.805  90.996  41.306  1.00 39.77  ? 282  PRO C O   1 
ATOM   7098  C  CB  . PRO C 1 304 ? 61.915  92.909  43.623  1.00 33.88  ? 282  PRO C CB  1 
ATOM   7099  C  CG  . PRO C 1 304 ? 61.858  93.741  42.357  1.00 19.51  ? 282  PRO C CG  1 
ATOM   7100  C  CD  . PRO C 1 304 ? 63.306  94.212  42.220  1.00 21.97  ? 282  PRO C CD  1 
ATOM   7101  N  N   . GLU C 1 305 ? 62.839  89.701  43.149  1.00 41.43  ? 283  GLU C N   1 
ATOM   7102  C  CA  . GLU C 1 305 ? 62.583  88.472  42.413  1.00 48.57  ? 283  GLU C CA  1 
ATOM   7103  C  C   . GLU C 1 305 ? 61.258  88.626  41.682  1.00 49.34  ? 283  GLU C C   1 
ATOM   7104  O  O   . GLU C 1 305 ? 60.252  89.000  42.277  1.00 47.88  ? 283  GLU C O   1 
ATOM   7105  C  CB  . GLU C 1 305 ? 62.521  87.273  43.364  1.00 54.31  ? 283  GLU C CB  1 
ATOM   7106  C  CG  . GLU C 1 305 ? 63.860  86.893  43.981  1.00 59.31  ? 283  GLU C CG  1 
ATOM   7107  C  CD  . GLU C 1 305 ? 63.738  85.743  44.970  1.00 65.53  ? 283  GLU C CD  1 
ATOM   7108  O  OE1 . GLU C 1 305 ? 64.764  85.368  45.578  1.00 63.98  ? 283  GLU C OE1 1 
ATOM   7109  O  OE2 . GLU C 1 305 ? 62.617  85.215  45.138  1.00 68.76  ? 283  GLU C OE2 1 
ATOM   7110  N  N   . GLY C 1 306 ? 61.265  88.335  40.388  1.00 49.76  ? 284  GLY C N   1 
ATOM   7111  C  CA  . GLY C 1 306 ? 60.059  88.478  39.597  1.00 49.08  ? 284  GLY C CA  1 
ATOM   7112  C  C   . GLY C 1 306 ? 60.259  89.635  38.641  1.00 50.28  ? 284  GLY C C   1 
ATOM   7113  O  O   . GLY C 1 306 ? 59.359  90.015  37.895  1.00 45.86  ? 284  GLY C O   1 
ATOM   7114  N  N   . SER C 1 307 ? 61.464  90.196  38.687  1.00 51.36  ? 285  SER C N   1 
ATOM   7115  C  CA  . SER C 1 307 ? 61.859  91.316  37.845  1.00 54.40  ? 285  SER C CA  1 
ATOM   7116  C  C   . SER C 1 307 ? 63.000  90.838  36.950  1.00 51.71  ? 285  SER C C   1 
ATOM   7117  O  O   . SER C 1 307 ? 63.661  89.849  37.262  1.00 52.48  ? 285  SER C O   1 
ATOM   7118  C  CB  . SER C 1 307 ? 62.327  92.490  38.717  1.00 56.85  ? 285  SER C CB  1 
ATOM   7119  O  OG  . SER C 1 307 ? 62.712  93.607  37.933  1.00 57.37  ? 285  SER C OG  1 
ATOM   7120  N  N   . ILE C 1 308 ? 63.233  91.542  35.846  1.00 49.20  ? 286  ILE C N   1 
ATOM   7121  C  CA  . ILE C 1 308 ? 64.289  91.172  34.903  1.00 44.63  ? 286  ILE C CA  1 
ATOM   7122  C  C   . ILE C 1 308 ? 65.444  92.165  34.847  1.00 39.63  ? 286  ILE C C   1 
ATOM   7123  O  O   . ILE C 1 308 ? 66.373  91.981  34.063  1.00 42.53  ? 286  ILE C O   1 
ATOM   7124  C  CB  . ILE C 1 308 ? 63.737  91.061  33.467  1.00 45.07  ? 286  ILE C CB  1 
ATOM   7125  C  CG1 . ILE C 1 308 ? 63.231  92.432  33.007  1.00 49.65  ? 286  ILE C CG1 1 
ATOM   7126  C  CG2 . ILE C 1 308 ? 62.615  90.034  33.411  1.00 46.00  ? 286  ILE C CG2 1 
ATOM   7127  C  CD1 . ILE C 1 308 ? 62.864  92.506  31.544  1.00 42.85  ? 286  ILE C CD1 1 
ATOM   7128  N  N   . LEU C 1 309 ? 65.393  93.213  35.662  1.00 34.15  ? 287  LEU C N   1 
ATOM   7129  C  CA  . LEU C 1 309 ? 66.436  94.240  35.649  1.00 32.69  ? 287  LEU C CA  1 
ATOM   7130  C  C   . LEU C 1 309 ? 67.863  93.786  35.947  1.00 30.34  ? 287  LEU C C   1 
ATOM   7131  O  O   . LEU C 1 309 ? 68.790  94.117  35.211  1.00 30.46  ? 287  LEU C O   1 
ATOM   7132  C  CB  . LEU C 1 309 ? 66.051  95.375  36.603  1.00 34.34  ? 287  LEU C CB  1 
ATOM   7133  C  CG  . LEU C 1 309 ? 64.740  96.113  36.294  1.00 33.87  ? 287  LEU C CG  1 
ATOM   7134  C  CD1 . LEU C 1 309 ? 64.619  97.341  37.194  1.00 23.79  ? 287  LEU C CD1 1 
ATOM   7135  C  CD2 . LEU C 1 309 ? 64.719  96.541  34.822  1.00 37.00  ? 287  LEU C CD2 1 
ATOM   7136  N  N   . ALA C 1 310 ? 68.038  93.027  37.021  1.00 30.57  ? 288  ALA C N   1 
ATOM   7137  C  CA  . ALA C 1 310 ? 69.366  92.572  37.416  1.00 32.53  ? 288  ALA C CA  1 
ATOM   7138  C  C   . ALA C 1 310 ? 70.137  91.801  36.346  1.00 29.84  ? 288  ALA C C   1 
ATOM   7139  O  O   . ALA C 1 310 ? 69.559  91.259  35.414  1.00 27.30  ? 288  ALA C O   1 
ATOM   7140  C  CB  . ALA C 1 310 ? 69.266  91.730  38.689  1.00 33.37  ? 288  ALA C CB  1 
ATOM   7141  N  N   . GLU C 1 311 ? 71.454  91.777  36.503  1.00 30.76  ? 289  GLU C N   1 
ATOM   7142  C  CA  . GLU C 1 311 ? 72.341  91.056  35.609  1.00 45.11  ? 289  GLU C CA  1 
ATOM   7143  C  C   . GLU C 1 311 ? 73.317  90.316  36.526  1.00 52.15  ? 289  GLU C C   1 
ATOM   7144  O  O   . GLU C 1 311 ? 73.626  90.788  37.620  1.00 59.03  ? 289  GLU C O   1 
ATOM   7145  C  CB  . GLU C 1 311 ? 73.124  92.019  34.714  1.00 41.68  ? 289  GLU C CB  1 
ATOM   7146  C  CG  . GLU C 1 311 ? 72.277  93.024  33.952  1.00 48.76  ? 289  GLU C CG  1 
ATOM   7147  C  CD  . GLU C 1 311 ? 73.089  93.806  32.929  1.00 46.02  ? 289  GLU C CD  1 
ATOM   7148  O  OE1 . GLU C 1 311 ? 73.371  93.264  31.843  1.00 42.65  ? 289  GLU C OE1 1 
ATOM   7149  O  OE2 . GLU C 1 311 ? 73.457  94.961  33.217  1.00 54.91  ? 289  GLU C OE2 1 
ATOM   7150  N  N   . PRO C 1 312 ? 73.814  89.146  36.103  1.00 55.14  ? 290  PRO C N   1 
ATOM   7151  C  CA  . PRO C 1 312 ? 73.538  88.456  34.839  1.00 55.04  ? 290  PRO C CA  1 
ATOM   7152  C  C   . PRO C 1 312 ? 72.139  87.851  34.777  1.00 52.98  ? 290  PRO C C   1 
ATOM   7153  O  O   . PRO C 1 312 ? 71.345  88.008  35.700  1.00 54.39  ? 290  PRO C O   1 
ATOM   7154  C  CB  . PRO C 1 312 ? 74.623  87.388  34.790  1.00 53.87  ? 290  PRO C CB  1 
ATOM   7155  C  CG  . PRO C 1 312 ? 75.737  88.001  35.576  1.00 58.94  ? 290  PRO C CG  1 
ATOM   7156  C  CD  . PRO C 1 312 ? 75.003  88.573  36.750  1.00 56.04  ? 290  PRO C CD  1 
ATOM   7157  N  N   . GLU C 1 313 ? 71.854  87.159  33.676  1.00 52.86  ? 291  GLU C N   1 
ATOM   7158  C  CA  . GLU C 1 313 ? 70.565  86.514  33.450  1.00 50.75  ? 291  GLU C CA  1 
ATOM   7159  C  C   . GLU C 1 313 ? 70.133  85.584  34.583  1.00 47.96  ? 291  GLU C C   1 
ATOM   7160  O  O   . GLU C 1 313 ? 69.004  85.675  35.076  1.00 42.95  ? 291  GLU C O   1 
ATOM   7161  C  CB  . GLU C 1 313 ? 70.616  85.722  32.144  1.00 54.46  ? 291  GLU C CB  1 
ATOM   7162  C  CG  . GLU C 1 313 ? 70.575  86.588  30.910  1.00 61.56  ? 291  GLU C CG  1 
ATOM   7163  C  CD  . GLU C 1 313 ? 69.181  87.093  30.623  1.00 64.86  ? 291  GLU C CD  1 
ATOM   7164  O  OE1 . GLU C 1 313 ? 68.489  87.491  31.588  1.00 66.02  ? 291  GLU C OE1 1 
ATOM   7165  O  OE2 . GLU C 1 313 ? 68.781  87.093  29.436  1.00 65.34  ? 291  GLU C OE2 1 
ATOM   7166  N  N   . GLU C 1 314 ? 71.037  84.689  34.980  1.00 49.74  ? 292  GLU C N   1 
ATOM   7167  C  CA  . GLU C 1 314 ? 70.776  83.718  36.042  1.00 52.34  ? 292  GLU C CA  1 
ATOM   7168  C  C   . GLU C 1 314 ? 69.979  84.320  37.187  1.00 51.67  ? 292  GLU C C   1 
ATOM   7169  O  O   . GLU C 1 314 ? 68.988  83.743  37.639  1.00 53.16  ? 292  GLU C O   1 
ATOM   7170  C  CB  . GLU C 1 314 ? 72.091  83.154  36.589  1.00 54.07  ? 292  GLU C CB  1 
ATOM   7171  C  CG  . GLU C 1 314 ? 72.971  82.480  35.549  1.00 61.49  ? 292  GLU C CG  1 
ATOM   7172  C  CD  . GLU C 1 314 ? 73.786  83.469  34.740  1.00 66.74  ? 292  GLU C CD  1 
ATOM   7173  O  OE1 . GLU C 1 314 ? 74.627  84.161  35.345  1.00 73.88  ? 292  GLU C OE1 1 
ATOM   7174  O  OE2 . GLU C 1 314 ? 73.590  83.555  33.506  1.00 67.21  ? 292  GLU C OE2 1 
ATOM   7175  N  N   . LEU C 1 315 ? 70.421  85.487  37.644  1.00 53.11  ? 293  LEU C N   1 
ATOM   7176  C  CA  . LEU C 1 315 ? 69.771  86.198  38.738  1.00 48.02  ? 293  LEU C CA  1 
ATOM   7177  C  C   . LEU C 1 315 ? 68.253  86.264  38.651  1.00 49.03  ? 293  LEU C C   1 
ATOM   7178  O  O   . LEU C 1 315 ? 67.572  86.207  39.675  1.00 46.58  ? 293  LEU C O   1 
ATOM   7179  C  CB  . LEU C 1 315 ? 70.341  87.611  38.849  1.00 49.29  ? 293  LEU C CB  1 
ATOM   7180  C  CG  . LEU C 1 315 ? 71.744  87.791  39.454  1.00 52.92  ? 293  LEU C CG  1 
ATOM   7181  C  CD1 . LEU C 1 315 ? 71.710  87.423  40.932  1.00 57.81  ? 293  LEU C CD1 1 
ATOM   7182  C  CD2 . LEU C 1 315 ? 72.764  86.946  38.704  1.00 43.62  ? 293  LEU C CD2 1 
ATOM   7183  N  N   . ASN C 1 316 ? 67.726  86.352  37.431  1.00 51.32  ? 294  ASN C N   1 
ATOM   7184  C  CA  . ASN C 1 316 ? 66.285  86.457  37.224  1.00 54.26  ? 294  ASN C CA  1 
ATOM   7185  C  C   . ASN C 1 316 ? 65.501  85.174  36.930  1.00 60.18  ? 294  ASN C C   1 
ATOM   7186  O  O   . ASN C 1 316 ? 64.379  85.251  36.429  1.00 64.29  ? 294  ASN C O   1 
ATOM   7187  C  CB  . ASN C 1 316 ? 66.008  87.458  36.105  1.00 50.44  ? 294  ASN C CB  1 
ATOM   7188  C  CG  . ASN C 1 316 ? 66.696  88.780  36.327  1.00 49.74  ? 294  ASN C CG  1 
ATOM   7189  O  OD1 . ASN C 1 316 ? 66.578  89.387  37.391  1.00 47.18  ? 294  ASN C OD1 1 
ATOM   7190  N  ND2 . ASN C 1 316 ? 67.416  89.241  35.315  1.00 47.80  ? 294  ASN C ND2 1 
ATOM   7191  N  N   . GLN C 1 317 ? 66.056  84.007  37.248  1.00 64.28  ? 295  GLN C N   1 
ATOM   7192  C  CA  . GLN C 1 317 ? 65.356  82.746  36.976  1.00 67.76  ? 295  GLN C CA  1 
ATOM   7193  C  C   . GLN C 1 317 ? 64.231  82.388  37.947  1.00 67.80  ? 295  GLN C C   1 
ATOM   7194  O  O   . GLN C 1 317 ? 64.491  81.873  39.032  1.00 71.74  ? 295  GLN C O   1 
ATOM   7195  C  CB  . GLN C 1 317 ? 66.350  81.582  36.953  1.00 70.12  ? 295  GLN C CB  1 
ATOM   7196  C  CG  . GLN C 1 317 ? 67.474  81.747  35.957  1.00 76.64  ? 295  GLN C CG  1 
ATOM   7197  C  CD  . GLN C 1 317 ? 68.421  80.558  35.935  1.00 76.81  ? 295  GLN C CD  1 
ATOM   7198  O  OE1 . GLN C 1 317 ? 68.783  80.036  36.983  1.00 72.14  ? 295  GLN C OE1 1 
ATOM   7199  N  NE2 . GLN C 1 317 ? 68.833  80.139  34.749  1.00 79.37  ? 295  GLN C NE2 1 
ATOM   7200  N  N   . THR C 1 318 ? 62.987  82.654  37.556  1.00 67.24  ? 296  THR C N   1 
ATOM   7201  C  CA  . THR C 1 318 ? 61.831  82.323  38.396  1.00 69.97  ? 296  THR C CA  1 
ATOM   7202  C  C   . THR C 1 318 ? 60.497  82.491  37.662  1.00 74.14  ? 296  THR C C   1 
ATOM   7203  O  O   . THR C 1 318 ? 60.438  83.057  36.565  1.00 76.01  ? 296  THR C O   1 
ATOM   7204  C  CB  . THR C 1 318 ? 61.774  83.206  39.674  1.00 66.79  ? 296  THR C CB  1 
ATOM   7205  O  OG1 . THR C 1 318 ? 63.019  83.127  40.377  1.00 68.78  ? 296  THR C OG1 1 
ATOM   7206  C  CG2 . THR C 1 318 ? 60.681  82.722  40.610  1.00 63.54  ? 296  THR C CG2 1 
ATOM   7207  N  N   . GLU C 1 319 ? 59.429  81.976  38.259  1.00 77.85  ? 297  GLU C N   1 
ATOM   7208  C  CA  . GLU C 1 319 ? 58.104  82.109  37.681  1.00 83.62  ? 297  GLU C CA  1 
ATOM   7209  C  C   . GLU C 1 319 ? 57.391  83.247  38.416  1.00 85.49  ? 297  GLU C C   1 
ATOM   7210  O  O   . GLU C 1 319 ? 56.363  83.746  37.948  1.00 88.51  ? 297  GLU C O   1 
ATOM   7211  C  CB  . GLU C 1 319 ? 57.327  80.792  37.838  1.00 85.95  ? 297  GLU C CB  1 
ATOM   7212  C  CG  . GLU C 1 319 ? 57.273  79.941  36.570  1.00 85.03  ? 297  GLU C CG  1 
ATOM   7213  C  CD  . GLU C 1 319 ? 56.238  80.443  35.569  1.00 85.94  ? 297  GLU C CD  1 
ATOM   7214  O  OE1 . GLU C 1 319 ? 55.037  80.439  35.918  1.00 83.55  ? 297  GLU C OE1 1 
ATOM   7215  O  OE2 . GLU C 1 319 ? 56.614  80.840  34.442  1.00 83.82  ? 297  GLU C OE2 1 
ATOM   7216  N  N   . GLN C 1 320 ? 57.939  83.641  39.569  1.00 84.44  ? 298  GLN C N   1 
ATOM   7217  C  CA  . GLN C 1 320 ? 57.376  84.757  40.330  1.00 82.49  ? 298  GLN C CA  1 
ATOM   7218  C  C   . GLN C 1 320 ? 57.307  85.877  39.320  1.00 81.81  ? 298  GLN C C   1 
ATOM   7219  O  O   . GLN C 1 320 ? 58.318  86.225  38.706  1.00 83.66  ? 298  GLN C O   1 
ATOM   7220  C  CB  . GLN C 1 320 ? 58.325  85.252  41.428  1.00 81.20  ? 298  GLN C CB  1 
ATOM   7221  C  CG  . GLN C 1 320 ? 58.712  84.246  42.482  1.00 79.58  ? 298  GLN C CG  1 
ATOM   7222  C  CD  . GLN C 1 320 ? 57.592  83.995  43.476  1.00 78.63  ? 298  GLN C CD  1 
ATOM   7223  O  OE1 . GLN C 1 320 ? 57.026  84.928  44.032  1.00 80.95  ? 298  GLN C OE1 1 
ATOM   7224  N  NE2 . GLN C 1 320 ? 57.255  82.735  43.680  1.00 74.00  ? 298  GLN C NE2 1 
ATOM   7225  N  N   . THR C 1 321 ? 56.135  86.447  39.127  1.00 80.02  ? 299  THR C N   1 
ATOM   7226  C  CA  . THR C 1 321 ? 56.041  87.539  38.174  1.00 78.45  ? 299  THR C CA  1 
ATOM   7227  C  C   . THR C 1 321 ? 55.557  88.724  39.009  1.00 75.80  ? 299  THR C C   1 
ATOM   7228  O  O   . THR C 1 321 ? 55.729  89.892  38.644  1.00 78.13  ? 299  THR C O   1 
ATOM   7229  C  CB  . THR C 1 321 ? 55.048  87.174  37.036  1.00 78.23  ? 299  THR C CB  1 
ATOM   7230  O  OG1 . THR C 1 321 ? 55.735  87.186  35.774  1.00 79.02  ? 299  THR C OG1 1 
ATOM   7231  C  CG2 . THR C 1 321 ? 53.870  88.132  36.991  1.00 78.33  ? 299  THR C CG2 1 
ATOM   7232  N  N   . THR C 1 322 ? 54.996  88.382  40.168  1.00 70.64  ? 300  THR C N   1 
ATOM   7233  C  CA  . THR C 1 322 ? 54.443  89.352  41.095  1.00 65.57  ? 300  THR C CA  1 
ATOM   7234  C  C   . THR C 1 322 ? 55.025  89.295  42.513  1.00 61.52  ? 300  THR C C   1 
ATOM   7235  O  O   . THR C 1 322 ? 55.398  88.233  43.011  1.00 61.70  ? 300  THR C O   1 
ATOM   7236  C  CB  . THR C 1 322 ? 52.932  89.155  41.200  1.00 64.93  ? 300  THR C CB  1 
ATOM   7237  O  OG1 . THR C 1 322 ? 52.666  87.786  41.533  1.00 69.24  ? 300  THR C OG1 1 
ATOM   7238  C  CG2 . THR C 1 322 ? 52.259  89.489  39.882  1.00 63.86  ? 300  THR C CG2 1 
ATOM   7239  N  N   . TYR C 1 323 ? 55.071  90.459  43.155  1.00 55.75  ? 301  TYR C N   1 
ATOM   7240  C  CA  . TYR C 1 323 ? 55.558  90.641  44.523  1.00 50.77  ? 301  TYR C CA  1 
ATOM   7241  C  C   . TYR C 1 323 ? 54.811  91.842  45.100  1.00 47.82  ? 301  TYR C C   1 
ATOM   7242  O  O   . TYR C 1 323 ? 54.218  92.617  44.357  1.00 44.27  ? 301  TYR C O   1 
ATOM   7243  C  CB  . TYR C 1 323 ? 57.069  90.887  44.539  1.00 52.62  ? 301  TYR C CB  1 
ATOM   7244  C  CG  . TYR C 1 323 ? 57.541  91.783  43.430  1.00 51.99  ? 301  TYR C CG  1 
ATOM   7245  C  CD1 . TYR C 1 323 ? 57.278  93.147  43.448  1.00 50.43  ? 301  TYR C CD1 1 
ATOM   7246  C  CD2 . TYR C 1 323 ? 58.214  91.255  42.332  1.00 55.21  ? 301  TYR C CD2 1 
ATOM   7247  C  CE1 . TYR C 1 323 ? 57.670  93.962  42.396  1.00 51.49  ? 301  TYR C CE1 1 
ATOM   7248  C  CE2 . TYR C 1 323 ? 58.610  92.056  41.273  1.00 52.51  ? 301  TYR C CE2 1 
ATOM   7249  C  CZ  . TYR C 1 323 ? 58.335  93.409  41.308  1.00 50.70  ? 301  TYR C CZ  1 
ATOM   7250  O  OH  . TYR C 1 323 ? 58.713  94.199  40.247  1.00 30.65  ? 301  TYR C OH  1 
ATOM   7251  N  N   . GLU C 1 324 ? 54.844  91.988  46.422  1.00 46.40  ? 302  GLU C N   1 
ATOM   7252  C  CA  . GLU C 1 324 ? 54.135  93.062  47.115  1.00 43.55  ? 302  GLU C CA  1 
ATOM   7253  C  C   . GLU C 1 324 ? 54.880  94.392  47.295  1.00 41.68  ? 302  GLU C C   1 
ATOM   7254  O  O   . GLU C 1 324 ? 54.240  95.418  47.544  1.00 35.68  ? 302  GLU C O   1 
ATOM   7255  C  CB  . GLU C 1 324 ? 53.692  92.571  48.494  1.00 45.45  ? 302  GLU C CB  1 
ATOM   7256  C  CG  . GLU C 1 324 ? 52.828  91.326  48.497  1.00 44.87  ? 302  GLU C CG  1 
ATOM   7257  C  CD  . GLU C 1 324 ? 51.438  91.569  47.937  1.00 48.53  ? 302  GLU C CD  1 
ATOM   7258  O  OE1 . GLU C 1 324 ? 50.973  92.727  47.960  1.00 44.79  ? 302  GLU C OE1 1 
ATOM   7259  O  OE2 . GLU C 1 324 ? 50.800  90.594  47.487  1.00 54.93  ? 302  GLU C OE2 1 
ATOM   7260  N  N   . VAL C 1 325 ? 56.211  94.384  47.200  1.00 39.27  ? 303  VAL C N   1 
ATOM   7261  C  CA  . VAL C 1 325 ? 56.982  95.620  47.359  1.00 38.90  ? 303  VAL C CA  1 
ATOM   7262  C  C   . VAL C 1 325 ? 56.758  96.559  46.189  1.00 37.83  ? 303  VAL C C   1 
ATOM   7263  O  O   . VAL C 1 325 ? 56.937  96.184  45.028  1.00 35.53  ? 303  VAL C O   1 
ATOM   7264  C  CB  . VAL C 1 325 ? 58.485  95.361  47.494  1.00 39.63  ? 303  VAL C CB  1 
ATOM   7265  C  CG1 . VAL C 1 325 ? 58.807  94.953  48.919  1.00 41.22  ? 303  VAL C CG1 1 
ATOM   7266  C  CG2 . VAL C 1 325 ? 58.909  94.286  46.526  1.00 47.01  ? 303  VAL C CG2 1 
ATOM   7267  N  N   . GLU C 1 326 ? 56.384  97.795  46.511  1.00 38.38  ? 304  GLU C N   1 
ATOM   7268  C  CA  . GLU C 1 326 ? 56.084  98.796  45.494  1.00 32.92  ? 304  GLU C CA  1 
ATOM   7269  C  C   . GLU C 1 326 ? 57.234  99.703  45.091  1.00 33.39  ? 304  GLU C C   1 
ATOM   7270  O  O   . GLU C 1 326 ? 58.092  100.033 45.899  1.00 26.16  ? 304  GLU C O   1 
ATOM   7271  C  CB  . GLU C 1 326 ? 54.913  99.661  45.955  1.00 27.90  ? 304  GLU C CB  1 
ATOM   7272  C  CG  . GLU C 1 326 ? 53.754  98.854  46.494  1.00 23.98  ? 304  GLU C CG  1 
ATOM   7273  C  CD  . GLU C 1 326 ? 52.567  99.711  46.878  1.00 35.33  ? 304  GLU C CD  1 
ATOM   7274  O  OE1 . GLU C 1 326 ? 51.893  99.365  47.877  1.00 36.48  ? 304  GLU C OE1 1 
ATOM   7275  O  OE2 . GLU C 1 326 ? 52.301  100.719 46.175  1.00 36.76  ? 304  GLU C OE2 1 
ATOM   7276  N  N   . GLY C 1 327 ? 57.234  100.091 43.818  1.00 38.00  ? 305  GLY C N   1 
ATOM   7277  C  CA  . GLY C 1 327 ? 58.247  100.990 43.302  1.00 33.17  ? 305  GLY C CA  1 
ATOM   7278  C  C   . GLY C 1 327 ? 59.496  100.402 42.692  1.00 28.34  ? 305  GLY C C   1 
ATOM   7279  O  O   . GLY C 1 327 ? 60.253  101.131 42.073  1.00 28.09  ? 305  GLY C O   1 
ATOM   7280  N  N   . ILE C 1 328 ? 59.730  99.105  42.849  1.00 34.67  ? 306  ILE C N   1 
ATOM   7281  C  CA  . ILE C 1 328 ? 60.938  98.503  42.286  1.00 31.57  ? 306  ILE C CA  1 
ATOM   7282  C  C   . ILE C 1 328 ? 60.668  97.334  41.353  1.00 30.49  ? 306  ILE C C   1 
ATOM   7283  O  O   . ILE C 1 328 ? 59.635  96.681  41.444  1.00 32.43  ? 306  ILE C O   1 
ATOM   7284  C  CB  . ILE C 1 328 ? 61.887  98.032  43.400  1.00 30.76  ? 306  ILE C CB  1 
ATOM   7285  C  CG1 . ILE C 1 328 ? 61.139  97.119  44.383  1.00 33.95  ? 306  ILE C CG1 1 
ATOM   7286  C  CG2 . ILE C 1 328 ? 62.458  99.238  44.125  1.00 37.52  ? 306  ILE C CG2 1 
ATOM   7287  C  CD1 . ILE C 1 328 ? 62.038  96.419  45.399  1.00 16.46  ? 306  ILE C CD1 1 
ATOM   7288  N  N   . GLY C 1 329 ? 61.613  97.081  40.456  1.00 27.03  ? 307  GLY C N   1 
ATOM   7289  C  CA  . GLY C 1 329 ? 61.475  95.979  39.529  1.00 28.35  ? 307  GLY C CA  1 
ATOM   7290  C  C   . GLY C 1 329 ? 60.664  96.412  38.336  1.00 30.50  ? 307  GLY C C   1 
ATOM   7291  O  O   . GLY C 1 329 ? 60.039  97.481  38.373  1.00 25.71  ? 307  GLY C O   1 
ATOM   7292  N  N   . TYR C 1 330 ? 60.678  95.587  37.288  1.00 30.31  ? 308  TYR C N   1 
ATOM   7293  C  CA  . TYR C 1 330 ? 59.943  95.864  36.054  1.00 30.73  ? 308  TYR C CA  1 
ATOM   7294  C  C   . TYR C 1 330 ? 60.151  94.688  35.100  1.00 29.64  ? 308  TYR C C   1 
ATOM   7295  O  O   . TYR C 1 330 ? 61.132  93.958  35.225  1.00 28.22  ? 308  TYR C O   1 
ATOM   7296  C  CB  . TYR C 1 330 ? 60.479  97.146  35.420  1.00 32.46  ? 308  TYR C CB  1 
ATOM   7297  C  CG  . TYR C 1 330 ? 59.472  97.940  34.613  1.00 37.02  ? 308  TYR C CG  1 
ATOM   7298  C  CD1 . TYR C 1 330 ? 58.303  98.422  35.201  1.00 33.47  ? 308  TYR C CD1 1 
ATOM   7299  C  CD2 . TYR C 1 330 ? 59.727  98.266  33.275  1.00 40.49  ? 308  TYR C CD2 1 
ATOM   7300  C  CE1 . TYR C 1 330 ? 57.418  99.214  34.483  1.00 46.89  ? 308  TYR C CE1 1 
ATOM   7301  C  CE2 . TYR C 1 330 ? 58.849  99.058  32.542  1.00 41.09  ? 308  TYR C CE2 1 
ATOM   7302  C  CZ  . TYR C 1 330 ? 57.697  99.534  33.153  1.00 49.52  ? 308  TYR C CZ  1 
ATOM   7303  O  OH  . TYR C 1 330 ? 56.836  100.359 32.454  1.00 52.18  ? 308  TYR C OH  1 
ATOM   7304  N  N   . ASP C 1 331 ? 59.225  94.491  34.164  1.00 33.58  ? 309  ASP C N   1 
ATOM   7305  C  CA  . ASP C 1 331 ? 59.345  93.402  33.193  1.00 39.38  ? 309  ASP C CA  1 
ATOM   7306  C  C   . ASP C 1 331 ? 59.900  93.893  31.866  1.00 39.00  ? 309  ASP C C   1 
ATOM   7307  O  O   . ASP C 1 331 ? 59.804  93.204  30.845  1.00 36.09  ? 309  ASP C O   1 
ATOM   7308  C  CB  . ASP C 1 331 ? 57.995  92.713  32.968  1.00 43.33  ? 309  ASP C CB  1 
ATOM   7309  C  CG  . ASP C 1 331 ? 56.816  93.630  33.229  1.00 51.80  ? 309  ASP C CG  1 
ATOM   7310  O  OD1 . ASP C 1 331 ? 56.750  94.722  32.624  1.00 56.96  ? 309  ASP C OD1 1 
ATOM   7311  O  OD2 . ASP C 1 331 ? 55.946  93.251  34.043  1.00 53.79  ? 309  ASP C OD2 1 
ATOM   7312  N  N   . PHE C 1 332 ? 60.477  95.094  31.905  1.00 40.52  ? 310  PHE C N   1 
ATOM   7313  C  CA  . PHE C 1 332 ? 61.088  95.742  30.742  1.00 43.12  ? 310  PHE C CA  1 
ATOM   7314  C  C   . PHE C 1 332 ? 62.273  96.564  31.227  1.00 37.94  ? 310  PHE C C   1 
ATOM   7315  O  O   . PHE C 1 332 ? 62.249  97.102  32.330  1.00 35.34  ? 310  PHE C O   1 
ATOM   7316  C  CB  . PHE C 1 332 ? 60.099  96.687  30.047  1.00 46.76  ? 310  PHE C CB  1 
ATOM   7317  C  CG  . PHE C 1 332 ? 58.962  95.986  29.360  1.00 54.05  ? 310  PHE C CG  1 
ATOM   7318  C  CD1 . PHE C 1 332 ? 57.653  96.172  29.791  1.00 54.31  ? 310  PHE C CD1 1 
ATOM   7319  C  CD2 . PHE C 1 332 ? 59.196  95.157  28.264  1.00 55.95  ? 310  PHE C CD2 1 
ATOM   7320  C  CE1 . PHE C 1 332 ? 56.587  95.545  29.135  1.00 63.60  ? 310  PHE C CE1 1 
ATOM   7321  C  CE2 . PHE C 1 332 ? 58.141  94.526  27.602  1.00 60.82  ? 310  PHE C CE2 1 
ATOM   7322  C  CZ  . PHE C 1 332 ? 56.835  94.720  28.036  1.00 61.46  ? 310  PHE C CZ  1 
ATOM   7323  N  N   . ILE C 1 333 ? 63.316  96.659  30.415  1.00 28.98  ? 311  ILE C N   1 
ATOM   7324  C  CA  . ILE C 1 333 ? 64.454  97.453  30.815  1.00 27.80  ? 311  ILE C CA  1 
ATOM   7325  C  C   . ILE C 1 333 ? 64.178  98.913  30.458  1.00 30.16  ? 311  ILE C C   1 
ATOM   7326  O  O   . ILE C 1 333 ? 64.247  99.303  29.287  1.00 26.88  ? 311  ILE C O   1 
ATOM   7327  C  CB  . ILE C 1 333 ? 65.722  96.968  30.119  1.00 23.09  ? 311  ILE C CB  1 
ATOM   7328  C  CG1 . ILE C 1 333 ? 65.930  95.501  30.461  1.00 19.93  ? 311  ILE C CG1 1 
ATOM   7329  C  CG2 . ILE C 1 333 ? 66.922  97.802  30.556  1.00 16.44  ? 311  ILE C CG2 1 
ATOM   7330  C  CD1 . ILE C 1 333 ? 67.283  94.977  30.082  1.00 26.83  ? 311  ILE C CD1 1 
ATOM   7331  N  N   . PRO C 1 334 ? 63.844  99.736  31.469  1.00 28.67  ? 312  PRO C N   1 
ATOM   7332  C  CA  . PRO C 1 334 ? 63.563  101.141 31.195  1.00 29.71  ? 312  PRO C CA  1 
ATOM   7333  C  C   . PRO C 1 334 ? 64.721  101.719 30.404  1.00 30.24  ? 312  PRO C C   1 
ATOM   7334  O  O   . PRO C 1 334 ? 65.857  101.269 30.553  1.00 19.08  ? 312  PRO C O   1 
ATOM   7335  C  CB  . PRO C 1 334 ? 63.435  101.747 32.593  1.00 26.88  ? 312  PRO C CB  1 
ATOM   7336  C  CG  . PRO C 1 334 ? 62.923  100.612 33.399  1.00 29.33  ? 312  PRO C CG  1 
ATOM   7337  C  CD  . PRO C 1 334 ? 63.777  99.468  32.916  1.00 28.51  ? 312  PRO C CD  1 
ATOM   7338  N  N   . THR C 1 335 ? 64.425  102.699 29.556  1.00 32.50  ? 313  THR C N   1 
ATOM   7339  C  CA  . THR C 1 335 ? 65.443  103.323 28.735  1.00 29.84  ? 313  THR C CA  1 
ATOM   7340  C  C   . THR C 1 335 ? 66.301  104.303 29.529  1.00 31.48  ? 313  THR C C   1 
ATOM   7341  O  O   . THR C 1 335 ? 67.448  104.576 29.154  1.00 35.15  ? 313  THR C O   1 
ATOM   7342  C  CB  . THR C 1 335 ? 64.794  104.018 27.515  1.00 33.09  ? 313  THR C CB  1 
ATOM   7343  O  OG1 . THR C 1 335 ? 65.431  105.273 27.280  1.00 30.81  ? 313  THR C OG1 1 
ATOM   7344  C  CG2 . THR C 1 335 ? 63.320  104.232 27.738  1.00 26.04  ? 313  THR C CG2 1 
ATOM   7345  N  N   . VAL C 1 336 ? 65.759  104.818 30.632  1.00 29.75  ? 314  VAL C N   1 
ATOM   7346  C  CA  . VAL C 1 336 ? 66.515  105.750 31.465  1.00 28.81  ? 314  VAL C CA  1 
ATOM   7347  C  C   . VAL C 1 336 ? 67.575  105.034 32.310  1.00 23.28  ? 314  VAL C C   1 
ATOM   7348  O  O   . VAL C 1 336 ? 68.464  105.669 32.880  1.00 18.04  ? 314  VAL C O   1 
ATOM   7349  C  CB  . VAL C 1 336 ? 65.596  106.551 32.414  1.00 26.02  ? 314  VAL C CB  1 
ATOM   7350  C  CG1 . VAL C 1 336 ? 64.685  107.460 31.615  1.00 28.47  ? 314  VAL C CG1 1 
ATOM   7351  C  CG2 . VAL C 1 336 ? 64.790  105.607 33.279  1.00 24.44  ? 314  VAL C CG2 1 
ATOM   7352  N  N   . LEU C 1 337 ? 67.476  103.712 32.373  1.00 15.18  ? 315  LEU C N   1 
ATOM   7353  C  CA  . LEU C 1 337 ? 68.415  102.908 33.136  1.00 13.42  ? 315  LEU C CA  1 
ATOM   7354  C  C   . LEU C 1 337 ? 69.662  102.520 32.342  1.00 15.04  ? 315  LEU C C   1 
ATOM   7355  O  O   . LEU C 1 337 ? 69.567  102.006 31.239  1.00 24.45  ? 315  LEU C O   1 
ATOM   7356  C  CB  . LEU C 1 337 ? 67.717  101.632 33.627  1.00 13.69  ? 315  LEU C CB  1 
ATOM   7357  C  CG  . LEU C 1 337 ? 68.598  100.455 34.101  1.00 16.46  ? 315  LEU C CG  1 
ATOM   7358  C  CD1 . LEU C 1 337 ? 69.475  100.883 35.269  1.00 5.50   ? 315  LEU C CD1 1 
ATOM   7359  C  CD2 . LEU C 1 337 ? 67.725  99.268  34.488  1.00 17.39  ? 315  LEU C CD2 1 
ATOM   7360  N  N   . ASP C 1 338 ? 70.832  102.759 32.913  1.00 20.56  ? 316  ASP C N   1 
ATOM   7361  C  CA  . ASP C 1 338 ? 72.101  102.398 32.293  1.00 18.23  ? 316  ASP C CA  1 
ATOM   7362  C  C   . ASP C 1 338 ? 72.709  101.299 33.183  1.00 32.14  ? 316  ASP C C   1 
ATOM   7363  O  O   . ASP C 1 338 ? 73.440  101.588 34.137  1.00 33.75  ? 316  ASP C O   1 
ATOM   7364  C  CB  . ASP C 1 338 ? 73.005  103.626 32.254  1.00 19.36  ? 316  ASP C CB  1 
ATOM   7365  C  CG  . ASP C 1 338 ? 74.395  103.339 31.686  1.00 25.39  ? 316  ASP C CG  1 
ATOM   7366  O  OD1 . ASP C 1 338 ? 75.161  104.291 31.458  1.00 30.38  ? 316  ASP C OD1 1 
ATOM   7367  O  OD2 . ASP C 1 338 ? 74.743  102.172 31.465  1.00 35.24  ? 316  ASP C OD2 1 
ATOM   7368  N  N   . ARG C 1 339 ? 72.395  100.038 32.885  1.00 36.15  ? 317  ARG C N   1 
ATOM   7369  C  CA  . ARG C 1 339 ? 72.896  98.918  33.697  1.00 39.42  ? 317  ARG C CA  1 
ATOM   7370  C  C   . ARG C 1 339 ? 74.410  98.815  33.672  1.00 36.44  ? 317  ARG C C   1 
ATOM   7371  O  O   . ARG C 1 339 ? 74.996  98.033  34.408  1.00 35.85  ? 317  ARG C O   1 
ATOM   7372  C  CB  . ARG C 1 339 ? 72.320  97.594  33.203  1.00 38.32  ? 317  ARG C CB  1 
ATOM   7373  C  CG  . ARG C 1 339 ? 70.809  97.469  33.252  1.00 46.51  ? 317  ARG C CG  1 
ATOM   7374  C  CD  . ARG C 1 339 ? 70.380  96.457  32.192  1.00 51.96  ? 317  ARG C CD  1 
ATOM   7375  N  NE  . ARG C 1 339 ? 69.685  95.295  32.739  1.00 57.67  ? 317  ARG C NE  1 
ATOM   7376  C  CZ  . ARG C 1 339 ? 69.453  94.179  32.052  1.00 57.35  ? 317  ARG C CZ  1 
ATOM   7377  N  NH1 . ARG C 1 339 ? 69.870  94.072  30.797  1.00 52.01  ? 317  ARG C NH1 1 
ATOM   7378  N  NH2 . ARG C 1 339 ? 68.786  93.178  32.610  1.00 58.06  ? 317  ARG C NH2 1 
ATOM   7379  N  N   . THR C 1 340 ? 75.033  99.603  32.811  1.00 36.84  ? 318  THR C N   1 
ATOM   7380  C  CA  . THR C 1 340 ? 76.482  99.601  32.663  1.00 36.94  ? 318  THR C CA  1 
ATOM   7381  C  C   . THR C 1 340 ? 77.251  100.129 33.860  1.00 32.48  ? 318  THR C C   1 
ATOM   7382  O  O   . THR C 1 340 ? 78.397  99.733  34.101  1.00 38.27  ? 318  THR C O   1 
ATOM   7383  C  CB  . THR C 1 340 ? 76.889  100.417 31.423  1.00 35.44  ? 318  THR C CB  1 
ATOM   7384  O  OG1 . THR C 1 340 ? 76.769  99.591  30.265  1.00 29.11  ? 318  THR C OG1 1 
ATOM   7385  C  CG2 . THR C 1 340 ? 78.319  100.931 31.534  1.00 34.81  ? 318  THR C CG2 1 
ATOM   7386  N  N   . VAL C 1 341 ? 76.630  101.028 34.602  1.00 26.30  ? 319  VAL C N   1 
ATOM   7387  C  CA  . VAL C 1 341 ? 77.296  101.607 35.759  1.00 32.84  ? 319  VAL C CA  1 
ATOM   7388  C  C   . VAL C 1 341 ? 77.023  100.875 37.080  1.00 31.42  ? 319  VAL C C   1 
ATOM   7389  O  O   . VAL C 1 341 ? 77.528  101.273 38.134  1.00 32.90  ? 319  VAL C O   1 
ATOM   7390  C  CB  . VAL C 1 341 ? 76.913  103.084 35.894  1.00 32.34  ? 319  VAL C CB  1 
ATOM   7391  C  CG1 . VAL C 1 341 ? 77.477  103.853 34.733  1.00 27.65  ? 319  VAL C CG1 1 
ATOM   7392  C  CG2 . VAL C 1 341 ? 75.397  103.229 35.916  1.00 31.55  ? 319  VAL C CG2 1 
ATOM   7393  N  N   . VAL C 1 342 ? 76.224  99.811  37.017  1.00 32.40  ? 320  VAL C N   1 
ATOM   7394  C  CA  . VAL C 1 342 ? 75.910  99.017  38.201  1.00 36.14  ? 320  VAL C CA  1 
ATOM   7395  C  C   . VAL C 1 342 ? 76.965  97.928  38.314  1.00 40.39  ? 320  VAL C C   1 
ATOM   7396  O  O   . VAL C 1 342 ? 77.030  97.035  37.473  1.00 48.04  ? 320  VAL C O   1 
ATOM   7397  C  CB  . VAL C 1 342 ? 74.527  98.358  38.102  1.00 30.73  ? 320  VAL C CB  1 
ATOM   7398  C  CG1 . VAL C 1 342 ? 74.265  97.526  39.351  1.00 33.41  ? 320  VAL C CG1 1 
ATOM   7399  C  CG2 . VAL C 1 342 ? 73.453  99.426  37.944  1.00 31.53  ? 320  VAL C CG2 1 
ATOM   7400  N  N   . ASP C 1 343 ? 77.793  98.004  39.350  1.00 42.76  ? 321  ASP C N   1 
ATOM   7401  C  CA  . ASP C 1 343 ? 78.861  97.030  39.538  1.00 39.32  ? 321  ASP C CA  1 
ATOM   7402  C  C   . ASP C 1 343 ? 78.417  95.622  39.916  1.00 37.53  ? 321  ASP C C   1 
ATOM   7403  O  O   . ASP C 1 343 ? 79.126  94.657  39.636  1.00 37.56  ? 321  ASP C O   1 
ATOM   7404  C  CB  . ASP C 1 343 ? 79.855  97.536  40.576  1.00 38.81  ? 321  ASP C CB  1 
ATOM   7405  C  CG  . ASP C 1 343 ? 80.633  98.731  40.091  1.00 36.83  ? 321  ASP C CG  1 
ATOM   7406  O  OD1 . ASP C 1 343 ? 81.147  98.668  38.961  1.00 32.18  ? 321  ASP C OD1 1 
ATOM   7407  O  OD2 . ASP C 1 343 ? 80.734  99.730  40.835  1.00 45.86  ? 321  ASP C OD2 1 
ATOM   7408  N  N   . LYS C 1 344 ? 77.260  95.497  40.555  1.00 34.55  ? 322  LYS C N   1 
ATOM   7409  C  CA  . LYS C 1 344 ? 76.767  94.189  40.943  1.00 28.99  ? 322  LYS C CA  1 
ATOM   7410  C  C   . LYS C 1 344 ? 75.332  94.258  41.422  1.00 34.38  ? 322  LYS C C   1 
ATOM   7411  O  O   . LYS C 1 344 ? 74.917  95.235  42.043  1.00 36.25  ? 322  LYS C O   1 
ATOM   7412  C  CB  . LYS C 1 344 ? 77.652  93.602  42.040  1.00 35.92  ? 322  LYS C CB  1 
ATOM   7413  C  CG  . LYS C 1 344 ? 77.249  92.213  42.516  1.00 30.08  ? 322  LYS C CG  1 
ATOM   7414  C  CD  . LYS C 1 344 ? 78.194  91.739  43.600  1.00 39.57  ? 322  LYS C CD  1 
ATOM   7415  C  CE  . LYS C 1 344 ? 77.731  90.422  44.191  1.00 43.46  ? 322  LYS C CE  1 
ATOM   7416  N  NZ  . LYS C 1 344 ? 78.595  89.997  45.334  1.00 48.67  ? 322  LYS C NZ  1 
ATOM   7417  N  N   . TRP C 1 345 ? 74.574  93.209  41.132  1.00 37.23  ? 323  TRP C N   1 
ATOM   7418  C  CA  . TRP C 1 345 ? 73.183  93.163  41.539  1.00 39.01  ? 323  TRP C CA  1 
ATOM   7419  C  C   . TRP C 1 345 ? 72.919  92.095  42.593  1.00 38.52  ? 323  TRP C C   1 
ATOM   7420  O  O   . TRP C 1 345 ? 73.704  91.159  42.773  1.00 37.60  ? 323  TRP C O   1 
ATOM   7421  C  CB  . TRP C 1 345 ? 72.277  92.889  40.333  1.00 36.59  ? 323  TRP C CB  1 
ATOM   7422  C  CG  . TRP C 1 345 ? 72.291  93.930  39.262  1.00 28.30  ? 323  TRP C CG  1 
ATOM   7423  C  CD1 . TRP C 1 345 ? 73.247  94.112  38.309  1.00 24.03  ? 323  TRP C CD1 1 
ATOM   7424  C  CD2 . TRP C 1 345 ? 71.257  94.888  38.985  1.00 29.29  ? 323  TRP C CD2 1 
ATOM   7425  N  NE1 . TRP C 1 345 ? 72.872  95.116  37.445  1.00 24.03  ? 323  TRP C NE1 1 
ATOM   7426  C  CE2 . TRP C 1 345 ? 71.653  95.610  37.835  1.00 27.21  ? 323  TRP C CE2 1 
ATOM   7427  C  CE3 . TRP C 1 345 ? 70.033  95.204  39.595  1.00 29.09  ? 323  TRP C CE3 1 
ATOM   7428  C  CZ2 . TRP C 1 345 ? 70.863  96.630  37.276  1.00 19.28  ? 323  TRP C CZ2 1 
ATOM   7429  C  CZ3 . TRP C 1 345 ? 69.244  96.222  39.034  1.00 22.81  ? 323  TRP C CZ3 1 
ATOM   7430  C  CH2 . TRP C 1 345 ? 69.666  96.917  37.886  1.00 14.32  ? 323  TRP C CH2 1 
ATOM   7431  N  N   . PHE C 1 346 ? 71.799  92.268  43.287  1.00 34.55  ? 324  PHE C N   1 
ATOM   7432  C  CA  . PHE C 1 346 ? 71.325  91.351  44.313  1.00 36.44  ? 324  PHE C CA  1 
ATOM   7433  C  C   . PHE C 1 346 ? 69.818  91.334  44.153  1.00 36.93  ? 324  PHE C C   1 
ATOM   7434  O  O   . PHE C 1 346 ? 69.206  92.366  43.876  1.00 41.66  ? 324  PHE C O   1 
ATOM   7435  C  CB  . PHE C 1 346 ? 71.640  91.849  45.728  1.00 34.72  ? 324  PHE C CB  1 
ATOM   7436  C  CG  . PHE C 1 346 ? 73.066  91.665  46.140  1.00 31.55  ? 324  PHE C CG  1 
ATOM   7437  C  CD1 . PHE C 1 346 ? 74.048  92.544  45.712  1.00 32.00  ? 324  PHE C CD1 1 
ATOM   7438  C  CD2 . PHE C 1 346 ? 73.423  90.617  46.977  1.00 31.05  ? 324  PHE C CD2 1 
ATOM   7439  C  CE1 . PHE C 1 346 ? 75.369  92.385  46.117  1.00 40.40  ? 324  PHE C CE1 1 
ATOM   7440  C  CE2 . PHE C 1 346 ? 74.737  90.449  47.386  1.00 35.78  ? 324  PHE C CE2 1 
ATOM   7441  C  CZ  . PHE C 1 346 ? 75.714  91.334  46.958  1.00 39.25  ? 324  PHE C CZ  1 
ATOM   7442  N  N   . LYS C 1 347 ? 69.217  90.168  44.313  1.00 34.89  ? 325  LYS C N   1 
ATOM   7443  C  CA  . LYS C 1 347 ? 67.776  90.070  44.206  1.00 33.58  ? 325  LYS C CA  1 
ATOM   7444  C  C   . LYS C 1 347 ? 67.264  90.053  45.641  1.00 37.09  ? 325  LYS C C   1 
ATOM   7445  O  O   . LYS C 1 347 ? 67.986  89.651  46.560  1.00 32.06  ? 325  LYS C O   1 
ATOM   7446  C  CB  . LYS C 1 347 ? 67.387  88.779  43.490  1.00 33.10  ? 325  LYS C CB  1 
ATOM   7447  C  CG  . LYS C 1 347 ? 67.987  88.629  42.090  1.00 35.52  ? 325  LYS C CG  1 
ATOM   7448  C  CD  . LYS C 1 347 ? 67.297  89.517  41.062  1.00 32.00  ? 325  LYS C CD  1 
ATOM   7449  C  CE  . LYS C 1 347 ? 65.825  89.133  40.887  1.00 39.16  ? 325  LYS C CE  1 
ATOM   7450  N  NZ  . LYS C 1 347 ? 65.188  89.844  39.744  1.00 31.40  ? 325  LYS C NZ  1 
ATOM   7451  N  N   . SER C 1 348 ? 66.035  90.505  45.841  1.00 30.75  ? 326  SER C N   1 
ATOM   7452  C  CA  . SER C 1 348 ? 65.467  90.505  47.173  1.00 35.26  ? 326  SER C CA  1 
ATOM   7453  C  C   . SER C 1 348 ? 64.053  89.951  47.066  1.00 40.02  ? 326  SER C C   1 
ATOM   7454  O  O   . SER C 1 348 ? 63.557  89.753  45.958  1.00 42.80  ? 326  SER C O   1 
ATOM   7455  C  CB  . SER C 1 348 ? 65.450  91.931  47.747  1.00 36.88  ? 326  SER C CB  1 
ATOM   7456  O  OG  . SER C 1 348 ? 64.576  92.795  47.031  1.00 22.57  ? 326  SER C OG  1 
ATOM   7457  N  N   . ASN C 1 349 ? 63.414  89.691  48.205  1.00 38.64  ? 327  ASN C N   1 
ATOM   7458  C  CA  . ASN C 1 349 ? 62.052  89.173  48.209  1.00 35.31  ? 327  ASN C CA  1 
ATOM   7459  C  C   . ASN C 1 349 ? 61.196  89.996  49.147  1.00 37.08  ? 327  ASN C C   1 
ATOM   7460  O  O   . ASN C 1 349 ? 61.714  90.769  49.942  1.00 39.78  ? 327  ASN C O   1 
ATOM   7461  C  CB  . ASN C 1 349 ? 62.033  87.701  48.627  1.00 35.81  ? 327  ASN C CB  1 
ATOM   7462  C  CG  . ASN C 1 349 ? 62.798  87.448  49.914  1.00 40.63  ? 327  ASN C CG  1 
ATOM   7463  O  OD1 . ASN C 1 349 ? 62.331  87.777  51.013  1.00 36.03  ? 327  ASN C OD1 1 
ATOM   7464  N  ND2 . ASN C 1 349 ? 63.990  86.866  49.784  1.00 35.38  ? 327  ASN C ND2 1 
ATOM   7465  N  N   . ASP C 1 350 ? 59.883  89.839  49.042  1.00 42.45  ? 328  ASP C N   1 
ATOM   7466  C  CA  . ASP C 1 350 ? 58.953  90.586  49.876  1.00 44.13  ? 328  ASP C CA  1 
ATOM   7467  C  C   . ASP C 1 350 ? 59.209  90.427  51.366  1.00 46.37  ? 328  ASP C C   1 
ATOM   7468  O  O   . ASP C 1 350 ? 59.332  91.413  52.095  1.00 46.10  ? 328  ASP C O   1 
ATOM   7469  C  CB  . ASP C 1 350 ? 57.514  90.159  49.577  1.00 45.57  ? 328  ASP C CB  1 
ATOM   7470  C  CG  . ASP C 1 350 ? 56.970  90.768  48.295  1.00 45.28  ? 328  ASP C CG  1 
ATOM   7471  O  OD1 . ASP C 1 350 ? 55.801  90.475  47.965  1.00 49.31  ? 328  ASP C OD1 1 
ATOM   7472  O  OD2 . ASP C 1 350 ? 57.697  91.535  47.626  1.00 37.78  ? 328  ASP C OD2 1 
ATOM   7473  N  N   . GLU C 1 351 ? 59.277  89.178  51.814  1.00 50.02  ? 329  GLU C N   1 
ATOM   7474  C  CA  . GLU C 1 351 ? 59.489  88.878  53.226  1.00 53.03  ? 329  GLU C CA  1 
ATOM   7475  C  C   . GLU C 1 351 ? 60.716  89.578  53.801  1.00 48.99  ? 329  GLU C C   1 
ATOM   7476  O  O   . GLU C 1 351 ? 60.647  90.206  54.856  1.00 45.79  ? 329  GLU C O   1 
ATOM   7477  C  CB  . GLU C 1 351 ? 59.605  87.364  53.418  1.00 58.53  ? 329  GLU C CB  1 
ATOM   7478  C  CG  . GLU C 1 351 ? 59.723  86.928  54.867  1.00 66.20  ? 329  GLU C CG  1 
ATOM   7479  C  CD  . GLU C 1 351 ? 59.153  85.541  55.095  1.00 73.38  ? 329  GLU C CD  1 
ATOM   7480  O  OE1 . GLU C 1 351 ? 59.365  84.977  56.192  1.00 74.47  ? 329  GLU C OE1 1 
ATOM   7481  O  OE2 . GLU C 1 351 ? 58.482  85.018  54.177  1.00 80.15  ? 329  GLU C OE2 1 
ATOM   7482  N  N   . GLU C 1 352 ? 61.834  89.454  53.098  1.00 45.31  ? 330  GLU C N   1 
ATOM   7483  C  CA  . GLU C 1 352 ? 63.094  90.061  53.500  1.00 43.15  ? 330  GLU C CA  1 
ATOM   7484  C  C   . GLU C 1 352 ? 62.891  91.581  53.561  1.00 47.05  ? 330  GLU C C   1 
ATOM   7485  O  O   . GLU C 1 352 ? 63.264  92.238  54.531  1.00 50.76  ? 330  GLU C O   1 
ATOM   7486  C  CB  . GLU C 1 352 ? 64.146  89.686  52.457  1.00 43.02  ? 330  GLU C CB  1 
ATOM   7487  C  CG  . GLU C 1 352 ? 65.591  89.924  52.809  1.00 40.74  ? 330  GLU C CG  1 
ATOM   7488  C  CD  . GLU C 1 352 ? 66.504  89.391  51.720  1.00 45.88  ? 330  GLU C CD  1 
ATOM   7489  O  OE1 . GLU C 1 352 ? 66.198  89.627  50.525  1.00 35.44  ? 330  GLU C OE1 1 
ATOM   7490  O  OE2 . GLU C 1 352 ? 67.520  88.742  52.058  1.00 49.92  ? 330  GLU C OE2 1 
ATOM   7491  N  N   . ALA C 1 353 ? 62.270  92.123  52.520  1.00 43.43  ? 331  ALA C N   1 
ATOM   7492  C  CA  . ALA C 1 353 ? 62.003  93.550  52.417  1.00 41.89  ? 331  ALA C CA  1 
ATOM   7493  C  C   . ALA C 1 353 ? 61.202  94.108  53.589  1.00 43.18  ? 331  ALA C C   1 
ATOM   7494  O  O   . ALA C 1 353 ? 61.643  95.041  54.268  1.00 43.72  ? 331  ALA C O   1 
ATOM   7495  C  CB  . ALA C 1 353 ? 61.271  93.843  51.116  1.00 40.24  ? 331  ALA C CB  1 
ATOM   7496  N  N   . PHE C 1 354 ? 60.017  93.547  53.811  1.00 38.82  ? 332  PHE C N   1 
ATOM   7497  C  CA  . PHE C 1 354 ? 59.140  94.001  54.889  1.00 40.23  ? 332  PHE C CA  1 
ATOM   7498  C  C   . PHE C 1 354 ? 59.690  93.790  56.300  1.00 39.45  ? 332  PHE C C   1 
ATOM   7499  O  O   . PHE C 1 354 ? 59.403  94.582  57.211  1.00 41.66  ? 332  PHE C O   1 
ATOM   7500  C  CB  . PHE C 1 354 ? 57.777  93.330  54.750  1.00 41.11  ? 332  PHE C CB  1 
ATOM   7501  C  CG  . PHE C 1 354 ? 57.073  93.671  53.469  1.00 46.78  ? 332  PHE C CG  1 
ATOM   7502  C  CD1 . PHE C 1 354 ? 56.466  92.684  52.712  1.00 43.49  ? 332  PHE C CD1 1 
ATOM   7503  C  CD2 . PHE C 1 354 ? 57.004  94.988  53.024  1.00 50.00  ? 332  PHE C CD2 1 
ATOM   7504  C  CE1 . PHE C 1 354 ? 55.799  93.000  51.534  1.00 42.92  ? 332  PHE C CE1 1 
ATOM   7505  C  CE2 . PHE C 1 354 ? 56.336  95.309  51.845  1.00 42.47  ? 332  PHE C CE2 1 
ATOM   7506  C  CZ  . PHE C 1 354 ? 55.733  94.313  51.102  1.00 36.71  ? 332  PHE C CZ  1 
ATOM   7507  N  N   . THR C 1 355 ? 60.475  92.733  56.489  1.00 29.00  ? 333  THR C N   1 
ATOM   7508  C  CA  . THR C 1 355 ? 61.043  92.480  57.796  1.00 36.75  ? 333  THR C CA  1 
ATOM   7509  C  C   . THR C 1 355 ? 62.089  93.542  58.108  1.00 39.55  ? 333  THR C C   1 
ATOM   7510  O  O   . THR C 1 355 ? 62.200  93.991  59.253  1.00 49.09  ? 333  THR C O   1 
ATOM   7511  C  CB  . THR C 1 355 ? 61.679  91.077  57.881  1.00 39.16  ? 333  THR C CB  1 
ATOM   7512  O  OG1 . THR C 1 355 ? 62.640  90.920  56.834  1.00 48.21  ? 333  THR C OG1 1 
ATOM   7513  C  CG2 . THR C 1 355 ? 60.604  90.003  57.753  1.00 42.72  ? 333  THR C CG2 1 
ATOM   7514  N  N   . PHE C 1 356 ? 62.849  93.954  57.095  1.00 35.83  ? 334  PHE C N   1 
ATOM   7515  C  CA  . PHE C 1 356 ? 63.857  94.977  57.300  1.00 26.46  ? 334  PHE C CA  1 
ATOM   7516  C  C   . PHE C 1 356 ? 63.227  96.352  57.409  1.00 24.94  ? 334  PHE C C   1 
ATOM   7517  O  O   . PHE C 1 356 ? 63.725  97.206  58.134  1.00 28.03  ? 334  PHE C O   1 
ATOM   7518  C  CB  . PHE C 1 356 ? 64.899  94.954  56.184  1.00 28.27  ? 334  PHE C CB  1 
ATOM   7519  C  CG  . PHE C 1 356 ? 66.051  94.025  56.459  1.00 34.13  ? 334  PHE C CG  1 
ATOM   7520  C  CD1 . PHE C 1 356 ? 65.897  92.647  56.342  1.00 35.36  ? 334  PHE C CD1 1 
ATOM   7521  C  CD2 . PHE C 1 356 ? 67.281  94.529  56.892  1.00 33.12  ? 334  PHE C CD2 1 
ATOM   7522  C  CE1 . PHE C 1 356 ? 66.951  91.787  56.653  1.00 34.02  ? 334  PHE C CE1 1 
ATOM   7523  C  CE2 . PHE C 1 356 ? 68.336  93.679  57.205  1.00 26.10  ? 334  PHE C CE2 1 
ATOM   7524  C  CZ  . PHE C 1 356 ? 68.176  92.310  57.087  1.00 31.98  ? 334  PHE C CZ  1 
ATOM   7525  N  N   . ALA C 1 357 ? 62.135  96.576  56.692  1.00 21.84  ? 335  ALA C N   1 
ATOM   7526  C  CA  . ALA C 1 357 ? 61.458  97.857  56.775  1.00 21.94  ? 335  ALA C CA  1 
ATOM   7527  C  C   . ALA C 1 357 ? 61.014  97.997  58.230  1.00 30.27  ? 335  ALA C C   1 
ATOM   7528  O  O   . ALA C 1 357 ? 61.184  99.048  58.852  1.00 36.59  ? 335  ALA C O   1 
ATOM   7529  C  CB  . ALA C 1 357 ? 60.249  97.882  55.858  1.00 19.57  ? 335  ALA C CB  1 
ATOM   7530  N  N   . ARG C 1 358 ? 60.449  96.926  58.775  1.00 30.15  ? 336  ARG C N   1 
ATOM   7531  C  CA  . ARG C 1 358 ? 59.988  96.930  60.160  1.00 31.80  ? 336  ARG C CA  1 
ATOM   7532  C  C   . ARG C 1 358 ? 61.124  97.127  61.163  1.00 35.43  ? 336  ARG C C   1 
ATOM   7533  O  O   . ARG C 1 358 ? 60.936  97.717  62.231  1.00 38.33  ? 336  ARG C O   1 
ATOM   7534  C  CB  . ARG C 1 358 ? 59.247  95.629  60.452  1.00 19.18  ? 336  ARG C CB  1 
ATOM   7535  C  CG  . ARG C 1 358 ? 57.769  95.736  60.189  1.00 15.70  ? 336  ARG C CG  1 
ATOM   7536  C  CD  . ARG C 1 358 ? 57.147  94.403  59.894  1.00 26.61  ? 336  ARG C CD  1 
ATOM   7537  N  NE  . ARG C 1 358 ? 55.694  94.498  59.968  1.00 26.09  ? 336  ARG C NE  1 
ATOM   7538  C  CZ  . ARG C 1 358 ? 54.999  94.330  61.084  1.00 25.63  ? 336  ARG C CZ  1 
ATOM   7539  N  NH1 . ARG C 1 358 ? 53.680  94.446  61.067  1.00 27.10  ? 336  ARG C NH1 1 
ATOM   7540  N  NH2 . ARG C 1 358 ? 55.624  94.020  62.213  1.00 32.92  ? 336  ARG C NH2 1 
ATOM   7541  N  N   . MET C 1 359 ? 62.301  96.631  60.799  1.00 34.79  ? 337  MET C N   1 
ATOM   7542  C  CA  . MET C 1 359 ? 63.491  96.723  61.632  1.00 34.58  ? 337  MET C CA  1 
ATOM   7543  C  C   . MET C 1 359 ? 64.021  98.162  61.669  1.00 35.23  ? 337  MET C C   1 
ATOM   7544  O  O   . MET C 1 359 ? 64.566  98.608  62.672  1.00 33.57  ? 337  MET C O   1 
ATOM   7545  C  CB  . MET C 1 359 ? 64.550  95.776  61.070  1.00 37.55  ? 337  MET C CB  1 
ATOM   7546  C  CG  . MET C 1 359 ? 65.601  95.327  62.053  1.00 46.36  ? 337  MET C CG  1 
ATOM   7547  S  SD  . MET C 1 359 ? 66.473  93.868  61.432  1.00 46.31  ? 337  MET C SD  1 
ATOM   7548  C  CE  . MET C 1 359 ? 67.854  94.596  60.678  1.00 54.13  ? 337  MET C CE  1 
ATOM   7549  N  N   . LEU C 1 360 ? 63.852  98.877  60.560  1.00 37.27  ? 338  LEU C N   1 
ATOM   7550  C  CA  . LEU C 1 360 ? 64.297  100.259 60.438  1.00 31.84  ? 338  LEU C CA  1 
ATOM   7551  C  C   . LEU C 1 360 ? 63.416  101.162 61.290  1.00 30.84  ? 338  LEU C C   1 
ATOM   7552  O  O   . LEU C 1 360 ? 63.879  102.146 61.862  1.00 31.66  ? 338  LEU C O   1 
ATOM   7553  C  CB  . LEU C 1 360 ? 64.232  100.706 58.971  1.00 25.84  ? 338  LEU C CB  1 
ATOM   7554  C  CG  . LEU C 1 360 ? 65.325  100.191 58.027  1.00 27.81  ? 338  LEU C CG  1 
ATOM   7555  C  CD1 . LEU C 1 360 ? 64.898  100.366 56.571  1.00 18.19  ? 338  LEU C CD1 1 
ATOM   7556  C  CD2 . LEU C 1 360 ? 66.618  100.930 58.296  1.00 23.62  ? 338  LEU C CD2 1 
ATOM   7557  N  N   . ILE C 1 361 ? 62.137  100.823 61.369  1.00 33.45  ? 339  ILE C N   1 
ATOM   7558  C  CA  . ILE C 1 361 ? 61.198  101.604 62.151  1.00 37.19  ? 339  ILE C CA  1 
ATOM   7559  C  C   . ILE C 1 361 ? 61.424  101.336 63.631  1.00 41.35  ? 339  ILE C C   1 
ATOM   7560  O  O   . ILE C 1 361 ? 61.449  102.259 64.445  1.00 46.94  ? 339  ILE C O   1 
ATOM   7561  C  CB  . ILE C 1 361 ? 59.739  101.237 61.804  1.00 39.72  ? 339  ILE C CB  1 
ATOM   7562  C  CG1 . ILE C 1 361 ? 59.453  101.558 60.328  1.00 36.61  ? 339  ILE C CG1 1 
ATOM   7563  C  CG2 . ILE C 1 361 ? 58.785  101.996 62.711  1.00 37.71  ? 339  ILE C CG2 1 
ATOM   7564  C  CD1 . ILE C 1 361 ? 58.099  101.075 59.831  1.00 29.11  ? 339  ILE C CD1 1 
ATOM   7565  N  N   . ALA C 1 362 ? 61.611  100.066 63.969  1.00 38.85  ? 340  ALA C N   1 
ATOM   7566  C  CA  . ALA C 1 362 ? 61.805  99.649  65.351  1.00 32.88  ? 340  ALA C CA  1 
ATOM   7567  C  C   . ALA C 1 362 ? 63.182  99.899  65.939  1.00 29.90  ? 340  ALA C C   1 
ATOM   7568  O  O   . ALA C 1 362 ? 63.300  100.214 67.119  1.00 32.64  ? 340  ALA C O   1 
ATOM   7569  C  CB  . ALA C 1 362 ? 61.457  98.177  65.489  1.00 33.77  ? 340  ALA C CB  1 
ATOM   7570  N  N   . GLN C 1 363 ? 64.227  99.762  65.138  1.00 31.47  ? 341  GLN C N   1 
ATOM   7571  C  CA  . GLN C 1 363 ? 65.565  99.960  65.669  1.00 29.46  ? 341  GLN C CA  1 
ATOM   7572  C  C   . GLN C 1 363 ? 66.247  101.279 65.346  1.00 29.06  ? 341  GLN C C   1 
ATOM   7573  O  O   . GLN C 1 363 ? 67.040  101.773 66.142  1.00 24.90  ? 341  GLN C O   1 
ATOM   7574  C  CB  . GLN C 1 363 ? 66.448  98.788  65.253  1.00 35.89  ? 341  GLN C CB  1 
ATOM   7575  C  CG  . GLN C 1 363 ? 66.120  97.520  66.029  1.00 43.27  ? 341  GLN C CG  1 
ATOM   7576  C  CD  . GLN C 1 363 ? 66.912  96.314  65.564  1.00 51.06  ? 341  GLN C CD  1 
ATOM   7577  O  OE1 . GLN C 1 363 ? 68.149  96.333  65.540  1.00 46.17  ? 341  GLN C OE1 1 
ATOM   7578  N  NE2 . GLN C 1 363 ? 66.200  95.248  65.195  1.00 54.25  ? 341  GLN C NE2 1 
ATOM   7579  N  N   . GLU C 1 364 ? 65.933  101.865 64.196  1.00 27.28  ? 342  GLU C N   1 
ATOM   7580  C  CA  . GLU C 1 364 ? 66.557  103.123 63.818  1.00 24.77  ? 342  GLU C CA  1 
ATOM   7581  C  C   . GLU C 1 364 ? 65.572  104.285 63.864  1.00 27.31  ? 342  GLU C C   1 
ATOM   7582  O  O   . GLU C 1 364 ? 65.967  105.445 63.735  1.00 32.63  ? 342  GLU C O   1 
ATOM   7583  C  CB  . GLU C 1 364 ? 67.152  103.008 62.416  1.00 19.49  ? 342  GLU C CB  1 
ATOM   7584  C  CG  . GLU C 1 364 ? 68.070  101.818 62.192  1.00 21.41  ? 342  GLU C CG  1 
ATOM   7585  C  CD  . GLU C 1 364 ? 69.377  101.889 62.980  1.00 31.86  ? 342  GLU C CD  1 
ATOM   7586  O  OE1 . GLU C 1 364 ? 69.908  103.010 63.173  1.00 33.78  ? 342  GLU C OE1 1 
ATOM   7587  O  OE2 . GLU C 1 364 ? 69.885  100.816 63.385  1.00 24.90  ? 342  GLU C OE2 1 
ATOM   7588  N  N   . GLY C 1 365 ? 64.291  103.975 64.039  1.00 23.97  ? 343  GLY C N   1 
ATOM   7589  C  CA  . GLY C 1 365 ? 63.278  105.018 64.101  1.00 22.81  ? 343  GLY C CA  1 
ATOM   7590  C  C   . GLY C 1 365 ? 63.032  105.772 62.797  1.00 22.85  ? 343  GLY C C   1 
ATOM   7591  O  O   . GLY C 1 365 ? 62.595  106.928 62.820  1.00 22.28  ? 343  GLY C O   1 
ATOM   7592  N  N   . LEU C 1 366 ? 63.303  105.120 61.665  1.00 18.99  ? 344  LEU C N   1 
ATOM   7593  C  CA  . LEU C 1 366 ? 63.116  105.722 60.341  1.00 16.17  ? 344  LEU C CA  1 
ATOM   7594  C  C   . LEU C 1 366 ? 61.797  105.229 59.765  1.00 14.94  ? 344  LEU C C   1 
ATOM   7595  O  O   . LEU C 1 366 ? 61.680  104.052 59.414  1.00 17.91  ? 344  LEU C O   1 
ATOM   7596  C  CB  . LEU C 1 366 ? 64.260  105.302 59.427  1.00 13.92  ? 344  LEU C CB  1 
ATOM   7597  C  CG  . LEU C 1 366 ? 65.649  105.506 60.041  1.00 20.55  ? 344  LEU C CG  1 
ATOM   7598  C  CD1 . LEU C 1 366 ? 66.689  104.593 59.378  1.00 17.57  ? 344  LEU C CD1 1 
ATOM   7599  C  CD2 . LEU C 1 366 ? 66.025  106.980 59.894  1.00 20.17  ? 344  LEU C CD2 1 
ATOM   7600  N  N   . LEU C 1 367 ? 60.813  106.122 59.652  1.00 13.36  ? 345  LEU C N   1 
ATOM   7601  C  CA  . LEU C 1 367 ? 59.492  105.744 59.144  1.00 15.77  ? 345  LEU C CA  1 
ATOM   7602  C  C   . LEU C 1 367 ? 59.475  105.659 57.627  1.00 20.07  ? 345  LEU C C   1 
ATOM   7603  O  O   . LEU C 1 367 ? 58.758  106.392 56.959  1.00 32.14  ? 345  LEU C O   1 
ATOM   7604  C  CB  . LEU C 1 367 ? 58.433  106.731 59.657  1.00 17.41  ? 345  LEU C CB  1 
ATOM   7605  C  CG  . LEU C 1 367 ? 58.349  106.774 61.201  1.00 26.57  ? 345  LEU C CG  1 
ATOM   7606  C  CD1 . LEU C 1 367 ? 57.561  107.982 61.667  1.00 32.86  ? 345  LEU C CD1 1 
ATOM   7607  C  CD2 . LEU C 1 367 ? 57.718  105.492 61.722  1.00 21.09  ? 345  LEU C CD2 1 
ATOM   7608  N  N   . CYS C 1 368 ? 60.272  104.733 57.102  1.00 19.55  ? 346  CYS C N   1 
ATOM   7609  C  CA  . CYS C 1 368 ? 60.421  104.499 55.673  1.00 22.88  ? 346  CYS C CA  1 
ATOM   7610  C  C   . CYS C 1 368 ? 59.485  103.415 55.169  1.00 24.93  ? 346  CYS C C   1 
ATOM   7611  O  O   . CYS C 1 368 ? 58.738  102.821 55.946  1.00 27.38  ? 346  CYS C O   1 
ATOM   7612  C  CB  . CYS C 1 368 ? 61.857  104.090 55.371  1.00 20.65  ? 346  CYS C CB  1 
ATOM   7613  S  SG  . CYS C 1 368 ? 62.320  102.584 56.195  1.00 36.56  ? 346  CYS C SG  1 
ATOM   7614  N  N   . GLY C 1 369 ? 59.556  103.145 53.867  1.00 26.87  ? 347  GLY C N   1 
ATOM   7615  C  CA  . GLY C 1 369 ? 58.696  102.148 53.250  1.00 30.52  ? 347  GLY C CA  1 
ATOM   7616  C  C   . GLY C 1 369 ? 59.335  100.808 52.925  1.00 31.98  ? 347  GLY C C   1 
ATOM   7617  O  O   . GLY C 1 369 ? 60.462  100.533 53.340  1.00 34.14  ? 347  GLY C O   1 
ATOM   7618  N  N   . GLY C 1 370 ? 58.604  99.987  52.167  1.00 27.03  ? 348  GLY C N   1 
ATOM   7619  C  CA  . GLY C 1 370 ? 59.071  98.665  51.788  1.00 29.92  ? 348  GLY C CA  1 
ATOM   7620  C  C   . GLY C 1 370 ? 60.354  98.604  50.983  1.00 34.64  ? 348  GLY C C   1 
ATOM   7621  O  O   . GLY C 1 370 ? 61.216  97.749  51.224  1.00 37.45  ? 348  GLY C O   1 
ATOM   7622  N  N   . SER C 1 371 ? 60.479  99.503  50.013  1.00 33.45  ? 349  SER C N   1 
ATOM   7623  C  CA  . SER C 1 371 ? 61.657  99.561  49.162  1.00 26.50  ? 349  SER C CA  1 
ATOM   7624  C  C   . SER C 1 371 ? 62.891  99.714  50.034  1.00 20.80  ? 349  SER C C   1 
ATOM   7625  O  O   . SER C 1 371 ? 63.917  99.083  49.801  1.00 15.89  ? 349  SER C O   1 
ATOM   7626  C  CB  . SER C 1 371 ? 61.537  100.748 48.203  1.00 23.67  ? 349  SER C CB  1 
ATOM   7627  O  OG  . SER C 1 371 ? 62.586  100.745 47.252  1.00 33.45  ? 349  SER C OG  1 
ATOM   7628  N  N   . ALA C 1 372 ? 62.771  100.569 51.043  1.00 25.86  ? 350  ALA C N   1 
ATOM   7629  C  CA  . ALA C 1 372 ? 63.855  100.829 51.988  1.00 29.66  ? 350  ALA C CA  1 
ATOM   7630  C  C   . ALA C 1 372 ? 64.338  99.521  52.626  1.00 30.51  ? 350  ALA C C   1 
ATOM   7631  O  O   . ALA C 1 372 ? 65.546  99.307  52.811  1.00 26.23  ? 350  ALA C O   1 
ATOM   7632  C  CB  . ALA C 1 372 ? 63.372  101.801 53.076  1.00 18.44  ? 350  ALA C CB  1 
ATOM   7633  N  N   . GLY C 1 373 ? 63.381  98.664  52.971  1.00 26.46  ? 351  GLY C N   1 
ATOM   7634  C  CA  . GLY C 1 373 ? 63.722  97.391  53.567  1.00 28.67  ? 351  GLY C CA  1 
ATOM   7635  C  C   . GLY C 1 373 ? 64.562  96.571  52.611  1.00 27.46  ? 351  GLY C C   1 
ATOM   7636  O  O   . GLY C 1 373 ? 65.583  96.009  53.012  1.00 30.02  ? 351  GLY C O   1 
ATOM   7637  N  N   . SER C 1 374 ? 64.134  96.507  51.349  1.00 26.29  ? 352  SER C N   1 
ATOM   7638  C  CA  . SER C 1 374 ? 64.842  95.753  50.314  1.00 27.17  ? 352  SER C CA  1 
ATOM   7639  C  C   . SER C 1 374 ? 66.287  96.195  50.221  1.00 28.17  ? 352  SER C C   1 
ATOM   7640  O  O   . SER C 1 374 ? 67.204  95.376  50.140  1.00 31.21  ? 352  SER C O   1 
ATOM   7641  C  CB  . SER C 1 374 ? 64.203  95.971  48.935  1.00 28.54  ? 352  SER C CB  1 
ATOM   7642  O  OG  . SER C 1 374 ? 62.859  95.523  48.873  1.00 36.92  ? 352  SER C OG  1 
ATOM   7643  N  N   . THR C 1 375 ? 66.473  97.508  50.232  1.00 27.86  ? 353  THR C N   1 
ATOM   7644  C  CA  . THR C 1 375 ? 67.797  98.112  50.123  1.00 27.52  ? 353  THR C CA  1 
ATOM   7645  C  C   . THR C 1 375 ? 68.740  97.850  51.300  1.00 28.07  ? 353  THR C C   1 
ATOM   7646  O  O   . THR C 1 375 ? 69.940  97.654  51.098  1.00 31.82  ? 353  THR C O   1 
ATOM   7647  C  CB  . THR C 1 375 ? 67.666  99.621  49.916  1.00 15.40  ? 353  THR C CB  1 
ATOM   7648  O  OG1 . THR C 1 375 ? 66.575  99.875  49.028  1.00 22.72  ? 353  THR C OG1 1 
ATOM   7649  C  CG2 . THR C 1 375 ? 68.924  100.182 49.306  1.00 19.62  ? 353  THR C CG2 1 
ATOM   7650  N  N   . VAL C 1 376 ? 68.218  97.844  52.524  1.00 27.48  ? 354  VAL C N   1 
ATOM   7651  C  CA  . VAL C 1 376 ? 69.087  97.600  53.672  1.00 32.99  ? 354  VAL C CA  1 
ATOM   7652  C  C   . VAL C 1 376 ? 69.356  96.104  53.799  1.00 37.99  ? 354  VAL C C   1 
ATOM   7653  O  O   . VAL C 1 376 ? 70.448  95.699  54.214  1.00 43.00  ? 354  VAL C O   1 
ATOM   7654  C  CB  . VAL C 1 376 ? 68.469  98.130  54.998  1.00 26.42  ? 354  VAL C CB  1 
ATOM   7655  C  CG1 . VAL C 1 376 ? 69.360  97.760  56.172  1.00 23.20  ? 354  VAL C CG1 1 
ATOM   7656  C  CG2 . VAL C 1 376 ? 68.291  99.631  54.926  1.00 25.39  ? 354  VAL C CG2 1 
ATOM   7657  N  N   . ALA C 1 377 ? 68.363  95.290  53.431  1.00 37.27  ? 355  ALA C N   1 
ATOM   7658  C  CA  . ALA C 1 377 ? 68.499  93.835  53.496  1.00 32.02  ? 355  ALA C CA  1 
ATOM   7659  C  C   . ALA C 1 377 ? 69.698  93.403  52.653  1.00 30.31  ? 355  ALA C C   1 
ATOM   7660  O  O   . ALA C 1 377 ? 70.495  92.566  53.073  1.00 35.70  ? 355  ALA C O   1 
ATOM   7661  C  CB  . ALA C 1 377 ? 67.231  93.163  52.994  1.00 30.58  ? 355  ALA C CB  1 
ATOM   7662  N  N   . VAL C 1 378 ? 69.833  93.987  51.467  1.00 28.47  ? 356  VAL C N   1 
ATOM   7663  C  CA  . VAL C 1 378 ? 70.956  93.667  50.589  1.00 28.87  ? 356  VAL C CA  1 
ATOM   7664  C  C   . VAL C 1 378 ? 72.271  94.272  51.091  1.00 31.72  ? 356  VAL C C   1 
ATOM   7665  O  O   . VAL C 1 378 ? 73.325  93.638  51.019  1.00 31.64  ? 356  VAL C O   1 
ATOM   7666  C  CB  . VAL C 1 378 ? 70.714  94.191  49.164  1.00 27.43  ? 356  VAL C CB  1 
ATOM   7667  C  CG1 . VAL C 1 378 ? 71.974  94.015  48.326  1.00 23.14  ? 356  VAL C CG1 1 
ATOM   7668  C  CG2 . VAL C 1 378 ? 69.540  93.456  48.528  1.00 38.20  ? 356  VAL C CG2 1 
ATOM   7669  N  N   . ALA C 1 379 ? 72.198  95.505  51.588  1.00 31.72  ? 357  ALA C N   1 
ATOM   7670  C  CA  . ALA C 1 379 ? 73.375  96.209  52.078  1.00 35.13  ? 357  ALA C CA  1 
ATOM   7671  C  C   . ALA C 1 379 ? 74.113  95.473  53.188  1.00 36.61  ? 357  ALA C C   1 
ATOM   7672  O  O   . ALA C 1 379 ? 75.344  95.402  53.171  1.00 34.62  ? 357  ALA C O   1 
ATOM   7673  C  CB  . ALA C 1 379 ? 72.994  97.605  52.547  1.00 37.02  ? 357  ALA C CB  1 
ATOM   7674  N  N   . VAL C 1 380 ? 73.382  94.921  54.153  1.00 35.38  ? 358  VAL C N   1 
ATOM   7675  C  CA  . VAL C 1 380 ? 74.053  94.210  55.240  1.00 40.03  ? 358  VAL C CA  1 
ATOM   7676  C  C   . VAL C 1 380 ? 74.823  93.003  54.700  1.00 38.77  ? 358  VAL C C   1 
ATOM   7677  O  O   . VAL C 1 380 ? 75.638  92.407  55.405  1.00 36.62  ? 358  VAL C O   1 
ATOM   7678  C  CB  . VAL C 1 380 ? 73.057  93.759  56.357  1.00 42.48  ? 358  VAL C CB  1 
ATOM   7679  C  CG1 . VAL C 1 380 ? 72.399  94.987  56.997  1.00 28.30  ? 358  VAL C CG1 1 
ATOM   7680  C  CG2 . VAL C 1 380 ? 72.014  92.814  55.789  1.00 48.50  ? 358  VAL C CG2 1 
ATOM   7681  N  N   . LYS C 1 381 ? 74.563  92.658  53.440  1.00 38.56  ? 359  LYS C N   1 
ATOM   7682  C  CA  . LYS C 1 381 ? 75.248  91.550  52.785  1.00 36.82  ? 359  LYS C CA  1 
ATOM   7683  C  C   . LYS C 1 381 ? 76.373  92.109  51.910  1.00 34.86  ? 359  LYS C C   1 
ATOM   7684  O  O   . LYS C 1 381 ? 77.536  91.750  52.060  1.00 30.87  ? 359  LYS C O   1 
ATOM   7685  C  CB  . LYS C 1 381 ? 74.294  90.769  51.882  1.00 35.04  ? 359  LYS C CB  1 
ATOM   7686  C  CG  . LYS C 1 381 ? 73.118  90.086  52.545  1.00 35.45  ? 359  LYS C CG  1 
ATOM   7687  C  CD  . LYS C 1 381 ? 72.312  89.346  51.458  1.00 48.03  ? 359  LYS C CD  1 
ATOM   7688  C  CE  . LYS C 1 381 ? 70.969  88.820  51.953  1.00 43.54  ? 359  LYS C CE  1 
ATOM   7689  N  NZ  . LYS C 1 381 ? 70.141  88.329  50.818  1.00 39.20  ? 359  LYS C NZ  1 
ATOM   7690  N  N   . ALA C 1 382 ? 76.008  93.007  51.002  1.00 37.29  ? 360  ALA C N   1 
ATOM   7691  C  CA  . ALA C 1 382 ? 76.959  93.602  50.075  1.00 36.50  ? 360  ALA C CA  1 
ATOM   7692  C  C   . ALA C 1 382 ? 78.093  94.376  50.724  1.00 39.34  ? 360  ALA C C   1 
ATOM   7693  O  O   . ALA C 1 382 ? 79.228  94.311  50.256  1.00 41.32  ? 360  ALA C O   1 
ATOM   7694  C  CB  . ALA C 1 382 ? 76.221  94.500  49.094  1.00 36.09  ? 360  ALA C CB  1 
ATOM   7695  N  N   . ALA C 1 383 ? 77.799  95.104  51.799  1.00 39.99  ? 361  ALA C N   1 
ATOM   7696  C  CA  . ALA C 1 383 ? 78.819  95.917  52.478  1.00 37.53  ? 361  ALA C CA  1 
ATOM   7697  C  C   . ALA C 1 383 ? 79.747  95.152  53.423  1.00 35.69  ? 361  ALA C C   1 
ATOM   7698  O  O   . ALA C 1 383 ? 80.594  95.750  54.086  1.00 33.59  ? 361  ALA C O   1 
ATOM   7699  C  CB  . ALA C 1 383 ? 78.151  97.084  53.236  1.00 31.53  ? 361  ALA C CB  1 
ATOM   7700  N  N   . GLN C 1 384 ? 79.587  93.836  53.486  1.00 39.45  ? 362  GLN C N   1 
ATOM   7701  C  CA  . GLN C 1 384 ? 80.428  93.018  54.344  1.00 43.60  ? 362  GLN C CA  1 
ATOM   7702  C  C   . GLN C 1 384 ? 81.900  93.212  53.995  1.00 43.63  ? 362  GLN C C   1 
ATOM   7703  O  O   . GLN C 1 384 ? 82.737  93.413  54.871  1.00 36.20  ? 362  GLN C O   1 
ATOM   7704  C  CB  . GLN C 1 384 ? 80.056  91.544  54.190  1.00 45.45  ? 362  GLN C CB  1 
ATOM   7705  C  CG  . GLN C 1 384 ? 78.773  91.151  54.892  1.00 46.83  ? 362  GLN C CG  1 
ATOM   7706  C  CD  . GLN C 1 384 ? 78.831  91.419  56.393  1.00 48.17  ? 362  GLN C CD  1 
ATOM   7707  O  OE1 . GLN C 1 384 ? 79.849  91.160  57.040  1.00 43.32  ? 362  GLN C OE1 1 
ATOM   7708  N  NE2 . GLN C 1 384 ? 77.732  91.927  56.955  1.00 28.64  ? 362  GLN C NE2 1 
ATOM   7709  N  N   . GLU C 1 385 ? 82.207  93.150  52.704  1.00 49.15  ? 363  GLU C N   1 
ATOM   7710  C  CA  . GLU C 1 385 ? 83.575  93.317  52.225  1.00 50.96  ? 363  GLU C CA  1 
ATOM   7711  C  C   . GLU C 1 385 ? 84.210  94.575  52.799  1.00 50.20  ? 363  GLU C C   1 
ATOM   7712  O  O   . GLU C 1 385 ? 85.425  94.637  52.990  1.00 56.23  ? 363  GLU C O   1 
ATOM   7713  C  CB  . GLU C 1 385 ? 83.592  93.392  50.687  1.00 57.50  ? 363  GLU C CB  1 
ATOM   7714  C  CG  . GLU C 1 385 ? 82.631  94.431  50.094  1.00 58.22  ? 363  GLU C CG  1 
ATOM   7715  C  CD  . GLU C 1 385 ? 82.830  94.643  48.598  1.00 63.05  ? 363  GLU C CD  1 
ATOM   7716  O  OE1 . GLU C 1 385 ? 83.884  95.188  48.208  1.00 64.14  ? 363  GLU C OE1 1 
ATOM   7717  O  OE2 . GLU C 1 385 ? 81.934  94.265  47.811  1.00 65.89  ? 363  GLU C OE2 1 
ATOM   7718  N  N   . LEU C 1 386 ? 83.379  95.575  53.073  1.00 45.70  ? 364  LEU C N   1 
ATOM   7719  C  CA  . LEU C 1 386 ? 83.858  96.844  53.604  1.00 45.69  ? 364  LEU C CA  1 
ATOM   7720  C  C   . LEU C 1 386 ? 84.417  96.757  55.010  1.00 45.43  ? 364  LEU C C   1 
ATOM   7721  O  O   . LEU C 1 386 ? 83.839  96.114  55.883  1.00 45.46  ? 364  LEU C O   1 
ATOM   7722  C  CB  . LEU C 1 386 ? 82.737  97.890  53.557  1.00 40.68  ? 364  LEU C CB  1 
ATOM   7723  C  CG  . LEU C 1 386 ? 82.731  98.872  52.378  1.00 36.58  ? 364  LEU C CG  1 
ATOM   7724  C  CD1 . LEU C 1 386 ? 83.164  98.184  51.082  1.00 28.78  ? 364  LEU C CD1 1 
ATOM   7725  C  CD2 . LEU C 1 386 ? 81.345  99.458  52.241  1.00 27.16  ? 364  LEU C CD2 1 
ATOM   7726  N  N   . GLN C 1 387 ? 85.548  97.421  55.213  1.00 49.34  ? 365  GLN C N   1 
ATOM   7727  C  CA  . GLN C 1 387 ? 86.213  97.452  56.507  1.00 50.08  ? 365  GLN C CA  1 
ATOM   7728  C  C   . GLN C 1 387 ? 85.962  98.777  57.223  1.00 46.84  ? 365  GLN C C   1 
ATOM   7729  O  O   . GLN C 1 387 ? 85.407  99.723  56.653  1.00 36.33  ? 365  GLN C O   1 
ATOM   7730  C  CB  . GLN C 1 387 ? 87.716  97.222  56.323  1.00 53.16  ? 365  GLN C CB  1 
ATOM   7731  C  CG  . GLN C 1 387 ? 88.045  95.800  55.892  1.00 61.51  ? 365  GLN C CG  1 
ATOM   7732  C  CD  . GLN C 1 387 ? 89.521  95.578  55.639  1.00 67.06  ? 365  GLN C CD  1 
ATOM   7733  O  OE1 . GLN C 1 387 ? 90.101  96.154  54.713  1.00 68.91  ? 365  GLN C OE1 1 
ATOM   7734  N  NE2 . GLN C 1 387 ? 90.142  94.738  56.464  1.00 66.26  ? 365  GLN C NE2 1 
ATOM   7735  N  N   . GLU C 1 388 ? 86.351  98.839  58.488  1.00 47.46  ? 366  GLU C N   1 
ATOM   7736  C  CA  . GLU C 1 388 ? 86.166  100.068 59.232  1.00 49.23  ? 366  GLU C CA  1 
ATOM   7737  C  C   . GLU C 1 388 ? 86.939  101.158 58.520  1.00 45.35  ? 366  GLU C C   1 
ATOM   7738  O  O   . GLU C 1 388 ? 87.988  100.901 57.928  1.00 43.45  ? 366  GLU C O   1 
ATOM   7739  C  CB  . GLU C 1 388 ? 86.649  99.904  60.672  1.00 54.80  ? 366  GLU C CB  1 
ATOM   7740  C  CG  . GLU C 1 388 ? 87.708  98.845  60.860  1.00 57.57  ? 366  GLU C CG  1 
ATOM   7741  C  CD  . GLU C 1 388 ? 87.740  98.352  62.281  1.00 59.84  ? 366  GLU C CD  1 
ATOM   7742  O  OE1 . GLU C 1 388 ? 87.916  99.180  63.199  1.00 58.51  ? 366  GLU C OE1 1 
ATOM   7743  O  OE2 . GLU C 1 388 ? 87.579  97.134  62.481  1.00 68.96  ? 366  GLU C OE2 1 
ATOM   7744  N  N   . GLY C 1 389 ? 86.411  102.372 58.573  1.00 41.85  ? 367  GLY C N   1 
ATOM   7745  C  CA  . GLY C 1 389 ? 87.058  103.475 57.902  1.00 39.88  ? 367  GLY C CA  1 
ATOM   7746  C  C   . GLY C 1 389 ? 86.341  103.688 56.584  1.00 38.43  ? 367  GLY C C   1 
ATOM   7747  O  O   . GLY C 1 389 ? 86.370  104.774 56.004  1.00 37.76  ? 367  GLY C O   1 
ATOM   7748  N  N   . GLN C 1 390 ? 85.683  102.642 56.100  1.00 39.11  ? 368  GLN C N   1 
ATOM   7749  C  CA  . GLN C 1 390 ? 84.951  102.762 54.852  1.00 35.62  ? 368  GLN C CA  1 
ATOM   7750  C  C   . GLN C 1 390 ? 83.503  103.162 55.109  1.00 33.77  ? 368  GLN C C   1 
ATOM   7751  O  O   . GLN C 1 390 ? 82.981  103.001 56.219  1.00 33.64  ? 368  GLN C O   1 
ATOM   7752  C  CB  . GLN C 1 390 ? 85.063  101.467 54.055  1.00 35.38  ? 368  GLN C CB  1 
ATOM   7753  C  CG  . GLN C 1 390 ? 86.467  101.296 53.467  1.00 37.13  ? 368  GLN C CG  1 
ATOM   7754  C  CD  . GLN C 1 390 ? 86.640  100.028 52.654  1.00 34.53  ? 368  GLN C CD  1 
ATOM   7755  O  OE1 . GLN C 1 390 ? 86.589  98.924  53.189  1.00 27.73  ? 368  GLN C OE1 1 
ATOM   7756  N  NE2 . GLN C 1 390 ? 86.845  100.185 51.352  1.00 37.30  ? 368  GLN C NE2 1 
ATOM   7757  N  N   . ARG C 1 391 ? 82.860  103.681 54.074  1.00 30.23  ? 369  ARG C N   1 
ATOM   7758  C  CA  . ARG C 1 391 ? 81.503  104.172 54.193  1.00 28.12  ? 369  ARG C CA  1 
ATOM   7759  C  C   . ARG C 1 391 ? 80.569  103.583 53.131  1.00 29.36  ? 369  ARG C C   1 
ATOM   7760  O  O   . ARG C 1 391 ? 80.914  103.518 51.957  1.00 26.42  ? 369  ARG C O   1 
ATOM   7761  C  CB  . ARG C 1 391 ? 81.562  105.694 54.077  1.00 26.53  ? 369  ARG C CB  1 
ATOM   7762  C  CG  . ARG C 1 391 ? 80.385  106.432 54.610  1.00 33.31  ? 369  ARG C CG  1 
ATOM   7763  C  CD  . ARG C 1 391 ? 80.829  107.525 55.583  1.00 43.02  ? 369  ARG C CD  1 
ATOM   7764  N  NE  . ARG C 1 391 ? 81.592  108.595 54.949  1.00 47.99  ? 369  ARG C NE  1 
ATOM   7765  C  CZ  . ARG C 1 391 ? 81.935  109.727 55.556  1.00 49.40  ? 369  ARG C CZ  1 
ATOM   7766  N  NH1 . ARG C 1 391 ? 81.585  109.929 56.816  1.00 54.58  ? 369  ARG C NH1 1 
ATOM   7767  N  NH2 . ARG C 1 391 ? 82.604  110.668 54.897  1.00 50.21  ? 369  ARG C NH2 1 
ATOM   7768  N  N   . CYS C 1 392 ? 79.387  103.150 53.552  1.00 30.74  ? 370  CYS C N   1 
ATOM   7769  C  CA  . CYS C 1 392 ? 78.414  102.601 52.616  1.00 35.54  ? 370  CYS C CA  1 
ATOM   7770  C  C   . CYS C 1 392 ? 77.113  103.392 52.708  1.00 38.14  ? 370  CYS C C   1 
ATOM   7771  O  O   . CYS C 1 392 ? 76.494  103.450 53.774  1.00 43.07  ? 370  CYS C O   1 
ATOM   7772  C  CB  . CYS C 1 392 ? 78.125  101.137 52.920  1.00 35.37  ? 370  CYS C CB  1 
ATOM   7773  S  SG  . CYS C 1 392 ? 76.845  100.445 51.856  1.00 37.83  ? 370  CYS C SG  1 
ATOM   7774  N  N   . VAL C 1 393 ? 76.703  103.997 51.591  1.00 36.42  ? 371  VAL C N   1 
ATOM   7775  C  CA  . VAL C 1 393 ? 75.475  104.788 51.555  1.00 27.45  ? 371  VAL C CA  1 
ATOM   7776  C  C   . VAL C 1 393 ? 74.333  104.055 50.881  1.00 30.41  ? 371  VAL C C   1 
ATOM   7777  O  O   . VAL C 1 393 ? 74.455  103.556 49.767  1.00 32.59  ? 371  VAL C O   1 
ATOM   7778  C  CB  . VAL C 1 393 ? 75.682  106.128 50.851  1.00 25.08  ? 371  VAL C CB  1 
ATOM   7779  C  CG1 . VAL C 1 393 ? 74.366  106.878 50.774  1.00 20.67  ? 371  VAL C CG1 1 
ATOM   7780  C  CG2 . VAL C 1 393 ? 76.709  106.956 51.622  1.00 27.05  ? 371  VAL C CG2 1 
ATOM   7781  N  N   . VAL C 1 394 ? 73.210  104.013 51.582  1.00 32.03  ? 372  VAL C N   1 
ATOM   7782  C  CA  . VAL C 1 394 ? 72.018  103.326 51.126  1.00 25.92  ? 372  VAL C CA  1 
ATOM   7783  C  C   . VAL C 1 394 ? 70.919  104.356 50.922  1.00 17.88  ? 372  VAL C C   1 
ATOM   7784  O  O   . VAL C 1 394 ? 70.853  105.346 51.623  1.00 20.58  ? 372  VAL C O   1 
ATOM   7785  C  CB  . VAL C 1 394 ? 71.601  102.279 52.188  1.00 23.77  ? 372  VAL C CB  1 
ATOM   7786  C  CG1 . VAL C 1 394 ? 70.734  102.925 53.253  1.00 18.94  ? 372  VAL C CG1 1 
ATOM   7787  C  CG2 . VAL C 1 394 ? 70.927  101.110 51.528  1.00 28.41  ? 372  VAL C CG2 1 
ATOM   7788  N  N   . ILE C 1 395 ? 70.051  104.111 49.961  1.00 19.26  ? 373  ILE C N   1 
ATOM   7789  C  CA  . ILE C 1 395 ? 68.964  105.032 49.651  1.00 19.98  ? 373  ILE C CA  1 
ATOM   7790  C  C   . ILE C 1 395 ? 67.601  104.509 50.119  1.00 24.09  ? 373  ILE C C   1 
ATOM   7791  O  O   . ILE C 1 395 ? 67.190  103.396 49.779  1.00 32.96  ? 373  ILE C O   1 
ATOM   7792  C  CB  . ILE C 1 395 ? 68.926  105.310 48.113  1.00 17.92  ? 373  ILE C CB  1 
ATOM   7793  C  CG1 . ILE C 1 395 ? 70.147  106.133 47.719  1.00 12.21  ? 373  ILE C CG1 1 
ATOM   7794  C  CG2 . ILE C 1 395 ? 67.662  106.048 47.725  1.00 18.71  ? 373  ILE C CG2 1 
ATOM   7795  C  CD1 . ILE C 1 395 ? 70.274  106.346 46.266  1.00 30.10  ? 373  ILE C CD1 1 
ATOM   7796  N  N   . LEU C 1 396 ? 66.909  105.309 50.917  1.00 24.16  ? 374  LEU C N   1 
ATOM   7797  C  CA  . LEU C 1 396 ? 65.593  104.934 51.417  1.00 24.58  ? 374  LEU C CA  1 
ATOM   7798  C  C   . LEU C 1 396 ? 64.643  105.863 50.666  1.00 24.57  ? 374  LEU C C   1 
ATOM   7799  O  O   . LEU C 1 396 ? 64.640  107.066 50.904  1.00 24.75  ? 374  LEU C O   1 
ATOM   7800  C  CB  . LEU C 1 396 ? 65.517  105.148 52.932  1.00 17.50  ? 374  LEU C CB  1 
ATOM   7801  C  CG  . LEU C 1 396 ? 66.728  104.630 53.717  1.00 21.83  ? 374  LEU C CG  1 
ATOM   7802  C  CD1 . LEU C 1 396 ? 66.393  104.658 55.206  1.00 21.47  ? 374  LEU C CD1 1 
ATOM   7803  C  CD2 . LEU C 1 396 ? 67.100  103.219 53.273  1.00 20.43  ? 374  LEU C CD2 1 
ATOM   7804  N  N   . PRO C 1 397 ? 63.854  105.306 49.722  1.00 27.37  ? 375  PRO C N   1 
ATOM   7805  C  CA  . PRO C 1 397 ? 62.868  105.947 48.838  1.00 26.96  ? 375  PRO C CA  1 
ATOM   7806  C  C   . PRO C 1 397 ? 61.617  106.657 49.356  1.00 25.51  ? 375  PRO C C   1 
ATOM   7807  O  O   . PRO C 1 397 ? 61.338  107.768 48.907  1.00 27.20  ? 375  PRO C O   1 
ATOM   7808  C  CB  . PRO C 1 397 ? 62.512  104.833 47.860  1.00 23.18  ? 375  PRO C CB  1 
ATOM   7809  C  CG  . PRO C 1 397 ? 63.764  104.021 47.831  1.00 30.15  ? 375  PRO C CG  1 
ATOM   7810  C  CD  . PRO C 1 397 ? 64.077  103.918 49.288  1.00 31.17  ? 375  PRO C CD  1 
ATOM   7811  N  N   . ASP C 1 398 ? 60.842  106.046 50.251  1.00 27.30  ? 376  ASP C N   1 
ATOM   7812  C  CA  . ASP C 1 398 ? 59.635  106.729 50.749  1.00 28.79  ? 376  ASP C CA  1 
ATOM   7813  C  C   . ASP C 1 398 ? 59.238  106.445 52.185  1.00 25.58  ? 376  ASP C C   1 
ATOM   7814  O  O   . ASP C 1 398 ? 59.898  105.693 52.884  1.00 30.08  ? 376  ASP C O   1 
ATOM   7815  C  CB  . ASP C 1 398 ? 58.430  106.456 49.835  1.00 29.58  ? 376  ASP C CB  1 
ATOM   7816  C  CG  . ASP C 1 398 ? 58.018  104.995 49.814  1.00 26.30  ? 376  ASP C CG  1 
ATOM   7817  O  OD1 . ASP C 1 398 ? 56.947  104.688 49.256  1.00 29.80  ? 376  ASP C OD1 1 
ATOM   7818  O  OD2 . ASP C 1 398 ? 58.757  104.150 50.345  1.00 23.83  ? 376  ASP C OD2 1 
ATOM   7819  N  N   . SER C 1 399 ? 58.149  107.069 52.617  1.00 31.02  ? 377  SER C N   1 
ATOM   7820  C  CA  . SER C 1 399 ? 57.662  106.917 53.979  1.00 33.63  ? 377  SER C CA  1 
ATOM   7821  C  C   . SER C 1 399 ? 56.687  105.768 54.137  1.00 33.89  ? 377  SER C C   1 
ATOM   7822  O  O   . SER C 1 399 ? 56.237  105.187 53.154  1.00 35.32  ? 377  SER C O   1 
ATOM   7823  C  CB  . SER C 1 399 ? 56.979  108.204 54.434  1.00 41.67  ? 377  SER C CB  1 
ATOM   7824  O  OG  . SER C 1 399 ? 55.659  108.286 53.927  1.00 42.63  ? 377  SER C OG  1 
ATOM   7825  N  N   . VAL C 1 400 ? 56.358  105.452 55.387  1.00 35.79  ? 378  VAL C N   1 
ATOM   7826  C  CA  . VAL C 1 400 ? 55.426  104.371 55.687  1.00 36.91  ? 378  VAL C CA  1 
ATOM   7827  C  C   . VAL C 1 400 ? 54.012  104.785 55.300  1.00 37.18  ? 378  VAL C C   1 
ATOM   7828  O  O   . VAL C 1 400 ? 53.127  103.939 55.174  1.00 40.74  ? 378  VAL C O   1 
ATOM   7829  C  CB  . VAL C 1 400 ? 55.404  104.017 57.210  1.00 44.99  ? 378  VAL C CB  1 
ATOM   7830  C  CG1 . VAL C 1 400 ? 56.710  103.359 57.631  1.00 40.41  ? 378  VAL C CG1 1 
ATOM   7831  C  CG2 . VAL C 1 400 ? 55.139  105.280 58.038  1.00 42.03  ? 378  VAL C CG2 1 
ATOM   7832  N  N   . ARG C 1 401 ? 53.802  106.084 55.103  1.00 32.53  ? 379  ARG C N   1 
ATOM   7833  C  CA  . ARG C 1 401 ? 52.475  106.594 54.780  1.00 32.14  ? 379  ARG C CA  1 
ATOM   7834  C  C   . ARG C 1 401 ? 51.704  105.795 53.730  1.00 37.49  ? 379  ARG C C   1 
ATOM   7835  O  O   . ARG C 1 401 ? 50.515  105.516 53.900  1.00 38.15  ? 379  ARG C O   1 
ATOM   7836  C  CB  . ARG C 1 401 ? 52.547  108.050 54.331  1.00 26.34  ? 379  ARG C CB  1 
ATOM   7837  C  CG  . ARG C 1 401 ? 51.191  108.747 54.377  1.00 20.17  ? 379  ARG C CG  1 
ATOM   7838  C  CD  . ARG C 1 401 ? 51.165  109.942 53.454  1.00 20.68  ? 379  ARG C CD  1 
ATOM   7839  N  NE  . ARG C 1 401 ? 51.435  109.518 52.080  1.00 28.48  ? 379  ARG C NE  1 
ATOM   7840  C  CZ  . ARG C 1 401 ? 52.180  110.203 51.219  1.00 33.11  ? 379  ARG C CZ  1 
ATOM   7841  N  NH1 . ARG C 1 401 ? 52.727  111.353 51.598  1.00 24.44  ? 379  ARG C NH1 1 
ATOM   7842  N  NH2 . ARG C 1 401 ? 52.384  109.733 49.987  1.00 26.05  ? 379  ARG C NH2 1 
ATOM   7843  N  N   . ASN C 1 402 ? 52.368  105.427 52.642  1.00 38.56  ? 380  ASN C N   1 
ATOM   7844  C  CA  . ASN C 1 402 ? 51.711  104.669 51.581  1.00 40.36  ? 380  ASN C CA  1 
ATOM   7845  C  C   . ASN C 1 402 ? 51.460  103.212 51.957  1.00 39.26  ? 380  ASN C C   1 
ATOM   7846  O  O   . ASN C 1 402 ? 50.847  102.466 51.196  1.00 43.08  ? 380  ASN C O   1 
ATOM   7847  C  CB  . ASN C 1 402 ? 52.547  104.728 50.292  1.00 40.69  ? 380  ASN C CB  1 
ATOM   7848  C  CG  . ASN C 1 402 ? 52.219  105.942 49.430  1.00 41.32  ? 380  ASN C CG  1 
ATOM   7849  O  OD1 . ASN C 1 402 ? 51.691  106.948 49.924  1.00 36.79  ? 380  ASN C OD1 1 
ATOM   7850  N  ND2 . ASN C 1 402 ? 52.541  105.857 48.135  1.00 24.16  ? 380  ASN C ND2 1 
ATOM   7851  N  N   . TYR C 1 403 ? 51.909  102.806 53.136  1.00 38.81  ? 381  TYR C N   1 
ATOM   7852  C  CA  . TYR C 1 403 ? 51.737  101.423 53.533  1.00 41.26  ? 381  TYR C CA  1 
ATOM   7853  C  C   . TYR C 1 403 ? 51.084  101.248 54.897  1.00 46.58  ? 381  TYR C C   1 
ATOM   7854  O  O   . TYR C 1 403 ? 51.289  100.230 55.564  1.00 47.13  ? 381  TYR C O   1 
ATOM   7855  C  CB  . TYR C 1 403 ? 53.100  100.732 53.513  1.00 43.33  ? 381  TYR C CB  1 
ATOM   7856  C  CG  . TYR C 1 403 ? 53.978  101.140 52.341  1.00 45.96  ? 381  TYR C CG  1 
ATOM   7857  C  CD1 . TYR C 1 403 ? 54.959  102.129 52.478  1.00 48.29  ? 381  TYR C CD1 1 
ATOM   7858  C  CD2 . TYR C 1 403 ? 53.831  100.535 51.094  1.00 47.59  ? 381  TYR C CD2 1 
ATOM   7859  C  CE1 . TYR C 1 403 ? 55.775  102.500 51.401  1.00 48.57  ? 381  TYR C CE1 1 
ATOM   7860  C  CE2 . TYR C 1 403 ? 54.637  100.898 50.011  1.00 51.61  ? 381  TYR C CE2 1 
ATOM   7861  C  CZ  . TYR C 1 403 ? 55.608  101.876 50.171  1.00 54.72  ? 381  TYR C CZ  1 
ATOM   7862  O  OH  . TYR C 1 403 ? 56.422  102.200 49.109  1.00 54.34  ? 381  TYR C OH  1 
ATOM   7863  N  N   . MET C 1 404 ? 50.295  102.232 55.310  1.00 46.86  ? 382  MET C N   1 
ATOM   7864  C  CA  . MET C 1 404 ? 49.630  102.169 56.603  1.00 46.90  ? 382  MET C CA  1 
ATOM   7865  C  C   . MET C 1 404 ? 48.873  100.867 56.790  1.00 51.76  ? 382  MET C C   1 
ATOM   7866  O  O   . MET C 1 404 ? 48.949  100.247 57.852  1.00 56.04  ? 382  MET C O   1 
ATOM   7867  C  CB  . MET C 1 404 ? 48.666  103.341 56.766  1.00 45.29  ? 382  MET C CB  1 
ATOM   7868  C  CG  . MET C 1 404 ? 49.352  104.689 56.769  1.00 44.19  ? 382  MET C CG  1 
ATOM   7869  S  SD  . MET C 1 404 ? 50.711  104.730 57.932  1.00 46.54  ? 382  MET C SD  1 
ATOM   7870  C  CE  . MET C 1 404 ? 49.871  105.253 59.423  1.00 36.57  ? 382  MET C CE  1 
ATOM   7871  N  N   . THR C 1 405 ? 48.152  100.447 55.756  1.00 52.56  ? 383  THR C N   1 
ATOM   7872  C  CA  . THR C 1 405 ? 47.374  99.218  55.835  1.00 50.95  ? 383  THR C CA  1 
ATOM   7873  C  C   . THR C 1 405 ? 48.055  98.005  55.213  1.00 49.87  ? 383  THR C C   1 
ATOM   7874  O  O   . THR C 1 405 ? 47.395  97.016  54.906  1.00 55.17  ? 383  THR C O   1 
ATOM   7875  C  CB  . THR C 1 405 ? 46.000  99.392  55.171  1.00 51.35  ? 383  THR C CB  1 
ATOM   7876  O  OG1 . THR C 1 405 ? 46.177  99.688  53.781  1.00 54.95  ? 383  THR C OG1 1 
ATOM   7877  C  CG2 . THR C 1 405 ? 45.232  100.529 55.838  1.00 53.08  ? 383  THR C CG2 1 
ATOM   7878  N  N   . LYS C 1 406 ? 49.369  98.072  55.026  1.00 48.64  ? 384  LYS C N   1 
ATOM   7879  C  CA  . LYS C 1 406 ? 50.092  96.945  54.452  1.00 43.87  ? 384  LYS C CA  1 
ATOM   7880  C  C   . LYS C 1 406 ? 51.158  96.399  55.408  1.00 41.20  ? 384  LYS C C   1 
ATOM   7881  O  O   . LYS C 1 406 ? 50.813  95.966  56.500  1.00 40.40  ? 384  LYS C O   1 
ATOM   7882  C  CB  . LYS C 1 406 ? 50.693  97.328  53.094  1.00 43.78  ? 384  LYS C CB  1 
ATOM   7883  C  CG  . LYS C 1 406 ? 49.634  97.637  52.028  1.00 40.31  ? 384  LYS C CG  1 
ATOM   7884  C  CD  . LYS C 1 406 ? 50.214  97.591  50.612  1.00 50.41  ? 384  LYS C CD  1 
ATOM   7885  C  CE  . LYS C 1 406 ? 49.145  97.804  49.540  1.00 47.77  ? 384  LYS C CE  1 
ATOM   7886  N  NZ  . LYS C 1 406 ? 49.688  97.628  48.152  1.00 52.18  ? 384  LYS C NZ  1 
ATOM   7887  N  N   . PHE C 1 407 ? 52.436  96.428  55.034  1.00 34.95  ? 385  PHE C N   1 
ATOM   7888  C  CA  . PHE C 1 407 ? 53.470  95.871  55.911  1.00 35.82  ? 385  PHE C CA  1 
ATOM   7889  C  C   . PHE C 1 407 ? 53.482  96.470  57.320  1.00 39.49  ? 385  PHE C C   1 
ATOM   7890  O  O   . PHE C 1 407 ? 54.034  95.880  58.249  1.00 34.51  ? 385  PHE C O   1 
ATOM   7891  C  CB  . PHE C 1 407 ? 54.867  96.002  55.264  1.00 39.68  ? 385  PHE C CB  1 
ATOM   7892  C  CG  . PHE C 1 407 ? 55.564  97.321  55.529  1.00 42.15  ? 385  PHE C CG  1 
ATOM   7893  C  CD1 . PHE C 1 407 ? 56.259  97.535  56.716  1.00 41.37  ? 385  PHE C CD1 1 
ATOM   7894  C  CD2 . PHE C 1 407 ? 55.536  98.342  54.584  1.00 39.70  ? 385  PHE C CD2 1 
ATOM   7895  C  CE1 . PHE C 1 407 ? 56.914  98.744  56.953  1.00 40.77  ? 385  PHE C CE1 1 
ATOM   7896  C  CE2 . PHE C 1 407 ? 56.188  99.551  54.816  1.00 37.94  ? 385  PHE C CE2 1 
ATOM   7897  C  CZ  . PHE C 1 407 ? 56.877  99.751  56.000  1.00 35.18  ? 385  PHE C CZ  1 
ATOM   7898  N  N   . LEU C 1 408 ? 52.863  97.636  57.478  1.00 42.27  ? 386  LEU C N   1 
ATOM   7899  C  CA  . LEU C 1 408 ? 52.825  98.306  58.766  1.00 41.27  ? 386  LEU C CA  1 
ATOM   7900  C  C   . LEU C 1 408 ? 51.698  97.739  59.624  1.00 47.13  ? 386  LEU C C   1 
ATOM   7901  O  O   . LEU C 1 408 ? 51.499  98.161  60.762  1.00 52.34  ? 386  LEU C O   1 
ATOM   7902  C  CB  . LEU C 1 408 ? 52.651  99.814  58.554  1.00 36.74  ? 386  LEU C CB  1 
ATOM   7903  C  CG  . LEU C 1 408 ? 53.079  100.854 59.613  1.00 30.48  ? 386  LEU C CG  1 
ATOM   7904  C  CD1 . LEU C 1 408 ? 51.926  101.195 60.511  1.00 24.41  ? 386  LEU C CD1 1 
ATOM   7905  C  CD2 . LEU C 1 408 ? 54.268  100.356 60.404  1.00 24.77  ? 386  LEU C CD2 1 
ATOM   7906  N  N   . SER C 1 409 ? 50.975  96.761  59.082  1.00 47.71  ? 387  SER C N   1 
ATOM   7907  C  CA  . SER C 1 409 ? 49.869  96.133  59.805  1.00 47.12  ? 387  SER C CA  1 
ATOM   7908  C  C   . SER C 1 409 ? 50.063  94.625  59.952  1.00 51.02  ? 387  SER C C   1 
ATOM   7909  O  O   . SER C 1 409 ? 50.260  93.911  58.964  1.00 46.23  ? 387  SER C O   1 
ATOM   7910  C  CB  . SER C 1 409 ? 48.547  96.403  59.086  1.00 43.84  ? 387  SER C CB  1 
ATOM   7911  O  OG  . SER C 1 409 ? 47.458  95.892  59.830  1.00 34.57  ? 387  SER C OG  1 
ATOM   7912  N  N   . ASP C 1 410 ? 49.998  94.141  61.190  1.00 56.95  ? 388  ASP C N   1 
ATOM   7913  C  CA  . ASP C 1 410 ? 50.173  92.716  61.460  1.00 58.48  ? 388  ASP C CA  1 
ATOM   7914  C  C   . ASP C 1 410 ? 49.120  91.881  60.738  1.00 59.22  ? 388  ASP C C   1 
ATOM   7915  O  O   . ASP C 1 410 ? 49.427  90.812  60.216  1.00 60.35  ? 388  ASP C O   1 
ATOM   7916  C  CB  . ASP C 1 410 ? 50.120  92.443  62.967  1.00 58.55  ? 388  ASP C CB  1 
ATOM   7917  C  CG  . ASP C 1 410 ? 51.260  93.106  63.722  1.00 58.25  ? 388  ASP C CG  1 
ATOM   7918  O  OD1 . ASP C 1 410 ? 51.511  92.723  64.882  1.00 64.93  ? 388  ASP C OD1 1 
ATOM   7919  O  OD2 . ASP C 1 410 ? 51.905  94.012  63.162  1.00 54.59  ? 388  ASP C OD2 1 
ATOM   7920  N  N   . ARG C 1 411 ? 47.882  92.369  60.713  1.00 61.21  ? 389  ARG C N   1 
ATOM   7921  C  CA  . ARG C 1 411 ? 46.799  91.666  60.029  1.00 62.30  ? 389  ARG C CA  1 
ATOM   7922  C  C   . ARG C 1 411 ? 47.253  91.340  58.612  1.00 60.69  ? 389  ARG C C   1 
ATOM   7923  O  O   . ARG C 1 411 ? 47.150  90.201  58.159  1.00 62.74  ? 389  ARG C O   1 
ATOM   7924  C  CB  . ARG C 1 411 ? 45.544  92.544  59.965  1.00 67.49  ? 389  ARG C CB  1 
ATOM   7925  C  CG  . ARG C 1 411 ? 44.810  92.709  61.284  1.00 75.19  ? 389  ARG C CG  1 
ATOM   7926  C  CD  . ARG C 1 411 ? 43.851  93.903  61.252  1.00 78.98  ? 389  ARG C CD  1 
ATOM   7927  N  NE  . ARG C 1 411 ? 44.573  95.176  61.245  1.00 83.30  ? 389  ARG C NE  1 
ATOM   7928  C  CZ  . ARG C 1 411 ? 43.997  96.373  61.308  1.00 79.77  ? 389  ARG C CZ  1 
ATOM   7929  N  NH1 . ARG C 1 411 ? 42.675  96.476  61.386  1.00 79.88  ? 389  ARG C NH1 1 
ATOM   7930  N  NH2 . ARG C 1 411 ? 44.745  97.470  61.297  1.00 75.89  ? 389  ARG C NH2 1 
ATOM   7931  N  N   . TRP C 1 412 ? 47.760  92.358  57.921  1.00 57.48  ? 390  TRP C N   1 
ATOM   7932  C  CA  . TRP C 1 412 ? 48.234  92.212  56.552  1.00 53.03  ? 390  TRP C CA  1 
ATOM   7933  C  C   . TRP C 1 412 ? 49.413  91.245  56.522  1.00 51.04  ? 390  TRP C C   1 
ATOM   7934  O  O   . TRP C 1 412 ? 49.405  90.270  55.777  1.00 52.23  ? 390  TRP C O   1 
ATOM   7935  C  CB  . TRP C 1 412 ? 48.664  93.574  56.002  1.00 50.28  ? 390  TRP C CB  1 
ATOM   7936  C  CG  . TRP C 1 412 ? 48.915  93.609  54.525  1.00 47.60  ? 390  TRP C CG  1 
ATOM   7937  C  CD1 . TRP C 1 412 ? 47.996  93.844  53.543  1.00 41.74  ? 390  TRP C CD1 1 
ATOM   7938  C  CD2 . TRP C 1 412 ? 50.174  93.428  53.863  1.00 49.52  ? 390  TRP C CD2 1 
ATOM   7939  N  NE1 . TRP C 1 412 ? 48.605  93.825  52.312  1.00 45.16  ? 390  TRP C NE1 1 
ATOM   7940  C  CE2 . TRP C 1 412 ? 49.942  93.572  52.479  1.00 49.88  ? 390  TRP C CE2 1 
ATOM   7941  C  CE3 . TRP C 1 412 ? 51.477  93.160  54.307  1.00 47.15  ? 390  TRP C CE3 1 
ATOM   7942  C  CZ2 . TRP C 1 412 ? 50.967  93.458  51.532  1.00 47.30  ? 390  TRP C CZ2 1 
ATOM   7943  C  CZ3 . TRP C 1 412 ? 52.498  93.046  53.359  1.00 45.28  ? 390  TRP C CZ3 1 
ATOM   7944  C  CH2 . TRP C 1 412 ? 52.233  93.196  51.992  1.00 43.34  ? 390  TRP C CH2 1 
ATOM   7945  N  N   . MET C 1 413 ? 50.423  91.517  57.339  1.00 49.27  ? 391  MET C N   1 
ATOM   7946  C  CA  . MET C 1 413 ? 51.602  90.662  57.388  1.00 50.94  ? 391  MET C CA  1 
ATOM   7947  C  C   . MET C 1 413 ? 51.217  89.199  57.596  1.00 52.63  ? 391  MET C C   1 
ATOM   7948  O  O   . MET C 1 413 ? 51.777  88.301  56.964  1.00 52.21  ? 391  MET C O   1 
ATOM   7949  C  CB  . MET C 1 413 ? 52.541  91.126  58.507  1.00 45.89  ? 391  MET C CB  1 
ATOM   7950  C  CG  . MET C 1 413 ? 53.238  92.456  58.236  1.00 44.59  ? 391  MET C CG  1 
ATOM   7951  S  SD  . MET C 1 413 ? 54.382  92.367  56.852  1.00 39.36  ? 391  MET C SD  1 
ATOM   7952  C  CE  . MET C 1 413 ? 55.849  91.677  57.636  1.00 37.42  ? 391  MET C CE  1 
ATOM   7953  N  N   . LEU C 1 414 ? 50.254  88.964  58.481  1.00 55.66  ? 392  LEU C N   1 
ATOM   7954  C  CA  . LEU C 1 414 ? 49.788  87.613  58.767  1.00 55.25  ? 392  LEU C CA  1 
ATOM   7955  C  C   . LEU C 1 414 ? 49.085  87.010  57.557  1.00 57.97  ? 392  LEU C C   1 
ATOM   7956  O  O   . LEU C 1 414 ? 49.465  85.945  57.070  1.00 57.61  ? 392  LEU C O   1 
ATOM   7957  C  CB  . LEU C 1 414 ? 48.831  87.629  59.959  1.00 53.04  ? 392  LEU C CB  1 
ATOM   7958  C  CG  . LEU C 1 414 ? 49.475  87.906  61.320  1.00 58.04  ? 392  LEU C CG  1 
ATOM   7959  C  CD1 . LEU C 1 414 ? 48.401  88.100  62.387  1.00 51.61  ? 392  LEU C CD1 1 
ATOM   7960  C  CD2 . LEU C 1 414 ? 50.396  86.747  61.679  1.00 54.79  ? 392  LEU C CD2 1 
ATOM   7961  N  N   . GLN C 1 415 ? 48.061  87.704  57.075  1.00 59.28  ? 393  GLN C N   1 
ATOM   7962  C  CA  . GLN C 1 415 ? 47.304  87.240  55.929  1.00 64.03  ? 393  GLN C CA  1 
ATOM   7963  C  C   . GLN C 1 415 ? 48.238  86.848  54.793  1.00 65.34  ? 393  GLN C C   1 
ATOM   7964  O  O   . GLN C 1 415 ? 48.138  85.751  54.249  1.00 66.41  ? 393  GLN C O   1 
ATOM   7965  C  CB  . GLN C 1 415 ? 46.336  88.337  55.458  1.00 70.22  ? 393  GLN C CB  1 
ATOM   7966  C  CG  . GLN C 1 415 ? 46.608  88.879  54.043  1.00 76.23  ? 393  GLN C CG  1 
ATOM   7967  C  CD  . GLN C 1 415 ? 45.538  88.490  53.027  1.00 78.81  ? 393  GLN C CD  1 
ATOM   7968  O  OE1 . GLN C 1 415 ? 45.128  87.326  52.945  1.00 76.60  ? 393  GLN C OE1 1 
ATOM   7969  N  NE2 . GLN C 1 415 ? 45.091  89.465  52.238  1.00 77.22  ? 393  GLN C NE2 1 
ATOM   7970  N  N   . LYS C 1 416 ? 49.162  87.744  54.459  1.00 67.50  ? 394  LYS C N   1 
ATOM   7971  C  CA  . LYS C 1 416 ? 50.090  87.524  53.352  1.00 67.61  ? 394  LYS C CA  1 
ATOM   7972  C  C   . LYS C 1 416 ? 51.130  86.458  53.635  1.00 66.31  ? 394  LYS C C   1 
ATOM   7973  O  O   . LYS C 1 416 ? 51.912  86.108  52.754  1.00 64.86  ? 394  LYS C O   1 
ATOM   7974  C  CB  . LYS C 1 416 ? 50.795  88.833  52.981  1.00 67.70  ? 394  LYS C CB  1 
ATOM   7975  C  CG  . LYS C 1 416 ? 49.858  90.009  52.700  1.00 67.01  ? 394  LYS C CG  1 
ATOM   7976  C  CD  . LYS C 1 416 ? 48.926  89.753  51.523  1.00 60.03  ? 394  LYS C CD  1 
ATOM   7977  C  CE  . LYS C 1 416 ? 49.688  89.616  50.221  1.00 60.10  ? 394  LYS C CE  1 
ATOM   7978  N  NZ  . LYS C 1 416 ? 48.755  89.502  49.067  1.00 63.13  ? 394  LYS C NZ  1 
ATOM   7979  N  N   . GLY C 1 417 ? 51.147  85.953  54.863  1.00 67.02  ? 395  GLY C N   1 
ATOM   7980  C  CA  . GLY C 1 417 ? 52.104  84.920  55.219  1.00 68.55  ? 395  GLY C CA  1 
ATOM   7981  C  C   . GLY C 1 417 ? 53.550  85.380  55.295  1.00 69.57  ? 395  GLY C C   1 
ATOM   7982  O  O   . GLY C 1 417 ? 54.467  84.639  54.937  1.00 67.17  ? 395  GLY C O   1 
ATOM   7983  N  N   . PHE C 1 418 ? 53.754  86.611  55.752  1.00 71.08  ? 396  PHE C N   1 
ATOM   7984  C  CA  . PHE C 1 418 ? 55.097  87.169  55.899  1.00 68.90  ? 396  PHE C CA  1 
ATOM   7985  C  C   . PHE C 1 418 ? 55.433  87.115  57.377  1.00 70.16  ? 396  PHE C C   1 
ATOM   7986  O  O   . PHE C 1 418 ? 56.595  87.014  57.770  1.00 69.80  ? 396  PHE C O   1 
ATOM   7987  C  CB  . PHE C 1 418 ? 55.131  88.629  55.444  1.00 68.20  ? 396  PHE C CB  1 
ATOM   7988  C  CG  . PHE C 1 418 ? 54.946  88.816  53.968  1.00 64.71  ? 396  PHE C CG  1 
ATOM   7989  C  CD1 . PHE C 1 418 ? 54.011  89.729  53.484  1.00 65.19  ? 396  PHE C CD1 1 
ATOM   7990  C  CD2 . PHE C 1 418 ? 55.722  88.103  53.060  1.00 62.99  ? 396  PHE C CD2 1 
ATOM   7991  C  CE1 . PHE C 1 418 ? 53.850  89.930  52.114  1.00 63.76  ? 396  PHE C CE1 1 
ATOM   7992  C  CE2 . PHE C 1 418 ? 55.571  88.296  51.688  1.00 62.35  ? 396  PHE C CE2 1 
ATOM   7993  C  CZ  . PHE C 1 418 ? 54.632  89.212  51.212  1.00 60.94  ? 396  PHE C CZ  1 
ATOM   7994  N  N   . LEU C 1 419 ? 54.389  87.186  58.193  1.00 71.53  ? 397  LEU C N   1 
ATOM   7995  C  CA  . LEU C 1 419 ? 54.547  87.161  59.634  1.00 69.77  ? 397  LEU C CA  1 
ATOM   7996  C  C   . LEU C 1 419 ? 53.713  86.028  60.232  1.00 70.37  ? 397  LEU C C   1 
ATOM   7997  O  O   . LEU C 1 419 ? 52.640  85.720  59.668  1.00 68.18  ? 397  LEU C O   1 
ATOM   7998  C  CB  . LEU C 1 419 ? 54.120  88.522  60.200  1.00 69.78  ? 397  LEU C CB  1 
ATOM   7999  C  CG  . LEU C 1 419 ? 54.405  88.850  61.661  1.00 63.14  ? 397  LEU C CG  1 
ATOM   8000  C  CD1 . LEU C 1 419 ? 53.336  88.245  62.541  1.00 68.32  ? 397  LEU C CD1 1 
ATOM   8001  C  CD2 . LEU C 1 419 ? 55.786  88.344  62.028  1.00 65.62  ? 397  LEU C CD2 1 
ATOM   8002  N  N   . TRP D 1 65  ? 49.342  110.417 90.854  1.00 78.92  ? 43   TRP D N   1 
ATOM   8003  C  CA  . TRP D 1 65  ? 48.435  111.433 90.264  1.00 79.56  ? 43   TRP D CA  1 
ATOM   8004  C  C   . TRP D 1 65  ? 48.195  112.681 91.113  1.00 78.75  ? 43   TRP D C   1 
ATOM   8005  O  O   . TRP D 1 65  ? 47.572  112.616 92.169  1.00 77.70  ? 43   TRP D O   1 
ATOM   8006  C  CB  . TRP D 1 65  ? 47.054  110.837 89.965  1.00 80.89  ? 43   TRP D CB  1 
ATOM   8007  C  CG  . TRP D 1 65  ? 46.251  111.582 88.906  1.00 84.61  ? 43   TRP D CG  1 
ATOM   8008  C  CD1 . TRP D 1 65  ? 46.520  111.611 87.566  1.00 85.31  ? 43   TRP D CD1 1 
ATOM   8009  C  CD2 . TRP D 1 65  ? 45.027  112.333 89.084  1.00 86.33  ? 43   TRP D CD2 1 
ATOM   8010  N  NE1 . TRP D 1 65  ? 45.541  112.310 86.897  1.00 85.03  ? 43   TRP D NE1 1 
ATOM   8011  C  CE2 . TRP D 1 65  ? 44.616  112.768 87.799  1.00 86.91  ? 43   TRP D CE2 1 
ATOM   8012  C  CE3 . TRP D 1 65  ? 44.238  112.675 90.197  1.00 87.15  ? 43   TRP D CE3 1 
ATOM   8013  C  CZ2 . TRP D 1 65  ? 43.454  113.526 87.594  1.00 86.79  ? 43   TRP D CZ2 1 
ATOM   8014  C  CZ3 . TRP D 1 65  ? 43.068  113.436 89.987  1.00 89.16  ? 43   TRP D CZ3 1 
ATOM   8015  C  CH2 . TRP D 1 65  ? 42.696  113.849 88.694  1.00 87.75  ? 43   TRP D CH2 1 
ATOM   8016  N  N   . ILE D 1 66  ? 48.712  113.809 90.660  1.00 77.33  ? 44   ILE D N   1 
ATOM   8017  C  CA  . ILE D 1 66  ? 48.463  115.054 91.340  1.00 77.91  ? 44   ILE D CA  1 
ATOM   8018  C  C   . ILE D 1 66  ? 47.963  115.700 90.088  1.00 78.49  ? 44   ILE D C   1 
ATOM   8019  O  O   . ILE D 1 66  ? 48.759  116.055 89.211  1.00 79.22  ? 44   ILE D O   1 
ATOM   8020  C  CB  . ILE D 1 66  ? 49.755  115.755 91.846  1.00 75.92  ? 44   ILE D CB  1 
ATOM   8021  C  CG1 . ILE D 1 66  ? 50.140  115.196 93.223  1.00 74.90  ? 44   ILE D CG1 1 
ATOM   8022  C  CG2 . ILE D 1 66  ? 49.589  117.270 91.873  1.00 76.26  ? 44   ILE D CG2 1 
ATOM   8023  C  CD1 . ILE D 1 66  ? 51.271  115.957 93.905  1.00 70.50  ? 44   ILE D CD1 1 
ATOM   8024  N  N   . ARG D 1 67  ? 46.641  115.754 89.976  1.00 78.92  ? 45   ARG D N   1 
ATOM   8025  C  CA  . ARG D 1 67  ? 45.928  116.292 88.831  1.00 77.87  ? 45   ARG D CA  1 
ATOM   8026  C  C   . ARG D 1 67  ? 46.741  117.093 87.821  1.00 76.23  ? 45   ARG D C   1 
ATOM   8027  O  O   . ARG D 1 67  ? 47.629  117.866 88.184  1.00 76.56  ? 45   ARG D O   1 
ATOM   8028  C  CB  . ARG D 1 67  ? 44.783  117.163 89.337  1.00 75.89  ? 45   ARG D CB  1 
ATOM   8029  C  CG  . ARG D 1 67  ? 45.197  118.158 90.420  1.00 73.87  ? 45   ARG D CG  1 
ATOM   8030  C  CD  . ARG D 1 67  ? 44.266  119.355 90.460  1.00 74.72  ? 45   ARG D CD  1 
ATOM   8031  N  NE  . ARG D 1 67  ? 44.485  120.228 91.615  1.00 70.60  ? 45   ARG D NE  1 
ATOM   8032  C  CZ  . ARG D 1 67  ? 44.032  121.479 91.702  1.00 65.00  ? 45   ARG D CZ  1 
ATOM   8033  N  NH1 . ARG D 1 67  ? 43.341  122.015 90.696  1.00 55.61  ? 45   ARG D NH1 1 
ATOM   8034  N  NH2 . ARG D 1 67  ? 44.248  122.190 92.804  1.00 56.25  ? 45   ARG D NH2 1 
ATOM   8035  N  N   . PRO D 1 68  ? 46.459  116.859 86.525  1.00 74.29  ? 46   PRO D N   1 
ATOM   8036  C  CA  . PRO D 1 68  ? 47.065  117.513 85.356  1.00 72.80  ? 46   PRO D CA  1 
ATOM   8037  C  C   . PRO D 1 68  ? 46.771  119.018 85.314  1.00 69.80  ? 46   PRO D C   1 
ATOM   8038  O  O   . PRO D 1 68  ? 47.252  119.730 84.422  1.00 64.11  ? 46   PRO D O   1 
ATOM   8039  C  CB  . PRO D 1 68  ? 46.417  116.778 84.196  1.00 72.72  ? 46   PRO D CB  1 
ATOM   8040  C  CG  . PRO D 1 68  ? 46.409  115.383 84.691  1.00 73.27  ? 46   PRO D CG  1 
ATOM   8041  C  CD  . PRO D 1 68  ? 45.999  115.500 86.163  1.00 72.74  ? 46   PRO D CD  1 
ATOM   8042  N  N   . ASP D 1 69  ? 45.990  119.499 86.286  1.00 68.03  ? 47   ASP D N   1 
ATOM   8043  C  CA  . ASP D 1 69  ? 45.600  120.910 86.336  1.00 65.02  ? 47   ASP D CA  1 
ATOM   8044  C  C   . ASP D 1 69  ? 45.992  121.746 87.554  1.00 61.17  ? 47   ASP D C   1 
ATOM   8045  O  O   . ASP D 1 69  ? 45.485  122.854 87.712  1.00 56.73  ? 47   ASP D O   1 
ATOM   8046  C  CB  . ASP D 1 69  ? 44.086  121.026 86.112  1.00 68.41  ? 47   ASP D CB  1 
ATOM   8047  C  CG  . ASP D 1 69  ? 43.287  120.088 86.997  1.00 69.43  ? 47   ASP D CG  1 
ATOM   8048  O  OD1 . ASP D 1 69  ? 42.992  120.451 88.154  1.00 67.14  ? 47   ASP D OD1 1 
ATOM   8049  O  OD2 . ASP D 1 69  ? 42.959  118.979 86.530  1.00 72.83  ? 47   ASP D OD2 1 
ATOM   8050  N  N   . ALA D 1 70  ? 46.873  121.236 88.413  1.00 58.10  ? 48   ALA D N   1 
ATOM   8051  C  CA  . ALA D 1 70  ? 47.314  122.006 89.576  1.00 57.77  ? 48   ALA D CA  1 
ATOM   8052  C  C   . ALA D 1 70  ? 47.639  123.411 89.051  1.00 59.02  ? 48   ALA D C   1 
ATOM   8053  O  O   . ALA D 1 70  ? 48.407  123.556 88.102  1.00 62.27  ? 48   ALA D O   1 
ATOM   8054  C  CB  . ALA D 1 70  ? 48.552  121.365 90.193  1.00 58.55  ? 48   ALA D CB  1 
ATOM   8055  N  N   . PRO D 1 71  ? 47.066  124.458 89.672  1.00 55.78  ? 49   PRO D N   1 
ATOM   8056  C  CA  . PRO D 1 71  ? 47.236  125.872 89.315  1.00 50.62  ? 49   PRO D CA  1 
ATOM   8057  C  C   . PRO D 1 71  ? 48.654  126.399 89.310  1.00 50.69  ? 49   PRO D C   1 
ATOM   8058  O  O   . PRO D 1 71  ? 48.997  127.203 90.165  1.00 50.51  ? 49   PRO D O   1 
ATOM   8059  C  CB  . PRO D 1 71  ? 46.396  126.584 90.359  1.00 51.55  ? 49   PRO D CB  1 
ATOM   8060  C  CG  . PRO D 1 71  ? 46.675  125.771 91.558  1.00 55.38  ? 49   PRO D CG  1 
ATOM   8061  C  CD  . PRO D 1 71  ? 46.485  124.356 91.022  1.00 53.54  ? 49   PRO D CD  1 
ATOM   8062  N  N   . SER D 1 72  ? 49.448  125.956 88.336  1.00 50.89  ? 50   SER D N   1 
ATOM   8063  C  CA  . SER D 1 72  ? 50.850  126.350 88.141  1.00 44.72  ? 50   SER D CA  1 
ATOM   8064  C  C   . SER D 1 72  ? 51.491  127.299 89.150  1.00 46.20  ? 50   SER D C   1 
ATOM   8065  O  O   . SER D 1 72  ? 50.887  128.288 89.555  1.00 53.86  ? 50   SER D O   1 
ATOM   8066  C  CB  . SER D 1 72  ? 51.010  126.955 86.755  1.00 33.63  ? 50   SER D CB  1 
ATOM   8067  O  OG  . SER D 1 72  ? 52.311  127.491 86.596  1.00 30.68  ? 50   SER D OG  1 
ATOM   8068  N  N   . ARG D 1 73  ? 52.740  127.021 89.517  1.00 47.54  ? 51   ARG D N   1 
ATOM   8069  C  CA  . ARG D 1 73  ? 53.447  127.859 90.485  1.00 51.67  ? 51   ARG D CA  1 
ATOM   8070  C  C   . ARG D 1 73  ? 54.648  128.628 89.914  1.00 52.78  ? 51   ARG D C   1 
ATOM   8071  O  O   . ARG D 1 73  ? 55.402  129.258 90.663  1.00 48.53  ? 51   ARG D O   1 
ATOM   8072  C  CB  . ARG D 1 73  ? 53.913  127.013 91.679  1.00 55.34  ? 51   ARG D CB  1 
ATOM   8073  C  CG  . ARG D 1 73  ? 52.798  126.440 92.545  1.00 50.72  ? 51   ARG D CG  1 
ATOM   8074  C  CD  . ARG D 1 73  ? 52.710  124.934 92.387  1.00 50.40  ? 51   ARG D CD  1 
ATOM   8075  N  NE  . ARG D 1 73  ? 53.965  124.277 92.749  1.00 46.57  ? 51   ARG D NE  1 
ATOM   8076  C  CZ  . ARG D 1 73  ? 54.232  122.999 92.506  1.00 48.15  ? 51   ARG D CZ  1 
ATOM   8077  N  NH1 . ARG D 1 73  ? 53.334  122.234 91.901  1.00 47.82  ? 51   ARG D NH1 1 
ATOM   8078  N  NH2 . ARG D 1 73  ? 55.401  122.484 92.857  1.00 57.55  ? 51   ARG D NH2 1 
ATOM   8079  N  N   . CYS D 1 74  ? 54.823  128.577 88.595  1.00 54.71  ? 52   CYS D N   1 
ATOM   8080  C  CA  . CYS D 1 74  ? 55.929  129.277 87.934  1.00 51.65  ? 52   CYS D CA  1 
ATOM   8081  C  C   . CYS D 1 74  ? 55.881  130.763 88.269  1.00 50.27  ? 52   CYS D C   1 
ATOM   8082  O  O   . CYS D 1 74  ? 54.804  131.356 88.295  1.00 51.82  ? 52   CYS D O   1 
ATOM   8083  C  CB  . CYS D 1 74  ? 55.841  129.096 86.412  1.00 51.41  ? 52   CYS D CB  1 
ATOM   8084  S  SG  . CYS D 1 74  ? 57.204  129.872 85.476  1.00 35.26  ? 52   CYS D SG  1 
ATOM   8085  N  N   . THR D 1 75  ? 57.038  131.373 88.502  1.00 51.14  ? 53   THR D N   1 
ATOM   8086  C  CA  . THR D 1 75  ? 57.064  132.789 88.859  1.00 56.44  ? 53   THR D CA  1 
ATOM   8087  C  C   . THR D 1 75  ? 57.476  133.758 87.752  1.00 55.45  ? 53   THR D C   1 
ATOM   8088  O  O   . THR D 1 75  ? 57.694  134.945 88.015  1.00 60.87  ? 53   THR D O   1 
ATOM   8089  C  CB  . THR D 1 75  ? 57.950  133.023 90.115  1.00 61.86  ? 53   THR D CB  1 
ATOM   8090  O  OG1 . THR D 1 75  ? 59.255  132.467 89.912  1.00 65.26  ? 53   THR D OG1 1 
ATOM   8091  C  CG2 . THR D 1 75  ? 57.325  132.359 91.326  1.00 64.13  ? 53   THR D CG2 1 
ATOM   8092  N  N   . TRP D 1 76  ? 57.566  133.252 86.522  1.00 50.79  ? 54   TRP D N   1 
ATOM   8093  C  CA  . TRP D 1 76  ? 57.922  134.063 85.359  1.00 41.55  ? 54   TRP D CA  1 
ATOM   8094  C  C   . TRP D 1 76  ? 56.944  135.236 85.228  1.00 41.03  ? 54   TRP D C   1 
ATOM   8095  O  O   . TRP D 1 76  ? 55.770  135.111 85.567  1.00 38.28  ? 54   TRP D O   1 
ATOM   8096  C  CB  . TRP D 1 76  ? 57.851  133.213 84.083  1.00 35.38  ? 54   TRP D CB  1 
ATOM   8097  C  CG  . TRP D 1 76  ? 58.053  133.993 82.784  1.00 35.25  ? 54   TRP D CG  1 
ATOM   8098  C  CD1 . TRP D 1 76  ? 59.231  134.178 82.106  1.00 39.25  ? 54   TRP D CD1 1 
ATOM   8099  C  CD2 . TRP D 1 76  ? 57.050  134.699 82.033  1.00 26.99  ? 54   TRP D CD2 1 
ATOM   8100  N  NE1 . TRP D 1 76  ? 59.022  134.950 80.984  1.00 35.32  ? 54   TRP D NE1 1 
ATOM   8101  C  CE2 . TRP D 1 76  ? 57.695  135.283 80.916  1.00 28.90  ? 54   TRP D CE2 1 
ATOM   8102  C  CE3 . TRP D 1 76  ? 55.673  134.892 82.197  1.00 12.77  ? 54   TRP D CE3 1 
ATOM   8103  C  CZ2 . TRP D 1 76  ? 57.008  136.046 79.969  1.00 21.61  ? 54   TRP D CZ2 1 
ATOM   8104  C  CZ3 . TRP D 1 76  ? 54.993  135.646 81.260  1.00 21.06  ? 54   TRP D CZ3 1 
ATOM   8105  C  CH2 . TRP D 1 76  ? 55.664  136.216 80.155  1.00 21.79  ? 54   TRP D CH2 1 
ATOM   8106  N  N   . GLN D 1 77  ? 57.440  136.370 84.743  1.00 39.34  ? 55   GLN D N   1 
ATOM   8107  C  CA  . GLN D 1 77  ? 56.625  137.555 84.522  1.00 40.11  ? 55   GLN D CA  1 
ATOM   8108  C  C   . GLN D 1 77  ? 57.320  138.306 83.404  1.00 36.84  ? 55   GLN D C   1 
ATOM   8109  O  O   . GLN D 1 77  ? 58.530  138.465 83.438  1.00 32.07  ? 55   GLN D O   1 
ATOM   8110  C  CB  . GLN D 1 77  ? 56.564  138.438 85.777  1.00 51.46  ? 55   GLN D CB  1 
ATOM   8111  C  CG  . GLN D 1 77  ? 55.909  137.777 86.994  1.00 64.92  ? 55   GLN D CG  1 
ATOM   8112  C  CD  . GLN D 1 77  ? 55.613  138.761 88.118  1.00 70.10  ? 55   GLN D CD  1 
ATOM   8113  O  OE1 . GLN D 1 77  ? 54.785  139.669 87.965  1.00 69.60  ? 55   GLN D OE1 1 
ATOM   8114  N  NE2 . GLN D 1 77  ? 56.290  138.587 89.252  1.00 69.59  ? 55   GLN D NE2 1 
ATOM   8115  N  N   . LEU D 1 78  ? 56.570  138.746 82.401  1.00 40.07  ? 56   LEU D N   1 
ATOM   8116  C  CA  . LEU D 1 78  ? 57.174  139.480 81.300  1.00 38.56  ? 56   LEU D CA  1 
ATOM   8117  C  C   . LEU D 1 78  ? 57.933  140.671 81.844  1.00 38.37  ? 56   LEU D C   1 
ATOM   8118  O  O   . LEU D 1 78  ? 57.465  141.349 82.755  1.00 33.11  ? 56   LEU D O   1 
ATOM   8119  C  CB  . LEU D 1 78  ? 56.108  139.970 80.318  1.00 39.50  ? 56   LEU D CB  1 
ATOM   8120  C  CG  . LEU D 1 78  ? 56.619  140.831 79.153  1.00 44.13  ? 56   LEU D CG  1 
ATOM   8121  C  CD1 . LEU D 1 78  ? 57.759  140.117 78.438  1.00 27.83  ? 56   LEU D CD1 1 
ATOM   8122  C  CD2 . LEU D 1 78  ? 55.480  141.125 78.192  1.00 37.86  ? 56   LEU D CD2 1 
ATOM   8123  N  N   . GLY D 1 79  ? 59.113  140.917 81.284  1.00 44.08  ? 57   GLY D N   1 
ATOM   8124  C  CA  . GLY D 1 79  ? 59.926  142.037 81.728  1.00 45.80  ? 57   GLY D CA  1 
ATOM   8125  C  C   . GLY D 1 79  ? 60.986  141.636 82.732  1.00 45.99  ? 57   GLY D C   1 
ATOM   8126  O  O   . GLY D 1 79  ? 61.889  142.416 83.046  1.00 46.34  ? 57   GLY D O   1 
ATOM   8127  N  N   . ARG D 1 80  ? 60.872  140.412 83.237  1.00 46.97  ? 58   ARG D N   1 
ATOM   8128  C  CA  . ARG D 1 80  ? 61.818  139.885 84.215  1.00 48.44  ? 58   ARG D CA  1 
ATOM   8129  C  C   . ARG D 1 80  ? 62.999  139.255 83.466  1.00 50.08  ? 58   ARG D C   1 
ATOM   8130  O  O   . ARG D 1 80  ? 62.802  138.472 82.533  1.00 57.19  ? 58   ARG D O   1 
ATOM   8131  C  CB  . ARG D 1 80  ? 61.108  138.859 85.094  1.00 42.87  ? 58   ARG D CB  1 
ATOM   8132  C  CG  . ARG D 1 80  ? 61.852  138.524 86.339  1.00 44.87  ? 58   ARG D CG  1 
ATOM   8133  C  CD  . ARG D 1 80  ? 61.070  137.575 87.221  1.00 48.28  ? 58   ARG D CD  1 
ATOM   8134  N  NE  . ARG D 1 80  ? 61.963  136.989 88.214  1.00 47.28  ? 58   ARG D NE  1 
ATOM   8135  C  CZ  . ARG D 1 80  ? 61.570  136.346 89.304  1.00 40.32  ? 58   ARG D CZ  1 
ATOM   8136  N  NH1 . ARG D 1 80  ? 62.481  135.855 90.125  1.00 42.68  ? 58   ARG D NH1 1 
ATOM   8137  N  NH2 . ARG D 1 80  ? 60.278  136.204 89.576  1.00 40.59  ? 58   ARG D NH2 1 
ATOM   8138  N  N   . PRO D 1 81  ? 64.243  139.597 83.858  1.00 51.04  ? 59   PRO D N   1 
ATOM   8139  C  CA  . PRO D 1 81  ? 65.471  139.081 83.225  1.00 50.38  ? 59   PRO D CA  1 
ATOM   8140  C  C   . PRO D 1 81  ? 65.538  137.559 83.099  1.00 53.28  ? 59   PRO D C   1 
ATOM   8141  O  O   . PRO D 1 81  ? 65.050  136.827 83.967  1.00 54.47  ? 59   PRO D O   1 
ATOM   8142  C  CB  . PRO D 1 81  ? 66.586  139.626 84.119  1.00 50.20  ? 59   PRO D CB  1 
ATOM   8143  C  CG  . PRO D 1 81  ? 65.981  140.884 84.695  1.00 50.22  ? 59   PRO D CG  1 
ATOM   8144  C  CD  . PRO D 1 81  ? 64.570  140.450 85.015  1.00 47.87  ? 59   PRO D CD  1 
ATOM   8145  N  N   . ALA D 1 82  ? 66.155  137.086 82.020  1.00 50.82  ? 60   ALA D N   1 
ATOM   8146  C  CA  . ALA D 1 82  ? 66.275  135.649 81.786  1.00 51.73  ? 60   ALA D CA  1 
ATOM   8147  C  C   . ALA D 1 82  ? 67.260  135.033 82.771  1.00 49.14  ? 60   ALA D C   1 
ATOM   8148  O  O   . ALA D 1 82  ? 67.200  133.839 83.078  1.00 48.82  ? 60   ALA D O   1 
ATOM   8149  C  CB  . ALA D 1 82  ? 66.730  135.385 80.357  1.00 52.96  ? 60   ALA D CB  1 
ATOM   8150  N  N   . SER D 1 83  ? 68.170  135.860 83.264  1.00 46.51  ? 61   SER D N   1 
ATOM   8151  C  CA  . SER D 1 83  ? 69.170  135.409 84.220  1.00 47.66  ? 61   SER D CA  1 
ATOM   8152  C  C   . SER D 1 83  ? 68.499  134.879 85.485  1.00 45.81  ? 61   SER D C   1 
ATOM   8153  O  O   . SER D 1 83  ? 69.096  134.129 86.255  1.00 46.36  ? 61   SER D O   1 
ATOM   8154  C  CB  . SER D 1 83  ? 70.102  136.569 84.577  1.00 47.82  ? 61   SER D CB  1 
ATOM   8155  O  OG  . SER D 1 83  ? 69.366  137.698 85.012  1.00 52.33  ? 61   SER D OG  1 
ATOM   8156  N  N   . GLU D 1 84  ? 67.249  135.273 85.687  1.00 41.52  ? 62   GLU D N   1 
ATOM   8157  C  CA  . GLU D 1 84  ? 66.511  134.859 86.860  1.00 37.13  ? 62   GLU D CA  1 
ATOM   8158  C  C   . GLU D 1 84  ? 65.745  133.558 86.722  1.00 27.71  ? 62   GLU D C   1 
ATOM   8159  O  O   . GLU D 1 84  ? 65.061  133.156 87.642  1.00 15.96  ? 62   GLU D O   1 
ATOM   8160  C  CB  . GLU D 1 84  ? 65.560  135.971 87.287  1.00 45.49  ? 62   GLU D CB  1 
ATOM   8161  C  CG  . GLU D 1 84  ? 66.270  137.133 87.958  1.00 53.76  ? 62   GLU D CG  1 
ATOM   8162  C  CD  . GLU D 1 84  ? 65.314  138.224 88.377  1.00 59.51  ? 62   GLU D CD  1 
ATOM   8163  O  OE1 . GLU D 1 84  ? 64.246  137.889 88.940  1.00 54.55  ? 62   GLU D OE1 1 
ATOM   8164  O  OE2 . GLU D 1 84  ? 65.634  139.415 88.150  1.00 64.28  ? 62   GLU D OE2 1 
ATOM   8165  N  N   . SER D 1 85  ? 65.845  132.901 85.575  1.00 31.71  ? 63   SER D N   1 
ATOM   8166  C  CA  . SER D 1 85  ? 65.160  131.626 85.401  1.00 37.14  ? 63   SER D CA  1 
ATOM   8167  C  C   . SER D 1 85  ? 65.915  130.556 86.180  1.00 37.84  ? 63   SER D C   1 
ATOM   8168  O  O   . SER D 1 85  ? 67.142  130.547 86.210  1.00 31.70  ? 63   SER D O   1 
ATOM   8169  C  CB  . SER D 1 85  ? 65.115  131.223 83.925  1.00 32.84  ? 63   SER D CB  1 
ATOM   8170  O  OG  . SER D 1 85  ? 64.821  129.841 83.787  1.00 31.97  ? 63   SER D OG  1 
ATOM   8171  N  N   . PRO D 1 86  ? 65.187  129.656 86.847  1.00 39.56  ? 64   PRO D N   1 
ATOM   8172  C  CA  . PRO D 1 86  ? 65.766  128.567 87.629  1.00 40.40  ? 64   PRO D CA  1 
ATOM   8173  C  C   . PRO D 1 86  ? 65.768  127.323 86.744  1.00 43.98  ? 64   PRO D C   1 
ATOM   8174  O  O   . PRO D 1 86  ? 66.071  126.218 87.202  1.00 37.15  ? 64   PRO D O   1 
ATOM   8175  C  CB  . PRO D 1 86  ? 64.779  128.424 88.770  1.00 34.41  ? 64   PRO D CB  1 
ATOM   8176  C  CG  . PRO D 1 86  ? 63.496  128.569 88.064  1.00 35.43  ? 64   PRO D CG  1 
ATOM   8177  C  CD  . PRO D 1 86  ? 63.760  129.789 87.165  1.00 38.85  ? 64   PRO D CD  1 
ATOM   8178  N  N   . HIS D 1 87  ? 65.413  127.521 85.475  1.00 46.59  ? 65   HIS D N   1 
ATOM   8179  C  CA  . HIS D 1 87  ? 65.330  126.426 84.519  1.00 49.40  ? 65   HIS D CA  1 
ATOM   8180  C  C   . HIS D 1 87  ? 66.586  126.204 83.690  1.00 53.82  ? 65   HIS D C   1 
ATOM   8181  O  O   . HIS D 1 87  ? 67.404  127.106 83.516  1.00 59.80  ? 65   HIS D O   1 
ATOM   8182  C  CB  . HIS D 1 87  ? 64.149  126.663 83.580  1.00 44.33  ? 65   HIS D CB  1 
ATOM   8183  C  CG  . HIS D 1 87  ? 62.828  126.730 84.282  1.00 38.88  ? 65   HIS D CG  1 
ATOM   8184  N  ND1 . HIS D 1 87  ? 62.301  125.661 84.970  1.00 30.91  ? 65   HIS D ND1 1 
ATOM   8185  C  CD2 . HIS D 1 87  ? 61.923  127.734 84.396  1.00 36.75  ? 65   HIS D CD2 1 
ATOM   8186  C  CE1 . HIS D 1 87  ? 61.129  126.001 85.476  1.00 26.93  ? 65   HIS D CE1 1 
ATOM   8187  N  NE2 . HIS D 1 87  ? 60.875  127.253 85.144  1.00 23.31  ? 65   HIS D NE2 1 
ATOM   8188  N  N   . HIS D 1 88  ? 66.743  124.982 83.193  1.00 56.15  ? 66   HIS D N   1 
ATOM   8189  C  CA  . HIS D 1 88  ? 67.875  124.669 82.337  1.00 58.32  ? 66   HIS D CA  1 
ATOM   8190  C  C   . HIS D 1 88  ? 67.408  125.036 80.935  1.00 55.57  ? 66   HIS D C   1 
ATOM   8191  O  O   . HIS D 1 88  ? 66.429  124.480 80.427  1.00 49.47  ? 66   HIS D O   1 
ATOM   8192  C  CB  . HIS D 1 88  ? 68.223  123.183 82.375  1.00 63.72  ? 66   HIS D CB  1 
ATOM   8193  C  CG  . HIS D 1 88  ? 69.357  122.819 81.467  1.00 70.89  ? 66   HIS D CG  1 
ATOM   8194  N  ND1 . HIS D 1 88  ? 69.316  121.737 80.612  1.00 73.96  ? 66   HIS D ND1 1 
ATOM   8195  C  CD2 . HIS D 1 88  ? 70.551  123.421 81.253  1.00 69.37  ? 66   HIS D CD2 1 
ATOM   8196  C  CE1 . HIS D 1 88  ? 70.434  121.692 79.909  1.00 71.73  ? 66   HIS D CE1 1 
ATOM   8197  N  NE2 . HIS D 1 88  ? 71.200  122.701 80.280  1.00 71.11  ? 66   HIS D NE2 1 
ATOM   8198  N  N   . HIS D 1 89  ? 68.105  125.975 80.309  1.00 50.38  ? 67   HIS D N   1 
ATOM   8199  C  CA  . HIS D 1 89  ? 67.717  126.412 78.982  1.00 48.72  ? 67   HIS D CA  1 
ATOM   8200  C  C   . HIS D 1 89  ? 68.652  125.955 77.876  1.00 47.59  ? 67   HIS D C   1 
ATOM   8201  O  O   . HIS D 1 89  ? 69.870  125.913 78.035  1.00 53.12  ? 67   HIS D O   1 
ATOM   8202  C  CB  . HIS D 1 89  ? 67.553  127.936 78.968  1.00 44.87  ? 67   HIS D CB  1 
ATOM   8203  C  CG  . HIS D 1 89  ? 66.354  128.413 79.733  1.00 38.77  ? 67   HIS D CG  1 
ATOM   8204  N  ND1 . HIS D 1 89  ? 65.066  128.241 79.277  1.00 27.91  ? 67   HIS D ND1 1 
ATOM   8205  C  CD2 . HIS D 1 89  ? 66.246  128.999 80.950  1.00 35.60  ? 67   HIS D CD2 1 
ATOM   8206  C  CE1 . HIS D 1 89  ? 64.216  128.696 80.180  1.00 29.05  ? 67   HIS D CE1 1 
ATOM   8207  N  NE2 . HIS D 1 89  ? 64.906  129.161 81.205  1.00 28.39  ? 67   HIS D NE2 1 
ATOM   8208  N  N   . THR D 1 90  ? 68.046  125.621 76.746  1.00 44.33  ? 68   THR D N   1 
ATOM   8209  C  CA  . THR D 1 90  ? 68.753  125.132 75.581  1.00 39.28  ? 68   THR D CA  1 
ATOM   8210  C  C   . THR D 1 90  ? 68.637  126.084 74.394  1.00 34.44  ? 68   THR D C   1 
ATOM   8211  O  O   . THR D 1 90  ? 67.671  126.831 74.265  1.00 28.11  ? 68   THR D O   1 
ATOM   8212  C  CB  . THR D 1 90  ? 68.208  123.732 75.208  1.00 40.07  ? 68   THR D CB  1 
ATOM   8213  O  OG1 . THR D 1 90  ? 68.824  122.749 76.052  1.00 47.46  ? 68   THR D OG1 1 
ATOM   8214  C  CG2 . THR D 1 90  ? 68.456  123.404 73.750  1.00 41.41  ? 68   THR D CG2 1 
ATOM   8215  N  N   . ALA D 1 91  ? 69.643  126.047 73.530  1.00 36.24  ? 69   ALA D N   1 
ATOM   8216  C  CA  . ALA D 1 91  ? 69.681  126.890 72.346  1.00 42.10  ? 69   ALA D CA  1 
ATOM   8217  C  C   . ALA D 1 91  ? 69.365  126.061 71.106  1.00 43.01  ? 69   ALA D C   1 
ATOM   8218  O  O   . ALA D 1 91  ? 69.651  124.857 71.061  1.00 39.65  ? 69   ALA D O   1 
ATOM   8219  C  CB  . ALA D 1 91  ? 71.060  127.529 72.209  1.00 37.88  ? 69   ALA D CB  1 
ATOM   8220  N  N   . PRO D 1 92  ? 68.758  126.689 70.085  1.00 41.35  ? 70   PRO D N   1 
ATOM   8221  C  CA  . PRO D 1 92  ? 68.436  125.940 68.866  1.00 41.94  ? 70   PRO D CA  1 
ATOM   8222  C  C   . PRO D 1 92  ? 69.684  125.302 68.253  1.00 42.11  ? 70   PRO D C   1 
ATOM   8223  O  O   . PRO D 1 92  ? 70.813  125.717 68.535  1.00 43.55  ? 70   PRO D O   1 
ATOM   8224  C  CB  . PRO D 1 92  ? 67.826  127.007 67.956  1.00 39.00  ? 70   PRO D CB  1 
ATOM   8225  C  CG  . PRO D 1 92  ? 67.150  127.915 68.930  1.00 42.68  ? 70   PRO D CG  1 
ATOM   8226  C  CD  . PRO D 1 92  ? 68.183  128.045 70.040  1.00 37.12  ? 70   PRO D CD  1 
ATOM   8227  N  N   . ALA D 1 93  ? 69.474  124.288 67.422  1.00 40.35  ? 71   ALA D N   1 
ATOM   8228  C  CA  . ALA D 1 93  ? 70.579  123.602 66.758  1.00 46.25  ? 71   ALA D CA  1 
ATOM   8229  C  C   . ALA D 1 93  ? 70.242  123.420 65.280  1.00 45.65  ? 71   ALA D C   1 
ATOM   8230  O  O   . ALA D 1 93  ? 69.106  123.100 64.934  1.00 45.20  ? 71   ALA D O   1 
ATOM   8231  C  CB  . ALA D 1 93  ? 70.827  122.238 67.417  1.00 42.66  ? 71   ALA D CB  1 
ATOM   8232  N  N   . LYS D 1 94  ? 71.218  123.644 64.406  1.00 49.18  ? 72   LYS D N   1 
ATOM   8233  C  CA  . LYS D 1 94  ? 70.986  123.471 62.976  1.00 52.31  ? 72   LYS D CA  1 
ATOM   8234  C  C   . LYS D 1 94  ? 71.391  122.064 62.554  1.00 56.23  ? 72   LYS D C   1 
ATOM   8235  O  O   . LYS D 1 94  ? 72.280  121.454 63.154  1.00 59.81  ? 72   LYS D O   1 
ATOM   8236  C  CB  . LYS D 1 94  ? 71.772  124.502 62.163  1.00 51.54  ? 72   LYS D CB  1 
ATOM   8237  C  CG  . LYS D 1 94  ? 71.101  125.865 62.049  1.00 56.02  ? 72   LYS D CG  1 
ATOM   8238  C  CD  . LYS D 1 94  ? 71.794  126.733 60.993  1.00 61.00  ? 72   LYS D CD  1 
ATOM   8239  C  CE  . LYS D 1 94  ? 71.067  128.058 60.758  1.00 58.54  ? 72   LYS D CE  1 
ATOM   8240  N  NZ  . LYS D 1 94  ? 71.132  128.979 61.933  1.00 56.74  ? 72   LYS D NZ  1 
ATOM   8241  N  N   . SER D 1 95  ? 70.725  121.555 61.523  1.00 59.42  ? 73   SER D N   1 
ATOM   8242  C  CA  . SER D 1 95  ? 70.992  120.217 61.008  1.00 58.81  ? 73   SER D CA  1 
ATOM   8243  C  C   . SER D 1 95  ? 72.412  120.057 60.475  1.00 56.75  ? 73   SER D C   1 
ATOM   8244  O  O   . SER D 1 95  ? 72.864  120.847 59.646  1.00 59.05  ? 73   SER D O   1 
ATOM   8245  C  CB  . SER D 1 95  ? 69.995  119.876 59.901  1.00 60.44  ? 73   SER D CB  1 
ATOM   8246  O  OG  . SER D 1 95  ? 70.473  118.804 59.103  1.00 65.28  ? 73   SER D OG  1 
ATOM   8247  N  N   . PRO D 1 96  ? 73.132  119.022 60.947  1.00 53.24  ? 74   PRO D N   1 
ATOM   8248  C  CA  . PRO D 1 96  ? 74.509  118.740 60.525  1.00 49.26  ? 74   PRO D CA  1 
ATOM   8249  C  C   . PRO D 1 96  ? 74.567  118.016 59.179  1.00 45.36  ? 74   PRO D C   1 
ATOM   8250  O  O   . PRO D 1 96  ? 73.534  117.603 58.644  1.00 44.51  ? 74   PRO D O   1 
ATOM   8251  C  CB  . PRO D 1 96  ? 75.040  117.875 61.663  1.00 50.33  ? 74   PRO D CB  1 
ATOM   8252  C  CG  . PRO D 1 96  ? 73.829  117.073 62.039  1.00 52.88  ? 74   PRO D CG  1 
ATOM   8253  C  CD  . PRO D 1 96  ? 72.728  118.120 62.044  1.00 53.06  ? 74   PRO D CD  1 
ATOM   8254  N  N   . LYS D 1 97  ? 75.779  117.872 58.644  1.00 42.71  ? 75   LYS D N   1 
ATOM   8255  C  CA  . LYS D 1 97  ? 76.000  117.185 57.367  1.00 40.65  ? 75   LYS D CA  1 
ATOM   8256  C  C   . LYS D 1 97  ? 75.376  115.802 57.436  1.00 38.49  ? 75   LYS D C   1 
ATOM   8257  O  O   . LYS D 1 97  ? 74.387  115.500 56.754  1.00 42.50  ? 75   LYS D O   1 
ATOM   8258  C  CB  . LYS D 1 97  ? 77.497  117.022 57.090  1.00 37.30  ? 75   LYS D CB  1 
ATOM   8259  C  CG  . LYS D 1 97  ? 78.051  117.860 55.930  1.00 40.04  ? 75   LYS D CG  1 
ATOM   8260  C  CD  . LYS D 1 97  ? 79.417  117.325 55.498  1.00 37.91  ? 75   LYS D CD  1 
ATOM   8261  C  CE  . LYS D 1 97  ? 80.203  118.328 54.676  1.00 31.52  ? 75   LYS D CE  1 
ATOM   8262  N  NZ  . LYS D 1 97  ? 80.933  119.280 55.550  1.00 39.85  ? 75   LYS D NZ  1 
ATOM   8263  N  N   . ILE D 1 98  ? 75.986  114.965 58.262  1.00 35.28  ? 76   ILE D N   1 
ATOM   8264  C  CA  . ILE D 1 98  ? 75.528  113.606 58.479  1.00 34.66  ? 76   ILE D CA  1 
ATOM   8265  C  C   . ILE D 1 98  ? 74.890  113.549 59.865  1.00 39.25  ? 76   ILE D C   1 
ATOM   8266  O  O   . ILE D 1 98  ? 75.503  113.963 60.848  1.00 48.36  ? 76   ILE D O   1 
ATOM   8267  C  CB  . ILE D 1 98  ? 76.714  112.633 58.420  1.00 34.26  ? 76   ILE D CB  1 
ATOM   8268  C  CG1 . ILE D 1 98  ? 77.175  112.479 56.963  1.00 30.60  ? 76   ILE D CG1 1 
ATOM   8269  C  CG2 . ILE D 1 98  ? 76.337  111.301 59.051  1.00 29.05  ? 76   ILE D CG2 1 
ATOM   8270  C  CD1 . ILE D 1 98  ? 78.395  111.584 56.806  1.00 22.57  ? 76   ILE D CD1 1 
ATOM   8271  N  N   . LEU D 1 99  ? 73.662  113.050 59.948  1.00 32.39  ? 77   LEU D N   1 
ATOM   8272  C  CA  . LEU D 1 99  ? 72.979  112.957 61.235  1.00 30.81  ? 77   LEU D CA  1 
ATOM   8273  C  C   . LEU D 1 99  ? 73.310  111.676 61.995  1.00 29.56  ? 77   LEU D C   1 
ATOM   8274  O  O   . LEU D 1 99  ? 73.121  110.577 61.467  1.00 26.83  ? 77   LEU D O   1 
ATOM   8275  C  CB  . LEU D 1 99  ? 71.460  113.049 61.034  1.00 31.80  ? 77   LEU D CB  1 
ATOM   8276  C  CG  . LEU D 1 99  ? 70.897  114.447 60.707  1.00 30.14  ? 77   LEU D CG  1 
ATOM   8277  C  CD1 . LEU D 1 99  ? 71.524  115.006 59.446  1.00 23.56  ? 77   LEU D CD1 1 
ATOM   8278  C  CD2 . LEU D 1 99  ? 69.401  114.358 60.572  1.00 26.65  ? 77   LEU D CD2 1 
ATOM   8279  N  N   . PRO D 1 100 ? 73.805  111.799 63.253  1.00 27.82  ? 78   PRO D N   1 
ATOM   8280  C  CA  . PRO D 1 100 ? 74.158  110.634 64.091  1.00 25.32  ? 78   PRO D CA  1 
ATOM   8281  C  C   . PRO D 1 100 ? 72.981  109.673 64.417  1.00 30.10  ? 78   PRO D C   1 
ATOM   8282  O  O   . PRO D 1 100 ? 73.193  108.490 64.696  1.00 34.23  ? 78   PRO D O   1 
ATOM   8283  C  CB  . PRO D 1 100 ? 74.767  111.271 65.342  1.00 19.32  ? 78   PRO D CB  1 
ATOM   8284  C  CG  . PRO D 1 100 ? 74.106  112.605 65.407  1.00 22.76  ? 78   PRO D CG  1 
ATOM   8285  C  CD  . PRO D 1 100 ? 74.082  113.059 63.965  1.00 19.65  ? 78   PRO D CD  1 
ATOM   8286  N  N   . ASP D 1 101 ? 71.754  110.189 64.405  1.00 31.38  ? 79   ASP D N   1 
ATOM   8287  C  CA  . ASP D 1 101 ? 70.561  109.376 64.627  1.00 31.77  ? 79   ASP D CA  1 
ATOM   8288  C  C   . ASP D 1 101 ? 69.376  110.221 64.177  1.00 30.71  ? 79   ASP D C   1 
ATOM   8289  O  O   . ASP D 1 101 ? 69.523  111.436 63.986  1.00 26.89  ? 79   ASP D O   1 
ATOM   8290  C  CB  . ASP D 1 101 ? 70.431  108.936 66.086  1.00 33.32  ? 79   ASP D CB  1 
ATOM   8291  C  CG  . ASP D 1 101 ? 70.062  110.069 67.009  1.00 41.82  ? 79   ASP D CG  1 
ATOM   8292  O  OD1 . ASP D 1 101 ? 69.005  110.702 66.786  1.00 39.08  ? 79   ASP D OD1 1 
ATOM   8293  O  OD2 . ASP D 1 101 ? 70.827  110.320 67.969  1.00 47.14  ? 79   ASP D OD2 1 
ATOM   8294  N  N   . ILE D 1 102 ? 68.214  109.593 64.000  1.00 29.87  ? 80   ILE D N   1 
ATOM   8295  C  CA  . ILE D 1 102 ? 67.036  110.309 63.496  1.00 29.76  ? 80   ILE D CA  1 
ATOM   8296  C  C   . ILE D 1 102 ? 66.474  111.391 64.405  1.00 26.97  ? 80   ILE D C   1 
ATOM   8297  O  O   . ILE D 1 102 ? 65.836  112.342 63.936  1.00 22.90  ? 80   ILE D O   1 
ATOM   8298  C  CB  . ILE D 1 102 ? 65.886  109.337 63.138  1.00 27.54  ? 80   ILE D CB  1 
ATOM   8299  C  CG1 . ILE D 1 102 ? 64.966  109.987 62.096  1.00 29.69  ? 80   ILE D CG1 1 
ATOM   8300  C  CG2 . ILE D 1 102 ? 65.080  108.999 64.372  1.00 28.77  ? 80   ILE D CG2 1 
ATOM   8301  C  CD1 . ILE D 1 102 ? 65.657  110.310 60.775  1.00 27.20  ? 80   ILE D CD1 1 
ATOM   8302  N  N   . LEU D 1 103 ? 66.700  111.243 65.701  1.00 19.51  ? 81   LEU D N   1 
ATOM   8303  C  CA  . LEU D 1 103 ? 66.208  112.229 66.638  1.00 25.24  ? 81   LEU D CA  1 
ATOM   8304  C  C   . LEU D 1 103 ? 66.786  113.607 66.316  1.00 22.12  ? 81   LEU D C   1 
ATOM   8305  O  O   . LEU D 1 103 ? 66.218  114.641 66.690  1.00 11.31  ? 81   LEU D O   1 
ATOM   8306  C  CB  . LEU D 1 103 ? 66.551  111.800 68.069  1.00 26.92  ? 81   LEU D CB  1 
ATOM   8307  C  CG  . LEU D 1 103 ? 65.881  110.460 68.375  1.00 31.50  ? 81   LEU D CG  1 
ATOM   8308  C  CD1 . LEU D 1 103 ? 66.151  110.056 69.816  1.00 27.22  ? 81   LEU D CD1 1 
ATOM   8309  C  CD2 . LEU D 1 103 ? 64.369  110.591 68.107  1.00 29.09  ? 81   LEU D CD2 1 
ATOM   8310  N  N   . LYS D 1 104 ? 67.913  113.612 65.616  1.00 19.52  ? 82   LYS D N   1 
ATOM   8311  C  CA  . LYS D 1 104 ? 68.542  114.854 65.227  1.00 24.28  ? 82   LYS D CA  1 
ATOM   8312  C  C   . LYS D 1 104 ? 67.703  115.517 64.121  1.00 24.68  ? 82   LYS D C   1 
ATOM   8313  O  O   . LYS D 1 104 ? 67.974  116.636 63.719  1.00 23.65  ? 82   LYS D O   1 
ATOM   8314  C  CB  . LYS D 1 104 ? 69.985  114.590 64.768  1.00 30.65  ? 82   LYS D CB  1 
ATOM   8315  C  CG  . LYS D 1 104 ? 71.022  114.951 65.818  1.00 40.36  ? 82   LYS D CG  1 
ATOM   8316  C  CD  . LYS D 1 104 ? 70.605  114.426 67.184  1.00 48.44  ? 82   LYS D CD  1 
ATOM   8317  C  CE  . LYS D 1 104 ? 71.314  115.147 68.321  1.00 50.93  ? 82   LYS D CE  1 
ATOM   8318  N  NZ  . LYS D 1 104 ? 70.565  114.934 69.599  1.00 53.70  ? 82   LYS D NZ  1 
ATOM   8319  N  N   . LYS D 1 105 ? 66.674  114.824 63.644  1.00 30.45  ? 83   LYS D N   1 
ATOM   8320  C  CA  . LYS D 1 105 ? 65.805  115.384 62.616  1.00 30.47  ? 83   LYS D CA  1 
ATOM   8321  C  C   . LYS D 1 105 ? 64.480  115.770 63.246  1.00 32.93  ? 83   LYS D C   1 
ATOM   8322  O  O   . LYS D 1 105 ? 63.410  115.499 62.714  1.00 36.27  ? 83   LYS D O   1 
ATOM   8323  C  CB  . LYS D 1 105 ? 65.577  114.392 61.471  1.00 29.88  ? 83   LYS D CB  1 
ATOM   8324  C  CG  . LYS D 1 105 ? 64.821  114.977 60.272  1.00 28.00  ? 83   LYS D CG  1 
ATOM   8325  C  CD  . LYS D 1 105 ? 65.366  116.343 59.851  1.00 33.14  ? 83   LYS D CD  1 
ATOM   8326  C  CE  . LYS D 1 105 ? 64.773  116.835 58.526  1.00 39.05  ? 83   LYS D CE  1 
ATOM   8327  N  NZ  . LYS D 1 105 ? 63.280  116.995 58.505  1.00 43.89  ? 83   LYS D NZ  1 
ATOM   8328  N  N   . ILE D 1 106 ? 64.588  116.388 64.416  1.00 38.61  ? 84   ILE D N   1 
ATOM   8329  C  CA  . ILE D 1 106 ? 63.464  116.896 65.194  1.00 35.68  ? 84   ILE D CA  1 
ATOM   8330  C  C   . ILE D 1 106 ? 63.879  118.355 65.416  1.00 33.80  ? 84   ILE D C   1 
ATOM   8331  O  O   . ILE D 1 106 ? 64.978  118.625 65.892  1.00 29.66  ? 84   ILE D O   1 
ATOM   8332  C  CB  . ILE D 1 106 ? 63.353  116.166 66.555  1.00 37.86  ? 84   ILE D CB  1 
ATOM   8333  C  CG1 . ILE D 1 106 ? 62.932  114.718 66.326  1.00 37.81  ? 84   ILE D CG1 1 
ATOM   8334  C  CG2 . ILE D 1 106 ? 62.365  116.872 67.464  1.00 31.73  ? 84   ILE D CG2 1 
ATOM   8335  C  CD1 . ILE D 1 106 ? 63.095  113.851 67.549  1.00 48.94  ? 84   ILE D CD1 1 
ATOM   8336  N  N   . GLY D 1 107 ? 63.019  119.292 65.047  1.00 30.76  ? 85   GLY D N   1 
ATOM   8337  C  CA  . GLY D 1 107 ? 63.369  120.687 65.207  1.00 32.63  ? 85   GLY D CA  1 
ATOM   8338  C  C   . GLY D 1 107 ? 63.946  121.205 63.905  1.00 35.48  ? 85   GLY D C   1 
ATOM   8339  O  O   . GLY D 1 107 ? 64.100  120.444 62.944  1.00 34.71  ? 85   GLY D O   1 
ATOM   8340  N  N   . ASP D 1 108 ? 64.267  122.495 63.865  1.00 34.75  ? 86   ASP D N   1 
ATOM   8341  C  CA  . ASP D 1 108 ? 64.821  123.102 62.657  1.00 34.85  ? 86   ASP D CA  1 
ATOM   8342  C  C   . ASP D 1 108 ? 63.826  122.838 61.519  1.00 32.92  ? 86   ASP D C   1 
ATOM   8343  O  O   . ASP D 1 108 ? 64.209  122.497 60.402  1.00 31.20  ? 86   ASP D O   1 
ATOM   8344  C  CB  . ASP D 1 108 ? 66.195  122.485 62.349  1.00 32.97  ? 86   ASP D CB  1 
ATOM   8345  C  CG  . ASP D 1 108 ? 66.972  123.259 61.292  1.00 39.28  ? 86   ASP D CG  1 
ATOM   8346  O  OD1 . ASP D 1 108 ? 67.192  124.475 61.475  1.00 45.84  ? 86   ASP D OD1 1 
ATOM   8347  O  OD2 . ASP D 1 108 ? 67.375  122.649 60.279  1.00 42.25  ? 86   ASP D OD2 1 
ATOM   8348  N  N   . THR D 1 109 ? 62.539  122.988 61.825  1.00 29.69  ? 87   THR D N   1 
ATOM   8349  C  CA  . THR D 1 109 ? 61.498  122.765 60.837  1.00 28.73  ? 87   THR D CA  1 
ATOM   8350  C  C   . THR D 1 109 ? 61.367  123.958 59.885  1.00 26.62  ? 87   THR D C   1 
ATOM   8351  O  O   . THR D 1 109 ? 61.649  125.099 60.257  1.00 30.04  ? 87   THR D O   1 
ATOM   8352  C  CB  . THR D 1 109 ? 60.134  122.501 61.507  1.00 29.87  ? 87   THR D CB  1 
ATOM   8353  O  OG1 . THR D 1 109 ? 59.782  123.606 62.347  1.00 34.00  ? 87   THR D OG1 1 
ATOM   8354  C  CG2 . THR D 1 109 ? 60.193  121.245 62.332  1.00 31.55  ? 87   THR D CG2 1 
ATOM   8355  N  N   . PRO D 1 110 ? 60.931  123.700 58.640  1.00 18.25  ? 88   PRO D N   1 
ATOM   8356  C  CA  . PRO D 1 110 ? 60.758  124.740 57.615  1.00 20.13  ? 88   PRO D CA  1 
ATOM   8357  C  C   . PRO D 1 110 ? 59.602  125.743 57.739  1.00 15.41  ? 88   PRO D C   1 
ATOM   8358  O  O   . PRO D 1 110 ? 58.505  125.414 58.156  1.00 19.81  ? 88   PRO D O   1 
ATOM   8359  C  CB  . PRO D 1 110 ? 60.674  123.935 56.320  1.00 23.96  ? 88   PRO D CB  1 
ATOM   8360  C  CG  . PRO D 1 110 ? 60.072  122.619 56.775  1.00 28.60  ? 88   PRO D CG  1 
ATOM   8361  C  CD  . PRO D 1 110 ? 60.778  122.348 58.068  1.00 16.03  ? 88   PRO D CD  1 
ATOM   8362  N  N   . MET D 1 111 ? 59.890  126.984 57.381  1.00 16.91  ? 89   MET D N   1 
ATOM   8363  C  CA  . MET D 1 111 ? 58.905  128.046 57.389  1.00 18.85  ? 89   MET D CA  1 
ATOM   8364  C  C   . MET D 1 111 ? 58.499  128.219 55.917  1.00 25.54  ? 89   MET D C   1 
ATOM   8365  O  O   . MET D 1 111 ? 59.307  128.608 55.055  1.00 14.97  ? 89   MET D O   1 
ATOM   8366  C  CB  . MET D 1 111 ? 59.518  129.341 57.924  1.00 20.76  ? 89   MET D CB  1 
ATOM   8367  C  CG  . MET D 1 111 ? 58.516  130.493 58.090  1.00 33.87  ? 89   MET D CG  1 
ATOM   8368  S  SD  . MET D 1 111 ? 57.346  130.301 59.481  1.00 36.67  ? 89   MET D SD  1 
ATOM   8369  C  CE  . MET D 1 111 ? 58.151  131.223 60.744  1.00 39.73  ? 89   MET D CE  1 
ATOM   8370  N  N   . VAL D 1 112 ? 57.242  127.917 55.627  1.00 27.46  ? 90   VAL D N   1 
ATOM   8371  C  CA  . VAL D 1 112 ? 56.759  128.009 54.271  1.00 24.89  ? 90   VAL D CA  1 
ATOM   8372  C  C   . VAL D 1 112 ? 55.664  129.045 54.104  1.00 28.13  ? 90   VAL D C   1 
ATOM   8373  O  O   . VAL D 1 112 ? 54.778  129.160 54.935  1.00 39.78  ? 90   VAL D O   1 
ATOM   8374  C  CB  . VAL D 1 112 ? 56.253  126.646 53.795  1.00 28.32  ? 90   VAL D CB  1 
ATOM   8375  C  CG1 . VAL D 1 112 ? 55.960  126.694 52.294  1.00 18.89  ? 90   VAL D CG1 1 
ATOM   8376  C  CG2 . VAL D 1 112 ? 57.303  125.562 54.115  1.00 20.00  ? 90   VAL D CG2 1 
ATOM   8377  N  N   . ARG D 1 113 ? 55.731  129.791 53.007  1.00 33.22  ? 91   ARG D N   1 
ATOM   8378  C  CA  . ARG D 1 113 ? 54.768  130.841 52.707  1.00 25.37  ? 91   ARG D CA  1 
ATOM   8379  C  C   . ARG D 1 113 ? 53.516  130.263 52.080  1.00 30.89  ? 91   ARG D C   1 
ATOM   8380  O  O   . ARG D 1 113 ? 53.601  129.452 51.153  1.00 29.36  ? 91   ARG D O   1 
ATOM   8381  C  CB  . ARG D 1 113 ? 55.384  131.848 51.731  1.00 21.19  ? 91   ARG D CB  1 
ATOM   8382  C  CG  . ARG D 1 113 ? 54.546  133.077 51.481  1.00 7.97   ? 91   ARG D CG  1 
ATOM   8383  C  CD  . ARG D 1 113 ? 54.897  133.700 50.166  1.00 21.34  ? 91   ARG D CD  1 
ATOM   8384  N  NE  . ARG D 1 113 ? 56.324  133.977 50.023  1.00 22.35  ? 91   ARG D NE  1 
ATOM   8385  C  CZ  . ARG D 1 113 ? 56.992  133.819 48.885  1.00 21.23  ? 91   ARG D CZ  1 
ATOM   8386  N  NH1 . ARG D 1 113 ? 56.368  133.379 47.792  1.00 23.78  ? 91   ARG D NH1 1 
ATOM   8387  N  NH2 . ARG D 1 113 ? 58.282  134.104 48.833  1.00 27.89  ? 91   ARG D NH2 1 
ATOM   8388  N  N   . ILE D 1 114 ? 52.361  130.672 52.601  1.00 28.71  ? 92   ILE D N   1 
ATOM   8389  C  CA  . ILE D 1 114 ? 51.067  130.244 52.069  1.00 28.91  ? 92   ILE D CA  1 
ATOM   8390  C  C   . ILE D 1 114 ? 50.779  131.232 50.928  1.00 25.30  ? 92   ILE D C   1 
ATOM   8391  O  O   . ILE D 1 114 ? 50.783  132.451 51.137  1.00 28.96  ? 92   ILE D O   1 
ATOM   8392  C  CB  . ILE D 1 114 ? 49.979  130.357 53.152  1.00 36.88  ? 92   ILE D CB  1 
ATOM   8393  C  CG1 . ILE D 1 114 ? 50.385  129.535 54.376  1.00 36.13  ? 92   ILE D CG1 1 
ATOM   8394  C  CG2 . ILE D 1 114 ? 48.638  129.899 52.602  1.00 31.99  ? 92   ILE D CG2 1 
ATOM   8395  C  CD1 . ILE D 1 114 ? 50.543  128.064 54.101  1.00 34.96  ? 92   ILE D CD1 1 
ATOM   8396  N  N   . ASN D 1 115 ? 50.524  130.728 49.729  1.00 22.28  ? 93   ASN D N   1 
ATOM   8397  C  CA  . ASN D 1 115 ? 50.318  131.641 48.603  1.00 27.68  ? 93   ASN D CA  1 
ATOM   8398  C  C   . ASN D 1 115 ? 48.903  131.835 48.062  1.00 28.68  ? 93   ASN D C   1 
ATOM   8399  O  O   . ASN D 1 115 ? 48.596  132.888 47.486  1.00 27.52  ? 93   ASN D O   1 
ATOM   8400  C  CB  . ASN D 1 115 ? 51.262  131.256 47.454  1.00 19.81  ? 93   ASN D CB  1 
ATOM   8401  C  CG  . ASN D 1 115 ? 52.728  131.268 47.880  1.00 25.26  ? 93   ASN D CG  1 
ATOM   8402  O  OD1 . ASN D 1 115 ? 53.306  132.328 48.131  1.00 26.55  ? 93   ASN D OD1 1 
ATOM   8403  N  ND2 . ASN D 1 115 ? 53.327  130.088 47.985  1.00 14.24  ? 93   ASN D ND2 1 
ATOM   8404  N  N   . LYS D 1 116 ? 48.037  130.846 48.251  1.00 28.35  ? 94   LYS D N   1 
ATOM   8405  C  CA  . LYS D 1 116 ? 46.686  130.962 47.740  1.00 24.71  ? 94   LYS D CA  1 
ATOM   8406  C  C   . LYS D 1 116 ? 45.632  131.275 48.779  1.00 28.56  ? 94   LYS D C   1 
ATOM   8407  O  O   . LYS D 1 116 ? 44.978  132.318 48.706  1.00 29.96  ? 94   LYS D O   1 
ATOM   8408  C  CB  . LYS D 1 116 ? 46.318  129.690 46.984  1.00 29.28  ? 94   LYS D CB  1 
ATOM   8409  C  CG  . LYS D 1 116 ? 47.212  129.440 45.771  1.00 33.03  ? 94   LYS D CG  1 
ATOM   8410  C  CD  . LYS D 1 116 ? 46.898  128.112 45.112  1.00 37.07  ? 94   LYS D CD  1 
ATOM   8411  C  CE  . LYS D 1 116 ? 47.908  127.785 44.023  1.00 33.47  ? 94   LYS D CE  1 
ATOM   8412  N  NZ  . LYS D 1 116 ? 47.656  126.440 43.441  1.00 31.41  ? 94   LYS D NZ  1 
ATOM   8413  N  N   . ILE D 1 117 ? 45.471  130.378 49.748  1.00 33.75  ? 95   ILE D N   1 
ATOM   8414  C  CA  . ILE D 1 117 ? 44.468  130.530 50.808  1.00 32.05  ? 95   ILE D CA  1 
ATOM   8415  C  C   . ILE D 1 117 ? 44.358  131.923 51.412  1.00 37.57  ? 95   ILE D C   1 
ATOM   8416  O  O   . ILE D 1 117 ? 43.266  132.487 51.493  1.00 37.58  ? 95   ILE D O   1 
ATOM   8417  C  CB  . ILE D 1 117 ? 44.720  129.519 51.948  1.00 24.20  ? 95   ILE D CB  1 
ATOM   8418  C  CG1 . ILE D 1 117 ? 44.478  128.091 51.432  1.00 20.77  ? 95   ILE D CG1 1 
ATOM   8419  C  CG2 . ILE D 1 117 ? 43.844  129.835 53.125  1.00 8.80   ? 95   ILE D CG2 1 
ATOM   8420  C  CD1 . ILE D 1 117 ? 44.910  126.995 52.397  1.00 21.58  ? 95   ILE D CD1 1 
ATOM   8421  N  N   . GLY D 1 118 ? 45.485  132.476 51.843  1.00 40.67  ? 96   GLY D N   1 
ATOM   8422  C  CA  . GLY D 1 118 ? 45.465  133.798 52.444  1.00 39.33  ? 96   GLY D CA  1 
ATOM   8423  C  C   . GLY D 1 118 ? 44.922  134.861 51.512  1.00 35.18  ? 96   GLY D C   1 
ATOM   8424  O  O   . GLY D 1 118 ? 44.086  135.666 51.901  1.00 31.09  ? 96   GLY D O   1 
ATOM   8425  N  N   . LYS D 1 119 ? 45.409  134.861 50.276  1.00 40.42  ? 97   LYS D N   1 
ATOM   8426  C  CA  . LYS D 1 119 ? 44.982  135.830 49.273  1.00 38.59  ? 97   LYS D CA  1 
ATOM   8427  C  C   . LYS D 1 119 ? 43.499  135.647 48.957  1.00 38.69  ? 97   LYS D C   1 
ATOM   8428  O  O   . LYS D 1 119 ? 42.761  136.618 48.787  1.00 36.72  ? 97   LYS D O   1 
ATOM   8429  C  CB  . LYS D 1 119 ? 45.807  135.654 47.993  1.00 37.14  ? 97   LYS D CB  1 
ATOM   8430  C  CG  . LYS D 1 119 ? 47.324  135.752 48.165  1.00 35.56  ? 97   LYS D CG  1 
ATOM   8431  C  CD  . LYS D 1 119 ? 47.753  137.143 48.621  1.00 35.60  ? 97   LYS D CD  1 
ATOM   8432  C  CE  . LYS D 1 119 ? 49.256  137.343 48.464  1.00 26.73  ? 97   LYS D CE  1 
ATOM   8433  N  NZ  . LYS D 1 119 ? 49.689  138.690 48.939  1.00 36.95  ? 97   LYS D NZ  1 
ATOM   8434  N  N   . LYS D 1 120 ? 43.076  134.390 48.880  1.00 37.68  ? 98   LYS D N   1 
ATOM   8435  C  CA  . LYS D 1 120 ? 41.688  134.043 48.594  1.00 36.81  ? 98   LYS D CA  1 
ATOM   8436  C  C   . LYS D 1 120 ? 40.706  134.591 49.631  1.00 38.81  ? 98   LYS D C   1 
ATOM   8437  O  O   . LYS D 1 120 ? 39.504  134.645 49.372  1.00 45.70  ? 98   LYS D O   1 
ATOM   8438  C  CB  . LYS D 1 120 ? 41.550  132.519 48.504  1.00 34.92  ? 98   LYS D CB  1 
ATOM   8439  C  CG  . LYS D 1 120 ? 40.126  132.002 48.429  1.00 38.95  ? 98   LYS D CG  1 
ATOM   8440  C  CD  . LYS D 1 120 ? 40.096  130.485 48.257  1.00 39.40  ? 98   LYS D CD  1 
ATOM   8441  C  CE  . LYS D 1 120 ? 38.676  129.943 48.363  1.00 43.18  ? 98   LYS D CE  1 
ATOM   8442  N  NZ  . LYS D 1 120 ? 38.605  128.483 48.079  1.00 48.11  ? 98   LYS D NZ  1 
ATOM   8443  N  N   . PHE D 1 121 ? 41.214  134.996 50.795  1.00 35.39  ? 99   PHE D N   1 
ATOM   8444  C  CA  . PHE D 1 121 ? 40.368  135.535 51.860  1.00 35.52  ? 99   PHE D CA  1 
ATOM   8445  C  C   . PHE D 1 121 ? 40.586  137.014 52.166  1.00 39.75  ? 99   PHE D C   1 
ATOM   8446  O  O   . PHE D 1 121 ? 40.150  137.506 53.201  1.00 36.43  ? 99   PHE D O   1 
ATOM   8447  C  CB  . PHE D 1 121 ? 40.548  134.737 53.151  1.00 31.30  ? 99   PHE D CB  1 
ATOM   8448  C  CG  . PHE D 1 121 ? 39.859  133.401 53.141  1.00 30.40  ? 99   PHE D CG  1 
ATOM   8449  C  CD1 . PHE D 1 121 ? 40.458  132.295 52.550  1.00 32.33  ? 99   PHE D CD1 1 
ATOM   8450  C  CD2 . PHE D 1 121 ? 38.608  133.248 53.722  1.00 28.86  ? 99   PHE D CD2 1 
ATOM   8451  C  CE1 . PHE D 1 121 ? 39.824  131.051 52.536  1.00 29.90  ? 99   PHE D CE1 1 
ATOM   8452  C  CE2 . PHE D 1 121 ? 37.962  132.009 53.714  1.00 36.80  ? 99   PHE D CE2 1 
ATOM   8453  C  CZ  . PHE D 1 121 ? 38.573  130.908 53.120  1.00 32.56  ? 99   PHE D CZ  1 
ATOM   8454  N  N   . GLY D 1 122 ? 41.270  137.721 51.275  1.00 43.76  ? 100  GLY D N   1 
ATOM   8455  C  CA  . GLY D 1 122 ? 41.494  139.139 51.488  1.00 44.77  ? 100  GLY D CA  1 
ATOM   8456  C  C   . GLY D 1 122 ? 42.659  139.515 52.379  1.00 44.75  ? 100  GLY D C   1 
ATOM   8457  O  O   . GLY D 1 122 ? 42.886  140.697 52.635  1.00 46.32  ? 100  GLY D O   1 
ATOM   8458  N  N   . LEU D 1 123 ? 43.401  138.524 52.856  1.00 40.12  ? 101  LEU D N   1 
ATOM   8459  C  CA  . LEU D 1 123 ? 44.550  138.789 53.712  1.00 39.32  ? 101  LEU D CA  1 
ATOM   8460  C  C   . LEU D 1 123 ? 45.557  139.665 52.970  1.00 37.78  ? 101  LEU D C   1 
ATOM   8461  O  O   . LEU D 1 123 ? 45.966  139.343 51.860  1.00 40.55  ? 101  LEU D O   1 
ATOM   8462  C  CB  . LEU D 1 123 ? 45.201  137.468 54.111  1.00 39.53  ? 101  LEU D CB  1 
ATOM   8463  C  CG  . LEU D 1 123 ? 45.250  137.128 55.601  1.00 42.24  ? 101  LEU D CG  1 
ATOM   8464  C  CD1 . LEU D 1 123 ? 43.957  137.536 56.274  1.00 42.16  ? 101  LEU D CD1 1 
ATOM   8465  C  CD2 . LEU D 1 123 ? 45.510  135.633 55.763  1.00 34.83  ? 101  LEU D CD2 1 
ATOM   8466  N  N   . LYS D 1 124 ? 45.956  140.776 53.572  1.00 38.48  ? 102  LYS D N   1 
ATOM   8467  C  CA  . LYS D 1 124 ? 46.918  141.654 52.926  1.00 37.96  ? 102  LYS D CA  1 
ATOM   8468  C  C   . LYS D 1 124 ? 48.348  141.398 53.418  1.00 36.11  ? 102  LYS D C   1 
ATOM   8469  O  O   . LYS D 1 124 ? 49.311  141.788 52.757  1.00 39.71  ? 102  LYS D O   1 
ATOM   8470  C  CB  . LYS D 1 124 ? 46.538  143.119 53.165  1.00 45.05  ? 102  LYS D CB  1 
ATOM   8471  C  CG  . LYS D 1 124 ? 45.099  143.488 52.762  1.00 54.39  ? 102  LYS D CG  1 
ATOM   8472  C  CD  . LYS D 1 124 ? 44.885  145.000 52.801  1.00 57.91  ? 102  LYS D CD  1 
ATOM   8473  C  CE  . LYS D 1 124 ? 45.263  145.575 54.167  1.00 67.20  ? 102  LYS D CE  1 
ATOM   8474  N  NZ  . LYS D 1 124 ? 45.435  147.061 54.159  1.00 65.78  ? 102  LYS D NZ  1 
ATOM   8475  N  N   . CYS D 1 125 ? 48.476  140.732 54.567  1.00 34.18  ? 103  CYS D N   1 
ATOM   8476  C  CA  . CYS D 1 125 ? 49.772  140.411 55.180  1.00 30.53  ? 103  CYS D CA  1 
ATOM   8477  C  C   . CYS D 1 125 ? 50.400  139.154 54.562  1.00 35.18  ? 103  CYS D C   1 
ATOM   8478  O  O   . CYS D 1 125 ? 49.802  138.506 53.705  1.00 31.70  ? 103  CYS D O   1 
ATOM   8479  C  CB  . CYS D 1 125 ? 49.584  140.156 56.678  1.00 29.22  ? 103  CYS D CB  1 
ATOM   8480  S  SG  . CYS D 1 125 ? 48.566  138.649 57.056  1.00 31.37  ? 103  CYS D SG  1 
ATOM   8481  N  N   . GLU D 1 126 ? 51.614  138.820 55.000  1.00 36.19  ? 104  GLU D N   1 
ATOM   8482  C  CA  . GLU D 1 126 ? 52.273  137.611 54.526  1.00 31.94  ? 104  GLU D CA  1 
ATOM   8483  C  C   . GLU D 1 126 ? 51.919  136.536 55.541  1.00 30.67  ? 104  GLU D C   1 
ATOM   8484  O  O   . GLU D 1 126 ? 52.079  136.736 56.742  1.00 31.88  ? 104  GLU D O   1 
ATOM   8485  C  CB  . GLU D 1 126 ? 53.800  137.772 54.451  1.00 28.21  ? 104  GLU D CB  1 
ATOM   8486  C  CG  . GLU D 1 126 ? 54.536  136.439 54.267  1.00 27.17  ? 104  GLU D CG  1 
ATOM   8487  C  CD  . GLU D 1 126 ? 56.024  136.599 54.013  1.00 39.12  ? 104  GLU D CD  1 
ATOM   8488  O  OE1 . GLU D 1 126 ? 56.623  137.534 54.586  1.00 38.46  ? 104  GLU D OE1 1 
ATOM   8489  O  OE2 . GLU D 1 126 ? 56.594  135.777 53.255  1.00 34.33  ? 104  GLU D OE2 1 
ATOM   8490  N  N   . LEU D 1 127 ? 51.423  135.407 55.049  1.00 28.04  ? 105  LEU D N   1 
ATOM   8491  C  CA  . LEU D 1 127 ? 51.021  134.292 55.900  1.00 28.56  ? 105  LEU D CA  1 
ATOM   8492  C  C   . LEU D 1 127 ? 52.082  133.198 55.829  1.00 29.20  ? 105  LEU D C   1 
ATOM   8493  O  O   . LEU D 1 127 ? 52.310  132.620 54.764  1.00 37.41  ? 105  LEU D O   1 
ATOM   8494  C  CB  . LEU D 1 127 ? 49.690  133.723 55.404  1.00 21.21  ? 105  LEU D CB  1 
ATOM   8495  C  CG  . LEU D 1 127 ? 48.549  133.421 56.378  1.00 28.64  ? 105  LEU D CG  1 
ATOM   8496  C  CD1 . LEU D 1 127 ? 47.740  132.273 55.804  1.00 15.46  ? 105  LEU D CD1 1 
ATOM   8497  C  CD2 . LEU D 1 127 ? 49.070  133.061 57.772  1.00 17.05  ? 105  LEU D CD2 1 
ATOM   8498  N  N   . LEU D 1 128 ? 52.728  132.902 56.948  1.00 25.15  ? 106  LEU D N   1 
ATOM   8499  C  CA  . LEU D 1 128 ? 53.755  131.863 56.951  1.00 23.90  ? 106  LEU D CA  1 
ATOM   8500  C  C   . LEU D 1 128 ? 53.329  130.651 57.784  1.00 25.90  ? 106  LEU D C   1 
ATOM   8501  O  O   . LEU D 1 128 ? 52.593  130.778 58.774  1.00 29.30  ? 106  LEU D O   1 
ATOM   8502  C  CB  . LEU D 1 128 ? 55.089  132.421 57.475  1.00 14.29  ? 106  LEU D CB  1 
ATOM   8503  C  CG  . LEU D 1 128 ? 55.660  133.623 56.738  1.00 12.12  ? 106  LEU D CG  1 
ATOM   8504  C  CD1 . LEU D 1 128 ? 56.892  134.104 57.424  1.00 13.74  ? 106  LEU D CD1 1 
ATOM   8505  C  CD2 . LEU D 1 128 ? 55.942  133.260 55.303  1.00 13.98  ? 106  LEU D CD2 1 
ATOM   8506  N  N   . ALA D 1 129 ? 53.796  129.474 57.378  1.00 22.39  ? 107  ALA D N   1 
ATOM   8507  C  CA  . ALA D 1 129 ? 53.457  128.244 58.076  1.00 26.88  ? 107  ALA D CA  1 
ATOM   8508  C  C   . ALA D 1 129 ? 54.679  127.533 58.632  1.00 29.70  ? 107  ALA D C   1 
ATOM   8509  O  O   . ALA D 1 129 ? 55.620  127.251 57.892  1.00 32.69  ? 107  ALA D O   1 
ATOM   8510  C  CB  . ALA D 1 129 ? 52.694  127.299 57.140  1.00 23.58  ? 107  ALA D CB  1 
ATOM   8511  N  N   . LYS D 1 130 ? 54.654  127.269 59.942  1.00 29.45  ? 108  LYS D N   1 
ATOM   8512  C  CA  . LYS D 1 130 ? 55.716  126.539 60.650  1.00 30.13  ? 108  LYS D CA  1 
ATOM   8513  C  C   . LYS D 1 130 ? 55.283  125.099 60.450  1.00 33.36  ? 108  LYS D C   1 
ATOM   8514  O  O   . LYS D 1 130 ? 54.374  124.623 61.130  1.00 35.90  ? 108  LYS D O   1 
ATOM   8515  C  CB  . LYS D 1 130 ? 55.680  126.842 62.155  1.00 30.21  ? 108  LYS D CB  1 
ATOM   8516  C  CG  . LYS D 1 130 ? 56.976  127.349 62.768  1.00 22.38  ? 108  LYS D CG  1 
ATOM   8517  C  CD  . LYS D 1 130 ? 58.108  126.361 62.681  1.00 10.53  ? 108  LYS D CD  1 
ATOM   8518  C  CE  . LYS D 1 130 ? 59.431  127.132 62.739  1.00 15.92  ? 108  LYS D CE  1 
ATOM   8519  N  NZ  . LYS D 1 130 ? 60.653  126.273 62.750  1.00 12.75  ? 108  LYS D NZ  1 
ATOM   8520  N  N   . CYS D 1 131 ? 55.913  124.394 59.526  1.00 31.45  ? 109  CYS D N   1 
ATOM   8521  C  CA  . CYS D 1 131 ? 55.483  123.031 59.269  1.00 32.97  ? 109  CYS D CA  1 
ATOM   8522  C  C   . CYS D 1 131 ? 56.133  122.033 60.185  1.00 30.74  ? 109  CYS D C   1 
ATOM   8523  O  O   . CYS D 1 131 ? 57.200  121.502 59.888  1.00 39.92  ? 109  CYS D O   1 
ATOM   8524  C  CB  . CYS D 1 131 ? 55.735  122.686 57.801  1.00 30.35  ? 109  CYS D CB  1 
ATOM   8525  S  SG  . CYS D 1 131 ? 54.957  123.910 56.731  1.00 25.88  ? 109  CYS D SG  1 
ATOM   8526  N  N   . GLU D 1 132 ? 55.476  121.768 61.305  1.00 28.83  ? 110  GLU D N   1 
ATOM   8527  C  CA  . GLU D 1 132 ? 56.028  120.826 62.270  1.00 29.95  ? 110  GLU D CA  1 
ATOM   8528  C  C   . GLU D 1 132 ? 55.835  119.372 61.856  1.00 31.26  ? 110  GLU D C   1 
ATOM   8529  O  O   . GLU D 1 132 ? 56.345  118.468 62.519  1.00 29.17  ? 110  GLU D O   1 
ATOM   8530  C  CB  . GLU D 1 132 ? 55.408  121.049 63.640  1.00 22.69  ? 110  GLU D CB  1 
ATOM   8531  C  CG  . GLU D 1 132 ? 56.417  121.122 64.764  1.00 23.07  ? 110  GLU D CG  1 
ATOM   8532  C  CD  . GLU D 1 132 ? 57.274  122.340 64.663  1.00 15.78  ? 110  GLU D CD  1 
ATOM   8533  O  OE1 . GLU D 1 132 ? 56.745  123.368 64.224  1.00 14.66  ? 110  GLU D OE1 1 
ATOM   8534  O  OE2 . GLU D 1 132 ? 58.463  122.276 65.028  1.00 29.18  ? 110  GLU D OE2 1 
ATOM   8535  N  N   . PHE D 1 133 ? 55.104  119.142 60.764  1.00 31.02  ? 111  PHE D N   1 
ATOM   8536  C  CA  . PHE D 1 133 ? 54.886  117.772 60.310  1.00 29.80  ? 111  PHE D CA  1 
ATOM   8537  C  C   . PHE D 1 133 ? 56.126  117.191 59.661  1.00 28.08  ? 111  PHE D C   1 
ATOM   8538  O  O   . PHE D 1 133 ? 56.097  116.064 59.181  1.00 29.31  ? 111  PHE D O   1 
ATOM   8539  C  CB  . PHE D 1 133 ? 53.672  117.665 59.365  1.00 28.50  ? 111  PHE D CB  1 
ATOM   8540  C  CG  . PHE D 1 133 ? 53.668  118.654 58.239  1.00 24.23  ? 111  PHE D CG  1 
ATOM   8541  C  CD1 . PHE D 1 133 ? 54.194  118.321 57.002  1.00 24.82  ? 111  PHE D CD1 1 
ATOM   8542  C  CD2 . PHE D 1 133 ? 53.121  119.924 58.414  1.00 33.48  ? 111  PHE D CD2 1 
ATOM   8543  C  CE1 . PHE D 1 133 ? 54.179  119.229 55.952  1.00 29.68  ? 111  PHE D CE1 1 
ATOM   8544  C  CE2 . PHE D 1 133 ? 53.103  120.844 57.365  1.00 30.54  ? 111  PHE D CE2 1 
ATOM   8545  C  CZ  . PHE D 1 133 ? 53.633  120.492 56.133  1.00 34.32  ? 111  PHE D CZ  1 
ATOM   8546  N  N   . PHE D 1 134 ? 57.220  117.955 59.670  1.00 27.16  ? 112  PHE D N   1 
ATOM   8547  C  CA  . PHE D 1 134 ? 58.477  117.484 59.100  1.00 24.22  ? 112  PHE D CA  1 
ATOM   8548  C  C   . PHE D 1 134 ? 59.402  116.877 60.156  1.00 29.43  ? 112  PHE D C   1 
ATOM   8549  O  O   . PHE D 1 134 ? 60.485  116.392 59.825  1.00 34.16  ? 112  PHE D O   1 
ATOM   8550  C  CB  . PHE D 1 134 ? 59.217  118.605 58.362  1.00 24.89  ? 112  PHE D CB  1 
ATOM   8551  C  CG  . PHE D 1 134 ? 58.677  118.896 56.980  1.00 31.89  ? 112  PHE D CG  1 
ATOM   8552  C  CD1 . PHE D 1 134 ? 57.762  119.929 56.772  1.00 36.97  ? 112  PHE D CD1 1 
ATOM   8553  C  CD2 . PHE D 1 134 ? 59.086  118.141 55.885  1.00 31.15  ? 112  PHE D CD2 1 
ATOM   8554  C  CE1 . PHE D 1 134 ? 57.268  120.204 55.492  1.00 35.48  ? 112  PHE D CE1 1 
ATOM   8555  C  CE2 . PHE D 1 134 ? 58.596  118.408 54.603  1.00 34.40  ? 112  PHE D CE2 1 
ATOM   8556  C  CZ  . PHE D 1 134 ? 57.684  119.444 54.408  1.00 32.88  ? 112  PHE D CZ  1 
ATOM   8557  N  N   . ASN D 1 135 ? 58.995  116.909 61.424  1.00 28.24  ? 113  ASN D N   1 
ATOM   8558  C  CA  . ASN D 1 135 ? 59.818  116.308 62.470  1.00 23.28  ? 113  ASN D CA  1 
ATOM   8559  C  C   . ASN D 1 135 ? 59.863  114.801 62.193  1.00 20.98  ? 113  ASN D C   1 
ATOM   8560  O  O   . ASN D 1 135 ? 58.937  114.243 61.592  1.00 18.28  ? 113  ASN D O   1 
ATOM   8561  C  CB  . ASN D 1 135 ? 59.241  116.583 63.868  1.00 20.85  ? 113  ASN D CB  1 
ATOM   8562  C  CG  . ASN D 1 135 ? 59.521  118.011 64.368  1.00 30.15  ? 113  ASN D CG  1 
ATOM   8563  O  OD1 . ASN D 1 135 ? 60.642  118.516 64.254  1.00 28.00  ? 113  ASN D OD1 1 
ATOM   8564  N  ND2 . ASN D 1 135 ? 58.501  118.655 64.948  1.00 18.15  ? 113  ASN D ND2 1 
ATOM   8565  N  N   . ALA D 1 136 ? 60.934  114.149 62.636  1.00 14.89  ? 114  ALA D N   1 
ATOM   8566  C  CA  . ALA D 1 136 ? 61.126  112.722 62.404  1.00 18.76  ? 114  ALA D CA  1 
ATOM   8567  C  C   . ALA D 1 136 ? 59.876  111.843 62.510  1.00 22.97  ? 114  ALA D C   1 
ATOM   8568  O  O   . ALA D 1 136 ? 59.671  110.943 61.687  1.00 21.99  ? 114  ALA D O   1 
ATOM   8569  C  CB  . ALA D 1 136 ? 62.202  112.195 63.334  1.00 23.14  ? 114  ALA D CB  1 
ATOM   8570  N  N   . GLY D 1 137 ? 59.054  112.101 63.524  1.00 26.02  ? 115  GLY D N   1 
ATOM   8571  C  CA  . GLY D 1 137 ? 57.850  111.309 63.733  1.00 26.12  ? 115  GLY D CA  1 
ATOM   8572  C  C   . GLY D 1 137 ? 56.589  111.880 63.115  1.00 28.41  ? 115  GLY D C   1 
ATOM   8573  O  O   . GLY D 1 137 ? 55.514  111.273 63.187  1.00 24.55  ? 115  GLY D O   1 
ATOM   8574  N  N   . GLY D 1 138 ? 56.709  113.065 62.527  1.00 27.52  ? 116  GLY D N   1 
ATOM   8575  C  CA  . GLY D 1 138 ? 55.564  113.672 61.876  1.00 26.84  ? 116  GLY D CA  1 
ATOM   8576  C  C   . GLY D 1 138 ? 54.726  114.657 62.661  1.00 28.83  ? 116  GLY D C   1 
ATOM   8577  O  O   . GLY D 1 138 ? 53.679  115.097 62.171  1.00 28.42  ? 116  GLY D O   1 
ATOM   8578  N  N   . SER D 1 139 ? 55.164  115.022 63.862  1.00 25.59  ? 117  SER D N   1 
ATOM   8579  C  CA  . SER D 1 139 ? 54.391  115.969 64.653  1.00 21.51  ? 117  SER D CA  1 
ATOM   8580  C  C   . SER D 1 139 ? 55.249  116.907 65.481  1.00 22.70  ? 117  SER D C   1 
ATOM   8581  O  O   . SER D 1 139 ? 56.439  116.669 65.675  1.00 17.57  ? 117  SER D O   1 
ATOM   8582  C  CB  . SER D 1 139 ? 53.429  115.222 65.583  1.00 20.78  ? 117  SER D CB  1 
ATOM   8583  O  OG  . SER D 1 139 ? 54.117  114.619 66.670  1.00 22.98  ? 117  SER D OG  1 
ATOM   8584  N  N   . VAL D 1 140 ? 54.619  117.974 65.965  1.00 24.11  ? 118  VAL D N   1 
ATOM   8585  C  CA  . VAL D 1 140 ? 55.281  118.956 66.808  1.00 24.63  ? 118  VAL D CA  1 
ATOM   8586  C  C   . VAL D 1 140 ? 55.632  118.337 68.157  1.00 27.46  ? 118  VAL D C   1 
ATOM   8587  O  O   . VAL D 1 140 ? 56.444  118.887 68.890  1.00 22.05  ? 118  VAL D O   1 
ATOM   8588  C  CB  . VAL D 1 140 ? 54.370  120.174 67.055  1.00 27.63  ? 118  VAL D CB  1 
ATOM   8589  C  CG1 . VAL D 1 140 ? 53.043  119.709 67.680  1.00 14.23  ? 118  VAL D CG1 1 
ATOM   8590  C  CG2 . VAL D 1 140 ? 55.075  121.193 67.948  1.00 11.27  ? 118  VAL D CG2 1 
ATOM   8591  N  N   . LYS D 1 141 ? 55.022  117.190 68.464  1.00 31.52  ? 119  LYS D N   1 
ATOM   8592  C  CA  . LYS D 1 141 ? 55.252  116.491 69.730  1.00 35.43  ? 119  LYS D CA  1 
ATOM   8593  C  C   . LYS D 1 141 ? 56.624  115.844 69.825  1.00 35.42  ? 119  LYS D C   1 
ATOM   8594  O  O   . LYS D 1 141 ? 57.097  115.541 70.919  1.00 41.78  ? 119  LYS D O   1 
ATOM   8595  C  CB  . LYS D 1 141 ? 54.181  115.423 69.953  1.00 32.59  ? 119  LYS D CB  1 
ATOM   8596  C  CG  . LYS D 1 141 ? 52.796  115.972 70.207  1.00 30.40  ? 119  LYS D CG  1 
ATOM   8597  C  CD  . LYS D 1 141 ? 52.766  116.744 71.491  1.00 37.61  ? 119  LYS D CD  1 
ATOM   8598  C  CE  . LYS D 1 141 ? 51.352  117.134 71.850  1.00 35.35  ? 119  LYS D CE  1 
ATOM   8599  N  NZ  . LYS D 1 141 ? 50.848  118.121 70.890  1.00 28.68  ? 119  LYS D NZ  1 
ATOM   8600  N  N   . ASP D 1 142 ? 57.272  115.639 68.687  1.00 36.44  ? 120  ASP D N   1 
ATOM   8601  C  CA  . ASP D 1 142 ? 58.588  115.021 68.699  1.00 36.36  ? 120  ASP D CA  1 
ATOM   8602  C  C   . ASP D 1 142 ? 59.557  115.906 69.478  1.00 35.34  ? 120  ASP D C   1 
ATOM   8603  O  O   . ASP D 1 142 ? 60.515  115.409 70.074  1.00 39.51  ? 120  ASP D O   1 
ATOM   8604  C  CB  . ASP D 1 142 ? 59.076  114.790 67.269  1.00 38.41  ? 120  ASP D CB  1 
ATOM   8605  C  CG  . ASP D 1 142 ? 58.118  113.931 66.464  1.00 38.93  ? 120  ASP D CG  1 
ATOM   8606  O  OD1 . ASP D 1 142 ? 57.259  113.267 67.074  1.00 35.14  ? 120  ASP D OD1 1 
ATOM   8607  O  OD2 . ASP D 1 142 ? 58.232  113.913 65.223  1.00 44.11  ? 120  ASP D OD2 1 
ATOM   8608  N  N   . ARG D 1 143 ? 59.296  117.210 69.476  1.00 28.81  ? 121  ARG D N   1 
ATOM   8609  C  CA  . ARG D 1 143 ? 60.127  118.160 70.208  1.00 35.88  ? 121  ARG D CA  1 
ATOM   8610  C  C   . ARG D 1 143 ? 59.988  117.921 71.718  1.00 37.88  ? 121  ARG D C   1 
ATOM   8611  O  O   . ARG D 1 143 ? 60.972  117.626 72.392  1.00 41.25  ? 121  ARG D O   1 
ATOM   8612  C  CB  . ARG D 1 143 ? 59.720  119.611 69.910  1.00 36.14  ? 121  ARG D CB  1 
ATOM   8613  C  CG  . ARG D 1 143 ? 60.180  120.207 68.579  1.00 29.98  ? 121  ARG D CG  1 
ATOM   8614  C  CD  . ARG D 1 143 ? 59.649  121.639 68.478  1.00 27.98  ? 121  ARG D CD  1 
ATOM   8615  N  NE  . ARG D 1 143 ? 59.832  122.242 67.162  1.00 31.90  ? 121  ARG D NE  1 
ATOM   8616  C  CZ  . ARG D 1 143 ? 60.869  122.999 66.800  1.00 28.05  ? 121  ARG D CZ  1 
ATOM   8617  N  NH1 . ARG D 1 143 ? 61.847  123.266 67.653  1.00 19.41  ? 121  ARG D NH1 1 
ATOM   8618  N  NH2 . ARG D 1 143 ? 60.923  123.499 65.575  1.00 20.01  ? 121  ARG D NH2 1 
ATOM   8619  N  N   . ILE D 1 144 ? 58.772  118.033 72.253  1.00 35.70  ? 122  ILE D N   1 
ATOM   8620  C  CA  . ILE D 1 144 ? 58.578  117.843 73.689  1.00 36.78  ? 122  ILE D CA  1 
ATOM   8621  C  C   . ILE D 1 144 ? 58.926  116.439 74.172  1.00 35.14  ? 122  ILE D C   1 
ATOM   8622  O  O   . ILE D 1 144 ? 59.315  116.259 75.323  1.00 38.14  ? 122  ILE D O   1 
ATOM   8623  C  CB  . ILE D 1 144 ? 57.128  118.213 74.162  1.00 39.54  ? 122  ILE D CB  1 
ATOM   8624  C  CG1 . ILE D 1 144 ? 56.109  117.172 73.698  1.00 39.86  ? 122  ILE D CG1 1 
ATOM   8625  C  CG2 . ILE D 1 144 ? 56.737  119.593 73.620  1.00 35.13  ? 122  ILE D CG2 1 
ATOM   8626  C  CD1 . ILE D 1 144 ? 54.752  117.315 74.377  1.00 33.26  ? 122  ILE D CD1 1 
ATOM   8627  N  N   . SER D 1 145 ? 58.802  115.442 73.307  1.00 32.61  ? 123  SER D N   1 
ATOM   8628  C  CA  . SER D 1 145 ? 59.139  114.087 73.712  1.00 33.27  ? 123  SER D CA  1 
ATOM   8629  C  C   . SER D 1 145 ? 60.639  114.023 73.925  1.00 30.41  ? 123  SER D C   1 
ATOM   8630  O  O   . SER D 1 145 ? 61.113  113.636 74.992  1.00 32.61  ? 123  SER D O   1 
ATOM   8631  C  CB  . SER D 1 145 ? 58.732  113.087 72.637  1.00 34.73  ? 123  SER D CB  1 
ATOM   8632  O  OG  . SER D 1 145 ? 57.339  113.127 72.428  1.00 42.06  ? 123  SER D OG  1 
ATOM   8633  N  N   . LEU D 1 146 ? 61.388  114.416 72.903  1.00 32.31  ? 124  LEU D N   1 
ATOM   8634  C  CA  . LEU D 1 146 ? 62.841  114.407 72.990  1.00 28.81  ? 124  LEU D CA  1 
ATOM   8635  C  C   . LEU D 1 146 ? 63.314  115.245 74.183  1.00 29.56  ? 124  LEU D C   1 
ATOM   8636  O  O   . LEU D 1 146 ? 64.171  114.814 74.954  1.00 28.23  ? 124  LEU D O   1 
ATOM   8637  C  CB  . LEU D 1 146 ? 63.439  114.955 71.698  1.00 23.57  ? 124  LEU D CB  1 
ATOM   8638  C  CG  . LEU D 1 146 ? 64.957  115.130 71.680  1.00 20.47  ? 124  LEU D CG  1 
ATOM   8639  C  CD1 . LEU D 1 146 ? 65.623  113.778 71.925  1.00 17.24  ? 124  LEU D CD1 1 
ATOM   8640  C  CD2 . LEU D 1 146 ? 65.400  115.718 70.351  1.00 9.20   ? 124  LEU D CD2 1 
ATOM   8641  N  N   . ARG D 1 147 ? 62.738  116.437 74.336  1.00 31.59  ? 125  ARG D N   1 
ATOM   8642  C  CA  . ARG D 1 147 ? 63.103  117.346 75.423  1.00 23.64  ? 125  ARG D CA  1 
ATOM   8643  C  C   . ARG D 1 147 ? 62.756  116.819 76.822  1.00 32.42  ? 125  ARG D C   1 
ATOM   8644  O  O   . ARG D 1 147 ? 63.504  117.061 77.776  1.00 34.38  ? 125  ARG D O   1 
ATOM   8645  C  CB  . ARG D 1 147 ? 62.444  118.716 75.216  1.00 19.35  ? 125  ARG D CB  1 
ATOM   8646  C  CG  . ARG D 1 147 ? 62.856  119.787 76.232  1.00 23.32  ? 125  ARG D CG  1 
ATOM   8647  C  CD  . ARG D 1 147 ? 64.358  120.032 76.202  1.00 23.33  ? 125  ARG D CD  1 
ATOM   8648  N  NE  . ARG D 1 147 ? 64.799  121.001 77.202  1.00 21.92  ? 125  ARG D NE  1 
ATOM   8649  C  CZ  . ARG D 1 147 ? 64.792  122.319 77.036  1.00 26.61  ? 125  ARG D CZ  1 
ATOM   8650  N  NH1 . ARG D 1 147 ? 64.361  122.860 75.904  1.00 28.40  ? 125  ARG D NH1 1 
ATOM   8651  N  NH2 . ARG D 1 147 ? 65.237  123.104 78.003  1.00 30.83  ? 125  ARG D NH2 1 
ATOM   8652  N  N   . MET D 1 148 ? 61.626  116.123 76.965  1.00 30.19  ? 126  MET D N   1 
ATOM   8653  C  CA  . MET D 1 148 ? 61.264  115.583 78.270  1.00 26.43  ? 126  MET D CA  1 
ATOM   8654  C  C   . MET D 1 148 ? 62.190  114.423 78.591  1.00 28.35  ? 126  MET D C   1 
ATOM   8655  O  O   . MET D 1 148 ? 62.535  114.198 79.750  1.00 28.24  ? 126  MET D O   1 
ATOM   8656  C  CB  . MET D 1 148 ? 59.818  115.087 78.296  1.00 29.90  ? 126  MET D CB  1 
ATOM   8657  C  CG  . MET D 1 148 ? 58.787  116.151 78.585  1.00 20.64  ? 126  MET D CG  1 
ATOM   8658  S  SD  . MET D 1 148 ? 57.199  115.392 78.824  1.00 31.32  ? 126  MET D SD  1 
ATOM   8659  C  CE  . MET D 1 148 ? 56.782  114.917 77.161  1.00 23.83  ? 126  MET D CE  1 
ATOM   8660  N  N   . ILE D 1 149 ? 62.579  113.675 77.563  1.00 27.04  ? 127  ILE D N   1 
ATOM   8661  C  CA  . ILE D 1 149 ? 63.487  112.563 77.770  1.00 25.84  ? 127  ILE D CA  1 
ATOM   8662  C  C   . ILE D 1 149 ? 64.867  113.121 78.100  1.00 29.23  ? 127  ILE D C   1 
ATOM   8663  O  O   . ILE D 1 149 ? 65.498  112.696 79.069  1.00 33.21  ? 127  ILE D O   1 
ATOM   8664  C  CB  . ILE D 1 149 ? 63.582  111.651 76.522  1.00 24.37  ? 127  ILE D CB  1 
ATOM   8665  C  CG1 . ILE D 1 149 ? 62.327  110.784 76.411  1.00 25.26  ? 127  ILE D CG1 1 
ATOM   8666  C  CG2 . ILE D 1 149 ? 64.813  110.763 76.619  1.00 26.19  ? 127  ILE D CG2 1 
ATOM   8667  C  CD1 . ILE D 1 149 ? 62.342  109.817 75.243  1.00 23.16  ? 127  ILE D CD1 1 
ATOM   8668  N  N   . GLU D 1 150 ? 65.324  114.087 77.308  1.00 32.35  ? 128  GLU D N   1 
ATOM   8669  C  CA  . GLU D 1 150 ? 66.633  114.698 77.526  1.00 35.27  ? 128  GLU D CA  1 
ATOM   8670  C  C   . GLU D 1 150 ? 66.778  115.374 78.890  1.00 33.23  ? 128  GLU D C   1 
ATOM   8671  O  O   . GLU D 1 150 ? 67.809  115.246 79.544  1.00 29.77  ? 128  GLU D O   1 
ATOM   8672  C  CB  . GLU D 1 150 ? 66.942  115.703 76.407  1.00 33.37  ? 128  GLU D CB  1 
ATOM   8673  C  CG  . GLU D 1 150 ? 67.593  115.065 75.187  1.00 41.80  ? 128  GLU D CG  1 
ATOM   8674  C  CD  . GLU D 1 150 ? 67.791  116.029 74.036  1.00 44.13  ? 128  GLU D CD  1 
ATOM   8675  O  OE1 . GLU D 1 150 ? 68.565  115.692 73.113  1.00 45.78  ? 128  GLU D OE1 1 
ATOM   8676  O  OE2 . GLU D 1 150 ? 67.167  117.111 74.047  1.00 47.81  ? 128  GLU D OE2 1 
ATOM   8677  N  N   . ASP D 1 151 ? 65.750  116.089 79.325  1.00 33.96  ? 129  ASP D N   1 
ATOM   8678  C  CA  . ASP D 1 151 ? 65.813  116.763 80.613  1.00 36.41  ? 129  ASP D CA  1 
ATOM   8679  C  C   . ASP D 1 151 ? 65.864  115.771 81.765  1.00 38.17  ? 129  ASP D C   1 
ATOM   8680  O  O   . ASP D 1 151 ? 66.522  116.019 82.770  1.00 42.56  ? 129  ASP D O   1 
ATOM   8681  C  CB  . ASP D 1 151 ? 64.622  117.708 80.775  1.00 35.31  ? 129  ASP D CB  1 
ATOM   8682  C  CG  . ASP D 1 151 ? 64.841  119.033 80.083  1.00 39.15  ? 129  ASP D CG  1 
ATOM   8683  O  OD1 . ASP D 1 151 ? 63.888  119.830 79.991  1.00 49.03  ? 129  ASP D OD1 1 
ATOM   8684  O  OD2 . ASP D 1 151 ? 65.976  119.287 79.634  1.00 46.17  ? 129  ASP D OD2 1 
ATOM   8685  N  N   . ALA D 1 152 ? 65.175  114.645 81.609  1.00 38.00  ? 130  ALA D N   1 
ATOM   8686  C  CA  . ALA D 1 152 ? 65.146  113.610 82.639  1.00 37.30  ? 130  ALA D CA  1 
ATOM   8687  C  C   . ALA D 1 152 ? 66.470  112.849 82.697  1.00 33.17  ? 130  ALA D C   1 
ATOM   8688  O  O   . ALA D 1 152 ? 66.829  112.294 83.733  1.00 33.88  ? 130  ALA D O   1 
ATOM   8689  C  CB  . ALA D 1 152 ? 63.988  112.642 82.378  1.00 33.93  ? 130  ALA D CB  1 
ATOM   8690  N  N   . GLU D 1 153 ? 67.188  112.816 81.578  1.00 36.59  ? 131  GLU D N   1 
ATOM   8691  C  CA  . GLU D 1 153 ? 68.483  112.138 81.509  1.00 34.21  ? 131  GLU D CA  1 
ATOM   8692  C  C   . GLU D 1 153 ? 69.531  113.017 82.177  1.00 35.57  ? 131  GLU D C   1 
ATOM   8693  O  O   . GLU D 1 153 ? 70.336  112.559 82.994  1.00 32.60  ? 131  GLU D O   1 
ATOM   8694  C  CB  . GLU D 1 153 ? 68.881  111.897 80.057  1.00 32.50  ? 131  GLU D CB  1 
ATOM   8695  C  CG  . GLU D 1 153 ? 68.024  110.874 79.343  1.00 41.80  ? 131  GLU D CG  1 
ATOM   8696  C  CD  . GLU D 1 153 ? 68.304  110.818 77.845  1.00 45.85  ? 131  GLU D CD  1 
ATOM   8697  O  OE1 . GLU D 1 153 ? 67.824  109.874 77.176  1.00 45.84  ? 131  GLU D OE1 1 
ATOM   8698  O  OE2 . GLU D 1 153 ? 68.997  111.723 77.338  1.00 50.64  ? 131  GLU D OE2 1 
ATOM   8699  N  N   . ARG D 1 154 ? 69.513  114.290 81.806  1.00 36.35  ? 132  ARG D N   1 
ATOM   8700  C  CA  . ARG D 1 154 ? 70.433  115.271 82.355  1.00 38.37  ? 132  ARG D CA  1 
ATOM   8701  C  C   . ARG D 1 154 ? 70.183  115.297 83.860  1.00 36.13  ? 132  ARG D C   1 
ATOM   8702  O  O   . ARG D 1 154 ? 71.106  115.443 84.661  1.00 26.17  ? 132  ARG D O   1 
ATOM   8703  C  CB  . ARG D 1 154 ? 70.121  116.643 81.754  1.00 43.96  ? 132  ARG D CB  1 
ATOM   8704  C  CG  . ARG D 1 154 ? 71.232  117.659 81.872  1.00 54.85  ? 132  ARG D CG  1 
ATOM   8705  C  CD  . ARG D 1 154 ? 70.739  119.056 81.511  1.00 59.51  ? 132  ARG D CD  1 
ATOM   8706  N  NE  . ARG D 1 154 ? 69.697  119.530 82.425  1.00 66.33  ? 132  ARG D NE  1 
ATOM   8707  C  CZ  . ARG D 1 154 ? 68.393  119.289 82.287  1.00 64.96  ? 132  ARG D CZ  1 
ATOM   8708  N  NH1 . ARG D 1 154 ? 67.952  118.579 81.259  1.00 65.76  ? 132  ARG D NH1 1 
ATOM   8709  N  NH2 . ARG D 1 154 ? 67.527  119.746 83.188  1.00 60.68  ? 132  ARG D NH2 1 
ATOM   8710  N  N   . ASP D 1 155 ? 68.909  115.133 84.208  1.00 35.40  ? 133  ASP D N   1 
ATOM   8711  C  CA  . ASP D 1 155 ? 68.405  115.133 85.576  1.00 38.71  ? 133  ASP D CA  1 
ATOM   8712  C  C   . ASP D 1 155 ? 68.922  114.038 86.505  1.00 42.81  ? 133  ASP D C   1 
ATOM   8713  O  O   . ASP D 1 155 ? 68.974  114.239 87.718  1.00 44.01  ? 133  ASP D O   1 
ATOM   8714  C  CB  . ASP D 1 155 ? 66.883  115.051 85.545  1.00 38.95  ? 133  ASP D CB  1 
ATOM   8715  C  CG  . ASP D 1 155 ? 66.234  116.112 86.383  1.00 46.24  ? 133  ASP D CG  1 
ATOM   8716  O  OD1 . ASP D 1 155 ? 65.001  116.285 86.268  1.00 42.00  ? 133  ASP D OD1 1 
ATOM   8717  O  OD2 . ASP D 1 155 ? 66.962  116.774 87.155  1.00 52.40  ? 133  ASP D OD2 1 
ATOM   8718  N  N   . GLY D 1 156 ? 69.293  112.891 85.938  1.00 40.49  ? 134  GLY D N   1 
ATOM   8719  C  CA  . GLY D 1 156 ? 69.771  111.777 86.733  1.00 36.90  ? 134  GLY D CA  1 
ATOM   8720  C  C   . GLY D 1 156 ? 68.599  110.847 86.984  1.00 38.04  ? 134  GLY D C   1 
ATOM   8721  O  O   . GLY D 1 156 ? 68.750  109.727 87.464  1.00 32.36  ? 134  GLY D O   1 
ATOM   8722  N  N   . THR D 1 157 ? 67.416  111.336 86.642  1.00 37.97  ? 135  THR D N   1 
ATOM   8723  C  CA  . THR D 1 157 ? 66.167  110.607 86.794  1.00 36.49  ? 135  THR D CA  1 
ATOM   8724  C  C   . THR D 1 157 ? 66.032  109.385 85.883  1.00 38.37  ? 135  THR D C   1 
ATOM   8725  O  O   . THR D 1 157 ? 65.795  108.269 86.351  1.00 41.58  ? 135  THR D O   1 
ATOM   8726  C  CB  . THR D 1 157 ? 64.989  111.536 86.484  1.00 37.62  ? 135  THR D CB  1 
ATOM   8727  O  OG1 . THR D 1 157 ? 64.974  112.604 87.440  1.00 46.82  ? 135  THR D OG1 1 
ATOM   8728  C  CG2 . THR D 1 157 ? 63.668  110.770 86.512  1.00 37.12  ? 135  THR D CG2 1 
ATOM   8729  N  N   . LEU D 1 158 ? 66.172  109.618 84.578  1.00 34.21  ? 136  LEU D N   1 
ATOM   8730  C  CA  . LEU D 1 158 ? 66.022  108.586 83.559  1.00 28.25  ? 136  LEU D CA  1 
ATOM   8731  C  C   . LEU D 1 158 ? 67.319  107.845 83.217  1.00 29.81  ? 136  LEU D C   1 
ATOM   8732  O  O   . LEU D 1 158 ? 68.210  108.380 82.551  1.00 28.14  ? 136  LEU D O   1 
ATOM   8733  C  CB  . LEU D 1 158 ? 65.431  109.227 82.306  1.00 26.07  ? 136  LEU D CB  1 
ATOM   8734  C  CG  . LEU D 1 158 ? 65.018  108.323 81.151  1.00 25.12  ? 136  LEU D CG  1 
ATOM   8735  C  CD1 . LEU D 1 158 ? 63.929  107.353 81.617  1.00 22.95  ? 136  LEU D CD1 1 
ATOM   8736  C  CD2 . LEU D 1 158 ? 64.517  109.204 80.010  1.00 30.74  ? 136  LEU D CD2 1 
ATOM   8737  N  N   . LYS D 1 159 ? 67.387  106.591 83.658  1.00 26.53  ? 137  LYS D N   1 
ATOM   8738  C  CA  . LYS D 1 159 ? 68.551  105.723 83.478  1.00 18.10  ? 137  LYS D CA  1 
ATOM   8739  C  C   . LYS D 1 159 ? 68.511  104.866 82.223  1.00 24.51  ? 137  LYS D C   1 
ATOM   8740  O  O   . LYS D 1 159 ? 67.430  104.505 81.737  1.00 25.05  ? 137  LYS D O   1 
ATOM   8741  C  CB  . LYS D 1 159 ? 68.678  104.787 84.693  1.00 15.11  ? 137  LYS D CB  1 
ATOM   8742  C  CG  . LYS D 1 159 ? 68.574  105.500 86.044  1.00 18.44  ? 137  LYS D CG  1 
ATOM   8743  C  CD  . LYS D 1 159 ? 68.621  104.539 87.211  1.00 14.00  ? 137  LYS D CD  1 
ATOM   8744  C  CE  . LYS D 1 159 ? 67.389  103.654 87.276  1.00 6.09   ? 137  LYS D CE  1 
ATOM   8745  N  NZ  . LYS D 1 159 ? 66.139  104.448 87.422  1.00 15.68  ? 137  LYS D NZ  1 
ATOM   8746  N  N   . PRO D 1 160 ? 69.694  104.526 81.673  1.00 25.51  ? 138  PRO D N   1 
ATOM   8747  C  CA  . PRO D 1 160 ? 69.701  103.693 80.472  1.00 26.70  ? 138  PRO D CA  1 
ATOM   8748  C  C   . PRO D 1 160 ? 68.840  102.459 80.734  1.00 29.69  ? 138  PRO D C   1 
ATOM   8749  O  O   . PRO D 1 160 ? 68.893  101.875 81.821  1.00 32.69  ? 138  PRO D O   1 
ATOM   8750  C  CB  . PRO D 1 160 ? 71.176  103.350 80.309  1.00 21.07  ? 138  PRO D CB  1 
ATOM   8751  C  CG  . PRO D 1 160 ? 71.839  104.618 80.752  1.00 18.19  ? 138  PRO D CG  1 
ATOM   8752  C  CD  . PRO D 1 160 ? 71.058  104.983 82.001  1.00 21.40  ? 138  PRO D CD  1 
ATOM   8753  N  N   . GLY D 1 161 ? 68.029  102.085 79.749  1.00 31.39  ? 139  GLY D N   1 
ATOM   8754  C  CA  . GLY D 1 161 ? 67.174  100.921 79.897  1.00 33.58  ? 139  GLY D CA  1 
ATOM   8755  C  C   . GLY D 1 161 ? 65.916  101.109 80.725  1.00 34.61  ? 139  GLY D C   1 
ATOM   8756  O  O   . GLY D 1 161 ? 65.166  100.158 80.923  1.00 40.42  ? 139  GLY D O   1 
ATOM   8757  N  N   . ASP D 1 162 ? 65.675  102.316 81.222  1.00 33.20  ? 140  ASP D N   1 
ATOM   8758  C  CA  . ASP D 1 162 ? 64.478  102.557 82.011  1.00 33.83  ? 140  ASP D CA  1 
ATOM   8759  C  C   . ASP D 1 162 ? 63.207  102.492 81.167  1.00 37.69  ? 140  ASP D C   1 
ATOM   8760  O  O   . ASP D 1 162 ? 63.259  102.470 79.934  1.00 40.52  ? 140  ASP D O   1 
ATOM   8761  C  CB  . ASP D 1 162 ? 64.581  103.901 82.726  1.00 30.88  ? 140  ASP D CB  1 
ATOM   8762  C  CG  . ASP D 1 162 ? 65.346  103.798 84.043  1.00 41.22  ? 140  ASP D CG  1 
ATOM   8763  O  OD1 . ASP D 1 162 ? 65.828  102.686 84.370  1.00 38.39  ? 140  ASP D OD1 1 
ATOM   8764  O  OD2 . ASP D 1 162 ? 65.466  104.820 84.756  1.00 37.71  ? 140  ASP D OD2 1 
ATOM   8765  N  N   . THR D 1 163 ? 62.061  102.455 81.833  1.00 33.84  ? 141  THR D N   1 
ATOM   8766  C  CA  . THR D 1 163 ? 60.797  102.380 81.127  1.00 38.28  ? 141  THR D CA  1 
ATOM   8767  C  C   . THR D 1 163 ? 60.021  103.691 81.179  1.00 38.30  ? 141  THR D C   1 
ATOM   8768  O  O   . THR D 1 163 ? 59.950  104.351 82.218  1.00 39.79  ? 141  THR D O   1 
ATOM   8769  C  CB  . THR D 1 163 ? 59.925  101.246 81.701  1.00 40.58  ? 141  THR D CB  1 
ATOM   8770  O  OG1 . THR D 1 163 ? 60.599  99.994  81.525  1.00 47.98  ? 141  THR D OG1 1 
ATOM   8771  C  CG2 . THR D 1 163 ? 58.583  101.186 81.000  1.00 41.68  ? 141  THR D CG2 1 
ATOM   8772  N  N   . ILE D 1 164 ? 59.447  104.070 80.041  1.00 35.76  ? 142  ILE D N   1 
ATOM   8773  C  CA  . ILE D 1 164 ? 58.657  105.289 79.954  1.00 35.15  ? 142  ILE D CA  1 
ATOM   8774  C  C   . ILE D 1 164 ? 57.193  104.925 79.714  1.00 35.70  ? 142  ILE D C   1 
ATOM   8775  O  O   . ILE D 1 164 ? 56.853  104.288 78.723  1.00 40.08  ? 142  ILE D O   1 
ATOM   8776  C  CB  . ILE D 1 164 ? 59.157  106.197 78.812  1.00 33.91  ? 142  ILE D CB  1 
ATOM   8777  C  CG1 . ILE D 1 164 ? 60.626  106.551 79.047  1.00 28.72  ? 142  ILE D CG1 1 
ATOM   8778  C  CG2 . ILE D 1 164 ? 58.310  107.458 78.735  1.00 27.17  ? 142  ILE D CG2 1 
ATOM   8779  C  CD1 . ILE D 1 164 ? 61.270  107.326 77.920  1.00 20.69  ? 142  ILE D CD1 1 
ATOM   8780  N  N   . ILE D 1 165 ? 56.335  105.325 80.643  1.00 37.02  ? 143  ILE D N   1 
ATOM   8781  C  CA  . ILE D 1 165 ? 54.907  105.055 80.561  1.00 36.63  ? 143  ILE D CA  1 
ATOM   8782  C  C   . ILE D 1 165 ? 54.196  106.364 80.260  1.00 39.72  ? 143  ILE D C   1 
ATOM   8783  O  O   . ILE D 1 165 ? 54.439  107.370 80.927  1.00 38.76  ? 143  ILE D O   1 
ATOM   8784  C  CB  . ILE D 1 165 ? 54.363  104.507 81.905  1.00 35.25  ? 143  ILE D CB  1 
ATOM   8785  C  CG1 . ILE D 1 165 ? 54.987  103.144 82.208  1.00 38.14  ? 143  ILE D CG1 1 
ATOM   8786  C  CG2 . ILE D 1 165 ? 52.855  104.400 81.855  1.00 40.16  ? 143  ILE D CG2 1 
ATOM   8787  C  CD1 . ILE D 1 165 ? 54.659  102.616 83.578  1.00 30.37  ? 143  ILE D CD1 1 
ATOM   8788  N  N   . GLU D 1 166 ? 53.334  106.364 79.248  1.00 39.39  ? 144  GLU D N   1 
ATOM   8789  C  CA  . GLU D 1 166 ? 52.598  107.570 78.921  1.00 42.60  ? 144  GLU D CA  1 
ATOM   8790  C  C   . GLU D 1 166 ? 51.139  107.287 78.619  1.00 45.21  ? 144  GLU D C   1 
ATOM   8791  O  O   . GLU D 1 166 ? 50.814  106.467 77.764  1.00 44.76  ? 144  GLU D O   1 
ATOM   8792  C  CB  . GLU D 1 166 ? 53.214  108.298 77.729  1.00 44.14  ? 144  GLU D CB  1 
ATOM   8793  C  CG  . GLU D 1 166 ? 52.580  109.663 77.479  1.00 49.88  ? 144  GLU D CG  1 
ATOM   8794  C  CD  . GLU D 1 166 ? 52.833  110.644 78.623  1.00 60.68  ? 144  GLU D CD  1 
ATOM   8795  O  OE1 . GLU D 1 166 ? 52.217  111.735 78.625  1.00 62.30  ? 144  GLU D OE1 1 
ATOM   8796  O  OE2 . GLU D 1 166 ? 53.654  110.329 79.518  1.00 63.75  ? 144  GLU D OE2 1 
ATOM   8797  N  N   . PRO D 1 167 ? 50.235  107.955 79.348  1.00 48.15  ? 145  PRO D N   1 
ATOM   8798  C  CA  . PRO D 1 167 ? 48.799  107.779 79.144  1.00 48.95  ? 145  PRO D CA  1 
ATOM   8799  C  C   . PRO D 1 167 ? 48.371  108.764 78.077  1.00 49.07  ? 145  PRO D C   1 
ATOM   8800  O  O   . PRO D 1 167 ? 48.130  109.938 78.358  1.00 53.31  ? 145  PRO D O   1 
ATOM   8801  C  CB  . PRO D 1 167 ? 48.218  108.107 80.513  1.00 50.23  ? 145  PRO D CB  1 
ATOM   8802  C  CG  . PRO D 1 167 ? 49.106  109.218 80.968  1.00 50.13  ? 145  PRO D CG  1 
ATOM   8803  C  CD  . PRO D 1 167 ? 50.497  108.740 80.570  1.00 48.20  ? 145  PRO D CD  1 
ATOM   8804  N  N   . THR D 1 168 ? 48.336  108.289 76.840  1.00 49.32  ? 146  THR D N   1 
ATOM   8805  C  CA  . THR D 1 168 ? 47.929  109.125 75.725  1.00 52.12  ? 146  THR D CA  1 
ATOM   8806  C  C   . THR D 1 168 ? 48.020  108.354 74.415  1.00 53.07  ? 146  THR D C   1 
ATOM   8807  O  O   . THR D 1 168 ? 48.985  107.629 74.162  1.00 52.37  ? 146  THR D O   1 
ATOM   8808  C  CB  . THR D 1 168 ? 48.800  110.394 75.628  1.00 51.72  ? 146  THR D CB  1 
ATOM   8809  O  OG1 . THR D 1 168 ? 48.105  111.384 74.860  1.00 54.08  ? 146  THR D OG1 1 
ATOM   8810  C  CG2 . THR D 1 168 ? 50.141  110.080 74.961  1.00 49.85  ? 146  THR D CG2 1 
ATOM   8811  N  N   . SER D 1 169 ? 47.001  108.510 73.585  1.00 56.58  ? 147  SER D N   1 
ATOM   8812  C  CA  . SER D 1 169 ? 46.965  107.836 72.295  1.00 59.12  ? 147  SER D CA  1 
ATOM   8813  C  C   . SER D 1 169 ? 47.343  108.833 71.203  1.00 54.50  ? 147  SER D C   1 
ATOM   8814  O  O   . SER D 1 169 ? 47.297  108.519 70.015  1.00 56.35  ? 147  SER D O   1 
ATOM   8815  C  CB  . SER D 1 169 ? 45.561  107.297 72.041  1.00 61.76  ? 147  SER D CB  1 
ATOM   8816  O  OG  . SER D 1 169 ? 44.592  108.323 72.200  1.00 65.06  ? 147  SER D OG  1 
ATOM   8817  N  N   . GLY D 1 170 ? 47.719  110.035 71.628  1.00 49.93  ? 148  GLY D N   1 
ATOM   8818  C  CA  . GLY D 1 170 ? 48.092  111.079 70.694  1.00 45.82  ? 148  GLY D CA  1 
ATOM   8819  C  C   . GLY D 1 170 ? 49.511  111.039 70.138  1.00 41.73  ? 148  GLY D C   1 
ATOM   8820  O  O   . GLY D 1 170 ? 50.190  109.998 70.150  1.00 32.99  ? 148  GLY D O   1 
ATOM   8821  N  N   . ASN D 1 171 ? 49.957  112.203 69.662  1.00 38.54  ? 149  ASN D N   1 
ATOM   8822  C  CA  . ASN D 1 171 ? 51.282  112.336 69.076  1.00 29.54  ? 149  ASN D CA  1 
ATOM   8823  C  C   . ASN D 1 171 ? 52.430  112.269 70.071  1.00 30.37  ? 149  ASN D C   1 
ATOM   8824  O  O   . ASN D 1 171 ? 53.559  111.931 69.692  1.00 28.91  ? 149  ASN D O   1 
ATOM   8825  C  CB  . ASN D 1 171 ? 51.372  113.622 68.267  1.00 13.72  ? 149  ASN D CB  1 
ATOM   8826  C  CG  . ASN D 1 171 ? 50.543  113.566 67.014  1.00 18.61  ? 149  ASN D CG  1 
ATOM   8827  O  OD1 . ASN D 1 171 ? 50.643  112.614 66.231  1.00 14.45  ? 149  ASN D OD1 1 
ATOM   8828  N  ND2 . ASN D 1 171 ? 49.722  114.587 66.801  1.00 19.14  ? 149  ASN D ND2 1 
ATOM   8829  N  N   . THR D 1 172 ? 52.161  112.588 71.335  1.00 28.89  ? 150  THR D N   1 
ATOM   8830  C  CA  . THR D 1 172 ? 53.221  112.515 72.322  1.00 28.92  ? 150  THR D CA  1 
ATOM   8831  C  C   . THR D 1 172 ? 53.551  111.038 72.526  1.00 26.86  ? 150  THR D C   1 
ATOM   8832  O  O   . THR D 1 172 ? 54.689  110.669 72.832  1.00 31.30  ? 150  THR D O   1 
ATOM   8833  C  CB  . THR D 1 172 ? 52.803  113.174 73.653  1.00 33.99  ? 150  THR D CB  1 
ATOM   8834  O  OG1 . THR D 1 172 ? 52.662  114.592 73.459  1.00 30.35  ? 150  THR D OG1 1 
ATOM   8835  C  CG2 . THR D 1 172 ? 53.853  112.907 74.735  1.00 26.31  ? 150  THR D CG2 1 
ATOM   8836  N  N   . GLY D 1 173 ? 52.545  110.192 72.327  1.00 29.30  ? 151  GLY D N   1 
ATOM   8837  C  CA  . GLY D 1 173 ? 52.739  108.757 72.455  1.00 26.39  ? 151  GLY D CA  1 
ATOM   8838  C  C   . GLY D 1 173 ? 53.671  108.267 71.361  1.00 24.30  ? 151  GLY D C   1 
ATOM   8839  O  O   . GLY D 1 173 ? 54.613  107.510 71.614  1.00 23.26  ? 151  GLY D O   1 
ATOM   8840  N  N   . ILE D 1 174 ? 53.410  108.708 70.135  1.00 24.37  ? 152  ILE D N   1 
ATOM   8841  C  CA  . ILE D 1 174 ? 54.237  108.330 68.996  1.00 25.82  ? 152  ILE D CA  1 
ATOM   8842  C  C   . ILE D 1 174 ? 55.645  108.896 69.169  1.00 26.14  ? 152  ILE D C   1 
ATOM   8843  O  O   . ILE D 1 174 ? 56.637  108.197 68.944  1.00 24.68  ? 152  ILE D O   1 
ATOM   8844  C  CB  . ILE D 1 174 ? 53.616  108.849 67.666  1.00 27.91  ? 152  ILE D CB  1 
ATOM   8845  C  CG1 . ILE D 1 174 ? 52.258  108.181 67.446  1.00 34.96  ? 152  ILE D CG1 1 
ATOM   8846  C  CG2 . ILE D 1 174 ? 54.538  108.545 66.490  1.00 24.35  ? 152  ILE D CG2 1 
ATOM   8847  C  CD1 . ILE D 1 174 ? 51.438  108.781 66.322  1.00 41.45  ? 152  ILE D CD1 1 
ATOM   8848  N  N   . GLY D 1 175 ? 55.723  110.163 69.578  1.00 28.02  ? 153  GLY D N   1 
ATOM   8849  C  CA  . GLY D 1 175 ? 57.011  110.807 69.787  1.00 23.51  ? 153  GLY D CA  1 
ATOM   8850  C  C   . GLY D 1 175 ? 57.892  110.082 70.793  1.00 26.18  ? 153  GLY D C   1 
ATOM   8851  O  O   . GLY D 1 175 ? 59.074  109.844 70.537  1.00 27.76  ? 153  GLY D O   1 
ATOM   8852  N  N   . LEU D 1 176 ? 57.323  109.737 71.945  1.00 22.61  ? 154  LEU D N   1 
ATOM   8853  C  CA  . LEU D 1 176 ? 58.070  109.024 72.977  1.00 20.29  ? 154  LEU D CA  1 
ATOM   8854  C  C   . LEU D 1 176 ? 58.488  107.651 72.483  1.00 23.94  ? 154  LEU D C   1 
ATOM   8855  O  O   . LEU D 1 176 ? 59.615  107.212 72.726  1.00 23.27  ? 154  LEU D O   1 
ATOM   8856  C  CB  . LEU D 1 176 ? 57.221  108.876 74.237  1.00 18.64  ? 154  LEU D CB  1 
ATOM   8857  C  CG  . LEU D 1 176 ? 56.919  110.183 74.976  1.00 28.32  ? 154  LEU D CG  1 
ATOM   8858  C  CD1 . LEU D 1 176 ? 55.737  109.989 75.923  1.00 27.50  ? 154  LEU D CD1 1 
ATOM   8859  C  CD2 . LEU D 1 176 ? 58.176  110.640 75.725  1.00 22.23  ? 154  LEU D CD2 1 
ATOM   8860  N  N   . ALA D 1 177 ? 57.574  106.972 71.791  1.00 25.96  ? 155  ALA D N   1 
ATOM   8861  C  CA  . ALA D 1 177 ? 57.859  105.643 71.264  1.00 25.37  ? 155  ALA D CA  1 
ATOM   8862  C  C   . ALA D 1 177 ? 59.074  105.697 70.339  1.00 25.86  ? 155  ALA D C   1 
ATOM   8863  O  O   . ALA D 1 177 ? 60.009  104.910 70.490  1.00 22.73  ? 155  ALA D O   1 
ATOM   8864  C  CB  . ALA D 1 177 ? 56.644  105.105 70.526  1.00 23.61  ? 155  ALA D CB  1 
ATOM   8865  N  N   . LEU D 1 178 ? 59.059  106.640 69.396  1.00 31.74  ? 156  LEU D N   1 
ATOM   8866  C  CA  . LEU D 1 178 ? 60.155  106.814 68.442  1.00 30.75  ? 156  LEU D CA  1 
ATOM   8867  C  C   . LEU D 1 178 ? 61.481  107.055 69.161  1.00 30.75  ? 156  LEU D C   1 
ATOM   8868  O  O   . LEU D 1 178 ? 62.448  106.319 68.960  1.00 31.35  ? 156  LEU D O   1 
ATOM   8869  C  CB  . LEU D 1 178 ? 59.842  107.982 67.494  1.00 28.47  ? 156  LEU D CB  1 
ATOM   8870  C  CG  . LEU D 1 178 ? 60.947  108.581 66.605  1.00 32.72  ? 156  LEU D CG  1 
ATOM   8871  C  CD1 . LEU D 1 178 ? 61.718  107.498 65.879  1.00 36.39  ? 156  LEU D CD1 1 
ATOM   8872  C  CD2 . LEU D 1 178 ? 60.315  109.537 65.601  1.00 26.38  ? 156  LEU D CD2 1 
ATOM   8873  N  N   . ALA D 1 179 ? 61.515  108.082 70.003  1.00 26.23  ? 157  ALA D N   1 
ATOM   8874  C  CA  . ALA D 1 179 ? 62.724  108.415 70.746  1.00 27.57  ? 157  ALA D CA  1 
ATOM   8875  C  C   . ALA D 1 179 ? 63.142  107.270 71.668  1.00 27.51  ? 157  ALA D C   1 
ATOM   8876  O  O   . ALA D 1 179 ? 64.329  107.074 71.931  1.00 21.72  ? 157  ALA D O   1 
ATOM   8877  C  CB  . ALA D 1 179 ? 62.509  109.686 71.558  1.00 27.66  ? 157  ALA D CB  1 
ATOM   8878  N  N   . ALA D 1 180 ? 62.166  106.511 72.156  1.00 32.96  ? 158  ALA D N   1 
ATOM   8879  C  CA  . ALA D 1 180 ? 62.461  105.392 73.044  1.00 31.12  ? 158  ALA D CA  1 
ATOM   8880  C  C   . ALA D 1 180 ? 63.234  104.308 72.304  1.00 33.63  ? 158  ALA D C   1 
ATOM   8881  O  O   . ALA D 1 180 ? 64.248  103.813 72.802  1.00 27.98  ? 158  ALA D O   1 
ATOM   8882  C  CB  . ALA D 1 180 ? 61.166  104.816 73.616  1.00 33.14  ? 158  ALA D CB  1 
ATOM   8883  N  N   . ALA D 1 181 ? 62.758  103.948 71.113  1.00 32.00  ? 159  ALA D N   1 
ATOM   8884  C  CA  . ALA D 1 181 ? 63.403  102.908 70.326  1.00 30.55  ? 159  ALA D CA  1 
ATOM   8885  C  C   . ALA D 1 181 ? 64.817  103.293 69.917  1.00 33.22  ? 159  ALA D C   1 
ATOM   8886  O  O   . ALA D 1 181 ? 65.680  102.428 69.776  1.00 29.29  ? 159  ALA D O   1 
ATOM   8887  C  CB  . ALA D 1 181 ? 62.568  102.589 69.090  1.00 29.23  ? 159  ALA D CB  1 
ATOM   8888  N  N   . VAL D 1 182 ? 65.066  104.584 69.721  1.00 36.22  ? 160  VAL D N   1 
ATOM   8889  C  CA  . VAL D 1 182 ? 66.405  105.008 69.327  1.00 34.46  ? 160  VAL D CA  1 
ATOM   8890  C  C   . VAL D 1 182 ? 67.361  104.978 70.512  1.00 36.96  ? 160  VAL D C   1 
ATOM   8891  O  O   . VAL D 1 182 ? 68.468  104.457 70.399  1.00 38.66  ? 160  VAL D O   1 
ATOM   8892  C  CB  . VAL D 1 182 ? 66.423  106.434 68.732  1.00 35.15  ? 160  VAL D CB  1 
ATOM   8893  C  CG1 . VAL D 1 182 ? 67.822  106.770 68.273  1.00 34.89  ? 160  VAL D CG1 1 
ATOM   8894  C  CG2 . VAL D 1 182 ? 65.475  106.528 67.570  1.00 27.21  ? 160  VAL D CG2 1 
ATOM   8895  N  N   . ARG D 1 183 ? 66.918  105.509 71.651  1.00 33.08  ? 161  ARG D N   1 
ATOM   8896  C  CA  . ARG D 1 183 ? 67.751  105.572 72.855  1.00 36.43  ? 161  ARG D CA  1 
ATOM   8897  C  C   . ARG D 1 183 ? 67.829  104.312 73.718  1.00 36.24  ? 161  ARG D C   1 
ATOM   8898  O  O   . ARG D 1 183 ? 68.650  104.234 74.624  1.00 38.19  ? 161  ARG D O   1 
ATOM   8899  C  CB  . ARG D 1 183 ? 67.291  106.735 73.731  1.00 42.30  ? 161  ARG D CB  1 
ATOM   8900  C  CG  . ARG D 1 183 ? 66.984  108.002 72.944  1.00 51.62  ? 161  ARG D CG  1 
ATOM   8901  C  CD  . ARG D 1 183 ? 68.232  108.758 72.505  1.00 50.38  ? 161  ARG D CD  1 
ATOM   8902  N  NE  . ARG D 1 183 ? 68.474  109.911 73.367  1.00 50.07  ? 161  ARG D NE  1 
ATOM   8903  C  CZ  . ARG D 1 183 ? 69.019  111.049 72.951  1.00 51.14  ? 161  ARG D CZ  1 
ATOM   8904  N  NH1 . ARG D 1 183 ? 69.383  111.193 71.678  1.00 48.90  ? 161  ARG D NH1 1 
ATOM   8905  N  NH2 . ARG D 1 183 ? 69.194  112.044 73.810  1.00 48.47  ? 161  ARG D NH2 1 
ATOM   8906  N  N   . GLY D 1 184 ? 66.974  103.333 73.464  1.00 37.36  ? 162  GLY D N   1 
ATOM   8907  C  CA  . GLY D 1 184 ? 67.027  102.123 74.261  1.00 35.61  ? 162  GLY D CA  1 
ATOM   8908  C  C   . GLY D 1 184 ? 66.176  102.123 75.519  1.00 37.70  ? 162  GLY D C   1 
ATOM   8909  O  O   . GLY D 1 184 ? 66.568  101.543 76.525  1.00 37.83  ? 162  GLY D O   1 
ATOM   8910  N  N   . TYR D 1 185 ? 65.020  102.780 75.466  1.00 37.41  ? 163  TYR D N   1 
ATOM   8911  C  CA  . TYR D 1 185 ? 64.094  102.816 76.590  1.00 34.65  ? 163  TYR D CA  1 
ATOM   8912  C  C   . TYR D 1 185 ? 62.884  101.963 76.253  1.00 38.99  ? 163  TYR D C   1 
ATOM   8913  O  O   . TYR D 1 185 ? 62.493  101.855 75.090  1.00 41.08  ? 163  TYR D O   1 
ATOM   8914  C  CB  . TYR D 1 185 ? 63.598  104.234 76.861  1.00 31.75  ? 163  TYR D CB  1 
ATOM   8915  C  CG  . TYR D 1 185 ? 64.666  105.167 77.336  1.00 36.53  ? 163  TYR D CG  1 
ATOM   8916  C  CD1 . TYR D 1 185 ? 64.987  106.314 76.611  1.00 37.50  ? 163  TYR D CD1 1 
ATOM   8917  C  CD2 . TYR D 1 185 ? 65.385  104.892 78.496  1.00 38.87  ? 163  TYR D CD2 1 
ATOM   8918  C  CE1 . TYR D 1 185 ? 66.006  107.166 77.028  1.00 40.65  ? 163  TYR D CE1 1 
ATOM   8919  C  CE2 . TYR D 1 185 ? 66.407  105.737 78.923  1.00 45.81  ? 163  TYR D CE2 1 
ATOM   8920  C  CZ  . TYR D 1 185 ? 66.712  106.871 78.182  1.00 43.69  ? 163  TYR D CZ  1 
ATOM   8921  O  OH  . TYR D 1 185 ? 67.733  107.690 78.592  1.00 39.74  ? 163  TYR D OH  1 
ATOM   8922  N  N   . ARG D 1 186 ? 62.292  101.352 77.271  1.00 38.91  ? 164  ARG D N   1 
ATOM   8923  C  CA  . ARG D 1 186 ? 61.105  100.553 77.058  1.00 36.87  ? 164  ARG D CA  1 
ATOM   8924  C  C   . ARG D 1 186 ? 59.986  101.583 77.053  1.00 34.23  ? 164  ARG D C   1 
ATOM   8925  O  O   . ARG D 1 186 ? 60.029  102.557 77.816  1.00 30.96  ? 164  ARG D O   1 
ATOM   8926  C  CB  . ARG D 1 186 ? 60.915  99.569  78.206  1.00 43.11  ? 164  ARG D CB  1 
ATOM   8927  C  CG  . ARG D 1 186 ? 59.716  98.660  78.049  1.00 44.65  ? 164  ARG D CG  1 
ATOM   8928  C  CD  . ARG D 1 186 ? 59.406  97.984  79.362  1.00 50.10  ? 164  ARG D CD  1 
ATOM   8929  N  NE  . ARG D 1 186 ? 58.282  97.059  79.266  1.00 56.09  ? 164  ARG D NE  1 
ATOM   8930  C  CZ  . ARG D 1 186 ? 57.659  96.539  80.318  1.00 56.58  ? 164  ARG D CZ  1 
ATOM   8931  N  NH1 . ARG D 1 186 ? 58.049  96.856  81.545  1.00 58.27  ? 164  ARG D NH1 1 
ATOM   8932  N  NH2 . ARG D 1 186 ? 56.651  95.698  80.147  1.00 58.24  ? 164  ARG D NH2 1 
ATOM   8933  N  N   . CYS D 1 187 ? 58.996  101.386 76.189  1.00 33.48  ? 165  CYS D N   1 
ATOM   8934  C  CA  . CYS D 1 187 ? 57.888  102.329 76.104  1.00 32.69  ? 165  CYS D CA  1 
ATOM   8935  C  C   . CYS D 1 187 ? 56.531  101.653 76.235  1.00 31.56  ? 165  CYS D C   1 
ATOM   8936  O  O   . CYS D 1 187 ? 56.244  100.675 75.556  1.00 36.51  ? 165  CYS D O   1 
ATOM   8937  C  CB  . CYS D 1 187 ? 57.962  103.090 74.779  1.00 28.69  ? 165  CYS D CB  1 
ATOM   8938  S  SG  . CYS D 1 187 ? 56.851  104.492 74.662  1.00 34.43  ? 165  CYS D SG  1 
ATOM   8939  N  N   . ILE D 1 188 ? 55.695  102.186 77.115  1.00 34.63  ? 166  ILE D N   1 
ATOM   8940  C  CA  . ILE D 1 188 ? 54.364  101.642 77.334  1.00 32.66  ? 166  ILE D CA  1 
ATOM   8941  C  C   . ILE D 1 188 ? 53.352  102.769 77.241  1.00 38.93  ? 166  ILE D C   1 
ATOM   8942  O  O   . ILE D 1 188 ? 53.356  103.684 78.062  1.00 43.93  ? 166  ILE D O   1 
ATOM   8943  C  CB  . ILE D 1 188 ? 54.238  101.013 78.729  1.00 33.97  ? 166  ILE D CB  1 
ATOM   8944  C  CG1 . ILE D 1 188 ? 55.224  99.853  78.874  1.00 33.07  ? 166  ILE D CG1 1 
ATOM   8945  C  CG2 . ILE D 1 188 ? 52.806  100.537 78.956  1.00 27.00  ? 166  ILE D CG2 1 
ATOM   8946  C  CD1 . ILE D 1 188 ? 55.334  99.331  80.289  1.00 35.94  ? 166  ILE D CD1 1 
ATOM   8947  N  N   . ILE D 1 189 ? 52.500  102.716 76.227  1.00 42.92  ? 167  ILE D N   1 
ATOM   8948  C  CA  . ILE D 1 189 ? 51.472  103.733 76.069  1.00 49.74  ? 167  ILE D CA  1 
ATOM   8949  C  C   . ILE D 1 189 ? 50.159  103.164 76.609  1.00 53.89  ? 167  ILE D C   1 
ATOM   8950  O  O   . ILE D 1 189 ? 49.851  101.982 76.419  1.00 52.59  ? 167  ILE D O   1 
ATOM   8951  C  CB  . ILE D 1 189 ? 51.298  104.149 74.573  1.00 49.91  ? 167  ILE D CB  1 
ATOM   8952  C  CG1 . ILE D 1 189 ? 52.310  105.237 74.209  1.00 46.81  ? 167  ILE D CG1 1 
ATOM   8953  C  CG2 . ILE D 1 189 ? 49.895  104.683 74.321  1.00 45.37  ? 167  ILE D CG2 1 
ATOM   8954  C  CD1 . ILE D 1 189 ? 53.724  104.785 74.267  1.00 46.30  ? 167  ILE D CD1 1 
ATOM   8955  N  N   . VAL D 1 190 ? 49.399  104.005 77.302  1.00 54.10  ? 168  VAL D N   1 
ATOM   8956  C  CA  . VAL D 1 190 ? 48.118  103.594 77.859  1.00 53.74  ? 168  VAL D CA  1 
ATOM   8957  C  C   . VAL D 1 190 ? 47.040  104.494 77.262  1.00 57.25  ? 168  VAL D C   1 
ATOM   8958  O  O   . VAL D 1 190 ? 47.046  105.710 77.461  1.00 53.26  ? 168  VAL D O   1 
ATOM   8959  C  CB  . VAL D 1 190 ? 48.120  103.707 79.405  1.00 50.24  ? 168  VAL D CB  1 
ATOM   8960  C  CG1 . VAL D 1 190 ? 46.786  103.251 79.962  1.00 52.82  ? 168  VAL D CG1 1 
ATOM   8961  C  CG2 . VAL D 1 190 ? 49.242  102.857 79.986  1.00 34.74  ? 168  VAL D CG2 1 
ATOM   8962  N  N   . MET D 1 191 ? 46.121  103.881 76.522  1.00 66.19  ? 169  MET D N   1 
ATOM   8963  C  CA  . MET D 1 191 ? 45.049  104.608 75.855  1.00 73.11  ? 169  MET D CA  1 
ATOM   8964  C  C   . MET D 1 191 ? 43.720  103.869 75.987  1.00 77.26  ? 169  MET D C   1 
ATOM   8965  O  O   . MET D 1 191 ? 43.691  102.691 76.342  1.00 77.88  ? 169  MET D O   1 
ATOM   8966  C  CB  . MET D 1 191 ? 45.390  104.743 74.374  1.00 76.96  ? 169  MET D CB  1 
ATOM   8967  C  CG  . MET D 1 191 ? 45.466  103.395 73.674  1.00 83.43  ? 169  MET D CG  1 
ATOM   8968  S  SD  . MET D 1 191 ? 45.997  103.496 71.973  1.00 93.32  ? 169  MET D SD  1 
ATOM   8969  C  CE  . MET D 1 191 ? 47.718  103.050 72.132  1.00 89.03  ? 169  MET D CE  1 
ATOM   8970  N  N   . PRO D 1 192 ? 42.602  104.557 75.698  1.00 80.56  ? 170  PRO D N   1 
ATOM   8971  C  CA  . PRO D 1 192 ? 41.261  103.965 75.776  1.00 83.00  ? 170  PRO D CA  1 
ATOM   8972  C  C   . PRO D 1 192 ? 41.160  102.677 74.948  1.00 84.88  ? 170  PRO D C   1 
ATOM   8973  O  O   . PRO D 1 192 ? 42.176  102.135 74.509  1.00 84.58  ? 170  PRO D O   1 
ATOM   8974  C  CB  . PRO D 1 192 ? 40.370  105.078 75.236  1.00 83.40  ? 170  PRO D CB  1 
ATOM   8975  C  CG  . PRO D 1 192 ? 41.065  106.306 75.735  1.00 81.90  ? 170  PRO D CG  1 
ATOM   8976  C  CD  . PRO D 1 192 ? 42.516  106.005 75.428  1.00 80.64  ? 170  PRO D CD  1 
ATOM   8977  N  N   . GLU D 1 193 ? 39.943  102.189 74.726  1.00 87.57  ? 171  GLU D N   1 
ATOM   8978  C  CA  . GLU D 1 193 ? 39.766  100.958 73.957  1.00 90.94  ? 171  GLU D CA  1 
ATOM   8979  C  C   . GLU D 1 193 ? 39.438  101.191 72.480  1.00 91.94  ? 171  GLU D C   1 
ATOM   8980  O  O   . GLU D 1 193 ? 39.292  100.239 71.707  1.00 94.93  ? 171  GLU D O   1 
ATOM   8981  C  CB  . GLU D 1 193 ? 38.686  100.074 74.602  1.00 91.30  ? 171  GLU D CB  1 
ATOM   8982  C  CG  . GLU D 1 193 ? 37.291  100.682 74.667  1.00 90.49  ? 171  GLU D CG  1 
ATOM   8983  C  CD  . GLU D 1 193 ? 36.303  99.788  75.402  1.00 92.17  ? 171  GLU D CD  1 
ATOM   8984  O  OE1 . GLU D 1 193 ? 36.159  98.608  75.017  1.00 94.72  ? 171  GLU D OE1 1 
ATOM   8985  O  OE2 . GLU D 1 193 ? 35.667  100.264 76.364  1.00 92.22  ? 171  GLU D OE2 1 
ATOM   8986  N  N   . LYS D 1 194 ? 39.334  102.459 72.086  1.00 89.42  ? 172  LYS D N   1 
ATOM   8987  C  CA  . LYS D 1 194 ? 39.033  102.806 70.697  1.00 88.58  ? 172  LYS D CA  1 
ATOM   8988  C  C   . LYS D 1 194 ? 40.330  103.067 69.933  1.00 88.00  ? 172  LYS D C   1 
ATOM   8989  O  O   . LYS D 1 194 ? 41.070  102.136 69.586  1.00 88.72  ? 172  LYS D O   1 
ATOM   8990  C  CB  . LYS D 1 194 ? 38.147  104.053 70.634  1.00 87.71  ? 172  LYS D CB  1 
ATOM   8991  C  CG  . LYS D 1 194 ? 36.851  103.981 71.441  1.00 86.77  ? 172  LYS D CG  1 
ATOM   8992  C  CD  . LYS D 1 194 ? 37.103  104.098 72.941  1.00 82.84  ? 172  LYS D CD  1 
ATOM   8993  C  CE  . LYS D 1 194 ? 35.795  104.063 73.720  1.00 78.02  ? 172  LYS D CE  1 
ATOM   8994  N  NZ  . LYS D 1 194 ? 36.003  104.186 75.192  1.00 77.25  ? 172  LYS D NZ  1 
ATOM   8995  N  N   . MET D 1 195 ? 40.591  104.342 69.670  1.00 86.53  ? 173  MET D N   1 
ATOM   8996  C  CA  . MET D 1 195 ? 41.788  104.789 68.967  1.00 84.52  ? 173  MET D CA  1 
ATOM   8997  C  C   . MET D 1 195 ? 42.088  104.247 67.581  1.00 82.68  ? 173  MET D C   1 
ATOM   8998  O  O   . MET D 1 195 ? 42.088  103.042 67.338  1.00 82.16  ? 173  MET D O   1 
ATOM   8999  C  CB  . MET D 1 195 ? 43.009  104.614 69.866  1.00 84.31  ? 173  MET D CB  1 
ATOM   9000  C  CG  . MET D 1 195 ? 43.395  105.905 70.530  1.00 85.54  ? 173  MET D CG  1 
ATOM   9001  S  SD  . MET D 1 195 ? 41.956  106.968 70.834  1.00 91.36  ? 173  MET D SD  1 
ATOM   9002  C  CE  . MET D 1 195 ? 41.835  107.884 69.242  1.00 86.02  ? 173  MET D CE  1 
ATOM   9003  N  N   . SER D 1 196 ? 42.361  105.191 66.685  1.00 80.34  ? 174  SER D N   1 
ATOM   9004  C  CA  . SER D 1 196 ? 42.667  104.932 65.282  1.00 76.68  ? 174  SER D CA  1 
ATOM   9005  C  C   . SER D 1 196 ? 43.775  103.908 65.064  1.00 74.32  ? 174  SER D C   1 
ATOM   9006  O  O   . SER D 1 196 ? 44.689  103.786 65.875  1.00 75.34  ? 174  SER D O   1 
ATOM   9007  C  CB  . SER D 1 196 ? 43.058  106.247 64.612  1.00 79.29  ? 174  SER D CB  1 
ATOM   9008  O  OG  . SER D 1 196 ? 42.233  107.312 65.071  1.00 78.66  ? 174  SER D OG  1 
ATOM   9009  N  N   . SER D 1 197 ? 43.686  103.178 63.957  1.00 72.93  ? 175  SER D N   1 
ATOM   9010  C  CA  . SER D 1 197 ? 44.689  102.175 63.616  1.00 71.47  ? 175  SER D CA  1 
ATOM   9011  C  C   . SER D 1 197 ? 45.951  102.877 63.131  1.00 69.89  ? 175  SER D C   1 
ATOM   9012  O  O   . SER D 1 197 ? 47.065  102.387 63.337  1.00 64.70  ? 175  SER D O   1 
ATOM   9013  C  CB  . SER D 1 197 ? 44.165  101.241 62.518  1.00 69.23  ? 175  SER D CB  1 
ATOM   9014  O  OG  . SER D 1 197 ? 43.062  100.484 62.977  1.00 66.19  ? 175  SER D OG  1 
ATOM   9015  N  N   . GLU D 1 198 ? 45.763  104.022 62.477  1.00 69.65  ? 176  GLU D N   1 
ATOM   9016  C  CA  . GLU D 1 198 ? 46.885  104.812 61.973  1.00 69.72  ? 176  GLU D CA  1 
ATOM   9017  C  C   . GLU D 1 198 ? 47.893  105.011 63.094  1.00 66.03  ? 176  GLU D C   1 
ATOM   9018  O  O   . GLU D 1 198 ? 49.103  104.905 62.891  1.00 61.48  ? 176  GLU D O   1 
ATOM   9019  C  CB  . GLU D 1 198 ? 46.408  106.187 61.493  1.00 71.37  ? 176  GLU D CB  1 
ATOM   9020  C  CG  . GLU D 1 198 ? 46.165  106.306 59.996  1.00 76.44  ? 176  GLU D CG  1 
ATOM   9021  C  CD  . GLU D 1 198 ? 45.122  105.340 59.491  1.00 77.63  ? 176  GLU D CD  1 
ATOM   9022  O  OE1 . GLU D 1 198 ? 45.485  104.190 59.161  1.00 77.51  ? 176  GLU D OE1 1 
ATOM   9023  O  OE2 . GLU D 1 198 ? 43.935  105.733 59.436  1.00 80.29  ? 176  GLU D OE2 1 
ATOM   9024  N  N   . LYS D 1 199 ? 47.372  105.295 64.284  1.00 64.99  ? 177  LYS D N   1 
ATOM   9025  C  CA  . LYS D 1 199 ? 48.201  105.523 65.455  1.00 59.01  ? 177  LYS D CA  1 
ATOM   9026  C  C   . LYS D 1 199 ? 48.655  104.247 66.164  1.00 56.69  ? 177  LYS D C   1 
ATOM   9027  O  O   . LYS D 1 199 ? 49.811  104.146 66.575  1.00 61.08  ? 177  LYS D O   1 
ATOM   9028  C  CB  . LYS D 1 199 ? 47.463  106.442 66.428  1.00 60.91  ? 177  LYS D CB  1 
ATOM   9029  C  CG  . LYS D 1 199 ? 47.238  107.845 65.868  1.00 63.61  ? 177  LYS D CG  1 
ATOM   9030  C  CD  . LYS D 1 199 ? 46.417  108.718 66.805  1.00 59.84  ? 177  LYS D CD  1 
ATOM   9031  C  CE  . LYS D 1 199 ? 44.994  108.203 66.933  1.00 61.64  ? 177  LYS D CE  1 
ATOM   9032  N  NZ  . LYS D 1 199 ? 44.159  109.068 67.807  1.00 63.88  ? 177  LYS D NZ  1 
ATOM   9033  N  N   . VAL D 1 200 ? 47.774  103.262 66.298  1.00 51.14  ? 178  VAL D N   1 
ATOM   9034  C  CA  . VAL D 1 200 ? 48.161  102.031 66.979  1.00 48.54  ? 178  VAL D CA  1 
ATOM   9035  C  C   . VAL D 1 200 ? 49.240  101.249 66.241  1.00 48.51  ? 178  VAL D C   1 
ATOM   9036  O  O   . VAL D 1 200 ? 50.187  100.768 66.862  1.00 45.61  ? 178  VAL D O   1 
ATOM   9037  C  CB  . VAL D 1 200 ? 46.948  101.096 67.226  1.00 48.52  ? 178  VAL D CB  1 
ATOM   9038  C  CG1 . VAL D 1 200 ? 47.432  99.720  67.667  1.00 48.37  ? 178  VAL D CG1 1 
ATOM   9039  C  CG2 . VAL D 1 200 ? 46.049  101.683 68.304  1.00 41.53  ? 178  VAL D CG2 1 
ATOM   9040  N  N   . ASP D 1 201 ? 49.107  101.117 64.924  1.00 51.28  ? 179  ASP D N   1 
ATOM   9041  C  CA  . ASP D 1 201 ? 50.099  100.368 64.154  1.00 52.46  ? 179  ASP D CA  1 
ATOM   9042  C  C   . ASP D 1 201 ? 51.453  101.069 64.093  1.00 49.32  ? 179  ASP D C   1 
ATOM   9043  O  O   . ASP D 1 201 ? 52.490  100.411 64.019  1.00 49.06  ? 179  ASP D O   1 
ATOM   9044  C  CB  . ASP D 1 201 ? 49.574  100.073 62.750  1.00 56.89  ? 179  ASP D CB  1 
ATOM   9045  C  CG  . ASP D 1 201 ? 48.462  99.039  62.755  1.00 59.58  ? 179  ASP D CG  1 
ATOM   9046  O  OD1 . ASP D 1 201 ? 48.698  97.908  63.239  1.00 58.31  ? 179  ASP D OD1 1 
ATOM   9047  O  OD2 . ASP D 1 201 ? 47.353  99.359  62.277  1.00 62.84  ? 179  ASP D OD2 1 
ATOM   9048  N  N   . VAL D 1 202 ? 51.451  102.398 64.132  1.00 45.50  ? 180  VAL D N   1 
ATOM   9049  C  CA  . VAL D 1 202 ? 52.709  103.126 64.127  1.00 41.88  ? 180  VAL D CA  1 
ATOM   9050  C  C   . VAL D 1 202 ? 53.393  102.891 65.483  1.00 42.86  ? 180  VAL D C   1 
ATOM   9051  O  O   . VAL D 1 202 ? 54.608  102.680 65.544  1.00 44.29  ? 180  VAL D O   1 
ATOM   9052  C  CB  . VAL D 1 202 ? 52.493  104.652 63.891  1.00 43.18  ? 180  VAL D CB  1 
ATOM   9053  C  CG1 . VAL D 1 202 ? 53.774  105.426 64.193  1.00 34.75  ? 180  VAL D CG1 1 
ATOM   9054  C  CG2 . VAL D 1 202 ? 52.092  104.898 62.438  1.00 37.22  ? 180  VAL D CG2 1 
ATOM   9055  N  N   . LEU D 1 203 ? 52.611  102.909 66.563  1.00 37.50  ? 181  LEU D N   1 
ATOM   9056  C  CA  . LEU D 1 203 ? 53.159  102.692 67.906  1.00 36.63  ? 181  LEU D CA  1 
ATOM   9057  C  C   . LEU D 1 203 ? 53.769  101.309 68.029  1.00 37.46  ? 181  LEU D C   1 
ATOM   9058  O  O   . LEU D 1 203 ? 54.890  101.151 68.518  1.00 33.78  ? 181  LEU D O   1 
ATOM   9059  C  CB  . LEU D 1 203 ? 52.074  102.851 68.975  1.00 34.49  ? 181  LEU D CB  1 
ATOM   9060  C  CG  . LEU D 1 203 ? 51.716  104.283 69.385  1.00 35.35  ? 181  LEU D CG  1 
ATOM   9061  C  CD1 . LEU D 1 203 ? 50.542  104.281 70.351  1.00 27.50  ? 181  LEU D CD1 1 
ATOM   9062  C  CD2 . LEU D 1 203 ? 52.937  104.933 70.013  1.00 28.11  ? 181  LEU D CD2 1 
ATOM   9063  N  N   . ARG D 1 204 ? 53.018  100.306 67.587  1.00 40.15  ? 182  ARG D N   1 
ATOM   9064  C  CA  . ARG D 1 204 ? 53.481  98.923  67.646  1.00 38.41  ? 182  ARG D CA  1 
ATOM   9065  C  C   . ARG D 1 204 ? 54.724  98.744  66.781  1.00 35.36  ? 182  ARG D C   1 
ATOM   9066  O  O   . ARG D 1 204 ? 55.576  97.903  67.078  1.00 35.30  ? 182  ARG D O   1 
ATOM   9067  C  CB  . ARG D 1 204 ? 52.375  97.964  67.176  1.00 42.61  ? 182  ARG D CB  1 
ATOM   9068  C  CG  . ARG D 1 204 ? 51.066  98.058  67.970  1.00 54.07  ? 182  ARG D CG  1 
ATOM   9069  C  CD  . ARG D 1 204 ? 50.006  97.080  67.456  1.00 59.60  ? 182  ARG D CD  1 
ATOM   9070  N  NE  . ARG D 1 204 ? 50.296  95.689  67.808  1.00 71.16  ? 182  ARG D NE  1 
ATOM   9071  C  CZ  . ARG D 1 204 ? 50.022  95.135  68.989  1.00 74.34  ? 182  ARG D CZ  1 
ATOM   9072  N  NH1 . ARG D 1 204 ? 49.441  95.850  69.946  1.00 70.57  ? 182  ARG D NH1 1 
ATOM   9073  N  NH2 . ARG D 1 204 ? 50.329  93.861  69.214  1.00 76.33  ? 182  ARG D NH2 1 
ATOM   9074  N  N   . ALA D 1 205 ? 54.826  99.532  65.711  1.00 32.59  ? 183  ALA D N   1 
ATOM   9075  C  CA  . ALA D 1 205 ? 55.977  99.443  64.811  1.00 33.07  ? 183  ALA D CA  1 
ATOM   9076  C  C   . ALA D 1 205 ? 57.221  100.019 65.473  1.00 29.43  ? 183  ALA D C   1 
ATOM   9077  O  O   . ALA D 1 205 ? 58.331  99.553  65.245  1.00 21.05  ? 183  ALA D O   1 
ATOM   9078  C  CB  . ALA D 1 205 ? 55.684  100.178 63.514  1.00 39.37  ? 183  ALA D CB  1 
ATOM   9079  N  N   . LEU D 1 206 ? 57.025  101.036 66.301  1.00 33.13  ? 184  LEU D N   1 
ATOM   9080  C  CA  . LEU D 1 206 ? 58.134  101.654 67.016  1.00 33.21  ? 184  LEU D CA  1 
ATOM   9081  C  C   . LEU D 1 206 ? 58.525  100.809 68.238  1.00 34.66  ? 184  LEU D C   1 
ATOM   9082  O  O   . LEU D 1 206 ? 59.443  101.158 68.983  1.00 36.42  ? 184  LEU D O   1 
ATOM   9083  C  CB  . LEU D 1 206 ? 57.749  103.070 67.434  1.00 27.15  ? 184  LEU D CB  1 
ATOM   9084  C  CG  . LEU D 1 206 ? 57.580  104.001 66.229  1.00 29.90  ? 184  LEU D CG  1 
ATOM   9085  C  CD1 . LEU D 1 206 ? 56.844  105.258 66.638  1.00 24.67  ? 184  LEU D CD1 1 
ATOM   9086  C  CD2 . LEU D 1 206 ? 58.956  104.323 65.640  1.00 27.67  ? 184  LEU D CD2 1 
ATOM   9087  N  N   . GLY D 1 207 ? 57.815  99.698  68.431  1.00 33.46  ? 185  GLY D N   1 
ATOM   9088  C  CA  . GLY D 1 207 ? 58.107  98.792  69.530  1.00 34.85  ? 185  GLY D CA  1 
ATOM   9089  C  C   . GLY D 1 207 ? 57.451  99.119  70.854  1.00 33.38  ? 185  GLY D C   1 
ATOM   9090  O  O   . GLY D 1 207 ? 57.776  98.522  71.882  1.00 28.21  ? 185  GLY D O   1 
ATOM   9091  N  N   . ALA D 1 208 ? 56.513  100.054 70.823  1.00 37.19  ? 186  ALA D N   1 
ATOM   9092  C  CA  . ALA D 1 208 ? 55.825  100.483 72.027  1.00 42.65  ? 186  ALA D CA  1 
ATOM   9093  C  C   . ALA D 1 208 ? 54.757  99.503  72.472  1.00 45.29  ? 186  ALA D C   1 
ATOM   9094  O  O   . ALA D 1 208 ? 53.965  99.022  71.659  1.00 44.48  ? 186  ALA D O   1 
ATOM   9095  C  CB  . ALA D 1 208 ? 55.203  101.853 71.806  1.00 40.98  ? 186  ALA D CB  1 
ATOM   9096  N  N   . GLU D 1 209 ? 54.740  99.216  73.771  1.00 46.31  ? 187  GLU D N   1 
ATOM   9097  C  CA  . GLU D 1 209 ? 53.753  98.315  74.344  1.00 48.40  ? 187  GLU D CA  1 
ATOM   9098  C  C   . GLU D 1 209 ? 52.473  99.099  74.581  1.00 48.45  ? 187  GLU D C   1 
ATOM   9099  O  O   . GLU D 1 209 ? 52.491  100.181 75.172  1.00 44.16  ? 187  GLU D O   1 
ATOM   9100  C  CB  . GLU D 1 209 ? 54.254  97.749  75.663  1.00 51.56  ? 187  GLU D CB  1 
ATOM   9101  C  CG  . GLU D 1 209 ? 55.572  97.013  75.547  1.00 55.93  ? 187  GLU D CG  1 
ATOM   9102  C  CD  . GLU D 1 209 ? 55.985  96.367  76.854  1.00 62.42  ? 187  GLU D CD  1 
ATOM   9103  O  OE1 . GLU D 1 209 ? 57.093  95.783  76.901  1.00 61.43  ? 187  GLU D OE1 1 
ATOM   9104  O  OE2 . GLU D 1 209 ? 55.199  96.445  77.831  1.00 61.27  ? 187  GLU D OE2 1 
ATOM   9105  N  N   . ILE D 1 210 ? 51.356  98.552  74.119  1.00 49.66  ? 188  ILE D N   1 
ATOM   9106  C  CA  . ILE D 1 210 ? 50.088  99.233  74.282  1.00 47.48  ? 188  ILE D CA  1 
ATOM   9107  C  C   . ILE D 1 210 ? 49.220  98.576  75.336  1.00 50.79  ? 188  ILE D C   1 
ATOM   9108  O  O   . ILE D 1 210 ? 49.142  97.351  75.422  1.00 48.92  ? 188  ILE D O   1 
ATOM   9109  C  CB  . ILE D 1 210 ? 49.324  99.289  72.952  1.00 46.88  ? 188  ILE D CB  1 
ATOM   9110  C  CG1 . ILE D 1 210 ? 50.173  100.019 71.913  1.00 48.19  ? 188  ILE D CG1 1 
ATOM   9111  C  CG2 . ILE D 1 210 ? 47.989  99.993  73.142  1.00 43.08  ? 188  ILE D CG2 1 
ATOM   9112  C  CD1 . ILE D 1 210 ? 49.565  100.061 70.536  1.00 61.32  ? 188  ILE D CD1 1 
ATOM   9113  N  N   . VAL D 1 211 ? 48.579  99.412  76.145  1.00 55.28  ? 189  VAL D N   1 
ATOM   9114  C  CA  . VAL D 1 211 ? 47.689  98.958  77.202  1.00 56.33  ? 189  VAL D CA  1 
ATOM   9115  C  C   . VAL D 1 211 ? 46.323  99.585  76.971  1.00 59.99  ? 189  VAL D C   1 
ATOM   9116  O  O   . VAL D 1 211 ? 46.185  100.811 76.959  1.00 58.74  ? 189  VAL D O   1 
ATOM   9117  C  CB  . VAL D 1 211 ? 48.213  99.380  78.593  1.00 57.93  ? 189  VAL D CB  1 
ATOM   9118  C  CG1 . VAL D 1 211 ? 47.154  99.125  79.655  1.00 51.72  ? 189  VAL D CG1 1 
ATOM   9119  C  CG2 . VAL D 1 211 ? 49.489  98.608  78.917  1.00 56.35  ? 189  VAL D CG2 1 
ATOM   9120  N  N   . ARG D 1 212 ? 45.321  98.733  76.779  1.00 65.35  ? 190  ARG D N   1 
ATOM   9121  C  CA  . ARG D 1 212 ? 43.954  99.184  76.537  1.00 68.67  ? 190  ARG D CA  1 
ATOM   9122  C  C   . ARG D 1 212 ? 43.142  99.181  77.826  1.00 72.25  ? 190  ARG D C   1 
ATOM   9123  O  O   . ARG D 1 212 ? 43.163  98.208  78.585  1.00 72.73  ? 190  ARG D O   1 
ATOM   9124  C  CB  . ARG D 1 212 ? 43.279  98.276  75.504  1.00 69.07  ? 190  ARG D CB  1 
ATOM   9125  C  CG  . ARG D 1 212 ? 43.997  98.231  74.165  1.00 70.28  ? 190  ARG D CG  1 
ATOM   9126  C  CD  . ARG D 1 212 ? 43.631  99.417  73.291  1.00 72.98  ? 190  ARG D CD  1 
ATOM   9127  N  NE  . ARG D 1 212 ? 42.421  99.161  72.519  1.00 75.65  ? 190  ARG D NE  1 
ATOM   9128  C  CZ  . ARG D 1 212 ? 42.309  98.191  71.616  1.00 82.62  ? 190  ARG D CZ  1 
ATOM   9129  N  NH1 . ARG D 1 212 ? 43.335  97.384  71.375  1.00 83.19  ? 190  ARG D NH1 1 
ATOM   9130  N  NH2 . ARG D 1 212 ? 41.174  98.026  70.951  1.00 86.42  ? 190  ARG D NH2 1 
ATOM   9131  N  N   . THR D 1 213 ? 42.431  100.280 78.068  1.00 74.89  ? 191  THR D N   1 
ATOM   9132  C  CA  . THR D 1 213 ? 41.600  100.415 79.258  1.00 77.17  ? 191  THR D CA  1 
ATOM   9133  C  C   . THR D 1 213 ? 40.128  100.373 78.864  1.00 81.08  ? 191  THR D C   1 
ATOM   9134  O  O   . THR D 1 213 ? 39.755  100.824 77.778  1.00 81.13  ? 191  THR D O   1 
ATOM   9135  C  CB  . THR D 1 213 ? 41.854  101.754 79.985  1.00 75.24  ? 191  THR D CB  1 
ATOM   9136  O  OG1 . THR D 1 213 ? 41.423  102.843 79.155  1.00 72.70  ? 191  THR D OG1 1 
ATOM   9137  C  CG2 . THR D 1 213 ? 43.328  101.914 80.302  1.00 71.93  ? 191  THR D CG2 1 
ATOM   9138  N  N   . PRO D 1 214 ? 39.272  99.830  79.745  1.00 83.50  ? 192  PRO D N   1 
ATOM   9139  C  CA  . PRO D 1 214 ? 37.833  99.745  79.465  1.00 84.59  ? 192  PRO D CA  1 
ATOM   9140  C  C   . PRO D 1 214 ? 37.201  101.110 79.149  1.00 86.92  ? 192  PRO D C   1 
ATOM   9141  O  O   . PRO D 1 214 ? 37.092  101.493 77.981  1.00 87.63  ? 192  PRO D O   1 
ATOM   9142  C  CB  . PRO D 1 214 ? 37.271  99.105  80.738  1.00 83.75  ? 192  PRO D CB  1 
ATOM   9143  C  CG  . PRO D 1 214 ? 38.272  99.491  81.798  1.00 82.31  ? 192  PRO D CG  1 
ATOM   9144  C  CD  . PRO D 1 214 ? 39.579  99.296  81.083  1.00 80.24  ? 192  PRO D CD  1 
ATOM   9145  N  N   . THR D 1 215 ? 36.792  101.836 80.189  1.00 87.64  ? 193  THR D N   1 
ATOM   9146  C  CA  . THR D 1 215 ? 36.177  103.156 80.025  1.00 87.93  ? 193  THR D CA  1 
ATOM   9147  C  C   . THR D 1 215 ? 35.203  103.209 78.846  1.00 87.05  ? 193  THR D C   1 
ATOM   9148  O  O   . THR D 1 215 ? 35.518  103.748 77.783  1.00 86.15  ? 193  THR D O   1 
ATOM   9149  C  CB  . THR D 1 215 ? 37.261  104.231 79.849  1.00 89.08  ? 193  THR D CB  1 
ATOM   9150  N  N   . GLU D 1 223 ? 41.222  109.439 86.463  1.00 91.76  ? 201  GLU D N   1 
ATOM   9151  C  CA  . GLU D 1 223 ? 40.645  108.990 85.198  1.00 92.78  ? 201  GLU D CA  1 
ATOM   9152  C  C   . GLU D 1 223 ? 40.681  107.463 85.049  1.00 91.90  ? 201  GLU D C   1 
ATOM   9153  O  O   . GLU D 1 223 ? 40.838  106.733 86.033  1.00 93.83  ? 201  GLU D O   1 
ATOM   9154  C  CB  . GLU D 1 223 ? 41.379  109.645 84.023  1.00 92.15  ? 201  GLU D CB  1 
ATOM   9155  N  N   . SER D 1 224 ? 40.535  106.987 83.813  1.00 88.46  ? 202  SER D N   1 
ATOM   9156  C  CA  . SER D 1 224 ? 40.538  105.552 83.529  1.00 82.90  ? 202  SER D CA  1 
ATOM   9157  C  C   . SER D 1 224 ? 41.907  105.068 83.061  1.00 78.46  ? 202  SER D C   1 
ATOM   9158  O  O   . SER D 1 224 ? 42.559  104.278 83.745  1.00 75.54  ? 202  SER D O   1 
ATOM   9159  C  CB  . SER D 1 224 ? 39.487  105.220 82.464  1.00 85.22  ? 202  SER D CB  1 
ATOM   9160  O  OG  . SER D 1 224 ? 39.795  105.835 81.224  1.00 88.97  ? 202  SER D OG  1 
ATOM   9161  N  N   . HIS D 1 225 ? 42.337  105.530 81.889  1.00 75.46  ? 203  HIS D N   1 
ATOM   9162  C  CA  . HIS D 1 225 ? 43.639  105.132 81.369  1.00 75.45  ? 203  HIS D CA  1 
ATOM   9163  C  C   . HIS D 1 225 ? 44.743  105.836 82.154  1.00 72.33  ? 203  HIS D C   1 
ATOM   9164  O  O   . HIS D 1 225 ? 45.851  105.312 82.293  1.00 75.74  ? 203  HIS D O   1 
ATOM   9165  C  CB  . HIS D 1 225 ? 43.764  105.447 79.865  1.00 77.01  ? 203  HIS D CB  1 
ATOM   9166  C  CG  . HIS D 1 225 ? 43.610  106.898 79.518  1.00 82.19  ? 203  HIS D CG  1 
ATOM   9167  N  ND1 . HIS D 1 225 ? 44.018  107.416 78.307  1.00 84.21  ? 203  HIS D ND1 1 
ATOM   9168  C  CD2 . HIS D 1 225 ? 43.070  107.933 80.205  1.00 83.31  ? 203  HIS D CD2 1 
ATOM   9169  C  CE1 . HIS D 1 225 ? 43.737  108.707 78.263  1.00 82.27  ? 203  HIS D CE1 1 
ATOM   9170  N  NE2 . HIS D 1 225 ? 43.162  109.046 79.403  1.00 82.12  ? 203  HIS D NE2 1 
ATOM   9171  N  N   . VAL D 1 226 ? 44.432  107.018 82.676  1.00 64.92  ? 204  VAL D N   1 
ATOM   9172  C  CA  . VAL D 1 226 ? 45.395  107.780 83.461  1.00 61.15  ? 204  VAL D CA  1 
ATOM   9173  C  C   . VAL D 1 226 ? 45.662  107.028 84.764  1.00 59.49  ? 204  VAL D C   1 
ATOM   9174  O  O   . VAL D 1 226 ? 46.795  106.994 85.248  1.00 58.02  ? 204  VAL D O   1 
ATOM   9175  C  CB  . VAL D 1 226 ? 44.861  109.187 83.795  1.00 57.63  ? 204  VAL D CB  1 
ATOM   9176  C  CG1 . VAL D 1 226 ? 45.936  109.997 84.502  1.00 54.47  ? 204  VAL D CG1 1 
ATOM   9177  C  CG2 . VAL D 1 226 ? 44.415  109.882 82.524  1.00 56.76  ? 204  VAL D CG2 1 
ATOM   9178  N  N   . GLY D 1 227 ? 44.610  106.428 85.319  1.00 56.66  ? 205  GLY D N   1 
ATOM   9179  C  CA  . GLY D 1 227 ? 44.748  105.668 86.548  1.00 55.66  ? 205  GLY D CA  1 
ATOM   9180  C  C   . GLY D 1 227 ? 45.606  104.430 86.342  1.00 56.77  ? 205  GLY D C   1 
ATOM   9181  O  O   . GLY D 1 227 ? 46.422  104.077 87.194  1.00 56.76  ? 205  GLY D O   1 
ATOM   9182  N  N   . VAL D 1 228 ? 45.423  103.768 85.203  1.00 56.97  ? 206  VAL D N   1 
ATOM   9183  C  CA  . VAL D 1 228 ? 46.189  102.569 84.879  1.00 57.01  ? 206  VAL D CA  1 
ATOM   9184  C  C   . VAL D 1 228 ? 47.651  102.931 84.638  1.00 59.21  ? 206  VAL D C   1 
ATOM   9185  O  O   . VAL D 1 228 ? 48.557  102.154 84.944  1.00 57.90  ? 206  VAL D O   1 
ATOM   9186  C  CB  . VAL D 1 228 ? 45.631  101.883 83.624  1.00 58.04  ? 206  VAL D CB  1 
ATOM   9187  C  CG1 . VAL D 1 228 ? 46.400  100.600 83.344  1.00 57.96  ? 206  VAL D CG1 1 
ATOM   9188  C  CG2 . VAL D 1 228 ? 44.153  101.601 83.813  1.00 54.95  ? 206  VAL D CG2 1 
ATOM   9189  N  N   . ALA D 1 229 ? 47.875  104.113 84.077  1.00 57.28  ? 207  ALA D N   1 
ATOM   9190  C  CA  . ALA D 1 229 ? 49.229  104.573 83.827  1.00 58.01  ? 207  ALA D CA  1 
ATOM   9191  C  C   . ALA D 1 229 ? 49.939  104.626 85.178  1.00 57.24  ? 207  ALA D C   1 
ATOM   9192  O  O   . ALA D 1 229 ? 50.964  103.975 85.386  1.00 56.49  ? 207  ALA D O   1 
ATOM   9193  C  CB  . ALA D 1 229 ? 49.201  105.960 83.190  1.00 60.15  ? 207  ALA D CB  1 
ATOM   9194  N  N   . TRP D 1 230 ? 49.368  105.395 86.100  1.00 56.47  ? 208  TRP D N   1 
ATOM   9195  C  CA  . TRP D 1 230 ? 49.941  105.547 87.427  1.00 57.78  ? 208  TRP D CA  1 
ATOM   9196  C  C   . TRP D 1 230 ? 49.999  104.256 88.226  1.00 55.12  ? 208  TRP D C   1 
ATOM   9197  O  O   . TRP D 1 230 ? 50.849  104.107 89.101  1.00 54.16  ? 208  TRP D O   1 
ATOM   9198  C  CB  . TRP D 1 230 ? 49.188  106.625 88.202  1.00 64.21  ? 208  TRP D CB  1 
ATOM   9199  C  CG  . TRP D 1 230 ? 50.015  107.850 88.368  1.00 74.80  ? 208  TRP D CG  1 
ATOM   9200  C  CD1 . TRP D 1 230 ? 50.945  108.082 89.342  1.00 78.11  ? 208  TRP D CD1 1 
ATOM   9201  C  CD2 . TRP D 1 230 ? 50.074  108.975 87.480  1.00 79.70  ? 208  TRP D CD2 1 
ATOM   9202  N  NE1 . TRP D 1 230 ? 51.584  109.279 89.113  1.00 80.22  ? 208  TRP D NE1 1 
ATOM   9203  C  CE2 . TRP D 1 230 ? 51.070  109.848 87.978  1.00 81.89  ? 208  TRP D CE2 1 
ATOM   9204  C  CE3 . TRP D 1 230 ? 49.384  109.330 86.308  1.00 81.82  ? 208  TRP D CE3 1 
ATOM   9205  C  CZ2 . TRP D 1 230 ? 51.396  111.058 87.343  1.00 83.59  ? 208  TRP D CZ2 1 
ATOM   9206  C  CZ3 . TRP D 1 230 ? 49.708  110.535 85.675  1.00 82.63  ? 208  TRP D CZ3 1 
ATOM   9207  C  CH2 . TRP D 1 230 ? 50.707  111.383 86.198  1.00 83.23  ? 208  TRP D CH2 1 
ATOM   9208  N  N   . ARG D 1 231 ? 49.104  103.320 87.925  1.00 52.67  ? 209  ARG D N   1 
ATOM   9209  C  CA  . ARG D 1 231 ? 49.099  102.037 88.621  1.00 48.84  ? 209  ARG D CA  1 
ATOM   9210  C  C   . ARG D 1 231 ? 50.364  101.290 88.199  1.00 45.93  ? 209  ARG D C   1 
ATOM   9211  O  O   . ARG D 1 231 ? 51.146  100.837 89.031  1.00 40.01  ? 209  ARG D O   1 
ATOM   9212  C  CB  . ARG D 1 231 ? 47.864  101.222 88.225  1.00 55.43  ? 209  ARG D CB  1 
ATOM   9213  C  CG  . ARG D 1 231 ? 47.711  99.892  88.967  1.00 63.89  ? 209  ARG D CG  1 
ATOM   9214  C  CD  . ARG D 1 231 ? 46.816  98.913  88.199  1.00 68.69  ? 209  ARG D CD  1 
ATOM   9215  N  NE  . ARG D 1 231 ? 47.469  98.411  86.989  1.00 76.36  ? 209  ARG D NE  1 
ATOM   9216  C  CZ  . ARG D 1 231 ? 46.939  97.519  86.154  1.00 79.88  ? 209  ARG D CZ  1 
ATOM   9217  N  NH1 . ARG D 1 231 ? 45.735  97.018  86.386  1.00 82.63  ? 209  ARG D NH1 1 
ATOM   9218  N  NH2 . ARG D 1 231 ? 47.618  97.119  85.086  1.00 82.46  ? 209  ARG D NH2 1 
ATOM   9219  N  N   . LEU D 1 232 ? 50.555  101.190 86.887  1.00 47.40  ? 210  LEU D N   1 
ATOM   9220  C  CA  . LEU D 1 232 ? 51.695  100.500 86.298  1.00 48.60  ? 210  LEU D CA  1 
ATOM   9221  C  C   . LEU D 1 232 ? 53.033  101.079 86.722  1.00 50.47  ? 210  LEU D C   1 
ATOM   9222  O  O   . LEU D 1 232 ? 54.012  100.345 86.882  1.00 49.84  ? 210  LEU D O   1 
ATOM   9223  C  CB  . LEU D 1 232 ? 51.589  100.543 84.777  1.00 48.60  ? 210  LEU D CB  1 
ATOM   9224  C  CG  . LEU D 1 232 ? 50.407  99.783  84.177  1.00 52.13  ? 210  LEU D CG  1 
ATOM   9225  C  CD1 . LEU D 1 232 ? 50.154  100.264 82.766  1.00 49.85  ? 210  LEU D CD1 1 
ATOM   9226  C  CD2 . LEU D 1 232 ? 50.684  98.287  84.214  1.00 46.21  ? 210  LEU D CD2 1 
ATOM   9227  N  N   . LYS D 1 233 ? 53.081  102.396 86.888  1.00 49.37  ? 211  LYS D N   1 
ATOM   9228  C  CA  . LYS D 1 233 ? 54.316  103.048 87.293  1.00 48.47  ? 211  LYS D CA  1 
ATOM   9229  C  C   . LYS D 1 233 ? 54.798  102.512 88.633  1.00 49.27  ? 211  LYS D C   1 
ATOM   9230  O  O   . LYS D 1 233 ? 55.996  102.344 88.844  1.00 49.55  ? 211  LYS D O   1 
ATOM   9231  C  CB  . LYS D 1 233 ? 54.124  104.557 87.400  1.00 47.26  ? 211  LYS D CB  1 
ATOM   9232  C  CG  . LYS D 1 233 ? 55.393  105.264 87.838  1.00 50.91  ? 211  LYS D CG  1 
ATOM   9233  C  CD  . LYS D 1 233 ? 55.184  106.756 88.047  1.00 54.75  ? 211  LYS D CD  1 
ATOM   9234  C  CE  . LYS D 1 233 ? 56.482  107.411 88.495  1.00 55.50  ? 211  LYS D CE  1 
ATOM   9235  N  NZ  . LYS D 1 233 ? 57.003  106.787 89.752  1.00 54.32  ? 211  LYS D NZ  1 
ATOM   9236  N  N   . ASN D 1 234 ? 53.855  102.249 89.536  1.00 51.56  ? 212  ASN D N   1 
ATOM   9237  C  CA  . ASN D 1 234 ? 54.185  101.726 90.857  1.00 54.52  ? 212  ASN D CA  1 
ATOM   9238  C  C   . ASN D 1 234 ? 54.448  100.233 90.810  1.00 53.04  ? 212  ASN D C   1 
ATOM   9239  O  O   . ASN D 1 234 ? 55.094  99.684  91.698  1.00 54.25  ? 212  ASN D O   1 
ATOM   9240  C  CB  . ASN D 1 234 ? 53.050  101.989 91.843  1.00 56.72  ? 212  ASN D CB  1 
ATOM   9241  C  CG  . ASN D 1 234 ? 52.758  103.459 92.012  1.00 59.78  ? 212  ASN D CG  1 
ATOM   9242  O  OD1 . ASN D 1 234 ? 53.655  104.255 92.314  1.00 60.44  ? 212  ASN D OD1 1 
ATOM   9243  N  ND2 . ASN D 1 234 ? 51.496  103.835 91.825  1.00 63.06  ? 212  ASN D ND2 1 
ATOM   9244  N  N   . GLU D 1 235 ? 53.952  99.580  89.767  1.00 53.89  ? 213  GLU D N   1 
ATOM   9245  C  CA  . GLU D 1 235 ? 54.127  98.147  89.628  1.00 55.17  ? 213  GLU D CA  1 
ATOM   9246  C  C   . GLU D 1 235 ? 55.355  97.757  88.817  1.00 57.06  ? 213  GLU D C   1 
ATOM   9247  O  O   . GLU D 1 235 ? 55.807  96.613  88.882  1.00 58.01  ? 213  GLU D O   1 
ATOM   9248  C  CB  . GLU D 1 235 ? 52.875  97.540  88.998  1.00 58.75  ? 213  GLU D CB  1 
ATOM   9249  C  CG  . GLU D 1 235 ? 51.617  97.807  89.799  1.00 62.72  ? 213  GLU D CG  1 
ATOM   9250  C  CD  . GLU D 1 235 ? 50.409  97.077  89.254  1.00 71.78  ? 213  GLU D CD  1 
ATOM   9251  O  OE1 . GLU D 1 235 ? 49.327  97.187  89.870  1.00 77.88  ? 213  GLU D OE1 1 
ATOM   9252  O  OE2 . GLU D 1 235 ? 50.540  96.393  88.213  1.00 73.62  ? 213  GLU D OE2 1 
ATOM   9253  N  N   . ILE D 1 236 ? 55.904  98.700  88.059  1.00 55.02  ? 214  ILE D N   1 
ATOM   9254  C  CA  . ILE D 1 236 ? 57.072  98.398  87.241  1.00 53.90  ? 214  ILE D CA  1 
ATOM   9255  C  C   . ILE D 1 236 ? 58.313  99.174  87.668  1.00 54.02  ? 214  ILE D C   1 
ATOM   9256  O  O   . ILE D 1 236 ? 58.336  100.407 87.640  1.00 57.32  ? 214  ILE D O   1 
ATOM   9257  C  CB  . ILE D 1 236 ? 56.788  98.687  85.763  1.00 52.10  ? 214  ILE D CB  1 
ATOM   9258  C  CG1 . ILE D 1 236 ? 55.472  98.022  85.359  1.00 51.50  ? 214  ILE D CG1 1 
ATOM   9259  C  CG2 . ILE D 1 236 ? 57.926  98.164  84.910  1.00 51.61  ? 214  ILE D CG2 1 
ATOM   9260  C  CD1 . ILE D 1 236 ? 54.952  98.452  84.008  1.00 46.19  ? 214  ILE D CD1 1 
ATOM   9261  N  N   . PRO D 1 237 ? 59.372  98.453  88.060  1.00 50.53  ? 215  PRO D N   1 
ATOM   9262  C  CA  . PRO D 1 237 ? 60.626  99.069  88.498  1.00 46.62  ? 215  PRO D CA  1 
ATOM   9263  C  C   . PRO D 1 237 ? 61.208  99.911  87.376  1.00 41.56  ? 215  PRO D C   1 
ATOM   9264  O  O   . PRO D 1 237 ? 61.094  99.543  86.210  1.00 33.74  ? 215  PRO D O   1 
ATOM   9265  C  CB  . PRO D 1 237 ? 61.517  97.865  88.820  1.00 47.67  ? 215  PRO D CB  1 
ATOM   9266  C  CG  . PRO D 1 237 ? 60.551  96.761  89.089  1.00 48.52  ? 215  PRO D CG  1 
ATOM   9267  C  CD  . PRO D 1 237 ? 59.494  96.988  88.042  1.00 51.07  ? 215  PRO D CD  1 
ATOM   9268  N  N   . ASN D 1 238 ? 61.834  101.028 87.734  1.00 39.23  ? 216  ASN D N   1 
ATOM   9269  C  CA  . ASN D 1 238 ? 62.445  101.936 86.763  1.00 40.77  ? 216  ASN D CA  1 
ATOM   9270  C  C   . ASN D 1 238 ? 61.449  102.559 85.792  1.00 37.58  ? 216  ASN D C   1 
ATOM   9271  O  O   . ASN D 1 238 ? 61.758  102.771 84.620  1.00 41.02  ? 216  ASN D O   1 
ATOM   9272  C  CB  . ASN D 1 238 ? 63.544  101.217 85.972  1.00 38.50  ? 216  ASN D CB  1 
ATOM   9273  C  CG  . ASN D 1 238 ? 64.705  100.799 86.849  1.00 39.36  ? 216  ASN D CG  1 
ATOM   9274  O  OD1 . ASN D 1 238 ? 65.146  101.564 87.716  1.00 25.73  ? 216  ASN D OD1 1 
ATOM   9275  N  ND2 . ASN D 1 238 ? 65.218  99.588  86.626  1.00 31.70  ? 216  ASN D ND2 1 
ATOM   9276  N  N   . SER D 1 239 ? 60.257  102.853 86.290  1.00 33.53  ? 217  SER D N   1 
ATOM   9277  C  CA  . SER D 1 239 ? 59.220  103.457 85.480  1.00 35.38  ? 217  SER D CA  1 
ATOM   9278  C  C   . SER D 1 239 ? 59.163  104.960 85.693  1.00 39.48  ? 217  SER D C   1 
ATOM   9279  O  O   . SER D 1 239 ? 59.459  105.464 86.782  1.00 42.15  ? 217  SER D O   1 
ATOM   9280  C  CB  . SER D 1 239 ? 57.855  102.859 85.829  1.00 35.92  ? 217  SER D CB  1 
ATOM   9281  O  OG  . SER D 1 239 ? 57.706  101.574 85.265  1.00 40.62  ? 217  SER D OG  1 
ATOM   9282  N  N   . HIS D 1 240 ? 58.768  105.666 84.643  1.00 40.24  ? 218  HIS D N   1 
ATOM   9283  C  CA  . HIS D 1 240 ? 58.642  107.112 84.689  1.00 42.36  ? 218  HIS D CA  1 
ATOM   9284  C  C   . HIS D 1 240 ? 57.497  107.525 83.787  1.00 42.79  ? 218  HIS D C   1 
ATOM   9285  O  O   . HIS D 1 240 ? 57.366  107.029 82.669  1.00 47.46  ? 218  HIS D O   1 
ATOM   9286  C  CB  . HIS D 1 240 ? 59.912  107.787 84.172  1.00 40.92  ? 218  HIS D CB  1 
ATOM   9287  C  CG  . HIS D 1 240 ? 61.157  107.337 84.858  1.00 39.27  ? 218  HIS D CG  1 
ATOM   9288  N  ND1 . HIS D 1 240 ? 61.591  107.881 86.047  1.00 38.62  ? 218  HIS D ND1 1 
ATOM   9289  C  CD2 . HIS D 1 240 ? 62.053  106.378 84.531  1.00 40.20  ? 218  HIS D CD2 1 
ATOM   9290  C  CE1 . HIS D 1 240 ? 62.703  107.276 86.423  1.00 44.26  ? 218  HIS D CE1 1 
ATOM   9291  N  NE2 . HIS D 1 240 ? 63.005  106.360 85.520  1.00 45.05  ? 218  HIS D NE2 1 
ATOM   9292  N  N   . ILE D 1 241 ? 56.662  108.424 84.285  1.00 37.66  ? 219  ILE D N   1 
ATOM   9293  C  CA  . ILE D 1 241 ? 55.569  108.948 83.503  1.00 34.66  ? 219  ILE D CA  1 
ATOM   9294  C  C   . ILE D 1 241 ? 56.001  110.384 83.285  1.00 41.35  ? 219  ILE D C   1 
ATOM   9295  O  O   . ILE D 1 241 ? 55.969  111.198 84.209  1.00 38.78  ? 219  ILE D O   1 
ATOM   9296  C  CB  . ILE D 1 241 ? 54.245  108.912 84.268  1.00 34.62  ? 219  ILE D CB  1 
ATOM   9297  C  CG1 . ILE D 1 241 ? 53.795  107.457 84.440  1.00 26.70  ? 219  ILE D CG1 1 
ATOM   9298  C  CG2 . ILE D 1 241 ? 53.201  109.771 83.528  1.00 18.32  ? 219  ILE D CG2 1 
ATOM   9299  C  CD1 . ILE D 1 241 ? 52.630  107.274 85.378  1.00 30.86  ? 219  ILE D CD1 1 
ATOM   9300  N  N   . LEU D 1 242 ? 56.445  110.688 82.071  1.00 44.61  ? 220  LEU D N   1 
ATOM   9301  C  CA  . LEU D 1 242 ? 56.902  112.033 81.770  1.00 45.37  ? 220  LEU D CA  1 
ATOM   9302  C  C   . LEU D 1 242 ? 55.798  113.069 81.987  1.00 45.86  ? 220  LEU D C   1 
ATOM   9303  O  O   . LEU D 1 242 ? 56.021  114.061 82.678  1.00 46.13  ? 220  LEU D O   1 
ATOM   9304  C  CB  . LEU D 1 242 ? 57.476  112.065 80.355  1.00 46.36  ? 220  LEU D CB  1 
ATOM   9305  C  CG  . LEU D 1 242 ? 58.745  111.205 80.344  1.00 38.66  ? 220  LEU D CG  1 
ATOM   9306  C  CD1 . LEU D 1 242 ? 59.326  111.107 78.957  1.00 37.16  ? 220  LEU D CD1 1 
ATOM   9307  C  CD2 . LEU D 1 242 ? 59.753  111.815 81.305  1.00 33.24  ? 220  LEU D CD2 1 
ATOM   9308  N  N   . ASP D 1 243 ? 54.617  112.841 81.414  1.00 44.29  ? 221  ASP D N   1 
ATOM   9309  C  CA  . ASP D 1 243 ? 53.470  113.736 81.620  1.00 45.09  ? 221  ASP D CA  1 
ATOM   9310  C  C   . ASP D 1 243 ? 53.558  115.117 80.985  1.00 45.51  ? 221  ASP D C   1 
ATOM   9311  O  O   . ASP D 1 243 ? 53.985  116.082 81.622  1.00 46.78  ? 221  ASP D O   1 
ATOM   9312  C  CB  . ASP D 1 243 ? 53.202  113.885 83.127  1.00 41.99  ? 221  ASP D CB  1 
ATOM   9313  C  CG  . ASP D 1 243 ? 51.969  114.720 83.428  1.00 43.53  ? 221  ASP D CG  1 
ATOM   9314  O  OD1 . ASP D 1 243 ? 51.683  114.957 84.624  1.00 42.15  ? 221  ASP D OD1 1 
ATOM   9315  O  OD2 . ASP D 1 243 ? 51.285  115.138 82.473  1.00 46.37  ? 221  ASP D OD2 1 
ATOM   9316  N  N   . GLN D 1 244 ? 53.098  115.203 79.742  1.00 46.82  ? 222  GLN D N   1 
ATOM   9317  C  CA  . GLN D 1 244 ? 53.112  116.441 78.965  1.00 46.57  ? 222  GLN D CA  1 
ATOM   9318  C  C   . GLN D 1 244 ? 52.293  117.592 79.534  1.00 44.03  ? 222  GLN D C   1 
ATOM   9319  O  O   . GLN D 1 244 ? 52.553  118.753 79.218  1.00 43.24  ? 222  GLN D O   1 
ATOM   9320  C  CB  . GLN D 1 244 ? 52.612  116.145 77.557  1.00 46.95  ? 222  GLN D CB  1 
ATOM   9321  C  CG  . GLN D 1 244 ? 51.266  115.451 77.561  1.00 45.15  ? 222  GLN D CG  1 
ATOM   9322  C  CD  . GLN D 1 244 ? 50.863  114.961 76.201  1.00 39.94  ? 222  GLN D CD  1 
ATOM   9323  O  OE1 . GLN D 1 244 ? 50.227  113.923 76.075  1.00 38.58  ? 222  GLN D OE1 1 
ATOM   9324  N  NE2 . GLN D 1 244 ? 51.227  115.707 75.170  1.00 39.41  ? 222  GLN D NE2 1 
ATOM   9325  N  N   . TYR D 1 245 ? 51.306  117.277 80.365  1.00 44.45  ? 223  TYR D N   1 
ATOM   9326  C  CA  . TYR D 1 245 ? 50.440  118.309 80.936  1.00 39.26  ? 223  TYR D CA  1 
ATOM   9327  C  C   . TYR D 1 245 ? 51.039  119.128 82.086  1.00 40.38  ? 223  TYR D C   1 
ATOM   9328  O  O   . TYR D 1 245 ? 50.593  120.257 82.349  1.00 34.25  ? 223  TYR D O   1 
ATOM   9329  C  CB  . TYR D 1 245 ? 49.107  117.676 81.350  1.00 32.52  ? 223  TYR D CB  1 
ATOM   9330  C  CG  . TYR D 1 245 ? 48.251  117.283 80.161  1.00 42.73  ? 223  TYR D CG  1 
ATOM   9331  C  CD1 . TYR D 1 245 ? 47.554  118.250 79.432  1.00 51.04  ? 223  TYR D CD1 1 
ATOM   9332  C  CD2 . TYR D 1 245 ? 48.181  115.957 79.729  1.00 42.79  ? 223  TYR D CD2 1 
ATOM   9333  C  CE1 . TYR D 1 245 ? 46.811  117.908 78.298  1.00 52.49  ? 223  TYR D CE1 1 
ATOM   9334  C  CE2 . TYR D 1 245 ? 47.446  115.604 78.599  1.00 43.00  ? 223  TYR D CE2 1 
ATOM   9335  C  CZ  . TYR D 1 245 ? 46.763  116.585 77.886  1.00 53.78  ? 223  TYR D CZ  1 
ATOM   9336  O  OH  . TYR D 1 245 ? 46.033  116.250 76.758  1.00 58.53  ? 223  TYR D OH  1 
ATOM   9337  N  N   . ARG D 1 246 ? 52.054  118.580 82.756  1.00 38.16  ? 224  ARG D N   1 
ATOM   9338  C  CA  . ARG D 1 246 ? 52.682  119.296 83.860  1.00 36.07  ? 224  ARG D CA  1 
ATOM   9339  C  C   . ARG D 1 246 ? 54.184  119.508 83.701  1.00 32.66  ? 224  ARG D C   1 
ATOM   9340  O  O   . ARG D 1 246 ? 54.753  120.392 84.344  1.00 27.59  ? 224  ARG D O   1 
ATOM   9341  C  CB  . ARG D 1 246 ? 52.433  118.573 85.196  1.00 40.62  ? 224  ARG D CB  1 
ATOM   9342  C  CG  . ARG D 1 246 ? 50.989  118.594 85.675  1.00 41.44  ? 224  ARG D CG  1 
ATOM   9343  C  CD  . ARG D 1 246 ? 50.878  118.323 87.176  1.00 48.22  ? 224  ARG D CD  1 
ATOM   9344  N  NE  . ARG D 1 246 ? 51.294  119.458 88.003  1.00 54.60  ? 224  ARG D NE  1 
ATOM   9345  C  CZ  . ARG D 1 246 ? 52.368  119.462 88.787  1.00 59.41  ? 224  ARG D CZ  1 
ATOM   9346  N  NH1 . ARG D 1 246 ? 53.146  118.390 88.854  1.00 66.75  ? 224  ARG D NH1 1 
ATOM   9347  N  NH2 . ARG D 1 246 ? 52.662  120.533 89.512  1.00 60.47  ? 224  ARG D NH2 1 
ATOM   9348  N  N   . ASN D 1 247 ? 54.821  118.704 82.853  1.00 31.13  ? 225  ASN D N   1 
ATOM   9349  C  CA  . ASN D 1 247 ? 56.267  118.794 82.661  1.00 28.08  ? 225  ASN D CA  1 
ATOM   9350  C  C   . ASN D 1 247 ? 56.754  120.052 81.944  1.00 24.64  ? 225  ASN D C   1 
ATOM   9351  O  O   . ASN D 1 247 ? 56.500  120.246 80.762  1.00 27.14  ? 225  ASN D O   1 
ATOM   9352  C  CB  . ASN D 1 247 ? 56.777  117.564 81.911  1.00 23.44  ? 225  ASN D CB  1 
ATOM   9353  C  CG  . ASN D 1 247 ? 58.274  117.386 82.047  1.00 21.72  ? 225  ASN D CG  1 
ATOM   9354  O  OD1 . ASN D 1 247 ? 59.027  118.349 81.967  1.00 25.96  ? 225  ASN D OD1 1 
ATOM   9355  N  ND2 . ASN D 1 247 ? 58.713  116.149 82.244  1.00 22.67  ? 225  ASN D ND2 1 
ATOM   9356  N  N   . ALA D 1 248 ? 57.475  120.890 82.677  1.00 26.25  ? 226  ALA D N   1 
ATOM   9357  C  CA  . ALA D 1 248 ? 58.016  122.136 82.150  1.00 35.28  ? 226  ALA D CA  1 
ATOM   9358  C  C   . ALA D 1 248 ? 58.798  121.985 80.853  1.00 34.56  ? 226  ALA D C   1 
ATOM   9359  O  O   . ALA D 1 248 ? 58.903  122.935 80.073  1.00 32.47  ? 226  ALA D O   1 
ATOM   9360  C  CB  . ALA D 1 248 ? 58.901  122.787 83.198  1.00 39.85  ? 226  ALA D CB  1 
ATOM   9361  N  N   . SER D 1 249 ? 59.358  120.798 80.638  1.00 33.87  ? 227  SER D N   1 
ATOM   9362  C  CA  . SER D 1 249 ? 60.145  120.522 79.440  1.00 34.36  ? 227  SER D CA  1 
ATOM   9363  C  C   . SER D 1 249 ? 59.334  120.775 78.171  1.00 34.56  ? 227  SER D C   1 
ATOM   9364  O  O   . SER D 1 249 ? 59.881  121.085 77.120  1.00 34.59  ? 227  SER D O   1 
ATOM   9365  C  CB  . SER D 1 249 ? 60.633  119.070 79.455  1.00 32.73  ? 227  SER D CB  1 
ATOM   9366  O  OG  . SER D 1 249 ? 61.492  118.823 80.554  1.00 31.92  ? 227  SER D OG  1 
ATOM   9367  N  N   . ASN D 1 250 ? 58.021  120.629 78.276  1.00 33.59  ? 228  ASN D N   1 
ATOM   9368  C  CA  . ASN D 1 250 ? 57.141  120.855 77.142  1.00 33.53  ? 228  ASN D CA  1 
ATOM   9369  C  C   . ASN D 1 250 ? 57.180  122.325 76.712  1.00 29.59  ? 228  ASN D C   1 
ATOM   9370  O  O   . ASN D 1 250 ? 57.726  122.664 75.669  1.00 25.53  ? 228  ASN D O   1 
ATOM   9371  C  CB  . ASN D 1 250 ? 55.716  120.438 77.507  1.00 41.40  ? 228  ASN D CB  1 
ATOM   9372  C  CG  . ASN D 1 250 ? 54.719  120.742 76.412  1.00 46.70  ? 228  ASN D CG  1 
ATOM   9373  O  OD1 . ASN D 1 250 ? 55.045  121.402 75.423  1.00 45.81  ? 228  ASN D OD1 1 
ATOM   9374  N  ND2 . ASN D 1 250 ? 53.487  120.266 76.586  1.00 46.92  ? 228  ASN D ND2 1 
ATOM   9375  N  N   . PRO D 1 251 ? 56.606  123.227 77.516  1.00 32.42  ? 229  PRO D N   1 
ATOM   9376  C  CA  . PRO D 1 251 ? 56.662  124.623 77.078  1.00 30.60  ? 229  PRO D CA  1 
ATOM   9377  C  C   . PRO D 1 251 ? 58.092  125.126 76.899  1.00 22.51  ? 229  PRO D C   1 
ATOM   9378  O  O   . PRO D 1 251 ? 58.357  126.013 76.093  1.00 19.80  ? 229  PRO D O   1 
ATOM   9379  C  CB  . PRO D 1 251 ? 55.906  125.360 78.184  1.00 27.50  ? 229  PRO D CB  1 
ATOM   9380  C  CG  . PRO D 1 251 ? 56.202  124.530 79.395  1.00 35.91  ? 229  PRO D CG  1 
ATOM   9381  C  CD  . PRO D 1 251 ? 56.010  123.129 78.862  1.00 33.17  ? 229  PRO D CD  1 
ATOM   9382  N  N   . LEU D 1 252 ? 59.023  124.557 77.648  1.00 29.48  ? 230  LEU D N   1 
ATOM   9383  C  CA  . LEU D 1 252 ? 60.411  124.990 77.540  1.00 28.99  ? 230  LEU D CA  1 
ATOM   9384  C  C   . LEU D 1 252 ? 60.987  124.670 76.172  1.00 25.52  ? 230  LEU D C   1 
ATOM   9385  O  O   . LEU D 1 252 ? 61.720  125.478 75.608  1.00 29.40  ? 230  LEU D O   1 
ATOM   9386  C  CB  . LEU D 1 252 ? 61.259  124.357 78.644  1.00 19.20  ? 230  LEU D CB  1 
ATOM   9387  C  CG  . LEU D 1 252 ? 61.080  124.978 80.028  1.00 19.85  ? 230  LEU D CG  1 
ATOM   9388  C  CD1 . LEU D 1 252 ? 61.867  124.177 81.049  1.00 30.78  ? 230  LEU D CD1 1 
ATOM   9389  C  CD2 . LEU D 1 252 ? 61.541  126.424 80.031  1.00 18.27  ? 230  LEU D CD2 1 
ATOM   9390  N  N   . ALA D 1 253 ? 60.648  123.501 75.636  1.00 26.05  ? 231  ALA D N   1 
ATOM   9391  C  CA  . ALA D 1 253 ? 61.135  123.105 74.318  1.00 27.72  ? 231  ALA D CA  1 
ATOM   9392  C  C   . ALA D 1 253 ? 60.801  124.214 73.321  1.00 25.93  ? 231  ALA D C   1 
ATOM   9393  O  O   . ALA D 1 253 ? 61.660  124.677 72.565  1.00 30.24  ? 231  ALA D O   1 
ATOM   9394  C  CB  . ALA D 1 253 ? 60.481  121.796 73.884  1.00 25.15  ? 231  ALA D CB  1 
ATOM   9395  N  N   . HIS D 1 254 ? 59.550  124.653 73.356  1.00 20.83  ? 232  HIS D N   1 
ATOM   9396  C  CA  . HIS D 1 254 ? 59.051  125.694 72.472  1.00 16.22  ? 232  HIS D CA  1 
ATOM   9397  C  C   . HIS D 1 254 ? 59.591  127.103 72.734  1.00 24.02  ? 232  HIS D C   1 
ATOM   9398  O  O   . HIS D 1 254 ? 59.704  127.921 71.809  1.00 29.68  ? 232  HIS D O   1 
ATOM   9399  C  CB  . HIS D 1 254 ? 57.522  125.692 72.512  1.00 14.55  ? 232  HIS D CB  1 
ATOM   9400  C  CG  . HIS D 1 254 ? 56.916  124.411 72.028  1.00 17.86  ? 232  HIS D CG  1 
ATOM   9401  N  ND1 . HIS D 1 254 ? 57.150  123.907 70.769  1.00 22.51  ? 232  HIS D ND1 1 
ATOM   9402  C  CD2 . HIS D 1 254 ? 56.126  123.506 72.652  1.00 30.76  ? 232  HIS D CD2 1 
ATOM   9403  C  CE1 . HIS D 1 254 ? 56.532  122.748 70.635  1.00 29.87  ? 232  HIS D CE1 1 
ATOM   9404  N  NE2 . HIS D 1 254 ? 55.903  122.480 71.764  1.00 33.42  ? 232  HIS D NE2 1 
ATOM   9405  N  N   . TYR D 1 255 ? 59.929  127.397 73.982  1.00 24.21  ? 233  TYR D N   1 
ATOM   9406  C  CA  . TYR D 1 255 ? 60.477  128.706 74.336  1.00 24.38  ? 233  TYR D CA  1 
ATOM   9407  C  C   . TYR D 1 255 ? 61.945  128.766 73.924  1.00 27.47  ? 233  TYR D C   1 
ATOM   9408  O  O   . TYR D 1 255 ? 62.462  129.837 73.567  1.00 22.06  ? 233  TYR D O   1 
ATOM   9409  C  CB  . TYR D 1 255 ? 60.376  128.908 75.854  1.00 33.38  ? 233  TYR D CB  1 
ATOM   9410  C  CG  . TYR D 1 255 ? 61.049  130.150 76.434  1.00 25.47  ? 233  TYR D CG  1 
ATOM   9411  C  CD1 . TYR D 1 255 ? 60.435  131.404 76.364  1.00 29.11  ? 233  TYR D CD1 1 
ATOM   9412  C  CD2 . TYR D 1 255 ? 62.275  130.054 77.105  1.00 23.86  ? 233  TYR D CD2 1 
ATOM   9413  C  CE1 . TYR D 1 255 ? 61.022  132.532 76.958  1.00 24.67  ? 233  TYR D CE1 1 
ATOM   9414  C  CE2 . TYR D 1 255 ? 62.874  131.175 77.697  1.00 18.47  ? 233  TYR D CE2 1 
ATOM   9415  C  CZ  . TYR D 1 255 ? 62.239  132.403 77.618  1.00 26.49  ? 233  TYR D CZ  1 
ATOM   9416  O  OH  . TYR D 1 255 ? 62.821  133.492 78.204  1.00 31.82  ? 233  TYR D OH  1 
ATOM   9417  N  N   . ASP D 1 256 ? 62.607  127.606 73.997  1.00 28.48  ? 234  ASP D N   1 
ATOM   9418  C  CA  . ASP D 1 256 ? 64.028  127.469 73.664  1.00 26.18  ? 234  ASP D CA  1 
ATOM   9419  C  C   . ASP D 1 256 ? 64.378  127.254 72.191  1.00 29.52  ? 234  ASP D C   1 
ATOM   9420  O  O   . ASP D 1 256 ? 65.360  127.819 71.703  1.00 28.94  ? 234  ASP D O   1 
ATOM   9421  C  CB  . ASP D 1 256 ? 64.658  126.332 74.467  1.00 20.72  ? 234  ASP D CB  1 
ATOM   9422  C  CG  . ASP D 1 256 ? 64.879  126.691 75.917  1.00 25.16  ? 234  ASP D CG  1 
ATOM   9423  O  OD1 . ASP D 1 256 ? 64.896  127.894 76.259  1.00 24.29  ? 234  ASP D OD1 1 
ATOM   9424  O  OD2 . ASP D 1 256 ? 65.057  125.758 76.723  1.00 36.14  ? 234  ASP D OD2 1 
ATOM   9425  N  N   . THR D 1 257 ? 63.588  126.439 71.486  1.00 33.24  ? 235  THR D N   1 
ATOM   9426  C  CA  . THR D 1 257 ? 63.854  126.148 70.076  1.00 28.34  ? 235  THR D CA  1 
ATOM   9427  C  C   . THR D 1 257 ? 62.838  126.708 69.077  1.00 30.21  ? 235  THR D C   1 
ATOM   9428  O  O   . THR D 1 257 ? 63.183  127.539 68.228  1.00 31.06  ? 235  THR D O   1 
ATOM   9429  C  CB  . THR D 1 257 ? 63.950  124.640 69.845  1.00 30.11  ? 235  THR D CB  1 
ATOM   9430  O  OG1 . THR D 1 257 ? 62.668  124.047 70.059  1.00 29.60  ? 235  THR D OG1 1 
ATOM   9431  C  CG2 . THR D 1 257 ? 64.949  124.017 70.809  1.00 30.91  ? 235  THR D CG2 1 
ATOM   9432  N  N   . THR D 1 258 ? 61.591  126.249 69.172  1.00 25.52  ? 236  THR D N   1 
ATOM   9433  C  CA  . THR D 1 258 ? 60.532  126.692 68.267  1.00 23.01  ? 236  THR D CA  1 
ATOM   9434  C  C   . THR D 1 258 ? 60.375  128.208 68.153  1.00 24.65  ? 236  THR D C   1 
ATOM   9435  O  O   . THR D 1 258 ? 60.356  128.762 67.062  1.00 29.77  ? 236  THR D O   1 
ATOM   9436  C  CB  . THR D 1 258 ? 59.168  126.129 68.674  1.00 19.08  ? 236  THR D CB  1 
ATOM   9437  O  OG1 . THR D 1 258 ? 59.330  124.815 69.216  1.00 20.42  ? 236  THR D OG1 1 
ATOM   9438  C  CG2 . THR D 1 258 ? 58.268  126.049 67.443  1.00 22.72  ? 236  THR D CG2 1 
ATOM   9439  N  N   . ALA D 1 259 ? 60.233  128.875 69.282  1.00 23.09  ? 237  ALA D N   1 
ATOM   9440  C  CA  . ALA D 1 259 ? 60.078  130.309 69.274  1.00 21.97  ? 237  ALA D CA  1 
ATOM   9441  C  C   . ALA D 1 259 ? 61.306  130.936 68.644  1.00 24.29  ? 237  ALA D C   1 
ATOM   9442  O  O   . ALA D 1 259 ? 61.184  131.833 67.802  1.00 28.64  ? 237  ALA D O   1 
ATOM   9443  C  CB  . ALA D 1 259 ? 59.902  130.823 70.716  1.00 28.94  ? 237  ALA D CB  1 
ATOM   9444  N  N   . ASP D 1 260 ? 62.484  130.463 69.064  1.00 19.06  ? 238  ASP D N   1 
ATOM   9445  C  CA  . ASP D 1 260 ? 63.753  130.984 68.562  1.00 22.04  ? 238  ASP D CA  1 
ATOM   9446  C  C   . ASP D 1 260 ? 63.921  130.756 67.062  1.00 22.98  ? 238  ASP D C   1 
ATOM   9447  O  O   . ASP D 1 260 ? 64.359  131.656 66.344  1.00 25.82  ? 238  ASP D O   1 
ATOM   9448  C  CB  . ASP D 1 260 ? 64.924  130.381 69.341  1.00 19.56  ? 238  ASP D CB  1 
ATOM   9449  C  CG  . ASP D 1 260 ? 65.371  131.265 70.515  1.00 27.67  ? 238  ASP D CG  1 
ATOM   9450  O  OD1 . ASP D 1 260 ? 66.265  130.849 71.283  1.00 40.69  ? 238  ASP D OD1 1 
ATOM   9451  O  OD2 . ASP D 1 260 ? 64.848  132.385 70.672  1.00 22.98  ? 238  ASP D OD2 1 
ATOM   9452  N  N   . GLU D 1 261 ? 63.572  129.562 66.590  1.00 20.45  ? 239  GLU D N   1 
ATOM   9453  C  CA  . GLU D 1 261 ? 63.668  129.267 65.168  1.00 19.89  ? 239  GLU D CA  1 
ATOM   9454  C  C   . GLU D 1 261 ? 62.761  130.242 64.420  1.00 26.54  ? 239  GLU D C   1 
ATOM   9455  O  O   . GLU D 1 261 ? 63.181  130.871 63.443  1.00 35.41  ? 239  GLU D O   1 
ATOM   9456  C  CB  . GLU D 1 261 ? 63.241  127.821 64.879  1.00 20.57  ? 239  GLU D CB  1 
ATOM   9457  C  CG  . GLU D 1 261 ? 64.129  126.769 65.532  1.00 7.04   ? 239  GLU D CG  1 
ATOM   9458  C  CD  . GLU D 1 261 ? 63.648  125.352 65.293  1.00 19.06  ? 239  GLU D CD  1 
ATOM   9459  O  OE1 . GLU D 1 261 ? 64.186  124.436 65.954  1.00 31.41  ? 239  GLU D OE1 1 
ATOM   9460  O  OE2 . GLU D 1 261 ? 62.745  125.144 64.451  1.00 26.87  ? 239  GLU D OE2 1 
ATOM   9461  N  N   . ILE D 1 262 ? 61.527  130.385 64.901  1.00 23.73  ? 240  ILE D N   1 
ATOM   9462  C  CA  . ILE D 1 262 ? 60.581  131.279 64.276  1.00 17.68  ? 240  ILE D CA  1 
ATOM   9463  C  C   . ILE D 1 262 ? 61.168  132.665 64.071  1.00 20.87  ? 240  ILE D C   1 
ATOM   9464  O  O   . ILE D 1 262 ? 61.135  133.192 62.955  1.00 24.94  ? 240  ILE D O   1 
ATOM   9465  C  CB  . ILE D 1 262 ? 59.294  131.386 65.103  1.00 16.90  ? 240  ILE D CB  1 
ATOM   9466  C  CG1 . ILE D 1 262 ? 58.554  130.049 65.059  1.00 13.57  ? 240  ILE D CG1 1 
ATOM   9467  C  CG2 . ILE D 1 262 ? 58.402  132.517 64.545  1.00 6.88   ? 240  ILE D CG2 1 
ATOM   9468  C  CD1 . ILE D 1 262 ? 57.164  130.072 65.747  1.00 9.92   ? 240  ILE D CD1 1 
ATOM   9469  N  N   . LEU D 1 263 ? 61.714  133.246 65.137  1.00 22.71  ? 241  LEU D N   1 
ATOM   9470  C  CA  . LEU D 1 263 ? 62.303  134.582 65.062  1.00 23.08  ? 241  LEU D CA  1 
ATOM   9471  C  C   . LEU D 1 263 ? 63.461  134.635 64.075  1.00 28.48  ? 241  LEU D C   1 
ATOM   9472  O  O   . LEU D 1 263 ? 63.583  135.583 63.302  1.00 29.52  ? 241  LEU D O   1 
ATOM   9473  C  CB  . LEU D 1 263 ? 62.781  135.038 66.448  1.00 28.55  ? 241  LEU D CB  1 
ATOM   9474  C  CG  . LEU D 1 263 ? 61.715  135.224 67.554  1.00 19.54  ? 241  LEU D CG  1 
ATOM   9475  C  CD1 . LEU D 1 263 ? 62.393  135.308 68.896  1.00 21.38  ? 241  LEU D CD1 1 
ATOM   9476  C  CD2 . LEU D 1 263 ? 60.875  136.460 67.282  1.00 14.62  ? 241  LEU D CD2 1 
ATOM   9477  N  N   . GLN D 1 264 ? 64.310  133.617 64.103  1.00 30.03  ? 242  GLN D N   1 
ATOM   9478  C  CA  . GLN D 1 264 ? 65.457  133.551 63.213  1.00 29.29  ? 242  GLN D CA  1 
ATOM   9479  C  C   . GLN D 1 264 ? 65.010  133.550 61.744  1.00 29.65  ? 242  GLN D C   1 
ATOM   9480  O  O   . GLN D 1 264 ? 65.572  134.267 60.918  1.00 33.04  ? 242  GLN D O   1 
ATOM   9481  C  CB  . GLN D 1 264 ? 66.269  132.290 63.538  1.00 34.19  ? 242  GLN D CB  1 
ATOM   9482  C  CG  . GLN D 1 264 ? 67.299  131.861 62.481  1.00 46.92  ? 242  GLN D CG  1 
ATOM   9483  C  CD  . GLN D 1 264 ? 68.625  132.597 62.579  1.00 50.66  ? 242  GLN D CD  1 
ATOM   9484  O  OE1 . GLN D 1 264 ? 69.495  132.439 61.720  1.00 54.10  ? 242  GLN D OE1 1 
ATOM   9485  N  NE2 . GLN D 1 264 ? 68.790  133.396 63.627  1.00 49.81  ? 242  GLN D NE2 1 
ATOM   9486  N  N   . GLN D 1 265 ? 63.992  132.755 61.427  1.00 30.83  ? 243  GLN D N   1 
ATOM   9487  C  CA  . GLN D 1 265 ? 63.478  132.646 60.062  1.00 24.35  ? 243  GLN D CA  1 
ATOM   9488  C  C   . GLN D 1 265 ? 62.741  133.918 59.609  1.00 30.51  ? 243  GLN D C   1 
ATOM   9489  O  O   . GLN D 1 265 ? 62.524  134.147 58.416  1.00 33.52  ? 243  GLN D O   1 
ATOM   9490  C  CB  . GLN D 1 265 ? 62.549  131.431 59.965  1.00 20.50  ? 243  GLN D CB  1 
ATOM   9491  C  CG  . GLN D 1 265 ? 63.258  130.102 60.138  1.00 22.38  ? 243  GLN D CG  1 
ATOM   9492  C  CD  . GLN D 1 265 ? 62.307  128.917 60.339  1.00 32.46  ? 243  GLN D CD  1 
ATOM   9493  O  OE1 . GLN D 1 265 ? 61.475  128.919 61.244  1.00 41.67  ? 243  GLN D OE1 1 
ATOM   9494  N  NE2 . GLN D 1 265 ? 62.443  127.898 59.506  1.00 28.01  ? 243  GLN D NE2 1 
ATOM   9495  N  N   . CYS D 1 266 ? 62.360  134.749 60.567  1.00 31.85  ? 244  CYS D N   1 
ATOM   9496  C  CA  . CYS D 1 266 ? 61.664  135.989 60.263  1.00 28.62  ? 244  CYS D CA  1 
ATOM   9497  C  C   . CYS D 1 266 ? 62.577  137.201 60.464  1.00 26.87  ? 244  CYS D C   1 
ATOM   9498  O  O   . CYS D 1 266 ? 62.157  138.343 60.292  1.00 26.23  ? 244  CYS D O   1 
ATOM   9499  C  CB  . CYS D 1 266 ? 60.439  136.130 61.167  1.00 24.87  ? 244  CYS D CB  1 
ATOM   9500  S  SG  . CYS D 1 266 ? 59.181  134.886 60.893  1.00 34.58  ? 244  CYS D SG  1 
ATOM   9501  N  N   . ASP D 1 267 ? 63.830  136.954 60.822  1.00 29.25  ? 245  ASP D N   1 
ATOM   9502  C  CA  . ASP D 1 267 ? 64.769  138.044 61.059  1.00 36.73  ? 245  ASP D CA  1 
ATOM   9503  C  C   . ASP D 1 267 ? 64.251  139.001 62.153  1.00 37.31  ? 245  ASP D C   1 
ATOM   9504  O  O   . ASP D 1 267 ? 64.502  140.209 62.105  1.00 36.31  ? 245  ASP D O   1 
ATOM   9505  C  CB  . ASP D 1 267 ? 65.010  138.826 59.761  1.00 41.90  ? 245  ASP D CB  1 
ATOM   9506  C  CG  . ASP D 1 267 ? 65.709  138.000 58.704  1.00 50.96  ? 245  ASP D CG  1 
ATOM   9507  O  OD1 . ASP D 1 267 ? 66.881  137.643 58.937  1.00 62.77  ? 245  ASP D OD1 1 
ATOM   9508  O  OD2 . ASP D 1 267 ? 65.093  137.706 57.646  1.00 42.97  ? 245  ASP D OD2 1 
ATOM   9509  N  N   . GLY D 1 268 ? 63.525  138.457 63.130  1.00 34.63  ? 246  GLY D N   1 
ATOM   9510  C  CA  . GLY D 1 268 ? 62.999  139.273 64.214  1.00 37.97  ? 246  GLY D CA  1 
ATOM   9511  C  C   . GLY D 1 268 ? 61.748  140.084 63.907  1.00 40.67  ? 246  GLY D C   1 
ATOM   9512  O  O   . GLY D 1 268 ? 61.211  140.749 64.792  1.00 41.08  ? 246  GLY D O   1 
ATOM   9513  N  N   . LYS D 1 269 ? 61.284  140.035 62.662  1.00 42.62  ? 247  LYS D N   1 
ATOM   9514  C  CA  . LYS D 1 269 ? 60.093  140.774 62.252  1.00 43.90  ? 247  LYS D CA  1 
ATOM   9515  C  C   . LYS D 1 269 ? 58.927  139.807 62.113  1.00 41.79  ? 247  LYS D C   1 
ATOM   9516  O  O   . LYS D 1 269 ? 58.944  138.907 61.268  1.00 38.54  ? 247  LYS D O   1 
ATOM   9517  C  CB  . LYS D 1 269 ? 60.342  141.469 60.919  1.00 48.15  ? 247  LYS D CB  1 
ATOM   9518  C  CG  . LYS D 1 269 ? 61.640  142.250 60.863  1.00 48.10  ? 247  LYS D CG  1 
ATOM   9519  C  CD  . LYS D 1 269 ? 61.920  142.653 59.428  1.00 59.56  ? 247  LYS D CD  1 
ATOM   9520  C  CE  . LYS D 1 269 ? 63.283  143.303 59.264  1.00 57.94  ? 247  LYS D CE  1 
ATOM   9521  N  NZ  . LYS D 1 269 ? 63.478  143.702 57.842  1.00 58.25  ? 247  LYS D NZ  1 
ATOM   9522  N  N   . LEU D 1 270 ? 57.916  140.012 62.950  1.00 38.82  ? 248  LEU D N   1 
ATOM   9523  C  CA  . LEU D 1 270 ? 56.727  139.170 62.994  1.00 34.33  ? 248  LEU D CA  1 
ATOM   9524  C  C   . LEU D 1 270 ? 55.642  140.030 63.669  1.00 33.78  ? 248  LEU D C   1 
ATOM   9525  O  O   . LEU D 1 270 ? 55.947  140.836 64.554  1.00 27.99  ? 248  LEU D O   1 
ATOM   9526  C  CB  . LEU D 1 270 ? 57.051  137.931 63.836  1.00 35.32  ? 248  LEU D CB  1 
ATOM   9527  C  CG  . LEU D 1 270 ? 56.142  136.712 63.940  1.00 40.25  ? 248  LEU D CG  1 
ATOM   9528  C  CD1 . LEU D 1 270 ? 56.851  135.680 64.781  1.00 41.64  ? 248  LEU D CD1 1 
ATOM   9529  C  CD2 . LEU D 1 270 ? 54.809  137.072 64.570  1.00 35.81  ? 248  LEU D CD2 1 
ATOM   9530  N  N   . ASP D 1 271 ? 54.385  139.871 63.273  1.00 31.02  ? 249  ASP D N   1 
ATOM   9531  C  CA  . ASP D 1 271 ? 53.334  140.687 63.865  1.00 30.53  ? 249  ASP D CA  1 
ATOM   9532  C  C   . ASP D 1 271 ? 52.220  139.890 64.503  1.00 31.86  ? 249  ASP D C   1 
ATOM   9533  O  O   . ASP D 1 271 ? 51.415  140.437 65.254  1.00 19.82  ? 249  ASP D O   1 
ATOM   9534  C  CB  . ASP D 1 271 ? 52.740  141.608 62.806  1.00 34.00  ? 249  ASP D CB  1 
ATOM   9535  C  CG  . ASP D 1 271 ? 53.778  142.484 62.163  1.00 37.01  ? 249  ASP D CG  1 
ATOM   9536  O  OD1 . ASP D 1 271 ? 54.147  143.500 62.781  1.00 36.62  ? 249  ASP D OD1 1 
ATOM   9537  O  OD2 . ASP D 1 271 ? 54.239  142.143 61.048  1.00 41.71  ? 249  ASP D OD2 1 
ATOM   9538  N  N   . MET D 1 272 ? 52.166  138.600 64.204  1.00 34.00  ? 250  MET D N   1 
ATOM   9539  C  CA  . MET D 1 272 ? 51.119  137.770 64.767  1.00 36.37  ? 250  MET D CA  1 
ATOM   9540  C  C   . MET D 1 272 ? 51.461  136.284 64.741  1.00 37.76  ? 250  MET D C   1 
ATOM   9541  O  O   . MET D 1 272 ? 52.130  135.795 63.830  1.00 36.91  ? 250  MET D O   1 
ATOM   9542  C  CB  . MET D 1 272 ? 49.809  138.012 64.012  1.00 35.43  ? 250  MET D CB  1 
ATOM   9543  C  CG  . MET D 1 272 ? 48.625  137.262 64.587  1.00 39.77  ? 250  MET D CG  1 
ATOM   9544  S  SD  . MET D 1 272 ? 47.090  137.637 63.753  1.00 43.41  ? 250  MET D SD  1 
ATOM   9545  C  CE  . MET D 1 272 ? 46.799  139.310 64.359  1.00 46.08  ? 250  MET D CE  1 
ATOM   9546  N  N   . LEU D 1 273 ? 51.002  135.576 65.763  1.00 34.24  ? 251  LEU D N   1 
ATOM   9547  C  CA  . LEU D 1 273 ? 51.219  134.149 65.857  1.00 31.14  ? 251  LEU D CA  1 
ATOM   9548  C  C   . LEU D 1 273 ? 49.883  133.498 66.187  1.00 35.81  ? 251  LEU D C   1 
ATOM   9549  O  O   . LEU D 1 273 ? 49.214  133.862 67.163  1.00 30.81  ? 251  LEU D O   1 
ATOM   9550  C  CB  . LEU D 1 273 ? 52.232  133.825 66.948  1.00 27.60  ? 251  LEU D CB  1 
ATOM   9551  C  CG  . LEU D 1 273 ? 52.423  132.326 67.181  1.00 30.80  ? 251  LEU D CG  1 
ATOM   9552  C  CD1 . LEU D 1 273 ? 53.392  131.752 66.159  1.00 23.41  ? 251  LEU D CD1 1 
ATOM   9553  C  CD2 . LEU D 1 273 ? 52.948  132.102 68.593  1.00 39.58  ? 251  LEU D CD2 1 
ATOM   9554  N  N   . VAL D 1 274 ? 49.497  132.543 65.352  1.00 34.35  ? 252  VAL D N   1 
ATOM   9555  C  CA  . VAL D 1 274 ? 48.259  131.816 65.532  1.00 34.96  ? 252  VAL D CA  1 
ATOM   9556  C  C   . VAL D 1 274 ? 48.632  130.362 65.756  1.00 39.08  ? 252  VAL D C   1 
ATOM   9557  O  O   . VAL D 1 274 ? 49.314  129.759 64.930  1.00 40.85  ? 252  VAL D O   1 
ATOM   9558  C  CB  . VAL D 1 274 ? 47.370  131.947 64.282  1.00 31.93  ? 252  VAL D CB  1 
ATOM   9559  C  CG1 . VAL D 1 274 ? 46.117  131.096 64.423  1.00 31.88  ? 252  VAL D CG1 1 
ATOM   9560  C  CG2 . VAL D 1 274 ? 46.996  133.404 64.078  1.00 33.07  ? 252  VAL D CG2 1 
ATOM   9561  N  N   . ALA D 1 275 ? 48.203  129.806 66.886  1.00 43.45  ? 253  ALA D N   1 
ATOM   9562  C  CA  . ALA D 1 275 ? 48.499  128.414 67.220  1.00 43.09  ? 253  ALA D CA  1 
ATOM   9563  C  C   . ALA D 1 275 ? 47.300  127.768 67.903  1.00 41.46  ? 253  ALA D C   1 
ATOM   9564  O  O   . ALA D 1 275 ? 46.629  128.411 68.707  1.00 36.44  ? 253  ALA D O   1 
ATOM   9565  C  CB  . ALA D 1 275 ? 49.722  128.351 68.140  1.00 43.60  ? 253  ALA D CB  1 
ATOM   9566  N  N   . SER D 1 276 ? 47.021  126.507 67.573  1.00 41.60  ? 254  SER D N   1 
ATOM   9567  C  CA  . SER D 1 276 ? 45.911  125.791 68.198  1.00 37.64  ? 254  SER D CA  1 
ATOM   9568  C  C   . SER D 1 276 ? 46.429  125.284 69.544  1.00 41.22  ? 254  SER D C   1 
ATOM   9569  O  O   . SER D 1 276 ? 47.622  125.026 69.691  1.00 45.66  ? 254  SER D O   1 
ATOM   9570  C  CB  . SER D 1 276 ? 45.446  124.635 67.308  1.00 34.97  ? 254  SER D CB  1 
ATOM   9571  O  OG  . SER D 1 276 ? 46.502  123.743 67.011  1.00 34.60  ? 254  SER D OG  1 
ATOM   9572  N  N   . VAL D 1 277 ? 45.544  125.134 70.525  1.00 44.36  ? 255  VAL D N   1 
ATOM   9573  C  CA  . VAL D 1 277 ? 45.973  124.714 71.861  1.00 39.74  ? 255  VAL D CA  1 
ATOM   9574  C  C   . VAL D 1 277 ? 45.458  123.370 72.390  1.00 40.79  ? 255  VAL D C   1 
ATOM   9575  O  O   . VAL D 1 277 ? 44.268  123.069 72.303  1.00 37.27  ? 255  VAL D O   1 
ATOM   9576  C  CB  . VAL D 1 277 ? 45.606  125.798 72.904  1.00 39.00  ? 255  VAL D CB  1 
ATOM   9577  C  CG1 . VAL D 1 277 ? 46.315  125.517 74.219  1.00 33.97  ? 255  VAL D CG1 1 
ATOM   9578  C  CG2 . VAL D 1 277 ? 45.972  127.175 72.379  1.00 23.89  ? 255  VAL D CG2 1 
ATOM   9579  N  N   . GLY D 1 278 ? 46.378  122.586 72.958  1.00 40.35  ? 256  GLY D N   1 
ATOM   9580  C  CA  . GLY D 1 278 ? 46.051  121.286 73.525  1.00 39.99  ? 256  GLY D CA  1 
ATOM   9581  C  C   . GLY D 1 278 ? 46.570  121.237 74.956  1.00 44.95  ? 256  GLY D C   1 
ATOM   9582  O  O   . GLY D 1 278 ? 45.803  121.302 75.917  1.00 42.10  ? 256  GLY D O   1 
ATOM   9583  N  N   . THR D 1 279 ? 47.884  121.120 75.098  1.00 43.11  ? 257  THR D N   1 
ATOM   9584  C  CA  . THR D 1 279 ? 48.509  121.102 76.406  1.00 38.57  ? 257  THR D CA  1 
ATOM   9585  C  C   . THR D 1 279 ? 48.795  122.558 76.729  1.00 38.49  ? 257  THR D C   1 
ATOM   9586  O  O   . THR D 1 279 ? 48.800  122.978 77.888  1.00 41.90  ? 257  THR D O   1 
ATOM   9587  C  CB  . THR D 1 279 ? 49.846  120.352 76.386  1.00 38.15  ? 257  THR D CB  1 
ATOM   9588  O  OG1 . THR D 1 279 ? 50.747  121.019 75.493  1.00 29.89  ? 257  THR D OG1 1 
ATOM   9589  C  CG2 . THR D 1 279 ? 49.642  118.915 75.950  1.00 34.07  ? 257  THR D CG2 1 
ATOM   9590  N  N   . GLY D 1 280 ? 49.032  123.327 75.677  1.00 35.52  ? 258  GLY D N   1 
ATOM   9591  C  CA  . GLY D 1 280 ? 49.323  124.738 75.838  1.00 32.02  ? 258  GLY D CA  1 
ATOM   9592  C  C   . GLY D 1 280 ? 50.813  124.961 75.702  1.00 29.50  ? 258  GLY D C   1 
ATOM   9593  O  O   . GLY D 1 280 ? 51.290  126.098 75.691  1.00 34.04  ? 258  GLY D O   1 
ATOM   9594  N  N   . GLY D 1 281 ? 51.554  123.866 75.596  1.00 23.75  ? 259  GLY D N   1 
ATOM   9595  C  CA  . GLY D 1 281 ? 52.995  123.971 75.464  1.00 24.24  ? 259  GLY D CA  1 
ATOM   9596  C  C   . GLY D 1 281 ? 53.448  124.923 74.363  1.00 24.22  ? 259  GLY D C   1 
ATOM   9597  O  O   . GLY D 1 281 ? 54.103  125.943 74.615  1.00 21.27  ? 259  GLY D O   1 
ATOM   9598  N  N   . THR D 1 282 ? 53.088  124.592 73.130  1.00 24.06  ? 260  THR D N   1 
ATOM   9599  C  CA  . THR D 1 282 ? 53.459  125.398 71.981  1.00 28.14  ? 260  THR D CA  1 
ATOM   9600  C  C   . THR D 1 282 ? 53.183  126.896 72.118  1.00 25.39  ? 260  THR D C   1 
ATOM   9601  O  O   . THR D 1 282 ? 54.117  127.693 72.082  1.00 16.52  ? 260  THR D O   1 
ATOM   9602  C  CB  . THR D 1 282 ? 52.754  124.887 70.714  1.00 33.66  ? 260  THR D CB  1 
ATOM   9603  O  OG1 . THR D 1 282 ? 53.020  123.489 70.567  1.00 25.16  ? 260  THR D OG1 1 
ATOM   9604  C  CG2 . THR D 1 282 ? 53.262  125.639 69.476  1.00 17.17  ? 260  THR D CG2 1 
ATOM   9605  N  N   . ILE D 1 283 ? 51.915  127.274 72.273  1.00 23.97  ? 261  ILE D N   1 
ATOM   9606  C  CA  . ILE D 1 283 ? 51.569  128.684 72.374  1.00 32.55  ? 261  ILE D CA  1 
ATOM   9607  C  C   . ILE D 1 283 ? 52.188  129.380 73.579  1.00 37.07  ? 261  ILE D C   1 
ATOM   9608  O  O   . ILE D 1 283 ? 52.602  130.531 73.471  1.00 39.95  ? 261  ILE D O   1 
ATOM   9609  C  CB  . ILE D 1 283 ? 50.026  128.907 72.390  1.00 36.65  ? 261  ILE D CB  1 
ATOM   9610  C  CG1 . ILE D 1 283 ? 49.714  130.371 72.042  1.00 31.74  ? 261  ILE D CG1 1 
ATOM   9611  C  CG2 . ILE D 1 283 ? 49.442  128.547 73.759  1.00 31.68  ? 261  ILE D CG2 1 
ATOM   9612  C  CD1 . ILE D 1 283 ? 48.240  130.663 71.870  1.00 11.63  ? 261  ILE D CD1 1 
ATOM   9613  N  N   . THR D 1 284 ? 52.265  128.689 74.716  1.00 41.94  ? 262  THR D N   1 
ATOM   9614  C  CA  . THR D 1 284 ? 52.843  129.285 75.915  1.00 41.04  ? 262  THR D CA  1 
ATOM   9615  C  C   . THR D 1 284 ? 54.335  129.462 75.745  1.00 39.01  ? 262  THR D C   1 
ATOM   9616  O  O   . THR D 1 284 ? 54.893  130.494 76.117  1.00 46.09  ? 262  THR D O   1 
ATOM   9617  C  CB  . THR D 1 284 ? 52.604  128.425 77.176  1.00 46.97  ? 262  THR D CB  1 
ATOM   9618  O  OG1 . THR D 1 284 ? 51.192  128.255 77.380  1.00 49.38  ? 262  THR D OG1 1 
ATOM   9619  C  CG2 . THR D 1 284 ? 53.228  129.102 78.409  1.00 39.32  ? 262  THR D CG2 1 
ATOM   9620  N  N   . GLY D 1 285 ? 54.983  128.450 75.190  1.00 37.18  ? 263  GLY D N   1 
ATOM   9621  C  CA  . GLY D 1 285 ? 56.412  128.537 74.993  1.00 36.36  ? 263  GLY D CA  1 
ATOM   9622  C  C   . GLY D 1 285 ? 56.762  129.648 74.026  1.00 37.75  ? 263  GLY D C   1 
ATOM   9623  O  O   . GLY D 1 285 ? 57.570  130.529 74.335  1.00 42.35  ? 263  GLY D O   1 
ATOM   9624  N  N   . ILE D 1 286 ? 56.144  129.613 72.852  1.00 34.87  ? 264  ILE D N   1 
ATOM   9625  C  CA  . ILE D 1 286 ? 56.409  130.609 71.840  1.00 34.71  ? 264  ILE D CA  1 
ATOM   9626  C  C   . ILE D 1 286 ? 55.939  131.979 72.284  1.00 35.68  ? 264  ILE D C   1 
ATOM   9627  O  O   . ILE D 1 286 ? 56.635  132.972 72.066  1.00 37.75  ? 264  ILE D O   1 
ATOM   9628  C  CB  . ILE D 1 286 ? 55.723  130.242 70.516  1.00 39.01  ? 264  ILE D CB  1 
ATOM   9629  C  CG1 . ILE D 1 286 ? 56.227  128.877 70.040  1.00 41.10  ? 264  ILE D CG1 1 
ATOM   9630  C  CG2 . ILE D 1 286 ? 56.030  131.290 69.457  1.00 43.69  ? 264  ILE D CG2 1 
ATOM   9631  C  CD1 . ILE D 1 286 ? 55.478  128.330 68.836  1.00 38.56  ? 264  ILE D CD1 1 
ATOM   9632  N  N   . ALA D 1 287 ? 54.771  132.047 72.915  1.00 36.80  ? 265  ALA D N   1 
ATOM   9633  C  CA  . ALA D 1 287 ? 54.245  133.344 73.359  1.00 38.95  ? 265  ALA D CA  1 
ATOM   9634  C  C   . ALA D 1 287 ? 55.141  134.045 74.392  1.00 36.08  ? 265  ALA D C   1 
ATOM   9635  O  O   . ALA D 1 287 ? 55.366  135.258 74.315  1.00 30.97  ? 265  ALA D O   1 
ATOM   9636  C  CB  . ALA D 1 287 ? 52.826  133.189 73.907  1.00 38.42  ? 265  ALA D CB  1 
ATOM   9637  N  N   . ARG D 1 288 ? 55.649  133.291 75.358  1.00 28.73  ? 266  ARG D N   1 
ATOM   9638  C  CA  . ARG D 1 288 ? 56.527  133.887 76.357  1.00 35.64  ? 266  ARG D CA  1 
ATOM   9639  C  C   . ARG D 1 288 ? 57.848  134.365 75.748  1.00 32.57  ? 266  ARG D C   1 
ATOM   9640  O  O   . ARG D 1 288 ? 58.419  135.351 76.193  1.00 31.36  ? 266  ARG D O   1 
ATOM   9641  C  CB  . ARG D 1 288 ? 56.814  132.898 77.497  1.00 35.17  ? 266  ARG D CB  1 
ATOM   9642  C  CG  . ARG D 1 288 ? 55.752  132.869 78.577  1.00 26.61  ? 266  ARG D CG  1 
ATOM   9643  C  CD  . ARG D 1 288 ? 56.200  131.990 79.736  1.00 40.54  ? 266  ARG D CD  1 
ATOM   9644  N  NE  . ARG D 1 288 ? 55.173  131.899 80.771  1.00 42.47  ? 266  ARG D NE  1 
ATOM   9645  C  CZ  . ARG D 1 288 ? 55.287  131.183 81.884  1.00 38.39  ? 266  ARG D CZ  1 
ATOM   9646  N  NH1 . ARG D 1 288 ? 56.382  130.488 82.125  1.00 32.50  ? 266  ARG D NH1 1 
ATOM   9647  N  NH2 . ARG D 1 288 ? 54.296  131.152 82.757  1.00 42.68  ? 266  ARG D NH2 1 
ATOM   9648  N  N   . LYS D 1 289 ? 58.338  133.668 74.729  1.00 34.41  ? 267  LYS D N   1 
ATOM   9649  C  CA  . LYS D 1 289 ? 59.582  134.074 74.099  1.00 29.64  ? 267  LYS D CA  1 
ATOM   9650  C  C   . LYS D 1 289 ? 59.353  135.244 73.160  1.00 28.28  ? 267  LYS D C   1 
ATOM   9651  O  O   . LYS D 1 289 ? 60.241  136.082 72.994  1.00 35.52  ? 267  LYS D O   1 
ATOM   9652  C  CB  . LYS D 1 289 ? 60.205  132.912 73.320  1.00 36.46  ? 267  LYS D CB  1 
ATOM   9653  C  CG  . LYS D 1 289 ? 61.441  133.307 72.485  1.00 27.63  ? 267  LYS D CG  1 
ATOM   9654  C  CD  . LYS D 1 289 ? 62.495  134.009 73.349  1.00 18.06  ? 267  LYS D CD  1 
ATOM   9655  C  CE  . LYS D 1 289 ? 63.002  133.125 74.493  1.00 10.49  ? 267  LYS D CE  1 
ATOM   9656  N  NZ  . LYS D 1 289 ? 63.920  132.052 74.070  1.00 11.43  ? 267  LYS D NZ  1 
ATOM   9657  N  N   . LEU D 1 290 ? 58.173  135.301 72.541  1.00 19.93  ? 268  LEU D N   1 
ATOM   9658  C  CA  . LEU D 1 290 ? 57.867  136.386 71.603  1.00 27.94  ? 268  LEU D CA  1 
ATOM   9659  C  C   . LEU D 1 290 ? 57.590  137.709 72.315  1.00 27.65  ? 268  LEU D C   1 
ATOM   9660  O  O   . LEU D 1 290 ? 58.110  138.749 71.925  1.00 29.19  ? 268  LEU D O   1 
ATOM   9661  C  CB  . LEU D 1 290 ? 56.684  136.002 70.707  1.00 28.69  ? 268  LEU D CB  1 
ATOM   9662  C  CG  . LEU D 1 290 ? 56.972  135.706 69.226  1.00 29.26  ? 268  LEU D CG  1 
ATOM   9663  C  CD1 . LEU D 1 290 ? 58.360  135.099 69.043  1.00 36.76  ? 268  LEU D CD1 1 
ATOM   9664  C  CD2 . LEU D 1 290 ? 55.894  134.761 68.705  1.00 26.70  ? 268  LEU D CD2 1 
ATOM   9665  N  N   . LYS D 1 291 ? 56.781  137.675 73.365  1.00 26.29  ? 269  LYS D N   1 
ATOM   9666  C  CA  . LYS D 1 291 ? 56.500  138.892 74.094  1.00 26.60  ? 269  LYS D CA  1 
ATOM   9667  C  C   . LYS D 1 291 ? 57.772  139.505 74.670  1.00 27.54  ? 269  LYS D C   1 
ATOM   9668  O  O   . LYS D 1 291 ? 57.818  140.697 74.944  1.00 31.06  ? 269  LYS D O   1 
ATOM   9669  C  CB  . LYS D 1 291 ? 55.495  138.626 75.213  1.00 35.64  ? 269  LYS D CB  1 
ATOM   9670  C  CG  . LYS D 1 291 ? 54.082  138.432 74.697  1.00 34.64  ? 269  LYS D CG  1 
ATOM   9671  C  CD  . LYS D 1 291 ? 53.067  138.825 75.745  1.00 42.61  ? 269  LYS D CD  1 
ATOM   9672  C  CE  . LYS D 1 291 ? 51.697  138.958 75.128  1.00 42.23  ? 269  LYS D CE  1 
ATOM   9673  N  NZ  . LYS D 1 291 ? 51.742  139.922 73.999  1.00 53.88  ? 269  LYS D NZ  1 
ATOM   9674  N  N   . GLU D 1 292 ? 58.804  138.692 74.861  1.00 31.81  ? 270  GLU D N   1 
ATOM   9675  C  CA  . GLU D 1 292 ? 60.059  139.206 75.388  1.00 37.13  ? 270  GLU D CA  1 
ATOM   9676  C  C   . GLU D 1 292 ? 60.866  139.852 74.249  1.00 43.06  ? 270  GLU D C   1 
ATOM   9677  O  O   . GLU D 1 292 ? 61.349  140.977 74.397  1.00 46.25  ? 270  GLU D O   1 
ATOM   9678  C  CB  . GLU D 1 292 ? 60.865  138.082 76.062  1.00 36.97  ? 270  GLU D CB  1 
ATOM   9679  C  CG  . GLU D 1 292 ? 60.129  137.404 77.218  1.00 33.71  ? 270  GLU D CG  1 
ATOM   9680  C  CD  . GLU D 1 292 ? 61.012  136.484 78.057  1.00 30.56  ? 270  GLU D CD  1 
ATOM   9681  O  OE1 . GLU D 1 292 ? 61.869  135.770 77.487  1.00 12.55  ? 270  GLU D OE1 1 
ATOM   9682  O  OE2 . GLU D 1 292 ? 60.821  136.470 79.291  1.00 29.17  ? 270  GLU D OE2 1 
ATOM   9683  N  N   . LYS D 1 293 ? 60.986  139.162 73.111  1.00 44.27  ? 271  LYS D N   1 
ATOM   9684  C  CA  . LYS D 1 293 ? 61.741  139.687 71.958  1.00 46.03  ? 271  LYS D CA  1 
ATOM   9685  C  C   . LYS D 1 293 ? 60.894  140.556 71.015  1.00 46.21  ? 271  LYS D C   1 
ATOM   9686  O  O   . LYS D 1 293 ? 61.301  141.646 70.624  1.00 40.24  ? 271  LYS D O   1 
ATOM   9687  C  CB  . LYS D 1 293 ? 62.369  138.537 71.163  1.00 37.61  ? 271  LYS D CB  1 
ATOM   9688  C  CG  . LYS D 1 293 ? 63.237  137.601 71.999  1.00 42.08  ? 271  LYS D CG  1 
ATOM   9689  C  CD  . LYS D 1 293 ? 64.478  138.293 72.521  1.00 44.61  ? 271  LYS D CD  1 
ATOM   9690  C  CE  . LYS D 1 293 ? 65.336  137.323 73.330  1.00 48.20  ? 271  LYS D CE  1 
ATOM   9691  N  NZ  . LYS D 1 293 ? 66.666  137.915 73.697  1.00 50.56  ? 271  LYS D NZ  1 
ATOM   9692  N  N   . CYS D 1 294 ? 59.715  140.070 70.648  1.00 51.28  ? 272  CYS D N   1 
ATOM   9693  C  CA  . CYS D 1 294 ? 58.832  140.818 69.762  1.00 55.98  ? 272  CYS D CA  1 
ATOM   9694  C  C   . CYS D 1 294 ? 57.602  141.329 70.502  1.00 55.76  ? 272  CYS D C   1 
ATOM   9695  O  O   . CYS D 1 294 ? 56.528  140.711 70.465  1.00 48.86  ? 272  CYS D O   1 
ATOM   9696  C  CB  . CYS D 1 294 ? 58.399  139.950 68.580  1.00 57.35  ? 272  CYS D CB  1 
ATOM   9697  S  SG  . CYS D 1 294 ? 57.141  140.728 67.528  1.00 59.54  ? 272  CYS D SG  1 
ATOM   9698  N  N   . PRO D 1 295 ? 57.749  142.472 71.188  1.00 59.98  ? 273  PRO D N   1 
ATOM   9699  C  CA  . PRO D 1 295 ? 56.647  143.073 71.943  1.00 63.80  ? 273  PRO D CA  1 
ATOM   9700  C  C   . PRO D 1 295 ? 55.374  143.282 71.110  1.00 66.06  ? 273  PRO D C   1 
ATOM   9701  O  O   . PRO D 1 295 ? 54.272  142.911 71.535  1.00 64.50  ? 273  PRO D O   1 
ATOM   9702  C  CB  . PRO D 1 295 ? 57.257  144.387 72.446  1.00 63.72  ? 273  PRO D CB  1 
ATOM   9703  C  CG  . PRO D 1 295 ? 58.318  144.699 71.416  1.00 64.23  ? 273  PRO D CG  1 
ATOM   9704  C  CD  . PRO D 1 295 ? 58.934  143.349 71.200  1.00 59.52  ? 273  PRO D CD  1 
ATOM   9705  N  N   . GLY D 1 296 ? 55.539  143.857 69.920  1.00 66.10  ? 274  GLY D N   1 
ATOM   9706  C  CA  . GLY D 1 296 ? 54.405  144.116 69.049  1.00 67.33  ? 274  GLY D CA  1 
ATOM   9707  C  C   . GLY D 1 296 ? 53.753  142.885 68.447  1.00 66.23  ? 274  GLY D C   1 
ATOM   9708  O  O   . GLY D 1 296 ? 52.863  142.999 67.604  1.00 66.99  ? 274  GLY D O   1 
ATOM   9709  N  N   . CYS D 1 297 ? 54.189  141.705 68.874  1.00 64.28  ? 275  CYS D N   1 
ATOM   9710  C  CA  . CYS D 1 297 ? 53.628  140.461 68.361  1.00 61.10  ? 275  CYS D CA  1 
ATOM   9711  C  C   . CYS D 1 297 ? 52.340  140.085 69.069  1.00 58.69  ? 275  CYS D C   1 
ATOM   9712  O  O   . CYS D 1 297 ? 52.312  139.933 70.291  1.00 56.70  ? 275  CYS D O   1 
ATOM   9713  C  CB  . CYS D 1 297 ? 54.634  139.320 68.510  1.00 59.89  ? 275  CYS D CB  1 
ATOM   9714  S  SG  . CYS D 1 297 ? 55.852  139.207 67.167  1.00 58.60  ? 275  CYS D SG  1 
ATOM   9715  N  N   . ARG D 1 298 ? 51.273  139.939 68.297  1.00 54.62  ? 276  ARG D N   1 
ATOM   9716  C  CA  . ARG D 1 298 ? 49.989  139.568 68.859  1.00 51.39  ? 276  ARG D CA  1 
ATOM   9717  C  C   . ARG D 1 298 ? 49.909  138.047 68.893  1.00 47.88  ? 276  ARG D C   1 
ATOM   9718  O  O   . ARG D 1 298 ? 50.259  137.382 67.925  1.00 45.80  ? 276  ARG D O   1 
ATOM   9719  C  CB  . ARG D 1 298 ? 48.865  140.171 68.008  1.00 55.44  ? 276  ARG D CB  1 
ATOM   9720  C  CG  . ARG D 1 298 ? 48.807  141.705 68.076  1.00 58.92  ? 276  ARG D CG  1 
ATOM   9721  C  CD  . ARG D 1 298 ? 48.642  142.378 66.701  1.00 68.72  ? 276  ARG D CD  1 
ATOM   9722  N  NE  . ARG D 1 298 ? 49.857  143.092 66.287  1.00 69.95  ? 276  ARG D NE  1 
ATOM   9723  C  CZ  . ARG D 1 298 ? 49.935  143.929 65.253  1.00 62.88  ? 276  ARG D CZ  1 
ATOM   9724  N  NH1 . ARG D 1 298 ? 48.868  144.173 64.505  1.00 58.70  ? 276  ARG D NH1 1 
ATOM   9725  N  NH2 . ARG D 1 298 ? 51.083  144.530 64.974  1.00 65.35  ? 276  ARG D NH2 1 
ATOM   9726  N  N   . ILE D 1 299 ? 49.481  137.500 70.026  1.00 45.87  ? 277  ILE D N   1 
ATOM   9727  C  CA  . ILE D 1 299 ? 49.355  136.055 70.194  1.00 43.27  ? 277  ILE D CA  1 
ATOM   9728  C  C   . ILE D 1 299 ? 47.885  135.666 70.073  1.00 39.38  ? 277  ILE D C   1 
ATOM   9729  O  O   . ILE D 1 299 ? 47.028  136.241 70.752  1.00 41.92  ? 277  ILE D O   1 
ATOM   9730  C  CB  . ILE D 1 299 ? 49.890  135.595 71.585  1.00 45.04  ? 277  ILE D CB  1 
ATOM   9731  C  CG1 . ILE D 1 299 ? 51.361  136.002 71.749  1.00 44.78  ? 277  ILE D CG1 1 
ATOM   9732  C  CG2 . ILE D 1 299 ? 49.724  134.083 71.742  1.00 43.67  ? 277  ILE D CG2 1 
ATOM   9733  C  CD1 . ILE D 1 299 ? 52.270  135.505 70.635  1.00 45.57  ? 277  ILE D CD1 1 
ATOM   9734  N  N   . ILE D 1 300 ? 47.601  134.693 69.209  1.00 33.21  ? 278  ILE D N   1 
ATOM   9735  C  CA  . ILE D 1 300 ? 46.233  134.228 68.980  1.00 28.48  ? 278  ILE D CA  1 
ATOM   9736  C  C   . ILE D 1 300 ? 46.099  132.747 69.290  1.00 27.63  ? 278  ILE D C   1 
ATOM   9737  O  O   . ILE D 1 300 ? 46.824  131.932 68.737  1.00 33.79  ? 278  ILE D O   1 
ATOM   9738  C  CB  . ILE D 1 300 ? 45.807  134.441 67.504  1.00 27.31  ? 278  ILE D CB  1 
ATOM   9739  C  CG1 . ILE D 1 300 ? 46.094  135.880 67.065  1.00 19.96  ? 278  ILE D CG1 1 
ATOM   9740  C  CG2 . ILE D 1 300 ? 44.330  134.138 67.348  1.00 23.98  ? 278  ILE D CG2 1 
ATOM   9741  C  CD1 . ILE D 1 300 ? 45.335  136.934 67.831  1.00 25.62  ? 278  ILE D CD1 1 
ATOM   9742  N  N   . GLY D 1 301 ? 45.157  132.403 70.163  1.00 31.08  ? 279  GLY D N   1 
ATOM   9743  C  CA  . GLY D 1 301 ? 44.947  131.014 70.530  1.00 28.97  ? 279  GLY D CA  1 
ATOM   9744  C  C   . GLY D 1 301 ? 43.699  130.437 69.898  1.00 32.30  ? 279  GLY D C   1 
ATOM   9745  O  O   . GLY D 1 301 ? 42.649  131.075 69.894  1.00 36.10  ? 279  GLY D O   1 
ATOM   9746  N  N   . VAL D 1 302 ? 43.811  129.226 69.364  1.00 31.42  ? 280  VAL D N   1 
ATOM   9747  C  CA  . VAL D 1 302 ? 42.687  128.565 68.721  1.00 31.08  ? 280  VAL D CA  1 
ATOM   9748  C  C   . VAL D 1 302 ? 42.181  127.407 69.566  1.00 31.17  ? 280  VAL D C   1 
ATOM   9749  O  O   . VAL D 1 302 ? 42.896  126.430 69.781  1.00 30.05  ? 280  VAL D O   1 
ATOM   9750  C  CB  . VAL D 1 302 ? 43.096  128.050 67.325  1.00 29.77  ? 280  VAL D CB  1 
ATOM   9751  C  CG1 . VAL D 1 302 ? 42.004  127.157 66.743  1.00 25.90  ? 280  VAL D CG1 1 
ATOM   9752  C  CG2 . VAL D 1 302 ? 43.357  129.233 66.411  1.00 30.32  ? 280  VAL D CG2 1 
ATOM   9753  N  N   . ASP D 1 303 ? 40.940  127.520 70.031  1.00 37.30  ? 281  ASP D N   1 
ATOM   9754  C  CA  . ASP D 1 303 ? 40.323  126.489 70.876  1.00 41.36  ? 281  ASP D CA  1 
ATOM   9755  C  C   . ASP D 1 303 ? 39.072  125.916 70.185  1.00 41.36  ? 281  ASP D C   1 
ATOM   9756  O  O   . ASP D 1 303 ? 38.232  126.665 69.684  1.00 43.84  ? 281  ASP D O   1 
ATOM   9757  C  CB  . ASP D 1 303 ? 39.950  127.110 72.236  1.00 39.55  ? 281  ASP D CB  1 
ATOM   9758  C  CG  . ASP D 1 303 ? 39.609  126.074 73.295  1.00 42.58  ? 281  ASP D CG  1 
ATOM   9759  O  OD1 . ASP D 1 303 ? 38.747  126.374 74.152  1.00 34.34  ? 281  ASP D OD1 1 
ATOM   9760  O  OD2 . ASP D 1 303 ? 40.209  124.976 73.289  1.00 40.90  ? 281  ASP D OD2 1 
ATOM   9761  N  N   . PRO D 1 304 ? 38.936  124.581 70.150  1.00 40.80  ? 282  PRO D N   1 
ATOM   9762  C  CA  . PRO D 1 304 ? 37.782  123.943 69.512  1.00 44.35  ? 282  PRO D CA  1 
ATOM   9763  C  C   . PRO D 1 304 ? 36.527  123.970 70.386  1.00 53.47  ? 282  PRO D C   1 
ATOM   9764  O  O   . PRO D 1 304 ? 36.607  123.824 71.612  1.00 57.52  ? 282  PRO D O   1 
ATOM   9765  C  CB  . PRO D 1 304 ? 38.279  122.525 69.276  1.00 43.34  ? 282  PRO D CB  1 
ATOM   9766  C  CG  . PRO D 1 304 ? 39.075  122.269 70.526  1.00 40.99  ? 282  PRO D CG  1 
ATOM   9767  C  CD  . PRO D 1 304 ? 39.865  123.566 70.679  1.00 42.46  ? 282  PRO D CD  1 
ATOM   9768  N  N   . GLU D 1 305 ? 35.370  124.157 69.755  1.00 60.73  ? 283  GLU D N   1 
ATOM   9769  C  CA  . GLU D 1 305 ? 34.105  124.180 70.486  1.00 63.30  ? 283  GLU D CA  1 
ATOM   9770  C  C   . GLU D 1 305 ? 33.945  122.856 71.221  1.00 64.06  ? 283  GLU D C   1 
ATOM   9771  O  O   . GLU D 1 305 ? 34.072  121.787 70.625  1.00 60.17  ? 283  GLU D O   1 
ATOM   9772  C  CB  . GLU D 1 305 ? 32.928  124.390 69.530  1.00 62.93  ? 283  GLU D CB  1 
ATOM   9773  C  CG  . GLU D 1 305 ? 32.867  125.781 68.917  1.00 65.03  ? 283  GLU D CG  1 
ATOM   9774  C  CD  . GLU D 1 305 ? 31.731  125.929 67.916  1.00 71.97  ? 283  GLU D CD  1 
ATOM   9775  O  OE1 . GLU D 1 305 ? 31.606  127.019 67.311  1.00 72.73  ? 283  GLU D OE1 1 
ATOM   9776  O  OE2 . GLU D 1 305 ? 30.963  124.956 67.735  1.00 74.21  ? 283  GLU D OE2 1 
ATOM   9777  N  N   . GLY D 1 306 ? 33.670  122.936 72.519  1.00 65.25  ? 284  GLY D N   1 
ATOM   9778  C  CA  . GLY D 1 306 ? 33.523  121.734 73.321  1.00 65.35  ? 284  GLY D CA  1 
ATOM   9779  C  C   . GLY D 1 306 ? 34.694  121.660 74.277  1.00 63.10  ? 284  GLY D C   1 
ATOM   9780  O  O   . GLY D 1 306 ? 34.852  120.702 75.032  1.00 62.63  ? 284  GLY D O   1 
ATOM   9781  N  N   . SER D 1 307 ? 35.523  122.694 74.223  1.00 60.28  ? 285  SER D N   1 
ATOM   9782  C  CA  . SER D 1 307 ? 36.698  122.805 75.070  1.00 59.37  ? 285  SER D CA  1 
ATOM   9783  C  C   . SER D 1 307 ? 36.492  124.025 75.962  1.00 56.35  ? 285  SER D C   1 
ATOM   9784  O  O   . SER D 1 307 ? 35.687  124.906 75.634  1.00 54.01  ? 285  SER D O   1 
ATOM   9785  C  CB  . SER D 1 307 ? 37.950  122.982 74.205  1.00 63.57  ? 285  SER D CB  1 
ATOM   9786  O  OG  . SER D 1 307 ? 39.118  123.086 75.001  1.00 64.64  ? 285  SER D OG  1 
ATOM   9787  N  N   . ILE D 1 308 ? 37.216  124.081 77.078  1.00 48.95  ? 286  ILE D N   1 
ATOM   9788  C  CA  . ILE D 1 308 ? 37.088  125.194 78.023  1.00 48.08  ? 286  ILE D CA  1 
ATOM   9789  C  C   . ILE D 1 308 ? 38.310  126.106 78.069  1.00 46.42  ? 286  ILE D C   1 
ATOM   9790  O  O   . ILE D 1 308 ? 38.365  127.043 78.868  1.00 44.09  ? 286  ILE D O   1 
ATOM   9791  C  CB  . ILE D 1 308 ? 36.864  124.677 79.458  1.00 45.77  ? 286  ILE D CB  1 
ATOM   9792  C  CG1 . ILE D 1 308 ? 38.086  123.863 79.903  1.00 46.47  ? 286  ILE D CG1 1 
ATOM   9793  C  CG2 . ILE D 1 308 ? 35.602  123.834 79.520  1.00 44.97  ? 286  ILE D CG2 1 
ATOM   9794  C  CD1 . ILE D 1 308 ? 38.085  123.473 81.352  1.00 42.93  ? 286  ILE D CD1 1 
ATOM   9795  N  N   . LEU D 1 309 ? 39.280  125.845 77.206  1.00 47.19  ? 287  LEU D N   1 
ATOM   9796  C  CA  . LEU D 1 309 ? 40.513  126.619 77.210  1.00 44.91  ? 287  LEU D CA  1 
ATOM   9797  C  C   . LEU D 1 309 ? 40.414  128.107 76.901  1.00 45.75  ? 287  LEU D C   1 
ATOM   9798  O  O   . LEU D 1 309 ? 40.974  128.927 77.632  1.00 47.90  ? 287  LEU D O   1 
ATOM   9799  C  CB  . LEU D 1 309 ? 41.535  125.966 76.280  1.00 42.10  ? 287  LEU D CB  1 
ATOM   9800  C  CG  . LEU D 1 309 ? 41.917  124.517 76.604  1.00 37.43  ? 287  LEU D CG  1 
ATOM   9801  C  CD1 . LEU D 1 309 ? 43.091  124.114 75.736  1.00 33.98  ? 287  LEU D CD1 1 
ATOM   9802  C  CD2 . LEU D 1 309 ? 42.283  124.378 78.070  1.00 34.09  ? 287  LEU D CD2 1 
ATOM   9803  N  N   . ALA D 1 310 ? 39.705  128.464 75.835  1.00 44.77  ? 288  ALA D N   1 
ATOM   9804  C  CA  . ALA D 1 310 ? 39.584  129.867 75.449  1.00 44.90  ? 288  ALA D CA  1 
ATOM   9805  C  C   . ALA D 1 310 ? 38.998  130.794 76.509  1.00 45.36  ? 288  ALA D C   1 
ATOM   9806  O  O   . ALA D 1 310 ? 38.293  130.367 77.417  1.00 48.42  ? 288  ALA D O   1 
ATOM   9807  C  CB  . ALA D 1 310 ? 38.773  129.981 74.176  1.00 44.10  ? 288  ALA D CB  1 
ATOM   9808  N  N   . GLU D 1 311 ? 39.311  132.075 76.379  1.00 47.13  ? 289  GLU D N   1 
ATOM   9809  C  CA  . GLU D 1 311 ? 38.805  133.106 77.272  1.00 51.45  ? 289  GLU D CA  1 
ATOM   9810  C  C   . GLU D 1 311 ? 38.333  134.231 76.349  1.00 55.18  ? 289  GLU D C   1 
ATOM   9811  O  O   . GLU D 1 311 ? 38.888  134.427 75.266  1.00 55.21  ? 289  GLU D O   1 
ATOM   9812  C  CB  . GLU D 1 311 ? 39.909  133.633 78.195  1.00 50.55  ? 289  GLU D CB  1 
ATOM   9813  C  CG  . GLU D 1 311 ? 40.668  132.563 78.964  1.00 60.12  ? 289  GLU D CG  1 
ATOM   9814  C  CD  . GLU D 1 311 ? 41.612  133.145 80.008  1.00 62.02  ? 289  GLU D CD  1 
ATOM   9815  O  OE1 . GLU D 1 311 ? 41.136  133.540 81.089  1.00 61.30  ? 289  GLU D OE1 1 
ATOM   9816  O  OE2 . GLU D 1 311 ? 42.831  133.217 79.744  1.00 64.25  ? 289  GLU D OE2 1 
ATOM   9817  N  N   . PRO D 1 312 ? 37.302  134.985 76.758  1.00 59.64  ? 290  PRO D N   1 
ATOM   9818  C  CA  . PRO D 1 312 ? 36.541  134.869 78.009  1.00 60.65  ? 290  PRO D CA  1 
ATOM   9819  C  C   . PRO D 1 312 ? 35.624  133.651 78.063  1.00 60.37  ? 290  PRO D C   1 
ATOM   9820  O  O   . PRO D 1 312 ? 35.602  132.836 77.145  1.00 64.37  ? 290  PRO D O   1 
ATOM   9821  C  CB  . PRO D 1 312 ? 35.752  136.177 78.054  1.00 59.90  ? 290  PRO D CB  1 
ATOM   9822  C  CG  . PRO D 1 312 ? 36.636  137.135 77.282  1.00 61.43  ? 290  PRO D CG  1 
ATOM   9823  C  CD  . PRO D 1 312 ? 37.032  136.280 76.109  1.00 60.60  ? 290  PRO D CD  1 
ATOM   9824  N  N   . GLU D 1 313 ? 34.870  133.541 79.151  1.00 59.92  ? 291  GLU D N   1 
ATOM   9825  C  CA  . GLU D 1 313 ? 33.936  132.439 79.360  1.00 58.17  ? 291  GLU D CA  1 
ATOM   9826  C  C   . GLU D 1 313 ? 32.941  132.245 78.218  1.00 60.70  ? 291  GLU D C   1 
ATOM   9827  O  O   . GLU D 1 313 ? 32.766  131.130 77.720  1.00 57.29  ? 291  GLU D O   1 
ATOM   9828  C  CB  . GLU D 1 313 ? 33.168  132.674 80.657  1.00 58.40  ? 291  GLU D CB  1 
ATOM   9829  C  CG  . GLU D 1 313 ? 33.993  132.426 81.895  1.00 56.90  ? 291  GLU D CG  1 
ATOM   9830  C  CD  . GLU D 1 313 ? 34.149  130.948 82.181  1.00 51.73  ? 291  GLU D CD  1 
ATOM   9831  O  OE1 . GLU D 1 313 ? 34.398  130.179 81.221  1.00 36.40  ? 291  GLU D OE1 1 
ATOM   9832  O  OE2 . GLU D 1 313 ? 34.027  130.567 83.369  1.00 52.85  ? 291  GLU D OE2 1 
ATOM   9833  N  N   . GLU D 1 314 ? 32.282  133.333 77.823  1.00 62.73  ? 292  GLU D N   1 
ATOM   9834  C  CA  . GLU D 1 314 ? 31.291  133.309 76.749  1.00 65.25  ? 292  GLU D CA  1 
ATOM   9835  C  C   . GLU D 1 314 ? 31.706  132.395 75.595  1.00 63.85  ? 292  GLU D C   1 
ATOM   9836  O  O   . GLU D 1 314 ? 30.925  131.564 75.130  1.00 59.27  ? 292  GLU D O   1 
ATOM   9837  C  CB  . GLU D 1 314 ? 31.057  134.726 76.203  1.00 71.85  ? 292  GLU D CB  1 
ATOM   9838  C  CG  . GLU D 1 314 ? 30.604  135.748 77.237  1.00 76.13  ? 292  GLU D CG  1 
ATOM   9839  C  CD  . GLU D 1 314 ? 31.754  136.319 78.049  1.00 80.22  ? 292  GLU D CD  1 
ATOM   9840  O  OE1 . GLU D 1 314 ? 32.617  137.001 77.454  1.00 83.44  ? 292  GLU D OE1 1 
ATOM   9841  O  OE2 . GLU D 1 314 ? 31.793  136.090 79.280  1.00 81.35  ? 292  GLU D OE2 1 
ATOM   9842  N  N   . LEU D 1 315 ? 32.944  132.562 75.140  1.00 62.98  ? 293  LEU D N   1 
ATOM   9843  C  CA  . LEU D 1 315 ? 33.485  131.778 74.041  1.00 61.49  ? 293  LEU D CA  1 
ATOM   9844  C  C   . LEU D 1 315 ? 33.194  130.282 74.132  1.00 62.48  ? 293  LEU D C   1 
ATOM   9845  O  O   . LEU D 1 315 ? 33.007  129.626 73.111  1.00 62.93  ? 293  LEU D O   1 
ATOM   9846  C  CB  . LEU D 1 315 ? 34.997  131.994 73.952  1.00 61.96  ? 293  LEU D CB  1 
ATOM   9847  C  CG  . LEU D 1 315 ? 35.523  133.311 73.368  1.00 61.32  ? 293  LEU D CG  1 
ATOM   9848  C  CD1 . LEU D 1 315 ? 35.176  133.379 71.889  1.00 63.46  ? 293  LEU D CD1 1 
ATOM   9849  C  CD2 . LEU D 1 315 ? 34.946  134.493 74.112  1.00 55.13  ? 293  LEU D CD2 1 
ATOM   9850  N  N   . ASN D 1 316 ? 33.133  129.750 75.349  1.00 63.21  ? 294  ASN D N   1 
ATOM   9851  C  CA  . ASN D 1 316 ? 32.908  128.320 75.548  1.00 65.09  ? 294  ASN D CA  1 
ATOM   9852  C  C   . ASN D 1 316 ? 31.476  127.857 75.828  1.00 67.86  ? 294  ASN D C   1 
ATOM   9853  O  O   . ASN D 1 316 ? 31.281  126.749 76.338  1.00 67.79  ? 294  ASN D O   1 
ATOM   9854  C  CB  . ASN D 1 316 ? 33.805  127.816 76.682  1.00 63.46  ? 294  ASN D CB  1 
ATOM   9855  C  CG  . ASN D 1 316 ? 35.266  128.167 76.473  1.00 64.09  ? 294  ASN D CG  1 
ATOM   9856  O  OD1 . ASN D 1 316 ? 35.835  127.905 75.414  1.00 67.71  ? 294  ASN D OD1 1 
ATOM   9857  N  ND2 . ASN D 1 316 ? 35.885  128.754 77.490  1.00 61.27  ? 294  ASN D ND2 1 
ATOM   9858  N  N   . GLN D 1 317 ? 30.478  128.671 75.489  1.00 70.19  ? 295  GLN D N   1 
ATOM   9859  C  CA  . GLN D 1 317 ? 29.080  128.298 75.748  1.00 70.63  ? 295  GLN D CA  1 
ATOM   9860  C  C   . GLN D 1 317 ? 28.473  127.295 74.758  1.00 69.04  ? 295  GLN D C   1 
ATOM   9861  O  O   . GLN D 1 317 ? 28.045  127.675 73.670  1.00 65.04  ? 295  GLN D O   1 
ATOM   9862  C  CB  . GLN D 1 317 ? 28.193  129.546 75.782  1.00 73.44  ? 295  GLN D CB  1 
ATOM   9863  C  CG  . GLN D 1 317 ? 28.597  130.590 76.797  1.00 79.04  ? 295  GLN D CG  1 
ATOM   9864  C  CD  . GLN D 1 317 ? 27.666  131.795 76.788  1.00 83.41  ? 295  GLN D CD  1 
ATOM   9865  O  OE1 . GLN D 1 317 ? 27.290  132.293 75.729  1.00 86.46  ? 295  GLN D OE1 1 
ATOM   9866  N  NE2 . GLN D 1 317 ? 27.302  132.272 77.969  1.00 86.16  ? 295  GLN D NE2 1 
ATOM   9867  N  N   . THR D 1 318 ? 28.423  126.020 75.146  1.00 70.55  ? 296  THR D N   1 
ATOM   9868  C  CA  . THR D 1 318 ? 27.849  124.976 74.295  1.00 73.41  ? 296  THR D CA  1 
ATOM   9869  C  C   . THR D 1 318 ? 27.701  123.639 75.025  1.00 80.65  ? 296  THR D C   1 
ATOM   9870  O  O   . THR D 1 318 ? 28.250  123.442 76.115  1.00 80.66  ? 296  THR D O   1 
ATOM   9871  C  CB  . THR D 1 318 ? 28.704  124.729 73.029  1.00 70.01  ? 296  THR D CB  1 
ATOM   9872  O  OG1 . THR D 1 318 ? 28.922  125.965 72.343  1.00 65.08  ? 296  THR D OG1 1 
ATOM   9873  C  CG2 . THR D 1 318 ? 27.989  123.782 72.079  1.00 67.46  ? 296  THR D CG2 1 
ATOM   9874  N  N   . GLU D 1 319 ? 26.943  122.727 74.422  1.00 86.33  ? 297  GLU D N   1 
ATOM   9875  C  CA  . GLU D 1 319 ? 26.740  121.405 74.987  1.00 87.60  ? 297  GLU D CA  1 
ATOM   9876  C  C   . GLU D 1 319 ? 27.698  120.450 74.268  1.00 86.34  ? 297  GLU D C   1 
ATOM   9877  O  O   . GLU D 1 319 ? 27.966  119.347 74.750  1.00 87.34  ? 297  GLU D O   1 
ATOM   9878  C  CB  . GLU D 1 319 ? 25.281  120.962 74.796  1.00 87.79  ? 297  GLU D CB  1 
ATOM   9879  C  CG  . GLU D 1 319 ? 24.418  121.104 76.051  1.00 87.25  ? 297  GLU D CG  1 
ATOM   9880  C  CD  . GLU D 1 319 ? 24.644  119.980 77.053  1.00 87.47  ? 297  GLU D CD  1 
ATOM   9881  O  OE1 . GLU D 1 319 ? 24.363  118.817 76.694  1.00 90.95  ? 297  GLU D OE1 1 
ATOM   9882  O  OE2 . GLU D 1 319 ? 25.097  120.249 78.189  1.00 86.62  ? 297  GLU D OE2 1 
ATOM   9883  N  N   . GLN D 1 320 ? 28.213  120.882 73.115  1.00 84.29  ? 298  GLN D N   1 
ATOM   9884  C  CA  . GLN D 1 320 ? 29.168  120.070 72.371  1.00 80.57  ? 298  GLN D CA  1 
ATOM   9885  C  C   . GLN D 1 320 ? 30.217  119.738 73.397  1.00 79.33  ? 298  GLN D C   1 
ATOM   9886  O  O   . GLN D 1 320 ? 30.784  120.636 74.029  1.00 77.01  ? 298  GLN D O   1 
ATOM   9887  C  CB  . GLN D 1 320 ? 29.902  120.859 71.284  1.00 82.65  ? 298  GLN D CB  1 
ATOM   9888  C  CG  . GLN D 1 320 ? 29.043  121.493 70.219  1.00 80.42  ? 298  GLN D CG  1 
ATOM   9889  C  CD  . GLN D 1 320 ? 28.533  120.480 69.201  1.00 80.42  ? 298  GLN D CD  1 
ATOM   9890  O  OE1 . GLN D 1 320 ? 29.307  119.750 68.598  1.00 79.63  ? 298  GLN D OE1 1 
ATOM   9891  N  NE2 . GLN D 1 320 ? 27.224  120.423 69.027  1.00 77.09  ? 298  GLN D NE2 1 
ATOM   9892  N  N   . THR D 1 321 ? 30.497  118.465 73.580  1.00 78.81  ? 299  THR D N   1 
ATOM   9893  C  CA  . THR D 1 321 ? 31.521  118.124 74.544  1.00 79.41  ? 299  THR D CA  1 
ATOM   9894  C  C   . THR D 1 321 ? 32.567  117.380 73.725  1.00 77.70  ? 299  THR D C   1 
ATOM   9895  O  O   . THR D 1 321 ? 33.743  117.280 74.099  1.00 77.80  ? 299  THR D O   1 
ATOM   9896  C  CB  . THR D 1 321 ? 30.920  117.242 75.663  1.00 81.81  ? 299  THR D CB  1 
ATOM   9897  O  OG1 . THR D 1 321 ? 31.077  117.892 76.930  1.00 82.55  ? 299  THR D OG1 1 
ATOM   9898  C  CG2 . THR D 1 321 ? 31.572  115.867 75.698  1.00 80.94  ? 299  THR D CG2 1 
ATOM   9899  N  N   . THR D 1 322 ? 32.114  116.911 72.564  1.00 74.69  ? 300  THR D N   1 
ATOM   9900  C  CA  . THR D 1 322 ? 32.945  116.138 71.657  1.00 67.71  ? 300  THR D CA  1 
ATOM   9901  C  C   . THR D 1 322 ? 33.091  116.714 70.262  1.00 62.70  ? 300  THR D C   1 
ATOM   9902  O  O   . THR D 1 322 ? 32.180  117.352 69.729  1.00 60.55  ? 300  THR D O   1 
ATOM   9903  C  CB  . THR D 1 322 ? 32.397  114.731 71.519  1.00 67.98  ? 300  THR D CB  1 
ATOM   9904  O  OG1 . THR D 1 322 ? 31.015  114.799 71.158  1.00 67.40  ? 300  THR D OG1 1 
ATOM   9905  C  CG2 . THR D 1 322 ? 32.539  113.967 72.823  1.00 68.59  ? 300  THR D CG2 1 
ATOM   9906  N  N   . TYR D 1 323 ? 34.256  116.444 69.684  1.00 59.20  ? 301  TYR D N   1 
ATOM   9907  C  CA  . TYR D 1 323 ? 34.609  116.870 68.338  1.00 50.17  ? 301  TYR D CA  1 
ATOM   9908  C  C   . TYR D 1 323 ? 35.609  115.861 67.790  1.00 47.94  ? 301  TYR D C   1 
ATOM   9909  O  O   . TYR D 1 323 ? 36.209  115.096 68.553  1.00 43.32  ? 301  TYR D O   1 
ATOM   9910  C  CB  . TYR D 1 323 ? 35.213  118.281 68.352  1.00 53.57  ? 301  TYR D CB  1 
ATOM   9911  C  CG  . TYR D 1 323 ? 36.182  118.522 69.485  1.00 48.68  ? 301  TYR D CG  1 
ATOM   9912  C  CD1 . TYR D 1 323 ? 37.442  117.946 69.479  1.00 43.37  ? 301  TYR D CD1 1 
ATOM   9913  C  CD2 . TYR D 1 323 ? 35.817  119.297 70.580  1.00 54.61  ? 301  TYR D CD2 1 
ATOM   9914  C  CE1 . TYR D 1 323 ? 38.318  118.132 70.535  1.00 50.63  ? 301  TYR D CE1 1 
ATOM   9915  C  CE2 . TYR D 1 323 ? 36.684  119.491 71.648  1.00 54.20  ? 301  TYR D CE2 1 
ATOM   9916  C  CZ  . TYR D 1 323 ? 37.928  118.905 71.617  1.00 51.92  ? 301  TYR D CZ  1 
ATOM   9917  O  OH  . TYR D 1 323 ? 38.767  119.096 72.689  1.00 47.29  ? 301  TYR D OH  1 
ATOM   9918  N  N   . GLU D 1 324 ? 35.788  115.874 66.471  1.00 41.34  ? 302  GLU D N   1 
ATOM   9919  C  CA  . GLU D 1 324 ? 36.670  114.934 65.794  1.00 39.16  ? 302  GLU D CA  1 
ATOM   9920  C  C   . GLU D 1 324 ? 38.132  115.344 65.637  1.00 37.29  ? 302  GLU D C   1 
ATOM   9921  O  O   . GLU D 1 324 ? 38.995  114.481 65.444  1.00 34.42  ? 302  GLU D O   1 
ATOM   9922  C  CB  . GLU D 1 324 ? 36.098  114.609 64.412  1.00 41.95  ? 302  GLU D CB  1 
ATOM   9923  C  CG  . GLU D 1 324 ? 34.681  114.046 64.407  1.00 43.33  ? 302  GLU D CG  1 
ATOM   9924  C  CD  . GLU D 1 324 ? 34.600  112.638 64.964  1.00 42.01  ? 302  GLU D CD  1 
ATOM   9925  O  OE1 . GLU D 1 324 ? 35.624  111.920 64.922  1.00 39.10  ? 302  GLU D OE1 1 
ATOM   9926  O  OE2 . GLU D 1 324 ? 33.505  112.244 65.428  1.00 49.27  ? 302  GLU D OE2 1 
ATOM   9927  N  N   . VAL D 1 325 ? 38.420  116.643 65.694  1.00 33.37  ? 303  VAL D N   1 
ATOM   9928  C  CA  . VAL D 1 325 ? 39.799  117.101 65.539  1.00 32.28  ? 303  VAL D CA  1 
ATOM   9929  C  C   . VAL D 1 325 ? 40.649  116.655 66.710  1.00 35.47  ? 303  VAL D C   1 
ATOM   9930  O  O   . VAL D 1 325 ? 40.304  116.887 67.868  1.00 39.35  ? 303  VAL D O   1 
ATOM   9931  C  CB  . VAL D 1 325 ? 39.891  118.630 65.415  1.00 29.50  ? 303  VAL D CB  1 
ATOM   9932  C  CG1 . VAL D 1 325 ? 39.595  119.052 63.994  1.00 21.80  ? 303  VAL D CG1 1 
ATOM   9933  C  CG2 . VAL D 1 325 ? 38.924  119.284 66.374  1.00 33.95  ? 303  VAL D CG2 1 
ATOM   9934  N  N   . GLU D 1 326 ? 41.775  116.024 66.399  1.00 37.35  ? 304  GLU D N   1 
ATOM   9935  C  CA  . GLU D 1 326 ? 42.671  115.501 67.425  1.00 37.17  ? 304  GLU D CA  1 
ATOM   9936  C  C   . GLU D 1 326 ? 43.810  116.425 67.850  1.00 36.68  ? 304  GLU D C   1 
ATOM   9937  O  O   . GLU D 1 326 ? 44.310  117.228 67.062  1.00 37.08  ? 304  GLU D O   1 
ATOM   9938  C  CB  . GLU D 1 326 ? 43.251  114.166 66.954  1.00 32.30  ? 304  GLU D CB  1 
ATOM   9939  C  CG  . GLU D 1 326 ? 42.204  113.228 66.390  1.00 40.48  ? 304  GLU D CG  1 
ATOM   9940  C  CD  . GLU D 1 326 ? 42.774  111.889 65.986  1.00 50.59  ? 304  GLU D CD  1 
ATOM   9941  O  OE1 . GLU D 1 326 ? 42.279  111.309 64.994  1.00 59.53  ? 304  GLU D OE1 1 
ATOM   9942  O  OE2 . GLU D 1 326 ? 43.710  111.410 66.664  1.00 53.77  ? 304  GLU D OE2 1 
ATOM   9943  N  N   . GLY D 1 327 ? 44.197  116.306 69.119  1.00 34.95  ? 305  GLY D N   1 
ATOM   9944  C  CA  . GLY D 1 327 ? 45.293  117.092 69.657  1.00 32.48  ? 305  GLY D CA  1 
ATOM   9945  C  C   . GLY D 1 327 ? 44.999  118.448 70.268  1.00 29.76  ? 305  GLY D C   1 
ATOM   9946  O  O   . GLY D 1 327 ? 45.875  119.020 70.904  1.00 30.48  ? 305  GLY D O   1 
ATOM   9947  N  N   . ILE D 1 328 ? 43.792  118.969 70.096  1.00 29.09  ? 306  ILE D N   1 
ATOM   9948  C  CA  . ILE D 1 328 ? 43.473  120.282 70.645  1.00 32.66  ? 306  ILE D CA  1 
ATOM   9949  C  C   . ILE D 1 328 ? 42.256  120.293 71.555  1.00 32.89  ? 306  ILE D C   1 
ATOM   9950  O  O   . ILE D 1 328 ? 41.363  119.461 71.435  1.00 30.36  ? 306  ILE D O   1 
ATOM   9951  C  CB  . ILE D 1 328 ? 43.241  121.316 69.526  1.00 35.95  ? 306  ILE D CB  1 
ATOM   9952  C  CG1 . ILE D 1 328 ? 42.212  120.784 68.525  1.00 33.28  ? 306  ILE D CG1 1 
ATOM   9953  C  CG2 . ILE D 1 328 ? 44.543  121.621 68.827  1.00 41.70  ? 306  ILE D CG2 1 
ATOM   9954  C  CD1 . ILE D 1 328 ? 41.732  121.831 67.539  1.00 27.12  ? 306  ILE D CD1 1 
ATOM   9955  N  N   . GLY D 1 329 ? 42.228  121.263 72.459  1.00 35.25  ? 307  GLY D N   1 
ATOM   9956  C  CA  . GLY D 1 329 ? 41.130  121.370 73.396  1.00 41.13  ? 307  GLY D CA  1 
ATOM   9957  C  C   . GLY D 1 329 ? 41.369  120.482 74.603  1.00 46.76  ? 307  GLY D C   1 
ATOM   9958  O  O   . GLY D 1 329 ? 42.273  119.635 74.593  1.00 41.39  ? 307  GLY D O   1 
ATOM   9959  N  N   . TYR D 1 330 ? 40.558  120.674 75.642  1.00 49.22  ? 308  TYR D N   1 
ATOM   9960  C  CA  . TYR D 1 330 ? 40.663  119.895 76.877  1.00 48.59  ? 308  TYR D CA  1 
ATOM   9961  C  C   . TYR D 1 330 ? 39.561  120.372 77.831  1.00 51.17  ? 308  TYR D C   1 
ATOM   9962  O  O   . TYR D 1 330 ? 39.072  121.501 77.713  1.00 47.66  ? 308  TYR D O   1 
ATOM   9963  C  CB  . TYR D 1 330 ? 42.035  120.124 77.510  1.00 48.49  ? 308  TYR D CB  1 
ATOM   9964  C  CG  . TYR D 1 330 ? 42.575  118.967 78.316  1.00 47.59  ? 308  TYR D CG  1 
ATOM   9965  C  CD1 . TYR D 1 330 ? 42.777  117.720 77.729  1.00 41.84  ? 308  TYR D CD1 1 
ATOM   9966  C  CD2 . TYR D 1 330 ? 42.949  119.138 79.656  1.00 48.72  ? 308  TYR D CD2 1 
ATOM   9967  C  CE1 . TYR D 1 330 ? 43.346  116.674 78.454  1.00 45.79  ? 308  TYR D CE1 1 
ATOM   9968  C  CE2 . TYR D 1 330 ? 43.518  118.102 80.394  1.00 44.74  ? 308  TYR D CE2 1 
ATOM   9969  C  CZ  . TYR D 1 330 ? 43.716  116.875 79.787  1.00 48.15  ? 308  TYR D CZ  1 
ATOM   9970  O  OH  . TYR D 1 330 ? 44.302  115.854 80.502  1.00 51.73  ? 308  TYR D OH  1 
ATOM   9971  N  N   . ASP D 1 331 ? 39.161  119.517 78.766  1.00 53.17  ? 309  ASP D N   1 
ATOM   9972  C  CA  . ASP D 1 331 ? 38.125  119.891 79.726  1.00 52.76  ? 309  ASP D CA  1 
ATOM   9973  C  C   . ASP D 1 331 ? 38.732  120.320 81.050  1.00 52.38  ? 309  ASP D C   1 
ATOM   9974  O  O   . ASP D 1 331 ? 38.044  120.406 82.059  1.00 52.81  ? 309  ASP D O   1 
ATOM   9975  C  CB  . ASP D 1 331 ? 37.148  118.734 79.946  1.00 51.43  ? 309  ASP D CB  1 
ATOM   9976  C  CG  . ASP D 1 331 ? 37.776  117.384 79.689  1.00 60.62  ? 309  ASP D CG  1 
ATOM   9977  O  OD1 . ASP D 1 331 ? 38.825  117.080 80.303  1.00 63.84  ? 309  ASP D OD1 1 
ATOM   9978  O  OD2 . ASP D 1 331 ? 37.213  116.624 78.866  1.00 66.84  ? 309  ASP D OD2 1 
ATOM   9979  N  N   . PHE D 1 332 ? 40.033  120.589 81.024  1.00 55.17  ? 310  PHE D N   1 
ATOM   9980  C  CA  . PHE D 1 332 ? 40.787  121.030 82.192  1.00 55.19  ? 310  PHE D CA  1 
ATOM   9981  C  C   . PHE D 1 332 ? 41.846  122.000 81.699  1.00 51.82  ? 310  PHE D C   1 
ATOM   9982  O  O   . PHE D 1 332 ? 42.324  121.881 80.577  1.00 51.51  ? 310  PHE D O   1 
ATOM   9983  C  CB  . PHE D 1 332 ? 41.487  119.849 82.872  1.00 58.90  ? 310  PHE D CB  1 
ATOM   9984  C  CG  . PHE D 1 332 ? 40.554  118.900 83.564  1.00 68.22  ? 310  PHE D CG  1 
ATOM   9985  C  CD1 . PHE D 1 332 ? 40.439  117.581 83.132  1.00 72.81  ? 310  PHE D CD1 1 
ATOM   9986  C  CD2 . PHE D 1 332 ? 39.797  119.317 84.658  1.00 70.56  ? 310  PHE D CD2 1 
ATOM   9987  C  CE1 . PHE D 1 332 ? 39.584  116.687 83.780  1.00 73.03  ? 310  PHE D CE1 1 
ATOM   9988  C  CE2 . PHE D 1 332 ? 38.938  118.433 85.315  1.00 72.56  ? 310  PHE D CE2 1 
ATOM   9989  C  CZ  . PHE D 1 332 ? 38.832  117.115 84.874  1.00 75.08  ? 310  PHE D CZ  1 
ATOM   9990  N  N   . ILE D 1 333 ? 42.213  122.967 82.525  1.00 50.17  ? 311  ILE D N   1 
ATOM   9991  C  CA  . ILE D 1 333 ? 43.241  123.906 82.116  1.00 44.50  ? 311  ILE D CA  1 
ATOM   9992  C  C   . ILE D 1 333 ? 44.595  123.308 82.490  1.00 43.12  ? 311  ILE D C   1 
ATOM   9993  O  O   . ILE D 1 333 ? 44.969  123.277 83.669  1.00 39.79  ? 311  ILE D O   1 
ATOM   9994  C  CB  . ILE D 1 333 ? 43.059  125.263 82.802  1.00 38.64  ? 311  ILE D CB  1 
ATOM   9995  C  CG1 . ILE D 1 333 ? 41.675  125.810 82.464  1.00 37.15  ? 311  ILE D CG1 1 
ATOM   9996  C  CG2 . ILE D 1 333 ? 44.149  126.229 82.352  1.00 36.19  ? 311  ILE D CG2 1 
ATOM   9997  C  CD1 . ILE D 1 333 ? 41.457  127.227 82.915  1.00 45.84  ? 311  ILE D CD1 1 
ATOM   9998  N  N   . PRO D 1 334 ? 45.336  122.794 81.487  1.00 43.25  ? 312  PRO D N   1 
ATOM   9999  C  CA  . PRO D 1 334 ? 46.649  122.201 81.759  1.00 41.61  ? 312  PRO D CA  1 
ATOM   10000 C  C   . PRO D 1 334 ? 47.487  123.193 82.543  1.00 41.84  ? 312  PRO D C   1 
ATOM   10001 O  O   . PRO D 1 334 ? 47.370  124.406 82.353  1.00 39.02  ? 312  PRO D O   1 
ATOM   10002 C  CB  . PRO D 1 334 ? 47.210  121.947 80.360  1.00 45.60  ? 312  PRO D CB  1 
ATOM   10003 C  CG  . PRO D 1 334 ? 45.983  121.708 79.541  1.00 39.31  ? 312  PRO D CG  1 
ATOM   10004 C  CD  . PRO D 1 334 ? 45.054  122.787 80.037  1.00 39.25  ? 312  PRO D CD  1 
ATOM   10005 N  N   . THR D 1 335 ? 48.331  122.679 83.426  1.00 45.24  ? 313  THR D N   1 
ATOM   10006 C  CA  . THR D 1 335 ? 49.172  123.536 84.244  1.00 39.15  ? 313  THR D CA  1 
ATOM   10007 C  C   . THR D 1 335 ? 50.323  124.151 83.442  1.00 42.05  ? 313  THR D C   1 
ATOM   10008 O  O   . THR D 1 335 ? 50.836  125.214 83.807  1.00 42.46  ? 313  THR D O   1 
ATOM   10009 C  CB  . THR D 1 335 ? 49.691  122.751 85.471  1.00 38.56  ? 313  THR D CB  1 
ATOM   10010 O  OG1 . THR D 1 335 ? 51.046  123.106 85.749  1.00 36.95  ? 313  THR D OG1 1 
ATOM   10011 C  CG2 . THR D 1 335 ? 49.589  121.266 85.225  1.00 39.95  ? 313  THR D CG2 1 
ATOM   10012 N  N   . VAL D 1 336 ? 50.714  123.508 82.337  1.00 41.36  ? 314  VAL D N   1 
ATOM   10013 C  CA  . VAL D 1 336 ? 51.803  124.035 81.501  1.00 40.37  ? 314  VAL D CA  1 
ATOM   10014 C  C   . VAL D 1 336 ? 51.350  125.220 80.659  1.00 39.13  ? 314  VAL D C   1 
ATOM   10015 O  O   . VAL D 1 336 ? 52.175  125.937 80.098  1.00 43.82  ? 314  VAL D O   1 
ATOM   10016 C  CB  . VAL D 1 336 ? 52.387  122.966 80.545  1.00 33.39  ? 314  VAL D CB  1 
ATOM   10017 C  CG1 . VAL D 1 336 ? 53.057  121.851 81.350  1.00 37.12  ? 314  VAL D CG1 1 
ATOM   10018 C  CG2 . VAL D 1 336 ? 51.298  122.409 79.656  1.00 36.23  ? 314  VAL D CG2 1 
ATOM   10019 N  N   . LEU D 1 337 ? 50.037  125.423 80.589  1.00 39.37  ? 315  LEU D N   1 
ATOM   10020 C  CA  . LEU D 1 337 ? 49.439  126.524 79.829  1.00 37.16  ? 315  LEU D CA  1 
ATOM   10021 C  C   . LEU D 1 337 ? 49.316  127.829 80.618  1.00 33.20  ? 315  LEU D C   1 
ATOM   10022 O  O   . LEU D 1 337 ? 48.761  127.857 81.711  1.00 44.57  ? 315  LEU D O   1 
ATOM   10023 C  CB  . LEU D 1 337 ? 48.046  126.120 79.330  1.00 36.00  ? 315  LEU D CB  1 
ATOM   10024 C  CG  . LEU D 1 337 ? 47.118  127.248 78.862  1.00 40.02  ? 315  LEU D CG  1 
ATOM   10025 C  CD1 . LEU D 1 337 ? 47.738  127.988 77.675  1.00 40.21  ? 315  LEU D CD1 1 
ATOM   10026 C  CD2 . LEU D 1 337 ? 45.766  126.664 78.480  1.00 29.08  ? 315  LEU D CD2 1 
ATOM   10027 N  N   . ASP D 1 338 ? 49.828  128.910 80.047  1.00 32.62  ? 316  ASP D N   1 
ATOM   10028 C  CA  . ASP D 1 338 ? 49.775  130.231 80.664  1.00 33.18  ? 316  ASP D CA  1 
ATOM   10029 C  C   . ASP D 1 338 ? 48.858  131.069 79.772  1.00 28.26  ? 316  ASP D C   1 
ATOM   10030 O  O   . ASP D 1 338 ? 49.309  131.702 78.824  1.00 30.18  ? 316  ASP D O   1 
ATOM   10031 C  CB  . ASP D 1 338 ? 51.198  130.820 80.715  1.00 37.01  ? 316  ASP D CB  1 
ATOM   10032 C  CG  . ASP D 1 338 ? 51.246  132.229 81.302  1.00 44.02  ? 316  ASP D CG  1 
ATOM   10033 O  OD1 . ASP D 1 338 ? 52.381  132.748 81.490  1.00 30.46  ? 316  ASP D OD1 1 
ATOM   10034 O  OD2 . ASP D 1 338 ? 50.162  132.808 81.563  1.00 39.84  ? 316  ASP D OD2 1 
ATOM   10035 N  N   . ARG D 1 339 ? 47.564  131.050 80.057  1.00 28.31  ? 317  ARG D N   1 
ATOM   10036 C  CA  . ARG D 1 339 ? 46.598  131.803 79.252  1.00 26.79  ? 317  ARG D CA  1 
ATOM   10037 C  C   . ARG D 1 339 ? 46.840  133.311 79.282  1.00 24.93  ? 317  ARG D C   1 
ATOM   10038 O  O   . ARG D 1 339 ? 46.223  134.054 78.542  1.00 25.91  ? 317  ARG D O   1 
ATOM   10039 C  CB  . ARG D 1 339 ? 45.181  131.545 79.750  1.00 29.67  ? 317  ARG D CB  1 
ATOM   10040 C  CG  . ARG D 1 339 ? 44.721  130.112 79.713  1.00 37.21  ? 317  ARG D CG  1 
ATOM   10041 C  CD  . ARG D 1 339 ? 43.626  129.936 80.759  1.00 52.90  ? 317  ARG D CD  1 
ATOM   10042 N  NE  . ARG D 1 339 ? 42.341  129.521 80.202  1.00 59.16  ? 317  ARG D NE  1 
ATOM   10043 C  CZ  . ARG D 1 339 ? 41.201  129.550 80.881  1.00 58.95  ? 317  ARG D CZ  1 
ATOM   10044 N  NH1 . ARG D 1 339 ? 41.196  129.983 82.137  1.00 57.33  ? 317  ARG D NH1 1 
ATOM   10045 N  NH2 . ARG D 1 339 ? 40.078  129.127 80.316  1.00 59.46  ? 317  ARG D NH2 1 
ATOM   10046 N  N   . THR D 1 340 ? 47.728  133.752 80.157  1.00 30.00  ? 318  THR D N   1 
ATOM   10047 C  CA  . THR D 1 340 ? 48.043  135.164 80.313  1.00 31.21  ? 318  THR D CA  1 
ATOM   10048 C  C   . THR D 1 340 ? 48.744  135.792 79.117  1.00 37.65  ? 318  THR D C   1 
ATOM   10049 O  O   . THR D 1 340 ? 48.613  136.993 78.881  1.00 38.58  ? 318  THR D O   1 
ATOM   10050 C  CB  . THR D 1 340 ? 48.922  135.367 81.564  1.00 30.35  ? 318  THR D CB  1 
ATOM   10051 O  OG1 . THR D 1 340 ? 48.078  135.445 82.715  1.00 29.87  ? 318  THR D OG1 1 
ATOM   10052 C  CG2 . THR D 1 340 ? 49.769  136.621 81.457  1.00 32.01  ? 318  THR D CG2 1 
ATOM   10053 N  N   . VAL D 1 341 ? 49.487  134.987 78.369  1.00 39.00  ? 319  VAL D N   1 
ATOM   10054 C  CA  . VAL D 1 341 ? 50.221  135.495 77.225  1.00 42.84  ? 319  VAL D CA  1 
ATOM   10055 C  C   . VAL D 1 341 ? 49.461  135.391 75.901  1.00 41.74  ? 319  VAL D C   1 
ATOM   10056 O  O   . VAL D 1 341 ? 49.967  135.790 74.847  1.00 44.22  ? 319  VAL D O   1 
ATOM   10057 C  CB  . VAL D 1 341 ? 51.570  134.771 77.104  1.00 48.76  ? 319  VAL D CB  1 
ATOM   10058 C  CG1 . VAL D 1 341 ? 52.457  135.146 78.280  1.00 51.83  ? 319  VAL D CG1 1 
ATOM   10059 C  CG2 . VAL D 1 341 ? 51.347  133.262 77.091  1.00 44.05  ? 319  VAL D CG2 1 
ATOM   10060 N  N   . VAL D 1 342 ? 48.249  134.847 75.954  1.00 37.02  ? 320  VAL D N   1 
ATOM   10061 C  CA  . VAL D 1 342 ? 47.424  134.716 74.761  1.00 31.23  ? 320  VAL D CA  1 
ATOM   10062 C  C   . VAL D 1 342 ? 46.599  135.988 74.656  1.00 35.31  ? 320  VAL D C   1 
ATOM   10063 O  O   . VAL D 1 342 ? 45.739  136.239 75.495  1.00 43.71  ? 320  VAL D O   1 
ATOM   10064 C  CB  . VAL D 1 342 ? 46.473  133.517 74.863  1.00 24.03  ? 320  VAL D CB  1 
ATOM   10065 C  CG1 . VAL D 1 342 ? 45.592  133.452 73.630  1.00 28.10  ? 320  VAL D CG1 1 
ATOM   10066 C  CG2 . VAL D 1 342 ? 47.270  132.234 75.003  1.00 25.45  ? 320  VAL D CG2 1 
ATOM   10067 N  N   . ASP D 1 343 ? 46.854  136.789 73.627  1.00 39.46  ? 321  ASP D N   1 
ATOM   10068 C  CA  . ASP D 1 343 ? 46.143  138.050 73.453  1.00 38.60  ? 321  ASP D CA  1 
ATOM   10069 C  C   . ASP D 1 343 ? 44.674  137.933 73.095  1.00 40.91  ? 321  ASP D C   1 
ATOM   10070 O  O   . ASP D 1 343 ? 43.893  138.824 73.407  1.00 39.27  ? 321  ASP D O   1 
ATOM   10071 C  CB  . ASP D 1 343 ? 46.847  138.914 72.410  1.00 40.31  ? 321  ASP D CB  1 
ATOM   10072 C  CG  . ASP D 1 343 ? 48.185  139.411 72.888  1.00 46.19  ? 321  ASP D CG  1 
ATOM   10073 O  OD1 . ASP D 1 343 ? 48.242  139.920 74.024  1.00 51.13  ? 321  ASP D OD1 1 
ATOM   10074 O  OD2 . ASP D 1 343 ? 49.173  139.299 72.131  1.00 50.66  ? 321  ASP D OD2 1 
ATOM   10075 N  N   . LYS D 1 344 ? 44.288  136.841 72.450  1.00 44.51  ? 322  LYS D N   1 
ATOM   10076 C  CA  . LYS D 1 344 ? 42.898  136.674 72.057  1.00 43.69  ? 322  LYS D CA  1 
ATOM   10077 C  C   . LYS D 1 344 ? 42.649  135.269 71.567  1.00 44.92  ? 322  LYS D C   1 
ATOM   10078 O  O   . LYS D 1 344 ? 43.519  134.650 70.954  1.00 42.45  ? 322  LYS D O   1 
ATOM   10079 C  CB  . LYS D 1 344 ? 42.544  137.668 70.947  1.00 53.91  ? 322  LYS D CB  1 
ATOM   10080 C  CG  . LYS D 1 344 ? 41.104  137.581 70.443  1.00 56.88  ? 322  LYS D CG  1 
ATOM   10081 C  CD  . LYS D 1 344 ? 40.850  138.620 69.368  1.00 59.92  ? 322  LYS D CD  1 
ATOM   10082 C  CE  . LYS D 1 344 ? 39.453  138.491 68.798  1.00 64.74  ? 322  LYS D CE  1 
ATOM   10083 N  NZ  . LYS D 1 344 ? 39.246  139.430 67.654  1.00 74.24  ? 322  LYS D NZ  1 
ATOM   10084 N  N   . TRP D 1 345 ? 41.449  134.770 71.830  1.00 46.72  ? 323  TRP D N   1 
ATOM   10085 C  CA  . TRP D 1 345 ? 41.093  133.427 71.419  1.00 45.08  ? 323  TRP D CA  1 
ATOM   10086 C  C   . TRP D 1 345 ? 39.997  133.420 70.365  1.00 46.69  ? 323  TRP D C   1 
ATOM   10087 O  O   . TRP D 1 345 ? 39.267  134.397 70.195  1.00 51.79  ? 323  TRP D O   1 
ATOM   10088 C  CB  . TRP D 1 345 ? 40.612  132.600 72.617  1.00 41.63  ? 323  TRP D CB  1 
ATOM   10089 C  CG  . TRP D 1 345 ? 41.619  132.365 73.702  1.00 35.78  ? 323  TRP D CG  1 
ATOM   10090 C  CD1 . TRP D 1 345 ? 42.012  133.252 74.663  1.00 34.50  ? 323  TRP D CD1 1 
ATOM   10091 C  CD2 . TRP D 1 345 ? 42.313  131.142 73.976  1.00 33.35  ? 323  TRP D CD2 1 
ATOM   10092 N  NE1 . TRP D 1 345 ? 42.903  132.656 75.525  1.00 33.78  ? 323  TRP D NE1 1 
ATOM   10093 C  CE2 . TRP D 1 345 ? 43.105  131.360 75.127  1.00 35.06  ? 323  TRP D CE2 1 
ATOM   10094 C  CE3 . TRP D 1 345 ? 42.340  129.882 73.363  1.00 27.34  ? 323  TRP D CE3 1 
ATOM   10095 C  CZ2 . TRP D 1 345 ? 43.918  130.360 75.681  1.00 27.68  ? 323  TRP D CZ2 1 
ATOM   10096 C  CZ3 . TRP D 1 345 ? 43.148  128.886 73.915  1.00 31.18  ? 323  TRP D CZ3 1 
ATOM   10097 C  CH2 . TRP D 1 345 ? 43.926  129.133 75.064  1.00 22.25  ? 323  TRP D CH2 1 
ATOM   10098 N  N   . PHE D 1 346 ? 39.910  132.293 69.665  1.00 45.21  ? 324  PHE D N   1 
ATOM   10099 C  CA  . PHE D 1 346 ? 38.911  132.039 68.635  1.00 40.27  ? 324  PHE D CA  1 
ATOM   10100 C  C   . PHE D 1 346 ? 38.557  130.571 68.796  1.00 39.74  ? 324  PHE D C   1 
ATOM   10101 O  O   . PHE D 1 346 ? 39.426  129.742 69.079  1.00 38.23  ? 324  PHE D O   1 
ATOM   10102 C  CB  . PHE D 1 346 ? 39.471  132.229 67.219  1.00 38.42  ? 324  PHE D CB  1 
ATOM   10103 C  CG  . PHE D 1 346 ? 39.625  133.660 66.803  1.00 35.75  ? 324  PHE D CG  1 
ATOM   10104 C  CD1 . PHE D 1 346 ? 40.716  134.412 67.224  1.00 32.72  ? 324  PHE D CD1 1 
ATOM   10105 C  CD2 . PHE D 1 346 ? 38.682  134.253 65.967  1.00 36.98  ? 324  PHE D CD2 1 
ATOM   10106 C  CE1 . PHE D 1 346 ? 40.869  135.739 66.815  1.00 29.82  ? 324  PHE D CE1 1 
ATOM   10107 C  CE2 . PHE D 1 346 ? 38.823  135.577 65.550  1.00 32.56  ? 324  PHE D CE2 1 
ATOM   10108 C  CZ  . PHE D 1 346 ? 39.918  136.324 65.974  1.00 25.04  ? 324  PHE D CZ  1 
ATOM   10109 N  N   . LYS D 1 347 ? 37.285  130.248 68.626  1.00 36.35  ? 325  LYS D N   1 
ATOM   10110 C  CA  . LYS D 1 347 ? 36.858  128.869 68.730  1.00 36.50  ? 325  LYS D CA  1 
ATOM   10111 C  C   . LYS D 1 347 ? 36.737  128.376 67.296  1.00 37.87  ? 325  LYS D C   1 
ATOM   10112 O  O   . LYS D 1 347 ? 36.544  129.168 66.374  1.00 37.21  ? 325  LYS D O   1 
ATOM   10113 C  CB  . LYS D 1 347 ? 35.500  128.781 69.435  1.00 43.09  ? 325  LYS D CB  1 
ATOM   10114 C  CG  . LYS D 1 347 ? 35.463  129.396 70.837  1.00 52.19  ? 325  LYS D CG  1 
ATOM   10115 C  CD  . LYS D 1 347 ? 36.171  128.537 71.876  1.00 54.99  ? 325  LYS D CD  1 
ATOM   10116 C  CE  . LYS D 1 347 ? 35.473  127.200 72.056  1.00 54.44  ? 325  LYS D CE  1 
ATOM   10117 N  NZ  . LYS D 1 347 ? 36.050  126.415 73.185  1.00 58.58  ? 325  LYS D NZ  1 
ATOM   10118 N  N   . SER D 1 348 ? 36.876  127.077 67.095  1.00 38.13  ? 326  SER D N   1 
ATOM   10119 C  CA  . SER D 1 348 ? 36.752  126.529 65.758  1.00 39.38  ? 326  SER D CA  1 
ATOM   10120 C  C   . SER D 1 348 ? 35.892  125.282 65.857  1.00 39.98  ? 326  SER D C   1 
ATOM   10121 O  O   . SER D 1 348 ? 35.569  124.836 66.955  1.00 36.77  ? 326  SER D O   1 
ATOM   10122 C  CB  . SER D 1 348 ? 38.131  126.183 65.183  1.00 40.52  ? 326  SER D CB  1 
ATOM   10123 O  OG  . SER D 1 348 ? 38.771  125.145 65.913  1.00 47.14  ? 326  SER D OG  1 
ATOM   10124 N  N   . ASN D 1 349 ? 35.511  124.726 64.712  1.00 44.04  ? 327  ASN D N   1 
ATOM   10125 C  CA  . ASN D 1 349 ? 34.695  123.519 64.702  1.00 47.03  ? 327  ASN D CA  1 
ATOM   10126 C  C   . ASN D 1 349 ? 35.308  122.504 63.765  1.00 47.89  ? 327  ASN D C   1 
ATOM   10127 O  O   . ASN D 1 349 ? 36.185  122.843 62.968  1.00 43.90  ? 327  ASN D O   1 
ATOM   10128 C  CB  . ASN D 1 349 ? 33.261  123.843 64.275  1.00 48.46  ? 327  ASN D CB  1 
ATOM   10129 C  CG  . ASN D 1 349 ? 33.199  124.658 63.003  1.00 47.34  ? 327  ASN D CG  1 
ATOM   10130 O  OD1 . ASN D 1 349 ? 33.432  124.146 61.908  1.00 55.45  ? 327  ASN D OD1 1 
ATOM   10131 N  ND2 . ASN D 1 349 ? 32.886  125.941 63.141  1.00 51.14  ? 327  ASN D ND2 1 
ATOM   10132 N  N   . ASP D 1 350 ? 34.851  121.259 63.871  1.00 48.47  ? 328  ASP D N   1 
ATOM   10133 C  CA  . ASP D 1 350 ? 35.361  120.180 63.033  1.00 51.84  ? 328  ASP D CA  1 
ATOM   10134 C  C   . ASP D 1 350 ? 35.262  120.473 61.539  1.00 54.16  ? 328  ASP D C   1 
ATOM   10135 O  O   . ASP D 1 350 ? 36.250  120.370 60.806  1.00 56.91  ? 328  ASP D O   1 
ATOM   10136 C  CB  . ASP D 1 350 ? 34.617  118.878 63.331  1.00 48.75  ? 328  ASP D CB  1 
ATOM   10137 C  CG  . ASP D 1 350 ? 35.098  118.202 64.595  1.00 51.34  ? 328  ASP D CG  1 
ATOM   10138 O  OD1 . ASP D 1 350 ? 34.544  117.133 64.924  1.00 52.03  ? 328  ASP D OD1 1 
ATOM   10139 O  OD2 . ASP D 1 350 ? 36.023  118.728 65.254  1.00 50.53  ? 328  ASP D OD2 1 
ATOM   10140 N  N   . GLU D 1 351 ? 34.065  120.834 61.092  1.00 55.61  ? 329  GLU D N   1 
ATOM   10141 C  CA  . GLU D 1 351 ? 33.828  121.116 59.679  1.00 59.75  ? 329  GLU D CA  1 
ATOM   10142 C  C   . GLU D 1 351 ? 34.798  122.149 59.110  1.00 58.31  ? 329  GLU D C   1 
ATOM   10143 O  O   . GLU D 1 351 ? 35.410  121.940 58.059  1.00 57.83  ? 329  GLU D O   1 
ATOM   10144 C  CB  . GLU D 1 351 ? 32.386  121.586 59.485  1.00 63.81  ? 329  GLU D CB  1 
ATOM   10145 C  CG  . GLU D 1 351 ? 31.988  121.806 58.039  1.00 69.89  ? 329  GLU D CG  1 
ATOM   10146 C  CD  . GLU D 1 351 ? 30.509  121.560 57.809  1.00 73.53  ? 329  GLU D CD  1 
ATOM   10147 O  OE1 . GLU D 1 351 ? 30.019  121.888 56.710  1.00 79.26  ? 329  GLU D OE1 1 
ATOM   10148 O  OE2 . GLU D 1 351 ? 29.837  121.030 58.723  1.00 75.55  ? 329  GLU D OE2 1 
ATOM   10149 N  N   . GLU D 1 352 ? 34.924  123.262 59.818  1.00 54.14  ? 330  GLU D N   1 
ATOM   10150 C  CA  . GLU D 1 352 ? 35.807  124.351 59.433  1.00 49.33  ? 330  GLU D CA  1 
ATOM   10151 C  C   . GLU D 1 352 ? 37.233  123.799 59.370  1.00 50.92  ? 330  GLU D C   1 
ATOM   10152 O  O   . GLU D 1 352 ? 37.959  124.013 58.394  1.00 54.44  ? 330  GLU D O   1 
ATOM   10153 C  CB  . GLU D 1 352 ? 35.685  125.451 60.489  1.00 43.96  ? 330  GLU D CB  1 
ATOM   10154 C  CG  . GLU D 1 352 ? 36.258  126.802 60.151  1.00 47.92  ? 330  GLU D CG  1 
ATOM   10155 C  CD  . GLU D 1 352 ? 35.933  127.825 61.235  1.00 53.57  ? 330  GLU D CD  1 
ATOM   10156 O  OE1 . GLU D 1 352 ? 36.090  127.500 62.429  1.00 53.13  ? 330  GLU D OE1 1 
ATOM   10157 O  OE2 . GLU D 1 352 ? 35.523  128.957 60.908  1.00 61.49  ? 330  GLU D OE2 1 
ATOM   10158 N  N   . ALA D 1 353 ? 37.611  123.060 60.409  1.00 48.66  ? 331  ALA D N   1 
ATOM   10159 C  CA  . ALA D 1 353 ? 38.945  122.472 60.513  1.00 45.89  ? 331  ALA D CA  1 
ATOM   10160 C  C   . ALA D 1 353 ? 39.319  121.568 59.343  1.00 40.59  ? 331  ALA D C   1 
ATOM   10161 O  O   . ALA D 1 353 ? 40.333  121.782 58.686  1.00 42.03  ? 331  ALA D O   1 
ATOM   10162 C  CB  . ALA D 1 353 ? 39.063  121.696 61.821  1.00 45.49  ? 331  ALA D CB  1 
ATOM   10163 N  N   . PHE D 1 354 ? 38.499  120.556 59.097  1.00 37.74  ? 332  PHE D N   1 
ATOM   10164 C  CA  . PHE D 1 354 ? 38.752  119.602 58.027  1.00 39.51  ? 332  PHE D CA  1 
ATOM   10165 C  C   . PHE D 1 354 ? 38.680  120.186 56.618  1.00 37.75  ? 332  PHE D C   1 
ATOM   10166 O  O   . PHE D 1 354 ? 39.388  119.733 55.718  1.00 35.03  ? 332  PHE D O   1 
ATOM   10167 C  CB  . PHE D 1 354 ? 37.782  118.433 58.163  1.00 41.90  ? 332  PHE D CB  1 
ATOM   10168 C  CG  . PHE D 1 354 ? 37.948  117.664 59.446  1.00 45.88  ? 332  PHE D CG  1 
ATOM   10169 C  CD1 . PHE D 1 354 ? 36.839  117.305 60.206  1.00 46.65  ? 332  PHE D CD1 1 
ATOM   10170 C  CD2 . PHE D 1 354 ? 39.214  117.290 59.891  1.00 46.21  ? 332  PHE D CD2 1 
ATOM   10171 C  CE1 . PHE D 1 354 ? 36.985  116.585 61.388  1.00 46.01  ? 332  PHE D CE1 1 
ATOM   10172 C  CE2 . PHE D 1 354 ? 39.370  116.568 61.072  1.00 49.26  ? 332  PHE D CE2 1 
ATOM   10173 C  CZ  . PHE D 1 354 ? 38.253  116.215 61.822  1.00 48.29  ? 332  PHE D CZ  1 
ATOM   10174 N  N   . THR D 1 355 ? 37.827  121.184 56.421  1.00 36.92  ? 333  THR D N   1 
ATOM   10175 C  CA  . THR D 1 355 ? 37.709  121.802 55.114  1.00 39.11  ? 333  THR D CA  1 
ATOM   10176 C  C   . THR D 1 355 ? 38.981  122.588 54.818  1.00 40.18  ? 333  THR D C   1 
ATOM   10177 O  O   . THR D 1 355 ? 39.450  122.615 53.678  1.00 42.35  ? 333  THR D O   1 
ATOM   10178 C  CB  . THR D 1 355 ? 36.492  122.743 55.029  1.00 41.61  ? 333  THR D CB  1 
ATOM   10179 O  OG1 . THR D 1 355 ? 36.563  123.704 56.083  1.00 49.06  ? 333  THR D OG1 1 
ATOM   10180 C  CG2 . THR D 1 355 ? 35.192  121.956 55.155  1.00 42.87  ? 333  THR D CG2 1 
ATOM   10181 N  N   . PHE D 1 356 ? 39.547  123.227 55.838  1.00 36.96  ? 334  PHE D N   1 
ATOM   10182 C  CA  . PHE D 1 356 ? 40.780  123.976 55.632  1.00 33.52  ? 334  PHE D CA  1 
ATOM   10183 C  C   . PHE D 1 356 ? 41.980  123.046 55.536  1.00 30.78  ? 334  PHE D C   1 
ATOM   10184 O  O   . PHE D 1 356 ? 42.944  123.355 54.843  1.00 38.12  ? 334  PHE D O   1 
ATOM   10185 C  CB  . PHE D 1 356 ? 41.002  125.004 56.738  1.00 26.49  ? 334  PHE D CB  1 
ATOM   10186 C  CG  . PHE D 1 356 ? 40.365  126.327 56.458  1.00 28.54  ? 334  PHE D CG  1 
ATOM   10187 C  CD1 . PHE D 1 356 ? 38.990  126.496 56.586  1.00 39.79  ? 334  PHE D CD1 1 
ATOM   10188 C  CD2 . PHE D 1 356 ? 41.136  127.407 56.046  1.00 27.98  ? 334  PHE D CD2 1 
ATOM   10189 C  CE1 . PHE D 1 356 ? 38.390  127.732 56.304  1.00 37.43  ? 334  PHE D CE1 1 
ATOM   10190 C  CE2 . PHE D 1 356 ? 40.556  128.645 55.761  1.00 26.13  ? 334  PHE D CE2 1 
ATOM   10191 C  CZ  . PHE D 1 356 ? 39.180  128.810 55.889  1.00 32.51  ? 334  PHE D CZ  1 
ATOM   10192 N  N   . ALA D 1 357 ? 41.931  121.914 56.226  1.00 31.59  ? 335  ALA D N   1 
ATOM   10193 C  CA  . ALA D 1 357 ? 43.027  120.961 56.155  1.00 38.28  ? 335  ALA D CA  1 
ATOM   10194 C  C   . ALA D 1 357 ? 43.084  120.483 54.705  1.00 39.31  ? 335  ALA D C   1 
ATOM   10195 O  O   . ALA D 1 357 ? 44.158  120.384 54.103  1.00 46.51  ? 335  ALA D O   1 
ATOM   10196 C  CB  . ALA D 1 357 ? 42.774  119.789 57.086  1.00 39.09  ? 335  ALA D CB  1 
ATOM   10197 N  N   . ARG D 1 358 ? 41.914  120.214 54.141  1.00 33.46  ? 336  ARG D N   1 
ATOM   10198 C  CA  . ARG D 1 358 ? 41.820  119.758 52.759  1.00 29.37  ? 336  ARG D CA  1 
ATOM   10199 C  C   . ARG D 1 358 ? 42.273  120.812 51.762  1.00 22.56  ? 336  ARG D C   1 
ATOM   10200 O  O   . ARG D 1 358 ? 42.803  120.486 50.703  1.00 15.08  ? 336  ARG D O   1 
ATOM   10201 C  CB  . ARG D 1 358 ? 40.386  119.334 52.454  1.00 30.63  ? 336  ARG D CB  1 
ATOM   10202 C  CG  . ARG D 1 358 ? 40.148  117.869 52.699  1.00 28.52  ? 336  ARG D CG  1 
ATOM   10203 C  CD  . ARG D 1 358 ? 38.694  117.575 53.025  1.00 35.09  ? 336  ARG D CD  1 
ATOM   10204 N  NE  . ARG D 1 358 ? 38.453  116.141 52.951  1.00 36.52  ? 336  ARG D NE  1 
ATOM   10205 C  CZ  . ARG D 1 358 ? 38.155  115.500 51.828  1.00 34.21  ? 336  ARG D CZ  1 
ATOM   10206 N  NH1 . ARG D 1 358 ? 37.977  114.188 51.847  1.00 39.08  ? 336  ARG D NH1 1 
ATOM   10207 N  NH2 . ARG D 1 358 ? 37.999  116.177 50.697  1.00 35.52  ? 336  ARG D NH2 1 
ATOM   10208 N  N   . MET D 1 359 ? 42.061  122.069 52.129  1.00 19.05  ? 337  MET D N   1 
ATOM   10209 C  CA  . MET D 1 359 ? 42.415  123.211 51.312  1.00 20.02  ? 337  MET D CA  1 
ATOM   10210 C  C   . MET D 1 359 ? 43.929  123.404 51.289  1.00 20.92  ? 337  MET D C   1 
ATOM   10211 O  O   . MET D 1 359 ? 44.493  123.855 50.300  1.00 24.38  ? 337  MET D O   1 
ATOM   10212 C  CB  . MET D 1 359 ? 41.715  124.452 51.878  1.00 25.28  ? 337  MET D CB  1 
ATOM   10213 C  CG  . MET D 1 359 ? 41.528  125.594 50.901  1.00 32.33  ? 337  MET D CG  1 
ATOM   10214 S  SD  . MET D 1 359 ? 40.327  126.760 51.541  1.00 49.53  ? 337  MET D SD  1 
ATOM   10215 C  CE  . MET D 1 359 ? 41.355  127.956 52.285  1.00 52.66  ? 337  MET D CE  1 
ATOM   10216 N  N   . LEU D 1 360 ? 44.583  123.061 52.391  1.00 28.42  ? 338  LEU D N   1 
ATOM   10217 C  CA  . LEU D 1 360 ? 46.035  123.190 52.511  1.00 29.78  ? 338  LEU D CA  1 
ATOM   10218 C  C   . LEU D 1 360 ? 46.717  122.125 51.653  1.00 27.39  ? 338  LEU D C   1 
ATOM   10219 O  O   . LEU D 1 360 ? 47.781  122.350 51.074  1.00 25.74  ? 338  LEU D O   1 
ATOM   10220 C  CB  . LEU D 1 360 ? 46.457  123.034 53.984  1.00 23.12  ? 338  LEU D CB  1 
ATOM   10221 C  CG  . LEU D 1 360 ? 46.195  124.227 54.918  1.00 25.51  ? 338  LEU D CG  1 
ATOM   10222 C  CD1 . LEU D 1 360 ? 46.250  123.792 56.379  1.00 30.68  ? 338  LEU D CD1 1 
ATOM   10223 C  CD2 . LEU D 1 360 ? 47.218  125.319 54.650  1.00 19.21  ? 338  LEU D CD2 1 
ATOM   10224 N  N   . ILE D 1 361 ? 46.096  120.958 51.582  1.00 23.71  ? 339  ILE D N   1 
ATOM   10225 C  CA  . ILE D 1 361 ? 46.648  119.875 50.800  1.00 26.64  ? 339  ILE D CA  1 
ATOM   10226 C  C   . ILE D 1 361 ? 46.442  120.162 49.321  1.00 29.41  ? 339  ILE D C   1 
ATOM   10227 O  O   . ILE D 1 361 ? 47.341  119.977 48.509  1.00 30.63  ? 339  ILE D O   1 
ATOM   10228 C  CB  . ILE D 1 361 ? 45.957  118.549 51.145  1.00 30.26  ? 339  ILE D CB  1 
ATOM   10229 C  CG1 . ILE D 1 361 ? 46.219  118.191 52.618  1.00 35.97  ? 339  ILE D CG1 1 
ATOM   10230 C  CG2 . ILE D 1 361 ? 46.461  117.447 50.229  1.00 35.00  ? 339  ILE D CG2 1 
ATOM   10231 C  CD1 . ILE D 1 361 ? 45.438  116.992 53.128  1.00 20.30  ? 339  ILE D CD1 1 
ATOM   10232 N  N   . ALA D 1 362 ? 45.254  120.642 48.983  1.00 31.96  ? 340  ALA D N   1 
ATOM   10233 C  CA  . ALA D 1 362 ? 44.904  120.929 47.600  1.00 34.62  ? 340  ALA D CA  1 
ATOM   10234 C  C   . ALA D 1 362 ? 45.461  122.217 47.018  1.00 35.55  ? 340  ALA D C   1 
ATOM   10235 O  O   . ALA D 1 362 ? 45.789  122.267 45.838  1.00 43.96  ? 340  ALA D O   1 
ATOM   10236 C  CB  . ALA D 1 362 ? 43.385  120.920 47.436  1.00 28.21  ? 340  ALA D CB  1 
ATOM   10237 N  N   . GLN D 1 363 ? 45.571  123.262 47.820  1.00 31.72  ? 341  GLN D N   1 
ATOM   10238 C  CA  . GLN D 1 363 ? 46.064  124.512 47.286  1.00 30.57  ? 341  GLN D CA  1 
ATOM   10239 C  C   . GLN D 1 363 ? 47.500  124.871 47.608  1.00 29.79  ? 341  GLN D C   1 
ATOM   10240 O  O   . GLN D 1 363 ? 48.157  125.534 46.810  1.00 31.44  ? 341  GLN D O   1 
ATOM   10241 C  CB  . GLN D 1 363 ? 45.129  125.645 47.702  1.00 38.00  ? 341  GLN D CB  1 
ATOM   10242 C  CG  . GLN D 1 363 ? 43.804  125.602 46.951  1.00 49.91  ? 341  GLN D CG  1 
ATOM   10243 C  CD  . GLN D 1 363 ? 42.810  126.647 47.418  1.00 48.08  ? 341  GLN D CD  1 
ATOM   10244 O  OE1 . GLN D 1 363 ? 43.119  127.842 47.461  1.00 55.21  ? 341  GLN D OE1 1 
ATOM   10245 N  NE2 . GLN D 1 363 ? 41.604  126.203 47.758  1.00 51.23  ? 341  GLN D NE2 1 
ATOM   10246 N  N   . GLU D 1 364 ? 47.998  124.435 48.760  1.00 26.90  ? 342  GLU D N   1 
ATOM   10247 C  CA  . GLU D 1 364 ? 49.367  124.752 49.143  1.00 19.47  ? 342  GLU D CA  1 
ATOM   10248 C  C   . GLU D 1 364 ? 50.287  123.533 49.099  1.00 17.75  ? 342  GLU D C   1 
ATOM   10249 O  O   . GLU D 1 364 ? 51.516  123.651 49.214  1.00 16.77  ? 342  GLU D O   1 
ATOM   10250 C  CB  . GLU D 1 364 ? 49.381  125.364 50.528  1.00 13.68  ? 342  GLU D CB  1 
ATOM   10251 C  CG  . GLU D 1 364 ? 48.433  126.516 50.725  1.00 9.65   ? 342  GLU D CG  1 
ATOM   10252 C  CD  . GLU D 1 364 ? 48.817  127.751 49.954  1.00 19.27  ? 342  GLU D CD  1 
ATOM   10253 O  OE1 . GLU D 1 364 ? 50.022  128.026 49.826  1.00 19.65  ? 342  GLU D OE1 1 
ATOM   10254 O  OE2 . GLU D 1 364 ? 47.908  128.472 49.492  1.00 28.26  ? 342  GLU D OE2 1 
ATOM   10255 N  N   . GLY D 1 365 ? 49.694  122.358 48.928  1.00 15.39  ? 343  GLY D N   1 
ATOM   10256 C  CA  . GLY D 1 365 ? 50.488  121.138 48.861  1.00 18.50  ? 343  GLY D CA  1 
ATOM   10257 C  C   . GLY D 1 365 ? 51.154  120.750 50.167  1.00 17.54  ? 343  GLY D C   1 
ATOM   10258 O  O   . GLY D 1 365 ? 52.198  120.108 50.157  1.00 23.02  ? 343  GLY D O   1 
ATOM   10259 N  N   . LEU D 1 366 ? 50.541  121.124 51.286  1.00 18.20  ? 344  LEU D N   1 
ATOM   10260 C  CA  . LEU D 1 366 ? 51.072  120.817 52.609  1.00 21.22  ? 344  LEU D CA  1 
ATOM   10261 C  C   . LEU D 1 366 ? 50.306  119.637 53.191  1.00 28.11  ? 344  LEU D C   1 
ATOM   10262 O  O   . LEU D 1 366 ? 49.143  119.781 53.565  1.00 28.38  ? 344  LEU D O   1 
ATOM   10263 C  CB  . LEU D 1 366 ? 50.899  122.033 53.507  1.00 21.57  ? 344  LEU D CB  1 
ATOM   10264 C  CG  . LEU D 1 366 ? 51.440  123.335 52.909  1.00 23.61  ? 344  LEU D CG  1 
ATOM   10265 C  CD1 . LEU D 1 366 ? 50.812  124.539 53.599  1.00 26.60  ? 344  LEU D CD1 1 
ATOM   10266 C  CD2 . LEU D 1 366 ? 52.958  123.365 53.058  1.00 24.36  ? 344  LEU D CD2 1 
ATOM   10267 N  N   . LEU D 1 367 ? 50.950  118.474 53.272  1.00 31.81  ? 345  LEU D N   1 
ATOM   10268 C  CA  . LEU D 1 367 ? 50.291  117.281 53.789  1.00 30.65  ? 345  LEU D CA  1 
ATOM   10269 C  C   . LEU D 1 367 ? 50.213  117.276 55.321  1.00 36.06  ? 345  LEU D C   1 
ATOM   10270 O  O   . LEU D 1 367 ? 50.783  116.407 55.999  1.00 30.92  ? 345  LEU D O   1 
ATOM   10271 C  CB  . LEU D 1 367 ? 51.010  116.036 53.264  1.00 33.13  ? 345  LEU D CB  1 
ATOM   10272 C  CG  . LEU D 1 367 ? 51.044  115.947 51.727  1.00 35.51  ? 345  LEU D CG  1 
ATOM   10273 C  CD1 . LEU D 1 367 ? 52.038  114.889 51.268  1.00 35.36  ? 345  LEU D CD1 1 
ATOM   10274 C  CD2 . LEU D 1 367 ? 49.656  115.637 51.204  1.00 41.38  ? 345  LEU D CD2 1 
ATOM   10275 N  N   . CYS D 1 368 ? 49.475  118.258 55.839  1.00 37.07  ? 346  CYS D N   1 
ATOM   10276 C  CA  . CYS D 1 368 ? 49.263  118.453 57.268  1.00 37.97  ? 346  CYS D CA  1 
ATOM   10277 C  C   . CYS D 1 368 ? 47.979  117.791 57.766  1.00 41.26  ? 346  CYS D C   1 
ATOM   10278 O  O   . CYS D 1 368 ? 47.222  117.227 56.984  1.00 37.79  ? 346  CYS D O   1 
ATOM   10279 C  CB  . CYS D 1 368 ? 49.187  119.938 57.570  1.00 38.22  ? 346  CYS D CB  1 
ATOM   10280 S  SG  . CYS D 1 368 ? 47.807  120.712 56.771  1.00 37.61  ? 346  CYS D SG  1 
ATOM   10281 N  N   . GLY D 1 369 ? 47.737  117.896 59.073  1.00 39.63  ? 347  GLY D N   1 
ATOM   10282 C  CA  . GLY D 1 369 ? 46.564  117.289 59.680  1.00 38.53  ? 347  GLY D CA  1 
ATOM   10283 C  C   . GLY D 1 369 ? 45.420  118.226 60.025  1.00 38.04  ? 347  GLY D C   1 
ATOM   10284 O  O   . GLY D 1 369 ? 45.434  119.404 59.665  1.00 36.88  ? 347  GLY D O   1 
ATOM   10285 N  N   . GLY D 1 370 ? 44.434  117.691 60.743  1.00 35.27  ? 348  GLY D N   1 
ATOM   10286 C  CA  . GLY D 1 370 ? 43.263  118.464 61.126  1.00 32.63  ? 348  GLY D CA  1 
ATOM   10287 C  C   . GLY D 1 370 ? 43.494  119.720 61.947  1.00 31.19  ? 348  GLY D C   1 
ATOM   10288 O  O   . GLY D 1 370 ? 42.866  120.759 61.716  1.00 21.91  ? 348  GLY D O   1 
ATOM   10289 N  N   . SER D 1 371 ? 44.380  119.621 62.929  1.00 33.20  ? 349  SER D N   1 
ATOM   10290 C  CA  . SER D 1 371 ? 44.700  120.758 63.780  1.00 29.49  ? 349  SER D CA  1 
ATOM   10291 C  C   . SER D 1 371 ? 45.146  121.935 62.904  1.00 24.27  ? 349  SER D C   1 
ATOM   10292 O  O   . SER D 1 371 ? 44.792  123.085 63.153  1.00 20.72  ? 349  SER D O   1 
ATOM   10293 C  CB  . SER D 1 371 ? 45.817  120.371 64.747  1.00 30.50  ? 349  SER D CB  1 
ATOM   10294 O  OG  . SER D 1 371 ? 46.033  121.397 65.695  1.00 38.93  ? 349  SER D OG  1 
ATOM   10295 N  N   . ALA D 1 372 ? 45.931  121.623 61.875  1.00 28.83  ? 350  ALA D N   1 
ATOM   10296 C  CA  . ALA D 1 372 ? 46.449  122.623 60.930  1.00 29.90  ? 350  ALA D CA  1 
ATOM   10297 C  C   . ALA D 1 372 ? 45.302  123.385 60.284  1.00 31.06  ? 350  ALA D C   1 
ATOM   10298 O  O   . ALA D 1 372 ? 45.376  124.601 60.081  1.00 29.58  ? 350  ALA D O   1 
ATOM   10299 C  CB  . ALA D 1 372 ? 47.295  121.943 59.850  1.00 13.86  ? 350  ALA D CB  1 
ATOM   10300 N  N   . GLY D 1 373 ? 44.244  122.656 59.956  1.00 33.22  ? 351  GLY D N   1 
ATOM   10301 C  CA  . GLY D 1 373 ? 43.088  123.286 59.358  1.00 35.79  ? 351  GLY D CA  1 
ATOM   10302 C  C   . GLY D 1 373 ? 42.479  124.298 60.315  1.00 38.67  ? 351  GLY D C   1 
ATOM   10303 O  O   . GLY D 1 373 ? 42.172  125.428 59.920  1.00 40.22  ? 351  GLY D O   1 
ATOM   10304 N  N   . SER D 1 374 ? 42.311  123.889 61.574  1.00 38.17  ? 352  SER D N   1 
ATOM   10305 C  CA  . SER D 1 374 ? 41.733  124.754 62.611  1.00 37.37  ? 352  SER D CA  1 
ATOM   10306 C  C   . SER D 1 374 ? 42.493  126.061 62.700  1.00 37.41  ? 352  SER D C   1 
ATOM   10307 O  O   . SER D 1 374 ? 41.911  127.143 62.755  1.00 39.10  ? 352  SER D O   1 
ATOM   10308 C  CB  . SER D 1 374 ? 41.793  124.081 63.995  1.00 37.51  ? 352  SER D CB  1 
ATOM   10309 O  OG  . SER D 1 374 ? 41.004  122.905 64.065  1.00 43.60  ? 352  SER D OG  1 
ATOM   10310 N  N   . THR D 1 375 ? 43.813  125.939 62.709  1.00 40.04  ? 353  THR D N   1 
ATOM   10311 C  CA  . THR D 1 375 ? 44.705  127.081 62.832  1.00 36.65  ? 353  THR D CA  1 
ATOM   10312 C  C   . THR D 1 375 ? 44.675  128.055 61.655  1.00 35.05  ? 353  THR D C   1 
ATOM   10313 O  O   . THR D 1 375 ? 44.772  129.273 61.848  1.00 29.87  ? 353  THR D O   1 
ATOM   10314 C  CB  . THR D 1 375 ? 46.146  126.586 63.058  1.00 39.41  ? 353  THR D CB  1 
ATOM   10315 O  OG1 . THR D 1 375 ? 46.119  125.469 63.964  1.00 33.48  ? 353  THR D OG1 1 
ATOM   10316 C  CG2 . THR D 1 375 ? 47.008  127.699 63.652  1.00 34.14  ? 353  THR D CG2 1 
ATOM   10317 N  N   . VAL D 1 376 ? 44.552  127.541 60.435  1.00 33.79  ? 354  VAL D N   1 
ATOM   10318 C  CA  . VAL D 1 376 ? 44.513  128.447 59.288  1.00 33.41  ? 354  VAL D CA  1 
ATOM   10319 C  C   . VAL D 1 376 ? 43.115  129.056 59.149  1.00 31.85  ? 354  VAL D C   1 
ATOM   10320 O  O   . VAL D 1 376 ? 42.965  130.208 58.731  1.00 27.61  ? 354  VAL D O   1 
ATOM   10321 C  CB  . VAL D 1 376 ? 44.907  127.732 57.967  1.00 30.50  ? 354  VAL D CB  1 
ATOM   10322 C  CG1 . VAL D 1 376 ? 44.784  128.712 56.792  1.00 33.27  ? 354  VAL D CG1 1 
ATOM   10323 C  CG2 . VAL D 1 376 ? 46.342  127.208 58.059  1.00 13.29  ? 354  VAL D CG2 1 
ATOM   10324 N  N   . ALA D 1 377 ? 42.099  128.278 59.512  1.00 29.45  ? 355  ALA D N   1 
ATOM   10325 C  CA  . ALA D 1 377 ? 40.728  128.753 59.436  1.00 28.74  ? 355  ALA D CA  1 
ATOM   10326 C  C   . ALA D 1 377 ? 40.594  130.022 60.283  1.00 29.69  ? 355  ALA D C   1 
ATOM   10327 O  O   . ALA D 1 377 ? 39.984  131.001 59.858  1.00 31.38  ? 355  ALA D O   1 
ATOM   10328 C  CB  . ALA D 1 377 ? 39.772  127.674 59.935  1.00 28.61  ? 355  ALA D CB  1 
ATOM   10329 N  N   . VAL D 1 378 ? 41.184  130.009 61.475  1.00 28.91  ? 356  VAL D N   1 
ATOM   10330 C  CA  . VAL D 1 378 ? 41.118  131.165 62.366  1.00 31.90  ? 356  VAL D CA  1 
ATOM   10331 C  C   . VAL D 1 378 ? 41.996  132.306 61.875  1.00 35.88  ? 356  VAL D C   1 
ATOM   10332 O  O   . VAL D 1 378 ? 41.607  133.478 61.939  1.00 35.05  ? 356  VAL D O   1 
ATOM   10333 C  CB  . VAL D 1 378 ? 41.570  130.801 63.794  1.00 34.48  ? 356  VAL D CB  1 
ATOM   10334 C  CG1 . VAL D 1 378 ? 41.680  132.065 64.642  1.00 41.67  ? 356  VAL D CG1 1 
ATOM   10335 C  CG2 . VAL D 1 378 ? 40.585  129.818 64.420  1.00 36.76  ? 356  VAL D CG2 1 
ATOM   10336 N  N   . ALA D 1 379 ? 43.184  131.953 61.390  1.00 40.33  ? 357  ALA D N   1 
ATOM   10337 C  CA  . ALA D 1 379 ? 44.143  132.932 60.888  1.00 42.85  ? 357  ALA D CA  1 
ATOM   10338 C  C   . ALA D 1 379 ? 43.599  133.823 59.772  1.00 45.90  ? 357  ALA D C   1 
ATOM   10339 O  O   . ALA D 1 379 ? 43.830  135.036 59.779  1.00 49.98  ? 357  ALA D O   1 
ATOM   10340 C  CB  . ALA D 1 379 ? 45.409  132.222 60.415  1.00 47.81  ? 357  ALA D CB  1 
ATOM   10341 N  N   . VAL D 1 380 ? 42.886  133.245 58.810  1.00 42.33  ? 358  VAL D N   1 
ATOM   10342 C  CA  . VAL D 1 380 ? 42.357  134.061 57.725  1.00 43.79  ? 358  VAL D CA  1 
ATOM   10343 C  C   . VAL D 1 380 ? 41.365  135.083 58.259  1.00 44.99  ? 358  VAL D C   1 
ATOM   10344 O  O   . VAL D 1 380 ? 40.980  136.007 57.553  1.00 42.19  ? 358  VAL D O   1 
ATOM   10345 C  CB  . VAL D 1 380 ? 41.691  133.198 56.623  1.00 42.04  ? 358  VAL D CB  1 
ATOM   10346 C  CG1 . VAL D 1 380 ? 42.732  132.283 56.005  1.00 33.09  ? 358  VAL D CG1 1 
ATOM   10347 C  CG2 . VAL D 1 380 ? 40.538  132.393 57.192  1.00 40.88  ? 358  VAL D CG2 1 
ATOM   10348 N  N   . LYS D 1 381 ? 40.963  134.911 59.517  1.00 49.61  ? 359  LYS D N   1 
ATOM   10349 C  CA  . LYS D 1 381 ? 40.038  135.832 60.174  1.00 45.76  ? 359  LYS D CA  1 
ATOM   10350 C  C   . LYS D 1 381 ? 40.830  136.800 61.059  1.00 45.30  ? 359  LYS D C   1 
ATOM   10351 O  O   . LYS D 1 381 ? 40.732  138.024 60.917  1.00 47.25  ? 359  LYS D O   1 
ATOM   10352 C  CB  . LYS D 1 381 ? 39.055  135.081 61.075  1.00 43.96  ? 359  LYS D CB  1 
ATOM   10353 C  CG  . LYS D 1 381 ? 38.121  134.089 60.415  1.00 41.89  ? 359  LYS D CG  1 
ATOM   10354 C  CD  . LYS D 1 381 ? 37.206  133.489 61.501  1.00 39.88  ? 359  LYS D CD  1 
ATOM   10355 C  CE  . LYS D 1 381 ? 36.393  132.306 61.003  1.00 43.60  ? 359  LYS D CE  1 
ATOM   10356 N  NZ  . LYS D 1 381 ? 35.709  131.634 62.138  1.00 40.36  ? 359  LYS D NZ  1 
ATOM   10357 N  N   . ALA D 1 382 ? 41.611  136.234 61.976  1.00 38.68  ? 360  ALA D N   1 
ATOM   10358 C  CA  . ALA D 1 382 ? 42.410  137.025 62.906  1.00 38.44  ? 360  ALA D CA  1 
ATOM   10359 C  C   . ALA D 1 382 ? 43.437  137.957 62.257  1.00 39.12  ? 360  ALA D C   1 
ATOM   10360 O  O   . ALA D 1 382 ? 43.641  139.083 62.725  1.00 38.04  ? 360  ALA D O   1 
ATOM   10361 C  CB  . ALA D 1 382 ? 43.109  136.098 63.900  1.00 35.88  ? 360  ALA D CB  1 
ATOM   10362 N  N   . ALA D 1 383 ? 44.074  137.499 61.181  1.00 38.09  ? 361  ALA D N   1 
ATOM   10363 C  CA  . ALA D 1 383 ? 45.101  138.295 60.507  1.00 41.53  ? 361  ALA D CA  1 
ATOM   10364 C  C   . ALA D 1 383 ? 44.567  139.372 59.577  1.00 43.43  ? 361  ALA D C   1 
ATOM   10365 O  O   . ALA D 1 383 ? 45.350  140.063 58.924  1.00 39.83  ? 361  ALA D O   1 
ATOM   10366 C  CB  . ALA D 1 383 ? 46.066  137.383 59.744  1.00 35.37  ? 361  ALA D CB  1 
ATOM   10367 N  N   . GLN D 1 384 ? 43.243  139.520 59.521  1.00 45.42  ? 362  GLN D N   1 
ATOM   10368 C  CA  . GLN D 1 384 ? 42.635  140.538 58.667  1.00 45.97  ? 362  GLN D CA  1 
ATOM   10369 C  C   . GLN D 1 384 ? 43.155  141.925 59.008  1.00 45.95  ? 362  GLN D C   1 
ATOM   10370 O  O   . GLN D 1 384 ? 43.515  142.691 58.120  1.00 43.89  ? 362  GLN D O   1 
ATOM   10371 C  CB  . GLN D 1 384 ? 41.117  140.517 58.807  1.00 43.68  ? 362  GLN D CB  1 
ATOM   10372 C  CG  . GLN D 1 384 ? 40.447  139.352 58.096  1.00 48.72  ? 362  GLN D CG  1 
ATOM   10373 C  CD  . GLN D 1 384 ? 40.712  139.357 56.599  1.00 53.00  ? 362  GLN D CD  1 
ATOM   10374 O  OE1 . GLN D 1 384 ? 40.678  140.406 55.956  1.00 60.39  ? 362  GLN D OE1 1 
ATOM   10375 N  NE2 . GLN D 1 384 ? 40.969  138.184 56.037  1.00 46.53  ? 362  GLN D NE2 1 
ATOM   10376 N  N   . GLU D 1 385 ? 43.188  142.238 60.300  1.00 50.34  ? 363  GLU D N   1 
ATOM   10377 C  CA  . GLU D 1 385 ? 43.663  143.532 60.777  1.00 54.74  ? 363  GLU D CA  1 
ATOM   10378 C  C   . GLU D 1 385 ? 45.037  143.880 60.199  1.00 57.37  ? 363  GLU D C   1 
ATOM   10379 O  O   . GLU D 1 385 ? 45.359  145.052 59.994  1.00 62.94  ? 363  GLU D O   1 
ATOM   10380 C  CB  . GLU D 1 385 ? 43.737  143.529 62.309  1.00 60.68  ? 363  GLU D CB  1 
ATOM   10381 C  CG  . GLU D 1 385 ? 44.527  142.356 62.897  1.00 65.51  ? 363  GLU D CG  1 
ATOM   10382 C  CD  . GLU D 1 385 ? 44.773  142.490 64.394  1.00 68.36  ? 363  GLU D CD  1 
ATOM   10383 O  OE1 . GLU D 1 385 ? 45.524  143.406 64.804  1.00 67.68  ? 363  GLU D OE1 1 
ATOM   10384 O  OE2 . GLU D 1 385 ? 44.212  141.675 65.160  1.00 71.34  ? 363  GLU D OE2 1 
ATOM   10385 N  N   . LEU D 1 386 ? 45.844  142.857 59.935  1.00 52.44  ? 364  LEU D N   1 
ATOM   10386 C  CA  . LEU D 1 386 ? 47.186  143.052 59.397  1.00 39.24  ? 364  LEU D CA  1 
ATOM   10387 C  C   . LEU D 1 386 ? 47.220  143.624 57.979  1.00 36.31  ? 364  LEU D C   1 
ATOM   10388 O  O   . LEU D 1 386 ? 46.492  143.176 57.092  1.00 28.70  ? 364  LEU D O   1 
ATOM   10389 C  CB  . LEU D 1 386 ? 47.947  141.723 59.444  1.00 40.01  ? 364  LEU D CB  1 
ATOM   10390 C  CG  . LEU D 1 386 ? 48.876  141.473 60.636  1.00 36.54  ? 364  LEU D CG  1 
ATOM   10391 C  CD1 . LEU D 1 386 ? 48.308  142.066 61.906  1.00 33.02  ? 364  LEU D CD1 1 
ATOM   10392 C  CD2 . LEU D 1 386 ? 49.095  139.975 60.777  1.00 36.50  ? 364  LEU D CD2 1 
ATOM   10393 N  N   . GLN D 1 387 ? 48.071  144.628 57.783  1.00 37.53  ? 365  GLN D N   1 
ATOM   10394 C  CA  . GLN D 1 387 ? 48.245  145.277 56.488  1.00 40.41  ? 365  GLN D CA  1 
ATOM   10395 C  C   . GLN D 1 387 ? 49.502  144.729 55.814  1.00 43.58  ? 365  GLN D C   1 
ATOM   10396 O  O   . GLN D 1 387 ? 50.331  144.085 56.465  1.00 38.33  ? 365  GLN D O   1 
ATOM   10397 C  CB  . GLN D 1 387 ? 48.431  146.780 56.660  1.00 46.13  ? 365  GLN D CB  1 
ATOM   10398 C  CG  . GLN D 1 387 ? 47.292  147.514 57.314  1.00 51.92  ? 365  GLN D CG  1 
ATOM   10399 C  CD  . GLN D 1 387 ? 47.582  149.005 57.438  1.00 59.45  ? 365  GLN D CD  1 
ATOM   10400 O  OE1 . GLN D 1 387 ? 48.584  149.407 58.036  1.00 58.28  ? 365  GLN D OE1 1 
ATOM   10401 N  NE2 . GLN D 1 387 ? 46.707  149.832 56.869  1.00 60.27  ? 365  GLN D NE2 1 
ATOM   10402 N  N   . GLU D 1 388 ? 49.656  144.998 54.518  1.00 45.69  ? 366  GLU D N   1 
ATOM   10403 C  CA  . GLU D 1 388 ? 50.833  144.532 53.791  1.00 48.49  ? 366  GLU D CA  1 
ATOM   10404 C  C   . GLU D 1 388 ? 52.074  145.026 54.496  1.00 48.87  ? 366  GLU D C   1 
ATOM   10405 O  O   . GLU D 1 388 ? 52.074  146.108 55.084  1.00 55.02  ? 366  GLU D O   1 
ATOM   10406 C  CB  . GLU D 1 388 ? 50.807  145.032 52.355  1.00 46.37  ? 366  GLU D CB  1 
ATOM   10407 C  CG  . GLU D 1 388 ? 50.046  146.310 52.179  1.00 57.39  ? 366  GLU D CG  1 
ATOM   10408 C  CD  . GLU D 1 388 ? 49.572  146.478 50.763  1.00 60.69  ? 366  GLU D CD  1 
ATOM   10409 O  OE1 . GLU D 1 388 ? 50.435  146.472 49.858  1.00 58.65  ? 366  GLU D OE1 1 
ATOM   10410 O  OE2 . GLU D 1 388 ? 48.342  146.605 50.561  1.00 64.97  ? 366  GLU D OE2 1 
ATOM   10411 N  N   . GLY D 1 389 ? 53.130  144.227 54.443  1.00 49.38  ? 367  GLY D N   1 
ATOM   10412 C  CA  . GLY D 1 389 ? 54.359  144.594 55.117  1.00 48.52  ? 367  GLY D CA  1 
ATOM   10413 C  C   . GLY D 1 389 ? 54.402  143.857 56.439  1.00 43.70  ? 367  GLY D C   1 
ATOM   10414 O  O   . GLY D 1 389 ? 55.464  143.659 57.018  1.00 45.51  ? 367  GLY D O   1 
ATOM   10415 N  N   . GLN D 1 390 ? 53.236  143.450 56.924  1.00 42.34  ? 368  GLN D N   1 
ATOM   10416 C  CA  . GLN D 1 390 ? 53.180  142.720 58.175  1.00 44.62  ? 368  GLN D CA  1 
ATOM   10417 C  C   . GLN D 1 390 ? 53.240  141.219 57.913  1.00 43.44  ? 368  GLN D C   1 
ATOM   10418 O  O   . GLN D 1 390 ? 52.971  140.751 56.802  1.00 40.26  ? 368  GLN D O   1 
ATOM   10419 C  CB  . GLN D 1 390 ? 51.936  143.118 58.974  1.00 45.84  ? 368  GLN D CB  1 
ATOM   10420 C  CG  . GLN D 1 390 ? 52.067  144.521 59.562  1.00 47.82  ? 368  GLN D CG  1 
ATOM   10421 C  CD  . GLN D 1 390 ? 50.865  144.941 60.379  1.00 48.77  ? 368  GLN D CD  1 
ATOM   10422 O  OE1 . GLN D 1 390 ? 49.766  145.117 59.850  1.00 51.22  ? 368  GLN D OE1 1 
ATOM   10423 N  NE2 . GLN D 1 390 ? 51.067  145.103 61.680  1.00 45.79  ? 368  GLN D NE2 1 
ATOM   10424 N  N   . ARG D 1 391 ? 53.593  140.472 58.953  1.00 43.76  ? 369  ARG D N   1 
ATOM   10425 C  CA  . ARG D 1 391 ? 53.773  139.035 58.843  1.00 38.25  ? 369  ARG D CA  1 
ATOM   10426 C  C   . ARG D 1 391 ? 52.994  138.258 59.902  1.00 33.58  ? 369  ARG D C   1 
ATOM   10427 O  O   . ARG D 1 391 ? 53.040  138.592 61.084  1.00 37.76  ? 369  ARG D O   1 
ATOM   10428 C  CB  . ARG D 1 391 ? 55.272  138.750 58.969  1.00 30.78  ? 369  ARG D CB  1 
ATOM   10429 C  CG  . ARG D 1 391 ? 55.720  137.435 58.438  1.00 36.87  ? 369  ARG D CG  1 
ATOM   10430 C  CD  . ARG D 1 391 ? 56.879  137.614 57.470  1.00 40.95  ? 369  ARG D CD  1 
ATOM   10431 N  NE  . ARG D 1 391 ? 58.097  138.094 58.114  1.00 37.28  ? 369  ARG D NE  1 
ATOM   10432 C  CZ  . ARG D 1 391 ? 59.270  138.189 57.495  1.00 34.97  ? 369  ARG D CZ  1 
ATOM   10433 N  NH1 . ARG D 1 391 ? 59.375  137.841 56.222  1.00 41.89  ? 369  ARG D NH1 1 
ATOM   10434 N  NH2 . ARG D 1 391 ? 60.344  138.620 58.143  1.00 34.74  ? 369  ARG D NH2 1 
ATOM   10435 N  N   . CYS D 1 392 ? 52.275  137.226 59.471  1.00 29.51  ? 370  CYS D N   1 
ATOM   10436 C  CA  . CYS D 1 392 ? 51.515  136.391 60.386  1.00 28.09  ? 370  CYS D CA  1 
ATOM   10437 C  C   . CYS D 1 392 ? 51.991  134.940 60.281  1.00 24.93  ? 370  CYS D C   1 
ATOM   10438 O  O   . CYS D 1 392 ? 51.913  134.333 59.218  1.00 18.11  ? 370  CYS D O   1 
ATOM   10439 C  CB  . CYS D 1 392 ? 50.023  136.459 60.079  1.00 27.93  ? 370  CYS D CB  1 
ATOM   10440 S  SG  . CYS D 1 392 ? 49.055  135.383 61.165  1.00 40.58  ? 370  CYS D SG  1 
ATOM   10441 N  N   . VAL D 1 393 ? 52.481  134.397 61.393  1.00 24.06  ? 371  VAL D N   1 
ATOM   10442 C  CA  . VAL D 1 393 ? 52.980  133.030 61.434  1.00 25.53  ? 371  VAL D CA  1 
ATOM   10443 C  C   . VAL D 1 393 ? 51.986  132.085 62.083  1.00 25.04  ? 371  VAL D C   1 
ATOM   10444 O  O   . VAL D 1 393 ? 51.509  132.324 63.186  1.00 35.06  ? 371  VAL D O   1 
ATOM   10445 C  CB  . VAL D 1 393 ? 54.318  132.934 62.191  1.00 25.82  ? 371  VAL D CB  1 
ATOM   10446 C  CG1 . VAL D 1 393 ? 54.750  131.480 62.291  1.00 18.55  ? 371  VAL D CG1 1 
ATOM   10447 C  CG2 . VAL D 1 393 ? 55.385  133.758 61.463  1.00 16.32  ? 371  VAL D CG2 1 
ATOM   10448 N  N   . VAL D 1 394 ? 51.691  131.003 61.380  1.00 25.43  ? 372  VAL D N   1 
ATOM   10449 C  CA  . VAL D 1 394 ? 50.744  130.013 61.838  1.00 22.34  ? 372  VAL D CA  1 
ATOM   10450 C  C   . VAL D 1 394 ? 51.501  128.698 62.066  1.00 22.79  ? 372  VAL D C   1 
ATOM   10451 O  O   . VAL D 1 394 ? 52.479  128.420 61.379  1.00 32.17  ? 372  VAL D O   1 
ATOM   10452 C  CB  . VAL D 1 394 ? 49.634  129.849 60.773  1.00 21.03  ? 372  VAL D CB  1 
ATOM   10453 C  CG1 . VAL D 1 394 ? 50.048  128.849 59.713  1.00 14.48  ? 372  VAL D CG1 1 
ATOM   10454 C  CG2 . VAL D 1 394 ? 48.350  129.465 61.426  1.00 24.44  ? 372  VAL D CG2 1 
ATOM   10455 N  N   . ILE D 1 395 ? 51.055  127.899 63.027  1.00 21.27  ? 373  ILE D N   1 
ATOM   10456 C  CA  . ILE D 1 395 ? 51.706  126.630 63.343  1.00 22.49  ? 373  ILE D CA  1 
ATOM   10457 C  C   . ILE D 1 395 ? 50.904  125.416 62.873  1.00 27.15  ? 373  ILE D C   1 
ATOM   10458 O  O   . ILE D 1 395 ? 49.750  125.241 63.250  1.00 35.21  ? 373  ILE D O   1 
ATOM   10459 C  CB  . ILE D 1 395 ? 51.955  126.528 64.881  1.00 23.62  ? 373  ILE D CB  1 
ATOM   10460 C  CG1 . ILE D 1 395 ? 53.035  127.527 65.279  1.00 22.28  ? 373  ILE D CG1 1 
ATOM   10461 C  CG2 . ILE D 1 395 ? 52.359  125.112 65.285  1.00 14.84  ? 373  ILE D CG2 1 
ATOM   10462 C  CD1 . ILE D 1 395 ? 53.284  127.581 66.736  1.00 30.75  ? 373  ILE D CD1 1 
ATOM   10463 N  N   . LEU D 1 396 ? 51.515  124.582 62.038  1.00 31.66  ? 374  LEU D N   1 
ATOM   10464 C  CA  . LEU D 1 396 ? 50.856  123.375 61.541  1.00 31.11  ? 374  LEU D CA  1 
ATOM   10465 C  C   . LEU D 1 396 ? 51.529  122.231 62.291  1.00 28.05  ? 374  LEU D C   1 
ATOM   10466 O  O   . LEU D 1 396 ? 52.697  121.925 62.039  1.00 26.26  ? 374  LEU D O   1 
ATOM   10467 C  CB  . LEU D 1 396 ? 51.069  123.250 60.029  1.00 35.89  ? 374  LEU D CB  1 
ATOM   10468 C  CG  . LEU D 1 396 ? 50.804  124.534 59.226  1.00 33.43  ? 374  LEU D CG  1 
ATOM   10469 C  CD1 . LEU D 1 396 ? 50.737  124.196 57.748  1.00 32.44  ? 374  LEU D CD1 1 
ATOM   10470 C  CD2 . LEU D 1 396 ? 49.503  125.196 59.671  1.00 34.38  ? 374  LEU D CD2 1 
ATOM   10471 N  N   . PRO D 1 397 ? 50.794  121.600 63.231  1.00 27.73  ? 375  PRO D N   1 
ATOM   10472 C  CA  . PRO D 1 397 ? 51.204  120.491 64.110  1.00 26.96  ? 375  PRO D CA  1 
ATOM   10473 C  C   . PRO D 1 397 ? 51.622  119.114 63.603  1.00 27.03  ? 375  PRO D C   1 
ATOM   10474 O  O   . PRO D 1 397 ? 52.635  118.584 64.074  1.00 31.29  ? 375  PRO D O   1 
ATOM   10475 C  CB  . PRO D 1 397 ? 50.050  120.400 65.111  1.00 23.56  ? 375  PRO D CB  1 
ATOM   10476 C  CG  . PRO D 1 397 ? 49.488  121.805 65.116  1.00 19.71  ? 375  PRO D CG  1 
ATOM   10477 C  CD  . PRO D 1 397 ? 49.479  122.118 63.652  1.00 20.12  ? 375  PRO D CD  1 
ATOM   10478 N  N   . ASP D 1 398 ? 50.871  118.509 62.688  1.00 27.06  ? 376  ASP D N   1 
ATOM   10479 C  CA  . ASP D 1 398 ? 51.266  117.175 62.201  1.00 29.36  ? 376  ASP D CA  1 
ATOM   10480 C  C   . ASP D 1 398 ? 50.877  116.848 60.765  1.00 26.02  ? 376  ASP D C   1 
ATOM   10481 O  O   . ASP D 1 398 ? 50.261  117.651 60.080  1.00 31.79  ? 376  ASP D O   1 
ATOM   10482 C  CB  . ASP D 1 398 ? 50.724  116.075 63.133  1.00 30.32  ? 376  ASP D CB  1 
ATOM   10483 C  CG  . ASP D 1 398 ? 49.216  116.009 63.153  1.00 19.02  ? 376  ASP D CG  1 
ATOM   10484 O  OD1 . ASP D 1 398 ? 48.678  115.058 63.752  1.00 30.84  ? 376  ASP D OD1 1 
ATOM   10485 O  OD2 . ASP D 1 398 ? 48.572  116.903 62.576  1.00 30.49  ? 376  ASP D OD2 1 
ATOM   10486 N  N   . SER D 1 399 ? 51.245  115.653 60.325  1.00 26.35  ? 377  SER D N   1 
ATOM   10487 C  CA  . SER D 1 399 ? 50.971  115.204 58.967  1.00 30.61  ? 377  SER D CA  1 
ATOM   10488 C  C   . SER D 1 399 ? 49.624  114.516 58.789  1.00 32.28  ? 377  SER D C   1 
ATOM   10489 O  O   . SER D 1 399 ? 48.944  114.196 59.760  1.00 39.64  ? 377  SER D O   1 
ATOM   10490 C  CB  . SER D 1 399 ? 52.071  114.245 58.503  1.00 40.09  ? 377  SER D CB  1 
ATOM   10491 O  OG  . SER D 1 399 ? 51.858  112.928 58.992  1.00 39.59  ? 377  SER D OG  1 
ATOM   10492 N  N   . VAL D 1 400 ? 49.253  114.282 57.535  1.00 33.35  ? 378  VAL D N   1 
ATOM   10493 C  CA  . VAL D 1 400 ? 47.999  113.617 57.225  1.00 29.31  ? 378  VAL D CA  1 
ATOM   10494 C  C   . VAL D 1 400 ? 48.086  112.141 57.611  1.00 34.75  ? 378  VAL D C   1 
ATOM   10495 O  O   . VAL D 1 400 ? 47.066  111.467 57.729  1.00 36.51  ? 378  VAL D O   1 
ATOM   10496 C  CB  . VAL D 1 400 ? 47.656  113.685 55.695  1.00 27.82  ? 378  VAL D CB  1 
ATOM   10497 C  CG1 . VAL D 1 400 ? 47.322  115.093 55.277  1.00 16.77  ? 378  VAL D CG1 1 
ATOM   10498 C  CG2 . VAL D 1 400 ? 48.820  113.169 54.875  1.00 17.89  ? 378  VAL D CG2 1 
ATOM   10499 N  N   . ARG D 1 401 ? 49.302  111.643 57.814  1.00 34.15  ? 379  ARG D N   1 
ATOM   10500 C  CA  . ARG D 1 401 ? 49.492  110.233 58.151  1.00 35.72  ? 379  ARG D CA  1 
ATOM   10501 C  C   . ARG D 1 401 ? 48.540  109.675 59.199  1.00 37.17  ? 379  ARG D C   1 
ATOM   10502 O  O   . ARG D 1 401 ? 48.015  108.579 59.035  1.00 42.04  ? 379  ARG D O   1 
ATOM   10503 C  CB  . ARG D 1 401 ? 50.919  109.968 58.616  1.00 23.58  ? 379  ARG D CB  1 
ATOM   10504 C  CG  . ARG D 1 401 ? 51.287  108.493 58.545  1.00 29.82  ? 379  ARG D CG  1 
ATOM   10505 C  CD  . ARG D 1 401 ? 52.444  108.182 59.480  1.00 36.88  ? 379  ARG D CD  1 
ATOM   10506 N  NE  . ARG D 1 401 ? 52.096  108.537 60.854  1.00 41.49  ? 379  ARG D NE  1 
ATOM   10507 C  CZ  . ARG D 1 401 ? 52.932  109.105 61.715  1.00 40.70  ? 379  ARG D CZ  1 
ATOM   10508 N  NH1 . ARG D 1 401 ? 54.177  109.383 61.343  1.00 27.26  ? 379  ARG D NH1 1 
ATOM   10509 N  NH2 . ARG D 1 401 ? 52.514  109.411 62.940  1.00 38.84  ? 379  ARG D NH2 1 
ATOM   10510 N  N   . ASN D 1 402 ? 48.326  110.411 60.279  1.00 42.48  ? 380  ASN D N   1 
ATOM   10511 C  CA  . ASN D 1 402 ? 47.436  109.942 61.341  1.00 50.53  ? 380  ASN D CA  1 
ATOM   10512 C  C   . ASN D 1 402 ? 45.955  110.032 60.977  1.00 53.09  ? 380  ASN D C   1 
ATOM   10513 O  O   . ASN D 1 402 ? 45.088  109.628 61.758  1.00 57.13  ? 380  ASN D O   1 
ATOM   10514 C  CB  . ASN D 1 402 ? 47.687  110.737 62.623  1.00 50.52  ? 380  ASN D CB  1 
ATOM   10515 C  CG  . ASN D 1 402 ? 48.784  110.141 63.469  1.00 58.37  ? 380  ASN D CG  1 
ATOM   10516 O  OD1 . ASN D 1 402 ? 49.650  109.420 62.965  1.00 59.24  ? 380  ASN D OD1 1 
ATOM   10517 N  ND2 . ASN D 1 402 ? 48.764  110.447 64.766  1.00 63.89  ? 380  ASN D ND2 1 
ATOM   10518 N  N   . TYR D 1 403 ? 45.660  110.546 59.791  1.00 49.96  ? 381  TYR D N   1 
ATOM   10519 C  CA  . TYR D 1 403 ? 44.273  110.691 59.390  1.00 48.26  ? 381  TYR D CA  1 
ATOM   10520 C  C   . TYR D 1 403 ? 43.963  110.091 58.016  1.00 47.46  ? 381  TYR D C   1 
ATOM   10521 O  O   . TYR D 1 403 ? 43.023  110.516 57.342  1.00 44.63  ? 381  TYR D O   1 
ATOM   10522 C  CB  . TYR D 1 403 ? 43.899  112.176 59.416  1.00 46.62  ? 381  TYR D CB  1 
ATOM   10523 C  CG  . TYR D 1 403 ? 44.493  112.931 60.587  1.00 47.94  ? 381  TYR D CG  1 
ATOM   10524 C  CD1 . TYR D 1 403 ? 45.670  113.669 60.451  1.00 50.27  ? 381  TYR D CD1 1 
ATOM   10525 C  CD2 . TYR D 1 403 ? 43.876  112.908 61.835  1.00 44.50  ? 381  TYR D CD2 1 
ATOM   10526 C  CE1 . TYR D 1 403 ? 46.211  114.370 61.535  1.00 48.47  ? 381  TYR D CE1 1 
ATOM   10527 C  CE2 . TYR D 1 403 ? 44.405  113.599 62.918  1.00 36.31  ? 381  TYR D CE2 1 
ATOM   10528 C  CZ  . TYR D 1 403 ? 45.567  114.331 62.769  1.00 44.29  ? 381  TYR D CZ  1 
ATOM   10529 O  OH  . TYR D 1 403 ? 46.057  115.046 63.847  1.00 31.04  ? 381  TYR D OH  1 
ATOM   10530 N  N   . MET D 1 404 ? 44.741  109.095 57.608  1.00 45.96  ? 382  MET D N   1 
ATOM   10531 C  CA  . MET D 1 404 ? 44.535  108.463 56.312  1.00 45.48  ? 382  MET D CA  1 
ATOM   10532 C  C   . MET D 1 404 ? 43.096  108.034 56.112  1.00 46.02  ? 382  MET D C   1 
ATOM   10533 O  O   . MET D 1 404 ? 42.515  108.257 55.049  1.00 49.56  ? 382  MET D O   1 
ATOM   10534 C  CB  . MET D 1 404 ? 45.450  107.250 56.158  1.00 42.60  ? 382  MET D CB  1 
ATOM   10535 C  CG  . MET D 1 404 ? 46.920  107.613 56.128  1.00 39.87  ? 382  MET D CG  1 
ATOM   10536 S  SD  . MET D 1 404 ? 47.194  108.941 54.959  1.00 43.60  ? 382  MET D SD  1 
ATOM   10537 C  CE  . MET D 1 404 ? 47.575  108.019 53.489  1.00 35.21  ? 382  MET D CE  1 
ATOM   10538 N  N   . THR D 1 405 ? 42.518  107.424 57.139  1.00 46.14  ? 383  THR D N   1 
ATOM   10539 C  CA  . THR D 1 405 ? 41.145  106.949 57.059  1.00 41.59  ? 383  THR D CA  1 
ATOM   10540 C  C   . THR D 1 405 ? 40.117  107.890 57.678  1.00 45.23  ? 383  THR D C   1 
ATOM   10541 O  O   . THR D 1 405 ? 39.001  107.477 57.977  1.00 44.78  ? 383  THR D O   1 
ATOM   10542 C  CB  . THR D 1 405 ? 41.006  105.574 57.722  1.00 39.51  ? 383  THR D CB  1 
ATOM   10543 O  OG1 . THR D 1 405 ? 41.305  105.687 59.119  1.00 30.87  ? 383  THR D OG1 1 
ATOM   10544 C  CG2 . THR D 1 405 ? 41.962  104.566 57.068  1.00 31.42  ? 383  THR D CG2 1 
ATOM   10545 N  N   . LYS D 1 406 ? 40.485  109.153 57.867  1.00 46.57  ? 384  LYS D N   1 
ATOM   10546 C  CA  . LYS D 1 406 ? 39.550  110.116 58.434  1.00 46.85  ? 384  LYS D CA  1 
ATOM   10547 C  C   . LYS D 1 406 ? 39.260  111.281 57.477  1.00 43.70  ? 384  LYS D C   1 
ATOM   10548 O  O   . LYS D 1 406 ? 38.754  111.051 56.379  1.00 42.48  ? 384  LYS D O   1 
ATOM   10549 C  CB  . LYS D 1 406 ? 40.050  110.613 59.800  1.00 49.39  ? 384  LYS D CB  1 
ATOM   10550 C  CG  . LYS D 1 406 ? 40.085  109.509 60.873  1.00 51.16  ? 384  LYS D CG  1 
ATOM   10551 C  CD  . LYS D 1 406 ? 40.171  110.082 62.295  1.00 52.53  ? 384  LYS D CD  1 
ATOM   10552 C  CE  . LYS D 1 406 ? 40.148  108.984 63.355  1.00 49.54  ? 384  LYS D CE  1 
ATOM   10553 N  NZ  . LYS D 1 406 ? 40.120  109.533 64.738  1.00 50.77  ? 384  LYS D NZ  1 
ATOM   10554 N  N   . PHE D 1 407 ? 39.583  112.513 57.860  1.00 37.90  ? 385  PHE D N   1 
ATOM   10555 C  CA  . PHE D 1 407 ? 39.285  113.655 56.997  1.00 39.26  ? 385  PHE D CA  1 
ATOM   10556 C  C   . PHE D 1 407 ? 39.888  113.542 55.598  1.00 41.61  ? 385  PHE D C   1 
ATOM   10557 O  O   . PHE D 1 407 ? 39.469  114.238 54.671  1.00 44.96  ? 385  PHE D O   1 
ATOM   10558 C  CB  . PHE D 1 407 ? 39.725  114.973 57.667  1.00 40.36  ? 385  PHE D CB  1 
ATOM   10559 C  CG  . PHE D 1 407 ? 41.164  115.364 57.405  1.00 42.76  ? 385  PHE D CG  1 
ATOM   10560 C  CD1 . PHE D 1 407 ? 41.533  115.988 56.210  1.00 42.33  ? 385  PHE D CD1 1 
ATOM   10561 C  CD2 . PHE D 1 407 ? 42.144  115.120 58.361  1.00 45.33  ? 385  PHE D CD2 1 
ATOM   10562 C  CE1 . PHE D 1 407 ? 42.858  116.363 55.971  1.00 45.04  ? 385  PHE D CE1 1 
ATOM   10563 C  CE2 . PHE D 1 407 ? 43.472  115.491 58.135  1.00 51.41  ? 385  PHE D CE2 1 
ATOM   10564 C  CZ  . PHE D 1 407 ? 43.830  116.114 56.936  1.00 46.39  ? 385  PHE D CZ  1 
ATOM   10565 N  N   . LEU D 1 408 ? 40.866  112.660 55.443  1.00 39.15  ? 386  LEU D N   1 
ATOM   10566 C  CA  . LEU D 1 408 ? 41.518  112.474 54.158  1.00 42.53  ? 386  LEU D CA  1 
ATOM   10567 C  C   . LEU D 1 408 ? 40.706  111.513 53.291  1.00 47.32  ? 386  LEU D C   1 
ATOM   10568 O  O   . LEU D 1 408 ? 41.075  111.228 52.153  1.00 58.32  ? 386  LEU D O   1 
ATOM   10569 C  CB  . LEU D 1 408 ? 42.948  111.948 54.382  1.00 35.50  ? 386  LEU D CB  1 
ATOM   10570 C  CG  . LEU D 1 408 ? 44.067  112.131 53.339  1.00 37.89  ? 386  LEU D CG  1 
ATOM   10571 C  CD1 . LEU D 1 408 ? 44.138  110.926 52.428  1.00 31.05  ? 386  LEU D CD1 1 
ATOM   10572 C  CD2 . LEU D 1 408 ? 43.851  113.427 52.553  1.00 24.94  ? 386  LEU D CD2 1 
ATOM   10573 N  N   . SER D 1 409 ? 39.589  111.029 53.828  1.00 52.46  ? 387  SER D N   1 
ATOM   10574 C  CA  . SER D 1 409 ? 38.731  110.095 53.097  1.00 54.01  ? 387  SER D CA  1 
ATOM   10575 C  C   . SER D 1 409 ? 37.311  110.628 52.938  1.00 54.98  ? 387  SER D C   1 
ATOM   10576 O  O   . SER D 1 409 ? 36.660  110.977 53.922  1.00 57.53  ? 387  SER D O   1 
ATOM   10577 C  CB  . SER D 1 409 ? 38.687  108.747 53.821  1.00 50.31  ? 387  SER D CB  1 
ATOM   10578 O  OG  . SER D 1 409 ? 37.945  107.794 53.080  1.00 54.77  ? 387  SER D OG  1 
ATOM   10579 N  N   . ASP D 1 410 ? 36.831  110.684 51.698  1.00 55.66  ? 388  ASP D N   1 
ATOM   10580 C  CA  . ASP D 1 410 ? 35.484  111.177 51.427  1.00 54.83  ? 388  ASP D CA  1 
ATOM   10581 C  C   . ASP D 1 410 ? 34.421  110.345 52.143  1.00 56.99  ? 388  ASP D C   1 
ATOM   10582 O  O   . ASP D 1 410 ? 33.439  110.887 52.654  1.00 52.51  ? 388  ASP D O   1 
ATOM   10583 C  CB  . ASP D 1 410 ? 35.212  111.184 49.920  1.00 57.12  ? 388  ASP D CB  1 
ATOM   10584 C  CG  . ASP D 1 410 ? 36.119  112.141 49.167  1.00 60.38  ? 388  ASP D CG  1 
ATOM   10585 O  OD1 . ASP D 1 410 ? 35.803  112.470 48.003  1.00 67.72  ? 388  ASP D OD1 1 
ATOM   10586 O  OD2 . ASP D 1 410 ? 37.149  112.560 49.732  1.00 52.29  ? 388  ASP D OD2 1 
ATOM   10587 N  N   . ARG D 1 411 ? 34.614  109.029 52.171  1.00 61.72  ? 389  ARG D N   1 
ATOM   10588 C  CA  . ARG D 1 411 ? 33.680  108.129 52.849  1.00 66.66  ? 389  ARG D CA  1 
ATOM   10589 C  C   . ARG D 1 411 ? 33.452  108.644 54.267  1.00 65.58  ? 389  ARG D C   1 
ATOM   10590 O  O   . ARG D 1 411 ? 32.315  108.815 54.709  1.00 64.91  ? 389  ARG D O   1 
ATOM   10591 C  CB  . ARG D 1 411 ? 34.257  106.709 52.912  1.00 70.84  ? 389  ARG D CB  1 
ATOM   10592 C  CG  . ARG D 1 411 ? 34.256  105.963 51.586  1.00 76.85  ? 389  ARG D CG  1 
ATOM   10593 C  CD  . ARG D 1 411 ? 35.196  104.756 51.617  1.00 80.78  ? 389  ARG D CD  1 
ATOM   10594 N  NE  . ARG D 1 411 ? 36.601  105.167 51.634  1.00 89.38  ? 389  ARG D NE  1 
ATOM   10595 C  CZ  . ARG D 1 411 ? 37.636  104.330 51.573  1.00 89.32  ? 389  ARG D CZ  1 
ATOM   10596 N  NH1 . ARG D 1 411 ? 37.435  103.021 51.490  1.00 90.44  ? 389  ARG D NH1 1 
ATOM   10597 N  NH2 . ARG D 1 411 ? 38.875  104.806 51.591  1.00 85.72  ? 389  ARG D NH2 1 
ATOM   10598 N  N   . TRP D 1 412 ? 34.554  108.890 54.968  1.00 63.88  ? 390  TRP D N   1 
ATOM   10599 C  CA  . TRP D 1 412 ? 34.520  109.388 56.337  1.00 60.48  ? 390  TRP D CA  1 
ATOM   10600 C  C   . TRP D 1 412 ? 33.857  110.756 56.365  1.00 58.87  ? 390  TRP D C   1 
ATOM   10601 O  O   . TRP D 1 412 ? 32.910  110.972 57.114  1.00 61.31  ? 390  TRP D O   1 
ATOM   10602 C  CB  . TRP D 1 412 ? 35.943  109.503 56.890  1.00 58.27  ? 390  TRP D CB  1 
ATOM   10603 C  CG  . TRP D 1 412 ? 36.033  109.735 58.367  1.00 53.73  ? 390  TRP D CG  1 
ATOM   10604 C  CD1 . TRP D 1 412 ? 36.053  108.786 59.345  1.00 53.26  ? 390  TRP D CD1 1 
ATOM   10605 C  CD2 . TRP D 1 412 ? 36.145  110.998 59.031  1.00 52.57  ? 390  TRP D CD2 1 
ATOM   10606 N  NE1 . TRP D 1 412 ? 36.176  109.377 60.580  1.00 51.95  ? 390  TRP D NE1 1 
ATOM   10607 C  CE2 . TRP D 1 412 ? 36.233  110.735 60.416  1.00 54.78  ? 390  TRP D CE2 1 
ATOM   10608 C  CE3 . TRP D 1 412 ? 36.180  112.326 58.592  1.00 51.90  ? 390  TRP D CE3 1 
ATOM   10609 C  CZ2 . TRP D 1 412 ? 36.354  111.754 61.367  1.00 56.90  ? 390  TRP D CZ2 1 
ATOM   10610 C  CZ3 . TRP D 1 412 ? 36.302  113.343 59.539  1.00 52.91  ? 390  TRP D CZ3 1 
ATOM   10611 C  CH2 . TRP D 1 412 ? 36.387  113.049 60.910  1.00 57.15  ? 390  TRP D CH2 1 
ATOM   10612 N  N   . MET D 1 413 ? 34.361  111.679 55.553  1.00 57.67  ? 391  MET D N   1 
ATOM   10613 C  CA  . MET D 1 413 ? 33.803  113.023 55.500  1.00 59.26  ? 391  MET D CA  1 
ATOM   10614 C  C   . MET D 1 413 ? 32.292  112.979 55.284  1.00 63.79  ? 391  MET D C   1 
ATOM   10615 O  O   . MET D 1 413 ? 31.544  113.743 55.897  1.00 63.16  ? 391  MET D O   1 
ATOM   10616 C  CB  . MET D 1 413 ? 34.471  113.827 54.382  1.00 56.68  ? 391  MET D CB  1 
ATOM   10617 C  CG  . MET D 1 413 ? 35.910  114.228 54.673  1.00 51.16  ? 391  MET D CG  1 
ATOM   10618 S  SD  . MET D 1 413 ? 36.050  115.366 56.083  1.00 42.13  ? 391  MET D SD  1 
ATOM   10619 C  CE  . MET D 1 413 ? 35.765  116.949 55.277  1.00 34.84  ? 391  MET D CE  1 
ATOM   10620 N  N   . LEU D 1 414 ? 31.845  112.074 54.418  1.00 66.87  ? 392  LEU D N   1 
ATOM   10621 C  CA  . LEU D 1 414 ? 30.422  111.932 54.131  1.00 69.41  ? 392  LEU D CA  1 
ATOM   10622 C  C   . LEU D 1 414 ? 29.641  111.389 55.330  1.00 67.95  ? 392  LEU D C   1 
ATOM   10623 O  O   . LEU D 1 414 ? 28.697  112.025 55.804  1.00 64.00  ? 392  LEU D O   1 
ATOM   10624 C  CB  . LEU D 1 414 ? 30.217  111.018 52.915  1.00 72.25  ? 392  LEU D CB  1 
ATOM   10625 C  CG  . LEU D 1 414 ? 30.640  111.598 51.556  1.00 73.69  ? 392  LEU D CG  1 
ATOM   10626 C  CD1 . LEU D 1 414 ? 30.587  110.514 50.484  1.00 73.59  ? 392  LEU D CD1 1 
ATOM   10627 C  CD2 . LEU D 1 414 ? 29.725  112.765 51.195  1.00 69.09  ? 392  LEU D CD2 1 
ATOM   10628 N  N   . GLN D 1 415 ? 30.042  110.225 55.834  1.00 67.37  ? 393  GLN D N   1 
ATOM   10629 C  CA  . GLN D 1 415 ? 29.352  109.614 56.968  1.00 68.43  ? 393  GLN D CA  1 
ATOM   10630 C  C   . GLN D 1 415 ? 29.306  110.522 58.204  1.00 67.81  ? 393  GLN D C   1 
ATOM   10631 O  O   . GLN D 1 415 ? 28.349  110.477 58.981  1.00 67.64  ? 393  GLN D O   1 
ATOM   10632 C  CB  . GLN D 1 415 ? 30.006  108.265 57.308  1.00 72.85  ? 393  GLN D CB  1 
ATOM   10633 C  CG  . GLN D 1 415 ? 31.013  108.283 58.450  1.00 78.26  ? 393  GLN D CG  1 
ATOM   10634 C  CD  . GLN D 1 415 ? 30.383  107.930 59.792  1.00 83.59  ? 393  GLN D CD  1 
ATOM   10635 O  OE1 . GLN D 1 415 ? 29.489  108.628 60.279  1.00 86.64  ? 393  GLN D OE1 1 
ATOM   10636 N  NE2 . GLN D 1 415 ? 30.847  106.836 60.394  1.00 84.39  ? 393  GLN D NE2 1 
ATOM   10637 N  N   . LYS D 1 416 ? 30.334  111.346 58.389  1.00 66.92  ? 394  LYS D N   1 
ATOM   10638 C  CA  . LYS D 1 416 ? 30.368  112.249 59.534  1.00 64.80  ? 394  LYS D CA  1 
ATOM   10639 C  C   . LYS D 1 416 ? 29.566  113.510 59.248  1.00 65.82  ? 394  LYS D C   1 
ATOM   10640 O  O   . LYS D 1 416 ? 29.391  114.351 60.128  1.00 66.47  ? 394  LYS D O   1 
ATOM   10641 C  CB  . LYS D 1 416 ? 31.807  112.639 59.885  1.00 63.45  ? 394  LYS D CB  1 
ATOM   10642 C  CG  . LYS D 1 416 ? 32.741  111.470 60.173  1.00 66.24  ? 394  LYS D CG  1 
ATOM   10643 C  CD  . LYS D 1 416 ? 32.283  110.617 61.353  1.00 58.83  ? 394  LYS D CD  1 
ATOM   10644 C  CE  . LYS D 1 416 ? 32.317  111.381 62.659  1.00 57.48  ? 394  LYS D CE  1 
ATOM   10645 N  NZ  . LYS D 1 416 ? 31.989  110.494 63.809  1.00 55.76  ? 394  LYS D NZ  1 
ATOM   10646 N  N   . GLY D 1 417 ? 29.090  113.644 58.015  1.00 66.21  ? 395  GLY D N   1 
ATOM   10647 C  CA  . GLY D 1 417 ? 28.303  114.809 57.652  1.00 68.01  ? 395  GLY D CA  1 
ATOM   10648 C  C   . GLY D 1 417 ? 29.079  116.111 57.577  1.00 68.83  ? 395  GLY D C   1 
ATOM   10649 O  O   . GLY D 1 417 ? 28.562  117.174 57.929  1.00 71.02  ? 395  GLY D O   1 
ATOM   10650 N  N   . PHE D 1 418 ? 30.325  116.032 57.123  1.00 69.53  ? 396  PHE D N   1 
ATOM   10651 C  CA  . PHE D 1 418 ? 31.172  117.214 56.983  1.00 68.06  ? 396  PHE D CA  1 
ATOM   10652 C  C   . PHE D 1 418 ? 31.204  117.558 55.502  1.00 70.18  ? 396  PHE D C   1 
ATOM   10653 O  O   . PHE D 1 418 ? 31.365  118.716 55.109  1.00 69.44  ? 396  PHE D O   1 
ATOM   10654 C  CB  . PHE D 1 418 ? 32.602  116.913 57.445  1.00 66.15  ? 396  PHE D CB  1 
ATOM   10655 C  CG  . PHE D 1 418 ? 32.737  116.686 58.920  1.00 60.83  ? 396  PHE D CG  1 
ATOM   10656 C  CD1 . PHE D 1 418 ? 33.409  115.569 59.400  1.00 55.64  ? 396  PHE D CD1 1 
ATOM   10657 C  CD2 . PHE D 1 418 ? 32.221  117.602 59.829  1.00 62.30  ? 396  PHE D CD2 1 
ATOM   10658 C  CE1 . PHE D 1 418 ? 33.567  115.368 60.763  1.00 61.09  ? 396  PHE D CE1 1 
ATOM   10659 C  CE2 . PHE D 1 418 ? 32.372  117.412 61.195  1.00 58.04  ? 396  PHE D CE2 1 
ATOM   10660 C  CZ  . PHE D 1 418 ? 33.047  116.293 61.664  1.00 62.14  ? 396  PHE D CZ  1 
ATOM   10661 N  N   . LEU D 1 419 ? 31.044  116.526 54.684  1.00 69.91  ? 397  LEU D N   1 
ATOM   10662 C  CA  . LEU D 1 419 ? 31.074  116.691 53.247  1.00 72.86  ? 397  LEU D CA  1 
ATOM   10663 C  C   . LEU D 1 419 ? 29.806  116.145 52.604  1.00 76.75  ? 397  LEU D C   1 
ATOM   10664 O  O   . LEU D 1 419 ? 29.199  115.216 53.182  1.00 80.00  ? 397  LEU D O   1 
ATOM   10665 C  CB  . LEU D 1 419 ? 32.311  115.975 52.696  1.00 72.51  ? 397  LEU D CB  1 
ATOM   10666 C  CG  . LEU D 1 419 ? 32.690  116.177 51.231  1.00 74.78  ? 397  LEU D CG  1 
ATOM   10667 C  CD1 . LEU D 1 419 ? 31.852  115.273 50.345  1.00 75.89  ? 397  LEU D CD1 1 
ATOM   10668 C  CD2 . LEU D 1 419 ? 32.506  117.646 50.862  1.00 77.02  ? 397  LEU D CD2 1 
ATOM   10669 N  N   . TRP E 1 65  ? 56.024  21.886  44.222  1.00 62.72  ? 43   TRP E N   1 
ATOM   10670 C  CA  . TRP E 1 65  ? 56.008  21.426  45.641  1.00 68.13  ? 43   TRP E CA  1 
ATOM   10671 C  C   . TRP E 1 65  ? 57.437  21.063  45.922  1.00 70.69  ? 43   TRP E C   1 
ATOM   10672 O  O   . TRP E 1 65  ? 58.185  20.795  44.984  1.00 72.56  ? 43   TRP E O   1 
ATOM   10673 C  CB  . TRP E 1 65  ? 55.248  20.104  45.832  1.00 70.40  ? 43   TRP E CB  1 
ATOM   10674 C  CG  . TRP E 1 65  ? 55.066  19.773  47.323  1.00 75.64  ? 43   TRP E CG  1 
ATOM   10675 C  CD1 . TRP E 1 65  ? 54.382  20.542  48.200  1.00 77.11  ? 43   TRP E CD1 1 
ATOM   10676 C  CD2 . TRP E 1 65  ? 55.520  18.610  48.088  1.00 77.51  ? 43   TRP E CD2 1 
ATOM   10677 N  NE1 . TRP E 1 65  ? 54.362  19.965  49.444  1.00 81.14  ? 43   TRP E NE1 1 
ATOM   10678 C  CE2 . TRP E 1 65  ? 55.045  18.781  49.410  1.00 78.07  ? 43   TRP E CE2 1 
ATOM   10679 C  CE3 . TRP E 1 65  ? 56.268  17.457  47.788  1.00 78.16  ? 43   TRP E CE3 1 
ATOM   10680 C  CZ2 . TRP E 1 65  ? 55.282  17.846  50.434  1.00 75.87  ? 43   TRP E CZ2 1 
ATOM   10681 C  CZ3 . TRP E 1 65  ? 56.508  16.518  48.822  1.00 73.87  ? 43   TRP E CZ3 1 
ATOM   10682 C  CH2 . TRP E 1 65  ? 56.010  16.728  50.124  1.00 76.09  ? 43   TRP E CH2 1 
ATOM   10683 N  N   . ILE E 1 66  ? 57.828  21.072  47.193  1.00 72.12  ? 44   ILE E N   1 
ATOM   10684 C  CA  . ILE E 1 66  ? 59.140  20.539  47.481  1.00 71.92  ? 44   ILE E