data_1JBR
# 
_entry.id   1JBR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JBR         
NDB   PR0051       
RCSB  RCSB013596   
WWPDB D_1000013596 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1aqz 'crystal structure of the ribotoxin restrictocin'                                                    unspecified 
PDB 430D 'structure of Sarcin/Ricin loop from rat 28S RNA'                                                    unspecified 
PDB 480D 'Crystal Structure Of The Sarcin/Ricin Domain From E. Coli 23 S Rrna'                                unspecified 
PDB 483D 'Crystal Structure Of The Sarcin/Ricin Domain From E. Coli 23 S Rrna'                                unspecified 
PDB 1JBS 'Crystal structure of ribotoxin restrictocin and a 29-mer SRD RNA analog'                            unspecified 
PDB 1JBT 'Crystal structure of ribotoxin restrictocin complexed with a 29-mer sarcin/ricin domain RNA analog' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JBR 
_pdbx_database_status.recvd_initial_deposition_date   2001-06-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yang, X.'      1 
'Gerczei, T.'   2 
'Glover, L.'    3 
'Correll, C.C.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structures of restrictocin-inhibitor complexes with implications for RNA recognition and base flipping.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            8 
_citation.page_first                968 
_citation.page_last                 973 
_citation.year                      2001 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11685244 
_citation.pdbx_database_id_DOI      10.1038/nsb1101-968 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yang, X.'      1 
primary 'Gerczei, T.'   2 
primary 'Glover, L.T.'  3 
primary 'Correll, C.C.' 4 
# 
_cell.entry_id           1JBR 
_cell.length_a           60.4 
_cell.length_b           109.7 
_cell.length_c           40.0 
_cell.angle_alpha        90.0 
_cell.angle_beta         97.8 
_cell.angle_gamma        90.0 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JBR 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-R(*GP*CP*GP*CP*UP*CP*CP*UP*CP*AP*GP*UP*AP*CP*GP*AP*GP*(A23))-3'" 5809.448  1   ?        ? ? ? 
2 polymer     syn "5'-R(*GP*GP*AP*AP*CP*CP*GP*GP*AP*GP*CP*GP*C)-3'"                    4234.621  1   ?        ? ? ? 
3 polymer     syn '31-mer SRD RNA analog'                                              10027.062 1   ?        ? ? ? 
4 polymer     nat Restrictocin                                                         16889.877 2   3.1.27.- ? ? ? 
5 non-polymer syn 'POTASSIUM ION'                                                      39.098    5   ?        ? ? ? 
6 water       nat water                                                                18.015    168 ?        ? ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        'ribonuclease mitogillin' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no yes 'GCGCUCCUCAGUACGAG(A23)' GCGCUCCUCAGUACGAGA C   ? 
2 polyribonucleotide no no  GGAACCGGAGCGC GGAACCGGAGCGC F   ? 
3 polyribonucleotide no no  GCGCUCCUCAGUACGAGAGGAACCGGAGCGC GCGCUCCUCAGUACGAGAGGAACCGGAGCGC D   ? 
4 'polypeptide(L)'   no no  
;ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPK
HSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
;
;ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPK
HSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   G   n 
1 2   C   n 
1 3   G   n 
1 4   C   n 
1 5   U   n 
1 6   C   n 
1 7   C   n 
1 8   U   n 
1 9   C   n 
1 10  A   n 
1 11  G   n 
1 12  U   n 
1 13  A   n 
1 14  C   n 
1 15  G   n 
1 16  A   n 
1 17  G   n 
1 18  A23 n 
2 1   G   n 
2 2   G   n 
2 3   A   n 
2 4   A   n 
2 5   C   n 
2 6   C   n 
2 7   G   n 
2 8   G   n 
2 9   A   n 
2 10  G   n 
2 11  C   n 
2 12  G   n 
2 13  C   n 
3 1   G   n 
3 2   C   n 
3 3   G   n 
3 4   C   n 
3 5   U   n 
3 6   C   n 
3 7   C   n 
3 8   U   n 
3 9   C   n 
3 10  A   n 
3 11  G   n 
3 12  U   n 
3 13  A   n 
3 14  C   n 
3 15  G   n 
3 16  A   n 
3 17  G   n 
3 18  A   n 
3 19  G   n 
3 20  G   n 
3 21  A   n 
3 22  A   n 
3 23  C   n 
3 24  C   n 
3 25  G   n 
3 26  G   n 
3 27  A   n 
3 28  G   n 
3 29  C   n 
3 30  G   n 
3 31  C   n 
4 1   ALA n 
4 2   THR n 
4 3   TRP n 
4 4   THR n 
4 5   CYS n 
4 6   ILE n 
4 7   ASN n 
4 8   GLN n 
4 9   GLN n 
4 10  LEU n 
4 11  ASN n 
4 12  PRO n 
4 13  LYS n 
4 14  THR n 
4 15  ASN n 
4 16  LYS n 
4 17  TRP n 
4 18  GLU n 
4 19  ASP n 
4 20  LYS n 
4 21  ARG n 
4 22  LEU n 
4 23  LEU n 
4 24  TYR n 
4 25  SER n 
4 26  GLN n 
4 27  ALA n 
4 28  LYS n 
4 29  ALA n 
4 30  GLU n 
4 31  SER n 
4 32  ASN n 
4 33  SER n 
4 34  HIS n 
4 35  HIS n 
4 36  ALA n 
4 37  PRO n 
4 38  LEU n 
4 39  SER n 
4 40  ASP n 
4 41  GLY n 
4 42  LYS n 
4 43  THR n 
4 44  GLY n 
4 45  SER n 
4 46  SER n 
4 47  TYR n 
4 48  PRO n 
4 49  HIS n 
4 50  TRP n 
4 51  PHE n 
4 52  THR n 
4 53  ASN n 
4 54  GLY n 
4 55  TYR n 
4 56  ASP n 
4 57  GLY n 
4 58  ASN n 
4 59  GLY n 
4 60  LYS n 
4 61  LEU n 
4 62  ILE n 
4 63  LYS n 
4 64  GLY n 
4 65  ARG n 
4 66  THR n 
4 67  PRO n 
4 68  ILE n 
4 69  LYS n 
4 70  PHE n 
4 71  GLY n 
4 72  LYS n 
4 73  ALA n 
4 74  ASP n 
4 75  CYS n 
4 76  ASP n 
4 77  ARG n 
4 78  PRO n 
4 79  PRO n 
4 80  LYS n 
4 81  HIS n 
4 82  SER n 
4 83  GLN n 
4 84  ASN n 
4 85  GLY n 
4 86  MET n 
4 87  GLY n 
4 88  LYS n 
4 89  ASP n 
4 90  ASP n 
4 91  HIS n 
4 92  TYR n 
4 93  LEU n 
4 94  LEU n 
4 95  GLU n 
4 96  PHE n 
4 97  PRO n 
4 98  THR n 
4 99  PHE n 
4 100 PRO n 
4 101 ASP n 
4 102 GLY n 
4 103 HIS n 
4 104 ASP n 
4 105 TYR n 
4 106 LYS n 
4 107 PHE n 
4 108 ASP n 
4 109 SER n 
4 110 LYS n 
4 111 LYS n 
4 112 PRO n 
4 113 LYS n 
4 114 GLU n 
4 115 ASP n 
4 116 PRO n 
4 117 GLY n 
4 118 PRO n 
4 119 ALA n 
4 120 ARG n 
4 121 VAL n 
4 122 ILE n 
4 123 TYR n 
4 124 THR n 
4 125 TYR n 
4 126 PRO n 
4 127 ASN n 
4 128 LYS n 
4 129 VAL n 
4 130 PHE n 
4 131 CYS n 
4 132 GLY n 
4 133 ILE n 
4 134 VAL n 
4 135 ALA n 
4 136 HIS n 
4 137 GLN n 
4 138 ARG n 
4 139 GLY n 
4 140 ASN n 
4 141 GLN n 
4 142 GLY n 
4 143 ASP n 
4 144 LEU n 
4 145 ARG n 
4 146 LEU n 
4 147 CYS n 
4 148 SER n 
4 149 HIS n 
# 
_entity_src_nat.entity_id                  4 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Aspergillus restrictus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      5064 
_entity_src_nat.genus                      Aspergillus 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'The sequence contains 14 highly conserved nucleotides among all living species.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP RNMG_ASPRE P67876 4 28 ? ? 
2 PDB 1JBR       1JBR   1 ?  ? ? 
3 PDB 1JBR       1JBR   2 ?  ? ? 
4 PDB 1JBR       1JBR   3 ?  ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JBR A 1 ? 149 ? P67876 28 ? 176 ? 1  149 
2 1 1JBR B 1 ? 149 ? P67876 28 ? 176 ? 1  149 
3 2 1JBR C 1 ? 18  ? 1JBR   0  ? 17  ? 0  17  
4 3 1JBR F 1 ? 13  ? 1JBR   18 ? 30  ? 18 30  
5 4 1JBR D 1 ? 31  ? 1JBR   0  ? 30  ? 0  30  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                    ? 'C10 H14 N5 O7 P'  347.221 
A23 'RNA linking'       n 
;ADENOSINE-5'-PHOSPHATE-2',3'-CYCLIC PHOSPHATE
;
? 'C10 H13 N5 O9 P2' 409.186 
ALA 'L-peptide linking' y ALANINE                                         ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                        ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                      ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                 ? 'C4 H7 N O4'       133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                     ? 'C9 H14 N3 O8 P'   323.197 
CYS 'L-peptide linking' y CYSTEINE                                        ? 'C3 H7 N O2 S'     121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                    ? 'C10 H14 N5 O8 P'  363.221 
GLN 'L-peptide linking' y GLUTAMINE                                       ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                 ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                         ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                       ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                           ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                      ? 'C6 H13 N O2'      131.173 
K   non-polymer         . 'POTASSIUM ION'                                 ? 'K 1'              39.098  
LEU 'L-peptide linking' y LEUCINE                                         ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                          ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                      ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                   ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                         ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                          ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                       ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                      ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                        ? 'C9 H11 N O3'      181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                      ? 'C9 H13 N2 O9 P'   324.181 
VAL 'L-peptide linking' y VALINE                                          ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1JBR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.44 
_exptl_crystal.density_percent_sol   49.53 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'PEG5000, K-MES, KCl, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 PEG5000 ? ? ? 
1 2 1 K-MES   ? ? ? 
1 3 1 KCl     ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2000-03-22 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    crystal 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-BM-C' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-BM-C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.entry_id                     1JBR 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             500 
_reflns.d_resolution_high            2.15 
_reflns.number_obs                   24648 
_reflns.number_all                   28101 
_reflns.percent_possible_obs         96.6 
_reflns.pdbx_Rmerge_I_obs            0.048 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        24.2 
_reflns.B_iso_Wilson_estimate        51.8 
_reflns.pdbx_redundancy              2.66 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.15 
_reflns_shell.d_res_low              2.19 
_reflns_shell.percent_possible_all   92.4 
_reflns_shell.Rmerge_I_obs           0.465 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.37 
_reflns_shell.pdbx_redundancy        2.16 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1277 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1JBR 
_refine.ls_number_reflns_obs                     24648 
_refine.ls_number_reflns_all                     28101 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             19.96 
_refine.ls_d_res_high                            2.15 
_refine.ls_percent_reflns_obs                    88.4 
_refine.ls_R_factor_obs                          0.238 
_refine.ls_R_factor_all                          0.238 
_refine.ls_R_factor_R_work                       0.232 
_refine.ls_R_factor_R_free                       0.29 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.9 
_refine.ls_number_reflns_R_free                  2437 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               50.02 
_refine.aniso_B[1][1]                            0.40 
_refine.aniso_B[2][2]                            -3.96 
_refine.aniso_B[3][3]                            3.56 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            13.90 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'flat model' 
_refine.solvent_model_param_ksol                 0.318052 
_refine.solvent_model_param_bsol                 40.7006 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;Electron density around A17 in chain C indicates
a mixture of multiple conformations.  Only the cleaved
conformation has been modeled, and some water molecules
around A17 in chain C may represent the alternative
conformation(s) of A17.
;
_refine.pdbx_starting_model                      'PDB entry 1aqz' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.pdbx_stereochemistry_target_values       'CNS parameter file' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1JBR 
_refine_analyze.Luzzati_coordinate_error_obs    0.36 
_refine_analyze.Luzzati_sigma_a_obs             0.52 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.47 
_refine_analyze.Luzzati_sigma_a_free            0.60 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2382 
_refine_hist.pdbx_number_atoms_nucleic_acid   1328 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             168 
_refine_hist.number_atoms_total               3883 
_refine_hist.d_res_high                       2.15 
_refine_hist.d_res_low                        19.96 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006381 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.29824  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 25.0     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.77     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.58     1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.57     2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.03     2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.93     2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.15 
_refine_ls_shell.d_res_low                        2.28 
_refine_ls_shell.number_reflns_R_work             2879 
_refine_ls_shell.R_factor_R_work                  0.417 
_refine_ls_shell.percent_reflns_obs               69.2 
_refine_ls_shell.R_factor_R_free                  0.426 
_refine_ls_shell.R_factor_R_free_error            0.023 
_refine_ls_shell.percent_reflns_R_free            10.5 
_refine_ls_shell.number_reflns_R_free             337 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM     PROTEIN.TOP         'X-RAY DIFFRACTION' 
2 DNA-RNA-ALLATOM.PARAM DNA-RNA-ALLATOM.TOP 'X-RAY DIFFRACTION' 
3 ION.PARAM             ION.TOP             'X-RAY DIFFRACTION' 
4 WATER_REP.PARAM       WATER.TOP           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1JBR 
_struct.title                     'Crystal Structure of the Ribotoxin Restrictocin and a 31-mer SRD RNA Inhibitor' 
_struct.pdbx_descriptor           'RESTRICTOCIN/31-MER SRD RNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JBR 
_struct_keywords.pdbx_keywords   HYDROLASE/RNA 
_struct_keywords.text            
;protein-RNA interaction, specific recognition, restrictocin, ribosomal RNA, sarcin/ricin domain, base flipping, HYDROLASE-RNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN D 26 ? ALA D 36 ? GLN A 26 ALA A 36 1 ? 11 
HELX_P HELX_P2 2 LYS D 72 ? ARG D 77 ? LYS A 72 ARG A 77 1 ? 6  
HELX_P HELX_P3 3 GLN E 26 ? ALA E 36 ? GLN B 26 ALA B 36 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? D CYS 5  SG    ? ? ? 1_555 D CYS 147 SG ? ? A CYS 5   A CYS 147 1_555 ? ? ? ? ? ? ?                    2.036 ? 
disulf2  disulf ? ? D CYS 75 SG    ? ? ? 1_555 D CYS 131 SG ? ? A CYS 75  A CYS 131 1_555 ? ? ? ? ? ? ?                    2.041 ? 
disulf3  disulf ? ? E CYS 5  SG    ? ? ? 1_555 E CYS 147 SG ? ? B CYS 5   B CYS 147 1_555 ? ? ? ? ? ? ?                    2.048 ? 
disulf4  disulf ? ? E CYS 75 SG    ? ? ? 1_555 E CYS 131 SG ? ? B CYS 75  B CYS 131 1_555 ? ? ? ? ? ? ?                    2.048 ? 
covale1  covale ? ? A G   17 "O3'" ? ? ? 1_555 A A23 18  P  ? ? C G   16  C A23 17  1_555 ? ? ? ? ? ? ?                    1.616 ? 
metalc1  metalc ? ? F K   .  K     ? ? ? 1_555 A U   8   O4 ? ? C K   202 C U   7   1_555 ? ? ? ? ? ? ?                    2.782 ? 
metalc2  metalc ? ? F K   .  K     ? ? ? 1_555 L HOH .   O  ? ? C K   202 F HOH 208 1_555 ? ? ? ? ? ? ?                    3.431 ? 
metalc3  metalc ? ? F K   .  K     ? ? ? 1_555 L HOH .   O  ? ? C K   202 F HOH 209 1_555 ? ? ? ? ? ? ?                    2.837 ? 
metalc4  metalc ? ? F K   .  K     ? ? ? 1_555 K HOH .   O  ? ? C K   202 C HOH 207 1_555 ? ? ? ? ? ? ?                    2.881 ? 
metalc5  metalc ? ? F K   .  K     ? ? ? 1_555 L HOH .   O  ? ? C K   202 F HOH 218 1_555 ? ? ? ? ? ? ?                    2.873 ? 
metalc6  metalc ? ? F K   .  K     ? ? ? 1_555 L HOH .   O  ? ? C K   202 F HOH 219 1_555 ? ? ? ? ? ? ?                    3.063 ? 
metalc7  metalc ? ? F K   .  K     ? ? ? 1_555 L HOH .   O  ? ? C K   202 F HOH 211 1_555 ? ? ? ? ? ? ?                    3.591 ? 
metalc8  metalc ? ? H K   .  K     ? ? ? 1_555 M HOH .   O  ? ? D K   201 D HOH 241 1_555 ? ? ? ? ? ? ?                    2.758 ? 
metalc9  metalc ? ? H K   .  K     ? ? ? 1_555 M HOH .   O  ? ? D K   201 D HOH 237 1_555 ? ? ? ? ? ? ?                    2.743 ? 
metalc10 metalc ? ? H K   .  K     ? ? ? 1_555 C U   8   O4 ? ? D K   201 D U   7   1_555 ? ? ? ? ? ? ?                    2.629 ? 
metalc11 metalc ? ? H K   .  K     ? ? ? 1_555 M HOH .   O  ? ? D K   201 D HOH 235 1_555 ? ? ? ? ? ? ?                    2.773 ? 
metalc12 metalc ? ? I K   .  K     ? ? ? 1_555 C G   25  O6 ? ? D K   204 D G   24  1_555 ? ? ? ? ? ? ?                    2.689 ? 
metalc13 metalc ? ? I K   .  K     ? ? ? 1_555 M HOH .   O  ? ? D K   204 D HOH 206 1_555 ? ? ? ? ? ? ?                    2.875 ? 
metalc14 metalc ? ? I K   .  K     ? ? ? 1_555 C G   25  N7 ? ? D K   204 D G   24  1_555 ? ? ? ? ? ? ?                    2.959 ? 
metalc15 metalc ? ? J K   .  K     ? ? ? 1_555 M HOH .   O  ? ? D K   205 D HOH 234 1_555 ? ? ? ? ? ? ?                    3.138 ? 
metalc16 metalc ? ? J K   .  K     ? ? ? 1_555 M HOH .   O  ? ? D K   205 D HOH 233 1_555 ? ? ? ? ? ? ?                    2.659 ? 
metalc17 metalc ? ? J K   .  K     ? ? ? 1_555 C G   15  O6 ? ? D K   205 D G   14  1_555 ? ? ? ? ? ? ?                    2.521 ? 
metalc18 metalc ? ? G K   .  K     ? ? ? 1_555 L HOH .   O  ? ? F K   203 F HOH 221 1_555 ? ? ? ? ? ? ?                    2.660 ? 
metalc19 metalc ? ? G K   .  K     ? ? ? 1_555 L HOH .   O  ? ? F K   203 F HOH 219 1_555 ? ? ? ? ? ? ?                    3.210 ? 
metalc20 metalc ? ? G K   .  K     ? ? ? 1_555 L HOH .   O  ? ? F K   203 F HOH 210 1_555 ? ? ? ? ? ? ?                    2.824 ? 
metalc21 metalc ? ? G K   .  K     ? ? ? 1_555 B G   7   O6 ? ? F K   203 F G   24  1_555 ? ? ? ? ? ? ?                    2.705 ? 
metalc22 metalc ? ? G K   .  K     ? ? ? 1_555 B G   7   N7 ? ? F K   203 F G   24  1_555 ? ? ? ? ? ? ?                    2.719 ? 
hydrog1  hydrog ? ? A G   1  N1    ? ? ? 1_555 B C   13  N3 ? ? C G   0   F C   30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog2  hydrog ? ? A G   1  N2    ? ? ? 1_555 B C   13  O2 ? ? C G   0   F C   30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog3  hydrog ? ? A G   1  O6    ? ? ? 1_555 B C   13  N4 ? ? C G   0   F C   30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog4  hydrog ? ? A C   2  N3    ? ? ? 1_555 B G   12  N1 ? ? C C   1   F G   29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog5  hydrog ? ? A C   2  N4    ? ? ? 1_555 B G   12  O6 ? ? C C   1   F G   29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog6  hydrog ? ? A C   2  O2    ? ? ? 1_555 B G   12  N2 ? ? C C   1   F G   29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog7  hydrog ? ? A G   3  N1    ? ? ? 1_555 B C   11  N3 ? ? C G   2   F C   28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog8  hydrog ? ? A G   3  N2    ? ? ? 1_555 B C   11  O2 ? ? C G   2   F C   28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog9  hydrog ? ? A G   3  O6    ? ? ? 1_555 B C   11  N4 ? ? C G   2   F C   28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog10 hydrog ? ? A C   4  N3    ? ? ? 1_555 B G   10  N1 ? ? C C   3   F G   27  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog11 hydrog ? ? A C   4  N4    ? ? ? 1_555 B G   10  O6 ? ? C C   3   F G   27  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog12 hydrog ? ? A C   4  O2    ? ? ? 1_555 B G   10  N2 ? ? C C   3   F G   27  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog13 hydrog ? ? A U   5  N3    ? ? ? 1_555 B A   9   N1 ? ? C U   4   F A   26  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog14 hydrog ? ? A U   5  O4    ? ? ? 1_555 B A   9   N6 ? ? C U   4   F A   26  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog15 hydrog ? ? A C   6  N3    ? ? ? 1_555 B G   8   N1 ? ? C C   5   F G   25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog16 hydrog ? ? A C   6  N4    ? ? ? 1_555 B G   8   O6 ? ? C C   5   F G   25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog17 hydrog ? ? A C   6  O2    ? ? ? 1_555 B G   8   N2 ? ? C C   5   F G   25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog18 hydrog ? ? A C   7  N3    ? ? ? 1_555 B G   7   N1 ? ? C C   6   F G   24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog19 hydrog ? ? A C   7  N4    ? ? ? 1_555 B G   7   O6 ? ? C C   6   F G   24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog20 hydrog ? ? A C   7  O2    ? ? ? 1_555 B G   7   N2 ? ? C C   6   F G   24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog21 hydrog ? ? A U   8  O2    ? ? ? 1_555 B C   6   N4 ? ? C U   7   F C   23  1_555 ? ? ? ? ? ? 'U-C MISPAIR'        ?     ? 
hydrog22 hydrog ? ? A C   9  O2    ? ? ? 1_555 B C   5   N4 ? ? C C   8   F C   22  1_555 ? ? ? ? ? ? 'C-C MISPAIR'        ?     ? 
hydrog23 hydrog ? ? A A   10 N6    ? ? ? 1_555 B A   4   N7 ? ? C A   9   F A   21  1_555 ? ? ? ? ? ? TYPE_2_PAIR          ?     ? 
hydrog24 hydrog ? ? A A   10 N7    ? ? ? 1_555 B A   4   N6 ? ? C A   9   F A   21  1_555 ? ? ? ? ? ? TYPE_2_PAIR          ?     ? 
hydrog25 hydrog ? ? A G   11 N2    ? ? ? 1_555 A U   12  O4 ? ? C G   10  C U   11  1_555 ? ? ? ? ? ? 'G-U MISPAIR'        ?     ? 
hydrog26 hydrog ? ? A U   12 N3    ? ? ? 1_555 B A   3   N7 ? ? C U   11  F A   20  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog27 hydrog ? ? A U   12 O2    ? ? ? 1_555 B A   3   N6 ? ? C U   11  F A   20  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog28 hydrog ? ? A A   13 N6    ? ? ? 1_555 B G   2   N3 ? ? C A   12  F G   19  1_555 ? ? ? ? ? ? TYPE_11_PAIR         ?     ? 
hydrog29 hydrog ? ? A A   13 N7    ? ? ? 1_555 B G   2   N2 ? ? C A   12  F G   19  1_555 ? ? ? ? ? ? TYPE_11_PAIR         ?     ? 
hydrog30 hydrog ? ? A C   14 N3    ? ? ? 1_555 B G   1   N1 ? ? C C   13  F G   18  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog31 hydrog ? ? A C   14 N4    ? ? ? 1_555 B G   1   O6 ? ? C C   13  F G   18  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog32 hydrog ? ? A C   14 O2    ? ? ? 1_555 B G   1   N2 ? ? C C   13  F G   18  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog33 hydrog ? ? C G   1  N1    ? ? ? 1_555 C C   31  N3 ? ? D G   0   D C   30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog34 hydrog ? ? C G   1  N2    ? ? ? 1_555 C C   31  O2 ? ? D G   0   D C   30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog35 hydrog ? ? C G   1  O6    ? ? ? 1_555 C C   31  N4 ? ? D G   0   D C   30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog36 hydrog ? ? C C   2  N3    ? ? ? 1_555 C G   30  N1 ? ? D C   1   D G   29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog37 hydrog ? ? C C   2  N4    ? ? ? 1_555 C G   30  O6 ? ? D C   1   D G   29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog38 hydrog ? ? C C   2  O2    ? ? ? 1_555 C G   30  N2 ? ? D C   1   D G   29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog39 hydrog ? ? C G   3  N1    ? ? ? 1_555 C C   29  N3 ? ? D G   2   D C   28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog40 hydrog ? ? C G   3  N2    ? ? ? 1_555 C C   29  O2 ? ? D G   2   D C   28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog41 hydrog ? ? C G   3  O6    ? ? ? 1_555 C C   29  N4 ? ? D G   2   D C   28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog42 hydrog ? ? C C   4  N3    ? ? ? 1_555 C G   28  N1 ? ? D C   3   D G   27  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog43 hydrog ? ? C C   4  N4    ? ? ? 1_555 C G   28  O6 ? ? D C   3   D G   27  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog44 hydrog ? ? C C   4  O2    ? ? ? 1_555 C G   28  N2 ? ? D C   3   D G   27  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog45 hydrog ? ? C U   5  N3    ? ? ? 1_555 C A   27  N1 ? ? D U   4   D A   26  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog46 hydrog ? ? C U   5  O4    ? ? ? 1_555 C A   27  N6 ? ? D U   4   D A   26  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog47 hydrog ? ? C C   6  N3    ? ? ? 1_555 C G   26  N1 ? ? D C   5   D G   25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog48 hydrog ? ? C C   6  N4    ? ? ? 1_555 C G   26  O6 ? ? D C   5   D G   25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog49 hydrog ? ? C C   6  O2    ? ? ? 1_555 C G   26  N2 ? ? D C   5   D G   25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog50 hydrog ? ? C C   7  N3    ? ? ? 1_555 C G   25  N1 ? ? D C   6   D G   24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog51 hydrog ? ? C C   7  N4    ? ? ? 1_555 C G   25  O6 ? ? D C   6   D G   24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog52 hydrog ? ? C C   7  O2    ? ? ? 1_555 C G   25  N2 ? ? D C   6   D G   24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog53 hydrog ? ? C U   8  O2    ? ? ? 1_555 C C   24  N4 ? ? D U   7   D C   23  1_555 ? ? ? ? ? ? 'U-C MISPAIR'        ?     ? 
hydrog54 hydrog ? ? C C   9  O2    ? ? ? 1_555 C C   23  N4 ? ? D C   8   D C   22  1_555 ? ? ? ? ? ? 'C-C MISPAIR'        ?     ? 
hydrog55 hydrog ? ? C A   10 N6    ? ? ? 1_555 C A   22  N7 ? ? D A   9   D A   21  1_555 ? ? ? ? ? ? TYPE_2_PAIR          ?     ? 
hydrog56 hydrog ? ? C A   10 N7    ? ? ? 1_555 C A   22  N6 ? ? D A   9   D A   21  1_555 ? ? ? ? ? ? TYPE_2_PAIR          ?     ? 
hydrog57 hydrog ? ? C G   11 N2    ? ? ? 1_555 C U   12  O4 ? ? D G   10  D U   11  1_555 ? ? ? ? ? ? 'G-U MISPAIR'        ?     ? 
hydrog58 hydrog ? ? C U   12 N3    ? ? ? 1_555 C A   21  N7 ? ? D U   11  D A   20  1_555 ? ? ? ? ? ? 'U-A PAIR'           ?     ? 
hydrog59 hydrog ? ? C A   13 N6    ? ? ? 1_555 C G   20  N3 ? ? D A   12  D G   19  1_555 ? ? ? ? ? ? TYPE_11_PAIR         ?     ? 
hydrog60 hydrog ? ? C A   13 N7    ? ? ? 1_555 C G   20  N2 ? ? D A   12  D G   19  1_555 ? ? ? ? ? ? TYPE_11_PAIR         ?     ? 
hydrog61 hydrog ? ? C C   14 N3    ? ? ? 1_555 C G   19  N1 ? ? D C   13  D G   18  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog62 hydrog ? ? C C   14 N4    ? ? ? 1_555 C G   19  O6 ? ? D C   13  D G   18  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog63 hydrog ? ? C C   14 O2    ? ? ? 1_555 C G   19  N2 ? ? D C   13  D G   18  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 47  D . ? TYR 47  A PRO 48  D ? PRO 48  A 1 0.36  
2 LYS 111 D . ? LYS 111 A PRO 112 D ? PRO 112 A 1 -0.43 
3 TYR 125 D . ? TYR 125 A PRO 126 D ? PRO 126 A 1 1.94  
4 TYR 47  E . ? TYR 47  B PRO 48  E ? PRO 48  B 1 -0.04 
5 LYS 111 E . ? LYS 111 B PRO 112 E ? PRO 112 B 1 -0.45 
6 TYR 125 E . ? TYR 125 B PRO 126 E ? PRO 126 B 1 0.76  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 2 ? 
D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR D 2   ? LEU D 10  ? THR A 2   LEU A 10  
A 2 TRP D 17  ? SER D 25  ? TRP A 17  SER A 25  
B 1 HIS D 49  ? TRP D 50  ? HIS A 49  TRP A 50  
B 2 TYR D 92  ? PRO D 97  ? TYR A 92  PRO A 97  
B 3 ALA D 119 ? TYR D 125 ? ALA A 119 TYR A 125 
B 4 PHE D 130 ? ARG D 138 ? PHE A 130 ARG A 138 
B 5 GLN D 141 ? LEU D 146 ? GLN A 141 LEU A 146 
C 1 THR E 2   ? LEU E 10  ? THR B 2   LEU B 10  
C 2 TRP E 17  ? SER E 25  ? TRP B 17  SER B 25  
D 1 HIS E 49  ? TRP E 50  ? HIS B 49  TRP B 50  
D 2 TYR E 92  ? PRO E 97  ? TYR B 92  PRO B 97  
D 3 ALA E 119 ? TYR E 125 ? ALA B 119 TYR B 125 
D 4 PHE E 130 ? ARG E 138 ? PHE B 130 ARG B 138 
D 5 GLN E 141 ? LEU E 146 ? GLN B 141 LEU B 146 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN D 9   ? N GLN A 9   O GLU D 18  ? O GLU A 18  
B 1 2 O HIS D 49  ? O HIS A 49  N GLU D 95  ? N GLU A 95  
B 2 3 O PHE D 96  ? O PHE A 96  N VAL D 121 ? N VAL A 121 
B 3 4 O ILE D 122 ? O ILE A 122 N CYS D 131 ? N CYS A 131 
B 4 5 O ARG D 138 ? O ARG A 138 N GLN D 141 ? N GLN A 141 
C 1 2 O GLN E 9   ? O GLN B 9   N GLU E 18  ? N GLU B 18  
D 1 2 O HIS E 49  ? O HIS B 49  N GLU E 95  ? N GLU B 95  
D 2 3 O PHE E 96  ? O PHE B 96  N VAL E 121 ? N VAL B 121 
D 3 4 O ILE E 122 ? O ILE B 122 N CYS E 131 ? N CYS B 131 
D 4 5 O ARG E 138 ? O ARG B 138 N GLN E 141 ? N GLN B 141 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE K D 201' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE K C 202' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE K F 203' 
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE K D 204' 
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE K D 205' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 U   C 8  ? U   D 7   . ? 1_555 ? 
2  AC1 4 HOH M .  ? HOH D 235 . ? 1_555 ? 
3  AC1 4 HOH M .  ? HOH D 237 . ? 1_555 ? 
4  AC1 4 HOH M .  ? HOH D 241 . ? 1_555 ? 
5  AC2 5 U   A 8  ? U   C 7   . ? 1_555 ? 
6  AC2 5 HOH K .  ? HOH C 207 . ? 1_555 ? 
7  AC2 5 HOH L .  ? HOH F 209 . ? 1_555 ? 
8  AC2 5 HOH L .  ? HOH F 218 . ? 1_555 ? 
9  AC2 5 HOH L .  ? HOH F 219 . ? 1_555 ? 
10 AC3 3 G   B 7  ? G   F 24  . ? 1_555 ? 
11 AC3 3 HOH L .  ? HOH F 210 . ? 1_555 ? 
12 AC3 3 HOH L .  ? HOH F 221 . ? 1_555 ? 
13 AC4 2 G   C 25 ? G   D 24  . ? 1_555 ? 
14 AC4 2 HOH M .  ? HOH D 206 . ? 1_555 ? 
15 AC5 2 G   C 15 ? G   D 14  . ? 1_555 ? 
16 AC5 2 HOH M .  ? HOH D 233 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1JBR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JBR 
_atom_sites.fract_transf_matrix[1][1]   0.016556 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002268 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009116 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.025233 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
K 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . G   A 1 1   ? 47.760  10.501  -8.900  1.00 47.94  ? 0   G   C "O5'" 1 
ATOM   2    C "C5'" . G   A 1 1   ? 48.743  9.649   -8.313  1.00 41.83  ? 0   G   C "C5'" 1 
ATOM   3    C "C4'" . G   A 1 1   ? 49.481  10.332  -7.184  1.00 37.61  ? 0   G   C "C4'" 1 
ATOM   4    O "O4'" . G   A 1 1   ? 49.974  11.624  -7.625  1.00 34.99  ? 0   G   C "O4'" 1 
ATOM   5    C "C3'" . G   A 1 1   ? 48.648  10.664  -5.959  1.00 37.06  ? 0   G   C "C3'" 1 
ATOM   6    O "O3'" . G   A 1 1   ? 48.518  9.527   -5.121  1.00 37.91  ? 0   G   C "O3'" 1 
ATOM   7    C "C2'" . G   A 1 1   ? 49.483  11.758  -5.309  1.00 36.49  ? 0   G   C "C2'" 1 
ATOM   8    O "O2'" . G   A 1 1   ? 50.590  11.282  -4.569  1.00 32.04  ? 0   G   C "O2'" 1 
ATOM   9    C "C1'" . G   A 1 1   ? 49.968  12.527  -6.539  1.00 33.10  ? 0   G   C "C1'" 1 
ATOM   10   N N9    . G   A 1 1   ? 49.126  13.671  -6.876  1.00 34.42  ? 0   G   C N9    1 
ATOM   11   C C8    . G   A 1 1   ? 48.415  13.889  -8.035  1.00 35.28  ? 0   G   C C8    1 
ATOM   12   N N7    . G   A 1 1   ? 47.776  15.030  -8.034  1.00 34.94  ? 0   G   C N7    1 
ATOM   13   C C5    . G   A 1 1   ? 48.084  15.595  -6.803  1.00 32.00  ? 0   G   C C5    1 
ATOM   14   C C6    . G   A 1 1   ? 47.689  16.826  -6.234  1.00 35.16  ? 0   G   C C6    1 
ATOM   15   O O6    . G   A 1 1   ? 46.966  17.704  -6.721  1.00 36.04  ? 0   G   C O6    1 
ATOM   16   N N1    . G   A 1 1   ? 48.226  16.999  -4.963  1.00 34.08  ? 0   G   C N1    1 
ATOM   17   C C2    . G   A 1 1   ? 49.040  16.100  -4.324  1.00 34.51  ? 0   G   C C2    1 
ATOM   18   N N2    . G   A 1 1   ? 49.471  16.443  -3.101  1.00 35.73  ? 0   G   C N2    1 
ATOM   19   N N3    . G   A 1 1   ? 49.412  14.951  -4.843  1.00 32.93  ? 0   G   C N3    1 
ATOM   20   C C4    . G   A 1 1   ? 48.906  14.766  -6.076  1.00 32.80  ? 0   G   C C4    1 
ATOM   21   P P     . C   A 1 2   ? 47.153  9.277   -4.322  1.00 41.51  ? 1   C   C P     1 
ATOM   22   O OP1   . C   A 1 2   ? 47.153  7.859   -3.902  1.00 41.56  ? 1   C   C OP1   1 
ATOM   23   O OP2   . C   A 1 2   ? 46.000  9.807   -5.093  1.00 40.89  ? 1   C   C OP2   1 
ATOM   24   O "O5'" . C   A 1 2   ? 47.303  10.185  -3.024  1.00 43.32  ? 1   C   C "O5'" 1 
ATOM   25   C "C5'" . C   A 1 2   ? 48.236  9.866   -1.998  1.00 40.80  ? 1   C   C "C5'" 1 
ATOM   26   C "C4'" . C   A 1 2   ? 48.293  10.986  -0.989  1.00 41.39  ? 1   C   C "C4'" 1 
ATOM   27   O "O4'" . C   A 1 2   ? 48.698  12.208  -1.657  1.00 40.26  ? 1   C   C "O4'" 1 
ATOM   28   C "C3'" . C   A 1 2   ? 46.978  11.380  -0.341  1.00 41.44  ? 1   C   C "C3'" 1 
ATOM   29   O "O3'" . C   A 1 2   ? 46.562  10.487  0.679   1.00 44.02  ? 1   C   C "O3'" 1 
ATOM   30   C "C2'" . C   A 1 2   ? 47.289  12.784  0.153   1.00 42.90  ? 1   C   C "C2'" 1 
ATOM   31   O "O2'" . C   A 1 2   ? 48.102  12.868  1.316   1.00 40.60  ? 1   C   C "O2'" 1 
ATOM   32   C "C1'" . C   A 1 2   ? 48.060  13.324  -1.047  1.00 40.09  ? 1   C   C "C1'" 1 
ATOM   33   N N1    . C   A 1 2   ? 47.199  13.998  -2.039  1.00 38.14  ? 1   C   C N1    1 
ATOM   34   C C2    . C   A 1 2   ? 46.778  15.313  -1.777  1.00 38.31  ? 1   C   C C2    1 
ATOM   35   O O2    . C   A 1 2   ? 47.096  15.844  -0.697  1.00 40.25  ? 1   C   C O2    1 
ATOM   36   N N3    . C   A 1 2   ? 46.033  15.965  -2.704  1.00 35.52  ? 1   C   C N3    1 
ATOM   37   C C4    . C   A 1 2   ? 45.698  15.350  -3.843  1.00 32.84  ? 1   C   C C4    1 
ATOM   38   N N4    . C   A 1 2   ? 44.983  16.036  -4.737  1.00 34.38  ? 1   C   C N4    1 
ATOM   39   C C5    . C   A 1 2   ? 46.087  14.006  -4.119  1.00 34.91  ? 1   C   C C5    1 
ATOM   40   C C6    . C   A 1 2   ? 46.827  13.372  -3.199  1.00 34.16  ? 1   C   C C6    1 
ATOM   41   P P     . G   A 1 3   ? 45.014  10.061  0.768   1.00 50.35  ? 2   G   C P     1 
ATOM   42   O OP1   . G   A 1 3   ? 44.954  8.824   1.594   1.00 46.36  ? 2   G   C OP1   1 
ATOM   43   O OP2   . G   A 1 3   ? 44.432  10.041  -0.605  1.00 49.43  ? 2   G   C OP2   1 
ATOM   44   O "O5'" . G   A 1 3   ? 44.356  11.274  1.572   1.00 47.61  ? 2   G   C "O5'" 1 
ATOM   45   C "C5'" . G   A 1 3   ? 44.955  11.757  2.776   1.00 48.88  ? 2   G   C "C5'" 1 
ATOM   46   C "C4'" . G   A 1 3   ? 44.347  13.081  3.193   1.00 49.15  ? 2   G   C "C4'" 1 
ATOM   47   O "O4'" . G   A 1 3   ? 44.854  14.155  2.353   1.00 48.80  ? 2   G   C "O4'" 1 
ATOM   48   C "C3'" . G   A 1 3   ? 42.838  13.244  3.094   1.00 49.63  ? 2   G   C "C3'" 1 
ATOM   49   O "O3'" . G   A 1 3   ? 42.120  12.599  4.143   1.00 51.28  ? 2   G   C "O3'" 1 
ATOM   50   C "C2'" . G   A 1 3   ? 42.703  14.759  3.134   1.00 48.62  ? 2   G   C "C2'" 1 
ATOM   51   O "O2'" . G   A 1 3   ? 42.886  15.316  4.420   1.00 48.16  ? 2   G   C "O2'" 1 
ATOM   52   C "C1'" . G   A 1 3   ? 43.858  15.164  2.217   1.00 47.26  ? 2   G   C "C1'" 1 
ATOM   53   N N9    . G   A 1 3   ? 43.459  15.252  0.811   1.00 43.53  ? 2   G   C N9    1 
ATOM   54   C C8    . G   A 1 3   ? 43.655  14.321  -0.179  1.00 41.82  ? 2   G   C C8    1 
ATOM   55   N N7    . G   A 1 3   ? 43.180  14.697  -1.336  1.00 38.86  ? 2   G   C N7    1 
ATOM   56   C C5    . G   A 1 3   ? 42.641  15.951  -1.096  1.00 40.44  ? 2   G   C C5    1 
ATOM   57   C C6    . G   A 1 3   ? 41.987  16.858  -1.975  1.00 42.03  ? 2   G   C C6    1 
ATOM   58   O O6    . G   A 1 3   ? 41.754  16.729  -3.192  1.00 42.72  ? 2   G   C O6    1 
ATOM   59   N N1    . G   A 1 3   ? 41.590  18.017  -1.310  1.00 38.95  ? 2   G   C N1    1 
ATOM   60   C C2    . G   A 1 3   ? 41.799  18.269  0.025   1.00 40.83  ? 2   G   C C2    1 
ATOM   61   N N2    . G   A 1 3   ? 41.343  19.432  0.496   1.00 38.05  ? 2   G   C N2    1 
ATOM   62   N N3    . G   A 1 3   ? 42.414  17.435  0.846   1.00 42.80  ? 2   G   C N3    1 
ATOM   63   C C4    . G   A 1 3   ? 42.803  16.306  0.224   1.00 41.42  ? 2   G   C C4    1 
ATOM   64   P P     . C   A 1 4   ? 40.656  11.997  3.844   1.00 51.79  ? 3   C   C P     1 
ATOM   65   O OP1   . C   A 1 4   ? 40.258  11.181  5.016   1.00 54.98  ? 3   C   C OP1   1 
ATOM   66   O OP2   . C   A 1 4   ? 40.666  11.370  2.501   1.00 54.32  ? 3   C   C OP2   1 
ATOM   67   O "O5'" . C   A 1 4   ? 39.732  13.294  3.764   1.00 50.71  ? 3   C   C "O5'" 1 
ATOM   68   C "C5'" . C   A 1 4   ? 39.268  13.945  4.945   1.00 47.35  ? 3   C   C "C5'" 1 
ATOM   69   C "C4'" . C   A 1 4   ? 38.608  15.258  4.595   1.00 43.38  ? 3   C   C "C4'" 1 
ATOM   70   O "O4'" . C   A 1 4   ? 39.465  15.982  3.663   1.00 42.81  ? 3   C   C "O4'" 1 
ATOM   71   C "C3'" . C   A 1 4   ? 37.286  15.178  3.844   1.00 41.40  ? 3   C   C "C3'" 1 
ATOM   72   O "O3'" . C   A 1 4   ? 36.162  14.806  4.647   1.00 42.87  ? 3   C   C "O3'" 1 
ATOM   73   C "C2'" . C   A 1 4   ? 37.218  16.574  3.237   1.00 39.22  ? 3   C   C "C2'" 1 
ATOM   74   O "O2'" . C   A 1 4   ? 36.938  17.607  4.164   1.00 33.79  ? 3   C   C "O2'" 1 
ATOM   75   C "C1'" . C   A 1 4   ? 38.658  16.718  2.744   1.00 39.45  ? 3   C   C "C1'" 1 
ATOM   76   N N1    . C   A 1 4   ? 38.871  16.198  1.371   1.00 36.17  ? 3   C   C N1    1 
ATOM   77   C C2    . C   A 1 4   ? 38.447  16.975  0.288   1.00 33.93  ? 3   C   C C2    1 
ATOM   78   O O2    . C   A 1 4   ? 37.935  18.082  0.505   1.00 33.33  ? 3   C   C O2    1 
ATOM   79   N N3    . C   A 1 4   ? 38.610  16.504  -0.970  1.00 33.55  ? 3   C   C N3    1 
ATOM   80   C C4    . C   A 1 4   ? 39.184  15.323  -1.172  1.00 33.05  ? 3   C   C C4    1 
ATOM   81   N N4    . C   A 1 4   ? 39.332  14.912  -2.434  1.00 30.55  ? 3   C   C N4    1 
ATOM   82   C C5    . C   A 1 4   ? 39.638  14.511  -0.090  1.00 32.33  ? 3   C   C C5    1 
ATOM   83   C C6    . C   A 1 4   ? 39.462  14.983  1.152   1.00 34.56  ? 3   C   C C6    1 
ATOM   84   P P     . U   A 1 5   ? 34.912  14.024  3.971   1.00 40.93  ? 4   U   C P     1 
ATOM   85   O OP1   . U   A 1 5   ? 33.956  13.733  5.052   1.00 41.82  ? 4   U   C OP1   1 
ATOM   86   O OP2   . U   A 1 5   ? 35.429  12.912  3.141   1.00 41.45  ? 4   U   C OP2   1 
ATOM   87   O "O5'" . U   A 1 5   ? 34.227  15.105  3.022   1.00 43.73  ? 4   U   C "O5'" 1 
ATOM   88   C "C5'" . U   A 1 5   ? 33.686  16.305  3.564   1.00 43.78  ? 4   U   C "C5'" 1 
ATOM   89   C "C4'" . U   A 1 5   ? 33.096  17.161  2.469   1.00 44.51  ? 4   U   C "C4'" 1 
ATOM   90   O "O4'" . U   A 1 5   ? 34.140  17.614  1.556   1.00 44.18  ? 4   U   C "O4'" 1 
ATOM   91   C "C3'" . U   A 1 5   ? 32.081  16.491  1.559   1.00 43.14  ? 4   U   C "C3'" 1 
ATOM   92   O "O3'" . U   A 1 5   ? 30.794  16.409  2.161   1.00 42.79  ? 4   U   C "O3'" 1 
ATOM   93   C "C2'" . U   A 1 5   ? 32.125  17.410  0.344   1.00 42.36  ? 4   U   C "C2'" 1 
ATOM   94   O "O2'" . U   A 1 5   ? 31.464  18.646  0.524   1.00 42.04  ? 4   U   C "O2'" 1 
ATOM   95   C "C1'" . U   A 1 5   ? 33.631  17.648  0.232   1.00 40.87  ? 4   U   C "C1'" 1 
ATOM   96   N N1    . U   A 1 5   ? 34.322  16.622  -0.569  1.00 39.15  ? 4   U   C N1    1 
ATOM   97   C C2    . U   A 1 5   ? 34.351  16.799  -1.949  1.00 36.92  ? 4   U   C C2    1 
ATOM   98   O O2    . U   A 1 5   ? 33.808  17.747  -2.513  1.00 35.28  ? 4   U   C O2    1 
ATOM   99   N N3    . U   A 1 5   ? 35.032  15.831  -2.642  1.00 34.50  ? 4   U   C N3    1 
ATOM   100  C C4    . U   A 1 5   ? 35.674  14.730  -2.120  1.00 36.66  ? 4   U   C C4    1 
ATOM   101  O O4    . U   A 1 5   ? 36.283  13.970  -2.878  1.00 36.69  ? 4   U   C O4    1 
ATOM   102  C C5    . U   A 1 5   ? 35.586  14.606  -0.689  1.00 37.64  ? 4   U   C C5    1 
ATOM   103  C C6    . U   A 1 5   ? 34.928  15.529  0.018   1.00 34.56  ? 4   U   C C6    1 
ATOM   104  P P     . C   A 1 6   ? 29.861  15.126  1.873   1.00 40.88  ? 5   C   C P     1 
ATOM   105  O OP1   . C   A 1 6   ? 28.769  15.191  2.870   1.00 42.87  ? 5   C   C OP1   1 
ATOM   106  O OP2   . C   A 1 6   ? 30.687  13.900  1.767   1.00 40.87  ? 5   C   C OP2   1 
ATOM   107  O "O5'" . C   A 1 6   ? 29.248  15.411  0.430   1.00 41.81  ? 5   C   C "O5'" 1 
ATOM   108  C "C5'" . C   A 1 6   ? 28.416  16.536  0.205   1.00 33.83  ? 5   C   C "C5'" 1 
ATOM   109  C "C4'" . C   A 1 6   ? 28.327  16.825  -1.262  1.00 35.94  ? 5   C   C "C4'" 1 
ATOM   110  O "O4'" . C   A 1 6   ? 29.652  17.083  -1.793  1.00 37.66  ? 5   C   C "O4'" 1 
ATOM   111  C "C3'" . C   A 1 6   ? 27.871  15.681  -2.138  1.00 33.02  ? 5   C   C "C3'" 1 
ATOM   112  O "O3'" . C   A 1 6   ? 26.488  15.423  -2.011  1.00 34.94  ? 5   C   C "O3'" 1 
ATOM   113  C "C2'" . C   A 1 6   ? 28.288  16.192  -3.506  1.00 35.79  ? 5   C   C "C2'" 1 
ATOM   114  O "O2'" . C   A 1 6   ? 27.451  17.205  -4.029  1.00 33.78  ? 5   C   C "O2'" 1 
ATOM   115  C "C1'" . C   A 1 6   ? 29.673  16.754  -3.177  1.00 35.06  ? 5   C   C "C1'" 1 
ATOM   116  N N1    . C   A 1 6   ? 30.715  15.741  -3.406  1.00 34.91  ? 5   C   C N1    1 
ATOM   117  C C2    . C   A 1 6   ? 31.113  15.489  -4.720  1.00 33.31  ? 5   C   C C2    1 
ATOM   118  O O2    . C   A 1 6   ? 30.640  16.175  -5.626  1.00 33.45  ? 5   C   C O2    1 
ATOM   119  N N3    . C   A 1 6   ? 32.001  14.513  -4.967  1.00 30.03  ? 5   C   C N3    1 
ATOM   120  C C4    . C   A 1 6   ? 32.515  13.810  -3.960  1.00 29.29  ? 5   C   C C4    1 
ATOM   121  N N4    . C   A 1 6   ? 33.390  12.850  -4.260  1.00 25.59  ? 5   C   C N4    1 
ATOM   122  C C5    . C   A 1 6   ? 32.154  14.063  -2.601  1.00 30.09  ? 5   C   C C5    1 
ATOM   123  C C6    . C   A 1 6   ? 31.260  15.030  -2.372  1.00 32.63  ? 5   C   C C6    1 
ATOM   124  P P     . C   A 1 7   ? 25.926  13.945  -2.307  1.00 31.94  ? 6   C   C P     1 
ATOM   125  O OP1   . C   A 1 7   ? 24.513  13.972  -1.859  1.00 35.76  ? 6   C   C OP1   1 
ATOM   126  O OP2   . C   A 1 7   ? 26.840  12.899  -1.794  1.00 32.27  ? 6   C   C OP2   1 
ATOM   127  O "O5'" . C   A 1 7   ? 25.971  13.860  -3.898  1.00 34.50  ? 6   C   C "O5'" 1 
ATOM   128  C "C5'" . C   A 1 7   ? 25.178  14.731  -4.700  1.00 27.50  ? 6   C   C "C5'" 1 
ATOM   129  C "C4'" . C   A 1 7   ? 25.497  14.524  -6.158  1.00 29.25  ? 6   C   C "C4'" 1 
ATOM   130  O "O4'" . C   A 1 7   ? 26.915  14.730  -6.345  1.00 26.87  ? 6   C   C "O4'" 1 
ATOM   131  C "C3'" . C   A 1 7   ? 25.250  13.130  -6.714  1.00 29.80  ? 6   C   C "C3'" 1 
ATOM   132  O "O3'" . C   A 1 7   ? 23.892  12.907  -7.078  1.00 34.15  ? 6   C   C "O3'" 1 
ATOM   133  C "C2'" . C   A 1 7   ? 26.190  13.096  -7.902  1.00 29.90  ? 6   C   C "C2'" 1 
ATOM   134  O "O2'" . C   A 1 7   ? 25.691  13.743  -9.053  1.00 28.10  ? 6   C   C "O2'" 1 
ATOM   135  C "C1'" . C   A 1 7   ? 27.400  13.841  -7.334  1.00 31.87  ? 6   C   C "C1'" 1 
ATOM   136  N N1    . C   A 1 7   ? 28.422  12.947  -6.738  1.00 30.84  ? 6   C   C N1    1 
ATOM   137  C C2    . C   A 1 7   ? 29.265  12.241  -7.607  1.00 29.80  ? 6   C   C C2    1 
ATOM   138  O O2    . C   A 1 7   ? 29.134  12.412  -8.827  1.00 34.64  ? 6   C   C O2    1 
ATOM   139  N N3    . C   A 1 7   ? 30.199  11.396  -7.095  1.00 30.50  ? 6   C   C N3    1 
ATOM   140  C C4    . C   A 1 7   ? 30.318  11.254  -5.769  1.00 28.23  ? 6   C   C C4    1 
ATOM   141  N N4    . C   A 1 7   ? 31.259  10.412  -5.311  1.00 26.13  ? 6   C   C N4    1 
ATOM   142  C C5    . C   A 1 7   ? 29.476  11.969  -4.854  1.00 27.15  ? 6   C   C C5    1 
ATOM   143  C C6    . C   A 1 7   ? 28.550  12.796  -5.378  1.00 29.92  ? 6   C   C C6    1 
ATOM   144  P P     . U   A 1 8   ? 23.181  11.517  -6.689  1.00 37.27  ? 7   U   C P     1 
ATOM   145  O OP1   . U   A 1 8   ? 21.736  11.682  -6.966  1.00 37.07  ? 7   U   C OP1   1 
ATOM   146  O OP2   . U   A 1 8   ? 23.622  11.137  -5.317  1.00 38.46  ? 7   U   C OP2   1 
ATOM   147  O "O5'" . U   A 1 8   ? 23.804  10.448  -7.692  1.00 36.09  ? 7   U   C "O5'" 1 
ATOM   148  C "C5'" . U   A 1 8   ? 23.908  10.707  -9.086  1.00 33.85  ? 7   U   C "C5'" 1 
ATOM   149  C "C4'" . U   A 1 8   ? 24.958  9.812   -9.708  1.00 34.58  ? 7   U   C "C4'" 1 
ATOM   150  O "O4'" . U   A 1 8   ? 26.284  10.204  -9.264  1.00 36.78  ? 7   U   C "O4'" 1 
ATOM   151  C "C3'" . U   A 1 8   ? 24.867  8.317   -9.424  1.00 38.94  ? 7   U   C "C3'" 1 
ATOM   152  O "O3'" . U   A 1 8   ? 24.018  7.682   -10.373 1.00 37.99  ? 7   U   C "O3'" 1 
ATOM   153  C "C2'" . U   A 1 8   ? 26.301  7.853   -9.646  1.00 33.67  ? 7   U   C "C2'" 1 
ATOM   154  O "O2'" . U   A 1 8   ? 26.570  7.588   -11.002 1.00 39.61  ? 7   U   C "O2'" 1 
ATOM   155  C "C1'" . U   A 1 8   ? 27.113  9.055   -9.149  1.00 36.19  ? 7   U   C "C1'" 1 
ATOM   156  N N1    . U   A 1 8   ? 27.555  8.925   -7.748  1.00 34.44  ? 7   U   C N1    1 
ATOM   157  C C2    . U   A 1 8   ? 28.654  8.113   -7.475  1.00 36.59  ? 7   U   C C2    1 
ATOM   158  O O2    . U   A 1 8   ? 29.267  7.506   -8.333  1.00 37.30  ? 7   U   C O2    1 
ATOM   159  N N3    . U   A 1 8   ? 29.005  8.034   -6.149  1.00 35.38  ? 7   U   C N3    1 
ATOM   160  C C4    . U   A 1 8   ? 28.397  8.661   -5.091  1.00 37.62  ? 7   U   C C4    1 
ATOM   161  O O4    . U   A 1 8   ? 28.853  8.509   -3.957  1.00 35.65  ? 7   U   C O4    1 
ATOM   162  C C5    . U   A 1 8   ? 27.270  9.478   -5.446  1.00 36.75  ? 7   U   C C5    1 
ATOM   163  C C6    . U   A 1 8   ? 26.899  9.579   -6.726  1.00 35.46  ? 7   U   C C6    1 
ATOM   164  P P     . C   A 1 9   ? 23.134  6.408   -9.943  1.00 44.14  ? 8   C   C P     1 
ATOM   165  O OP1   . C   A 1 9   ? 22.351  6.040   -11.153 1.00 43.42  ? 8   C   C OP1   1 
ATOM   166  O OP2   . C   A 1 9   ? 22.429  6.682   -8.661  1.00 37.47  ? 8   C   C OP2   1 
ATOM   167  O "O5'" . C   A 1 9   ? 24.192  5.249   -9.669  1.00 41.50  ? 8   C   C "O5'" 1 
ATOM   168  C "C5'" . C   A 1 9   ? 25.093  4.824   -10.684 1.00 46.15  ? 8   C   C "C5'" 1 
ATOM   169  C "C4'" . C   A 1 9   ? 26.103  3.862   -10.111 1.00 47.64  ? 8   C   C "C4'" 1 
ATOM   170  O "O4'" . C   A 1 9   ? 27.057  4.594   -9.301  1.00 48.16  ? 8   C   C "O4'" 1 
ATOM   171  C "C3'" . C   A 1 9   ? 25.533  2.808   -9.176  1.00 51.43  ? 8   C   C "C3'" 1 
ATOM   172  O "O3'" . C   A 1 9   ? 25.070  1.692   -9.928  1.00 54.90  ? 8   C   C "O3'" 1 
ATOM   173  C "C2'" . C   A 1 9   ? 26.735  2.454   -8.310  1.00 49.42  ? 8   C   C "C2'" 1 
ATOM   174  O "O2'" . C   A 1 9   ? 27.593  1.520   -8.932  1.00 51.40  ? 8   C   C "O2'" 1 
ATOM   175  C "C1'" . C   A 1 9   ? 27.425  3.814   -8.174  1.00 46.89  ? 8   C   C "C1'" 1 
ATOM   176  N N1    . C   A 1 9   ? 27.088  4.567   -6.947  1.00 43.37  ? 8   C   C N1    1 
ATOM   177  C C2    . C   A 1 9   ? 27.980  4.527   -5.851  1.00 41.94  ? 8   C   C C2    1 
ATOM   178  O O2    . C   A 1 9   ? 29.010  3.854   -5.934  1.00 42.37  ? 8   C   C O2    1 
ATOM   179  N N3    . C   A 1 9   ? 27.684  5.226   -4.733  1.00 39.78  ? 8   C   C N3    1 
ATOM   180  C C4    . C   A 1 9   ? 26.561  5.938   -4.672  1.00 36.87  ? 8   C   C C4    1 
ATOM   181  N N4    . C   A 1 9   ? 26.313  6.603   -3.551  1.00 34.49  ? 8   C   C N4    1 
ATOM   182  C C5    . C   A 1 9   ? 25.640  5.995   -5.763  1.00 36.89  ? 8   C   C C5    1 
ATOM   183  C C6    . C   A 1 9   ? 25.939  5.302   -6.866  1.00 36.14  ? 8   C   C C6    1 
ATOM   184  P P     . A   A 1 10  ? 23.956  0.706   -9.304  1.00 58.59  ? 9   A   C P     1 
ATOM   185  O OP1   . A   A 1 10  ? 24.673  -0.167  -8.332  1.00 59.54  ? 9   A   C OP1   1 
ATOM   186  O OP2   . A   A 1 10  ? 23.223  0.098   -10.447 1.00 59.80  ? 9   A   C OP2   1 
ATOM   187  O "O5'" . A   A 1 10  ? 22.931  1.627   -8.500  1.00 55.99  ? 9   A   C "O5'" 1 
ATOM   188  C "C5'" . A   A 1 10  ? 21.542  1.297   -8.480  1.00 56.25  ? 9   A   C "C5'" 1 
ATOM   189  C "C4'" . A   A 1 10  ? 20.802  2.049   -7.389  1.00 55.45  ? 9   A   C "C4'" 1 
ATOM   190  O "O4'" . A   A 1 10  ? 21.480  1.873   -6.107  1.00 54.39  ? 9   A   C "O4'" 1 
ATOM   191  C "C3'" . A   A 1 10  ? 20.742  3.561   -7.603  1.00 55.36  ? 9   A   C "C3'" 1 
ATOM   192  O "O3'" . A   A 1 10  ? 19.595  4.111   -6.943  1.00 59.44  ? 9   A   C "O3'" 1 
ATOM   193  C "C2'" . A   A 1 10  ? 22.026  4.034   -6.925  1.00 54.51  ? 9   A   C "C2'" 1 
ATOM   194  O "O2'" . A   A 1 10  ? 21.995  5.387   -6.514  1.00 55.10  ? 9   A   C "O2'" 1 
ATOM   195  C "C1'" . A   A 1 10  ? 22.070  3.100   -5.715  1.00 53.23  ? 9   A   C "C1'" 1 
ATOM   196  N N9    . A   A 1 10  ? 23.371  2.875   -5.078  1.00 49.02  ? 9   A   C N9    1 
ATOM   197  C C8    . A   A 1 10  ? 24.445  2.144   -5.519  1.00 48.43  ? 9   A   C C8    1 
ATOM   198  N N7    . A   A 1 10  ? 25.479  2.182   -4.709  1.00 44.34  ? 9   A   C N7    1 
ATOM   199  C C5    . A   A 1 10  ? 25.053  2.983   -3.662  1.00 45.69  ? 9   A   C C5    1 
ATOM   200  C C6    . A   A 1 10  ? 25.682  3.409   -2.485  1.00 45.59  ? 9   A   C C6    1 
ATOM   201  N N6    . A   A 1 10  ? 26.934  3.081   -2.153  1.00 44.83  ? 9   A   C N6    1 
ATOM   202  N N1    . A   A 1 10  ? 24.976  4.200   -1.648  1.00 44.10  ? 9   A   C N1    1 
ATOM   203  C C2    . A   A 1 10  ? 23.728  4.533   -1.983  1.00 44.12  ? 9   A   C C2    1 
ATOM   204  N N3    . A   A 1 10  ? 23.030  4.199   -3.056  1.00 45.14  ? 9   A   C N3    1 
ATOM   205  C C4    . A   A 1 10  ? 23.757  3.413   -3.870  1.00 47.35  ? 9   A   C C4    1 
ATOM   206  P P     . G   A 1 11  ? 18.240  4.389   -7.772  1.00 60.80  ? 10  G   C P     1 
ATOM   207  O OP1   . G   A 1 11  ? 18.247  3.490   -8.953  1.00 62.26  ? 10  G   C OP1   1 
ATOM   208  O OP2   . G   A 1 11  ? 18.102  5.850   -7.973  1.00 59.44  ? 10  G   C OP2   1 
ATOM   209  O "O5'" . G   A 1 11  ? 17.071  3.919   -6.794  1.00 62.63  ? 10  G   C "O5'" 1 
ATOM   210  C "C5'" . G   A 1 11  ? 17.162  4.092   -5.377  1.00 63.51  ? 10  G   C "C5'" 1 
ATOM   211  C "C4'" . G   A 1 11  ? 17.792  2.869   -4.745  1.00 63.95  ? 10  G   C "C4'" 1 
ATOM   212  O "O4'" . G   A 1 11  ? 18.300  3.202   -3.420  1.00 64.14  ? 10  G   C "O4'" 1 
ATOM   213  C "C3'" . G   A 1 11  ? 16.834  1.708   -4.509  1.00 63.50  ? 10  G   C "C3'" 1 
ATOM   214  O "O3'" . G   A 1 11  ? 17.636  0.528   -4.442  1.00 65.07  ? 10  G   C "O3'" 1 
ATOM   215  C "C2'" . G   A 1 11  ? 16.255  2.053   -3.137  1.00 64.23  ? 10  G   C "C2'" 1 
ATOM   216  O "O2'" . G   A 1 11  ? 15.685  0.985   -2.419  1.00 67.00  ? 10  G   C "O2'" 1 
ATOM   217  C "C1'" . G   A 1 11  ? 17.497  2.587   -2.437  1.00 60.74  ? 10  G   C "C1'" 1 
ATOM   218  N N9    . G   A 1 11  ? 17.342  3.491   -1.307  1.00 59.13  ? 10  G   C N9    1 
ATOM   219  C C8    . G   A 1 11  ? 16.272  4.295   -0.983  1.00 59.93  ? 10  G   C C8    1 
ATOM   220  N N7    . G   A 1 11  ? 16.459  4.973   0.120   1.00 59.38  ? 10  G   C N7    1 
ATOM   221  C C5    . G   A 1 11  ? 17.728  4.595   0.542   1.00 59.59  ? 10  G   C C5    1 
ATOM   222  C C6    . G   A 1 11  ? 18.490  4.998   1.680   1.00 59.91  ? 10  G   C C6    1 
ATOM   223  O O6    . G   A 1 11  ? 18.183  5.797   2.576   1.00 60.50  ? 10  G   C O6    1 
ATOM   224  N N1    . G   A 1 11  ? 19.731  4.366   1.711   1.00 60.34  ? 10  G   C N1    1 
ATOM   225  C C2    . G   A 1 11  ? 20.185  3.467   0.773   1.00 59.51  ? 10  G   C C2    1 
ATOM   226  N N2    . G   A 1 11  ? 21.412  2.965   0.967   1.00 57.41  ? 10  G   C N2    1 
ATOM   227  N N3    . G   A 1 11  ? 19.489  3.087   -0.279  1.00 58.79  ? 10  G   C N3    1 
ATOM   228  C C4    . G   A 1 11  ? 18.282  3.685   -0.332  1.00 59.33  ? 10  G   C C4    1 
ATOM   229  P P     . U   A 1 12  ? 16.939  -0.914  -4.395  1.00 65.11  ? 11  U   C P     1 
ATOM   230  O OP1   . U   A 1 12  ? 15.789  -0.832  -5.332  1.00 65.78  ? 11  U   C OP1   1 
ATOM   231  O OP2   . U   A 1 12  ? 16.705  -1.272  -2.976  1.00 64.03  ? 11  U   C OP2   1 
ATOM   232  O "O5'" . U   A 1 12  ? 18.010  -1.928  -4.987  1.00 61.54  ? 11  U   C "O5'" 1 
ATOM   233  C "C5'" . U   A 1 12  ? 18.213  -2.022  -6.383  1.00 63.71  ? 11  U   C "C5'" 1 
ATOM   234  C "C4'" . U   A 1 12  ? 19.684  -2.130  -6.683  1.00 65.82  ? 11  U   C "C4'" 1 
ATOM   235  O "O4'" . U   A 1 12  ? 20.369  -0.912  -6.293  1.00 65.34  ? 11  U   C "O4'" 1 
ATOM   236  C "C3'" . U   A 1 12  ? 20.416  -3.219  -5.926  1.00 65.29  ? 11  U   C "C3'" 1 
ATOM   237  O "O3'" . U   A 1 12  ? 20.225  -4.452  -6.597  1.00 68.38  ? 11  U   C "O3'" 1 
ATOM   238  C "C2'" . U   A 1 12  ? 21.864  -2.744  -5.994  1.00 65.27  ? 11  U   C "C2'" 1 
ATOM   239  O "O2'" . U   A 1 12  ? 22.526  -3.094  -7.195  1.00 66.79  ? 11  U   C "O2'" 1 
ATOM   240  C "C1'" . U   A 1 12  ? 21.697  -1.224  -5.902  1.00 63.20  ? 11  U   C "C1'" 1 
ATOM   241  N N1    . U   A 1 12  ? 21.956  -0.645  -4.571  1.00 59.16  ? 11  U   C N1    1 
ATOM   242  C C2    . U   A 1 12  ? 23.232  -0.764  -4.053  1.00 55.74  ? 11  U   C C2    1 
ATOM   243  O O2    . U   A 1 12  ? 24.133  -1.348  -4.633  1.00 53.48  ? 11  U   C O2    1 
ATOM   244  N N3    . U   A 1 12  ? 23.419  -0.169  -2.833  1.00 53.58  ? 11  U   C N3    1 
ATOM   245  C C4    . U   A 1 12  ? 22.490  0.517   -2.090  1.00 54.10  ? 11  U   C C4    1 
ATOM   246  O O4    . U   A 1 12  ? 22.822  1.009   -1.013  1.00 54.11  ? 11  U   C O4    1 
ATOM   247  C C5    . U   A 1 12  ? 21.190  0.589   -2.679  1.00 55.94  ? 11  U   C C5    1 
ATOM   248  C C6    . U   A 1 12  ? 20.970  0.017   -3.864  1.00 58.37  ? 11  U   C C6    1 
ATOM   249  P P     . A   A 1 13  ? 19.507  -5.673  -5.836  1.00 70.30  ? 12  A   C P     1 
ATOM   250  O OP1   . A   A 1 13  ? 18.558  -6.296  -6.801  1.00 71.64  ? 12  A   C OP1   1 
ATOM   251  O OP2   . A   A 1 13  ? 19.004  -5.214  -4.513  1.00 71.63  ? 12  A   C OP2   1 
ATOM   252  O "O5'" . A   A 1 13  ? 20.703  -6.688  -5.574  1.00 66.40  ? 12  A   C "O5'" 1 
ATOM   253  C "C5'" . A   A 1 13  ? 21.816  -6.741  -6.453  1.00 59.90  ? 12  A   C "C5'" 1 
ATOM   254  C "C4'" . A   A 1 13  ? 23.095  -6.795  -5.666  1.00 60.15  ? 12  A   C "C4'" 1 
ATOM   255  O "O4'" . A   A 1 13  ? 23.440  -5.478  -5.169  1.00 58.25  ? 12  A   C "O4'" 1 
ATOM   256  C "C3'" . A   A 1 13  ? 23.102  -7.631  -4.395  1.00 60.80  ? 12  A   C "C3'" 1 
ATOM   257  O "O3'" . A   A 1 13  ? 23.168  -9.029  -4.667  1.00 63.67  ? 12  A   C "O3'" 1 
ATOM   258  C "C2'" . A   A 1 13  ? 24.375  -7.126  -3.727  1.00 59.70  ? 12  A   C "C2'" 1 
ATOM   259  O "O2'" . A   A 1 13  ? 25.548  -7.694  -4.287  1.00 55.74  ? 12  A   C "O2'" 1 
ATOM   260  C "C1'" . A   A 1 13  ? 24.289  -5.623  -4.031  1.00 58.68  ? 12  A   C "C1'" 1 
ATOM   261  N N9    . A   A 1 13  ? 23.750  -4.828  -2.918  1.00 56.52  ? 12  A   C N9    1 
ATOM   262  C C8    . A   A 1 13  ? 22.500  -4.259  -2.787  1.00 55.25  ? 12  A   C C8    1 
ATOM   263  N N7    . A   A 1 13  ? 22.327  -3.616  -1.655  1.00 55.04  ? 12  A   C N7    1 
ATOM   264  C C5    . A   A 1 13  ? 23.544  -3.764  -0.996  1.00 53.92  ? 12  A   C C5    1 
ATOM   265  C C6    . A   A 1 13  ? 24.013  -3.308  0.260   1.00 52.59  ? 12  A   C C6    1 
ATOM   266  N N6    . A   A 1 13  ? 23.285  -2.581  1.111   1.00 48.72  ? 12  A   C N6    1 
ATOM   267  N N1    . A   A 1 13  ? 25.274  -3.631  0.611   1.00 52.40  ? 12  A   C N1    1 
ATOM   268  C C2    . A   A 1 13  ? 26.008  -4.361  -0.238  1.00 53.80  ? 12  A   C C2    1 
ATOM   269  N N3    . A   A 1 13  ? 25.687  -4.843  -1.436  1.00 53.03  ? 12  A   C N3    1 
ATOM   270  C C4    . A   A 1 13  ? 24.428  -4.507  -1.761  1.00 54.00  ? 12  A   C C4    1 
ATOM   271  P P     . C   A 1 14  ? 22.188  -10.046 -3.889  1.00 64.92  ? 13  C   C P     1 
ATOM   272  O OP1   . C   A 1 14  ? 22.514  -11.404 -4.390  1.00 64.75  ? 13  C   C OP1   1 
ATOM   273  O OP2   . C   A 1 14  ? 20.787  -9.543  -4.001  1.00 64.27  ? 13  C   C OP2   1 
ATOM   274  O "O5'" . C   A 1 14  ? 22.640  -9.946  -2.357  1.00 64.69  ? 13  C   C "O5'" 1 
ATOM   275  C "C5'" . C   A 1 14  ? 24.020  -9.925  -1.983  1.00 65.89  ? 13  C   C "C5'" 1 
ATOM   276  C "C4'" . C   A 1 14  ? 24.198  -9.279  -0.618  1.00 69.26  ? 13  C   C "C4'" 1 
ATOM   277  O "O4'" . C   A 1 14  ? 24.075  -7.828  -0.714  1.00 69.90  ? 13  C   C "O4'" 1 
ATOM   278  C "C3'" . C   A 1 14  ? 23.210  -9.650  0.481   1.00 69.82  ? 13  C   C "C3'" 1 
ATOM   279  O "O3'" . C   A 1 14  ? 23.526  -10.894 1.090   1.00 72.75  ? 13  C   C "O3'" 1 
ATOM   280  C "C2'" . C   A 1 14  ? 23.385  -8.488  1.453   1.00 69.16  ? 13  C   C "C2'" 1 
ATOM   281  O "O2'" . C   A 1 14  ? 24.552  -8.559  2.251   1.00 66.37  ? 13  C   C "O2'" 1 
ATOM   282  C "C1'" . C   A 1 14  ? 23.491  -7.314  0.480   1.00 68.42  ? 13  C   C "C1'" 1 
ATOM   283  N N1    . C   A 1 14  ? 22.176  -6.721  0.159   1.00 68.54  ? 13  C   C N1    1 
ATOM   284  C C2    . C   A 1 14  ? 21.505  -5.966  1.145   1.00 67.26  ? 13  C   C C2    1 
ATOM   285  O O2    . C   A 1 14  ? 22.030  -5.823  2.262   1.00 65.58  ? 13  C   C O2    1 
ATOM   286  N N3    . C   A 1 14  ? 20.303  -5.418  0.849   1.00 66.43  ? 13  C   C N3    1 
ATOM   287  C C4    . C   A 1 14  ? 19.766  -5.599  -0.361  1.00 68.54  ? 13  C   C C4    1 
ATOM   288  N N4    . C   A 1 14  ? 18.578  -5.041  -0.612  1.00 68.68  ? 13  C   C N4    1 
ATOM   289  C C5    . C   A 1 14  ? 20.421  -6.361  -1.372  1.00 68.64  ? 13  C   C C5    1 
ATOM   290  C C6    . C   A 1 14  ? 21.609  -6.898  -1.074  1.00 68.06  ? 13  C   C C6    1 
ATOM   291  P P     . G   A 1 15  ? 22.343  -11.847 1.624   1.00 75.46  ? 14  G   C P     1 
ATOM   292  O OP1   . G   A 1 15  ? 22.997  -12.908 2.436   1.00 76.94  ? 14  G   C OP1   1 
ATOM   293  O OP2   . G   A 1 15  ? 21.477  -12.231 0.481   1.00 76.34  ? 14  G   C OP2   1 
ATOM   294  O "O5'" . G   A 1 15  ? 21.480  -10.919 2.593   1.00 75.95  ? 14  G   C "O5'" 1 
ATOM   295  C "C5'" . G   A 1 15  ? 21.891  -10.678 3.937   1.00 73.50  ? 14  G   C "C5'" 1 
ATOM   296  C "C4'" . G   A 1 15  ? 21.054  -9.583  4.562   1.00 72.35  ? 14  G   C "C4'" 1 
ATOM   297  O "O4'" . G   A 1 15  ? 20.636  -8.589  3.596   1.00 69.88  ? 14  G   C "O4'" 1 
ATOM   298  C "C3'" . G   A 1 15  ? 19.718  -9.979  5.167   1.00 72.40  ? 14  G   C "C3'" 1 
ATOM   299  O "O3'" . G   A 1 15  ? 19.889  -10.674 6.401   1.00 76.39  ? 14  G   C "O3'" 1 
ATOM   300  C "C2'" . G   A 1 15  ? 19.050  -8.615  5.364   1.00 70.20  ? 14  G   C "C2'" 1 
ATOM   301  O "O2'" . G   A 1 15  ? 19.382  -7.997  6.593   1.00 70.43  ? 14  G   C "O2'" 1 
ATOM   302  C "C1'" . G   A 1 15  ? 19.629  -7.795  4.201   1.00 67.21  ? 14  G   C "C1'" 1 
ATOM   303  N N9    . G   A 1 15  ? 18.630  -7.414  3.205   1.00 61.00  ? 14  G   C N9    1 
ATOM   304  C C8    . G   A 1 15  ? 18.546  -7.823  1.896   1.00 59.15  ? 14  G   C C8    1 
ATOM   305  N N7    . G   A 1 15  ? 17.518  -7.318  1.268   1.00 58.29  ? 14  G   C N7    1 
ATOM   306  C C5    . G   A 1 15  ? 16.887  -6.522  2.217   1.00 54.72  ? 14  G   C C5    1 
ATOM   307  C C6    . G   A 1 15  ? 15.712  -5.719  2.118   1.00 54.04  ? 14  G   C C6    1 
ATOM   308  O O6    . G   A 1 15  ? 14.976  -5.547  1.138   1.00 52.44  ? 14  G   C O6    1 
ATOM   309  N N1    . G   A 1 15  ? 15.423  -5.082  3.322   1.00 50.52  ? 14  G   C N1    1 
ATOM   310  C C2    . G   A 1 15  ? 16.168  -5.195  4.471   1.00 52.90  ? 14  G   C C2    1 
ATOM   311  N N2    . G   A 1 15  ? 15.728  -4.503  5.535   1.00 49.42  ? 14  G   C N2    1 
ATOM   312  N N3    . G   A 1 15  ? 17.266  -5.935  4.574   1.00 54.73  ? 14  G   C N3    1 
ATOM   313  C C4    . G   A 1 15  ? 17.562  -6.566  3.416   1.00 57.01  ? 14  G   C C4    1 
ATOM   314  P P     . A   A 1 16  ? 18.781  -11.741 6.883   1.00 77.69  ? 15  A   C P     1 
ATOM   315  O OP1   . A   A 1 16  ? 19.395  -12.528 7.985   1.00 78.09  ? 15  A   C OP1   1 
ATOM   316  O OP2   . A   A 1 16  ? 18.228  -12.447 5.696   1.00 77.30  ? 15  A   C OP2   1 
ATOM   317  O "O5'" . A   A 1 16  ? 17.620  -10.843 7.506   1.00 77.83  ? 15  A   C "O5'" 1 
ATOM   318  C "C5'" . A   A 1 16  ? 17.811  -10.140 8.733   1.00 78.09  ? 15  A   C "C5'" 1 
ATOM   319  C "C4'" . A   A 1 16  ? 16.618  -9.259  9.023   1.00 79.25  ? 15  A   C "C4'" 1 
ATOM   320  O "O4'" . A   A 1 16  ? 16.295  -8.452  7.860   1.00 77.48  ? 15  A   C "O4'" 1 
ATOM   321  C "C3'" . A   A 1 16  ? 15.332  -9.962  9.446   1.00 80.18  ? 15  A   C "C3'" 1 
ATOM   322  O "O3'" . A   A 1 16  ? 14.683  -9.250  10.491  1.00 86.70  ? 15  A   C "O3'" 1 
ATOM   323  C "C2'" . A   A 1 16  ? 14.483  -9.950  8.181   1.00 78.04  ? 15  A   C "C2'" 1 
ATOM   324  O "O2'" . A   A 1 16  ? 13.101  -9.878  8.454   1.00 77.49  ? 15  A   C "O2'" 1 
ATOM   325  C "C1'" . A   A 1 16  ? 14.954  -8.674  7.480   1.00 75.60  ? 15  A   C "C1'" 1 
ATOM   326  N N9    . A   A 1 16  ? 14.914  -8.802  6.025   1.00 71.94  ? 15  A   C N9    1 
ATOM   327  C C8    . A   A 1 16  ? 15.719  -9.585  5.233   1.00 71.11  ? 15  A   C C8    1 
ATOM   328  N N7    . A   A 1 16  ? 15.427  -9.526  3.958   1.00 69.79  ? 15  A   C N7    1 
ATOM   329  C C5    . A   A 1 16  ? 14.362  -8.637  3.902   1.00 69.40  ? 15  A   C C5    1 
ATOM   330  C C6    . A   A 1 16  ? 13.595  -8.150  2.830   1.00 68.19  ? 15  A   C C6    1 
ATOM   331  N N6    . A   A 1 16  ? 13.787  -8.511  1.561   1.00 67.39  ? 15  A   C N6    1 
ATOM   332  N N1    . A   A 1 16  ? 12.609  -7.270  3.112   1.00 68.72  ? 15  A   C N1    1 
ATOM   333  C C2    . A   A 1 16  ? 12.415  -6.912  4.390   1.00 67.91  ? 15  A   C C2    1 
ATOM   334  N N3    . A   A 1 16  ? 13.068  -7.302  5.483   1.00 68.23  ? 15  A   C N3    1 
ATOM   335  C C4    . A   A 1 16  ? 14.041  -8.176  5.167   1.00 69.78  ? 15  A   C C4    1 
ATOM   336  P P     . G   A 1 17  ? 15.066  -9.552  12.025  1.00 92.14  ? 16  G   C P     1 
ATOM   337  O OP1   . G   A 1 17  ? 15.875  -10.800 12.089  1.00 92.75  ? 16  G   C OP1   1 
ATOM   338  O OP2   . G   A 1 17  ? 13.806  -9.462  12.801  1.00 92.32  ? 16  G   C OP2   1 
ATOM   339  O "O5'" . G   A 1 17  ? 15.987  -8.320  12.453  1.00 95.69  ? 16  G   C "O5'" 1 
ATOM   340  C "C5'" . G   A 1 17  ? 16.884  -7.699  11.522  1.00 101.54 ? 16  G   C "C5'" 1 
ATOM   341  C "C4'" . G   A 1 17  ? 16.483  -6.254  11.279  1.00 105.40 ? 16  G   C "C4'" 1 
ATOM   342  O "O4'" . G   A 1 17  ? 15.084  -6.071  11.669  1.00 107.10 ? 16  G   C "O4'" 1 
ATOM   343  C "C3'" . G   A 1 17  ? 17.223  -5.235  12.146  1.00 107.41 ? 16  G   C "C3'" 1 
ATOM   344  O "O3'" . G   A 1 17  ? 16.988  -3.873  11.722  1.00 108.15 ? 16  G   C "O3'" 1 
ATOM   345  C "C2'" . G   A 1 17  ? 16.429  -5.398  13.430  1.00 107.82 ? 16  G   C "C2'" 1 
ATOM   346  O "O2'" . G   A 1 17  ? 16.714  -4.448  14.437  1.00 108.57 ? 16  G   C "O2'" 1 
ATOM   347  C "C1'" . G   A 1 17  ? 15.033  -5.254  12.829  1.00 108.17 ? 16  G   C "C1'" 1 
ATOM   348  N N9    . G   A 1 17  ? 13.879  -5.621  13.637  1.00 108.68 ? 16  G   C N9    1 
ATOM   349  C C8    . G   A 1 17  ? 12.898  -6.523  13.316  1.00 108.44 ? 16  G   C C8    1 
ATOM   350  N N7    . G   A 1 17  ? 11.975  -6.615  14.229  1.00 108.81 ? 16  G   C N7    1 
ATOM   351  C C5    . G   A 1 17  ? 12.371  -5.728  15.214  1.00 109.16 ? 16  G   C C5    1 
ATOM   352  C C6    . G   A 1 17  ? 11.766  -5.404  16.442  1.00 109.38 ? 16  G   C C6    1 
ATOM   353  O O6    . G   A 1 17  ? 10.719  -5.851  16.923  1.00 109.72 ? 16  G   C O6    1 
ATOM   354  N N1    . G   A 1 17  ? 12.503  -4.453  17.140  1.00 109.81 ? 16  G   C N1    1 
ATOM   355  C C2    . G   A 1 17  ? 13.675  -3.886  16.705  1.00 109.74 ? 16  G   C C2    1 
ATOM   356  N N2    . G   A 1 17  ? 14.240  -2.983  17.522  1.00 110.21 ? 16  G   C N2    1 
ATOM   357  N N3    . G   A 1 17  ? 14.250  -4.182  15.555  1.00 109.34 ? 16  G   C N3    1 
ATOM   358  C C4    . G   A 1 17  ? 13.548  -5.106  14.866  1.00 109.22 ? 16  G   C C4    1 
HETATM 359  P PC    . A23 A 1 18  ? 12.969  1.052   7.294   1.00 103.21 ? 17  A23 C PC    1 
HETATM 360  O O1C   . A23 A 1 18  ? 12.658  0.786   5.867   1.00 102.19 ? 17  A23 C O1C   1 
HETATM 361  O O2C   . A23 A 1 18  ? 13.383  2.450   7.540   1.00 103.63 ? 17  A23 C O2C   1 
HETATM 362  P P     . A23 A 1 18  ? 17.118  -3.437  10.171  1.00 108.17 ? 17  A23 C P     1 
HETATM 363  O OP1   . A23 A 1 18  ? 17.502  -4.596  9.315   1.00 107.79 ? 17  A23 C OP1   1 
HETATM 364  O OP2   . A23 A 1 18  ? 17.994  -2.238  10.213  1.00 108.20 ? 17  A23 C OP2   1 
HETATM 365  O "O5'" . A23 A 1 18  ? 15.649  -2.942  9.765   1.00 106.81 ? 17  A23 C "O5'" 1 
HETATM 366  C "C5'" . A23 A 1 18  ? 15.122  -3.190  8.452   1.00 104.86 ? 17  A23 C "C5'" 1 
HETATM 367  C "C4'" . A23 A 1 18  ? 14.006  -2.210  8.095   1.00 103.74 ? 17  A23 C "C4'" 1 
HETATM 368  O "O4'" . A23 A 1 18  ? 12.705  -2.830  8.073   1.00 102.70 ? 17  A23 C "O4'" 1 
HETATM 369  C "C3'" . A23 A 1 18  ? 13.893  -0.860  8.786   1.00 103.34 ? 17  A23 C "C3'" 1 
HETATM 370  O "O3'" . A23 A 1 18  ? 14.165  0.119   7.810   1.00 103.39 ? 17  A23 C "O3'" 1 
HETATM 371  C "C2'" . A23 A 1 18  ? 12.399  -0.651  9.072   1.00 103.08 ? 17  A23 C "C2'" 1 
HETATM 372  O "O2'" . A23 A 1 18  ? 11.877  0.452   8.325   1.00 103.42 ? 17  A23 C "O2'" 1 
HETATM 373  C "C1'" . A23 A 1 18  ? 11.740  -1.972  8.652   1.00 102.45 ? 17  A23 C "C1'" 1 
HETATM 374  N N9    . A23 A 1 18  ? 11.092  -2.741  9.713   1.00 101.00 ? 17  A23 C N9    1 
HETATM 375  C C8    . A23 A 1 18  ? 11.084  -2.571  11.078  1.00 100.41 ? 17  A23 C C8    1 
HETATM 376  N N7    . A23 A 1 18  ? 10.557  -3.580  11.729  1.00 99.46  ? 17  A23 C N7    1 
HETATM 377  C C5    . A23 A 1 18  ? 10.151  -4.447  10.723  1.00 99.79  ? 17  A23 C C5    1 
HETATM 378  C C6    . A23 A 1 18  ? 9.529   -5.700  10.748  1.00 99.95  ? 17  A23 C C6    1 
HETATM 379  N N6    . A23 A 1 18  ? 9.212   -6.348  11.869  1.00 100.26 ? 17  A23 C N6    1 
HETATM 380  N N1    . A23 A 1 18  ? 9.249   -6.284  9.561   1.00 100.11 ? 17  A23 C N1    1 
HETATM 381  C C2    . A23 A 1 18  ? 9.584   -5.646  8.434   1.00 98.47  ? 17  A23 C C2    1 
HETATM 382  N N3    . A23 A 1 18  ? 10.175  -4.475  8.282   1.00 98.78  ? 17  A23 C N3    1 
HETATM 383  C C4    . A23 A 1 18  ? 10.437  -3.921  9.479   1.00 100.13 ? 17  A23 C C4    1 
ATOM   384  O "O5'" . G   B 2 1   ? 16.454  2.876   5.866   1.00 67.06  ? 18  G   F "O5'" 1 
ATOM   385  C "C5'" . G   B 2 1   ? 15.983  1.569   6.213   1.00 62.58  ? 18  G   F "C5'" 1 
ATOM   386  C "C4'" . G   B 2 1   ? 16.920  0.842   7.150   1.00 60.30  ? 18  G   F "C4'" 1 
ATOM   387  O "O4'" . G   B 2 1   ? 16.545  -0.559  7.238   1.00 59.69  ? 18  G   F "O4'" 1 
ATOM   388  C "C3'" . G   B 2 1   ? 18.387  0.866   6.741   1.00 57.01  ? 18  G   F "C3'" 1 
ATOM   389  O "O3'" . G   B 2 1   ? 19.063  1.805   7.554   1.00 54.85  ? 18  G   F "O3'" 1 
ATOM   390  C "C2'" . G   B 2 1   ? 18.870  -0.541  7.063   1.00 55.99  ? 18  G   F "C2'" 1 
ATOM   391  O "O2'" . G   B 2 1   ? 19.286  -0.683  8.402   1.00 55.69  ? 18  G   F "O2'" 1 
ATOM   392  C "C1'" . G   B 2 1   ? 17.614  -1.361  6.793   1.00 56.15  ? 18  G   F "C1'" 1 
ATOM   393  N N9    . G   B 2 1   ? 17.407  -1.669  5.380   1.00 53.42  ? 18  G   F N9    1 
ATOM   394  C C8    . G   B 2 1   ? 16.310  -1.361  4.606   1.00 52.63  ? 18  G   F C8    1 
ATOM   395  N N7    . G   B 2 1   ? 16.408  -1.800  3.381   1.00 52.96  ? 18  G   F N7    1 
ATOM   396  C C5    . G   B 2 1   ? 17.646  -2.429  3.343   1.00 51.44  ? 18  G   F C5    1 
ATOM   397  C C6    . G   B 2 1   ? 18.296  -3.098  2.287   1.00 49.18  ? 18  G   F C6    1 
ATOM   398  O O6    . G   B 2 1   ? 17.896  -3.279  1.138   1.00 49.58  ? 18  G   F O6    1 
ATOM   399  N N1    . G   B 2 1   ? 19.539  -3.588  2.678   1.00 48.89  ? 18  G   F N1    1 
ATOM   400  C C2    . G   B 2 1   ? 20.083  -3.449  3.932   1.00 50.23  ? 18  G   F C2    1 
ATOM   401  N N2    . G   B 2 1   ? 21.293  -3.989  4.123   1.00 49.23  ? 18  G   F N2    1 
ATOM   402  N N3    . G   B 2 1   ? 19.483  -2.827  4.928   1.00 50.34  ? 18  G   F N3    1 
ATOM   403  C C4    . G   B 2 1   ? 18.277  -2.347  4.566   1.00 51.77  ? 18  G   F C4    1 
ATOM   404  P P     . G   B 2 2   ? 19.863  3.006   6.873   1.00 52.41  ? 19  G   F P     1 
ATOM   405  O OP1   . G   B 2 2   ? 20.635  3.626   7.983   1.00 53.46  ? 19  G   F OP1   1 
ATOM   406  O OP2   . G   B 2 2   ? 18.938  3.835   6.058   1.00 53.36  ? 19  G   F OP2   1 
ATOM   407  O "O5'" . G   B 2 2   ? 20.857  2.285   5.866   1.00 50.55  ? 19  G   F "O5'" 1 
ATOM   408  C "C5'" . G   B 2 2   ? 21.822  1.354   6.334   1.00 46.29  ? 19  G   F "C5'" 1 
ATOM   409  C "C4'" . G   B 2 2   ? 22.466  0.657   5.171   1.00 44.04  ? 19  G   F "C4'" 1 
ATOM   410  O "O4'" . G   B 2 2   ? 21.561  -0.366  4.673   1.00 41.76  ? 19  G   F "O4'" 1 
ATOM   411  C "C3'" . G   B 2 2   ? 22.728  1.532   3.959   1.00 44.69  ? 19  G   F "C3'" 1 
ATOM   412  O "O3'" . G   B 2 2   ? 23.919  2.299   4.087   1.00 44.96  ? 19  G   F "O3'" 1 
ATOM   413  C "C2'" . G   B 2 2   ? 22.794  0.496   2.849   1.00 43.39  ? 19  G   F "C2'" 1 
ATOM   414  O "O2'" . G   B 2 2   ? 24.014  -0.220  2.864   1.00 46.06  ? 19  G   F "O2'" 1 
ATOM   415  C "C1'" . G   B 2 2   ? 21.636  -0.419  3.255   1.00 44.03  ? 19  G   F "C1'" 1 
ATOM   416  N N9    . G   B 2 2   ? 20.344  0.005   2.726   1.00 43.28  ? 19  G   F N9    1 
ATOM   417  C C8    . G   B 2 2   ? 19.435  0.815   3.361   1.00 44.32  ? 19  G   F C8    1 
ATOM   418  N N7    . G   B 2 2   ? 18.367  1.038   2.650   1.00 44.91  ? 19  G   F N7    1 
ATOM   419  C C5    . G   B 2 2   ? 18.577  0.333   1.476   1.00 43.68  ? 19  G   F C5    1 
ATOM   420  C C6    . G   B 2 2   ? 17.751  0.202   0.324   1.00 45.86  ? 19  G   F C6    1 
ATOM   421  O O6    . G   B 2 2   ? 16.634  0.697   0.114   1.00 49.67  ? 19  G   F O6    1 
ATOM   422  N N1    . G   B 2 2   ? 18.339  -0.603  -0.639  1.00 43.09  ? 19  G   F N1    1 
ATOM   423  C C2    . G   B 2 2   ? 19.560  -1.214  -0.517  1.00 42.63  ? 19  G   F C2    1 
ATOM   424  N N2    . G   B 2 2   ? 19.937  -1.960  -1.570  1.00 44.18  ? 19  G   F N2    1 
ATOM   425  N N3    . G   B 2 2   ? 20.346  -1.103  0.554   1.00 42.60  ? 19  G   F N3    1 
ATOM   426  C C4    . G   B 2 2   ? 19.792  -0.316  1.505   1.00 43.20  ? 19  G   F C4    1 
ATOM   427  P P     . A   B 2 3   ? 24.115  3.617   3.185   1.00 46.69  ? 20  A   F P     1 
ATOM   428  O OP1   . A   B 2 3   ? 25.178  4.456   3.802   1.00 49.70  ? 20  A   F OP1   1 
ATOM   429  O OP2   . A   B 2 3   ? 22.774  4.203   2.933   1.00 47.82  ? 20  A   F OP2   1 
ATOM   430  O "O5'" . A   B 2 3   ? 24.665  3.053   1.803   1.00 45.38  ? 20  A   F "O5'" 1 
ATOM   431  C "C5'" . A   B 2 3   ? 25.999  3.302   1.388   1.00 46.75  ? 20  A   F "C5'" 1 
ATOM   432  C "C4'" . A   B 2 3   ? 26.943  2.336   2.060   1.00 48.65  ? 20  A   F "C4'" 1 
ATOM   433  O "O4'" . A   B 2 3   ? 26.355  1.003   2.081   1.00 52.03  ? 20  A   F "O4'" 1 
ATOM   434  C "C3'" . A   B 2 3   ? 28.275  2.164   1.353   1.00 49.72  ? 20  A   F "C3'" 1 
ATOM   435  O "O3'" . A   B 2 3   ? 29.192  3.167   1.777   1.00 47.79  ? 20  A   F "O3'" 1 
ATOM   436  C "C2'" . A   B 2 3   ? 28.668  0.747   1.757   1.00 49.14  ? 20  A   F "C2'" 1 
ATOM   437  O "O2'" . A   B 2 3   ? 29.131  0.646   3.084   1.00 48.86  ? 20  A   F "O2'" 1 
ATOM   438  C "C1'" . A   B 2 3   ? 27.319  0.042   1.675   1.00 49.51  ? 20  A   F "C1'" 1 
ATOM   439  N N9    . A   B 2 3   ? 26.961  -0.461  0.345   1.00 48.47  ? 20  A   F N9    1 
ATOM   440  C C8    . A   B 2 3   ? 25.801  -0.242  -0.358  1.00 49.57  ? 20  A   F C8    1 
ATOM   441  N N7    . A   B 2 3   ? 25.765  -0.840  -1.523  1.00 48.14  ? 20  A   F N7    1 
ATOM   442  C C5    . A   B 2 3   ? 26.984  -1.495  -1.597  1.00 49.67  ? 20  A   F C5    1 
ATOM   443  C C6    . A   B 2 3   ? 27.562  -2.309  -2.589  1.00 49.96  ? 20  A   F C6    1 
ATOM   444  N N6    . A   B 2 3   ? 26.963  -2.611  -3.745  1.00 52.27  ? 20  A   F N6    1 
ATOM   445  N N1    . A   B 2 3   ? 28.792  -2.806  -2.351  1.00 47.52  ? 20  A   F N1    1 
ATOM   446  C C2    . A   B 2 3   ? 29.394  -2.501  -1.197  1.00 49.18  ? 20  A   F C2    1 
ATOM   447  N N3    . A   B 2 3   ? 28.956  -1.749  -0.189  1.00 49.57  ? 20  A   F N3    1 
ATOM   448  C C4    . A   B 2 3   ? 27.731  -1.270  -0.454  1.00 49.15  ? 20  A   F C4    1 
ATOM   449  P P     . A   B 2 4   ? 29.804  4.187   0.698   1.00 51.59  ? 21  A   F P     1 
ATOM   450  O OP1   . A   B 2 4   ? 30.189  5.441   1.394   1.00 53.11  ? 21  A   F OP1   1 
ATOM   451  O OP2   . A   B 2 4   ? 28.877  4.248   -0.464  1.00 50.01  ? 21  A   F OP2   1 
ATOM   452  O "O5'" . A   B 2 4   ? 31.155  3.491   0.213   1.00 52.15  ? 21  A   F "O5'" 1 
ATOM   453  C "C5'" . A   B 2 4   ? 31.806  2.496   1.006   1.00 51.45  ? 21  A   F "C5'" 1 
ATOM   454  C "C4'" . A   B 2 4   ? 32.479  1.470   0.125   1.00 50.57  ? 21  A   F "C4'" 1 
ATOM   455  O "O4'" . A   B 2 4   ? 31.512  0.477   -0.297  1.00 52.24  ? 21  A   F "O4'" 1 
ATOM   456  C "C3'" . A   B 2 4   ? 33.103  1.974   -1.167  1.00 52.37  ? 21  A   F "C3'" 1 
ATOM   457  O "O3'" . A   B 2 4   ? 34.419  2.450   -0.914  1.00 52.62  ? 21  A   F "O3'" 1 
ATOM   458  C "C2'" . A   B 2 4   ? 33.126  0.717   -2.031  1.00 52.18  ? 21  A   F "C2'" 1 
ATOM   459  O "O2'" . A   B 2 4   ? 34.239  -0.110  -1.760  1.00 55.26  ? 21  A   F "O2'" 1 
ATOM   460  C "C1'" . A   B 2 4   ? 31.841  0.013   -1.595  1.00 52.05  ? 21  A   F "C1'" 1 
ATOM   461  N N9    . A   B 2 4   ? 30.694  0.235   -2.474  1.00 50.71  ? 21  A   F N9    1 
ATOM   462  C C8    . A   B 2 4   ? 29.653  1.114   -2.305  1.00 50.69  ? 21  A   F C8    1 
ATOM   463  N N7    . A   B 2 4   ? 28.759  1.067   -3.264  1.00 51.11  ? 21  A   F N7    1 
ATOM   464  C C5    . A   B 2 4   ? 29.246  0.095   -4.124  1.00 50.07  ? 21  A   F C5    1 
ATOM   465  C C6    . A   B 2 4   ? 28.755  -0.426  -5.332  1.00 50.98  ? 21  A   F C6    1 
ATOM   466  N N6    . A   B 2 4   ? 27.619  -0.023  -5.903  1.00 49.26  ? 21  A   F N6    1 
ATOM   467  N N1    . A   B 2 4   ? 29.481  -1.388  -5.940  1.00 51.05  ? 21  A   F N1    1 
ATOM   468  C C2    . A   B 2 4   ? 30.621  -1.792  -5.363  1.00 51.42  ? 21  A   F C2    1 
ATOM   469  N N3    . A   B 2 4   ? 31.185  -1.379  -4.229  1.00 51.33  ? 21  A   F N3    1 
ATOM   470  C C4    . A   B 2 4   ? 30.438  -0.424  -3.651  1.00 50.69  ? 21  A   F C4    1 
ATOM   471  P P     . C   B 2 5   ? 35.152  3.388   -1.990  1.00 54.46  ? 22  C   F P     1 
ATOM   472  O OP1   . C   B 2 5   ? 36.471  3.760   -1.416  1.00 55.15  ? 22  C   F OP1   1 
ATOM   473  O OP2   . C   B 2 5   ? 34.211  4.454   -2.402  1.00 56.02  ? 22  C   F OP2   1 
ATOM   474  O "O5'" . C   B 2 5   ? 35.394  2.428   -3.239  1.00 55.77  ? 22  C   F "O5'" 1 
ATOM   475  C "C5'" . C   B 2 5   ? 36.453  1.473   -3.231  1.00 55.93  ? 22  C   F "C5'" 1 
ATOM   476  C "C4'" . C   B 2 5   ? 36.312  0.516   -4.388  1.00 55.65  ? 22  C   F "C4'" 1 
ATOM   477  O "O4'" . C   B 2 5   ? 34.960  -0.012  -4.446  1.00 59.93  ? 22  C   F "O4'" 1 
ATOM   478  C "C3'" . C   B 2 5   ? 36.485  1.117   -5.768  1.00 56.72  ? 22  C   F "C3'" 1 
ATOM   479  O "O3'" . C   B 2 5   ? 37.848  1.342   -6.074  1.00 56.69  ? 22  C   F "O3'" 1 
ATOM   480  C "C2'" . C   B 2 5   ? 35.831  0.067   -6.660  1.00 57.29  ? 22  C   F "C2'" 1 
ATOM   481  O "O2'" . C   B 2 5   ? 36.629  -1.056  -6.954  1.00 60.29  ? 22  C   F "O2'" 1 
ATOM   482  C "C1'" . C   B 2 5   ? 34.657  -0.376  -5.790  1.00 59.02  ? 22  C   F "C1'" 1 
ATOM   483  N N1    . C   B 2 5   ? 33.386  0.250   -6.203  1.00 59.89  ? 22  C   F N1    1 
ATOM   484  C C2    . C   B 2 5   ? 32.756  -0.223  -7.371  1.00 59.24  ? 22  C   F C2    1 
ATOM   485  O O2    . C   B 2 5   ? 33.293  -1.133  -8.023  1.00 59.99  ? 22  C   F O2    1 
ATOM   486  N N3    . C   B 2 5   ? 31.586  0.324   -7.756  1.00 58.55  ? 22  C   F N3    1 
ATOM   487  C C4    . C   B 2 5   ? 31.041  1.307   -7.037  1.00 56.33  ? 22  C   F C4    1 
ATOM   488  N N4    . C   B 2 5   ? 29.880  1.811   -7.457  1.00 54.42  ? 22  C   F N4    1 
ATOM   489  C C5    . C   B 2 5   ? 31.661  1.814   -5.855  1.00 56.61  ? 22  C   F C5    1 
ATOM   490  C C6    . C   B 2 5   ? 32.820  1.263   -5.478  1.00 57.72  ? 22  C   F C6    1 
ATOM   491  P P     . C   B 2 6   ? 38.284  2.744   -6.716  1.00 54.81  ? 23  C   F P     1 
ATOM   492  O OP1   . C   B 2 6   ? 39.757  2.722   -6.881  1.00 53.96  ? 23  C   F OP1   1 
ATOM   493  O OP2   . C   B 2 6   ? 37.653  3.833   -5.922  1.00 55.74  ? 23  C   F OP2   1 
ATOM   494  O "O5'" . C   B 2 6   ? 37.598  2.719   -8.152  1.00 55.49  ? 23  C   F "O5'" 1 
ATOM   495  C "C5'" . C   B 2 6   ? 37.976  1.754   -9.121  1.00 55.16  ? 23  C   F "C5'" 1 
ATOM   496  C "C4'" . C   B 2 6   ? 37.029  1.785   -10.292 1.00 57.15  ? 23  C   F "C4'" 1 
ATOM   497  O "O4'" . C   B 2 6   ? 35.705  1.370   -9.863  1.00 56.95  ? 23  C   F "O4'" 1 
ATOM   498  C "C3'" . C   B 2 6   ? 36.751  3.128   -10.951 1.00 57.43  ? 23  C   F "C3'" 1 
ATOM   499  O "O3'" . C   B 2 6   ? 37.802  3.629   -11.765 1.00 58.14  ? 23  C   F "O3'" 1 
ATOM   500  C "C2'" . C   B 2 6   ? 35.495  2.801   -11.739 1.00 57.87  ? 23  C   F "C2'" 1 
ATOM   501  O "O2'" . C   B 2 6   ? 35.718  2.032   -12.907 1.00 56.89  ? 23  C   F "O2'" 1 
ATOM   502  C "C1'" . C   B 2 6   ? 34.726  1.991   -10.695 1.00 58.53  ? 23  C   F "C1'" 1 
ATOM   503  N N1    . C   B 2 6   ? 33.858  2.863   -9.874  1.00 58.96  ? 23  C   F N1    1 
ATOM   504  C C2    . C   B 2 6   ? 32.673  3.352   -10.447 1.00 58.92  ? 23  C   F C2    1 
ATOM   505  O O2    . C   B 2 6   ? 32.390  3.032   -11.616 1.00 60.36  ? 23  C   F O2    1 
ATOM   506  N N3    . C   B 2 6   ? 31.870  4.158   -9.717  1.00 58.57  ? 23  C   F N3    1 
ATOM   507  C C4    . C   B 2 6   ? 32.205  4.481   -8.466  1.00 57.50  ? 23  C   F C4    1 
ATOM   508  N N4    . C   B 2 6   ? 31.375  5.272   -7.788  1.00 54.77  ? 23  C   F N4    1 
ATOM   509  C C5    . C   B 2 6   ? 33.403  4.003   -7.858  1.00 56.80  ? 23  C   F C5    1 
ATOM   510  C C6    . C   B 2 6   ? 34.192  3.203   -8.591  1.00 58.06  ? 23  C   F C6    1 
ATOM   511  P P     . G   B 2 7   ? 38.104  5.212   -11.779 1.00 60.76  ? 24  G   F P     1 
ATOM   512  O OP1   . G   B 2 7   ? 39.204  5.473   -12.736 1.00 61.63  ? 24  G   F OP1   1 
ATOM   513  O OP2   . G   B 2 7   ? 38.248  5.660   -10.365 1.00 61.52  ? 24  G   F OP2   1 
ATOM   514  O "O5'" . G   B 2 7   ? 36.778  5.858   -12.391 1.00 60.19  ? 24  G   F "O5'" 1 
ATOM   515  C "C5'" . G   B 2 7   ? 36.197  5.348   -13.593 1.00 58.90  ? 24  G   F "C5'" 1 
ATOM   516  C "C4'" . G   B 2 7   ? 34.887  6.052   -13.907 1.00 57.16  ? 24  G   F "C4'" 1 
ATOM   517  O "O4'" . G   B 2 7   ? 33.809  5.567   -13.054 1.00 58.26  ? 24  G   F "O4'" 1 
ATOM   518  C "C3'" . G   B 2 7   ? 34.838  7.559   -13.735 1.00 55.35  ? 24  G   F "C3'" 1 
ATOM   519  O "O3'" . G   B 2 7   ? 35.402  8.239   -14.830 1.00 54.63  ? 24  G   F "O3'" 1 
ATOM   520  C "C2'" . G   B 2 7   ? 33.345  7.805   -13.624 1.00 57.07  ? 24  G   F "C2'" 1 
ATOM   521  O "O2'" . G   B 2 7   ? 32.631  7.764   -14.844 1.00 57.49  ? 24  G   F "O2'" 1 
ATOM   522  C "C1'" . G   B 2 7   ? 32.954  6.651   -12.703 1.00 57.77  ? 24  G   F "C1'" 1 
ATOM   523  N N9    . G   B 2 7   ? 33.205  7.020   -11.308 1.00 58.17  ? 24  G   F N9    1 
ATOM   524  C C8    . G   B 2 7   ? 34.128  6.475   -10.445 1.00 56.86  ? 24  G   F C8    1 
ATOM   525  N N7    . G   B 2 7   ? 34.113  7.031   -9.266  1.00 55.72  ? 24  G   F N7    1 
ATOM   526  C C5    . G   B 2 7   ? 33.118  8.000   -9.352  1.00 55.46  ? 24  G   F C5    1 
ATOM   527  C C6    . G   B 2 7   ? 32.636  8.916   -8.382  1.00 51.93  ? 24  G   F C6    1 
ATOM   528  O O6    . G   B 2 7   ? 32.993  9.051   -7.215  1.00 51.83  ? 24  G   F O6    1 
ATOM   529  N N1    . G   B 2 7   ? 31.625  9.721   -8.895  1.00 49.95  ? 24  G   F N1    1 
ATOM   530  C C2    . G   B 2 7   ? 31.133  9.651   -10.171 1.00 48.99  ? 24  G   F C2    1 
ATOM   531  N N2    . G   B 2 7   ? 30.160  10.508  -10.483 1.00 44.94  ? 24  G   F N2    1 
ATOM   532  N N3    . G   B 2 7   ? 31.564  8.799   -11.078 1.00 52.35  ? 24  G   F N3    1 
ATOM   533  C C4    . G   B 2 7   ? 32.551  8.008   -10.604 1.00 55.57  ? 24  G   F C4    1 
ATOM   534  P P     . G   B 2 8   ? 36.389  9.464   -14.562 1.00 54.82  ? 25  G   F P     1 
ATOM   535  O OP1   . G   B 2 8   ? 37.079  9.738   -15.846 1.00 58.42  ? 25  G   F OP1   1 
ATOM   536  O OP2   . G   B 2 8   ? 37.191  9.160   -13.353 1.00 55.24  ? 25  G   F OP2   1 
ATOM   537  O "O5'" . G   B 2 8   ? 35.416  10.680  -14.210 1.00 55.85  ? 25  G   F "O5'" 1 
ATOM   538  C "C5'" . G   B 2 8   ? 34.739  11.408  -15.233 1.00 52.66  ? 25  G   F "C5'" 1 
ATOM   539  C "C4'" . G   B 2 8   ? 33.796  12.432  -14.632 1.00 49.16  ? 25  G   F "C4'" 1 
ATOM   540  O "O4'" . G   B 2 8   ? 32.985  11.831  -13.586 1.00 46.97  ? 25  G   F "O4'" 1 
ATOM   541  C "C3'" . G   B 2 8   ? 34.411  13.635  -13.943 1.00 46.90  ? 25  G   F "C3'" 1 
ATOM   542  O "O3'" . G   B 2 8   ? 34.912  14.605  -14.850 1.00 48.98  ? 25  G   F "O3'" 1 
ATOM   543  C "C2'" . G   B 2 8   ? 33.236  14.144  -13.118 1.00 45.04  ? 25  G   F "C2'" 1 
ATOM   544  O "O2'" . G   B 2 8   ? 32.268  14.918  -13.813 1.00 41.70  ? 25  G   F "O2'" 1 
ATOM   545  C "C1'" . G   B 2 8   ? 32.643  12.822  -12.624 1.00 45.05  ? 25  G   F "C1'" 1 
ATOM   546  N N9    . G   B 2 8   ? 33.188  12.420  -11.328 1.00 42.48  ? 25  G   F N9    1 
ATOM   547  C C8    . G   B 2 8   ? 34.132  11.453  -11.094 1.00 43.11  ? 25  G   F C8    1 
ATOM   548  N N7    . G   B 2 8   ? 34.442  11.335  -9.835  1.00 40.89  ? 25  G   F N7    1 
ATOM   549  C C5    . G   B 2 8   ? 33.652  12.277  -9.197  1.00 38.51  ? 25  G   F C5    1 
ATOM   550  C C6    . G   B 2 8   ? 33.560  12.611  -7.823  1.00 36.16  ? 25  G   F C6    1 
ATOM   551  O O6    . G   B 2 8   ? 34.183  12.127  -6.880  1.00 33.85  ? 25  G   F O6    1 
ATOM   552  N N1    . G   B 2 8   ? 32.629  13.625  -7.602  1.00 32.80  ? 25  G   F N1    1 
ATOM   553  C C2    . G   B 2 8   ? 31.878  14.235  -8.589  1.00 33.97  ? 25  G   F C2    1 
ATOM   554  N N2    . G   B 2 8   ? 31.027  15.179  -8.194  1.00 26.67  ? 25  G   F N2    1 
ATOM   555  N N3    . G   B 2 8   ? 31.962  13.930  -9.873  1.00 35.17  ? 25  G   F N3    1 
ATOM   556  C C4    . G   B 2 8   ? 32.865  12.950  -10.103 1.00 38.46  ? 25  G   F C4    1 
ATOM   557  P P     . A   B 2 9   ? 36.093  15.589  -14.380 1.00 54.39  ? 26  A   F P     1 
ATOM   558  O OP1   . A   B 2 9   ? 36.440  16.489  -15.505 1.00 58.55  ? 26  A   F OP1   1 
ATOM   559  O OP2   . A   B 2 9   ? 37.150  14.748  -13.777 1.00 55.64  ? 26  A   F OP2   1 
ATOM   560  O "O5'" . A   B 2 9   ? 35.436  16.453  -13.213 1.00 52.04  ? 26  A   F "O5'" 1 
ATOM   561  C "C5'" . A   B 2 9   ? 35.283  17.860  -13.343 1.00 50.28  ? 26  A   F "C5'" 1 
ATOM   562  C "C4'" . A   B 2 9   ? 34.334  18.390  -12.291 1.00 50.40  ? 26  A   F "C4'" 1 
ATOM   563  O "O4'" . A   B 2 9   ? 33.654  17.298  -11.602 1.00 50.74  ? 26  A   F "O4'" 1 
ATOM   564  C "C3'" . A   B 2 9   ? 34.969  19.183  -11.160 1.00 48.08  ? 26  A   F "C3'" 1 
ATOM   565  O "O3'" . A   B 2 9   ? 35.263  20.515  -11.565 1.00 48.20  ? 26  A   F "O3'" 1 
ATOM   566  C "C2'" . A   B 2 9   ? 33.885  19.107  -10.094 1.00 44.72  ? 26  A   F "C2'" 1 
ATOM   567  O "O2'" . A   B 2 9   ? 32.795  19.970  -10.312 1.00 38.90  ? 26  A   F "O2'" 1 
ATOM   568  C "C1'" . A   B 2 9   ? 33.432  17.656  -10.244 1.00 45.57  ? 26  A   F "C1'" 1 
ATOM   569  N N9    . A   B 2 9   ? 34.198  16.740  -9.399  1.00 46.80  ? 26  A   F N9    1 
ATOM   570  C C8    . A   B 2 9   ? 35.010  15.710  -9.799  1.00 46.77  ? 26  A   F C8    1 
ATOM   571  N N7    . A   B 2 9   ? 35.578  15.067  -8.809  1.00 47.46  ? 26  A   F N7    1 
ATOM   572  C C5    . A   B 2 9   ? 35.111  15.716  -7.679  1.00 45.47  ? 26  A   F C5    1 
ATOM   573  C C6    . A   B 2 9   ? 35.350  15.510  -6.313  1.00 44.48  ? 26  A   F C6    1 
ATOM   574  N N6    . A   B 2 9   ? 36.153  14.555  -5.844  1.00 42.37  ? 26  A   F N6    1 
ATOM   575  N N1    . A   B 2 9   ? 34.727  16.326  -5.437  1.00 40.99  ? 26  A   F N1    1 
ATOM   576  C C2    . A   B 2 9   ? 33.915  17.287  -5.918  1.00 43.37  ? 26  A   F C2    1 
ATOM   577  N N3    . A   B 2 9   ? 33.611  17.580  -7.182  1.00 44.72  ? 26  A   F N3    1 
ATOM   578  C C4    . A   B 2 9   ? 34.252  16.746  -8.024  1.00 46.58  ? 26  A   F C4    1 
ATOM   579  P P     . G   B 2 10  ? 36.652  21.194  -11.128 1.00 49.47  ? 27  G   F P     1 
ATOM   580  O OP1   . G   B 2 10  ? 36.880  22.355  -12.017 1.00 49.40  ? 27  G   F OP1   1 
ATOM   581  O OP2   . G   B 2 10  ? 37.688  20.132  -11.028 1.00 47.02  ? 27  G   F OP2   1 
ATOM   582  O "O5'" . G   B 2 10  ? 36.356  21.756  -9.667  1.00 48.15  ? 27  G   F "O5'" 1 
ATOM   583  C "C5'" . G   B 2 10  ? 35.129  22.423  -9.383  1.00 47.36  ? 27  G   F "C5'" 1 
ATOM   584  C "C4'" . G   B 2 10  ? 34.967  22.630  -7.900  1.00 44.72  ? 27  G   F "C4'" 1 
ATOM   585  O "O4'" . G   B 2 10  ? 34.582  21.386  -7.256  1.00 46.22  ? 27  G   F "O4'" 1 
ATOM   586  C "C3'" . G   B 2 10  ? 36.213  23.040  -7.145  1.00 44.64  ? 27  G   F "C3'" 1 
ATOM   587  O "O3'" . G   B 2 10  ? 36.469  24.416  -7.304  1.00 45.57  ? 27  G   F "O3'" 1 
ATOM   588  C "C2'" . G   B 2 10  ? 35.832  22.681  -5.718  1.00 43.52  ? 27  G   F "C2'" 1 
ATOM   589  O "O2'" . G   B 2 10  ? 34.931  23.617  -5.140  1.00 43.25  ? 27  G   F "O2'" 1 
ATOM   590  C "C1'" . G   B 2 10  ? 35.147  21.334  -5.949  1.00 41.65  ? 27  G   F "C1'" 1 
ATOM   591  N N9    . G   B 2 10  ? 36.026  20.169  -5.884  1.00 39.13  ? 27  G   F N9    1 
ATOM   592  C C8    . G   B 2 10  ? 36.572  19.479  -6.944  1.00 35.94  ? 27  G   F C8    1 
ATOM   593  N N7    . G   B 2 10  ? 37.242  18.422  -6.580  1.00 33.25  ? 27  G   F N7    1 
ATOM   594  C C5    . G   B 2 10  ? 37.158  18.425  -5.193  1.00 34.38  ? 27  G   F C5    1 
ATOM   595  C C6    . G   B 2 10  ? 37.687  17.523  -4.246  1.00 34.93  ? 27  G   F C6    1 
ATOM   596  O O6    . G   B 2 10  ? 38.342  16.496  -4.447  1.00 32.95  ? 27  G   F O6    1 
ATOM   597  N N1    . G   B 2 10  ? 37.377  17.906  -2.945  1.00 34.51  ? 27  G   F N1    1 
ATOM   598  C C2    . G   B 2 10  ? 36.645  19.016  -2.600  1.00 36.31  ? 27  G   F C2    1 
ATOM   599  N N2    . G   B 2 10  ? 36.455  19.220  -1.284  1.00 33.22  ? 27  G   F N2    1 
ATOM   600  N N3    . G   B 2 10  ? 36.137  19.863  -3.479  1.00 35.25  ? 27  G   F N3    1 
ATOM   601  C C4    . G   B 2 10  ? 36.429  19.508  -4.747  1.00 36.29  ? 27  G   F C4    1 
ATOM   602  P P     . C   B 2 11  ? 37.945  24.970  -7.056  1.00 49.34  ? 28  C   F P     1 
ATOM   603  O OP1   . C   B 2 11  ? 37.902  26.434  -7.282  1.00 51.49  ? 28  C   F OP1   1 
ATOM   604  O OP2   . C   B 2 11  ? 38.881  24.135  -7.847  1.00 49.74  ? 28  C   F OP2   1 
ATOM   605  O "O5'" . C   B 2 11  ? 38.185  24.693  -5.501  1.00 49.44  ? 28  C   F "O5'" 1 
ATOM   606  C "C5'" . C   B 2 11  ? 37.502  25.458  -4.507  1.00 46.18  ? 28  C   F "C5'" 1 
ATOM   607  C "C4'" . C   B 2 11  ? 37.951  25.058  -3.118  1.00 44.79  ? 28  C   F "C4'" 1 
ATOM   608  O "O4'" . C   B 2 11  ? 37.521  23.699  -2.831  1.00 43.14  ? 28  C   F "O4'" 1 
ATOM   609  C "C3'" . C   B 2 11  ? 39.447  25.014  -2.862  1.00 42.60  ? 28  C   F "C3'" 1 
ATOM   610  O "O3'" . C   B 2 11  ? 40.021  26.289  -2.643  1.00 44.98  ? 28  C   F "O3'" 1 
ATOM   611  C "C2'" . C   B 2 11  ? 39.520  24.098  -1.655  1.00 41.14  ? 28  C   F "C2'" 1 
ATOM   612  O "O2'" . C   B 2 11  ? 39.110  24.703  -0.441  1.00 42.16  ? 28  C   F "O2'" 1 
ATOM   613  C "C1'" . C   B 2 11  ? 38.515  23.031  -2.074  1.00 37.11  ? 28  C   F "C1'" 1 
ATOM   614  N N1    . C   B 2 11  ? 39.115  21.981  -2.916  1.00 35.88  ? 28  C   F N1    1 
ATOM   615  C C2    . C   B 2 11  ? 39.784  20.934  -2.292  1.00 33.25  ? 28  C   F C2    1 
ATOM   616  O O2    . C   B 2 11  ? 39.863  20.933  -1.059  1.00 33.53  ? 28  C   F O2    1 
ATOM   617  N N3    . C   B 2 11  ? 40.330  19.952  -3.047  1.00 32.27  ? 28  C   F N3    1 
ATOM   618  C C4    . C   B 2 11  ? 40.222  19.996  -4.381  1.00 32.36  ? 28  C   F C4    1 
ATOM   619  N N4    . C   B 2 11  ? 40.768  19.011  -5.087  1.00 28.61  ? 28  C   F N4    1 
ATOM   620  C C5    . C   B 2 11  ? 39.547  21.057  -5.046  1.00 30.76  ? 28  C   F C5    1 
ATOM   621  C C6    . C   B 2 11  ? 39.017  22.022  -4.283  1.00 34.46  ? 28  C   F C6    1 
ATOM   622  P P     . G   B 2 12  ? 41.535  26.553  -3.097  1.00 45.84  ? 29  G   F P     1 
ATOM   623  O OP1   . G   B 2 12  ? 41.800  28.002  -2.960  1.00 48.83  ? 29  G   F OP1   1 
ATOM   624  O OP2   . G   B 2 12  ? 41.761  25.887  -4.407  1.00 50.87  ? 29  G   F OP2   1 
ATOM   625  O "O5'" . G   B 2 12  ? 42.412  25.753  -2.031  1.00 46.88  ? 29  G   F "O5'" 1 
ATOM   626  C "C5'" . G   B 2 12  ? 42.349  26.072  -0.644  1.00 42.43  ? 29  G   F "C5'" 1 
ATOM   627  C "C4'" . G   B 2 12  ? 43.063  25.022  0.168   1.00 41.19  ? 29  G   F "C4'" 1 
ATOM   628  O "O4'" . G   B 2 12  ? 42.441  23.732  -0.051  1.00 40.17  ? 29  G   F "O4'" 1 
ATOM   629  C "C3'" . G   B 2 12  ? 44.513  24.762  -0.187  1.00 43.03  ? 29  G   F "C3'" 1 
ATOM   630  O "O3'" . G   B 2 12  ? 45.398  25.746  0.322   1.00 47.81  ? 29  G   F "O3'" 1 
ATOM   631  C "C2'" . G   B 2 12  ? 44.731  23.394  0.435   1.00 42.12  ? 29  G   F "C2'" 1 
ATOM   632  O "O2'" . G   B 2 12  ? 44.853  23.401  1.847   1.00 42.38  ? 29  G   F "O2'" 1 
ATOM   633  C "C1'" . G   B 2 12  ? 43.425  22.708  0.047   1.00 39.86  ? 29  G   F "C1'" 1 
ATOM   634  N N9    . G   B 2 12  ? 43.503  21.981  -1.220  1.00 36.45  ? 29  G   F N9    1 
ATOM   635  C C8    . G   B 2 12  ? 43.052  22.384  -2.456  1.00 34.99  ? 29  G   F C8    1 
ATOM   636  N N7    . G   B 2 12  ? 43.253  21.491  -3.389  1.00 38.21  ? 29  G   F N7    1 
ATOM   637  C C5    . G   B 2 12  ? 43.878  20.439  -2.730  1.00 36.12  ? 29  G   F C5    1 
ATOM   638  C C6    . G   B 2 12  ? 44.350  19.184  -3.219  1.00 35.30  ? 29  G   F C6    1 
ATOM   639  O O6    . G   B 2 12  ? 44.313  18.738  -4.367  1.00 35.90  ? 29  G   F O6    1 
ATOM   640  N N1    . G   B 2 12  ? 44.921  18.425  -2.209  1.00 34.19  ? 29  G   F N1    1 
ATOM   641  C C2    . G   B 2 12  ? 45.038  18.821  -0.902  1.00 36.30  ? 29  G   F C2    1 
ATOM   642  N N2    . G   B 2 12  ? 45.623  17.952  -0.065  1.00 35.52  ? 29  G   F N2    1 
ATOM   643  N N3    . G   B 2 12  ? 44.613  19.982  -0.440  1.00 35.52  ? 29  G   F N3    1 
ATOM   644  C C4    . G   B 2 12  ? 44.046  20.732  -1.396  1.00 35.25  ? 29  G   F C4    1 
ATOM   645  P P     . C   B 2 13  ? 46.720  26.123  -0.512  1.00 51.65  ? 30  C   F P     1 
ATOM   646  O OP1   . C   B 2 13  ? 47.401  27.232  0.210   1.00 53.31  ? 30  C   F OP1   1 
ATOM   647  O OP2   . C   B 2 13  ? 46.320  26.308  -1.933  1.00 50.37  ? 30  C   F OP2   1 
ATOM   648  O "O5'" . C   B 2 13  ? 47.642  24.823  -0.424  1.00 46.67  ? 30  C   F "O5'" 1 
ATOM   649  C "C5'" . C   B 2 13  ? 48.286  24.473  0.794   1.00 48.53  ? 30  C   F "C5'" 1 
ATOM   650  C "C4'" . C   B 2 13  ? 48.876  23.085  0.707   1.00 48.60  ? 30  C   F "C4'" 1 
ATOM   651  O "O4'" . C   B 2 13  ? 47.874  22.118  0.292   1.00 47.68  ? 30  C   F "O4'" 1 
ATOM   652  C "C3'" . C   B 2 13  ? 50.012  22.864  -0.279  1.00 48.91  ? 30  C   F "C3'" 1 
ATOM   653  O "O3'" . C   B 2 13  ? 51.295  23.267  0.203   1.00 52.67  ? 30  C   F "O3'" 1 
ATOM   654  C "C2'" . C   B 2 13  ? 50.021  21.345  -0.379  1.00 48.43  ? 30  C   F "C2'" 1 
ATOM   655  O "O2'" . C   B 2 13  ? 50.692  20.719  0.696   1.00 45.47  ? 30  C   F "O2'" 1 
ATOM   656  C "C1'" . C   B 2 13  ? 48.521  21.033  -0.364  1.00 46.53  ? 30  C   F "C1'" 1 
ATOM   657  N N1    . C   B 2 13  ? 47.996  20.915  -1.739  1.00 44.67  ? 30  C   F N1    1 
ATOM   658  C C2    . C   B 2 13  ? 48.138  19.695  -2.403  1.00 41.50  ? 30  C   F C2    1 
ATOM   659  O O2    . C   B 2 13  ? 48.669  18.750  -1.808  1.00 42.12  ? 30  C   F O2    1 
ATOM   660  N N3    . C   B 2 13  ? 47.702  19.579  -3.675  1.00 41.13  ? 30  C   F N3    1 
ATOM   661  C C4    . C   B 2 13  ? 47.140  20.625  -4.285  1.00 42.30  ? 30  C   F C4    1 
ATOM   662  N N4    . C   B 2 13  ? 46.729  20.469  -5.545  1.00 43.01  ? 30  C   F N4    1 
ATOM   663  C C5    . C   B 2 13  ? 46.970  21.880  -3.627  1.00 40.31  ? 30  C   F C5    1 
ATOM   664  C C6    . C   B 2 13  ? 47.403  21.979  -2.367  1.00 41.58  ? 30  C   F C6    1 
ATOM   665  O "O5'" . G   C 3 1   ? 51.001  23.589  -5.939  1.00 53.18  ? 0   G   D "O5'" 1 
ATOM   666  C "C5'" . G   C 3 1   ? 51.096  23.608  -4.506  1.00 48.79  ? 0   G   D "C5'" 1 
ATOM   667  C "C4'" . G   C 3 1   ? 51.529  22.275  -3.935  1.00 48.38  ? 0   G   D "C4'" 1 
ATOM   668  O "O4'" . G   C 3 1   ? 50.462  21.304  -4.116  1.00 46.46  ? 0   G   D "O4'" 1 
ATOM   669  C "C3'" . G   C 3 1   ? 52.740  21.622  -4.584  1.00 47.62  ? 0   G   D "C3'" 1 
ATOM   670  O "O3'" . G   C 3 1   ? 53.960  22.143  -4.059  1.00 48.58  ? 0   G   D "O3'" 1 
ATOM   671  C "C2'" . G   C 3 1   ? 52.532  20.158  -4.214  1.00 47.45  ? 0   G   D "C2'" 1 
ATOM   672  O "O2'" . G   C 3 1   ? 52.931  19.818  -2.898  1.00 46.81  ? 0   G   D "O2'" 1 
ATOM   673  C "C1'" . G   C 3 1   ? 51.016  20.029  -4.372  1.00 42.83  ? 0   G   D "C1'" 1 
ATOM   674  N N9    . G   C 3 1   ? 50.616  19.607  -5.712  1.00 41.22  ? 0   G   D N9    1 
ATOM   675  C C8    . G   C 3 1   ? 49.851  20.301  -6.623  1.00 39.53  ? 0   G   D C8    1 
ATOM   676  N N7    . G   C 3 1   ? 49.675  19.651  -7.742  1.00 37.65  ? 0   G   D N7    1 
ATOM   677  C C5    . G   C 3 1   ? 50.363  18.457  -7.558  1.00 37.63  ? 0   G   D C5    1 
ATOM   678  C C6    . G   C 3 1   ? 50.537  17.346  -8.430  1.00 38.43  ? 0   G   D C6    1 
ATOM   679  O O6    . G   C 3 1   ? 50.104  17.186  -9.584  1.00 39.98  ? 0   G   D O6    1 
ATOM   680  N N1    . G   C 3 1   ? 51.310  16.354  -7.839  1.00 38.65  ? 0   G   D N1    1 
ATOM   681  C C2    . G   C 3 1   ? 51.848  16.419  -6.575  1.00 35.13  ? 0   G   D C2    1 
ATOM   682  N N2    . G   C 3 1   ? 52.569  15.366  -6.182  1.00 35.04  ? 0   G   D N2    1 
ATOM   683  N N3    . G   C 3 1   ? 51.690  17.440  -5.761  1.00 35.25  ? 0   G   D N3    1 
ATOM   684  C C4    . G   C 3 1   ? 50.946  18.416  -6.312  1.00 36.72  ? 0   G   D C4    1 
ATOM   685  P P     . C   C 3 2   ? 55.172  22.506  -5.055  1.00 50.15  ? 1   C   D P     1 
ATOM   686  O OP1   . C   C 3 2   ? 56.042  23.453  -4.324  1.00 54.30  ? 1   C   D OP1   1 
ATOM   687  O OP2   . C   C 3 2   ? 54.643  22.894  -6.387  1.00 50.34  ? 1   C   D OP2   1 
ATOM   688  O "O5'" . C   C 3 2   ? 55.961  21.134  -5.236  1.00 45.99  ? 1   C   D "O5'" 1 
ATOM   689  C "C5'" . C   C 3 2   ? 56.395  20.368  -4.116  1.00 45.11  ? 1   C   D "C5'" 1 
ATOM   690  C "C4'" . C   C 3 2   ? 56.773  18.963  -4.554  1.00 45.89  ? 1   C   D "C4'" 1 
ATOM   691  O "O4'" . C   C 3 2   ? 55.583  18.200  -4.900  1.00 43.63  ? 1   C   D "O4'" 1 
ATOM   692  C "C3'" . C   C 3 2   ? 57.644  18.831  -5.793  1.00 46.81  ? 1   C   D "C3'" 1 
ATOM   693  O "O3'" . C   C 3 2   ? 59.016  19.111  -5.538  1.00 49.53  ? 1   C   D "O3'" 1 
ATOM   694  C "C2'" . C   C 3 2   ? 57.392  17.383  -6.199  1.00 46.39  ? 1   C   D "C2'" 1 
ATOM   695  O "O2'" . C   C 3 2   ? 58.111  16.411  -5.464  1.00 47.05  ? 1   C   D "O2'" 1 
ATOM   696  C "C1'" . C   C 3 2   ? 55.892  17.265  -5.933  1.00 45.48  ? 1   C   D "C1'" 1 
ATOM   697  N N1    . C   C 3 2   ? 55.090  17.590  -7.134  1.00 46.41  ? 1   C   D N1    1 
ATOM   698  C C2    . C   C 3 2   ? 54.948  16.617  -8.150  1.00 46.12  ? 1   C   D C2    1 
ATOM   699  O O2    . C   C 3 2   ? 55.490  15.509  -8.014  1.00 43.67  ? 1   C   D O2    1 
ATOM   700  N N3    . C   C 3 2   ? 54.225  16.920  -9.256  1.00 45.67  ? 1   C   D N3    1 
ATOM   701  C C4    . C   C 3 2   ? 53.662  18.126  -9.378  1.00 47.41  ? 1   C   D C4    1 
ATOM   702  N N4    . C   C 3 2   ? 52.973  18.383  -10.490 1.00 50.00  ? 1   C   D N4    1 
ATOM   703  C C5    . C   C 3 2   ? 53.785  19.125  -8.366  1.00 47.01  ? 1   C   D C5    1 
ATOM   704  C C6    . C   C 3 2   ? 54.499  18.819  -7.273  1.00 46.69  ? 1   C   D C6    1 
ATOM   705  P P     . G   C 3 3   ? 59.916  19.806  -6.684  1.00 53.34  ? 2   G   D P     1 
ATOM   706  O OP1   . G   C 3 3   ? 61.152  20.290  -6.016  1.00 53.92  ? 2   G   D OP1   1 
ATOM   707  O OP2   . G   C 3 3   ? 59.090  20.763  -7.474  1.00 51.34  ? 2   G   D OP2   1 
ATOM   708  O "O5'" . G   C 3 3   ? 60.315  18.601  -7.640  1.00 49.07  ? 2   G   D "O5'" 1 
ATOM   709  C "C5'" . G   C 3 3   ? 60.929  17.439  -7.115  1.00 49.26  ? 2   G   D "C5'" 1 
ATOM   710  C "C4'" . G   C 3 3   ? 60.943  16.343  -8.149  1.00 50.68  ? 2   G   D "C4'" 1 
ATOM   711  O "O4'" . G   C 3 3   ? 59.588  15.887  -8.426  1.00 50.57  ? 2   G   D "O4'" 1 
ATOM   712  C "C3'" . G   C 3 3   ? 61.471  16.675  -9.537  1.00 48.83  ? 2   G   D "C3'" 1 
ATOM   713  O "O3'" . G   C 3 3   ? 62.893  16.743  -9.584  1.00 49.23  ? 2   G   D "O3'" 1 
ATOM   714  C "C2'" . G   C 3 3   ? 60.955  15.475  -10.316 1.00 49.10  ? 2   G   D "C2'" 1 
ATOM   715  O "O2'" . G   C 3 3   ? 61.699  14.302  -10.039 1.00 45.37  ? 2   G   D "O2'" 1 
ATOM   716  C "C1'" . G   C 3 3   ? 59.538  15.356  -9.742  1.00 47.74  ? 2   G   D "C1'" 1 
ATOM   717  N N9    . G   C 3 3   ? 58.536  16.088  -10.515 1.00 45.04  ? 2   G   D N9    1 
ATOM   718  C C8    . G   C 3 3   ? 57.942  17.292  -10.206 1.00 42.53  ? 2   G   D C8    1 
ATOM   719  N N7    . G   C 3 3   ? 57.082  17.685  -11.107 1.00 43.22  ? 2   G   D N7    1 
ATOM   720  C C5    . G   C 3 3   ? 57.107  16.679  -12.068 1.00 43.94  ? 2   G   D C5    1 
ATOM   721  C C6    . G   C 3 3   ? 56.381  16.543  -13.290 1.00 43.25  ? 2   G   D C6    1 
ATOM   722  O O6    . G   C 3 3   ? 55.541  17.312  -13.779 1.00 42.61  ? 2   G   D O6    1 
ATOM   723  N N1    . G   C 3 3   ? 56.720  15.368  -13.959 1.00 39.91  ? 2   G   D N1    1 
ATOM   724  C C2    . G   C 3 3   ? 57.633  14.443  -13.515 1.00 43.36  ? 2   G   D C2    1 
ATOM   725  N N2    . G   C 3 3   ? 57.832  13.367  -14.298 1.00 42.38  ? 2   G   D N2    1 
ATOM   726  N N3    . G   C 3 3   ? 58.309  14.557  -12.383 1.00 43.40  ? 2   G   D N3    1 
ATOM   727  C C4    . G   C 3 3   ? 58.000  15.690  -11.717 1.00 44.43  ? 2   G   D C4    1 
ATOM   728  P P     . C   C 3 4   ? 63.611  17.814  -10.550 1.00 50.35  ? 3   C   D P     1 
ATOM   729  O OP1   . C   C 3 4   ? 65.051  17.816  -10.196 1.00 50.47  ? 3   C   D OP1   1 
ATOM   730  O OP2   . C   C 3 4   ? 62.852  19.086  -10.514 1.00 47.50  ? 3   C   D OP2   1 
ATOM   731  O "O5'" . C   C 3 4   ? 63.458  17.182  -12.004 1.00 47.50  ? 3   C   D "O5'" 1 
ATOM   732  C "C5'" . C   C 3 4   ? 64.227  16.047  -12.383 1.00 44.50  ? 3   C   D "C5'" 1 
ATOM   733  C "C4'" . C   C 3 4   ? 63.683  15.436  -13.653 1.00 44.30  ? 3   C   D "C4'" 1 
ATOM   734  O "O4'" . C   C 3 4   ? 62.264  15.145  -13.513 1.00 42.40  ? 3   C   D "O4'" 1 
ATOM   735  C "C3'" . C   C 3 4   ? 63.765  16.275  -14.920 1.00 41.64  ? 3   C   D "C3'" 1 
ATOM   736  O "O3'" . C   C 3 4   ? 65.073  16.256  -15.486 1.00 41.54  ? 3   C   D "O3'" 1 
ATOM   737  C "C2'" . C   C 3 4   ? 62.731  15.583  -15.801 1.00 39.21  ? 3   C   D "C2'" 1 
ATOM   738  O "O2'" . C   C 3 4   ? 63.189  14.368  -16.372 1.00 37.74  ? 3   C   D "O2'" 1 
ATOM   739  C "C1'" . C   C 3 4   ? 61.627  15.300  -14.776 1.00 40.35  ? 3   C   D "C1'" 1 
ATOM   740  N N1    . C   C 3 4   ? 60.637  16.390  -14.676 1.00 38.32  ? 3   C   D N1    1 
ATOM   741  C C2    . C   C 3 4   ? 59.673  16.530  -15.692 1.00 35.85  ? 3   C   D C2    1 
ATOM   742  O O2    . C   C 3 4   ? 59.661  15.711  -16.636 1.00 35.79  ? 3   C   D O2    1 
ATOM   743  N N3    . C   C 3 4   ? 58.785  17.543  -15.616 1.00 33.42  ? 3   C   D N3    1 
ATOM   744  C C4    . C   C 3 4   ? 58.826  18.391  -14.583 1.00 35.14  ? 3   C   D C4    1 
ATOM   745  N N4    . C   C 3 4   ? 57.933  19.389  -14.547 1.00 30.42  ? 3   C   D N4    1 
ATOM   746  C C5    . C   C 3 4   ? 59.782  18.260  -13.537 1.00 33.92  ? 3   C   D C5    1 
ATOM   747  C C6    . C   C 3 4   ? 60.656  17.262  -13.622 1.00 36.03  ? 3   C   D C6    1 
ATOM   748  P P     . U   C 3 5   ? 65.658  17.586  -16.189 1.00 45.10  ? 4   U   D P     1 
ATOM   749  O OP1   . U   C 3 5   ? 67.125  17.418  -16.263 1.00 44.77  ? 4   U   D OP1   1 
ATOM   750  O OP2   . U   C 3 5   ? 65.091  18.784  -15.500 1.00 42.72  ? 4   U   D OP2   1 
ATOM   751  O "O5'" . U   C 3 5   ? 65.073  17.556  -17.672 1.00 42.67  ? 4   U   D "O5'" 1 
ATOM   752  C "C5'" . U   C 3 5   ? 65.279  16.435  -18.525 1.00 43.90  ? 4   U   D "C5'" 1 
ATOM   753  C "C4'" . U   C 3 5   ? 64.333  16.491  -19.704 1.00 45.70  ? 4   U   D "C4'" 1 
ATOM   754  O "O4'" . U   C 3 5   ? 62.967  16.322  -19.246 1.00 46.50  ? 4   U   D "O4'" 1 
ATOM   755  C "C3'" . U   C 3 5   ? 64.279  17.797  -20.478 1.00 46.42  ? 4   U   D "C3'" 1 
ATOM   756  O "O3'" . U   C 3 5   ? 65.380  17.912  -21.369 1.00 47.10  ? 4   U   D "O3'" 1 
ATOM   757  C "C2'" . U   C 3 5   ? 62.943  17.663  -21.202 1.00 46.81  ? 4   U   D "C2'" 1 
ATOM   758  O "O2'" . U   C 3 5   ? 62.956  16.799  -22.318 1.00 46.36  ? 4   U   D "O2'" 1 
ATOM   759  C "C1'" . U   C 3 5   ? 62.085  17.037  -20.102 1.00 46.69  ? 4   U   D "C1'" 1 
ATOM   760  N N1    . U   C 3 5   ? 61.365  18.046  -19.314 1.00 44.18  ? 4   U   D N1    1 
ATOM   761  C C2    . U   C 3 5   ? 60.309  18.694  -19.924 1.00 44.20  ? 4   U   D C2    1 
ATOM   762  O O2    . U   C 3 5   ? 59.956  18.450  -21.065 1.00 44.53  ? 4   U   D O2    1 
ATOM   763  N N3    . U   C 3 5   ? 59.686  19.640  -19.150 1.00 45.04  ? 4   U   D N3    1 
ATOM   764  C C4    . U   C 3 5   ? 60.006  19.994  -17.850 1.00 44.89  ? 4   U   D C4    1 
ATOM   765  O O4    . U   C 3 5   ? 59.340  20.850  -17.275 1.00 45.57  ? 4   U   D O4    1 
ATOM   766  C C5    . U   C 3 5   ? 61.107  19.278  -17.291 1.00 43.50  ? 4   U   D C5    1 
ATOM   767  C C6    . U   C 3 5   ? 61.732  18.350  -18.023 1.00 44.74  ? 4   U   D C6    1 
ATOM   768  P P     . C   C 3 6   ? 66.145  19.316  -21.516 1.00 47.94  ? 5   C   D P     1 
ATOM   769  O OP1   . C   C 3 6   ? 67.458  18.986  -22.127 1.00 46.97  ? 5   C   D OP1   1 
ATOM   770  O OP2   . C   C 3 6   ? 66.097  20.073  -20.243 1.00 48.10  ? 5   C   D OP2   1 
ATOM   771  O "O5'" . C   C 3 6   ? 65.275  20.121  -22.575 1.00 47.16  ? 5   C   D "O5'" 1 
ATOM   772  C "C5'" . C   C 3 6   ? 65.000  19.566  -23.853 1.00 47.48  ? 5   C   D "C5'" 1 
ATOM   773  C "C4'" . C   C 3 6   ? 63.861  20.300  -24.504 1.00 45.94  ? 5   C   D "C4'" 1 
ATOM   774  O "O4'" . C   C 3 6   ? 62.619  20.019  -23.807 1.00 45.03  ? 5   C   D "O4'" 1 
ATOM   775  C "C3'" . C   C 3 6   ? 63.927  21.814  -24.470 1.00 45.73  ? 5   C   D "C3'" 1 
ATOM   776  O "O3'" . C   C 3 6   ? 64.851  22.316  -25.425 1.00 47.23  ? 5   C   D "O3'" 1 
ATOM   777  C "C2'" . C   C 3 6   ? 62.484  22.167  -24.795 1.00 45.92  ? 5   C   D "C2'" 1 
ATOM   778  O "O2'" . C   C 3 6   ? 62.171  22.025  -26.174 1.00 41.54  ? 5   C   D "O2'" 1 
ATOM   779  C "C1'" . C   C 3 6   ? 61.743  21.131  -23.937 1.00 44.17  ? 5   C   D "C1'" 1 
ATOM   780  N N1    . C   C 3 6   ? 61.409  21.639  -22.585 1.00 44.38  ? 5   C   D N1    1 
ATOM   781  C C2    . C   C 3 6   ? 60.253  22.412  -22.425 1.00 42.68  ? 5   C   D C2    1 
ATOM   782  O O2    . C   C 3 6   ? 59.521  22.609  -23.404 1.00 43.91  ? 5   C   D O2    1 
ATOM   783  N N3    . C   C 3 6   ? 59.964  22.924  -21.213 1.00 42.04  ? 5   C   D N3    1 
ATOM   784  C C4    . C   C 3 6   ? 60.773  22.685  -20.178 1.00 42.23  ? 5   C   D C4    1 
ATOM   785  N N4    . C   C 3 6   ? 60.461  23.235  -19.005 1.00 41.20  ? 5   C   D N4    1 
ATOM   786  C C5    . C   C 3 6   ? 61.940  21.882  -20.302 1.00 40.01  ? 5   C   D C5    1 
ATOM   787  C C6    . C   C 3 6   ? 62.218  21.385  -21.510 1.00 41.66  ? 5   C   D C6    1 
ATOM   788  P P     . C   C 3 7   ? 65.565  23.731  -25.168 1.00 48.01  ? 6   C   D P     1 
ATOM   789  O OP1   . C   C 3 7   ? 66.605  23.873  -26.217 1.00 48.35  ? 6   C   D OP1   1 
ATOM   790  O OP2   . C   C 3 7   ? 65.959  23.813  -23.740 1.00 44.88  ? 6   C   D OP2   1 
ATOM   791  O "O5'" . C   C 3 7   ? 64.397  24.790  -25.442 1.00 48.02  ? 6   C   D "O5'" 1 
ATOM   792  C "C5'" . C   C 3 7   ? 63.650  24.755  -26.662 1.00 48.80  ? 6   C   D "C5'" 1 
ATOM   793  C "C4'" . C   C 3 7   ? 62.523  25.774  -26.645 1.00 48.53  ? 6   C   D "C4'" 1 
ATOM   794  O "O4'" . C   C 3 7   ? 61.453  25.351  -25.760 1.00 47.55  ? 6   C   D "O4'" 1 
ATOM   795  C "C3'" . C   C 3 7   ? 62.849  27.192  -26.198 1.00 48.30  ? 6   C   D "C3'" 1 
ATOM   796  O "O3'" . C   C 3 7   ? 63.410  27.939  -27.263 1.00 49.24  ? 6   C   D "O3'" 1 
ATOM   797  C "C2'" . C   C 3 7   ? 61.472  27.728  -25.837 1.00 49.21  ? 6   C   D "C2'" 1 
ATOM   798  O "O2'" . C   C 3 7   ? 60.724  28.204  -26.947 1.00 47.30  ? 6   C   D "O2'" 1 
ATOM   799  C "C1'" . C   C 3 7   ? 60.835  26.494  -25.191 1.00 47.63  ? 6   C   D "C1'" 1 
ATOM   800  N N1    . C   C 3 7   ? 61.044  26.465  -23.733 1.00 47.77  ? 6   C   D N1    1 
ATOM   801  C C2    . C   C 3 7   ? 60.221  27.247  -22.933 1.00 47.47  ? 6   C   D C2    1 
ATOM   802  O O2    . C   C 3 7   ? 59.350  27.941  -23.475 1.00 45.79  ? 6   C   D O2    1 
ATOM   803  N N3    . C   C 3 7   ? 60.392  27.236  -21.591 1.00 46.49  ? 6   C   D N3    1 
ATOM   804  C C4    . C   C 3 7   ? 61.348  26.486  -21.047 1.00 48.01  ? 6   C   D C4    1 
ATOM   805  N N4    . C   C 3 7   ? 61.478  26.511  -19.717 1.00 46.18  ? 6   C   D N4    1 
ATOM   806  C C5    . C   C 3 7   ? 62.212  25.679  -21.840 1.00 46.42  ? 6   C   D C5    1 
ATOM   807  C C6    . C   C 3 7   ? 62.025  25.695  -23.167 1.00 47.89  ? 6   C   D C6    1 
ATOM   808  P P     . U   C 3 8   ? 64.650  28.924  -26.982 1.00 52.85  ? 7   U   D P     1 
ATOM   809  O OP1   . U   C 3 8   ? 65.090  29.393  -28.328 1.00 50.65  ? 7   U   D OP1   1 
ATOM   810  O OP2   . U   C 3 8   ? 65.633  28.247  -26.088 1.00 49.82  ? 7   U   D OP2   1 
ATOM   811  O "O5'" . U   C 3 8   ? 63.991  30.138  -26.182 1.00 49.70  ? 7   U   D "O5'" 1 
ATOM   812  C "C5'" . U   C 3 8   ? 62.826  30.797  -26.681 1.00 49.66  ? 7   U   D "C5'" 1 
ATOM   813  C "C4'" . U   C 3 8   ? 62.173  31.639  -25.601 1.00 49.64  ? 7   U   D "C4'" 1 
ATOM   814  O "O4'" . U   C 3 8   ? 61.439  30.806  -24.660 1.00 49.20  ? 7   U   D "O4'" 1 
ATOM   815  C "C3'" . U   C 3 8   ? 63.074  32.503  -24.732 1.00 50.06  ? 7   U   D "C3'" 1 
ATOM   816  O "O3'" . U   C 3 8   ? 63.396  33.724  -25.389 1.00 51.00  ? 7   U   D "O3'" 1 
ATOM   817  C "C2'" . U   C 3 8   ? 62.191  32.747  -23.513 1.00 49.38  ? 7   U   D "C2'" 1 
ATOM   818  O "O2'" . U   C 3 8   ? 61.263  33.804  -23.667 1.00 47.03  ? 7   U   D "O2'" 1 
ATOM   819  C "C1'" . U   C 3 8   ? 61.480  31.395  -23.370 1.00 47.93  ? 7   U   D "C1'" 1 
ATOM   820  N N1    . U   C 3 8   ? 62.191  30.482  -22.462 1.00 48.95  ? 7   U   D N1    1 
ATOM   821  C C2    . U   C 3 8   ? 61.985  30.626  -21.099 1.00 49.43  ? 7   U   D C2    1 
ATOM   822  O O2    . U   C 3 8   ? 61.242  31.471  -20.624 1.00 51.03  ? 7   U   D O2    1 
ATOM   823  N N3    . U   C 3 8   ? 62.687  29.742  -20.313 1.00 48.70  ? 7   U   D N3    1 
ATOM   824  C C4    . U   C 3 8   ? 63.556  28.751  -20.743 1.00 50.16  ? 7   U   D C4    1 
ATOM   825  O O4    . U   C 3 8   ? 64.107  28.021  -19.917 1.00 49.81  ? 7   U   D O4    1 
ATOM   826  C C5    . U   C 3 8   ? 63.715  28.673  -22.159 1.00 48.14  ? 7   U   D C5    1 
ATOM   827  C C6    . U   C 3 8   ? 63.046  29.514  -22.949 1.00 49.28  ? 7   U   D C6    1 
ATOM   828  P P     . C   C 3 9   ? 64.820  34.434  -25.120 1.00 53.99  ? 8   C   D P     1 
ATOM   829  O OP1   . C   C 3 9   ? 64.908  35.579  -26.070 1.00 55.94  ? 8   C   D OP1   1 
ATOM   830  O OP2   . C   C 3 9   ? 65.903  33.412  -25.105 1.00 51.89  ? 8   C   D OP2   1 
ATOM   831  O "O5'" . C   C 3 9   ? 64.711  35.013  -23.642 1.00 49.25  ? 8   C   D "O5'" 1 
ATOM   832  C "C5'" . C   C 3 9   ? 63.649  35.881  -23.269 1.00 48.57  ? 8   C   D "C5'" 1 
ATOM   833  C "C4'" . C   C 3 9   ? 63.505  35.901  -21.768 1.00 49.70  ? 8   C   D "C4'" 1 
ATOM   834  O "O4'" . C   C 3 9   ? 63.155  34.569  -21.297 1.00 49.27  ? 8   C   D "O4'" 1 
ATOM   835  C "C3'" . C   C 3 9   ? 64.772  36.254  -21.004 1.00 50.08  ? 8   C   D "C3'" 1 
ATOM   836  O "O3'" . C   C 3 9   ? 64.945  37.667  -20.924 1.00 52.53  ? 8   C   D "O3'" 1 
ATOM   837  C "C2'" . C   C 3 9   ? 64.518  35.609  -19.646 1.00 49.43  ? 8   C   D "C2'" 1 
ATOM   838  O "O2'" . C   C 3 9   ? 63.721  36.389  -18.787 1.00 52.40  ? 8   C   D "O2'" 1 
ATOM   839  C "C1'" . C   C 3 9   ? 63.761  34.337  -20.038 1.00 47.15  ? 8   C   D "C1'" 1 
ATOM   840  N N1    . C   C 3 9   ? 64.627  33.143  -20.121 1.00 44.65  ? 8   C   D N1    1 
ATOM   841  C C2    . C   C 3 9   ? 64.772  32.334  -18.975 1.00 44.48  ? 8   C   D C2    1 
ATOM   842  O O2    . C   C 3 9   ? 64.160  32.633  -17.940 1.00 45.95  ? 8   C   D O2    1 
ATOM   843  N N3    . C   C 3 9   ? 65.581  31.251  -19.025 1.00 41.89  ? 8   C   D N3    1 
ATOM   844  C C4    . C   C 3 9   ? 66.236  30.960  -20.145 1.00 40.48  ? 8   C   D C4    1 
ATOM   845  N N4    . C   C 3 9   ? 67.036  29.899  -20.127 1.00 37.63  ? 8   C   D N4    1 
ATOM   846  C C5    . C   C 3 9   ? 66.102  31.752  -21.330 1.00 41.25  ? 8   C   D C5    1 
ATOM   847  C C6    . C   C 3 9   ? 65.292  32.823  -21.273 1.00 42.87  ? 8   C   D C6    1 
ATOM   848  P P     . A   C 3 10  ? 66.420  38.288  -20.734 1.00 54.73  ? 9   A   D P     1 
ATOM   849  O OP1   . A   C 3 10  ? 66.806  38.108  -19.310 1.00 55.83  ? 9   A   D OP1   1 
ATOM   850  O OP2   . A   C 3 10  ? 66.435  39.643  -21.331 1.00 56.97  ? 9   A   D OP2   1 
ATOM   851  O "O5'" . A   C 3 10  ? 67.360  37.361  -21.617 1.00 56.13  ? 9   A   D "O5'" 1 
ATOM   852  C "C5'" . A   C 3 10  ? 68.037  37.883  -22.744 1.00 54.44  ? 9   A   D "C5'" 1 
ATOM   853  C "C4'" . A   C 3 10  ? 69.149  36.952  -23.171 1.00 55.05  ? 9   A   D "C4'" 1 
ATOM   854  O "O4'" . A   C 3 10  ? 69.656  36.218  -22.013 1.00 54.57  ? 9   A   D "O4'" 1 
ATOM   855  C "C3'" . A   C 3 10  ? 68.666  35.871  -24.138 1.00 54.61  ? 9   A   D "C3'" 1 
ATOM   856  O "O3'" . A   C 3 10  ? 69.768  35.421  -24.919 1.00 55.45  ? 9   A   D "O3'" 1 
ATOM   857  C "C2'" . A   C 3 10  ? 68.214  34.765  -23.194 1.00 52.11  ? 9   A   D "C2'" 1 
ATOM   858  O "O2'" . A   C 3 10  ? 68.209  33.489  -23.786 1.00 53.57  ? 9   A   D "O2'" 1 
ATOM   859  C "C1'" . A   C 3 10  ? 69.300  34.853  -22.128 1.00 52.91  ? 9   A   D "C1'" 1 
ATOM   860  N N9    . A   C 3 10  ? 68.989  34.291  -20.816 1.00 51.91  ? 9   A   D N9    1 
ATOM   861  C C8    . A   C 3 10  ? 68.250  34.837  -19.800 1.00 52.44  ? 9   A   D C8    1 
ATOM   862  N N7    . A   C 3 10  ? 68.126  34.051  -18.758 1.00 52.91  ? 9   A   D N7    1 
ATOM   863  C C5    . A   C 3 10  ? 68.837  32.912  -19.109 1.00 50.10  ? 9   A   D C5    1 
ATOM   864  C C6    . A   C 3 10  ? 69.081  31.700  -18.434 1.00 48.01  ? 9   A   D C6    1 
ATOM   865  N N6    . A   C 3 10  ? 68.604  31.424  -17.220 1.00 46.11  ? 9   A   D N6    1 
ATOM   866  N N1    . A   C 3 10  ? 69.834  30.770  -19.061 1.00 47.91  ? 9   A   D N1    1 
ATOM   867  C C2    . A   C 3 10  ? 70.304  31.046  -20.284 1.00 48.99  ? 9   A   D C2    1 
ATOM   868  N N3    . A   C 3 10  ? 70.139  32.143  -21.024 1.00 48.93  ? 9   A   D N3    1 
ATOM   869  C C4    . A   C 3 10  ? 69.384  33.049  -20.370 1.00 51.17  ? 9   A   D C4    1 
ATOM   870  P P     . G   C 3 11  ? 70.016  36.041  -26.379 1.00 56.33  ? 10  G   D P     1 
ATOM   871  O OP1   . G   C 3 11  ? 69.640  37.484  -26.343 1.00 53.35  ? 10  G   D OP1   1 
ATOM   872  O OP2   . G   C 3 11  ? 69.344  35.129  -27.342 1.00 53.61  ? 10  G   D OP2   1 
ATOM   873  O "O5'" . G   C 3 11  ? 71.597  35.961  -26.601 1.00 53.82  ? 10  G   D "O5'" 1 
ATOM   874  C "C5'" . G   C 3 11  ? 72.398  34.962  -25.986 1.00 52.86  ? 10  G   D "C5'" 1 
ATOM   875  C "C4'" . G   C 3 11  ? 72.821  35.403  -24.603 1.00 54.90  ? 10  G   D "C4'" 1 
ATOM   876  O "O4'" . G   C 3 11  ? 73.224  34.238  -23.842 1.00 56.65  ? 10  G   D "O4'" 1 
ATOM   877  C "C3'" . G   C 3 11  ? 74.015  36.350  -24.518 1.00 55.48  ? 10  G   D "C3'" 1 
ATOM   878  O "O3'" . G   C 3 11  ? 73.902  36.979  -23.232 1.00 56.41  ? 10  G   D "O3'" 1 
ATOM   879  C "C2'" . G   C 3 11  ? 75.188  35.366  -24.536 1.00 57.41  ? 10  G   D "C2'" 1 
ATOM   880  O "O2'" . G   C 3 11  ? 76.436  35.850  -24.065 1.00 57.04  ? 10  G   D "O2'" 1 
ATOM   881  C "C1'" . G   C 3 11  ? 74.626  34.247  -23.665 1.00 56.70  ? 10  G   D "C1'" 1 
ATOM   882  N N9    . G   C 3 11  ? 75.141  32.892  -23.826 1.00 58.23  ? 10  G   D N9    1 
ATOM   883  C C8    . G   C 3 11  ? 75.842  32.368  -24.884 1.00 59.03  ? 10  G   D C8    1 
ATOM   884  N N7    . G   C 3 11  ? 76.173  31.118  -24.707 1.00 58.50  ? 10  G   D N7    1 
ATOM   885  C C5    . G   C 3 11  ? 75.656  30.797  -23.461 1.00 57.86  ? 10  G   D C5    1 
ATOM   886  C C6    . G   C 3 11  ? 75.697  29.583  -22.733 1.00 57.40  ? 10  G   D C6    1 
ATOM   887  O O6    . G   C 3 11  ? 76.215  28.506  -23.056 1.00 57.24  ? 10  G   D O6    1 
ATOM   888  N N1    . G   C 3 11  ? 75.049  29.702  -21.508 1.00 58.54  ? 10  G   D N1    1 
ATOM   889  C C2    . G   C 3 11  ? 74.438  30.842  -21.042 1.00 57.17  ? 10  G   D C2    1 
ATOM   890  N N2    . G   C 3 11  ? 73.874  30.767  -19.830 1.00 58.73  ? 10  G   D N2    1 
ATOM   891  N N3    . G   C 3 11  ? 74.387  31.972  -21.714 1.00 56.86  ? 10  G   D N3    1 
ATOM   892  C C4    . G   C 3 11  ? 75.013  31.881  -22.906 1.00 57.79  ? 10  G   D C4    1 
ATOM   893  P P     . U   C 3 12  ? 75.016  38.030  -22.728 1.00 58.01  ? 11  U   D P     1 
ATOM   894  O OP1   . U   C 3 12  ? 75.468  38.807  -23.911 1.00 57.46  ? 11  U   D OP1   1 
ATOM   895  O OP2   . U   C 3 12  ? 76.018  37.325  -21.892 1.00 53.50  ? 11  U   D OP2   1 
ATOM   896  O "O5'" . U   C 3 12  ? 74.196  39.011  -21.774 1.00 59.85  ? 11  U   D "O5'" 1 
ATOM   897  C "C5'" . U   C 3 12  ? 73.160  39.846  -22.296 1.00 60.94  ? 11  U   D "C5'" 1 
ATOM   898  C "C4'" . U   C 3 12  ? 72.079  40.067  -21.260 1.00 62.04  ? 11  U   D "C4'" 1 
ATOM   899  O "O4'" . U   C 3 12  ? 71.154  38.947  -21.288 1.00 61.45  ? 11  U   D "O4'" 1 
ATOM   900  C "C3'" . U   C 3 12  ? 72.529  40.184  -19.808 1.00 62.99  ? 11  U   D "C3'" 1 
ATOM   901  O "O3'" . U   C 3 12  ? 72.858  41.533  -19.477 1.00 64.43  ? 11  U   D "O3'" 1 
ATOM   902  C "C2'" . U   C 3 12  ? 71.296  39.707  -19.047 1.00 62.51  ? 11  U   D "C2'" 1 
ATOM   903  O "O2'" . U   C 3 12  ? 70.304  40.700  -18.902 1.00 63.23  ? 11  U   D "O2'" 1 
ATOM   904  C "C1'" . U   C 3 12  ? 70.778  38.599  -19.966 1.00 61.55  ? 11  U   D "C1'" 1 
ATOM   905  N N1    . U   C 3 12  ? 71.281  37.246  -19.661 1.00 61.09  ? 11  U   D N1    1 
ATOM   906  C C2    . U   C 3 12  ? 70.868  36.649  -18.475 1.00 59.49  ? 11  U   D C2    1 
ATOM   907  O O2    . U   C 3 12  ? 70.132  37.195  -17.671 1.00 59.11  ? 11  U   D O2    1 
ATOM   908  N N3    . U   C 3 12  ? 71.354  35.387  -18.263 1.00 59.69  ? 11  U   D N3    1 
ATOM   909  C C4    . U   C 3 12  ? 72.190  34.668  -19.083 1.00 59.15  ? 11  U   D C4    1 
ATOM   910  O O4    . U   C 3 12  ? 72.529  33.532  -18.749 1.00 57.81  ? 11  U   D O4    1 
ATOM   911  C C5    . U   C 3 12  ? 72.582  35.346  -20.282 1.00 59.07  ? 11  U   D C5    1 
ATOM   912  C C6    . U   C 3 12  ? 72.129  36.578  -20.523 1.00 60.06  ? 11  U   D C6    1 
ATOM   913  P P     . A   C 3 13  ? 74.054  41.839  -18.435 1.00 64.62  ? 12  A   D P     1 
ATOM   914  O OP1   . A   C 3 13  ? 74.199  43.316  -18.378 1.00 67.02  ? 12  A   D OP1   1 
ATOM   915  O OP2   . A   C 3 13  ? 75.233  41.004  -18.787 1.00 65.54  ? 12  A   D OP2   1 
ATOM   916  O "O5'" . A   C 3 13  ? 73.476  41.360  -17.030 1.00 63.21  ? 12  A   D "O5'" 1 
ATOM   917  C "C5'" . A   C 3 13  ? 72.392  42.055  -16.415 1.00 59.10  ? 12  A   D "C5'" 1 
ATOM   918  C "C4'" . A   C 3 13  ? 72.002  41.387  -15.119 1.00 58.19  ? 12  A   D "C4'" 1 
ATOM   919  O "O4'" . A   C 3 13  ? 71.498  40.053  -15.384 1.00 55.39  ? 12  A   D "O4'" 1 
ATOM   920  C "C3'" . A   C 3 13  ? 73.111  41.177  -14.099 1.00 57.85  ? 12  A   D "C3'" 1 
ATOM   921  O "O3'" . A   C 3 13  ? 73.337  42.359  -13.336 1.00 60.22  ? 12  A   D "O3'" 1 
ATOM   922  C "C2'" . A   C 3 13  ? 72.547  40.044  -13.248 1.00 56.83  ? 12  A   D "C2'" 1 
ATOM   923  O "O2'" . A   C 3 13  ? 71.627  40.455  -12.255 1.00 54.27  ? 12  A   D "O2'" 1 
ATOM   924  C "C1'" . A   C 3 13  ? 71.841  39.193  -14.307 1.00 56.23  ? 12  A   D "C1'" 1 
ATOM   925  N N9    . A   C 3 13  ? 72.676  38.105  -14.821 1.00 54.66  ? 12  A   D N9    1 
ATOM   926  C C8    . A   C 3 13  ? 73.329  38.037  -16.030 1.00 53.86  ? 12  A   D C8    1 
ATOM   927  N N7    . A   C 3 13  ? 74.003  36.927  -16.204 1.00 53.53  ? 12  A   D N7    1 
ATOM   928  C C5    . A   C 3 13  ? 73.776  36.211  -15.037 1.00 52.56  ? 12  A   D C5    1 
ATOM   929  C C6    . A   C 3 13  ? 74.208  34.938  -14.605 1.00 51.08  ? 12  A   D C6    1 
ATOM   930  N N6    . A   C 3 13  ? 74.984  34.127  -15.338 1.00 47.20  ? 12  A   D N6    1 
ATOM   931  N N1    . A   C 3 13  ? 73.808  34.524  -13.380 1.00 50.99  ? 12  A   D N1    1 
ATOM   932  C C2    . A   C 3 13  ? 73.029  35.337  -12.652 1.00 51.71  ? 12  A   D C2    1 
ATOM   933  N N3    . A   C 3 13  ? 72.553  36.545  -12.953 1.00 51.57  ? 12  A   D N3    1 
ATOM   934  C C4    . A   C 3 13  ? 72.966  36.928  -14.173 1.00 52.96  ? 12  A   D C4    1 
ATOM   935  P P     . C   C 3 14  ? 74.826  42.959  -13.218 1.00 63.59  ? 13  C   D P     1 
ATOM   936  O OP1   . C   C 3 14  ? 74.763  44.166  -12.350 1.00 64.42  ? 13  C   D OP1   1 
ATOM   937  O OP2   . C   C 3 14  ? 75.397  43.075  -14.585 1.00 60.38  ? 13  C   D OP2   1 
ATOM   938  O "O5'" . C   C 3 14  ? 75.633  41.830  -12.427 1.00 61.79  ? 13  C   D "O5'" 1 
ATOM   939  C "C5'" . C   C 3 14  ? 75.107  41.252  -11.233 1.00 60.89  ? 13  C   D "C5'" 1 
ATOM   940  C "C4'" . C   C 3 14  ? 75.638  39.844  -11.042 1.00 61.89  ? 13  C   D "C4'" 1 
ATOM   941  O "O4'" . C   C 3 14  ? 75.082  38.940  -12.043 1.00 61.09  ? 13  C   D "O4'" 1 
ATOM   942  C "C3'" . C   C 3 14  ? 77.140  39.642  -11.184 1.00 61.66  ? 13  C   D "C3'" 1 
ATOM   943  O "O3'" . C   C 3 14  ? 77.863  40.043  -10.032 1.00 62.82  ? 13  C   D "O3'" 1 
ATOM   944  C "C2'" . C   C 3 14  ? 77.228  38.140  -11.408 1.00 59.91  ? 13  C   D "C2'" 1 
ATOM   945  O "O2'" . C   C 3 14  ? 77.132  37.374  -10.221 1.00 57.79  ? 13  C   D "O2'" 1 
ATOM   946  C "C1'" . C   C 3 14  ? 76.032  37.917  -12.340 1.00 58.54  ? 13  C   D "C1'" 1 
ATOM   947  N N1    . C   C 3 14  ? 76.424  38.017  -13.763 1.00 54.77  ? 13  C   D N1    1 
ATOM   948  C C2    . C   C 3 14  ? 77.162  36.965  -14.334 1.00 52.76  ? 13  C   D C2    1 
ATOM   949  O O2    . C   C 3 14  ? 77.451  35.981  -13.631 1.00 48.84  ? 13  C   D O2    1 
ATOM   950  N N3    . C   C 3 14  ? 77.545  37.052  -15.631 1.00 52.26  ? 13  C   D N3    1 
ATOM   951  C C4    . C   C 3 14  ? 77.222  38.128  -16.354 1.00 52.51  ? 13  C   D C4    1 
ATOM   952  N N4    . C   C 3 14  ? 77.627  38.171  -17.632 1.00 50.20  ? 13  C   D N4    1 
ATOM   953  C C5    . C   C 3 14  ? 76.471  39.209  -15.802 1.00 52.87  ? 13  C   D C5    1 
ATOM   954  C C6    . C   C 3 14  ? 76.095  39.112  -14.517 1.00 53.27  ? 13  C   D C6    1 
ATOM   955  P P     . G   C 3 15  ? 79.303  40.732  -10.207 1.00 65.82  ? 14  G   D P     1 
ATOM   956  O OP1   . G   C 3 15  ? 79.794  41.044  -8.839  1.00 66.02  ? 14  G   D OP1   1 
ATOM   957  O OP2   . G   C 3 15  ? 79.173  41.825  -11.212 1.00 62.91  ? 14  G   D OP2   1 
ATOM   958  O "O5'" . G   C 3 15  ? 80.220  39.571  -10.809 1.00 62.82  ? 14  G   D "O5'" 1 
ATOM   959  C "C5'" . G   C 3 15  ? 80.413  38.350  -10.092 1.00 61.96  ? 14  G   D "C5'" 1 
ATOM   960  C "C4'" . G   C 3 15  ? 81.138  37.333  -10.947 1.00 59.53  ? 14  G   D "C4'" 1 
ATOM   961  O "O4'" . G   C 3 15  ? 80.449  37.152  -12.205 1.00 59.80  ? 14  G   D "O4'" 1 
ATOM   962  C "C3'" . G   C 3 15  ? 82.547  37.695  -11.374 1.00 59.96  ? 14  G   D "C3'" 1 
ATOM   963  O "O3'" . G   C 3 15  ? 83.462  37.365  -10.345 1.00 63.44  ? 14  G   D "O3'" 1 
ATOM   964  C "C2'" . G   C 3 15  ? 82.775  36.784  -12.575 1.00 58.26  ? 14  G   D "C2'" 1 
ATOM   965  O "O2'" . G   C 3 15  ? 83.247  35.505  -12.200 1.00 58.20  ? 14  G   D "O2'" 1 
ATOM   966  C "C1'" . G   C 3 15  ? 81.368  36.677  -13.170 1.00 56.18  ? 14  G   D "C1'" 1 
ATOM   967  N N9    . G   C 3 15  ? 81.157  37.395  -14.428 1.00 53.08  ? 14  G   D N9    1 
ATOM   968  C C8    . G   C 3 15  ? 80.423  38.541  -14.626 1.00 50.32  ? 14  G   D C8    1 
ATOM   969  N N7    . G   C 3 15  ? 80.373  38.906  -15.877 1.00 49.72  ? 14  G   D N7    1 
ATOM   970  C C5    . G   C 3 15  ? 81.128  37.953  -16.545 1.00 50.11  ? 14  G   D C5    1 
ATOM   971  C C6    . G   C 3 15  ? 81.427  37.823  -17.923 1.00 51.78  ? 14  G   D C6    1 
ATOM   972  O O6    . G   C 3 15  ? 81.065  38.547  -18.860 1.00 52.71  ? 14  G   D O6    1 
ATOM   973  N N1    . G   C 3 15  ? 82.234  36.711  -18.170 1.00 51.04  ? 14  G   D N1    1 
ATOM   974  C C2    . G   C 3 15  ? 82.691  35.838  -17.211 1.00 49.21  ? 14  G   D C2    1 
ATOM   975  N N2    . G   C 3 15  ? 83.456  34.821  -17.644 1.00 46.81  ? 14  G   D N2    1 
ATOM   976  N N3    . G   C 3 15  ? 82.415  35.951  -15.922 1.00 49.15  ? 14  G   D N3    1 
ATOM   977  C C4    . G   C 3 15  ? 81.633  37.022  -15.664 1.00 49.84  ? 14  G   D C4    1 
ATOM   978  P P     . A   C 3 16  ? 84.838  38.179  -10.215 1.00 65.58  ? 15  A   D P     1 
ATOM   979  O OP1   . A   C 3 16  ? 85.422  37.806  -8.897  1.00 64.99  ? 15  A   D OP1   1 
ATOM   980  O OP2   . A   C 3 16  ? 84.582  39.613  -10.538 1.00 64.08  ? 15  A   D OP2   1 
ATOM   981  O "O5'" . A   C 3 16  ? 85.756  37.588  -11.374 1.00 63.59  ? 15  A   D "O5'" 1 
ATOM   982  C "C5'" . A   C 3 16  ? 86.247  36.254  -11.324 1.00 63.85  ? 15  A   D "C5'" 1 
ATOM   983  C "C4'" . A   C 3 16  ? 87.061  35.972  -12.560 1.00 65.28  ? 15  A   D "C4'" 1 
ATOM   984  O "O4'" . A   C 3 16  ? 86.256  36.325  -13.719 1.00 63.78  ? 15  A   D "O4'" 1 
ATOM   985  C "C3'" . A   C 3 16  ? 88.344  36.790  -12.684 1.00 68.12  ? 15  A   D "C3'" 1 
ATOM   986  O "O3'" . A   C 3 16  ? 89.357  36.055  -13.358 1.00 74.02  ? 15  A   D "O3'" 1 
ATOM   987  C "C2'" . A   C 3 16  ? 87.899  37.987  -13.512 1.00 66.16  ? 15  A   D "C2'" 1 
ATOM   988  O "O2'" . A   C 3 16  ? 88.953  38.632  -14.199 1.00 66.89  ? 15  A   D "O2'" 1 
ATOM   989  C "C1'" . A   C 3 16  ? 86.913  37.323  -14.470 1.00 62.39  ? 15  A   D "C1'" 1 
ATOM   990  N N9    . A   C 3 16  ? 85.909  38.235  -15.017 1.00 58.13  ? 15  A   D N9    1 
ATOM   991  C C8    . A   C 3 16  ? 85.207  39.222  -14.368 1.00 56.82  ? 15  A   D C8    1 
ATOM   992  N N7    . A   C 3 16  ? 84.424  39.916  -15.154 1.00 54.35  ? 15  A   D N7    1 
ATOM   993  C C5    . A   C 3 16  ? 84.610  39.338  -16.402 1.00 52.84  ? 15  A   D C5    1 
ATOM   994  C C6    . A   C 3 16  ? 84.068  39.624  -17.654 1.00 50.37  ? 15  A   D C6    1 
ATOM   995  N N6    . A   C 3 16  ? 83.205  40.612  -17.869 1.00 51.92  ? 15  A   D N6    1 
ATOM   996  N N1    . A   C 3 16  ? 84.451  38.856  -18.697 1.00 52.25  ? 15  A   D N1    1 
ATOM   997  C C2    . A   C 3 16  ? 85.329  37.869  -18.481 1.00 53.48  ? 15  A   D C2    1 
ATOM   998  N N3    . A   C 3 16  ? 85.915  37.505  -17.347 1.00 55.15  ? 15  A   D N3    1 
ATOM   999  C C4    . A   C 3 16  ? 85.507  38.292  -16.330 1.00 55.27  ? 15  A   D C4    1 
ATOM   1000 P P     . G   C 3 17  ? 90.335  35.093  -12.520 1.00 81.44  ? 16  G   D P     1 
ATOM   1001 O OP1   . G   C 3 17  ? 89.882  34.996  -11.104 1.00 80.75  ? 16  G   D OP1   1 
ATOM   1002 O OP2   . G   C 3 17  ? 91.719  35.549  -12.809 1.00 81.26  ? 16  G   D OP2   1 
ATOM   1003 O "O5'" . G   C 3 17  ? 90.111  33.664  -13.192 1.00 83.73  ? 16  G   D "O5'" 1 
ATOM   1004 C "C5'" . G   C 3 17  ? 88.796  33.135  -13.369 1.00 86.16  ? 16  G   D "C5'" 1 
ATOM   1005 C "C4'" . G   C 3 17  ? 88.860  31.726  -13.918 1.00 88.42  ? 16  G   D "C4'" 1 
ATOM   1006 O "O4'" . G   C 3 17  ? 90.098  31.088  -13.489 1.00 89.55  ? 16  G   D "O4'" 1 
ATOM   1007 C "C3'" . G   C 3 17  ? 87.725  30.804  -13.462 1.00 90.11  ? 16  G   D "C3'" 1 
ATOM   1008 O "O3'" . G   C 3 17  ? 87.264  29.965  -14.529 1.00 91.22  ? 16  G   D "O3'" 1 
ATOM   1009 C "C2'" . G   C 3 17  ? 88.386  29.977  -12.361 1.00 90.39  ? 16  G   D "C2'" 1 
ATOM   1010 O "O2'" . G   C 3 17  ? 87.768  28.720  -12.171 1.00 90.47  ? 16  G   D "O2'" 1 
ATOM   1011 C "C1'" . G   C 3 17  ? 89.798  29.828  -12.925 1.00 91.22  ? 16  G   D "C1'" 1 
ATOM   1012 N N9    . G   C 3 17  ? 90.848  29.440  -11.978 1.00 92.63  ? 16  G   D N9    1 
ATOM   1013 C C8    . G   C 3 17  ? 91.249  28.152  -11.712 1.00 93.13  ? 16  G   D C8    1 
ATOM   1014 N N7    . G   C 3 17  ? 92.208  28.081  -10.828 1.00 93.84  ? 16  G   D N7    1 
ATOM   1015 C C5    . G   C 3 17  ? 92.461  29.401  -10.483 1.00 94.79  ? 16  G   D C5    1 
ATOM   1016 C C6    . G   C 3 17  ? 93.403  29.948  -9.562  1.00 95.56  ? 16  G   D C6    1 
ATOM   1017 O O6    . G   C 3 17  ? 94.223  29.351  -8.846  1.00 95.30  ? 16  G   D O6    1 
ATOM   1018 N N1    . G   C 3 17  ? 93.328  31.336  -9.519  1.00 95.57  ? 16  G   D N1    1 
ATOM   1019 C C2    . G   C 3 17  ? 92.465  32.103  -10.260 1.00 95.50  ? 16  G   D C2    1 
ATOM   1020 N N2    . G   C 3 17  ? 92.551  33.426  -10.073 1.00 95.95  ? 16  G   D N2    1 
ATOM   1021 N N3    . G   C 3 17  ? 91.581  31.610  -11.121 1.00 95.14  ? 16  G   D N3    1 
ATOM   1022 C C4    . G   C 3 17  ? 91.633  30.260  -11.182 1.00 94.19  ? 16  G   D C4    1 
ATOM   1023 P P     . A   C 3 18  ? 86.039  30.446  -15.465 1.00 90.93  ? 17  A   D P     1 
ATOM   1024 O OP1   . A   C 3 18  ? 85.116  31.241  -14.611 1.00 91.08  ? 17  A   D OP1   1 
ATOM   1025 O OP2   . A   C 3 18  ? 85.511  29.271  -16.210 1.00 90.78  ? 17  A   D OP2   1 
ATOM   1026 O "O5'" . A   C 3 18  ? 86.730  31.443  -16.502 1.00 88.09  ? 17  A   D "O5'" 1 
ATOM   1027 C "C5'" . A   C 3 18  ? 87.340  30.972  -17.708 1.00 81.57  ? 17  A   D "C5'" 1 
ATOM   1028 C "C4'" . A   C 3 18  ? 86.597  31.528  -18.898 1.00 77.47  ? 17  A   D "C4'" 1 
ATOM   1029 O "O4'" . A   C 3 18  ? 86.760  32.930  -19.064 1.00 76.70  ? 17  A   D "O4'" 1 
ATOM   1030 C "C3'" . A   C 3 18  ? 86.713  30.902  -20.277 1.00 74.81  ? 17  A   D "C3'" 1 
ATOM   1031 O "O3'" . A   C 3 18  ? 85.388  30.753  -20.565 1.00 70.05  ? 17  A   D "O3'" 1 
ATOM   1032 C "C2'" . A   C 3 18  ? 87.227  31.986  -21.244 1.00 74.19  ? 17  A   D "C2'" 1 
ATOM   1033 O "O2'" . A   C 3 18  ? 86.470  32.364  -22.444 1.00 73.26  ? 17  A   D "O2'" 1 
ATOM   1034 C "C1'" . A   C 3 18  ? 87.340  33.168  -20.315 1.00 74.96  ? 17  A   D "C1'" 1 
ATOM   1035 N N9    . A   C 3 18  ? 88.675  33.731  -20.083 1.00 74.46  ? 17  A   D N9    1 
ATOM   1036 C C8    . A   C 3 18  ? 89.054  35.045  -20.249 1.00 72.97  ? 17  A   D C8    1 
ATOM   1037 N N7    . A   C 3 18  ? 90.301  35.280  -19.926 1.00 72.08  ? 17  A   D N7    1 
ATOM   1038 C C5    . A   C 3 18  ? 90.784  34.040  -19.528 1.00 72.21  ? 17  A   D C5    1 
ATOM   1039 C C6    . A   C 3 18  ? 92.046  33.620  -19.068 1.00 72.49  ? 17  A   D C6    1 
ATOM   1040 N N6    . A   C 3 18  ? 93.090  34.440  -18.921 1.00 70.96  ? 17  A   D N6    1 
ATOM   1041 N N1    . A   C 3 18  ? 92.200  32.313  -18.757 1.00 71.94  ? 17  A   D N1    1 
ATOM   1042 C C2    . A   C 3 18  ? 91.149  31.494  -18.901 1.00 72.80  ? 17  A   D C2    1 
ATOM   1043 N N3    . A   C 3 18  ? 89.914  31.769  -19.321 1.00 72.92  ? 17  A   D N3    1 
ATOM   1044 C C4    . A   C 3 18  ? 89.795  33.074  -19.624 1.00 73.11  ? 17  A   D C4    1 
ATOM   1045 P P     . G   C 3 19  ? 84.979  29.631  -21.546 1.00 67.85  ? 18  G   D P     1 
ATOM   1046 O OP1   . G   C 3 19  ? 86.181  28.860  -21.963 1.00 67.32  ? 18  G   D OP1   1 
ATOM   1047 O OP2   . G   C 3 19  ? 84.100  30.248  -22.585 1.00 65.56  ? 18  G   D OP2   1 
ATOM   1048 O "O5'" . G   C 3 19  ? 84.114  28.642  -20.645 1.00 63.75  ? 18  G   D "O5'" 1 
ATOM   1049 C "C5'" . G   C 3 19  ? 82.758  28.934  -20.333 1.00 55.29  ? 18  G   D "C5'" 1 
ATOM   1050 C "C4'" . G   C 3 19  ? 82.609  29.126  -18.853 1.00 52.55  ? 18  G   D "C4'" 1 
ATOM   1051 O "O4'" . G   C 3 19  ? 83.073  30.457  -18.489 1.00 50.86  ? 18  G   D "O4'" 1 
ATOM   1052 C "C3'" . G   C 3 19  ? 81.187  29.050  -18.323 1.00 49.78  ? 18  G   D "C3'" 1 
ATOM   1053 O "O3'" . G   C 3 19  ? 80.816  27.699  -18.076 1.00 46.67  ? 18  G   D "O3'" 1 
ATOM   1054 C "C2'" . G   C 3 19  ? 81.290  29.875  -17.046 1.00 48.97  ? 18  G   D "C2'" 1 
ATOM   1055 O "O2'" . G   C 3 19  ? 81.896  29.174  -15.978 1.00 49.65  ? 18  G   D "O2'" 1 
ATOM   1056 C "C1'" . G   C 3 19  ? 82.216  31.004  -17.500 1.00 47.14  ? 18  G   D "C1'" 1 
ATOM   1057 N N9    . G   C 3 19  ? 81.517  32.145  -18.082 1.00 45.05  ? 18  G   D N9    1 
ATOM   1058 C C8    . G   C 3 19  ? 81.535  32.546  -19.397 1.00 42.16  ? 18  G   D C8    1 
ATOM   1059 N N7    . G   C 3 19  ? 80.803  33.601  -19.617 1.00 43.43  ? 18  G   D N7    1 
ATOM   1060 C C5    . G   C 3 19  ? 80.275  33.922  -18.372 1.00 42.54  ? 18  G   D C5    1 
ATOM   1061 C C6    . G   C 3 19  ? 79.412  34.978  -17.983 1.00 40.94  ? 18  G   D C6    1 
ATOM   1062 O O6    . G   C 3 19  ? 78.921  35.870  -18.678 1.00 41.75  ? 18  G   D O6    1 
ATOM   1063 N N1    . G   C 3 19  ? 79.130  34.931  -16.628 1.00 42.27  ? 18  G   D N1    1 
ATOM   1064 C C2    . G   C 3 19  ? 79.610  33.995  -15.752 1.00 43.84  ? 18  G   D C2    1 
ATOM   1065 N N2    . G   C 3 19  ? 79.215  34.120  -14.477 1.00 43.14  ? 18  G   D N2    1 
ATOM   1066 N N3    . G   C 3 19  ? 80.416  33.009  -16.100 1.00 44.34  ? 18  G   D N3    1 
ATOM   1067 C C4    . G   C 3 19  ? 80.705  33.034  -17.416 1.00 41.61  ? 18  G   D C4    1 
ATOM   1068 P P     . G   C 3 20  ? 79.374  27.176  -18.546 1.00 42.85  ? 19  G   D P     1 
ATOM   1069 O OP1   . G   C 3 20  ? 79.185  25.817  -18.001 1.00 47.92  ? 19  G   D OP1   1 
ATOM   1070 O OP2   . G   C 3 20  ? 79.211  27.410  -20.004 1.00 47.17  ? 19  G   D OP2   1 
ATOM   1071 O "O5'" . G   C 3 20  ? 78.354  28.143  -17.807 1.00 44.53  ? 19  G   D "O5'" 1 
ATOM   1072 C "C5'" . G   C 3 20  ? 78.369  28.298  -16.394 1.00 42.80  ? 19  G   D "C5'" 1 
ATOM   1073 C "C4'" . G   C 3 20  ? 77.448  29.428  -15.999 1.00 44.78  ? 19  G   D "C4'" 1 
ATOM   1074 O "O4'" . G   C 3 20  ? 78.073  30.693  -16.364 1.00 43.63  ? 19  G   D "O4'" 1 
ATOM   1075 C "C3'" . G   C 3 20  ? 76.126  29.478  -16.749 1.00 43.47  ? 19  G   D "C3'" 1 
ATOM   1076 O "O3'" . G   C 3 20  ? 75.156  28.566  -16.243 1.00 44.06  ? 19  G   D "O3'" 1 
ATOM   1077 C "C2'" . G   C 3 20  ? 75.734  30.935  -16.578 1.00 41.06  ? 19  G   D "C2'" 1 
ATOM   1078 O "O2'" . G   C 3 20  ? 75.264  31.235  -15.287 1.00 41.25  ? 19  G   D "O2'" 1 
ATOM   1079 C "C1'" . G   C 3 20  ? 77.081  31.615  -16.795 1.00 42.67  ? 19  G   D "C1'" 1 
ATOM   1080 N N9    . G   C 3 20  ? 77.318  31.929  -18.200 1.00 43.02  ? 19  G   D N9    1 
ATOM   1081 C C8    . G   C 3 20  ? 77.997  31.164  -19.118 1.00 45.49  ? 19  G   D C8    1 
ATOM   1082 N N7    . G   C 3 20  ? 78.027  31.699  -20.307 1.00 45.12  ? 19  G   D N7    1 
ATOM   1083 C C5    . G   C 3 20  ? 77.331  32.892  -20.166 1.00 45.09  ? 19  G   D C5    1 
ATOM   1084 C C6    . G   C 3 20  ? 77.035  33.904  -21.119 1.00 45.48  ? 19  G   D C6    1 
ATOM   1085 O O6    . G   C 3 20  ? 77.342  33.952  -22.315 1.00 45.65  ? 19  G   D O6    1 
ATOM   1086 N N1    . G   C 3 20  ? 76.307  34.939  -20.553 1.00 46.28  ? 19  G   D N1    1 
ATOM   1087 C C2    . G   C 3 20  ? 75.913  35.004  -19.239 1.00 47.99  ? 19  G   D C2    1 
ATOM   1088 N N2    . G   C 3 20  ? 75.216  36.102  -18.882 1.00 48.25  ? 19  G   D N2    1 
ATOM   1089 N N3    . G   C 3 20  ? 76.181  34.068  -18.341 1.00 44.75  ? 19  G   D N3    1 
ATOM   1090 C C4    . G   C 3 20  ? 76.888  33.049  -18.871 1.00 43.75  ? 19  G   D C4    1 
ATOM   1091 P P     . A   C 3 21  ? 73.954  28.080  -17.205 1.00 45.13  ? 20  A   D P     1 
ATOM   1092 O OP1   . A   C 3 21  ? 73.373  26.876  -16.566 1.00 45.57  ? 20  A   D OP1   1 
ATOM   1093 O OP2   . A   C 3 21  ? 74.476  27.998  -18.598 1.00 44.19  ? 20  A   D OP2   1 
ATOM   1094 O "O5'" . A   C 3 21  ? 72.910  29.286  -17.173 1.00 44.92  ? 20  A   D "O5'" 1 
ATOM   1095 C "C5'" . A   C 3 21  ? 71.629  29.152  -16.564 1.00 43.71  ? 20  A   D "C5'" 1 
ATOM   1096 C "C4'" . A   C 3 21  ? 71.752  29.226  -15.058 1.00 44.02  ? 20  A   D "C4'" 1 
ATOM   1097 O "O4'" . A   C 3 21  ? 72.560  30.370  -14.657 1.00 44.42  ? 20  A   D "O4'" 1 
ATOM   1098 C "C3'" . A   C 3 21  ? 70.442  29.387  -14.301 1.00 44.26  ? 20  A   D "C3'" 1 
ATOM   1099 O "O3'" . A   C 3 21  ? 69.848  28.123  -14.059 1.00 42.74  ? 20  A   D "O3'" 1 
ATOM   1100 C "C2'" . A   C 3 21  ? 70.901  30.053  -13.016 1.00 46.94  ? 20  A   D "C2'" 1 
ATOM   1101 O "O2'" . A   C 3 21  ? 71.507  29.145  -12.117 1.00 43.71  ? 20  A   D "O2'" 1 
ATOM   1102 C "C1'" . A   C 3 21  ? 71.931  31.038  -13.571 1.00 47.95  ? 20  A   D "C1'" 1 
ATOM   1103 N N9    . A   C 3 21  ? 71.341  32.289  -14.067 1.00 49.42  ? 20  A   D N9    1 
ATOM   1104 C C8    . A   C 3 21  ? 71.326  32.771  -15.356 1.00 48.74  ? 20  A   D C8    1 
ATOM   1105 N N7    . A   C 3 21  ? 70.757  33.947  -15.475 1.00 48.79  ? 20  A   D N7    1 
ATOM   1106 C C5    . A   C 3 21  ? 70.358  34.258  -14.182 1.00 48.47  ? 20  A   D C5    1 
ATOM   1107 C C6    . A   C 3 21  ? 69.698  35.380  -13.635 1.00 49.80  ? 20  A   D C6    1 
ATOM   1108 N N6    . A   C 3 21  ? 69.306  36.439  -14.349 1.00 48.73  ? 20  A   D N6    1 
ATOM   1109 N N1    . A   C 3 21  ? 69.454  35.376  -12.308 1.00 50.54  ? 20  A   D N1    1 
ATOM   1110 C C2    . A   C 3 21  ? 69.849  34.314  -11.587 1.00 50.39  ? 20  A   D C2    1 
ATOM   1111 N N3    . A   C 3 21  ? 70.473  33.207  -11.984 1.00 49.30  ? 20  A   D N3    1 
ATOM   1112 C C4    . A   C 3 21  ? 70.703  33.242  -13.307 1.00 48.80  ? 20  A   D C4    1 
ATOM   1113 P P     . A   C 3 22  ? 68.385  27.824  -14.626 1.00 43.53  ? 21  A   D P     1 
ATOM   1114 O OP1   . A   C 3 22  ? 68.154  26.365  -14.514 1.00 43.78  ? 21  A   D OP1   1 
ATOM   1115 O OP2   . A   C 3 22  ? 68.263  28.486  -15.951 1.00 42.41  ? 21  A   D OP2   1 
ATOM   1116 O "O5'" . A   C 3 22  ? 67.433  28.571  -13.588 1.00 46.45  ? 21  A   D "O5'" 1 
ATOM   1117 C "C5'" . A   C 3 22  ? 67.499  28.269  -12.194 1.00 48.66  ? 21  A   D "C5'" 1 
ATOM   1118 C "C4'" . A   C 3 22  ? 67.031  29.447  -11.374 1.00 49.70  ? 21  A   D "C4'" 1 
ATOM   1119 O "O4'" . A   C 3 22  ? 67.839  30.600  -11.706 1.00 49.61  ? 21  A   D "O4'" 1 
ATOM   1120 C "C3'" . A   C 3 22  ? 65.604  29.907  -11.628 1.00 53.09  ? 21  A   D "C3'" 1 
ATOM   1121 O "O3'" . A   C 3 22  ? 64.659  29.155  -10.880 1.00 55.25  ? 21  A   D "O3'" 1 
ATOM   1122 C "C2'" . A   C 3 22  ? 65.641  31.364  -11.183 1.00 53.89  ? 21  A   D "C2'" 1 
ATOM   1123 O "O2'" . A   C 3 22  ? 65.448  31.583  -9.798  1.00 51.81  ? 21  A   D "O2'" 1 
ATOM   1124 C "C1'" . A   C 3 22  ? 67.046  31.776  -11.620 1.00 53.20  ? 21  A   D "C1'" 1 
ATOM   1125 N N9    . A   C 3 22  ? 67.051  32.451  -12.919 1.00 52.99  ? 21  A   D N9    1 
ATOM   1126 C C8    . A   C 3 22  ? 67.417  31.956  -14.150 1.00 53.68  ? 21  A   D C8    1 
ATOM   1127 N N7    . A   C 3 22  ? 67.320  32.832  -15.121 1.00 54.23  ? 21  A   D N7    1 
ATOM   1128 C C5    . A   C 3 22  ? 66.857  33.982  -14.489 1.00 53.61  ? 21  A   D C5    1 
ATOM   1129 C C6    . A   C 3 22  ? 66.554  35.271  -14.965 1.00 52.53  ? 21  A   D C6    1 
ATOM   1130 N N6    . A   C 3 22  ? 66.686  35.644  -16.236 1.00 53.07  ? 21  A   D N6    1 
ATOM   1131 N N1    . A   C 3 22  ? 66.107  36.180  -14.072 1.00 53.06  ? 21  A   D N1    1 
ATOM   1132 C C2    . A   C 3 22  ? 65.980  35.812  -12.790 1.00 49.90  ? 21  A   D C2    1 
ATOM   1133 N N3    . A   C 3 22  ? 66.239  34.641  -12.222 1.00 50.49  ? 21  A   D N3    1 
ATOM   1134 C C4    . A   C 3 22  ? 66.680  33.758  -13.135 1.00 52.81  ? 21  A   D C4    1 
ATOM   1135 P P     . C   C 3 23  ? 63.177  28.944  -11.463 1.00 56.03  ? 22  C   D P     1 
ATOM   1136 O OP1   . C   C 3 23  ? 62.548  27.865  -10.657 1.00 57.30  ? 22  C   D OP1   1 
ATOM   1137 O OP2   . C   C 3 23  ? 63.272  28.801  -12.934 1.00 55.17  ? 22  C   D OP2   1 
ATOM   1138 O "O5'" . C   C 3 23  ? 62.434  30.319  -11.154 1.00 55.17  ? 22  C   D "O5'" 1 
ATOM   1139 C "C5'" . C   C 3 23  ? 62.263  30.772  -9.818  1.00 53.32  ? 22  C   D "C5'" 1 
ATOM   1140 C "C4'" . C   C 3 23  ? 61.874  32.230  -9.805  1.00 53.64  ? 22  C   D "C4'" 1 
ATOM   1141 O "O4'" . C   C 3 23  ? 62.888  33.048  -10.449 1.00 53.80  ? 22  C   D "O4'" 1 
ATOM   1142 C "C3'" . C   C 3 23  ? 60.624  32.602  -10.575 1.00 54.37  ? 22  C   D "C3'" 1 
ATOM   1143 O "O3'" . C   C 3 23  ? 59.456  32.201  -9.881  1.00 56.23  ? 22  C   D "O3'" 1 
ATOM   1144 C "C2'" . C   C 3 23  ? 60.782  34.115  -10.672 1.00 54.23  ? 22  C   D "C2'" 1 
ATOM   1145 O "O2'" . C   C 3 23  ? 60.496  34.802  -9.471  1.00 51.16  ? 22  C   D "O2'" 1 
ATOM   1146 C "C1'" . C   C 3 23  ? 62.277  34.224  -10.979 1.00 54.40  ? 22  C   D "C1'" 1 
ATOM   1147 N N1    . C   C 3 23  ? 62.540  34.308  -12.434 1.00 55.32  ? 22  C   D N1    1 
ATOM   1148 C C2    . C   C 3 23  ? 62.344  35.541  -13.083 1.00 56.34  ? 22  C   D C2    1 
ATOM   1149 O O2    . C   C 3 23  ? 61.992  36.526  -12.415 1.00 56.55  ? 22  C   D O2    1 
ATOM   1150 N N3    . C   C 3 23  ? 62.544  35.624  -14.422 1.00 56.64  ? 22  C   D N3    1 
ATOM   1151 C C4    . C   C 3 23  ? 62.930  34.545  -15.107 1.00 55.13  ? 22  C   D C4    1 
ATOM   1152 N N4    . C   C 3 23  ? 63.105  34.673  -16.423 1.00 55.01  ? 22  C   D N4    1 
ATOM   1153 C C5    . C   C 3 23  ? 63.149  33.286  -14.473 1.00 55.05  ? 22  C   D C5    1 
ATOM   1154 C C6    . C   C 3 23  ? 62.947  33.213  -13.148 1.00 55.33  ? 22  C   D C6    1 
ATOM   1155 P P     . C   C 3 24  ? 58.291  31.431  -10.670 1.00 58.63  ? 23  C   D P     1 
ATOM   1156 O OP1   . C   C 3 24  ? 57.229  31.136  -9.675  1.00 59.46  ? 23  C   D OP1   1 
ATOM   1157 O OP2   . C   C 3 24  ? 58.883  30.321  -11.461 1.00 56.38  ? 23  C   D OP2   1 
ATOM   1158 O "O5'" . C   C 3 24  ? 57.729  32.527  -11.679 1.00 57.57  ? 23  C   D "O5'" 1 
ATOM   1159 C "C5'" . C   C 3 24  ? 57.116  33.720  -11.195 1.00 59.59  ? 23  C   D "C5'" 1 
ATOM   1160 C "C4'" . C   C 3 24  ? 56.824  34.661  -12.339 1.00 59.83  ? 23  C   D "C4'" 1 
ATOM   1161 O "O4'" . C   C 3 24  ? 58.073  35.114  -12.924 1.00 62.09  ? 23  C   D "O4'" 1 
ATOM   1162 C "C3'" . C   C 3 24  ? 56.100  34.061  -13.529 1.00 60.60  ? 23  C   D "C3'" 1 
ATOM   1163 O "O3'" . C   C 3 24  ? 54.711  33.968  -13.326 1.00 62.54  ? 23  C   D "O3'" 1 
ATOM   1164 C "C2'" . C   C 3 24  ? 56.418  35.069  -14.614 1.00 62.45  ? 23  C   D "C2'" 1 
ATOM   1165 O "O2'" . C   C 3 24  ? 55.647  36.249  -14.529 1.00 62.98  ? 23  C   D "O2'" 1 
ATOM   1166 C "C1'" . C   C 3 24  ? 57.890  35.344  -14.316 1.00 62.35  ? 23  C   D "C1'" 1 
ATOM   1167 N N1    . C   C 3 24  ? 58.764  34.434  -15.079 1.00 61.72  ? 23  C   D N1    1 
ATOM   1168 C C2    . C   C 3 24  ? 59.181  34.832  -16.351 1.00 61.43  ? 23  C   D C2    1 
ATOM   1169 O O2    . C   C 3 24  ? 58.823  35.943  -16.779 1.00 59.34  ? 23  C   D O2    1 
ATOM   1170 N N3    . C   C 3 24  ? 59.959  34.000  -17.082 1.00 61.86  ? 23  C   D N3    1 
ATOM   1171 C C4    . C   C 3 24  ? 60.324  32.817  -16.584 1.00 61.89  ? 23  C   D C4    1 
ATOM   1172 N N4    . C   C 3 24  ? 61.092  32.033  -17.343 1.00 62.83  ? 23  C   D N4    1 
ATOM   1173 C C5    . C   C 3 24  ? 59.919  32.388  -15.288 1.00 60.79  ? 23  C   D C5    1 
ATOM   1174 C C6    . C   C 3 24  ? 59.149  33.219  -14.575 1.00 61.55  ? 23  C   D C6    1 
ATOM   1175 P P     . G   C 3 25  ? 53.907  32.744  -13.972 1.00 61.60  ? 24  G   D P     1 
ATOM   1176 O OP1   . G   C 3 25  ? 52.470  33.023  -13.713 1.00 63.54  ? 24  G   D OP1   1 
ATOM   1177 O OP2   . G   C 3 25  ? 54.516  31.483  -13.479 1.00 62.93  ? 24  G   D OP2   1 
ATOM   1178 O "O5'" . G   C 3 25  ? 54.199  32.855  -15.532 1.00 60.91  ? 24  G   D "O5'" 1 
ATOM   1179 C "C5'" . G   C 3 25  ? 53.667  33.930  -16.295 1.00 61.45  ? 24  G   D "C5'" 1 
ATOM   1180 C "C4'" . G   C 3 25  ? 54.072  33.801  -17.742 1.00 60.59  ? 24  G   D "C4'" 1 
ATOM   1181 O "O4'" . G   C 3 25  ? 55.513  33.955  -17.883 1.00 60.19  ? 24  G   D "O4'" 1 
ATOM   1182 C "C3'" . G   C 3 25  ? 53.804  32.471  -18.420 1.00 58.48  ? 24  G   D "C3'" 1 
ATOM   1183 O "O3'" . G   C 3 25  ? 52.439  32.298  -18.760 1.00 60.59  ? 24  G   D "O3'" 1 
ATOM   1184 C "C2'" . G   C 3 25  ? 54.710  32.584  -19.633 1.00 59.68  ? 24  G   D "C2'" 1 
ATOM   1185 O "O2'" . G   C 3 25  ? 54.220  33.441  -20.649 1.00 56.15  ? 24  G   D "O2'" 1 
ATOM   1186 C "C1'" . G   C 3 25  ? 55.969  33.158  -18.976 1.00 61.16  ? 24  G   D "C1'" 1 
ATOM   1187 N N9    . G   C 3 25  ? 56.812  32.081  -18.458 1.00 60.68  ? 24  G   D N9    1 
ATOM   1188 C C8    . G   C 3 25  ? 57.076  31.766  -17.143 1.00 60.59  ? 24  G   D C8    1 
ATOM   1189 N N7    . G   C 3 25  ? 57.829  30.709  -17.010 1.00 59.95  ? 24  G   D N7    1 
ATOM   1190 C C5    . G   C 3 25  ? 58.089  30.309  -18.312 1.00 60.83  ? 24  G   D C5    1 
ATOM   1191 C C6    . G   C 3 25  ? 58.856  29.227  -18.805 1.00 59.85  ? 24  G   D C6    1 
ATOM   1192 O O6    . G   C 3 25  ? 59.477  28.372  -18.168 1.00 61.20  ? 24  G   D O6    1 
ATOM   1193 N N1    . G   C 3 25  ? 58.857  29.194  -20.195 1.00 58.90  ? 24  G   D N1    1 
ATOM   1194 C C2    . G   C 3 25  ? 58.204  30.087  -21.008 1.00 59.57  ? 24  G   D C2    1 
ATOM   1195 N N2    . G   C 3 25  ? 58.323  29.894  -22.321 1.00 60.15  ? 24  G   D N2    1 
ATOM   1196 N N3    . G   C 3 25  ? 57.487  31.097  -20.563 1.00 59.87  ? 24  G   D N3    1 
ATOM   1197 C C4    . G   C 3 25  ? 57.474  31.150  -19.216 1.00 60.41  ? 24  G   D C4    1 
ATOM   1198 P P     . G   C 3 26  ? 51.716  30.896  -18.445 1.00 59.77  ? 25  G   D P     1 
ATOM   1199 O OP1   . G   C 3 26  ? 50.255  31.156  -18.404 1.00 60.81  ? 25  G   D OP1   1 
ATOM   1200 O OP2   . G   C 3 26  ? 52.386  30.289  -17.262 1.00 61.53  ? 25  G   D OP2   1 
ATOM   1201 O "O5'" . G   C 3 26  ? 52.044  29.988  -19.713 1.00 60.03  ? 25  G   D "O5'" 1 
ATOM   1202 C "C5'" . G   C 3 26  ? 51.903  30.497  -21.038 1.00 60.05  ? 25  G   D "C5'" 1 
ATOM   1203 C "C4'" . G   C 3 26  ? 52.646  29.625  -22.026 1.00 60.60  ? 25  G   D "C4'" 1 
ATOM   1204 O "O4'" . G   C 3 26  ? 54.083  29.718  -21.818 1.00 60.56  ? 25  G   D "O4'" 1 
ATOM   1205 C "C3'" . G   C 3 26  ? 52.406  28.125  -21.965 1.00 60.67  ? 25  G   D "C3'" 1 
ATOM   1206 O "O3'" . G   C 3 26  ? 51.166  27.753  -22.543 1.00 62.85  ? 25  G   D "O3'" 1 
ATOM   1207 C "C2'" . G   C 3 26  ? 53.577  27.615  -22.790 1.00 59.73  ? 25  G   D "C2'" 1 
ATOM   1208 O "O2'" . G   C 3 26  ? 53.404  27.824  -24.178 1.00 59.33  ? 25  G   D "O2'" 1 
ATOM   1209 C "C1'" . G   C 3 26  ? 54.700  28.516  -22.274 1.00 59.28  ? 25  G   D "C1'" 1 
ATOM   1210 N N9    . G   C 3 26  ? 55.436  27.895  -21.174 1.00 57.50  ? 25  G   D N9    1 
ATOM   1211 C C8    . G   C 3 26  ? 55.378  28.200  -19.834 1.00 56.79  ? 25  G   D C8    1 
ATOM   1212 N N7    . G   C 3 26  ? 56.151  27.441  -19.103 1.00 57.52  ? 25  G   D N7    1 
ATOM   1213 C C5    . G   C 3 26  ? 56.757  26.587  -20.015 1.00 54.40  ? 25  G   D C5    1 
ATOM   1214 C C6    . G   C 3 26  ? 57.699  25.547  -19.816 1.00 53.61  ? 25  G   D C6    1 
ATOM   1215 O O6    . G   C 3 26  ? 58.205  25.157  -18.761 1.00 54.38  ? 25  G   D O6    1 
ATOM   1216 N N1    . G   C 3 26  ? 58.050  24.941  -21.016 1.00 53.08  ? 25  G   D N1    1 
ATOM   1217 C C2    . G   C 3 26  ? 57.558  25.292  -22.249 1.00 53.12  ? 25  G   D C2    1 
ATOM   1218 N N2    . G   C 3 26  ? 58.008  24.595  -23.293 1.00 52.39  ? 25  G   D N2    1 
ATOM   1219 N N3    . G   C 3 26  ? 56.684  26.257  -22.446 1.00 52.78  ? 25  G   D N3    1 
ATOM   1220 C C4    . G   C 3 26  ? 56.330  26.858  -21.295 1.00 54.78  ? 25  G   D C4    1 
ATOM   1221 P P     . A   C 3 27  ? 50.352  26.500  -21.946 1.00 65.42  ? 26  A   D P     1 
ATOM   1222 O OP1   . A   C 3 27  ? 49.013  26.533  -22.584 1.00 66.87  ? 26  A   D OP1   1 
ATOM   1223 O OP2   . A   C 3 27  ? 50.454  26.519  -20.466 1.00 65.00  ? 26  A   D OP2   1 
ATOM   1224 O "O5'" . A   C 3 27  ? 51.144  25.224  -22.478 1.00 64.48  ? 26  A   D "O5'" 1 
ATOM   1225 C "C5'" . A   C 3 27  ? 51.065  24.836  -23.847 1.00 64.50  ? 26  A   D "C5'" 1 
ATOM   1226 C "C4'" . A   C 3 27  ? 52.147  23.831  -24.186 1.00 65.20  ? 26  A   D "C4'" 1 
ATOM   1227 O "O4'" . A   C 3 27  ? 53.454  24.273  -23.726 1.00 64.29  ? 26  A   D "O4'" 1 
ATOM   1228 C "C3'" . A   C 3 27  ? 52.040  22.445  -23.573 1.00 64.90  ? 26  A   D "C3'" 1 
ATOM   1229 O "O3'" . A   C 3 27  ? 51.031  21.661  -24.196 1.00 65.40  ? 26  A   D "O3'" 1 
ATOM   1230 C "C2'" . A   C 3 27  ? 53.435  21.902  -23.850 1.00 63.74  ? 26  A   D "C2'" 1 
ATOM   1231 O "O2'" . A   C 3 27  ? 53.626  21.476  -25.184 1.00 64.27  ? 26  A   D "O2'" 1 
ATOM   1232 C "C1'" . A   C 3 27  ? 54.292  23.135  -23.551 1.00 62.94  ? 26  A   D "C1'" 1 
ATOM   1233 N N9    . A   C 3 27  ? 54.777  23.106  -22.170 1.00 60.40  ? 26  A   D N9    1 
ATOM   1234 C C8    . A   C 3 27  ? 54.369  23.845  -21.089 1.00 58.79  ? 26  A   D C8    1 
ATOM   1235 N N7    . A   C 3 27  ? 54.993  23.539  -19.976 1.00 57.90  ? 26  A   D N7    1 
ATOM   1236 C C5    . A   C 3 27  ? 55.877  22.538  -20.354 1.00 59.16  ? 26  A   D C5    1 
ATOM   1237 C C6    . A   C 3 27  ? 56.829  21.793  -19.637 1.00 60.29  ? 26  A   D C6    1 
ATOM   1238 N N6    . A   C 3 27  ? 57.060  21.943  -18.335 1.00 61.10  ? 26  A   D N6    1 
ATOM   1239 N N1    . A   C 3 27  ? 57.546  20.875  -20.315 1.00 62.11  ? 26  A   D N1    1 
ATOM   1240 C C2    . A   C 3 27  ? 57.318  20.722  -21.623 1.00 60.98  ? 26  A   D C2    1 
ATOM   1241 N N3    . A   C 3 27  ? 56.456  21.359  -22.404 1.00 59.65  ? 26  A   D N3    1 
ATOM   1242 C C4    . A   C 3 27  ? 55.758  22.266  -21.701 1.00 58.90  ? 26  A   D C4    1 
ATOM   1243 P P     . G   C 3 28  ? 50.436  20.375  -23.432 1.00 64.18  ? 27  G   D P     1 
ATOM   1244 O OP1   . G   C 3 28  ? 49.425  19.750  -24.333 1.00 66.12  ? 27  G   D OP1   1 
ATOM   1245 O OP2   . G   C 3 28  ? 50.049  20.792  -22.061 1.00 64.32  ? 27  G   D OP2   1 
ATOM   1246 O "O5'" . G   C 3 28  ? 51.671  19.375  -23.307 1.00 64.11  ? 27  G   D "O5'" 1 
ATOM   1247 C "C5'" . G   C 3 28  ? 51.740  18.203  -24.116 1.00 58.83  ? 27  G   D "C5'" 1 
ATOM   1248 C "C4'" . G   C 3 28  ? 53.023  17.451  -23.856 1.00 56.33  ? 27  G   D "C4'" 1 
ATOM   1249 O "O4'" . G   C 3 28  ? 54.076  18.339  -23.386 1.00 54.99  ? 27  G   D "O4'" 1 
ATOM   1250 C "C3'" . G   C 3 28  ? 52.973  16.406  -22.765 1.00 54.43  ? 27  G   D "C3'" 1 
ATOM   1251 O "O3'" . G   C 3 28  ? 52.247  15.245  -23.138 1.00 52.84  ? 27  G   D "O3'" 1 
ATOM   1252 C "C2'" . G   C 3 28  ? 54.456  16.171  -22.520 1.00 53.27  ? 27  G   D "C2'" 1 
ATOM   1253 O "O2'" . G   C 3 28  ? 55.109  15.410  -23.518 1.00 53.46  ? 27  G   D "O2'" 1 
ATOM   1254 C "C1'" . G   C 3 28  ? 54.964  17.610  -22.548 1.00 52.74  ? 27  G   D "C1'" 1 
ATOM   1255 N N9    . G   C 3 28  ? 54.953  18.212  -21.219 1.00 52.55  ? 27  G   D N9    1 
ATOM   1256 C C8    . G   C 3 28  ? 54.121  19.200  -20.747 1.00 52.44  ? 27  G   D C8    1 
ATOM   1257 N N7    . G   C 3 28  ? 54.381  19.542  -19.516 1.00 51.98  ? 27  G   D N7    1 
ATOM   1258 C C5    . G   C 3 28  ? 55.444  18.727  -19.153 1.00 52.30  ? 27  G   D C5    1 
ATOM   1259 C C6    . G   C 3 28  ? 56.158  18.643  -17.938 1.00 52.77  ? 27  G   D C6    1 
ATOM   1260 O O6    . G   C 3 28  ? 55.993  19.300  -16.904 1.00 51.42  ? 27  G   D O6    1 
ATOM   1261 N N1    . G   C 3 28  ? 57.159  17.673  -17.998 1.00 53.36  ? 27  G   D N1    1 
ATOM   1262 C C2    . G   C 3 28  ? 57.434  16.888  -19.094 1.00 52.49  ? 27  G   D C2    1 
ATOM   1263 N N2    . G   C 3 28  ? 58.436  16.006  -18.969 1.00 53.02  ? 27  G   D N2    1 
ATOM   1264 N N3    . G   C 3 28  ? 56.774  16.962  -20.232 1.00 51.84  ? 27  G   D N3    1 
ATOM   1265 C C4    . G   C 3 28  ? 55.801  17.896  -20.192 1.00 52.29  ? 27  G   D C4    1 
ATOM   1266 P P     . C   C 3 29  ? 51.462  14.419  -22.009 1.00 54.71  ? 28  C   D P     1 
ATOM   1267 O OP1   . C   C 3 29  ? 50.603  13.423  -22.701 1.00 59.09  ? 28  C   D OP1   1 
ATOM   1268 O OP2   . C   C 3 29  ? 50.843  15.378  -21.060 1.00 55.01  ? 28  C   D OP2   1 
ATOM   1269 O "O5'" . C   C 3 29  ? 52.618  13.615  -21.259 1.00 53.03  ? 28  C   D "O5'" 1 
ATOM   1270 C "C5'" . C   C 3 29  ? 53.508  12.769  -21.991 1.00 51.81  ? 28  C   D "C5'" 1 
ATOM   1271 C "C4'" . C   C 3 29  ? 54.523  12.130  -21.068 1.00 49.07  ? 28  C   D "C4'" 1 
ATOM   1272 O "O4'" . C   C 3 29  ? 55.467  13.135  -20.606 1.00 48.92  ? 28  C   D "O4'" 1 
ATOM   1273 C "C3'" . C   C 3 29  ? 53.972  11.497  -19.797 1.00 49.48  ? 28  C   D "C3'" 1 
ATOM   1274 O "O3'" . C   C 3 29  ? 53.575  10.155  -20.012 1.00 52.51  ? 28  C   D "O3'" 1 
ATOM   1275 C "C2'" . C   C 3 29  ? 55.160  11.572  -18.847 1.00 47.06  ? 28  C   D "C2'" 1 
ATOM   1276 O "O2'" . C   C 3 29  ? 56.117  10.543  -19.002 1.00 47.06  ? 28  C   D "O2'" 1 
ATOM   1277 C "C1'" . C   C 3 29  ? 55.755  12.921  -19.233 1.00 44.73  ? 28  C   D "C1'" 1 
ATOM   1278 N N1    . C   C 3 29  ? 55.179  14.020  -18.443 1.00 42.84  ? 28  C   D N1    1 
ATOM   1279 C C2    . C   C 3 29  ? 55.767  14.324  -17.225 1.00 38.52  ? 28  C   D C2    1 
ATOM   1280 O O2    . C   C 3 29  ? 56.711  13.638  -16.843 1.00 37.65  ? 28  C   D O2    1 
ATOM   1281 N N3    . C   C 3 29  ? 55.288  15.351  -16.490 1.00 40.62  ? 28  C   D N3    1 
ATOM   1282 C C4    . C   C 3 29  ? 54.252  16.059  -16.934 1.00 42.90  ? 28  C   D C4    1 
ATOM   1283 N N4    . C   C 3 29  ? 53.824  17.075  -16.182 1.00 42.79  ? 28  C   D N4    1 
ATOM   1284 C C5    . C   C 3 29  ? 53.609  15.756  -18.175 1.00 42.86  ? 28  C   D C5    1 
ATOM   1285 C C6    . C   C 3 29  ? 54.098  14.736  -18.888 1.00 39.01  ? 28  C   D C6    1 
ATOM   1286 P P     . G   C 3 30  ? 52.409  9.526   -19.110 1.00 54.42  ? 29  G   D P     1 
ATOM   1287 O OP1   . G   C 3 30  ? 52.275  8.094   -19.489 1.00 52.88  ? 29  G   D OP1   1 
ATOM   1288 O OP2   . G   C 3 30  ? 51.229  10.426  -19.197 1.00 57.42  ? 29  G   D OP2   1 
ATOM   1289 O "O5'" . G   C 3 30  ? 52.944  9.673   -17.612 1.00 54.59  ? 29  G   D "O5'" 1 
ATOM   1290 C "C5'" . G   C 3 30  ? 53.640  8.610   -16.970 1.00 52.60  ? 29  G   D "C5'" 1 
ATOM   1291 C "C4'" . G   C 3 30  ? 54.399  9.119   -15.762 1.00 50.47  ? 29  G   D "C4'" 1 
ATOM   1292 O "O4'" . G   C 3 30  ? 54.770  10.513  -15.907 1.00 49.34  ? 29  G   D "O4'" 1 
ATOM   1293 C "C3'" . G   C 3 30  ? 53.669  9.150   -14.433 1.00 48.64  ? 29  G   D "C3'" 1 
ATOM   1294 O "O3'" . G   C 3 30  ? 53.437  7.855   -13.899 1.00 50.80  ? 29  G   D "O3'" 1 
ATOM   1295 C "C2'" . G   C 3 30  ? 54.638  9.978   -13.602 1.00 48.82  ? 29  G   D "C2'" 1 
ATOM   1296 O "O2'" . G   C 3 30  ? 55.810  9.293   -13.188 1.00 47.37  ? 29  G   D "O2'" 1 
ATOM   1297 C "C1'" . G   C 3 30  ? 55.012  11.060  -14.614 1.00 47.02  ? 29  G   D "C1'" 1 
ATOM   1298 N N9    . G   C 3 30  ? 54.222  12.277  -14.443 1.00 45.07  ? 29  G   D N9    1 
ATOM   1299 C C8    . G   C 3 30  ? 53.285  12.801  -15.301 1.00 43.05  ? 29  G   D C8    1 
ATOM   1300 N N7    . G   C 3 30  ? 52.747  13.904  -14.856 1.00 44.39  ? 29  G   D N7    1 
ATOM   1301 C C5    . G   C 3 30  ? 53.367  14.125  -13.630 1.00 44.94  ? 29  G   D C5    1 
ATOM   1302 C C6    . G   C 3 30  ? 53.196  15.168  -12.686 1.00 45.45  ? 29  G   D C6    1 
ATOM   1303 O O6    . G   C 3 30  ? 52.435  16.142  -12.743 1.00 50.55  ? 29  G   D O6    1 
ATOM   1304 N N1    . G   C 3 30  ? 54.025  15.005  -11.586 1.00 43.62  ? 29  G   D N1    1 
ATOM   1305 C C2    . G   C 3 30  ? 54.905  13.971  -11.412 1.00 44.19  ? 29  G   D C2    1 
ATOM   1306 N N2    . G   C 3 30  ? 55.624  13.986  -10.279 1.00 43.90  ? 29  G   D N2    1 
ATOM   1307 N N3    . G   C 3 30  ? 55.074  12.993  -12.280 1.00 43.01  ? 29  G   D N3    1 
ATOM   1308 C C4    . G   C 3 30  ? 54.279  13.133  -13.360 1.00 44.78  ? 29  G   D C4    1 
ATOM   1309 P P     . C   C 3 31  ? 52.089  7.570   -13.073 1.00 52.70  ? 30  C   D P     1 
ATOM   1310 O OP1   . C   C 3 31  ? 51.914  6.099   -13.010 1.00 50.77  ? 30  C   D OP1   1 
ATOM   1311 O OP2   . C   C 3 31  ? 51.003  8.413   -13.645 1.00 54.35  ? 30  C   D OP2   1 
ATOM   1312 O "O5'" . C   C 3 31  ? 52.405  8.125   -11.605 1.00 52.35  ? 30  C   D "O5'" 1 
ATOM   1313 C "C5'" . C   C 3 31  ? 53.611  7.780   -10.936 1.00 48.11  ? 30  C   D "C5'" 1 
ATOM   1314 C "C4'" . C   C 3 31  ? 53.869  8.717   -9.772  1.00 48.07  ? 30  C   D "C4'" 1 
ATOM   1315 O "O4'" . C   C 3 31  ? 54.008  10.084  -10.218 1.00 44.52  ? 30  C   D "O4'" 1 
ATOM   1316 C "C3'" . C   C 3 31  ? 52.815  8.793   -8.683  1.00 47.28  ? 30  C   D "C3'" 1 
ATOM   1317 O "O3'" . C   C 3 31  ? 52.976  7.682   -7.805  1.00 50.79  ? 30  C   D "O3'" 1 
ATOM   1318 C "C2'" . C   C 3 31  ? 53.166  10.105  -7.984  1.00 45.33  ? 30  C   D "C2'" 1 
ATOM   1319 O "O2'" . C   C 3 31  ? 54.164  9.986   -6.991  1.00 44.65  ? 30  C   D "O2'" 1 
ATOM   1320 C "C1'" . C   C 3 31  ? 53.667  10.962  -9.152  1.00 43.66  ? 30  C   D "C1'" 1 
ATOM   1321 N N1    . C   C 3 31  ? 52.660  11.929  -9.635  1.00 40.65  ? 30  C   D N1    1 
ATOM   1322 C C2    . C   C 3 31  ? 52.441  13.102  -8.905  1.00 40.11  ? 30  C   D C2    1 
ATOM   1323 O O2    . C   C 3 31  ? 53.088  13.294  -7.858  1.00 40.17  ? 30  C   D O2    1 
ATOM   1324 N N3    . C   C 3 31  ? 51.527  13.999  -9.354  1.00 40.70  ? 30  C   D N3    1 
ATOM   1325 C C4    . C   C 3 31  ? 50.844  13.753  -10.476 1.00 40.07  ? 30  C   D C4    1 
ATOM   1326 N N4    . C   C 3 31  ? 49.952  14.662  -10.882 1.00 38.34  ? 30  C   D N4    1 
ATOM   1327 C C5    . C   C 3 31  ? 51.043  12.565  -11.232 1.00 40.31  ? 30  C   D C5    1 
ATOM   1328 C C6    . C   C 3 31  ? 51.949  11.688  -10.781 1.00 41.48  ? 30  C   D C6    1 
ATOM   1329 N N     . ALA D 4 1   ? -12.280 7.073   12.952  1.00 45.49  ? 1   ALA A N     1 
ATOM   1330 C CA    . ALA D 4 1   ? -11.450 6.563   14.083  1.00 44.15  ? 1   ALA A CA    1 
ATOM   1331 C C     . ALA D 4 1   ? -10.201 7.420   14.257  1.00 43.64  ? 1   ALA A C     1 
ATOM   1332 O O     . ALA D 4 1   ? -9.642  7.943   13.288  1.00 42.86  ? 1   ALA A O     1 
ATOM   1333 C CB    . ALA D 4 1   ? -11.055 5.111   13.829  1.00 43.50  ? 1   ALA A CB    1 
ATOM   1334 N N     . THR D 4 2   ? -9.764  7.562   15.497  1.00 40.95  ? 2   THR A N     1 
ATOM   1335 C CA    . THR D 4 2   ? -8.582  8.353   15.786  1.00 41.25  ? 2   THR A CA    1 
ATOM   1336 C C     . THR D 4 2   ? -7.537  7.457   16.425  1.00 39.76  ? 2   THR A C     1 
ATOM   1337 O O     . THR D 4 2   ? -7.829  6.750   17.376  1.00 40.56  ? 2   THR A O     1 
ATOM   1338 C CB    . THR D 4 2   ? -8.934  9.519   16.738  1.00 42.33  ? 2   THR A CB    1 
ATOM   1339 O OG1   . THR D 4 2   ? -9.755  10.464  16.039  1.00 42.25  ? 2   THR A OG1   1 
ATOM   1340 C CG2   . THR D 4 2   ? -7.669  10.214  17.243  1.00 42.68  ? 2   THR A CG2   1 
ATOM   1341 N N     . TRP D 4 3   ? -6.324  7.450   15.889  1.00 39.21  ? 3   TRP A N     1 
ATOM   1342 C CA    . TRP D 4 3   ? -5.291  6.613   16.477  1.00 37.93  ? 3   TRP A CA    1 
ATOM   1343 C C     . TRP D 4 3   ? -4.230  7.480   17.116  1.00 37.87  ? 3   TRP A C     1 
ATOM   1344 O O     . TRP D 4 3   ? -3.854  8.522   16.575  1.00 36.52  ? 3   TRP A O     1 
ATOM   1345 C CB    . TRP D 4 3   ? -4.637  5.699   15.442  1.00 35.89  ? 3   TRP A CB    1 
ATOM   1346 C CG    . TRP D 4 3   ? -5.537  4.623   14.876  1.00 36.68  ? 3   TRP A CG    1 
ATOM   1347 C CD1   . TRP D 4 3   ? -6.664  4.805   14.118  1.00 36.75  ? 3   TRP A CD1   1 
ATOM   1348 C CD2   . TRP D 4 3   ? -5.321  3.204   14.932  1.00 35.81  ? 3   TRP A CD2   1 
ATOM   1349 N NE1   . TRP D 4 3   ? -7.155  3.590   13.693  1.00 37.73  ? 3   TRP A NE1   1 
ATOM   1350 C CE2   . TRP D 4 3   ? -6.351  2.592   14.178  1.00 38.45  ? 3   TRP A CE2   1 
ATOM   1351 C CE3   . TRP D 4 3   ? -4.356  2.390   15.542  1.00 35.10  ? 3   TRP A CE3   1 
ATOM   1352 C CZ2   . TRP D 4 3   ? -6.439  1.201   14.019  1.00 36.07  ? 3   TRP A CZ2   1 
ATOM   1353 C CZ3   . TRP D 4 3   ? -4.443  1.016   15.383  1.00 35.50  ? 3   TRP A CZ3   1 
ATOM   1354 C CH2   . TRP D 4 3   ? -5.477  0.432   14.626  1.00 36.53  ? 3   TRP A CH2   1 
ATOM   1355 N N     . THR D 4 4   ? -3.757  7.037   18.277  1.00 37.52  ? 4   THR A N     1 
ATOM   1356 C CA    . THR D 4 4   ? -2.734  7.750   19.012  1.00 37.48  ? 4   THR A CA    1 
ATOM   1357 C C     . THR D 4 4   ? -1.435  6.964   19.065  1.00 38.99  ? 4   THR A C     1 
ATOM   1358 O O     . THR D 4 4   ? -1.423  5.776   19.403  1.00 40.25  ? 4   THR A O     1 
ATOM   1359 C CB    . THR D 4 4   ? -3.192  8.039   20.453  1.00 37.27  ? 4   THR A CB    1 
ATOM   1360 O OG1   . THR D 4 4   ? -4.405  8.806   20.422  1.00 38.30  ? 4   THR A OG1   1 
ATOM   1361 C CG2   . THR D 4 4   ? -2.111  8.816   21.209  1.00 30.76  ? 4   THR A CG2   1 
ATOM   1362 N N     . CYS D 4 5   ? -0.338  7.626   18.718  1.00 39.35  ? 5   CYS A N     1 
ATOM   1363 C CA    . CYS D 4 5   ? 0.965   6.982   18.765  1.00 40.91  ? 5   CYS A CA    1 
ATOM   1364 C C     . CYS D 4 5   ? 1.840   7.773   19.710  1.00 40.21  ? 5   CYS A C     1 
ATOM   1365 O O     . CYS D 4 5   ? 1.685   8.982   19.834  1.00 39.01  ? 5   CYS A O     1 
ATOM   1366 C CB    . CYS D 4 5   ? 1.642   6.954   17.392  1.00 40.50  ? 5   CYS A CB    1 
ATOM   1367 S SG    . CYS D 4 5   ? 0.825   6.017   16.054  1.00 44.45  ? 5   CYS A SG    1 
ATOM   1368 N N     . ILE D 4 6   ? 2.751   7.075   20.375  1.00 39.33  ? 6   ILE A N     1 
ATOM   1369 C CA    . ILE D 4 6   ? 3.689   7.694   21.305  1.00 40.22  ? 6   ILE A CA    1 
ATOM   1370 C C     . ILE D 4 6   ? 5.042   7.507   20.661  1.00 39.87  ? 6   ILE A C     1 
ATOM   1371 O O     . ILE D 4 6   ? 5.455   6.383   20.394  1.00 41.60  ? 6   ILE A O     1 
ATOM   1372 C CB    . ILE D 4 6   ? 3.701   6.976   22.688  1.00 42.75  ? 6   ILE A CB    1 
ATOM   1373 C CG1   . ILE D 4 6   ? 2.281   6.901   23.259  1.00 40.86  ? 6   ILE A CG1   1 
ATOM   1374 C CG2   . ILE D 4 6   ? 4.636   7.705   23.650  1.00 40.82  ? 6   ILE A CG2   1 
ATOM   1375 C CD1   . ILE D 4 6   ? 1.619   8.260   23.463  1.00 44.34  ? 6   ILE A CD1   1 
ATOM   1376 N N     . ASN D 4 7   ? 5.730   8.606   20.394  1.00 39.75  ? 7   ASN A N     1 
ATOM   1377 C CA    . ASN D 4 7   ? 7.031   8.527   19.762  1.00 38.83  ? 7   ASN A CA    1 
ATOM   1378 C C     . ASN D 4 7   ? 8.048   9.307   20.568  1.00 40.28  ? 7   ASN A C     1 
ATOM   1379 O O     . ASN D 4 7   ? 7.815   10.460  20.928  1.00 41.77  ? 7   ASN A O     1 
ATOM   1380 C CB    . ASN D 4 7   ? 6.969   9.095   18.346  1.00 32.54  ? 7   ASN A CB    1 
ATOM   1381 C CG    . ASN D 4 7   ? 8.291   8.991   17.628  1.00 27.43  ? 7   ASN A CG    1 
ATOM   1382 O OD1   . ASN D 4 7   ? 8.784   9.963   17.070  1.00 33.06  ? 7   ASN A OD1   1 
ATOM   1383 N ND2   . ASN D 4 7   ? 8.877   7.804   17.633  1.00 31.76  ? 7   ASN A ND2   1 
ATOM   1384 N N     . GLN D 4 8   ? 9.185   8.693   20.852  1.00 40.08  ? 8   GLN A N     1 
ATOM   1385 C CA    . GLN D 4 8   ? 10.189  9.410   21.618  1.00 42.09  ? 8   GLN A CA    1 
ATOM   1386 C C     . GLN D 4 8   ? 11.049  10.265  20.696  1.00 39.62  ? 8   GLN A C     1 
ATOM   1387 O O     . GLN D 4 8   ? 11.595  9.783   19.705  1.00 39.89  ? 8   GLN A O     1 
ATOM   1388 C CB    . GLN D 4 8   ? 11.036  8.422   22.426  1.00 43.81  ? 8   GLN A CB    1 
ATOM   1389 C CG    . GLN D 4 8   ? 10.298  7.899   23.640  1.00 46.95  ? 8   GLN A CG    1 
ATOM   1390 C CD    . GLN D 4 8   ? 11.059  6.823   24.386  1.00 51.64  ? 8   GLN A CD    1 
ATOM   1391 O OE1   . GLN D 4 8   ? 12.232  6.996   24.732  1.00 53.77  ? 8   GLN A OE1   1 
ATOM   1392 N NE2   . GLN D 4 8   ? 10.388  5.703   24.653  1.00 52.16  ? 8   GLN A NE2   1 
ATOM   1393 N N     . GLN D 4 9   ? 11.155  11.543  21.028  1.00 38.99  ? 9   GLN A N     1 
ATOM   1394 C CA    . GLN D 4 9   ? 11.922  12.472  20.221  1.00 39.70  ? 9   GLN A CA    1 
ATOM   1395 C C     . GLN D 4 9   ? 12.955  13.224  21.047  1.00 38.07  ? 9   GLN A C     1 
ATOM   1396 O O     . GLN D 4 9   ? 12.667  13.697  22.142  1.00 37.12  ? 9   GLN A O     1 
ATOM   1397 C CB    . GLN D 4 9   ? 10.955  13.421  19.495  1.00 38.53  ? 9   GLN A CB    1 
ATOM   1398 C CG    . GLN D 4 9   ? 10.049  12.631  18.563  1.00 38.08  ? 9   GLN A CG    1 
ATOM   1399 C CD    . GLN D 4 9   ? 9.071   13.469  17.775  1.00 38.02  ? 9   GLN A CD    1 
ATOM   1400 O OE1   . GLN D 4 9   ? 8.203   12.926  17.103  1.00 34.90  ? 9   GLN A OE1   1 
ATOM   1401 N NE2   . GLN D 4 9   ? 9.202   14.790  17.852  1.00 37.83  ? 9   GLN A NE2   1 
ATOM   1402 N N     . LEU D 4 10  ? 14.168  13.311  20.511  1.00 38.14  ? 10  LEU A N     1 
ATOM   1403 C CA    . LEU D 4 10  ? 15.283  13.953  21.206  1.00 39.17  ? 10  LEU A CA    1 
ATOM   1404 C C     . LEU D 4 10  ? 15.180  15.468  21.326  1.00 39.23  ? 10  LEU A C     1 
ATOM   1405 O O     . LEU D 4 10  ? 14.889  16.159  20.367  1.00 40.43  ? 10  LEU A O     1 
ATOM   1406 C CB    . LEU D 4 10  ? 16.607  13.544  20.532  1.00 36.90  ? 10  LEU A CB    1 
ATOM   1407 C CG    . LEU D 4 10  ? 17.913  14.008  21.199  1.00 40.46  ? 10  LEU A CG    1 
ATOM   1408 C CD1   . LEU D 4 10  ? 17.905  13.664  22.695  1.00 36.53  ? 10  LEU A CD1   1 
ATOM   1409 C CD2   . LEU D 4 10  ? 19.112  13.351  20.521  1.00 39.91  ? 10  LEU A CD2   1 
ATOM   1410 N N     . ASN D 4 11  ? 15.412  15.977  22.528  1.00 40.60  ? 11  ASN A N     1 
ATOM   1411 C CA    . ASN D 4 11  ? 15.361  17.409  22.792  1.00 41.33  ? 11  ASN A CA    1 
ATOM   1412 C C     . ASN D 4 11  ? 16.792  17.933  22.661  1.00 43.29  ? 11  ASN A C     1 
ATOM   1413 O O     . ASN D 4 11  ? 17.678  17.504  23.387  1.00 42.92  ? 11  ASN A O     1 
ATOM   1414 C CB    . ASN D 4 11  ? 14.846  17.623  24.208  1.00 42.38  ? 11  ASN A CB    1 
ATOM   1415 C CG    . ASN D 4 11  ? 14.653  19.070  24.542  1.00 42.33  ? 11  ASN A CG    1 
ATOM   1416 O OD1   . ASN D 4 11  ? 15.407  19.927  24.103  1.00 44.95  ? 11  ASN A OD1   1 
ATOM   1417 N ND2   . ASN D 4 11  ? 13.641  19.358  25.338  1.00 38.26  ? 11  ASN A ND2   1 
ATOM   1418 N N     . PRO D 4 12  ? 17.042  18.857  21.721  1.00 44.36  ? 12  PRO A N     1 
ATOM   1419 C CA    . PRO D 4 12  ? 18.402  19.391  21.545  1.00 45.98  ? 12  PRO A CA    1 
ATOM   1420 C C     . PRO D 4 12  ? 18.920  20.239  22.707  1.00 47.08  ? 12  PRO A C     1 
ATOM   1421 O O     . PRO D 4 12  ? 20.112  20.512  22.798  1.00 47.63  ? 12  PRO A O     1 
ATOM   1422 C CB    . PRO D 4 12  ? 18.292  20.206  20.268  1.00 44.18  ? 12  PRO A CB    1 
ATOM   1423 C CG    . PRO D 4 12  ? 16.879  20.676  20.301  1.00 43.17  ? 12  PRO A CG    1 
ATOM   1424 C CD    . PRO D 4 12  ? 16.113  19.454  20.750  1.00 44.36  ? 12  PRO A CD    1 
ATOM   1425 N N     . LYS D 4 13  ? 18.021  20.672  23.581  1.00 49.73  ? 13  LYS A N     1 
ATOM   1426 C CA    . LYS D 4 13  ? 18.407  21.503  24.718  1.00 52.92  ? 13  LYS A CA    1 
ATOM   1427 C C     . LYS D 4 13  ? 18.811  20.651  25.903  1.00 54.22  ? 13  LYS A C     1 
ATOM   1428 O O     . LYS D 4 13  ? 19.972  20.672  26.359  1.00 55.76  ? 13  LYS A O     1 
ATOM   1429 C CB    . LYS D 4 13  ? 17.233  22.398  25.120  1.00 54.57  ? 13  LYS A CB    1 
ATOM   1430 C CG    . LYS D 4 13  ? 17.257  23.810  24.557  1.00 54.87  ? 13  LYS A CG    1 
ATOM   1431 C CD    . LYS D 4 13  ? 16.260  24.680  25.314  1.00 56.52  ? 13  LYS A CD    1 
ATOM   1432 C CE    . LYS D 4 13  ? 16.405  26.165  24.983  1.00 59.05  ? 13  LYS A CE    1 
ATOM   1433 N NZ    . LYS D 4 13  ? 15.931  26.520  23.620  1.00 59.05  ? 13  LYS A NZ    1 
ATOM   1434 N N     . THR D 4 14  ? 17.833  19.895  26.396  1.00 53.58  ? 14  THR A N     1 
ATOM   1435 C CA    . THR D 4 14  ? 18.009  19.030  27.572  1.00 50.67  ? 14  THR A CA    1 
ATOM   1436 C C     . THR D 4 14  ? 18.796  17.777  27.221  1.00 50.23  ? 14  THR A C     1 
ATOM   1437 O O     . THR D 4 14  ? 19.469  17.157  28.062  1.00 50.32  ? 14  THR A O     1 
ATOM   1438 C CB    . THR D 4 14  ? 16.612  18.647  28.135  1.00 50.83  ? 14  THR A CB    1 
ATOM   1439 O OG1   . THR D 4 14  ? 15.928  17.822  27.181  1.00 51.19  ? 14  THR A OG1   1 
ATOM   1440 C CG2   . THR D 4 14  ? 15.785  19.886  28.372  1.00 48.96  ? 14  THR A CG2   1 
ATOM   1441 N N     . ASN D 4 15  ? 18.753  17.481  25.933  1.00 48.25  ? 15  ASN A N     1 
ATOM   1442 C CA    . ASN D 4 15  ? 19.378  16.331  25.340  1.00 45.02  ? 15  ASN A CA    1 
ATOM   1443 C C     . ASN D 4 15  ? 18.781  15.047  25.866  1.00 42.60  ? 15  ASN A C     1 
ATOM   1444 O O     . ASN D 4 15  ? 19.430  14.006  25.857  1.00 42.44  ? 15  ASN A O     1 
ATOM   1445 C CB    . ASN D 4 15  ? 20.871  16.307  25.555  1.00 47.07  ? 15  ASN A CB    1 
ATOM   1446 C CG    . ASN D 4 15  ? 21.511  15.299  24.678  1.00 51.01  ? 15  ASN A CG    1 
ATOM   1447 O OD1   . ASN D 4 15  ? 21.180  15.193  23.475  1.00 50.58  ? 15  ASN A OD1   1 
ATOM   1448 N ND2   . ASN D 4 15  ? 22.421  14.516  25.252  1.00 51.68  ? 15  ASN A ND2   1 
ATOM   1449 N N     . LYS D 4 16  ? 17.544  15.141  26.338  1.00 39.81  ? 16  LYS A N     1 
ATOM   1450 C CA    . LYS D 4 16  ? 16.831  13.974  26.839  1.00 39.81  ? 16  LYS A CA    1 
ATOM   1451 C C     . LYS D 4 16  ? 15.760  13.562  25.824  1.00 40.37  ? 16  LYS A C     1 
ATOM   1452 O O     . LYS D 4 16  ? 15.205  14.413  25.128  1.00 38.67  ? 16  LYS A O     1 
ATOM   1453 C CB    . LYS D 4 16  ? 16.141  14.275  28.177  1.00 39.44  ? 16  LYS A CB    1 
ATOM   1454 C CG    . LYS D 4 16  ? 17.071  14.755  29.305  1.00 42.36  ? 16  LYS A CG    1 
ATOM   1455 C CD    . LYS D 4 16  ? 16.302  15.450  30.447  1.00 40.35  ? 16  LYS A CD    1 
ATOM   1456 C CE    . LYS D 4 16  ? 15.555  14.476  31.357  1.00 42.65  ? 16  LYS A CE    1 
ATOM   1457 N NZ    . LYS D 4 16  ? 14.869  15.179  32.497  1.00 38.82  ? 16  LYS A NZ    1 
ATOM   1458 N N     . TRP D 4 17  ? 15.487  12.260  25.735  1.00 39.97  ? 17  TRP A N     1 
ATOM   1459 C CA    . TRP D 4 17  ? 14.466  11.738  24.825  1.00 39.89  ? 17  TRP A CA    1 
ATOM   1460 C C     . TRP D 4 17  ? 13.112  11.945  25.462  1.00 38.82  ? 17  TRP A C     1 
ATOM   1461 O O     . TRP D 4 17  ? 12.851  11.362  26.492  1.00 40.46  ? 17  TRP A O     1 
ATOM   1462 C CB    . TRP D 4 17  ? 14.676  10.244  24.581  1.00 38.95  ? 17  TRP A CB    1 
ATOM   1463 C CG    . TRP D 4 17  ? 15.789  9.959   23.684  1.00 41.14  ? 17  TRP A CG    1 
ATOM   1464 C CD1   . TRP D 4 17  ? 17.080  9.720   24.031  1.00 42.69  ? 17  TRP A CD1   1 
ATOM   1465 C CD2   . TRP D 4 17  ? 15.747  9.964   22.254  1.00 43.56  ? 17  TRP A CD2   1 
ATOM   1466 N NE1   . TRP D 4 17  ? 17.858  9.578   22.903  1.00 43.83  ? 17  TRP A NE1   1 
ATOM   1467 C CE2   . TRP D 4 17  ? 17.061  9.726   21.798  1.00 44.52  ? 17  TRP A CE2   1 
ATOM   1468 C CE3   . TRP D 4 17  ? 14.725  10.154  21.312  1.00 45.37  ? 17  TRP A CE3   1 
ATOM   1469 C CZ2   . TRP D 4 17  ? 17.383  9.671   20.441  1.00 44.74  ? 17  TRP A CZ2   1 
ATOM   1470 C CZ3   . TRP D 4 17  ? 15.044  10.100  19.961  1.00 43.94  ? 17  TRP A CZ3   1 
ATOM   1471 C CH2   . TRP D 4 17  ? 16.363  9.860   19.539  1.00 45.31  ? 17  TRP A CH2   1 
ATOM   1472 N N     . GLU D 4 18  ? 12.244  12.743  24.844  1.00 40.84  ? 18  GLU A N     1 
ATOM   1473 C CA    . GLU D 4 18  ? 10.922  13.020  25.405  1.00 43.40  ? 18  GLU A CA    1 
ATOM   1474 C C     . GLU D 4 18  ? 9.756   12.377  24.663  1.00 44.20  ? 18  GLU A C     1 
ATOM   1475 O O     . GLU D 4 18  ? 9.824   12.163  23.458  1.00 45.41  ? 18  GLU A O     1 
ATOM   1476 C CB    . GLU D 4 18  ? 10.705  14.528  25.462  1.00 47.06  ? 18  GLU A CB    1 
ATOM   1477 C CG    . GLU D 4 18  ? 11.911  15.281  25.982  1.00 52.13  ? 18  GLU A CG    1 
ATOM   1478 C CD    . GLU D 4 18  ? 11.656  16.765  26.101  1.00 56.79  ? 18  GLU A CD    1 
ATOM   1479 O OE1   . GLU D 4 18  ? 11.022  17.328  25.183  1.00 58.39  ? 18  GLU A OE1   1 
ATOM   1480 O OE2   . GLU D 4 18  ? 12.097  17.366  27.107  1.00 60.68  ? 18  GLU A OE2   1 
ATOM   1481 N N     . ASP D 4 19  ? 8.679   12.081  25.386  1.00 43.95  ? 19  ASP A N     1 
ATOM   1482 C CA    . ASP D 4 19  ? 7.509   11.463  24.779  1.00 44.12  ? 19  ASP A CA    1 
ATOM   1483 C C     . ASP D 4 19  ? 6.717   12.459  23.961  1.00 44.73  ? 19  ASP A C     1 
ATOM   1484 O O     . ASP D 4 19  ? 6.493   13.589  24.384  1.00 45.12  ? 19  ASP A O     1 
ATOM   1485 C CB    . ASP D 4 19  ? 6.586   10.873  25.841  1.00 46.27  ? 19  ASP A CB    1 
ATOM   1486 C CG    . ASP D 4 19  ? 7.073   9.541   26.371  1.00 47.84  ? 19  ASP A CG    1 
ATOM   1487 O OD1   . ASP D 4 19  ? 6.354   8.943   27.198  1.00 51.10  ? 19  ASP A OD1   1 
ATOM   1488 O OD2   . ASP D 4 19  ? 8.162   9.089   25.967  1.00 49.38  ? 19  ASP A OD2   1 
ATOM   1489 N N     . LYS D 4 20  ? 6.300   12.036  22.775  1.00 43.54  ? 20  LYS A N     1 
ATOM   1490 C CA    . LYS D 4 20  ? 5.502   12.890  21.912  1.00 43.19  ? 20  LYS A CA    1 
ATOM   1491 C C     . LYS D 4 20  ? 4.279   12.091  21.503  1.00 41.64  ? 20  LYS A C     1 
ATOM   1492 O O     . LYS D 4 20  ? 4.388   10.948  21.055  1.00 36.96  ? 20  LYS A O     1 
ATOM   1493 C CB    . LYS D 4 20  ? 6.305   13.316  20.687  1.00 44.34  ? 20  LYS A CB    1 
ATOM   1494 C CG    . LYS D 4 20  ? 7.445   14.249  21.008  1.00 46.86  ? 20  LYS A CG    1 
ATOM   1495 C CD    . LYS D 4 20  ? 6.929   15.630  21.381  1.00 50.30  ? 20  LYS A CD    1 
ATOM   1496 C CE    . LYS D 4 20  ? 8.085   16.603  21.577  1.00 52.50  ? 20  LYS A CE    1 
ATOM   1497 N NZ    . LYS D 4 20  ? 7.625   18.018  21.660  1.00 54.69  ? 20  LYS A NZ    1 
ATOM   1498 N N     . ARG D 4 21  ? 3.112   12.694  21.693  1.00 41.94  ? 21  ARG A N     1 
ATOM   1499 C CA    . ARG D 4 21  ? 1.853   12.058  21.358  1.00 43.11  ? 21  ARG A CA    1 
ATOM   1500 C C     . ARG D 4 21  ? 1.455   12.527  19.966  1.00 41.69  ? 21  ARG A C     1 
ATOM   1501 O O     . ARG D 4 21  ? 1.605   13.703  19.642  1.00 43.29  ? 21  ARG A O     1 
ATOM   1502 C CB    . ARG D 4 21  ? 0.811   12.430  22.410  1.00 46.07  ? 21  ARG A CB    1 
ATOM   1503 C CG    . ARG D 4 21  ? 1.114   11.783  23.759  1.00 51.49  ? 21  ARG A CG    1 
ATOM   1504 C CD    . ARG D 4 21  ? 0.398   12.451  24.924  1.00 56.42  ? 21  ARG A CD    1 
ATOM   1505 N NE    . ARG D 4 21  ? 1.001   13.736  25.290  1.00 61.81  ? 21  ARG A NE    1 
ATOM   1506 C CZ    . ARG D 4 21  ? 2.221   13.883  25.810  1.00 64.84  ? 21  ARG A CZ    1 
ATOM   1507 N NH1   . ARG D 4 21  ? 2.993   12.823  26.031  1.00 64.70  ? 21  ARG A NH1   1 
ATOM   1508 N NH2   . ARG D 4 21  ? 2.669   15.097  26.120  1.00 64.75  ? 21  ARG A NH2   1 
ATOM   1509 N N     . LEU D 4 22  ? 0.964   11.600  19.146  1.00 38.51  ? 22  LEU A N     1 
ATOM   1510 C CA    . LEU D 4 22  ? 0.595   11.908  17.762  1.00 37.27  ? 22  LEU A CA    1 
ATOM   1511 C C     . LEU D 4 22  ? -0.722  11.265  17.353  1.00 36.36  ? 22  LEU A C     1 
ATOM   1512 O O     . LEU D 4 22  ? -0.905  10.048  17.465  1.00 34.76  ? 22  LEU A O     1 
ATOM   1513 C CB    . LEU D 4 22  ? 1.716   11.450  16.826  1.00 33.68  ? 22  LEU A CB    1 
ATOM   1514 C CG    . LEU D 4 22  ? 3.123   11.953  17.177  1.00 32.96  ? 22  LEU A CG    1 
ATOM   1515 C CD1   . LEU D 4 22  ? 4.141   11.164  16.371  1.00 32.12  ? 22  LEU A CD1   1 
ATOM   1516 C CD2   . LEU D 4 22  ? 3.252   13.447  16.902  1.00 28.47  ? 22  LEU A CD2   1 
ATOM   1517 N N     . LEU D 4 23  ? -1.633  12.102  16.873  1.00 37.66  ? 23  LEU A N     1 
ATOM   1518 C CA    . LEU D 4 23  ? -2.964  11.659  16.459  1.00 38.46  ? 23  LEU A CA    1 
ATOM   1519 C C     . LEU D 4 23  ? -3.083  11.513  14.946  1.00 39.03  ? 23  LEU A C     1 
ATOM   1520 O O     . LEU D 4 23  ? -2.641  12.389  14.197  1.00 40.83  ? 23  LEU A O     1 
ATOM   1521 C CB    . LEU D 4 23  ? -4.021  12.663  16.940  1.00 38.79  ? 23  LEU A CB    1 
ATOM   1522 C CG    . LEU D 4 23  ? -4.057  13.067  18.418  1.00 37.95  ? 23  LEU A CG    1 
ATOM   1523 C CD1   . LEU D 4 23  ? -5.159  14.103  18.614  1.00 37.36  ? 23  LEU A CD1   1 
ATOM   1524 C CD2   . LEU D 4 23  ? -4.311  11.858  19.299  1.00 38.48  ? 23  LEU A CD2   1 
ATOM   1525 N N     . TYR D 4 24  ? -3.699  10.420  14.504  1.00 39.45  ? 24  TYR A N     1 
ATOM   1526 C CA    . TYR D 4 24  ? -3.894  10.169  13.075  1.00 39.33  ? 24  TYR A CA    1 
ATOM   1527 C C     . TYR D 4 24  ? -5.322  9.736   12.782  1.00 40.50  ? 24  TYR A C     1 
ATOM   1528 O O     . TYR D 4 24  ? -5.926  8.981   13.551  1.00 40.48  ? 24  TYR A O     1 
ATOM   1529 C CB    . TYR D 4 24  ? -2.962  9.067   12.570  1.00 36.78  ? 24  TYR A CB    1 
ATOM   1530 C CG    . TYR D 4 24  ? -1.509  9.247   12.919  1.00 36.22  ? 24  TYR A CG    1 
ATOM   1531 C CD1   . TYR D 4 24  ? -1.063  9.083   14.233  1.00 38.17  ? 24  TYR A CD1   1 
ATOM   1532 C CD2   . TYR D 4 24  ? -0.574  9.592   11.947  1.00 34.83  ? 24  TYR A CD2   1 
ATOM   1533 C CE1   . TYR D 4 24  ? 0.270   9.263   14.566  1.00 33.26  ? 24  TYR A CE1   1 
ATOM   1534 C CE2   . TYR D 4 24  ? 0.768   9.775   12.274  1.00 30.99  ? 24  TYR A CE2   1 
ATOM   1535 C CZ    . TYR D 4 24  ? 1.179   9.609   13.592  1.00 31.80  ? 24  TYR A CZ    1 
ATOM   1536 O OH    . TYR D 4 24  ? 2.497   9.803   13.941  1.00 27.32  ? 24  TYR A OH    1 
ATOM   1537 N N     . SER D 4 25  ? -5.860  10.223  11.670  1.00 41.29  ? 25  SER A N     1 
ATOM   1538 C CA    . SER D 4 25  ? -7.207  9.859   11.236  1.00 41.97  ? 25  SER A CA    1 
ATOM   1539 C C     . SER D 4 25  ? -7.061  8.532   10.491  1.00 40.79  ? 25  SER A C     1 
ATOM   1540 O O     . SER D 4 25  ? -6.173  8.396   9.645   1.00 40.36  ? 25  SER A O     1 
ATOM   1541 C CB    . SER D 4 25  ? -7.758  10.931  10.287  1.00 42.99  ? 25  SER A CB    1 
ATOM   1542 O OG    . SER D 4 25  ? -8.838  10.423  9.527   1.00 48.02  ? 25  SER A OG    1 
ATOM   1543 N N     . GLN D 4 26  ? -7.915  7.557   10.792  1.00 39.30  ? 26  GLN A N     1 
ATOM   1544 C CA    . GLN D 4 26  ? -7.810  6.270   10.121  1.00 38.25  ? 26  GLN A CA    1 
ATOM   1545 C C     . GLN D 4 26  ? -8.168  6.397   8.648   1.00 39.03  ? 26  GLN A C     1 
ATOM   1546 O O     . GLN D 4 26  ? -7.526  5.790   7.789   1.00 37.71  ? 26  GLN A O     1 
ATOM   1547 C CB    . GLN D 4 26  ? -8.718  5.217   10.774  1.00 38.10  ? 26  GLN A CB    1 
ATOM   1548 C CG    . GLN D 4 26  ? -8.421  3.804   10.269  1.00 37.87  ? 26  GLN A CG    1 
ATOM   1549 C CD    . GLN D 4 26  ? -9.237  2.730   10.963  1.00 37.91  ? 26  GLN A CD    1 
ATOM   1550 O OE1   . GLN D 4 26  ? -9.341  2.707   12.185  1.00 41.49  ? 26  GLN A OE1   1 
ATOM   1551 N NE2   . GLN D 4 26  ? -9.805  1.822   10.184  1.00 37.43  ? 26  GLN A NE2   1 
ATOM   1552 N N     . ALA D 4 27  ? -9.197  7.189   8.358   1.00 38.96  ? 27  ALA A N     1 
ATOM   1553 C CA    . ALA D 4 27  ? -9.628  7.378   6.981   1.00 39.17  ? 27  ALA A CA    1 
ATOM   1554 C C     . ALA D 4 27  ? -8.464  7.882   6.145   1.00 38.26  ? 27  ALA A C     1 
ATOM   1555 O O     . ALA D 4 27  ? -8.177  7.345   5.078   1.00 38.83  ? 27  ALA A O     1 
ATOM   1556 C CB    . ALA D 4 27  ? -10.788 8.368   6.925   1.00 40.21  ? 27  ALA A CB    1 
ATOM   1557 N N     . LYS D 4 28  ? -7.789  8.915   6.638   1.00 38.27  ? 28  LYS A N     1 
ATOM   1558 C CA    . LYS D 4 28  ? -6.661  9.476   5.915   1.00 37.92  ? 28  LYS A CA    1 
ATOM   1559 C C     . LYS D 4 28  ? -5.571  8.436   5.705   1.00 39.24  ? 28  LYS A C     1 
ATOM   1560 O O     . LYS D 4 28  ? -4.996  8.350   4.619   1.00 39.43  ? 28  LYS A O     1 
ATOM   1561 C CB    . LYS D 4 28  ? -6.108  10.688  6.657   1.00 37.09  ? 28  LYS A CB    1 
ATOM   1562 C CG    . LYS D 4 28  ? -7.112  11.818  6.731   1.00 40.00  ? 28  LYS A CG    1 
ATOM   1563 C CD    . LYS D 4 28  ? -6.478  13.098  7.222   1.00 42.65  ? 28  LYS A CD    1 
ATOM   1564 C CE    . LYS D 4 28  ? -7.520  14.188  7.395   1.00 44.95  ? 28  LYS A CE    1 
ATOM   1565 N NZ    . LYS D 4 28  ? -6.886  15.477  7.777   1.00 48.23  ? 28  LYS A NZ    1 
ATOM   1566 N N     . ALA D 4 29  ? -5.306  7.644   6.747   1.00 38.21  ? 29  ALA A N     1 
ATOM   1567 C CA    . ALA D 4 29  ? -4.300  6.593   6.700   1.00 36.72  ? 29  ALA A CA    1 
ATOM   1568 C C     . ALA D 4 29  ? -4.636  5.521   5.654   1.00 35.65  ? 29  ALA A C     1 
ATOM   1569 O O     . ALA D 4 29  ? -3.749  5.014   4.963   1.00 32.99  ? 29  ALA A O     1 
ATOM   1570 C CB    . ALA D 4 29  ? -4.144  5.959   8.082   1.00 34.63  ? 29  ALA A CB    1 
ATOM   1571 N N     . GLU D 4 30  ? -5.911  5.171   5.545   1.00 36.83  ? 30  GLU A N     1 
ATOM   1572 C CA    . GLU D 4 30  ? -6.324  4.172   4.566   1.00 39.02  ? 30  GLU A CA    1 
ATOM   1573 C C     . GLU D 4 30  ? -6.164  4.793   3.194   1.00 38.23  ? 30  GLU A C     1 
ATOM   1574 O O     . GLU D 4 30  ? -5.717  4.142   2.255   1.00 40.63  ? 30  GLU A O     1 
ATOM   1575 C CB    . GLU D 4 30  ? -7.784  3.776   4.777   1.00 41.96  ? 30  GLU A CB    1 
ATOM   1576 C CG    . GLU D 4 30  ? -8.046  3.060   6.067   1.00 46.86  ? 30  GLU A CG    1 
ATOM   1577 C CD    . GLU D 4 30  ? -9.480  2.609   6.173   1.00 51.85  ? 30  GLU A CD    1 
ATOM   1578 O OE1   . GLU D 4 30  ? -9.895  1.782   5.327   1.00 52.89  ? 30  GLU A OE1   1 
ATOM   1579 O OE2   . GLU D 4 30  ? -10.191 3.080   7.095   1.00 52.57  ? 30  GLU A OE2   1 
ATOM   1580 N N     . SER D 4 31  ? -6.537  6.066   3.097   1.00 38.35  ? 31  SER A N     1 
ATOM   1581 C CA    . SER D 4 31  ? -6.434  6.812   1.851   1.00 39.16  ? 31  SER A CA    1 
ATOM   1582 C C     . SER D 4 31  ? -4.974  6.827   1.425   1.00 39.10  ? 31  SER A C     1 
ATOM   1583 O O     . SER D 4 31  ? -4.651  6.677   0.239   1.00 40.81  ? 31  SER A O     1 
ATOM   1584 C CB    . SER D 4 31  ? -6.957  8.234   2.055   1.00 39.27  ? 31  SER A CB    1 
ATOM   1585 O OG    . SER D 4 31  ? -6.703  9.037   0.925   1.00 40.86  ? 31  SER A OG    1 
ATOM   1586 N N     . ASN D 4 32  ? -4.090  6.990   2.403   1.00 36.58  ? 32  ASN A N     1 
ATOM   1587 C CA    . ASN D 4 32  ? -2.665  6.987   2.132   1.00 35.29  ? 32  ASN A CA    1 
ATOM   1588 C C     . ASN D 4 32  ? -2.280  5.657   1.467   1.00 34.17  ? 32  ASN A C     1 
ATOM   1589 O O     . ASN D 4 32  ? -1.540  5.643   0.482   1.00 33.00  ? 32  ASN A O     1 
ATOM   1590 C CB    . ASN D 4 32  ? -1.870  7.134   3.432   1.00 36.00  ? 32  ASN A CB    1 
ATOM   1591 C CG    . ASN D 4 32  ? -1.952  8.528   4.032   1.00 37.35  ? 32  ASN A CG    1 
ATOM   1592 O OD1   . ASN D 4 32  ? -1.719  8.700   5.237   1.00 30.65  ? 32  ASN A OD1   1 
ATOM   1593 N ND2   . ASN D 4 32  ? -2.263  9.531   3.202   1.00 33.46  ? 32  ASN A ND2   1 
ATOM   1594 N N     . SER D 4 33  ? -2.783  4.543   1.997   1.00 32.62  ? 33  SER A N     1 
ATOM   1595 C CA    . SER D 4 33  ? -2.440  3.246   1.428   1.00 35.80  ? 33  SER A CA    1 
ATOM   1596 C C     . SER D 4 33  ? -3.099  3.000   0.070   1.00 37.69  ? 33  SER A C     1 
ATOM   1597 O O     . SER D 4 33  ? -2.547  2.270   -0.766  1.00 34.83  ? 33  SER A O     1 
ATOM   1598 C CB    . SER D 4 33  ? -2.781  2.098   2.394   1.00 35.61  ? 33  SER A CB    1 
ATOM   1599 O OG    . SER D 4 33  ? -4.170  1.862   2.482   1.00 36.74  ? 33  SER A OG    1 
ATOM   1600 N N     . HIS D 4 34  ? -4.275  3.590   -0.147  1.00 37.94  ? 34  HIS A N     1 
ATOM   1601 C CA    . HIS D 4 34  ? -4.949  3.429   -1.440  1.00 40.39  ? 34  HIS A CA    1 
ATOM   1602 C C     . HIS D 4 34  ? -4.133  4.122   -2.531  1.00 39.51  ? 34  HIS A C     1 
ATOM   1603 O O     . HIS D 4 34  ? -3.893  3.549   -3.586  1.00 42.17  ? 34  HIS A O     1 
ATOM   1604 C CB    . HIS D 4 34  ? -6.363  4.039   -1.428  1.00 39.62  ? 34  HIS A CB    1 
ATOM   1605 C CG    . HIS D 4 34  ? -7.311  3.376   -0.475  1.00 37.88  ? 34  HIS A CG    1 
ATOM   1606 N ND1   . HIS D 4 34  ? -7.382  2.008   -0.322  1.00 38.41  ? 34  HIS A ND1   1 
ATOM   1607 C CD2   . HIS D 4 34  ? -8.229  3.896   0.375   1.00 37.95  ? 34  HIS A CD2   1 
ATOM   1608 C CE1   . HIS D 4 34  ? -8.296  1.712   0.585   1.00 37.20  ? 34  HIS A CE1   1 
ATOM   1609 N NE2   . HIS D 4 34  ? -8.824  2.841   1.024   1.00 37.21  ? 34  HIS A NE2   1 
ATOM   1610 N N     . HIS D 4 35  ? -3.688  5.347   -2.264  1.00 40.14  ? 35  HIS A N     1 
ATOM   1611 C CA    . HIS D 4 35  ? -2.929  6.110   -3.249  1.00 39.23  ? 35  HIS A CA    1 
ATOM   1612 C C     . HIS D 4 35  ? -1.517  5.614   -3.444  1.00 41.26  ? 35  HIS A C     1 
ATOM   1613 O O     . HIS D 4 35  ? -0.888  5.916   -4.459  1.00 42.23  ? 35  HIS A O     1 
ATOM   1614 C CB    . HIS D 4 35  ? -2.874  7.580   -2.863  1.00 40.59  ? 35  HIS A CB    1 
ATOM   1615 C CG    . HIS D 4 35  ? -4.218  8.199   -2.626  1.00 42.99  ? 35  HIS A CG    1 
ATOM   1616 N ND1   . HIS D 4 35  ? -4.372  9.420   -2.002  1.00 39.86  ? 35  HIS A ND1   1 
ATOM   1617 C CD2   . HIS D 4 35  ? -5.469  7.755   -2.899  1.00 40.11  ? 35  HIS A CD2   1 
ATOM   1618 C CE1   . HIS D 4 35  ? -5.659  9.698   -1.895  1.00 39.23  ? 35  HIS A CE1   1 
ATOM   1619 N NE2   . HIS D 4 35  ? -6.345  8.703   -2.431  1.00 40.92  ? 35  HIS A NE2   1 
ATOM   1620 N N     . ALA D 4 36  ? -0.986  4.882   -2.472  1.00 40.31  ? 36  ALA A N     1 
ATOM   1621 C CA    . ALA D 4 36  ? 0.368   4.369   -2.632  1.00 40.34  ? 36  ALA A CA    1 
ATOM   1622 C C     . ALA D 4 36  ? 0.280   3.252   -3.667  1.00 40.78  ? 36  ALA A C     1 
ATOM   1623 O O     . ALA D 4 36  ? -0.733  2.568   -3.743  1.00 40.24  ? 36  ALA A O     1 
ATOM   1624 C CB    . ALA D 4 36  ? 0.899   3.822   -1.305  1.00 39.35  ? 36  ALA A CB    1 
ATOM   1625 N N     . PRO D 4 37  ? 1.327   3.065   -4.489  1.00 42.09  ? 37  PRO A N     1 
ATOM   1626 C CA    . PRO D 4 37  ? 1.291   1.998   -5.498  1.00 44.99  ? 37  PRO A CA    1 
ATOM   1627 C C     . PRO D 4 37  ? 1.360   0.624   -4.835  1.00 46.07  ? 37  PRO A C     1 
ATOM   1628 O O     . PRO D 4 37  ? 1.764   0.510   -3.678  1.00 46.32  ? 37  PRO A O     1 
ATOM   1629 C CB    . PRO D 4 37  ? 2.525   2.289   -6.353  1.00 44.09  ? 37  PRO A CB    1 
ATOM   1630 C CG    . PRO D 4 37  ? 3.464   2.891   -5.384  1.00 42.67  ? 37  PRO A CG    1 
ATOM   1631 C CD    . PRO D 4 37  ? 2.571   3.842   -4.602  1.00 41.38  ? 37  PRO A CD    1 
ATOM   1632 N N     . LEU D 4 38  ? 0.978   -0.416  -5.572  1.00 46.57  ? 38  LEU A N     1 
ATOM   1633 C CA    . LEU D 4 38  ? 0.980   -1.769  -5.030  1.00 46.32  ? 38  LEU A CA    1 
ATOM   1634 C C     . LEU D 4 38  ? 2.207   -2.585  -5.413  1.00 46.86  ? 38  LEU A C     1 
ATOM   1635 O O     . LEU D 4 38  ? 2.108   -3.595  -6.107  1.00 46.35  ? 38  LEU A O     1 
ATOM   1636 C CB    . LEU D 4 38  ? -0.296  -2.515  -5.451  1.00 45.94  ? 38  LEU A CB    1 
ATOM   1637 C CG    . LEU D 4 38  ? -0.570  -3.899  -4.852  1.00 45.68  ? 38  LEU A CG    1 
ATOM   1638 C CD1   . LEU D 4 38  ? -0.601  -3.832  -3.331  1.00 44.42  ? 38  LEU A CD1   1 
ATOM   1639 C CD2   . LEU D 4 38  ? -1.899  -4.408  -5.372  1.00 45.64  ? 38  LEU A CD2   1 
ATOM   1640 N N     . SER D 4 39  ? 3.368   -2.128  -4.958  1.00 45.63  ? 39  SER A N     1 
ATOM   1641 C CA    . SER D 4 39  ? 4.613   -2.828  -5.206  1.00 45.08  ? 39  SER A CA    1 
ATOM   1642 C C     . SER D 4 39  ? 5.373   -2.932  -3.879  1.00 44.43  ? 39  SER A C     1 
ATOM   1643 O O     . SER D 4 39  ? 5.090   -2.202  -2.931  1.00 43.56  ? 39  SER A O     1 
ATOM   1644 C CB    . SER D 4 39  ? 5.449   -2.089  -6.251  1.00 44.43  ? 39  SER A CB    1 
ATOM   1645 O OG    . SER D 4 39  ? 5.797   -0.788  -5.823  1.00 52.05  ? 39  SER A OG    1 
ATOM   1646 N N     . ASP D 4 40  ? 6.327   -3.848  -3.810  1.00 44.57  ? 40  ASP A N     1 
ATOM   1647 C CA    . ASP D 4 40  ? 7.099   -4.033  -2.595  1.00 44.44  ? 40  ASP A CA    1 
ATOM   1648 C C     . ASP D 4 40  ? 8.477   -3.397  -2.672  1.00 45.19  ? 40  ASP A C     1 
ATOM   1649 O O     . ASP D 4 40  ? 9.432   -4.030  -3.114  1.00 46.56  ? 40  ASP A O     1 
ATOM   1650 C CB    . ASP D 4 40  ? 7.253   -5.525  -2.288  1.00 45.39  ? 40  ASP A CB    1 
ATOM   1651 C CG    . ASP D 4 40  ? 8.258   -5.786  -1.176  1.00 47.70  ? 40  ASP A CG    1 
ATOM   1652 O OD1   . ASP D 4 40  ? 8.359   -4.928  -0.260  1.00 44.58  ? 40  ASP A OD1   1 
ATOM   1653 O OD2   . ASP D 4 40  ? 8.935   -6.842  -1.210  1.00 47.70  ? 40  ASP A OD2   1 
ATOM   1654 N N     . GLY D 4 41  ? 8.586   -2.153  -2.224  1.00 44.15  ? 41  GLY A N     1 
ATOM   1655 C CA    . GLY D 4 41  ? 9.866   -1.469  -2.252  1.00 44.14  ? 41  GLY A CA    1 
ATOM   1656 C C     . GLY D 4 41  ? 10.492  -1.311  -3.631  1.00 46.44  ? 41  GLY A C     1 
ATOM   1657 O O     . GLY D 4 41  ? 11.663  -1.623  -3.824  1.00 49.30  ? 41  GLY A O     1 
ATOM   1658 N N     . LYS D 4 42  ? 9.726   -0.823  -4.599  1.00 46.93  ? 42  LYS A N     1 
ATOM   1659 C CA    . LYS D 4 42  ? 10.256  -0.639  -5.942  1.00 48.21  ? 42  LYS A CA    1 
ATOM   1660 C C     . LYS D 4 42  ? 10.090  0.802   -6.380  1.00 47.38  ? 42  LYS A C     1 
ATOM   1661 O O     . LYS D 4 42  ? 10.142  1.115   -7.560  1.00 48.92  ? 42  LYS A O     1 
ATOM   1662 C CB    . LYS D 4 42  ? 9.559   -1.587  -6.921  1.00 49.57  ? 42  LYS A CB    1 
ATOM   1663 C CG    . LYS D 4 42  ? 9.847   -3.060  -6.621  1.00 51.23  ? 42  LYS A CG    1 
ATOM   1664 C CD    . LYS D 4 42  ? 11.340  -3.354  -6.699  1.00 53.04  ? 42  LYS A CD    1 
ATOM   1665 C CE    . LYS D 4 42  ? 11.695  -4.704  -6.073  1.00 57.12  ? 42  LYS A CE    1 
ATOM   1666 N NZ    . LYS D 4 42  ? 11.605  -4.696  -4.574  1.00 54.96  ? 42  LYS A NZ    1 
ATOM   1667 N N     . THR D 4 43  ? 9.886   1.677   -5.406  1.00 48.34  ? 43  THR A N     1 
ATOM   1668 C CA    . THR D 4 43  ? 9.735   3.100   -5.658  1.00 46.22  ? 43  THR A CA    1 
ATOM   1669 C C     . THR D 4 43  ? 11.077  3.741   -5.355  1.00 45.45  ? 43  THR A C     1 
ATOM   1670 O O     . THR D 4 43  ? 11.974  3.090   -4.815  1.00 46.44  ? 43  THR A O     1 
ATOM   1671 C CB    . THR D 4 43  ? 8.694   3.719   -4.736  1.00 46.82  ? 43  THR A CB    1 
ATOM   1672 O OG1   . THR D 4 43  ? 9.028   3.400   -3.374  1.00 45.59  ? 43  THR A OG1   1 
ATOM   1673 C CG2   . THR D 4 43  ? 7.301   3.203   -5.082  1.00 41.96  ? 43  THR A CG2   1 
ATOM   1674 N N     . GLY D 4 44  ? 11.217  5.011   -5.708  1.00 44.29  ? 44  GLY A N     1 
ATOM   1675 C CA    . GLY D 4 44  ? 12.468  5.693   -5.454  1.00 43.47  ? 44  GLY A CA    1 
ATOM   1676 C C     . GLY D 4 44  ? 12.740  5.792   -3.971  1.00 42.54  ? 44  GLY A C     1 
ATOM   1677 O O     . GLY D 4 44  ? 13.894  5.795   -3.545  1.00 41.87  ? 44  GLY A O     1 
ATOM   1678 N N     . SER D 4 45  ? 11.670  5.855   -3.183  1.00 41.76  ? 45  SER A N     1 
ATOM   1679 C CA    . SER D 4 45  ? 11.789  5.979   -1.735  1.00 40.28  ? 45  SER A CA    1 
ATOM   1680 C C     . SER D 4 45  ? 11.938  4.642   -1.023  1.00 41.69  ? 45  SER A C     1 
ATOM   1681 O O     . SER D 4 45  ? 12.422  4.599   0.111   1.00 42.01  ? 45  SER A O     1 
ATOM   1682 C CB    . SER D 4 45  ? 10.571  6.709   -1.163  1.00 38.61  ? 45  SER A CB    1 
ATOM   1683 O OG    . SER D 4 45  ? 9.446   5.849   -1.089  1.00 36.57  ? 45  SER A OG    1 
ATOM   1684 N N     . SER D 4 46  ? 11.509  3.572   -1.693  1.00 41.04  ? 46  SER A N     1 
ATOM   1685 C CA    . SER D 4 46  ? 11.539  2.197   -1.185  1.00 41.38  ? 46  SER A CA    1 
ATOM   1686 C C     . SER D 4 46  ? 10.242  1.890   -0.440  1.00 40.70  ? 46  SER A C     1 
ATOM   1687 O O     . SER D 4 46  ? 10.053  0.783   0.073   1.00 41.22  ? 46  SER A O     1 
ATOM   1688 C CB    . SER D 4 46  ? 12.744  1.936   -0.261  1.00 44.07  ? 46  SER A CB    1 
ATOM   1689 O OG    . SER D 4 46  ? 12.500  2.367   1.072   1.00 46.65  ? 46  SER A OG    1 
ATOM   1690 N N     . TYR D 4 47  ? 9.357   2.881   -0.387  1.00 38.22  ? 47  TYR A N     1 
ATOM   1691 C CA    . TYR D 4 47  ? 8.058   2.746   0.258   1.00 37.56  ? 47  TYR A CA    1 
ATOM   1692 C C     . TYR D 4 47  ? 6.959   2.724   -0.797  1.00 37.44  ? 47  TYR A C     1 
ATOM   1693 O O     . TYR D 4 47  ? 6.972   3.533   -1.725  1.00 38.39  ? 47  TYR A O     1 
ATOM   1694 C CB    . TYR D 4 47  ? 7.793   3.926   1.192   1.00 38.59  ? 47  TYR A CB    1 
ATOM   1695 C CG    . TYR D 4 47  ? 8.570   3.886   2.472   1.00 38.64  ? 47  TYR A CG    1 
ATOM   1696 C CD1   . TYR D 4 47  ? 8.264   2.955   3.467   1.00 35.60  ? 47  TYR A CD1   1 
ATOM   1697 C CD2   . TYR D 4 47  ? 9.616   4.776   2.695   1.00 38.29  ? 47  TYR A CD2   1 
ATOM   1698 C CE1   . TYR D 4 47  ? 8.975   2.912   4.651   1.00 37.07  ? 47  TYR A CE1   1 
ATOM   1699 C CE2   . TYR D 4 47  ? 10.348  4.739   3.887   1.00 40.50  ? 47  TYR A CE2   1 
ATOM   1700 C CZ    . TYR D 4 47  ? 10.017  3.806   4.854   1.00 39.46  ? 47  TYR A CZ    1 
ATOM   1701 O OH    . TYR D 4 47  ? 10.721  3.778   6.029   1.00 42.85  ? 47  TYR A OH    1 
ATOM   1702 N N     . PRO D 4 48  ? 5.966   1.836   -0.639  1.00 36.47  ? 48  PRO A N     1 
ATOM   1703 C CA    . PRO D 4 48  ? 5.883   0.903   0.488   1.00 36.98  ? 48  PRO A CA    1 
ATOM   1704 C C     . PRO D 4 48  ? 6.697   -0.369  0.274   1.00 36.10  ? 48  PRO A C     1 
ATOM   1705 O O     . PRO D 4 48  ? 7.188   -0.642  -0.823  1.00 36.08  ? 48  PRO A O     1 
ATOM   1706 C CB    . PRO D 4 48  ? 4.386   0.615   0.580   1.00 36.81  ? 48  PRO A CB    1 
ATOM   1707 C CG    . PRO D 4 48  ? 3.974   0.603   -0.872  1.00 38.59  ? 48  PRO A CG    1 
ATOM   1708 C CD    . PRO D 4 48  ? 4.726   1.805   -1.443  1.00 37.82  ? 48  PRO A CD    1 
ATOM   1709 N N     . HIS D 4 49  ? 6.852   -1.136  1.340   1.00 35.13  ? 49  HIS A N     1 
ATOM   1710 C CA    . HIS D 4 49  ? 7.563   -2.393  1.267   1.00 36.05  ? 49  HIS A CA    1 
ATOM   1711 C C     . HIS D 4 49  ? 7.068   -3.303  2.371   1.00 36.48  ? 49  HIS A C     1 
ATOM   1712 O O     . HIS D 4 49  ? 6.205   -2.930  3.177   1.00 34.25  ? 49  HIS A O     1 
ATOM   1713 C CB    . HIS D 4 49  ? 9.097   -2.228  1.347   1.00 36.27  ? 49  HIS A CB    1 
ATOM   1714 C CG    . HIS D 4 49  ? 9.589   -1.621  2.623   1.00 36.38  ? 49  HIS A CG    1 
ATOM   1715 N ND1   . HIS D 4 49  ? 9.886   -0.282  2.744   1.00 38.32  ? 49  HIS A ND1   1 
ATOM   1716 C CD2   . HIS D 4 49  ? 9.822   -2.169  3.840   1.00 37.73  ? 49  HIS A CD2   1 
ATOM   1717 C CE1   . HIS D 4 49  ? 10.280  -0.028  3.979   1.00 35.66  ? 49  HIS A CE1   1 
ATOM   1718 N NE2   . HIS D 4 49  ? 10.249  -1.156  4.665   1.00 38.57  ? 49  HIS A NE2   1 
ATOM   1719 N N     . TRP D 4 50  ? 7.642   -4.497  2.384   1.00 36.21  ? 50  TRP A N     1 
ATOM   1720 C CA    . TRP D 4 50  ? 7.282   -5.556  3.288   1.00 36.35  ? 50  TRP A CA    1 
ATOM   1721 C C     . TRP D 4 50  ? 7.580   -5.362  4.765   1.00 36.93  ? 50  TRP A C     1 
ATOM   1722 O O     . TRP D 4 50  ? 8.716   -5.102  5.163   1.00 37.31  ? 50  TRP A O     1 
ATOM   1723 C CB    . TRP D 4 50  ? 7.920   -6.851  2.773   1.00 36.33  ? 50  TRP A CB    1 
ATOM   1724 C CG    . TRP D 4 50  ? 7.595   -8.064  3.564   1.00 35.34  ? 50  TRP A CG    1 
ATOM   1725 C CD1   . TRP D 4 50  ? 6.425   -8.336  4.214   1.00 35.70  ? 50  TRP A CD1   1 
ATOM   1726 C CD2   . TRP D 4 50  ? 8.428   -9.208  3.737   1.00 38.03  ? 50  TRP A CD2   1 
ATOM   1727 N NE1   . TRP D 4 50  ? 6.480   -9.583  4.781   1.00 37.36  ? 50  TRP A NE1   1 
ATOM   1728 C CE2   . TRP D 4 50  ? 7.699   -10.144 4.502   1.00 38.17  ? 50  TRP A CE2   1 
ATOM   1729 C CE3   . TRP D 4 50  ? 9.726   -9.537  3.320   1.00 39.59  ? 50  TRP A CE3   1 
ATOM   1730 C CZ2   . TRP D 4 50  ? 8.224   -11.389 4.860   1.00 39.84  ? 50  TRP A CZ2   1 
ATOM   1731 C CZ3   . TRP D 4 50  ? 10.247  -10.771 3.674   1.00 40.98  ? 50  TRP A CZ3   1 
ATOM   1732 C CH2   . TRP D 4 50  ? 9.494   -11.683 4.440   1.00 40.69  ? 50  TRP A CH2   1 
ATOM   1733 N N     . PHE D 4 51  ? 6.517   -5.488  5.558   1.00 37.65  ? 51  PHE A N     1 
ATOM   1734 C CA    . PHE D 4 51  ? 6.557   -5.393  7.014   1.00 38.91  ? 51  PHE A CA    1 
ATOM   1735 C C     . PHE D 4 51  ? 6.450   -6.851  7.493   1.00 39.62  ? 51  PHE A C     1 
ATOM   1736 O O     . PHE D 4 51  ? 5.359   -7.408  7.605   1.00 40.64  ? 51  PHE A O     1 
ATOM   1737 C CB    . PHE D 4 51  ? 5.366   -4.573  7.517   1.00 36.47  ? 51  PHE A CB    1 
ATOM   1738 C CG    . PHE D 4 51  ? 5.235   -4.549  9.014   1.00 37.53  ? 51  PHE A CG    1 
ATOM   1739 C CD1   . PHE D 4 51  ? 6.129   -3.831  9.793   1.00 38.65  ? 51  PHE A CD1   1 
ATOM   1740 C CD2   . PHE D 4 51  ? 4.232   -5.270  9.646   1.00 36.83  ? 51  PHE A CD2   1 
ATOM   1741 C CE1   . PHE D 4 51  ? 6.025   -3.834  11.186  1.00 40.91  ? 51  PHE A CE1   1 
ATOM   1742 C CE2   . PHE D 4 51  ? 4.119   -5.280  11.037  1.00 39.52  ? 51  PHE A CE2   1 
ATOM   1743 C CZ    . PHE D 4 51  ? 5.017   -4.560  11.808  1.00 39.30  ? 51  PHE A CZ    1 
ATOM   1744 N N     . THR D 4 52  ? 7.595   -7.468  7.753   1.00 40.17  ? 52  THR A N     1 
ATOM   1745 C CA    . THR D 4 52  ? 7.650   -8.865  8.169   1.00 43.51  ? 52  THR A CA    1 
ATOM   1746 C C     . THR D 4 52  ? 6.783   -9.216  9.379   1.00 43.70  ? 52  THR A C     1 
ATOM   1747 O O     . THR D 4 52  ? 6.213   -10.306 9.440   1.00 42.23  ? 52  THR A O     1 
ATOM   1748 C CB    . THR D 4 52  ? 9.088   -9.283  8.500   1.00 42.87  ? 52  THR A CB    1 
ATOM   1749 O OG1   . THR D 4 52  ? 9.461   -8.710  9.758   1.00 46.16  ? 52  THR A OG1   1 
ATOM   1750 C CG2   . THR D 4 52  ? 10.050  -8.807  7.429   1.00 39.65  ? 52  THR A CG2   1 
ATOM   1751 N N     . ASN D 4 53  ? 6.702   -8.298  10.339  1.00 42.82  ? 53  ASN A N     1 
ATOM   1752 C CA    . ASN D 4 53  ? 5.922   -8.511  11.558  1.00 42.82  ? 53  ASN A CA    1 
ATOM   1753 C C     . ASN D 4 53  ? 6.510   -9.695  12.320  1.00 44.26  ? 53  ASN A C     1 
ATOM   1754 O O     . ASN D 4 53  ? 5.797   -10.410 13.031  1.00 45.56  ? 53  ASN A O     1 
ATOM   1755 C CB    . ASN D 4 53  ? 4.443   -8.776  11.222  1.00 41.98  ? 53  ASN A CB    1 
ATOM   1756 C CG    . ASN D 4 53  ? 3.510   -8.548  12.415  1.00 39.53  ? 53  ASN A CG    1 
ATOM   1757 O OD1   . ASN D 4 53  ? 3.806   -7.757  13.318  1.00 38.42  ? 53  ASN A OD1   1 
ATOM   1758 N ND2   . ASN D 4 53  ? 2.367   -9.225  12.408  1.00 36.11  ? 53  ASN A ND2   1 
ATOM   1759 N N     . GLY D 4 54  ? 7.815   -9.899  12.139  1.00 45.27  ? 54  GLY A N     1 
ATOM   1760 C CA    . GLY D 4 54  ? 8.524   -10.974 12.810  1.00 45.38  ? 54  GLY A CA    1 
ATOM   1761 C C     . GLY D 4 54  ? 8.589   -12.315 12.102  1.00 48.55  ? 54  GLY A C     1 
ATOM   1762 O O     . GLY D 4 54  ? 9.090   -13.278 12.677  1.00 50.09  ? 54  GLY A O     1 
ATOM   1763 N N     . TYR D 4 55  ? 8.093   -12.398 10.869  1.00 49.17  ? 55  TYR A N     1 
ATOM   1764 C CA    . TYR D 4 55  ? 8.113   -13.658 10.128  1.00 49.96  ? 55  TYR A CA    1 
ATOM   1765 C C     . TYR D 4 55  ? 9.070   -13.640 8.943   1.00 49.60  ? 55  TYR A C     1 
ATOM   1766 O O     . TYR D 4 55  ? 9.611   -12.600 8.580   1.00 48.90  ? 55  TYR A O     1 
ATOM   1767 C CB    . TYR D 4 55  ? 6.722   -13.977 9.587   1.00 51.46  ? 55  TYR A CB    1 
ATOM   1768 C CG    . TYR D 4 55  ? 5.655   -14.154 10.634  1.00 55.27  ? 55  TYR A CG    1 
ATOM   1769 C CD1   . TYR D 4 55  ? 5.437   -15.395 11.237  1.00 55.41  ? 55  TYR A CD1   1 
ATOM   1770 C CD2   . TYR D 4 55  ? 4.845   -13.083 11.011  1.00 55.26  ? 55  TYR A CD2   1 
ATOM   1771 C CE1   . TYR D 4 55  ? 4.433   -15.560 12.184  1.00 56.67  ? 55  TYR A CE1   1 
ATOM   1772 C CE2   . TYR D 4 55  ? 3.844   -13.239 11.956  1.00 55.93  ? 55  TYR A CE2   1 
ATOM   1773 C CZ    . TYR D 4 55  ? 3.642   -14.476 12.536  1.00 55.80  ? 55  TYR A CZ    1 
ATOM   1774 O OH    . TYR D 4 55  ? 2.645   -14.622 13.461  1.00 57.63  ? 55  TYR A OH    1 
ATOM   1775 N N     . ASP D 4 56  ? 9.275   -14.811 8.350   1.00 51.22  ? 56  ASP A N     1 
ATOM   1776 C CA    . ASP D 4 56  ? 10.110  -14.931 7.165   1.00 52.40  ? 56  ASP A CA    1 
ATOM   1777 C C     . ASP D 4 56  ? 9.157   -15.179 6.000   1.00 52.52  ? 56  ASP A C     1 
ATOM   1778 O O     . ASP D 4 56  ? 7.945   -15.281 6.202   1.00 51.66  ? 56  ASP A O     1 
ATOM   1779 C CB    . ASP D 4 56  ? 11.122  -16.081 7.291   1.00 54.66  ? 56  ASP A CB    1 
ATOM   1780 C CG    . ASP D 4 56  ? 10.484  -17.407 7.684   1.00 56.09  ? 56  ASP A CG    1 
ATOM   1781 O OD1   . ASP D 4 56  ? 9.450   -17.798 7.091   1.00 55.54  ? 56  ASP A OD1   1 
ATOM   1782 O OD2   . ASP D 4 56  ? 11.050  -18.071 8.583   1.00 55.82  ? 56  ASP A OD2   1 
ATOM   1783 N N     . GLY D 4 57  ? 9.696   -15.275 4.792   1.00 51.89  ? 57  GLY A N     1 
ATOM   1784 C CA    . GLY D 4 57  ? 8.858   -15.488 3.632   1.00 53.70  ? 57  GLY A CA    1 
ATOM   1785 C C     . GLY D 4 57  ? 7.963   -16.712 3.647   1.00 56.62  ? 57  GLY A C     1 
ATOM   1786 O O     . GLY D 4 57  ? 6.967   -16.741 2.932   1.00 57.90  ? 57  GLY A O     1 
ATOM   1787 N N     . ASN D 4 58  ? 8.285   -17.719 4.454   1.00 59.58  ? 58  ASN A N     1 
ATOM   1788 C CA    . ASN D 4 58  ? 7.476   -18.940 4.478   1.00 61.02  ? 58  ASN A CA    1 
ATOM   1789 C C     . ASN D 4 58  ? 6.379   -18.985 5.546   1.00 60.63  ? 58  ASN A C     1 
ATOM   1790 O O     . ASN D 4 58  ? 5.778   -20.031 5.775   1.00 62.26  ? 58  ASN A O     1 
ATOM   1791 C CB    . ASN D 4 58  ? 8.383   -20.170 4.632   1.00 62.57  ? 58  ASN A CB    1 
ATOM   1792 C CG    . ASN D 4 58  ? 9.572   -20.151 3.674   1.00 64.60  ? 58  ASN A CG    1 
ATOM   1793 O OD1   . ASN D 4 58  ? 9.422   -19.905 2.469   1.00 63.11  ? 58  ASN A OD1   1 
ATOM   1794 N ND2   . ASN D 4 58  ? 10.763  -20.423 4.208   1.00 63.47  ? 58  ASN A ND2   1 
ATOM   1795 N N     . GLY D 4 59  ? 6.117   -17.860 6.198   1.00 59.70  ? 59  GLY A N     1 
ATOM   1796 C CA    . GLY D 4 59  ? 5.081   -17.831 7.216   1.00 59.11  ? 59  GLY A CA    1 
ATOM   1797 C C     . GLY D 4 59  ? 5.439   -18.502 8.530   1.00 59.97  ? 59  GLY A C     1 
ATOM   1798 O O     . GLY D 4 59  ? 4.552   -18.895 9.285   1.00 60.14  ? 59  GLY A O     1 
ATOM   1799 N N     . LYS D 4 60  ? 6.732   -18.638 8.810   1.00 60.80  ? 60  LYS A N     1 
ATOM   1800 C CA    . LYS D 4 60  ? 7.191   -19.259 10.050  1.00 61.55  ? 60  LYS A CA    1 
ATOM   1801 C C     . LYS D 4 60  ? 7.866   -18.214 10.945  1.00 61.84  ? 60  LYS A C     1 
ATOM   1802 O O     . LYS D 4 60  ? 8.672   -17.412 10.471  1.00 61.38  ? 60  LYS A O     1 
ATOM   1803 C CB    . LYS D 4 60  ? 8.184   -20.386 9.748   1.00 63.65  ? 60  LYS A CB    1 
ATOM   1804 C CG    . LYS D 4 60  ? 7.759   -21.763 10.261  1.00 65.90  ? 60  LYS A CG    1 
ATOM   1805 C CD    . LYS D 4 60  ? 6.786   -22.450 9.309   1.00 67.40  ? 60  LYS A CD    1 
ATOM   1806 C CE    . LYS D 4 60  ? 7.505   -22.995 8.084   1.00 68.78  ? 60  LYS A CE    1 
ATOM   1807 N NZ    . LYS D 4 60  ? 8.356   -21.959 7.411   1.00 71.68  ? 60  LYS A NZ    1 
ATOM   1808 N N     . LEU D 4 61  ? 7.540   -18.234 12.236  1.00 61.65  ? 61  LEU A N     1 
ATOM   1809 C CA    . LEU D 4 61  ? 8.107   -17.286 13.192  1.00 63.09  ? 61  LEU A CA    1 
ATOM   1810 C C     . LEU D 4 61  ? 9.623   -17.185 13.055  1.00 64.48  ? 61  LEU A C     1 
ATOM   1811 O O     . LEU D 4 61  ? 10.270  -18.089 12.529  1.00 65.37  ? 61  LEU A O     1 
ATOM   1812 C CB    . LEU D 4 61  ? 7.743   -17.696 14.621  1.00 61.86  ? 61  LEU A CB    1 
ATOM   1813 C CG    . LEU D 4 61  ? 8.164   -16.764 15.764  1.00 60.59  ? 61  LEU A CG    1 
ATOM   1814 C CD1   . LEU D 4 61  ? 7.593   -15.365 15.564  1.00 58.01  ? 61  LEU A CD1   1 
ATOM   1815 C CD2   . LEU D 4 61  ? 7.677   -17.349 17.078  1.00 61.77  ? 61  LEU A CD2   1 
ATOM   1816 N N     . ILE D 4 62  ? 10.194  -16.088 13.535  1.00 66.10  ? 62  ILE A N     1 
ATOM   1817 C CA    . ILE D 4 62  ? 11.631  -15.911 13.426  1.00 68.42  ? 62  ILE A CA    1 
ATOM   1818 C C     . ILE D 4 62  ? 12.408  -16.326 14.674  1.00 69.54  ? 62  ILE A C     1 
ATOM   1819 O O     . ILE D 4 62  ? 13.631  -16.428 14.636  1.00 71.29  ? 62  ILE A O     1 
ATOM   1820 C CB    . ILE D 4 62  ? 11.977  -14.449 13.060  1.00 68.42  ? 62  ILE A CB    1 
ATOM   1821 C CG1   . ILE D 4 62  ? 13.068  -14.435 11.988  1.00 68.19  ? 62  ILE A CG1   1 
ATOM   1822 C CG2   . ILE D 4 62  ? 12.437  -13.685 14.289  1.00 68.31  ? 62  ILE A CG2   1 
ATOM   1823 C CD1   . ILE D 4 62  ? 12.651  -15.086 10.686  1.00 67.43  ? 62  ILE A CD1   1 
ATOM   1824 N N     . LYS D 4 63  ? 11.700  -16.577 15.771  1.00 71.02  ? 63  LYS A N     1 
ATOM   1825 C CA    . LYS D 4 63  ? 12.335  -16.982 17.026  1.00 71.58  ? 63  LYS A CA    1 
ATOM   1826 C C     . LYS D 4 63  ? 13.063  -15.813 17.666  1.00 70.59  ? 63  LYS A C     1 
ATOM   1827 O O     . LYS D 4 63  ? 14.137  -15.412 17.217  1.00 69.71  ? 63  LYS A O     1 
ATOM   1828 C CB    . LYS D 4 63  ? 13.320  -18.133 16.792  1.00 72.58  ? 63  LYS A CB    1 
ATOM   1829 C CG    . LYS D 4 63  ? 12.660  -19.446 16.420  1.00 74.21  ? 63  LYS A CG    1 
ATOM   1830 C CD    . LYS D 4 63  ? 13.691  -20.501 16.046  1.00 75.61  ? 63  LYS A CD    1 
ATOM   1831 C CE    . LYS D 4 63  ? 13.004  -21.814 15.690  1.00 77.84  ? 63  LYS A CE    1 
ATOM   1832 N NZ    . LYS D 4 63  ? 13.957  -22.888 15.290  1.00 78.06  ? 63  LYS A NZ    1 
ATOM   1833 N N     . GLY D 4 64  ? 12.469  -15.278 18.725  1.00 70.09  ? 64  GLY A N     1 
ATOM   1834 C CA    . GLY D 4 64  ? 13.058  -14.148 19.413  1.00 69.51  ? 64  GLY A CA    1 
ATOM   1835 C C     . GLY D 4 64  ? 12.194  -12.933 19.154  1.00 69.13  ? 64  GLY A C     1 
ATOM   1836 O O     . GLY D 4 64  ? 12.304  -11.906 19.829  1.00 69.45  ? 64  GLY A O     1 
ATOM   1837 N N     . ARG D 4 65  ? 11.315  -13.054 18.170  1.00 66.75  ? 65  ARG A N     1 
ATOM   1838 C CA    . ARG D 4 65  ? 10.440  -11.950 17.835  1.00 65.20  ? 65  ARG A CA    1 
ATOM   1839 C C     . ARG D 4 65  ? 8.979   -12.252 18.119  1.00 61.80  ? 65  ARG A C     1 
ATOM   1840 O O     . ARG D 4 65  ? 8.540   -13.399 18.040  1.00 60.98  ? 65  ARG A O     1 
ATOM   1841 C CB    . ARG D 4 65  ? 10.632  -11.564 16.371  1.00 67.29  ? 65  ARG A CB    1 
ATOM   1842 C CG    . ARG D 4 65  ? 12.013  -10.978 16.087  1.00 70.69  ? 65  ARG A CG    1 
ATOM   1843 C CD    . ARG D 4 65  ? 11.955  -10.079 14.879  1.00 71.79  ? 65  ARG A CD    1 
ATOM   1844 N NE    . ARG D 4 65  ? 10.871  -9.112  15.023  1.00 74.54  ? 65  ARG A NE    1 
ATOM   1845 C CZ    . ARG D 4 65  ? 10.333  -8.431  14.018  1.00 74.13  ? 65  ARG A CZ    1 
ATOM   1846 N NH1   . ARG D 4 65  ? 10.781  -8.608  12.782  1.00 74.08  ? 65  ARG A NH1   1 
ATOM   1847 N NH2   . ARG D 4 65  ? 9.356   -7.563  14.255  1.00 73.33  ? 65  ARG A NH2   1 
ATOM   1848 N N     . THR D 4 66  ? 8.236   -11.208 18.471  1.00 58.56  ? 66  THR A N     1 
ATOM   1849 C CA    . THR D 4 66  ? 6.819   -11.342 18.769  1.00 56.00  ? 66  THR A CA    1 
ATOM   1850 C C     . THR D 4 66  ? 6.036   -10.511 17.762  1.00 54.64  ? 66  THR A C     1 
ATOM   1851 O O     . THR D 4 66  ? 6.135   -9.285  17.749  1.00 51.21  ? 66  THR A O     1 
ATOM   1852 C CB    . THR D 4 66  ? 6.496   -10.837 20.192  1.00 57.69  ? 66  THR A CB    1 
ATOM   1853 O OG1   . THR D 4 66  ? 7.479   -11.328 21.117  1.00 56.65  ? 66  THR A OG1   1 
ATOM   1854 C CG2   . THR D 4 66  ? 5.113   -11.321 20.622  1.00 56.29  ? 66  THR A CG2   1 
ATOM   1855 N N     . PRO D 4 67  ? 5.263   -11.171 16.887  1.00 54.20  ? 67  PRO A N     1 
ATOM   1856 C CA    . PRO D 4 67  ? 4.483   -10.439 15.890  1.00 54.11  ? 67  PRO A CA    1 
ATOM   1857 C C     . PRO D 4 67  ? 3.442   -9.541  16.518  1.00 53.96  ? 67  PRO A C     1 
ATOM   1858 O O     . PRO D 4 67  ? 2.922   -9.834  17.594  1.00 55.38  ? 67  PRO A O     1 
ATOM   1859 C CB    . PRO D 4 67  ? 3.850   -11.550 15.061  1.00 53.77  ? 67  PRO A CB    1 
ATOM   1860 C CG    . PRO D 4 67  ? 4.886   -12.618 15.115  1.00 54.99  ? 67  PRO A CG    1 
ATOM   1861 C CD    . PRO D 4 67  ? 5.268   -12.611 16.578  1.00 54.77  ? 67  PRO A CD    1 
ATOM   1862 N N     . ILE D 4 68  ? 3.150   -8.433  15.849  1.00 52.37  ? 68  ILE A N     1 
ATOM   1863 C CA    . ILE D 4 68  ? 2.139   -7.523  16.343  1.00 49.82  ? 68  ILE A CA    1 
ATOM   1864 C C     . ILE D 4 68  ? 0.811   -8.173  16.017  1.00 50.40  ? 68  ILE A C     1 
ATOM   1865 O O     . ILE D 4 68  ? 0.652   -8.775  14.962  1.00 50.43  ? 68  ILE A O     1 
ATOM   1866 C CB    . ILE D 4 68  ? 2.232   -6.144  15.649  1.00 47.65  ? 68  ILE A CB    1 
ATOM   1867 C CG1   . ILE D 4 68  ? 3.384   -5.346  16.259  1.00 45.01  ? 68  ILE A CG1   1 
ATOM   1868 C CG2   . ILE D 4 68  ? 0.911   -5.390  15.772  1.00 44.47  ? 68  ILE A CG2   1 
ATOM   1869 C CD1   . ILE D 4 68  ? 3.699   -4.070  15.520  1.00 41.82  ? 68  ILE A CD1   1 
ATOM   1870 N N     . LYS D 4 69  ? -0.130  -8.071  16.940  1.00 52.53  ? 69  LYS A N     1 
ATOM   1871 C CA    . LYS D 4 69  ? -1.459  -8.627  16.735  1.00 54.25  ? 69  LYS A CA    1 
ATOM   1872 C C     . LYS D 4 69  ? -2.351  -7.466  16.285  1.00 52.49  ? 69  LYS A C     1 
ATOM   1873 O O     . LYS D 4 69  ? -2.553  -6.499  17.022  1.00 51.81  ? 69  LYS A O     1 
ATOM   1874 C CB    . LYS D 4 69  ? -1.983  -9.222  18.046  1.00 57.63  ? 69  LYS A CB    1 
ATOM   1875 C CG    . LYS D 4 69  ? -3.197  -10.141 17.905  1.00 62.64  ? 69  LYS A CG    1 
ATOM   1876 C CD    . LYS D 4 69  ? -2.834  -11.466 17.230  1.00 66.75  ? 69  LYS A CD    1 
ATOM   1877 C CE    . LYS D 4 69  ? -3.970  -12.491 17.341  1.00 68.34  ? 69  LYS A CE    1 
ATOM   1878 N NZ    . LYS D 4 69  ? -5.254  -12.009 16.746  1.00 67.91  ? 69  LYS A NZ    1 
ATOM   1879 N N     . PHE D 4 70  ? -2.871  -7.553  15.070  1.00 51.66  ? 70  PHE A N     1 
ATOM   1880 C CA    . PHE D 4 70  ? -3.726  -6.499  14.558  1.00 51.75  ? 70  PHE A CA    1 
ATOM   1881 C C     . PHE D 4 70  ? -5.186  -6.780  14.882  1.00 54.90  ? 70  PHE A C     1 
ATOM   1882 O O     . PHE D 4 70  ? -6.038  -5.891  14.780  1.00 56.63  ? 70  PHE A O     1 
ATOM   1883 C CB    . PHE D 4 70  ? -3.515  -6.341  13.049  1.00 49.17  ? 70  PHE A CB    1 
ATOM   1884 C CG    . PHE D 4 70  ? -2.181  -5.739  12.691  1.00 47.58  ? 70  PHE A CG    1 
ATOM   1885 C CD1   . PHE D 4 70  ? -1.937  -4.391  12.901  1.00 46.96  ? 70  PHE A CD1   1 
ATOM   1886 C CD2   . PHE D 4 70  ? -1.151  -6.532  12.194  1.00 47.44  ? 70  PHE A CD2   1 
ATOM   1887 C CE1   . PHE D 4 70  ? -0.692  -3.842  12.628  1.00 46.23  ? 70  PHE A CE1   1 
ATOM   1888 C CE2   . PHE D 4 70  ? 0.098   -5.990  11.919  1.00 46.12  ? 70  PHE A CE2   1 
ATOM   1889 C CZ    . PHE D 4 70  ? 0.326   -4.644  12.137  1.00 45.95  ? 70  PHE A CZ    1 
ATOM   1890 N N     . GLY D 4 71  ? -5.473  -8.013  15.287  1.00 54.88  ? 71  GLY A N     1 
ATOM   1891 C CA    . GLY D 4 71  ? -6.836  -8.361  15.636  1.00 55.45  ? 71  GLY A CA    1 
ATOM   1892 C C     . GLY D 4 71  ? -7.706  -8.699  14.443  1.00 58.24  ? 71  GLY A C     1 
ATOM   1893 O O     . GLY D 4 71  ? -8.930  -8.824  14.574  1.00 58.26  ? 71  GLY A O     1 
ATOM   1894 N N     . LYS D 4 72  ? -7.081  -8.848  13.278  1.00 58.44  ? 72  LYS A N     1 
ATOM   1895 C CA    . LYS D 4 72  ? -7.809  -9.186  12.063  1.00 57.89  ? 72  LYS A CA    1 
ATOM   1896 C C     . LYS D 4 72  ? -7.119  -10.375 11.397  1.00 58.25  ? 72  LYS A C     1 
ATOM   1897 O O     . LYS D 4 72  ? -5.890  -10.480 11.410  1.00 57.78  ? 72  LYS A O     1 
ATOM   1898 C CB    . LYS D 4 72  ? -7.836  -7.985  11.123  1.00 60.32  ? 72  LYS A CB    1 
ATOM   1899 C CG    . LYS D 4 72  ? -9.093  -7.875  10.274  1.00 60.37  ? 72  LYS A CG    1 
ATOM   1900 C CD    . LYS D 4 72  ? -9.119  -6.561  9.478   1.00 59.95  ? 72  LYS A CD    1 
ATOM   1901 C CE    . LYS D 4 72  ? -9.205  -5.322  10.378  1.00 59.61  ? 72  LYS A CE    1 
ATOM   1902 N NZ    . LYS D 4 72  ? -7.990  -5.101  11.214  1.00 59.65  ? 72  LYS A NZ    1 
ATOM   1903 N N     . ALA D 4 73  ? -7.922  -11.264 10.820  1.00 57.63  ? 73  ALA A N     1 
ATOM   1904 C CA    . ALA D 4 73  ? -7.437  -12.478 10.169  1.00 56.14  ? 73  ALA A CA    1 
ATOM   1905 C C     . ALA D 4 73  ? -6.422  -12.287 9.050   1.00 55.80  ? 73  ALA A C     1 
ATOM   1906 O O     . ALA D 4 73  ? -5.306  -12.793 9.135   1.00 57.09  ? 73  ALA A O     1 
ATOM   1907 C CB    . ALA D 4 73  ? -8.618  -13.282 9.654   1.00 55.93  ? 73  ALA A CB    1 
ATOM   1908 N N     . ASP D 4 74  ? -6.808  -11.579 7.994   1.00 55.16  ? 74  ASP A N     1 
ATOM   1909 C CA    . ASP D 4 74  ? -5.909  -11.354 6.863   1.00 54.14  ? 74  ASP A CA    1 
ATOM   1910 C C     . ASP D 4 74  ? -4.591  -10.758 7.332   1.00 52.64  ? 74  ASP A C     1 
ATOM   1911 O O     . ASP D 4 74  ? -3.532  -11.058 6.789   1.00 52.23  ? 74  ASP A O     1 
ATOM   1912 C CB    . ASP D 4 74  ? -6.543  -10.395 5.844   1.00 57.80  ? 74  ASP A CB    1 
ATOM   1913 C CG    . ASP D 4 74  ? -8.022  -10.674 5.607   1.00 60.05  ? 74  ASP A CG    1 
ATOM   1914 O OD1   . ASP D 4 74  ? -8.828  -10.483 6.551   1.00 61.99  ? 74  ASP A OD1   1 
ATOM   1915 O OD2   . ASP D 4 74  ? -8.376  -11.082 4.478   1.00 60.04  ? 74  ASP A OD2   1 
ATOM   1916 N N     . CYS D 4 75  ? -4.676  -9.906  8.346   1.00 51.05  ? 75  CYS A N     1 
ATOM   1917 C CA    . CYS D 4 75  ? -3.512  -9.221  8.896   1.00 50.79  ? 75  CYS A CA    1 
ATOM   1918 C C     . CYS D 4 75  ? -2.601  -10.067 9.785   1.00 50.31  ? 75  CYS A C     1 
ATOM   1919 O O     . CYS D 4 75  ? -1.380  -9.977  9.685   1.00 50.52  ? 75  CYS A O     1 
ATOM   1920 C CB    . CYS D 4 75  ? -3.968  -7.988  9.682   1.00 49.91  ? 75  CYS A CB    1 
ATOM   1921 S SG    . CYS D 4 75  ? -4.888  -6.747  8.708   1.00 49.99  ? 75  CYS A SG    1 
ATOM   1922 N N     . ASP D 4 76  ? -3.190  -10.871 10.666  1.00 50.89  ? 76  ASP A N     1 
ATOM   1923 C CA    . ASP D 4 76  ? -2.407  -11.705 11.576  1.00 49.95  ? 76  ASP A CA    1 
ATOM   1924 C C     . ASP D 4 76  ? -2.001  -13.035 10.939  1.00 50.45  ? 76  ASP A C     1 
ATOM   1925 O O     . ASP D 4 76  ? -1.292  -13.837 11.545  1.00 51.11  ? 76  ASP A O     1 
ATOM   1926 C CB    . ASP D 4 76  ? -3.189  -11.945 12.875  1.00 49.77  ? 76  ASP A CB    1 
ATOM   1927 C CG    . ASP D 4 76  ? -3.418  -10.654 13.682  1.00 50.49  ? 76  ASP A CG    1 
ATOM   1928 O OD1   . ASP D 4 76  ? -2.431  -9.972  14.045  1.00 51.80  ? 76  ASP A OD1   1 
ATOM   1929 O OD2   . ASP D 4 76  ? -4.586  -10.323 13.962  1.00 48.80  ? 76  ASP A OD2   1 
ATOM   1930 N N     . ARG D 4 77  ? -2.445  -13.254 9.705   1.00 49.61  ? 77  ARG A N     1 
ATOM   1931 C CA    . ARG D 4 77  ? -2.122  -14.466 8.963   1.00 49.87  ? 77  ARG A CA    1 
ATOM   1932 C C     . ARG D 4 77  ? -0.643  -14.456 8.557   1.00 52.37  ? 77  ARG A C     1 
ATOM   1933 O O     . ARG D 4 77  ? -0.197  -13.558 7.843   1.00 51.59  ? 77  ARG A O     1 
ATOM   1934 C CB    . ARG D 4 77  ? -3.020  -14.533 7.723   1.00 49.65  ? 77  ARG A CB    1 
ATOM   1935 C CG    . ARG D 4 77  ? -2.468  -15.285 6.519   1.00 49.28  ? 77  ARG A CG    1 
ATOM   1936 C CD    . ARG D 4 77  ? -2.663  -16.776 6.622   1.00 50.40  ? 77  ARG A CD    1 
ATOM   1937 N NE    . ARG D 4 77  ? -2.327  -17.475 5.378   1.00 53.82  ? 77  ARG A NE    1 
ATOM   1938 C CZ    . ARG D 4 77  ? -2.942  -17.290 4.207   1.00 55.01  ? 77  ARG A CZ    1 
ATOM   1939 N NH1   . ARG D 4 77  ? -3.938  -16.418 4.102   1.00 54.56  ? 77  ARG A NH1   1 
ATOM   1940 N NH2   . ARG D 4 77  ? -2.565  -17.988 3.139   1.00 53.20  ? 77  ARG A NH2   1 
ATOM   1941 N N     . PRO D 4 78  ? 0.145   -15.445 9.025   1.00 53.00  ? 78  PRO A N     1 
ATOM   1942 C CA    . PRO D 4 78  ? 1.573   -15.509 8.678   1.00 52.56  ? 78  PRO A CA    1 
ATOM   1943 C C     . PRO D 4 78  ? 1.785   -15.255 7.183   1.00 52.52  ? 78  PRO A C     1 
ATOM   1944 O O     . PRO D 4 78  ? 1.076   -15.798 6.350   1.00 52.79  ? 78  PRO A O     1 
ATOM   1945 C CB    . PRO D 4 78  ? 1.960   -16.919 9.101   1.00 52.61  ? 78  PRO A CB    1 
ATOM   1946 C CG    . PRO D 4 78  ? 1.143   -17.102 10.346  1.00 53.36  ? 78  PRO A CG    1 
ATOM   1947 C CD    . PRO D 4 78  ? -0.219  -16.524 9.961   1.00 53.06  ? 78  PRO A CD    1 
ATOM   1948 N N     . PRO D 4 79  ? 2.789   -14.439 6.831   1.00 52.98  ? 79  PRO A N     1 
ATOM   1949 C CA    . PRO D 4 79  ? 3.107   -14.084 5.445   1.00 52.99  ? 79  PRO A CA    1 
ATOM   1950 C C     . PRO D 4 79  ? 3.634   -15.134 4.473   1.00 53.96  ? 79  PRO A C     1 
ATOM   1951 O O     . PRO D 4 79  ? 4.235   -16.133 4.862   1.00 55.72  ? 79  PRO A O     1 
ATOM   1952 C CB    . PRO D 4 79  ? 4.108   -12.951 5.616   1.00 52.61  ? 79  PRO A CB    1 
ATOM   1953 C CG    . PRO D 4 79  ? 4.872   -13.396 6.816   1.00 52.76  ? 79  PRO A CG    1 
ATOM   1954 C CD    . PRO D 4 79  ? 3.767   -13.837 7.756   1.00 50.99  ? 79  PRO A CD    1 
ATOM   1955 N N     . LYS D 4 80  ? 3.390   -14.864 3.193   1.00 53.49  ? 80  LYS A N     1 
ATOM   1956 C CA    . LYS D 4 80  ? 3.856   -15.669 2.070   1.00 52.44  ? 80  LYS A CA    1 
ATOM   1957 C C     . LYS D 4 80  ? 4.409   -14.601 1.121   1.00 53.04  ? 80  LYS A C     1 
ATOM   1958 O O     . LYS D 4 80  ? 3.668   -14.007 0.336   1.00 48.84  ? 80  LYS A O     1 
ATOM   1959 C CB    . LYS D 4 80  ? 2.704   -16.419 1.404   1.00 54.03  ? 80  LYS A CB    1 
ATOM   1960 C CG    . LYS D 4 80  ? 3.079   -17.107 0.091   1.00 54.56  ? 80  LYS A CG    1 
ATOM   1961 C CD    . LYS D 4 80  ? 4.200   -18.120 0.279   1.00 55.16  ? 80  LYS A CD    1 
ATOM   1962 C CE    . LYS D 4 80  ? 4.638   -18.738 -1.051  1.00 58.08  ? 80  LYS A CE    1 
ATOM   1963 N NZ    . LYS D 4 80  ? 3.522   -19.410 -1.782  1.00 58.12  ? 80  LYS A NZ    1 
ATOM   1964 N N     . HIS D 4 81  ? 5.714   -14.360 1.225   1.00 53.91  ? 81  HIS A N     1 
ATOM   1965 C CA    . HIS D 4 81  ? 6.406   -13.342 0.440   1.00 57.43  ? 81  HIS A CA    1 
ATOM   1966 C C     . HIS D 4 81  ? 7.620   -13.902 -0.298  1.00 58.27  ? 81  HIS A C     1 
ATOM   1967 O O     . HIS D 4 81  ? 8.537   -14.448 0.312   1.00 56.92  ? 81  HIS A O     1 
ATOM   1968 C CB    . HIS D 4 81  ? 6.807   -12.205 1.396   1.00 60.15  ? 81  HIS A CB    1 
ATOM   1969 C CG    . HIS D 4 81  ? 7.736   -11.183 0.810   1.00 60.77  ? 81  HIS A CG    1 
ATOM   1970 N ND1   . HIS D 4 81  ? 9.076   -11.426 0.601   1.00 60.07  ? 81  HIS A ND1   1 
ATOM   1971 C CD2   . HIS D 4 81  ? 7.528   -9.892  0.457   1.00 61.25  ? 81  HIS A CD2   1 
ATOM   1972 C CE1   . HIS D 4 81  ? 9.655   -10.328 0.148   1.00 59.26  ? 81  HIS A CE1   1 
ATOM   1973 N NE2   . HIS D 4 81  ? 8.738   -9.382  0.052   1.00 59.96  ? 81  HIS A NE2   1 
ATOM   1974 N N     . SER D 4 82  ? 7.608   -13.763 -1.620  1.00 61.27  ? 82  SER A N     1 
ATOM   1975 C CA    . SER D 4 82  ? 8.692   -14.242 -2.475  1.00 64.34  ? 82  SER A CA    1 
ATOM   1976 C C     . SER D 4 82  ? 9.858   -13.253 -2.591  1.00 66.18  ? 82  SER A C     1 
ATOM   1977 O O     . SER D 4 82  ? 9.840   -12.176 -1.995  1.00 66.49  ? 82  SER A O     1 
ATOM   1978 C CB    . SER D 4 82  ? 8.154   -14.552 -3.871  1.00 64.99  ? 82  SER A CB    1 
ATOM   1979 O OG    . SER D 4 82  ? 7.085   -15.479 -3.799  1.00 67.53  ? 82  SER A OG    1 
ATOM   1980 N N     . GLN D 4 83  ? 10.857  -13.641 -3.381  1.00 67.91  ? 83  GLN A N     1 
ATOM   1981 C CA    . GLN D 4 83  ? 12.078  -12.865 -3.615  1.00 69.57  ? 83  GLN A CA    1 
ATOM   1982 C C     . GLN D 4 83  ? 11.892  -11.360 -3.791  1.00 68.96  ? 83  GLN A C     1 
ATOM   1983 O O     . GLN D 4 83  ? 12.730  -10.564 -3.364  1.00 68.33  ? 83  GLN A O     1 
ATOM   1984 C CB    . GLN D 4 83  ? 12.796  -13.415 -4.854  1.00 71.96  ? 83  GLN A CB    1 
ATOM   1985 C CG    . GLN D 4 83  ? 14.155  -12.783 -5.156  1.00 75.32  ? 83  GLN A CG    1 
ATOM   1986 C CD    . GLN D 4 83  ? 15.314  -13.473 -4.440  1.00 77.80  ? 83  GLN A CD    1 
ATOM   1987 O OE1   . GLN D 4 83  ? 16.481  -13.143 -4.669  1.00 77.93  ? 83  GLN A OE1   1 
ATOM   1988 N NE2   . GLN D 4 83  ? 14.997  -14.435 -3.575  1.00 78.84  ? 83  GLN A NE2   1 
ATOM   1989 N N     . ASN D 4 84  ? 10.793  -10.977 -4.425  1.00 68.57  ? 84  ASN A N     1 
ATOM   1990 C CA    . ASN D 4 84  ? 10.514  -9.574  -4.699  1.00 69.01  ? 84  ASN A CA    1 
ATOM   1991 C C     . ASN D 4 84  ? 9.065   -9.223  -4.375  1.00 69.06  ? 84  ASN A C     1 
ATOM   1992 O O     . ASN D 4 84  ? 8.515   -8.252  -4.903  1.00 67.13  ? 84  ASN A O     1 
ATOM   1993 C CB    . ASN D 4 84  ? 10.802  -9.300  -6.175  1.00 69.46  ? 84  ASN A CB    1 
ATOM   1994 C CG    . ASN D 4 84  ? 10.237  -10.385 -7.078  1.00 69.41  ? 84  ASN A CG    1 
ATOM   1995 O OD1   . ASN D 4 84  ? 10.562  -11.566 -6.929  1.00 67.96  ? 84  ASN A OD1   1 
ATOM   1996 N ND2   . ASN D 4 84  ? 9.384   -9.991  -8.016  1.00 71.00  ? 84  ASN A ND2   1 
ATOM   1997 N N     . GLY D 4 85  ? 8.458   -10.035 -3.513  1.00 68.89  ? 85  GLY A N     1 
ATOM   1998 C CA    . GLY D 4 85  ? 7.082   -9.819  -3.109  1.00 69.15  ? 85  GLY A CA    1 
ATOM   1999 C C     . GLY D 4 85  ? 6.109   -9.702  -4.263  1.00 68.54  ? 85  GLY A C     1 
ATOM   2000 O O     . GLY D 4 85  ? 5.171   -8.909  -4.207  1.00 68.84  ? 85  GLY A O     1 
ATOM   2001 N N     . MET D 4 86  ? 6.316   -10.485 -5.313  1.00 69.22  ? 86  MET A N     1 
ATOM   2002 C CA    . MET D 4 86  ? 5.415   -10.423 -6.453  1.00 70.35  ? 86  MET A CA    1 
ATOM   2003 C C     . MET D 4 86  ? 4.881   -11.792 -6.829  1.00 69.85  ? 86  MET A C     1 
ATOM   2004 O O     . MET D 4 86  ? 4.311   -11.972 -7.906  1.00 68.82  ? 86  MET A O     1 
ATOM   2005 C CB    . MET D 4 86  ? 6.112   -9.775  -7.652  1.00 72.28  ? 86  MET A CB    1 
ATOM   2006 C CG    . MET D 4 86  ? 6.530   -8.332  -7.400  1.00 75.02  ? 86  MET A CG    1 
ATOM   2007 S SD    . MET D 4 86  ? 6.780   -7.366  -8.912  1.00 79.15  ? 86  MET A SD    1 
ATOM   2008 C CE    . MET D 4 86  ? 8.587   -7.480  -9.115  1.00 76.82  ? 86  MET A CE    1 
ATOM   2009 N N     . GLY D 4 87  ? 5.072   -12.754 -5.931  1.00 69.95  ? 87  GLY A N     1 
ATOM   2010 C CA    . GLY D 4 87  ? 4.583   -14.098 -6.171  1.00 69.43  ? 87  GLY A CA    1 
ATOM   2011 C C     . GLY D 4 87  ? 3.108   -14.047 -6.519  1.00 69.68  ? 87  GLY A C     1 
ATOM   2012 O O     . GLY D 4 87  ? 2.368   -13.189 -6.020  1.00 68.98  ? 87  GLY A O     1 
ATOM   2013 N N     . LYS D 4 88  ? 2.676   -14.964 -7.377  1.00 68.91  ? 88  LYS A N     1 
ATOM   2014 C CA    . LYS D 4 88  ? 1.287   -15.006 -7.808  1.00 68.98  ? 88  LYS A CA    1 
ATOM   2015 C C     . LYS D 4 88  ? 0.344   -15.426 -6.684  1.00 67.78  ? 88  LYS A C     1 
ATOM   2016 O O     . LYS D 4 88  ? -0.857  -15.151 -6.732  1.00 66.95  ? 88  LYS A O     1 
ATOM   2017 C CB    . LYS D 4 88  ? 1.165   -15.944 -9.010  1.00 71.64  ? 88  LYS A CB    1 
ATOM   2018 C CG    . LYS D 4 88  ? 2.062   -15.510 -10.165 1.00 74.11  ? 88  LYS A CG    1 
ATOM   2019 C CD    . LYS D 4 88  ? 2.067   -16.497 -11.321 1.00 75.68  ? 88  LYS A CD    1 
ATOM   2020 C CE    . LYS D 4 88  ? 2.950   -15.978 -12.448 1.00 76.10  ? 88  LYS A CE    1 
ATOM   2021 N NZ    . LYS D 4 88  ? 3.043   -16.937 -13.577 1.00 76.65  ? 88  LYS A NZ    1 
ATOM   2022 N N     . ASP D 4 89  ? 0.899   -16.078 -5.667  1.00 66.34  ? 89  ASP A N     1 
ATOM   2023 C CA    . ASP D 4 89  ? 0.118   -16.525 -4.524  1.00 65.40  ? 89  ASP A CA    1 
ATOM   2024 C C     . ASP D 4 89  ? 0.596   -15.845 -3.238  1.00 63.45  ? 89  ASP A C     1 
ATOM   2025 O O     . ASP D 4 89  ? 0.185   -16.211 -2.133  1.00 62.37  ? 89  ASP A O     1 
ATOM   2026 C CB    . ASP D 4 89  ? 0.224   -18.048 -4.394  1.00 69.75  ? 89  ASP A CB    1 
ATOM   2027 C CG    . ASP D 4 89  ? -0.379  -18.573 -3.101  1.00 73.66  ? 89  ASP A CG    1 
ATOM   2028 O OD1   . ASP D 4 89  ? -1.539  -18.210 -2.788  1.00 74.75  ? 89  ASP A OD1   1 
ATOM   2029 O OD2   . ASP D 4 89  ? 0.313   -19.352 -2.403  1.00 75.32  ? 89  ASP A OD2   1 
ATOM   2030 N N     . ASP D 4 90  ? 1.458   -14.845 -3.390  1.00 59.89  ? 90  ASP A N     1 
ATOM   2031 C CA    . ASP D 4 90  ? 1.990   -14.110 -2.248  1.00 57.91  ? 90  ASP A CA    1 
ATOM   2032 C C     . ASP D 4 90  ? 0.941   -13.301 -1.486  1.00 55.37  ? 90  ASP A C     1 
ATOM   2033 O O     . ASP D 4 90  ? 0.012   -12.742 -2.059  1.00 54.97  ? 90  ASP A O     1 
ATOM   2034 C CB    . ASP D 4 90  ? 3.103   -13.164 -2.704  1.00 59.07  ? 90  ASP A CB    1 
ATOM   2035 C CG    . ASP D 4 90  ? 4.434   -13.864 -2.865  1.00 59.51  ? 90  ASP A CG    1 
ATOM   2036 O OD1   . ASP D 4 90  ? 4.428   -15.087 -3.126  1.00 61.20  ? 90  ASP A OD1   1 
ATOM   2037 O OD2   . ASP D 4 90  ? 5.482   -13.187 -2.744  1.00 56.69  ? 90  ASP A OD2   1 
ATOM   2038 N N     . HIS D 4 91  ? 1.096   -13.256 -0.176  1.00 52.68  ? 91  HIS A N     1 
ATOM   2039 C CA    . HIS D 4 91  ? 0.199   -12.488 0.660   1.00 50.77  ? 91  HIS A CA    1 
ATOM   2040 C C     . HIS D 4 91  ? 1.041   -12.076 1.845   1.00 48.16  ? 91  HIS A C     1 
ATOM   2041 O O     . HIS D 4 91  ? 1.716   -12.898 2.457   1.00 47.90  ? 91  HIS A O     1 
ATOM   2042 C CB    . HIS D 4 91  ? -1.026  -13.319 1.078   1.00 51.68  ? 91  HIS A CB    1 
ATOM   2043 C CG    . HIS D 4 91  ? -0.694  -14.590 1.800   1.00 51.81  ? 91  HIS A CG    1 
ATOM   2044 N ND1   . HIS D 4 91  ? -0.524  -14.648 3.167   1.00 51.15  ? 91  HIS A ND1   1 
ATOM   2045 C CD2   . HIS D 4 91  ? -0.480  -15.845 1.339   1.00 49.19  ? 91  HIS A CD2   1 
ATOM   2046 C CE1   . HIS D 4 91  ? -0.216  -15.885 3.515   1.00 51.41  ? 91  HIS A CE1   1 
ATOM   2047 N NE2   . HIS D 4 91  ? -0.183  -16.630 2.425   1.00 49.92  ? 91  HIS A NE2   1 
ATOM   2048 N N     . TYR D 4 92  ? 1.042   -10.787 2.142   1.00 46.63  ? 92  TYR A N     1 
ATOM   2049 C CA    . TYR D 4 92  ? 1.841   -10.301 3.247   1.00 44.10  ? 92  TYR A CA    1 
ATOM   2050 C C     . TYR D 4 92  ? 1.451   -8.895  3.657   1.00 42.71  ? 92  TYR A C     1 
ATOM   2051 O O     . TYR D 4 92  ? 0.434   -8.370  3.202   1.00 43.64  ? 92  TYR A O     1 
ATOM   2052 C CB    . TYR D 4 92  ? 3.318   -10.374 2.867   1.00 42.81  ? 92  TYR A CB    1 
ATOM   2053 C CG    . TYR D 4 92  ? 3.670   -9.677  1.575   1.00 44.39  ? 92  TYR A CG    1 
ATOM   2054 C CD1   . TYR D 4 92  ? 3.741   -8.288  1.508   1.00 44.67  ? 92  TYR A CD1   1 
ATOM   2055 C CD2   . TYR D 4 92  ? 3.949   -10.406 0.419   1.00 43.68  ? 92  TYR A CD2   1 
ATOM   2056 C CE1   . TYR D 4 92  ? 4.081   -7.645  0.330   1.00 44.78  ? 92  TYR A CE1   1 
ATOM   2057 C CE2   . TYR D 4 92  ? 4.293   -9.768  -0.769  1.00 43.12  ? 92  TYR A CE2   1 
ATOM   2058 C CZ    . TYR D 4 92  ? 4.354   -8.390  -0.803  1.00 43.94  ? 92  TYR A CZ    1 
ATOM   2059 O OH    . TYR D 4 92  ? 4.672   -7.739  -1.971  1.00 46.40  ? 92  TYR A OH    1 
ATOM   2060 N N     . LEU D 4 93  ? 2.255   -8.290  4.524   1.00 41.67  ? 93  LEU A N     1 
ATOM   2061 C CA    . LEU D 4 93  ? 1.968   -6.951  5.002   1.00 38.08  ? 93  LEU A CA    1 
ATOM   2062 C C     . LEU D 4 93  ? 2.889   -5.888  4.410   1.00 36.41  ? 93  LEU A C     1 
ATOM   2063 O O     . LEU D 4 93  ? 4.082   -6.123  4.166   1.00 35.63  ? 93  LEU A O     1 
ATOM   2064 C CB    . LEU D 4 93  ? 2.049   -6.909  6.533   1.00 38.74  ? 93  LEU A CB    1 
ATOM   2065 C CG    . LEU D 4 93  ? 1.138   -7.837  7.351   1.00 40.34  ? 93  LEU A CG    1 
ATOM   2066 C CD1   . LEU D 4 93  ? 1.338   -7.558  8.848   1.00 37.76  ? 93  LEU A CD1   1 
ATOM   2067 C CD2   . LEU D 4 93  ? -0.328  -7.624  6.965   1.00 41.64  ? 93  LEU A CD2   1 
ATOM   2068 N N     . LEU D 4 94  ? 2.313   -4.716  4.176   1.00 32.35  ? 94  LEU A N     1 
ATOM   2069 C CA    . LEU D 4 94  ? 3.041   -3.583  3.631   1.00 34.58  ? 94  LEU A CA    1 
ATOM   2070 C C     . LEU D 4 94  ? 3.030   -2.469  4.668   1.00 32.76  ? 94  LEU A C     1 
ATOM   2071 O O     . LEU D 4 94  ? 2.097   -2.363  5.467   1.00 32.51  ? 94  LEU A O     1 
ATOM   2072 C CB    . LEU D 4 94  ? 2.366   -3.060  2.354   1.00 33.93  ? 94  LEU A CB    1 
ATOM   2073 C CG    . LEU D 4 94  ? 2.537   -3.859  1.061   1.00 36.96  ? 94  LEU A CG    1 
ATOM   2074 C CD1   . LEU D 4 94  ? 1.640   -3.255  -0.035  1.00 32.84  ? 94  LEU A CD1   1 
ATOM   2075 C CD2   . LEU D 4 94  ? 3.996   -3.837  0.638   1.00 32.21  ? 94  LEU A CD2   1 
ATOM   2076 N N     . GLU D 4 95  ? 4.065   -1.641  4.654   1.00 32.14  ? 95  GLU A N     1 
ATOM   2077 C CA    . GLU D 4 95  ? 4.117   -0.515  5.574   1.00 31.70  ? 95  GLU A CA    1 
ATOM   2078 C C     . GLU D 4 95  ? 4.319   0.692   4.678   1.00 28.43  ? 95  GLU A C     1 
ATOM   2079 O O     . GLU D 4 95  ? 5.020   0.607   3.684   1.00 26.09  ? 95  GLU A O     1 
ATOM   2080 C CB    . GLU D 4 95  ? 5.294   -0.626  6.544   1.00 31.19  ? 95  GLU A CB    1 
ATOM   2081 C CG    . GLU D 4 95  ? 6.646   -0.337  5.924   1.00 34.09  ? 95  GLU A CG    1 
ATOM   2082 C CD    . GLU D 4 95  ? 7.756   -0.236  6.964   1.00 38.04  ? 95  GLU A CD    1 
ATOM   2083 O OE1   . GLU D 4 95  ? 8.363   -1.277  7.324   1.00 37.85  ? 95  GLU A OE1   1 
ATOM   2084 O OE2   . GLU D 4 95  ? 8.009   0.894   7.427   1.00 34.42  ? 95  GLU A OE2   1 
ATOM   2085 N N     . PHE D 4 96  ? 3.698   1.808   5.031   1.00 27.30  ? 96  PHE A N     1 
ATOM   2086 C CA    . PHE D 4 96  ? 3.846   3.019   4.253   1.00 23.98  ? 96  PHE A CA    1 
ATOM   2087 C C     . PHE D 4 96  ? 3.752   4.152   5.245   1.00 22.49  ? 96  PHE A C     1 
ATOM   2088 O O     . PHE D 4 96  ? 2.968   4.094   6.174   1.00 26.09  ? 96  PHE A O     1 
ATOM   2089 C CB    . PHE D 4 96  ? 2.710   3.119   3.229   1.00 24.20  ? 96  PHE A CB    1 
ATOM   2090 C CG    . PHE D 4 96  ? 2.909   4.185   2.205   1.00 21.76  ? 96  PHE A CG    1 
ATOM   2091 C CD1   . PHE D 4 96  ? 3.857   4.033   1.203   1.00 22.69  ? 96  PHE A CD1   1 
ATOM   2092 C CD2   . PHE D 4 96  ? 2.135   5.338   2.230   1.00 23.21  ? 96  PHE A CD2   1 
ATOM   2093 C CE1   . PHE D 4 96  ? 4.029   5.018   0.227   1.00 23.49  ? 96  PHE A CE1   1 
ATOM   2094 C CE2   . PHE D 4 96  ? 2.302   6.331   1.260   1.00 19.09  ? 96  PHE A CE2   1 
ATOM   2095 C CZ    . PHE D 4 96  ? 3.244   6.169   0.263   1.00 20.76  ? 96  PHE A CZ    1 
ATOM   2096 N N     . PRO D 4 97  ? 4.549   5.207   5.060   1.00 24.26  ? 97  PRO A N     1 
ATOM   2097 C CA    . PRO D 4 97  ? 4.507   6.339   5.985   1.00 24.81  ? 97  PRO A CA    1 
ATOM   2098 C C     . PRO D 4 97  ? 3.157   7.038   6.037   1.00 28.38  ? 97  PRO A C     1 
ATOM   2099 O O     . PRO D 4 97  ? 2.502   7.251   5.012   1.00 33.00  ? 97  PRO A O     1 
ATOM   2100 C CB    . PRO D 4 97  ? 5.597   7.273   5.451   1.00 22.82  ? 97  PRO A CB    1 
ATOM   2101 C CG    . PRO D 4 97  ? 6.548   6.352   4.770   1.00 24.23  ? 97  PRO A CG    1 
ATOM   2102 C CD    . PRO D 4 97  ? 5.636   5.366   4.077   1.00 23.81  ? 97  PRO A CD    1 
ATOM   2103 N N     . THR D 4 98  ? 2.753   7.419   7.237   1.00 28.87  ? 98  THR A N     1 
ATOM   2104 C CA    . THR D 4 98  ? 1.501   8.126   7.423   1.00 30.47  ? 98  THR A CA    1 
ATOM   2105 C C     . THR D 4 98  ? 1.803   9.209   8.472   1.00 32.24  ? 98  THR A C     1 
ATOM   2106 O O     . THR D 4 98  ? 2.622   9.007   9.360   1.00 30.11  ? 98  THR A O     1 
ATOM   2107 C CB    . THR D 4 98  ? 0.387   7.128   7.867   1.00 33.36  ? 98  THR A CB    1 
ATOM   2108 O OG1   . THR D 4 98  ? -0.894  7.704   7.605   1.00 35.64  ? 98  THR A OG1   1 
ATOM   2109 C CG2   . THR D 4 98  ? 0.512   6.771   9.364   1.00 33.62  ? 98  THR A CG2   1 
ATOM   2110 N N     . PHE D 4 99  ? 1.171   10.369  8.347   1.00 34.78  ? 99  PHE A N     1 
ATOM   2111 C CA    . PHE D 4 99  ? 1.419   11.475  9.264   1.00 34.41  ? 99  PHE A CA    1 
ATOM   2112 C C     . PHE D 4 99  ? 0.107   12.011  9.810   1.00 35.81  ? 99  PHE A C     1 
ATOM   2113 O O     . PHE D 4 99  ? -0.957  11.681  9.309   1.00 37.97  ? 99  PHE A O     1 
ATOM   2114 C CB    . PHE D 4 99  ? 2.144   12.617  8.535   1.00 33.11  ? 99  PHE A CB    1 
ATOM   2115 C CG    . PHE D 4 99  ? 3.389   12.194  7.831   1.00 30.42  ? 99  PHE A CG    1 
ATOM   2116 C CD1   . PHE D 4 99  ? 4.636   12.413  8.405   1.00 28.40  ? 99  PHE A CD1   1 
ATOM   2117 C CD2   . PHE D 4 99  ? 3.318   11.549  6.593   1.00 29.97  ? 99  PHE A CD2   1 
ATOM   2118 C CE1   . PHE D 4 99  ? 5.789   12.000  7.765   1.00 25.28  ? 99  PHE A CE1   1 
ATOM   2119 C CE2   . PHE D 4 99  ? 4.463   11.130  5.944   1.00 28.46  ? 99  PHE A CE2   1 
ATOM   2120 C CZ    . PHE D 4 99  ? 5.709   11.355  6.532   1.00 32.16  ? 99  PHE A CZ    1 
ATOM   2121 N N     . PRO D 4 100 ? 0.174   12.849  10.856  1.00 35.67  ? 100 PRO A N     1 
ATOM   2122 C CA    . PRO D 4 100 ? -1.014  13.441  11.475  1.00 34.65  ? 100 PRO A CA    1 
ATOM   2123 C C     . PRO D 4 100 ? -1.802  14.327  10.497  1.00 35.10  ? 100 PRO A C     1 
ATOM   2124 O O     . PRO D 4 100 ? -3.028  14.337  10.520  1.00 34.33  ? 100 PRO A O     1 
ATOM   2125 C CB    . PRO D 4 100 ? -0.432  14.245  12.629  1.00 34.88  ? 100 PRO A CB    1 
ATOM   2126 C CG    . PRO D 4 100 ? 0.795   13.462  12.994  1.00 36.76  ? 100 PRO A CG    1 
ATOM   2127 C CD    . PRO D 4 100 ? 1.381   13.148  11.649  1.00 34.54  ? 100 PRO A CD    1 
ATOM   2128 N N     . ASP D 4 101 ? -1.103  15.077  9.648   1.00 37.56  ? 101 ASP A N     1 
ATOM   2129 C CA    . ASP D 4 101 ? -1.794  15.930  8.686   1.00 40.99  ? 101 ASP A CA    1 
ATOM   2130 C C     . ASP D 4 101 ? -2.425  15.093  7.573   1.00 42.23  ? 101 ASP A C     1 
ATOM   2131 O O     . ASP D 4 101 ? -3.204  15.600  6.765   1.00 45.41  ? 101 ASP A O     1 
ATOM   2132 C CB    . ASP D 4 101 ? -0.843  16.962  8.081   1.00 41.50  ? 101 ASP A CB    1 
ATOM   2133 C CG    . ASP D 4 101 ? 0.314   16.330  7.339   1.00 45.61  ? 101 ASP A CG    1 
ATOM   2134 O OD1   . ASP D 4 101 ? 0.184   15.165  6.903   1.00 46.64  ? 101 ASP A OD1   1 
ATOM   2135 O OD2   . ASP D 4 101 ? 1.355   17.006  7.175   1.00 46.87  ? 101 ASP A OD2   1 
ATOM   2136 N N     . GLY D 4 102 ? -2.067  13.812  7.532   1.00 41.47  ? 102 GLY A N     1 
ATOM   2137 C CA    . GLY D 4 102 ? -2.622  12.901  6.549   1.00 38.74  ? 102 GLY A CA    1 
ATOM   2138 C C     . GLY D 4 102 ? -2.191  13.056  5.100   1.00 38.84  ? 102 GLY A C     1 
ATOM   2139 O O     . GLY D 4 102 ? -2.777  12.409  4.231   1.00 37.51  ? 102 GLY A O     1 
ATOM   2140 N N     . HIS D 4 103 ? -1.182  13.879  4.819   1.00 36.20  ? 103 HIS A N     1 
ATOM   2141 C CA    . HIS D 4 103 ? -0.754  14.052  3.437   1.00 36.05  ? 103 HIS A CA    1 
ATOM   2142 C C     . HIS D 4 103 ? -0.143  12.773  2.838   1.00 37.46  ? 103 HIS A C     1 
ATOM   2143 O O     . HIS D 4 103 ? 0.336   11.896  3.567   1.00 37.36  ? 103 HIS A O     1 
ATOM   2144 C CB    . HIS D 4 103 ? 0.234   15.228  3.317   1.00 34.68  ? 103 HIS A CB    1 
ATOM   2145 C CG    . HIS D 4 103 ? 1.648   14.903  3.706   1.00 39.82  ? 103 HIS A CG    1 
ATOM   2146 N ND1   . HIS D 4 103 ? 2.086   14.900  5.015   1.00 41.38  ? 103 HIS A ND1   1 
ATOM   2147 C CD2   . HIS D 4 103 ? 2.731   14.597  2.950   1.00 37.90  ? 103 HIS A CD2   1 
ATOM   2148 C CE1   . HIS D 4 103 ? 3.375   14.608  5.047   1.00 36.05  ? 103 HIS A CE1   1 
ATOM   2149 N NE2   . HIS D 4 103 ? 3.789   14.420  3.807   1.00 37.72  ? 103 HIS A NE2   1 
ATOM   2150 N N     . ASP D 4 104 ? -0.167  12.655  1.511   1.00 35.94  ? 104 ASP A N     1 
ATOM   2151 C CA    . ASP D 4 104 ? 0.412   11.484  0.865   1.00 34.35  ? 104 ASP A CA    1 
ATOM   2152 C C     . ASP D 4 104 ? 1.929   11.628  0.810   1.00 33.12  ? 104 ASP A C     1 
ATOM   2153 O O     . ASP D 4 104 ? 2.450   12.637  0.348   1.00 31.43  ? 104 ASP A O     1 
ATOM   2154 C CB    . ASP D 4 104 ? -0.125  11.306  -0.560  1.00 36.69  ? 104 ASP A CB    1 
ATOM   2155 C CG    . ASP D 4 104 ? -1.599  10.968  -0.589  1.00 37.10  ? 104 ASP A CG    1 
ATOM   2156 O OD1   . ASP D 4 104 ? -2.024  10.068  0.161   1.00 41.61  ? 104 ASP A OD1   1 
ATOM   2157 O OD2   . ASP D 4 104 ? -2.338  11.598  -1.367  1.00 42.43  ? 104 ASP A OD2   1 
ATOM   2158 N N     . TYR D 4 105 ? 2.622   10.611  1.304   1.00 30.96  ? 105 TYR A N     1 
ATOM   2159 C CA    . TYR D 4 105 ? 4.070   10.580  1.310   1.00 32.46  ? 105 TYR A CA    1 
ATOM   2160 C C     . TYR D 4 105 ? 4.552   10.507  -0.134  1.00 33.67  ? 105 TYR A C     1 
ATOM   2161 O O     . TYR D 4 105 ? 4.002   9.760   -0.949  1.00 34.15  ? 105 TYR A O     1 
ATOM   2162 C CB    . TYR D 4 105 ? 4.553   9.351   2.070   1.00 29.60  ? 105 TYR A CB    1 
ATOM   2163 C CG    . TYR D 4 105 ? 6.043   9.179   2.073   1.00 28.18  ? 105 TYR A CG    1 
ATOM   2164 C CD1   . TYR D 4 105 ? 6.851   9.931   2.928   1.00 27.81  ? 105 TYR A CD1   1 
ATOM   2165 C CD2   . TYR D 4 105 ? 6.654   8.277   1.211   1.00 25.65  ? 105 TYR A CD2   1 
ATOM   2166 C CE1   . TYR D 4 105 ? 8.230   9.787   2.922   1.00 26.83  ? 105 TYR A CE1   1 
ATOM   2167 C CE2   . TYR D 4 105 ? 8.027   8.124   1.191   1.00 26.13  ? 105 TYR A CE2   1 
ATOM   2168 C CZ    . TYR D 4 105 ? 8.812   8.886   2.047   1.00 26.71  ? 105 TYR A CZ    1 
ATOM   2169 O OH    . TYR D 4 105 ? 10.176  8.773   1.982   1.00 29.31  ? 105 TYR A OH    1 
ATOM   2170 N N     . LYS D 4 106 ? 5.576   11.275  -0.463  1.00 32.50  ? 106 LYS A N     1 
ATOM   2171 C CA    . LYS D 4 106 ? 6.081   11.248  -1.826  1.00 34.62  ? 106 LYS A CA    1 
ATOM   2172 C C     . LYS D 4 106 ? 6.931   10.015  -2.064  1.00 33.30  ? 106 LYS A C     1 
ATOM   2173 O O     . LYS D 4 106 ? 8.149   10.082  -2.000  1.00 34.27  ? 106 LYS A O     1 
ATOM   2174 C CB    . LYS D 4 106 ? 6.876   12.512  -2.105  1.00 35.16  ? 106 LYS A CB    1 
ATOM   2175 C CG    . LYS D 4 106 ? 6.015   13.728  -1.994  1.00 39.22  ? 106 LYS A CG    1 
ATOM   2176 C CD    . LYS D 4 106 ? 6.768   14.951  -2.453  1.00 46.29  ? 106 LYS A CD    1 
ATOM   2177 C CE    . LYS D 4 106 ? 5.889   16.186  -2.423  1.00 46.25  ? 106 LYS A CE    1 
ATOM   2178 N NZ    . LYS D 4 106 ? 6.718   17.366  -2.796  1.00 52.19  ? 106 LYS A NZ    1 
ATOM   2179 N N     . PHE D 4 107 ? 6.274   8.896   -2.360  1.00 34.08  ? 107 PHE A N     1 
ATOM   2180 C CA    . PHE D 4 107 ? 6.960   7.622   -2.575  1.00 36.32  ? 107 PHE A CA    1 
ATOM   2181 C C     . PHE D 4 107 ? 8.071   7.563   -3.634  1.00 38.35  ? 107 PHE A C     1 
ATOM   2182 O O     . PHE D 4 107 ? 8.933   6.687   -3.581  1.00 36.33  ? 107 PHE A O     1 
ATOM   2183 C CB    . PHE D 4 107 ? 5.931   6.519   -2.837  1.00 37.23  ? 107 PHE A CB    1 
ATOM   2184 C CG    . PHE D 4 107 ? 5.048   6.761   -4.040  1.00 39.76  ? 107 PHE A CG    1 
ATOM   2185 C CD1   . PHE D 4 107 ? 5.507   6.485   -5.329  1.00 38.96  ? 107 PHE A CD1   1 
ATOM   2186 C CD2   . PHE D 4 107 ? 3.734   7.205   -3.876  1.00 39.32  ? 107 PHE A CD2   1 
ATOM   2187 C CE1   . PHE D 4 107 ? 4.673   6.640   -6.432  1.00 40.97  ? 107 PHE A CE1   1 
ATOM   2188 C CE2   . PHE D 4 107 ? 2.891   7.364   -4.979  1.00 39.08  ? 107 PHE A CE2   1 
ATOM   2189 C CZ    . PHE D 4 107 ? 3.364   7.078   -6.257  1.00 39.90  ? 107 PHE A CZ    1 
ATOM   2190 N N     . ASP D 4 108 ? 8.060   8.475   -4.599  1.00 40.06  ? 108 ASP A N     1 
ATOM   2191 C CA    . ASP D 4 108 ? 9.113   8.472   -5.600  1.00 40.71  ? 108 ASP A CA    1 
ATOM   2192 C C     . ASP D 4 108 ? 10.243  9.424   -5.211  1.00 39.64  ? 108 ASP A C     1 
ATOM   2193 O O     . ASP D 4 108 ? 11.214  9.579   -5.948  1.00 37.60  ? 108 ASP A O     1 
ATOM   2194 C CB    . ASP D 4 108 ? 8.569   8.861   -6.983  1.00 43.19  ? 108 ASP A CB    1 
ATOM   2195 C CG    . ASP D 4 108 ? 8.022   7.669   -7.757  1.00 44.61  ? 108 ASP A CG    1 
ATOM   2196 O OD1   . ASP D 4 108 ? 8.662   6.590   -7.741  1.00 43.21  ? 108 ASP A OD1   1 
ATOM   2197 O OD2   . ASP D 4 108 ? 6.957   7.823   -8.393  1.00 46.14  ? 108 ASP A OD2   1 
ATOM   2198 N N     . SER D 4 109 ? 10.119  10.068  -4.057  1.00 39.41  ? 109 SER A N     1 
ATOM   2199 C CA    . SER D 4 109 ? 11.171  10.980  -3.622  1.00 38.72  ? 109 SER A CA    1 
ATOM   2200 C C     . SER D 4 109 ? 12.419  10.150  -3.402  1.00 38.43  ? 109 SER A C     1 
ATOM   2201 O O     . SER D 4 109 ? 12.334  8.972   -3.067  1.00 38.75  ? 109 SER A O     1 
ATOM   2202 C CB    . SER D 4 109 ? 10.777  11.712  -2.330  1.00 37.14  ? 109 SER A CB    1 
ATOM   2203 O OG    . SER D 4 109 ? 10.529  10.823  -1.246  1.00 39.52  ? 109 SER A OG    1 
ATOM   2204 N N     . LYS D 4 110 ? 13.579  10.761  -3.610  1.00 39.51  ? 110 LYS A N     1 
ATOM   2205 C CA    . LYS D 4 110 ? 14.831  10.059  -3.435  1.00 41.05  ? 110 LYS A CA    1 
ATOM   2206 C C     . LYS D 4 110 ? 16.010  11.015  -3.448  1.00 41.60  ? 110 LYS A C     1 
ATOM   2207 O O     . LYS D 4 110 ? 15.962  12.073  -4.066  1.00 40.24  ? 110 LYS A O     1 
ATOM   2208 C CB    . LYS D 4 110 ? 15.006  9.031   -4.548  1.00 42.18  ? 110 LYS A CB    1 
ATOM   2209 C CG    . LYS D 4 110 ? 15.096  9.645   -5.923  1.00 45.05  ? 110 LYS A CG    1 
ATOM   2210 C CD    . LYS D 4 110 ? 16.300  9.087   -6.659  1.00 47.74  ? 110 LYS A CD    1 
ATOM   2211 C CE    . LYS D 4 110 ? 16.055  7.680   -7.158  1.00 47.50  ? 110 LYS A CE    1 
ATOM   2212 N NZ    . LYS D 4 110 ? 15.348  7.677   -8.472  1.00 50.26  ? 110 LYS A NZ    1 
ATOM   2213 N N     . LYS D 4 111 ? 17.069  10.638  -2.750  1.00 42.97  ? 111 LYS A N     1 
ATOM   2214 C CA    . LYS D 4 111 ? 18.280  11.446  -2.703  1.00 45.88  ? 111 LYS A CA    1 
ATOM   2215 C C     . LYS D 4 111 ? 18.013  12.948  -2.648  1.00 46.57  ? 111 LYS A C     1 
ATOM   2216 O O     . LYS D 4 111 ? 18.340  13.685  -3.576  1.00 49.60  ? 111 LYS A O     1 
ATOM   2217 C CB    . LYS D 4 111 ? 19.158  11.101  -3.912  1.00 45.19  ? 111 LYS A CB    1 
ATOM   2218 C CG    . LYS D 4 111 ? 19.326  9.586   -4.072  1.00 44.84  ? 111 LYS A CG    1 
ATOM   2219 C CD    . LYS D 4 111 ? 20.417  9.204   -5.040  1.00 47.96  ? 111 LYS A CD    1 
ATOM   2220 C CE    . LYS D 4 111 ? 20.538  7.696   -5.137  1.00 48.35  ? 111 LYS A CE    1 
ATOM   2221 N NZ    . LYS D 4 111 ? 20.681  7.092   -3.783  1.00 52.53  ? 111 LYS A NZ    1 
ATOM   2222 N N     . PRO D 4 112 ? 17.410  13.419  -1.549  1.00 46.11  ? 112 PRO A N     1 
ATOM   2223 C CA    . PRO D 4 112 ? 16.986  12.595  -0.412  1.00 43.77  ? 112 PRO A CA    1 
ATOM   2224 C C     . PRO D 4 112 ? 15.487  12.305  -0.514  1.00 41.46  ? 112 PRO A C     1 
ATOM   2225 O O     . PRO D 4 112 ? 14.733  13.135  -1.023  1.00 43.53  ? 112 PRO A O     1 
ATOM   2226 C CB    . PRO D 4 112 ? 17.275  13.499  0.767   1.00 44.18  ? 112 PRO A CB    1 
ATOM   2227 C CG    . PRO D 4 112 ? 16.761  14.826  0.234   1.00 44.28  ? 112 PRO A CG    1 
ATOM   2228 C CD    . PRO D 4 112 ? 17.287  14.854  -1.220  1.00 45.60  ? 112 PRO A CD    1 
ATOM   2229 N N     . LYS D 4 113 ? 15.060  11.136  -0.047  1.00 37.37  ? 113 LYS A N     1 
ATOM   2230 C CA    . LYS D 4 113 ? 13.642  10.798  -0.053  1.00 34.91  ? 113 LYS A CA    1 
ATOM   2231 C C     . LYS D 4 113 ? 13.025  11.676  1.041   1.00 34.77  ? 113 LYS A C     1 
ATOM   2232 O O     . LYS D 4 113 ? 13.738  12.165  1.931   1.00 32.89  ? 113 LYS A O     1 
ATOM   2233 C CB    . LYS D 4 113 ? 13.434  9.321   0.309   1.00 37.26  ? 113 LYS A CB    1 
ATOM   2234 C CG    . LYS D 4 113 ? 13.792  8.980   1.756   1.00 33.78  ? 113 LYS A CG    1 
ATOM   2235 C CD    . LYS D 4 113 ? 13.430  7.567   2.111   1.00 34.60  ? 113 LYS A CD    1 
ATOM   2236 C CE    . LYS D 4 113 ? 14.660  6.706   2.246   1.00 34.75  ? 113 LYS A CE    1 
ATOM   2237 N NZ    . LYS D 4 113 ? 14.277  5.293   2.468   1.00 42.63  ? 113 LYS A NZ    1 
ATOM   2238 N N     . GLU D 4 114 ? 11.720  11.897  0.975   1.00 29.06  ? 114 GLU A N     1 
ATOM   2239 C CA    . GLU D 4 114 ? 11.061  12.693  1.996   1.00 30.68  ? 114 GLU A CA    1 
ATOM   2240 C C     . GLU D 4 114 ? 11.202  11.980  3.350   1.00 31.05  ? 114 GLU A C     1 
ATOM   2241 O O     . GLU D 4 114 ? 11.275  10.750  3.413   1.00 27.47  ? 114 GLU A O     1 
ATOM   2242 C CB    . GLU D 4 114 ? 9.580   12.849  1.672   1.00 28.04  ? 114 GLU A CB    1 
ATOM   2243 C CG    . GLU D 4 114 ? 8.732   13.420  2.804   1.00 29.69  ? 114 GLU A CG    1 
ATOM   2244 C CD    . GLU D 4 114 ? 7.235   13.377  2.482   1.00 32.18  ? 114 GLU A CD    1 
ATOM   2245 O OE1   . GLU D 4 114 ? 6.893   12.838  1.412   1.00 33.24  ? 114 GLU A OE1   1 
ATOM   2246 O OE2   . GLU D 4 114 ? 6.400   13.863  3.288   1.00 30.53  ? 114 GLU A OE2   1 
ATOM   2247 N N     . ASP D 4 115 ? 11.252  12.755  4.427   1.00 30.52  ? 115 ASP A N     1 
ATOM   2248 C CA    . ASP D 4 115 ? 11.345  12.170  5.759   1.00 31.35  ? 115 ASP A CA    1 
ATOM   2249 C C     . ASP D 4 115 ? 10.078  11.328  5.990   1.00 30.69  ? 115 ASP A C     1 
ATOM   2250 O O     . ASP D 4 115 ? 8.967   11.833  5.906   1.00 31.98  ? 115 ASP A O     1 
ATOM   2251 C CB    . ASP D 4 115 ? 11.406  13.271  6.808   1.00 33.80  ? 115 ASP A CB    1 
ATOM   2252 C CG    . ASP D 4 115 ? 11.611  12.730  8.203   1.00 36.13  ? 115 ASP A CG    1 
ATOM   2253 O OD1   . ASP D 4 115 ? 11.188  11.595  8.503   1.00 36.01  ? 115 ASP A OD1   1 
ATOM   2254 O OD2   . ASP D 4 115 ? 12.198  13.463  9.018   1.00 40.21  ? 115 ASP A OD2   1 
ATOM   2255 N N     . PRO D 4 116 ? 10.238  10.037  6.290   1.00 30.31  ? 116 PRO A N     1 
ATOM   2256 C CA    . PRO D 4 116 ? 9.093   9.152   6.526   1.00 31.38  ? 116 PRO A CA    1 
ATOM   2257 C C     . PRO D 4 116 ? 8.468   9.271   7.921   1.00 31.60  ? 116 PRO A C     1 
ATOM   2258 O O     . PRO D 4 116 ? 7.401   8.707   8.178   1.00 31.10  ? 116 PRO A O     1 
ATOM   2259 C CB    . PRO D 4 116 ? 9.676   7.770   6.273   1.00 31.72  ? 116 PRO A CB    1 
ATOM   2260 C CG    . PRO D 4 116 ? 11.072  7.915   6.885   1.00 34.32  ? 116 PRO A CG    1 
ATOM   2261 C CD    . PRO D 4 116 ? 11.514  9.302   6.381   1.00 32.03  ? 116 PRO A CD    1 
ATOM   2262 N N     . GLY D 4 117 ? 9.123   10.001  8.822   1.00 32.29  ? 117 GLY A N     1 
ATOM   2263 C CA    . GLY D 4 117 ? 8.578   10.161  10.159  1.00 30.08  ? 117 GLY A CA    1 
ATOM   2264 C C     . GLY D 4 117 ? 8.527   8.851   10.921  1.00 28.97  ? 117 GLY A C     1 
ATOM   2265 O O     . GLY D 4 117 ? 9.013   7.834   10.444  1.00 28.13  ? 117 GLY A O     1 
ATOM   2266 N N     . PRO D 4 118 ? 7.907   8.836   12.104  1.00 29.98  ? 118 PRO A N     1 
ATOM   2267 C CA    . PRO D 4 118 ? 7.815   7.624   12.918  1.00 29.82  ? 118 PRO A CA    1 
ATOM   2268 C C     . PRO D 4 118 ? 6.672   6.650   12.644  1.00 30.53  ? 118 PRO A C     1 
ATOM   2269 O O     . PRO D 4 118 ? 6.809   5.460   12.909  1.00 31.85  ? 118 PRO A O     1 
ATOM   2270 C CB    . PRO D 4 118 ? 7.728   8.190   14.332  1.00 28.82  ? 118 PRO A CB    1 
ATOM   2271 C CG    . PRO D 4 118 ? 6.874   9.367   14.117  1.00 26.93  ? 118 PRO A CG    1 
ATOM   2272 C CD    . PRO D 4 118 ? 7.439   10.005  12.870  1.00 29.21  ? 118 PRO A CD    1 
ATOM   2273 N N     . ALA D 4 119 ? 5.555   7.147   12.125  1.00 30.46  ? 119 ALA A N     1 
ATOM   2274 C CA    . ALA D 4 119 ? 4.375   6.317   11.899  1.00 30.65  ? 119 ALA A CA    1 
ATOM   2275 C C     . ALA D 4 119 ? 4.216   5.660   10.532  1.00 31.16  ? 119 ALA A C     1 
ATOM   2276 O O     . ALA D 4 119 ? 4.630   6.202   9.504   1.00 31.16  ? 119 ALA A O     1 
ATOM   2277 C CB    . ALA D 4 119 ? 3.133   7.129   12.213  1.00 27.68  ? 119 ALA A CB    1 
ATOM   2278 N N     . ARG D 4 120 ? 3.585   4.492   10.529  1.00 28.52  ? 120 ARG A N     1 
ATOM   2279 C CA    . ARG D 4 120 ? 3.358   3.761   9.287   1.00 26.89  ? 120 ARG A CA    1 
ATOM   2280 C C     . ARG D 4 120 ? 1.944   3.168   9.236   1.00 28.04  ? 120 ARG A C     1 
ATOM   2281 O O     . ARG D 4 120 ? 1.380   2.748   10.251  1.00 28.88  ? 120 ARG A O     1 
ATOM   2282 C CB    . ARG D 4 120 ? 4.380   2.631   9.147   1.00 27.63  ? 120 ARG A CB    1 
ATOM   2283 C CG    . ARG D 4 120 ? 5.846   3.059   9.313   1.00 33.55  ? 120 ARG A CG    1 
ATOM   2284 C CD    . ARG D 4 120 ? 6.558   3.281   7.979   1.00 31.48  ? 120 ARG A CD    1 
ATOM   2285 N NE    . ARG D 4 120 ? 7.990   3.531   8.152   1.00 35.71  ? 120 ARG A NE    1 
ATOM   2286 C CZ    . ARG D 4 120 ? 8.501   4.675   8.609   1.00 36.77  ? 120 ARG A CZ    1 
ATOM   2287 N NH1   . ARG D 4 120 ? 7.685   5.679   8.930   1.00 35.73  ? 120 ARG A NH1   1 
ATOM   2288 N NH2   . ARG D 4 120 ? 9.809   4.818   8.780   1.00 36.92  ? 120 ARG A NH2   1 
ATOM   2289 N N     . VAL D 4 121 ? 1.337   3.168   8.060   1.00 27.66  ? 121 VAL A N     1 
ATOM   2290 C CA    . VAL D 4 121 ? 0.034   2.551   7.962   1.00 25.34  ? 121 VAL A CA    1 
ATOM   2291 C C     . VAL D 4 121 ? 0.362   1.142   7.464   1.00 27.89  ? 121 VAL A C     1 
ATOM   2292 O O     . VAL D 4 121 ? 1.142   0.962   6.525   1.00 29.04  ? 121 VAL A O     1 
ATOM   2293 C CB    . VAL D 4 121 ? -0.907  3.335   7.007   1.00 27.41  ? 121 VAL A CB    1 
ATOM   2294 C CG1   . VAL D 4 121 ? -0.310  3.440   5.606   1.00 22.47  ? 121 VAL A CG1   1 
ATOM   2295 C CG2   . VAL D 4 121 ? -2.264  2.663   6.992   1.00 27.67  ? 121 VAL A CG2   1 
ATOM   2296 N N     . ILE D 4 122 ? -0.172  0.133   8.142   1.00 28.40  ? 122 ILE A N     1 
ATOM   2297 C CA    . ILE D 4 122 ? 0.100   -1.247  7.776   1.00 28.27  ? 122 ILE A CA    1 
ATOM   2298 C C     . ILE D 4 122 ? -1.122  -1.848  7.140   1.00 29.17  ? 122 ILE A C     1 
ATOM   2299 O O     . ILE D 4 122 ? -2.213  -1.736  7.673   1.00 33.01  ? 122 ILE A O     1 
ATOM   2300 C CB    . ILE D 4 122 ? 0.469   -2.087  9.006   1.00 28.99  ? 122 ILE A CB    1 
ATOM   2301 C CG1   . ILE D 4 122 ? 1.678   -1.450  9.705   1.00 25.36  ? 122 ILE A CG1   1 
ATOM   2302 C CG2   . ILE D 4 122 ? 0.746   -3.559  8.584   1.00 24.70  ? 122 ILE A CG2   1 
ATOM   2303 C CD1   . ILE D 4 122 ? 2.892   -1.339  8.834   1.00 24.98  ? 122 ILE A CD1   1 
ATOM   2304 N N     . TYR D 4 123 ? -0.937  -2.507  6.006   1.00 32.16  ? 123 TYR A N     1 
ATOM   2305 C CA    . TYR D 4 123 ? -2.066  -3.091  5.295   1.00 34.11  ? 123 TYR A CA    1 
ATOM   2306 C C     . TYR D 4 123 ? -1.608  -4.291  4.475   1.00 35.32  ? 123 TYR A C     1 
ATOM   2307 O O     . TYR D 4 123 ? -0.420  -4.503  4.292   1.00 36.38  ? 123 TYR A O     1 
ATOM   2308 C CB    . TYR D 4 123 ? -2.727  -2.024  4.396   1.00 31.76  ? 123 TYR A CB    1 
ATOM   2309 C CG    . TYR D 4 123 ? -1.753  -1.287  3.498   1.00 34.43  ? 123 TYR A CG    1 
ATOM   2310 C CD1   . TYR D 4 123 ? -0.845  -0.366  4.023   1.00 36.02  ? 123 TYR A CD1   1 
ATOM   2311 C CD2   . TYR D 4 123 ? -1.697  -1.556  2.130   1.00 37.16  ? 123 TYR A CD2   1 
ATOM   2312 C CE1   . TYR D 4 123 ? 0.101   0.263   3.206   1.00 37.00  ? 123 TYR A CE1   1 
ATOM   2313 C CE2   . TYR D 4 123 ? -0.759  -0.932  1.308   1.00 37.51  ? 123 TYR A CE2   1 
ATOM   2314 C CZ    . TYR D 4 123 ? 0.137   -0.031  1.855   1.00 37.25  ? 123 TYR A CZ    1 
ATOM   2315 O OH    . TYR D 4 123 ? 1.094   0.532   1.056   1.00 33.51  ? 123 TYR A OH    1 
ATOM   2316 N N     . THR D 4 124 ? -2.564  -5.068  3.980   1.00 37.00  ? 124 THR A N     1 
ATOM   2317 C CA    . THR D 4 124 ? -2.263  -6.273  3.216   1.00 36.38  ? 124 THR A CA    1 
ATOM   2318 C C     . THR D 4 124 ? -1.988  -6.139  1.723   1.00 38.04  ? 124 THR A C     1 
ATOM   2319 O O     . THR D 4 124 ? -2.448  -5.217  1.050   1.00 39.65  ? 124 THR A O     1 
ATOM   2320 C CB    . THR D 4 124 ? -3.414  -7.284  3.330   1.00 36.49  ? 124 THR A CB    1 
ATOM   2321 O OG1   . THR D 4 124 ? -4.613  -6.661  2.865   1.00 36.06  ? 124 THR A OG1   1 
ATOM   2322 C CG2   . THR D 4 124 ? -3.605  -7.743  4.771   1.00 29.46  ? 124 THR A CG2   1 
ATOM   2323 N N     . TYR D 4 125 ? -1.224  -7.097  1.222   1.00 39.92  ? 125 TYR A N     1 
ATOM   2324 C CA    . TYR D 4 125 ? -0.930  -7.209  -0.188  1.00 42.83  ? 125 TYR A CA    1 
ATOM   2325 C C     . TYR D 4 125 ? -1.669  -8.507  -0.518  1.00 44.17  ? 125 TYR A C     1 
ATOM   2326 O O     . TYR D 4 125 ? -1.502  -9.501  0.178   1.00 42.81  ? 125 TYR A O     1 
ATOM   2327 C CB    . TYR D 4 125 ? 0.565   -7.370  -0.428  1.00 45.82  ? 125 TYR A CB    1 
ATOM   2328 C CG    . TYR D 4 125 ? 0.898   -7.804  -1.834  1.00 49.91  ? 125 TYR A CG    1 
ATOM   2329 C CD1   . TYR D 4 125 ? 0.965   -9.157  -2.168  1.00 51.01  ? 125 TYR A CD1   1 
ATOM   2330 C CD2   . TYR D 4 125 ? 1.114   -6.866  -2.839  1.00 50.45  ? 125 TYR A CD2   1 
ATOM   2331 C CE1   . TYR D 4 125 ? 1.239   -9.565  -3.464  1.00 52.31  ? 125 TYR A CE1   1 
ATOM   2332 C CE2   . TYR D 4 125 ? 1.387   -7.262  -4.145  1.00 53.03  ? 125 TYR A CE2   1 
ATOM   2333 C CZ    . TYR D 4 125 ? 1.449   -8.615  -4.454  1.00 54.20  ? 125 TYR A CZ    1 
ATOM   2334 O OH    . TYR D 4 125 ? 1.723   -9.020  -5.749  1.00 52.32  ? 125 TYR A OH    1 
ATOM   2335 N N     . PRO D 4 126 ? -2.462  -8.529  -1.601  1.00 45.20  ? 126 PRO A N     1 
ATOM   2336 C CA    . PRO D 4 126 ? -2.683  -7.443  -2.554  1.00 44.88  ? 126 PRO A CA    1 
ATOM   2337 C C     . PRO D 4 126 ? -4.008  -6.688  -2.453  1.00 44.21  ? 126 PRO A C     1 
ATOM   2338 O O     . PRO D 4 126 ? -4.310  -5.860  -3.319  1.00 46.03  ? 126 PRO A O     1 
ATOM   2339 C CB    . PRO D 4 126 ? -2.557  -8.164  -3.882  1.00 45.95  ? 126 PRO A CB    1 
ATOM   2340 C CG    . PRO D 4 126 ? -3.361  -9.424  -3.594  1.00 46.10  ? 126 PRO A CG    1 
ATOM   2341 C CD    . PRO D 4 126 ? -2.936  -9.809  -2.164  1.00 46.67  ? 126 PRO A CD    1 
ATOM   2342 N N     . ASN D 4 127 ? -4.791  -6.941  -1.412  1.00 43.12  ? 127 ASN A N     1 
ATOM   2343 C CA    . ASN D 4 127 ? -6.084  -6.268  -1.286  1.00 42.56  ? 127 ASN A CA    1 
ATOM   2344 C C     . ASN D 4 127 ? -6.161  -5.071  -0.341  1.00 41.67  ? 127 ASN A C     1 
ATOM   2345 O O     . ASN D 4 127 ? -7.248  -4.606  0.004   1.00 41.40  ? 127 ASN A O     1 
ATOM   2346 C CB    . ASN D 4 127 ? -7.145  -7.297  -0.928  1.00 42.20  ? 127 ASN A CB    1 
ATOM   2347 C CG    . ASN D 4 127 ? -7.061  -8.509  -1.817  1.00 44.73  ? 127 ASN A CG    1 
ATOM   2348 O OD1   . ASN D 4 127 ? -6.868  -8.385  -3.040  1.00 43.11  ? 127 ASN A OD1   1 
ATOM   2349 N ND2   . ASN D 4 127 ? -7.188  -9.691  -1.224  1.00 45.77  ? 127 ASN A ND2   1 
ATOM   2350 N N     . LYS D 4 128 ? -5.003  -4.572  0.068   1.00 39.65  ? 128 LYS A N     1 
ATOM   2351 C CA    . LYS D 4 128 ? -4.935  -3.404  0.932   1.00 37.99  ? 128 LYS A CA    1 
ATOM   2352 C C     . LYS D 4 128 ? -5.956  -3.357  2.076   1.00 36.72  ? 128 LYS A C     1 
ATOM   2353 O O     . LYS D 4 128 ? -6.583  -2.321  2.326   1.00 35.07  ? 128 LYS A O     1 
ATOM   2354 C CB    . LYS D 4 128 ? -5.052  -2.138  0.072   1.00 38.00  ? 128 LYS A CB    1 
ATOM   2355 C CG    . LYS D 4 128 ? -4.048  -2.088  -1.089  1.00 36.62  ? 128 LYS A CG    1 
ATOM   2356 C CD    . LYS D 4 128 ? -4.033  -0.722  -1.773  1.00 35.67  ? 128 LYS A CD    1 
ATOM   2357 C CE    . LYS D 4 128 ? -2.967  -0.684  -2.873  1.00 36.95  ? 128 LYS A CE    1 
ATOM   2358 N NZ    . LYS D 4 128 ? -2.860  0.643   -3.553  1.00 36.84  ? 128 LYS A NZ    1 
ATOM   2359 N N     . VAL D 4 129 ? -6.134  -4.475  2.771   1.00 37.09  ? 129 VAL A N     1 
ATOM   2360 C CA    . VAL D 4 129 ? -7.050  -4.482  3.905   1.00 35.75  ? 129 VAL A CA    1 
ATOM   2361 C C     . VAL D 4 129 ? -6.304  -3.687  4.993   1.00 37.54  ? 129 VAL A C     1 
ATOM   2362 O O     . VAL D 4 129 ? -5.107  -3.910  5.234   1.00 35.66  ? 129 VAL A O     1 
ATOM   2363 C CB    . VAL D 4 129 ? -7.329  -5.934  4.405   1.00 35.62  ? 129 VAL A CB    1 
ATOM   2364 C CG1   . VAL D 4 129 ? -8.291  -5.905  5.579   1.00 32.30  ? 129 VAL A CG1   1 
ATOM   2365 C CG2   . VAL D 4 129 ? -7.903  -6.796  3.267   1.00 36.48  ? 129 VAL A CG2   1 
ATOM   2366 N N     . PHE D 4 130 ? -6.990  -2.743  5.627   1.00 37.28  ? 130 PHE A N     1 
ATOM   2367 C CA    . PHE D 4 130 ? -6.359  -1.952  6.677   1.00 37.35  ? 130 PHE A CA    1 
ATOM   2368 C C     . PHE D 4 130 ? -6.105  -2.808  7.922   1.00 38.54  ? 130 PHE A C     1 
ATOM   2369 O O     . PHE D 4 130 ? -7.018  -3.448  8.433   1.00 35.62  ? 130 PHE A O     1 
ATOM   2370 C CB    . PHE D 4 130 ? -7.242  -0.774  7.073   1.00 36.43  ? 130 PHE A CB    1 
ATOM   2371 C CG    . PHE D 4 130 ? -6.744  -0.037  8.281   1.00 37.76  ? 130 PHE A CG    1 
ATOM   2372 C CD1   . PHE D 4 130 ? -5.689  0.865   8.177   1.00 40.12  ? 130 PHE A CD1   1 
ATOM   2373 C CD2   . PHE D 4 130 ? -7.323  -0.247  9.521   1.00 37.45  ? 130 PHE A CD2   1 
ATOM   2374 C CE1   . PHE D 4 130 ? -5.219  1.556   9.292   1.00 38.50  ? 130 PHE A CE1   1 
ATOM   2375 C CE2   . PHE D 4 130 ? -6.862  0.438   10.650  1.00 41.86  ? 130 PHE A CE2   1 
ATOM   2376 C CZ    . PHE D 4 130 ? -5.809  1.342   10.531  1.00 38.22  ? 130 PHE A CZ    1 
ATOM   2377 N N     . CYS D 4 131 ? -4.867  -2.787  8.410   1.00 38.79  ? 131 CYS A N     1 
ATOM   2378 C CA    . CYS D 4 131 ? -4.482  -3.561  9.584   1.00 41.39  ? 131 CYS A CA    1 
ATOM   2379 C C     . CYS D 4 131 ? -4.280  -2.686  10.823  1.00 42.92  ? 131 CYS A C     1 
ATOM   2380 O O     . CYS D 4 131 ? -4.636  -3.079  11.938  1.00 43.91  ? 131 CYS A O     1 
ATOM   2381 C CB    . CYS D 4 131 ? -3.203  -4.335  9.279   1.00 42.85  ? 131 CYS A CB    1 
ATOM   2382 S SG    . CYS D 4 131 ? -3.413  -5.559  7.946   1.00 47.90  ? 131 CYS A SG    1 
ATOM   2383 N N     . GLY D 4 132 ? -3.697  -1.506  10.630  1.00 41.32  ? 132 GLY A N     1 
ATOM   2384 C CA    . GLY D 4 132 ? -3.486  -0.610  11.748  1.00 39.62  ? 132 GLY A CA    1 
ATOM   2385 C C     . GLY D 4 132 ? -2.410  0.411   11.469  1.00 40.65  ? 132 GLY A C     1 
ATOM   2386 O O     . GLY D 4 132 ? -1.894  0.507   10.355  1.00 38.61  ? 132 GLY A O     1 
ATOM   2387 N N     . ILE D 4 133 ? -2.091  1.195   12.489  1.00 39.84  ? 133 ILE A N     1 
ATOM   2388 C CA    . ILE D 4 133 ? -1.048  2.193   12.398  1.00 40.22  ? 133 ILE A CA    1 
ATOM   2389 C C     . ILE D 4 133 ? -0.081  1.887   13.531  1.00 39.57  ? 133 ILE A C     1 
ATOM   2390 O O     . ILE D 4 133 ? -0.464  1.749   14.693  1.00 36.82  ? 133 ILE A O     1 
ATOM   2391 C CB    . ILE D 4 133 ? -1.597  3.636   12.537  1.00 42.38  ? 133 ILE A CB    1 
ATOM   2392 C CG1   . ILE D 4 133 ? -2.526  3.959   11.364  1.00 42.15  ? 133 ILE A CG1   1 
ATOM   2393 C CG2   . ILE D 4 133 ? -0.451  4.632   12.523  1.00 39.45  ? 133 ILE A CG2   1 
ATOM   2394 C CD1   . ILE D 4 133 ? -3.193  5.307   11.480  1.00 45.31  ? 133 ILE A CD1   1 
ATOM   2395 N N     . VAL D 4 134 ? 1.179   1.741   13.165  1.00 38.48  ? 134 VAL A N     1 
ATOM   2396 C CA    . VAL D 4 134 ? 2.212   1.435   14.123  1.00 38.06  ? 134 VAL A CA    1 
ATOM   2397 C C     . VAL D 4 134 ? 3.175   2.608   14.085  1.00 39.64  ? 134 VAL A C     1 
ATOM   2398 O O     . VAL D 4 134 ? 3.039   3.508   13.247  1.00 42.71  ? 134 VAL A O     1 
ATOM   2399 C CB    . VAL D 4 134 ? 2.939   0.152   13.727  1.00 35.37  ? 134 VAL A CB    1 
ATOM   2400 C CG1   . VAL D 4 134 ? 1.927   -0.951  13.464  1.00 37.20  ? 134 VAL A CG1   1 
ATOM   2401 C CG2   . VAL D 4 134 ? 3.779   0.400   12.500  1.00 35.51  ? 134 VAL A CG2   1 
ATOM   2402 N N     . ALA D 4 135 ? 4.150   2.604   14.979  1.00 36.68  ? 135 ALA A N     1 
ATOM   2403 C CA    . ALA D 4 135 ? 5.097   3.694   15.024  1.00 35.67  ? 135 ALA A CA    1 
ATOM   2404 C C     . ALA D 4 135 ? 6.316   3.277   15.818  1.00 36.29  ? 135 ALA A C     1 
ATOM   2405 O O     . ALA D 4 135 ? 6.211   2.563   16.818  1.00 37.75  ? 135 ALA A O     1 
ATOM   2406 C CB    . ALA D 4 135 ? 4.446   4.910   15.661  1.00 32.73  ? 135 ALA A CB    1 
ATOM   2407 N N     . HIS D 4 136 ? 7.478   3.718   15.366  1.00 36.39  ? 136 HIS A N     1 
ATOM   2408 C CA    . HIS D 4 136 ? 8.700   3.389   16.068  1.00 37.16  ? 136 HIS A CA    1 
ATOM   2409 C C     . HIS D 4 136 ? 8.587   3.968   17.466  1.00 36.71  ? 136 HIS A C     1 
ATOM   2410 O O     . HIS D 4 136 ? 8.074   5.075   17.664  1.00 31.23  ? 136 HIS A O     1 
ATOM   2411 C CB    . HIS D 4 136 ? 9.901   3.974   15.333  1.00 37.34  ? 136 HIS A CB    1 
ATOM   2412 C CG    . HIS D 4 136 ? 10.096  3.406   13.960  1.00 36.42  ? 136 HIS A CG    1 
ATOM   2413 N ND1   . HIS D 4 136 ? 10.794  2.241   13.727  1.00 37.20  ? 136 HIS A ND1   1 
ATOM   2414 C CD2   . HIS D 4 136 ? 9.632   3.813   12.754  1.00 36.06  ? 136 HIS A CD2   1 
ATOM   2415 C CE1   . HIS D 4 136 ? 10.748  1.953   12.437  1.00 38.25  ? 136 HIS A CE1   1 
ATOM   2416 N NE2   . HIS D 4 136 ? 10.048  2.891   11.825  1.00 35.11  ? 136 HIS A NE2   1 
ATOM   2417 N N     . GLN D 4 137 ? 9.043   3.204   18.444  1.00 39.35  ? 137 GLN A N     1 
ATOM   2418 C CA    . GLN D 4 137 ? 8.984   3.663   19.827  1.00 43.58  ? 137 GLN A CA    1 
ATOM   2419 C C     . GLN D 4 137 ? 9.806   4.939   20.042  1.00 40.95  ? 137 GLN A C     1 
ATOM   2420 O O     . GLN D 4 137 ? 9.360   5.871   20.713  1.00 41.52  ? 137 GLN A O     1 
ATOM   2421 C CB    . GLN D 4 137 ? 9.469   2.546   20.764  1.00 47.76  ? 137 GLN A CB    1 
ATOM   2422 C CG    . GLN D 4 137 ? 9.696   3.000   22.195  1.00 55.53  ? 137 GLN A CG    1 
ATOM   2423 C CD    . GLN D 4 137 ? 9.558   1.865   23.190  1.00 60.59  ? 137 GLN A CD    1 
ATOM   2424 O OE1   . GLN D 4 137 ? 10.252  0.843   23.095  1.00 61.23  ? 137 GLN A OE1   1 
ATOM   2425 N NE2   . GLN D 4 137 ? 8.655   2.037   24.155  1.00 61.68  ? 137 GLN A NE2   1 
ATOM   2426 N N     . ARG D 4 138 ? 10.999  4.981   19.459  1.00 40.71  ? 138 ARG A N     1 
ATOM   2427 C CA    . ARG D 4 138 ? 11.876  6.139   19.604  1.00 41.52  ? 138 ARG A CA    1 
ATOM   2428 C C     . ARG D 4 138 ? 12.519  6.521   18.287  1.00 41.24  ? 138 ARG A C     1 
ATOM   2429 O O     . ARG D 4 138 ? 13.075  5.683   17.595  1.00 42.28  ? 138 ARG A O     1 
ATOM   2430 C CB    . ARG D 4 138 ? 12.971  5.858   20.630  1.00 43.49  ? 138 ARG A CB    1 
ATOM   2431 C CG    . ARG D 4 138 ? 14.034  6.931   20.683  1.00 46.05  ? 138 ARG A CG    1 
ATOM   2432 C CD    . ARG D 4 138 ? 15.141  6.594   21.666  1.00 49.25  ? 138 ARG A CD    1 
ATOM   2433 N NE    . ARG D 4 138 ? 14.700  6.632   23.060  1.00 49.21  ? 138 ARG A NE    1 
ATOM   2434 C CZ    . ARG D 4 138 ? 15.523  6.479   24.091  1.00 47.98  ? 138 ARG A CZ    1 
ATOM   2435 N NH1   . ARG D 4 138 ? 16.814  6.273   23.874  1.00 45.02  ? 138 ARG A NH1   1 
ATOM   2436 N NH2   . ARG D 4 138 ? 15.064  6.562   25.332  1.00 46.30  ? 138 ARG A NH2   1 
ATOM   2437 N N     . GLY D 4 139 ? 12.447  7.801   17.950  1.00 41.50  ? 139 GLY A N     1 
ATOM   2438 C CA    . GLY D 4 139 ? 13.017  8.254   16.702  1.00 42.10  ? 139 GLY A CA    1 
ATOM   2439 C C     . GLY D 4 139 ? 12.258  7.636   15.551  1.00 43.43  ? 139 GLY A C     1 
ATOM   2440 O O     . GLY D 4 139 ? 11.115  7.205   15.712  1.00 44.12  ? 139 GLY A O     1 
ATOM   2441 N N     . ASN D 4 140 ? 12.890  7.587   14.387  1.00 45.06  ? 140 ASN A N     1 
ATOM   2442 C CA    . ASN D 4 140 ? 12.262  7.011   13.214  1.00 46.30  ? 140 ASN A CA    1 
ATOM   2443 C C     . ASN D 4 140 ? 12.792  5.612   12.976  1.00 48.69  ? 140 ASN A C     1 
ATOM   2444 O O     . ASN D 4 140 ? 12.669  5.080   11.884  1.00 48.48  ? 140 ASN A O     1 
ATOM   2445 C CB    . ASN D 4 140 ? 12.540  7.887   11.996  1.00 46.14  ? 140 ASN A CB    1 
ATOM   2446 C CG    . ASN D 4 140 ? 11.836  9.220   12.069  1.00 45.61  ? 140 ASN A CG    1 
ATOM   2447 O OD1   . ASN D 4 140 ? 12.252  10.184  11.431  1.00 49.85  ? 140 ASN A OD1   1 
ATOM   2448 N ND2   . ASN D 4 140 ? 10.757  9.283   12.836  1.00 43.57  ? 140 ASN A ND2   1 
ATOM   2449 N N     . GLN D 4 141 ? 13.375  5.009   14.005  1.00 52.86  ? 141 GLN A N     1 
ATOM   2450 C CA    . GLN D 4 141 ? 13.927  3.672   13.855  1.00 56.31  ? 141 GLN A CA    1 
ATOM   2451 C C     . GLN D 4 141 ? 13.670  2.749   15.042  1.00 57.71  ? 141 GLN A C     1 
ATOM   2452 O O     . GLN D 4 141 ? 13.040  3.139   16.030  1.00 59.19  ? 141 GLN A O     1 
ATOM   2453 C CB    . GLN D 4 141 ? 15.431  3.769   13.607  1.00 59.70  ? 141 GLN A CB    1 
ATOM   2454 C CG    . GLN D 4 141 ? 15.805  4.594   12.381  1.00 63.62  ? 141 GLN A CG    1 
ATOM   2455 C CD    . GLN D 4 141 ? 17.278  4.482   12.032  1.00 65.62  ? 141 GLN A CD    1 
ATOM   2456 O OE1   . GLN D 4 141 ? 17.759  5.133   11.104  1.00 66.02  ? 141 GLN A OE1   1 
ATOM   2457 N NE2   . GLN D 4 141 ? 18.001  3.645   12.774  1.00 66.11  ? 141 GLN A NE2   1 
ATOM   2458 N N     . GLY D 4 142 ? 14.158  1.516   14.930  1.00 56.09  ? 142 GLY A N     1 
ATOM   2459 C CA    . GLY D 4 142 ? 13.987  0.557   16.001  1.00 55.54  ? 142 GLY A CA    1 
ATOM   2460 C C     . GLY D 4 142 ? 12.640  -0.129  16.017  1.00 54.52  ? 142 GLY A C     1 
ATOM   2461 O O     . GLY D 4 142 ? 11.972  -0.234  14.996  1.00 54.68  ? 142 GLY A O     1 
ATOM   2462 N N     . ASP D 4 143 ? 12.251  -0.589  17.199  1.00 54.53  ? 143 ASP A N     1 
ATOM   2463 C CA    . ASP D 4 143 ? 10.991  -1.293  17.427  1.00 55.80  ? 143 ASP A CA    1 
ATOM   2464 C C     . ASP D 4 143 ? 9.726   -0.524  16.992  1.00 54.27  ? 143 ASP A C     1 
ATOM   2465 O O     . ASP D 4 143 ? 9.559   0.641   17.325  1.00 54.85  ? 143 ASP A O     1 
ATOM   2466 C CB    . ASP D 4 143 ? 10.904  -1.641  18.922  1.00 58.17  ? 143 ASP A CB    1 
ATOM   2467 C CG    . ASP D 4 143 ? 10.102  -2.908  19.194  1.00 58.06  ? 143 ASP A CG    1 
ATOM   2468 O OD1   . ASP D 4 143 ? 10.363  -3.926  18.526  1.00 58.95  ? 143 ASP A OD1   1 
ATOM   2469 O OD2   . ASP D 4 143 ? 9.224   -2.892  20.084  1.00 58.28  ? 143 ASP A OD2   1 
ATOM   2470 N N     . LEU D 4 144 ? 8.846   -1.193  16.251  1.00 53.56  ? 144 LEU A N     1 
ATOM   2471 C CA    . LEU D 4 144 ? 7.577   -0.615  15.788  1.00 52.30  ? 144 LEU A CA    1 
ATOM   2472 C C     . LEU D 4 144 ? 6.425   -1.105  16.672  1.00 51.91  ? 144 LEU A C     1 
ATOM   2473 O O     . LEU D 4 144 ? 6.163   -2.306  16.744  1.00 51.81  ? 144 LEU A O     1 
ATOM   2474 C CB    . LEU D 4 144 ? 7.292   -1.032  14.340  1.00 52.26  ? 144 LEU A CB    1 
ATOM   2475 C CG    . LEU D 4 144 ? 7.965   -0.273  13.190  1.00 53.59  ? 144 LEU A CG    1 
ATOM   2476 C CD1   . LEU D 4 144 ? 7.774   -1.036  11.889  1.00 52.85  ? 144 LEU A CD1   1 
ATOM   2477 C CD2   . LEU D 4 144 ? 7.373   1.124   13.073  1.00 52.19  ? 144 LEU A CD2   1 
ATOM   2478 N N     . ARG D 4 145 ? 5.728   -0.180  17.330  1.00 50.40  ? 145 ARG A N     1 
ATOM   2479 C CA    . ARG D 4 145 ? 4.618   -0.545  18.209  1.00 47.74  ? 145 ARG A CA    1 
ATOM   2480 C C     . ARG D 4 145 ? 3.257   -0.222  17.621  1.00 45.67  ? 145 ARG A C     1 
ATOM   2481 O O     . ARG D 4 145 ? 3.113   0.721   16.846  1.00 42.94  ? 145 ARG A O     1 
ATOM   2482 C CB    . ARG D 4 145 ? 4.725   0.190   19.549  1.00 49.82  ? 145 ARG A CB    1 
ATOM   2483 C CG    . ARG D 4 145 ? 6.037   0.000   20.280  1.00 56.41  ? 145 ARG A CG    1 
ATOM   2484 C CD    . ARG D 4 145 ? 6.016   0.698   21.639  1.00 60.87  ? 145 ARG A CD    1 
ATOM   2485 N NE    . ARG D 4 145 ? 5.884   2.152   21.531  1.00 64.82  ? 145 ARG A NE    1 
ATOM   2486 C CZ    . ARG D 4 145 ? 5.871   2.984   22.571  1.00 65.05  ? 145 ARG A CZ    1 
ATOM   2487 N NH1   . ARG D 4 145 ? 5.983   2.508   23.806  1.00 65.76  ? 145 ARG A NH1   1 
ATOM   2488 N NH2   . ARG D 4 145 ? 5.747   4.292   22.380  1.00 64.14  ? 145 ARG A NH2   1 
ATOM   2489 N N     . LEU D 4 146 ? 2.256   -1.010  18.007  1.00 43.74  ? 146 LEU A N     1 
ATOM   2490 C CA    . LEU D 4 146 ? 0.892   -0.778  17.567  1.00 42.82  ? 146 LEU A CA    1 
ATOM   2491 C C     . LEU D 4 146 ? 0.380   0.434   18.349  1.00 43.47  ? 146 LEU A C     1 
ATOM   2492 O O     . LEU D 4 146 ? 0.583   0.537   19.563  1.00 41.02  ? 146 LEU A O     1 
ATOM   2493 C CB    . LEU D 4 146 ? 0.017   -1.986  17.874  1.00 42.64  ? 146 LEU A CB    1 
ATOM   2494 C CG    . LEU D 4 146 ? -1.461  -1.833  17.503  1.00 42.11  ? 146 LEU A CG    1 
ATOM   2495 C CD1   . LEU D 4 146 ? -1.587  -1.687  15.992  1.00 41.65  ? 146 LEU A CD1   1 
ATOM   2496 C CD2   . LEU D 4 146 ? -2.249  -3.043  17.982  1.00 38.50  ? 146 LEU A CD2   1 
ATOM   2497 N N     . CYS D 4 147 ? -0.276  1.358   17.657  1.00 42.39  ? 147 CYS A N     1 
ATOM   2498 C CA    . CYS D 4 147 ? -0.789  2.548   18.316  1.00 41.67  ? 147 CYS A CA    1 
ATOM   2499 C C     . CYS D 4 147 ? -2.185  2.285   18.873  1.00 41.59  ? 147 CYS A C     1 
ATOM   2500 O O     . CYS D 4 147 ? -2.733  1.205   18.701  1.00 41.65  ? 147 CYS A O     1 
ATOM   2501 C CB    . CYS D 4 147 ? -0.780  3.737   17.336  1.00 40.99  ? 147 CYS A CB    1 
ATOM   2502 S SG    . CYS D 4 147 ? 0.859   4.051   16.584  1.00 39.67  ? 147 CYS A SG    1 
ATOM   2503 N N     . SER D 4 148 ? -2.744  3.273   19.555  1.00 44.64  ? 148 SER A N     1 
ATOM   2504 C CA    . SER D 4 148 ? -4.063  3.150   20.165  1.00 48.06  ? 148 SER A CA    1 
ATOM   2505 C C     . SER D 4 148 ? -5.173  3.729   19.308  1.00 50.37  ? 148 SER A C     1 
ATOM   2506 O O     . SER D 4 148 ? -4.919  4.511   18.403  1.00 51.65  ? 148 SER A O     1 
ATOM   2507 C CB    . SER D 4 148 ? -4.071  3.872   21.516  1.00 49.69  ? 148 SER A CB    1 
ATOM   2508 O OG    . SER D 4 148 ? -3.105  3.321   22.392  1.00 54.44  ? 148 SER A OG    1 
ATOM   2509 N N     . HIS D 4 149 ? -6.412  3.353   19.608  1.00 53.22  ? 149 HIS A N     1 
ATOM   2510 C CA    . HIS D 4 149 ? -7.561  3.880   18.873  1.00 55.03  ? 149 HIS A CA    1 
ATOM   2511 C C     . HIS D 4 149 ? -8.868  3.526   19.580  1.00 54.72  ? 149 HIS A C     1 
ATOM   2512 O O     . HIS D 4 149 ? -8.835  2.652   20.461  1.00 55.26  ? 149 HIS A O     1 
ATOM   2513 C CB    . HIS D 4 149 ? -7.596  3.315   17.456  1.00 54.46  ? 149 HIS A CB    1 
ATOM   2514 C CG    . HIS D 4 149 ? -8.003  1.881   17.403  1.00 54.20  ? 149 HIS A CG    1 
ATOM   2515 N ND1   . HIS D 4 149 ? -7.290  0.886   18.037  1.00 53.00  ? 149 HIS A ND1   1 
ATOM   2516 C CD2   . HIS D 4 149 ? -9.082  1.280   16.850  1.00 52.73  ? 149 HIS A CD2   1 
ATOM   2517 C CE1   . HIS D 4 149 ? -7.916  -0.266  17.880  1.00 54.43  ? 149 HIS A CE1   1 
ATOM   2518 N NE2   . HIS D 4 149 ? -9.007  -0.054  17.165  1.00 55.39  ? 149 HIS A NE2   1 
ATOM   2519 O OXT   . HIS D 4 149 ? -9.910  4.113   19.233  1.00 56.71  ? 149 HIS A OXT   1 
ATOM   2520 N N     . ALA E 4 1   ? 104.006 31.646  -40.180 1.00 45.05  ? 1   ALA B N     1 
ATOM   2521 C CA    . ALA E 4 1   ? 102.578 31.712  -40.591 1.00 44.75  ? 1   ALA B CA    1 
ATOM   2522 C C     . ALA E 4 1   ? 101.785 30.517  -40.067 1.00 43.10  ? 1   ALA B C     1 
ATOM   2523 O O     . ALA E 4 1   ? 100.561 30.571  -40.013 1.00 42.67  ? 1   ALA B O     1 
ATOM   2524 C CB    . ALA E 4 1   ? 102.474 31.773  -42.116 1.00 45.90  ? 1   ALA B CB    1 
ATOM   2525 N N     . THR E 4 2   ? 102.483 29.446  -39.688 1.00 40.08  ? 2   THR B N     1 
ATOM   2526 C CA    . THR E 4 2   ? 101.823 28.248  -39.181 1.00 38.75  ? 2   THR B CA    1 
ATOM   2527 C C     . THR E 4 2   ? 102.060 28.019  -37.704 1.00 39.15  ? 2   THR B C     1 
ATOM   2528 O O     . THR E 4 2   ? 103.180 27.768  -37.280 1.00 39.89  ? 2   THR B O     1 
ATOM   2529 C CB    . THR E 4 2   ? 102.271 26.990  -39.933 1.00 36.89  ? 2   THR B CB    1 
ATOM   2530 O OG1   . THR E 4 2   ? 101.942 27.122  -41.321 1.00 38.06  ? 2   THR B OG1   1 
ATOM   2531 C CG2   . THR E 4 2   ? 101.574 25.770  -39.374 1.00 33.94  ? 2   THR B CG2   1 
ATOM   2532 N N     . TRP E 4 3   ? 100.983 28.085  -36.929 1.00 38.31  ? 3   TRP B N     1 
ATOM   2533 C CA    . TRP E 4 3   ? 101.045 27.900  -35.486 1.00 39.42  ? 3   TRP B CA    1 
ATOM   2534 C C     . TRP E 4 3   ? 100.680 26.484  -35.043 1.00 40.27  ? 3   TRP B C     1 
ATOM   2535 O O     . TRP E 4 3   ? 99.747  25.865  -35.565 1.00 38.48  ? 3   TRP B O     1 
ATOM   2536 C CB    . TRP E 4 3   ? 100.106 28.884  -34.804 1.00 38.29  ? 3   TRP B CB    1 
ATOM   2537 C CG    . TRP E 4 3   ? 100.563 30.295  -34.848 1.00 40.93  ? 3   TRP B CG    1 
ATOM   2538 C CD1   . TRP E 4 3   ? 100.755 31.075  -35.961 1.00 40.57  ? 3   TRP B CD1   1 
ATOM   2539 C CD2   . TRP E 4 3   ? 100.828 31.131  -33.719 1.00 40.72  ? 3   TRP B CD2   1 
ATOM   2540 N NE1   . TRP E 4 3   ? 101.117 32.348  -35.585 1.00 42.72  ? 3   TRP B NE1   1 
ATOM   2541 C CE2   . TRP E 4 3   ? 101.167 32.408  -34.215 1.00 40.94  ? 3   TRP B CE2   1 
ATOM   2542 C CE3   . TRP E 4 3   ? 100.803 30.925  -32.335 1.00 41.32  ? 3   TRP B CE3   1 
ATOM   2543 C CZ2   . TRP E 4 3   ? 101.477 33.474  -33.373 1.00 40.14  ? 3   TRP B CZ2   1 
ATOM   2544 C CZ3   . TRP E 4 3   ? 101.109 31.989  -31.497 1.00 41.69  ? 3   TRP B CZ3   1 
ATOM   2545 C CH2   . TRP E 4 3   ? 101.440 33.246  -32.019 1.00 38.68  ? 3   TRP B CH2   1 
ATOM   2546 N N     . THR E 4 4   ? 101.411 25.980  -34.058 1.00 40.86  ? 4   THR B N     1 
ATOM   2547 C CA    . THR E 4 4   ? 101.154 24.645  -33.540 1.00 41.36  ? 4   THR B CA    1 
ATOM   2548 C C     . THR E 4 4   ? 100.711 24.723  -32.088 1.00 41.79  ? 4   THR B C     1 
ATOM   2549 O O     . THR E 4 4   ? 101.332 25.420  -31.281 1.00 41.97  ? 4   THR B O     1 
ATOM   2550 C CB    . THR E 4 4   ? 102.413 23.777  -33.635 1.00 40.98  ? 4   THR B CB    1 
ATOM   2551 O OG1   . THR E 4 4   ? 102.775 23.618  -35.013 1.00 43.85  ? 4   THR B OG1   1 
ATOM   2552 C CG2   . THR E 4 4   ? 102.175 22.426  -33.010 1.00 40.43  ? 4   THR B CG2   1 
ATOM   2553 N N     . CYS E 4 5   ? 99.634  24.018  -31.755 1.00 40.62  ? 5   CYS B N     1 
ATOM   2554 C CA    . CYS E 4 5   ? 99.141  24.013  -30.382 1.00 40.87  ? 5   CYS B CA    1 
ATOM   2555 C C     . CYS E 4 5   ? 99.059  22.586  -29.861 1.00 40.78  ? 5   CYS B C     1 
ATOM   2556 O O     . CYS E 4 5   ? 98.933  21.631  -30.634 1.00 38.41  ? 5   CYS B O     1 
ATOM   2557 C CB    . CYS E 4 5   ? 97.741  24.625  -30.282 1.00 42.10  ? 5   CYS B CB    1 
ATOM   2558 S SG    . CYS E 4 5   ? 97.451  26.266  -31.033 1.00 46.49  ? 5   CYS B SG    1 
ATOM   2559 N N     . ILE E 4 6   ? 99.133  22.444  -28.544 1.00 40.68  ? 6   ILE B N     1 
ATOM   2560 C CA    . ILE E 4 6   ? 99.023  21.130  -27.942 1.00 39.72  ? 6   ILE B CA    1 
ATOM   2561 C C     . ILE E 4 6   ? 97.808  21.142  -27.033 1.00 37.79  ? 6   ILE B C     1 
ATOM   2562 O O     . ILE E 4 6   ? 97.707  21.954  -26.138 1.00 35.50  ? 6   ILE B O     1 
ATOM   2563 C CB    . ILE E 4 6   ? 100.274 20.762  -27.139 1.00 40.14  ? 6   ILE B CB    1 
ATOM   2564 C CG1   . ILE E 4 6   ? 101.495 20.814  -28.053 1.00 40.95  ? 6   ILE B CG1   1 
ATOM   2565 C CG2   . ILE E 4 6   ? 100.118 19.364  -26.566 1.00 41.10  ? 6   ILE B CG2   1 
ATOM   2566 C CD1   . ILE E 4 6   ? 102.773 20.360  -27.404 1.00 43.03  ? 6   ILE B CD1   1 
ATOM   2567 N N     . ASN E 4 7   ? 96.869  20.249  -27.296 1.00 36.35  ? 7   ASN B N     1 
ATOM   2568 C CA    . ASN E 4 7   ? 95.665  20.177  -26.505 1.00 36.62  ? 7   ASN B CA    1 
ATOM   2569 C C     . ASN E 4 7   ? 95.355  18.749  -26.117 1.00 38.83  ? 7   ASN B C     1 
ATOM   2570 O O     . ASN E 4 7   ? 95.233  17.869  -26.967 1.00 40.55  ? 7   ASN B O     1 
ATOM   2571 C CB    . ASN E 4 7   ? 94.481  20.739  -27.281 1.00 36.45  ? 7   ASN B CB    1 
ATOM   2572 C CG    . ASN E 4 7   ? 93.191  20.656  -26.502 1.00 37.07  ? 7   ASN B CG    1 
ATOM   2573 O OD1   . ASN E 4 7   ? 92.201  20.089  -26.969 1.00 35.44  ? 7   ASN B OD1   1 
ATOM   2574 N ND2   . ASN E 4 7   ? 93.194  21.225  -25.297 1.00 37.16  ? 7   ASN B ND2   1 
ATOM   2575 N N     . GLN E 4 8   ? 95.224  18.516  -24.824 1.00 39.38  ? 8   GLN B N     1 
ATOM   2576 C CA    . GLN E 4 8   ? 94.907  17.187  -24.354 1.00 41.49  ? 8   GLN B CA    1 
ATOM   2577 C C     . GLN E 4 8   ? 93.425  16.917  -24.574 1.00 41.87  ? 8   GLN B C     1 
ATOM   2578 O O     . GLN E 4 8   ? 92.577  17.750  -24.261 1.00 39.28  ? 8   GLN B O     1 
ATOM   2579 C CB    . GLN E 4 8   ? 95.263  17.076  -22.877 1.00 45.38  ? 8   GLN B CB    1 
ATOM   2580 C CG    . GLN E 4 8   ? 96.670  17.575  -22.596 1.00 47.60  ? 8   GLN B CG    1 
ATOM   2581 C CD    . GLN E 4 8   ? 97.148  17.221  -21.210 1.00 51.06  ? 8   GLN B CD    1 
ATOM   2582 O OE1   . GLN E 4 8   ? 96.516  17.574  -20.218 1.00 52.81  ? 8   GLN B OE1   1 
ATOM   2583 N NE2   . GLN E 4 8   ? 98.277  16.521  -21.132 1.00 50.91  ? 8   GLN B NE2   1 
ATOM   2584 N N     . GLN E 4 9   ? 93.121  15.752  -25.134 1.00 42.87  ? 9   GLN B N     1 
ATOM   2585 C CA    . GLN E 4 9   ? 91.744  15.364  -25.386 1.00 42.55  ? 9   GLN B CA    1 
ATOM   2586 C C     . GLN E 4 9   ? 91.540  13.979  -24.795 1.00 44.50  ? 9   GLN B C     1 
ATOM   2587 O O     . GLN E 4 9   ? 92.482  13.192  -24.690 1.00 43.76  ? 9   GLN B O     1 
ATOM   2588 C CB    . GLN E 4 9   ? 91.455  15.397  -26.895 1.00 40.77  ? 9   GLN B CB    1 
ATOM   2589 C CG    . GLN E 4 9   ? 91.658  16.801  -27.473 1.00 41.55  ? 9   GLN B CG    1 
ATOM   2590 C CD    . GLN E 4 9   ? 91.574  16.885  -28.988 1.00 40.51  ? 9   GLN B CD    1 
ATOM   2591 O OE1   . GLN E 4 9   ? 91.803  17.946  -29.566 1.00 38.10  ? 9   GLN B OE1   1 
ATOM   2592 N NE2   . GLN E 4 9   ? 91.242  15.777  -29.634 1.00 38.33  ? 9   GLN B NE2   1 
ATOM   2593 N N     . LEU E 4 10  ? 90.310  13.696  -24.388 1.00 46.81  ? 10  LEU B N     1 
ATOM   2594 C CA    . LEU E 4 10  ? 89.985  12.427  -23.771 1.00 49.28  ? 10  LEU B CA    1 
ATOM   2595 C C     . LEU E 4 10  ? 89.542  11.380  -24.769 1.00 52.70  ? 10  LEU B C     1 
ATOM   2596 O O     . LEU E 4 10  ? 88.601  11.595  -25.536 1.00 53.72  ? 10  LEU B O     1 
ATOM   2597 C CB    . LEU E 4 10  ? 88.892  12.623  -22.728 1.00 48.35  ? 10  LEU B CB    1 
ATOM   2598 C CG    . LEU E 4 10  ? 88.548  11.380  -21.905 1.00 47.93  ? 10  LEU B CG    1 
ATOM   2599 C CD1   . LEU E 4 10  ? 89.635  11.180  -20.851 1.00 43.81  ? 10  LEU B CD1   1 
ATOM   2600 C CD2   . LEU E 4 10  ? 87.174  11.532  -21.249 1.00 44.87  ? 10  LEU B CD2   1 
ATOM   2601 N N     . ASN E 4 11  ? 90.232  10.244  -24.742 1.00 56.60  ? 11  ASN B N     1 
ATOM   2602 C CA    . ASN E 4 11  ? 89.951  9.112   -25.618 1.00 59.66  ? 11  ASN B CA    1 
ATOM   2603 C C     . ASN E 4 11  ? 88.819  8.308   -24.980 1.00 61.96  ? 11  ASN B C     1 
ATOM   2604 O O     . ASN E 4 11  ? 88.964  7.809   -23.863 1.00 62.45  ? 11  ASN B O     1 
ATOM   2605 C CB    . ASN E 4 11  ? 91.205  8.239   -25.737 1.00 58.98  ? 11  ASN B CB    1 
ATOM   2606 C CG    . ASN E 4 11  ? 90.993  7.008   -26.607 1.00 59.83  ? 11  ASN B CG    1 
ATOM   2607 O OD1   . ASN E 4 11  ? 89.901  6.440   -26.668 1.00 58.77  ? 11  ASN B OD1   1 
ATOM   2608 N ND2   . ASN E 4 11  ? 92.051  6.569   -27.260 1.00 59.16  ? 11  ASN B ND2   1 
ATOM   2609 N N     . PRO E 4 12  ? 87.676  8.179   -25.673 1.00 64.27  ? 12  PRO B N     1 
ATOM   2610 C CA    . PRO E 4 12  ? 86.551  7.420   -25.112 1.00 65.95  ? 12  PRO B CA    1 
ATOM   2611 C C     . PRO E 4 12  ? 86.946  6.036   -24.601 1.00 67.31  ? 12  PRO B C     1 
ATOM   2612 O O     . PRO E 4 12  ? 86.418  5.557   -23.595 1.00 67.59  ? 12  PRO B O     1 
ATOM   2613 C CB    . PRO E 4 12  ? 85.567  7.362   -26.274 1.00 66.11  ? 12  PRO B CB    1 
ATOM   2614 C CG    . PRO E 4 12  ? 85.782  8.689   -26.936 1.00 65.63  ? 12  PRO B CG    1 
ATOM   2615 C CD    . PRO E 4 12  ? 87.304  8.781   -26.966 1.00 64.67  ? 12  PRO B CD    1 
ATOM   2616 N N     . LYS E 4 13  ? 87.867  5.392   -25.306 1.00 68.03  ? 13  LYS B N     1 
ATOM   2617 C CA    . LYS E 4 13  ? 88.342  4.087   -24.891 1.00 68.95  ? 13  LYS B CA    1 
ATOM   2618 C C     . LYS E 4 13  ? 89.566  4.353   -24.026 1.00 69.32  ? 13  LYS B C     1 
ATOM   2619 O O     . LYS E 4 13  ? 90.648  4.654   -24.535 1.00 69.79  ? 13  LYS B O     1 
ATOM   2620 C CB    . LYS E 4 13  ? 88.696  3.231   -26.111 1.00 68.16  ? 13  LYS B CB    1 
ATOM   2621 C CG    . LYS E 4 13  ? 87.477  2.805   -26.903 1.00 67.48  ? 13  LYS B CG    1 
ATOM   2622 C CD    . LYS E 4 13  ? 87.855  2.043   -28.153 1.00 68.09  ? 13  LYS B CD    1 
ATOM   2623 C CE    . LYS E 4 13  ? 86.622  1.733   -28.985 1.00 68.10  ? 13  LYS B CE    1 
ATOM   2624 N NZ    . LYS E 4 13  ? 86.969  1.091   -30.276 1.00 67.91  ? 13  LYS B NZ    1 
ATOM   2625 N N     . THR E 4 14  ? 89.347  4.266   -22.715 1.00 70.24  ? 14  THR B N     1 
ATOM   2626 C CA    . THR E 4 14  ? 90.347  4.492   -21.673 1.00 70.65  ? 14  THR B CA    1 
ATOM   2627 C C     . THR E 4 14  ? 90.197  5.929   -21.188 1.00 70.27  ? 14  THR B C     1 
ATOM   2628 O O     . THR E 4 14  ? 90.631  6.864   -21.859 1.00 71.09  ? 14  THR B O     1 
ATOM   2629 C CB    . THR E 4 14  ? 91.795  4.272   -22.176 1.00 71.06  ? 14  THR B CB    1 
ATOM   2630 O OG1   . THR E 4 14  ? 91.871  3.036   -22.898 1.00 74.45  ? 14  THR B OG1   1 
ATOM   2631 C CG2   . THR E 4 14  ? 92.755  4.207   -21.002 1.00 71.68  ? 14  THR B CG2   1 
ATOM   2632 N N     . ASN E 4 15  ? 89.568  6.107   -20.029 1.00 69.52  ? 15  ASN B N     1 
ATOM   2633 C CA    . ASN E 4 15  ? 89.374  7.452   -19.504 1.00 68.89  ? 15  ASN B CA    1 
ATOM   2634 C C     . ASN E 4 15  ? 90.678  8.226   -19.326 1.00 68.59  ? 15  ASN B C     1 
ATOM   2635 O O     . ASN E 4 15  ? 90.847  8.939   -18.335 1.00 70.27  ? 15  ASN B O     1 
ATOM   2636 C CB    . ASN E 4 15  ? 88.584  7.418   -18.184 1.00 67.72  ? 15  ASN B CB    1 
ATOM   2637 C CG    . ASN E 4 15  ? 87.536  8.520   -18.118 1.00 67.83  ? 15  ASN B CG    1 
ATOM   2638 O OD1   . ASN E 4 15  ? 87.122  9.036   -19.163 1.00 65.96  ? 15  ASN B OD1   1 
ATOM   2639 N ND2   . ASN E 4 15  ? 87.088  8.879   -16.902 1.00 65.52  ? 15  ASN B ND2   1 
ATOM   2640 N N     . LYS E 4 16  ? 91.591  8.107   -20.294 1.00 66.89  ? 16  LYS B N     1 
ATOM   2641 C CA    . LYS E 4 16  ? 92.881  8.799   -20.255 1.00 65.19  ? 16  LYS B CA    1 
ATOM   2642 C C     . LYS E 4 16  ? 93.058  9.845   -21.363 1.00 62.04  ? 16  LYS B C     1 
ATOM   2643 O O     . LYS E 4 16  ? 92.648  9.647   -22.511 1.00 60.71  ? 16  LYS B O     1 
ATOM   2644 C CB    . LYS E 4 16  ? 94.027  7.796   -20.341 1.00 67.58  ? 16  LYS B CB    1 
ATOM   2645 C CG    . LYS E 4 16  ? 94.024  6.993   -21.625 1.00 70.53  ? 16  LYS B CG    1 
ATOM   2646 C CD    . LYS E 4 16  ? 95.363  6.315   -21.859 1.00 73.70  ? 16  LYS B CD    1 
ATOM   2647 C CE    . LYS E 4 16  ? 95.712  5.364   -20.723 1.00 74.70  ? 16  LYS B CE    1 
ATOM   2648 N NZ    . LYS E 4 16  ? 97.010  4.678   -20.962 1.00 74.49  ? 16  LYS B NZ    1 
ATOM   2649 N N     . TRP E 4 17  ? 93.711  10.943  -20.999 1.00 58.73  ? 17  TRP B N     1 
ATOM   2650 C CA    . TRP E 4 17  ? 93.961  12.066  -21.893 1.00 56.83  ? 17  TRP B CA    1 
ATOM   2651 C C     . TRP E 4 17  ? 95.196  11.891  -22.764 1.00 54.95  ? 17  TRP B C     1 
ATOM   2652 O O     . TRP E 4 17  ? 96.242  11.468  -22.287 1.00 55.40  ? 17  TRP B O     1 
ATOM   2653 C CB    . TRP E 4 17  ? 94.107  13.343  -21.063 1.00 57.13  ? 17  TRP B CB    1 
ATOM   2654 C CG    . TRP E 4 17  ? 92.944  13.580  -20.172 1.00 58.79  ? 17  TRP B CG    1 
ATOM   2655 C CD1   . TRP E 4 17  ? 92.687  12.979  -18.969 1.00 59.27  ? 17  TRP B CD1   1 
ATOM   2656 C CD2   . TRP E 4 17  ? 91.810  14.392  -20.467 1.00 58.82  ? 17  TRP B CD2   1 
ATOM   2657 N NE1   . TRP E 4 17  ? 91.453  13.363  -18.506 1.00 59.93  ? 17  TRP B NE1   1 
ATOM   2658 C CE2   . TRP E 4 17  ? 90.892  14.231  -19.408 1.00 59.78  ? 17  TRP B CE2   1 
ATOM   2659 C CE3   . TRP E 4 17  ? 91.476  15.240  -21.531 1.00 58.02  ? 17  TRP B CE3   1 
ATOM   2660 C CZ2   . TRP E 4 17  ? 89.662  14.885  -19.382 1.00 58.94  ? 17  TRP B CZ2   1 
ATOM   2661 C CZ3   . TRP E 4 17  ? 90.256  15.888  -21.505 1.00 58.69  ? 17  TRP B CZ3   1 
ATOM   2662 C CH2   . TRP E 4 17  ? 89.362  15.707  -20.436 1.00 58.89  ? 17  TRP B CH2   1 
ATOM   2663 N N     . GLU E 4 18  ? 95.067  12.234  -24.042 1.00 53.33  ? 18  GLU B N     1 
ATOM   2664 C CA    . GLU E 4 18  ? 96.173  12.127  -24.983 1.00 51.90  ? 18  GLU B CA    1 
ATOM   2665 C C     . GLU E 4 18  ? 96.502  13.511  -25.555 1.00 50.64  ? 18  GLU B C     1 
ATOM   2666 O O     . GLU E 4 18  ? 95.610  14.341  -25.756 1.00 47.14  ? 18  GLU B O     1 
ATOM   2667 C CB    . GLU E 4 18  ? 95.800  11.162  -26.109 1.00 53.68  ? 18  GLU B CB    1 
ATOM   2668 C CG    . GLU E 4 18  ? 95.244  9.834   -25.602 1.00 58.63  ? 18  GLU B CG    1 
ATOM   2669 C CD    . GLU E 4 18  ? 94.570  9.013   -26.691 1.00 61.47  ? 18  GLU B CD    1 
ATOM   2670 O OE1   . GLU E 4 18  ? 94.042  9.621   -27.646 1.00 65.33  ? 18  GLU B OE1   1 
ATOM   2671 O OE2   . GLU E 4 18  ? 94.548  7.768   -26.585 1.00 61.31  ? 18  GLU B OE2   1 
ATOM   2672 N N     . ASP E 4 19  ? 97.786  13.759  -25.797 1.00 48.39  ? 19  ASP B N     1 
ATOM   2673 C CA    . ASP E 4 19  ? 98.230  15.035  -26.341 1.00 48.83  ? 19  ASP B CA    1 
ATOM   2674 C C     . ASP E 4 19  ? 98.034  15.106  -27.849 1.00 47.42  ? 19  ASP B C     1 
ATOM   2675 O O     . ASP E 4 19  ? 98.726  14.424  -28.599 1.00 48.05  ? 19  ASP B O     1 
ATOM   2676 C CB    . ASP E 4 19  ? 99.713  15.261  -26.023 1.00 50.14  ? 19  ASP B CB    1 
ATOM   2677 C CG    . ASP E 4 19  ? 99.949  15.644  -24.577 1.00 52.12  ? 19  ASP B CG    1 
ATOM   2678 O OD1   . ASP E 4 19  ? 101.104 15.952  -24.218 1.00 53.66  ? 19  ASP B OD1   1 
ATOM   2679 O OD2   . ASP E 4 19  ? 98.979  15.643  -23.797 1.00 53.93  ? 19  ASP B OD2   1 
ATOM   2680 N N     . LYS E 4 20  ? 97.088  15.921  -28.294 1.00 45.32  ? 20  LYS B N     1 
ATOM   2681 C CA    . LYS E 4 20  ? 96.855  16.073  -29.726 1.00 43.70  ? 20  LYS B CA    1 
ATOM   2682 C C     . LYS E 4 20  ? 97.607  17.316  -30.182 1.00 42.55  ? 20  LYS B C     1 
ATOM   2683 O O     . LYS E 4 20  ? 97.649  18.326  -29.471 1.00 42.48  ? 20  LYS B O     1 
ATOM   2684 C CB    . LYS E 4 20  ? 95.362  16.236  -30.031 1.00 44.44  ? 20  LYS B CB    1 
ATOM   2685 C CG    . LYS E 4 20  ? 94.475  15.061  -29.616 1.00 48.46  ? 20  LYS B CG    1 
ATOM   2686 C CD    . LYS E 4 20  ? 94.807  13.793  -30.388 1.00 51.16  ? 20  LYS B CD    1 
ATOM   2687 C CE    . LYS E 4 20  ? 93.848  12.658  -30.037 1.00 55.60  ? 20  LYS B CE    1 
ATOM   2688 N NZ    . LYS E 4 20  ? 92.430  12.952  -30.437 1.00 57.86  ? 20  LYS B NZ    1 
ATOM   2689 N N     . ARG E 4 21  ? 98.220  17.234  -31.358 1.00 42.82  ? 21  ARG B N     1 
ATOM   2690 C CA    . ARG E 4 21  ? 98.967  18.355  -31.911 1.00 42.38  ? 21  ARG B CA    1 
ATOM   2691 C C     . ARG E 4 21  ? 98.194  18.917  -33.096 1.00 41.13  ? 21  ARG B C     1 
ATOM   2692 O O     . ARG E 4 21  ? 97.928  18.216  -34.073 1.00 40.82  ? 21  ARG B O     1 
ATOM   2693 C CB    . ARG E 4 21  ? 100.358 17.895  -32.332 1.00 42.87  ? 21  ARG B CB    1 
ATOM   2694 C CG    . ARG E 4 21  ? 101.051 17.130  -31.237 1.00 47.68  ? 21  ARG B CG    1 
ATOM   2695 C CD    . ARG E 4 21  ? 102.483 16.823  -31.596 1.00 52.65  ? 21  ARG B CD    1 
ATOM   2696 N NE    . ARG E 4 21  ? 103.192 18.045  -31.954 1.00 57.58  ? 21  ARG B NE    1 
ATOM   2697 C CZ    . ARG E 4 21  ? 104.509 18.133  -32.083 1.00 61.66  ? 21  ARG B CZ    1 
ATOM   2698 N NH1   . ARG E 4 21  ? 105.267 17.061  -31.876 1.00 64.86  ? 21  ARG B NH1   1 
ATOM   2699 N NH2   . ARG E 4 21  ? 105.067 19.289  -32.428 1.00 62.60  ? 21  ARG B NH2   1 
ATOM   2700 N N     . LEU E 4 22  ? 97.822  20.185  -32.988 1.00 39.63  ? 22  LEU B N     1 
ATOM   2701 C CA    . LEU E 4 22  ? 97.054  20.849  -34.027 1.00 38.37  ? 22  LEU B CA    1 
ATOM   2702 C C     . LEU E 4 22  ? 97.825  22.046  -34.611 1.00 37.64  ? 22  LEU B C     1 
ATOM   2703 O O     . LEU E 4 22  ? 98.603  22.705  -33.902 1.00 34.71  ? 22  LEU B O     1 
ATOM   2704 C CB    . LEU E 4 22  ? 95.722  21.303  -33.425 1.00 39.51  ? 22  LEU B CB    1 
ATOM   2705 C CG    . LEU E 4 22  ? 94.949  20.252  -32.611 1.00 39.58  ? 22  LEU B CG    1 
ATOM   2706 C CD1   . LEU E 4 22  ? 93.844  20.924  -31.808 1.00 37.44  ? 22  LEU B CD1   1 
ATOM   2707 C CD2   . LEU E 4 22  ? 94.354  19.201  -33.534 1.00 39.64  ? 22  LEU B CD2   1 
ATOM   2708 N N     . LEU E 4 23  ? 97.622  22.305  -35.905 1.00 35.05  ? 23  LEU B N     1 
ATOM   2709 C CA    . LEU E 4 23  ? 98.278  23.417  -36.606 1.00 34.19  ? 23  LEU B CA    1 
ATOM   2710 C C     . LEU E 4 23  ? 97.232  24.430  -37.049 1.00 35.07  ? 23  LEU B C     1 
ATOM   2711 O O     . LEU E 4 23  ? 96.065  24.076  -37.270 1.00 34.61  ? 23  LEU B O     1 
ATOM   2712 C CB    . LEU E 4 23  ? 99.019  22.933  -37.855 1.00 34.99  ? 23  LEU B CB    1 
ATOM   2713 C CG    . LEU E 4 23  ? 100.070 21.821  -37.791 1.00 38.56  ? 23  LEU B CG    1 
ATOM   2714 C CD1   . LEU E 4 23  ? 100.561 21.548  -39.205 1.00 34.87  ? 23  LEU B CD1   1 
ATOM   2715 C CD2   . LEU E 4 23  ? 101.237 22.213  -36.885 1.00 38.20  ? 23  LEU B CD2   1 
ATOM   2716 N N     . TYR E 4 24  ? 97.647  25.689  -37.178 1.00 34.91  ? 24  TYR B N     1 
ATOM   2717 C CA    . TYR E 4 24  ? 96.744  26.753  -37.611 1.00 36.00  ? 24  TYR B CA    1 
ATOM   2718 C C     . TYR E 4 24  ? 97.477  27.750  -38.495 1.00 38.12  ? 24  TYR B C     1 
ATOM   2719 O O     . TYR E 4 24  ? 98.672  27.991  -38.316 1.00 39.70  ? 24  TYR B O     1 
ATOM   2720 C CB    . TYR E 4 24  ? 96.163  27.515  -36.411 1.00 34.82  ? 24  TYR B CB    1 
ATOM   2721 C CG    . TYR E 4 24  ? 95.441  26.652  -35.394 1.00 35.09  ? 24  TYR B CG    1 
ATOM   2722 C CD1   . TYR E 4 24  ? 96.159  25.808  -34.538 1.00 31.85  ? 24  TYR B CD1   1 
ATOM   2723 C CD2   . TYR E 4 24  ? 94.039  26.658  -35.308 1.00 29.46  ? 24  TYR B CD2   1 
ATOM   2724 C CE1   . TYR E 4 24  ? 95.508  24.992  -33.630 1.00 32.08  ? 24  TYR B CE1   1 
ATOM   2725 C CE2   . TYR E 4 24  ? 93.375  25.843  -34.397 1.00 33.02  ? 24  TYR B CE2   1 
ATOM   2726 C CZ    . TYR E 4 24  ? 94.123  25.009  -33.558 1.00 33.35  ? 24  TYR B CZ    1 
ATOM   2727 O OH    . TYR E 4 24  ? 93.501  24.196  -32.649 1.00 31.19  ? 24  TYR B OH    1 
ATOM   2728 N N     . SER E 4 25  ? 96.757  28.333  -39.448 1.00 37.76  ? 25  SER B N     1 
ATOM   2729 C CA    . SER E 4 25  ? 97.328  29.343  -40.335 1.00 37.37  ? 25  SER B CA    1 
ATOM   2730 C C     . SER E 4 25  ? 97.061  30.730  -39.748 1.00 37.21  ? 25  SER B C     1 
ATOM   2731 O O     . SER E 4 25  ? 95.928  31.050  -39.398 1.00 39.28  ? 25  SER B O     1 
ATOM   2732 C CB    . SER E 4 25  ? 96.678  29.267  -41.711 1.00 35.84  ? 25  SER B CB    1 
ATOM   2733 O OG    . SER E 4 25  ? 96.701  30.543  -42.314 1.00 36.00  ? 25  SER B OG    1 
ATOM   2734 N N     . GLN E 4 26  ? 98.092  31.557  -39.641 1.00 39.00  ? 26  GLN B N     1 
ATOM   2735 C CA    . GLN E 4 26  ? 97.911  32.897  -39.100 1.00 42.42  ? 26  GLN B CA    1 
ATOM   2736 C C     . GLN E 4 26  ? 97.055  33.708  -40.057 1.00 43.96  ? 26  GLN B C     1 
ATOM   2737 O O     . GLN E 4 26  ? 96.209  34.492  -39.637 1.00 44.05  ? 26  GLN B O     1 
ATOM   2738 C CB    . GLN E 4 26  ? 99.254  33.592  -38.913 1.00 44.32  ? 26  GLN B CB    1 
ATOM   2739 C CG    . GLN E 4 26  ? 99.147  34.951  -38.237 1.00 47.35  ? 26  GLN B CG    1 
ATOM   2740 C CD    . GLN E 4 26  ? 100.511 35.557  -37.934 1.00 46.74  ? 26  GLN B CD    1 
ATOM   2741 O OE1   . GLN E 4 26  ? 101.385 34.883  -37.400 1.00 45.07  ? 26  GLN B OE1   1 
ATOM   2742 N NE2   . GLN E 4 26  ? 100.688 36.835  -38.263 1.00 46.60  ? 26  GLN B NE2   1 
ATOM   2743 N N     . ALA E 4 27  ? 97.277  33.510  -41.351 1.00 46.07  ? 27  ALA B N     1 
ATOM   2744 C CA    . ALA E 4 27  ? 96.506  34.226  -42.357 1.00 46.49  ? 27  ALA B CA    1 
ATOM   2745 C C     . ALA E 4 27  ? 95.037  33.978  -42.086 1.00 45.41  ? 27  ALA B C     1 
ATOM   2746 O O     . ALA E 4 27  ? 94.253  34.912  -41.980 1.00 47.46  ? 27  ALA B O     1 
ATOM   2747 C CB    . ALA E 4 27  ? 96.874  33.741  -43.754 1.00 44.37  ? 27  ALA B CB    1 
ATOM   2748 N N     . LYS E 4 28  ? 94.666  32.711  -41.959 1.00 46.12  ? 28  LYS B N     1 
ATOM   2749 C CA    . LYS E 4 28  ? 93.274  32.369  -41.704 1.00 45.46  ? 28  LYS B CA    1 
ATOM   2750 C C     . LYS E 4 28  ? 92.782  32.813  -40.334 1.00 44.47  ? 28  LYS B C     1 
ATOM   2751 O O     . LYS E 4 28  ? 91.678  33.335  -40.222 1.00 43.20  ? 28  LYS B O     1 
ATOM   2752 C CB    . LYS E 4 28  ? 93.059  30.872  -41.893 1.00 47.03  ? 28  LYS B CB    1 
ATOM   2753 C CG    . LYS E 4 28  ? 93.296  30.448  -43.324 1.00 51.04  ? 28  LYS B CG    1 
ATOM   2754 C CD    . LYS E 4 28  ? 92.983  28.988  -43.560 1.00 55.33  ? 28  LYS B CD    1 
ATOM   2755 C CE    . LYS E 4 28  ? 93.459  28.558  -44.940 1.00 57.72  ? 28  LYS B CE    1 
ATOM   2756 N NZ    . LYS E 4 28  ? 93.201  27.113  -45.198 1.00 60.47  ? 28  LYS B NZ    1 
ATOM   2757 N N     . ALA E 4 29  ? 93.587  32.617  -39.295 1.00 43.34  ? 29  ALA B N     1 
ATOM   2758 C CA    . ALA E 4 29  ? 93.174  33.039  -37.962 1.00 44.19  ? 29  ALA B CA    1 
ATOM   2759 C C     . ALA E 4 29  ? 92.809  34.524  -38.001 1.00 45.52  ? 29  ALA B C     1 
ATOM   2760 O O     . ALA E 4 29  ? 91.764  34.930  -37.490 1.00 45.16  ? 29  ALA B O     1 
ATOM   2761 C CB    . ALA E 4 29  ? 94.294  32.795  -36.955 1.00 42.97  ? 29  ALA B CB    1 
ATOM   2762 N N     . GLU E 4 30  ? 93.669  35.332  -38.619 1.00 47.25  ? 30  GLU B N     1 
ATOM   2763 C CA    . GLU E 4 30  ? 93.422  36.772  -38.723 1.00 49.68  ? 30  GLU B CA    1 
ATOM   2764 C C     . GLU E 4 30  ? 92.151  37.070  -39.531 1.00 48.91  ? 30  GLU B C     1 
ATOM   2765 O O     . GLU E 4 30  ? 91.428  38.020  -39.238 1.00 49.68  ? 30  GLU B O     1 
ATOM   2766 C CB    . GLU E 4 30  ? 94.631  37.474  -39.354 1.00 48.36  ? 30  GLU B CB    1 
ATOM   2767 C CG    . GLU E 4 30  ? 95.785  37.708  -38.386 1.00 52.62  ? 30  GLU B CG    1 
ATOM   2768 C CD    . GLU E 4 30  ? 97.037  38.285  -39.059 1.00 54.68  ? 30  GLU B CD    1 
ATOM   2769 O OE1   . GLU E 4 30  ? 97.970  38.704  -38.339 1.00 56.80  ? 30  GLU B OE1   1 
ATOM   2770 O OE2   . GLU E 4 30  ? 97.097  38.312  -40.306 1.00 55.38  ? 30  GLU B OE2   1 
ATOM   2771 N N     . SER E 4 31  ? 91.882  36.245  -40.536 1.00 47.80  ? 31  SER B N     1 
ATOM   2772 C CA    . SER E 4 31  ? 90.702  36.402  -41.372 1.00 48.02  ? 31  SER B CA    1 
ATOM   2773 C C     . SER E 4 31  ? 89.461  36.154  -40.520 1.00 49.04  ? 31  SER B C     1 
ATOM   2774 O O     . SER E 4 31  ? 88.476  36.893  -40.594 1.00 49.47  ? 31  SER B O     1 
ATOM   2775 C CB    . SER E 4 31  ? 90.747  35.399  -42.536 1.00 50.85  ? 31  SER B CB    1 
ATOM   2776 O OG    . SER E 4 31  ? 89.571  35.456  -43.336 1.00 52.26  ? 31  SER B OG    1 
ATOM   2777 N N     . ASN E 4 32  ? 89.515  35.098  -39.714 1.00 47.80  ? 32  ASN B N     1 
ATOM   2778 C CA    . ASN E 4 32  ? 88.405  34.752  -38.843 1.00 44.62  ? 32  ASN B CA    1 
ATOM   2779 C C     . ASN E 4 32  ? 88.018  35.980  -38.040 1.00 44.43  ? 32  ASN B C     1 
ATOM   2780 O O     . ASN E 4 32  ? 86.845  36.335  -37.969 1.00 43.55  ? 32  ASN B O     1 
ATOM   2781 C CB    . ASN E 4 32  ? 88.810  33.652  -37.859 1.00 43.48  ? 32  ASN B CB    1 
ATOM   2782 C CG    . ASN E 4 32  ? 89.031  32.314  -38.520 1.00 43.42  ? 32  ASN B CG    1 
ATOM   2783 O OD1   . ASN E 4 32  ? 89.916  31.563  -38.116 1.00 40.88  ? 32  ASN B OD1   1 
ATOM   2784 N ND2   . ASN E 4 32  ? 88.217  31.993  -39.519 1.00 45.29  ? 32  ASN B ND2   1 
ATOM   2785 N N     . SER E 4 33  ? 89.018  36.613  -37.425 1.00 45.05  ? 33  SER B N     1 
ATOM   2786 C CA    . SER E 4 33  ? 88.798  37.791  -36.586 1.00 46.10  ? 33  SER B CA    1 
ATOM   2787 C C     . SER E 4 33  ? 88.277  38.994  -37.369 1.00 48.04  ? 33  SER B C     1 
ATOM   2788 O O     . SER E 4 33  ? 87.621  39.869  -36.802 1.00 47.87  ? 33  SER B O     1 
ATOM   2789 C CB    . SER E 4 33  ? 90.085  38.182  -35.855 1.00 44.63  ? 33  SER B CB    1 
ATOM   2790 O OG    . SER E 4 33  ? 91.021  38.743  -36.754 1.00 45.40  ? 33  SER B OG    1 
ATOM   2791 N N     . HIS E 4 34  ? 88.579  39.050  -38.665 1.00 49.46  ? 34  HIS B N     1 
ATOM   2792 C CA    . HIS E 4 34  ? 88.088  40.150  -39.478 1.00 51.16  ? 34  HIS B CA    1 
ATOM   2793 C C     . HIS E 4 34  ? 86.600  39.941  -39.687 1.00 50.95  ? 34  HIS B C     1 
ATOM   2794 O O     . HIS E 4 34  ? 85.797  40.841  -39.425 1.00 49.32  ? 34  HIS B O     1 
ATOM   2795 C CB    . HIS E 4 34  ? 88.793  40.209  -40.838 1.00 52.84  ? 34  HIS B CB    1 
ATOM   2796 C CG    . HIS E 4 34  ? 90.232  40.623  -40.761 1.00 53.79  ? 34  HIS B CG    1 
ATOM   2797 N ND1   . HIS E 4 34  ? 90.706  41.499  -39.805 1.00 54.98  ? 34  HIS B ND1   1 
ATOM   2798 C CD2   . HIS E 4 34  ? 91.294  40.304  -41.538 1.00 53.05  ? 34  HIS B CD2   1 
ATOM   2799 C CE1   . HIS E 4 34  ? 91.998  41.700  -39.997 1.00 54.68  ? 34  HIS B CE1   1 
ATOM   2800 N NE2   . HIS E 4 34  ? 92.378  40.986  -41.043 1.00 55.00  ? 34  HIS B NE2   1 
ATOM   2801 N N     . HIS E 4 35  ? 86.236  38.746  -40.147 1.00 51.54  ? 35  HIS B N     1 
ATOM   2802 C CA    . HIS E 4 35  ? 84.834  38.411  -40.401 1.00 53.52  ? 35  HIS B CA    1 
ATOM   2803 C C     . HIS E 4 35  ? 83.988  38.459  -39.132 1.00 54.01  ? 35  HIS B C     1 
ATOM   2804 O O     . HIS E 4 35  ? 82.760  38.546  -39.205 1.00 54.25  ? 35  HIS B O     1 
ATOM   2805 C CB    . HIS E 4 35  ? 84.711  37.012  -41.014 1.00 55.29  ? 35  HIS B CB    1 
ATOM   2806 C CG    . HIS E 4 35  ? 85.309  36.886  -42.382 1.00 58.20  ? 35  HIS B CG    1 
ATOM   2807 N ND1   . HIS E 4 35  ? 86.612  37.239  -42.663 1.00 59.74  ? 35  HIS B ND1   1 
ATOM   2808 C CD2   . HIS E 4 35  ? 84.792  36.405  -43.538 1.00 57.12  ? 35  HIS B CD2   1 
ATOM   2809 C CE1   . HIS E 4 35  ? 86.873  36.977  -43.931 1.00 60.01  ? 35  HIS B CE1   1 
ATOM   2810 N NE2   . HIS E 4 35  ? 85.785  36.470  -44.484 1.00 59.07  ? 35  HIS B NE2   1 
ATOM   2811 N N     . ALA E 4 36  ? 84.644  38.399  -37.975 1.00 52.49  ? 36  ALA B N     1 
ATOM   2812 C CA    . ALA E 4 36  ? 83.946  38.425  -36.693 1.00 52.09  ? 36  ALA B CA    1 
ATOM   2813 C C     . ALA E 4 36  ? 83.510  39.834  -36.338 1.00 52.36  ? 36  ALA B C     1 
ATOM   2814 O O     . ALA E 4 36  ? 84.167  40.800  -36.708 1.00 52.09  ? 36  ALA B O     1 
ATOM   2815 C CB    . ALA E 4 36  ? 84.852  37.876  -35.594 1.00 50.14  ? 36  ALA B CB    1 
ATOM   2816 N N     . PRO E 4 37  ? 82.379  39.975  -35.629 1.00 54.30  ? 37  PRO B N     1 
ATOM   2817 C CA    . PRO E 4 37  ? 81.920  41.317  -35.250 1.00 55.60  ? 37  PRO B CA    1 
ATOM   2818 C C     . PRO E 4 37  ? 82.751  41.886  -34.103 1.00 55.13  ? 37  PRO B C     1 
ATOM   2819 O O     . PRO E 4 37  ? 83.085  41.176  -33.157 1.00 55.08  ? 37  PRO B O     1 
ATOM   2820 C CB    . PRO E 4 37  ? 80.456  41.092  -34.862 1.00 55.81  ? 37  PRO B CB    1 
ATOM   2821 C CG    . PRO E 4 37  ? 80.449  39.680  -34.369 1.00 54.66  ? 37  PRO B CG    1 
ATOM   2822 C CD    . PRO E 4 37  ? 81.325  38.975  -35.382 1.00 54.03  ? 37  PRO B CD    1 
ATOM   2823 N N     . LEU E 4 38  ? 83.085  43.170  -34.208 1.00 55.46  ? 38  LEU B N     1 
ATOM   2824 C CA    . LEU E 4 38  ? 83.886  43.867  -33.202 1.00 55.81  ? 38  LEU B CA    1 
ATOM   2825 C C     . LEU E 4 38  ? 83.031  44.269  -32.008 1.00 54.76  ? 38  LEU B C     1 
ATOM   2826 O O     . LEU E 4 38  ? 82.516  45.387  -31.952 1.00 54.74  ? 38  LEU B O     1 
ATOM   2827 C CB    . LEU E 4 38  ? 84.531  45.114  -33.823 1.00 57.89  ? 38  LEU B CB    1 
ATOM   2828 C CG    . LEU E 4 38  ? 85.285  46.096  -32.920 1.00 58.36  ? 38  LEU B CG    1 
ATOM   2829 C CD1   . LEU E 4 38  ? 86.372  45.381  -32.150 1.00 60.63  ? 38  LEU B CD1   1 
ATOM   2830 C CD2   . LEU E 4 38  ? 85.892  47.189  -33.772 1.00 59.25  ? 38  LEU B CD2   1 
ATOM   2831 N N     . SER E 4 39  ? 82.888  43.352  -31.056 1.00 53.43  ? 39  SER B N     1 
ATOM   2832 C CA    . SER E 4 39  ? 82.089  43.595  -29.862 1.00 51.98  ? 39  SER B CA    1 
ATOM   2833 C C     . SER E 4 39  ? 82.438  42.600  -28.759 1.00 52.03  ? 39  SER B C     1 
ATOM   2834 O O     . SER E 4 39  ? 83.030  41.547  -29.011 1.00 52.32  ? 39  SER B O     1 
ATOM   2835 C CB    . SER E 4 39  ? 80.614  43.475  -30.201 1.00 51.16  ? 39  SER B CB    1 
ATOM   2836 O OG    . SER E 4 39  ? 80.327  42.174  -30.678 1.00 51.59  ? 39  SER B OG    1 
ATOM   2837 N N     . ASP E 4 40  ? 82.055  42.927  -27.533 1.00 50.71  ? 40  ASP B N     1 
ATOM   2838 C CA    . ASP E 4 40  ? 82.365  42.073  -26.407 1.00 50.03  ? 40  ASP B CA    1 
ATOM   2839 C C     . ASP E 4 40  ? 81.177  41.247  -25.949 1.00 50.88  ? 40  ASP B C     1 
ATOM   2840 O O     . ASP E 4 40  ? 80.268  41.754  -25.293 1.00 49.27  ? 40  ASP B O     1 
ATOM   2841 C CB    . ASP E 4 40  ? 82.904  42.922  -25.256 1.00 48.86  ? 40  ASP B CB    1 
ATOM   2842 C CG    . ASP E 4 40  ? 83.365  42.084  -24.073 1.00 49.38  ? 40  ASP B CG    1 
ATOM   2843 O OD1   . ASP E 4 40  ? 83.644  40.876  -24.249 1.00 46.32  ? 40  ASP B OD1   1 
ATOM   2844 O OD2   . ASP E 4 40  ? 83.465  42.647  -22.963 1.00 49.36  ? 40  ASP B OD2   1 
ATOM   2845 N N     . GLY E 4 41  ? 81.197  39.970  -26.325 1.00 52.11  ? 41  GLY B N     1 
ATOM   2846 C CA    . GLY E 4 41  ? 80.152  39.032  -25.953 1.00 54.54  ? 41  GLY B CA    1 
ATOM   2847 C C     . GLY E 4 41  ? 78.686  39.363  -26.193 1.00 57.04  ? 41  GLY B C     1 
ATOM   2848 O O     . GLY E 4 41  ? 77.825  38.892  -25.446 1.00 59.02  ? 41  GLY B O     1 
ATOM   2849 N N     . LYS E 4 42  ? 78.368  40.149  -27.212 1.00 57.63  ? 42  LYS B N     1 
ATOM   2850 C CA    . LYS E 4 42  ? 76.966  40.449  -27.454 1.00 59.82  ? 42  LYS B CA    1 
ATOM   2851 C C     . LYS E 4 42  ? 76.268  39.241  -28.076 1.00 59.42  ? 42  LYS B C     1 
ATOM   2852 O O     . LYS E 4 42  ? 75.219  38.811  -27.606 1.00 61.49  ? 42  LYS B O     1 
ATOM   2853 C CB    . LYS E 4 42  ? 76.826  41.679  -28.363 1.00 61.21  ? 42  LYS B CB    1 
ATOM   2854 C CG    . LYS E 4 42  ? 76.992  43.008  -27.618 1.00 63.02  ? 42  LYS B CG    1 
ATOM   2855 C CD    . LYS E 4 42  ? 76.664  44.208  -28.499 1.00 64.91  ? 42  LYS B CD    1 
ATOM   2856 C CE    . LYS E 4 42  ? 77.643  44.325  -29.663 1.00 66.66  ? 42  LYS B CE    1 
ATOM   2857 N NZ    . LYS E 4 42  ? 77.307  45.423  -30.614 1.00 65.93  ? 42  LYS B NZ    1 
ATOM   2858 N N     . THR E 4 43  ? 76.878  38.695  -29.121 1.00 58.57  ? 43  THR B N     1 
ATOM   2859 C CA    . THR E 4 43  ? 76.375  37.543  -29.869 1.00 55.65  ? 43  THR B CA    1 
ATOM   2860 C C     . THR E 4 43  ? 75.700  36.431  -29.077 1.00 54.74  ? 43  THR B C     1 
ATOM   2861 O O     . THR E 4 43  ? 75.836  36.337  -27.858 1.00 56.45  ? 43  THR B O     1 
ATOM   2862 C CB    . THR E 4 43  ? 77.510  36.885  -30.652 1.00 57.18  ? 43  THR B CB    1 
ATOM   2863 O OG1   . THR E 4 43  ? 78.545  36.500  -29.736 1.00 55.71  ? 43  THR B OG1   1 
ATOM   2864 C CG2   . THR E 4 43  ? 78.078  37.846  -31.684 1.00 56.60  ? 43  THR B CG2   1 
ATOM   2865 N N     . GLY E 4 44  ? 74.990  35.569  -29.798 1.00 52.47  ? 44  GLY B N     1 
ATOM   2866 C CA    . GLY E 4 44  ? 74.314  34.450  -29.171 1.00 49.74  ? 44  GLY B CA    1 
ATOM   2867 C C     . GLY E 4 44  ? 75.273  33.371  -28.690 1.00 49.37  ? 44  GLY B C     1 
ATOM   2868 O O     . GLY E 4 44  ? 74.943  32.615  -27.770 1.00 50.04  ? 44  GLY B O     1 
ATOM   2869 N N     . SER E 4 45  ? 76.456  33.291  -29.302 1.00 46.94  ? 45  SER B N     1 
ATOM   2870 C CA    . SER E 4 45  ? 77.458  32.296  -28.918 1.00 44.56  ? 45  SER B CA    1 
ATOM   2871 C C     . SER E 4 45  ? 78.403  32.845  -27.856 1.00 42.60  ? 45  SER B C     1 
ATOM   2872 O O     . SER E 4 45  ? 79.246  32.114  -27.332 1.00 42.34  ? 45  SER B O     1 
ATOM   2873 C CB    . SER E 4 45  ? 78.290  31.871  -30.131 1.00 43.06  ? 45  SER B CB    1 
ATOM   2874 O OG    . SER E 4 45  ? 79.208  32.888  -30.508 1.00 41.81  ? 45  SER B OG    1 
ATOM   2875 N N     . SER E 4 46  ? 78.258  34.136  -27.572 1.00 42.26  ? 46  SER B N     1 
ATOM   2876 C CA    . SER E 4 46  ? 79.085  34.869  -26.600 1.00 43.32  ? 46  SER B CA    1 
ATOM   2877 C C     . SER E 4 46  ? 80.456  35.235  -27.187 1.00 43.06  ? 46  SER B C     1 
ATOM   2878 O O     . SER E 4 46  ? 81.281  35.871  -26.515 1.00 44.81  ? 46  SER B O     1 
ATOM   2879 C CB    . SER E 4 46  ? 79.278  34.063  -25.309 1.00 38.95  ? 46  SER B CB    1 
ATOM   2880 O OG    . SER E 4 46  ? 80.385  33.186  -25.417 1.00 39.97  ? 46  SER B OG    1 
ATOM   2881 N N     . TYR E 4 47  ? 80.697  34.825  -28.435 1.00 41.15  ? 47  TYR B N     1 
ATOM   2882 C CA    . TYR E 4 47  ? 81.951  35.123  -29.123 1.00 42.15  ? 47  TYR B CA    1 
ATOM   2883 C C     . TYR E 4 47  ? 81.709  36.073  -30.298 1.00 43.18  ? 47  TYR B C     1 
ATOM   2884 O O     . TYR E 4 47  ? 80.703  35.963  -30.995 1.00 44.44  ? 47  TYR B O     1 
ATOM   2885 C CB    . TYR E 4 47  ? 82.594  33.844  -29.650 1.00 41.36  ? 47  TYR B CB    1 
ATOM   2886 C CG    . TYR E 4 47  ? 83.161  32.947  -28.583 1.00 41.01  ? 47  TYR B CG    1 
ATOM   2887 C CD1   . TYR E 4 47  ? 84.392  33.228  -27.987 1.00 39.24  ? 47  TYR B CD1   1 
ATOM   2888 C CD2   . TYR E 4 47  ? 82.464  31.817  -28.158 1.00 37.58  ? 47  TYR B CD2   1 
ATOM   2889 C CE1   . TYR E 4 47  ? 84.912  32.400  -26.991 1.00 39.56  ? 47  TYR B CE1   1 
ATOM   2890 C CE2   . TYR E 4 47  ? 82.975  30.993  -27.167 1.00 38.95  ? 47  TYR B CE2   1 
ATOM   2891 C CZ    . TYR E 4 47  ? 84.191  31.287  -26.586 1.00 38.61  ? 47  TYR B CZ    1 
ATOM   2892 O OH    . TYR E 4 47  ? 84.664  30.481  -25.576 1.00 40.29  ? 47  TYR B OH    1 
ATOM   2893 N N     . PRO E 4 48  ? 82.641  37.007  -30.541 1.00 42.33  ? 48  PRO B N     1 
ATOM   2894 C CA    . PRO E 4 48  ? 83.877  37.197  -29.773 1.00 44.41  ? 48  PRO B CA    1 
ATOM   2895 C C     . PRO E 4 48  ? 83.648  37.952  -28.466 1.00 43.69  ? 48  PRO B C     1 
ATOM   2896 O O     . PRO E 4 48  ? 82.683  38.698  -28.343 1.00 45.12  ? 48  PRO B O     1 
ATOM   2897 C CB    . PRO E 4 48  ? 84.751  37.983  -30.743 1.00 44.82  ? 48  PRO B CB    1 
ATOM   2898 C CG    . PRO E 4 48  ? 83.747  38.882  -31.398 1.00 44.39  ? 48  PRO B CG    1 
ATOM   2899 C CD    . PRO E 4 48  ? 82.583  37.941  -31.679 1.00 43.25  ? 48  PRO B CD    1 
ATOM   2900 N N     . HIS E 4 49  ? 84.522  37.751  -27.485 1.00 43.36  ? 49  HIS B N     1 
ATOM   2901 C CA    . HIS E 4 49  ? 84.384  38.468  -26.224 1.00 43.61  ? 49  HIS B CA    1 
ATOM   2902 C C     . HIS E 4 49  ? 85.742  38.735  -25.585 1.00 44.27  ? 49  HIS B C     1 
ATOM   2903 O O     . HIS E 4 49  ? 86.770  38.309  -26.095 1.00 43.97  ? 49  HIS B O     1 
ATOM   2904 C CB    . HIS E 4 49  ? 83.453  37.722  -25.240 1.00 44.51  ? 49  HIS B CB    1 
ATOM   2905 C CG    . HIS E 4 49  ? 84.002  36.427  -24.725 1.00 43.93  ? 49  HIS B CG    1 
ATOM   2906 N ND1   . HIS E 4 49  ? 83.438  35.205  -25.034 1.00 43.16  ? 49  HIS B ND1   1 
ATOM   2907 C CD2   . HIS E 4 49  ? 85.060  36.160  -23.920 1.00 44.62  ? 49  HIS B CD2   1 
ATOM   2908 C CE1   . HIS E 4 49  ? 84.128  34.243  -24.444 1.00 44.00  ? 49  HIS B CE1   1 
ATOM   2909 N NE2   . HIS E 4 49  ? 85.116  34.794  -23.762 1.00 46.24  ? 49  HIS B NE2   1 
ATOM   2910 N N     . TRP E 4 50  ? 85.731  39.448  -24.466 1.00 45.35  ? 50  TRP B N     1 
ATOM   2911 C CA    . TRP E 4 50  ? 86.949  39.810  -23.751 1.00 47.52  ? 50  TRP B CA    1 
ATOM   2912 C C     . TRP E 4 50  ? 87.775  38.656  -23.162 1.00 47.39  ? 50  TRP B C     1 
ATOM   2913 O O     . TRP E 4 50  ? 87.249  37.741  -22.525 1.00 46.92  ? 50  TRP B O     1 
ATOM   2914 C CB    . TRP E 4 50  ? 86.604  40.831  -22.645 1.00 47.95  ? 50  TRP B CB    1 
ATOM   2915 C CG    . TRP E 4 50  ? 87.797  41.334  -21.864 1.00 51.49  ? 50  TRP B CG    1 
ATOM   2916 C CD1   . TRP E 4 50  ? 89.029  41.647  -22.362 1.00 51.30  ? 50  TRP B CD1   1 
ATOM   2917 C CD2   . TRP E 4 50  ? 87.844  41.637  -20.461 1.00 53.33  ? 50  TRP B CD2   1 
ATOM   2918 N NE1   . TRP E 4 50  ? 89.838  42.127  -21.362 1.00 54.26  ? 50  TRP B NE1   1 
ATOM   2919 C CE2   . TRP E 4 50  ? 89.138  42.132  -20.184 1.00 53.74  ? 50  TRP B CE2   1 
ATOM   2920 C CE3   . TRP E 4 50  ? 86.918  41.539  -19.410 1.00 53.22  ? 50  TRP B CE3   1 
ATOM   2921 C CZ2   . TRP E 4 50  ? 89.530  42.531  -18.899 1.00 53.38  ? 50  TRP B CZ2   1 
ATOM   2922 C CZ3   . TRP E 4 50  ? 87.310  41.938  -18.127 1.00 53.19  ? 50  TRP B CZ3   1 
ATOM   2923 C CH2   . TRP E 4 50  ? 88.604  42.427  -17.888 1.00 53.26  ? 50  TRP B CH2   1 
ATOM   2924 N N     . PHE E 4 51  ? 89.080  38.726  -23.405 1.00 49.29  ? 51  PHE B N     1 
ATOM   2925 C CA    . PHE E 4 51  ? 90.063  37.763  -22.903 1.00 51.36  ? 51  PHE B CA    1 
ATOM   2926 C C     . PHE E 4 51  ? 90.952  38.608  -21.996 1.00 52.42  ? 51  PHE B C     1 
ATOM   2927 O O     . PHE E 4 51  ? 91.865  39.289  -22.475 1.00 51.62  ? 51  PHE B O     1 
ATOM   2928 C CB    . PHE E 4 51  ? 90.897  37.181  -24.060 1.00 51.86  ? 51  PHE B CB    1 
ATOM   2929 C CG    . PHE E 4 51  ? 92.171  36.501  -23.615 1.00 49.00  ? 51  PHE B CG    1 
ATOM   2930 C CD1   . PHE E 4 51  ? 92.131  35.377  -22.804 1.00 48.64  ? 51  PHE B CD1   1 
ATOM   2931 C CD2   . PHE E 4 51  ? 93.410  37.010  -23.991 1.00 47.24  ? 51  PHE B CD2   1 
ATOM   2932 C CE1   . PHE E 4 51  ? 93.305  34.774  -22.374 1.00 49.24  ? 51  PHE B CE1   1 
ATOM   2933 C CE2   . PHE E 4 51  ? 94.589  36.414  -23.568 1.00 46.93  ? 51  PHE B CE2   1 
ATOM   2934 C CZ    . PHE E 4 51  ? 94.540  35.296  -22.759 1.00 48.54  ? 51  PHE B CZ    1 
ATOM   2935 N N     . THR E 4 52  ? 90.669  38.577  -20.695 1.00 53.31  ? 52  THR B N     1 
ATOM   2936 C CA    . THR E 4 52  ? 91.412  39.374  -19.716 1.00 53.31  ? 52  THR B CA    1 
ATOM   2937 C C     . THR E 4 52  ? 92.918  39.184  -19.800 1.00 52.35  ? 52  THR B C     1 
ATOM   2938 O O     . THR E 4 52  ? 93.684  40.139  -19.638 1.00 53.01  ? 52  THR B O     1 
ATOM   2939 C CB    . THR E 4 52  ? 90.971  39.057  -18.254 1.00 53.99  ? 52  THR B CB    1 
ATOM   2940 O OG1   . THR E 4 52  ? 91.546  37.815  -17.827 1.00 54.81  ? 52  THR B OG1   1 
ATOM   2941 C CG2   . THR E 4 52  ? 89.458  38.967  -18.160 1.00 52.53  ? 52  THR B CG2   1 
ATOM   2942 N N     . ASN E 4 53  ? 93.334  37.953  -20.067 1.00 50.14  ? 53  ASN B N     1 
ATOM   2943 C CA    . ASN E 4 53  ? 94.745  37.626  -20.141 1.00 49.98  ? 53  ASN B CA    1 
ATOM   2944 C C     . ASN E 4 53  ? 95.294  37.722  -18.713 1.00 52.69  ? 53  ASN B C     1 
ATOM   2945 O O     . ASN E 4 53  ? 96.502  37.662  -18.492 1.00 53.53  ? 53  ASN B O     1 
ATOM   2946 C CB    . ASN E 4 53  ? 95.473  38.590  -21.094 1.00 47.22  ? 53  ASN B CB    1 
ATOM   2947 C CG    . ASN E 4 53  ? 96.890  38.125  -21.442 1.00 45.61  ? 53  ASN B CG    1 
ATOM   2948 O OD1   . ASN E 4 53  ? 97.295  37.011  -21.087 1.00 44.14  ? 53  ASN B OD1   1 
ATOM   2949 N ND2   . ASN E 4 53  ? 97.644  38.977  -22.148 1.00 38.95  ? 53  ASN B ND2   1 
ATOM   2950 N N     . GLY E 4 54  ? 94.389  37.873  -17.746 1.00 54.22  ? 54  GLY B N     1 
ATOM   2951 C CA    . GLY E 4 54  ? 94.792  37.947  -16.348 1.00 59.93  ? 54  GLY B CA    1 
ATOM   2952 C C     . GLY E 4 54  ? 94.661  39.290  -15.634 1.00 62.27  ? 54  GLY B C     1 
ATOM   2953 O O     . GLY E 4 54  ? 95.145  39.451  -14.516 1.00 62.29  ? 54  GLY B O     1 
ATOM   2954 N N     . TYR E 4 55  ? 94.006  40.252  -16.276 1.00 64.65  ? 55  TYR B N     1 
ATOM   2955 C CA    . TYR E 4 55  ? 93.826  41.588  -15.712 1.00 66.00  ? 55  TYR B CA    1 
ATOM   2956 C C     . TYR E 4 55  ? 92.360  41.853  -15.406 1.00 67.40  ? 55  TYR B C     1 
ATOM   2957 O O     . TYR E 4 55  ? 91.485  41.040  -15.724 1.00 67.82  ? 55  TYR B O     1 
ATOM   2958 C CB    . TYR E 4 55  ? 94.277  42.659  -16.710 1.00 65.90  ? 55  TYR B CB    1 
ATOM   2959 C CG    . TYR E 4 55  ? 95.747  42.684  -17.064 1.00 67.85  ? 55  TYR B CG    1 
ATOM   2960 C CD1   . TYR E 4 55  ? 96.352  41.624  -17.742 1.00 69.45  ? 55  TYR B CD1   1 
ATOM   2961 C CD2   . TYR E 4 55  ? 96.523  43.805  -16.774 1.00 68.77  ? 55  TYR B CD2   1 
ATOM   2962 C CE1   . TYR E 4 55  ? 97.697  41.691  -18.127 1.00 69.54  ? 55  TYR B CE1   1 
ATOM   2963 C CE2   . TYR E 4 55  ? 97.861  43.882  -17.152 1.00 69.07  ? 55  TYR B CE2   1 
ATOM   2964 C CZ    . TYR E 4 55  ? 98.439  42.828  -17.826 1.00 69.44  ? 55  TYR B CZ    1 
ATOM   2965 O OH    . TYR E 4 55  ? 99.750  42.929  -18.206 1.00 70.82  ? 55  TYR B OH    1 
ATOM   2966 N N     . ASP E 4 56  ? 92.094  42.998  -14.785 1.00 67.53  ? 56  ASP B N     1 
ATOM   2967 C CA    . ASP E 4 56  ? 90.723  43.389  -14.502 1.00 68.66  ? 56  ASP B CA    1 
ATOM   2968 C C     . ASP E 4 56  ? 90.426  44.508  -15.481 1.00 69.16  ? 56  ASP B C     1 
ATOM   2969 O O     . ASP E 4 56  ? 91.265  44.828  -16.324 1.00 70.10  ? 56  ASP B O     1 
ATOM   2970 C CB    . ASP E 4 56  ? 90.551  43.880  -13.059 1.00 69.76  ? 56  ASP B CB    1 
ATOM   2971 C CG    . ASP E 4 56  ? 91.505  45.002  -12.694 1.00 70.42  ? 56  ASP B CG    1 
ATOM   2972 O OD1   . ASP E 4 56  ? 91.666  45.956  -13.486 1.00 68.86  ? 56  ASP B OD1   1 
ATOM   2973 O OD2   . ASP E 4 56  ? 92.085  44.932  -11.591 1.00 72.03  ? 56  ASP B OD2   1 
ATOM   2974 N N     . GLY E 4 57  ? 89.242  45.099  -15.383 1.00 69.03  ? 57  GLY B N     1 
ATOM   2975 C CA    . GLY E 4 57  ? 88.891  46.172  -16.293 1.00 69.96  ? 57  GLY B CA    1 
ATOM   2976 C C     . GLY E 4 57  ? 89.697  47.446  -16.100 1.00 71.31  ? 57  GLY B C     1 
ATOM   2977 O O     . GLY E 4 57  ? 90.020  48.133  -17.071 1.00 70.31  ? 57  GLY B O     1 
ATOM   2978 N N     . ASN E 4 58  ? 90.021  47.767  -14.849 1.00 72.65  ? 58  ASN B N     1 
ATOM   2979 C CA    . ASN E 4 58  ? 90.780  48.978  -14.539 1.00 74.62  ? 58  ASN B CA    1 
ATOM   2980 C C     . ASN E 4 58  ? 92.206  48.882  -15.071 1.00 74.33  ? 58  ASN B C     1 
ATOM   2981 O O     . ASN E 4 58  ? 92.876  49.889  -15.273 1.00 74.09  ? 58  ASN B O     1 
ATOM   2982 C CB    . ASN E 4 58  ? 90.816  49.215  -13.023 1.00 76.07  ? 58  ASN B CB    1 
ATOM   2983 C CG    . ASN E 4 58  ? 89.433  49.184  -12.389 1.00 77.28  ? 58  ASN B CG    1 
ATOM   2984 O OD1   . ASN E 4 58  ? 88.524  49.902  -12.811 1.00 77.80  ? 58  ASN B OD1   1 
ATOM   2985 N ND2   . ASN E 4 58  ? 89.273  48.354  -11.362 1.00 77.81  ? 58  ASN B ND2   1 
ATOM   2986 N N     . GLY E 4 59  ? 92.659  47.658  -15.302 1.00 75.37  ? 59  GLY B N     1 
ATOM   2987 C CA    . GLY E 4 59  ? 94.002  47.454  -15.797 1.00 75.39  ? 59  GLY B CA    1 
ATOM   2988 C C     . GLY E 4 59  ? 94.803  46.677  -14.775 1.00 75.44  ? 59  GLY B C     1 
ATOM   2989 O O     . GLY E 4 59  ? 95.632  45.849  -15.130 1.00 75.16  ? 59  GLY B O     1 
ATOM   2990 N N     . LYS E 4 60  ? 94.550  46.940  -13.499 1.00 75.88  ? 60  LYS B N     1 
ATOM   2991 C CA    . LYS E 4 60  ? 95.261  46.252  -12.429 1.00 76.90  ? 60  LYS B CA    1 
ATOM   2992 C C     . LYS E 4 60  ? 95.340  44.750  -12.708 1.00 76.92  ? 60  LYS B C     1 
ATOM   2993 O O     . LYS E 4 60  ? 94.391  44.148  -13.214 1.00 77.18  ? 60  LYS B O     1 
ATOM   2994 C CB    . LYS E 4 60  ? 94.555  46.501  -11.092 1.00 77.73  ? 60  LYS B CB    1 
ATOM   2995 C CG    . LYS E 4 60  ? 95.329  46.023  -9.862  1.00 79.52  ? 60  LYS B CG    1 
ATOM   2996 C CD    . LYS E 4 60  ? 96.647  46.780  -9.687  1.00 81.56  ? 60  LYS B CD    1 
ATOM   2997 C CE    . LYS E 4 60  ? 96.438  48.289  -9.518  1.00 82.07  ? 60  LYS B CE    1 
ATOM   2998 N NZ    . LYS E 4 60  ? 95.709  48.638  -8.263  1.00 82.95  ? 60  LYS B NZ    1 
ATOM   2999 N N     . LEU E 4 61  ? 96.478  44.147  -12.385 1.00 77.23  ? 61  LEU B N     1 
ATOM   3000 C CA    . LEU E 4 61  ? 96.669  42.718  -12.604 1.00 78.27  ? 61  LEU B CA    1 
ATOM   3001 C C     . LEU E 4 61  ? 96.051  41.952  -11.440 1.00 78.40  ? 61  LEU B C     1 
ATOM   3002 O O     . LEU E 4 61  ? 96.152  42.381  -10.296 1.00 79.46  ? 61  LEU B O     1 
ATOM   3003 C CB    . LEU E 4 61  ? 98.165  42.411  -12.708 1.00 78.91  ? 61  LEU B CB    1 
ATOM   3004 C CG    . LEU E 4 61  ? 98.571  41.085  -13.351 1.00 79.92  ? 61  LEU B CG    1 
ATOM   3005 C CD1   . LEU E 4 61  ? 98.247  39.928  -12.429 1.00 80.50  ? 61  LEU B CD1   1 
ATOM   3006 C CD2   . LEU E 4 61  ? 97.853  40.942  -14.679 1.00 80.03  ? 61  LEU B CD2   1 
ATOM   3007 N N     . ILE E 4 62  ? 95.401  40.827  -11.718 1.00 78.61  ? 62  ILE B N     1 
ATOM   3008 C CA    . ILE E 4 62  ? 94.787  40.059  -10.641 1.00 79.32  ? 62  ILE B CA    1 
ATOM   3009 C C     . ILE E 4 62  ? 95.742  39.039  -10.016 1.00 79.55  ? 62  ILE B C     1 
ATOM   3010 O O     . ILE E 4 62  ? 96.452  38.316  -10.710 1.00 79.98  ? 62  ILE B O     1 
ATOM   3011 C CB    . ILE E 4 62  ? 93.481  39.367  -11.114 1.00 78.66  ? 62  ILE B CB    1 
ATOM   3012 C CG1   . ILE E 4 62  ? 92.955  38.430  -10.022 1.00 78.74  ? 62  ILE B CG1   1 
ATOM   3013 C CG2   . ILE E 4 62  ? 93.717  38.641  -12.409 1.00 79.35  ? 62  ILE B CG2   1 
ATOM   3014 C CD1   . ILE E 4 62  ? 91.599  37.820  -10.331 1.00 77.76  ? 62  ILE B CD1   1 
ATOM   3015 N N     . LYS E 4 63  ? 95.741  39.006  -8.687  1.00 79.83  ? 63  LYS B N     1 
ATOM   3016 C CA    . LYS E 4 63  ? 96.595  38.136  -7.883  1.00 79.91  ? 63  LYS B CA    1 
ATOM   3017 C C     . LYS E 4 63  ? 96.810  36.712  -8.386  1.00 78.76  ? 63  LYS B C     1 
ATOM   3018 O O     . LYS E 4 63  ? 95.858  36.000  -8.701  1.00 78.46  ? 63  LYS B O     1 
ATOM   3019 C CB    . LYS E 4 63  ? 96.054  38.086  -6.450  1.00 81.74  ? 63  LYS B CB    1 
ATOM   3020 C CG    . LYS E 4 63  ? 96.984  37.416  -5.453  1.00 83.57  ? 63  LYS B CG    1 
ATOM   3021 C CD    . LYS E 4 63  ? 96.482  37.591  -4.028  1.00 85.66  ? 63  LYS B CD    1 
ATOM   3022 C CE    . LYS E 4 63  ? 97.557  37.203  -3.025  1.00 86.26  ? 63  LYS B CE    1 
ATOM   3023 N NZ    . LYS E 4 63  ? 98.805  37.986  -3.252  1.00 86.83  ? 63  LYS B NZ    1 
ATOM   3024 N N     . GLY E 4 64  ? 98.078  36.312  -8.446  1.00 77.98  ? 64  GLY B N     1 
ATOM   3025 C CA    . GLY E 4 64  ? 98.440  34.972  -8.876  1.00 77.96  ? 64  GLY B CA    1 
ATOM   3026 C C     . GLY E 4 64  ? 98.321  34.676  -10.358 1.00 77.87  ? 64  GLY B C     1 
ATOM   3027 O O     . GLY E 4 64  ? 98.495  33.531  -10.784 1.00 77.38  ? 64  GLY B O     1 
ATOM   3028 N N     . ARG E 4 65  ? 98.037  35.703  -11.150 1.00 77.68  ? 65  ARG B N     1 
ATOM   3029 C CA    . ARG E 4 65  ? 97.878  35.530  -12.589 1.00 77.77  ? 65  ARG B CA    1 
ATOM   3030 C C     . ARG E 4 65  ? 99.106  35.970  -13.382 1.00 76.20  ? 65  ARG B C     1 
ATOM   3031 O O     . ARG E 4 65  ? 99.656  37.048  -13.146 1.00 76.04  ? 65  ARG B O     1 
ATOM   3032 C CB    . ARG E 4 65  ? 96.642  36.302  -13.057 1.00 78.84  ? 65  ARG B CB    1 
ATOM   3033 C CG    . ARG E 4 65  ? 95.399  35.952  -12.261 1.00 81.34  ? 65  ARG B CG    1 
ATOM   3034 C CD    . ARG E 4 65  ? 94.970  34.512  -12.478 1.00 84.40  ? 65  ARG B CD    1 
ATOM   3035 N NE    . ARG E 4 65  ? 94.185  34.346  -13.699 1.00 86.45  ? 65  ARG B NE    1 
ATOM   3036 C CZ    . ARG E 4 65  ? 93.650  33.193  -14.085 1.00 88.50  ? 65  ARG B CZ    1 
ATOM   3037 N NH1   . ARG E 4 65  ? 93.824  32.105  -13.343 1.00 88.87  ? 65  ARG B NH1   1 
ATOM   3038 N NH2   . ARG E 4 65  ? 92.925  33.128  -15.198 1.00 88.90  ? 65  ARG B NH2   1 
ATOM   3039 N N     . THR E 4 66  ? 99.520  35.124  -14.323 1.00 74.23  ? 66  THR B N     1 
ATOM   3040 C CA    . THR E 4 66  ? 100.682 35.389  -15.170 1.00 72.69  ? 66  THR B CA    1 
ATOM   3041 C C     . THR E 4 66  ? 100.253 35.646  -16.613 1.00 71.19  ? 66  THR B C     1 
ATOM   3042 O O     . THR E 4 66  ? 100.129 34.714  -17.402 1.00 70.37  ? 66  THR B O     1 
ATOM   3043 C CB    . THR E 4 66  ? 101.647 34.189  -15.183 1.00 73.25  ? 66  THR B CB    1 
ATOM   3044 O OG1   . THR E 4 66  ? 101.811 33.682  -13.851 1.00 73.57  ? 66  THR B OG1   1 
ATOM   3045 C CG2   . THR E 4 66  ? 103.001 34.611  -15.744 1.00 72.41  ? 66  THR B CG2   1 
ATOM   3046 N N     . PRO E 4 67  ? 100.032 36.917  -16.977 1.00 70.58  ? 67  PRO B N     1 
ATOM   3047 C CA    . PRO E 4 67  ? 99.614  37.306  -18.330 1.00 69.72  ? 67  PRO B CA    1 
ATOM   3048 C C     . PRO E 4 67  ? 100.528 36.743  -19.418 1.00 68.76  ? 67  PRO B C     1 
ATOM   3049 O O     . PRO E 4 67  ? 101.748 36.827  -19.304 1.00 69.86  ? 67  PRO B O     1 
ATOM   3050 C CB    . PRO E 4 67  ? 99.664  38.827  -18.273 1.00 70.07  ? 67  PRO B CB    1 
ATOM   3051 C CG    . PRO E 4 67  ? 99.316  39.108  -16.840 1.00 70.07  ? 67  PRO B CG    1 
ATOM   3052 C CD    . PRO E 4 67  ? 100.156 38.102  -16.112 1.00 70.53  ? 67  PRO B CD    1 
ATOM   3053 N N     . ILE E 4 68  ? 99.940  36.174  -20.468 1.00 66.44  ? 68  ILE B N     1 
ATOM   3054 C CA    . ILE E 4 68  ? 100.723 35.607  -21.565 1.00 65.52  ? 68  ILE B CA    1 
ATOM   3055 C C     . ILE E 4 68  ? 101.465 36.730  -22.292 1.00 63.29  ? 68  ILE B C     1 
ATOM   3056 O O     . ILE E 4 68  ? 100.975 37.855  -22.370 1.00 61.61  ? 68  ILE B O     1 
ATOM   3057 C CB    . ILE E 4 68  ? 99.808  34.856  -22.577 1.00 65.88  ? 68  ILE B CB    1 
ATOM   3058 C CG1   . ILE E 4 68  ? 100.645 34.009  -23.536 1.00 66.69  ? 68  ILE B CG1   1 
ATOM   3059 C CG2   . ILE E 4 68  ? 99.007  35.845  -23.382 1.00 67.52  ? 68  ILE B CG2   1 
ATOM   3060 C CD1   . ILE E 4 68  ? 101.324 32.818  -22.879 1.00 67.86  ? 68  ILE B CD1   1 
ATOM   3061 N N     . LYS E 4 69  ? 102.648 36.431  -22.818 1.00 62.50  ? 69  LYS B N     1 
ATOM   3062 C CA    . LYS E 4 69  ? 103.425 37.445  -23.531 1.00 61.44  ? 69  LYS B CA    1 
ATOM   3063 C C     . LYS E 4 69  ? 103.378 37.225  -25.037 1.00 59.07  ? 69  LYS B C     1 
ATOM   3064 O O     . LYS E 4 69  ? 104.081 36.374  -25.567 1.00 59.31  ? 69  LYS B O     1 
ATOM   3065 C CB    . LYS E 4 69  ? 104.881 37.426  -23.063 1.00 62.30  ? 69  LYS B CB    1 
ATOM   3066 C CG    . LYS E 4 69  ? 105.738 38.539  -23.655 1.00 64.41  ? 69  LYS B CG    1 
ATOM   3067 C CD    . LYS E 4 69  ? 105.274 39.905  -23.177 1.00 65.94  ? 69  LYS B CD    1 
ATOM   3068 C CE    . LYS E 4 69  ? 106.294 40.991  -23.515 1.00 68.16  ? 69  LYS B CE    1 
ATOM   3069 N NZ    . LYS E 4 69  ? 105.957 42.320  -22.905 1.00 66.68  ? 69  LYS B NZ    1 
ATOM   3070 N N     . PHE E 4 70  ? 102.557 38.010  -25.724 1.00 58.29  ? 70  PHE B N     1 
ATOM   3071 C CA    . PHE E 4 70  ? 102.410 37.895  -27.174 1.00 56.47  ? 70  PHE B CA    1 
ATOM   3072 C C     . PHE E 4 70  ? 103.616 38.433  -27.929 1.00 55.36  ? 70  PHE B C     1 
ATOM   3073 O O     . PHE E 4 70  ? 104.107 37.796  -28.855 1.00 54.08  ? 70  PHE B O     1 
ATOM   3074 C CB    . PHE E 4 70  ? 101.142 38.624  -27.624 1.00 57.61  ? 70  PHE B CB    1 
ATOM   3075 C CG    . PHE E 4 70  ? 99.878  38.018  -27.086 1.00 57.00  ? 70  PHE B CG    1 
ATOM   3076 C CD1   . PHE E 4 70  ? 99.379  36.832  -27.619 1.00 56.16  ? 70  PHE B CD1   1 
ATOM   3077 C CD2   . PHE E 4 70  ? 99.194  38.621  -26.034 1.00 56.79  ? 70  PHE B CD2   1 
ATOM   3078 C CE1   . PHE E 4 70  ? 98.219  36.256  -27.115 1.00 55.40  ? 70  PHE B CE1   1 
ATOM   3079 C CE2   . PHE E 4 70  ? 98.030  38.052  -25.520 1.00 55.68  ? 70  PHE B CE2   1 
ATOM   3080 C CZ    . PHE E 4 70  ? 97.542  36.866  -26.064 1.00 56.03  ? 70  PHE B CZ    1 
ATOM   3081 N N     . GLY E 4 71  ? 104.093 39.609  -27.532 1.00 55.68  ? 71  GLY B N     1 
ATOM   3082 C CA    . GLY E 4 71  ? 105.251 40.188  -28.190 1.00 55.68  ? 71  GLY B CA    1 
ATOM   3083 C C     . GLY E 4 71  ? 104.986 41.497  -28.907 1.00 55.38  ? 71  GLY B C     1 
ATOM   3084 O O     . GLY E 4 71  ? 105.716 41.866  -29.821 1.00 55.90  ? 71  GLY B O     1 
ATOM   3085 N N     . LYS E 4 72  ? 103.933 42.191  -28.502 1.00 55.61  ? 72  LYS B N     1 
ATOM   3086 C CA    . LYS E 4 72  ? 103.574 43.477  -29.086 1.00 56.46  ? 72  LYS B CA    1 
ATOM   3087 C C     . LYS E 4 72  ? 103.152 44.354  -27.927 1.00 56.53  ? 72  LYS B C     1 
ATOM   3088 O O     . LYS E 4 72  ? 102.582 43.865  -26.951 1.00 57.11  ? 72  LYS B O     1 
ATOM   3089 C CB    . LYS E 4 72  ? 102.396 43.348  -30.057 1.00 55.77  ? 72  LYS B CB    1 
ATOM   3090 C CG    . LYS E 4 72  ? 102.640 42.465  -31.258 1.00 59.06  ? 72  LYS B CG    1 
ATOM   3091 C CD    . LYS E 4 72  ? 101.447 42.525  -32.210 1.00 59.24  ? 72  LYS B CD    1 
ATOM   3092 C CE    . LYS E 4 72  ? 101.662 41.659  -33.442 1.00 60.62  ? 72  LYS B CE    1 
ATOM   3093 N NZ    . LYS E 4 72  ? 100.611 41.896  -34.479 1.00 59.86  ? 72  LYS B NZ    1 
ATOM   3094 N N     . ALA E 4 73  ? 103.429 45.647  -28.029 1.00 56.95  ? 73  ALA B N     1 
ATOM   3095 C CA    . ALA E 4 73  ? 103.065 46.578  -26.971 1.00 56.60  ? 73  ALA B CA    1 
ATOM   3096 C C     . ALA E 4 73  ? 101.555 46.705  -26.955 1.00 56.56  ? 73  ALA B C     1 
ATOM   3097 O O     . ALA E 4 73  ? 100.922 46.645  -25.900 1.00 58.63  ? 73  ALA B O     1 
ATOM   3098 C CB    . ALA E 4 73  ? 103.703 47.936  -27.226 1.00 55.84  ? 73  ALA B CB    1 
ATOM   3099 N N     . ASP E 4 74  ? 100.986 46.878  -28.142 1.00 56.41  ? 74  ASP B N     1 
ATOM   3100 C CA    . ASP E 4 74  ? 99.551  47.020  -28.304 1.00 55.51  ? 74  ASP B CA    1 
ATOM   3101 C C     . ASP E 4 74  ? 98.846  45.866  -27.599 1.00 56.11  ? 74  ASP B C     1 
ATOM   3102 O O     . ASP E 4 74  ? 97.828  46.057  -26.935 1.00 56.76  ? 74  ASP B O     1 
ATOM   3103 C CB    . ASP E 4 74  ? 99.222  47.035  -29.798 1.00 56.38  ? 74  ASP B CB    1 
ATOM   3104 C CG    . ASP E 4 74  ? 97.759  47.285  -30.074 1.00 55.26  ? 74  ASP B CG    1 
ATOM   3105 O OD1   . ASP E 4 74  ? 97.209  48.277  -29.552 1.00 55.44  ? 74  ASP B OD1   1 
ATOM   3106 O OD2   . ASP E 4 74  ? 97.163  46.491  -30.829 1.00 56.07  ? 74  ASP B OD2   1 
ATOM   3107 N N     . CYS E 4 75  ? 99.415  44.672  -27.733 1.00 55.89  ? 75  CYS B N     1 
ATOM   3108 C CA    . CYS E 4 75  ? 98.866  43.471  -27.124 1.00 56.59  ? 75  CYS B CA    1 
ATOM   3109 C C     . CYS E 4 75  ? 99.226  43.363  -25.648 1.00 59.03  ? 75  CYS B C     1 
ATOM   3110 O O     . CYS E 4 75  ? 98.342  43.356  -24.796 1.00 60.42  ? 75  CYS B O     1 
ATOM   3111 C CB    . CYS E 4 75  ? 99.370  42.231  -27.863 1.00 54.65  ? 75  CYS B CB    1 
ATOM   3112 S SG    . CYS E 4 75  ? 98.839  42.138  -29.600 1.00 52.90  ? 75  CYS B SG    1 
ATOM   3113 N N     . ASP E 4 76  ? 100.520 43.258  -25.351 1.00 60.64  ? 76  ASP B N     1 
ATOM   3114 C CA    . ASP E 4 76  ? 100.981 43.158  -23.970 1.00 62.21  ? 76  ASP B CA    1 
ATOM   3115 C C     . ASP E 4 76  ? 100.912 44.551  -23.382 1.00 62.13  ? 76  ASP B C     1 
ATOM   3116 O O     . ASP E 4 76  ? 101.868 45.313  -23.472 1.00 63.76  ? 76  ASP B O     1 
ATOM   3117 C CB    . ASP E 4 76  ? 102.423 42.669  -23.911 1.00 63.76  ? 76  ASP B CB    1 
ATOM   3118 C CG    . ASP E 4 76  ? 102.689 41.541  -24.872 1.00 65.94  ? 76  ASP B CG    1 
ATOM   3119 O OD1   . ASP E 4 76  ? 101.892 40.578  -24.887 1.00 67.63  ? 76  ASP B OD1   1 
ATOM   3120 O OD2   . ASP E 4 76  ? 103.699 41.619  -25.605 1.00 66.24  ? 76  ASP B OD2   1 
ATOM   3121 N N     . ARG E 4 77  ? 99.776  44.879  -22.786 1.00 62.26  ? 77  ARG B N     1 
ATOM   3122 C CA    . ARG E 4 77  ? 99.569  46.195  -22.210 1.00 63.27  ? 77  ARG B CA    1 
ATOM   3123 C C     . ARG E 4 77  ? 98.274  46.162  -21.419 1.00 63.11  ? 77  ARG B C     1 
ATOM   3124 O O     . ARG E 4 77  ? 97.228  45.777  -21.943 1.00 63.60  ? 77  ARG B O     1 
ATOM   3125 C CB    . ARG E 4 77  ? 99.461  47.242  -23.323 1.00 64.14  ? 77  ARG B CB    1 
ATOM   3126 C CG    . ARG E 4 77  ? 99.143  48.641  -22.838 1.00 67.06  ? 77  ARG B CG    1 
ATOM   3127 C CD    . ARG E 4 77  ? 97.978  49.251  -23.610 1.00 69.46  ? 77  ARG B CD    1 
ATOM   3128 N NE    . ARG E 4 77  ? 98.188  49.220  -25.058 1.00 72.51  ? 77  ARG B NE    1 
ATOM   3129 C CZ    . ARG E 4 77  ? 97.358  49.756  -25.953 1.00 72.95  ? 77  ARG B CZ    1 
ATOM   3130 N NH1   . ARG E 4 77  ? 96.250  50.372  -25.559 1.00 73.75  ? 77  ARG B NH1   1 
ATOM   3131 N NH2   . ARG E 4 77  ? 97.635  49.677  -27.247 1.00 73.11  ? 77  ARG B NH2   1 
ATOM   3132 N N     . PRO E 4 78  ? 98.327  46.562  -20.144 1.00 62.03  ? 78  PRO B N     1 
ATOM   3133 C CA    . PRO E 4 78  ? 97.143  46.572  -19.288 1.00 61.48  ? 78  PRO B CA    1 
ATOM   3134 C C     . PRO E 4 78  ? 95.884  47.038  -20.013 1.00 60.89  ? 78  PRO B C     1 
ATOM   3135 O O     . PRO E 4 78  ? 95.900  48.014  -20.768 1.00 58.78  ? 78  PRO B O     1 
ATOM   3136 C CB    . PRO E 4 78  ? 97.557  47.498  -18.159 1.00 62.35  ? 78  PRO B CB    1 
ATOM   3137 C CG    . PRO E 4 78  ? 99.002  47.133  -17.995 1.00 63.44  ? 78  PRO B CG    1 
ATOM   3138 C CD    . PRO E 4 78  ? 99.501  47.081  -19.423 1.00 61.88  ? 78  PRO B CD    1 
ATOM   3139 N N     . PRO E 4 79  ? 94.777  46.324  -19.795 1.00 60.39  ? 79  PRO B N     1 
ATOM   3140 C CA    . PRO E 4 79  ? 93.468  46.586  -20.387 1.00 60.77  ? 79  PRO B CA    1 
ATOM   3141 C C     . PRO E 4 79  ? 92.709  47.796  -19.857 1.00 61.64  ? 79  PRO B C     1 
ATOM   3142 O O     . PRO E 4 79  ? 92.847  48.190  -18.697 1.00 62.38  ? 79  PRO B O     1 
ATOM   3143 C CB    . PRO E 4 79  ? 92.706  45.293  -20.115 1.00 60.76  ? 79  PRO B CB    1 
ATOM   3144 C CG    . PRO E 4 79  ? 93.784  44.272  -20.049 1.00 61.50  ? 79  PRO B CG    1 
ATOM   3145 C CD    . PRO E 4 79  ? 94.810  44.972  -19.221 1.00 60.74  ? 79  PRO B CD    1 
ATOM   3146 N N     . LYS E 4 80  ? 91.899  48.362  -20.745 1.00 61.73  ? 80  LYS B N     1 
ATOM   3147 C CA    . LYS E 4 80  ? 91.040  49.500  -20.467 1.00 63.24  ? 80  LYS B CA    1 
ATOM   3148 C C     . LYS E 4 80  ? 89.670  48.896  -20.749 1.00 62.96  ? 80  LYS B C     1 
ATOM   3149 O O     . LYS E 4 80  ? 89.108  49.102  -21.822 1.00 62.71  ? 80  LYS B O     1 
ATOM   3150 C CB    . LYS E 4 80  ? 91.308  50.626  -21.474 1.00 66.09  ? 80  LYS B CB    1 
ATOM   3151 C CG    . LYS E 4 80  ? 90.943  52.043  -21.019 1.00 68.03  ? 80  LYS B CG    1 
ATOM   3152 C CD    . LYS E 4 80  ? 92.116  52.716  -20.295 1.00 69.83  ? 80  LYS B CD    1 
ATOM   3153 C CE    . LYS E 4 80  ? 91.874  54.203  -20.072 1.00 70.38  ? 80  LYS B CE    1 
ATOM   3154 N NZ    . LYS E 4 80  ? 90.644  54.451  -19.268 1.00 71.01  ? 80  LYS B NZ    1 
ATOM   3155 N N     . HIS E 4 81  ? 89.142  48.132  -19.802 1.00 62.48  ? 81  HIS B N     1 
ATOM   3156 C CA    . HIS E 4 81  ? 87.853  47.489  -20.007 1.00 62.55  ? 81  HIS B CA    1 
ATOM   3157 C C     . HIS E 4 81  ? 86.743  47.977  -19.078 1.00 62.81  ? 81  HIS B C     1 
ATOM   3158 O O     . HIS E 4 81  ? 86.859  47.919  -17.849 1.00 59.75  ? 81  HIS B O     1 
ATOM   3159 C CB    . HIS E 4 81  ? 88.014  45.964  -19.889 1.00 63.04  ? 81  HIS B CB    1 
ATOM   3160 C CG    . HIS E 4 81  ? 86.812  45.187  -20.341 1.00 64.09  ? 81  HIS B CG    1 
ATOM   3161 N ND1   . HIS E 4 81  ? 85.961  44.550  -19.463 1.00 63.24  ? 81  HIS B ND1   1 
ATOM   3162 C CD2   . HIS E 4 81  ? 86.310  44.962  -21.579 1.00 63.15  ? 81  HIS B CD2   1 
ATOM   3163 C CE1   . HIS E 4 81  ? 84.987  43.969  -20.141 1.00 63.04  ? 81  HIS B CE1   1 
ATOM   3164 N NE2   . HIS E 4 81  ? 85.175  44.204  -21.427 1.00 61.66  ? 81  HIS B NE2   1 
ATOM   3165 N N     . SER E 4 82  ? 85.668  48.463  -19.693 1.00 63.88  ? 82  SER B N     1 
ATOM   3166 C CA    . SER E 4 82  ? 84.501  48.948  -18.969 1.00 66.13  ? 82  SER B CA    1 
ATOM   3167 C C     . SER E 4 82  ? 83.551  47.763  -18.806 1.00 68.09  ? 82  SER B C     1 
ATOM   3168 O O     . SER E 4 82  ? 83.759  46.716  -19.424 1.00 67.93  ? 82  SER B O     1 
ATOM   3169 C CB    . SER E 4 82  ? 83.819  50.063  -19.764 1.00 65.86  ? 82  SER B CB    1 
ATOM   3170 O OG    . SER E 4 82  ? 83.392  49.597  -21.033 1.00 68.06  ? 82  SER B OG    1 
ATOM   3171 N N     . GLN E 4 83  ? 82.513  47.926  -17.986 1.00 70.00  ? 83  GLN B N     1 
ATOM   3172 C CA    . GLN E 4 83  ? 81.542  46.856  -17.748 1.00 72.45  ? 83  GLN B CA    1 
ATOM   3173 C C     . GLN E 4 83  ? 81.199  46.054  -19.002 1.00 73.26  ? 83  GLN B C     1 
ATOM   3174 O O     . GLN E 4 83  ? 81.258  44.819  -18.994 1.00 72.42  ? 83  GLN B O     1 
ATOM   3175 C CB    . GLN E 4 83  ? 80.242  47.417  -17.160 1.00 72.52  ? 83  GLN B CB    1 
ATOM   3176 C CG    . GLN E 4 83  ? 79.161  46.352  -16.993 1.00 74.36  ? 83  GLN B CG    1 
ATOM   3177 C CD    . GLN E 4 83  ? 77.790  46.927  -16.687 1.00 76.30  ? 83  GLN B CD    1 
ATOM   3178 O OE1   . GLN E 4 83  ? 77.321  47.851  -17.361 1.00 76.37  ? 83  GLN B OE1   1 
ATOM   3179 N NE2   . GLN E 4 83  ? 77.131  46.371  -15.676 1.00 75.70  ? 83  GLN B NE2   1 
ATOM   3180 N N     . ASN E 4 84  ? 80.838  46.761  -20.071 1.00 74.46  ? 84  ASN B N     1 
ATOM   3181 C CA    . ASN E 4 84  ? 80.471  46.121  -21.330 1.00 76.41  ? 84  ASN B CA    1 
ATOM   3182 C C     . ASN E 4 84  ? 81.588  46.198  -22.367 1.00 77.80  ? 84  ASN B C     1 
ATOM   3183 O O     . ASN E 4 84  ? 81.473  45.630  -23.455 1.00 78.11  ? 84  ASN B O     1 
ATOM   3184 C CB    . ASN E 4 84  ? 79.194  46.762  -21.896 1.00 76.28  ? 84  ASN B CB    1 
ATOM   3185 C CG    . ASN E 4 84  ? 79.455  48.093  -22.598 1.00 77.15  ? 84  ASN B CG    1 
ATOM   3186 O OD1   . ASN E 4 84  ? 80.184  48.956  -22.096 1.00 76.32  ? 84  ASN B OD1   1 
ATOM   3187 N ND2   . ASN E 4 84  ? 78.841  48.268  -23.763 1.00 76.76  ? 84  ASN B ND2   1 
ATOM   3188 N N     . GLY E 4 85  ? 82.666  46.900  -22.026 1.00 79.48  ? 85  GLY B N     1 
ATOM   3189 C CA    . GLY E 4 85  ? 83.786  47.039  -22.941 1.00 80.15  ? 85  GLY B CA    1 
ATOM   3190 C C     . GLY E 4 85  ? 83.411  47.634  -24.288 1.00 81.46  ? 85  GLY B C     1 
ATOM   3191 O O     . GLY E 4 85  ? 83.814  47.119  -25.336 1.00 80.63  ? 85  GLY B O     1 
ATOM   3192 N N     . MET E 4 86  ? 82.633  48.712  -24.275 1.00 82.48  ? 86  MET B N     1 
ATOM   3193 C CA    . MET E 4 86  ? 82.238  49.358  -25.521 1.00 83.81  ? 86  MET B CA    1 
ATOM   3194 C C     . MET E 4 86  ? 82.546  50.851  -25.461 1.00 83.86  ? 86  MET B C     1 
ATOM   3195 O O     . MET E 4 86  ? 82.202  51.600  -26.378 1.00 83.11  ? 86  MET B O     1 
ATOM   3196 C CB    . MET E 4 86  ? 80.748  49.140  -25.799 1.00 86.09  ? 86  MET B CB    1 
ATOM   3197 C CG    . MET E 4 86  ? 80.368  49.130  -27.291 1.00 88.92  ? 86  MET B CG    1 
ATOM   3198 S SD    . MET E 4 86  ? 80.863  47.610  -28.193 1.00 91.93  ? 86  MET B SD    1 
ATOM   3199 C CE    . MET E 4 86  ? 81.889  48.280  -29.523 1.00 91.01  ? 86  MET B CE    1 
ATOM   3200 N N     . GLY E 4 87  ? 83.187  51.275  -24.373 1.00 83.96  ? 87  GLY B N     1 
ATOM   3201 C CA    . GLY E 4 87  ? 83.561  52.671  -24.230 1.00 83.98  ? 87  GLY B CA    1 
ATOM   3202 C C     . GLY E 4 87  ? 84.554  52.990  -25.332 1.00 84.58  ? 87  GLY B C     1 
ATOM   3203 O O     . GLY E 4 87  ? 85.574  52.311  -25.466 1.00 85.03  ? 87  GLY B O     1 
ATOM   3204 N N     . LYS E 4 88  ? 84.264  54.023  -26.118 1.00 84.31  ? 88  LYS B N     1 
ATOM   3205 C CA    . LYS E 4 88  ? 85.118  54.402  -27.241 1.00 83.19  ? 88  LYS B CA    1 
ATOM   3206 C C     . LYS E 4 88  ? 86.602  54.555  -26.934 1.00 81.40  ? 88  LYS B C     1 
ATOM   3207 O O     . LYS E 4 88  ? 87.422  54.525  -27.853 1.00 80.74  ? 88  LYS B O     1 
ATOM   3208 C CB    . LYS E 4 88  ? 84.614  55.696  -27.886 1.00 84.22  ? 88  LYS B CB    1 
ATOM   3209 C CG    . LYS E 4 88  ? 85.114  55.885  -29.314 1.00 84.77  ? 88  LYS B CG    1 
ATOM   3210 C CD    . LYS E 4 88  ? 84.566  54.785  -30.224 1.00 85.16  ? 88  LYS B CD    1 
ATOM   3211 C CE    . LYS E 4 88  ? 85.150  54.850  -31.628 1.00 85.00  ? 88  LYS B CE    1 
ATOM   3212 N NZ    . LYS E 4 88  ? 86.586  54.458  -31.665 1.00 84.90  ? 88  LYS B NZ    1 
ATOM   3213 N N     . ASP E 4 89  ? 86.952  54.710  -25.660 1.00 79.61  ? 89  ASP B N     1 
ATOM   3214 C CA    . ASP E 4 89  ? 88.356  54.873  -25.282 1.00 78.45  ? 89  ASP B CA    1 
ATOM   3215 C C     . ASP E 4 89  ? 88.961  53.604  -24.692 1.00 76.70  ? 89  ASP B C     1 
ATOM   3216 O O     . ASP E 4 89  ? 90.137  53.583  -24.331 1.00 76.28  ? 89  ASP B O     1 
ATOM   3217 C CB    . ASP E 4 89  ? 88.511  56.009  -24.266 1.00 79.76  ? 89  ASP B CB    1 
ATOM   3218 C CG    . ASP E 4 89  ? 88.221  55.564  -22.842 1.00 80.98  ? 89  ASP B CG    1 
ATOM   3219 O OD1   . ASP E 4 89  ? 87.056  55.219  -22.543 1.00 81.31  ? 89  ASP B OD1   1 
ATOM   3220 O OD2   . ASP E 4 89  ? 89.168  55.554  -22.026 1.00 80.75  ? 89  ASP B OD2   1 
ATOM   3221 N N     . ASP E 4 90  ? 88.156  52.552  -24.589 1.00 74.55  ? 90  ASP B N     1 
ATOM   3222 C CA    . ASP E 4 90  ? 88.624  51.288  -24.032 1.00 72.89  ? 90  ASP B CA    1 
ATOM   3223 C C     . ASP E 4 90  ? 89.521  50.508  -25.003 1.00 70.32  ? 90  ASP B C     1 
ATOM   3224 O O     . ASP E 4 90  ? 89.371  50.606  -26.223 1.00 68.83  ? 90  ASP B O     1 
ATOM   3225 C CB    . ASP E 4 90  ? 87.418  50.430  -23.610 1.00 75.40  ? 90  ASP B CB    1 
ATOM   3226 C CG    . ASP E 4 90  ? 86.735  50.951  -22.342 1.00 77.53  ? 90  ASP B CG    1 
ATOM   3227 O OD1   . ASP E 4 90  ? 86.363  52.145  -22.315 1.00 79.15  ? 90  ASP B OD1   1 
ATOM   3228 O OD2   . ASP E 4 90  ? 86.568  50.169  -21.376 1.00 76.46  ? 90  ASP B OD2   1 
ATOM   3229 N N     . HIS E 4 91  ? 90.464  49.749  -24.449 1.00 67.46  ? 91  HIS B N     1 
ATOM   3230 C CA    . HIS E 4 91  ? 91.385  48.934  -25.239 1.00 65.01  ? 91  HIS B CA    1 
ATOM   3231 C C     . HIS E 4 91  ? 91.687  47.652  -24.468 1.00 62.76  ? 91  HIS B C     1 
ATOM   3232 O O     . HIS E 4 91  ? 92.019  47.692  -23.285 1.00 61.83  ? 91  HIS B O     1 
ATOM   3233 C CB    . HIS E 4 91  ? 92.682  49.705  -25.516 1.00 66.07  ? 91  HIS B CB    1 
ATOM   3234 C CG    . HIS E 4 91  ? 93.374  50.195  -24.280 1.00 68.06  ? 91  HIS B CG    1 
ATOM   3235 N ND1   . HIS E 4 91  ? 94.038  49.353  -23.413 1.00 67.64  ? 91  HIS B ND1   1 
ATOM   3236 C CD2   . HIS E 4 91  ? 93.463  51.435  -23.741 1.00 67.98  ? 91  HIS B CD2   1 
ATOM   3237 C CE1   . HIS E 4 91  ? 94.503  50.052  -22.393 1.00 68.25  ? 91  HIS B CE1   1 
ATOM   3238 N NE2   . HIS E 4 91  ? 94.167  51.318  -22.567 1.00 68.02  ? 91  HIS B NE2   1 
ATOM   3239 N N     . TYR E 4 92  ? 91.569  46.512  -25.139 1.00 60.81  ? 92  TYR B N     1 
ATOM   3240 C CA    . TYR E 4 92  ? 91.807  45.226  -24.491 1.00 57.74  ? 92  TYR B CA    1 
ATOM   3241 C C     . TYR E 4 92  ? 91.835  44.073  -25.509 1.00 55.41  ? 92  TYR B C     1 
ATOM   3242 O O     . TYR E 4 92  ? 91.613  44.271  -26.707 1.00 52.85  ? 92  TYR B O     1 
ATOM   3243 C CB    . TYR E 4 92  ? 90.718  44.990  -23.430 1.00 57.80  ? 92  TYR B CB    1 
ATOM   3244 C CG    . TYR E 4 92  ? 89.318  45.045  -23.998 1.00 58.25  ? 92  TYR B CG    1 
ATOM   3245 C CD1   . TYR E 4 92  ? 88.791  43.961  -24.692 1.00 58.64  ? 92  TYR B CD1   1 
ATOM   3246 C CD2   . TYR E 4 92  ? 88.541  46.199  -23.894 1.00 58.68  ? 92  TYR B CD2   1 
ATOM   3247 C CE1   . TYR E 4 92  ? 87.531  44.017  -25.274 1.00 60.42  ? 92  TYR B CE1   1 
ATOM   3248 C CE2   . TYR E 4 92  ? 87.274  46.268  -24.476 1.00 58.88  ? 92  TYR B CE2   1 
ATOM   3249 C CZ    . TYR E 4 92  ? 86.775  45.168  -25.168 1.00 60.72  ? 92  TYR B CZ    1 
ATOM   3250 O OH    . TYR E 4 92  ? 85.528  45.201  -25.763 1.00 59.27  ? 92  TYR B OH    1 
ATOM   3251 N N     . LEU E 4 93  ? 92.108  42.870  -25.017 1.00 52.40  ? 93  LEU B N     1 
ATOM   3252 C CA    . LEU E 4 93  ? 92.183  41.690  -25.863 1.00 51.02  ? 93  LEU B CA    1 
ATOM   3253 C C     . LEU E 4 93  ? 90.863  40.940  -26.010 1.00 51.11  ? 93  LEU B C     1 
ATOM   3254 O O     . LEU E 4 93  ? 90.185  40.653  -25.021 1.00 51.44  ? 93  LEU B O     1 
ATOM   3255 C CB    . LEU E 4 93  ? 93.240  40.730  -25.315 1.00 50.22  ? 93  LEU B CB    1 
ATOM   3256 C CG    . LEU E 4 93  ? 94.649  41.313  -25.147 1.00 50.06  ? 93  LEU B CG    1 
ATOM   3257 C CD1   . LEU E 4 93  ? 95.575  40.259  -24.587 1.00 47.47  ? 93  LEU B CD1   1 
ATOM   3258 C CD2   . LEU E 4 93  ? 95.164  41.819  -26.486 1.00 48.38  ? 93  LEU B CD2   1 
ATOM   3259 N N     . LEU E 4 94  ? 90.512  40.635  -27.258 1.00 48.82  ? 94  LEU B N     1 
ATOM   3260 C CA    . LEU E 4 94  ? 89.306  39.881  -27.584 1.00 46.85  ? 94  LEU B CA    1 
ATOM   3261 C C     . LEU E 4 94  ? 89.757  38.495  -28.020 1.00 45.12  ? 94  LEU B C     1 
ATOM   3262 O O     . LEU E 4 94  ? 90.815  38.342  -28.630 1.00 44.77  ? 94  LEU B O     1 
ATOM   3263 C CB    . LEU E 4 94  ? 88.560  40.512  -28.759 1.00 47.29  ? 94  LEU B CB    1 
ATOM   3264 C CG    . LEU E 4 94  ? 87.778  41.817  -28.643 1.00 48.37  ? 94  LEU B CG    1 
ATOM   3265 C CD1   . LEU E 4 94  ? 87.477  42.330  -30.043 1.00 48.27  ? 94  LEU B CD1   1 
ATOM   3266 C CD2   . LEU E 4 94  ? 86.491  41.595  -27.859 1.00 47.58  ? 94  LEU B CD2   1 
ATOM   3267 N N     . GLU E 4 95  ? 88.957  37.482  -27.716 1.00 44.05  ? 95  GLU B N     1 
ATOM   3268 C CA    . GLU E 4 95  ? 89.286  36.124  -28.121 1.00 41.46  ? 95  GLU B CA    1 
ATOM   3269 C C     . GLU E 4 95  ? 88.170  35.591  -29.014 1.00 40.15  ? 95  GLU B C     1 
ATOM   3270 O O     . GLU E 4 95  ? 86.998  35.910  -28.815 1.00 39.90  ? 95  GLU B O     1 
ATOM   3271 C CB    . GLU E 4 95  ? 89.433  35.233  -26.902 1.00 42.69  ? 95  GLU B CB    1 
ATOM   3272 C CG    . GLU E 4 95  ? 88.123  34.784  -26.307 1.00 44.63  ? 95  GLU B CG    1 
ATOM   3273 C CD    . GLU E 4 95  ? 88.332  33.910  -25.098 1.00 46.88  ? 95  GLU B CD    1 
ATOM   3274 O OE1   . GLU E 4 95  ? 88.571  34.467  -24.005 1.00 46.44  ? 95  GLU B OE1   1 
ATOM   3275 O OE2   . GLU E 4 95  ? 88.278  32.671  -25.246 1.00 47.60  ? 95  GLU B OE2   1 
ATOM   3276 N N     . PHE E 4 96  ? 88.537  34.784  -30.004 1.00 39.24  ? 96  PHE B N     1 
ATOM   3277 C CA    . PHE E 4 96  ? 87.560  34.216  -30.919 1.00 35.92  ? 96  PHE B CA    1 
ATOM   3278 C C     . PHE E 4 96  ? 88.024  32.813  -31.332 1.00 33.83  ? 96  PHE B C     1 
ATOM   3279 O O     . PHE E 4 96  ? 89.208  32.578  -31.531 1.00 32.57  ? 96  PHE B O     1 
ATOM   3280 C CB    . PHE E 4 96  ? 87.424  35.130  -32.146 1.00 35.34  ? 96  PHE B CB    1 
ATOM   3281 C CG    . PHE E 4 96  ? 86.243  34.804  -33.033 1.00 37.66  ? 96  PHE B CG    1 
ATOM   3282 C CD1   . PHE E 4 96  ? 84.936  35.046  -32.601 1.00 37.46  ? 96  PHE B CD1   1 
ATOM   3283 C CD2   . PHE E 4 96  ? 86.439  34.274  -34.305 1.00 36.74  ? 96  PHE B CD2   1 
ATOM   3284 C CE1   . PHE E 4 96  ? 83.845  34.765  -33.427 1.00 38.23  ? 96  PHE B CE1   1 
ATOM   3285 C CE2   . PHE E 4 96  ? 85.359  33.988  -35.139 1.00 36.31  ? 96  PHE B CE2   1 
ATOM   3286 C CZ    . PHE E 4 96  ? 84.059  34.233  -34.702 1.00 37.99  ? 96  PHE B CZ    1 
ATOM   3287 N N     . PRO E 4 97  ? 87.089  31.864  -31.463 1.00 32.20  ? 97  PRO B N     1 
ATOM   3288 C CA    . PRO E 4 97  ? 87.418  30.490  -31.853 1.00 32.01  ? 97  PRO B CA    1 
ATOM   3289 C C     . PRO E 4 97  ? 88.098  30.396  -33.229 1.00 33.48  ? 97  PRO B C     1 
ATOM   3290 O O     . PRO E 4 97  ? 87.606  30.947  -34.215 1.00 31.09  ? 97  PRO B O     1 
ATOM   3291 C CB    . PRO E 4 97  ? 86.059  29.794  -31.859 1.00 32.88  ? 97  PRO B CB    1 
ATOM   3292 C CG    . PRO E 4 97  ? 85.243  30.605  -30.921 1.00 33.29  ? 97  PRO B CG    1 
ATOM   3293 C CD    . PRO E 4 97  ? 85.645  32.009  -31.248 1.00 32.06  ? 97  PRO B CD    1 
ATOM   3294 N N     . THR E 4 98  ? 89.224  29.695  -33.289 1.00 29.94  ? 98  THR B N     1 
ATOM   3295 C CA    . THR E 4 98  ? 89.939  29.525  -34.544 1.00 32.47  ? 98  THR B CA    1 
ATOM   3296 C C     . THR E 4 98  ? 90.254  28.041  -34.701 1.00 30.68  ? 98  THR B C     1 
ATOM   3297 O O     . THR E 4 98  ? 90.651  27.364  -33.747 1.00 32.52  ? 98  THR B O     1 
ATOM   3298 C CB    . THR E 4 98  ? 91.231  30.401  -34.588 1.00 34.69  ? 98  THR B CB    1 
ATOM   3299 O OG1   . THR E 4 98  ? 91.701  30.488  -35.939 1.00 35.01  ? 98  THR B OG1   1 
ATOM   3300 C CG2   . THR E 4 98  ? 92.316  29.821  -33.722 1.00 28.64  ? 98  THR B CG2   1 
ATOM   3301 N N     . PHE E 4 99  ? 90.067  27.537  -35.911 1.00 29.54  ? 99  PHE B N     1 
ATOM   3302 C CA    . PHE E 4 99  ? 90.253  26.121  -36.181 1.00 28.41  ? 99  PHE B CA    1 
ATOM   3303 C C     . PHE E 4 99  ? 91.251  25.817  -37.275 1.00 29.02  ? 99  PHE B C     1 
ATOM   3304 O O     . PHE E 4 99  ? 91.516  26.643  -38.136 1.00 30.97  ? 99  PHE B O     1 
ATOM   3305 C CB    . PHE E 4 99  ? 88.918  25.512  -36.576 1.00 29.92  ? 99  PHE B CB    1 
ATOM   3306 C CG    . PHE E 4 99  ? 87.779  25.883  -35.672 1.00 27.30  ? 99  PHE B CG    1 
ATOM   3307 C CD1   . PHE E 4 99  ? 87.492  25.122  -34.546 1.00 24.83  ? 99  PHE B CD1   1 
ATOM   3308 C CD2   . PHE E 4 99  ? 86.938  26.946  -35.996 1.00 28.30  ? 99  PHE B CD2   1 
ATOM   3309 C CE1   . PHE E 4 99  ? 86.369  25.409  -33.760 1.00 27.92  ? 99  PHE B CE1   1 
ATOM   3310 C CE2   . PHE E 4 99  ? 85.821  27.236  -35.223 1.00 25.47  ? 99  PHE B CE2   1 
ATOM   3311 C CZ    . PHE E 4 99  ? 85.534  26.463  -34.104 1.00 28.50  ? 99  PHE B CZ    1 
ATOM   3312 N N     . PRO E 4 100 ? 91.811  24.604  -37.262 1.00 30.38  ? 100 PRO B N     1 
ATOM   3313 C CA    . PRO E 4 100 ? 92.783  24.216  -38.280 1.00 33.77  ? 100 PRO B CA    1 
ATOM   3314 C C     . PRO E 4 100 ? 92.332  24.503  -39.712 1.00 34.72  ? 100 PRO B C     1 
ATOM   3315 O O     . PRO E 4 100 ? 93.075  25.123  -40.465 1.00 37.59  ? 100 PRO B O     1 
ATOM   3316 C CB    . PRO E 4 100 ? 92.994  22.734  -37.993 1.00 33.34  ? 100 PRO B CB    1 
ATOM   3317 C CG    . PRO E 4 100 ? 92.924  22.723  -36.479 1.00 33.92  ? 100 PRO B CG    1 
ATOM   3318 C CD    . PRO E 4 100 ? 91.693  23.560  -36.230 1.00 31.32  ? 100 PRO B CD    1 
ATOM   3319 N N     . ASP E 4 101 ? 91.126  24.075  -40.078 1.00 35.73  ? 101 ASP B N     1 
ATOM   3320 C CA    . ASP E 4 101 ? 90.607  24.311  -41.434 1.00 38.70  ? 101 ASP B CA    1 
ATOM   3321 C C     . ASP E 4 101 ? 90.367  25.789  -41.774 1.00 37.78  ? 101 ASP B C     1 
ATOM   3322 O O     . ASP E 4 101 ? 90.028  26.118  -42.910 1.00 40.10  ? 101 ASP B O     1 
ATOM   3323 C CB    . ASP E 4 101 ? 89.302  23.519  -41.684 1.00 39.12  ? 101 ASP B CB    1 
ATOM   3324 C CG    . ASP E 4 101 ? 88.093  24.048  -40.880 1.00 43.59  ? 101 ASP B CG    1 
ATOM   3325 O OD1   . ASP E 4 101 ? 87.990  25.262  -40.591 1.00 44.25  ? 101 ASP B OD1   1 
ATOM   3326 O OD2   . ASP E 4 101 ? 87.206  23.233  -40.561 1.00 47.85  ? 101 ASP B OD2   1 
ATOM   3327 N N     . GLY E 4 102 ? 90.525  26.669  -40.791 1.00 36.58  ? 102 GLY B N     1 
ATOM   3328 C CA    . GLY E 4 102 ? 90.338  28.095  -41.018 1.00 37.61  ? 102 GLY B CA    1 
ATOM   3329 C C     . GLY E 4 102 ? 88.920  28.653  -41.082 1.00 38.80  ? 102 GLY B C     1 
ATOM   3330 O O     . GLY E 4 102 ? 88.737  29.874  -41.104 1.00 38.66  ? 102 GLY B O     1 
ATOM   3331 N N     . HIS E 4 103 ? 87.913  27.783  -41.087 1.00 40.16  ? 103 HIS B N     1 
ATOM   3332 C CA    . HIS E 4 103 ? 86.530  28.239  -41.183 1.00 42.92  ? 103 HIS B CA    1 
ATOM   3333 C C     . HIS E 4 103 ? 86.125  29.275  -40.129 1.00 45.19  ? 103 HIS B C     1 
ATOM   3334 O O     . HIS E 4 103 ? 86.669  29.306  -39.020 1.00 44.34  ? 103 HIS B O     1 
ATOM   3335 C CB    . HIS E 4 103 ? 85.575  27.039  -41.167 1.00 42.68  ? 103 HIS B CB    1 
ATOM   3336 C CG    . HIS E 4 103 ? 85.062  26.666  -39.809 1.00 43.01  ? 103 HIS B CG    1 
ATOM   3337 N ND1   . HIS E 4 103 ? 84.315  27.524  -39.032 1.00 44.76  ? 103 HIS B ND1   1 
ATOM   3338 C CD2   . HIS E 4 103 ? 85.122  25.499  -39.126 1.00 42.33  ? 103 HIS B CD2   1 
ATOM   3339 C CE1   . HIS E 4 103 ? 83.933  26.902  -37.931 1.00 41.18  ? 103 HIS B CE1   1 
ATOM   3340 N NE2   . HIS E 4 103 ? 84.409  25.670  -37.964 1.00 42.69  ? 103 HIS B NE2   1 
ATOM   3341 N N     . ASP E 4 104 ? 85.178  30.135  -40.508 1.00 45.75  ? 104 ASP B N     1 
ATOM   3342 C CA    . ASP E 4 104 ? 84.678  31.199  -39.646 1.00 44.79  ? 104 ASP B CA    1 
ATOM   3343 C C     . ASP E 4 104 ? 83.662  30.655  -38.652 1.00 45.01  ? 104 ASP B C     1 
ATOM   3344 O O     . ASP E 4 104 ? 82.724  29.935  -39.017 1.00 44.03  ? 104 ASP B O     1 
ATOM   3345 C CB    . ASP E 4 104 ? 84.036  32.306  -40.487 1.00 48.71  ? 104 ASP B CB    1 
ATOM   3346 C CG    . ASP E 4 104 ? 85.043  33.047  -41.352 1.00 52.62  ? 104 ASP B CG    1 
ATOM   3347 O OD1   . ASP E 4 104 ? 86.069  33.519  -40.816 1.00 58.03  ? 104 ASP B OD1   1 
ATOM   3348 O OD2   . ASP E 4 104 ? 84.807  33.169  -42.570 1.00 55.05  ? 104 ASP B OD2   1 
ATOM   3349 N N     . TYR E 4 105 ? 83.845  31.011  -37.389 1.00 42.53  ? 105 TYR B N     1 
ATOM   3350 C CA    . TYR E 4 105 ? 82.966  30.536  -36.336 1.00 41.87  ? 105 TYR B CA    1 
ATOM   3351 C C     . TYR E 4 105 ? 81.553  31.131  -36.405 1.00 42.06  ? 105 TYR B C     1 
ATOM   3352 O O     . TYR E 4 105 ? 81.398  32.322  -36.610 1.00 44.98  ? 105 TYR B O     1 
ATOM   3353 C CB    . TYR E 4 105 ? 83.605  30.854  -34.990 1.00 39.36  ? 105 TYR B CB    1 
ATOM   3354 C CG    . TYR E 4 105 ? 82.846  30.299  -33.825 1.00 37.68  ? 105 TYR B CG    1 
ATOM   3355 C CD1   . TYR E 4 105 ? 82.816  28.919  -33.577 1.00 36.28  ? 105 TYR B CD1   1 
ATOM   3356 C CD2   . TYR E 4 105 ? 82.136  31.144  -32.978 1.00 35.09  ? 105 TYR B CD2   1 
ATOM   3357 C CE1   . TYR E 4 105 ? 82.092  28.402  -32.512 1.00 31.87  ? 105 TYR B CE1   1 
ATOM   3358 C CE2   . TYR E 4 105 ? 81.415  30.637  -31.909 1.00 35.26  ? 105 TYR B CE2   1 
ATOM   3359 C CZ    . TYR E 4 105 ? 81.397  29.272  -31.685 1.00 33.36  ? 105 TYR B CZ    1 
ATOM   3360 O OH    . TYR E 4 105 ? 80.683  28.793  -30.620 1.00 35.99  ? 105 TYR B OH    1 
ATOM   3361 N N     . LYS E 4 106 ? 80.522  30.311  -36.248 1.00 42.34  ? 106 LYS B N     1 
ATOM   3362 C CA    . LYS E 4 106 ? 79.159  30.845  -36.277 1.00 43.95  ? 106 LYS B CA    1 
ATOM   3363 C C     . LYS E 4 106 ? 78.848  31.537  -34.961 1.00 42.89  ? 106 LYS B C     1 
ATOM   3364 O O     . LYS E 4 106 ? 78.115  31.013  -34.139 1.00 44.01  ? 106 LYS B O     1 
ATOM   3365 C CB    . LYS E 4 106 ? 78.140  29.730  -36.533 1.00 44.57  ? 106 LYS B CB    1 
ATOM   3366 C CG    . LYS E 4 106 ? 78.006  29.365  -38.004 1.00 45.53  ? 106 LYS B CG    1 
ATOM   3367 C CD    . LYS E 4 106 ? 77.084  28.176  -38.201 1.00 50.50  ? 106 LYS B CD    1 
ATOM   3368 C CE    . LYS E 4 106 ? 76.850  27.904  -39.682 1.00 50.40  ? 106 LYS B CE    1 
ATOM   3369 N NZ    . LYS E 4 106 ? 78.120  28.002  -40.465 1.00 50.17  ? 106 LYS B NZ    1 
ATOM   3370 N N     . PHE E 4 107 ? 79.415  32.725  -34.787 1.00 46.08  ? 107 PHE B N     1 
ATOM   3371 C CA    . PHE E 4 107 ? 79.269  33.539  -33.581 1.00 47.54  ? 107 PHE B CA    1 
ATOM   3372 C C     . PHE E 4 107 ? 77.833  33.865  -33.177 1.00 51.16  ? 107 PHE B C     1 
ATOM   3373 O O     . PHE E 4 107 ? 77.561  34.170  -32.013 1.00 49.97  ? 107 PHE B O     1 
ATOM   3374 C CB    . PHE E 4 107 ? 80.058  34.842  -33.752 1.00 46.44  ? 107 PHE B CB    1 
ATOM   3375 C CG    . PHE E 4 107 ? 79.551  35.704  -34.863 1.00 47.80  ? 107 PHE B CG    1 
ATOM   3376 C CD1   . PHE E 4 107 ? 78.371  36.440  -34.714 1.00 47.77  ? 107 PHE B CD1   1 
ATOM   3377 C CD2   . PHE E 4 107 ? 80.210  35.736  -36.090 1.00 48.75  ? 107 PHE B CD2   1 
ATOM   3378 C CE1   . PHE E 4 107 ? 77.852  37.192  -35.775 1.00 46.64  ? 107 PHE B CE1   1 
ATOM   3379 C CE2   . PHE E 4 107 ? 79.701  36.485  -37.160 1.00 48.87  ? 107 PHE B CE2   1 
ATOM   3380 C CZ    . PHE E 4 107 ? 78.520  37.211  -37.000 1.00 49.22  ? 107 PHE B CZ    1 
ATOM   3381 N N     . ASP E 4 108 ? 76.909  33.826  -34.129 1.00 54.44  ? 108 ASP B N     1 
ATOM   3382 C CA    . ASP E 4 108 ? 75.524  34.113  -33.795 1.00 57.10  ? 108 ASP B CA    1 
ATOM   3383 C C     . ASP E 4 108 ? 74.774  32.867  -33.374 1.00 58.15  ? 108 ASP B C     1 
ATOM   3384 O O     . ASP E 4 108 ? 73.711  32.961  -32.771 1.00 58.94  ? 108 ASP B O     1 
ATOM   3385 C CB    . ASP E 4 108 ? 74.797  34.771  -34.969 1.00 59.37  ? 108 ASP B CB    1 
ATOM   3386 C CG    . ASP E 4 108 ? 74.838  36.280  -34.897 1.00 61.57  ? 108 ASP B CG    1 
ATOM   3387 O OD1   . ASP E 4 108 ? 74.964  36.803  -33.765 1.00 62.92  ? 108 ASP B OD1   1 
ATOM   3388 O OD2   . ASP E 4 108 ? 74.732  36.940  -35.957 1.00 62.74  ? 108 ASP B OD2   1 
ATOM   3389 N N     . SER E 4 109 ? 75.328  31.699  -33.685 1.00 59.63  ? 109 SER B N     1 
ATOM   3390 C CA    . SER E 4 109 ? 74.674  30.439  -33.329 1.00 62.07  ? 109 SER B CA    1 
ATOM   3391 C C     . SER E 4 109 ? 74.438  30.366  -31.831 1.00 62.55  ? 109 SER B C     1 
ATOM   3392 O O     . SER E 4 109 ? 75.338  30.630  -31.043 1.00 61.36  ? 109 SER B O     1 
ATOM   3393 C CB    . SER E 4 109 ? 75.524  29.232  -33.760 1.00 63.94  ? 109 SER B CB    1 
ATOM   3394 O OG    . SER E 4 109 ? 76.688  29.081  -32.953 1.00 63.32  ? 109 SER B OG    1 
ATOM   3395 N N     . LYS E 4 110 ? 73.221  30.019  -31.440 1.00 64.74  ? 110 LYS B N     1 
ATOM   3396 C CA    . LYS E 4 110 ? 72.897  29.902  -30.027 1.00 66.96  ? 110 LYS B CA    1 
ATOM   3397 C C     . LYS E 4 110 ? 72.273  28.536  -29.751 1.00 67.70  ? 110 LYS B C     1 
ATOM   3398 O O     . LYS E 4 110 ? 71.512  28.012  -30.566 1.00 66.30  ? 110 LYS B O     1 
ATOM   3399 C CB    . LYS E 4 110 ? 71.951  31.029  -29.607 1.00 68.03  ? 110 LYS B CB    1 
ATOM   3400 C CG    . LYS E 4 110 ? 71.433  30.925  -28.173 1.00 69.78  ? 110 LYS B CG    1 
ATOM   3401 C CD    . LYS E 4 110 ? 70.814  32.249  -27.727 1.00 70.04  ? 110 LYS B CD    1 
ATOM   3402 C CE    . LYS E 4 110 ? 69.917  32.097  -26.504 1.00 68.92  ? 110 LYS B CE    1 
ATOM   3403 N NZ    . LYS E 4 110 ? 68.591  31.501  -26.859 1.00 68.99  ? 110 LYS B NZ    1 
ATOM   3404 N N     . LYS E 4 111 ? 72.625  27.969  -28.601 1.00 69.03  ? 111 LYS B N     1 
ATOM   3405 C CA    . LYS E 4 111 ? 72.146  26.660  -28.151 1.00 71.74  ? 111 LYS B CA    1 
ATOM   3406 C C     . LYS E 4 111 ? 71.340  25.826  -29.169 1.00 71.73  ? 111 LYS B C     1 
ATOM   3407 O O     . LYS E 4 111 ? 70.160  26.098  -29.428 1.00 72.65  ? 111 LYS B O     1 
ATOM   3408 C CB    . LYS E 4 111 ? 71.342  26.821  -26.846 1.00 73.31  ? 111 LYS B CB    1 
ATOM   3409 C CG    . LYS E 4 111 ? 72.167  27.350  -25.663 1.00 75.17  ? 111 LYS B CG    1 
ATOM   3410 C CD    . LYS E 4 111 ? 71.387  27.308  -24.346 1.00 76.39  ? 111 LYS B CD    1 
ATOM   3411 C CE    . LYS E 4 111 ? 72.258  27.759  -23.174 1.00 77.04  ? 111 LYS B CE    1 
ATOM   3412 N NZ    . LYS E 4 111 ? 71.591  27.576  -21.851 1.00 75.84  ? 111 LYS B NZ    1 
ATOM   3413 N N     . PRO E 4 112 ? 71.981  24.793  -29.756 1.00 70.83  ? 112 PRO B N     1 
ATOM   3414 C CA    . PRO E 4 112 ? 73.381  24.489  -29.444 1.00 67.74  ? 112 PRO B CA    1 
ATOM   3415 C C     . PRO E 4 112 ? 74.318  25.402  -30.222 1.00 65.33  ? 112 PRO B C     1 
ATOM   3416 O O     . PRO E 4 112 ? 74.336  25.385  -31.455 1.00 65.87  ? 112 PRO B O     1 
ATOM   3417 C CB    . PRO E 4 112 ? 73.514  23.035  -29.874 1.00 68.91  ? 112 PRO B CB    1 
ATOM   3418 C CG    . PRO E 4 112 ? 72.668  23.004  -31.114 1.00 69.20  ? 112 PRO B CG    1 
ATOM   3419 C CD    . PRO E 4 112 ? 71.426  23.786  -30.685 1.00 70.47  ? 112 PRO B CD    1 
ATOM   3420 N N     . LYS E 4 113 ? 75.079  26.221  -29.510 1.00 60.93  ? 113 LYS B N     1 
ATOM   3421 C CA    . LYS E 4 113 ? 76.020  27.092  -30.183 1.00 56.77  ? 113 LYS B CA    1 
ATOM   3422 C C     . LYS E 4 113 ? 77.045  26.161  -30.806 1.00 53.23  ? 113 LYS B C     1 
ATOM   3423 O O     . LYS E 4 113 ? 77.135  24.995  -30.431 1.00 53.34  ? 113 LYS B O     1 
ATOM   3424 C CB    . LYS E 4 113 ? 76.715  28.011  -29.181 1.00 59.19  ? 113 LYS B CB    1 
ATOM   3425 C CG    . LYS E 4 113 ? 77.675  27.296  -28.230 1.00 59.29  ? 113 LYS B CG    1 
ATOM   3426 C CD    . LYS E 4 113 ? 78.328  28.279  -27.267 1.00 59.09  ? 113 LYS B CD    1 
ATOM   3427 C CE    . LYS E 4 113 ? 77.369  28.681  -26.162 1.00 61.12  ? 113 LYS B CE    1 
ATOM   3428 N NZ    . LYS E 4 113 ? 76.079  29.228  -26.671 1.00 61.58  ? 113 LYS B NZ    1 
ATOM   3429 N N     . GLU E 4 114 ? 77.819  26.658  -31.758 1.00 48.53  ? 114 GLU B N     1 
ATOM   3430 C CA    . GLU E 4 114 ? 78.836  25.817  -32.366 1.00 43.17  ? 114 GLU B CA    1 
ATOM   3431 C C     . GLU E 4 114 ? 79.966  25.573  -31.366 1.00 40.15  ? 114 GLU B C     1 
ATOM   3432 O O     . GLU E 4 114 ? 80.413  26.486  -30.682 1.00 38.35  ? 114 GLU B O     1 
ATOM   3433 C CB    . GLU E 4 114 ? 79.396  26.481  -33.618 1.00 41.93  ? 114 GLU B CB    1 
ATOM   3434 C CG    . GLU E 4 114 ? 80.680  25.839  -34.124 1.00 42.21  ? 114 GLU B CG    1 
ATOM   3435 C CD    . GLU E 4 114 ? 81.105  26.357  -35.486 1.00 44.35  ? 114 GLU B CD    1 
ATOM   3436 O OE1   . GLU E 4 114 ? 80.815  27.534  -35.827 1.00 45.89  ? 114 GLU B OE1   1 
ATOM   3437 O OE2   . GLU E 4 114 ? 81.752  25.581  -36.210 1.00 44.71  ? 114 GLU B OE2   1 
ATOM   3438 N N     . ASP E 4 115 ? 80.408  24.329  -31.276 1.00 37.89  ? 115 ASP B N     1 
ATOM   3439 C CA    . ASP E 4 115 ? 81.492  23.954  -30.387 1.00 37.36  ? 115 ASP B CA    1 
ATOM   3440 C C     . ASP E 4 115 ? 82.711  24.774  -30.816 1.00 35.72  ? 115 ASP B C     1 
ATOM   3441 O O     . ASP E 4 115 ? 83.162  24.672  -31.950 1.00 37.58  ? 115 ASP B O     1 
ATOM   3442 C CB    . ASP E 4 115 ? 81.709  22.444  -30.514 1.00 37.96  ? 115 ASP B CB    1 
ATOM   3443 C CG    . ASP E 4 115 ? 83.083  21.998  -30.073 1.00 41.56  ? 115 ASP B CG    1 
ATOM   3444 O OD1   . ASP E 4 115 ? 83.658  22.600  -29.142 1.00 41.49  ? 115 ASP B OD1   1 
ATOM   3445 O OD2   . ASP E 4 115 ? 83.580  21.009  -30.660 1.00 40.12  ? 115 ASP B OD2   1 
ATOM   3446 N N     . PRO E 4 116 ? 83.250  25.608  -29.912 1.00 32.44  ? 116 PRO B N     1 
ATOM   3447 C CA    . PRO E 4 116 ? 84.408  26.481  -30.156 1.00 32.54  ? 116 PRO B CA    1 
ATOM   3448 C C     . PRO E 4 116 ? 85.779  25.851  -30.268 1.00 29.55  ? 116 PRO B C     1 
ATOM   3449 O O     . PRO E 4 116 ? 86.727  26.511  -30.674 1.00 31.27  ? 116 PRO B O     1 
ATOM   3450 C CB    . PRO E 4 116 ? 84.345  27.465  -28.990 1.00 31.30  ? 116 PRO B CB    1 
ATOM   3451 C CG    . PRO E 4 116 ? 83.908  26.584  -27.873 1.00 32.04  ? 116 PRO B CG    1 
ATOM   3452 C CD    . PRO E 4 116 ? 82.764  25.781  -28.531 1.00 33.40  ? 116 PRO B CD    1 
ATOM   3453 N N     . GLY E 4 117 ? 85.894  24.582  -29.906 1.00 30.49  ? 117 GLY B N     1 
ATOM   3454 C CA    . GLY E 4 117 ? 87.189  23.930  -29.963 1.00 29.10  ? 117 GLY B CA    1 
ATOM   3455 C C     . GLY E 4 117 ? 88.088  24.532  -28.896 1.00 27.99  ? 117 GLY B C     1 
ATOM   3456 O O     . GLY E 4 117 ? 87.665  25.438  -28.181 1.00 24.71  ? 117 GLY B O     1 
ATOM   3457 N N     . PRO E 4 118 ? 89.345  24.077  -28.799 1.00 28.75  ? 118 PRO B N     1 
ATOM   3458 C CA    . PRO E 4 118 ? 90.372  24.503  -27.848 1.00 28.93  ? 118 PRO B CA    1 
ATOM   3459 C C     . PRO E 4 118 ? 91.180  25.762  -28.198 1.00 31.58  ? 118 PRO B C     1 
ATOM   3460 O O     . PRO E 4 118 ? 91.781  26.381  -27.318 1.00 31.26  ? 118 PRO B O     1 
ATOM   3461 C CB    . PRO E 4 118 ? 91.263  23.289  -27.790 1.00 26.73  ? 118 PRO B CB    1 
ATOM   3462 C CG    . PRO E 4 118 ? 91.314  22.904  -29.207 1.00 28.61  ? 118 PRO B CG    1 
ATOM   3463 C CD    . PRO E 4 118 ? 89.863  22.989  -29.649 1.00 28.42  ? 118 PRO B CD    1 
ATOM   3464 N N     . ALA E 4 119 ? 91.202  26.138  -29.473 1.00 32.23  ? 119 ALA B N     1 
ATOM   3465 C CA    . ALA E 4 119 ? 91.981  27.296  -29.915 1.00 32.29  ? 119 ALA B CA    1 
ATOM   3466 C C     . ALA E 4 119 ? 91.224  28.619  -30.120 1.00 32.89  ? 119 ALA B C     1 
ATOM   3467 O O     . ALA E 4 119 ? 90.037  28.645  -30.425 1.00 31.34  ? 119 ALA B O     1 
ATOM   3468 C CB    . ALA E 4 119 ? 92.729  26.935  -31.189 1.00 33.70  ? 119 ALA B CB    1 
ATOM   3469 N N     . ARG E 4 120 ? 91.948  29.718  -29.950 1.00 34.61  ? 120 ARG B N     1 
ATOM   3470 C CA    . ARG E 4 120 ? 91.389  31.055  -30.110 1.00 35.20  ? 120 ARG B CA    1 
ATOM   3471 C C     . ARG E 4 120 ? 92.405  31.995  -30.755 1.00 36.16  ? 120 ARG B C     1 
ATOM   3472 O O     . ARG E 4 120 ? 93.599  31.965  -30.438 1.00 36.46  ? 120 ARG B O     1 
ATOM   3473 C CB    . ARG E 4 120 ? 91.013  31.656  -28.751 1.00 33.86  ? 120 ARG B CB    1 
ATOM   3474 C CG    . ARG E 4 120 ? 90.240  30.741  -27.820 1.00 34.24  ? 120 ARG B CG    1 
ATOM   3475 C CD    . ARG E 4 120 ? 88.741  30.848  -28.019 1.00 34.28  ? 120 ARG B CD    1 
ATOM   3476 N NE    . ARG E 4 120 ? 88.034  29.903  -27.164 1.00 35.46  ? 120 ARG B NE    1 
ATOM   3477 C CZ    . ARG E 4 120 ? 87.893  28.607  -27.426 1.00 38.17  ? 120 ARG B CZ    1 
ATOM   3478 N NH1   . ARG E 4 120 ? 88.404  28.079  -28.531 1.00 37.86  ? 120 ARG B NH1   1 
ATOM   3479 N NH2   . ARG E 4 120 ? 87.240  27.834  -26.571 1.00 41.14  ? 120 ARG B NH2   1 
ATOM   3480 N N     . VAL E 4 121 ? 91.942  32.815  -31.686 1.00 34.45  ? 121 VAL B N     1 
ATOM   3481 C CA    . VAL E 4 121 ? 92.831  33.799  -32.261 1.00 33.99  ? 121 VAL B CA    1 
ATOM   3482 C C     . VAL E 4 121 ? 92.638  34.950  -31.271 1.00 34.54  ? 121 VAL B C     1 
ATOM   3483 O O     . VAL E 4 121 ? 91.523  35.194  -30.819 1.00 30.46  ? 121 VAL B O     1 
ATOM   3484 C CB    . VAL E 4 121 ? 92.397  34.240  -33.680 1.00 35.13  ? 121 VAL B CB    1 
ATOM   3485 C CG1   . VAL E 4 121 ? 90.917  34.572  -33.707 1.00 30.44  ? 121 VAL B CG1   1 
ATOM   3486 C CG2   . VAL E 4 121 ? 93.213  35.450  -34.102 1.00 36.00  ? 121 VAL B CG2   1 
ATOM   3487 N N     . ILE E 4 122 ? 93.725  35.608  -30.891 1.00 37.33  ? 122 ILE B N     1 
ATOM   3488 C CA    . ILE E 4 122 ? 93.650  36.728  -29.961 1.00 41.43  ? 122 ILE B CA    1 
ATOM   3489 C C     . ILE E 4 122 ? 93.966  38.018  -30.715 1.00 43.23  ? 122 ILE B C     1 
ATOM   3490 O O     . ILE E 4 122 ? 95.035  38.135  -31.312 1.00 44.41  ? 122 ILE B O     1 
ATOM   3491 C CB    . ILE E 4 122 ? 94.671  36.579  -28.817 1.00 40.88  ? 122 ILE B CB    1 
ATOM   3492 C CG1   . ILE E 4 122 ? 94.407  35.292  -28.045 1.00 40.93  ? 122 ILE B CG1   1 
ATOM   3493 C CG2   . ILE E 4 122 ? 94.584  37.776  -27.890 1.00 42.33  ? 122 ILE B CG2   1 
ATOM   3494 C CD1   . ILE E 4 122 ? 93.057  35.268  -27.368 1.00 42.88  ? 122 ILE B CD1   1 
ATOM   3495 N N     . TYR E 4 123 ? 93.035  38.972  -30.702 1.00 44.28  ? 123 TYR B N     1 
ATOM   3496 C CA    . TYR E 4 123 ? 93.241  40.255  -31.377 1.00 46.00  ? 123 TYR B CA    1 
ATOM   3497 C C     . TYR E 4 123 ? 92.805  41.414  -30.498 1.00 47.09  ? 123 TYR B C     1 
ATOM   3498 O O     . TYR E 4 123 ? 92.152  41.211  -29.483 1.00 47.90  ? 123 TYR B O     1 
ATOM   3499 C CB    . TYR E 4 123 ? 92.498  40.317  -32.722 1.00 45.04  ? 123 TYR B CB    1 
ATOM   3500 C CG    . TYR E 4 123 ? 91.040  39.909  -32.685 1.00 44.58  ? 123 TYR B CG    1 
ATOM   3501 C CD1   . TYR E 4 123 ? 90.663  38.619  -32.307 1.00 43.54  ? 123 TYR B CD1   1 
ATOM   3502 C CD2   . TYR E 4 123 ? 90.043  40.789  -33.085 1.00 44.74  ? 123 TYR B CD2   1 
ATOM   3503 C CE1   . TYR E 4 123 ? 89.338  38.218  -32.332 1.00 42.19  ? 123 TYR B CE1   1 
ATOM   3504 C CE2   . TYR E 4 123 ? 88.702  40.394  -33.113 1.00 45.13  ? 123 TYR B CE2   1 
ATOM   3505 C CZ    . TYR E 4 123 ? 88.361  39.108  -32.735 1.00 43.45  ? 123 TYR B CZ    1 
ATOM   3506 O OH    . TYR E 4 123 ? 87.041  38.712  -32.737 1.00 42.75  ? 123 TYR B OH    1 
ATOM   3507 N N     . THR E 4 124 ? 93.158  42.628  -30.906 1.00 47.58  ? 124 THR B N     1 
ATOM   3508 C CA    . THR E 4 124 ? 92.840  43.822  -30.135 1.00 48.05  ? 124 THR B CA    1 
ATOM   3509 C C     . THR E 4 124 ? 91.554  44.558  -30.463 1.00 48.66  ? 124 THR B C     1 
ATOM   3510 O O     . THR E 4 124 ? 91.108  44.604  -31.605 1.00 48.70  ? 124 THR B O     1 
ATOM   3511 C CB    . THR E 4 124 ? 93.958  44.873  -30.251 1.00 48.81  ? 124 THR B CB    1 
ATOM   3512 O OG1   . THR E 4 124 ? 94.031  45.340  -31.605 1.00 47.88  ? 124 THR B OG1   1 
ATOM   3513 C CG2   . THR E 4 124 ? 95.295  44.283  -29.842 1.00 46.89  ? 124 THR B CG2   1 
ATOM   3514 N N     . TYR E 4 125 ? 90.967  45.134  -29.423 1.00 51.06  ? 125 TYR B N     1 
ATOM   3515 C CA    . TYR E 4 125 ? 89.779  45.958  -29.551 1.00 51.98  ? 125 TYR B CA    1 
ATOM   3516 C C     . TYR E 4 125 ? 90.371  47.348  -29.348 1.00 51.19  ? 125 TYR B C     1 
ATOM   3517 O O     . TYR E 4 125 ? 91.121  47.571  -28.396 1.00 48.47  ? 125 TYR B O     1 
ATOM   3518 C CB    . TYR E 4 125 ? 88.757  45.669  -28.439 1.00 54.48  ? 125 TYR B CB    1 
ATOM   3519 C CG    . TYR E 4 125 ? 87.609  46.664  -28.410 1.00 57.10  ? 125 TYR B CG    1 
ATOM   3520 C CD1   . TYR E 4 125 ? 87.742  47.905  -27.773 1.00 56.92  ? 125 TYR B CD1   1 
ATOM   3521 C CD2   . TYR E 4 125 ? 86.404  46.384  -29.054 1.00 56.83  ? 125 TYR B CD2   1 
ATOM   3522 C CE1   . TYR E 4 125 ? 86.697  48.841  -27.782 1.00 56.30  ? 125 TYR B CE1   1 
ATOM   3523 C CE2   . TYR E 4 125 ? 85.357  47.310  -29.069 1.00 56.74  ? 125 TYR B CE2   1 
ATOM   3524 C CZ    . TYR E 4 125 ? 85.509  48.534  -28.434 1.00 56.67  ? 125 TYR B CZ    1 
ATOM   3525 O OH    . TYR E 4 125 ? 84.469  49.442  -28.454 1.00 55.31  ? 125 TYR B OH    1 
ATOM   3526 N N     . PRO E 4 126 ? 90.032  48.300  -30.226 1.00 50.83  ? 126 PRO B N     1 
ATOM   3527 C CA    . PRO E 4 126 ? 89.122  48.102  -31.355 1.00 51.77  ? 126 PRO B CA    1 
ATOM   3528 C C     . PRO E 4 126 ? 89.793  47.912  -32.716 1.00 51.84  ? 126 PRO B C     1 
ATOM   3529 O O     . PRO E 4 126 ? 89.128  47.549  -33.688 1.00 53.78  ? 126 PRO B O     1 
ATOM   3530 C CB    . PRO E 4 126 ? 88.296  49.375  -31.325 1.00 51.28  ? 126 PRO B CB    1 
ATOM   3531 C CG    . PRO E 4 126 ? 89.361  50.391  -31.057 1.00 50.31  ? 126 PRO B CG    1 
ATOM   3532 C CD    . PRO E 4 126 ? 90.210  49.738  -29.959 1.00 49.93  ? 126 PRO B CD    1 
ATOM   3533 N N     . ASN E 4 127 ? 91.097  48.152  -32.784 1.00 52.70  ? 127 ASN B N     1 
ATOM   3534 C CA    . ASN E 4 127 ? 91.837  48.058  -34.046 1.00 53.19  ? 127 ASN B CA    1 
ATOM   3535 C C     . ASN E 4 127 ? 92.016  46.657  -34.633 1.00 53.76  ? 127 ASN B C     1 
ATOM   3536 O O     . ASN E 4 127 ? 92.498  46.524  -35.759 1.00 53.53  ? 127 ASN B O     1 
ATOM   3537 C CB    . ASN E 4 127 ? 93.212  48.702  -33.879 1.00 53.29  ? 127 ASN B CB    1 
ATOM   3538 C CG    . ASN E 4 127 ? 93.142  50.042  -33.175 1.00 53.55  ? 127 ASN B CG    1 
ATOM   3539 O OD1   . ASN E 4 127 ? 92.490  50.969  -33.645 1.00 52.76  ? 127 ASN B OD1   1 
ATOM   3540 N ND2   . ASN E 4 127 ? 93.817  50.148  -32.035 1.00 55.77  ? 127 ASN B ND2   1 
ATOM   3541 N N     . LYS E 4 128 ? 91.637  45.624  -33.879 1.00 52.95  ? 128 LYS B N     1 
ATOM   3542 C CA    . LYS E 4 128 ? 91.765  44.233  -34.329 1.00 51.28  ? 128 LYS B CA    1 
ATOM   3543 C C     . LYS E 4 128 ? 93.178  43.867  -34.766 1.00 50.85  ? 128 LYS B C     1 
ATOM   3544 O O     . LYS E 4 128 ? 93.366  43.310  -35.846 1.00 49.45  ? 128 LYS B O     1 
ATOM   3545 C CB    . LYS E 4 128 ? 90.806  43.932  -35.489 1.00 50.67  ? 128 LYS B CB    1 
ATOM   3546 C CG    . LYS E 4 128 ? 89.333  43.876  -35.120 1.00 51.71  ? 128 LYS B CG    1 
ATOM   3547 C CD    . LYS E 4 128 ? 88.528  43.339  -36.295 1.00 53.14  ? 128 LYS B CD    1 
ATOM   3548 C CE    . LYS E 4 128 ? 87.032  43.304  -36.024 1.00 54.49  ? 128 LYS B CE    1 
ATOM   3549 N NZ    . LYS E 4 128 ? 86.299  42.744  -37.209 1.00 53.37  ? 128 LYS B NZ    1 
ATOM   3550 N N     . VAL E 4 129 ? 94.167  44.183  -33.935 1.00 50.06  ? 129 VAL B N     1 
ATOM   3551 C CA    . VAL E 4 129 ? 95.551  43.852  -34.250 1.00 48.87  ? 129 VAL B CA    1 
ATOM   3552 C C     . VAL E 4 129 ? 95.848  42.440  -33.759 1.00 48.86  ? 129 VAL B C     1 
ATOM   3553 O O     . VAL E 4 129 ? 95.605  42.111  -32.593 1.00 49.03  ? 129 VAL B O     1 
ATOM   3554 C CB    . VAL E 4 129 ? 96.554  44.811  -33.565 1.00 49.14  ? 129 VAL B CB    1 
ATOM   3555 C CG1   . VAL E 4 129 ? 97.961  44.485  -34.022 1.00 47.63  ? 129 VAL B CG1   1 
ATOM   3556 C CG2   . VAL E 4 129 ? 96.215  46.250  -33.893 1.00 49.03  ? 129 VAL B CG2   1 
ATOM   3557 N N     . PHE E 4 130 ? 96.380  41.612  -34.651 1.00 48.22  ? 130 PHE B N     1 
ATOM   3558 C CA    . PHE E 4 130 ? 96.708  40.237  -34.312 1.00 46.32  ? 130 PHE B CA    1 
ATOM   3559 C C     . PHE E 4 130 ? 97.748  40.124  -33.208 1.00 46.28  ? 130 PHE B C     1 
ATOM   3560 O O     . PHE E 4 130 ? 98.830  40.694  -33.303 1.00 45.51  ? 130 PHE B O     1 
ATOM   3561 C CB    . PHE E 4 130 ? 97.238  39.511  -35.539 1.00 46.04  ? 130 PHE B CB    1 
ATOM   3562 C CG    . PHE E 4 130 ? 97.618  38.083  -35.273 1.00 45.63  ? 130 PHE B CG    1 
ATOM   3563 C CD1   . PHE E 4 130 ? 96.642  37.120  -35.078 1.00 42.70  ? 130 PHE B CD1   1 
ATOM   3564 C CD2   . PHE E 4 130 ? 98.954  37.703  -35.217 1.00 45.38  ? 130 PHE B CD2   1 
ATOM   3565 C CE1   . PHE E 4 130 ? 96.990  35.806  -34.837 1.00 43.56  ? 130 PHE B CE1   1 
ATOM   3566 C CE2   . PHE E 4 130 ? 99.310  36.381  -34.974 1.00 42.94  ? 130 PHE B CE2   1 
ATOM   3567 C CZ    . PHE E 4 130 ? 98.329  35.437  -34.786 1.00 43.78  ? 130 PHE B CZ    1 
ATOM   3568 N N     . CYS E 4 131 ? 97.420  39.370  -32.165 1.00 45.94  ? 131 CYS B N     1 
ATOM   3569 C CA    . CYS E 4 131 ? 98.345  39.156  -31.063 1.00 45.17  ? 131 CYS B CA    1 
ATOM   3570 C C     . CYS E 4 131 ? 98.918  37.760  -31.138 1.00 43.94  ? 131 CYS B C     1 
ATOM   3571 O O     . CYS E 4 131 ? 100.117 37.561  -30.986 1.00 44.18  ? 131 CYS B O     1 
ATOM   3572 C CB    . CYS E 4 131 ? 97.637  39.361  -29.731 1.00 48.59  ? 131 CYS B CB    1 
ATOM   3573 S SG    . CYS E 4 131 ? 97.086  41.080  -29.543 1.00 51.30  ? 131 CYS B SG    1 
ATOM   3574 N N     . GLY E 4 132 ? 98.056  36.784  -31.387 1.00 43.89  ? 132 GLY B N     1 
ATOM   3575 C CA    . GLY E 4 132 ? 98.534  35.424  -31.485 1.00 41.98  ? 132 GLY B CA    1 
ATOM   3576 C C     . GLY E 4 132 ? 97.435  34.397  -31.350 1.00 41.38  ? 132 GLY B C     1 
ATOM   3577 O O     . GLY E 4 132 ? 96.253  34.730  -31.229 1.00 37.87  ? 132 GLY B O     1 
ATOM   3578 N N     . ILE E 4 133 ? 97.845  33.135  -31.401 1.00 40.83  ? 133 ILE B N     1 
ATOM   3579 C CA    . ILE E 4 133 ? 96.937  32.022  -31.251 1.00 39.52  ? 133 ILE B CA    1 
ATOM   3580 C C     . ILE E 4 133 ? 97.299  31.292  -29.953 1.00 39.68  ? 133 ILE B C     1 
ATOM   3581 O O     . ILE E 4 133 ? 98.473  31.057  -29.670 1.00 37.75  ? 133 ILE B O     1 
ATOM   3582 C CB    . ILE E 4 133 ? 97.037  31.076  -32.462 1.00 38.94  ? 133 ILE B CB    1 
ATOM   3583 C CG1   . ILE E 4 133 ? 96.424  31.771  -33.683 1.00 38.05  ? 133 ILE B CG1   1 
ATOM   3584 C CG2   . ILE E 4 133 ? 96.322  29.734  -32.172 1.00 36.01  ? 133 ILE B CG2   1 
ATOM   3585 C CD1   . ILE E 4 133 ? 96.547  30.984  -34.949 1.00 36.42  ? 133 ILE B CD1   1 
ATOM   3586 N N     . VAL E 4 134 ? 96.273  30.986  -29.160 1.00 38.30  ? 134 VAL B N     1 
ATOM   3587 C CA    . VAL E 4 134 ? 96.428  30.276  -27.903 1.00 38.34  ? 134 VAL B CA    1 
ATOM   3588 C C     . VAL E 4 134 ? 95.447  29.100  -27.923 1.00 39.48  ? 134 VAL B C     1 
ATOM   3589 O O     . VAL E 4 134 ? 94.595  28.998  -28.819 1.00 40.90  ? 134 VAL B O     1 
ATOM   3590 C CB    . VAL E 4 134 ? 96.092  31.190  -26.682 1.00 40.83  ? 134 VAL B CB    1 
ATOM   3591 C CG1   . VAL E 4 134 ? 96.912  32.487  -26.755 1.00 38.61  ? 134 VAL B CG1   1 
ATOM   3592 C CG2   . VAL E 4 134 ? 94.575  31.499  -26.636 1.00 38.69  ? 134 VAL B CG2   1 
ATOM   3593 N N     . ALA E 4 135 ? 95.557  28.220  -26.942 1.00 36.26  ? 135 ALA B N     1 
ATOM   3594 C CA    . ALA E 4 135 ? 94.668  27.081  -26.878 1.00 37.77  ? 135 ALA B CA    1 
ATOM   3595 C C     . ALA E 4 135 ? 94.640  26.524  -25.472 1.00 37.90  ? 135 ALA B C     1 
ATOM   3596 O O     . ALA E 4 135 ? 95.626  26.620  -24.744 1.00 35.60  ? 135 ALA B O     1 
ATOM   3597 C CB    . ALA E 4 135 ? 95.124  26.006  -27.853 1.00 38.70  ? 135 ALA B CB    1 
ATOM   3598 N N     . HIS E 4 136 ? 93.498  25.958  -25.095 1.00 35.93  ? 136 HIS B N     1 
ATOM   3599 C CA    . HIS E 4 136 ? 93.349  25.371  -23.779 1.00 36.67  ? 136 HIS B CA    1 
ATOM   3600 C C     . HIS E 4 136 ? 94.259  24.168  -23.701 1.00 37.86  ? 136 HIS B C     1 
ATOM   3601 O O     . HIS E 4 136 ? 94.483  23.480  -24.696 1.00 38.68  ? 136 HIS B O     1 
ATOM   3602 C CB    . HIS E 4 136 ? 91.899  24.964  -23.526 1.00 34.50  ? 136 HIS B CB    1 
ATOM   3603 C CG    . HIS E 4 136 ? 90.970  26.126  -23.351 1.00 35.08  ? 136 HIS B CG    1 
ATOM   3604 N ND1   . HIS E 4 136 ? 90.957  26.901  -22.211 1.00 35.84  ? 136 HIS B ND1   1 
ATOM   3605 C CD2   . HIS E 4 136 ? 90.027  26.649  -24.172 1.00 32.66  ? 136 HIS B CD2   1 
ATOM   3606 C CE1   . HIS E 4 136 ? 90.043  27.848  -22.334 1.00 33.11  ? 136 HIS B CE1   1 
ATOM   3607 N NE2   . HIS E 4 136 ? 89.464  27.717  -23.516 1.00 33.37  ? 136 HIS B NE2   1 
ATOM   3608 N N     . GLN E 4 137 ? 94.799  23.934  -22.512 1.00 40.27  ? 137 GLN B N     1 
ATOM   3609 C CA    . GLN E 4 137 ? 95.707  22.826  -22.291 1.00 41.56  ? 137 GLN B CA    1 
ATOM   3610 C C     . GLN E 4 137 ? 94.971  21.506  -22.341 1.00 39.70  ? 137 GLN B C     1 
ATOM   3611 O O     . GLN E 4 137 ? 95.473  20.529  -22.890 1.00 41.11  ? 137 GLN B O     1 
ATOM   3612 C CB    . GLN E 4 137 ? 96.400  22.980  -20.935 1.00 45.53  ? 137 GLN B CB    1 
ATOM   3613 C CG    . GLN E 4 137 ? 97.406  21.886  -20.626 1.00 52.68  ? 137 GLN B CG    1 
ATOM   3614 C CD    . GLN E 4 137 ? 98.006  22.028  -19.241 1.00 58.03  ? 137 GLN B CD    1 
ATOM   3615 O OE1   . GLN E 4 137 ? 97.300  21.944  -18.225 1.00 58.26  ? 137 GLN B OE1   1 
ATOM   3616 N NE2   . GLN E 4 137 ? 99.316  22.250  -19.190 1.00 60.11  ? 137 GLN B NE2   1 
ATOM   3617 N N     . ARG E 4 138 ? 93.768  21.489  -21.782 1.00 39.79  ? 138 ARG B N     1 
ATOM   3618 C CA    . ARG E 4 138 ? 92.966  20.275  -21.731 1.00 39.54  ? 138 ARG B CA    1 
ATOM   3619 C C     . ARG E 4 138 ? 91.524  20.532  -22.151 1.00 37.22  ? 138 ARG B C     1 
ATOM   3620 O O     . ARG E 4 138 ? 90.840  21.362  -21.570 1.00 37.16  ? 138 ARG B O     1 
ATOM   3621 C CB    . ARG E 4 138 ? 92.995  19.725  -20.306 1.00 42.68  ? 138 ARG B CB    1 
ATOM   3622 C CG    . ARG E 4 138 ? 92.281  18.409  -20.125 1.00 48.06  ? 138 ARG B CG    1 
ATOM   3623 C CD    . ARG E 4 138 ? 93.236  17.394  -19.526 1.00 52.26  ? 138 ARG B CD    1 
ATOM   3624 N NE    . ARG E 4 138 ? 92.981  17.153  -18.110 1.00 55.11  ? 138 ARG B NE    1 
ATOM   3625 C CZ    . ARG E 4 138 ? 93.821  16.520  -17.295 1.00 54.53  ? 138 ARG B CZ    1 
ATOM   3626 N NH1   . ARG E 4 138 ? 94.986  16.062  -17.742 1.00 52.02  ? 138 ARG B NH1   1 
ATOM   3627 N NH2   . ARG E 4 138 ? 93.482  16.328  -16.029 1.00 56.09  ? 138 ARG B NH2   1 
ATOM   3628 N N     . GLY E 4 139 ? 91.050  19.802  -23.145 1.00 36.14  ? 139 GLY B N     1 
ATOM   3629 C CA    . GLY E 4 139 ? 89.681  20.010  -23.593 1.00 33.99  ? 139 GLY B CA    1 
ATOM   3630 C C     . GLY E 4 139 ? 89.502  21.410  -24.154 1.00 31.95  ? 139 GLY B C     1 
ATOM   3631 O O     . GLY E 4 139 ? 90.439  21.975  -24.714 1.00 32.91  ? 139 GLY B O     1 
ATOM   3632 N N     . ASN E 4 140 ? 88.310  21.970  -23.999 1.00 30.90  ? 140 ASN B N     1 
ATOM   3633 C CA    . ASN E 4 140 ? 88.028  23.310  -24.489 1.00 32.36  ? 140 ASN B CA    1 
ATOM   3634 C C     . ASN E 4 140 ? 87.833  24.265  -23.315 1.00 36.07  ? 140 ASN B C     1 
ATOM   3635 O O     . ASN E 4 140 ? 87.050  25.200  -23.401 1.00 38.65  ? 140 ASN B O     1 
ATOM   3636 C CB    . ASN E 4 140 ? 86.762  23.319  -25.345 1.00 30.29  ? 140 ASN B CB    1 
ATOM   3637 C CG    . ASN E 4 140 ? 86.830  22.351  -26.532 1.00 33.84  ? 140 ASN B CG    1 
ATOM   3638 O OD1   . ASN E 4 140 ? 85.804  22.012  -27.118 1.00 35.81  ? 140 ASN B OD1   1 
ATOM   3639 N ND2   . ASN E 4 140 ? 88.029  21.915  -26.888 1.00 31.70  ? 140 ASN B ND2   1 
ATOM   3640 N N     . GLN E 4 141 ? 88.522  24.026  -22.210 1.00 39.58  ? 141 GLN B N     1 
ATOM   3641 C CA    . GLN E 4 141 ? 88.390  24.924  -21.070 1.00 46.64  ? 141 GLN B CA    1 
ATOM   3642 C C     . GLN E 4 141 ? 89.581  24.777  -20.128 1.00 47.65  ? 141 GLN B C     1 
ATOM   3643 O O     . GLN E 4 141 ? 90.369  23.838  -20.244 1.00 48.69  ? 141 GLN B O     1 
ATOM   3644 C CB    . GLN E 4 141 ? 87.071  24.664  -20.317 1.00 50.35  ? 141 GLN B CB    1 
ATOM   3645 C CG    . GLN E 4 141 ? 87.163  23.615  -19.216 1.00 55.81  ? 141 GLN B CG    1 
ATOM   3646 C CD    . GLN E 4 141 ? 87.678  22.290  -19.727 1.00 60.88  ? 141 GLN B CD    1 
ATOM   3647 O OE1   . GLN E 4 141 ? 86.994  21.594  -20.487 1.00 65.14  ? 141 GLN B OE1   1 
ATOM   3648 N NE2   . GLN E 4 141 ? 88.896  21.931  -19.323 1.00 62.59  ? 141 GLN B NE2   1 
ATOM   3649 N N     . GLY E 4 142 ? 89.709  25.712  -19.193 1.00 48.97  ? 142 GLY B N     1 
ATOM   3650 C CA    . GLY E 4 142 ? 90.825  25.670  -18.270 1.00 48.40  ? 142 GLY B CA    1 
ATOM   3651 C C     . GLY E 4 142 ? 91.820  26.737  -18.669 1.00 48.66  ? 142 GLY B C     1 
ATOM   3652 O O     . GLY E 4 142 ? 91.427  27.791  -19.150 1.00 47.04  ? 142 GLY B O     1 
ATOM   3653 N N     . ASP E 4 143 ? 93.109  26.459  -18.502 1.00 50.74  ? 143 ASP B N     1 
ATOM   3654 C CA    . ASP E 4 143 ? 94.149  27.435  -18.827 1.00 53.03  ? 143 ASP B CA    1 
ATOM   3655 C C     . ASP E 4 143 ? 94.591  27.484  -20.291 1.00 52.54  ? 143 ASP B C     1 
ATOM   3656 O O     . ASP E 4 143 ? 94.933  26.465  -20.892 1.00 51.93  ? 143 ASP B O     1 
ATOM   3657 C CB    . ASP E 4 143 ? 95.365  27.191  -17.938 1.00 54.78  ? 143 ASP B CB    1 
ATOM   3658 C CG    . ASP E 4 143 ? 95.862  25.774  -18.029 1.00 58.13  ? 143 ASP B CG    1 
ATOM   3659 O OD1   . ASP E 4 143 ? 95.055  24.850  -17.769 1.00 59.28  ? 143 ASP B OD1   1 
ATOM   3660 O OD2   . ASP E 4 143 ? 97.052  25.583  -18.363 1.00 60.42  ? 143 ASP B OD2   1 
ATOM   3661 N N     . LEU E 4 144 ? 94.589  28.697  -20.839 1.00 52.40  ? 144 LEU B N     1 
ATOM   3662 C CA    . LEU E 4 144 ? 94.977  28.963  -22.219 1.00 52.77  ? 144 LEU B CA    1 
ATOM   3663 C C     . LEU E 4 144 ? 96.464  29.262  -22.341 1.00 53.85  ? 144 LEU B C     1 
ATOM   3664 O O     . LEU E 4 144 ? 96.970  30.160  -21.671 1.00 54.50  ? 144 LEU B O     1 
ATOM   3665 C CB    . LEU E 4 144 ? 94.227  30.180  -22.744 1.00 52.01  ? 144 LEU B CB    1 
ATOM   3666 C CG    . LEU E 4 144 ? 92.765  30.032  -23.121 1.00 53.14  ? 144 LEU B CG    1 
ATOM   3667 C CD1   . LEU E 4 144 ? 92.201  31.395  -23.451 1.00 53.54  ? 144 LEU B CD1   1 
ATOM   3668 C CD2   . LEU E 4 144 ? 92.646  29.096  -24.308 1.00 51.52  ? 144 LEU B CD2   1 
ATOM   3669 N N     . ARG E 4 145 ? 97.165  28.536  -23.202 1.00 53.16  ? 145 ARG B N     1 
ATOM   3670 C CA    . ARG E 4 145 ? 98.584  28.798  -23.379 1.00 53.79  ? 145 ARG B CA    1 
ATOM   3671 C C     . ARG E 4 145 ? 98.918  29.167  -24.819 1.00 51.71  ? 145 ARG B C     1 
ATOM   3672 O O     . ARG E 4 145 ? 98.254  28.740  -25.770 1.00 51.41  ? 145 ARG B O     1 
ATOM   3673 C CB    . ARG E 4 145 ? 99.424  27.598  -22.915 1.00 57.89  ? 145 ARG B CB    1 
ATOM   3674 C CG    . ARG E 4 145 ? 99.122  26.295  -23.612 1.00 63.30  ? 145 ARG B CG    1 
ATOM   3675 C CD    . ARG E 4 145 ? 99.869  25.139  -22.960 1.00 66.51  ? 145 ARG B CD    1 
ATOM   3676 N NE    . ARG E 4 145 ? 99.399  23.843  -23.454 1.00 70.43  ? 145 ARG B NE    1 
ATOM   3677 C CZ    . ARG E 4 145 ? 99.648  22.679  -22.860 1.00 71.75  ? 145 ARG B CZ    1 
ATOM   3678 N NH1   . ARG E 4 145 ? 100.367 22.640  -21.743 1.00 73.04  ? 145 ARG B NH1   1 
ATOM   3679 N NH2   . ARG E 4 145 ? 99.167  21.552  -23.372 1.00 72.08  ? 145 ARG B NH2   1 
ATOM   3680 N N     . LEU E 4 146 ? 99.949  29.985  -24.967 1.00 48.03  ? 146 LEU B N     1 
ATOM   3681 C CA    . LEU E 4 146 ? 100.376 30.432  -26.275 1.00 45.74  ? 146 LEU B CA    1 
ATOM   3682 C C     . LEU E 4 146 ? 100.923 29.269  -27.102 1.00 45.89  ? 146 LEU B C     1 
ATOM   3683 O O     . LEU E 4 146 ? 101.686 28.424  -26.616 1.00 41.17  ? 146 LEU B O     1 
ATOM   3684 C CB    . LEU E 4 146 ? 101.443 31.520  -26.130 1.00 44.90  ? 146 LEU B CB    1 
ATOM   3685 C CG    . LEU E 4 146 ? 101.685 32.435  -27.332 1.00 44.02  ? 146 LEU B CG    1 
ATOM   3686 C CD1   . LEU E 4 146 ? 100.439 33.259  -27.611 1.00 44.50  ? 146 LEU B CD1   1 
ATOM   3687 C CD2   . LEU E 4 146 ? 102.854 33.354  -27.052 1.00 44.29  ? 146 LEU B CD2   1 
ATOM   3688 N N     . CYS E 4 147 ? 100.501 29.222  -28.360 1.00 45.02  ? 147 CYS B N     1 
ATOM   3689 C CA    . CYS E 4 147 ? 100.963 28.190  -29.273 1.00 44.84  ? 147 CYS B CA    1 
ATOM   3690 C C     . CYS E 4 147 ? 102.275 28.705  -29.866 1.00 44.71  ? 147 CYS B C     1 
ATOM   3691 O O     . CYS E 4 147 ? 102.574 29.897  -29.785 1.00 44.44  ? 147 CYS B O     1 
ATOM   3692 C CB    . CYS E 4 147 ? 99.915  27.970  -30.366 1.00 42.54  ? 147 CYS B CB    1 
ATOM   3693 S SG    . CYS E 4 147 ? 98.250  27.613  -29.714 1.00 39.74  ? 147 CYS B SG    1 
ATOM   3694 N N     . SER E 4 148 ? 103.066 27.817  -30.447 1.00 45.73  ? 148 SER B N     1 
ATOM   3695 C CA    . SER E 4 148 ? 104.334 28.227  -31.038 1.00 48.28  ? 148 SER B CA    1 
ATOM   3696 C C     . SER E 4 148 ? 104.194 28.343  -32.550 1.00 49.85  ? 148 SER B C     1 
ATOM   3697 O O     . SER E 4 148 ? 103.230 27.841  -33.135 1.00 50.89  ? 148 SER B O     1 
ATOM   3698 C CB    . SER E 4 148 ? 105.434 27.218  -30.698 1.00 46.30  ? 148 SER B CB    1 
ATOM   3699 O OG    . SER E 4 148 ? 105.167 25.958  -31.282 1.00 47.29  ? 148 SER B OG    1 
ATOM   3700 N N     . HIS E 4 149 ? 105.158 29.005  -33.180 1.00 51.56  ? 149 HIS B N     1 
ATOM   3701 C CA    . HIS E 4 149 ? 105.137 29.177  -34.629 1.00 53.75  ? 149 HIS B CA    1 
ATOM   3702 C C     . HIS E 4 149 ? 106.534 29.486  -35.170 1.00 53.51  ? 149 HIS B C     1 
ATOM   3703 O O     . HIS E 4 149 ? 107.021 28.709  -36.022 1.00 53.80  ? 149 HIS B O     1 
ATOM   3704 C CB    . HIS E 4 149 ? 104.178 30.307  -35.017 1.00 55.42  ? 149 HIS B CB    1 
ATOM   3705 C CG    . HIS E 4 149 ? 104.593 31.653  -34.508 1.00 59.15  ? 149 HIS B CG    1 
ATOM   3706 N ND1   . HIS E 4 149 ? 104.508 32.007  -33.178 1.00 60.16  ? 149 HIS B ND1   1 
ATOM   3707 C CD2   . HIS E 4 149 ? 105.133 32.719  -35.147 1.00 59.60  ? 149 HIS B CD2   1 
ATOM   3708 C CE1   . HIS E 4 149 ? 104.977 33.232  -33.019 1.00 59.40  ? 149 HIS B CE1   1 
ATOM   3709 N NE2   . HIS E 4 149 ? 105.363 33.686  -34.199 1.00 60.49  ? 149 HIS B NE2   1 
ATOM   3710 O OXT   . HIS E 4 149 ? 107.118 30.505  -34.739 1.00 52.19  ? 149 HIS B OXT   1 
HETATM 3711 K K     . K   F 5 .   ? 30.914  7.559   -2.348  1.00 42.26  ? 202 K   C K     1 
HETATM 3712 K K     . K   G 5 .   ? 35.168  7.497   -6.804  1.00 44.96  ? 203 K   F K     1 
HETATM 3713 K K     . K   H 5 .   ? 64.524  27.112  -17.486 1.00 50.56  ? 201 K   D K     1 
HETATM 3714 K K     . K   I 5 .   ? 58.845  28.342  -15.554 1.00 53.62  ? 204 K   D K     1 
HETATM 3715 K K     . K   J 5 .   ? 80.012  40.271  -20.368 1.00 65.98  ? 205 K   D K     1 
HETATM 3716 O O     . HOH K 6 .   ? 13.880  -1.370  -1.743  1.00 36.91  ? 203 HOH C O     1 
HETATM 3717 O O     . HOH K 6 .   ? 26.108  -3.154  3.396   1.00 46.31  ? 204 HOH C O     1 
HETATM 3718 O O     . HOH K 6 .   ? 45.183  18.181  -9.022  1.00 38.58  ? 205 HOH C O     1 
HETATM 3719 O O     . HOH K 6 .   ? 29.896  20.193  2.603   1.00 39.15  ? 206 HOH C O     1 
HETATM 3720 O O     . HOH K 6 .   ? 31.254  10.411  -2.571  1.00 25.53  ? 207 HOH C O     1 
HETATM 3721 O O     . HOH K 6 .   ? 46.362  15.461  -11.159 1.00 49.15  ? 208 HOH C O     1 
HETATM 3722 O O     . HOH K 6 .   ? 24.064  17.828  -2.206  1.00 51.63  ? 209 HOH C O     1 
HETATM 3723 O O     . HOH K 6 .   ? 27.582  9.788   -1.894  1.00 38.02  ? 210 HOH C O     1 
HETATM 3724 O O     . HOH K 6 .   ? 28.738  9.306   0.394   1.00 32.82  ? 211 HOH C O     1 
HETATM 3725 O O     . HOH K 6 .   ? 44.439  14.165  -7.107  1.00 37.05  ? 212 HOH C O     1 
HETATM 3726 O O     . HOH K 6 .   ? 33.097  12.613  1.358   1.00 36.00  ? 213 HOH C O     1 
HETATM 3727 O O     . HOH K 6 .   ? 27.332  -6.763  -2.810  1.00 42.17  ? 214 HOH C O     1 
HETATM 3728 O O     . HOH K 6 .   ? 42.891  13.332  -3.342  1.00 36.55  ? 215 HOH C O     1 
HETATM 3729 O O     . HOH K 6 .   ? 24.636  8.719   -3.019  1.00 49.47  ? 216 HOH C O     1 
HETATM 3730 O O     . HOH K 6 .   ? 24.280  -5.729  4.301   1.00 49.33  ? 217 HOH C O     1 
HETATM 3731 O O     . HOH K 6 .   ? 41.586  15.083  -5.504  1.00 43.26  ? 218 HOH C O     1 
HETATM 3732 O O     . HOH K 6 .   ? 19.983  -4.443  12.060  1.00 51.43  ? 219 HOH C O     1 
HETATM 3733 O O     . HOH K 6 .   ? 14.870  -2.403  0.488   1.00 53.83  ? 220 HOH C O     1 
HETATM 3734 O O     . HOH K 6 .   ? 14.152  1.549   9.917   1.00 41.28  ? 221 HOH C O     1 
HETATM 3735 O O     . HOH K 6 .   ? 42.301  12.010  6.549   1.00 52.06  ? 222 HOH C O     1 
HETATM 3736 O O     . HOH L 6 .   ? 37.965  11.486  -13.593 1.00 49.82  ? 204 HOH F O     1 
HETATM 3737 O O     . HOH L 6 .   ? 41.004  18.322  -7.836  1.00 43.42  ? 205 HOH F O     1 
HETATM 3738 O O     . HOH L 6 .   ? 43.878  18.811  -6.874  1.00 40.43  ? 206 HOH F O     1 
HETATM 3739 O O     . HOH L 6 .   ? 27.186  6.874   3.231   1.00 38.78  ? 207 HOH F O     1 
HETATM 3740 O O     . HOH L 6 .   ? 31.174  6.662   -5.649  1.00 24.77  ? 208 HOH F O     1 
HETATM 3741 O O     . HOH L 6 .   ? 29.773  5.029   -2.938  1.00 38.22  ? 209 HOH F O     1 
HETATM 3742 O O     . HOH L 6 .   ? 36.229  9.332   -8.670  1.00 45.27  ? 210 HOH F O     1 
HETATM 3743 O O     . HOH L 6 .   ? 33.066  7.542   0.527   1.00 56.96  ? 211 HOH F O     1 
HETATM 3744 O O     . HOH L 6 .   ? 39.509  15.824  -7.158  1.00 35.91  ? 212 HOH F O     1 
HETATM 3745 O O     . HOH L 6 .   ? 43.013  21.603  -5.965  1.00 37.03  ? 213 HOH F O     1 
HETATM 3746 O O     . HOH L 6 .   ? 27.981  -3.142  -7.506  1.00 39.49  ? 214 HOH F O     1 
HETATM 3747 O O     . HOH L 6 .   ? 22.367  6.249   1.185   1.00 34.68  ? 215 HOH F O     1 
HETATM 3748 O O     . HOH L 6 .   ? 15.927  2.612   2.823   1.00 38.67  ? 216 HOH F O     1 
HETATM 3749 O O     . HOH L 6 .   ? 33.975  6.783   -17.369 1.00 41.21  ? 217 HOH F O     1 
HETATM 3750 O O     . HOH L 6 .   ? 33.536  6.662   -1.590  1.00 30.46  ? 218 HOH F O     1 
HETATM 3751 O O     . HOH L 6 .   ? 33.323  7.900   -4.208  1.00 43.22  ? 219 HOH F O     1 
HETATM 3752 O O     . HOH L 6 .   ? 14.118  4.062   5.234   1.00 48.67  ? 220 HOH F O     1 
HETATM 3753 O O     . HOH L 6 .   ? 35.083  9.913   -5.695  1.00 45.69  ? 221 HOH F O     1 
HETATM 3754 O O     . HOH L 6 .   ? 43.572  20.924  -8.874  1.00 60.96  ? 222 HOH F O     1 
HETATM 3755 O O     . HOH L 6 .   ? 29.063  10.242  -13.426 1.00 41.02  ? 223 HOH F O     1 
HETATM 3756 O O     . HOH L 6 .   ? 37.420  13.158  -8.346  1.00 34.60  ? 224 HOH F O     1 
HETATM 3757 O O     . HOH M 6 .   ? 60.422  29.743  -13.601 1.00 34.76  ? 206 HOH D O     1 
HETATM 3758 O O     . HOH M 6 .   ? 78.284  37.619  -23.091 1.00 51.90  ? 207 HOH D O     1 
HETATM 3759 O O     . HOH M 6 .   ? 75.030  32.373  -12.028 1.00 39.07  ? 208 HOH D O     1 
HETATM 3760 O O     . HOH M 6 .   ? 65.439  15.537  -23.555 1.00 39.18  ? 209 HOH D O     1 
HETATM 3761 O O     . HOH M 6 .   ? 62.392  23.130  -16.652 1.00 36.87  ? 210 HOH D O     1 
HETATM 3762 O O     . HOH M 6 .   ? 62.036  35.145  -6.765  1.00 46.68  ? 211 HOH D O     1 
HETATM 3763 O O     . HOH M 6 .   ? 60.003  17.164  -2.938  1.00 33.65  ? 212 HOH D O     1 
HETATM 3764 O O     . HOH M 6 .   ? 59.467  34.015  -21.624 1.00 38.01  ? 213 HOH D O     1 
HETATM 3765 O O     . HOH M 6 .   ? 54.654  19.848  -13.353 1.00 47.34  ? 214 HOH D O     1 
HETATM 3766 O O     . HOH M 6 .   ? 54.609  29.857  -10.764 1.00 48.40  ? 215 HOH D O     1 
HETATM 3767 O O     . HOH M 6 .   ? 55.026  6.544   -6.611  1.00 55.68  ? 216 HOH D O     1 
HETATM 3768 O O     . HOH M 6 .   ? 81.763  31.665  -23.082 1.00 48.16  ? 217 HOH D O     1 
HETATM 3769 O O     . HOH M 6 .   ? 54.275  21.117  -15.810 1.00 34.36  ? 218 HOH D O     1 
HETATM 3770 O O     . HOH M 6 .   ? 71.579  31.946  -23.550 1.00 48.31  ? 219 HOH D O     1 
HETATM 3771 O O     . HOH M 6 .   ? 55.591  24.581  -2.048  1.00 39.76  ? 220 HOH D O     1 
HETATM 3772 O O     . HOH M 6 .   ? 64.803  38.429  -17.234 1.00 51.43  ? 221 HOH D O     1 
HETATM 3773 O O     . HOH M 6 .   ? 57.578  11.803  -9.841  1.00 47.75  ? 222 HOH D O     1 
HETATM 3774 O O     . HOH M 6 .   ? 84.209  38.263  -21.383 1.00 41.51  ? 223 HOH D O     1 
HETATM 3775 O O     . HOH M 6 .   ? 57.135  8.826   -5.918  1.00 34.26  ? 224 HOH D O     1 
HETATM 3776 O O     . HOH M 6 .   ? 63.526  20.616  -8.282  1.00 52.76  ? 225 HOH D O     1 
HETATM 3777 O O     . HOH M 6 .   ? 48.545  14.426  -13.284 1.00 45.59  ? 226 HOH D O     1 
HETATM 3778 O O     . HOH M 6 .   ? 59.964  11.337  -13.549 1.00 45.53  ? 227 HOH D O     1 
HETATM 3779 O O     . HOH M 6 .   ? 51.178  20.735  -12.648 1.00 50.20  ? 228 HOH D O     1 
HETATM 3780 O O     . HOH M 6 .   ? 61.118  36.191  -19.500 1.00 48.37  ? 229 HOH D O     1 
HETATM 3781 O O     . HOH M 6 .   ? 54.157  14.569  -3.699  1.00 47.03  ? 230 HOH D O     1 
HETATM 3782 O O     . HOH M 6 .   ? 76.702  42.923  -16.833 1.00 46.18  ? 231 HOH D O     1 
HETATM 3783 O O     . HOH M 6 .   ? 65.010  23.628  -20.962 1.00 49.44  ? 232 HOH D O     1 
HETATM 3784 O O     . HOH M 6 .   ? 79.535  40.988  -17.852 1.00 61.65  ? 233 HOH D O     1 
HETATM 3785 O O     . HOH M 6 .   ? 79.388  37.240  -20.889 1.00 33.44  ? 234 HOH D O     1 
HETATM 3786 O O     . HOH M 6 .   ? 63.349  24.833  -18.543 1.00 41.80  ? 235 HOH D O     1 
HETATM 3787 O O     . HOH M 6 .   ? 64.085  14.343  -8.745  1.00 59.08  ? 236 HOH D O     1 
HETATM 3788 O O     . HOH M 6 .   ? 63.655  27.129  -14.884 1.00 48.76  ? 237 HOH D O     1 
HETATM 3789 O O     . HOH M 6 .   ? 55.652  13.493  -6.834  1.00 33.68  ? 238 HOH D O     1 
HETATM 3790 O O     . HOH M 6 .   ? 85.152  29.011  -12.935 1.00 49.29  ? 239 HOH D O     1 
HETATM 3791 O O     . HOH M 6 .   ? 76.967  33.942  -11.159 1.00 46.21  ? 240 HOH D O     1 
HETATM 3792 O O     . HOH M 6 .   ? 66.018  29.259  -16.610 1.00 38.44  ? 241 HOH D O     1 
HETATM 3793 O O     . HOH M 6 .   ? 52.807  21.673  -18.217 1.00 41.28  ? 242 HOH D O     1 
HETATM 3794 O O     . HOH M 6 .   ? 70.306  34.155  -30.446 1.00 53.82  ? 243 HOH D O     1 
HETATM 3795 O O     . HOH M 6 .   ? 90.738  30.153  -16.347 1.00 49.47  ? 244 HOH D O     1 
HETATM 3796 O O     . HOH N 6 .   ? -5.172  11.145  22.275  1.00 30.05  ? 150 HOH A O     1 
HETATM 3797 O O     . HOH N 6 .   ? 5.464   9.259   9.926   1.00 32.33  ? 151 HOH A O     1 
HETATM 3798 O O     . HOH N 6 .   ? 1.648   15.638  10.019  1.00 36.74  ? 152 HOH A O     1 
HETATM 3799 O O     . HOH N 6 .   ? 0.105   0.087   -1.712  1.00 36.25  ? 153 HOH A O     1 
HETATM 3800 O O     . HOH N 6 .   ? -4.474  14.810  13.374  1.00 35.58  ? 154 HOH A O     1 
HETATM 3801 O O     . HOH N 6 .   ? 3.922   11.141  11.804  1.00 35.71  ? 155 HOH A O     1 
HETATM 3802 O O     . HOH N 6 .   ? 7.829   13.980  5.592   1.00 24.31  ? 156 HOH A O     1 
HETATM 3803 O O     . HOH N 6 .   ? -10.848 8.729   10.261  1.00 36.03  ? 157 HOH A O     1 
HETATM 3804 O O     . HOH N 6 .   ? -0.306  -12.837 5.385   1.00 41.23  ? 158 HOH A O     1 
HETATM 3805 O O     . HOH N 6 .   ? 5.392   13.176  12.770  1.00 31.69  ? 159 HOH A O     1 
HETATM 3806 O O     . HOH N 6 .   ? 1.140   8.984   3.415   1.00 32.45  ? 160 HOH A O     1 
HETATM 3807 O O     . HOH N 6 .   ? -2.683  9.967   8.530   1.00 37.37  ? 161 HOH A O     1 
HETATM 3808 O O     . HOH N 6 .   ? 12.990  3.614   24.273  1.00 57.91  ? 162 HOH A O     1 
HETATM 3809 O O     . HOH N 6 .   ? -5.481  -8.899  0.955   1.00 35.93  ? 163 HOH A O     1 
HETATM 3810 O O     . HOH N 6 .   ? -0.313  8.151   -0.142  1.00 50.73  ? 164 HOH A O     1 
HETATM 3811 O O     . HOH N 6 .   ? 7.125   13.682  14.600  1.00 43.48  ? 165 HOH A O     1 
HETATM 3812 O O     . HOH N 6 .   ? 14.934  10.824  29.795  1.00 45.76  ? 166 HOH A O     1 
HETATM 3813 O O     . HOH N 6 .   ? 6.538   10.626  -5.031  1.00 43.70  ? 167 HOH A O     1 
HETATM 3814 O O     . HOH N 6 .   ? -5.455  -3.449  14.387  1.00 46.56  ? 168 HOH A O     1 
HETATM 3815 O O     . HOH N 6 .   ? 7.080   13.519  10.708  1.00 47.50  ? 169 HOH A O     1 
HETATM 3816 O O     . HOH N 6 .   ? 1.045   2.829   21.839  1.00 46.10  ? 170 HOH A O     1 
HETATM 3817 O O     . HOH N 6 .   ? -3.300  2.775   -7.230  1.00 58.15  ? 171 HOH A O     1 
HETATM 3818 O O     . HOH N 6 .   ? 15.379  11.634  4.291   1.00 35.42  ? 172 HOH A O     1 
HETATM 3819 O O     . HOH N 6 .   ? 5.283   3.910   19.280  1.00 48.42  ? 173 HOH A O     1 
HETATM 3820 O O     . HOH N 6 .   ? -10.420 6.158   3.539   1.00 47.07  ? 174 HOH A O     1 
HETATM 3821 O O     . HOH N 6 .   ? 11.038  -13.230 1.150   1.00 47.76  ? 175 HOH A O     1 
HETATM 3822 O O     . HOH N 6 .   ? 10.459  -3.371  22.126  1.00 55.95  ? 176 HOH A O     1 
HETATM 3823 O O     . HOH N 6 .   ? 7.062   -19.435 0.502   1.00 49.29  ? 177 HOH A O     1 
HETATM 3824 O O     . HOH N 6 .   ? 10.789  10.834  15.438  1.00 45.31  ? 178 HOH A O     1 
HETATM 3825 O O     . HOH N 6 .   ? -4.598  10.592  0.832   1.00 33.88  ? 179 HOH A O     1 
HETATM 3826 O O     . HOH N 6 .   ? -6.717  14.192  14.444  1.00 42.59  ? 180 HOH A O     1 
HETATM 3827 O O     . HOH N 6 .   ? -0.266  10.848  6.153   1.00 29.48  ? 181 HOH A O     1 
HETATM 3828 O O     . HOH N 6 .   ? 5.443   15.323  0.711   1.00 44.63  ? 182 HOH A O     1 
HETATM 3829 O O     . HOH N 6 .   ? 2.679   -3.313  19.704  1.00 38.07  ? 183 HOH A O     1 
HETATM 3830 O O     . HOH N 6 .   ? 0.012   -11.439 14.854  1.00 48.39  ? 184 HOH A O     1 
HETATM 3831 O O     . HOH N 6 .   ? -6.117  12.706  -0.651  1.00 42.18  ? 185 HOH A O     1 
HETATM 3832 O O     . HOH N 6 .   ? -5.271  12.336  -3.627  1.00 44.85  ? 186 HOH A O     1 
HETATM 3833 O O     . HOH N 6 .   ? -0.368  -0.174  -7.985  1.00 51.01  ? 187 HOH A O     1 
HETATM 3834 O O     . HOH N 6 .   ? 20.615  6.511   -0.703  1.00 44.81  ? 188 HOH A O     1 
HETATM 3835 O O     . HOH N 6 .   ? 16.564  12.425  -7.396  1.00 49.56  ? 189 HOH A O     1 
HETATM 3836 O O     . HOH N 6 .   ? -9.998  -1.589  3.932   1.00 50.15  ? 190 HOH A O     1 
HETATM 3837 O O     . HOH N 6 .   ? 13.244  -0.826  11.886  1.00 48.57  ? 191 HOH A O     1 
HETATM 3838 O O     . HOH N 6 .   ? 21.339  17.563  22.090  1.00 45.62  ? 192 HOH A O     1 
HETATM 3839 O O     . HOH N 6 .   ? 0.553   -12.811 12.592  1.00 39.09  ? 193 HOH A O     1 
HETATM 3840 O O     . HOH N 6 .   ? 9.767   1.604   9.588   1.00 33.97  ? 194 HOH A O     1 
HETATM 3841 O O     . HOH N 6 .   ? -4.706  -12.169 4.260   1.00 48.03  ? 195 HOH A O     1 
HETATM 3842 O O     . HOH N 6 .   ? -4.258  11.925  9.727   1.00 35.35  ? 196 HOH A O     1 
HETATM 3843 O O     . HOH N 6 .   ? -9.915  7.145   -0.001  1.00 51.31  ? 197 HOH A O     1 
HETATM 3844 O O     . HOH N 6 .   ? 14.906  -12.001 17.361  1.00 50.74  ? 198 HOH A O     1 
HETATM 3845 O O     . HOH N 6 .   ? 22.428  17.343  30.233  1.00 54.33  ? 199 HOH A O     1 
HETATM 3846 O O     . HOH N 6 .   ? 5.016   19.874  20.892  1.00 48.57  ? 200 HOH A O     1 
HETATM 3847 O O     . HOH N 6 .   ? 3.020   15.604  19.368  1.00 40.53  ? 201 HOH A O     1 
HETATM 3848 O O     . HOH N 6 .   ? 16.250  -8.848  16.988  1.00 45.55  ? 202 HOH A O     1 
HETATM 3849 O O     . HOH N 6 .   ? 9.509   -0.509  21.244  1.00 58.60  ? 203 HOH A O     1 
HETATM 3850 O O     . HOH O 6 .   ? 90.017  21.542  -33.315 1.00 33.34  ? 150 HOH B O     1 
HETATM 3851 O O     . HOH O 6 .   ? 99.528  24.860  -26.866 1.00 54.97  ? 151 HOH B O     1 
HETATM 3852 O O     . HOH O 6 .   ? 93.949  25.101  -43.405 1.00 47.55  ? 152 HOH B O     1 
HETATM 3853 O O     . HOH O 6 .   ? 89.350  19.558  -27.249 1.00 36.65  ? 153 HOH B O     1 
HETATM 3854 O O     . HOH O 6 .   ? 99.510  32.046  -42.672 1.00 44.09  ? 154 HOH B O     1 
HETATM 3855 O O     . HOH O 6 .   ? 95.699  23.843  -40.047 1.00 49.42  ? 155 HOH B O     1 
HETATM 3856 O O     . HOH O 6 .   ? 100.299 19.671  -22.080 1.00 45.09  ? 156 HOH B O     1 
HETATM 3857 O O     . HOH O 6 .   ? 72.348  36.828  -32.434 1.00 45.51  ? 157 HOH B O     1 
HETATM 3858 O O     . HOH O 6 .   ? 86.967  42.491  -14.246 1.00 51.04  ? 158 HOH B O     1 
HETATM 3859 O O     . HOH O 6 .   ? 104.382 21.802  -36.196 1.00 44.37  ? 159 HOH B O     1 
HETATM 3860 O O     . HOH O 6 .   ? 93.656  21.736  -41.716 1.00 43.23  ? 160 HOH B O     1 
HETATM 3861 O O     . HOH O 6 .   ? 94.878  46.957  -27.375 1.00 46.95  ? 161 HOH B O     1 
HETATM 3862 O O     . HOH O 6 .   ? 89.186  25.712  -31.600 1.00 23.17  ? 162 HOH B O     1 
HETATM 3863 O O     . HOH O 6 .   ? 86.663  31.239  -36.716 1.00 35.88  ? 163 HOH B O     1 
HETATM 3864 O O     . HOH O 6 .   ? 90.711  23.980  -33.229 1.00 33.75  ? 164 HOH B O     1 
HETATM 3865 O O     . HOH O 6 .   ? 81.229  45.250  -36.082 1.00 44.62  ? 165 HOH B O     1 
HETATM 3866 O O     . HOH O 6 .   ? 89.417  22.437  -38.730 1.00 32.14  ? 166 HOH B O     1 
HETATM 3867 O O     . HOH O 6 .   ? 93.987  27.771  -40.133 1.00 40.00  ? 167 HOH B O     1 
HETATM 3868 O O     . HOH O 6 .   ? 89.236  28.739  -38.156 1.00 43.96  ? 168 HOH B O     1 
HETATM 3869 O O     . HOH O 6 .   ? 92.777  42.393  -22.565 1.00 39.55  ? 169 HOH B O     1 
HETATM 3870 O O     . HOH O 6 .   ? 100.495 35.275  -6.008  1.00 46.34  ? 170 HOH B O     1 
HETATM 3871 O O     . HOH O 6 .   ? 87.350  21.494  -32.827 1.00 35.79  ? 171 HOH B O     1 
HETATM 3872 O O     . HOH O 6 .   ? 97.428  42.095  -22.210 1.00 35.16  ? 172 HOH B O     1 
HETATM 3873 O O     . HOH O 6 .   ? 85.563  21.937  -34.788 1.00 33.47  ? 173 HOH B O     1 
HETATM 3874 O O     . HOH O 6 .   ? 89.538  10.798  -16.603 1.00 43.17  ? 174 HOH B O     1 
HETATM 3875 O O     . HOH O 6 .   ? 102.831 29.096  -42.893 1.00 44.50  ? 175 HOH B O     1 
HETATM 3876 O O     . HOH O 6 .   ? 87.870  33.435  -42.845 1.00 48.41  ? 176 HOH B O     1 
HETATM 3877 O O     . HOH O 6 .   ? 83.294  24.130  -34.844 1.00 38.99  ? 177 HOH B O     1 
HETATM 3878 O O     . HOH O 6 .   ? 88.303  30.048  -24.226 1.00 39.27  ? 178 HOH B O     1 
HETATM 3879 O O     . HOH O 6 .   ? 86.011  40.933  -34.031 1.00 46.07  ? 179 HOH B O     1 
HETATM 3880 O O     . HOH O 6 .   ? 84.876  15.214  -23.441 1.00 44.23  ? 180 HOH B O     1 
HETATM 3881 O O     . HOH O 6 .   ? 94.903  30.551  -14.912 1.00 41.88  ? 181 HOH B O     1 
HETATM 3882 O O     . HOH O 6 .   ? 88.841  28.501  -44.171 1.00 39.13  ? 182 HOH B O     1 
HETATM 3883 O O     . HOH O 6 .   ? 95.163  42.757  -22.247 1.00 42.18  ? 183 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   G   1   0   0   G   G   C . n 
A 1 2   C   2   1   1   C   C   C . n 
A 1 3   G   3   2   2   G   G   C . n 
A 1 4   C   4   3   3   C   C   C . n 
A 1 5   U   5   4   4   U   U   C . n 
A 1 6   C   6   5   5   C   C   C . n 
A 1 7   C   7   6   6   C   C   C . n 
A 1 8   U   8   7   7   U   U   C . n 
A 1 9   C   9   8   8   C   C   C . n 
A 1 10  A   10  9   9   A   A   C . n 
A 1 11  G   11  10  10  G   G   C . n 
A 1 12  U   12  11  11  U   U   C . n 
A 1 13  A   13  12  12  A   A   C . n 
A 1 14  C   14  13  13  C   C   C . n 
A 1 15  G   15  14  14  G   G   C . n 
A 1 16  A   16  15  15  A   A   C . n 
A 1 17  G   17  16  16  G   G   C . n 
A 1 18  A23 18  17  17  A23 A   C . n 
B 2 1   G   1   18  18  G   G   F . n 
B 2 2   G   2   19  19  G   G   F . n 
B 2 3   A   3   20  20  A   A   F . n 
B 2 4   A   4   21  21  A   A   F . n 
B 2 5   C   5   22  22  C   C   F . n 
B 2 6   C   6   23  23  C   C   F . n 
B 2 7   G   7   24  24  G   G   F . n 
B 2 8   G   8   25  25  G   G   F . n 
B 2 9   A   9   26  26  A   A   F . n 
B 2 10  G   10  27  27  G   G   F . n 
B 2 11  C   11  28  28  C   C   F . n 
B 2 12  G   12  29  29  G   G   F . n 
B 2 13  C   13  30  30  C   C   F . n 
C 3 1   G   1   0   0   G   G   D . n 
C 3 2   C   2   1   1   C   C   D . n 
C 3 3   G   3   2   2   G   G   D . n 
C 3 4   C   4   3   3   C   C   D . n 
C 3 5   U   5   4   4   U   U   D . n 
C 3 6   C   6   5   5   C   C   D . n 
C 3 7   C   7   6   6   C   C   D . n 
C 3 8   U   8   7   7   U   U   D . n 
C 3 9   C   9   8   8   C   C   D . n 
C 3 10  A   10  9   9   A   A   D . n 
C 3 11  G   11  10  10  G   G   D . n 
C 3 12  U   12  11  11  U   U   D . n 
C 3 13  A   13  12  12  A   A   D . n 
C 3 14  C   14  13  13  C   C   D . n 
C 3 15  G   15  14  14  G   G   D . n 
C 3 16  A   16  15  15  A   A   D . n 
C 3 17  G   17  16  16  G   G   D . n 
C 3 18  A   18  17  17  A   A   D . n 
C 3 19  G   19  18  18  G   G   D . n 
C 3 20  G   20  19  19  G   G   D . n 
C 3 21  A   21  20  20  A   A   D . n 
C 3 22  A   22  21  21  A   A   D . n 
C 3 23  C   23  22  22  C   C   D . n 
C 3 24  C   24  23  23  C   C   D . n 
C 3 25  G   25  24  24  G   G   D . n 
C 3 26  G   26  25  25  G   G   D . n 
C 3 27  A   27  26  26  A   A   D . n 
C 3 28  G   28  27  27  G   G   D . n 
C 3 29  C   29  28  28  C   C   D . n 
C 3 30  G   30  29  29  G   G   D . n 
C 3 31  C   31  30  30  C   C   D . n 
D 4 1   ALA 1   1   1   ALA ALA A . n 
D 4 2   THR 2   2   2   THR THR A . n 
D 4 3   TRP 3   3   3   TRP TRP A . n 
D 4 4   THR 4   4   4   THR THR A . n 
D 4 5   CYS 5   5   5   CYS CYS A . n 
D 4 6   ILE 6   6   6   ILE ILE A . n 
D 4 7   ASN 7   7   7   ASN ASN A . n 
D 4 8   GLN 8   8   8   GLN GLN A . n 
D 4 9   GLN 9   9   9   GLN GLN A . n 
D 4 10  LEU 10  10  10  LEU LEU A . n 
D 4 11  ASN 11  11  11  ASN ASN A . n 
D 4 12  PRO 12  12  12  PRO PRO A . n 
D 4 13  LYS 13  13  13  LYS LYS A . n 
D 4 14  THR 14  14  14  THR THR A . n 
D 4 15  ASN 15  15  15  ASN ASN A . n 
D 4 16  LYS 16  16  16  LYS LYS A . n 
D 4 17  TRP 17  17  17  TRP TRP A . n 
D 4 18  GLU 18  18  18  GLU GLU A . n 
D 4 19  ASP 19  19  19  ASP ASP A . n 
D 4 20  LYS 20  20  20  LYS LYS A . n 
D 4 21  ARG 21  21  21  ARG ARG A . n 
D 4 22  LEU 22  22  22  LEU LEU A . n 
D 4 23  LEU 23  23  23  LEU LEU A . n 
D 4 24  TYR 24  24  24  TYR TYR A . n 
D 4 25  SER 25  25  25  SER SER A . n 
D 4 26  GLN 26  26  26  GLN GLN A . n 
D 4 27  ALA 27  27  27  ALA ALA A . n 
D 4 28  LYS 28  28  28  LYS LYS A . n 
D 4 29  ALA 29  29  29  ALA ALA A . n 
D 4 30  GLU 30  30  30  GLU GLU A . n 
D 4 31  SER 31  31  31  SER SER A . n 
D 4 32  ASN 32  32  32  ASN ASN A . n 
D 4 33  SER 33  33  33  SER SER A . n 
D 4 34  HIS 34  34  34  HIS HIS A . n 
D 4 35  HIS 35  35  35  HIS HIS A . n 
D 4 36  ALA 36  36  36  ALA ALA A . n 
D 4 37  PRO 37  37  37  PRO PRO A . n 
D 4 38  LEU 38  38  38  LEU LEU A . n 
D 4 39  SER 39  39  39  SER SER A . n 
D 4 40  ASP 40  40  40  ASP ASP A . n 
D 4 41  GLY 41  41  41  GLY GLY A . n 
D 4 42  LYS 42  42  42  LYS LYS A . n 
D 4 43  THR 43  43  43  THR THR A . n 
D 4 44  GLY 44  44  44  GLY GLY A . n 
D 4 45  SER 45  45  45  SER SER A . n 
D 4 46  SER 46  46  46  SER SER A . n 
D 4 47  TYR 47  47  47  TYR TYR A . n 
D 4 48  PRO 48  48  48  PRO PRO A . n 
D 4 49  HIS 49  49  49  HIS HIS A . n 
D 4 50  TRP 50  50  50  TRP TRP A . n 
D 4 51  PHE 51  51  51  PHE PHE A . n 
D 4 52  THR 52  52  52  THR THR A . n 
D 4 53  ASN 53  53  53  ASN ASN A . n 
D 4 54  GLY 54  54  54  GLY GLY A . n 
D 4 55  TYR 55  55  55  TYR TYR A . n 
D 4 56  ASP 56  56  56  ASP ASP A . n 
D 4 57  GLY 57  57  57  GLY GLY A . n 
D 4 58  ASN 58  58  58  ASN ASN A . n 
D 4 59  GLY 59  59  59  GLY GLY A . n 
D 4 60  LYS 60  60  60  LYS LYS A . n 
D 4 61  LEU 61  61  61  LEU LEU A . n 
D 4 62  ILE 62  62  62  ILE ILE A . n 
D 4 63  LYS 63  63  63  LYS LYS A . n 
D 4 64  GLY 64  64  64  GLY GLY A . n 
D 4 65  ARG 65  65  65  ARG ARG A . n 
D 4 66  THR 66  66  66  THR THR A . n 
D 4 67  PRO 67  67  67  PRO PRO A . n 
D 4 68  ILE 68  68  68  ILE ILE A . n 
D 4 69  LYS 69  69  69  LYS LYS A . n 
D 4 70  PHE 70  70  70  PHE PHE A . n 
D 4 71  GLY 71  71  71  GLY GLY A . n 
D 4 72  LYS 72  72  72  LYS LYS A . n 
D 4 73  ALA 73  73  73  ALA ALA A . n 
D 4 74  ASP 74  74  74  ASP ASP A . n 
D 4 75  CYS 75  75  75  CYS CYS A . n 
D 4 76  ASP 76  76  76  ASP ASP A . n 
D 4 77  ARG 77  77  77  ARG ARG A . n 
D 4 78  PRO 78  78  78  PRO PRO A . n 
D 4 79  PRO 79  79  79  PRO PRO A . n 
D 4 80  LYS 80  80  80  LYS LYS A . n 
D 4 81  HIS 81  81  81  HIS HIS A . n 
D 4 82  SER 82  82  82  SER SER A . n 
D 4 83  GLN 83  83  83  GLN GLN A . n 
D 4 84  ASN 84  84  84  ASN ASN A . n 
D 4 85  GLY 85  85  85  GLY GLY A . n 
D 4 86  MET 86  86  86  MET MET A . n 
D 4 87  GLY 87  87  87  GLY GLY A . n 
D 4 88  LYS 88  88  88  LYS LYS A . n 
D 4 89  ASP 89  89  89  ASP ASP A . n 
D 4 90  ASP 90  90  90  ASP ASP A . n 
D 4 91  HIS 91  91  91  HIS HIS A . n 
D 4 92  TYR 92  92  92  TYR TYR A . n 
D 4 93  LEU 93  93  93  LEU LEU A . n 
D 4 94  LEU 94  94  94  LEU LEU A . n 
D 4 95  GLU 95  95  95  GLU GLU A . n 
D 4 96  PHE 96  96  96  PHE PHE A . n 
D 4 97  PRO 97  97  97  PRO PRO A . n 
D 4 98  THR 98  98  98  THR THR A . n 
D 4 99  PHE 99  99  99  PHE PHE A . n 
D 4 100 PRO 100 100 100 PRO PRO A . n 
D 4 101 ASP 101 101 101 ASP ASP A . n 
D 4 102 GLY 102 102 102 GLY GLY A . n 
D 4 103 HIS 103 103 103 HIS HIS A . n 
D 4 104 ASP 104 104 104 ASP ASP A . n 
D 4 105 TYR 105 105 105 TYR TYR A . n 
D 4 106 LYS 106 106 106 LYS LYS A . n 
D 4 107 PHE 107 107 107 PHE PHE A . n 
D 4 108 ASP 108 108 108 ASP ASP A . n 
D 4 109 SER 109 109 109 SER SER A . n 
D 4 110 LYS 110 110 110 LYS LYS A . n 
D 4 111 LYS 111 111 111 LYS LYS A . n 
D 4 112 PRO 112 112 112 PRO PRO A . n 
D 4 113 LYS 113 113 113 LYS LYS A . n 
D 4 114 GLU 114 114 114 GLU GLU A . n 
D 4 115 ASP 115 115 115 ASP ASP A . n 
D 4 116 PRO 116 116 116 PRO PRO A . n 
D 4 117 GLY 117 117 117 GLY GLY A . n 
D 4 118 PRO 118 118 118 PRO PRO A . n 
D 4 119 ALA 119 119 119 ALA ALA A . n 
D 4 120 ARG 120 120 120 ARG ARG A . n 
D 4 121 VAL 121 121 121 VAL VAL A . n 
D 4 122 ILE 122 122 122 ILE ILE A . n 
D 4 123 TYR 123 123 123 TYR TYR A . n 
D 4 124 THR 124 124 124 THR THR A . n 
D 4 125 TYR 125 125 125 TYR TYR A . n 
D 4 126 PRO 126 126 126 PRO PRO A . n 
D 4 127 ASN 127 127 127 ASN ASN A . n 
D 4 128 LYS 128 128 128 LYS LYS A . n 
D 4 129 VAL 129 129 129 VAL VAL A . n 
D 4 130 PHE 130 130 130 PHE PHE A . n 
D 4 131 CYS 131 131 131 CYS CYS A . n 
D 4 132 GLY 132 132 132 GLY GLY A . n 
D 4 133 ILE 133 133 133 ILE ILE A . n 
D 4 134 VAL 134 134 134 VAL VAL A . n 
D 4 135 ALA 135 135 135 ALA ALA A . n 
D 4 136 HIS 136 136 136 HIS HIS A . n 
D 4 137 GLN 137 137 137 GLN GLN A . n 
D 4 138 ARG 138 138 138 ARG ARG A . n 
D 4 139 GLY 139 139 139 GLY GLY A . n 
D 4 140 ASN 140 140 140 ASN ASN A . n 
D 4 141 GLN 141 141 141 GLN GLN A . n 
D 4 142 GLY 142 142 142 GLY GLY A . n 
D 4 143 ASP 143 143 143 ASP ASP A . n 
D 4 144 LEU 144 144 144 LEU LEU A . n 
D 4 145 ARG 145 145 145 ARG ARG A . n 
D 4 146 LEU 146 146 146 LEU LEU A . n 
D 4 147 CYS 147 147 147 CYS CYS A . n 
D 4 148 SER 148 148 148 SER SER A . n 
D 4 149 HIS 149 149 149 HIS HIS A . n 
E 4 1   ALA 1   1   1   ALA ALA B . n 
E 4 2   THR 2   2   2   THR THR B . n 
E 4 3   TRP 3   3   3   TRP TRP B . n 
E 4 4   THR 4   4   4   THR THR B . n 
E 4 5   CYS 5   5   5   CYS CYS B . n 
E 4 6   ILE 6   6   6   ILE ILE B . n 
E 4 7   ASN 7   7   7   ASN ASN B . n 
E 4 8   GLN 8   8   8   GLN GLN B . n 
E 4 9   GLN 9   9   9   GLN GLN B . n 
E 4 10  LEU 10  10  10  LEU LEU B . n 
E 4 11  ASN 11  11  11  ASN ASN B . n 
E 4 12  PRO 12  12  12  PRO PRO B . n 
E 4 13  LYS 13  13  13  LYS LYS B . n 
E 4 14  THR 14  14  14  THR THR B . n 
E 4 15  ASN 15  15  15  ASN ASN B . n 
E 4 16  LYS 16  16  16  LYS LYS B . n 
E 4 17  TRP 17  17  17  TRP TRP B . n 
E 4 18  GLU 18  18  18  GLU GLU B . n 
E 4 19  ASP 19  19  19  ASP ASP B . n 
E 4 20  LYS 20  20  20  LYS LYS B . n 
E 4 21  ARG 21  21  21  ARG ARG B . n 
E 4 22  LEU 22  22  22  LEU LEU B . n 
E 4 23  LEU 23  23  23  LEU LEU B . n 
E 4 24  TYR 24  24  24  TYR TYR B . n 
E 4 25  SER 25  25  25  SER SER B . n 
E 4 26  GLN 26  26  26  GLN GLN B . n 
E 4 27  ALA 27  27  27  ALA ALA B . n 
E 4 28  LYS 28  28  28  LYS LYS B . n 
E 4 29  ALA 29  29  29  ALA ALA B . n 
E 4 30  GLU 30  30  30  GLU GLU B . n 
E 4 31  SER 31  31  31  SER SER B . n 
E 4 32  ASN 32  32  32  ASN ASN B . n 
E 4 33  SER 33  33  33  SER SER B . n 
E 4 34  HIS 34  34  34  HIS HIS B . n 
E 4 35  HIS 35  35  35  HIS HIS B . n 
E 4 36  ALA 36  36  36  ALA ALA B . n 
E 4 37  PRO 37  37  37  PRO PRO B . n 
E 4 38  LEU 38  38  38  LEU LEU B . n 
E 4 39  SER 39  39  39  SER SER B . n 
E 4 40  ASP 40  40  40  ASP ASP B . n 
E 4 41  GLY 41  41  41  GLY GLY B . n 
E 4 42  LYS 42  42  42  LYS LYS B . n 
E 4 43  THR 43  43  43  THR THR B . n 
E 4 44  GLY 44  44  44  GLY GLY B . n 
E 4 45  SER 45  45  45  SER SER B . n 
E 4 46  SER 46  46  46  SER SER B . n 
E 4 47  TYR 47  47  47  TYR TYR B . n 
E 4 48  PRO 48  48  48  PRO PRO B . n 
E 4 49  HIS 49  49  49  HIS HIS B . n 
E 4 50  TRP 50  50  50  TRP TRP B . n 
E 4 51  PHE 51  51  51  PHE PHE B . n 
E 4 52  THR 52  52  52  THR THR B . n 
E 4 53  ASN 53  53  53  ASN ASN B . n 
E 4 54  GLY 54  54  54  GLY GLY B . n 
E 4 55  TYR 55  55  55  TYR TYR B . n 
E 4 56  ASP 56  56  56  ASP ASP B . n 
E 4 57  GLY 57  57  57  GLY GLY B . n 
E 4 58  ASN 58  58  58  ASN ASN B . n 
E 4 59  GLY 59  59  59  GLY GLY B . n 
E 4 60  LYS 60  60  60  LYS LYS B . n 
E 4 61  LEU 61  61  61  LEU LEU B . n 
E 4 62  ILE 62  62  62  ILE ILE B . n 
E 4 63  LYS 63  63  63  LYS LYS B . n 
E 4 64  GLY 64  64  64  GLY GLY B . n 
E 4 65  ARG 65  65  65  ARG ARG B . n 
E 4 66  THR 66  66  66  THR THR B . n 
E 4 67  PRO 67  67  67  PRO PRO B . n 
E 4 68  ILE 68  68  68  ILE ILE B . n 
E 4 69  LYS 69  69  69  LYS LYS B . n 
E 4 70  PHE 70  70  70  PHE PHE B . n 
E 4 71  GLY 71  71  71  GLY GLY B . n 
E 4 72  LYS 72  72  72  LYS LYS B . n 
E 4 73  ALA 73  73  73  ALA ALA B . n 
E 4 74  ASP 74  74  74  ASP ASP B . n 
E 4 75  CYS 75  75  75  CYS CYS B . n 
E 4 76  ASP 76  76  76  ASP ASP B . n 
E 4 77  ARG 77  77  77  ARG ARG B . n 
E 4 78  PRO 78  78  78  PRO PRO B . n 
E 4 79  PRO 79  79  79  PRO PRO B . n 
E 4 80  LYS 80  80  80  LYS LYS B . n 
E 4 81  HIS 81  81  81  HIS HIS B . n 
E 4 82  SER 82  82  82  SER SER B . n 
E 4 83  GLN 83  83  83  GLN GLN B . n 
E 4 84  ASN 84  84  84  ASN ASN B . n 
E 4 85  GLY 85  85  85  GLY GLY B . n 
E 4 86  MET 86  86  86  MET MET B . n 
E 4 87  GLY 87  87  87  GLY GLY B . n 
E 4 88  LYS 88  88  88  LYS LYS B . n 
E 4 89  ASP 89  89  89  ASP ASP B . n 
E 4 90  ASP 90  90  90  ASP ASP B . n 
E 4 91  HIS 91  91  91  HIS HIS B . n 
E 4 92  TYR 92  92  92  TYR TYR B . n 
E 4 93  LEU 93  93  93  LEU LEU B . n 
E 4 94  LEU 94  94  94  LEU LEU B . n 
E 4 95  GLU 95  95  95  GLU GLU B . n 
E 4 96  PHE 96  96  96  PHE PHE B . n 
E 4 97  PRO 97  97  97  PRO PRO B . n 
E 4 98  THR 98  98  98  THR THR B . n 
E 4 99  PHE 99  99  99  PHE PHE B . n 
E 4 100 PRO 100 100 100 PRO PRO B . n 
E 4 101 ASP 101 101 101 ASP ASP B . n 
E 4 102 GLY 102 102 102 GLY GLY B . n 
E 4 103 HIS 103 103 103 HIS HIS B . n 
E 4 104 ASP 104 104 104 ASP ASP B . n 
E 4 105 TYR 105 105 105 TYR TYR B . n 
E 4 106 LYS 106 106 106 LYS LYS B . n 
E 4 107 PHE 107 107 107 PHE PHE B . n 
E 4 108 ASP 108 108 108 ASP ASP B . n 
E 4 109 SER 109 109 109 SER SER B . n 
E 4 110 LYS 110 110 110 LYS LYS B . n 
E 4 111 LYS 111 111 111 LYS LYS B . n 
E 4 112 PRO 112 112 112 PRO PRO B . n 
E 4 113 LYS 113 113 113 LYS LYS B . n 
E 4 114 GLU 114 114 114 GLU GLU B . n 
E 4 115 ASP 115 115 115 ASP ASP B . n 
E 4 116 PRO 116 116 116 PRO PRO B . n 
E 4 117 GLY 117 117 117 GLY GLY B . n 
E 4 118 PRO 118 118 118 PRO PRO B . n 
E 4 119 ALA 119 119 119 ALA ALA B . n 
E 4 120 ARG 120 120 120 ARG ARG B . n 
E 4 121 VAL 121 121 121 VAL VAL B . n 
E 4 122 ILE 122 122 122 ILE ILE B . n 
E 4 123 TYR 123 123 123 TYR TYR B . n 
E 4 124 THR 124 124 124 THR THR B . n 
E 4 125 TYR 125 125 125 TYR TYR B . n 
E 4 126 PRO 126 126 126 PRO PRO B . n 
E 4 127 ASN 127 127 127 ASN ASN B . n 
E 4 128 LYS 128 128 128 LYS LYS B . n 
E 4 129 VAL 129 129 129 VAL VAL B . n 
E 4 130 PHE 130 130 130 PHE PHE B . n 
E 4 131 CYS 131 131 131 CYS CYS B . n 
E 4 132 GLY 132 132 132 GLY GLY B . n 
E 4 133 ILE 133 133 133 ILE ILE B . n 
E 4 134 VAL 134 134 134 VAL VAL B . n 
E 4 135 ALA 135 135 135 ALA ALA B . n 
E 4 136 HIS 136 136 136 HIS HIS B . n 
E 4 137 GLN 137 137 137 GLN GLN B . n 
E 4 138 ARG 138 138 138 ARG ARG B . n 
E 4 139 GLY 139 139 139 GLY GLY B . n 
E 4 140 ASN 140 140 140 ASN ASN B . n 
E 4 141 GLN 141 141 141 GLN GLN B . n 
E 4 142 GLY 142 142 142 GLY GLY B . n 
E 4 143 ASP 143 143 143 ASP ASP B . n 
E 4 144 LEU 144 144 144 LEU LEU B . n 
E 4 145 ARG 145 145 145 ARG ARG B . n 
E 4 146 LEU 146 146 146 LEU LEU B . n 
E 4 147 CYS 147 147 147 CYS CYS B . n 
E 4 148 SER 148 148 148 SER SER B . n 
E 4 149 HIS 149 149 149 HIS HIS B . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    A23 
_pdbx_struct_mod_residue.label_seq_id     18 
_pdbx_struct_mod_residue.auth_asym_id     C 
_pdbx_struct_mod_residue.auth_comp_id     A23 
_pdbx_struct_mod_residue.auth_seq_id      17 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   A 
_pdbx_struct_mod_residue.details          ? 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? trimeric 3 
2 author_defined_assembly ? dimeric  2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,D,F,G,K,L,N 
2 1 C,E,H,I,J,M,O   
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O4 ? A U   8  ? C U   7   ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 208 ? 1_555 65.7  ? 
2  O4 ? A U   8  ? C U   7   ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 209 ? 1_555 83.5  ? 
3  O  ? L HOH .  ? F HOH 208 ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 209 ? 1_555 66.2  ? 
4  O4 ? A U   8  ? C U   7   ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? K HOH .  ? C HOH 207 ? 1_555 72.8  ? 
5  O  ? L HOH .  ? F HOH 208 ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? K HOH .  ? C HOH 207 ? 1_555 100.1 ? 
6  O  ? L HOH .  ? F HOH 209 ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? K HOH .  ? C HOH 207 ? 1_555 156.1 ? 
7  O4 ? A U   8  ? C U   7   ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 218 ? 1_555 159.3 ? 
8  O  ? L HOH .  ? F HOH 208 ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 218 ? 1_555 95.9  ? 
9  O  ? L HOH .  ? F HOH 209 ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 218 ? 1_555 98.2  ? 
10 O  ? K HOH .  ? C HOH 207 ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 218 ? 1_555 102.8 ? 
11 O4 ? A U   8  ? C U   7   ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 219 ? 1_555 101.2 ? 
12 O  ? L HOH .  ? F HOH 208 ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 219 ? 1_555 52.1  ? 
13 O  ? L HOH .  ? F HOH 209 ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 219 ? 1_555 106.8 ? 
14 O  ? K HOH .  ? C HOH 207 ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 219 ? 1_555 75.5  ? 
15 O  ? L HOH .  ? F HOH 218 ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 219 ? 1_555 58.5  ? 
16 O4 ? A U   8  ? C U   7   ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 211 ? 1_555 155.3 ? 
17 O  ? L HOH .  ? F HOH 208 ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 211 ? 1_555 136.4 ? 
18 O  ? L HOH .  ? F HOH 209 ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 211 ? 1_555 113.8 ? 
19 O  ? K HOH .  ? C HOH 207 ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 211 ? 1_555 89.8  ? 
20 O  ? L HOH .  ? F HOH 218 ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 211 ? 1_555 40.6  ? 
21 O  ? L HOH .  ? F HOH 219 ? 1_555 K ? F K . ? C K 202 ? 1_555 O  ? L HOH .  ? F HOH 211 ? 1_555 90.9  ? 
22 O  ? M HOH .  ? D HOH 241 ? 1_555 K ? H K . ? D K 201 ? 1_555 O  ? M HOH .  ? D HOH 237 ? 1_555 82.3  ? 
23 O  ? M HOH .  ? D HOH 241 ? 1_555 K ? H K . ? D K 201 ? 1_555 O4 ? C U   8  ? D U   7   ? 1_555 96.3  ? 
24 O  ? M HOH .  ? D HOH 237 ? 1_555 K ? H K . ? D K 201 ? 1_555 O4 ? C U   8  ? D U   7   ? 1_555 145.6 ? 
25 O  ? M HOH .  ? D HOH 241 ? 1_555 K ? H K . ? D K 201 ? 1_555 O  ? M HOH .  ? D HOH 235 ? 1_555 171.9 ? 
26 O  ? M HOH .  ? D HOH 237 ? 1_555 K ? H K . ? D K 201 ? 1_555 O  ? M HOH .  ? D HOH 235 ? 1_555 103.4 ? 
27 O4 ? C U   8  ? D U   7   ? 1_555 K ? H K . ? D K 201 ? 1_555 O  ? M HOH .  ? D HOH 235 ? 1_555 82.2  ? 
28 O6 ? C G   25 ? D G   24  ? 1_555 K ? I K . ? D K 204 ? 1_555 O  ? M HOH .  ? D HOH 206 ? 1_555 121.7 ? 
29 O6 ? C G   25 ? D G   24  ? 1_555 K ? I K . ? D K 204 ? 1_555 N7 ? C G   25 ? D G   24  ? 1_555 66.0  ? 
30 O  ? M HOH .  ? D HOH 206 ? 1_555 K ? I K . ? D K 204 ? 1_555 N7 ? C G   25 ? D G   24  ? 1_555 97.6  ? 
31 O  ? M HOH .  ? D HOH 234 ? 1_555 K ? J K . ? D K 205 ? 1_555 O  ? M HOH .  ? D HOH 233 ? 1_555 112.4 ? 
32 O  ? M HOH .  ? D HOH 234 ? 1_555 K ? J K . ? D K 205 ? 1_555 O6 ? C G   15 ? D G   14  ? 1_555 61.4  ? 
33 O  ? M HOH .  ? D HOH 233 ? 1_555 K ? J K . ? D K 205 ? 1_555 O6 ? C G   15 ? D G   14  ? 1_555 72.1  ? 
34 O  ? L HOH .  ? F HOH 221 ? 1_555 K ? G K . ? F K 203 ? 1_555 O  ? L HOH .  ? F HOH 219 ? 1_555 62.0  ? 
35 O  ? L HOH .  ? F HOH 221 ? 1_555 K ? G K . ? F K 203 ? 1_555 O  ? L HOH .  ? F HOH 210 ? 1_555 72.4  ? 
36 O  ? L HOH .  ? F HOH 219 ? 1_555 K ? G K . ? F K 203 ? 1_555 O  ? L HOH .  ? F HOH 210 ? 1_555 132.0 ? 
37 O  ? L HOH .  ? F HOH 221 ? 1_555 K ? G K . ? F K 203 ? 1_555 O6 ? B G   7  ? F G   24  ? 1_555 61.0  ? 
38 O  ? L HOH .  ? F HOH 219 ? 1_555 K ? G K . ? F K 203 ? 1_555 O6 ? B G   7  ? F G   24  ? 1_555 65.7  ? 
39 O  ? L HOH .  ? F HOH 210 ? 1_555 K ? G K . ? F K 203 ? 1_555 O6 ? B G   7  ? F G   24  ? 1_555 80.1  ? 
40 O  ? L HOH .  ? F HOH 221 ? 1_555 K ? G K . ? F K 203 ? 1_555 N7 ? B G   7  ? F G   24  ? 1_555 121.4 ? 
41 O  ? L HOH .  ? F HOH 219 ? 1_555 K ? G K . ? F K 203 ? 1_555 N7 ? B G   7  ? F G   24  ? 1_555 122.1 ? 
42 O  ? L HOH .  ? F HOH 210 ? 1_555 K ? G K . ? F K 203 ? 1_555 N7 ? B G   7  ? F G   24  ? 1_555 70.1  ? 
43 O6 ? B G   7  ? F G   24  ? 1_555 K ? G K . ? F K 203 ? 1_555 N7 ? B G   7  ? F G   24  ? 1_555 69.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-10-26 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
CNS       refinement       1.0 ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 46  ? ? 89.62   -0.04  
2  1 LEU A 61  ? ? -48.01  158.89 
3  1 LYS A 63  ? ? 72.29   105.46 
4  1 LYS A 111 ? ? 38.31   65.74  
5  1 THR B 14  ? ? 96.73   102.28 
6  1 ASN B 15  ? ? -57.03  41.33  
7  1 THR B 43  ? ? -38.01  164.93 
8  1 SER B 46  ? ? 78.37   -1.33  
9  1 LYS B 63  ? ? -39.71  129.88 
10 1 ARG B 77  ? ? -170.85 126.47 
11 1 PRO B 78  ? ? -39.59  135.68 
12 1 LYS B 80  ? ? -119.43 79.23  
13 1 LYS B 111 ? ? 8.53    103.88 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1JBR 'double helix'         
1JBR 'a-form double helix'  
1JBR 'bulge loop'           
1JBR 'mismatched base pair' 
1JBR 'triple helix'         
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B G 1  1_555 A C 14 1_555 -0.354 -0.504 0.613  -3.714  -0.883  -3.761   1  F_G18:C13_C F 18 ? C 13 ? 19 1  
1 B G 2  1_555 A A 13 1_555 6.833  -4.752 0.389  -3.329  -5.502  -6.856   2  F_G19:A12_C F 19 ? C 12 ? 11 10 
1 B A 3  1_555 A U 12 1_555 -4.245 -1.954 -0.770 -2.457  -8.853  -104.854 3  F_A20:U11_C F 20 ? C 11 ? 24 4  
1 B A 4  1_555 A A 10 1_555 6.310  -5.185 -0.203 10.988  2.265   172.879  4  F_A21:A9_C  F 21 ? C 9  ? 2  8  
1 B C 5  1_555 A C 9  1_555 -6.843 -5.818 -0.266 9.132   -8.453  -6.850   5  F_C22:C8_C  F 22 ? C 8  ? ?  10 
1 B C 6  1_555 A U 8  1_555 -4.963 -1.610 -0.627 9.761   -10.796 -1.067   6  F_C23:U7_C  F 23 ? C 7  ? ?  ?  
1 B G 7  1_555 A C 7  1_555 -0.144 -0.136 -0.044 -13.288 -14.015 1.129    7  F_G24:C6_C  F 24 ? C 6  ? 19 1  
1 B G 8  1_555 A C 6  1_555 0.077  -0.143 -0.178 -9.279  -6.651  -0.699   8  F_G25:C5_C  F 25 ? C 5  ? 19 1  
1 B A 9  1_555 A U 5  1_555 -0.303 -0.113 -0.097 -7.420  -7.258  2.286    9  F_A26:U4_C  F 26 ? C 4  ? 20 1  
1 B G 10 1_555 A C 4  1_555 -0.191 -0.329 -0.287 0.386   -8.562  1.520    10 F_G27:C3_C  F 27 ? C 3  ? 19 1  
1 B C 11 1_555 A G 3  1_555 0.533  -0.148 0.183  -1.127  -11.101 5.063    11 F_C28:G2_C  F 28 ? C 2  ? 19 1  
1 B G 12 1_555 A C 2  1_555 0.067  -0.233 -0.109 -3.642  -14.098 1.525    12 F_G29:C1_C  F 29 ? C 1  ? 19 1  
1 B C 13 1_555 A G 1  1_555 0.261  -0.091 0.055  5.304   -9.587  1.595    13 F_C30:G0_C  F 30 ? C 0  ? 19 1  
1 C G 1  1_555 C C 31 1_555 -0.239 -0.245 0.289  -0.256  -11.626 -0.573   14 D_G0:C30_D  D 0  ? D 30 ? 19 1  
1 C C 2  1_555 C G 30 1_555 -0.073 0.085  -0.011 5.146   -11.428 4.528    15 D_C1:G29_D  D 1  ? D 29 ? 19 1  
1 C G 3  1_555 C C 29 1_555 -0.654 -0.219 -0.114 1.259   -10.228 1.997    16 D_G2:C28_D  D 2  ? D 28 ? 19 1  
1 C C 4  1_555 C G 28 1_555 0.459  -0.151 -0.039 6.537   -9.684  3.403    17 D_C3:G27_D  D 3  ? D 27 ? 19 1  
1 C U 5  1_555 C A 27 1_555 -0.018 -0.251 0.204  5.679   -6.948  -2.251   18 D_U4:A26_D  D 4  ? D 26 ? 20 1  
1 C C 6  1_555 C G 26 1_555 0.030  -0.146 -0.352 14.358  -8.691  5.238    19 D_C5:G25_D  D 5  ? D 25 ? 19 1  
1 C C 7  1_555 C G 25 1_555 0.266  -0.096 -0.133 8.776   -11.747 7.409    20 D_C6:G24_D  D 6  ? D 24 ? 19 1  
1 C U 8  1_555 C C 24 1_555 4.782  -1.330 -0.758 -20.036 -13.605 1.288    21 D_U7:C23_D  D 7  ? D 23 ? ?  ?  
1 C C 9  1_555 C C 23 1_555 6.965  -5.375 -0.131 -10.168 -20.377 -10.324  22 D_C8:C22_D  D 8  ? D 22 ? ?  6  
1 C A 10 1_555 C A 22 1_555 -6.060 5.237  -0.001 -15.290 -4.663  -170.956 23 D_A9:A21_D  D 9  ? D 21 ? 2  8  
1 C U 12 1_555 C A 21 1_555 4.506  -1.608 -0.618 5.985   -17.853 -103.632 24 D_U11:A20_D D 11 ? D 20 ? ?  ?  
1 C A 13 1_555 C G 20 1_555 -6.947 -4.363 0.152  6.611   -8.420  -3.321   25 D_A12:G19_D D 12 ? D 19 ? 11 10 
1 C C 14 1_555 C G 19 1_555 0.201  -0.203 0.050  4.219   -9.195  -0.010   26 D_C13:G18_D D 13 ? D 18 ? 19 1  
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B G 1  1_555 A C 14 1_555 B G 2  1_555 A A 13 1_555 -0.746 -0.840 3.368  6.173   4.186    68.771   -0.896 0.887   3.250  3.695   
-5.449  69.124   1  FF_G18G19:A12C13_CC F 18 ? C 13 ? F 19 ? C 12 ? 
1 B G 2  1_555 A A 13 1_555 B A 3  1_555 A U 12 1_555 -5.317 -0.125 3.273  2.074   2.715    -15.974  -1.664 -17.106 3.893  -9.628  
7.355   -16.333  2  FF_G19A20:U11A12_CC F 19 ? C 12 ? F 20 ? C 11 ? 
1 B A 3  1_555 A U 12 1_555 B A 4  1_555 A A 10 1_555 0.805  0.705  3.213  7.016   -2.503   -91.694  -0.443 0.692   3.174  1.742   
4.883   -91.929  3  FF_A20A21:A9U11_CC  F 20 ? C 11 ? F 21 ? C 9  ? 
1 B A 4  1_555 A A 10 1_555 B C 5  1_555 A C 9  1_555 -0.368 -1.319 3.066  0.430   -4.386   115.412  -0.736 0.222   3.096  -2.594  
-0.254  115.465  4  FF_A21C22:C8A9_CC   F 21 ? C 9  ? F 22 ? C 8  ? 
1 B C 5  1_555 A C 9  1_555 B C 6  1_555 A U 8  1_555 0.508  -0.974 3.527  -10.390 9.595    50.293   -1.774 -1.298  3.150  11.041  
11.956  52.119   5  FF_C22C23:U7C8_CC   F 22 ? C 8  ? F 23 ? C 7  ? 
1 B C 6  1_555 A U 8  1_555 B G 7  1_555 A C 7  1_555 0.207  -1.379 4.011  -7.800  6.012    51.308   -2.047 -0.856  3.771  6.870   
8.914   52.182   6  FF_C23G24:C6U7_CC   F 23 ? C 7  ? F 24 ? C 6  ? 
1 B G 7  1_555 A C 7  1_555 B G 8  1_555 A C 6  1_555 -0.233 -2.176 3.224  2.618   7.688    32.224   -4.978 0.806   2.623  13.584  
-4.625  33.206   7  FF_G24G25:C5C6_CC   F 24 ? C 6  ? F 25 ? C 5  ? 
1 B G 8  1_555 A C 6  1_555 B A 9  1_555 A U 5  1_555 0.184  -1.835 3.190  0.760   7.559    26.010   -5.639 -0.221  2.568  16.356  
-1.645  27.079   8  FF_G25A26:U4C5_CC   F 25 ? C 5  ? F 26 ? C 4  ? 
1 B A 9  1_555 A U 5  1_555 B G 10 1_555 A C 4  1_555 -0.310 -1.931 3.108  0.150   6.111    33.245   -4.210 0.555   2.719  10.570  
-0.260  33.787   9  FF_A26G27:C3U4_CC   F 26 ? C 4  ? F 27 ? C 3  ? 
1 B G 10 1_555 A C 4  1_555 B C 11 1_555 A G 3  1_555 -0.035 -1.188 3.359  -3.998  6.889    35.731   -2.837 -0.492  3.071  11.059  
6.418   36.580   10 FF_G27C28:G2C3_CC   F 27 ? C 3  ? F 28 ? C 2  ? 
1 B C 11 1_555 A G 3  1_555 B G 12 1_555 A C 2  1_555 0.003  -1.678 3.244  3.130   11.460   28.052   -5.254 0.557   2.378  22.412  
-6.122  30.417   11 FF_C28G29:C1G2_CC   F 28 ? C 2  ? F 29 ? C 1  ? 
1 B G 12 1_555 A C 2  1_555 B C 13 1_555 A G 1  1_555 0.759  -1.593 3.007  1.106   2.694    34.054   -3.096 -1.134  2.899  4.590   
-1.884  34.174   12 FF_G29C30:G0C1_CC   F 29 ? C 1  ? F 30 ? C 0  ? 
1 B C 13 1_555 A G 1  1_555 C G 1  1_555 C C 31 1_555 0.221  -3.815 3.324  -1.748  7.736    -13.405  6.137  -0.979  4.776  -29.954 
-6.767  -15.567  13 FD_C30G0:C30G0_DC   F 30 ? C 0  ? D 0  ? D 30 ? 
1 C G 1  1_555 C C 31 1_555 C C 2  1_555 C G 30 1_555 -0.133 -2.036 3.177  0.017   -0.209   33.625   -3.486 0.233   3.189  -0.360  
-0.030  33.625   14 DD_G0C1:G29C30_DD   D 0  ? D 30 ? D 1  ? D 29 ? 
1 C C 2  1_555 C G 30 1_555 C G 3  1_555 C C 29 1_555 -0.629 -2.047 3.324  -0.588  8.861    22.662   -7.379 1.325   2.379  21.518  
1.428   24.319   15 DD_C1G2:C28G29_DD   D 1  ? D 29 ? D 2  ? D 28 ? 
1 C G 3  1_555 C C 29 1_555 C C 4  1_555 C G 28 1_555 0.302  -1.425 3.184  -1.887  6.053    38.034   -2.862 -0.677  2.914  9.210   
2.871   38.540   16 DD_G2C3:G27C28_DD   D 2  ? D 28 ? D 3  ? D 27 ? 
1 C C 4  1_555 C G 28 1_555 C U 5  1_555 C A 27 1_555 -0.463 -2.050 3.222  -4.185  7.908    29.749   -5.224 0.127   2.642  14.981  
7.928   31.036   17 DD_C3U4:A26G27_DD   D 3  ? D 27 ? D 4  ? D 26 ? 
1 C U 5  1_555 C A 27 1_555 C C 6  1_555 C G 26 1_555 0.092  -1.884 3.020  2.058   6.570    29.465   -4.759 0.183   2.550  12.700  
-3.978  30.241   18 DD_U4C5:G25A26_DD   D 4  ? D 26 ? D 5  ? D 25 ? 
1 C C 6  1_555 C G 26 1_555 C C 7  1_555 C G 25 1_555 -0.069 -2.253 3.478  -2.930  8.858    29.373   -5.918 -0.424  2.694  16.939  
5.604   30.788   19 DD_C5C6:G24G25_DD   D 5  ? D 25 ? D 6  ? D 24 ? 
1 C C 7  1_555 C G 25 1_555 C U 8  1_555 C C 24 1_555 -0.605 -1.332 4.153  10.157  14.832   48.065   -2.778 1.547   3.443  17.513  
-11.993 51.129   20 DD_C6U7:C23G24_DD   D 6  ? D 24 ? D 7  ? D 23 ? 
1 C U 8  1_555 C C 24 1_555 C C 9  1_555 C C 23 1_555 -0.592 -0.880 3.294  3.651   7.956    47.537   -1.684 1.003   3.067  9.773   
-4.485  48.290   21 DD_U7C8:C22C23_DD   D 7  ? D 23 ? D 8  ? D 22 ? 
1 C C 9  1_555 C C 23 1_555 C A 10 1_555 C A 22 1_555 3.485  -0.499 -0.568 -89.644 -150.264 -117.420 0.208  1.768   0.219  75.446  
-45.009 -177.389 22 DD_C8A9:A21C22_DD   D 8  ? D 22 ? D 9  ? D 21 ? 
1 C A 10 1_555 C A 22 1_555 C U 12 1_555 C A 21 1_555 1.587  -2.808 0.931  122.040 125.002  13.923   -1.453 -0.748  -0.781 64.168  
-62.648 174.736  23 DD_A9U11:A20A21_DD  D 9  ? D 21 ? D 11 ? D 20 ? 
1 C U 12 1_555 C A 21 1_555 C A 13 1_555 C G 20 1_555 5.128  -0.850 3.264  -1.596  -0.647   -13.638  4.245  19.715  3.792  2.712   
-6.685  -13.746  24 DD_U11A12:G19A20_DD D 11 ? D 20 ? D 12 ? D 19 ? 
1 C A 13 1_555 C G 20 1_555 C C 14 1_555 C G 19 1_555 0.468  -0.698 3.485  -3.721  5.324    63.194   -0.910 -0.617  3.393  5.067   
3.541   63.493   25 DD_A12C13:G18G19_DD D 12 ? D 19 ? D 13 ? D 18 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'POTASSIUM ION' K   
6 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 5 K   1  202 202 K   K   C . 
G 5 K   1  203 203 K   K   F . 
H 5 K   1  201 201 K   K   D . 
I 5 K   1  204 204 K   K   D . 
J 5 K   1  205 205 K   K   D . 
K 6 HOH 1  203 8   HOH TIP C . 
K 6 HOH 2  204 17  HOH TIP C . 
K 6 HOH 3  205 25  HOH TIP C . 
K 6 HOH 4  206 39  HOH TIP C . 
K 6 HOH 5  207 43  HOH TIP C . 
K 6 HOH 6  208 45  HOH TIP C . 
K 6 HOH 7  209 61  HOH TIP C . 
K 6 HOH 8  210 62  HOH TIP C . 
K 6 HOH 9  211 76  HOH TIP C . 
K 6 HOH 10 212 80  HOH TIP C . 
K 6 HOH 11 213 85  HOH TIP C . 
K 6 HOH 12 214 130 HOH TIP C . 
K 6 HOH 13 215 137 HOH TIP C . 
K 6 HOH 14 216 146 HOH TIP C . 
K 6 HOH 15 217 148 HOH TIP C . 
K 6 HOH 16 218 149 HOH TIP C . 
K 6 HOH 17 219 156 HOH TIP C . 
K 6 HOH 18 220 167 HOH TIP C . 
K 6 HOH 19 221 169 HOH TIP C . 
K 6 HOH 20 222 175 HOH TIP C . 
L 6 HOH 1  204 1   HOH TIP F . 
L 6 HOH 2  205 4   HOH TIP F . 
L 6 HOH 3  206 15  HOH TIP F . 
L 6 HOH 4  207 18  HOH TIP F . 
L 6 HOH 5  208 22  HOH TIP F . 
L 6 HOH 6  209 24  HOH TIP F . 
L 6 HOH 7  210 55  HOH TIP F . 
L 6 HOH 8  211 60  HOH TIP F . 
L 6 HOH 9  212 64  HOH TIP F . 
L 6 HOH 10 213 84  HOH TIP F . 
L 6 HOH 11 214 94  HOH TIP F . 
L 6 HOH 12 215 104 HOH TIP F . 
L 6 HOH 13 216 106 HOH TIP F . 
L 6 HOH 14 217 115 HOH TIP F . 
L 6 HOH 15 218 118 HOH TIP F . 
L 6 HOH 16 219 119 HOH TIP F . 
L 6 HOH 17 220 125 HOH TIP F . 
L 6 HOH 18 221 139 HOH TIP F . 
L 6 HOH 19 222 147 HOH TIP F . 
L 6 HOH 20 223 151 HOH TIP F . 
L 6 HOH 21 224 153 HOH TIP F . 
M 6 HOH 1  206 2   HOH TIP D . 
M 6 HOH 2  207 7   HOH TIP D . 
M 6 HOH 3  208 10  HOH TIP D . 
M 6 HOH 4  209 26  HOH TIP D . 
M 6 HOH 5  210 32  HOH TIP D . 
M 6 HOH 6  211 35  HOH TIP D . 
M 6 HOH 7  212 41  HOH TIP D . 
M 6 HOH 8  213 47  HOH TIP D . 
M 6 HOH 9  214 48  HOH TIP D . 
M 6 HOH 10 215 49  HOH TIP D . 
M 6 HOH 11 216 52  HOH TIP D . 
M 6 HOH 12 217 66  HOH TIP D . 
M 6 HOH 13 218 69  HOH TIP D . 
M 6 HOH 14 219 70  HOH TIP D . 
M 6 HOH 15 220 72  HOH TIP D . 
M 6 HOH 16 221 82  HOH TIP D . 
M 6 HOH 17 222 86  HOH TIP D . 
M 6 HOH 18 223 87  HOH TIP D . 
M 6 HOH 19 224 89  HOH TIP D . 
M 6 HOH 20 225 96  HOH TIP D . 
M 6 HOH 21 226 97  HOH TIP D . 
M 6 HOH 22 227 100 HOH TIP D . 
M 6 HOH 23 228 103 HOH TIP D . 
M 6 HOH 24 229 105 HOH TIP D . 
M 6 HOH 25 230 107 HOH TIP D . 
M 6 HOH 26 231 116 HOH TIP D . 
M 6 HOH 27 232 120 HOH TIP D . 
M 6 HOH 28 233 123 HOH TIP D . 
M 6 HOH 29 234 124 HOH TIP D . 
M 6 HOH 30 235 126 HOH TIP D . 
M 6 HOH 31 236 131 HOH TIP D . 
M 6 HOH 32 237 132 HOH TIP D . 
M 6 HOH 33 238 133 HOH TIP D . 
M 6 HOH 34 239 135 HOH TIP D . 
M 6 HOH 35 240 143 HOH TIP D . 
M 6 HOH 36 241 144 HOH TIP D . 
M 6 HOH 37 242 158 HOH TIP D . 
M 6 HOH 38 243 168 HOH TIP D . 
M 6 HOH 39 244 176 HOH TIP D . 
N 6 HOH 1  150 6   HOH TIP A . 
N 6 HOH 2  151 9   HOH TIP A . 
N 6 HOH 3  152 11  HOH TIP A . 
N 6 HOH 4  153 12  HOH TIP A . 
N 6 HOH 5  154 13  HOH TIP A . 
N 6 HOH 6  155 14  HOH TIP A . 
N 6 HOH 7  156 16  HOH TIP A . 
N 6 HOH 8  157 19  HOH TIP A . 
N 6 HOH 9  158 20  HOH TIP A . 
N 6 HOH 10 159 23  HOH TIP A . 
N 6 HOH 11 160 30  HOH TIP A . 
N 6 HOH 12 161 31  HOH TIP A . 
N 6 HOH 13 162 33  HOH TIP A . 
N 6 HOH 14 163 36  HOH TIP A . 
N 6 HOH 15 164 40  HOH TIP A . 
N 6 HOH 16 165 42  HOH TIP A . 
N 6 HOH 17 166 44  HOH TIP A . 
N 6 HOH 18 167 51  HOH TIP A . 
N 6 HOH 19 168 53  HOH TIP A . 
N 6 HOH 20 169 54  HOH TIP A . 
N 6 HOH 21 170 58  HOH TIP A . 
N 6 HOH 22 171 59  HOH TIP A . 
N 6 HOH 23 172 65  HOH TIP A . 
N 6 HOH 24 173 67  HOH TIP A . 
N 6 HOH 25 174 68  HOH TIP A . 
N 6 HOH 26 175 71  HOH TIP A . 
N 6 HOH 27 176 73  HOH TIP A . 
N 6 HOH 28 177 74  HOH TIP A . 
N 6 HOH 29 178 75  HOH TIP A . 
N 6 HOH 30 179 77  HOH TIP A . 
N 6 HOH 31 180 79  HOH TIP A . 
N 6 HOH 32 181 81  HOH TIP A . 
N 6 HOH 33 182 83  HOH TIP A . 
N 6 HOH 34 183 90  HOH TIP A . 
N 6 HOH 35 184 95  HOH TIP A . 
N 6 HOH 36 185 109 HOH TIP A . 
N 6 HOH 37 186 110 HOH TIP A . 
N 6 HOH 38 187 111 HOH TIP A . 
N 6 HOH 39 188 113 HOH TIP A . 
N 6 HOH 40 189 121 HOH TIP A . 
N 6 HOH 41 190 122 HOH TIP A . 
N 6 HOH 42 191 127 HOH TIP A . 
N 6 HOH 43 192 136 HOH TIP A . 
N 6 HOH 44 193 138 HOH TIP A . 
N 6 HOH 45 194 141 HOH TIP A . 
N 6 HOH 46 195 152 HOH TIP A . 
N 6 HOH 47 196 154 HOH TIP A . 
N 6 HOH 48 197 155 HOH TIP A . 
N 6 HOH 49 198 157 HOH TIP A . 
N 6 HOH 50 199 159 HOH TIP A . 
N 6 HOH 51 200 160 HOH TIP A . 
N 6 HOH 52 201 162 HOH TIP A . 
N 6 HOH 53 202 164 HOH TIP A . 
N 6 HOH 54 203 165 HOH TIP A . 
O 6 HOH 1  150 5   HOH TIP B . 
O 6 HOH 2  151 21  HOH TIP B . 
O 6 HOH 3  152 27  HOH TIP B . 
O 6 HOH 4  153 28  HOH TIP B . 
O 6 HOH 5  154 29  HOH TIP B . 
O 6 HOH 6  155 34  HOH TIP B . 
O 6 HOH 7  156 37  HOH TIP B . 
O 6 HOH 8  157 38  HOH TIP B . 
O 6 HOH 9  158 46  HOH TIP B . 
O 6 HOH 10 159 50  HOH TIP B . 
O 6 HOH 11 160 56  HOH TIP B . 
O 6 HOH 12 161 57  HOH TIP B . 
O 6 HOH 13 162 63  HOH TIP B . 
O 6 HOH 14 163 78  HOH TIP B . 
O 6 HOH 15 164 88  HOH TIP B . 
O 6 HOH 16 165 91  HOH TIP B . 
O 6 HOH 17 166 92  HOH TIP B . 
O 6 HOH 18 167 93  HOH TIP B . 
O 6 HOH 19 168 98  HOH TIP B . 
O 6 HOH 20 169 99  HOH TIP B . 
O 6 HOH 21 170 101 HOH TIP B . 
O 6 HOH 22 171 102 HOH TIP B . 
O 6 HOH 23 172 108 HOH TIP B . 
O 6 HOH 24 173 112 HOH TIP B . 
O 6 HOH 25 174 117 HOH TIP B . 
O 6 HOH 26 175 128 HOH TIP B . 
O 6 HOH 27 176 129 HOH TIP B . 
O 6 HOH 28 177 134 HOH TIP B . 
O 6 HOH 29 178 140 HOH TIP B . 
O 6 HOH 30 179 145 HOH TIP B . 
O 6 HOH 31 180 150 HOH TIP B . 
O 6 HOH 32 181 161 HOH TIP B . 
O 6 HOH 33 182 166 HOH TIP B . 
O 6 HOH 34 183 170 HOH TIP B . 
#