data_1JCA
# 
_entry.id   1JCA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JCA         
RCSB  RCSB013615   
WWPDB D_1000013615 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1J73 
_pdbx_database_related.details        '1J73 contains the same sequence and structure, but substitution of Dab-A8 residue by Lysine' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JCA 
_pdbx_database_status.recvd_initial_deposition_date   2001-06-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Weiss, M.A.'       1 
'Wan, Z.'           2 
'Zhao, M.'          3 
'Chu, Y.-C.'        4 
'Nakagawa, S.H.'    5 
'Burke, G.T.'       6 
'Jia, W.'           7 
'Hellmich, R.'      8 
'Katsoyannis, P.G.' 9 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Non-standard insulin design: structure-activity relationships at the periphery of the insulin receptor.' J.Mol.Biol. 315 
103  111  2002 JMOBAK UK 0022-2836 0070 ? 11779231 10.1006/jmbi.2001.5224         
1       'A Proposed Interaction Model of Insulin Molecules with its Receptor' BIOPHYS.CHEM.          50  63   71   1994 BICIAZ NE 
0301-4622 0829 ? ?        '10.1016/0301-4622(94)85020-8' 
2       
;Diabetes-associated Mutations in a beta-Cell Transcription Factor Destabilize an Antiparallel "mini-zipper" in a Dimerization Interface
;
Proc.Natl.Acad.Sci.USA 97  1999 2004 2000 PNASA6 US 0027-8424 0040 ? ?        10.1073/pnas.97.5.1999         
3       'The Relationship Between Insulin Bioactivity and Structure in the NH2-terminal A-chain Helix' J.Mol.Biol.            284 
477  488  1998 JMOBAK UK 0022-2836 0070 ? ?        10.1006/jmbi.1998.2175         
4       'Mapping the Functional Surface of Insulin by Design: Structure and Function of Novel A-chain Analogue' J.Mol.Biol. 264 
390  403  1996 JMOBAK UK 0022-2836 0070 ? ?        10.1006/jmbi.1996.0648         
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Weiss, M.A.'       1  
primary 'Wan, Z.'           2  
primary 'Zhao, M.'          3  
primary 'Chu, Y.C.'         4  
primary 'Nakagawa, S.H.'    5  
primary 'Burke, G.T.'       6  
primary 'Jia, W.'           7  
primary 'Hellmich, R.'      8  
primary 'Katsoyannis, P.G.' 9  
1       'Liang, D.C.'       10 
1       'Chang, W.R.'       11 
1       'Wan, Z.L.'         12 
1       'Vijayan, N.M.'     13 
2       'Hua, Q.X.'         14 
2       'Zhao, M.'          15 
2       'Narayana, N.'      16 
2       'Nakagawa, S.H.'    17 
2       'Jia, W.'           18 
2       'Weiss, M.A.'       19 
3       'Olsen, H.B.'       20 
3       'Ludvigsen, S.'     21 
3       'Kaarsholm, N.C.'   22 
4       'Hua, Q.X.'         23 
4       'Hu, S.Q.'          24 
4       'Frank, B.H.'       25 
4       'Jia, W.'           26 
4       'Chu, Y.C.'         27 
4       'Wang, S.H.'        28 
4       'Burke, G.T.'       29 
4       'Katsoyannis, P.G.' 30 
4       'Weiss, M.A.'       31 
# 
_cell.entry_id           1JCA 
_cell.length_a           80.652 
_cell.length_b           80.652 
_cell.length_c           37.936 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JCA 
_symmetry.space_group_name_H-M             'H 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                146 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'insulin a' 2411.774 2  ? T8K ? ? 
2 polymer     syn 'insulin b' 3433.953 2  ? ?   ? ? 
3 non-polymer syn 'ZINC ION'  65.409   2  ? ?   ? ? 
4 water       nat water       18.015   36 ? ?   ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GIVEQCCKSICSLYQLENYCN          GIVEQCCKSICSLYQLENYCN          A,C ? 
2 'polypeptide(L)' no no FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFFYTPKT B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ILE n 
1 3  VAL n 
1 4  GLU n 
1 5  GLN n 
1 6  CYS n 
1 7  CYS n 
1 8  LYS n 
1 9  SER n 
1 10 ILE n 
1 11 CYS n 
1 12 SER n 
1 13 LEU n 
1 14 TYR n 
1 15 GLN n 
1 16 LEU n 
1 17 GLU n 
1 18 ASN n 
1 19 TYR n 
1 20 CYS n 
1 21 ASN n 
2 1  PHE n 
2 2  VAL n 
2 3  ASN n 
2 4  GLN n 
2 5  HIS n 
2 6  LEU n 
2 7  CYS n 
2 8  GLY n 
2 9  SER n 
2 10 HIS n 
2 11 LEU n 
2 12 VAL n 
2 13 GLU n 
2 14 ALA n 
2 15 LEU n 
2 16 TYR n 
2 17 LEU n 
2 18 VAL n 
2 19 CYS n 
2 20 GLY n 
2 21 GLU n 
2 22 ARG n 
2 23 GLY n 
2 24 PHE n 
2 25 PHE n 
2 26 TYR n 
2 27 THR n 
2 28 PRO n 
2 29 LYS n 
2 30 THR n 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? ? ? ? 
'This peptide was chemically synthesized. The sequence of the peptide is naturally found in Homo sapiens (humans).' 
2 1 sample ? ? ? ? ? 
'This peptide was chemically synthesized. The sequence of the peptide is naturally found in Homo sapiens (humans).' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP INS_HUMAN P01308 1 90 ? ? 
2 UNP INS_HUMAN P01308 2 25 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JCA A 1 ? 21 ? P01308 90 ? 110 ? 1 21 
2 2 1JCA B 1 ? 30 ? P01308 25 ? 54  ? 1 30 
3 1 1JCA C 1 ? 21 ? P01308 90 ? 110 ? 1 21 
4 2 1JCA D 1 ? 30 ? P01308 25 ? 54  ? 1 30 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1JCA LYS A 8 ? UNP P01308 THR 97 ENGINEERED 8 1 
3 1JCA LYS C 8 ? UNP P01308 THR 97 ENGINEERED 8 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1JCA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.03 
_exptl_crystal.density_percent_sol   39.43 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ambient 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'Tris, sodium citrate, acetone, phenol, pH 7.0, VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           290 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS II' 
_diffrn_detector.pdbx_collection_date   2000-01-01 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    MIRROR 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1JCA 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             10.0 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   3169 
_reflns.number_all                   3369 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            0.071 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   97.5 
_reflns_shell.Rmerge_I_obs           0.16 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1JCA 
_refine.ls_number_reflns_obs                     3160 
_refine.ls_number_reflns_all                     3213 
_refine.pdbx_ls_sigma_I                          1.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    89.2 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.204 
_refine.ls_R_factor_R_free                       0.241 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  300 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1TRZ' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        803 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             36 
_refine_hist.number_atoms_total               841 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d           0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg        2.40  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d 23.8  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d 0.68  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1JCA 
_struct.title                     'Non-standard Design of Unstable Insulin Analogues with Enhanced Activity' 
_struct.pdbx_descriptor           'insulin a, insulin b' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JCA 
_struct_keywords.pdbx_keywords   'HORMONE/GROWTH FACTOR' 
_struct_keywords.text            'A8-Lysine human insulin, insulin receptor, HORMONE-GROWTH FACTOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 
;The biological assembly is a hexamer generated from the dimer 
in the asymmetric unit by the operations:  -y, x-y, z and      
-x+y, -x, z.
;
? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 1  ? CYS A 6  ? GLY A 1  CYS A 6  1 ? 6  
HELX_P HELX_P2 2 SER A 12 ? ASN A 18 ? SER A 12 ASN A 18 1 ? 7  
HELX_P HELX_P3 3 CYS B 7  ? GLY B 20 ? CYS B 7  GLY B 20 1 ? 14 
HELX_P HELX_P4 4 GLU B 21 ? GLY B 23 ? GLU B 21 GLY B 23 5 ? 3  
HELX_P HELX_P5 5 GLY C 1  ? CYS C 6  ? GLY C 1  CYS C 6  1 ? 6  
HELX_P HELX_P6 6 SER C 12 ? GLU C 17 ? SER C 12 GLU C 17 1 ? 6  
HELX_P HELX_P7 7 ASN D 3  ? GLY D 20 ? ASN D 3  GLY D 20 1 ? 18 
HELX_P HELX_P8 8 GLU D 21 ? GLY D 23 ? GLU D 21 GLY D 23 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 6  SG ? ? ? 1_555 A CYS 11 SG  ? ? A CYS 6  A CYS 11 1_555 ? ? ? ? ? ? ? 2.007 ? 
disulf2 disulf ? ? A CYS 7  SG ? ? ? 1_555 B CYS 7  SG  ? ? A CYS 7  B CYS 7  1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG  ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 2.015 ? 
disulf4 disulf ? ? C CYS 6  SG ? ? ? 1_555 C CYS 11 SG  ? ? C CYS 6  C CYS 11 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf5 disulf ? ? C CYS 7  SG ? ? ? 1_555 D CYS 7  SG  ? ? C CYS 7  D CYS 7  1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf6 disulf ? ? C CYS 20 SG ? ? ? 1_555 D CYS 19 SG  ? ? C CYS 20 D CYS 19 1_555 ? ? ? ? ? ? ? 2.023 ? 
metalc1 metalc ? ? E ZN  .  ZN ? ? ? 1_555 B HIS 10 NE2 ? ? B ZN  41 B HIS 10 1_555 ? ? ? ? ? ? ? 2.223 ? 
metalc2 metalc ? ? F ZN  .  ZN ? ? ? 1_555 D HIS 10 NE2 ? ? D ZN  42 D HIS 10 1_555 ? ? ? ? ? ? ? 1.932 ? 
metalc3 metalc ? ? E ZN  .  ZN ? ? ? 1_555 B HIS 10 NE2 ? ? B ZN  41 B HIS 10 2_555 ? ? ? ? ? ? ? 2.223 ? 
metalc4 metalc ? ? E ZN  .  ZN ? ? ? 1_555 B HIS 10 NE2 ? ? B ZN  41 B HIS 10 3_555 ? ? ? ? ? ? ? 2.223 ? 
metalc5 metalc ? ? F ZN  .  ZN ? ? ? 1_555 D HIS 10 NE2 ? ? D ZN  42 D HIS 10 2_555 ? ? ? ? ? ? ? 1.932 ? 
metalc6 metalc ? ? F ZN  .  ZN ? ? ? 1_555 D HIS 10 NE2 ? ? D ZN  42 D HIS 10 3_555 ? ? ? ? ? ? ? 1.932 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE B 24 ? TYR B 26 ? PHE B 24 TYR B 26 
A 2 PHE D 24 ? TYR D 26 ? PHE D 24 TYR D 26 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   B 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    26 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    B 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     26 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   PHE 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   D 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    24 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    PHE 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    D 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     24 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ZN B 41' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ZN D 42' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 HIS B 10 ? HIS B 10 . ? 2_555 ? 
2 AC1 3 HIS B 10 ? HIS B 10 . ? 1_555 ? 
3 AC1 3 HIS B 10 ? HIS B 10 . ? 3_555 ? 
4 AC2 3 HIS D 10 ? HIS D 10 . ? 1_555 ? 
5 AC2 3 HIS D 10 ? HIS D 10 . ? 2_555 ? 
6 AC2 3 HIS D 10 ? HIS D 10 . ? 3_555 ? 
# 
_database_PDB_matrix.entry_id          1JCA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JCA 
_atom_sites.fract_transf_matrix[1][1]   0.012399 
_atom_sites.fract_transf_matrix[1][2]   0.007159 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014317 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.026360 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . GLY A 1 1  ? -1.321  20.442 -13.235 1.00 38.18 ? 1  GLY A N   1 
ATOM   2   C  CA  . GLY A 1 1  ? -1.147  19.993 -11.878 1.00 36.86 ? 1  GLY A CA  1 
ATOM   3   C  C   . GLY A 1 1  ? -0.097  18.906 -11.738 1.00 37.48 ? 1  GLY A C   1 
ATOM   4   O  O   . GLY A 1 1  ? 0.708   18.675 -12.643 1.00 38.93 ? 1  GLY A O   1 
ATOM   5   N  N   . ILE A 1 2  ? -0.134  18.208 -10.598 1.00 35.60 ? 2  ILE A N   1 
ATOM   6   C  CA  . ILE A 1 2  ? 0.818   17.149 -10.287 1.00 32.80 ? 2  ILE A CA  1 
ATOM   7   C  C   . ILE A 1 2  ? 0.724   15.913 -11.176 1.00 34.02 ? 2  ILE A C   1 
ATOM   8   O  O   . ILE A 1 2  ? 1.734   15.241 -11.392 1.00 34.49 ? 2  ILE A O   1 
ATOM   9   C  CB  . ILE A 1 2  ? 0.638   16.800 -8.773  1.00 32.88 ? 2  ILE A CB  1 
ATOM   10  C  CG1 . ILE A 1 2  ? 1.740   15.833 -8.362  1.00 33.56 ? 2  ILE A CG1 1 
ATOM   11  C  CG2 . ILE A 1 2  ? -0.764  16.254 -8.495  1.00 32.49 ? 2  ILE A CG2 1 
ATOM   12  C  CD1 . ILE A 1 2  ? 1.785   15.527 -6.858  1.00 33.92 ? 2  ILE A CD1 1 
ATOM   13  N  N   . VAL A 1 3  ? -0.460  15.636 -11.747 1.00 35.70 ? 3  VAL A N   1 
ATOM   14  C  CA  . VAL A 1 3  ? -0.706  14.476 -12.610 1.00 34.30 ? 3  VAL A CA  1 
ATOM   15  C  C   . VAL A 1 3  ? -0.125  14.640 -14.027 1.00 37.62 ? 3  VAL A C   1 
ATOM   16  O  O   . VAL A 1 3  ? -0.050  13.689 -14.813 1.00 38.28 ? 3  VAL A O   1 
ATOM   17  C  CB  . VAL A 1 3  ? -2.245  14.228 -12.639 1.00 29.85 ? 3  VAL A CB  1 
ATOM   18  C  CG1 . VAL A 1 3  ? -2.575  12.895 -13.288 1.00 25.25 ? 3  VAL A CG1 1 
ATOM   19  C  CG2 . VAL A 1 3  ? -2.783  14.158 -11.219 1.00 25.64 ? 3  VAL A CG2 1 
ATOM   20  N  N   . GLU A 1 4  ? 0.308   15.858 -14.379 1.00 40.01 ? 4  GLU A N   1 
ATOM   21  C  CA  . GLU A 1 4  ? 0.967   16.137 -15.651 1.00 41.26 ? 4  GLU A CA  1 
ATOM   22  C  C   . GLU A 1 4  ? 2.491   16.108 -15.455 1.00 39.70 ? 4  GLU A C   1 
ATOM   23  O  O   . GLU A 1 4  ? 3.247   15.745 -16.362 1.00 39.10 ? 4  GLU A O   1 
ATOM   24  C  CB  . GLU A 1 4  ? 0.454   17.509 -16.154 1.00 44.50 ? 4  GLU A CB  1 
ATOM   25  C  CG  . GLU A 1 4  ? 1.425   18.646 -16.553 1.00 47.43 ? 4  GLU A CG  1 
ATOM   26  C  CD  . GLU A 1 4  ? 1.505   18.978 -18.047 1.00 48.28 ? 4  GLU A CD  1 
ATOM   27  O  OE1 . GLU A 1 4  ? 1.392   18.078 -18.877 1.00 47.74 ? 4  GLU A OE1 1 
ATOM   28  O  OE2 . GLU A 1 4  ? 1.671   20.150 -18.388 1.00 50.21 ? 4  GLU A OE2 1 
ATOM   29  N  N   . GLN A 1 5  ? 2.958   16.488 -14.258 1.00 36.57 ? 5  GLN A N   1 
ATOM   30  C  CA  . GLN A 1 5  ? 4.378   16.491 -13.964 1.00 35.62 ? 5  GLN A CA  1 
ATOM   31  C  C   . GLN A 1 5  ? 4.893   15.171 -13.435 1.00 36.24 ? 5  GLN A C   1 
ATOM   32  O  O   . GLN A 1 5  ? 5.817   14.602 -14.017 1.00 37.62 ? 5  GLN A O   1 
ATOM   33  C  CB  . GLN A 1 5  ? 4.765   17.532 -12.919 1.00 34.39 ? 5  GLN A CB  1 
ATOM   34  C  CG  . GLN A 1 5  ? 4.822   18.983 -13.340 1.00 31.47 ? 5  GLN A CG  1 
ATOM   35  C  CD  . GLN A 1 5  ? 5.616   19.789 -12.328 1.00 30.68 ? 5  GLN A CD  1 
ATOM   36  O  OE1 . GLN A 1 5  ? 5.480   19.631 -11.116 1.00 31.36 ? 5  GLN A OE1 1 
ATOM   37  N  NE2 . GLN A 1 5  ? 6.502   20.659 -12.802 1.00 33.19 ? 5  GLN A NE2 1 
ATOM   38  N  N   . CYS A 1 6  ? 4.317   14.688 -12.329 1.00 35.03 ? 6  CYS A N   1 
ATOM   39  C  CA  . CYS A 1 6  ? 4.816   13.486 -11.692 1.00 34.33 ? 6  CYS A CA  1 
ATOM   40  C  C   . CYS A 1 6  ? 4.243   12.157 -12.166 1.00 33.52 ? 6  CYS A C   1 
ATOM   41  O  O   . CYS A 1 6  ? 4.818   11.107 -11.868 1.00 33.89 ? 6  CYS A O   1 
ATOM   42  C  CB  . CYS A 1 6  ? 4.622   13.650 -10.193 1.00 35.07 ? 6  CYS A CB  1 
ATOM   43  S  SG  . CYS A 1 6  ? 5.455   15.113 -9.509  1.00 36.28 ? 6  CYS A SG  1 
ATOM   44  N  N   . CYS A 1 7  ? 3.141   12.166 -12.924 1.00 32.78 ? 7  CYS A N   1 
ATOM   45  C  CA  . CYS A 1 7  ? 2.589   10.931 -13.452 1.00 32.65 ? 7  CYS A CA  1 
ATOM   46  C  C   . CYS A 1 7  ? 2.826   10.842 -14.954 1.00 32.78 ? 7  CYS A C   1 
ATOM   47  O  O   . CYS A 1 7  ? 3.340   9.822  -15.413 1.00 36.21 ? 7  CYS A O   1 
ATOM   48  C  CB  . CYS A 1 7  ? 1.092   10.868 -13.114 1.00 32.49 ? 7  CYS A CB  1 
ATOM   49  S  SG  . CYS A 1 7  ? 0.233   9.336  -13.577 1.00 32.88 ? 7  CYS A SG  1 
ATOM   50  N  N   . LYS A 1 8  ? 2.506   11.865 -15.758 1.00 32.12 ? 8  LYS A N   1 
ATOM   51  C  CA  . LYS A 1 8  ? 2.760   11.836 -17.197 1.00 32.55 ? 8  LYS A CA  1 
ATOM   52  C  C   . LYS A 1 8  ? 4.220   11.992 -17.605 1.00 34.67 ? 8  LYS A C   1 
ATOM   53  O  O   . LYS A 1 8  ? 4.620   11.688 -18.729 1.00 37.10 ? 8  LYS A O   1 
ATOM   54  C  CB  . LYS A 1 8  ? 1.978   12.923 -17.881 1.00 34.03 ? 8  LYS A CB  1 
ATOM   55  C  CG  . LYS A 1 8  ? 0.830   12.382 -18.704 1.00 38.53 ? 8  LYS A CG  1 
ATOM   56  C  CD  . LYS A 1 8  ? -0.055  13.525 -19.201 1.00 42.93 ? 8  LYS A CD  1 
ATOM   57  C  CE  . LYS A 1 8  ? 0.534   14.170 -20.453 1.00 45.38 ? 8  LYS A CE  1 
ATOM   58  N  NZ  . LYS A 1 8  ? 0.149   15.564 -20.550 1.00 45.28 ? 8  LYS A NZ  1 
ATOM   59  N  N   . SER A 1 9  ? 5.010   12.539 -16.681 1.00 36.44 ? 9  SER A N   1 
ATOM   60  C  CA  . SER A 1 9  ? 6.451   12.701 -16.807 1.00 35.43 ? 9  SER A CA  1 
ATOM   61  C  C   . SER A 1 9  ? 7.042   12.204 -15.486 1.00 35.52 ? 9  SER A C   1 
ATOM   62  O  O   . SER A 1 9  ? 6.332   11.639 -14.647 1.00 37.39 ? 9  SER A O   1 
ATOM   63  C  CB  . SER A 1 9  ? 6.809   14.180 -17.021 1.00 35.83 ? 9  SER A CB  1 
ATOM   64  O  OG  . SER A 1 9  ? 6.220   14.751 -18.184 1.00 36.05 ? 9  SER A OG  1 
ATOM   65  N  N   . ILE A 1 10 ? 8.339   12.390 -15.234 1.00 33.87 ? 10 ILE A N   1 
ATOM   66  C  CA  . ILE A 1 10 ? 8.932   11.928 -13.987 1.00 32.64 ? 10 ILE A CA  1 
ATOM   67  C  C   . ILE A 1 10 ? 9.333   13.111 -13.111 1.00 34.11 ? 10 ILE A C   1 
ATOM   68  O  O   . ILE A 1 10 ? 9.790   14.151 -13.591 1.00 34.03 ? 10 ILE A O   1 
ATOM   69  C  CB  . ILE A 1 10 ? 10.133  11.025 -14.350 1.00 32.55 ? 10 ILE A CB  1 
ATOM   70  C  CG1 . ILE A 1 10 ? 9.657   9.839  -15.178 1.00 29.07 ? 10 ILE A CG1 1 
ATOM   71  C  CG2 . ILE A 1 10 ? 10.792  10.496 -13.085 1.00 34.40 ? 10 ILE A CG2 1 
ATOM   72  C  CD1 . ILE A 1 10 ? 10.768  8.985  -15.816 1.00 33.43 ? 10 ILE A CD1 1 
ATOM   73  N  N   . CYS A 1 11 ? 9.118   12.945 -11.802 1.00 34.62 ? 11 CYS A N   1 
ATOM   74  C  CA  . CYS A 1 11 ? 9.442   13.954 -10.808 1.00 35.37 ? 11 CYS A CA  1 
ATOM   75  C  C   . CYS A 1 11 ? 10.533  13.540 -9.853  1.00 36.52 ? 11 CYS A C   1 
ATOM   76  O  O   . CYS A 1 11 ? 10.487  12.483 -9.218  1.00 37.99 ? 11 CYS A O   1 
ATOM   77  C  CB  . CYS A 1 11 ? 8.259   14.322 -9.918  1.00 35.24 ? 11 CYS A CB  1 
ATOM   78  S  SG  . CYS A 1 11 ? 7.035   15.375 -10.719 1.00 37.89 ? 11 CYS A SG  1 
ATOM   79  N  N   . SER A 1 12 ? 11.495  14.455 -9.744  1.00 36.16 ? 12 SER A N   1 
ATOM   80  C  CA  . SER A 1 12 ? 12.548  14.348 -8.750  1.00 36.36 ? 12 SER A CA  1 
ATOM   81  C  C   . SER A 1 12 ? 12.003  14.773 -7.383  1.00 34.94 ? 12 SER A C   1 
ATOM   82  O  O   . SER A 1 12 ? 10.869  15.247 -7.264  1.00 33.72 ? 12 SER A O   1 
ATOM   83  C  CB  . SER A 1 12 ? 13.712  15.246 -9.146  1.00 39.46 ? 12 SER A CB  1 
ATOM   84  O  OG  . SER A 1 12 ? 13.347  16.620 -9.177  1.00 43.61 ? 12 SER A OG  1 
ATOM   85  N  N   . LEU A 1 13 ? 12.817  14.636 -6.334  1.00 33.16 ? 13 LEU A N   1 
ATOM   86  C  CA  . LEU A 1 13 ? 12.424  14.969 -4.970  1.00 31.14 ? 13 LEU A CA  1 
ATOM   87  C  C   . LEU A 1 13 ? 11.953  16.414 -4.788  1.00 33.41 ? 13 LEU A C   1 
ATOM   88  O  O   . LEU A 1 13 ? 11.031  16.690 -4.017  1.00 36.26 ? 13 LEU A O   1 
ATOM   89  C  CB  . LEU A 1 13 ? 13.619  14.671 -4.069  1.00 26.67 ? 13 LEU A CB  1 
ATOM   90  C  CG  . LEU A 1 13 ? 13.510  14.853 -2.565  1.00 26.85 ? 13 LEU A CG  1 
ATOM   91  C  CD1 . LEU A 1 13 ? 12.440  13.940 -2.024  1.00 24.82 ? 13 LEU A CD1 1 
ATOM   92  C  CD2 . LEU A 1 13 ? 14.838  14.531 -1.914  1.00 24.97 ? 13 LEU A CD2 1 
ATOM   93  N  N   . TYR A 1 14 ? 12.543  17.343 -5.547  1.00 32.65 ? 14 TYR A N   1 
ATOM   94  C  CA  . TYR A 1 14 ? 12.244  18.762 -5.424  1.00 31.28 ? 14 TYR A CA  1 
ATOM   95  C  C   . TYR A 1 14 ? 10.970  19.156 -6.151  1.00 30.62 ? 14 TYR A C   1 
ATOM   96  O  O   . TYR A 1 14 ? 10.173  19.903 -5.585  1.00 31.24 ? 14 TYR A O   1 
ATOM   97  C  CB  . TYR A 1 14 ? 13.440  19.563 -5.951  1.00 31.82 ? 14 TYR A CB  1 
ATOM   98  C  CG  . TYR A 1 14 ? 14.748  19.088 -5.319  1.00 36.02 ? 14 TYR A CG  1 
ATOM   99  C  CD1 . TYR A 1 14 ? 14.930  19.148 -3.933  1.00 34.42 ? 14 TYR A CD1 1 
ATOM   100 C  CD2 . TYR A 1 14 ? 15.745  18.534 -6.128  1.00 36.51 ? 14 TYR A CD2 1 
ATOM   101 C  CE1 . TYR A 1 14 ? 16.099  18.649 -3.364  1.00 34.72 ? 14 TYR A CE1 1 
ATOM   102 C  CE2 . TYR A 1 14 ? 16.916  18.036 -5.557  1.00 35.00 ? 14 TYR A CE2 1 
ATOM   103 C  CZ  . TYR A 1 14 ? 17.085  18.096 -4.175  1.00 36.64 ? 14 TYR A CZ  1 
ATOM   104 O  OH  . TYR A 1 14 ? 18.241  17.600 -3.604  1.00 36.40 ? 14 TYR A OH  1 
ATOM   105 N  N   . GLN A 1 15 ? 10.721  18.647 -7.369  1.00 30.03 ? 15 GLN A N   1 
ATOM   106 C  CA  . GLN A 1 15 ? 9.494   18.943 -8.114  1.00 30.38 ? 15 GLN A CA  1 
ATOM   107 C  C   . GLN A 1 15 ? 8.209   18.405 -7.503  1.00 30.15 ? 15 GLN A C   1 
ATOM   108 O  O   . GLN A 1 15 ? 7.103   18.714 -7.943  1.00 31.86 ? 15 GLN A O   1 
ATOM   109 C  CB  . GLN A 1 15 ? 9.560   18.396 -9.525  1.00 29.64 ? 15 GLN A CB  1 
ATOM   110 C  CG  . GLN A 1 15 ? 10.559  19.142 -10.371 1.00 33.31 ? 15 GLN A CG  1 
ATOM   111 C  CD  . GLN A 1 15 ? 10.294  18.983 -11.855 1.00 36.98 ? 15 GLN A CD  1 
ATOM   112 O  OE1 . GLN A 1 15 ? 10.129  19.965 -12.576 1.00 40.73 ? 15 GLN A OE1 1 
ATOM   113 N  NE2 . GLN A 1 15 ? 10.241  17.753 -12.360 1.00 39.12 ? 15 GLN A NE2 1 
ATOM   114 N  N   . LEU A 1 16 ? 8.391   17.562 -6.492  1.00 31.45 ? 16 LEU A N   1 
ATOM   115 C  CA  . LEU A 1 16 ? 7.325   16.944 -5.747  1.00 31.83 ? 16 LEU A CA  1 
ATOM   116 C  C   . LEU A 1 16 ? 7.108   17.719 -4.455  1.00 32.46 ? 16 LEU A C   1 
ATOM   117 O  O   . LEU A 1 16 ? 5.974   17.799 -3.982  1.00 33.74 ? 16 LEU A O   1 
ATOM   118 C  CB  . LEU A 1 16 ? 7.731   15.519 -5.482  1.00 31.51 ? 16 LEU A CB  1 
ATOM   119 C  CG  . LEU A 1 16 ? 6.696   14.516 -5.035  1.00 32.61 ? 16 LEU A CG  1 
ATOM   120 C  CD1 . LEU A 1 16 ? 5.605   14.359 -6.077  1.00 32.91 ? 16 LEU A CD1 1 
ATOM   121 C  CD2 . LEU A 1 16 ? 7.390   13.184 -4.839  1.00 37.42 ? 16 LEU A CD2 1 
ATOM   122 N  N   . GLU A 1 17 ? 8.176   18.308 -3.879  1.00 33.11 ? 17 GLU A N   1 
ATOM   123 C  CA  . GLU A 1 17 ? 8.103   19.127 -2.667  1.00 30.40 ? 17 GLU A CA  1 
ATOM   124 C  C   . GLU A 1 17 ? 7.384   20.453 -2.839  1.00 27.57 ? 17 GLU A C   1 
ATOM   125 O  O   . GLU A 1 17 ? 6.958   21.067 -1.862  1.00 26.81 ? 17 GLU A O   1 
ATOM   126 C  CB  . GLU A 1 17 ? 9.487   19.432 -2.138  1.00 32.96 ? 17 GLU A CB  1 
ATOM   127 C  CG  . GLU A 1 17 ? 10.043  18.262 -1.366  1.00 35.44 ? 17 GLU A CG  1 
ATOM   128 C  CD  . GLU A 1 17 ? 11.409  18.512 -0.762  1.00 39.50 ? 17 GLU A CD  1 
ATOM   129 O  OE1 . GLU A 1 17 ? 11.467  18.993 0.371   1.00 39.84 ? 17 GLU A OE1 1 
ATOM   130 O  OE2 . GLU A 1 17 ? 12.405  18.221 -1.429  1.00 43.70 ? 17 GLU A OE2 1 
ATOM   131 N  N   . ASN A 1 18 ? 7.241   20.910 -4.086  1.00 25.88 ? 18 ASN A N   1 
ATOM   132 C  CA  . ASN A 1 18 ? 6.457   22.094 -4.403  1.00 26.80 ? 18 ASN A CA  1 
ATOM   133 C  C   . ASN A 1 18 ? 4.961   21.862 -4.187  1.00 26.00 ? 18 ASN A C   1 
ATOM   134 O  O   . ASN A 1 18 ? 4.151   22.789 -4.211  1.00 25.43 ? 18 ASN A O   1 
ATOM   135 C  CB  . ASN A 1 18 ? 6.710   22.490 -5.852  1.00 27.50 ? 18 ASN A CB  1 
ATOM   136 C  CG  . ASN A 1 18 ? 8.122   23.008 -6.086  1.00 29.60 ? 18 ASN A CG  1 
ATOM   137 O  OD1 . ASN A 1 18 ? 8.814   22.580 -7.012  1.00 31.89 ? 18 ASN A OD1 1 
ATOM   138 N  ND2 . ASN A 1 18 ? 8.585   23.941 -5.254  1.00 29.36 ? 18 ASN A ND2 1 
ATOM   139 N  N   . TYR A 1 19 ? 4.581   20.598 -3.971  1.00 24.89 ? 19 TYR A N   1 
ATOM   140 C  CA  . TYR A 1 19 ? 3.211   20.236 -3.681  1.00 23.14 ? 19 TYR A CA  1 
ATOM   141 C  C   . TYR A 1 19 ? 2.983   20.041 -2.187  1.00 24.31 ? 19 TYR A C   1 
ATOM   142 O  O   . TYR A 1 19 ? 1.908   19.621 -1.768  1.00 26.43 ? 19 TYR A O   1 
ATOM   143 C  CB  . TYR A 1 19 ? 2.872   18.980 -4.484  1.00 19.51 ? 19 TYR A CB  1 
ATOM   144 C  CG  . TYR A 1 19 ? 2.875   19.268 -5.984  1.00 18.44 ? 19 TYR A CG  1 
ATOM   145 C  CD1 . TYR A 1 19 ? 1.872   20.069 -6.538  1.00 18.89 ? 19 TYR A CD1 1 
ATOM   146 C  CD2 . TYR A 1 19 ? 3.884   18.758 -6.805  1.00 17.44 ? 19 TYR A CD2 1 
ATOM   147 C  CE1 . TYR A 1 19 ? 1.880   20.363 -7.905  1.00 20.10 ? 19 TYR A CE1 1 
ATOM   148 C  CE2 . TYR A 1 19 ? 3.897   19.048 -8.173  1.00 18.49 ? 19 TYR A CE2 1 
ATOM   149 C  CZ  . TYR A 1 19 ? 2.894   19.851 -8.712  1.00 22.13 ? 19 TYR A CZ  1 
ATOM   150 O  OH  . TYR A 1 19 ? 2.899   20.146 -10.061 1.00 24.74 ? 19 TYR A OH  1 
ATOM   151 N  N   . CYS A 1 20 ? 3.980   20.364 -1.347  1.00 25.55 ? 20 CYS A N   1 
ATOM   152 C  CA  . CYS A 1 20 ? 3.793   20.379 0.101   1.00 26.39 ? 20 CYS A CA  1 
ATOM   153 C  C   . CYS A 1 20 ? 3.220   21.731 0.511   1.00 27.82 ? 20 CYS A C   1 
ATOM   154 O  O   . CYS A 1 20 ? 3.088   22.649 -0.301  1.00 31.12 ? 20 CYS A O   1 
ATOM   155 C  CB  . CYS A 1 20 ? 5.094   20.220 0.879   1.00 26.30 ? 20 CYS A CB  1 
ATOM   156 S  SG  . CYS A 1 20 ? 6.074   18.736 0.561   1.00 33.92 ? 20 CYS A SG  1 
ATOM   157 N  N   . ASN A 1 21 ? 2.893   21.881 1.795   1.00 28.75 ? 21 ASN A N   1 
ATOM   158 C  CA  . ASN A 1 21 ? 2.371   23.131 2.322   1.00 29.21 ? 21 ASN A CA  1 
ATOM   159 C  C   . ASN A 1 21 ? 3.461   24.037 2.913   1.00 32.24 ? 21 ASN A C   1 
ATOM   160 O  O   . ASN A 1 21 ? 4.615   23.921 2.489   1.00 33.47 ? 21 ASN A O   1 
ATOM   161 C  CB  . ASN A 1 21 ? 1.301   22.765 3.354   1.00 26.97 ? 21 ASN A CB  1 
ATOM   162 C  CG  . ASN A 1 21 ? 0.102   22.058 2.740   1.00 25.43 ? 21 ASN A CG  1 
ATOM   163 O  OD1 . ASN A 1 21 ? -0.232  22.230 1.568   1.00 25.73 ? 21 ASN A OD1 1 
ATOM   164 N  ND2 . ASN A 1 21 ? -0.574  21.234 3.528   1.00 23.69 ? 21 ASN A ND2 1 
ATOM   165 O  OXT . ASN A 1 21 ? 3.162   24.879 3.765   1.00 34.30 ? 21 ASN A OXT 1 
ATOM   166 N  N   . PHE B 2 1  ? 15.627  10.310 -4.602  1.00 32.30 ? 1  PHE B N   1 
ATOM   167 C  CA  . PHE B 2 1  ? 14.306  9.754  -4.812  1.00 29.72 ? 1  PHE B CA  1 
ATOM   168 C  C   . PHE B 2 1  ? 14.230  8.924  -6.096  1.00 29.19 ? 1  PHE B C   1 
ATOM   169 O  O   . PHE B 2 1  ? 15.016  9.129  -7.024  1.00 28.86 ? 1  PHE B O   1 
ATOM   170 C  CB  . PHE B 2 1  ? 13.316  10.907 -4.843  1.00 27.59 ? 1  PHE B CB  1 
ATOM   171 C  CG  . PHE B 2 1  ? 11.987  10.524 -4.221  1.00 25.93 ? 1  PHE B CG  1 
ATOM   172 C  CD1 . PHE B 2 1  ? 11.941  10.145 -2.877  1.00 24.50 ? 1  PHE B CD1 1 
ATOM   173 C  CD2 . PHE B 2 1  ? 10.823  10.537 -4.991  1.00 24.84 ? 1  PHE B CD2 1 
ATOM   174 C  CE1 . PHE B 2 1  ? 10.726  9.777  -2.304  1.00 22.17 ? 1  PHE B CE1 1 
ATOM   175 C  CE2 . PHE B 2 1  ? 9.611   10.166 -4.408  1.00 23.56 ? 1  PHE B CE2 1 
ATOM   176 C  CZ  . PHE B 2 1  ? 9.561   9.787  -3.069  1.00 23.09 ? 1  PHE B CZ  1 
ATOM   177 N  N   . VAL B 2 2  ? 13.274  7.986  -6.166  1.00 27.50 ? 2  VAL B N   1 
ATOM   178 C  CA  . VAL B 2 2  ? 13.114  7.055  -7.281  1.00 29.52 ? 2  VAL B CA  1 
ATOM   179 C  C   . VAL B 2 2  ? 12.891  7.729  -8.641  1.00 32.53 ? 2  VAL B C   1 
ATOM   180 O  O   . VAL B 2 2  ? 12.277  8.795  -8.748  1.00 33.88 ? 2  VAL B O   1 
ATOM   181 C  CB  . VAL B 2 2  ? 11.956  6.085  -6.862  1.00 28.41 ? 2  VAL B CB  1 
ATOM   182 C  CG1 . VAL B 2 2  ? 10.604  6.764  -6.947  1.00 31.45 ? 2  VAL B CG1 1 
ATOM   183 C  CG2 . VAL B 2 2  ? 11.996  4.855  -7.740  1.00 28.76 ? 2  VAL B CG2 1 
ATOM   184 N  N   . ASN B 2 3  ? 13.445  7.120  -9.699  1.00 36.80 ? 3  ASN B N   1 
ATOM   185 C  CA  . ASN B 2 3  ? 13.381  7.672  -11.044 1.00 39.45 ? 3  ASN B CA  1 
ATOM   186 C  C   . ASN B 2 3  ? 12.181  7.160  -11.833 1.00 41.17 ? 3  ASN B C   1 
ATOM   187 O  O   . ASN B 2 3  ? 12.173  7.238  -13.064 1.00 43.00 ? 3  ASN B O   1 
ATOM   188 C  CB  . ASN B 2 3  ? 14.705  7.313  -11.736 1.00 43.85 ? 3  ASN B CB  1 
ATOM   189 C  CG  . ASN B 2 3  ? 15.181  8.218  -12.875 1.00 46.61 ? 3  ASN B CG  1 
ATOM   190 O  OD1 . ASN B 2 3  ? 14.447  8.579  -13.795 1.00 46.14 ? 3  ASN B OD1 1 
ATOM   191 N  ND2 . ASN B 2 3  ? 16.461  8.589  -12.853 1.00 49.47 ? 3  ASN B ND2 1 
ATOM   192 N  N   . GLN B 2 4  ? 11.095  6.712  -11.185 1.00 42.43 ? 4  GLN B N   1 
ATOM   193 C  CA  . GLN B 2 4  ? 9.923   6.224  -11.915 1.00 43.54 ? 4  GLN B CA  1 
ATOM   194 C  C   . GLN B 2 4  ? 8.772   7.223  -11.978 1.00 42.33 ? 4  GLN B C   1 
ATOM   195 O  O   . GLN B 2 4  ? 8.779   8.259  -11.310 1.00 41.66 ? 4  GLN B O   1 
ATOM   196 C  CB  . GLN B 2 4  ? 9.380   4.924  -11.290 1.00 45.12 ? 4  GLN B CB  1 
ATOM   197 C  CG  . GLN B 2 4  ? 8.753   5.050  -9.892  1.00 47.23 ? 4  GLN B CG  1 
ATOM   198 C  CD  . GLN B 2 4  ? 7.488   4.222  -9.673  1.00 47.74 ? 4  GLN B CD  1 
ATOM   199 O  OE1 . GLN B 2 4  ? 6.806   3.802  -10.611 1.00 47.48 ? 4  GLN B OE1 1 
ATOM   200 N  NE2 . GLN B 2 4  ? 7.123   3.979  -8.416  1.00 46.14 ? 4  GLN B NE2 1 
ATOM   201 N  N   . HIS B 2 5  ? 7.778   6.891  -12.813 1.00 40.67 ? 5  HIS B N   1 
ATOM   202 C  CA  . HIS B 2 5  ? 6.534   7.641  -12.923 1.00 38.20 ? 5  HIS B CA  1 
ATOM   203 C  C   . HIS B 2 5  ? 5.680   7.248  -11.722 1.00 37.62 ? 5  HIS B C   1 
ATOM   204 O  O   . HIS B 2 5  ? 5.408   6.068  -11.489 1.00 37.60 ? 5  HIS B O   1 
ATOM   205 C  CB  . HIS B 2 5  ? 5.775   7.276  -14.195 1.00 38.52 ? 5  HIS B CB  1 
ATOM   206 C  CG  . HIS B 2 5  ? 6.464   7.659  -15.496 1.00 38.68 ? 5  HIS B CG  1 
ATOM   207 N  ND1 . HIS B 2 5  ? 6.166   8.686  -16.282 1.00 38.59 ? 5  HIS B ND1 1 
ATOM   208 C  CD2 . HIS B 2 5  ? 7.509   6.971  -16.063 1.00 40.41 ? 5  HIS B CD2 1 
ATOM   209 C  CE1 . HIS B 2 5  ? 6.994   8.630  -17.299 1.00 39.89 ? 5  HIS B CE1 1 
ATOM   210 N  NE2 . HIS B 2 5  ? 7.801   7.602  -17.167 1.00 40.08 ? 5  HIS B NE2 1 
ATOM   211 N  N   . LEU B 2 6  ? 5.289   8.234  -10.919 1.00 35.09 ? 6  LEU B N   1 
ATOM   212 C  CA  . LEU B 2 6  ? 4.489   7.999  -9.729  1.00 31.96 ? 6  LEU B CA  1 
ATOM   213 C  C   . LEU B 2 6  ? 3.023   8.330  -9.962  1.00 31.19 ? 6  LEU B C   1 
ATOM   214 O  O   . LEU B 2 6  ? 2.660   9.479  -10.198 1.00 32.18 ? 6  LEU B O   1 
ATOM   215 C  CB  . LEU B 2 6  ? 5.049   8.850  -8.611  1.00 30.65 ? 6  LEU B CB  1 
ATOM   216 C  CG  . LEU B 2 6  ? 6.413   8.504  -8.072  1.00 26.29 ? 6  LEU B CG  1 
ATOM   217 C  CD1 . LEU B 2 6  ? 6.952   9.671  -7.270  1.00 27.81 ? 6  LEU B CD1 1 
ATOM   218 C  CD2 . LEU B 2 6  ? 6.305   7.248  -7.229  1.00 27.89 ? 6  LEU B CD2 1 
ATOM   219 N  N   . CYS B 2 7  ? 2.144   7.337  -9.913  1.00 31.18 ? 7  CYS B N   1 
ATOM   220 C  CA  . CYS B 2 7  ? 0.735   7.593  -10.156 1.00 31.25 ? 7  CYS B CA  1 
ATOM   221 C  C   . CYS B 2 7  ? -0.172  7.026  -9.079  1.00 30.49 ? 7  CYS B C   1 
ATOM   222 O  O   . CYS B 2 7  ? 0.297   6.350  -8.166  1.00 29.08 ? 7  CYS B O   1 
ATOM   223 C  CB  . CYS B 2 7  ? 0.351   7.010  -11.504 1.00 31.05 ? 7  CYS B CB  1 
ATOM   224 S  SG  . CYS B 2 7  ? 1.269   7.742  -12.881 1.00 36.33 ? 7  CYS B SG  1 
ATOM   225 N  N   . GLY B 2 8  ? -1.470  7.368  -9.178  1.00 29.12 ? 8  GLY B N   1 
ATOM   226 C  CA  . GLY B 2 8  ? -2.535  6.901  -8.297  1.00 24.39 ? 8  GLY B CA  1 
ATOM   227 C  C   . GLY B 2 8  ? -2.264  7.144  -6.828  1.00 23.34 ? 8  GLY B C   1 
ATOM   228 O  O   . GLY B 2 8  ? -1.849  8.225  -6.416  1.00 22.95 ? 8  GLY B O   1 
ATOM   229 N  N   . SER B 2 9  ? -2.478  6.079  -6.051  1.00 22.13 ? 9  SER B N   1 
ATOM   230 C  CA  . SER B 2 9  ? -2.246  6.124  -4.619  1.00 20.49 ? 9  SER B CA  1 
ATOM   231 C  C   . SER B 2 9  ? -0.764  6.120  -4.280  1.00 19.88 ? 9  SER B C   1 
ATOM   232 O  O   . SER B 2 9  ? -0.411  6.497  -3.166  1.00 21.41 ? 9  SER B O   1 
ATOM   233 C  CB  . SER B 2 9  ? -2.949  4.937  -3.940  1.00 18.88 ? 9  SER B CB  1 
ATOM   234 O  OG  . SER B 2 9  ? -2.551  3.655  -4.399  1.00 15.66 ? 9  SER B OG  1 
ATOM   235 N  N   . HIS B 2 10 ? 0.116   5.724  -5.217  1.00 20.80 ? 10 HIS B N   1 
ATOM   236 C  CA  . HIS B 2 10 ? 1.567   5.731  -5.032  1.00 21.48 ? 10 HIS B CA  1 
ATOM   237 C  C   . HIS B 2 10 ? 2.120   7.148  -5.058  1.00 21.79 ? 10 HIS B C   1 
ATOM   238 O  O   . HIS B 2 10 ? 3.071   7.465  -4.346  1.00 20.66 ? 10 HIS B O   1 
ATOM   239 C  CB  . HIS B 2 10 ? 2.260   4.922  -6.126  1.00 18.29 ? 10 HIS B CB  1 
ATOM   240 C  CG  . HIS B 2 10 ? 1.888   3.449  -6.099  1.00 19.28 ? 10 HIS B CG  1 
ATOM   241 N  ND1 . HIS B 2 10 ? 1.763   2.679  -5.028  1.00 18.01 ? 10 HIS B ND1 1 
ATOM   242 C  CD2 . HIS B 2 10 ? 1.596   2.701  -7.210  1.00 18.12 ? 10 HIS B CD2 1 
ATOM   243 C  CE1 . HIS B 2 10 ? 1.403   1.500  -5.466  1.00 20.11 ? 10 HIS B CE1 1 
ATOM   244 N  NE2 . HIS B 2 10 ? 1.301   1.511  -6.770  1.00 20.74 ? 10 HIS B NE2 1 
ATOM   245 N  N   . LEU B 2 11 ? 1.506   8.007  -5.881  1.00 23.18 ? 11 LEU B N   1 
ATOM   246 C  CA  . LEU B 2 11 ? 1.838   9.420  -5.958  1.00 20.40 ? 11 LEU B CA  1 
ATOM   247 C  C   . LEU B 2 11 ? 1.475   10.143 -4.666  1.00 22.05 ? 11 LEU B C   1 
ATOM   248 O  O   . LEU B 2 11 ? 2.219   11.017 -4.219  1.00 26.06 ? 11 LEU B O   1 
ATOM   249 C  CB  . LEU B 2 11 ? 1.089   10.044 -7.127  1.00 19.97 ? 11 LEU B CB  1 
ATOM   250 C  CG  . LEU B 2 11 ? 1.224   11.526 -7.429  1.00 18.44 ? 11 LEU B CG  1 
ATOM   251 C  CD1 . LEU B 2 11 ? 2.682   11.849 -7.678  1.00 18.43 ? 11 LEU B CD1 1 
ATOM   252 C  CD2 . LEU B 2 11 ? 0.378   11.885 -8.637  1.00 15.35 ? 11 LEU B CD2 1 
ATOM   253 N  N   . VAL B 2 12 ? 0.334   9.784  -4.059  1.00 21.10 ? 12 VAL B N   1 
ATOM   254 C  CA  . VAL B 2 12 ? -0.143  10.362 -2.805  1.00 18.22 ? 12 VAL B CA  1 
ATOM   255 C  C   . VAL B 2 12 ? 0.723   9.902  -1.633  1.00 17.80 ? 12 VAL B C   1 
ATOM   256 O  O   . VAL B 2 12 ? 0.979   10.645 -0.687  1.00 18.46 ? 12 VAL B O   1 
ATOM   257 C  CB  . VAL B 2 12 ? -1.623  9.949  -2.614  1.00 14.56 ? 12 VAL B CB  1 
ATOM   258 C  CG1 . VAL B 2 12 ? -2.201  10.475 -1.322  1.00 14.35 ? 12 VAL B CG1 1 
ATOM   259 C  CG2 . VAL B 2 12 ? -2.443  10.565 -3.719  1.00 13.37 ? 12 VAL B CG2 1 
ATOM   260 N  N   . GLU B 2 13 ? 1.198   8.658  -1.708  1.00 18.35 ? 13 GLU B N   1 
ATOM   261 C  CA  . GLU B 2 13 ? 2.057   8.078  -0.696  1.00 17.65 ? 13 GLU B CA  1 
ATOM   262 C  C   . GLU B 2 13 ? 3.491   8.600  -0.809  1.00 17.45 ? 13 GLU B C   1 
ATOM   263 O  O   . GLU B 2 13 ? 4.222   8.654  0.183   1.00 16.60 ? 13 GLU B O   1 
ATOM   264 C  CB  . GLU B 2 13 ? 1.968   6.579  -0.873  1.00 19.99 ? 13 GLU B CB  1 
ATOM   265 C  CG  . GLU B 2 13 ? 2.294   5.763  0.367   1.00 25.15 ? 13 GLU B CG  1 
ATOM   266 C  CD  . GLU B 2 13 ? 1.510   6.117  1.624   1.00 30.17 ? 13 GLU B CD  1 
ATOM   267 O  OE1 . GLU B 2 13 ? 0.298   6.349  1.559   1.00 32.47 ? 13 GLU B OE1 1 
ATOM   268 O  OE2 . GLU B 2 13 ? 2.133   6.153  2.684   1.00 34.18 ? 13 GLU B OE2 1 
ATOM   269 N  N   . ALA B 2 14 ? 3.907   9.003  -2.021  1.00 16.69 ? 14 ALA B N   1 
ATOM   270 C  CA  . ALA B 2 14 ? 5.192   9.655  -2.244  1.00 16.52 ? 14 ALA B CA  1 
ATOM   271 C  C   . ALA B 2 14 ? 5.153   11.004 -1.541  1.00 18.56 ? 14 ALA B C   1 
ATOM   272 O  O   . ALA B 2 14 ? 6.000   11.275 -0.693  1.00 21.11 ? 14 ALA B O   1 
ATOM   273 C  CB  . ALA B 2 14 ? 5.428   9.889  -3.722  1.00 12.59 ? 14 ALA B CB  1 
ATOM   274 N  N   . LEU B 2 15 ? 4.110   11.804 -1.829  1.00 20.01 ? 15 LEU B N   1 
ATOM   275 C  CA  . LEU B 2 15 ? 3.855   13.096 -1.199  1.00 19.37 ? 15 LEU B CA  1 
ATOM   276 C  C   . LEU B 2 15 ? 3.781   13.049 0.323   1.00 18.53 ? 15 LEU B C   1 
ATOM   277 O  O   . LEU B 2 15 ? 4.175   14.000 0.996   1.00 20.81 ? 15 LEU B O   1 
ATOM   278 C  CB  . LEU B 2 15 ? 2.545   13.678 -1.707  1.00 20.69 ? 15 LEU B CB  1 
ATOM   279 C  CG  . LEU B 2 15 ? 2.413   14.240 -3.106  1.00 20.13 ? 15 LEU B CG  1 
ATOM   280 C  CD1 . LEU B 2 15 ? 0.949   14.479 -3.416  1.00 20.00 ? 15 LEU B CD1 1 
ATOM   281 C  CD2 . LEU B 2 15 ? 3.184   15.536 -3.205  1.00 22.82 ? 15 LEU B CD2 1 
ATOM   282 N  N   . TYR B 2 16 ? 3.270   11.951 0.887   1.00 17.98 ? 16 TYR B N   1 
ATOM   283 C  CA  . TYR B 2 16 ? 3.174   11.757 2.327   1.00 18.19 ? 16 TYR B CA  1 
ATOM   284 C  C   . TYR B 2 16 ? 4.558   11.640 2.966   1.00 20.88 ? 16 TYR B C   1 
ATOM   285 O  O   . TYR B 2 16 ? 4.823   12.229 4.015   1.00 23.14 ? 16 TYR B O   1 
ATOM   286 C  CB  . TYR B 2 16 ? 2.347   10.491 2.598   1.00 13.95 ? 16 TYR B CB  1 
ATOM   287 C  CG  . TYR B 2 16 ? 2.140   10.204 4.077   1.00 13.07 ? 16 TYR B CG  1 
ATOM   288 C  CD1 . TYR B 2 16 ? 1.335   11.057 4.829   1.00 13.29 ? 16 TYR B CD1 1 
ATOM   289 C  CD2 . TYR B 2 16 ? 2.781   9.122  4.690   1.00 10.41 ? 16 TYR B CD2 1 
ATOM   290 C  CE1 . TYR B 2 16 ? 1.171   10.843 6.196   1.00 9.93  ? 16 TYR B CE1 1 
ATOM   291 C  CE2 . TYR B 2 16 ? 2.619   8.905  6.061   1.00 8.32  ? 16 TYR B CE2 1 
ATOM   292 C  CZ  . TYR B 2 16 ? 1.814   9.772  6.801   1.00 8.59  ? 16 TYR B CZ  1 
ATOM   293 O  OH  . TYR B 2 16 ? 1.636   9.583  8.153   1.00 12.95 ? 16 TYR B OH  1 
ATOM   294 N  N   . LEU B 2 17 ? 5.446   10.867 2.332   1.00 22.12 ? 17 LEU B N   1 
ATOM   295 C  CA  . LEU B 2 17 ? 6.803   10.648 2.803   1.00 20.25 ? 17 LEU B CA  1 
ATOM   296 C  C   . LEU B 2 17 ? 7.653   11.901 2.676   1.00 18.43 ? 17 LEU B C   1 
ATOM   297 O  O   . LEU B 2 17 ? 8.243   12.362 3.649   1.00 19.94 ? 17 LEU B O   1 
ATOM   298 C  CB  . LEU B 2 17 ? 7.427   9.512  1.997   1.00 23.07 ? 17 LEU B CB  1 
ATOM   299 C  CG  . LEU B 2 17 ? 8.867   9.093  2.259   1.00 23.76 ? 17 LEU B CG  1 
ATOM   300 C  CD1 . LEU B 2 17 ? 9.010   8.538  3.667   1.00 26.85 ? 17 LEU B CD1 1 
ATOM   301 C  CD2 . LEU B 2 17 ? 9.259   8.031  1.255   1.00 24.76 ? 17 LEU B CD2 1 
ATOM   302 N  N   . VAL B 2 18 ? 7.677   12.462 1.466   1.00 17.47 ? 18 VAL B N   1 
ATOM   303 C  CA  . VAL B 2 18 ? 8.457   13.634 1.106   1.00 19.02 ? 18 VAL B CA  1 
ATOM   304 C  C   . VAL B 2 18 ? 8.160   14.888 1.934   1.00 20.12 ? 18 VAL B C   1 
ATOM   305 O  O   . VAL B 2 18 ? 9.101   15.617 2.250   1.00 25.40 ? 18 VAL B O   1 
ATOM   306 C  CB  . VAL B 2 18 ? 8.218   13.822 -0.417  1.00 18.55 ? 18 VAL B CB  1 
ATOM   307 C  CG1 . VAL B 2 18 ? 8.789   15.108 -0.953  1.00 20.26 ? 18 VAL B CG1 1 
ATOM   308 C  CG2 . VAL B 2 18 ? 8.961   12.729 -1.145  1.00 12.38 ? 18 VAL B CG2 1 
ATOM   309 N  N   . CYS B 2 19 ? 6.903   15.162 2.326   1.00 19.80 ? 19 CYS B N   1 
ATOM   310 C  CA  . CYS B 2 19 ? 6.563   16.327 3.140   1.00 20.46 ? 19 CYS B CA  1 
ATOM   311 C  C   . CYS B 2 19 ? 6.578   16.068 4.639   1.00 21.56 ? 19 CYS B C   1 
ATOM   312 O  O   . CYS B 2 19 ? 7.116   16.870 5.397   1.00 25.36 ? 19 CYS B O   1 
ATOM   313 C  CB  . CYS B 2 19 ? 5.189   16.846 2.794   1.00 20.58 ? 19 CYS B CB  1 
ATOM   314 S  SG  . CYS B 2 19 ? 4.949   17.130 1.026   1.00 26.43 ? 19 CYS B SG  1 
ATOM   315 N  N   . GLY B 2 20 ? 5.967   14.972 5.093   1.00 25.58 ? 20 GLY B N   1 
ATOM   316 C  CA  . GLY B 2 20 ? 5.925   14.601 6.500   1.00 29.10 ? 20 GLY B CA  1 
ATOM   317 C  C   . GLY B 2 20 ? 5.033   15.513 7.333   1.00 31.57 ? 20 GLY B C   1 
ATOM   318 O  O   . GLY B 2 20 ? 3.818   15.600 7.131   1.00 32.61 ? 20 GLY B O   1 
ATOM   319 N  N   . GLU B 2 21 ? 5.682   16.216 8.267   1.00 33.20 ? 21 GLU B N   1 
ATOM   320 C  CA  . GLU B 2 21 ? 5.016   17.131 9.184   1.00 34.62 ? 21 GLU B CA  1 
ATOM   321 C  C   . GLU B 2 21 ? 4.574   18.460 8.576   1.00 33.32 ? 21 GLU B C   1 
ATOM   322 O  O   . GLU B 2 21 ? 3.943   19.280 9.248   1.00 32.69 ? 21 GLU B O   1 
ATOM   323 C  CB  . GLU B 2 21 ? 5.937   17.387 10.371  1.00 38.91 ? 21 GLU B CB  1 
ATOM   324 C  CG  . GLU B 2 21 ? 6.165   16.121 11.203  1.00 42.74 ? 21 GLU B CG  1 
ATOM   325 C  CD  . GLU B 2 21 ? 7.613   15.638 11.265  1.00 44.96 ? 21 GLU B CD  1 
ATOM   326 O  OE1 . GLU B 2 21 ? 8.250   15.510 10.214  1.00 43.68 ? 21 GLU B OE1 1 
ATOM   327 O  OE2 . GLU B 2 21 ? 8.096   15.383 12.376  1.00 44.93 ? 21 GLU B OE2 1 
ATOM   328 N  N   . ARG B 2 22 ? 4.895   18.678 7.293   1.00 31.16 ? 22 ARG B N   1 
ATOM   329 C  CA  . ARG B 2 22 ? 4.432   19.848 6.556   1.00 28.41 ? 22 ARG B CA  1 
ATOM   330 C  C   . ARG B 2 22 ? 3.070   19.586 5.932   1.00 27.94 ? 22 ARG B C   1 
ATOM   331 O  O   . ARG B 2 22 ? 2.215   20.472 5.850   1.00 30.11 ? 22 ARG B O   1 
ATOM   332 C  CB  . ARG B 2 22 ? 5.415   20.218 5.445   1.00 25.62 ? 22 ARG B CB  1 
ATOM   333 C  CG  . ARG B 2 22 ? 6.714   20.790 6.010   1.00 27.71 ? 22 ARG B CG  1 
ATOM   334 C  CD  . ARG B 2 22 ? 7.587   21.432 4.940   1.00 26.15 ? 22 ARG B CD  1 
ATOM   335 N  NE  . ARG B 2 22 ? 8.261   20.467 4.089   1.00 25.23 ? 22 ARG B NE  1 
ATOM   336 C  CZ  . ARG B 2 22 ? 8.588   20.750 2.827   1.00 27.44 ? 22 ARG B CZ  1 
ATOM   337 N  NH1 . ARG B 2 22 ? 8.305   21.935 2.277   1.00 29.16 ? 22 ARG B NH1 1 
ATOM   338 N  NH2 . ARG B 2 22 ? 9.225   19.831 2.108   1.00 27.25 ? 22 ARG B NH2 1 
ATOM   339 N  N   . GLY B 2 23 ? 2.858   18.338 5.509   1.00 25.00 ? 23 GLY B N   1 
ATOM   340 C  CA  . GLY B 2 23 ? 1.618   17.938 4.876   1.00 22.98 ? 23 GLY B CA  1 
ATOM   341 C  C   . GLY B 2 23 ? 1.623   18.330 3.415   1.00 22.03 ? 23 GLY B C   1 
ATOM   342 O  O   . GLY B 2 23 ? 2.628   18.820 2.902   1.00 23.51 ? 23 GLY B O   1 
ATOM   343 N  N   . PHE B 2 24 ? 0.482   18.134 2.751   1.00 20.26 ? 24 PHE B N   1 
ATOM   344 C  CA  . PHE B 2 24 ? 0.369   18.411 1.329   1.00 19.38 ? 24 PHE B CA  1 
ATOM   345 C  C   . PHE B 2 24 ? -1.043  18.693 0.830   1.00 19.49 ? 24 PHE B C   1 
ATOM   346 O  O   . PHE B 2 24 ? -2.019  18.695 1.579   1.00 19.06 ? 24 PHE B O   1 
ATOM   347 C  CB  . PHE B 2 24 ? 0.960   17.222 0.549   1.00 18.82 ? 24 PHE B CB  1 
ATOM   348 C  CG  . PHE B 2 24 ? 0.302   15.859 0.766   1.00 14.78 ? 24 PHE B CG  1 
ATOM   349 C  CD1 . PHE B 2 24 ? -0.569  15.352 -0.201  1.00 13.34 ? 24 PHE B CD1 1 
ATOM   350 C  CD2 . PHE B 2 24 ? 0.591   15.102 1.907   1.00 16.99 ? 24 PHE B CD2 1 
ATOM   351 C  CE1 . PHE B 2 24 ? -1.142  14.096 -0.022  1.00 13.21 ? 24 PHE B CE1 1 
ATOM   352 C  CE2 . PHE B 2 24 ? 0.012   13.845 2.075   1.00 14.79 ? 24 PHE B CE2 1 
ATOM   353 C  CZ  . PHE B 2 24 ? -0.851  13.342 1.110   1.00 11.30 ? 24 PHE B CZ  1 
ATOM   354 N  N   . PHE B 2 25 ? -1.109  18.969 -0.472  1.00 17.08 ? 25 PHE B N   1 
ATOM   355 C  CA  . PHE B 2 25 ? -2.370  19.083 -1.164  1.00 19.55 ? 25 PHE B CA  1 
ATOM   356 C  C   . PHE B 2 25 ? -2.268  18.283 -2.450  1.00 22.77 ? 25 PHE B C   1 
ATOM   357 O  O   . PHE B 2 25 ? -1.278  18.341 -3.185  1.00 23.55 ? 25 PHE B O   1 
ATOM   358 C  CB  . PHE B 2 25 ? -2.707  20.553 -1.477  1.00 18.10 ? 25 PHE B CB  1 
ATOM   359 C  CG  . PHE B 2 25 ? -1.732  21.374 -2.310  1.00 15.58 ? 25 PHE B CG  1 
ATOM   360 C  CD1 . PHE B 2 25 ? -1.940  21.522 -3.686  1.00 13.79 ? 25 PHE B CD1 1 
ATOM   361 C  CD2 . PHE B 2 25 ? -0.631  21.974 -1.699  1.00 14.88 ? 25 PHE B CD2 1 
ATOM   362 C  CE1 . PHE B 2 25 ? -1.042  22.269 -4.447  1.00 11.77 ? 25 PHE B CE1 1 
ATOM   363 C  CE2 . PHE B 2 25 ? 0.258   22.718 -2.471  1.00 16.60 ? 25 PHE B CE2 1 
ATOM   364 C  CZ  . PHE B 2 25 ? 0.056   22.865 -3.840  1.00 12.60 ? 25 PHE B CZ  1 
ATOM   365 N  N   . TYR B 2 26 ? -3.296  17.467 -2.679  1.00 22.94 ? 26 TYR B N   1 
ATOM   366 C  CA  . TYR B 2 26 ? -3.400  16.669 -3.885  1.00 22.06 ? 26 TYR B CA  1 
ATOM   367 C  C   . TYR B 2 26 ? -4.654  17.151 -4.582  1.00 21.52 ? 26 TYR B C   1 
ATOM   368 O  O   . TYR B 2 26 ? -5.765  16.968 -4.091  1.00 23.69 ? 26 TYR B O   1 
ATOM   369 C  CB  . TYR B 2 26 ? -3.501  15.177 -3.513  1.00 21.06 ? 26 TYR B CB  1 
ATOM   370 C  CG  . TYR B 2 26 ? -3.739  14.211 -4.675  1.00 21.19 ? 26 TYR B CG  1 
ATOM   371 C  CD1 . TYR B 2 26 ? -2.785  14.048 -5.680  1.00 21.64 ? 26 TYR B CD1 1 
ATOM   372 C  CD2 . TYR B 2 26 ? -4.937  13.492 -4.733  1.00 22.87 ? 26 TYR B CD2 1 
ATOM   373 C  CE1 . TYR B 2 26 ? -3.030  13.175 -6.741  1.00 21.89 ? 26 TYR B CE1 1 
ATOM   374 C  CE2 . TYR B 2 26 ? -5.186  12.619 -5.790  1.00 19.89 ? 26 TYR B CE2 1 
ATOM   375 C  CZ  . TYR B 2 26 ? -4.231  12.468 -6.790  1.00 20.16 ? 26 TYR B CZ  1 
ATOM   376 O  OH  . TYR B 2 26 ? -4.494  11.625 -7.854  1.00 23.71 ? 26 TYR B OH  1 
ATOM   377 N  N   . THR B 2 27 ? -4.467  17.849 -5.699  1.00 22.57 ? 27 THR B N   1 
ATOM   378 C  CA  . THR B 2 27 ? -5.575  18.299 -6.520  1.00 26.35 ? 27 THR B CA  1 
ATOM   379 C  C   . THR B 2 27 ? -5.302  17.825 -7.948  1.00 26.42 ? 27 THR B C   1 
ATOM   380 O  O   . THR B 2 27 ? -4.510  18.420 -8.678  1.00 25.70 ? 27 THR B O   1 
ATOM   381 C  CB  . THR B 2 27 ? -5.724  19.853 -6.460  1.00 28.55 ? 27 THR B CB  1 
ATOM   382 O  OG1 . THR B 2 27 ? -4.478  20.419 -6.833  1.00 33.28 ? 27 THR B OG1 1 
ATOM   383 C  CG2 . THR B 2 27 ? -6.135  20.353 -5.078  1.00 28.30 ? 27 THR B CG2 1 
ATOM   384 N  N   . PRO B 2 28 ? -5.916  16.706 -8.368  1.00 26.87 ? 28 PRO B N   1 
ATOM   385 C  CA  . PRO B 2 28 ? -5.602  15.997 -9.606  1.00 28.97 ? 28 PRO B CA  1 
ATOM   386 C  C   . PRO B 2 28 ? -6.186  16.491 -10.924 1.00 31.76 ? 28 PRO B C   1 
ATOM   387 O  O   . PRO B 2 28 ? -6.039  15.843 -11.963 1.00 32.57 ? 28 PRO B O   1 
ATOM   388 C  CB  . PRO B 2 28 ? -6.008  14.583 -9.282  1.00 27.20 ? 28 PRO B CB  1 
ATOM   389 C  CG  . PRO B 2 28 ? -7.245  14.791 -8.459  1.00 26.13 ? 28 PRO B CG  1 
ATOM   390 C  CD  . PRO B 2 28 ? -6.834  15.921 -7.545  1.00 25.25 ? 28 PRO B CD  1 
ATOM   391 N  N   . LYS B 2 29 ? -6.808  17.669 -10.904 1.00 35.51 ? 29 LYS B N   1 
ATOM   392 C  CA  . LYS B 2 29 ? -7.523  18.207 -12.052 1.00 38.69 ? 29 LYS B CA  1 
ATOM   393 C  C   . LYS B 2 29 ? -6.776  18.999 -13.117 1.00 40.88 ? 29 LYS B C   1 
ATOM   394 O  O   . LYS B 2 29 ? -5.812  19.727 -12.864 1.00 43.33 ? 29 LYS B O   1 
ATOM   395 C  CB  . LYS B 2 29 ? -8.666  19.043 -11.507 1.00 37.95 ? 29 LYS B CB  1 
ATOM   396 C  CG  . LYS B 2 29 ? -9.830  18.198 -11.009 1.00 37.06 ? 29 LYS B CG  1 
ATOM   397 C  CD  . LYS B 2 29 ? -10.999 18.311 -11.974 1.00 38.52 ? 29 LYS B CD  1 
ATOM   398 C  CE  . LYS B 2 29 ? -11.549 19.732 -11.917 1.00 40.38 ? 29 LYS B CE  1 
ATOM   399 N  NZ  . LYS B 2 29 ? -12.597 19.947 -12.897 1.00 46.13 ? 29 LYS B NZ  1 
ATOM   400 N  N   . THR B 2 30 ? -7.306  18.841 -14.334 1.00 41.53 ? 30 THR B N   1 
ATOM   401 C  CA  . THR B 2 30 ? -6.793  19.460 -15.549 1.00 43.29 ? 30 THR B CA  1 
ATOM   402 C  C   . THR B 2 30 ? -7.551  20.717 -15.963 1.00 44.85 ? 30 THR B C   1 
ATOM   403 O  O   . THR B 2 30 ? -8.771  20.646 -16.127 1.00 48.71 ? 30 THR B O   1 
ATOM   404 C  CB  . THR B 2 30 ? -6.830  18.392 -16.648 1.00 43.03 ? 30 THR B CB  1 
ATOM   405 O  OG1 . THR B 2 30 ? -5.833  17.458 -16.250 1.00 47.10 ? 30 THR B OG1 1 
ATOM   406 C  CG2 . THR B 2 30 ? -6.547  18.886 -18.057 1.00 45.01 ? 30 THR B CG2 1 
ATOM   407 O  OXT . THR B 2 30 ? -6.914  21.756 -16.131 1.00 44.65 ? 30 THR B OXT 1 
ATOM   408 N  N   . GLY C 1 1  ? -6.835  16.942 15.011  1.00 32.52 ? 1  GLY C N   1 
ATOM   409 C  CA  . GLY C 1 1  ? -7.460  17.075 13.708  1.00 35.66 ? 1  GLY C CA  1 
ATOM   410 C  C   . GLY C 1 1  ? -8.015  15.746 13.225  1.00 35.99 ? 1  GLY C C   1 
ATOM   411 O  O   . GLY C 1 1  ? -8.736  15.061 13.955  1.00 35.69 ? 1  GLY C O   1 
ATOM   412 N  N   . ILE C 1 2  ? -7.676  15.392 11.978  1.00 35.92 ? 2  ILE C N   1 
ATOM   413 C  CA  . ILE C 1 2  ? -8.081  14.130 11.363  1.00 36.23 ? 2  ILE C CA  1 
ATOM   414 C  C   . ILE C 1 2  ? -7.250  12.953 11.887  1.00 37.79 ? 2  ILE C C   1 
ATOM   415 O  O   . ILE C 1 2  ? -7.771  11.864 12.145  1.00 36.71 ? 2  ILE C O   1 
ATOM   416 C  CB  . ILE C 1 2  ? -7.961  14.257 9.804   1.00 35.58 ? 2  ILE C CB  1 
ATOM   417 C  CG1 . ILE C 1 2  ? -8.301  12.906 9.164   1.00 33.99 ? 2  ILE C CG1 1 
ATOM   418 C  CG2 . ILE C 1 2  ? -6.570  14.772 9.407   1.00 34.81 ? 2  ILE C CG2 1 
ATOM   419 C  CD1 . ILE C 1 2  ? -8.241  12.840 7.626   1.00 34.27 ? 2  ILE C CD1 1 
ATOM   420 N  N   . VAL C 1 3  ? -5.949  13.205 12.098  1.00 38.22 ? 3  VAL C N   1 
ATOM   421 C  CA  . VAL C 1 3  ? -4.986  12.233 12.607  1.00 37.68 ? 3  VAL C CA  1 
ATOM   422 C  C   . VAL C 1 3  ? -5.232  11.964 14.095  1.00 38.67 ? 3  VAL C C   1 
ATOM   423 O  O   . VAL C 1 3  ? -4.507  11.229 14.763  1.00 41.55 ? 3  VAL C O   1 
ATOM   424 C  CB  . VAL C 1 3  ? -3.537  12.760 12.404  1.00 38.33 ? 3  VAL C CB  1 
ATOM   425 C  CG1 . VAL C 1 3  ? -2.595  11.570 12.314  1.00 37.43 ? 3  VAL C CG1 1 
ATOM   426 C  CG2 . VAL C 1 3  ? -3.400  13.578 11.126  1.00 40.10 ? 3  VAL C CG2 1 
ATOM   427 N  N   . GLU C 1 4  ? -6.285  12.567 14.639  1.00 39.07 ? 4  GLU C N   1 
ATOM   428 C  CA  . GLU C 1 4  ? -6.683  12.403 16.018  1.00 40.06 ? 4  GLU C CA  1 
ATOM   429 C  C   . GLU C 1 4  ? -8.064  11.761 16.095  1.00 38.85 ? 4  GLU C C   1 
ATOM   430 O  O   . GLU C 1 4  ? -8.388  11.119 17.093  1.00 39.71 ? 4  GLU C O   1 
ATOM   431 C  CB  . GLU C 1 4  ? -6.679  13.771 16.648  1.00 43.02 ? 4  GLU C CB  1 
ATOM   432 C  CG  . GLU C 1 4  ? -7.122  13.816 18.101  1.00 46.03 ? 4  GLU C CG  1 
ATOM   433 C  CD  . GLU C 1 4  ? -7.393  15.223 18.603  1.00 47.06 ? 4  GLU C CD  1 
ATOM   434 O  OE1 . GLU C 1 4  ? -7.979  16.028 17.872  1.00 46.24 ? 4  GLU C OE1 1 
ATOM   435 O  OE2 . GLU C 1 4  ? -7.013  15.493 19.740  1.00 46.68 ? 4  GLU C OE2 1 
ATOM   436 N  N   . GLN C 1 5  ? -8.909  11.938 15.073  1.00 37.65 ? 5  GLN C N   1 
ATOM   437 C  CA  . GLN C 1 5  ? -10.228 11.333 15.074  1.00 37.25 ? 5  GLN C CA  1 
ATOM   438 C  C   . GLN C 1 5  ? -10.235 9.934  14.470  1.00 36.73 ? 5  GLN C C   1 
ATOM   439 O  O   . GLN C 1 5  ? -10.622 8.996  15.171  1.00 37.48 ? 5  GLN C O   1 
ATOM   440 C  CB  . GLN C 1 5  ? -11.197 12.246 14.321  0.50 36.79 ? 5  GLN C CB  1 
ATOM   441 C  CG  . GLN C 1 5  ? -11.533 13.500 15.129  0.50 36.13 ? 5  GLN C CG  1 
ATOM   442 C  CD  . GLN C 1 5  ? -12.459 14.506 14.452  0.50 36.01 ? 5  GLN C CD  1 
ATOM   443 O  OE1 . GLN C 1 5  ? -13.416 14.071 13.634  0.50 35.44 ? 5  GLN C OE1 1 
ATOM   444 N  NE2 . GLN C 1 5  ? -12.342 15.712 14.670  0.50 34.88 ? 5  GLN C NE2 1 
ATOM   445 N  N   . CYS C 1 6  ? -9.787  9.750  13.212  1.00 35.34 ? 6  CYS C N   1 
ATOM   446 C  CA  . CYS C 1 6  ? -9.771  8.446  12.548  1.00 33.28 ? 6  CYS C CA  1 
ATOM   447 C  C   . CYS C 1 6  ? -8.684  7.473  12.998  1.00 32.40 ? 6  CYS C C   1 
ATOM   448 O  O   . CYS C 1 6  ? -8.754  6.277  12.704  1.00 30.00 ? 6  CYS C O   1 
ATOM   449 C  CB  . CYS C 1 6  ? -9.621  8.613  11.051  1.00 33.10 ? 6  CYS C CB  1 
ATOM   450 S  SG  . CYS C 1 6  ? -10.782 9.767  10.291  1.00 31.02 ? 6  CYS C SG  1 
ATOM   451 N  N   . CYS C 1 7  ? -7.656  7.995  13.679  1.00 31.12 ? 7  CYS C N   1 
ATOM   452 C  CA  . CYS C 1 7  ? -6.563  7.207  14.228  1.00 31.62 ? 7  CYS C CA  1 
ATOM   453 C  C   . CYS C 1 7  ? -6.762  6.852  15.699  1.00 32.94 ? 7  CYS C C   1 
ATOM   454 O  O   . CYS C 1 7  ? -5.878  6.298  16.354  1.00 36.02 ? 7  CYS C O   1 
ATOM   455 C  CB  . CYS C 1 7  ? -5.262  7.980  14.066  1.00 28.97 ? 7  CYS C CB  1 
ATOM   456 S  SG  . CYS C 1 7  ? -4.746  8.078  12.335  1.00 32.12 ? 7  CYS C SG  1 
ATOM   457 N  N   . LYS C 1 8  ? -7.936  7.185  16.240  1.00 34.25 ? 8  LYS C N   1 
ATOM   458 C  CA  . LYS C 1 8  ? -8.304  6.925  17.628  1.00 34.30 ? 8  LYS C CA  1 
ATOM   459 C  C   . LYS C 1 8  ? -9.469  5.936  17.622  1.00 34.15 ? 8  LYS C C   1 
ATOM   460 O  O   . LYS C 1 8  ? -9.517  4.971  18.385  1.00 33.47 ? 8  LYS C O   1 
ATOM   461 C  CB  . LYS C 1 8  ? -8.722  8.239  18.274  1.00 32.99 ? 8  LYS C CB  1 
ATOM   462 C  CG  . LYS C 1 8  ? -8.681  8.323  19.793  1.00 36.51 ? 8  LYS C CG  1 
ATOM   463 C  CD  . LYS C 1 8  ? -7.282  8.690  20.282  1.00 34.81 ? 8  LYS C CD  1 
ATOM   464 C  CE  . LYS C 1 8  ? -7.300  8.906  21.791  1.00 33.34 ? 8  LYS C CE  1 
ATOM   465 N  NZ  . LYS C 1 8  ? -5.976  9.228  22.290  1.00 29.88 ? 8  LYS C NZ  1 
ATOM   466 N  N   . SER C 1 9  ? -10.403 6.223  16.708  1.00 34.16 ? 9  SER C N   1 
ATOM   467 C  CA  . SER C 1 9  ? -11.627 5.482  16.434  1.00 34.76 ? 9  SER C CA  1 
ATOM   468 C  C   . SER C 1 9  ? -11.819 5.522  14.918  1.00 34.24 ? 9  SER C C   1 
ATOM   469 O  O   . SER C 1 9  ? -11.652 6.589  14.326  1.00 36.24 ? 9  SER C O   1 
ATOM   470 C  CB  . SER C 1 9  ? -12.794 6.165  17.153  1.00 36.48 ? 9  SER C CB  1 
ATOM   471 O  OG  . SER C 1 9  ? -12.868 7.570  16.898  1.00 33.04 ? 9  SER C OG  1 
ATOM   472 N  N   . ILE C 1 10 ? -12.179 4.434  14.227  1.00 31.15 ? 10 ILE C N   1 
ATOM   473 C  CA  . ILE C 1 10 ? -12.229 4.478  12.768  1.00 29.75 ? 10 ILE C CA  1 
ATOM   474 C  C   . ILE C 1 10 ? -13.355 5.282  12.145  1.00 28.24 ? 10 ILE C C   1 
ATOM   475 O  O   . ILE C 1 10 ? -14.516 5.228  12.546  1.00 29.56 ? 10 ILE C O   1 
ATOM   476 C  CB  . ILE C 1 10 ? -12.277 3.043  12.162  1.00 30.89 ? 10 ILE C CB  1 
ATOM   477 C  CG1 . ILE C 1 10 ? -13.480 2.216  12.589  1.00 33.93 ? 10 ILE C CG1 1 
ATOM   478 C  CG2 . ILE C 1 10 ? -10.985 2.375  12.597  1.00 32.81 ? 10 ILE C CG2 1 
ATOM   479 C  CD1 . ILE C 1 10 ? -13.613 0.880  11.823  1.00 36.44 ? 10 ILE C CD1 1 
ATOM   480 N  N   . CYS C 1 11 ? -12.955 6.092  11.169  1.00 28.19 ? 11 CYS C N   1 
ATOM   481 C  CA  . CYS C 1 11 ? -13.896 6.899  10.421  1.00 29.07 ? 11 CYS C CA  1 
ATOM   482 C  C   . CYS C 1 11 ? -14.457 6.099  9.278   1.00 30.28 ? 11 CYS C C   1 
ATOM   483 O  O   . CYS C 1 11 ? -13.728 5.395  8.578   1.00 33.20 ? 11 CYS C O   1 
ATOM   484 C  CB  . CYS C 1 11 ? -13.256 8.120  9.808   1.00 28.38 ? 11 CYS C CB  1 
ATOM   485 S  SG  . CYS C 1 11 ? -12.565 9.208  11.058  1.00 30.35 ? 11 CYS C SG  1 
ATOM   486 N  N   . SER C 1 12 ? -15.769 6.222  9.089   1.00 32.47 ? 12 SER C N   1 
ATOM   487 C  CA  . SER C 1 12 ? -16.418 5.594  7.954   1.00 33.26 ? 12 SER C CA  1 
ATOM   488 C  C   . SER C 1 12 ? -16.071 6.387  6.703   1.00 31.21 ? 12 SER C C   1 
ATOM   489 O  O   . SER C 1 12 ? -15.437 7.441  6.766   1.00 32.82 ? 12 SER C O   1 
ATOM   490 C  CB  . SER C 1 12 ? -17.945 5.565  8.168   1.00 37.43 ? 12 SER C CB  1 
ATOM   491 O  OG  . SER C 1 12 ? -18.547 6.833  8.417   1.00 36.27 ? 12 SER C OG  1 
ATOM   492 N  N   . LEU C 1 13 ? -16.465 5.872  5.547   1.00 30.23 ? 13 LEU C N   1 
ATOM   493 C  CA  . LEU C 1 13 ? -16.261 6.510  4.255   1.00 30.26 ? 13 LEU C CA  1 
ATOM   494 C  C   . LEU C 1 13 ? -16.953 7.878  4.202   1.00 30.62 ? 13 LEU C C   1 
ATOM   495 O  O   . LEU C 1 13 ? -16.498 8.815  3.546   1.00 30.31 ? 13 LEU C O   1 
ATOM   496 C  CB  . LEU C 1 13 ? -16.809 5.506  3.260   1.00 31.12 ? 13 LEU C CB  1 
ATOM   497 C  CG  . LEU C 1 13 ? -16.631 5.502  1.763   1.00 31.38 ? 13 LEU C CG  1 
ATOM   498 C  CD1 . LEU C 1 13 ? -17.225 4.190  1.319   1.00 32.46 ? 13 LEU C CD1 1 
ATOM   499 C  CD2 . LEU C 1 13 ? -17.333 6.643  1.045   1.00 34.78 ? 13 LEU C CD2 1 
ATOM   500 N  N   . TYR C 1 14 ? -18.071 7.989  4.931   1.00 30.14 ? 14 TYR C N   1 
ATOM   501 C  CA  . TYR C 1 14 ? -18.893 9.188  5.017   1.00 28.08 ? 14 TYR C CA  1 
ATOM   502 C  C   . TYR C 1 14 ? -18.288 10.247 5.920   1.00 27.65 ? 14 TYR C C   1 
ATOM   503 O  O   . TYR C 1 14 ? -18.438 11.445 5.685   1.00 28.01 ? 14 TYR C O   1 
ATOM   504 C  CB  . TYR C 1 14 ? -20.277 8.805  5.532   1.00 25.36 ? 14 TYR C CB  1 
ATOM   505 C  CG  . TYR C 1 14 ? -20.974 7.885  4.544   1.00 26.60 ? 14 TYR C CG  1 
ATOM   506 C  CD1 . TYR C 1 14 ? -21.606 8.417  3.419   1.00 28.06 ? 14 TYR C CD1 1 
ATOM   507 C  CD2 . TYR C 1 14 ? -20.949 6.507  4.748   1.00 26.77 ? 14 TYR C CD2 1 
ATOM   508 C  CE1 . TYR C 1 14 ? -22.214 7.570  2.494   1.00 26.80 ? 14 TYR C CE1 1 
ATOM   509 C  CE2 . TYR C 1 14 ? -21.555 5.655  3.826   1.00 27.08 ? 14 TYR C CE2 1 
ATOM   510 C  CZ  . TYR C 1 14 ? -22.187 6.192  2.707   1.00 27.39 ? 14 TYR C CZ  1 
ATOM   511 O  OH  . TYR C 1 14 ? -22.812 5.347  1.810   1.00 29.59 ? 14 TYR C OH  1 
ATOM   512 N  N   . GLN C 1 15 ? -17.614 9.771  6.971   1.00 26.57 ? 15 GLN C N   1 
ATOM   513 C  CA  . GLN C 1 15 ? -16.934 10.596 7.950   1.00 25.78 ? 15 GLN C CA  1 
ATOM   514 C  C   . GLN C 1 15 ? -15.625 11.124 7.368   1.00 27.44 ? 15 GLN C C   1 
ATOM   515 O  O   . GLN C 1 15 ? -15.095 12.131 7.832   1.00 29.35 ? 15 GLN C O   1 
ATOM   516 C  CB  . GLN C 1 15 ? -16.704 9.731  9.163   1.00 20.96 ? 15 GLN C CB  1 
ATOM   517 C  CG  . GLN C 1 15 ? -16.853 10.409 10.510  1.00 21.52 ? 15 GLN C CG  1 
ATOM   518 C  CD  . GLN C 1 15 ? -17.205 9.419  11.615  1.00 23.02 ? 15 GLN C CD  1 
ATOM   519 O  OE1 . GLN C 1 15 ? -17.354 8.218  11.385  1.00 24.44 ? 15 GLN C OE1 1 
ATOM   520 N  NE2 . GLN C 1 15 ? -17.372 9.878  12.853  1.00 26.01 ? 15 GLN C NE2 1 
ATOM   521 N  N   . LEU C 1 16 ? -15.096 10.458 6.336   1.00 27.44 ? 16 LEU C N   1 
ATOM   522 C  CA  . LEU C 1 16 ? -13.894 10.885 5.648   1.00 27.91 ? 16 LEU C CA  1 
ATOM   523 C  C   . LEU C 1 16 ? -14.175 11.912 4.560   1.00 29.13 ? 16 LEU C C   1 
ATOM   524 O  O   . LEU C 1 16 ? -13.275 12.682 4.224   1.00 30.79 ? 16 LEU C O   1 
ATOM   525 C  CB  . LEU C 1 16 ? -13.185 9.680  5.023   1.00 28.05 ? 16 LEU C CB  1 
ATOM   526 C  CG  . LEU C 1 16 ? -12.475 8.667  5.924   1.00 24.73 ? 16 LEU C CG  1 
ATOM   527 C  CD1 . LEU C 1 16 ? -12.052 7.479  5.086   1.00 16.66 ? 16 LEU C CD1 1 
ATOM   528 C  CD2 . LEU C 1 16 ? -11.263 9.298  6.590   1.00 23.91 ? 16 LEU C CD2 1 
ATOM   529 N  N   . GLU C 1 17 ? -15.386 11.959 3.979   1.00 29.90 ? 17 GLU C N   1 
ATOM   530 C  CA  . GLU C 1 17 ? -15.742 12.943 2.951   1.00 29.70 ? 17 GLU C CA  1 
ATOM   531 C  C   . GLU C 1 17 ? -15.693 14.389 3.412   1.00 28.07 ? 17 GLU C C   1 
ATOM   532 O  O   . GLU C 1 17 ? -15.654 15.294 2.582   1.00 27.65 ? 17 GLU C O   1 
ATOM   533 C  CB  . GLU C 1 17 ? -17.148 12.714 2.407   1.00 31.93 ? 17 GLU C CB  1 
ATOM   534 C  CG  . GLU C 1 17 ? -17.176 11.998 1.059   1.00 36.20 ? 17 GLU C CG  1 
ATOM   535 C  CD  . GLU C 1 17 ? -18.566 11.895 0.436   1.00 39.26 ? 17 GLU C CD  1 
ATOM   536 O  OE1 . GLU C 1 17 ? -19.412 11.191 0.992   1.00 43.63 ? 17 GLU C OE1 1 
ATOM   537 O  OE2 . GLU C 1 17 ? -18.798 12.513 -0.608  1.00 38.60 ? 17 GLU C OE2 1 
ATOM   538 N  N   . ASN C 1 18 ? -15.694 14.607 4.733   1.00 28.41 ? 18 ASN C N   1 
ATOM   539 C  CA  . ASN C 1 18 ? -15.596 15.924 5.356   1.00 30.36 ? 18 ASN C CA  1 
ATOM   540 C  C   . ASN C 1 18 ? -14.280 16.592 4.967   1.00 30.49 ? 18 ASN C C   1 
ATOM   541 O  O   . ASN C 1 18 ? -14.209 17.761 4.578   1.00 33.27 ? 18 ASN C O   1 
ATOM   542 C  CB  . ASN C 1 18 ? -15.611 15.836 6.891   1.00 29.90 ? 18 ASN C CB  1 
ATOM   543 C  CG  . ASN C 1 18 ? -16.740 15.040 7.523   1.00 30.53 ? 18 ASN C CG  1 
ATOM   544 O  OD1 . ASN C 1 18 ? -17.834 14.913 6.977   1.00 32.73 ? 18 ASN C OD1 1 
ATOM   545 N  ND2 . ASN C 1 18 ? -16.496 14.487 8.708   1.00 30.22 ? 18 ASN C ND2 1 
ATOM   546 N  N   . TYR C 1 19 ? -13.245 15.751 5.038   1.00 28.09 ? 19 TYR C N   1 
ATOM   547 C  CA  . TYR C 1 19 ? -11.870 16.138 4.827   1.00 23.99 ? 19 TYR C CA  1 
ATOM   548 C  C   . TYR C 1 19 ? -11.471 16.328 3.377   1.00 24.45 ? 19 TYR C C   1 
ATOM   549 O  O   . TYR C 1 19 ? -10.328 16.690 3.112   1.00 26.98 ? 19 TYR C O   1 
ATOM   550 C  CB  . TYR C 1 19 ? -10.994 15.089 5.505   1.00 22.40 ? 19 TYR C CB  1 
ATOM   551 C  CG  . TYR C 1 19 ? -11.402 14.860 6.956   1.00 23.21 ? 19 TYR C CG  1 
ATOM   552 C  CD1 . TYR C 1 19 ? -11.273 15.877 7.906   1.00 24.51 ? 19 TYR C CD1 1 
ATOM   553 C  CD2 . TYR C 1 19 ? -11.943 13.629 7.330   1.00 24.00 ? 19 TYR C CD2 1 
ATOM   554 C  CE1 . TYR C 1 19 ? -11.692 15.665 9.222   1.00 25.83 ? 19 TYR C CE1 1 
ATOM   555 C  CE2 . TYR C 1 19 ? -12.360 13.411 8.641   1.00 24.53 ? 19 TYR C CE2 1 
ATOM   556 C  CZ  . TYR C 1 19 ? -12.237 14.430 9.580   1.00 25.23 ? 19 TYR C CZ  1 
ATOM   557 O  OH  . TYR C 1 19 ? -12.687 14.215 10.869  1.00 28.63 ? 19 TYR C OH  1 
ATOM   558 N  N   . CYS C 1 20 ? -12.372 16.126 2.411   1.00 25.34 ? 20 CYS C N   1 
ATOM   559 C  CA  . CYS C 1 20 ? -12.054 16.347 1.002   1.00 28.73 ? 20 CYS C CA  1 
ATOM   560 C  C   . CYS C 1 20 ? -12.231 17.819 0.610   1.00 28.89 ? 20 CYS C C   1 
ATOM   561 O  O   . CYS C 1 20 ? -12.561 18.638 1.470   1.00 31.40 ? 20 CYS C O   1 
ATOM   562 C  CB  . CYS C 1 20 ? -12.959 15.481 0.118   1.00 30.27 ? 20 CYS C CB  1 
ATOM   563 S  SG  . CYS C 1 20 ? -12.965 13.691 0.426   1.00 31.61 ? 20 CYS C SG  1 
ATOM   564 N  N   . ASN C 1 21 ? -12.010 18.223 -0.654  1.00 29.26 ? 21 ASN C N   1 
ATOM   565 C  CA  . ASN C 1 21 ? -12.233 19.601 -1.091  1.00 28.55 ? 21 ASN C CA  1 
ATOM   566 C  C   . ASN C 1 21 ? -13.651 19.808 -1.604  1.00 28.82 ? 21 ASN C C   1 
ATOM   567 O  O   . ASN C 1 21 ? -14.441 20.375 -0.852  1.00 30.37 ? 21 ASN C O   1 
ATOM   568 C  CB  . ASN C 1 21 ? -11.241 19.995 -2.196  1.00 28.33 ? 21 ASN C CB  1 
ATOM   569 C  CG  . ASN C 1 21 ? -9.847  20.360 -1.709  1.00 31.48 ? 21 ASN C CG  1 
ATOM   570 O  OD1 . ASN C 1 21 ? -8.931  20.514 -2.514  1.00 31.85 ? 21 ASN C OD1 1 
ATOM   571 N  ND2 . ASN C 1 21 ? -9.614  20.527 -0.407  1.00 31.39 ? 21 ASN C ND2 1 
ATOM   572 O  OXT . ASN C 1 21 ? -13.971 19.395 -2.722  1.00 29.01 ? 21 ASN C OXT 1 
ATOM   573 N  N   . VAL D 2 2  ? -0.382  4.601  19.826  1.00 49.82 ? 2  VAL D N   1 
ATOM   574 C  CA  . VAL D 2 2  ? -0.982  5.169  18.624  1.00 49.54 ? 2  VAL D CA  1 
ATOM   575 C  C   . VAL D 2 2  ? 0.124   5.771  17.758  1.00 46.86 ? 2  VAL D C   1 
ATOM   576 O  O   . VAL D 2 2  ? 0.577   6.900  17.998  1.00 49.42 ? 2  VAL D O   1 
ATOM   577 C  CB  . VAL D 2 2  ? -2.027  6.293  18.981  1.00 41.94 ? 2  VAL D CB  1 
ATOM   578 C  CG1 . VAL D 2 2  ? -2.828  6.594  17.713  1.00 40.93 ? 2  VAL D CG1 1 
ATOM   579 C  CG2 . VAL D 2 2  ? -2.968  5.886  20.122  1.00 42.56 ? 2  VAL D CG2 1 
ATOM   580 N  N   . ASN D 2 3  ? 0.599   5.017  16.756  1.00 40.68 ? 3  ASN D N   1 
ATOM   581 C  CA  . ASN D 2 3  ? 1.609   5.559  15.870  1.00 43.39 ? 3  ASN D CA  1 
ATOM   582 C  C   . ASN D 2 3  ? 0.832   6.236  14.764  1.00 40.98 ? 3  ASN D C   1 
ATOM   583 O  O   . ASN D 2 3  ? 0.310   5.623  13.833  1.00 40.79 ? 3  ASN D O   1 
ATOM   584 C  CB  . ASN D 2 3  ? 2.492   4.462  15.295  1.00 40.03 ? 3  ASN D CB  1 
ATOM   585 C  CG  . ASN D 2 3  ? 3.726   5.035  14.616  1.00 37.95 ? 3  ASN D CG  1 
ATOM   586 O  OD1 . ASN D 2 3  ? 3.622   5.800  13.661  1.00 38.68 ? 3  ASN D OD1 1 
ATOM   587 N  ND2 . ASN D 2 3  ? 4.928   4.705  15.086  1.00 37.04 ? 3  ASN D ND2 1 
ATOM   588 N  N   . GLN D 2 4  ? 0.761   7.552  14.936  1.00 38.17 ? 4  GLN D N   1 
ATOM   589 C  CA  . GLN D 2 4  ? 0.041   8.407  14.021  1.00 36.93 ? 4  GLN D CA  1 
ATOM   590 C  C   . GLN D 2 4  ? 0.714   8.611  12.680  1.00 34.07 ? 4  GLN D C   1 
ATOM   591 O  O   . GLN D 2 4  ? 0.118   9.206  11.779  1.00 34.59 ? 4  GLN D O   1 
ATOM   592 C  CB  . GLN D 2 4  ? -0.193  9.739  14.703  1.00 39.83 ? 4  GLN D CB  1 
ATOM   593 C  CG  . GLN D 2 4  ? -1.245  9.574  15.795  1.00 45.80 ? 4  GLN D CG  1 
ATOM   594 C  CD  . GLN D 2 4  ? -1.524  10.834 16.601  1.00 40.50 ? 4  GLN D CD  1 
ATOM   595 O  OE1 . GLN D 2 4  ? -1.808  11.907 16.058  1.00 41.40 ? 4  GLN D OE1 1 
ATOM   596 N  NE2 . GLN D 2 4  ? -1.448  10.712 17.930  1.00 41.66 ? 4  GLN D NE2 1 
ATOM   597 N  N   . HIS D 2 5  ? 1.944   8.111  12.518  1.00 31.04 ? 5  HIS D N   1 
ATOM   598 C  CA  . HIS D 2 5  ? 2.602   8.199  11.232  1.00 29.18 ? 5  HIS D CA  1 
ATOM   599 C  C   . HIS D 2 5  ? 2.195   6.995  10.397  1.00 28.03 ? 5  HIS D C   1 
ATOM   600 O  O   . HIS D 2 5  ? 1.886   7.159  9.215   1.00 28.82 ? 5  HIS D O   1 
ATOM   601 C  CB  . HIS D 2 5  ? 4.105   8.210  11.388  1.00 27.83 ? 5  HIS D CB  1 
ATOM   602 C  CG  . HIS D 2 5  ? 4.738   8.883  10.184  1.00 27.38 ? 5  HIS D CG  1 
ATOM   603 N  ND1 . HIS D 2 5  ? 4.633   10.164 9.858   1.00 29.69 ? 5  HIS D ND1 1 
ATOM   604 C  CD2 . HIS D 2 5  ? 5.505   8.254  9.237   1.00 27.06 ? 5  HIS D CD2 1 
ATOM   605 C  CE1 . HIS D 2 5  ? 5.311   10.319 8.747   1.00 31.55 ? 5  HIS D CE1 1 
ATOM   606 N  NE2 . HIS D 2 5  ? 5.834   9.174  8.373   1.00 28.11 ? 5  HIS D NE2 1 
ATOM   607 N  N   . LEU D 2 6  ? 2.169   5.779  10.972  1.00 25.51 ? 6  LEU D N   1 
ATOM   608 C  CA  . LEU D 2 6  ? 1.709   4.596  10.246  1.00 23.20 ? 6  LEU D CA  1 
ATOM   609 C  C   . LEU D 2 6  ? 0.227   4.731  9.958   1.00 21.79 ? 6  LEU D C   1 
ATOM   610 O  O   . LEU D 2 6  ? -0.258  4.318  8.906   1.00 20.03 ? 6  LEU D O   1 
ATOM   611 C  CB  . LEU D 2 6  ? 1.862   3.304  11.033  1.00 23.50 ? 6  LEU D CB  1 
ATOM   612 C  CG  . LEU D 2 6  ? 3.204   2.815  11.542  1.00 24.37 ? 6  LEU D CG  1 
ATOM   613 C  CD1 . LEU D 2 6  ? 2.990   1.453  12.181  1.00 21.97 ? 6  LEU D CD1 1 
ATOM   614 C  CD2 . LEU D 2 6  ? 4.216   2.719  10.415  1.00 21.46 ? 6  LEU D CD2 1 
ATOM   615 N  N   . CYS D 2 7  ? -0.479  5.338  10.917  1.00 21.13 ? 7  CYS D N   1 
ATOM   616 C  CA  . CYS D 2 7  ? -1.900  5.576  10.800  1.00 22.68 ? 7  CYS D CA  1 
ATOM   617 C  C   . CYS D 2 7  ? -2.247  6.592  9.730   1.00 21.07 ? 7  CYS D C   1 
ATOM   618 O  O   . CYS D 2 7  ? -3.195  6.366  8.983   1.00 22.20 ? 7  CYS D O   1 
ATOM   619 C  CB  . CYS D 2 7  ? -2.452  6.056  12.119  1.00 25.18 ? 7  CYS D CB  1 
ATOM   620 S  SG  . CYS D 2 7  ? -4.241  6.159  11.952  1.00 28.24 ? 7  CYS D SG  1 
ATOM   621 N  N   . GLY D 2 8  ? -1.485  7.693  9.635   1.00 19.63 ? 8  GLY D N   1 
ATOM   622 C  CA  . GLY D 2 8  ? -1.698  8.750  8.652   1.00 16.42 ? 8  GLY D CA  1 
ATOM   623 C  C   . GLY D 2 8  ? -1.487  8.257  7.231   1.00 16.55 ? 8  GLY D C   1 
ATOM   624 O  O   . GLY D 2 8  ? -2.151  8.706  6.298   1.00 14.96 ? 8  GLY D O   1 
ATOM   625 N  N   . SER D 2 9  ? -0.550  7.309  7.097   1.00 19.47 ? 9  SER D N   1 
ATOM   626 C  CA  . SER D 2 9  ? -0.203  6.630  5.851   1.00 22.06 ? 9  SER D CA  1 
ATOM   627 C  C   . SER D 2 9  ? -1.398  5.941  5.198   1.00 21.39 ? 9  SER D C   1 
ATOM   628 O  O   . SER D 2 9  ? -1.561  5.979  3.977   1.00 21.06 ? 9  SER D O   1 
ATOM   629 C  CB  . SER D 2 9  ? 0.899   5.616  6.160   1.00 20.54 ? 9  SER D CB  1 
ATOM   630 O  OG  . SER D 2 9  ? 1.348   4.883  5.032   1.00 23.64 ? 9  SER D OG  1 
ATOM   631 N  N   . HIS D 2 10 ? -2.237  5.315  6.032   1.00 21.55 ? 10 HIS D N   1 
ATOM   632 C  CA  . HIS D 2 10 ? -3.463  4.659  5.598   1.00 22.85 ? 10 HIS D CA  1 
ATOM   633 C  C   . HIS D 2 10 ? -4.610  5.638  5.367   1.00 23.57 ? 10 HIS D C   1 
ATOM   634 O  O   . HIS D 2 10 ? -5.500  5.376  4.557   1.00 25.47 ? 10 HIS D O   1 
ATOM   635 C  CB  . HIS D 2 10 ? -3.872  3.626  6.639   1.00 23.51 ? 10 HIS D CB  1 
ATOM   636 C  CG  . HIS D 2 10 ? -2.950  2.418  6.650   1.00 21.80 ? 10 HIS D CG  1 
ATOM   637 N  ND1 . HIS D 2 10 ? -2.875  1.483  5.715   1.00 22.96 ? 10 HIS D ND1 1 
ATOM   638 C  CD2 . HIS D 2 10 ? -2.040  2.127  7.630   1.00 20.61 ? 10 HIS D CD2 1 
ATOM   639 C  CE1 . HIS D 2 10 ? -1.948  0.647  6.109   1.00 23.03 ? 10 HIS D CE1 1 
ATOM   640 N  NE2 . HIS D 2 10 ? -1.447  1.028  7.257   1.00 22.18 ? 10 HIS D NE2 1 
ATOM   641 N  N   . LEU D 2 11 ? -4.606  6.773  6.081   1.00 23.46 ? 11 LEU D N   1 
ATOM   642 C  CA  . LEU D 2 11 ? -5.589  7.830  5.905   1.00 22.88 ? 11 LEU D CA  1 
ATOM   643 C  C   . LEU D 2 11 ? -5.503  8.481  4.544   1.00 24.83 ? 11 LEU D C   1 
ATOM   644 O  O   . LEU D 2 11 ? -6.518  8.602  3.868   1.00 27.30 ? 11 LEU D O   1 
ATOM   645 C  CB  . LEU D 2 11 ? -5.412  8.930  6.927   1.00 21.16 ? 11 LEU D CB  1 
ATOM   646 C  CG  . LEU D 2 11 ? -5.917  8.687  8.331   1.00 26.77 ? 11 LEU D CG  1 
ATOM   647 C  CD1 . LEU D 2 11 ? -5.525  9.844  9.233   1.00 25.35 ? 11 LEU D CD1 1 
ATOM   648 C  CD2 . LEU D 2 11 ? -7.425  8.540  8.289   1.00 27.88 ? 11 LEU D CD2 1 
ATOM   649 N  N   . VAL D 2 12 ? -4.301  8.880  4.110   1.00 24.64 ? 12 VAL D N   1 
ATOM   650 C  CA  . VAL D 2 12 ? -4.131  9.556  2.833   1.00 24.44 ? 12 VAL D CA  1 
ATOM   651 C  C   . VAL D 2 12 ? -4.525  8.692  1.639   1.00 26.17 ? 12 VAL D C   1 
ATOM   652 O  O   . VAL D 2 12 ? -5.058  9.223  0.663   1.00 27.65 ? 12 VAL D O   1 
ATOM   653 C  CB  . VAL D 2 12 ? -2.657  10.054 2.699   1.00 21.88 ? 12 VAL D CB  1 
ATOM   654 C  CG1 . VAL D 2 12 ? -2.428  11.081 3.792   1.00 18.22 ? 12 VAL D CG1 1 
ATOM   655 C  CG2 . VAL D 2 12 ? -1.631  8.948  2.856   1.00 22.56 ? 12 VAL D CG2 1 
ATOM   656 N  N   . GLU D 2 13 ? -4.325  7.365  1.700   1.00 27.17 ? 13 GLU D N   1 
ATOM   657 C  CA  . GLU D 2 13 ? -4.771  6.469  0.639   1.00 26.05 ? 13 GLU D CA  1 
ATOM   658 C  C   . GLU D 2 13 ? -6.283  6.284  0.661   1.00 24.45 ? 13 GLU D C   1 
ATOM   659 O  O   . GLU D 2 13 ? -6.883  6.023  -0.383  1.00 23.44 ? 13 GLU D O   1 
ATOM   660 C  CB  . GLU D 2 13 ? -4.125  5.098  0.762   1.00 29.76 ? 13 GLU D CB  1 
ATOM   661 C  CG  . GLU D 2 13 ? -2.634  5.128  0.474   1.00 37.85 ? 13 GLU D CG  1 
ATOM   662 C  CD  . GLU D 2 13 ? -2.053  3.762  0.138   1.00 41.64 ? 13 GLU D CD  1 
ATOM   663 O  OE1 . GLU D 2 13 ? -1.280  3.224  0.936   1.00 41.84 ? 13 GLU D OE1 1 
ATOM   664 O  OE2 . GLU D 2 13 ? -2.369  3.250  -0.940  1.00 42.13 ? 13 GLU D OE2 1 
ATOM   665 N  N   . ALA D 2 14 ? -6.914  6.414  1.840   1.00 20.97 ? 14 ALA D N   1 
ATOM   666 C  CA  . ALA D 2 14 ? -8.366  6.371  1.963   1.00 20.06 ? 14 ALA D CA  1 
ATOM   667 C  C   . ALA D 2 14 ? -8.959  7.600  1.300   1.00 18.26 ? 14 ALA D C   1 
ATOM   668 O  O   . ALA D 2 14 ? -9.796  7.492  0.407   1.00 16.72 ? 14 ALA D O   1 
ATOM   669 C  CB  . ALA D 2 14 ? -8.799  6.379  3.417   1.00 19.78 ? 14 ALA D CB  1 
ATOM   670 N  N   . LEU D 2 15 ? -8.436  8.766  1.701   1.00 19.54 ? 15 LEU D N   1 
ATOM   671 C  CA  . LEU D 2 15 ? -8.821  10.065 1.175   1.00 17.82 ? 15 LEU D CA  1 
ATOM   672 C  C   . LEU D 2 15 ? -8.549  10.207 -0.312  1.00 18.98 ? 15 LEU D C   1 
ATOM   673 O  O   . LEU D 2 15 ? -9.185  11.029 -0.967  1.00 22.71 ? 15 LEU D O   1 
ATOM   674 C  CB  . LEU D 2 15 ? -8.081  11.152 1.932   1.00 18.98 ? 15 LEU D CB  1 
ATOM   675 C  CG  . LEU D 2 15 ? -8.382  11.305 3.417   1.00 21.38 ? 15 LEU D CG  1 
ATOM   676 C  CD1 . LEU D 2 15 ? -7.382  12.258 4.028   1.00 22.80 ? 15 LEU D CD1 1 
ATOM   677 C  CD2 . LEU D 2 15 ? -9.797  11.817 3.617   1.00 24.78 ? 15 LEU D CD2 1 
ATOM   678 N  N   . TYR D 2 16 ? -7.608  9.438  -0.881  1.00 18.53 ? 16 TYR D N   1 
ATOM   679 C  CA  . TYR D 2 16 ? -7.408  9.408  -2.325  1.00 16.46 ? 16 TYR D CA  1 
ATOM   680 C  C   . TYR D 2 16 ? -8.626  8.746  -2.987  1.00 19.36 ? 16 TYR D C   1 
ATOM   681 O  O   . TYR D 2 16 ? -9.103  9.205  -4.027  1.00 20.95 ? 16 TYR D O   1 
ATOM   682 C  CB  . TYR D 2 16 ? -6.117  8.622  -2.671  1.00 12.08 ? 16 TYR D CB  1 
ATOM   683 C  CG  . TYR D 2 16 ? -6.065  8.153  -4.125  1.00 10.89 ? 16 TYR D CG  1 
ATOM   684 C  CD1 . TYR D 2 16 ? -5.906  9.077  -5.157  1.00 12.71 ? 16 TYR D CD1 1 
ATOM   685 C  CD2 . TYR D 2 16 ? -6.282  6.806  -4.432  1.00 12.10 ? 16 TYR D CD2 1 
ATOM   686 C  CE1 . TYR D 2 16 ? -5.982  8.669  -6.489  1.00 12.15 ? 16 TYR D CE1 1 
ATOM   687 C  CE2 . TYR D 2 16 ? -6.360  6.392  -5.764  1.00 11.64 ? 16 TYR D CE2 1 
ATOM   688 C  CZ  . TYR D 2 16 ? -6.213  7.331  -6.780  1.00 10.84 ? 16 TYR D CZ  1 
ATOM   689 O  OH  . TYR D 2 16 ? -6.330  6.947  -8.095  1.00 19.17 ? 16 TYR D OH  1 
ATOM   690 N  N   . LEU D 2 17 ? -9.130  7.658  -2.389  1.00 17.98 ? 17 LEU D N   1 
ATOM   691 C  CA  . LEU D 2 17 ? -10.236 6.892  -2.939  1.00 17.63 ? 17 LEU D CA  1 
ATOM   692 C  C   . LEU D 2 17 ? -11.598 7.533  -2.764  1.00 17.55 ? 17 LEU D C   1 
ATOM   693 O  O   . LEU D 2 17 ? -12.356 7.631  -3.723  1.00 14.08 ? 17 LEU D O   1 
ATOM   694 C  CB  . LEU D 2 17 ? -10.223 5.506  -2.304  1.00 14.57 ? 17 LEU D CB  1 
ATOM   695 C  CG  . LEU D 2 17 ? -9.046  4.620  -2.668  1.00 12.97 ? 17 LEU D CG  1 
ATOM   696 C  CD1 . LEU D 2 17 ? -9.023  3.407  -1.773  1.00 15.46 ? 17 LEU D CD1 1 
ATOM   697 C  CD2 . LEU D 2 17 ? -9.152  4.217  -4.119  1.00 9.45  ? 17 LEU D CD2 1 
ATOM   698 N  N   . VAL D 2 18 ? -11.890 7.991  -1.543  1.00 18.65 ? 18 VAL D N   1 
ATOM   699 C  CA  . VAL D 2 18 ? -13.147 8.627  -1.172  1.00 23.67 ? 18 VAL D CA  1 
ATOM   700 C  C   . VAL D 2 18 ? -13.402 9.947  -1.890  1.00 25.95 ? 18 VAL D C   1 
ATOM   701 O  O   . VAL D 2 18 ? -14.531 10.232 -2.292  1.00 29.31 ? 18 VAL D O   1 
ATOM   702 C  CB  . VAL D 2 18 ? -13.146 8.827  0.367   1.00 24.56 ? 18 VAL D CB  1 
ATOM   703 C  CG1 . VAL D 2 18 ? -14.348 9.627  0.844   1.00 24.12 ? 18 VAL D CG1 1 
ATOM   704 C  CG2 . VAL D 2 18 ? -13.212 7.462  1.024   1.00 25.28 ? 18 VAL D CG2 1 
ATOM   705 N  N   . CYS D 2 19 ? -12.359 10.771 -2.041  1.00 29.07 ? 19 CYS D N   1 
ATOM   706 C  CA  . CYS D 2 19 ? -12.485 12.059 -2.693  1.00 28.50 ? 19 CYS D CA  1 
ATOM   707 C  C   . CYS D 2 19 ? -12.388 11.906 -4.204  1.00 27.73 ? 19 CYS D C   1 
ATOM   708 O  O   . CYS D 2 19 ? -13.368 12.187 -4.894  1.00 33.19 ? 19 CYS D O   1 
ATOM   709 C  CB  . CYS D 2 19 ? -11.400 12.983 -2.170  1.00 27.85 ? 19 CYS D CB  1 
ATOM   710 S  SG  . CYS D 2 19 ? -11.242 12.980 -0.361  1.00 28.73 ? 19 CYS D SG  1 
ATOM   711 N  N   . GLY D 2 20 ? -11.276 11.431 -4.769  1.00 26.25 ? 20 GLY D N   1 
ATOM   712 C  CA  . GLY D 2 20 ? -11.173 11.265 -6.215  1.00 28.16 ? 20 GLY D CA  1 
ATOM   713 C  C   . GLY D 2 20 ? -10.650 12.516 -6.903  1.00 30.97 ? 20 GLY D C   1 
ATOM   714 O  O   . GLY D 2 20 ? -9.666  13.091 -6.437  1.00 32.47 ? 20 GLY D O   1 
ATOM   715 N  N   . GLU D 2 21 ? -11.271 12.972 -8.005  1.00 32.35 ? 21 GLU D N   1 
ATOM   716 C  CA  . GLU D 2 21 ? -10.812 14.181 -8.685  1.00 32.01 ? 21 GLU D CA  1 
ATOM   717 C  C   . GLU D 2 21 ? -11.079 15.498 -7.967  1.00 30.90 ? 21 GLU D C   1 
ATOM   718 O  O   . GLU D 2 21 ? -10.524 16.526 -8.352  1.00 32.44 ? 21 GLU D O   1 
ATOM   719 C  CB  . GLU D 2 21 ? -11.410 14.280 -10.093 1.00 35.34 ? 21 GLU D CB  1 
ATOM   720 C  CG  . GLU D 2 21 ? -10.454 13.656 -11.121 1.00 38.94 ? 21 GLU D CG  1 
ATOM   721 C  CD  . GLU D 2 21 ? -10.748 13.951 -12.590 1.00 41.06 ? 21 GLU D CD  1 
ATOM   722 O  OE1 . GLU D 2 21 ? -11.853 13.658 -13.061 1.00 42.43 ? 21 GLU D OE1 1 
ATOM   723 O  OE2 . GLU D 2 21 ? -9.856  14.473 -13.263 1.00 38.97 ? 21 GLU D OE2 1 
ATOM   724 N  N   . ARG D 2 22 ? -11.903 15.523 -6.913  1.00 29.32 ? 22 ARG D N   1 
ATOM   725 C  CA  . ARG D 2 22 ? -12.108 16.719 -6.098  1.00 28.50 ? 22 ARG D CA  1 
ATOM   726 C  C   . ARG D 2 22 ? -10.808 17.066 -5.374  1.00 27.92 ? 22 ARG D C   1 
ATOM   727 O  O   . ARG D 2 22 ? -10.394 18.226 -5.287  1.00 31.34 ? 22 ARG D O   1 
ATOM   728 C  CB  . ARG D 2 22 ? -13.185 16.482 -5.054  1.00 29.88 ? 22 ARG D CB  1 
ATOM   729 C  CG  . ARG D 2 22 ? -14.576 16.246 -5.617  1.00 32.52 ? 22 ARG D CG  1 
ATOM   730 C  CD  . ARG D 2 22 ? -15.489 15.706 -4.525  1.00 33.82 ? 22 ARG D CD  1 
ATOM   731 N  NE  . ARG D 2 22 ? -15.569 16.614 -3.394  1.00 38.17 ? 22 ARG D NE  1 
ATOM   732 C  CZ  . ARG D 2 22 ? -15.959 16.214 -2.181  1.00 43.82 ? 22 ARG D CZ  1 
ATOM   733 N  NH1 . ARG D 2 22 ? -16.299 14.943 -1.936  1.00 46.42 ? 22 ARG D NH1 1 
ATOM   734 N  NH2 . ARG D 2 22 ? -16.021 17.113 -1.197  1.00 42.62 ? 22 ARG D NH2 1 
ATOM   735 N  N   . GLY D 2 23 ? -10.159 16.016 -4.864  1.00 23.56 ? 23 GLY D N   1 
ATOM   736 C  CA  . GLY D 2 23 ? -8.895  16.137 -4.166  1.00 17.68 ? 23 GLY D CA  1 
ATOM   737 C  C   . GLY D 2 23 ? -9.073  16.386 -2.686  1.00 15.32 ? 23 GLY D C   1 
ATOM   738 O  O   . GLY D 2 23 ? -10.177 16.331 -2.148  1.00 16.56 ? 23 GLY D O   1 
ATOM   739 N  N   . PHE D 2 24 ? -7.944  16.658 -2.038  1.00 12.96 ? 24 PHE D N   1 
ATOM   740 C  CA  . PHE D 2 24 ? -7.911  16.930 -0.615  1.00 12.63 ? 24 PHE D CA  1 
ATOM   741 C  C   . PHE D 2 24 ? -6.613  17.613 -0.208  1.00 14.32 ? 24 PHE D C   1 
ATOM   742 O  O   . PHE D 2 24 ? -5.647  17.730 -0.962  1.00 9.28  ? 24 PHE D O   1 
ATOM   743 C  CB  . PHE D 2 24 ? -8.086  15.612 0.188   1.00 14.65 ? 24 PHE D CB  1 
ATOM   744 C  CG  . PHE D 2 24 ? -6.929  14.618 0.146   1.00 13.29 ? 24 PHE D CG  1 
ATOM   745 C  CD1 . PHE D 2 24 ? -6.604  13.946 -1.037  1.00 12.31 ? 24 PHE D CD1 1 
ATOM   746 C  CD2 . PHE D 2 24 ? -6.178  14.403 1.304   1.00 12.31 ? 24 PHE D CD2 1 
ATOM   747 C  CE1 . PHE D 2 24 ? -5.526  13.065 -1.059  1.00 12.33 ? 24 PHE D CE1 1 
ATOM   748 C  CE2 . PHE D 2 24 ? -5.103  13.520 1.271   1.00 15.50 ? 24 PHE D CE2 1 
ATOM   749 C  CZ  . PHE D 2 24 ? -4.778  12.855 0.092   1.00 14.36 ? 24 PHE D CZ  1 
ATOM   750 N  N   . PHE D 2 25 ? -6.662  18.065 1.042   1.00 17.75 ? 25 PHE D N   1 
ATOM   751 C  CA  . PHE D 2 25 ? -5.567  18.723 1.720   1.00 21.39 ? 25 PHE D CA  1 
ATOM   752 C  C   . PHE D 2 25 ? -5.299  17.958 3.001   1.00 23.40 ? 25 PHE D C   1 
ATOM   753 O  O   . PHE D 2 25 ? -6.156  17.822 3.881   1.00 23.41 ? 25 PHE D O   1 
ATOM   754 C  CB  . PHE D 2 25 ? -5.911  20.172 2.092   1.00 27.73 ? 25 PHE D CB  1 
ATOM   755 C  CG  . PHE D 2 25 ? -5.750  21.249 1.015   1.00 35.79 ? 25 PHE D CG  1 
ATOM   756 C  CD1 . PHE D 2 25 ? -6.513  21.236 -0.161  1.00 37.03 ? 25 PHE D CD1 1 
ATOM   757 C  CD2 . PHE D 2 25 ? -4.827  22.282 1.223   1.00 36.99 ? 25 PHE D CD2 1 
ATOM   758 C  CE1 . PHE D 2 25 ? -6.352  22.250 -1.115  1.00 37.44 ? 25 PHE D CE1 1 
ATOM   759 C  CE2 . PHE D 2 25 ? -4.673  23.291 0.264   1.00 37.13 ? 25 PHE D CE2 1 
ATOM   760 C  CZ  . PHE D 2 25 ? -5.437  23.282 -0.904  1.00 36.29 ? 25 PHE D CZ  1 
ATOM   761 N  N   . TYR D 2 26 ? -4.083  17.419 3.076   1.00 25.68 ? 26 TYR D N   1 
ATOM   762 C  CA  . TYR D 2 26 ? -3.635  16.736 4.274   1.00 25.81 ? 26 TYR D CA  1 
ATOM   763 C  C   . TYR D 2 26 ? -2.675  17.649 5.011   1.00 26.55 ? 26 TYR D C   1 
ATOM   764 O  O   . TYR D 2 26 ? -1.720  18.192 4.460   1.00 26.51 ? 26 TYR D O   1 
ATOM   765 C  CB  . TYR D 2 26 ? -2.919  15.429 3.939   1.00 24.04 ? 26 TYR D CB  1 
ATOM   766 C  CG  . TYR D 2 26 ? -2.443  14.689 5.183   1.00 23.11 ? 26 TYR D CG  1 
ATOM   767 C  CD1 . TYR D 2 26 ? -3.354  14.015 6.002   1.00 25.27 ? 26 TYR D CD1 1 
ATOM   768 C  CD2 . TYR D 2 26 ? -1.089  14.709 5.517   1.00 24.56 ? 26 TYR D CD2 1 
ATOM   769 C  CE1 . TYR D 2 26 ? -2.909  13.363 7.158   1.00 25.02 ? 26 TYR D CE1 1 
ATOM   770 C  CE2 . TYR D 2 26 ? -0.641  14.063 6.668   1.00 25.14 ? 26 TYR D CE2 1 
ATOM   771 C  CZ  . TYR D 2 26 ? -1.552  13.395 7.479   1.00 26.40 ? 26 TYR D CZ  1 
ATOM   772 O  OH  . TYR D 2 26 ? -1.098  12.774 8.624   1.00 29.85 ? 26 TYR D OH  1 
ATOM   773 N  N   . THR D 2 27 ? -2.984  17.788 6.294   1.00 29.23 ? 27 THR D N   1 
ATOM   774 C  CA  . THR D 2 27 ? -2.201  18.568 7.231   1.00 33.23 ? 27 THR D CA  1 
ATOM   775 C  C   . THR D 2 27 ? -2.211  17.815 8.554   1.00 35.76 ? 27 THR D C   1 
ATOM   776 O  O   . THR D 2 27 ? -3.265  17.683 9.184   1.00 34.70 ? 27 THR D O   1 
ATOM   777 C  CB  . THR D 2 27 ? -2.793  19.991 7.439   1.00 33.98 ? 27 THR D CB  1 
ATOM   778 O  OG1 . THR D 2 27 ? -4.201  19.831 7.559   1.00 36.26 ? 27 THR D OG1 1 
ATOM   779 C  CG2 . THR D 2 27 ? -2.428  20.963 6.323   1.00 33.59 ? 27 THR D CG2 1 
ATOM   780 N  N   . PRO D 2 28 ? -1.061  17.279 8.995   1.00 38.54 ? 28 PRO D N   1 
ATOM   781 C  CA  . PRO D 2 28 ? -0.907  16.523 10.237  1.00 41.51 ? 28 PRO D CA  1 
ATOM   782 C  C   . PRO D 2 28 ? -1.436  17.274 11.445  1.00 43.24 ? 28 PRO D C   1 
ATOM   783 O  O   . PRO D 2 28 ? -2.147  16.747 12.300  1.00 43.34 ? 28 PRO D O   1 
ATOM   784 C  CB  . PRO D 2 28 ? 0.580   16.254 10.340  1.00 40.57 ? 28 PRO D CB  1 
ATOM   785 C  CG  . PRO D 2 28 ? 1.035   16.294 8.908   1.00 41.60 ? 28 PRO D CG  1 
ATOM   786 C  CD  . PRO D 2 28 ? 0.239   17.462 8.360   1.00 40.61 ? 28 PRO D CD  1 
ATOM   787 N  N   . LYS D 2 29 ? -1.038  18.549 11.453  1.00 46.14 ? 29 LYS D N   1 
ATOM   788 C  CA  . LYS D 2 29 ? -1.345  19.498 12.506  1.00 47.75 ? 29 LYS D CA  1 
ATOM   789 C  C   . LYS D 2 29 ? -1.440  20.883 11.890  1.00 48.45 ? 29 LYS D C   1 
ATOM   790 O  O   . LYS D 2 29 ? -0.645  21.232 11.016  1.00 48.22 ? 29 LYS D O   1 
ATOM   791 C  CB  . LYS D 2 29 ? -0.237  19.536 13.567  1.00 48.67 ? 29 LYS D CB  1 
ATOM   792 C  CG  . LYS D 2 29 ? 0.102   18.205 14.226  1.00 49.07 ? 29 LYS D CG  1 
ATOM   793 C  CD  . LYS D 2 29 ? 1.073   18.326 15.379  1.00 49.21 ? 29 LYS D CD  1 
ATOM   794 C  CE  . LYS D 2 29 ? 1.317   16.894 15.813  1.00 48.79 ? 29 LYS D CE  1 
ATOM   795 N  NZ  . LYS D 2 29 ? 2.055   16.832 17.059  1.00 48.47 ? 29 LYS D NZ  1 
ATOM   796 N  N   . THR D 2 30 ? -2.453  21.634 12.352  1.00 49.87 ? 30 THR D N   1 
ATOM   797 C  CA  . THR D 2 30 ? -2.717  23.043 12.052  1.00 49.93 ? 30 THR D CA  1 
ATOM   798 C  C   . THR D 2 30 ? -2.481  23.585 10.629  1.00 49.77 ? 30 THR D C   1 
ATOM   799 O  O   . THR D 2 30 ? -3.468  23.787 9.918   1.00 50.62 ? 30 THR D O   1 
ATOM   800 C  CB  . THR D 2 30 ? -1.914  23.847 13.124  1.00 49.27 ? 30 THR D CB  1 
ATOM   801 O  OG1 . THR D 2 30 ? -2.314  23.336 14.398  1.00 49.03 ? 30 THR D OG1 1 
ATOM   802 C  CG2 . THR D 2 30 ? -2.196  25.340 13.104  1.00 49.41 ? 30 THR D CG2 1 
ATOM   803 O  OXT . THR D 2 30 ? -1.337  23.804 10.228  1.00 49.05 ? 30 THR D OXT 1 
HETATM 804 ZN ZN  . ZN  E 3 .  ? 0.000   0.000  -7.753  0.33 19.28 ? 41 ZN  B ZN  1 
HETATM 805 ZN ZN  . ZN  F 3 .  ? 0.000   0.000  8.020   0.33 18.94 ? 42 ZN  D ZN  1 
HETATM 806 O  O   . HOH G 4 .  ? 15.257  19.971 -0.869  1.00 23.32 ? 22 HOH A O   1 
HETATM 807 O  O   . HOH G 4 .  ? 14.011  22.564 -1.249  1.00 53.97 ? 23 HOH A O   1 
HETATM 808 O  O   . HOH G 4 .  ? 3.272   24.666 6.920   1.00 56.46 ? 24 HOH A O   1 
HETATM 809 O  O   . HOH G 4 .  ? 14.443  19.452 -10.790 1.00 23.46 ? 25 HOH A O   1 
HETATM 810 O  O   . HOH G 4 .  ? 12.662  23.032 -7.056  1.00 50.11 ? 26 HOH A O   1 
HETATM 811 O  O   . HOH G 4 .  ? 10.156  22.374 -11.011 1.00 40.75 ? 27 HOH A O   1 
HETATM 812 O  O   . HOH G 4 .  ? 11.448  17.438 2.642   1.00 42.50 ? 28 HOH A O   1 
HETATM 813 O  O   . HOH G 4 .  ? 11.106  17.822 5.372   1.00 41.87 ? 29 HOH A O   1 
HETATM 814 O  O   . HOH H 4 .  ? -5.727  14.330 -15.850 1.00 27.70 ? 42 HOH B O   1 
HETATM 815 O  O   . HOH H 4 .  ? 14.731  4.474  -10.732 1.00 25.87 ? 43 HOH B O   1 
HETATM 816 O  O   . HOH H 4 .  ? 11.101  14.105 10.097  1.00 32.39 ? 44 HOH B O   1 
HETATM 817 O  O   . HOH H 4 .  ? -3.301  17.547 -11.322 1.00 52.28 ? 45 HOH B O   1 
HETATM 818 O  O   . HOH H 4 .  ? -2.422  10.008 -8.846  1.00 30.69 ? 46 HOH B O   1 
HETATM 819 O  O   . HOH H 4 .  ? 8.156   19.221 12.316  1.00 27.98 ? 47 HOH B O   1 
HETATM 820 O  O   . HOH H 4 .  ? 10.543  13.101 5.203   1.00 41.93 ? 48 HOH B O   1 
HETATM 821 O  O   . HOH H 4 .  ? -5.345  21.565 -19.487 1.00 34.34 ? 49 HOH B O   1 
HETATM 822 O  O   . HOH H 4 .  ? -4.175  16.630 -14.103 1.00 46.78 ? 50 HOH B O   1 
HETATM 823 O  O   . HOH H 4 .  ? 5.385   4.249  -5.106  1.00 54.37 ? 51 HOH B O   1 
HETATM 824 O  O   . HOH H 4 .  ? 1.872   3.609  -2.200  1.00 29.06 ? 52 HOH B O   1 
HETATM 825 O  O   . HOH I 4 .  ? -14.091 22.416 2.008   1.00 31.50 ? 22 HOH C O   1 
HETATM 826 O  O   . HOH I 4 .  ? -23.224 6.253  -0.937  1.00 33.54 ? 23 HOH C O   1 
HETATM 827 O  O   . HOH I 4 .  ? -7.528  17.913 9.795   1.00 20.71 ? 24 HOH C O   1 
HETATM 828 O  O   . HOH I 4 .  ? -6.873  5.326  20.370  1.00 31.48 ? 25 HOH C O   1 
HETATM 829 O  O   . HOH I 4 .  ? -12.809 23.505 -1.945  1.00 39.43 ? 26 HOH C O   1 
HETATM 830 O  O   . HOH I 4 .  ? -17.220 12.586 13.381  1.00 46.58 ? 27 HOH C O   1 
HETATM 831 O  O   . HOH I 4 .  ? -15.943 14.640 17.384  1.00 42.41 ? 28 HOH C O   1 
HETATM 832 O  O   . HOH I 4 .  ? -11.315 14.431 19.799  1.00 51.10 ? 29 HOH C O   1 
HETATM 833 O  O   . HOH J 4 .  ? -7.264  3.144  2.847   1.00 24.23 ? 43 HOH D O   1 
HETATM 834 O  O   . HOH J 4 .  ? 0.797   2.332  17.835  1.00 43.06 ? 44 HOH D O   1 
HETATM 835 O  O   . HOH J 4 .  ? -2.477  18.469 17.544  1.00 45.79 ? 45 HOH D O   1 
HETATM 836 O  O   . HOH J 4 .  ? 5.084   7.683  15.939  1.00 32.65 ? 46 HOH D O   1 
HETATM 837 O  O   . HOH J 4 .  ? 1.027   25.245 11.440  1.00 36.44 ? 47 HOH D O   1 
HETATM 838 O  O   . HOH J 4 .  ? -0.574  1.572  -2.253  1.00 50.45 ? 48 HOH D O   1 
HETATM 839 O  O   . HOH J 4 .  ? -8.055  11.848 -4.571  1.00 26.20 ? 49 HOH D O   1 
HETATM 840 O  O   . HOH J 4 .  ? 3.738   1.911  17.023  1.00 40.89 ? 50 HOH D O   1 
HETATM 841 O  O   . HOH J 4 .  ? -2.162  9.287  21.173  1.00 36.00 ? 51 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  1  GLY GLY A . n 
A 1 2  ILE 2  2  2  ILE ILE A . n 
A 1 3  VAL 3  3  3  VAL VAL A . n 
A 1 4  GLU 4  4  4  GLU GLU A . n 
A 1 5  GLN 5  5  5  GLN GLN A . n 
A 1 6  CYS 6  6  6  CYS CYS A . n 
A 1 7  CYS 7  7  7  CYS CYS A . n 
A 1 8  LYS 8  8  8  LYS LYS A . n 
A 1 9  SER 9  9  9  SER SER A . n 
A 1 10 ILE 10 10 10 ILE ILE A . n 
A 1 11 CYS 11 11 11 CYS CYS A . n 
A 1 12 SER 12 12 12 SER SER A . n 
A 1 13 LEU 13 13 13 LEU LEU A . n 
A 1 14 TYR 14 14 14 TYR TYR A . n 
A 1 15 GLN 15 15 15 GLN GLN A . n 
A 1 16 LEU 16 16 16 LEU LEU A . n 
A 1 17 GLU 17 17 17 GLU GLU A . n 
A 1 18 ASN 18 18 18 ASN ASN A . n 
A 1 19 TYR 19 19 19 TYR TYR A . n 
A 1 20 CYS 20 20 20 CYS CYS A . n 
A 1 21 ASN 21 21 21 ASN ASN A . n 
B 2 1  PHE 1  1  1  PHE PHE B . n 
B 2 2  VAL 2  2  2  VAL VAL B . n 
B 2 3  ASN 3  3  3  ASN ASN B . n 
B 2 4  GLN 4  4  4  GLN GLN B . n 
B 2 5  HIS 5  5  5  HIS HIS B . n 
B 2 6  LEU 6  6  6  LEU LEU B . n 
B 2 7  CYS 7  7  7  CYS CYS B . n 
B 2 8  GLY 8  8  8  GLY GLY B . n 
B 2 9  SER 9  9  9  SER SER B . n 
B 2 10 HIS 10 10 10 HIS HIS B . n 
B 2 11 LEU 11 11 11 LEU LEU B . n 
B 2 12 VAL 12 12 12 VAL VAL B . n 
B 2 13 GLU 13 13 13 GLU GLU B . n 
B 2 14 ALA 14 14 14 ALA ALA B . n 
B 2 15 LEU 15 15 15 LEU LEU B . n 
B 2 16 TYR 16 16 16 TYR TYR B . n 
B 2 17 LEU 17 17 17 LEU LEU B . n 
B 2 18 VAL 18 18 18 VAL VAL B . n 
B 2 19 CYS 19 19 19 CYS CYS B . n 
B 2 20 GLY 20 20 20 GLY GLY B . n 
B 2 21 GLU 21 21 21 GLU GLU B . n 
B 2 22 ARG 22 22 22 ARG ARG B . n 
B 2 23 GLY 23 23 23 GLY GLY B . n 
B 2 24 PHE 24 24 24 PHE PHE B . n 
B 2 25 PHE 25 25 25 PHE PHE B . n 
B 2 26 TYR 26 26 26 TYR TYR B . n 
B 2 27 THR 27 27 27 THR THR B . n 
B 2 28 PRO 28 28 28 PRO PRO B . n 
B 2 29 LYS 29 29 29 LYS LYS B . n 
B 2 30 THR 30 30 30 THR THR B . n 
C 1 1  GLY 1  1  1  GLY GLY C . n 
C 1 2  ILE 2  2  2  ILE ILE C . n 
C 1 3  VAL 3  3  3  VAL VAL C . n 
C 1 4  GLU 4  4  4  GLU GLU C . n 
C 1 5  GLN 5  5  5  GLN GLN C . n 
C 1 6  CYS 6  6  6  CYS CYS C . n 
C 1 7  CYS 7  7  7  CYS CYS C . n 
C 1 8  LYS 8  8  8  LYS LYS C . n 
C 1 9  SER 9  9  9  SER SER C . n 
C 1 10 ILE 10 10 10 ILE ILE C . n 
C 1 11 CYS 11 11 11 CYS CYS C . n 
C 1 12 SER 12 12 12 SER SER C . n 
C 1 13 LEU 13 13 13 LEU LEU C . n 
C 1 14 TYR 14 14 14 TYR TYR C . n 
C 1 15 GLN 15 15 15 GLN GLN C . n 
C 1 16 LEU 16 16 16 LEU LEU C . n 
C 1 17 GLU 17 17 17 GLU GLU C . n 
C 1 18 ASN 18 18 18 ASN ASN C . n 
C 1 19 TYR 19 19 19 TYR TYR C . n 
C 1 20 CYS 20 20 20 CYS CYS C . n 
C 1 21 ASN 21 21 21 ASN ASN C . n 
D 2 1  PHE 1  1  ?  ?   ?   D . n 
D 2 2  VAL 2  2  2  VAL VAL D . n 
D 2 3  ASN 3  3  3  ASN ASN D . n 
D 2 4  GLN 4  4  4  GLN GLN D . n 
D 2 5  HIS 5  5  5  HIS HIS D . n 
D 2 6  LEU 6  6  6  LEU LEU D . n 
D 2 7  CYS 7  7  7  CYS CYS D . n 
D 2 8  GLY 8  8  8  GLY GLY D . n 
D 2 9  SER 9  9  9  SER SER D . n 
D 2 10 HIS 10 10 10 HIS HIS D . n 
D 2 11 LEU 11 11 11 LEU LEU D . n 
D 2 12 VAL 12 12 12 VAL VAL D . n 
D 2 13 GLU 13 13 13 GLU GLU D . n 
D 2 14 ALA 14 14 14 ALA ALA D . n 
D 2 15 LEU 15 15 15 LEU LEU D . n 
D 2 16 TYR 16 16 16 TYR TYR D . n 
D 2 17 LEU 17 17 17 LEU LEU D . n 
D 2 18 VAL 18 18 18 VAL VAL D . n 
D 2 19 CYS 19 19 19 CYS CYS D . n 
D 2 20 GLY 20 20 20 GLY GLY D . n 
D 2 21 GLU 21 21 21 GLU GLU D . n 
D 2 22 ARG 22 22 22 ARG ARG D . n 
D 2 23 GLY 23 23 23 GLY GLY D . n 
D 2 24 PHE 24 24 24 PHE PHE D . n 
D 2 25 PHE 25 25 25 PHE PHE D . n 
D 2 26 TYR 26 26 26 TYR TYR D . n 
D 2 27 THR 27 27 27 THR THR D . n 
D 2 28 PRO 28 28 28 PRO PRO D . n 
D 2 29 LYS 29 29 29 LYS LYS D . n 
D 2 30 THR 30 30 30 THR THR D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA     hexameric   6  
2 author_and_software_defined_assembly PISA     hexameric   6  
3 software_defined_assembly            PISA,PQS dodecameric 12 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2,3 A,B,E,G,H           
2 1,2,3 C,D,F,I,J           
3 1,2,3 A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5220  ? 
1 MORE         -90   ? 
1 'SSA (A^2)'  10590 ? 
2 'ABSA (A^2)' 5190  ? 
2 MORE         -117  ? 
2 'SSA (A^2)'  10870 ? 
3 'ABSA (A^2)' 17590 ? 
3 MORE         -263  ? 
3 'SSA (A^2)'  14280 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_555 -y,x-y,z  -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038  -0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038  0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 B ZN 41 ? E ZN . 
2 1 D ZN 42 ? F ZN . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? B HIS 10 ? B HIS 10 ? 1_555 ZN ? E ZN . ? B ZN 41 ? 1_555 NE2 ? B HIS 10 ? B HIS 10 ? 2_555 101.9 ? 
2 NE2 ? B HIS 10 ? B HIS 10 ? 1_555 ZN ? E ZN . ? B ZN 41 ? 1_555 NE2 ? B HIS 10 ? B HIS 10 ? 3_555 101.9 ? 
3 NE2 ? B HIS 10 ? B HIS 10 ? 2_555 ZN ? E ZN . ? B ZN 41 ? 1_555 NE2 ? B HIS 10 ? B HIS 10 ? 3_555 101.9 ? 
4 NE2 ? D HIS 10 ? D HIS 10 ? 1_555 ZN ? F ZN . ? D ZN 42 ? 1_555 NE2 ? D HIS 10 ? D HIS 10 ? 2_555 105.4 ? 
5 NE2 ? D HIS 10 ? D HIS 10 ? 1_555 ZN ? F ZN . ? D ZN 42 ? 1_555 NE2 ? D HIS 10 ? D HIS 10 ? 3_555 105.4 ? 
6 NE2 ? D HIS 10 ? D HIS 10 ? 2_555 ZN ? F ZN . ? D ZN 42 ? 1_555 NE2 ? D HIS 10 ? D HIS 10 ? 3_555 105.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-06-20 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
X-PLOR    'model building' .   ? 3 
X-PLOR    refinement       3.1 ? 4 
X-PLOR    phasing          .   ? 5 
# 
_pdbx_database_remark.id     400 
_pdbx_database_remark.text   
;COMPOUND
The crystallographic asymmetric unit of insulin 
consists of two insulin monomers each consisting 
of two heterochains. 
The entry presents coordinates for monomer 1 
(chain indicators A and B) and monomer 2 (chain 
indicators C and D). There are two zinc ions per 
insulin hexamer located on the three-fold axis. 
The conformations of two monomers are different 
as the result of a change in conformation of the 
first eight residues of the B-chain. 
;
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 NE2 B HIS 5  ? ? CD2 B HIS 5  ? ? 1.305 1.373 -0.068 0.011 N 
2 1 NE2 B HIS 10 ? ? CD2 B HIS 10 ? ? 1.303 1.373 -0.070 0.011 N 
3 1 NE2 D HIS 5  ? ? CD2 D HIS 5  ? ? 1.304 1.373 -0.069 0.011 N 
4 1 NE2 D HIS 10 ? ? CD2 D HIS 10 ? ? 1.303 1.373 -0.070 0.011 N 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     D 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     PHE 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      1 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    D 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    PHE 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ZINC ION' ZN  
4 water      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 ZN  1  41 1  ZN  ZN  B . 
F 3 ZN  1  42 2  ZN  ZN  D . 
G 4 HOH 1  22 5  HOH HOH A . 
G 4 HOH 2  23 8  HOH HOH A . 
G 4 HOH 3  24 12 HOH HOH A . 
G 4 HOH 4  25 15 HOH HOH A . 
G 4 HOH 5  26 17 HOH HOH A . 
G 4 HOH 6  27 18 HOH HOH A . 
G 4 HOH 7  28 30 HOH HOH A . 
G 4 HOH 8  29 33 HOH HOH A . 
H 4 HOH 1  42 3  HOH HOH B . 
H 4 HOH 2  43 4  HOH HOH B . 
H 4 HOH 3  44 10 HOH HOH B . 
H 4 HOH 4  45 19 HOH HOH B . 
H 4 HOH 5  46 21 HOH HOH B . 
H 4 HOH 6  47 23 HOH HOH B . 
H 4 HOH 7  48 25 HOH HOH B . 
H 4 HOH 8  49 26 HOH HOH B . 
H 4 HOH 9  50 27 HOH HOH B . 
H 4 HOH 10 51 29 HOH HOH B . 
H 4 HOH 11 52 36 HOH HOH B . 
I 4 HOH 1  22 6  HOH HOH C . 
I 4 HOH 2  23 11 HOH HOH C . 
I 4 HOH 3  24 14 HOH HOH C . 
I 4 HOH 4  25 16 HOH HOH C . 
I 4 HOH 5  26 20 HOH HOH C . 
I 4 HOH 6  27 24 HOH HOH C . 
I 4 HOH 7  28 32 HOH HOH C . 
I 4 HOH 8  29 35 HOH HOH C . 
J 4 HOH 1  43 7  HOH HOH D . 
J 4 HOH 2  44 9  HOH HOH D . 
J 4 HOH 3  45 13 HOH HOH D . 
J 4 HOH 4  46 22 HOH HOH D . 
J 4 HOH 5  47 28 HOH HOH D . 
J 4 HOH 6  48 31 HOH HOH D . 
J 4 HOH 7  49 34 HOH HOH D . 
J 4 HOH 8  50 37 HOH HOH D . 
J 4 HOH 9  51 38 HOH HOH D . 
#