data_1JCO
# 
_entry.id   1JCO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JCO         
RCSB  RCSB013628   
WWPDB D_1000013628 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JCO 
_pdbx_database_status.recvd_initial_deposition_date   2001-06-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Keller, D.'   1 
'Clausen, R.'  2 
'Josefsen, K.' 3 
'Led, J.J.'    4 
# 
_citation.id                        primary 
_citation.title                     
;Flexibility and bioactivity of insulin: an NMR investigation of the solution structure and folding of an unusually flexible human insulin mutant with increased biological activity.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            40 
_citation.page_first                10732 
_citation.page_last                 10740 
_citation.year                      2001 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11524020 
_citation.pdbx_database_id_DOI      10.1021/bi0108150 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Keller, D.'   1 
primary 'Clausen, R.'  2 
primary 'Josefsen, K.' 3 
primary 'Led, J.J.'    4 
# 
_cell.entry_id           1JCO 
_cell.length_a           ? 
_cell.length_b           ? 
_cell.length_c           ? 
_cell.angle_alpha        ? 
_cell.angle_beta         ? 
_cell.angle_gamma        ? 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Insulin A chain' 2383.698 1 ? ?            ? ? 
2 polymer man 'Insulin B chain' 3433.953 1 ? 'T27P, P28T' ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN          GIVEQCCTSICSLYQLENYCN          A ? 
2 'polypeptide(L)' no no FVNQHLCGSHLVEALYLVCGERGFFYPTKT FVNQHLCGSHLVEALYLVCGERGFFYPTKT B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ILE n 
1 3  VAL n 
1 4  GLU n 
1 5  GLN n 
1 6  CYS n 
1 7  CYS n 
1 8  THR n 
1 9  SER n 
1 10 ILE n 
1 11 CYS n 
1 12 SER n 
1 13 LEU n 
1 14 TYR n 
1 15 GLN n 
1 16 LEU n 
1 17 GLU n 
1 18 ASN n 
1 19 TYR n 
1 20 CYS n 
1 21 ASN n 
2 1  PHE n 
2 2  VAL n 
2 3  ASN n 
2 4  GLN n 
2 5  HIS n 
2 6  LEU n 
2 7  CYS n 
2 8  GLY n 
2 9  SER n 
2 10 HIS n 
2 11 LEU n 
2 12 VAL n 
2 13 GLU n 
2 14 ALA n 
2 15 LEU n 
2 16 TYR n 
2 17 LEU n 
2 18 VAL n 
2 19 CYS n 
2 20 GLY n 
2 21 GLU n 
2 22 ARG n 
2 23 GLY n 
2 24 PHE n 
2 25 PHE n 
2 26 TYR n 
2 27 PRO n 
2 28 THR n 
2 29 LYS n 
2 30 THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Pichia pastoris' 4922 Pichia ? ? ? ? ? ? ? ? ? ? ? 
? ? Plasmid ? ? ? pPIC9 ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Pichia pastoris' 4922 Pichia ? ? ? ? ? ? ? ? ? ? ? 
? ? Plasmid ? ? ? pPIC9 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP INS_HUMAN 1 GIVEQCCTSICSLYQLENYCN          90 P01308 ? 
2 UNP INS_HUMAN 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKT 25 P01308 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JCO A 1 ? 21 ? P01308 90 ? 110 ? 1 21 
2 2 1JCO B 1 ? 30 ? P01308 25 ? 54  ? 1 30 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 1JCO PRO B 27 ? UNP P01308 THR 51 ENGINEERED 27 1 
2 1JCO THR B 28 ? UNP P01308 PRO 52 ENGINEERED 28 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl.experiment_id   1 
_pdbx_nmr_exptl.solution_id     3 
_pdbx_nmr_exptl.conditions_id   1 
_pdbx_nmr_exptl.type            '2D NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  3.13 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '2.8 mM PT-insulin; 10%D2O; 90%H2O'                        '10% D2O, 90% H2O'                      
2 '2.8 mM PT-insulin; 100% D2O'                              '100% D2O'                              
3 '2.8 mM PT-insulin; 35% Trifluoroethanol; 5% D2O; 60% H2O' '35% Trifluoroethanol; 5% D2O; 60% H2O' 
4 '2.8 mM PT-insulin; 35% Trifluoroethanol; 65% D2O;'        '35% Trifluoroethanol; 65% D2O;'        
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Varian 'Unity INOVA' 500 
2 ? Varian 'Unity INOVA' 750 
3 ? Varian 'Unity INOVA' 800 
# 
_pdbx_nmr_refine.entry_id           1JCO 
_pdbx_nmr_refine.method             'simulated annealing, molecular dynamics' 
_pdbx_nmr_refine.details            
'197 NOEs, 52 dihedral angles, 11 hydrogen bonds. Force constants: k(NOE)= 50 kcal mol-1 AA-1, k(DIHE)= 200 kcal mol-1 AA-1' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1JCO 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             25 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1JCO 
_pdbx_nmr_representative.conformer_id         12 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
NMRPipe ?                             processing           'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer, Bax' 1 
XEASY   'Digital UNIX V4.0 version 1' 'data analysis'      'Bartels, Xia, Billeter, Guntert, Wuthrich'      2 
X-PLOR  3.851                         'structure solution' Brunger                                          3 
X-PLOR  3.851                         refinement           Brunger                                          4 
# 
_exptl.entry_id          1JCO 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1JCO 
_struct.title                     'Solution structure of the monomeric [Thr(B27)->Pro,Pro(B28)->Thr] insulin mutant (PT insulin)' 
_struct.pdbx_descriptor           'Insulin A chain/Insulin B chain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JCO 
_struct_keywords.pdbx_keywords   'HORMONE/GROWTH FACTOR' 
_struct_keywords.text            'Helix-turn-helix, Coil-helix-coil, HORMONE-GROWTH FACTOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 1  ? CYS A 7  ? GLY A 1  CYS A 7  1 ? 7  
HELX_P HELX_P2 2 SER A 12 ? CYS A 20 ? SER A 12 CYS A 20 1 ? 9  
HELX_P HELX_P3 3 SER B 9  ? GLY B 20 ? SER B 9  GLY B 20 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 6  SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6  A CYS 11 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf2 disulf ? ? A CYS 7  SG ? ? ? 1_555 B CYS 7  SG ? ? A CYS 7  B CYS 7  1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 2.023 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1JCO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JCO 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? 0.126   5.552   -9.393  1.00 0.00 ? 1  GLY A N    1  
ATOM 2     C CA   . GLY A 1 1  ? -0.067  5.138   -7.974  1.00 0.00 ? 1  GLY A CA   1  
ATOM 3     C C    . GLY A 1 1  ? 1.290   4.813   -7.347  1.00 0.00 ? 1  GLY A C    1  
ATOM 4     O O    . GLY A 1 1  ? 2.188   4.324   -8.004  1.00 0.00 ? 1  GLY A O    1  
ATOM 5     H H1   . GLY A 1 1  ? -0.595  6.255   -9.650  1.00 0.00 ? 1  GLY A H1   1  
ATOM 6     H H2   . GLY A 1 1  ? 0.036   4.720   -10.012 1.00 0.00 ? 1  GLY A H2   1  
ATOM 7     H H3   . GLY A 1 1  ? 1.071   5.969   -9.508  1.00 0.00 ? 1  GLY A H3   1  
ATOM 8     H HA2  . GLY A 1 1  ? -0.535  5.943   -7.426  1.00 0.00 ? 1  GLY A HA2  1  
ATOM 9     H HA3  . GLY A 1 1  ? -0.695  4.262   -7.936  1.00 0.00 ? 1  GLY A HA3  1  
ATOM 10    N N    . ILE A 1 2  ? 1.447   5.082   -6.080  1.00 0.00 ? 2  ILE A N    1  
ATOM 11    C CA   . ILE A 1 2  ? 2.747   4.789   -5.412  1.00 0.00 ? 2  ILE A CA   1  
ATOM 12    C C    . ILE A 1 2  ? 3.096   3.312   -5.596  1.00 0.00 ? 2  ILE A C    1  
ATOM 13    O O    . ILE A 1 2  ? 4.249   2.947   -5.718  1.00 0.00 ? 2  ILE A O    1  
ATOM 14    C CB   . ILE A 1 2  ? 2.642   5.109   -3.918  1.00 0.00 ? 2  ILE A CB   1  
ATOM 15    C CG1  . ILE A 1 2  ? 1.236   4.770   -3.414  1.00 0.00 ? 2  ILE A CG1  1  
ATOM 16    C CG2  . ILE A 1 2  ? 2.916   6.598   -3.695  1.00 0.00 ? 2  ILE A CG2  1  
ATOM 17    C CD1  . ILE A 1 2  ? 1.311   4.324   -1.953  1.00 0.00 ? 2  ILE A CD1  1  
ATOM 18    H H    . ILE A 1 2  ? 0.710   5.477   -5.570  1.00 0.00 ? 2  ILE A H    1  
ATOM 19    H HA   . ILE A 1 2  ? 3.521   5.395   -5.855  1.00 0.00 ? 2  ILE A HA   1  
ATOM 20    H HB   . ILE A 1 2  ? 3.372   4.526   -3.374  1.00 0.00 ? 2  ILE A HB   1  
ATOM 21    H HG12 . ILE A 1 2  ? 0.605   5.645   -3.492  1.00 0.00 ? 2  ILE A HG12 1  
ATOM 22    H HG13 . ILE A 1 2  ? 0.821   3.972   -4.011  1.00 0.00 ? 2  ILE A HG13 1  
ATOM 23    H HG21 . ILE A 1 2  ? 3.243   6.756   -2.678  1.00 0.00 ? 2  ILE A HG21 1  
ATOM 24    H HG22 . ILE A 1 2  ? 2.012   7.161   -3.873  1.00 0.00 ? 2  ILE A HG22 1  
ATOM 25    H HG23 . ILE A 1 2  ? 3.686   6.929   -4.376  1.00 0.00 ? 2  ILE A HG23 1  
ATOM 26    H HD11 . ILE A 1 2  ? 0.357   3.917   -1.652  1.00 0.00 ? 2  ILE A HD11 1  
ATOM 27    H HD12 . ILE A 1 2  ? 1.553   5.172   -1.329  1.00 0.00 ? 2  ILE A HD12 1  
ATOM 28    H HD13 . ILE A 1 2  ? 2.075   3.569   -1.846  1.00 0.00 ? 2  ILE A HD13 1  
ATOM 29    N N    . VAL A 1 3  ? 2.111   2.459   -5.618  1.00 0.00 ? 3  VAL A N    1  
ATOM 30    C CA   . VAL A 1 3  ? 2.378   1.012   -5.792  1.00 0.00 ? 3  VAL A CA   1  
ATOM 31    C C    . VAL A 1 3  ? 3.127   0.779   -7.107  1.00 0.00 ? 3  VAL A C    1  
ATOM 32    O O    . VAL A 1 3  ? 4.118   0.077   -7.154  1.00 0.00 ? 3  VAL A O    1  
ATOM 33    C CB   . VAL A 1 3  ? 1.038   0.272   -5.797  1.00 0.00 ? 3  VAL A CB   1  
ATOM 34    C CG1  . VAL A 1 3  ? 0.388   0.349   -7.182  1.00 0.00 ? 3  VAL A CG1  1  
ATOM 35    C CG2  . VAL A 1 3  ? 1.270   -1.185  -5.426  1.00 0.00 ? 3  VAL A CG2  1  
ATOM 36    H H    . VAL A 1 3  ? 1.191   2.767   -5.516  1.00 0.00 ? 3  VAL A H    1  
ATOM 37    H HA   . VAL A 1 3  ? 2.981   0.659   -4.974  1.00 0.00 ? 3  VAL A HA   1  
ATOM 38    H HB   . VAL A 1 3  ? 0.379   0.725   -5.071  1.00 0.00 ? 3  VAL A HB   1  
ATOM 39    H HG11 . VAL A 1 3  ? 1.045   -0.097  -7.914  1.00 0.00 ? 3  VAL A HG11 1  
ATOM 40    H HG12 . VAL A 1 3  ? 0.209   1.382   -7.439  1.00 0.00 ? 3  VAL A HG12 1  
ATOM 41    H HG13 . VAL A 1 3  ? -0.551  -0.186  -7.169  1.00 0.00 ? 3  VAL A HG13 1  
ATOM 42    H HG21 . VAL A 1 3  ? 1.026   -1.330  -4.385  1.00 0.00 ? 3  VAL A HG21 1  
ATOM 43    H HG22 . VAL A 1 3  ? 2.306   -1.434  -5.594  1.00 0.00 ? 3  VAL A HG22 1  
ATOM 44    H HG23 . VAL A 1 3  ? 0.642   -1.813  -6.036  1.00 0.00 ? 3  VAL A HG23 1  
ATOM 45    N N    . GLU A 1 4  ? 2.660   1.363   -8.171  1.00 0.00 ? 4  GLU A N    1  
ATOM 46    C CA   . GLU A 1 4  ? 3.340   1.181   -9.483  1.00 0.00 ? 4  GLU A CA   1  
ATOM 47    C C    . GLU A 1 4  ? 4.692   1.893   -9.462  1.00 0.00 ? 4  GLU A C    1  
ATOM 48    O O    . GLU A 1 4  ? 5.661   1.427   -10.029 1.00 0.00 ? 4  GLU A O    1  
ATOM 49    C CB   . GLU A 1 4  ? 2.469   1.770   -10.595 1.00 0.00 ? 4  GLU A CB   1  
ATOM 50    C CG   . GLU A 1 4  ? 1.377   0.767   -10.973 1.00 0.00 ? 4  GLU A CG   1  
ATOM 51    C CD   . GLU A 1 4  ? 0.529   1.339   -12.110 1.00 0.00 ? 4  GLU A CD   1  
ATOM 52    O OE1  . GLU A 1 4  ? 0.058   2.455   -11.968 1.00 0.00 ? 4  GLU A OE1  1  
ATOM 53    O OE2  . GLU A 1 4  ? 0.366   0.650   -13.104 1.00 0.00 ? 4  GLU A OE2  1  
ATOM 54    H H    . GLU A 1 4  ? 1.861   1.925   -8.107  1.00 0.00 ? 4  GLU A H    1  
ATOM 55    H HA   . GLU A 1 4  ? 3.492   0.129   -9.665  1.00 0.00 ? 4  GLU A HA   1  
ATOM 56    H HB2  . GLU A 1 4  ? 2.014   2.686   -10.248 1.00 0.00 ? 4  GLU A HB2  1  
ATOM 57    H HB3  . GLU A 1 4  ? 3.080   1.977   -11.460 1.00 0.00 ? 4  GLU A HB3  1  
ATOM 58    H HG2  . GLU A 1 4  ? 1.834   -0.158  -11.292 1.00 0.00 ? 4  GLU A HG2  1  
ATOM 59    H HG3  . GLU A 1 4  ? 0.747   0.581   -10.116 1.00 0.00 ? 4  GLU A HG3  1  
ATOM 60    N N    . GLN A 1 5  ? 4.762   3.024   -8.819  1.00 0.00 ? 5  GLN A N    1  
ATOM 61    C CA   . GLN A 1 5  ? 6.047   3.776   -8.767  1.00 0.00 ? 5  GLN A CA   1  
ATOM 62    C C    . GLN A 1 5  ? 6.985   3.143   -7.737  1.00 0.00 ? 5  GLN A C    1  
ATOM 63    O O    . GLN A 1 5  ? 8.191   3.173   -7.886  1.00 0.00 ? 5  GLN A O    1  
ATOM 64    C CB   . GLN A 1 5  ? 5.772   5.230   -8.379  1.00 0.00 ? 5  GLN A CB   1  
ATOM 65    C CG   . GLN A 1 5  ? 6.529   6.163   -9.326  1.00 0.00 ? 5  GLN A CG   1  
ATOM 66    C CD   . GLN A 1 5  ? 5.619   7.323   -9.736  1.00 0.00 ? 5  GLN A CD   1  
ATOM 67    O OE1  . GLN A 1 5  ? 4.961   7.917   -8.905  1.00 0.00 ? 5  GLN A OE1  1  
ATOM 68    N NE2  . GLN A 1 5  ? 5.554   7.673   -10.991 1.00 0.00 ? 5  GLN A NE2  1  
ATOM 69    H H    . GLN A 1 5  ? 3.966   3.383   -8.375  1.00 0.00 ? 5  GLN A H    1  
ATOM 70    H HA   . GLN A 1 5  ? 6.515   3.749   -9.738  1.00 0.00 ? 5  GLN A HA   1  
ATOM 71    H HB2  . GLN A 1 5  ? 4.712   5.426   -8.448  1.00 0.00 ? 5  GLN A HB2  1  
ATOM 72    H HB3  . GLN A 1 5  ? 6.105   5.401   -7.366  1.00 0.00 ? 5  GLN A HB3  1  
ATOM 73    H HG2  . GLN A 1 5  ? 7.405   6.550   -8.826  1.00 0.00 ? 5  GLN A HG2  1  
ATOM 74    H HG3  . GLN A 1 5  ? 6.829   5.616   -10.207 1.00 0.00 ? 5  GLN A HG3  1  
ATOM 75    H HE21 . GLN A 1 5  ? 6.085   7.193   -11.661 1.00 0.00 ? 5  GLN A HE21 1  
ATOM 76    H HE22 . GLN A 1 5  ? 4.975   8.415   -11.264 1.00 0.00 ? 5  GLN A HE22 1  
ATOM 77    N N    . CYS A 1 6  ? 6.450   2.576   -6.691  1.00 0.00 ? 6  CYS A N    1  
ATOM 78    C CA   . CYS A 1 6  ? 7.331   1.954   -5.660  1.00 0.00 ? 6  CYS A CA   1  
ATOM 79    C C    . CYS A 1 6  ? 7.533   0.469   -5.977  1.00 0.00 ? 6  CYS A C    1  
ATOM 80    O O    . CYS A 1 6  ? 8.340   -0.200  -5.363  1.00 0.00 ? 6  CYS A O    1  
ATOM 81    C CB   . CYS A 1 6  ? 6.694   2.113   -4.275  1.00 0.00 ? 6  CYS A CB   1  
ATOM 82    S SG   . CYS A 1 6  ? 5.307   0.967   -4.092  1.00 0.00 ? 6  CYS A SG   1  
ATOM 83    H H    . CYS A 1 6  ? 5.476   2.564   -6.581  1.00 0.00 ? 6  CYS A H    1  
ATOM 84    H HA   . CYS A 1 6  ? 8.290   2.451   -5.669  1.00 0.00 ? 6  CYS A HA   1  
ATOM 85    H HB2  . CYS A 1 6  ? 7.432   1.902   -3.516  1.00 0.00 ? 6  CYS A HB2  1  
ATOM 86    H HB3  . CYS A 1 6  ? 6.339   3.126   -4.158  1.00 0.00 ? 6  CYS A HB3  1  
ATOM 87    N N    . CYS A 1 7  ? 6.809   -0.052  -6.930  1.00 0.00 ? 7  CYS A N    1  
ATOM 88    C CA   . CYS A 1 7  ? 6.967   -1.493  -7.280  1.00 0.00 ? 7  CYS A CA   1  
ATOM 89    C C    . CYS A 1 7  ? 8.449   -1.807  -7.501  1.00 0.00 ? 7  CYS A C    1  
ATOM 90    O O    . CYS A 1 7  ? 9.041   -1.395  -8.479  1.00 0.00 ? 7  CYS A O    1  
ATOM 91    C CB   . CYS A 1 7  ? 6.186   -1.796  -8.560  1.00 0.00 ? 7  CYS A CB   1  
ATOM 92    S SG   . CYS A 1 7  ? 6.446   -3.526  -9.027  1.00 0.00 ? 7  CYS A SG   1  
ATOM 93    H H    . CYS A 1 7  ? 6.163   0.504   -7.414  1.00 0.00 ? 7  CYS A H    1  
ATOM 94    H HA   . CYS A 1 7  ? 6.586   -2.102  -6.473  1.00 0.00 ? 7  CYS A HA   1  
ATOM 95    H HB2  . CYS A 1 7  ? 5.134   -1.624  -8.390  1.00 0.00 ? 7  CYS A HB2  1  
ATOM 96    H HB3  . CYS A 1 7  ? 6.533   -1.153  -9.355  1.00 0.00 ? 7  CYS A HB3  1  
ATOM 97    N N    . THR A 1 8  ? 9.052   -2.534  -6.600  1.00 0.00 ? 8  THR A N    1  
ATOM 98    C CA   . THR A 1 8  ? 10.495  -2.877  -6.756  1.00 0.00 ? 8  THR A CA   1  
ATOM 99    C C    . THR A 1 8  ? 10.978  -3.616  -5.505  1.00 0.00 ? 8  THR A C    1  
ATOM 100   O O    . THR A 1 8  ? 10.233  -4.342  -4.877  1.00 0.00 ? 8  THR A O    1  
ATOM 101   C CB   . THR A 1 8  ? 11.307  -1.592  -6.935  1.00 0.00 ? 8  THR A CB   1  
ATOM 102   O OG1  . THR A 1 8  ? 12.692  -1.910  -6.968  1.00 0.00 ? 8  THR A OG1  1  
ATOM 103   C CG2  . THR A 1 8  ? 11.028  -0.642  -5.769  1.00 0.00 ? 8  THR A CG2  1  
ATOM 104   H H    . THR A 1 8  ? 8.555   -2.856  -5.819  1.00 0.00 ? 8  THR A H    1  
ATOM 105   H HA   . THR A 1 8  ? 10.625  -3.510  -7.621  1.00 0.00 ? 8  THR A HA   1  
ATOM 106   H HB   . THR A 1 8  ? 11.026  -1.112  -7.859  1.00 0.00 ? 8  THR A HB   1  
ATOM 107   H HG1  . THR A 1 8  ? 13.023  -1.703  -7.845  1.00 0.00 ? 8  THR A HG1  1  
ATOM 108   H HG21 . THR A 1 8  ? 10.452  0.201   -6.121  1.00 0.00 ? 8  THR A HG21 1  
ATOM 109   H HG22 . THR A 1 8  ? 11.963  -0.293  -5.357  1.00 0.00 ? 8  THR A HG22 1  
ATOM 110   H HG23 . THR A 1 8  ? 10.471  -1.165  -5.005  1.00 0.00 ? 8  THR A HG23 1  
ATOM 111   N N    . SER A 1 9  ? 12.217  -3.435  -5.134  1.00 0.00 ? 9  SER A N    1  
ATOM 112   C CA   . SER A 1 9  ? 12.737  -4.124  -3.919  1.00 0.00 ? 9  SER A CA   1  
ATOM 113   C C    . SER A 1 9  ? 11.855  -3.765  -2.724  1.00 0.00 ? 9  SER A C    1  
ATOM 114   O O    . SER A 1 9  ? 11.098  -4.577  -2.230  1.00 0.00 ? 9  SER A O    1  
ATOM 115   C CB   . SER A 1 9  ? 14.165  -3.659  -3.645  1.00 0.00 ? 9  SER A CB   1  
ATOM 116   O OG   . SER A 1 9  ? 15.078  -4.522  -4.310  1.00 0.00 ? 9  SER A OG   1  
ATOM 117   H H    . SER A 1 9  ? 12.803  -2.843  -5.650  1.00 0.00 ? 9  SER A H    1  
ATOM 118   H HA   . SER A 1 9  ? 12.726  -5.193  -4.073  1.00 0.00 ? 9  SER A HA   1  
ATOM 119   H HB2  . SER A 1 9  ? 14.293  -2.655  -4.011  1.00 0.00 ? 9  SER A HB2  1  
ATOM 120   H HB3  . SER A 1 9  ? 14.346  -3.677  -2.578  1.00 0.00 ? 9  SER A HB3  1  
ATOM 121   H HG   . SER A 1 9  ? 15.894  -4.037  -4.452  1.00 0.00 ? 9  SER A HG   1  
ATOM 122   N N    . ILE A 1 10 ? 11.942  -2.547  -2.265  1.00 0.00 ? 10 ILE A N    1  
ATOM 123   C CA   . ILE A 1 10 ? 11.104  -2.118  -1.111  1.00 0.00 ? 10 ILE A CA   1  
ATOM 124   C C    . ILE A 1 10 ? 10.140  -1.026  -1.579  1.00 0.00 ? 10 ILE A C    1  
ATOM 125   O O    . ILE A 1 10 ? 10.526  -0.085  -2.244  1.00 0.00 ? 10 ILE A O    1  
ATOM 126   C CB   . ILE A 1 10 ? 11.997  -1.560  -0.003  1.00 0.00 ? 10 ILE A CB   1  
ATOM 127   C CG1  . ILE A 1 10 ? 11.187  -1.420  1.295   1.00 0.00 ? 10 ILE A CG1  1  
ATOM 128   C CG2  . ILE A 1 10 ? 12.526  -0.193  -0.430  1.00 0.00 ? 10 ILE A CG2  1  
ATOM 129   C CD1  . ILE A 1 10 ? 10.084  -0.368  1.122   1.00 0.00 ? 10 ILE A CD1  1  
ATOM 130   H H    . ILE A 1 10 ? 12.555  -1.909  -2.687  1.00 0.00 ? 10 ILE A H    1  
ATOM 131   H HA   . ILE A 1 10 ? 10.543  -2.961  -0.736  1.00 0.00 ? 10 ILE A HA   1  
ATOM 132   H HB   . ILE A 1 10 ? 12.828  -2.232  0.159   1.00 0.00 ? 10 ILE A HB   1  
ATOM 133   H HG12 . ILE A 1 10 ? 10.738  -2.371  1.539   1.00 0.00 ? 10 ILE A HG12 1  
ATOM 134   H HG13 . ILE A 1 10 ? 11.845  -1.119  2.096   1.00 0.00 ? 10 ILE A HG13 1  
ATOM 135   H HG21 . ILE A 1 10 ? 13.541  -0.078  -0.088  1.00 0.00 ? 10 ILE A HG21 1  
ATOM 136   H HG22 . ILE A 1 10 ? 11.907  0.580   -0.001  1.00 0.00 ? 10 ILE A HG22 1  
ATOM 137   H HG23 . ILE A 1 10 ? 12.497  -0.121  -1.508  1.00 0.00 ? 10 ILE A HG23 1  
ATOM 138   H HD11 . ILE A 1 10 ? 9.986   0.205   2.031   1.00 0.00 ? 10 ILE A HD11 1  
ATOM 139   H HD12 . ILE A 1 10 ? 9.147   -0.860  0.907   1.00 0.00 ? 10 ILE A HD12 1  
ATOM 140   H HD13 . ILE A 1 10 ? 10.339  0.294   0.307   1.00 0.00 ? 10 ILE A HD13 1  
ATOM 141   N N    . CYS A 1 11 ? 8.895   -1.138  -1.227  1.00 0.00 ? 11 CYS A N    1  
ATOM 142   C CA   . CYS A 1 11 ? 7.919   -0.102  -1.640  1.00 0.00 ? 11 CYS A CA   1  
ATOM 143   C C    . CYS A 1 11 ? 7.767   0.866   -0.477  1.00 0.00 ? 11 CYS A C    1  
ATOM 144   O O    . CYS A 1 11 ? 7.452   0.466   0.620   1.00 0.00 ? 11 CYS A O    1  
ATOM 145   C CB   . CYS A 1 11 ? 6.571   -0.756  -1.951  1.00 0.00 ? 11 CYS A CB   1  
ATOM 146   S SG   . CYS A 1 11 ? 5.303   0.523   -2.121  1.00 0.00 ? 11 CYS A SG   1  
ATOM 147   H H    . CYS A 1 11 ? 8.604   -1.899  -0.683  1.00 0.00 ? 11 CYS A H    1  
ATOM 148   H HA   . CYS A 1 11 ? 8.285   0.423   -2.510  1.00 0.00 ? 11 CYS A HA   1  
ATOM 149   H HB2  . CYS A 1 11 ? 6.647   -1.314  -2.873  1.00 0.00 ? 11 CYS A HB2  1  
ATOM 150   H HB3  . CYS A 1 11 ? 6.302   -1.425  -1.147  1.00 0.00 ? 11 CYS A HB3  1  
ATOM 151   N N    . SER A 1 12 ? 8.028   2.125   -0.715  1.00 0.00 ? 12 SER A N    1  
ATOM 152   C CA   . SER A 1 12 ? 7.949   3.154   0.363   1.00 0.00 ? 12 SER A CA   1  
ATOM 153   C C    . SER A 1 12 ? 6.865   2.809   1.385   1.00 0.00 ? 12 SER A C    1  
ATOM 154   O O    . SER A 1 12 ? 5.756   3.300   1.316   1.00 0.00 ? 12 SER A O    1  
ATOM 155   C CB   . SER A 1 12 ? 7.635   4.511   -0.266  1.00 0.00 ? 12 SER A CB   1  
ATOM 156   O OG   . SER A 1 12 ? 8.812   5.030   -0.872  1.00 0.00 ? 12 SER A OG   1  
ATOM 157   H H    . SER A 1 12 ? 8.305   2.396   -1.614  1.00 0.00 ? 12 SER A H    1  
ATOM 158   H HA   . SER A 1 12 ? 8.902   3.212   0.865   1.00 0.00 ? 12 SER A HA   1  
ATOM 159   H HB2  . SER A 1 12 ? 6.872   4.394   -1.017  1.00 0.00 ? 12 SER A HB2  1  
ATOM 160   H HB3  . SER A 1 12 ? 7.283   5.188   0.501   1.00 0.00 ? 12 SER A HB3  1  
ATOM 161   H HG   . SER A 1 12 ? 9.165   5.712   -0.297  1.00 0.00 ? 12 SER A HG   1  
ATOM 162   N N    . LEU A 1 13 ? 7.183   1.990   2.354   1.00 0.00 ? 13 LEU A N    1  
ATOM 163   C CA   . LEU A 1 13 ? 6.173   1.656   3.387   1.00 0.00 ? 13 LEU A CA   1  
ATOM 164   C C    . LEU A 1 13 ? 5.722   2.970   3.993   1.00 0.00 ? 13 LEU A C    1  
ATOM 165   O O    . LEU A 1 13 ? 4.589   3.137   4.399   1.00 0.00 ? 13 LEU A O    1  
ATOM 166   C CB   . LEU A 1 13 ? 6.799   0.767   4.465   1.00 0.00 ? 13 LEU A CB   1  
ATOM 167   C CG   . LEU A 1 13 ? 6.052   -0.566  4.524   1.00 0.00 ? 13 LEU A CG   1  
ATOM 168   C CD1  . LEU A 1 13 ? 7.032   -1.713  4.271   1.00 0.00 ? 13 LEU A CD1  1  
ATOM 169   C CD2  . LEU A 1 13 ? 5.418   -0.734  5.907   1.00 0.00 ? 13 LEU A CD2  1  
ATOM 170   H H    . LEU A 1 13 ? 8.086   1.618   2.410   1.00 0.00 ? 13 LEU A H    1  
ATOM 171   H HA   . LEU A 1 13 ? 5.333   1.154   2.931   1.00 0.00 ? 13 LEU A HA   1  
ATOM 172   H HB2  . LEU A 1 13 ? 7.837   0.589   4.226   1.00 0.00 ? 13 LEU A HB2  1  
ATOM 173   H HB3  . LEU A 1 13 ? 6.728   1.260   5.423   1.00 0.00 ? 13 LEU A HB3  1  
ATOM 174   H HG   . LEU A 1 13 ? 5.280   -0.579  3.768   1.00 0.00 ? 13 LEU A HG   1  
ATOM 175   H HD11 . LEU A 1 13 ? 6.587   -2.423  3.590   1.00 0.00 ? 13 LEU A HD11 1  
ATOM 176   H HD12 . LEU A 1 13 ? 7.261   -2.204  5.205   1.00 0.00 ? 13 LEU A HD12 1  
ATOM 177   H HD13 . LEU A 1 13 ? 7.941   -1.321  3.838   1.00 0.00 ? 13 LEU A HD13 1  
ATOM 178   H HD21 . LEU A 1 13 ? 5.503   -1.764  6.219   1.00 0.00 ? 13 LEU A HD21 1  
ATOM 179   H HD22 . LEU A 1 13 ? 4.376   -0.456  5.862   1.00 0.00 ? 13 LEU A HD22 1  
ATOM 180   H HD23 . LEU A 1 13 ? 5.930   -0.100  6.617   1.00 0.00 ? 13 LEU A HD23 1  
ATOM 181   N N    . TYR A 1 14 ? 6.614   3.917   4.028   1.00 0.00 ? 14 TYR A N    1  
ATOM 182   C CA   . TYR A 1 14 ? 6.258   5.252   4.575   1.00 0.00 ? 14 TYR A CA   1  
ATOM 183   C C    . TYR A 1 14 ? 5.261   5.908   3.625   1.00 0.00 ? 14 TYR A C    1  
ATOM 184   O O    . TYR A 1 14 ? 4.318   6.550   4.042   1.00 0.00 ? 14 TYR A O    1  
ATOM 185   C CB   . TYR A 1 14 ? 7.515   6.118   4.687   1.00 0.00 ? 14 TYR A CB   1  
ATOM 186   C CG   . TYR A 1 14 ? 7.725   6.520   6.127   1.00 0.00 ? 14 TYR A CG   1  
ATOM 187   C CD1  . TYR A 1 14 ? 7.710   5.548   7.135   1.00 0.00 ? 14 TYR A CD1  1  
ATOM 188   C CD2  . TYR A 1 14 ? 7.936   7.865   6.455   1.00 0.00 ? 14 TYR A CD2  1  
ATOM 189   C CE1  . TYR A 1 14 ? 7.905   5.921   8.470   1.00 0.00 ? 14 TYR A CE1  1  
ATOM 190   C CE2  . TYR A 1 14 ? 8.132   8.237   7.790   1.00 0.00 ? 14 TYR A CE2  1  
ATOM 191   C CZ   . TYR A 1 14 ? 8.116   7.266   8.798   1.00 0.00 ? 14 TYR A CZ   1  
ATOM 192   O OH   . TYR A 1 14 ? 8.308   7.633   10.114  1.00 0.00 ? 14 TYR A OH   1  
ATOM 193   H H    . TYR A 1 14 ? 7.518   3.749   3.668   1.00 0.00 ? 14 TYR A H    1  
ATOM 194   H HA   . TYR A 1 14 ? 5.805   5.137   5.547   1.00 0.00 ? 14 TYR A HA   1  
ATOM 195   H HB2  . TYR A 1 14 ? 8.371   5.557   4.340   1.00 0.00 ? 14 TYR A HB2  1  
ATOM 196   H HB3  . TYR A 1 14 ? 7.396   7.004   4.081   1.00 0.00 ? 14 TYR A HB3  1  
ATOM 197   H HD1  . TYR A 1 14 ? 7.547   4.511   6.882   1.00 0.00 ? 14 TYR A HD1  1  
ATOM 198   H HD2  . TYR A 1 14 ? 7.948   8.614   5.678   1.00 0.00 ? 14 TYR A HD2  1  
ATOM 199   H HE1  . TYR A 1 14 ? 7.893   5.171   9.248   1.00 0.00 ? 14 TYR A HE1  1  
ATOM 200   H HE2  . TYR A 1 14 ? 8.295   9.275   8.043   1.00 0.00 ? 14 TYR A HE2  1  
ATOM 201   H HH   . TYR A 1 14 ? 9.005   8.293   10.139  1.00 0.00 ? 14 TYR A HH   1  
ATOM 202   N N    . GLN A 1 15 ? 5.451   5.734   2.346   1.00 0.00 ? 15 GLN A N    1  
ATOM 203   C CA   . GLN A 1 15 ? 4.501   6.332   1.371   1.00 0.00 ? 15 GLN A CA   1  
ATOM 204   C C    . GLN A 1 15 ? 3.158   5.616   1.504   1.00 0.00 ? 15 GLN A C    1  
ATOM 205   O O    . GLN A 1 15 ? 2.112   6.233   1.531   1.00 0.00 ? 15 GLN A O    1  
ATOM 206   C CB   . GLN A 1 15 ? 5.040   6.157   -0.051  1.00 0.00 ? 15 GLN A CB   1  
ATOM 207   C CG   . GLN A 1 15 ? 6.209   7.118   -0.275  1.00 0.00 ? 15 GLN A CG   1  
ATOM 208   C CD   . GLN A 1 15 ? 5.700   8.397   -0.943  1.00 0.00 ? 15 GLN A CD   1  
ATOM 209   O OE1  . GLN A 1 15 ? 4.708   8.960   -0.527  1.00 0.00 ? 15 GLN A OE1  1  
ATOM 210   N NE2  . GLN A 1 15 ? 6.344   8.883   -1.969  1.00 0.00 ? 15 GLN A NE2  1  
ATOM 211   H H    . GLN A 1 15 ? 6.210   5.198   2.030   1.00 0.00 ? 15 GLN A H    1  
ATOM 212   H HA   . GLN A 1 15 ? 4.375   7.383   1.587   1.00 0.00 ? 15 GLN A HA   1  
ATOM 213   H HB2  . GLN A 1 15 ? 5.377   5.140   -0.185  1.00 0.00 ? 15 GLN A HB2  1  
ATOM 214   H HB3  . GLN A 1 15 ? 4.257   6.374   -0.762  1.00 0.00 ? 15 GLN A HB3  1  
ATOM 215   H HG2  . GLN A 1 15 ? 6.661   7.362   0.675   1.00 0.00 ? 15 GLN A HG2  1  
ATOM 216   H HG3  . GLN A 1 15 ? 6.943   6.649   -0.913  1.00 0.00 ? 15 GLN A HG3  1  
ATOM 217   H HE21 . GLN A 1 15 ? 7.145   8.429   -2.305  1.00 0.00 ? 15 GLN A HE21 1  
ATOM 218   H HE22 . GLN A 1 15 ? 6.026   9.701   -2.404  1.00 0.00 ? 15 GLN A HE22 1  
ATOM 219   N N    . LEU A 1 16 ? 3.182   4.313   1.607   1.00 0.00 ? 16 LEU A N    1  
ATOM 220   C CA   . LEU A 1 16 ? 1.910   3.557   1.762   1.00 0.00 ? 16 LEU A CA   1  
ATOM 221   C C    . LEU A 1 16 ? 1.298   3.915   3.115   1.00 0.00 ? 16 LEU A C    1  
ATOM 222   O O    . LEU A 1 16 ? 0.134   4.248   3.215   1.00 0.00 ? 16 LEU A O    1  
ATOM 223   C CB   . LEU A 1 16 ? 2.196   2.054   1.708   1.00 0.00 ? 16 LEU A CB   1  
ATOM 224   C CG   . LEU A 1 16 ? 2.072   1.562   0.266   1.00 0.00 ? 16 LEU A CG   1  
ATOM 225   C CD1  . LEU A 1 16 ? 3.280   2.041   -0.541  1.00 0.00 ? 16 LEU A CD1  1  
ATOM 226   C CD2  . LEU A 1 16 ? 2.026   0.032   0.253   1.00 0.00 ? 16 LEU A CD2  1  
ATOM 227   H H    . LEU A 1 16 ? 4.037   3.836   1.598   1.00 0.00 ? 16 LEU A H    1  
ATOM 228   H HA   . LEU A 1 16 ? 1.227   3.827   0.970   1.00 0.00 ? 16 LEU A HA   1  
ATOM 229   H HB2  . LEU A 1 16 ? 3.197   1.865   2.070   1.00 0.00 ? 16 LEU A HB2  1  
ATOM 230   H HB3  . LEU A 1 16 ? 1.484   1.530   2.328   1.00 0.00 ? 16 LEU A HB3  1  
ATOM 231   H HG   . LEU A 1 16 ? 1.167   1.956   -0.173  1.00 0.00 ? 16 LEU A HG   1  
ATOM 232   H HD11 . LEU A 1 16 ? 3.158   1.753   -1.575  1.00 0.00 ? 16 LEU A HD11 1  
ATOM 233   H HD12 . LEU A 1 16 ? 4.178   1.591   -0.145  1.00 0.00 ? 16 LEU A HD12 1  
ATOM 234   H HD13 . LEU A 1 16 ? 3.355   3.116   -0.473  1.00 0.00 ? 16 LEU A HD13 1  
ATOM 235   H HD21 . LEU A 1 16 ? 1.469   -0.319  1.109   1.00 0.00 ? 16 LEU A HD21 1  
ATOM 236   H HD22 . LEU A 1 16 ? 3.032   -0.359  0.292   1.00 0.00 ? 16 LEU A HD22 1  
ATOM 237   H HD23 . LEU A 1 16 ? 1.544   -0.305  -0.653  1.00 0.00 ? 16 LEU A HD23 1  
ATOM 238   N N    . GLU A 1 17 ? 2.083   3.861   4.157   1.00 0.00 ? 17 GLU A N    1  
ATOM 239   C CA   . GLU A 1 17 ? 1.558   4.212   5.503   1.00 0.00 ? 17 GLU A CA   1  
ATOM 240   C C    . GLU A 1 17 ? 1.120   5.678   5.496   1.00 0.00 ? 17 GLU A C    1  
ATOM 241   O O    . GLU A 1 17 ? 0.134   6.045   6.097   1.00 0.00 ? 17 GLU A O    1  
ATOM 242   C CB   . GLU A 1 17 ? 2.654   4.011   6.551   1.00 0.00 ? 17 GLU A CB   1  
ATOM 243   C CG   . GLU A 1 17 ? 3.111   2.551   6.541   1.00 0.00 ? 17 GLU A CG   1  
ATOM 244   C CD   . GLU A 1 17 ? 4.581   2.474   6.959   1.00 0.00 ? 17 GLU A CD   1  
ATOM 245   O OE1  . GLU A 1 17 ? 5.314   3.397   6.645   1.00 0.00 ? 17 GLU A OE1  1  
ATOM 246   O OE2  . GLU A 1 17 ? 4.948   1.493   7.584   1.00 0.00 ? 17 GLU A OE2  1  
ATOM 247   H H    . GLU A 1 17 ? 3.020   3.597   4.051   1.00 0.00 ? 17 GLU A H    1  
ATOM 248   H HA   . GLU A 1 17 ? 0.714   3.583   5.734   1.00 0.00 ? 17 GLU A HA   1  
ATOM 249   H HB2  . GLU A 1 17 ? 3.493   4.653   6.322   1.00 0.00 ? 17 GLU A HB2  1  
ATOM 250   H HB3  . GLU A 1 17 ? 2.268   4.259   7.528   1.00 0.00 ? 17 GLU A HB3  1  
ATOM 251   H HG2  . GLU A 1 17 ? 2.508   1.981   7.234   1.00 0.00 ? 17 GLU A HG2  1  
ATOM 252   H HG3  . GLU A 1 17 ? 2.999   2.145   5.547   1.00 0.00 ? 17 GLU A HG3  1  
ATOM 253   N N    . ASN A 1 18 ? 1.852   6.517   4.815   1.00 0.00 ? 18 ASN A N    1  
ATOM 254   C CA   . ASN A 1 18 ? 1.485   7.962   4.759   1.00 0.00 ? 18 ASN A CA   1  
ATOM 255   C C    . ASN A 1 18 ? 0.373   8.173   3.725   1.00 0.00 ? 18 ASN A C    1  
ATOM 256   O O    . ASN A 1 18 ? -0.314  9.174   3.735   1.00 0.00 ? 18 ASN A O    1  
ATOM 257   C CB   . ASN A 1 18 ? 2.710   8.786   4.355   1.00 0.00 ? 18 ASN A CB   1  
ATOM 258   C CG   . ASN A 1 18 ? 3.796   8.649   5.422   1.00 0.00 ? 18 ASN A CG   1  
ATOM 259   O OD1  . ASN A 1 18 ? 3.503   8.560   6.598   1.00 0.00 ? 18 ASN A OD1  1  
ATOM 260   N ND2  . ASN A 1 18 ? 5.050   8.630   5.059   1.00 0.00 ? 18 ASN A ND2  1  
ATOM 261   H H    . ASN A 1 18 ? 2.648   6.196   4.338   1.00 0.00 ? 18 ASN A H    1  
ATOM 262   H HA   . ASN A 1 18 ? 1.139   8.284   5.730   1.00 0.00 ? 18 ASN A HA   1  
ATOM 263   H HB2  . ASN A 1 18 ? 3.087   8.428   3.408   1.00 0.00 ? 18 ASN A HB2  1  
ATOM 264   H HB3  . ASN A 1 18 ? 2.430   9.824   4.261   1.00 0.00 ? 18 ASN A HB3  1  
ATOM 265   H HD21 . ASN A 1 18 ? 5.286   8.703   4.110   1.00 0.00 ? 18 ASN A HD21 1  
ATOM 266   H HD22 . ASN A 1 18 ? 5.754   8.540   5.733   1.00 0.00 ? 18 ASN A HD22 1  
ATOM 267   N N    . TYR A 1 19 ? 0.200   7.242   2.826   1.00 0.00 ? 19 TYR A N    1  
ATOM 268   C CA   . TYR A 1 19 ? -0.853  7.389   1.785   1.00 0.00 ? 19 TYR A CA   1  
ATOM 269   C C    . TYR A 1 19 ? -2.206  7.586   2.456   1.00 0.00 ? 19 TYR A C    1  
ATOM 270   O O    . TYR A 1 19 ? -2.849  8.606   2.305   1.00 0.00 ? 19 TYR A O    1  
ATOM 271   C CB   . TYR A 1 19 ? -0.899  6.116   0.938   1.00 0.00 ? 19 TYR A CB   1  
ATOM 272   C CG   . TYR A 1 19 ? -1.922  6.271   -0.161  1.00 0.00 ? 19 TYR A CG   1  
ATOM 273   C CD1  . TYR A 1 19 ? -1.999  7.468   -0.878  1.00 0.00 ? 19 TYR A CD1  1  
ATOM 274   C CD2  . TYR A 1 19 ? -2.787  5.214   -0.469  1.00 0.00 ? 19 TYR A CD2  1  
ATOM 275   C CE1  . TYR A 1 19 ? -2.940  7.613   -1.904  1.00 0.00 ? 19 TYR A CE1  1  
ATOM 276   C CE2  . TYR A 1 19 ? -3.729  5.358   -1.495  1.00 0.00 ? 19 TYR A CE2  1  
ATOM 277   C CZ   . TYR A 1 19 ? -3.805  6.557   -2.213  1.00 0.00 ? 19 TYR A CZ   1  
ATOM 278   O OH   . TYR A 1 19 ? -4.733  6.698   -3.225  1.00 0.00 ? 19 TYR A OH   1  
ATOM 279   H H    . TYR A 1 19 ? 0.762   6.444   2.834   1.00 0.00 ? 19 TYR A H    1  
ATOM 280   H HA   . TYR A 1 19 ? -0.629  8.236   1.156   1.00 0.00 ? 19 TYR A HA   1  
ATOM 281   H HB2  . TYR A 1 19 ? 0.074   5.939   0.502   1.00 0.00 ? 19 TYR A HB2  1  
ATOM 282   H HB3  . TYR A 1 19 ? -1.170  5.281   1.565   1.00 0.00 ? 19 TYR A HB3  1  
ATOM 283   H HD1  . TYR A 1 19 ? -1.334  8.282   -0.637  1.00 0.00 ? 19 TYR A HD1  1  
ATOM 284   H HD2  . TYR A 1 19 ? -2.731  4.289   0.087   1.00 0.00 ? 19 TYR A HD2  1  
ATOM 285   H HE1  . TYR A 1 19 ? -2.998  8.538   -2.457  1.00 0.00 ? 19 TYR A HE1  1  
ATOM 286   H HE2  . TYR A 1 19 ? -4.396  4.542   -1.733  1.00 0.00 ? 19 TYR A HE2  1  
ATOM 287   H HH   . TYR A 1 19 ? -5.469  7.211   -2.883  1.00 0.00 ? 19 TYR A HH   1  
ATOM 288   N N    . CYS A 1 20 ? -2.637  6.606   3.193   1.00 0.00 ? 20 CYS A N    1  
ATOM 289   C CA   . CYS A 1 20 ? -3.954  6.705   3.886   1.00 0.00 ? 20 CYS A CA   1  
ATOM 290   C C    . CYS A 1 20 ? -4.981  7.354   2.955   1.00 0.00 ? 20 CYS A C    1  
ATOM 291   O O    . CYS A 1 20 ? -4.788  7.430   1.758   1.00 0.00 ? 20 CYS A O    1  
ATOM 292   C CB   . CYS A 1 20 ? -3.804  7.551   5.150   1.00 0.00 ? 20 CYS A CB   1  
ATOM 293   S SG   . CYS A 1 20 ? -2.459  6.889   6.164   1.00 0.00 ? 20 CYS A SG   1  
ATOM 294   H H    . CYS A 1 20 ? -2.087  5.798   3.290   1.00 0.00 ? 20 CYS A H    1  
ATOM 295   H HA   . CYS A 1 20 ? -4.292  5.717   4.155   1.00 0.00 ? 20 CYS A HA   1  
ATOM 296   H HB2  . CYS A 1 20 ? -3.579  8.572   4.876   1.00 0.00 ? 20 CYS A HB2  1  
ATOM 297   H HB3  . CYS A 1 20 ? -4.725  7.525   5.713   1.00 0.00 ? 20 CYS A HB3  1  
ATOM 298   N N    . ASN A 1 21 ? -6.072  7.823   3.496   1.00 0.00 ? 21 ASN A N    1  
ATOM 299   C CA   . ASN A 1 21 ? -7.110  8.467   2.642   1.00 0.00 ? 21 ASN A CA   1  
ATOM 300   C C    . ASN A 1 21 ? -7.963  9.406   3.497   1.00 0.00 ? 21 ASN A C    1  
ATOM 301   O O    . ASN A 1 21 ? -8.494  8.948   4.495   1.00 0.00 ? 21 ASN A O    1  
ATOM 302   C CB   . ASN A 1 21 ? -8.002  7.388   2.024   1.00 0.00 ? 21 ASN A CB   1  
ATOM 303   C CG   . ASN A 1 21 ? -8.883  8.013   0.941   1.00 0.00 ? 21 ASN A CG   1  
ATOM 304   O OD1  . ASN A 1 21 ? -8.496  8.082   -0.209  1.00 0.00 ? 21 ASN A OD1  1  
ATOM 305   N ND2  . ASN A 1 21 ? -10.060 8.476   1.261   1.00 0.00 ? 21 ASN A ND2  1  
ATOM 306   O OXT  . ASN A 1 21 ? -8.070  10.567  3.139   1.00 0.00 ? 21 ASN A OXT  1  
ATOM 307   H H    . ASN A 1 21 ? -6.208  7.751   4.463   1.00 0.00 ? 21 ASN A H    1  
ATOM 308   H HA   . ASN A 1 21 ? -6.630  9.031   1.856   1.00 0.00 ? 21 ASN A HA   1  
ATOM 309   H HB2  . ASN A 1 21 ? -7.384  6.617   1.587   1.00 0.00 ? 21 ASN A HB2  1  
ATOM 310   H HB3  . ASN A 1 21 ? -8.628  6.957   2.790   1.00 0.00 ? 21 ASN A HB3  1  
ATOM 311   H HD21 . ASN A 1 21 ? -10.373 8.421   2.188   1.00 0.00 ? 21 ASN A HD21 1  
ATOM 312   H HD22 . ASN A 1 21 ? -10.632 8.878   0.575   1.00 0.00 ? 21 ASN A HD22 1  
ATOM 313   N N    . PHE B 2 1  ? 14.999  0.513   7.622   1.00 0.00 ? 1  PHE B N    1  
ATOM 314   C CA   . PHE B 2 1  ? 14.769  -0.933  7.346   1.00 0.00 ? 1  PHE B CA   1  
ATOM 315   C C    . PHE B 2 1  ? 14.484  -1.130  5.856   1.00 0.00 ? 1  PHE B C    1  
ATOM 316   O O    . PHE B 2 1  ? 14.400  -0.182  5.100   1.00 0.00 ? 1  PHE B O    1  
ATOM 317   C CB   . PHE B 2 1  ? 13.572  -1.424  8.163   1.00 0.00 ? 1  PHE B CB   1  
ATOM 318   C CG   . PHE B 2 1  ? 12.326  -0.697  7.718   1.00 0.00 ? 1  PHE B CG   1  
ATOM 319   C CD1  . PHE B 2 1  ? 11.649  -1.110  6.564   1.00 0.00 ? 1  PHE B CD1  1  
ATOM 320   C CD2  . PHE B 2 1  ? 11.847  0.390   8.458   1.00 0.00 ? 1  PHE B CD2  1  
ATOM 321   C CE1  . PHE B 2 1  ? 10.493  -0.436  6.151   1.00 0.00 ? 1  PHE B CE1  1  
ATOM 322   C CE2  . PHE B 2 1  ? 10.692  1.064   8.046   1.00 0.00 ? 1  PHE B CE2  1  
ATOM 323   C CZ   . PHE B 2 1  ? 10.015  0.651   6.892   1.00 0.00 ? 1  PHE B CZ   1  
ATOM 324   H H1   . PHE B 2 1  ? 16.017  0.717   7.577   1.00 0.00 ? 1  PHE B H1   1  
ATOM 325   H H2   . PHE B 2 1  ? 14.638  0.746   8.570   1.00 0.00 ? 1  PHE B H2   1  
ATOM 326   H H3   . PHE B 2 1  ? 14.501  1.085   6.910   1.00 0.00 ? 1  PHE B H3   1  
ATOM 327   H HA   . PHE B 2 1  ? 15.648  -1.497  7.622   1.00 0.00 ? 1  PHE B HA   1  
ATOM 328   H HB2  . PHE B 2 1  ? 13.443  -2.486  8.010   1.00 0.00 ? 1  PHE B HB2  1  
ATOM 329   H HB3  . PHE B 2 1  ? 13.746  -1.229  9.210   1.00 0.00 ? 1  PHE B HB3  1  
ATOM 330   H HD1  . PHE B 2 1  ? 12.018  -1.949  5.992   1.00 0.00 ? 1  PHE B HD1  1  
ATOM 331   H HD2  . PHE B 2 1  ? 12.369  0.709   9.348   1.00 0.00 ? 1  PHE B HD2  1  
ATOM 332   H HE1  . PHE B 2 1  ? 9.971   -0.755  5.261   1.00 0.00 ? 1  PHE B HE1  1  
ATOM 333   H HE2  . PHE B 2 1  ? 10.322  1.903   8.617   1.00 0.00 ? 1  PHE B HE2  1  
ATOM 334   H HZ   . PHE B 2 1  ? 9.123   1.171   6.573   1.00 0.00 ? 1  PHE B HZ   1  
ATOM 335   N N    . VAL B 2 2  ? 14.334  -2.353  5.427   1.00 0.00 ? 2  VAL B N    1  
ATOM 336   C CA   . VAL B 2 2  ? 14.055  -2.609  3.986   1.00 0.00 ? 2  VAL B CA   1  
ATOM 337   C C    . VAL B 2 2  ? 13.336  -3.952  3.837   1.00 0.00 ? 2  VAL B C    1  
ATOM 338   O O    . VAL B 2 2  ? 13.652  -4.914  4.509   1.00 0.00 ? 2  VAL B O    1  
ATOM 339   C CB   . VAL B 2 2  ? 15.373  -2.648  3.211   1.00 0.00 ? 2  VAL B CB   1  
ATOM 340   C CG1  . VAL B 2 2  ? 16.320  -3.657  3.862   1.00 0.00 ? 2  VAL B CG1  1  
ATOM 341   C CG2  . VAL B 2 2  ? 15.100  -3.066  1.765   1.00 0.00 ? 2  VAL B CG2  1  
ATOM 342   H H    . VAL B 2 2  ? 14.405  -3.104  6.054   1.00 0.00 ? 2  VAL B H    1  
ATOM 343   H HA   . VAL B 2 2  ? 13.429  -1.821  3.595   1.00 0.00 ? 2  VAL B HA   1  
ATOM 344   H HB   . VAL B 2 2  ? 15.827  -1.667  3.225   1.00 0.00 ? 2  VAL B HB   1  
ATOM 345   H HG11 . VAL B 2 2  ? 16.988  -4.058  3.115   1.00 0.00 ? 2  VAL B HG11 1  
ATOM 346   H HG12 . VAL B 2 2  ? 15.745  -4.461  4.298   1.00 0.00 ? 2  VAL B HG12 1  
ATOM 347   H HG13 . VAL B 2 2  ? 16.894  -3.166  4.634   1.00 0.00 ? 2  VAL B HG13 1  
ATOM 348   H HG21 . VAL B 2 2  ? 15.787  -2.556  1.106   1.00 0.00 ? 2  VAL B HG21 1  
ATOM 349   H HG22 . VAL B 2 2  ? 14.086  -2.804  1.499   1.00 0.00 ? 2  VAL B HG22 1  
ATOM 350   H HG23 . VAL B 2 2  ? 15.232  -4.134  1.667   1.00 0.00 ? 2  VAL B HG23 1  
ATOM 351   N N    . ASN B 2 3  ? 12.372  -4.026  2.961   1.00 0.00 ? 3  ASN B N    1  
ATOM 352   C CA   . ASN B 2 3  ? 11.635  -5.307  2.770   1.00 0.00 ? 3  ASN B CA   1  
ATOM 353   C C    . ASN B 2 3  ? 11.736  -5.740  1.306   1.00 0.00 ? 3  ASN B C    1  
ATOM 354   O O    . ASN B 2 3  ? 12.358  -5.083  0.496   1.00 0.00 ? 3  ASN B O    1  
ATOM 355   C CB   . ASN B 2 3  ? 10.165  -5.112  3.147   1.00 0.00 ? 3  ASN B CB   1  
ATOM 356   C CG   . ASN B 2 3  ? 9.468   -4.265  2.080   1.00 0.00 ? 3  ASN B CG   1  
ATOM 357   O OD1  . ASN B 2 3  ? 9.456   -4.619  0.918   1.00 0.00 ? 3  ASN B OD1  1  
ATOM 358   N ND2  . ASN B 2 3  ? 8.882   -3.152  2.428   1.00 0.00 ? 3  ASN B ND2  1  
ATOM 359   H H    . ASN B 2 3  ? 12.132  -3.239  2.428   1.00 0.00 ? 3  ASN B H    1  
ATOM 360   H HA   . ASN B 2 3  ? 12.070  -6.069  3.401   1.00 0.00 ? 3  ASN B HA   1  
ATOM 361   H HB2  . ASN B 2 3  ? 9.681   -6.075  3.216   1.00 0.00 ? 3  ASN B HB2  1  
ATOM 362   H HB3  . ASN B 2 3  ? 10.102  -4.608  4.100   1.00 0.00 ? 3  ASN B HB3  1  
ATOM 363   H HD21 . ASN B 2 3  ? 8.891   -2.867  3.366   1.00 0.00 ? 3  ASN B HD21 1  
ATOM 364   H HD22 . ASN B 2 3  ? 8.433   -2.602  1.753   1.00 0.00 ? 3  ASN B HD22 1  
ATOM 365   N N    . GLN B 2 4  ? 11.129  -6.843  0.961   1.00 0.00 ? 4  GLN B N    1  
ATOM 366   C CA   . GLN B 2 4  ? 11.194  -7.316  -0.451  1.00 0.00 ? 4  GLN B CA   1  
ATOM 367   C C    . GLN B 2 4  ? 9.788   -7.677  -0.936  1.00 0.00 ? 4  GLN B C    1  
ATOM 368   O O    . GLN B 2 4  ? 9.555   -8.757  -1.440  1.00 0.00 ? 4  GLN B O    1  
ATOM 369   C CB   . GLN B 2 4  ? 12.094  -8.550  -0.533  1.00 0.00 ? 4  GLN B CB   1  
ATOM 370   C CG   . GLN B 2 4  ? 13.261  -8.397  0.445   1.00 0.00 ? 4  GLN B CG   1  
ATOM 371   C CD   . GLN B 2 4  ? 14.518  -9.027  -0.157  1.00 0.00 ? 4  GLN B CD   1  
ATOM 372   O OE1  . GLN B 2 4  ? 14.925  -8.676  -1.247  1.00 0.00 ? 4  GLN B OE1  1  
ATOM 373   N NE2  . GLN B 2 4  ? 15.155  -9.949  0.511   1.00 0.00 ? 4  GLN B NE2  1  
ATOM 374   H H    . GLN B 2 4  ? 10.633  -7.360  1.629   1.00 0.00 ? 4  GLN B H    1  
ATOM 375   H HA   . GLN B 2 4  ? 11.600  -6.533  -1.074  1.00 0.00 ? 4  GLN B HA   1  
ATOM 376   H HB2  . GLN B 2 4  ? 11.522  -9.430  -0.277  1.00 0.00 ? 4  GLN B HB2  1  
ATOM 377   H HB3  . GLN B 2 4  ? 12.479  -8.649  -1.537  1.00 0.00 ? 4  GLN B HB3  1  
ATOM 378   H HG2  . GLN B 2 4  ? 13.438  -7.347  0.632   1.00 0.00 ? 4  GLN B HG2  1  
ATOM 379   H HG3  . GLN B 2 4  ? 13.021  -8.893  1.373   1.00 0.00 ? 4  GLN B HG3  1  
ATOM 380   H HE21 . GLN B 2 4  ? 14.827  -10.232 1.390   1.00 0.00 ? 4  GLN B HE21 1  
ATOM 381   H HE22 . GLN B 2 4  ? 15.962  -10.359 0.134   1.00 0.00 ? 4  GLN B HE22 1  
ATOM 382   N N    . HIS B 2 5  ? 8.850   -6.780  -0.790  1.00 0.00 ? 5  HIS B N    1  
ATOM 383   C CA   . HIS B 2 5  ? 7.461   -7.074  -1.246  1.00 0.00 ? 5  HIS B CA   1  
ATOM 384   C C    . HIS B 2 5  ? 7.507   -7.751  -2.619  1.00 0.00 ? 5  HIS B C    1  
ATOM 385   O O    . HIS B 2 5  ? 8.517   -7.734  -3.294  1.00 0.00 ? 5  HIS B O    1  
ATOM 386   C CB   . HIS B 2 5  ? 6.671   -5.766  -1.347  1.00 0.00 ? 5  HIS B CB   1  
ATOM 387   C CG   . HIS B 2 5  ? 7.395   -4.813  -2.258  1.00 0.00 ? 5  HIS B CG   1  
ATOM 388   N ND1  . HIS B 2 5  ? 8.523   -4.115  -1.854  1.00 0.00 ? 5  HIS B ND1  1  
ATOM 389   C CD2  . HIS B 2 5  ? 7.168   -4.436  -3.559  1.00 0.00 ? 5  HIS B CD2  1  
ATOM 390   C CE1  . HIS B 2 5  ? 8.928   -3.363  -2.892  1.00 0.00 ? 5  HIS B CE1  1  
ATOM 391   N NE2  . HIS B 2 5  ? 8.137   -3.521  -3.957  1.00 0.00 ? 5  HIS B NE2  1  
ATOM 392   H H    . HIS B 2 5  ? 9.059   -5.914  -0.381  1.00 0.00 ? 5  HIS B H    1  
ATOM 393   H HA   . HIS B 2 5  ? 6.980   -7.731  -0.537  1.00 0.00 ? 5  HIS B HA   1  
ATOM 394   H HB2  . HIS B 2 5  ? 5.688   -5.969  -1.746  1.00 0.00 ? 5  HIS B HB2  1  
ATOM 395   H HB3  . HIS B 2 5  ? 6.578   -5.325  -0.366  1.00 0.00 ? 5  HIS B HB3  1  
ATOM 396   H HD1  . HIS B 2 5  ? 8.945   -4.158  -0.971  1.00 0.00 ? 5  HIS B HD1  1  
ATOM 397   H HD2  . HIS B 2 5  ? 6.359   -4.796  -4.178  1.00 0.00 ? 5  HIS B HD2  1  
ATOM 398   H HE1  . HIS B 2 5  ? 9.794   -2.718  -2.871  1.00 0.00 ? 5  HIS B HE1  1  
ATOM 399   N N    . LEU B 2 6  ? 6.424   -8.348  -3.036  1.00 0.00 ? 6  LEU B N    1  
ATOM 400   C CA   . LEU B 2 6  ? 6.413   -9.027  -4.364  1.00 0.00 ? 6  LEU B CA   1  
ATOM 401   C C    . LEU B 2 6  ? 5.805   -8.093  -5.413  1.00 0.00 ? 6  LEU B C    1  
ATOM 402   O O    . LEU B 2 6  ? 5.861   -8.358  -6.597  1.00 0.00 ? 6  LEU B O    1  
ATOM 403   C CB   . LEU B 2 6  ? 5.580   -10.308 -4.277  1.00 0.00 ? 6  LEU B CB   1  
ATOM 404   C CG   . LEU B 2 6  ? 4.185   -9.977  -3.747  1.00 0.00 ? 6  LEU B CG   1  
ATOM 405   C CD1  . LEU B 2 6  ? 3.134   -10.391 -4.778  1.00 0.00 ? 6  LEU B CD1  1  
ATOM 406   C CD2  . LEU B 2 6  ? 3.944   -10.738 -2.441  1.00 0.00 ? 6  LEU B CD2  1  
ATOM 407   H H    . LEU B 2 6  ? 5.619   -8.353  -2.476  1.00 0.00 ? 6  LEU B H    1  
ATOM 408   H HA   . LEU B 2 6  ? 7.425   -9.275  -4.648  1.00 0.00 ? 6  LEU B HA   1  
ATOM 409   H HB2  . LEU B 2 6  ? 5.498   -10.750 -5.260  1.00 0.00 ? 6  LEU B HB2  1  
ATOM 410   H HB3  . LEU B 2 6  ? 6.062   -11.005 -3.608  1.00 0.00 ? 6  LEU B HB3  1  
ATOM 411   H HG   . LEU B 2 6  ? 4.112   -8.914  -3.566  1.00 0.00 ? 6  LEU B HG   1  
ATOM 412   H HD11 . LEU B 2 6  ? 3.461   -10.095 -5.764  1.00 0.00 ? 6  LEU B HD11 1  
ATOM 413   H HD12 . LEU B 2 6  ? 2.196   -9.908  -4.550  1.00 0.00 ? 6  LEU B HD12 1  
ATOM 414   H HD13 . LEU B 2 6  ? 3.004   -11.463 -4.749  1.00 0.00 ? 6  LEU B HD13 1  
ATOM 415   H HD21 . LEU B 2 6  ? 2.896   -10.690 -2.185  1.00 0.00 ? 6  LEU B HD21 1  
ATOM 416   H HD22 . LEU B 2 6  ? 4.529   -10.291 -1.651  1.00 0.00 ? 6  LEU B HD22 1  
ATOM 417   H HD23 . LEU B 2 6  ? 4.238   -11.770 -2.567  1.00 0.00 ? 6  LEU B HD23 1  
ATOM 418   N N    . CYS B 2 7  ? 5.224   -7.003  -4.988  1.00 0.00 ? 7  CYS B N    1  
ATOM 419   C CA   . CYS B 2 7  ? 4.612   -6.051  -5.960  1.00 0.00 ? 7  CYS B CA   1  
ATOM 420   C C    . CYS B 2 7  ? 3.434   -6.725  -6.663  1.00 0.00 ? 7  CYS B C    1  
ATOM 421   O O    . CYS B 2 7  ? 3.603   -7.502  -7.581  1.00 0.00 ? 7  CYS B O    1  
ATOM 422   C CB   . CYS B 2 7  ? 5.655   -5.626  -6.997  1.00 0.00 ? 7  CYS B CB   1  
ATOM 423   S SG   . CYS B 2 7  ? 4.888   -4.503  -8.192  1.00 0.00 ? 7  CYS B SG   1  
ATOM 424   H H    . CYS B 2 7  ? 5.187   -6.811  -4.028  1.00 0.00 ? 7  CYS B H    1  
ATOM 425   H HA   . CYS B 2 7  ? 4.260   -5.179  -5.429  1.00 0.00 ? 7  CYS B HA   1  
ATOM 426   H HB2  . CYS B 2 7  ? 6.471   -5.123  -6.501  1.00 0.00 ? 7  CYS B HB2  1  
ATOM 427   H HB3  . CYS B 2 7  ? 6.029   -6.498  -7.512  1.00 0.00 ? 7  CYS B HB3  1  
ATOM 428   N N    . GLY B 2 8  ? 2.240   -6.431  -6.232  1.00 0.00 ? 8  GLY B N    1  
ATOM 429   C CA   . GLY B 2 8  ? 1.038   -7.048  -6.862  1.00 0.00 ? 8  GLY B CA   1  
ATOM 430   C C    . GLY B 2 8  ? -0.079  -7.129  -5.825  1.00 0.00 ? 8  GLY B C    1  
ATOM 431   O O    . GLY B 2 8  ? -1.057  -6.411  -5.889  1.00 0.00 ? 8  GLY B O    1  
ATOM 432   H H    . GLY B 2 8  ? 2.132   -5.803  -5.487  1.00 0.00 ? 8  GLY B H    1  
ATOM 433   H HA2  . GLY B 2 8  ? 0.717   -6.443  -7.695  1.00 0.00 ? 8  GLY B HA2  1  
ATOM 434   H HA3  . GLY B 2 8  ? 1.279   -8.042  -7.207  1.00 0.00 ? 8  GLY B HA3  1  
ATOM 435   N N    . SER B 2 9  ? 0.070   -7.992  -4.863  1.00 0.00 ? 9  SER B N    1  
ATOM 436   C CA   . SER B 2 9  ? -0.968  -8.120  -3.804  1.00 0.00 ? 9  SER B CA   1  
ATOM 437   C C    . SER B 2 9  ? -0.357  -7.710  -2.464  1.00 0.00 ? 9  SER B C    1  
ATOM 438   O O    . SER B 2 9  ? -1.016  -7.147  -1.613  1.00 0.00 ? 9  SER B O    1  
ATOM 439   C CB   . SER B 2 9  ? -1.446  -9.571  -3.727  1.00 0.00 ? 9  SER B CB   1  
ATOM 440   O OG   . SER B 2 9  ? -2.718  -9.681  -4.352  1.00 0.00 ? 9  SER B OG   1  
ATOM 441   H H    . SER B 2 9  ? 0.873   -8.550  -4.832  1.00 0.00 ? 9  SER B H    1  
ATOM 442   H HA   . SER B 2 9  ? -1.803  -7.475  -4.035  1.00 0.00 ? 9  SER B HA   1  
ATOM 443   H HB2  . SER B 2 9  ? -0.744  -10.211 -4.236  1.00 0.00 ? 9  SER B HB2  1  
ATOM 444   H HB3  . SER B 2 9  ? -1.516  -9.871  -2.689  1.00 0.00 ? 9  SER B HB3  1  
ATOM 445   H HG   . SER B 2 9  ? -2.639  -10.304 -5.078  1.00 0.00 ? 9  SER B HG   1  
ATOM 446   N N    . HIS B 2 10 ? 0.905   -7.987  -2.276  1.00 0.00 ? 10 HIS B N    1  
ATOM 447   C CA   . HIS B 2 10 ? 1.573   -7.617  -1.001  1.00 0.00 ? 10 HIS B CA   1  
ATOM 448   C C    . HIS B 2 10 ? 1.730   -6.098  -0.924  1.00 0.00 ? 10 HIS B C    1  
ATOM 449   O O    . HIS B 2 10 ? 1.447   -5.486  0.087   1.00 0.00 ? 10 HIS B O    1  
ATOM 450   C CB   . HIS B 2 10 ? 2.955   -8.273  -0.945  1.00 0.00 ? 10 HIS B CB   1  
ATOM 451   C CG   . HIS B 2 10 ? 2.879   -9.537  -0.134  1.00 0.00 ? 10 HIS B CG   1  
ATOM 452   N ND1  . HIS B 2 10 ? 1.823   -10.428 -0.251  1.00 0.00 ? 10 HIS B ND1  1  
ATOM 453   C CD2  . HIS B 2 10 ? 3.719   -10.073 0.810   1.00 0.00 ? 10 HIS B CD2  1  
ATOM 454   C CE1  . HIS B 2 10 ? 2.054   -11.444 0.600   1.00 0.00 ? 10 HIS B CE1  1  
ATOM 455   N NE2  . HIS B 2 10 ? 3.197   -11.278 1.272   1.00 0.00 ? 10 HIS B NE2  1  
ATOM 456   H H    . HIS B 2 10 ? 1.414   -8.440  -2.976  1.00 0.00 ? 10 HIS B H    1  
ATOM 457   H HA   . HIS B 2 10 ? 0.978   -7.962  -0.173  1.00 0.00 ? 10 HIS B HA   1  
ATOM 458   H HB2  . HIS B 2 10 ? 3.282   -8.507  -1.948  1.00 0.00 ? 10 HIS B HB2  1  
ATOM 459   H HB3  . HIS B 2 10 ? 3.658   -7.593  -0.487  1.00 0.00 ? 10 HIS B HB3  1  
ATOM 460   H HD1  . HIS B 2 10 ? 1.050   -10.335 -0.846  1.00 0.00 ? 10 HIS B HD1  1  
ATOM 461   H HD2  . HIS B 2 10 ? 4.645   -9.628  1.143   1.00 0.00 ? 10 HIS B HD2  1  
ATOM 462   H HE1  . HIS B 2 10 ? 1.396   -12.291 0.725   1.00 0.00 ? 10 HIS B HE1  1  
ATOM 463   N N    . LEU B 2 11 ? 2.183   -5.483  -1.983  1.00 0.00 ? 11 LEU B N    1  
ATOM 464   C CA   . LEU B 2 11 ? 2.361   -4.005  -1.963  1.00 0.00 ? 11 LEU B CA   1  
ATOM 465   C C    . LEU B 2 11 ? 1.017   -3.332  -1.687  1.00 0.00 ? 11 LEU B C    1  
ATOM 466   O O    . LEU B 2 11 ? 0.919   -2.433  -0.875  1.00 0.00 ? 11 LEU B O    1  
ATOM 467   C CB   . LEU B 2 11 ? 2.898   -3.532  -3.316  1.00 0.00 ? 11 LEU B CB   1  
ATOM 468   C CG   . LEU B 2 11 ? 3.762   -2.286  -3.112  1.00 0.00 ? 11 LEU B CG   1  
ATOM 469   C CD1  . LEU B 2 11 ? 4.423   -1.897  -4.436  1.00 0.00 ? 11 LEU B CD1  1  
ATOM 470   C CD2  . LEU B 2 11 ? 2.885   -1.130  -2.623  1.00 0.00 ? 11 LEU B CD2  1  
ATOM 471   H H    . LEU B 2 11 ? 2.408   -5.995  -2.788  1.00 0.00 ? 11 LEU B H    1  
ATOM 472   H HA   . LEU B 2 11 ? 3.061   -3.738  -1.186  1.00 0.00 ? 11 LEU B HA   1  
ATOM 473   H HB2  . LEU B 2 11 ? 3.494   -4.317  -3.760  1.00 0.00 ? 11 LEU B HB2  1  
ATOM 474   H HB3  . LEU B 2 11 ? 2.072   -3.293  -3.968  1.00 0.00 ? 11 LEU B HB3  1  
ATOM 475   H HG   . LEU B 2 11 ? 4.527   -2.495  -2.378  1.00 0.00 ? 11 LEU B HG   1  
ATOM 476   H HD11 . LEU B 2 11 ? 3.949   -1.009  -4.827  1.00 0.00 ? 11 LEU B HD11 1  
ATOM 477   H HD12 . LEU B 2 11 ? 4.313   -2.705  -5.144  1.00 0.00 ? 11 LEU B HD12 1  
ATOM 478   H HD13 . LEU B 2 11 ? 5.472   -1.702  -4.272  1.00 0.00 ? 11 LEU B HD13 1  
ATOM 479   H HD21 . LEU B 2 11 ? 1.845   -1.405  -2.709  1.00 0.00 ? 11 LEU B HD21 1  
ATOM 480   H HD22 . LEU B 2 11 ? 3.077   -0.253  -3.223  1.00 0.00 ? 11 LEU B HD22 1  
ATOM 481   H HD23 . LEU B 2 11 ? 3.117   -0.916  -1.590  1.00 0.00 ? 11 LEU B HD23 1  
ATOM 482   N N    . VAL B 2 12 ? -0.022  -3.754  -2.356  1.00 0.00 ? 12 VAL B N    1  
ATOM 483   C CA   . VAL B 2 12 ? -1.351  -3.125  -2.121  1.00 0.00 ? 12 VAL B CA   1  
ATOM 484   C C    . VAL B 2 12 ? -1.882  -3.557  -0.757  1.00 0.00 ? 12 VAL B C    1  
ATOM 485   O O    . VAL B 2 12 ? -2.429  -2.764  -0.016  1.00 0.00 ? 12 VAL B O    1  
ATOM 486   C CB   . VAL B 2 12 ? -2.335  -3.541  -3.220  1.00 0.00 ? 12 VAL B CB   1  
ATOM 487   C CG1  . VAL B 2 12 ? -2.104  -2.679  -4.462  1.00 0.00 ? 12 VAL B CG1  1  
ATOM 488   C CG2  . VAL B 2 12 ? -2.124  -5.014  -3.581  1.00 0.00 ? 12 VAL B CG2  1  
ATOM 489   H H    . VAL B 2 12 ? 0.074   -4.478  -3.008  1.00 0.00 ? 12 VAL B H    1  
ATOM 490   H HA   . VAL B 2 12 ? -1.238  -2.053  -2.126  1.00 0.00 ? 12 VAL B HA   1  
ATOM 491   H HB   . VAL B 2 12 ? -3.347  -3.396  -2.868  1.00 0.00 ? 12 VAL B HB   1  
ATOM 492   H HG11 . VAL B 2 12 ? -2.252  -1.639  -4.212  1.00 0.00 ? 12 VAL B HG11 1  
ATOM 493   H HG12 . VAL B 2 12 ? -2.801  -2.966  -5.235  1.00 0.00 ? 12 VAL B HG12 1  
ATOM 494   H HG13 . VAL B 2 12 ? -1.094  -2.823  -4.817  1.00 0.00 ? 12 VAL B HG13 1  
ATOM 495   H HG21 . VAL B 2 12 ? -2.974  -5.371  -4.143  1.00 0.00 ? 12 VAL B HG21 1  
ATOM 496   H HG22 . VAL B 2 12 ? -2.020  -5.596  -2.678  1.00 0.00 ? 12 VAL B HG22 1  
ATOM 497   H HG23 . VAL B 2 12 ? -1.230  -5.114  -4.179  1.00 0.00 ? 12 VAL B HG23 1  
ATOM 498   N N    . GLU B 2 13 ? -1.712  -4.799  -0.407  1.00 0.00 ? 13 GLU B N    1  
ATOM 499   C CA   . GLU B 2 13 ? -2.195  -5.257  0.920   1.00 0.00 ? 13 GLU B CA   1  
ATOM 500   C C    . GLU B 2 13 ? -1.509  -4.419  1.997   1.00 0.00 ? 13 GLU B C    1  
ATOM 501   O O    . GLU B 2 13 ? -2.054  -4.176  3.055   1.00 0.00 ? 13 GLU B O    1  
ATOM 502   C CB   . GLU B 2 13 ? -1.844  -6.734  1.116   1.00 0.00 ? 13 GLU B CB   1  
ATOM 503   C CG   . GLU B 2 13 ? -3.049  -7.600  0.746   1.00 0.00 ? 13 GLU B CG   1  
ATOM 504   C CD   . GLU B 2 13 ? -2.993  -8.913  1.527   1.00 0.00 ? 13 GLU B CD   1  
ATOM 505   O OE1  . GLU B 2 13 ? -2.821  -8.855  2.734   1.00 0.00 ? 13 GLU B OE1  1  
ATOM 506   O OE2  . GLU B 2 13 ? -3.123  -9.955  0.906   1.00 0.00 ? 13 GLU B OE2  1  
ATOM 507   H H    . GLU B 2 13 ? -1.256  -5.424  -1.007  1.00 0.00 ? 13 GLU B H    1  
ATOM 508   H HA   . GLU B 2 13 ? -3.265  -5.125  0.984   1.00 0.00 ? 13 GLU B HA   1  
ATOM 509   H HB2  . GLU B 2 13 ? -1.006  -6.991  0.484   1.00 0.00 ? 13 GLU B HB2  1  
ATOM 510   H HB3  . GLU B 2 13 ? -1.582  -6.908  2.149   1.00 0.00 ? 13 GLU B HB3  1  
ATOM 511   H HG2  . GLU B 2 13 ? -3.960  -7.072  0.991   1.00 0.00 ? 13 GLU B HG2  1  
ATOM 512   H HG3  . GLU B 2 13 ? -3.029  -7.812  -0.313  1.00 0.00 ? 13 GLU B HG3  1  
ATOM 513   N N    . ALA B 2 14 ? -0.311  -3.975  1.728   1.00 0.00 ? 14 ALA B N    1  
ATOM 514   C CA   . ALA B 2 14 ? 0.420   -3.150  2.726   1.00 0.00 ? 14 ALA B CA   1  
ATOM 515   C C    . ALA B 2 14 ? -0.257  -1.788  2.857   1.00 0.00 ? 14 ALA B C    1  
ATOM 516   O O    . ALA B 2 14 ? -0.507  -1.308  3.943   1.00 0.00 ? 14 ALA B O    1  
ATOM 517   C CB   . ALA B 2 14 ? 1.868   -2.960  2.269   1.00 0.00 ? 14 ALA B CB   1  
ATOM 518   H H    . ALA B 2 14 ? 0.105   -4.180  0.865   1.00 0.00 ? 14 ALA B H    1  
ATOM 519   H HA   . ALA B 2 14 ? 0.407   -3.651  3.676   1.00 0.00 ? 14 ALA B HA   1  
ATOM 520   H HB1  . ALA B 2 14 ? 1.960   -2.018  1.749   1.00 0.00 ? 14 ALA B HB1  1  
ATOM 521   H HB2  . ALA B 2 14 ? 2.146   -3.766  1.606   1.00 0.00 ? 14 ALA B HB2  1  
ATOM 522   H HB3  . ALA B 2 14 ? 2.520   -2.961  3.130   1.00 0.00 ? 14 ALA B HB3  1  
ATOM 523   N N    . LEU B 2 15 ? -0.558  -1.164  1.754   1.00 0.00 ? 15 LEU B N    1  
ATOM 524   C CA   . LEU B 2 15 ? -1.222  0.170   1.803   1.00 0.00 ? 15 LEU B CA   1  
ATOM 525   C C    . LEU B 2 15 ? -2.552  0.041   2.532   1.00 0.00 ? 15 LEU B C    1  
ATOM 526   O O    . LEU B 2 15 ? -2.939  0.909   3.284   1.00 0.00 ? 15 LEU B O    1  
ATOM 527   C CB   . LEU B 2 15 ? -1.458  0.663   0.369   1.00 0.00 ? 15 LEU B CB   1  
ATOM 528   C CG   . LEU B 2 15 ? -1.936  2.119   0.370   1.00 0.00 ? 15 LEU B CG   1  
ATOM 529   C CD1  . LEU B 2 15 ? -3.339  2.211   0.980   1.00 0.00 ? 15 LEU B CD1  1  
ATOM 530   C CD2  . LEU B 2 15 ? -0.963  2.979   1.180   1.00 0.00 ? 15 LEU B CD2  1  
ATOM 531   H H    . LEU B 2 15 ? -0.347  -1.576  0.891   1.00 0.00 ? 15 LEU B H    1  
ATOM 532   H HA   . LEU B 2 15 ? -0.595  0.868   2.340   1.00 0.00 ? 15 LEU B HA   1  
ATOM 533   H HB2  . LEU B 2 15 ? -0.536  0.592   -0.188  1.00 0.00 ? 15 LEU B HB2  1  
ATOM 534   H HB3  . LEU B 2 15 ? -2.207  0.044   -0.102  1.00 0.00 ? 15 LEU B HB3  1  
ATOM 535   H HG   . LEU B 2 15 ? -1.969  2.481   -0.648  1.00 0.00 ? 15 LEU B HG   1  
ATOM 536   H HD11 . LEU B 2 15 ? -3.266  2.556   2.001   1.00 0.00 ? 15 LEU B HD11 1  
ATOM 537   H HD12 . LEU B 2 15 ? -3.805  1.237   0.961   1.00 0.00 ? 15 LEU B HD12 1  
ATOM 538   H HD13 . LEU B 2 15 ? -3.936  2.906   0.408   1.00 0.00 ? 15 LEU B HD13 1  
ATOM 539   H HD21 . LEU B 2 15 ? -0.643  3.817   0.580   1.00 0.00 ? 15 LEU B HD21 1  
ATOM 540   H HD22 . LEU B 2 15 ? -0.103  2.389   1.455   1.00 0.00 ? 15 LEU B HD22 1  
ATOM 541   H HD23 . LEU B 2 15 ? -1.455  3.339   2.071   1.00 0.00 ? 15 LEU B HD23 1  
ATOM 542   N N    . TYR B 2 16 ? -3.249  -1.032  2.332   1.00 0.00 ? 16 TYR B N    1  
ATOM 543   C CA   . TYR B 2 16 ? -4.541  -1.199  3.040   1.00 0.00 ? 16 TYR B CA   1  
ATOM 544   C C    . TYR B 2 16 ? -4.250  -1.395  4.527   1.00 0.00 ? 16 TYR B C    1  
ATOM 545   O O    . TYR B 2 16 ? -4.830  -0.753  5.380   1.00 0.00 ? 16 TYR B O    1  
ATOM 546   C CB   . TYR B 2 16 ? -5.275  -2.425  2.492   1.00 0.00 ? 16 TYR B CB   1  
ATOM 547   C CG   . TYR B 2 16 ? -5.936  -2.072  1.181   1.00 0.00 ? 16 TYR B CG   1  
ATOM 548   C CD1  . TYR B 2 16 ? -5.179  -1.522  0.140   1.00 0.00 ? 16 TYR B CD1  1  
ATOM 549   C CD2  . TYR B 2 16 ? -7.307  -2.296  1.007   1.00 0.00 ? 16 TYR B CD2  1  
ATOM 550   C CE1  . TYR B 2 16 ? -5.792  -1.195  -1.075  1.00 0.00 ? 16 TYR B CE1  1  
ATOM 551   C CE2  . TYR B 2 16 ? -7.921  -1.969  -0.208  1.00 0.00 ? 16 TYR B CE2  1  
ATOM 552   C CZ   . TYR B 2 16 ? -7.163  -1.419  -1.249  1.00 0.00 ? 16 TYR B CZ   1  
ATOM 553   O OH   . TYR B 2 16 ? -7.768  -1.096  -2.447  1.00 0.00 ? 16 TYR B OH   1  
ATOM 554   H H    . TYR B 2 16 ? -2.920  -1.730  1.729   1.00 0.00 ? 16 TYR B H    1  
ATOM 555   H HA   . TYR B 2 16 ? -5.148  -0.318  2.900   1.00 0.00 ? 16 TYR B HA   1  
ATOM 556   H HB2  . TYR B 2 16 ? -4.567  -3.226  2.335   1.00 0.00 ? 16 TYR B HB2  1  
ATOM 557   H HB3  . TYR B 2 16 ? -6.026  -2.741  3.200   1.00 0.00 ? 16 TYR B HB3  1  
ATOM 558   H HD1  . TYR B 2 16 ? -4.121  -1.350  0.275   1.00 0.00 ? 16 TYR B HD1  1  
ATOM 559   H HD2  . TYR B 2 16 ? -7.891  -2.720  1.810   1.00 0.00 ? 16 TYR B HD2  1  
ATOM 560   H HE1  . TYR B 2 16 ? -5.208  -0.771  -1.878  1.00 0.00 ? 16 TYR B HE1  1  
ATOM 561   H HE2  . TYR B 2 16 ? -8.978  -2.141  -0.343  1.00 0.00 ? 16 TYR B HE2  1  
ATOM 562   H HH   . TYR B 2 16 ? -8.708  -1.273  -2.362  1.00 0.00 ? 16 TYR B HH   1  
ATOM 563   N N    . LEU B 2 17 ? -3.351  -2.287  4.835   1.00 0.00 ? 17 LEU B N    1  
ATOM 564   C CA   . LEU B 2 17 ? -3.005  -2.550  6.260   1.00 0.00 ? 17 LEU B CA   1  
ATOM 565   C C    . LEU B 2 17 ? -2.254  -1.364  6.874   1.00 0.00 ? 17 LEU B C    1  
ATOM 566   O O    . LEU B 2 17 ? -2.508  -0.982  7.999   1.00 0.00 ? 17 LEU B O    1  
ATOM 567   C CB   . LEU B 2 17 ? -2.140  -3.808  6.354   1.00 0.00 ? 17 LEU B CB   1  
ATOM 568   C CG   . LEU B 2 17 ? -3.029  -5.021  6.632   1.00 0.00 ? 17 LEU B CG   1  
ATOM 569   C CD1  . LEU B 2 17 ? -2.175  -6.290  6.639   1.00 0.00 ? 17 LEU B CD1  1  
ATOM 570   C CD2  . LEU B 2 17 ? -3.704  -4.855  7.996   1.00 0.00 ? 17 LEU B CD2  1  
ATOM 571   H H    . LEU B 2 17 ? -2.904  -2.789  4.124   1.00 0.00 ? 17 LEU B H    1  
ATOM 572   H HA   . LEU B 2 17 ? -3.914  -2.701  6.811   1.00 0.00 ? 17 LEU B HA   1  
ATOM 573   H HB2  . LEU B 2 17 ? -1.613  -3.953  5.422   1.00 0.00 ? 17 LEU B HB2  1  
ATOM 574   H HB3  . LEU B 2 17 ? -1.427  -3.695  7.157   1.00 0.00 ? 17 LEU B HB3  1  
ATOM 575   H HG   . LEU B 2 17 ? -3.783  -5.098  5.862   1.00 0.00 ? 17 LEU B HG   1  
ATOM 576   H HD11 . LEU B 2 17 ? -1.919  -6.546  7.657   1.00 0.00 ? 17 LEU B HD11 1  
ATOM 577   H HD12 . LEU B 2 17 ? -1.272  -6.119  6.072   1.00 0.00 ? 17 LEU B HD12 1  
ATOM 578   H HD13 . LEU B 2 17 ? -2.732  -7.101  6.193   1.00 0.00 ? 17 LEU B HD13 1  
ATOM 579   H HD21 . LEU B 2 17 ? -2.987  -4.476  8.709   1.00 0.00 ? 17 LEU B HD21 1  
ATOM 580   H HD22 . LEU B 2 17 ? -4.075  -5.812  8.333   1.00 0.00 ? 17 LEU B HD22 1  
ATOM 581   H HD23 . LEU B 2 17 ? -4.526  -4.160  7.909   1.00 0.00 ? 17 LEU B HD23 1  
ATOM 582   N N    . VAL B 2 18 ? -1.330  -0.780  6.162   1.00 0.00 ? 18 VAL B N    1  
ATOM 583   C CA   . VAL B 2 18 ? -0.582  0.371   6.747   1.00 0.00 ? 18 VAL B CA   1  
ATOM 584   C C    . VAL B 2 18 ? -1.601  1.420   7.174   1.00 0.00 ? 18 VAL B C    1  
ATOM 585   O O    . VAL B 2 18 ? -1.578  1.916   8.283   1.00 0.00 ? 18 VAL B O    1  
ATOM 586   C CB   . VAL B 2 18 ? 0.380   0.961   5.708   1.00 0.00 ? 18 VAL B CB   1  
ATOM 587   C CG1  . VAL B 2 18 ? 1.356   -0.116  5.235   1.00 0.00 ? 18 VAL B CG1  1  
ATOM 588   C CG2  . VAL B 2 18 ? -0.413  1.485   4.518   1.00 0.00 ? 18 VAL B CG2  1  
ATOM 589   H H    . VAL B 2 18 ? -1.128  -1.098  5.259   1.00 0.00 ? 18 VAL B H    1  
ATOM 590   H HA   . VAL B 2 18 ? -0.029  0.037   7.609   1.00 0.00 ? 18 VAL B HA   1  
ATOM 591   H HB   . VAL B 2 18 ? 0.932   1.771   6.146   1.00 0.00 ? 18 VAL B HB   1  
ATOM 592   H HG11 . VAL B 2 18 ? 1.495   -0.032  4.167   1.00 0.00 ? 18 VAL B HG11 1  
ATOM 593   H HG12 . VAL B 2 18 ? 0.957   -1.092  5.470   1.00 0.00 ? 18 VAL B HG12 1  
ATOM 594   H HG13 . VAL B 2 18 ? 2.305   0.015   5.732   1.00 0.00 ? 18 VAL B HG13 1  
ATOM 595   H HG21 . VAL B 2 18 ? 0.268   1.784   3.735   1.00 0.00 ? 18 VAL B HG21 1  
ATOM 596   H HG22 . VAL B 2 18 ? -1.006  2.334   4.825   1.00 0.00 ? 18 VAL B HG22 1  
ATOM 597   H HG23 . VAL B 2 18 ? -1.060  0.707   4.154   1.00 0.00 ? 18 VAL B HG23 1  
ATOM 598   N N    . CYS B 2 19 ? -2.514  1.729   6.307   1.00 0.00 ? 19 CYS B N    1  
ATOM 599   C CA   . CYS B 2 19 ? -3.575  2.714   6.645   1.00 0.00 ? 19 CYS B CA   1  
ATOM 600   C C    . CYS B 2 19 ? -4.450  2.900   5.414   1.00 0.00 ? 19 CYS B C    1  
ATOM 601   O O    . CYS B 2 19 ? -4.930  3.978   5.129   1.00 0.00 ? 19 CYS B O    1  
ATOM 602   C CB   . CYS B 2 19 ? -2.956  4.051   7.072   1.00 0.00 ? 19 CYS B CB   1  
ATOM 603   S SG   . CYS B 2 19 ? -2.326  4.943   5.629   1.00 0.00 ? 19 CYS B SG   1  
ATOM 604   H H    . CYS B 2 19 ? -2.516  1.291   5.425   1.00 0.00 ? 19 CYS B H    1  
ATOM 605   H HA   . CYS B 2 19 ? -4.178  2.322   7.453   1.00 0.00 ? 19 CYS B HA   1  
ATOM 606   H HB2  . CYS B 2 19 ? -3.709  4.652   7.560   1.00 0.00 ? 19 CYS B HB2  1  
ATOM 607   H HB3  . CYS B 2 19 ? -2.147  3.866   7.761   1.00 0.00 ? 19 CYS B HB3  1  
ATOM 608   N N    . GLY B 2 20 ? -4.655  1.843   4.680   1.00 0.00 ? 20 GLY B N    1  
ATOM 609   C CA   . GLY B 2 20 ? -5.493  1.940   3.456   1.00 0.00 ? 20 GLY B CA   1  
ATOM 610   C C    . GLY B 2 20 ? -6.779  1.146   3.672   1.00 0.00 ? 20 GLY B C    1  
ATOM 611   O O    . GLY B 2 20 ? -7.383  0.653   2.742   1.00 0.00 ? 20 GLY B O    1  
ATOM 612   H H    . GLY B 2 20 ? -4.252  0.977   4.937   1.00 0.00 ? 20 GLY B H    1  
ATOM 613   H HA2  . GLY B 2 20 ? -5.732  2.979   3.267   1.00 0.00 ? 20 GLY B HA2  1  
ATOM 614   H HA3  . GLY B 2 20 ? -4.956  1.534   2.613   1.00 0.00 ? 20 GLY B HA3  1  
ATOM 615   N N    . GLU B 2 21 ? -7.194  1.018   4.901   1.00 0.00 ? 21 GLU B N    1  
ATOM 616   C CA   . GLU B 2 21 ? -8.440  0.261   5.199   1.00 0.00 ? 21 GLU B CA   1  
ATOM 617   C C    . GLU B 2 21 ? -9.413  1.181   5.938   1.00 0.00 ? 21 GLU B C    1  
ATOM 618   O O    . GLU B 2 21 ? -10.615 1.013   5.872   1.00 0.00 ? 21 GLU B O    1  
ATOM 619   C CB   . GLU B 2 21 ? -8.108  -0.947  6.078   1.00 0.00 ? 21 GLU B CB   1  
ATOM 620   C CG   . GLU B 2 21 ? -8.611  -2.224  5.402   1.00 0.00 ? 21 GLU B CG   1  
ATOM 621   C CD   . GLU B 2 21 ? -8.092  -3.445  6.165   1.00 0.00 ? 21 GLU B CD   1  
ATOM 622   O OE1  . GLU B 2 21 ? -6.936  -3.428  6.553   1.00 0.00 ? 21 GLU B OE1  1  
ATOM 623   O OE2  . GLU B 2 21 ? -8.860  -4.375  6.347   1.00 0.00 ? 21 GLU B OE2  1  
ATOM 624   H H    . GLU B 2 21 ? -6.682  1.423   5.632   1.00 0.00 ? 21 GLU B H    1  
ATOM 625   H HA   . GLU B 2 21 ? -8.889  -0.074  4.276   1.00 0.00 ? 21 GLU B HA   1  
ATOM 626   H HB2  . GLU B 2 21 ? -7.038  -1.009  6.216   1.00 0.00 ? 21 GLU B HB2  1  
ATOM 627   H HB3  . GLU B 2 21 ? -8.589  -0.837  7.038   1.00 0.00 ? 21 GLU B HB3  1  
ATOM 628   H HG2  . GLU B 2 21 ? -9.692  -2.230  5.404   1.00 0.00 ? 21 GLU B HG2  1  
ATOM 629   H HG3  . GLU B 2 21 ? -8.252  -2.258  4.385   1.00 0.00 ? 21 GLU B HG3  1  
ATOM 630   N N    . ARG B 2 22 ? -8.901  2.158   6.638   1.00 0.00 ? 22 ARG B N    1  
ATOM 631   C CA   . ARG B 2 22 ? -9.789  3.093   7.375   1.00 0.00 ? 22 ARG B CA   1  
ATOM 632   C C    . ARG B 2 22 ? -10.406 4.078   6.386   1.00 0.00 ? 22 ARG B C    1  
ATOM 633   O O    . ARG B 2 22 ? -11.608 4.241   6.320   1.00 0.00 ? 22 ARG B O    1  
ATOM 634   C CB   . ARG B 2 22 ? -8.974  3.857   8.421   1.00 0.00 ? 22 ARG B CB   1  
ATOM 635   C CG   . ARG B 2 22 ? -9.704  3.820   9.765   1.00 0.00 ? 22 ARG B CG   1  
ATOM 636   C CD   . ARG B 2 22 ? -10.955 4.697   9.691   1.00 0.00 ? 22 ARG B CD   1  
ATOM 637   N NE   . ARG B 2 22 ? -11.348 5.119   11.065  1.00 0.00 ? 22 ARG B NE   1  
ATOM 638   C CZ   . ARG B 2 22 ? -11.647 6.367   11.303  1.00 0.00 ? 22 ARG B CZ   1  
ATOM 639   N NH1  . ARG B 2 22 ? -10.791 7.310   11.016  1.00 0.00 ? 22 ARG B NH1  1  
ATOM 640   N NH2  . ARG B 2 22 ? -12.803 6.672   11.828  1.00 0.00 ? 22 ARG B NH2  1  
ATOM 641   H H    . ARG B 2 22 ? -7.933  2.278   6.674   1.00 0.00 ? 22 ARG B H    1  
ATOM 642   H HA   . ARG B 2 22 ? -10.566 2.535   7.861   1.00 0.00 ? 22 ARG B HA   1  
ATOM 643   H HB2  . ARG B 2 22 ? -8.001  3.398   8.525   1.00 0.00 ? 22 ARG B HB2  1  
ATOM 644   H HB3  . ARG B 2 22 ? -8.856  4.883   8.106   1.00 0.00 ? 22 ARG B HB3  1  
ATOM 645   H HG2  . ARG B 2 22 ? -9.988  2.803   9.992   1.00 0.00 ? 22 ARG B HG2  1  
ATOM 646   H HG3  . ARG B 2 22 ? -9.051  4.193   10.539  1.00 0.00 ? 22 ARG B HG3  1  
ATOM 647   H HD2  . ARG B 2 22 ? -10.748 5.570   9.091   1.00 0.00 ? 22 ARG B HD2  1  
ATOM 648   H HD3  . ARG B 2 22 ? -11.761 4.136   9.242   1.00 0.00 ? 22 ARG B HD3  1  
ATOM 649   H HE   . ARG B 2 22 ? -11.381 4.460   11.789  1.00 0.00 ? 22 ARG B HE   1  
ATOM 650   H HH11 . ARG B 2 22 ? -9.906  7.076   10.614  1.00 0.00 ? 22 ARG B HH11 1  
ATOM 651   H HH12 . ARG B 2 22 ? -11.021 8.266   11.198  1.00 0.00 ? 22 ARG B HH12 1  
ATOM 652   H HH21 . ARG B 2 22 ? -13.458 5.949   12.047  1.00 0.00 ? 22 ARG B HH21 1  
ATOM 653   H HH22 . ARG B 2 22 ? -13.032 7.628   12.010  1.00 0.00 ? 22 ARG B HH22 1  
ATOM 654   N N    . GLY B 2 23 ? -9.588  4.728   5.608   1.00 0.00 ? 23 GLY B N    1  
ATOM 655   C CA   . GLY B 2 23 ? -10.120 5.698   4.610   1.00 0.00 ? 23 GLY B CA   1  
ATOM 656   C C    . GLY B 2 23 ? -10.406 4.961   3.300   1.00 0.00 ? 23 GLY B C    1  
ATOM 657   O O    . GLY B 2 23 ? -10.605 5.565   2.265   1.00 0.00 ? 23 GLY B O    1  
ATOM 658   H H    . GLY B 2 23 ? -8.623  4.572   5.677   1.00 0.00 ? 23 GLY B H    1  
ATOM 659   H HA2  . GLY B 2 23 ? -11.032 6.139   4.986   1.00 0.00 ? 23 GLY B HA2  1  
ATOM 660   H HA3  . GLY B 2 23 ? -9.389  6.472   4.432   1.00 0.00 ? 23 GLY B HA3  1  
ATOM 661   N N    . PHE B 2 24 ? -10.425 3.656   3.341   1.00 0.00 ? 24 PHE B N    1  
ATOM 662   C CA   . PHE B 2 24 ? -10.694 2.869   2.106   1.00 0.00 ? 24 PHE B CA   1  
ATOM 663   C C    . PHE B 2 24 ? -12.001 2.090   2.277   1.00 0.00 ? 24 PHE B C    1  
ATOM 664   O O    . PHE B 2 24 ? -12.348 1.256   1.464   1.00 0.00 ? 24 PHE B O    1  
ATOM 665   C CB   . PHE B 2 24 ? -9.548  1.881   1.875   1.00 0.00 ? 24 PHE B CB   1  
ATOM 666   C CG   . PHE B 2 24 ? -8.321  2.619   1.387   1.00 0.00 ? 24 PHE B CG   1  
ATOM 667   C CD1  . PHE B 2 24 ? -7.810  3.698   2.120   1.00 0.00 ? 24 PHE B CD1  1  
ATOM 668   C CD2  . PHE B 2 24 ? -7.695  2.224   0.198   1.00 0.00 ? 24 PHE B CD2  1  
ATOM 669   C CE1  . PHE B 2 24 ? -6.677  4.381   1.663   1.00 0.00 ? 24 PHE B CE1  1  
ATOM 670   C CE2  . PHE B 2 24 ? -6.560  2.907   -0.257  1.00 0.00 ? 24 PHE B CE2  1  
ATOM 671   C CZ   . PHE B 2 24 ? -6.053  3.985   0.476   1.00 0.00 ? 24 PHE B CZ   1  
ATOM 672   H H    . PHE B 2 24 ? -10.259 3.192   4.188   1.00 0.00 ? 24 PHE B H    1  
ATOM 673   H HA   . PHE B 2 24 ? -10.775 3.535   1.260   1.00 0.00 ? 24 PHE B HA   1  
ATOM 674   H HB2  . PHE B 2 24 ? -9.321  1.378   2.803   1.00 0.00 ? 24 PHE B HB2  1  
ATOM 675   H HB3  . PHE B 2 24 ? -9.845  1.152   1.136   1.00 0.00 ? 24 PHE B HB3  1  
ATOM 676   H HD1  . PHE B 2 24 ? -8.286  4.002   3.039   1.00 0.00 ? 24 PHE B HD1  1  
ATOM 677   H HD2  . PHE B 2 24 ? -8.083  1.389   -0.366  1.00 0.00 ? 24 PHE B HD2  1  
ATOM 678   H HE1  . PHE B 2 24 ? -6.283  5.213   2.229   1.00 0.00 ? 24 PHE B HE1  1  
ATOM 679   H HE2  . PHE B 2 24 ? -6.078  2.602   -1.174  1.00 0.00 ? 24 PHE B HE2  1  
ATOM 680   H HZ   . PHE B 2 24 ? -5.179  4.512   0.124   1.00 0.00 ? 24 PHE B HZ   1  
ATOM 681   N N    . PHE B 2 25 ? -12.724 2.348   3.333   1.00 0.00 ? 25 PHE B N    1  
ATOM 682   C CA   . PHE B 2 25 ? -14.002 1.616   3.559   1.00 0.00 ? 25 PHE B CA   1  
ATOM 683   C C    . PHE B 2 25 ? -15.091 2.179   2.645   1.00 0.00 ? 25 PHE B C    1  
ATOM 684   O O    . PHE B 2 25 ? -15.095 3.347   2.311   1.00 0.00 ? 25 PHE B O    1  
ATOM 685   C CB   . PHE B 2 25 ? -14.430 1.778   5.019   1.00 0.00 ? 25 PHE B CB   1  
ATOM 686   C CG   . PHE B 2 25 ? -14.521 0.419   5.671   1.00 0.00 ? 25 PHE B CG   1  
ATOM 687   C CD1  . PHE B 2 25 ? -15.370 -0.558  5.138   1.00 0.00 ? 25 PHE B CD1  1  
ATOM 688   C CD2  . PHE B 2 25 ? -13.757 0.137   6.810   1.00 0.00 ? 25 PHE B CD2  1  
ATOM 689   C CE1  . PHE B 2 25 ? -15.455 -1.818  5.743   1.00 0.00 ? 25 PHE B CE1  1  
ATOM 690   C CE2  . PHE B 2 25 ? -13.841 -1.123  7.415   1.00 0.00 ? 25 PHE B CE2  1  
ATOM 691   C CZ   . PHE B 2 25 ? -14.690 -2.100  6.882   1.00 0.00 ? 25 PHE B CZ   1  
ATOM 692   H H    . PHE B 2 25 ? -12.424 3.020   3.980   1.00 0.00 ? 25 PHE B H    1  
ATOM 693   H HA   . PHE B 2 25 ? -13.858 0.568   3.342   1.00 0.00 ? 25 PHE B HA   1  
ATOM 694   H HB2  . PHE B 2 25 ? -13.702 2.380   5.542   1.00 0.00 ? 25 PHE B HB2  1  
ATOM 695   H HB3  . PHE B 2 25 ? -15.394 2.261   5.060   1.00 0.00 ? 25 PHE B HB3  1  
ATOM 696   H HD1  . PHE B 2 25 ? -15.960 -0.340  4.260   1.00 0.00 ? 25 PHE B HD1  1  
ATOM 697   H HD2  . PHE B 2 25 ? -13.102 0.891   7.221   1.00 0.00 ? 25 PHE B HD2  1  
ATOM 698   H HE1  . PHE B 2 25 ? -16.109 -2.572  5.332   1.00 0.00 ? 25 PHE B HE1  1  
ATOM 699   H HE2  . PHE B 2 25 ? -13.252 -1.341  8.293   1.00 0.00 ? 25 PHE B HE2  1  
ATOM 700   H HZ   . PHE B 2 25 ? -14.756 -3.072  7.348   1.00 0.00 ? 25 PHE B HZ   1  
ATOM 701   N N    . TYR B 2 26 ? -16.018 1.354   2.240   1.00 0.00 ? 26 TYR B N    1  
ATOM 702   C CA   . TYR B 2 26 ? -17.111 1.834   1.350   1.00 0.00 ? 26 TYR B CA   1  
ATOM 703   C C    . TYR B 2 26 ? -18.451 1.287   1.854   1.00 0.00 ? 26 TYR B C    1  
ATOM 704   O O    . TYR B 2 26 ? -18.505 0.215   2.423   1.00 0.00 ? 26 TYR B O    1  
ATOM 705   C CB   . TYR B 2 26 ? -16.861 1.340   -0.076  1.00 0.00 ? 26 TYR B CB   1  
ATOM 706   C CG   . TYR B 2 26 ? -15.749 2.148   -0.700  1.00 0.00 ? 26 TYR B CG   1  
ATOM 707   C CD1  . TYR B 2 26 ? -16.005 3.438   -1.180  1.00 0.00 ? 26 TYR B CD1  1  
ATOM 708   C CD2  . TYR B 2 26 ? -14.461 1.608   -0.798  1.00 0.00 ? 26 TYR B CD2  1  
ATOM 709   C CE1  . TYR B 2 26 ? -14.974 4.187   -1.759  1.00 0.00 ? 26 TYR B CE1  1  
ATOM 710   C CE2  . TYR B 2 26 ? -13.430 2.357   -1.376  1.00 0.00 ? 26 TYR B CE2  1  
ATOM 711   C CZ   . TYR B 2 26 ? -13.686 3.647   -1.857  1.00 0.00 ? 26 TYR B CZ   1  
ATOM 712   O OH   . TYR B 2 26 ? -12.669 4.386   -2.426  1.00 0.00 ? 26 TYR B OH   1  
ATOM 713   H H    . TYR B 2 26 ? -15.995 0.416   2.524   1.00 0.00 ? 26 TYR B H    1  
ATOM 714   H HA   . TYR B 2 26 ? -17.136 2.914   1.359   1.00 0.00 ? 26 TYR B HA   1  
ATOM 715   H HB2  . TYR B 2 26 ? -16.580 0.298   -0.052  1.00 0.00 ? 26 TYR B HB2  1  
ATOM 716   H HB3  . TYR B 2 26 ? -17.761 1.457   -0.661  1.00 0.00 ? 26 TYR B HB3  1  
ATOM 717   H HD1  . TYR B 2 26 ? -16.999 3.854   -1.105  1.00 0.00 ? 26 TYR B HD1  1  
ATOM 718   H HD2  . TYR B 2 26 ? -14.263 0.613   -0.427  1.00 0.00 ? 26 TYR B HD2  1  
ATOM 719   H HE1  . TYR B 2 26 ? -15.172 5.182   -2.129  1.00 0.00 ? 26 TYR B HE1  1  
ATOM 720   H HE2  . TYR B 2 26 ? -12.436 1.940   -1.452  1.00 0.00 ? 26 TYR B HE2  1  
ATOM 721   H HH   . TYR B 2 26 ? -12.956 4.662   -3.300  1.00 0.00 ? 26 TYR B HH   1  
ATOM 722   N N    . PRO B 2 27 ? -19.494 2.044   1.628   1.00 0.00 ? 27 PRO B N    1  
ATOM 723   C CA   . PRO B 2 27 ? -20.854 1.665   2.049   1.00 0.00 ? 27 PRO B CA   1  
ATOM 724   C C    . PRO B 2 27 ? -21.436 0.617   1.095   1.00 0.00 ? 27 PRO B C    1  
ATOM 725   O O    . PRO B 2 27 ? -21.479 0.810   -0.104  1.00 0.00 ? 27 PRO B O    1  
ATOM 726   C CB   . PRO B 2 27 ? -21.635 2.980   1.963   1.00 0.00 ? 27 PRO B CB   1  
ATOM 727   C CG   . PRO B 2 27 ? -20.855 3.887   0.981   1.00 0.00 ? 27 PRO B CG   1  
ATOM 728   C CD   . PRO B 2 27 ? -19.414 3.345   0.932   1.00 0.00 ? 27 PRO B CD   1  
ATOM 729   H HA   . PRO B 2 27 ? -20.853 1.302   3.063   1.00 0.00 ? 27 PRO B HA   1  
ATOM 730   H HB2  . PRO B 2 27 ? -22.633 2.794   1.588   1.00 0.00 ? 27 PRO B HB2  1  
ATOM 731   H HB3  . PRO B 2 27 ? -21.682 3.449   2.933   1.00 0.00 ? 27 PRO B HB3  1  
ATOM 732   H HG2  . PRO B 2 27 ? -21.306 3.842   -0.001  1.00 0.00 ? 27 PRO B HG2  1  
ATOM 733   H HG3  . PRO B 2 27 ? -20.849 4.904   1.341   1.00 0.00 ? 27 PRO B HG3  1  
ATOM 734   H HD2  . PRO B 2 27 ? -19.097 3.210   -0.094  1.00 0.00 ? 27 PRO B HD2  1  
ATOM 735   H HD3  . PRO B 2 27 ? -18.742 4.007   1.454   1.00 0.00 ? 27 PRO B HD3  1  
ATOM 736   N N    . THR B 2 28 ? -21.882 -0.492  1.620   1.00 0.00 ? 28 THR B N    1  
ATOM 737   C CA   . THR B 2 28 ? -22.459 -1.552  0.745   1.00 0.00 ? 28 THR B CA   1  
ATOM 738   C C    . THR B 2 28 ? -21.350 -2.164  -0.113  1.00 0.00 ? 28 THR B C    1  
ATOM 739   O O    . THR B 2 28 ? -20.960 -1.615  -1.124  1.00 0.00 ? 28 THR B O    1  
ATOM 740   C CB   . THR B 2 28 ? -23.528 -0.939  -0.162  1.00 0.00 ? 28 THR B CB   1  
ATOM 741   O OG1  . THR B 2 28 ? -24.113 0.181   0.488   1.00 0.00 ? 28 THR B OG1  1  
ATOM 742   C CG2  . THR B 2 28 ? -24.608 -1.981  -0.458  1.00 0.00 ? 28 THR B CG2  1  
ATOM 743   H H    . THR B 2 28 ? -21.837 -0.628  2.589   1.00 0.00 ? 28 THR B H    1  
ATOM 744   H HA   . THR B 2 28 ? -22.905 -2.321  1.359   1.00 0.00 ? 28 THR B HA   1  
ATOM 745   H HB   . THR B 2 28 ? -23.076 -0.622  -1.089  1.00 0.00 ? 28 THR B HB   1  
ATOM 746   H HG1  . THR B 2 28 ? -24.759 -0.146  1.119   1.00 0.00 ? 28 THR B HG1  1  
ATOM 747   H HG21 . THR B 2 28 ? -25.167 -2.186  0.443   1.00 0.00 ? 28 THR B HG21 1  
ATOM 748   H HG22 . THR B 2 28 ? -24.143 -2.891  -0.808  1.00 0.00 ? 28 THR B HG22 1  
ATOM 749   H HG23 . THR B 2 28 ? -25.275 -1.602  -1.218  1.00 0.00 ? 28 THR B HG23 1  
ATOM 750   N N    . LYS B 2 29 ? -20.838 -3.298  0.282   1.00 0.00 ? 29 LYS B N    1  
ATOM 751   C CA   . LYS B 2 29 ? -19.756 -3.944  -0.509  1.00 0.00 ? 29 LYS B CA   1  
ATOM 752   C C    . LYS B 2 29 ? -20.323 -5.153  -1.254  1.00 0.00 ? 29 LYS B C    1  
ATOM 753   O O    . LYS B 2 29 ? -21.411 -5.616  -0.973  1.00 0.00 ? 29 LYS B O    1  
ATOM 754   C CB   . LYS B 2 29 ? -18.641 -4.404  0.433   1.00 0.00 ? 29 LYS B CB   1  
ATOM 755   C CG   . LYS B 2 29 ? -17.557 -3.328  0.504   1.00 0.00 ? 29 LYS B CG   1  
ATOM 756   C CD   . LYS B 2 29 ? -16.382 -3.727  -0.391  1.00 0.00 ? 29 LYS B CD   1  
ATOM 757   C CE   . LYS B 2 29 ? -15.081 -3.182  0.201   1.00 0.00 ? 29 LYS B CE   1  
ATOM 758   N NZ   . LYS B 2 29 ? -14.037 -4.245  0.169   1.00 0.00 ? 29 LYS B NZ   1  
ATOM 759   H H    . LYS B 2 29 ? -21.166 -3.725  1.099   1.00 0.00 ? 29 LYS B H    1  
ATOM 760   H HA   . LYS B 2 29 ? -19.358 -3.236  -1.220  1.00 0.00 ? 29 LYS B HA   1  
ATOM 761   H HB2  . LYS B 2 29 ? -19.049 -4.571  1.419   1.00 0.00 ? 29 LYS B HB2  1  
ATOM 762   H HB3  . LYS B 2 29 ? -18.211 -5.321  0.060   1.00 0.00 ? 29 LYS B HB3  1  
ATOM 763   H HG2  . LYS B 2 29 ? -17.963 -2.385  0.167   1.00 0.00 ? 29 LYS B HG2  1  
ATOM 764   H HG3  . LYS B 2 29 ? -17.213 -3.229  1.523   1.00 0.00 ? 29 LYS B HG3  1  
ATOM 765   H HD2  . LYS B 2 29 ? -16.327 -4.804  -0.453  1.00 0.00 ? 29 LYS B HD2  1  
ATOM 766   H HD3  . LYS B 2 29 ? -16.525 -3.316  -1.379  1.00 0.00 ? 29 LYS B HD3  1  
ATOM 767   H HE2  . LYS B 2 29 ? -14.749 -2.334  -0.379  1.00 0.00 ? 29 LYS B HE2  1  
ATOM 768   H HE3  . LYS B 2 29 ? -15.251 -2.876  1.223   1.00 0.00 ? 29 LYS B HE3  1  
ATOM 769   H HZ1  . LYS B 2 29 ? -13.991 -4.715  1.095   1.00 0.00 ? 29 LYS B HZ1  1  
ATOM 770   H HZ2  . LYS B 2 29 ? -13.114 -3.818  -0.051  1.00 0.00 ? 29 LYS B HZ2  1  
ATOM 771   H HZ3  . LYS B 2 29 ? -14.278 -4.946  -0.561  1.00 0.00 ? 29 LYS B HZ3  1  
ATOM 772   N N    . THR B 2 30 ? -19.592 -5.667  -2.202  1.00 0.00 ? 30 THR B N    1  
ATOM 773   C CA   . THR B 2 30 ? -20.084 -6.846  -2.969  1.00 0.00 ? 30 THR B CA   1  
ATOM 774   C C    . THR B 2 30 ? -18.895 -7.576  -3.599  1.00 0.00 ? 30 THR B C    1  
ATOM 775   O O    . THR B 2 30 ? -19.094 -8.672  -4.096  1.00 0.00 ? 30 THR B O    1  
ATOM 776   C CB   . THR B 2 30 ? -21.037 -6.377  -4.071  1.00 0.00 ? 30 THR B CB   1  
ATOM 777   O OG1  . THR B 2 30 ? -20.552 -5.163  -4.628  1.00 0.00 ? 30 THR B OG1  1  
ATOM 778   C CG2  . THR B 2 30 ? -22.429 -6.151  -3.482  1.00 0.00 ? 30 THR B CG2  1  
ATOM 779   O OXT  . THR B 2 30 ? -17.807 -7.026  -3.574  1.00 0.00 ? 30 THR B OXT  1  
ATOM 780   H H    . THR B 2 30 ? -18.719 -5.276  -2.409  1.00 0.00 ? 30 THR B H    1  
ATOM 781   H HA   . THR B 2 30 ? -20.606 -7.517  -2.303  1.00 0.00 ? 30 THR B HA   1  
ATOM 782   H HB   . THR B 2 30 ? -21.094 -7.130  -4.842  1.00 0.00 ? 30 THR B HB   1  
ATOM 783   H HG1  . THR B 2 30 ? -19.598 -5.233  -4.707  1.00 0.00 ? 30 THR B HG1  1  
ATOM 784   H HG21 . THR B 2 30 ? -23.146 -6.042  -4.283  1.00 0.00 ? 30 THR B HG21 1  
ATOM 785   H HG22 . THR B 2 30 ? -22.424 -5.256  -2.878  1.00 0.00 ? 30 THR B HG22 1  
ATOM 786   H HG23 . THR B 2 30 ? -22.702 -6.997  -2.868  1.00 0.00 ? 30 THR B HG23 1  
ATOM 787   N N    . GLY A 1 1  ? -0.025  9.393   -5.331  1.00 0.00 ? 1  GLY A N    2  
ATOM 788   C CA   . GLY A 1 1  ? -0.156  8.839   -3.953  1.00 0.00 ? 1  GLY A CA   2  
ATOM 789   C C    . GLY A 1 1  ? 1.228   8.473   -3.415  1.00 0.00 ? 1  GLY A C    2  
ATOM 790   O O    . GLY A 1 1  ? 2.214   8.532   -4.122  1.00 0.00 ? 1  GLY A O    2  
ATOM 791   H H1   . GLY A 1 1  ? -0.434  10.348  -5.362  1.00 0.00 ? 1  GLY A H1   2  
ATOM 792   H H2   . GLY A 1 1  ? -0.529  8.777   -6.001  1.00 0.00 ? 1  GLY A H2   2  
ATOM 793   H H3   . GLY A 1 1  ? 0.980   9.441   -5.592  1.00 0.00 ? 1  GLY A H3   2  
ATOM 794   H HA2  . GLY A 1 1  ? -0.610  9.580   -3.310  1.00 0.00 ? 1  GLY A HA2  2  
ATOM 795   H HA3  . GLY A 1 1  ? -0.775  7.955   -3.978  1.00 0.00 ? 1  GLY A HA3  2  
ATOM 796   N N    . ILE A 1 2  ? 1.309   8.095   -2.169  1.00 0.00 ? 2  ILE A N    2  
ATOM 797   C CA   . ILE A 1 2  ? 2.631   7.726   -1.588  1.00 0.00 ? 2  ILE A CA   2  
ATOM 798   C C    . ILE A 1 2  ? 3.129   6.432   -2.233  1.00 0.00 ? 2  ILE A C    2  
ATOM 799   O O    . ILE A 1 2  ? 4.316   6.218   -2.378  1.00 0.00 ? 2  ILE A O    2  
ATOM 800   C CB   . ILE A 1 2  ? 2.493   7.525   -0.076  1.00 0.00 ? 2  ILE A CB   2  
ATOM 801   C CG1  . ILE A 1 2  ? 1.185   6.788   0.228   1.00 0.00 ? 2  ILE A CG1  2  
ATOM 802   C CG2  . ILE A 1 2  ? 2.481   8.887   0.620   1.00 0.00 ? 2  ILE A CG2  2  
ATOM 803   C CD1  . ILE A 1 2  ? 1.347   5.968   1.511   1.00 0.00 ? 2  ILE A CD1  2  
ATOM 804   H H    . ILE A 1 2  ? 0.502   8.054   -1.615  1.00 0.00 ? 2  ILE A H    2  
ATOM 805   H HA   . ILE A 1 2  ? 3.341   8.517   -1.783  1.00 0.00 ? 2  ILE A HA   2  
ATOM 806   H HB   . ILE A 1 2  ? 3.329   6.944   0.286   1.00 0.00 ? 2  ILE A HB   2  
ATOM 807   H HG12 . ILE A 1 2  ? 0.388   7.506   0.358   1.00 0.00 ? 2  ILE A HG12 2  
ATOM 808   H HG13 . ILE A 1 2  ? 0.944   6.127   -0.591  1.00 0.00 ? 2  ILE A HG13 2  
ATOM 809   H HG21 . ILE A 1 2  ? 2.355   8.746   1.684   1.00 0.00 ? 2  ILE A HG21 2  
ATOM 810   H HG22 . ILE A 1 2  ? 1.664   9.480   0.237   1.00 0.00 ? 2  ILE A HG22 2  
ATOM 811   H HG23 . ILE A 1 2  ? 3.415   9.395   0.433   1.00 0.00 ? 2  ILE A HG23 2  
ATOM 812   H HD11 . ILE A 1 2  ? 1.252   4.917   1.281   1.00 0.00 ? 2  ILE A HD11 2  
ATOM 813   H HD12 . ILE A 1 2  ? 0.582   6.252   2.219   1.00 0.00 ? 2  ILE A HD12 2  
ATOM 814   H HD13 . ILE A 1 2  ? 2.321   6.157   1.938   1.00 0.00 ? 2  ILE A HD13 2  
ATOM 815   N N    . VAL A 1 3  ? 2.233   5.569   -2.624  1.00 0.00 ? 3  VAL A N    2  
ATOM 816   C CA   . VAL A 1 3  ? 2.648   4.296   -3.259  1.00 0.00 ? 3  VAL A CA   2  
ATOM 817   C C    . VAL A 1 3  ? 3.288   4.596   -4.617  1.00 0.00 ? 3  VAL A C    2  
ATOM 818   O O    . VAL A 1 3  ? 4.301   4.030   -4.977  1.00 0.00 ? 3  VAL A O    2  
ATOM 819   C CB   . VAL A 1 3  ? 1.404   3.416   -3.429  1.00 0.00 ? 3  VAL A CB   2  
ATOM 820   C CG1  . VAL A 1 3  ? 1.612   2.422   -4.566  1.00 0.00 ? 3  VAL A CG1  2  
ATOM 821   C CG2  . VAL A 1 3  ? 1.144   2.651   -2.130  1.00 0.00 ? 3  VAL A CG2  2  
ATOM 822   H H    . VAL A 1 3  ? 1.282   5.758   -2.504  1.00 0.00 ? 3  VAL A H    2  
ATOM 823   H HA   . VAL A 1 3  ? 3.363   3.794   -2.628  1.00 0.00 ? 3  VAL A HA   2  
ATOM 824   H HB   . VAL A 1 3  ? 0.553   4.042   -3.653  1.00 0.00 ? 3  VAL A HB   2  
ATOM 825   H HG11 . VAL A 1 3  ? 1.208   2.835   -5.478  1.00 0.00 ? 3  VAL A HG11 2  
ATOM 826   H HG12 . VAL A 1 3  ? 1.108   1.499   -4.331  1.00 0.00 ? 3  VAL A HG12 2  
ATOM 827   H HG13 . VAL A 1 3  ? 2.668   2.238   -4.690  1.00 0.00 ? 3  VAL A HG13 2  
ATOM 828   H HG21 . VAL A 1 3  ? 2.086   2.402   -1.665  1.00 0.00 ? 3  VAL A HG21 2  
ATOM 829   H HG22 . VAL A 1 3  ? 0.600   1.745   -2.349  1.00 0.00 ? 3  VAL A HG22 2  
ATOM 830   H HG23 . VAL A 1 3  ? 0.563   3.267   -1.460  1.00 0.00 ? 3  VAL A HG23 2  
ATOM 831   N N    . GLU A 1 4  ? 2.705   5.484   -5.370  1.00 0.00 ? 4  GLU A N    2  
ATOM 832   C CA   . GLU A 1 4  ? 3.278   5.823   -6.702  1.00 0.00 ? 4  GLU A CA   2  
ATOM 833   C C    . GLU A 1 4  ? 4.711   6.323   -6.522  1.00 0.00 ? 4  GLU A C    2  
ATOM 834   O O    . GLU A 1 4  ? 5.616   5.919   -7.225  1.00 0.00 ? 4  GLU A O    2  
ATOM 835   C CB   . GLU A 1 4  ? 2.433   6.917   -7.358  1.00 0.00 ? 4  GLU A CB   2  
ATOM 836   C CG   . GLU A 1 4  ? 2.709   6.943   -8.862  1.00 0.00 ? 4  GLU A CG   2  
ATOM 837   C CD   . GLU A 1 4  ? 3.886   7.876   -9.150  1.00 0.00 ? 4  GLU A CD   2  
ATOM 838   O OE1  . GLU A 1 4  ? 3.841   9.010   -8.702  1.00 0.00 ? 4  GLU A OE1  2  
ATOM 839   O OE2  . GLU A 1 4  ? 4.813   7.440   -9.813  1.00 0.00 ? 4  GLU A OE2  2  
ATOM 840   H H    . GLU A 1 4  ? 1.891   5.928   -5.058  1.00 0.00 ? 4  GLU A H    2  
ATOM 841   H HA   . GLU A 1 4  ? 3.280   4.945   -7.326  1.00 0.00 ? 4  GLU A HA   2  
ATOM 842   H HB2  . GLU A 1 4  ? 1.386   6.713   -7.186  1.00 0.00 ? 4  GLU A HB2  2  
ATOM 843   H HB3  . GLU A 1 4  ? 2.689   7.874   -6.930  1.00 0.00 ? 4  GLU A HB3  2  
ATOM 844   H HG2  . GLU A 1 4  ? 2.947   5.945   -9.201  1.00 0.00 ? 4  GLU A HG2  2  
ATOM 845   H HG3  . GLU A 1 4  ? 1.833   7.301   -9.383  1.00 0.00 ? 4  GLU A HG3  2  
ATOM 846   N N    . GLN A 1 5  ? 4.921   7.197   -5.580  1.00 0.00 ? 5  GLN A N    2  
ATOM 847   C CA   . GLN A 1 5  ? 6.293   7.728   -5.343  1.00 0.00 ? 5  GLN A CA   2  
ATOM 848   C C    . GLN A 1 5  ? 7.087   6.731   -4.498  1.00 0.00 ? 5  GLN A C    2  
ATOM 849   O O    . GLN A 1 5  ? 8.272   6.542   -4.690  1.00 0.00 ? 5  GLN A O    2  
ATOM 850   C CB   . GLN A 1 5  ? 6.199   9.063   -4.601  1.00 0.00 ? 5  GLN A CB   2  
ATOM 851   C CG   . GLN A 1 5  ? 7.505   9.839   -4.776  1.00 0.00 ? 5  GLN A CG   2  
ATOM 852   C CD   . GLN A 1 5  ? 8.276   9.847   -3.455  1.00 0.00 ? 5  GLN A CD   2  
ATOM 853   O OE1  . GLN A 1 5  ? 9.018   8.929   -3.165  1.00 0.00 ? 5  GLN A OE1  2  
ATOM 854   N NE2  . GLN A 1 5  ? 8.130   10.852  -2.634  1.00 0.00 ? 5  GLN A NE2  2  
ATOM 855   H H    . GLN A 1 5  ? 4.175   7.503   -5.026  1.00 0.00 ? 5  GLN A H    2  
ATOM 856   H HA   . GLN A 1 5  ? 6.791   7.876   -6.289  1.00 0.00 ? 5  GLN A HA   2  
ATOM 857   H HB2  . GLN A 1 5  ? 5.379   9.641   -5.002  1.00 0.00 ? 5  GLN A HB2  2  
ATOM 858   H HB3  . GLN A 1 5  ? 6.030   8.879   -3.550  1.00 0.00 ? 5  GLN A HB3  2  
ATOM 859   H HG2  . GLN A 1 5  ? 8.105   9.367   -5.541  1.00 0.00 ? 5  GLN A HG2  2  
ATOM 860   H HG3  . GLN A 1 5  ? 7.285   10.855  -5.068  1.00 0.00 ? 5  GLN A HG3  2  
ATOM 861   H HE21 . GLN A 1 5  ? 7.531   11.592  -2.868  1.00 0.00 ? 5  GLN A HE21 2  
ATOM 862   H HE22 . GLN A 1 5  ? 8.619   10.866  -1.785  1.00 0.00 ? 5  GLN A HE22 2  
ATOM 863   N N    . CYS A 1 6  ? 6.441   6.096   -3.561  1.00 0.00 ? 6  CYS A N    2  
ATOM 864   C CA   . CYS A 1 6  ? 7.150   5.113   -2.693  1.00 0.00 ? 6  CYS A CA   2  
ATOM 865   C C    . CYS A 1 6  ? 7.519   3.869   -3.509  1.00 0.00 ? 6  CYS A C    2  
ATOM 866   O O    . CYS A 1 6  ? 8.227   2.999   -3.043  1.00 0.00 ? 6  CYS A O    2  
ATOM 867   C CB   . CYS A 1 6  ? 6.232   4.713   -1.536  1.00 0.00 ? 6  CYS A CB   2  
ATOM 868   S SG   . CYS A 1 6  ? 6.964   3.331   -0.629  1.00 0.00 ? 6  CYS A SG   2  
ATOM 869   H H    . CYS A 1 6  ? 5.487   6.270   -3.425  1.00 0.00 ? 6  CYS A H    2  
ATOM 870   H HA   . CYS A 1 6  ? 8.049   5.564   -2.299  1.00 0.00 ? 6  CYS A HA   2  
ATOM 871   H HB2  . CYS A 1 6  ? 6.105   5.553   -0.870  1.00 0.00 ? 6  CYS A HB2  2  
ATOM 872   H HB3  . CYS A 1 6  ? 5.271   4.415   -1.928  1.00 0.00 ? 6  CYS A HB3  2  
ATOM 873   N N    . CYS A 1 7  ? 7.043   3.776   -4.720  1.00 0.00 ? 7  CYS A N    2  
ATOM 874   C CA   . CYS A 1 7  ? 7.366   2.585   -5.560  1.00 0.00 ? 7  CYS A CA   2  
ATOM 875   C C    . CYS A 1 7  ? 8.877   2.506   -5.792  1.00 0.00 ? 7  CYS A C    2  
ATOM 876   O O    . CYS A 1 7  ? 9.486   3.426   -6.300  1.00 0.00 ? 7  CYS A O    2  
ATOM 877   C CB   . CYS A 1 7  ? 6.650   2.703   -6.907  1.00 0.00 ? 7  CYS A CB   2  
ATOM 878   S SG   . CYS A 1 7  ? 5.717   1.186   -7.229  1.00 0.00 ? 7  CYS A SG   2  
ATOM 879   H H    . CYS A 1 7  ? 6.471   4.487   -5.078  1.00 0.00 ? 7  CYS A H    2  
ATOM 880   H HA   . CYS A 1 7  ? 7.034   1.691   -5.055  1.00 0.00 ? 7  CYS A HA   2  
ATOM 881   H HB2  . CYS A 1 7  ? 5.973   3.544   -6.883  1.00 0.00 ? 7  CYS A HB2  2  
ATOM 882   H HB3  . CYS A 1 7  ? 7.379   2.851   -7.690  1.00 0.00 ? 7  CYS A HB3  2  
ATOM 883   N N    . THR A 1 8  ? 9.487   1.408   -5.427  1.00 0.00 ? 8  THR A N    2  
ATOM 884   C CA   . THR A 1 8  ? 10.959  1.260   -5.629  1.00 0.00 ? 8  THR A CA   2  
ATOM 885   C C    . THR A 1 8  ? 11.467  0.065   -4.819  1.00 0.00 ? 8  THR A C    2  
ATOM 886   O O    . THR A 1 8  ? 11.668  0.156   -3.624  1.00 0.00 ? 8  THR A O    2  
ATOM 887   C CB   . THR A 1 8  ? 11.675  2.530   -5.160  1.00 0.00 ? 8  THR A CB   2  
ATOM 888   O OG1  . THR A 1 8  ? 10.818  3.270   -4.301  1.00 0.00 ? 8  THR A OG1  2  
ATOM 889   C CG2  . THR A 1 8  ? 12.051  3.385   -6.371  1.00 0.00 ? 8  THR A CG2  2  
ATOM 890   H H    . THR A 1 8  ? 8.974   0.677   -5.022  1.00 0.00 ? 8  THR A H    2  
ATOM 891   H HA   . THR A 1 8  ? 11.163  1.098   -6.677  1.00 0.00 ? 8  THR A HA   2  
ATOM 892   H HB   . THR A 1 8  ? 12.573  2.260   -4.625  1.00 0.00 ? 8  THR A HB   2  
ATOM 893   H HG1  . THR A 1 8  ? 11.279  4.070   -4.039  1.00 0.00 ? 8  THR A HG1  2  
ATOM 894   H HG21 . THR A 1 8  ? 13.105  3.617   -6.335  1.00 0.00 ? 8  THR A HG21 2  
ATOM 895   H HG22 . THR A 1 8  ? 11.480  4.302   -6.356  1.00 0.00 ? 8  THR A HG22 2  
ATOM 896   H HG23 . THR A 1 8  ? 11.833  2.840   -7.278  1.00 0.00 ? 8  THR A HG23 2  
ATOM 897   N N    . SER A 1 9  ? 11.679  -1.057  -5.457  1.00 0.00 ? 9  SER A N    2  
ATOM 898   C CA   . SER A 1 9  ? 12.174  -2.254  -4.715  1.00 0.00 ? 9  SER A CA   2  
ATOM 899   C C    . SER A 1 9  ? 11.216  -2.567  -3.568  1.00 0.00 ? 9  SER A C    2  
ATOM 900   O O    . SER A 1 9  ? 10.302  -3.355  -3.704  1.00 0.00 ? 9  SER A O    2  
ATOM 901   C CB   . SER A 1 9  ? 13.560  -1.961  -4.145  1.00 0.00 ? 9  SER A CB   2  
ATOM 902   O OG   . SER A 1 9  ? 14.545  -2.241  -5.131  1.00 0.00 ? 9  SER A OG   2  
ATOM 903   H H    . SER A 1 9  ? 11.512  -1.112  -6.421  1.00 0.00 ? 9  SER A H    2  
ATOM 904   H HA   . SER A 1 9  ? 12.228  -3.100  -5.385  1.00 0.00 ? 9  SER A HA   2  
ATOM 905   H HB2  . SER A 1 9  ? 13.622  -0.923  -3.865  1.00 0.00 ? 9  SER A HB2  2  
ATOM 906   H HB3  . SER A 1 9  ? 13.724  -2.578  -3.271  1.00 0.00 ? 9  SER A HB3  2  
ATOM 907   H HG   . SER A 1 9  ? 14.290  -3.048  -5.584  1.00 0.00 ? 9  SER A HG   2  
ATOM 908   N N    . ILE A 1 10 ? 11.413  -1.941  -2.440  1.00 0.00 ? 10 ILE A N    2  
ATOM 909   C CA   . ILE A 1 10 ? 10.511  -2.179  -1.274  1.00 0.00 ? 10 ILE A CA   2  
ATOM 910   C C    . ILE A 1 10 ? 9.819   -0.858  -0.937  1.00 0.00 ? 10 ILE A C    2  
ATOM 911   O O    . ILE A 1 10 ? 10.455  0.166   -0.777  1.00 0.00 ? 10 ILE A O    2  
ATOM 912   C CB   . ILE A 1 10 ? 11.316  -2.714  -0.068  1.00 0.00 ? 10 ILE A CB   2  
ATOM 913   C CG1  . ILE A 1 10 ? 11.050  -1.888  1.207   1.00 0.00 ? 10 ILE A CG1  2  
ATOM 914   C CG2  . ILE A 1 10 ? 12.802  -2.652  -0.397  1.00 0.00 ? 10 ILE A CG2  2  
ATOM 915   C CD1  . ILE A 1 10 ? 9.570   -1.988  1.605   1.00 0.00 ? 10 ILE A CD1  2  
ATOM 916   H H    . ILE A 1 10 ? 12.153  -1.303  -2.360  1.00 0.00 ? 10 ILE A H    2  
ATOM 917   H HA   . ILE A 1 10 ? 9.761   -2.906  -1.554  1.00 0.00 ? 10 ILE A HA   2  
ATOM 918   H HB   . ILE A 1 10 ? 11.039  -3.745  0.109   1.00 0.00 ? 10 ILE A HB   2  
ATOM 919   H HG12 . ILE A 1 10 ? 11.663  -2.266  2.012   1.00 0.00 ? 10 ILE A HG12 2  
ATOM 920   H HG13 . ILE A 1 10 ? 11.300  -0.854  1.021   1.00 0.00 ? 10 ILE A HG13 2  
ATOM 921   H HG21 . ILE A 1 10 ? 13.368  -3.079  0.412   1.00 0.00 ? 10 ILE A HG21 2  
ATOM 922   H HG22 . ILE A 1 10 ? 13.091  -1.621  -0.543  1.00 0.00 ? 10 ILE A HG22 2  
ATOM 923   H HG23 . ILE A 1 10 ? 12.988  -3.208  -1.305  1.00 0.00 ? 10 ILE A HG23 2  
ATOM 924   H HD11 . ILE A 1 10 ? 9.461   -2.688  2.420   1.00 0.00 ? 10 ILE A HD11 2  
ATOM 925   H HD12 . ILE A 1 10 ? 8.989   -2.326  0.761   1.00 0.00 ? 10 ILE A HD12 2  
ATOM 926   H HD13 . ILE A 1 10 ? 9.215   -1.016  1.918   1.00 0.00 ? 10 ILE A HD13 2  
ATOM 927   N N    . CYS A 1 11 ? 8.526   -0.877  -0.817  1.00 0.00 ? 11 CYS A N    2  
ATOM 928   C CA   . CYS A 1 11 ? 7.804   0.371   -0.479  1.00 0.00 ? 11 CYS A CA   2  
ATOM 929   C C    . CYS A 1 11 ? 7.561   0.358   1.020   1.00 0.00 ? 11 CYS A C    2  
ATOM 930   O O    . CYS A 1 11 ? 6.981   -0.568  1.540   1.00 0.00 ? 11 CYS A O    2  
ATOM 931   C CB   . CYS A 1 11 ? 6.467   0.413   -1.220  1.00 0.00 ? 11 CYS A CB   2  
ATOM 932   S SG   . CYS A 1 11 ? 5.552   1.890   -0.717  1.00 0.00 ? 11 CYS A SG   2  
ATOM 933   H H    . CYS A 1 11 ? 8.032   -1.714  -0.941  1.00 0.00 ? 11 CYS A H    2  
ATOM 934   H HA   . CYS A 1 11 ? 8.403   1.228   -0.748  1.00 0.00 ? 11 CYS A HA   2  
ATOM 935   H HB2  . CYS A 1 11 ? 6.645   0.445   -2.285  1.00 0.00 ? 11 CYS A HB2  2  
ATOM 936   H HB3  . CYS A 1 11 ? 5.891   -0.468  -0.976  1.00 0.00 ? 11 CYS A HB3  2  
ATOM 937   N N    . SER A 1 12 ? 8.036   1.365   1.708   1.00 0.00 ? 12 SER A N    2  
ATOM 938   C CA   . SER A 1 12 ? 7.889   1.436   3.191   1.00 0.00 ? 12 SER A CA   2  
ATOM 939   C C    . SER A 1 12 ? 6.618   0.725   3.656   1.00 0.00 ? 12 SER A C    2  
ATOM 940   O O    . SER A 1 12 ? 5.590   1.340   3.860   1.00 0.00 ? 12 SER A O    2  
ATOM 941   C CB   . SER A 1 12 ? 7.836   2.904   3.614   1.00 0.00 ? 12 SER A CB   2  
ATOM 942   O OG   . SER A 1 12 ? 9.146   3.453   3.565   1.00 0.00 ? 12 SER A OG   2  
ATOM 943   H H    . SER A 1 12 ? 8.520   2.077   1.243   1.00 0.00 ? 12 SER A H    2  
ATOM 944   H HA   . SER A 1 12 ? 8.745   0.969   3.653   1.00 0.00 ? 12 SER A HA   2  
ATOM 945   H HB2  . SER A 1 12 ? 7.197   3.452   2.943   1.00 0.00 ? 12 SER A HB2  2  
ATOM 946   H HB3  . SER A 1 12 ? 7.443   2.974   4.619   1.00 0.00 ? 12 SER A HB3  2  
ATOM 947   H HG   . SER A 1 12 ? 9.601   3.070   2.812   1.00 0.00 ? 12 SER A HG   2  
ATOM 948   N N    . LEU A 1 13 ? 6.684   -0.568  3.851   1.00 0.00 ? 13 LEU A N    2  
ATOM 949   C CA   . LEU A 1 13 ? 5.485   -1.297  4.328   1.00 0.00 ? 13 LEU A CA   2  
ATOM 950   C C    . LEU A 1 13 ? 5.048   -0.616  5.609   1.00 0.00 ? 13 LEU A C    2  
ATOM 951   O O    . LEU A 1 13 ? 3.880   -0.547  5.937   1.00 0.00 ? 13 LEU A O    2  
ATOM 952   C CB   . LEU A 1 13 ? 5.838   -2.761  4.605   1.00 0.00 ? 13 LEU A CB   2  
ATOM 953   C CG   . LEU A 1 13 ? 4.588   -3.506  5.077   1.00 0.00 ? 13 LEU A CG   2  
ATOM 954   C CD1  . LEU A 1 13 ? 4.004   -4.311  3.915   1.00 0.00 ? 13 LEU A CD1  2  
ATOM 955   C CD2  . LEU A 1 13 ? 4.963   -4.457  6.216   1.00 0.00 ? 13 LEU A CD2  2  
ATOM 956   H H    . LEU A 1 13 ? 7.524   -1.047  3.698   1.00 0.00 ? 13 LEU A H    2  
ATOM 957   H HA   . LEU A 1 13 ? 4.698   -1.235  3.591   1.00 0.00 ? 13 LEU A HA   2  
ATOM 958   H HB2  . LEU A 1 13 ? 6.211   -3.218  3.700   1.00 0.00 ? 13 LEU A HB2  2  
ATOM 959   H HB3  . LEU A 1 13 ? 6.595   -2.809  5.373   1.00 0.00 ? 13 LEU A HB3  2  
ATOM 960   H HG   . LEU A 1 13 ? 3.855   -2.794  5.426   1.00 0.00 ? 13 LEU A HG   2  
ATOM 961   H HD11 . LEU A 1 13 ? 4.633   -4.197  3.045   1.00 0.00 ? 13 LEU A HD11 2  
ATOM 962   H HD12 . LEU A 1 13 ? 3.011   -3.950  3.691   1.00 0.00 ? 13 LEU A HD12 2  
ATOM 963   H HD13 . LEU A 1 13 ? 3.954   -5.355  4.190   1.00 0.00 ? 13 LEU A HD13 2  
ATOM 964   H HD21 . LEU A 1 13 ? 4.895   -3.934  7.159   1.00 0.00 ? 13 LEU A HD21 2  
ATOM 965   H HD22 . LEU A 1 13 ? 5.974   -4.810  6.073   1.00 0.00 ? 13 LEU A HD22 2  
ATOM 966   H HD23 . LEU A 1 13 ? 4.286   -5.298  6.221   1.00 0.00 ? 13 LEU A HD23 2  
ATOM 967   N N    . TYR A 1 14 ? 5.998   -0.084  6.321   1.00 0.00 ? 14 TYR A N    2  
ATOM 968   C CA   . TYR A 1 14 ? 5.670   0.637   7.580   1.00 0.00 ? 14 TYR A CA   2  
ATOM 969   C C    . TYR A 1 14 ? 4.898   1.902   7.217   1.00 0.00 ? 14 TYR A C    2  
ATOM 970   O O    . TYR A 1 14 ? 3.915   2.247   7.844   1.00 0.00 ? 14 TYR A O    2  
ATOM 971   C CB   . TYR A 1 14 ? 6.960   1.010   8.314   1.00 0.00 ? 14 TYR A CB   2  
ATOM 972   C CG   . TYR A 1 14 ? 6.920   0.460   9.719   1.00 0.00 ? 14 TYR A CG   2  
ATOM 973   C CD1  . TYR A 1 14 ? 6.401   -0.819  9.957   1.00 0.00 ? 14 TYR A CD1  2  
ATOM 974   C CD2  . TYR A 1 14 ? 7.403   1.228   10.785  1.00 0.00 ? 14 TYR A CD2  2  
ATOM 975   C CE1  . TYR A 1 14 ? 6.364   -1.328  11.260  1.00 0.00 ? 14 TYR A CE1  2  
ATOM 976   C CE2  . TYR A 1 14 ? 7.367   0.719   12.089  1.00 0.00 ? 14 TYR A CE2  2  
ATOM 977   C CZ   . TYR A 1 14 ? 6.848   -0.560  12.326  1.00 0.00 ? 14 TYR A CZ   2  
ATOM 978   O OH   . TYR A 1 14 ? 6.812   -1.062  13.611  1.00 0.00 ? 14 TYR A OH   2  
ATOM 979   H H    . TYR A 1 14 ? 6.933   -0.142  6.007   1.00 0.00 ? 14 TYR A H    2  
ATOM 980   H HA   . TYR A 1 14 ? 5.058   0.010   8.209   1.00 0.00 ? 14 TYR A HA   2  
ATOM 981   H HB2  . TYR A 1 14 ? 7.806   0.593   7.788   1.00 0.00 ? 14 TYR A HB2  2  
ATOM 982   H HB3  . TYR A 1 14 ? 7.054   2.085   8.352   1.00 0.00 ? 14 TYR A HB3  2  
ATOM 983   H HD1  . TYR A 1 14 ? 6.028   -1.411  9.134   1.00 0.00 ? 14 TYR A HD1  2  
ATOM 984   H HD2  . TYR A 1 14 ? 7.803   2.215   10.602  1.00 0.00 ? 14 TYR A HD2  2  
ATOM 985   H HE1  . TYR A 1 14 ? 5.964   -2.314  11.443  1.00 0.00 ? 14 TYR A HE1  2  
ATOM 986   H HE2  . TYR A 1 14 ? 7.739   1.311   12.911  1.00 0.00 ? 14 TYR A HE2  2  
ATOM 987   H HH   . TYR A 1 14 ? 5.898   -1.069  13.902  1.00 0.00 ? 14 TYR A HH   2  
ATOM 988   N N    . GLN A 1 15 ? 5.325   2.586   6.192   1.00 0.00 ? 15 GLN A N    2  
ATOM 989   C CA   . GLN A 1 15 ? 4.605   3.817   5.768   1.00 0.00 ? 15 GLN A CA   2  
ATOM 990   C C    . GLN A 1 15 ? 3.264   3.407   5.164   1.00 0.00 ? 15 GLN A C    2  
ATOM 991   O O    . GLN A 1 15 ? 2.233   3.975   5.464   1.00 0.00 ? 15 GLN A O    2  
ATOM 992   C CB   . GLN A 1 15 ? 5.432   4.567   4.722   1.00 0.00 ? 15 GLN A CB   2  
ATOM 993   C CG   . GLN A 1 15 ? 6.727   5.074   5.360   1.00 0.00 ? 15 GLN A CG   2  
ATOM 994   C CD   . GLN A 1 15 ? 6.521   6.503   5.865   1.00 0.00 ? 15 GLN A CD   2  
ATOM 995   O OE1  . GLN A 1 15 ? 6.132   7.375   5.114   1.00 0.00 ? 15 GLN A OE1  2  
ATOM 996   N NE2  . GLN A 1 15 ? 6.767   6.781   7.116   1.00 0.00 ? 15 GLN A NE2  2  
ATOM 997   H H    . GLN A 1 15 ? 6.109   2.277   5.691   1.00 0.00 ? 15 GLN A H    2  
ATOM 998   H HA   . GLN A 1 15 ? 4.438   4.452   6.626   1.00 0.00 ? 15 GLN A HA   2  
ATOM 999   H HB2  . GLN A 1 15 ? 5.668   3.900   3.906   1.00 0.00 ? 15 GLN A HB2  2  
ATOM 1000  H HB3  . GLN A 1 15 ? 4.864   5.406   4.348   1.00 0.00 ? 15 GLN A HB3  2  
ATOM 1001  H HG2  . GLN A 1 15 ? 6.995   4.433   6.187   1.00 0.00 ? 15 GLN A HG2  2  
ATOM 1002  H HG3  . GLN A 1 15 ? 7.518   5.065   4.625   1.00 0.00 ? 15 GLN A HG3  2  
ATOM 1003  H HE21 . GLN A 1 15 ? 7.081   6.078   7.722   1.00 0.00 ? 15 GLN A HE21 2  
ATOM 1004  H HE22 . GLN A 1 15 ? 6.638   7.693   7.450   1.00 0.00 ? 15 GLN A HE22 2  
ATOM 1005  N N    . LEU A 1 16 ? 3.270   2.408   4.321   1.00 0.00 ? 16 LEU A N    2  
ATOM 1006  C CA   . LEU A 1 16 ? 1.996   1.945   3.707   1.00 0.00 ? 16 LEU A CA   2  
ATOM 1007  C C    . LEU A 1 16 ? 1.039   1.537   4.825   1.00 0.00 ? 16 LEU A C    2  
ATOM 1008  O O    . LEU A 1 16 ? -0.103  1.950   4.863   1.00 0.00 ? 16 LEU A O    2  
ATOM 1009  C CB   . LEU A 1 16 ? 2.273   0.742   2.802   1.00 0.00 ? 16 LEU A CB   2  
ATOM 1010  C CG   . LEU A 1 16 ? 3.155   1.178   1.632   1.00 0.00 ? 16 LEU A CG   2  
ATOM 1011  C CD1  . LEU A 1 16 ? 3.755   -0.056  0.956   1.00 0.00 ? 16 LEU A CD1  2  
ATOM 1012  C CD2  . LEU A 1 16 ? 2.309   1.952   0.619   1.00 0.00 ? 16 LEU A CD2  2  
ATOM 1013  H H    . LEU A 1 16 ? 4.112   1.957   4.102   1.00 0.00 ? 16 LEU A H    2  
ATOM 1014  H HA   . LEU A 1 16 ? 1.560   2.745   3.128   1.00 0.00 ? 16 LEU A HA   2  
ATOM 1015  H HB2  . LEU A 1 16 ? 2.780   -0.026  3.370   1.00 0.00 ? 16 LEU A HB2  2  
ATOM 1016  H HB3  . LEU A 1 16 ? 1.341   0.353   2.423   1.00 0.00 ? 16 LEU A HB3  2  
ATOM 1017  H HG   . LEU A 1 16 ? 3.951   1.811   1.997   1.00 0.00 ? 16 LEU A HG   2  
ATOM 1018  H HD11 . LEU A 1 16 ? 3.849   0.124   -0.105  1.00 0.00 ? 16 LEU A HD11 2  
ATOM 1019  H HD12 . LEU A 1 16 ? 3.110   -0.906  1.121   1.00 0.00 ? 16 LEU A HD12 2  
ATOM 1020  H HD13 . LEU A 1 16 ? 4.730   -0.257  1.374   1.00 0.00 ? 16 LEU A HD13 2  
ATOM 1021  H HD21 . LEU A 1 16 ? 1.595   2.570   1.144   1.00 0.00 ? 16 LEU A HD21 2  
ATOM 1022  H HD22 . LEU A 1 16 ? 1.783   1.257   -0.017  1.00 0.00 ? 16 LEU A HD22 2  
ATOM 1023  H HD23 . LEU A 1 16 ? 2.951   2.577   0.016   1.00 0.00 ? 16 LEU A HD23 2  
ATOM 1024  N N    . GLU A 1 17 ? 1.500   0.740   5.748   1.00 0.00 ? 17 GLU A N    2  
ATOM 1025  C CA   . GLU A 1 17 ? 0.623   0.323   6.870   1.00 0.00 ? 17 GLU A CA   2  
ATOM 1026  C C    . GLU A 1 17 ? 0.342   1.541   7.750   1.00 0.00 ? 17 GLU A C    2  
ATOM 1027  O O    . GLU A 1 17 ? -0.775  1.780   8.163   1.00 0.00 ? 17 GLU A O    2  
ATOM 1028  C CB   . GLU A 1 17 ? 1.322   -0.757  7.698   1.00 0.00 ? 17 GLU A CB   2  
ATOM 1029  C CG   . GLU A 1 17 ? 0.278   -1.549  8.486   1.00 0.00 ? 17 GLU A CG   2  
ATOM 1030  C CD   . GLU A 1 17 ? 0.480   -1.312  9.984   1.00 0.00 ? 17 GLU A CD   2  
ATOM 1031  O OE1  . GLU A 1 17 ? 1.621   -1.316  10.416  1.00 0.00 ? 17 GLU A OE1  2  
ATOM 1032  O OE2  . GLU A 1 17 ? -0.510  -1.131  10.674  1.00 0.00 ? 17 GLU A OE2  2  
ATOM 1033  H H    . GLU A 1 17 ? 2.425   0.424   5.707   1.00 0.00 ? 17 GLU A H    2  
ATOM 1034  H HA   . GLU A 1 17 ? -0.303  -0.063  6.477   1.00 0.00 ? 17 GLU A HA   2  
ATOM 1035  H HB2  . GLU A 1 17 ? 1.861   -1.423  7.040   1.00 0.00 ? 17 GLU A HB2  2  
ATOM 1036  H HB3  . GLU A 1 17 ? 2.013   -0.293  8.386   1.00 0.00 ? 17 GLU A HB3  2  
ATOM 1037  H HG2  . GLU A 1 17 ? -0.712  -1.223  8.199   1.00 0.00 ? 17 GLU A HG2  2  
ATOM 1038  H HG3  . GLU A 1 17 ? 0.387   -2.601  8.271   1.00 0.00 ? 17 GLU A HG3  2  
ATOM 1039  N N    . ASN A 1 18 ? 1.354   2.317   8.033   1.00 0.00 ? 18 ASN A N    2  
ATOM 1040  C CA   . ASN A 1 18 ? 1.155   3.527   8.879   1.00 0.00 ? 18 ASN A CA   2  
ATOM 1041  C C    . ASN A 1 18 ? 0.315   4.555   8.114   1.00 0.00 ? 18 ASN A C    2  
ATOM 1042  O O    . ASN A 1 18 ? -0.287  5.435   8.697   1.00 0.00 ? 18 ASN A O    2  
ATOM 1043  C CB   . ASN A 1 18 ? 2.515   4.138   9.224   1.00 0.00 ? 18 ASN A CB   2  
ATOM 1044  C CG   . ASN A 1 18 ? 3.274   3.201   10.165  1.00 0.00 ? 18 ASN A CG   2  
ATOM 1045  O OD1  . ASN A 1 18 ? 2.685   2.579   11.028  1.00 0.00 ? 18 ASN A OD1  2  
ATOM 1046  N ND2  . ASN A 1 18 ? 4.566   3.072   10.035  1.00 0.00 ? 18 ASN A ND2  2  
ATOM 1047  H H    . ASN A 1 18 ? 2.247   2.104   7.685   1.00 0.00 ? 18 ASN A H    2  
ATOM 1048  H HA   . ASN A 1 18 ? 0.644   3.250   9.789   1.00 0.00 ? 18 ASN A HA   2  
ATOM 1049  H HB2  . ASN A 1 18 ? 3.086   4.279   8.318   1.00 0.00 ? 18 ASN A HB2  2  
ATOM 1050  H HB3  . ASN A 1 18 ? 2.369   5.091   9.710   1.00 0.00 ? 18 ASN A HB3  2  
ATOM 1051  H HD21 . ASN A 1 18 ? 5.040   3.574   9.339   1.00 0.00 ? 18 ASN A HD21 2  
ATOM 1052  H HD22 . ASN A 1 18 ? 5.062   2.474   10.631  1.00 0.00 ? 18 ASN A HD22 2  
ATOM 1053  N N    . TYR A 1 19 ? 0.266   4.449   6.813   1.00 0.00 ? 19 TYR A N    2  
ATOM 1054  C CA   . TYR A 1 19 ? -0.537  5.416   6.017   1.00 0.00 ? 19 TYR A CA   2  
ATOM 1055  C C    . TYR A 1 19 ? -1.986  5.351   6.490   1.00 0.00 ? 19 TYR A C    2  
ATOM 1056  O O    . TYR A 1 19 ? -2.544  6.324   6.957   1.00 0.00 ? 19 TYR A O    2  
ATOM 1057  C CB   . TYR A 1 19 ? -0.451  5.035   4.530   1.00 0.00 ? 19 TYR A CB   2  
ATOM 1058  C CG   . TYR A 1 19 ? -1.621  5.618   3.766   1.00 0.00 ? 19 TYR A CG   2  
ATOM 1059  C CD1  . TYR A 1 19 ? -2.813  4.891   3.643   1.00 0.00 ? 19 TYR A CD1  2  
ATOM 1060  C CD2  . TYR A 1 19 ? -1.511  6.883   3.180   1.00 0.00 ? 19 TYR A CD2  2  
ATOM 1061  C CE1  . TYR A 1 19 ? -3.892  5.432   2.933   1.00 0.00 ? 19 TYR A CE1  2  
ATOM 1062  C CE2  . TYR A 1 19 ? -2.589  7.424   2.471   1.00 0.00 ? 19 TYR A CE2  2  
ATOM 1063  C CZ   . TYR A 1 19 ? -3.780  6.699   2.347   1.00 0.00 ? 19 TYR A CZ   2  
ATOM 1064  O OH   . TYR A 1 19 ? -4.843  7.232   1.647   1.00 0.00 ? 19 TYR A OH   2  
ATOM 1065  H H    . TYR A 1 19 ? 0.750   3.732   6.359   1.00 0.00 ? 19 TYR A H    2  
ATOM 1066  H HA   . TYR A 1 19 ? -0.150  6.412   6.160   1.00 0.00 ? 19 TYR A HA   2  
ATOM 1067  H HB2  . TYR A 1 19 ? 0.470   5.416   4.117   1.00 0.00 ? 19 TYR A HB2  2  
ATOM 1068  H HB3  . TYR A 1 19 ? -0.465  3.960   4.437   1.00 0.00 ? 19 TYR A HB3  2  
ATOM 1069  H HD1  . TYR A 1 19 ? -2.901  3.912   4.094   1.00 0.00 ? 19 TYR A HD1  2  
ATOM 1070  H HD2  . TYR A 1 19 ? -0.594  7.442   3.275   1.00 0.00 ? 19 TYR A HD2  2  
ATOM 1071  H HE1  . TYR A 1 19 ? -4.810  4.873   2.837   1.00 0.00 ? 19 TYR A HE1  2  
ATOM 1072  H HE2  . TYR A 1 19 ? -2.502  8.401   2.018   1.00 0.00 ? 19 TYR A HE2  2  
ATOM 1073  H HH   . TYR A 1 19 ? -4.490  7.741   0.914   1.00 0.00 ? 19 TYR A HH   2  
ATOM 1074  N N    . CYS A 1 20 ? -2.588  4.203   6.371   1.00 0.00 ? 20 CYS A N    2  
ATOM 1075  C CA   . CYS A 1 20 ? -4.004  4.043   6.807   1.00 0.00 ? 20 CYS A CA   2  
ATOM 1076  C C    . CYS A 1 20 ? -4.812  5.284   6.423   1.00 0.00 ? 20 CYS A C    2  
ATOM 1077  O O    . CYS A 1 20 ? -4.407  6.068   5.588   1.00 0.00 ? 20 CYS A O    2  
ATOM 1078  C CB   . CYS A 1 20 ? -4.053  3.845   8.323   1.00 0.00 ? 20 CYS A CB   2  
ATOM 1079  S SG   . CYS A 1 20 ? -5.171  2.475   8.714   1.00 0.00 ? 20 CYS A SG   2  
ATOM 1080  H H    . CYS A 1 20 ? -2.102  3.439   5.994   1.00 0.00 ? 20 CYS A H    2  
ATOM 1081  H HA   . CYS A 1 20 ? -4.427  3.180   6.322   1.00 0.00 ? 20 CYS A HA   2  
ATOM 1082  H HB2  . CYS A 1 20 ? -3.063  3.617   8.689   1.00 0.00 ? 20 CYS A HB2  2  
ATOM 1083  H HB3  . CYS A 1 20 ? -4.413  4.748   8.793   1.00 0.00 ? 20 CYS A HB3  2  
ATOM 1084  N N    . ASN A 1 21 ? -5.956  5.466   7.023   1.00 0.00 ? 21 ASN A N    2  
ATOM 1085  C CA   . ASN A 1 21 ? -6.791  6.655   6.692   1.00 0.00 ? 21 ASN A CA   2  
ATOM 1086  C C    . ASN A 1 21 ? -8.188  6.480   7.291   1.00 0.00 ? 21 ASN A C    2  
ATOM 1087  O O    . ASN A 1 21 ? -8.910  7.461   7.359   1.00 0.00 ? 21 ASN A O    2  
ATOM 1088  C CB   . ASN A 1 21 ? -6.902  6.795   5.172   1.00 0.00 ? 21 ASN A CB   2  
ATOM 1089  C CG   . ASN A 1 21 ? -6.386  8.170   4.747   1.00 0.00 ? 21 ASN A CG   2  
ATOM 1090  O OD1  . ASN A 1 21 ? -5.252  8.305   4.332   1.00 0.00 ? 21 ASN A OD1  2  
ATOM 1091  N ND2  . ASN A 1 21 ? -7.176  9.205   4.832   1.00 0.00 ? 21 ASN A ND2  2  
ATOM 1092  O OXT  . ASN A 1 21 ? -8.513  5.367   7.671   1.00 0.00 ? 21 ASN A OXT  2  
ATOM 1093  H H    . ASN A 1 21 ? -6.266  4.820   7.692   1.00 0.00 ? 21 ASN A H    2  
ATOM 1094  H HA   . ASN A 1 21 ? -6.333  7.543   7.103   1.00 0.00 ? 21 ASN A HA   2  
ATOM 1095  H HB2  . ASN A 1 21 ? -6.312  6.025   4.697   1.00 0.00 ? 21 ASN A HB2  2  
ATOM 1096  H HB3  . ASN A 1 21 ? -7.935  6.693   4.876   1.00 0.00 ? 21 ASN A HB3  2  
ATOM 1097  H HD21 . ASN A 1 21 ? -8.091  9.097   5.167   1.00 0.00 ? 21 ASN A HD21 2  
ATOM 1098  H HD22 . ASN A 1 21 ? -6.855  10.091  4.562   1.00 0.00 ? 21 ASN A HD22 2  
ATOM 1099  N N    . PHE B 2 1  ? 12.047  -9.362  6.315   1.00 0.00 ? 1  PHE B N    2  
ATOM 1100  C CA   . PHE B 2 1  ? 11.907  -9.612  4.852   1.00 0.00 ? 1  PHE B CA   2  
ATOM 1101  C C    . PHE B 2 1  ? 12.153  -8.310  4.086   1.00 0.00 ? 1  PHE B C    2  
ATOM 1102  O O    . PHE B 2 1  ? 12.160  -7.236  4.655   1.00 0.00 ? 1  PHE B O    2  
ATOM 1103  C CB   . PHE B 2 1  ? 10.495  -10.120 4.554   1.00 0.00 ? 1  PHE B CB   2  
ATOM 1104  C CG   . PHE B 2 1  ? 10.124  -11.192 5.551   1.00 0.00 ? 1  PHE B CG   2  
ATOM 1105  C CD1  . PHE B 2 1  ? 11.099  -12.081 6.018   1.00 0.00 ? 1  PHE B CD1  2  
ATOM 1106  C CD2  . PHE B 2 1  ? 8.805   -11.296 6.009   1.00 0.00 ? 1  PHE B CD2  2  
ATOM 1107  C CE1  . PHE B 2 1  ? 10.755  -13.075 6.942   1.00 0.00 ? 1  PHE B CE1  2  
ATOM 1108  C CE2  . PHE B 2 1  ? 8.461   -12.289 6.933   1.00 0.00 ? 1  PHE B CE2  2  
ATOM 1109  C CZ   . PHE B 2 1  ? 9.436   -13.179 7.400   1.00 0.00 ? 1  PHE B CZ   2  
ATOM 1110  H H1   . PHE B 2 1  ? 11.105  -9.235  6.737   1.00 0.00 ? 1  PHE B H1   2  
ATOM 1111  H H2   . PHE B 2 1  ? 12.615  -8.504  6.466   1.00 0.00 ? 1  PHE B H2   2  
ATOM 1112  H H3   . PHE B 2 1  ? 12.518  -10.174 6.762   1.00 0.00 ? 1  PHE B H3   2  
ATOM 1113  H HA   . PHE B 2 1  ? 12.629  -10.353 4.543   1.00 0.00 ? 1  PHE B HA   2  
ATOM 1114  H HB2  . PHE B 2 1  ? 9.795   -9.301  4.628   1.00 0.00 ? 1  PHE B HB2  2  
ATOM 1115  H HB3  . PHE B 2 1  ? 10.463  -10.532 3.556   1.00 0.00 ? 1  PHE B HB3  2  
ATOM 1116  H HD1  . PHE B 2 1  ? 12.117  -12.001 5.665   1.00 0.00 ? 1  PHE B HD1  2  
ATOM 1117  H HD2  . PHE B 2 1  ? 8.053   -10.610 5.649   1.00 0.00 ? 1  PHE B HD2  2  
ATOM 1118  H HE1  . PHE B 2 1  ? 11.507  -13.761 7.303   1.00 0.00 ? 1  PHE B HE1  2  
ATOM 1119  H HE2  . PHE B 2 1  ? 7.443   -12.369 7.286   1.00 0.00 ? 1  PHE B HE2  2  
ATOM 1120  H HZ   . PHE B 2 1  ? 9.171   -13.945 8.113   1.00 0.00 ? 1  PHE B HZ   2  
ATOM 1121  N N    . VAL B 2 2  ? 12.354  -8.397  2.800   1.00 0.00 ? 2  VAL B N    2  
ATOM 1122  C CA   . VAL B 2 2  ? 12.598  -7.164  1.999   1.00 0.00 ? 2  VAL B CA   2  
ATOM 1123  C C    . VAL B 2 2  ? 11.630  -7.125  0.816   1.00 0.00 ? 2  VAL B C    2  
ATOM 1124  O O    . VAL B 2 2  ? 10.899  -8.063  0.569   1.00 0.00 ? 2  VAL B O    2  
ATOM 1125  C CB   . VAL B 2 2  ? 14.037  -7.170  1.479   1.00 0.00 ? 2  VAL B CB   2  
ATOM 1126  C CG1  . VAL B 2 2  ? 15.003  -6.964  2.646   1.00 0.00 ? 2  VAL B CG1  2  
ATOM 1127  C CG2  . VAL B 2 2  ? 14.329  -8.515  0.809   1.00 0.00 ? 2  VAL B CG2  2  
ATOM 1128  H H    . VAL B 2 2  ? 12.344  -9.272  2.360   1.00 0.00 ? 2  VAL B H    2  
ATOM 1129  H HA   . VAL B 2 2  ? 12.444  -6.294  2.620   1.00 0.00 ? 2  VAL B HA   2  
ATOM 1130  H HB   . VAL B 2 2  ? 14.163  -6.373  0.762   1.00 0.00 ? 2  VAL B HB   2  
ATOM 1131  H HG11 . VAL B 2 2  ? 15.979  -6.704  2.264   1.00 0.00 ? 2  VAL B HG11 2  
ATOM 1132  H HG12 . VAL B 2 2  ? 15.073  -7.875  3.222   1.00 0.00 ? 2  VAL B HG12 2  
ATOM 1133  H HG13 . VAL B 2 2  ? 14.640  -6.166  3.278   1.00 0.00 ? 2  VAL B HG13 2  
ATOM 1134  H HG21 . VAL B 2 2  ? 15.091  -9.038  1.367   1.00 0.00 ? 2  VAL B HG21 2  
ATOM 1135  H HG22 . VAL B 2 2  ? 14.675  -8.346  -0.201  1.00 0.00 ? 2  VAL B HG22 2  
ATOM 1136  H HG23 . VAL B 2 2  ? 13.427  -9.109  0.786   1.00 0.00 ? 2  VAL B HG23 2  
ATOM 1137  N N    . ASN B 2 3  ? 11.618  -6.046  0.081   1.00 0.00 ? 3  ASN B N    2  
ATOM 1138  C CA   . ASN B 2 3  ? 10.697  -5.950  -1.085  1.00 0.00 ? 3  ASN B CA   2  
ATOM 1139  C C    . ASN B 2 3  ? 9.315   -6.471  -0.685  1.00 0.00 ? 3  ASN B C    2  
ATOM 1140  O O    . ASN B 2 3  ? 9.036   -7.650  -0.779  1.00 0.00 ? 3  ASN B O    2  
ATOM 1141  C CB   . ASN B 2 3  ? 11.246  -6.792  -2.238  1.00 0.00 ? 3  ASN B CB   2  
ATOM 1142  C CG   . ASN B 2 3  ? 11.074  -6.033  -3.555  1.00 0.00 ? 3  ASN B CG   2  
ATOM 1143  O OD1  . ASN B 2 3  ? 12.041  -5.710  -4.214  1.00 0.00 ? 3  ASN B OD1  2  
ATOM 1144  N ND2  . ASN B 2 3  ? 9.873   -5.732  -3.967  1.00 0.00 ? 3  ASN B ND2  2  
ATOM 1145  H H    . ASN B 2 3  ? 12.216  -5.300  0.297   1.00 0.00 ? 3  ASN B H    2  
ATOM 1146  H HA   . ASN B 2 3  ? 10.617  -4.919  -1.398  1.00 0.00 ? 3  ASN B HA   2  
ATOM 1147  H HB2  . ASN B 2 3  ? 12.295  -6.990  -2.071  1.00 0.00 ? 3  ASN B HB2  2  
ATOM 1148  H HB3  . ASN B 2 3  ? 10.707  -7.726  -2.290  1.00 0.00 ? 3  ASN B HB3  2  
ATOM 1149  H HD21 . ASN B 2 3  ? 9.092   -5.993  -3.435  1.00 0.00 ? 3  ASN B HD21 2  
ATOM 1150  H HD22 . ASN B 2 3  ? 9.752   -5.245  -4.809  1.00 0.00 ? 3  ASN B HD22 2  
ATOM 1151  N N    . GLN B 2 4  ? 8.448   -5.605  -0.238  1.00 0.00 ? 4  GLN B N    2  
ATOM 1152  C CA   . GLN B 2 4  ? 7.089   -6.058  0.169   1.00 0.00 ? 4  GLN B CA   2  
ATOM 1153  C C    . GLN B 2 4  ? 6.070   -5.638  -0.890  1.00 0.00 ? 4  GLN B C    2  
ATOM 1154  O O    . GLN B 2 4  ? 4.960   -5.253  -0.580  1.00 0.00 ? 4  GLN B O    2  
ATOM 1155  C CB   . GLN B 2 4  ? 6.719   -5.428  1.513   1.00 0.00 ? 4  GLN B CB   2  
ATOM 1156  C CG   . GLN B 2 4  ? 6.111   -6.494  2.427   1.00 0.00 ? 4  GLN B CG   2  
ATOM 1157  C CD   . GLN B 2 4  ? 7.119   -7.627  2.631   1.00 0.00 ? 4  GLN B CD   2  
ATOM 1158  O OE1  . GLN B 2 4  ? 7.999   -7.530  3.462   1.00 0.00 ? 4  GLN B OE1  2  
ATOM 1159  N NE2  . GLN B 2 4  ? 7.027   -8.705  1.901   1.00 0.00 ? 4  GLN B NE2  2  
ATOM 1160  H H    . GLN B 2 4  ? 8.692   -4.658  -0.168  1.00 0.00 ? 4  GLN B H    2  
ATOM 1161  H HA   . GLN B 2 4  ? 7.084   -7.133  0.260   1.00 0.00 ? 4  GLN B HA   2  
ATOM 1162  H HB2  . GLN B 2 4  ? 7.607   -5.020  1.975   1.00 0.00 ? 4  GLN B HB2  2  
ATOM 1163  H HB3  . GLN B 2 4  ? 6.000   -4.639  1.356   1.00 0.00 ? 4  GLN B HB3  2  
ATOM 1164  H HG2  . GLN B 2 4  ? 5.867   -6.052  3.382   1.00 0.00 ? 4  GLN B HG2  2  
ATOM 1165  H HG3  . GLN B 2 4  ? 5.215   -6.890  1.972   1.00 0.00 ? 4  GLN B HG3  2  
ATOM 1166  H HE21 . GLN B 2 4  ? 6.317   -8.783  1.230   1.00 0.00 ? 4  GLN B HE21 2  
ATOM 1167  H HE22 . GLN B 2 4  ? 7.668   -9.436  2.024   1.00 0.00 ? 4  GLN B HE22 2  
ATOM 1168  N N    . HIS B 2 5  ? 6.437   -5.716  -2.138  1.00 0.00 ? 5  HIS B N    2  
ATOM 1169  C CA   . HIS B 2 5  ? 5.491   -5.327  -3.221  1.00 0.00 ? 5  HIS B CA   2  
ATOM 1170  C C    . HIS B 2 5  ? 6.179   -5.469  -4.582  1.00 0.00 ? 5  HIS B C    2  
ATOM 1171  O O    . HIS B 2 5  ? 7.388   -5.541  -4.673  1.00 0.00 ? 5  HIS B O    2  
ATOM 1172  C CB   . HIS B 2 5  ? 5.049   -3.873  -3.021  1.00 0.00 ? 5  HIS B CB   2  
ATOM 1173  C CG   . HIS B 2 5  ? 6.177   -2.946  -3.385  1.00 0.00 ? 5  HIS B CG   2  
ATOM 1174  N ND1  . HIS B 2 5  ? 7.373   -2.927  -2.687  1.00 0.00 ? 5  HIS B ND1  2  
ATOM 1175  C CD2  . HIS B 2 5  ? 6.305   -2.002  -4.374  1.00 0.00 ? 5  HIS B CD2  2  
ATOM 1176  C CE1  . HIS B 2 5  ? 8.163   -2.001  -3.260  1.00 0.00 ? 5  HIS B CE1  2  
ATOM 1177  N NE2  . HIS B 2 5  ? 7.560   -1.407  -4.293  1.00 0.00 ? 5  HIS B NE2  2  
ATOM 1178  H H    . HIS B 2 5  ? 7.334   -6.034  -2.361  1.00 0.00 ? 5  HIS B H    2  
ATOM 1179  H HA   . HIS B 2 5  ? 4.627   -5.973  -3.188  1.00 0.00 ? 5  HIS B HA   2  
ATOM 1180  H HB2  . HIS B 2 5  ? 4.197   -3.667  -3.652  1.00 0.00 ? 5  HIS B HB2  2  
ATOM 1181  H HB3  . HIS B 2 5  ? 4.776   -3.718  -1.988  1.00 0.00 ? 5  HIS B HB3  2  
ATOM 1182  H HD1  . HIS B 2 5  ? 7.603   -3.487  -1.915  1.00 0.00 ? 5  HIS B HD1  2  
ATOM 1183  H HD2  . HIS B 2 5  ? 5.548   -1.760  -5.105  1.00 0.00 ? 5  HIS B HD2  2  
ATOM 1184  H HE1  . HIS B 2 5  ? 9.163   -1.769  -2.928  1.00 0.00 ? 5  HIS B HE1  2  
ATOM 1185  N N    . LEU B 2 6  ? 5.415   -5.501  -5.639  1.00 0.00 ? 6  LEU B N    2  
ATOM 1186  C CA   . LEU B 2 6  ? 6.020   -5.629  -6.995  1.00 0.00 ? 6  LEU B CA   2  
ATOM 1187  C C    . LEU B 2 6  ? 6.007   -4.262  -7.686  1.00 0.00 ? 6  LEU B C    2  
ATOM 1188  O O    . LEU B 2 6  ? 6.489   -4.111  -8.791  1.00 0.00 ? 6  LEU B O    2  
ATOM 1189  C CB   . LEU B 2 6  ? 5.210   -6.628  -7.824  1.00 0.00 ? 6  LEU B CB   2  
ATOM 1190  C CG   . LEU B 2 6  ? 5.318   -8.019  -7.196  1.00 0.00 ? 6  LEU B CG   2  
ATOM 1191  C CD1  . LEU B 2 6  ? 4.061   -8.309  -6.375  1.00 0.00 ? 6  LEU B CD1  2  
ATOM 1192  C CD2  . LEU B 2 6  ? 5.455   -9.067  -8.303  1.00 0.00 ? 6  LEU B CD2  2  
ATOM 1193  H H    . LEU B 2 6  ? 4.443   -5.436  -5.543  1.00 0.00 ? 6  LEU B H    2  
ATOM 1194  H HA   . LEU B 2 6  ? 7.038   -5.977  -6.904  1.00 0.00 ? 6  LEU B HA   2  
ATOM 1195  H HB2  . LEU B 2 6  ? 4.174   -6.321  -7.845  1.00 0.00 ? 6  LEU B HB2  2  
ATOM 1196  H HB3  . LEU B 2 6  ? 5.597   -6.658  -8.831  1.00 0.00 ? 6  LEU B HB3  2  
ATOM 1197  H HG   . LEU B 2 6  ? 6.185   -8.056  -6.553  1.00 0.00 ? 6  LEU B HG   2  
ATOM 1198  H HD11 . LEU B 2 6  ? 4.039   -9.355  -6.108  1.00 0.00 ? 6  LEU B HD11 2  
ATOM 1199  H HD12 . LEU B 2 6  ? 3.186   -8.068  -6.959  1.00 0.00 ? 6  LEU B HD12 2  
ATOM 1200  H HD13 . LEU B 2 6  ? 4.071   -7.708  -5.477  1.00 0.00 ? 6  LEU B HD13 2  
ATOM 1201  H HD21 . LEU B 2 6  ? 4.869   -9.938  -8.049  1.00 0.00 ? 6  LEU B HD21 2  
ATOM 1202  H HD22 . LEU B 2 6  ? 6.493   -9.349  -8.405  1.00 0.00 ? 6  LEU B HD22 2  
ATOM 1203  H HD23 . LEU B 2 6  ? 5.101   -8.654  -9.236  1.00 0.00 ? 6  LEU B HD23 2  
ATOM 1204  N N    . CYS B 2 7  ? 5.456   -3.267  -7.041  1.00 0.00 ? 7  CYS B N    2  
ATOM 1205  C CA   . CYS B 2 7  ? 5.407   -1.906  -7.649  1.00 0.00 ? 7  CYS B CA   2  
ATOM 1206  C C    . CYS B 2 7  ? 4.444   -1.906  -8.839  1.00 0.00 ? 7  CYS B C    2  
ATOM 1207  O O    . CYS B 2 7  ? 4.322   -0.929  -9.551  1.00 0.00 ? 7  CYS B O    2  
ATOM 1208  C CB   . CYS B 2 7  ? 6.805   -1.502  -8.116  1.00 0.00 ? 7  CYS B CB   2  
ATOM 1209  S SG   . CYS B 2 7  ? 6.792   0.230   -8.648  1.00 0.00 ? 7  CYS B SG   2  
ATOM 1210  H H    . CYS B 2 7  ? 5.074   -3.415  -6.153  1.00 0.00 ? 7  CYS B H    2  
ATOM 1211  H HA   . CYS B 2 7  ? 5.058   -1.201  -6.910  1.00 0.00 ? 7  CYS B HA   2  
ATOM 1212  H HB2  . CYS B 2 7  ? 7.503   -1.623  -7.300  1.00 0.00 ? 7  CYS B HB2  2  
ATOM 1213  H HB3  . CYS B 2 7  ? 7.105   -2.129  -8.941  1.00 0.00 ? 7  CYS B HB3  2  
ATOM 1214  N N    . GLY B 2 8  ? 3.752   -2.991  -9.053  1.00 0.00 ? 8  GLY B N    2  
ATOM 1215  C CA   . GLY B 2 8  ? 2.788   -3.052  -10.188 1.00 0.00 ? 8  GLY B CA   2  
ATOM 1216  C C    . GLY B 2 8  ? 1.433   -3.514  -9.658  1.00 0.00 ? 8  GLY B C    2  
ATOM 1217  O O    . GLY B 2 8  ? 1.081   -4.673  -9.757  1.00 0.00 ? 8  GLY B O    2  
ATOM 1218  H H    . GLY B 2 8  ? 3.859   -3.764  -8.462  1.00 0.00 ? 8  GLY B H    2  
ATOM 1219  H HA2  . GLY B 2 8  ? 2.691   -2.071  -10.633 1.00 0.00 ? 8  GLY B HA2  2  
ATOM 1220  H HA3  . GLY B 2 8  ? 3.141   -3.752  -10.926 1.00 0.00 ? 8  GLY B HA3  2  
ATOM 1221  N N    . SER B 2 9  ? 0.680   -2.615  -9.081  1.00 0.00 ? 9  SER B N    2  
ATOM 1222  C CA   . SER B 2 9  ? -0.654  -2.984  -8.520  1.00 0.00 ? 9  SER B CA   2  
ATOM 1223  C C    . SER B 2 9  ? -0.468  -3.588  -7.124  1.00 0.00 ? 9  SER B C    2  
ATOM 1224  O O    . SER B 2 9  ? -1.187  -3.266  -6.199  1.00 0.00 ? 9  SER B O    2  
ATOM 1225  C CB   . SER B 2 9  ? -1.343  -4.001  -9.433  1.00 0.00 ? 9  SER B CB   2  
ATOM 1226  O OG   . SER B 2 9  ? -1.121  -5.311  -8.927  1.00 0.00 ? 9  SER B OG   2  
ATOM 1227  H H    . SER B 2 9  ? 1.000   -1.693  -9.007  1.00 0.00 ? 9  SER B H    2  
ATOM 1228  H HA   . SER B 2 9  ? -1.267  -2.097  -8.446  1.00 0.00 ? 9  SER B HA   2  
ATOM 1229  H HB2  . SER B 2 9  ? -2.402  -3.805  -9.459  1.00 0.00 ? 9  SER B HB2  2  
ATOM 1230  H HB3  . SER B 2 9  ? -0.939  -3.917  -10.433 1.00 0.00 ? 9  SER B HB3  2  
ATOM 1231  H HG   . SER B 2 9  ? -1.765  -5.475  -8.235  1.00 0.00 ? 9  SER B HG   2  
ATOM 1232  N N    . HIS B 2 10 ? 0.492   -4.459  -6.964  1.00 0.00 ? 10 HIS B N    2  
ATOM 1233  C CA   . HIS B 2 10 ? 0.727   -5.080  -5.631  1.00 0.00 ? 10 HIS B CA   2  
ATOM 1234  C C    . HIS B 2 10 ? 0.996   -3.989  -4.595  1.00 0.00 ? 10 HIS B C    2  
ATOM 1235  O O    . HIS B 2 10 ? 0.463   -4.009  -3.504  1.00 0.00 ? 10 HIS B O    2  
ATOM 1236  C CB   . HIS B 2 10 ? 1.942   -6.006  -5.711  1.00 0.00 ? 10 HIS B CB   2  
ATOM 1237  C CG   . HIS B 2 10 ? 1.520   -7.418  -5.410  1.00 0.00 ? 10 HIS B CG   2  
ATOM 1238  N ND1  . HIS B 2 10 ? 0.815   -8.188  -6.321  1.00 0.00 ? 10 HIS B ND1  2  
ATOM 1239  C CD2  . HIS B 2 10 ? 1.698   -8.212  -4.305  1.00 0.00 ? 10 HIS B CD2  2  
ATOM 1240  C CE1  . HIS B 2 10 ? 0.595   -9.388  -5.752  1.00 0.00 ? 10 HIS B CE1  2  
ATOM 1241  N NE2  . HIS B 2 10 ? 1.113   -9.455  -4.522  1.00 0.00 ? 10 HIS B NE2  2  
ATOM 1242  H H    . HIS B 2 10 ? 1.060   -4.706  -7.720  1.00 0.00 ? 10 HIS B H    2  
ATOM 1243  H HA   . HIS B 2 10 ? -0.142  -5.650  -5.340  1.00 0.00 ? 10 HIS B HA   2  
ATOM 1244  H HB2  . HIS B 2 10 ? 2.366   -5.959  -6.704  1.00 0.00 ? 10 HIS B HB2  2  
ATOM 1245  H HB3  . HIS B 2 10 ? 2.681   -5.690  -4.990  1.00 0.00 ? 10 HIS B HB3  2  
ATOM 1246  H HD1  . HIS B 2 10 ? 0.528   -7.910  -7.216  1.00 0.00 ? 10 HIS B HD1  2  
ATOM 1247  H HD2  . HIS B 2 10 ? 2.213   -7.916  -3.403  1.00 0.00 ? 10 HIS B HD2  2  
ATOM 1248  H HE1  . HIS B 2 10 ? 0.064   -10.197 -6.231  1.00 0.00 ? 10 HIS B HE1  2  
ATOM 1249  N N    . LEU B 2 11 ? 1.828   -3.039  -4.925  1.00 0.00 ? 11 LEU B N    2  
ATOM 1250  C CA   . LEU B 2 11 ? 2.139   -1.952  -3.956  1.00 0.00 ? 11 LEU B CA   2  
ATOM 1251  C C    . LEU B 2 11 ? 0.846   -1.256  -3.528  1.00 0.00 ? 11 LEU B C    2  
ATOM 1252  O O    . LEU B 2 11 ? 0.622   -1.011  -2.360  1.00 0.00 ? 11 LEU B O    2  
ATOM 1253  C CB   . LEU B 2 11 ? 3.070   -0.933  -4.613  1.00 0.00 ? 11 LEU B CB   2  
ATOM 1254  C CG   . LEU B 2 11 ? 3.907   -0.243  -3.535  1.00 0.00 ? 11 LEU B CG   2  
ATOM 1255  C CD1  . LEU B 2 11 ? 4.651   0.944   -4.147  1.00 0.00 ? 11 LEU B CD1  2  
ATOM 1256  C CD2  . LEU B 2 11 ? 2.987   0.253   -2.418  1.00 0.00 ? 11 LEU B CD2  2  
ATOM 1257  H H    . LEU B 2 11 ? 2.252   -3.045  -5.808  1.00 0.00 ? 11 LEU B H    2  
ATOM 1258  H HA   . LEU B 2 11 ? 2.623   -2.373  -3.088  1.00 0.00 ? 11 LEU B HA   2  
ATOM 1259  H HB2  . LEU B 2 11 ? 3.722   -1.439  -5.310  1.00 0.00 ? 11 LEU B HB2  2  
ATOM 1260  H HB3  . LEU B 2 11 ? 2.484   -0.194  -5.138  1.00 0.00 ? 11 LEU B HB3  2  
ATOM 1261  H HG   . LEU B 2 11 ? 4.622   -0.946  -3.130  1.00 0.00 ? 11 LEU B HG   2  
ATOM 1262  H HD11 . LEU B 2 11 ? 4.470   1.827   -3.554  1.00 0.00 ? 11 LEU B HD11 2  
ATOM 1263  H HD12 . LEU B 2 11 ? 4.300   1.108   -5.155  1.00 0.00 ? 11 LEU B HD12 2  
ATOM 1264  H HD13 . LEU B 2 11 ? 5.710   0.733   -4.164  1.00 0.00 ? 11 LEU B HD13 2  
ATOM 1265  H HD21 . LEU B 2 11 ? 3.476   1.049   -1.876  1.00 0.00 ? 11 LEU B HD21 2  
ATOM 1266  H HD22 . LEU B 2 11 ? 2.768   -0.561  -1.743  1.00 0.00 ? 11 LEU B HD22 2  
ATOM 1267  H HD23 . LEU B 2 11 ? 2.067   0.623   -2.847  1.00 0.00 ? 11 LEU B HD23 2  
ATOM 1268  N N    . VAL B 2 12 ? -0.006  -0.932  -4.461  1.00 0.00 ? 12 VAL B N    2  
ATOM 1269  C CA   . VAL B 2 12 ? -1.277  -0.250  -4.093  1.00 0.00 ? 12 VAL B CA   2  
ATOM 1270  C C    . VAL B 2 12 ? -2.169  -1.222  -3.327  1.00 0.00 ? 12 VAL B C    2  
ATOM 1271  O O    . VAL B 2 12 ? -2.676  -0.910  -2.268  1.00 0.00 ? 12 VAL B O    2  
ATOM 1272  C CB   . VAL B 2 12 ? -1.996  0.222   -5.358  1.00 0.00 ? 12 VAL B CB   2  
ATOM 1273  C CG1  . VAL B 2 12 ? -2.967  1.349   -5.003  1.00 0.00 ? 12 VAL B CG1  2  
ATOM 1274  C CG2  . VAL B 2 12 ? -0.967  0.736   -6.367  1.00 0.00 ? 12 VAL B CG2  2  
ATOM 1275  H H    . VAL B 2 12 ? 0.191   -1.134  -5.400  1.00 0.00 ? 12 VAL B H    2  
ATOM 1276  H HA   . VAL B 2 12 ? -1.056  0.596   -3.464  1.00 0.00 ? 12 VAL B HA   2  
ATOM 1277  H HB   . VAL B 2 12 ? -2.545  -0.603  -5.788  1.00 0.00 ? 12 VAL B HB   2  
ATOM 1278  H HG11 . VAL B 2 12 ? -3.147  1.348   -3.939  1.00 0.00 ? 12 VAL B HG11 2  
ATOM 1279  H HG12 . VAL B 2 12 ? -3.900  1.199   -5.526  1.00 0.00 ? 12 VAL B HG12 2  
ATOM 1280  H HG13 . VAL B 2 12 ? -2.540  2.297   -5.296  1.00 0.00 ? 12 VAL B HG13 2  
ATOM 1281  H HG21 . VAL B 2 12 ? -1.308  1.672   -6.785  1.00 0.00 ? 12 VAL B HG21 2  
ATOM 1282  H HG22 . VAL B 2 12 ? -0.847  0.011   -7.159  1.00 0.00 ? 12 VAL B HG22 2  
ATOM 1283  H HG23 . VAL B 2 12 ? -0.020  0.887   -5.871  1.00 0.00 ? 12 VAL B HG23 2  
ATOM 1284  N N    . GLU B 2 13 ? -2.354  -2.402  -3.842  1.00 0.00 ? 13 GLU B N    2  
ATOM 1285  C CA   . GLU B 2 13 ? -3.200  -3.390  -3.127  1.00 0.00 ? 13 GLU B CA   2  
ATOM 1286  C C    . GLU B 2 13 ? -2.658  -3.552  -1.708  1.00 0.00 ? 13 GLU B C    2  
ATOM 1287  O O    . GLU B 2 13 ? -3.387  -3.841  -0.779  1.00 0.00 ? 13 GLU B O    2  
ATOM 1288  C CB   . GLU B 2 13 ? -3.147  -4.735  -3.854  1.00 0.00 ? 13 GLU B CB   2  
ATOM 1289  C CG   . GLU B 2 13 ? -4.478  -4.984  -4.567  1.00 0.00 ? 13 GLU B CG   2  
ATOM 1290  C CD   . GLU B 2 13 ? -4.326  -6.152  -5.542  1.00 0.00 ? 13 GLU B CD   2  
ATOM 1291  O OE1  . GLU B 2 13 ? -4.392  -7.285  -5.094  1.00 0.00 ? 13 GLU B OE1  2  
ATOM 1292  O OE2  . GLU B 2 13 ? -4.144  -5.894  -6.721  1.00 0.00 ? 13 GLU B OE2  2  
ATOM 1293  H H    . GLU B 2 13 ? -1.928  -2.641  -4.692  1.00 0.00 ? 13 GLU B H    2  
ATOM 1294  H HA   . GLU B 2 13 ? -4.220  -3.036  -3.088  1.00 0.00 ? 13 GLU B HA   2  
ATOM 1295  H HB2  . GLU B 2 13 ? -2.347  -4.721  -4.580  1.00 0.00 ? 13 GLU B HB2  2  
ATOM 1296  H HB3  . GLU B 2 13 ? -2.971  -5.525  -3.140  1.00 0.00 ? 13 GLU B HB3  2  
ATOM 1297  H HG2  . GLU B 2 13 ? -5.239  -5.220  -3.836  1.00 0.00 ? 13 GLU B HG2  2  
ATOM 1298  H HG3  . GLU B 2 13 ? -4.766  -4.097  -5.112  1.00 0.00 ? 13 GLU B HG3  2  
ATOM 1299  N N    . ALA B 2 14 ? -1.377  -3.369  -1.537  1.00 0.00 ? 14 ALA B N    2  
ATOM 1300  C CA   . ALA B 2 14 ? -0.776  -3.510  -0.184  1.00 0.00 ? 14 ALA B CA   2  
ATOM 1301  C C    . ALA B 2 14 ? -1.249  -2.365  0.710   1.00 0.00 ? 14 ALA B C    2  
ATOM 1302  O O    . ALA B 2 14 ? -1.656  -2.568  1.836   1.00 0.00 ? 14 ALA B O    2  
ATOM 1303  C CB   . ALA B 2 14 ? 0.749   -3.474  -0.297  1.00 0.00 ? 14 ALA B CB   2  
ATOM 1304  H H    . ALA B 2 14 ? -0.810  -3.132  -2.300  1.00 0.00 ? 14 ALA B H    2  
ATOM 1305  H HA   . ALA B 2 14 ? -1.082  -4.448  0.242   1.00 0.00 ? 14 ALA B HA   2  
ATOM 1306  H HB1  . ALA B 2 14 ? 1.187   -3.831  0.624   1.00 0.00 ? 14 ALA B HB1  2  
ATOM 1307  H HB2  . ALA B 2 14 ? 1.073   -2.460  -0.479  1.00 0.00 ? 14 ALA B HB2  2  
ATOM 1308  H HB3  . ALA B 2 14 ? 1.065   -4.105  -1.114  1.00 0.00 ? 14 ALA B HB3  2  
ATOM 1309  N N    . LEU B 2 15 ? -1.198  -1.162  0.214   1.00 0.00 ? 15 LEU B N    2  
ATOM 1310  C CA   . LEU B 2 15 ? -1.641  0.003   1.030   1.00 0.00 ? 15 LEU B CA   2  
ATOM 1311  C C    . LEU B 2 15 ? -3.118  -0.152  1.374   1.00 0.00 ? 15 LEU B C    2  
ATOM 1312  O O    . LEU B 2 15 ? -3.550  0.176   2.461   1.00 0.00 ? 15 LEU B O    2  
ATOM 1313  C CB   . LEU B 2 15 ? -1.431  1.293   0.230   1.00 0.00 ? 15 LEU B CB   2  
ATOM 1314  C CG   . LEU B 2 15 ? -1.633  2.507   1.139   1.00 0.00 ? 15 LEU B CG   2  
ATOM 1315  C CD1  . LEU B 2 15 ? -3.117  2.651   1.482   1.00 0.00 ? 15 LEU B CD1  2  
ATOM 1316  C CD2  . LEU B 2 15 ? -0.828  2.320   2.426   1.00 0.00 ? 15 LEU B CD2  2  
ATOM 1317  H H    . LEU B 2 15 ? -0.866  -1.025  -0.697  1.00 0.00 ? 15 LEU B H    2  
ATOM 1318  H HA   . LEU B 2 15 ? -1.068  0.044   1.942   1.00 0.00 ? 15 LEU B HA   2  
ATOM 1319  H HB2  . LEU B 2 15 ? -0.428  1.306   -0.171  1.00 0.00 ? 15 LEU B HB2  2  
ATOM 1320  H HB3  . LEU B 2 15 ? -2.143  1.332   -0.582  1.00 0.00 ? 15 LEU B HB3  2  
ATOM 1321  H HG   . LEU B 2 15 ? -1.295  3.397   0.627   1.00 0.00 ? 15 LEU B HG   2  
ATOM 1322  H HD11 . LEU B 2 15 ? -3.291  2.292   2.485   1.00 0.00 ? 15 LEU B HD11 2  
ATOM 1323  H HD12 . LEU B 2 15 ? -3.705  2.072   0.785   1.00 0.00 ? 15 LEU B HD12 2  
ATOM 1324  H HD13 . LEU B 2 15 ? -3.402  3.691   1.417   1.00 0.00 ? 15 LEU B HD13 2  
ATOM 1325  H HD21 . LEU B 2 15 ? -0.377  3.260   2.707   1.00 0.00 ? 15 LEU B HD21 2  
ATOM 1326  H HD22 . LEU B 2 15 ? -0.056  1.584   2.264   1.00 0.00 ? 15 LEU B HD22 2  
ATOM 1327  H HD23 . LEU B 2 15 ? -1.485  1.986   3.216   1.00 0.00 ? 15 LEU B HD23 2  
ATOM 1328  N N    . TYR B 2 16 ? -3.899  -0.649  0.461   1.00 0.00 ? 16 TYR B N    2  
ATOM 1329  C CA   . TYR B 2 16 ? -5.345  -0.821  0.753   1.00 0.00 ? 16 TYR B CA   2  
ATOM 1330  C C    . TYR B 2 16 ? -5.519  -1.931  1.786   1.00 0.00 ? 16 TYR B C    2  
ATOM 1331  O O    . TYR B 2 16 ? -6.164  -1.758  2.800   1.00 0.00 ? 16 TYR B O    2  
ATOM 1332  C CB   . TYR B 2 16 ? -6.086  -1.196  -0.532  1.00 0.00 ? 16 TYR B CB   2  
ATOM 1333  C CG   . TYR B 2 16 ? -6.042  -0.034  -1.496  1.00 0.00 ? 16 TYR B CG   2  
ATOM 1334  C CD1  . TYR B 2 16 ? -6.250  1.269   -1.030  1.00 0.00 ? 16 TYR B CD1  2  
ATOM 1335  C CD2  . TYR B 2 16 ? -5.792  -0.261  -2.854  1.00 0.00 ? 16 TYR B CD2  2  
ATOM 1336  C CE1  . TYR B 2 16 ? -6.209  2.346   -1.924  1.00 0.00 ? 16 TYR B CE1  2  
ATOM 1337  C CE2  . TYR B 2 16 ? -5.751  0.815   -3.748  1.00 0.00 ? 16 TYR B CE2  2  
ATOM 1338  C CZ   . TYR B 2 16 ? -5.959  2.119   -3.283  1.00 0.00 ? 16 TYR B CZ   2  
ATOM 1339  O OH   . TYR B 2 16 ? -5.919  3.181   -4.163  1.00 0.00 ? 16 TYR B OH   2  
ATOM 1340  H H    . TYR B 2 16 ? -3.536  -0.910  -0.410  1.00 0.00 ? 16 TYR B H    2  
ATOM 1341  H HA   . TYR B 2 16 ? -5.743  0.097   1.143   1.00 0.00 ? 16 TYR B HA   2  
ATOM 1342  H HB2  . TYR B 2 16 ? -5.613  -2.056  -0.982  1.00 0.00 ? 16 TYR B HB2  2  
ATOM 1343  H HB3  . TYR B 2 16 ? -7.114  -1.430  -0.299  1.00 0.00 ? 16 TYR B HB3  2  
ATOM 1344  H HD1  . TYR B 2 16 ? -6.442  1.445   0.018   1.00 0.00 ? 16 TYR B HD1  2  
ATOM 1345  H HD2  . TYR B 2 16 ? -5.632  -1.267  -3.213  1.00 0.00 ? 16 TYR B HD2  2  
ATOM 1346  H HE1  . TYR B 2 16 ? -6.369  3.352   -1.565  1.00 0.00 ? 16 TYR B HE1  2  
ATOM 1347  H HE2  . TYR B 2 16 ? -5.559  0.640   -4.796  1.00 0.00 ? 16 TYR B HE2  2  
ATOM 1348  H HH   . TYR B 2 16 ? -5.268  2.980   -4.840  1.00 0.00 ? 16 TYR B HH   2  
ATOM 1349  N N    . LEU B 2 17 ? -4.945  -3.070  1.534   1.00 0.00 ? 17 LEU B N    2  
ATOM 1350  C CA   . LEU B 2 17 ? -5.070  -4.199  2.496   1.00 0.00 ? 17 LEU B CA   2  
ATOM 1351  C C    . LEU B 2 17 ? -4.276  -3.908  3.770   1.00 0.00 ? 17 LEU B C    2  
ATOM 1352  O O    . LEU B 2 17 ? -4.715  -4.199  4.865   1.00 0.00 ? 17 LEU B O    2  
ATOM 1353  C CB   . LEU B 2 17 ? -4.551  -5.485  1.850   1.00 0.00 ? 17 LEU B CB   2  
ATOM 1354  C CG   . LEU B 2 17 ? -5.690  -6.500  1.748   1.00 0.00 ? 17 LEU B CG   2  
ATOM 1355  C CD1  . LEU B 2 17 ? -6.180  -6.861  3.152   1.00 0.00 ? 17 LEU B CD1  2  
ATOM 1356  C CD2  . LEU B 2 17 ? -6.844  -5.892  0.948   1.00 0.00 ? 17 LEU B CD2  2  
ATOM 1357  H H    . LEU B 2 17 ? -4.429  -3.182  0.710   1.00 0.00 ? 17 LEU B H    2  
ATOM 1358  H HA   . LEU B 2 17 ? -6.107  -4.322  2.755   1.00 0.00 ? 17 LEU B HA   2  
ATOM 1359  H HB2  . LEU B 2 17 ? -4.175  -5.264  0.861   1.00 0.00 ? 17 LEU B HB2  2  
ATOM 1360  H HB3  . LEU B 2 17 ? -3.757  -5.897  2.454   1.00 0.00 ? 17 LEU B HB3  2  
ATOM 1361  H HG   . LEU B 2 17 ? -5.335  -7.391  1.251   1.00 0.00 ? 17 LEU B HG   2  
ATOM 1362  H HD11 . LEU B 2 17 ? -5.362  -7.277  3.723   1.00 0.00 ? 17 LEU B HD11 2  
ATOM 1363  H HD12 . LEU B 2 17 ? -6.975  -7.588  3.080   1.00 0.00 ? 17 LEU B HD12 2  
ATOM 1364  H HD13 . LEU B 2 17 ? -6.548  -5.973  3.644   1.00 0.00 ? 17 LEU B HD13 2  
ATOM 1365  H HD21 . LEU B 2 17 ? -6.951  -6.419  0.012   1.00 0.00 ? 17 LEU B HD21 2  
ATOM 1366  H HD22 . LEU B 2 17 ? -6.637  -4.850  0.753   1.00 0.00 ? 17 LEU B HD22 2  
ATOM 1367  H HD23 . LEU B 2 17 ? -7.759  -5.976  1.515   1.00 0.00 ? 17 LEU B HD23 2  
ATOM 1368  N N    . VAL B 2 18 ? -3.102  -3.357  3.641   1.00 0.00 ? 18 VAL B N    2  
ATOM 1369  C CA   . VAL B 2 18 ? -2.281  -3.076  4.852   1.00 0.00 ? 18 VAL B CA   2  
ATOM 1370  C C    . VAL B 2 18 ? -3.061  -2.172  5.809   1.00 0.00 ? 18 VAL B C    2  
ATOM 1371  O O    . VAL B 2 18 ? -3.165  -2.452  6.987   1.00 0.00 ? 18 VAL B O    2  
ATOM 1372  C CB   . VAL B 2 18 ? -0.963  -2.403  4.449   1.00 0.00 ? 18 VAL B CB   2  
ATOM 1373  C CG1  . VAL B 2 18 ? -1.202  -0.926  4.132   1.00 0.00 ? 18 VAL B CG1  2  
ATOM 1374  C CG2  . VAL B 2 18 ? 0.035   -2.518  5.602   1.00 0.00 ? 18 VAL B CG2  2  
ATOM 1375  H H    . VAL B 2 18 ? -2.757  -3.143  2.750   1.00 0.00 ? 18 VAL B H    2  
ATOM 1376  H HA   . VAL B 2 18 ? -2.063  -4.008  5.351   1.00 0.00 ? 18 VAL B HA   2  
ATOM 1377  H HB   . VAL B 2 18 ? -0.561  -2.897  3.577   1.00 0.00 ? 18 VAL B HB   2  
ATOM 1378  H HG11 . VAL B 2 18 ? -0.280  -0.478  3.793   1.00 0.00 ? 18 VAL B HG11 2  
ATOM 1379  H HG12 . VAL B 2 18 ? -1.544  -0.418  5.021   1.00 0.00 ? 18 VAL B HG12 2  
ATOM 1380  H HG13 . VAL B 2 18 ? -1.950  -0.841  3.358   1.00 0.00 ? 18 VAL B HG13 2  
ATOM 1381  H HG21 . VAL B 2 18 ? 0.635   -3.406  5.472   1.00 0.00 ? 18 VAL B HG21 2  
ATOM 1382  H HG22 . VAL B 2 18 ? -0.502  -2.580  6.537   1.00 0.00 ? 18 VAL B HG22 2  
ATOM 1383  H HG23 . VAL B 2 18 ? 0.675   -1.649  5.611   1.00 0.00 ? 18 VAL B HG23 2  
ATOM 1384  N N    . CYS B 2 19 ? -3.614  -1.092  5.326   1.00 0.00 ? 19 CYS B N    2  
ATOM 1385  C CA   . CYS B 2 19 ? -4.381  -0.196  6.241   1.00 0.00 ? 19 CYS B CA   2  
ATOM 1386  C C    . CYS B 2 19 ? -5.325  0.702   5.442   1.00 0.00 ? 19 CYS B C    2  
ATOM 1387  O O    . CYS B 2 19 ? -5.798  1.704   5.936   1.00 0.00 ? 19 CYS B O    2  
ATOM 1388  C CB   . CYS B 2 19 ? -3.405  0.681   7.028   1.00 0.00 ? 19 CYS B CB   2  
ATOM 1389  S SG   . CYS B 2 19 ? -3.978  0.844   8.738   1.00 0.00 ? 19 CYS B SG   2  
ATOM 1390  H H    . CYS B 2 19 ? -3.525  -0.871  4.372   1.00 0.00 ? 19 CYS B H    2  
ATOM 1391  H HA   . CYS B 2 19 ? -4.956  -0.796  6.930   1.00 0.00 ? 19 CYS B HA   2  
ATOM 1392  H HB2  . CYS B 2 19 ? -2.426  0.228   7.018   1.00 0.00 ? 19 CYS B HB2  2  
ATOM 1393  H HB3  . CYS B 2 19 ? -3.354  1.659   6.572   1.00 0.00 ? 19 CYS B HB3  2  
ATOM 1394  N N    . GLY B 2 20 ? -5.617  0.363   4.218   1.00 0.00 ? 20 GLY B N    2  
ATOM 1395  C CA   . GLY B 2 20 ? -6.535  1.231   3.429   1.00 0.00 ? 20 GLY B CA   2  
ATOM 1396  C C    . GLY B 2 20 ? -7.948  0.648   3.472   1.00 0.00 ? 20 GLY B C    2  
ATOM 1397  O O    . GLY B 2 20 ? -8.921  1.338   3.251   1.00 0.00 ? 20 GLY B O    2  
ATOM 1398  H H    . GLY B 2 20 ? -5.240  -0.455  3.822   1.00 0.00 ? 20 GLY B H    2  
ATOM 1399  H HA2  . GLY B 2 20 ? -6.540  2.225   3.856   1.00 0.00 ? 20 GLY B HA2  2  
ATOM 1400  H HA3  . GLY B 2 20 ? -6.197  1.284   2.408   1.00 0.00 ? 20 GLY B HA3  2  
ATOM 1401  N N    . GLU B 2 21 ? -8.072  -0.616  3.761   1.00 0.00 ? 21 GLU B N    2  
ATOM 1402  C CA   . GLU B 2 21 ? -9.427  -1.230  3.823   1.00 0.00 ? 21 GLU B CA   2  
ATOM 1403  C C    . GLU B 2 21 ? -10.339 -0.342  4.670   1.00 0.00 ? 21 GLU B C    2  
ATOM 1404  O O    . GLU B 2 21 ? -11.536 -0.291  4.468   1.00 0.00 ? 21 GLU B O    2  
ATOM 1405  C CB   . GLU B 2 21 ? -9.331  -2.619  4.457   1.00 0.00 ? 21 GLU B CB   2  
ATOM 1406  C CG   . GLU B 2 21 ? -10.683 -3.326  4.344   1.00 0.00 ? 21 GLU B CG   2  
ATOM 1407  C CD   . GLU B 2 21 ? -10.772 -4.045  2.996   1.00 0.00 ? 21 GLU B CD   2  
ATOM 1408  O OE1  . GLU B 2 21 ? -9.829  -3.942  2.229   1.00 0.00 ? 21 GLU B OE1  2  
ATOM 1409  O OE2  . GLU B 2 21 ? -11.781 -4.686  2.755   1.00 0.00 ? 21 GLU B OE2  2  
ATOM 1410  H H    . GLU B 2 21 ? -7.277  -1.160  3.942   1.00 0.00 ? 21 GLU B H    2  
ATOM 1411  H HA   . GLU B 2 21 ? -9.831  -1.315  2.825   1.00 0.00 ? 21 GLU B HA   2  
ATOM 1412  H HB2  . GLU B 2 21 ? -8.576  -3.197  3.943   1.00 0.00 ? 21 GLU B HB2  2  
ATOM 1413  H HB3  . GLU B 2 21 ? -9.064  -2.522  5.498   1.00 0.00 ? 21 GLU B HB3  2  
ATOM 1414  H HG2  . GLU B 2 21 ? -10.780 -4.046  5.144   1.00 0.00 ? 21 GLU B HG2  2  
ATOM 1415  H HG3  . GLU B 2 21 ? -11.477 -2.599  4.415   1.00 0.00 ? 21 GLU B HG3  2  
ATOM 1416  N N    . ARG B 2 22 ? -9.781  0.356   5.621   1.00 0.00 ? 22 ARG B N    2  
ATOM 1417  C CA   . ARG B 2 22 ? -10.607 1.237   6.483   1.00 0.00 ? 22 ARG B CA   2  
ATOM 1418  C C    . ARG B 2 22 ? -10.541 2.676   5.967   1.00 0.00 ? 22 ARG B C    2  
ATOM 1419  O O    . ARG B 2 22 ? -11.538 3.366   5.893   1.00 0.00 ? 22 ARG B O    2  
ATOM 1420  C CB   . ARG B 2 22 ? -10.082 1.185   7.919   1.00 0.00 ? 22 ARG B CB   2  
ATOM 1421  C CG   . ARG B 2 22 ? -11.230 1.454   8.893   1.00 0.00 ? 22 ARG B CG   2  
ATOM 1422  C CD   . ARG B 2 22 ? -10.742 2.369   10.018  1.00 0.00 ? 22 ARG B CD   2  
ATOM 1423  N NE   . ARG B 2 22 ? -10.215 1.541   11.138  1.00 0.00 ? 22 ARG B NE   2  
ATOM 1424  C CZ   . ARG B 2 22 ? -11.014 1.149   12.092  1.00 0.00 ? 22 ARG B CZ   2  
ATOM 1425  N NH1  . ARG B 2 22 ? -11.737 2.023   12.738  1.00 0.00 ? 22 ARG B NH1  2  
ATOM 1426  N NH2  . ARG B 2 22 ? -11.091 -0.117  12.400  1.00 0.00 ? 22 ARG B NH2  2  
ATOM 1427  H H    . ARG B 2 22 ? -8.820  0.299   5.769   1.00 0.00 ? 22 ARG B H    2  
ATOM 1428  H HA   . ARG B 2 22 ? -11.622 0.895   6.461   1.00 0.00 ? 22 ARG B HA   2  
ATOM 1429  H HB2  . ARG B 2 22 ? -9.665  0.207   8.114   1.00 0.00 ? 22 ARG B HB2  2  
ATOM 1430  H HB3  . ARG B 2 22 ? -9.317  1.935   8.051   1.00 0.00 ? 22 ARG B HB3  2  
ATOM 1431  H HG2  . ARG B 2 22 ? -12.044 1.932   8.367   1.00 0.00 ? 22 ARG B HG2  2  
ATOM 1432  H HG3  . ARG B 2 22 ? -11.572 0.521   9.315   1.00 0.00 ? 22 ARG B HG3  2  
ATOM 1433  H HD2  . ARG B 2 22 ? -9.958  3.011   9.645   1.00 0.00 ? 22 ARG B HD2  2  
ATOM 1434  H HD3  . ARG B 2 22 ? -11.564 2.974   10.372  1.00 0.00 ? 22 ARG B HD3  2  
ATOM 1435  H HE   . ARG B 2 22 ? -9.267  1.291   11.159  1.00 0.00 ? 22 ARG B HE   2  
ATOM 1436  H HH11 . ARG B 2 22 ? -11.678 2.993   12.502  1.00 0.00 ? 22 ARG B HH11 2  
ATOM 1437  H HH12 . ARG B 2 22 ? -12.350 1.723   13.469  1.00 0.00 ? 22 ARG B HH12 2  
ATOM 1438  H HH21 . ARG B 2 22 ? -10.538 -0.787  11.905  1.00 0.00 ? 22 ARG B HH21 2  
ATOM 1439  H HH22 . ARG B 2 22 ? -11.704 -0.417  13.131  1.00 0.00 ? 22 ARG B HH22 2  
ATOM 1440  N N    . GLY B 2 23 ? -9.373  3.134   5.613   1.00 0.00 ? 23 GLY B N    2  
ATOM 1441  C CA   . GLY B 2 23 ? -9.241  4.531   5.106   1.00 0.00 ? 23 GLY B CA   2  
ATOM 1442  C C    . GLY B 2 23 ? -9.181  4.523   3.577   1.00 0.00 ? 23 GLY B C    2  
ATOM 1443  O O    . GLY B 2 23 ? -8.570  5.378   2.966   1.00 0.00 ? 23 GLY B O    2  
ATOM 1444  H H    . GLY B 2 23 ? -8.582  2.561   5.684   1.00 0.00 ? 23 GLY B H    2  
ATOM 1445  H HA2  . GLY B 2 23 ? -10.093 5.112   5.430   1.00 0.00 ? 23 GLY B HA2  2  
ATOM 1446  H HA3  . GLY B 2 23 ? -8.336  4.971   5.495   1.00 0.00 ? 23 GLY B HA3  2  
ATOM 1447  N N    . PHE B 2 24 ? -9.807  3.564   2.954   1.00 0.00 ? 24 PHE B N    2  
ATOM 1448  C CA   . PHE B 2 24 ? -9.783  3.501   1.464   1.00 0.00 ? 24 PHE B CA   2  
ATOM 1449  C C    . PHE B 2 24 ? -10.903 2.581   0.971   1.00 0.00 ? 24 PHE B C    2  
ATOM 1450  O O    . PHE B 2 24 ? -10.847 2.049   -0.120  1.00 0.00 ? 24 PHE B O    2  
ATOM 1451  C CB   . PHE B 2 24 ? -8.435  2.946   1.003   1.00 0.00 ? 24 PHE B CB   2  
ATOM 1452  C CG   . PHE B 2 24 ? -7.603  4.059   0.413   1.00 0.00 ? 24 PHE B CG   2  
ATOM 1453  C CD1  . PHE B 2 24 ? -8.186  4.982   -0.463  1.00 0.00 ? 24 PHE B CD1  2  
ATOM 1454  C CD2  . PHE B 2 24 ? -6.247  4.168   0.744   1.00 0.00 ? 24 PHE B CD2  2  
ATOM 1455  C CE1  . PHE B 2 24 ? -7.414  6.014   -1.009  1.00 0.00 ? 24 PHE B CE1  2  
ATOM 1456  C CE2  . PHE B 2 24 ? -5.474  5.200   0.198   1.00 0.00 ? 24 PHE B CE2  2  
ATOM 1457  C CZ   . PHE B 2 24 ? -6.058  6.123   -0.678  1.00 0.00 ? 24 PHE B CZ   2  
ATOM 1458  H H    . PHE B 2 24 ? -10.291 2.883   3.465   1.00 0.00 ? 24 PHE B H    2  
ATOM 1459  H HA   . PHE B 2 24 ? -9.924  4.491   1.058   1.00 0.00 ? 24 PHE B HA   2  
ATOM 1460  H HB2  . PHE B 2 24 ? -7.916  2.517   1.847   1.00 0.00 ? 24 PHE B HB2  2  
ATOM 1461  H HB3  . PHE B 2 24 ? -8.598  2.185   0.255   1.00 0.00 ? 24 PHE B HB3  2  
ATOM 1462  H HD1  . PHE B 2 24 ? -9.232  4.897   -0.717  1.00 0.00 ? 24 PHE B HD1  2  
ATOM 1463  H HD2  . PHE B 2 24 ? -5.796  3.455   1.420   1.00 0.00 ? 24 PHE B HD2  2  
ATOM 1464  H HE1  . PHE B 2 24 ? -7.864  6.725   -1.684  1.00 0.00 ? 24 PHE B HE1  2  
ATOM 1465  H HE2  . PHE B 2 24 ? -4.428  5.284   0.453   1.00 0.00 ? 24 PHE B HE2  2  
ATOM 1466  H HZ   . PHE B 2 24 ? -5.462  6.919   -1.099  1.00 0.00 ? 24 PHE B HZ   2  
ATOM 1467  N N    . PHE B 2 25 ? -11.918 2.388   1.766   1.00 0.00 ? 25 PHE B N    2  
ATOM 1468  C CA   . PHE B 2 25 ? -13.038 1.500   1.344   1.00 0.00 ? 25 PHE B CA   2  
ATOM 1469  C C    . PHE B 2 25 ? -14.034 2.298   0.501   1.00 0.00 ? 25 PHE B C    2  
ATOM 1470  O O    . PHE B 2 25 ? -14.404 3.405   0.840   1.00 0.00 ? 25 PHE B O    2  
ATOM 1471  C CB   . PHE B 2 25 ? -13.748 0.951   2.584   1.00 0.00 ? 25 PHE B CB   2  
ATOM 1472  C CG   . PHE B 2 25 ? -14.563 -0.262  2.202   1.00 0.00 ? 25 PHE B CG   2  
ATOM 1473  C CD1  . PHE B 2 25 ? -15.717 -0.114  1.423   1.00 0.00 ? 25 PHE B CD1  2  
ATOM 1474  C CD2  . PHE B 2 25 ? -14.164 -1.535  2.628   1.00 0.00 ? 25 PHE B CD2  2  
ATOM 1475  C CE1  . PHE B 2 25 ? -16.472 -1.239  1.071   1.00 0.00 ? 25 PHE B CE1  2  
ATOM 1476  C CE2  . PHE B 2 25 ? -14.920 -2.660  2.275   1.00 0.00 ? 25 PHE B CE2  2  
ATOM 1477  C CZ   . PHE B 2 25 ? -16.074 -2.512  1.496   1.00 0.00 ? 25 PHE B CZ   2  
ATOM 1478  H H    . PHE B 2 25 ? -11.942 2.824   2.642   1.00 0.00 ? 25 PHE B H    2  
ATOM 1479  H HA   . PHE B 2 25 ? -12.648 0.680   0.760   1.00 0.00 ? 25 PHE B HA   2  
ATOM 1480  H HB2  . PHE B 2 25 ? -13.013 0.673   3.325   1.00 0.00 ? 25 PHE B HB2  2  
ATOM 1481  H HB3  . PHE B 2 25 ? -14.401 1.708   2.990   1.00 0.00 ? 25 PHE B HB3  2  
ATOM 1482  H HD1  . PHE B 2 25 ? -16.024 0.868   1.095   1.00 0.00 ? 25 PHE B HD1  2  
ATOM 1483  H HD2  . PHE B 2 25 ? -13.274 -1.650  3.229   1.00 0.00 ? 25 PHE B HD2  2  
ATOM 1484  H HE1  . PHE B 2 25 ? -17.362 -1.125  0.470   1.00 0.00 ? 25 PHE B HE1  2  
ATOM 1485  H HE2  . PHE B 2 25 ? -14.613 -3.642  2.604   1.00 0.00 ? 25 PHE B HE2  2  
ATOM 1486  H HZ   . PHE B 2 25 ? -16.657 -3.379  1.224   1.00 0.00 ? 25 PHE B HZ   2  
ATOM 1487  N N    . TYR B 2 26 ? -14.473 1.745   -0.596  1.00 0.00 ? 26 TYR B N    2  
ATOM 1488  C CA   . TYR B 2 26 ? -15.447 2.470   -1.460  1.00 0.00 ? 26 TYR B CA   2  
ATOM 1489  C C    . TYR B 2 26 ? -16.562 1.511   -1.889  1.00 0.00 ? 26 TYR B C    2  
ATOM 1490  O O    . TYR B 2 26 ? -16.335 0.327   -2.039  1.00 0.00 ? 26 TYR B O    2  
ATOM 1491  C CB   . TYR B 2 26 ? -14.734 3.013   -2.702  1.00 0.00 ? 26 TYR B CB   2  
ATOM 1492  C CG   . TYR B 2 26 ? -13.582 2.107   -3.070  1.00 0.00 ? 26 TYR B CG   2  
ATOM 1493  C CD1  . TYR B 2 26 ? -13.828 0.787   -3.467  1.00 0.00 ? 26 TYR B CD1  2  
ATOM 1494  C CD2  . TYR B 2 26 ? -12.269 2.588   -3.014  1.00 0.00 ? 26 TYR B CD2  2  
ATOM 1495  C CE1  . TYR B 2 26 ? -12.760 -0.051  -3.808  1.00 0.00 ? 26 TYR B CE1  2  
ATOM 1496  C CE2  . TYR B 2 26 ? -11.201 1.750   -3.354  1.00 0.00 ? 26 TYR B CE2  2  
ATOM 1497  C CZ   . TYR B 2 26 ? -11.446 0.430   -3.751  1.00 0.00 ? 26 TYR B CZ   2  
ATOM 1498  O OH   . TYR B 2 26 ? -10.393 -0.396  -4.087  1.00 0.00 ? 26 TYR B OH   2  
ATOM 1499  H H    . TYR B 2 26 ? -14.163 0.850   -0.851  1.00 0.00 ? 26 TYR B H    2  
ATOM 1500  H HA   . TYR B 2 26 ? -15.875 3.292   -0.904  1.00 0.00 ? 26 TYR B HA   2  
ATOM 1501  H HB2  . TYR B 2 26 ? -15.432 3.058   -3.526  1.00 0.00 ? 26 TYR B HB2  2  
ATOM 1502  H HB3  . TYR B 2 26 ? -14.358 4.005   -2.496  1.00 0.00 ? 26 TYR B HB3  2  
ATOM 1503  H HD1  . TYR B 2 26 ? -14.841 0.416   -3.511  1.00 0.00 ? 26 TYR B HD1  2  
ATOM 1504  H HD2  . TYR B 2 26 ? -12.079 3.606   -2.707  1.00 0.00 ? 26 TYR B HD2  2  
ATOM 1505  H HE1  . TYR B 2 26 ? -12.949 -1.070  -4.114  1.00 0.00 ? 26 TYR B HE1  2  
ATOM 1506  H HE2  . TYR B 2 26 ? -10.188 2.121   -3.311  1.00 0.00 ? 26 TYR B HE2  2  
ATOM 1507  H HH   . TYR B 2 26 ? -9.629  0.156   -4.269  1.00 0.00 ? 26 TYR B HH   2  
ATOM 1508  N N    . PRO B 2 27 ? -17.737 2.057   -2.072  1.00 0.00 ? 27 PRO B N    2  
ATOM 1509  C CA   . PRO B 2 27 ? -18.918 1.280   -2.486  1.00 0.00 ? 27 PRO B CA   2  
ATOM 1510  C C    . PRO B 2 27 ? -18.864 0.989   -3.989  1.00 0.00 ? 27 PRO B C    2  
ATOM 1511  O O    . PRO B 2 27 ? -18.131 1.617   -4.726  1.00 0.00 ? 27 PRO B O    2  
ATOM 1512  C CB   . PRO B 2 27 ? -20.091 2.205   -2.151  1.00 0.00 ? 27 PRO B CB   2  
ATOM 1513  C CG   . PRO B 2 27 ? -19.515 3.640   -2.105  1.00 0.00 ? 27 PRO B CG   2  
ATOM 1514  C CD   . PRO B 2 27 ? -17.997 3.499   -1.884  1.00 0.00 ? 27 PRO B CD   2  
ATOM 1515  H HA   . PRO B 2 27 ? -18.993 0.366   -1.920  1.00 0.00 ? 27 PRO B HA   2  
ATOM 1516  H HB2  . PRO B 2 27 ? -20.851 2.130   -2.917  1.00 0.00 ? 27 PRO B HB2  2  
ATOM 1517  H HB3  . PRO B 2 27 ? -20.504 1.948   -1.188  1.00 0.00 ? 27 PRO B HB3  2  
ATOM 1518  H HG2  . PRO B 2 27 ? -19.710 4.147   -3.040  1.00 0.00 ? 27 PRO B HG2  2  
ATOM 1519  H HG3  . PRO B 2 27 ? -19.952 4.190   -1.286  1.00 0.00 ? 27 PRO B HG3  2  
ATOM 1520  H HD2  . PRO B 2 27 ? -17.453 4.083   -2.614  1.00 0.00 ? 27 PRO B HD2  2  
ATOM 1521  H HD3  . PRO B 2 27 ? -17.730 3.798   -0.882  1.00 0.00 ? 27 PRO B HD3  2  
ATOM 1522  N N    . THR B 2 28 ? -19.636 0.042   -4.447  1.00 0.00 ? 28 THR B N    2  
ATOM 1523  C CA   . THR B 2 28 ? -19.628 -0.285  -5.901  1.00 0.00 ? 28 THR B CA   2  
ATOM 1524  C C    . THR B 2 28 ? -18.303 -0.958  -6.265  1.00 0.00 ? 28 THR B C    2  
ATOM 1525  O O    . THR B 2 28 ? -17.456 -0.374  -6.910  1.00 0.00 ? 28 THR B O    2  
ATOM 1526  C CB   . THR B 2 28 ? -19.786 1.002   -6.714  1.00 0.00 ? 28 THR B CB   2  
ATOM 1527  O OG1  . THR B 2 28 ? -20.355 2.012   -5.892  1.00 0.00 ? 28 THR B OG1  2  
ATOM 1528  C CG2  . THR B 2 28 ? -20.699 0.743   -7.913  1.00 0.00 ? 28 THR B CG2  2  
ATOM 1529  H H    . THR B 2 28 ? -20.221 -0.453  -3.836  1.00 0.00 ? 28 THR B H    2  
ATOM 1530  H HA   . THR B 2 28 ? -20.446 -0.955  -6.124  1.00 0.00 ? 28 THR B HA   2  
ATOM 1531  H HB   . THR B 2 28 ? -18.819 1.327   -7.066  1.00 0.00 ? 28 THR B HB   2  
ATOM 1532  H HG1  . THR B 2 28 ? -20.293 2.847   -6.361  1.00 0.00 ? 28 THR B HG1  2  
ATOM 1533  H HG21 . THR B 2 28 ? -20.098 0.505   -8.778  1.00 0.00 ? 28 THR B HG21 2  
ATOM 1534  H HG22 . THR B 2 28 ? -21.287 1.626   -8.115  1.00 0.00 ? 28 THR B HG22 2  
ATOM 1535  H HG23 . THR B 2 28 ? -21.356 -0.085  -7.692  1.00 0.00 ? 28 THR B HG23 2  
ATOM 1536  N N    . LYS B 2 29 ? -18.117 -2.184  -5.856  1.00 0.00 ? 29 LYS B N    2  
ATOM 1537  C CA   . LYS B 2 29 ? -16.847 -2.891  -6.180  1.00 0.00 ? 29 LYS B CA   2  
ATOM 1538  C C    . LYS B 2 29 ? -17.105 -3.928  -7.275  1.00 0.00 ? 29 LYS B C    2  
ATOM 1539  O O    . LYS B 2 29 ? -17.841 -4.876  -7.085  1.00 0.00 ? 29 LYS B O    2  
ATOM 1540  C CB   . LYS B 2 29 ? -16.320 -3.593  -4.927  1.00 0.00 ? 29 LYS B CB   2  
ATOM 1541  C CG   . LYS B 2 29 ? -14.790 -3.569  -4.933  1.00 0.00 ? 29 LYS B CG   2  
ATOM 1542  C CD   . LYS B 2 29 ? -14.255 -4.955  -4.567  1.00 0.00 ? 29 LYS B CD   2  
ATOM 1543  C CE   . LYS B 2 29 ? -12.924 -4.809  -3.829  1.00 0.00 ? 29 LYS B CE   2  
ATOM 1544  N NZ   . LYS B 2 29 ? -13.181 -4.448  -2.406  1.00 0.00 ? 29 LYS B NZ   2  
ATOM 1545  H H    . LYS B 2 29 ? -18.813 -2.638  -5.337  1.00 0.00 ? 29 LYS B H    2  
ATOM 1546  H HA   . LYS B 2 29 ? -16.115 -2.177  -6.526  1.00 0.00 ? 29 LYS B HA   2  
ATOM 1547  H HB2  . LYS B 2 29 ? -16.685 -3.082  -4.048  1.00 0.00 ? 29 LYS B HB2  2  
ATOM 1548  H HB3  . LYS B 2 29 ? -16.662 -4.617  -4.916  1.00 0.00 ? 29 LYS B HB3  2  
ATOM 1549  H HG2  . LYS B 2 29 ? -14.439 -3.295  -5.918  1.00 0.00 ? 29 LYS B HG2  2  
ATOM 1550  H HG3  . LYS B 2 29 ? -14.438 -2.848  -4.211  1.00 0.00 ? 29 LYS B HG3  2  
ATOM 1551  H HD2  . LYS B 2 29 ? -14.968 -5.459  -3.930  1.00 0.00 ? 29 LYS B HD2  2  
ATOM 1552  H HD3  . LYS B 2 29 ? -14.105 -5.533  -5.466  1.00 0.00 ? 29 LYS B HD3  2  
ATOM 1553  H HE2  . LYS B 2 29 ? -12.384 -5.744  -3.871  1.00 0.00 ? 29 LYS B HE2  2  
ATOM 1554  H HE3  . LYS B 2 29 ? -12.336 -4.033  -4.297  1.00 0.00 ? 29 LYS B HE3  2  
ATOM 1555  H HZ1  . LYS B 2 29 ? -13.382 -3.431  -2.337  1.00 0.00 ? 29 LYS B HZ1  2  
ATOM 1556  H HZ2  . LYS B 2 29 ? -12.342 -4.677  -1.834  1.00 0.00 ? 29 LYS B HZ2  2  
ATOM 1557  H HZ3  . LYS B 2 29 ? -13.998 -4.986  -2.054  1.00 0.00 ? 29 LYS B HZ3  2  
ATOM 1558  N N    . THR B 2 30 ? -16.504 -3.756  -8.421  1.00 0.00 ? 30 THR B N    2  
ATOM 1559  C CA   . THR B 2 30 ? -16.715 -4.732  -9.527  1.00 0.00 ? 30 THR B CA   2  
ATOM 1560  C C    . THR B 2 30 ? -15.404 -4.929  -10.290 1.00 0.00 ? 30 THR B C    2  
ATOM 1561  O O    . THR B 2 30 ? -14.561 -5.662  -9.800  1.00 0.00 ? 30 THR B O    2  
ATOM 1562  C CB   . THR B 2 30 ? -17.785 -4.197  -10.482 1.00 0.00 ? 30 THR B CB   2  
ATOM 1563  O OG1  . THR B 2 30 ? -17.852 -5.030  -11.630 1.00 0.00 ? 30 THR B OG1  2  
ATOM 1564  C CG2  . THR B 2 30 ? -17.429 -2.770  -10.903 1.00 0.00 ? 30 THR B CG2  2  
ATOM 1565  O OXT  . THR B 2 30 ? -15.265 -4.344  -11.352 1.00 0.00 ? 30 THR B OXT  2  
ATOM 1566  H H    . THR B 2 30 ? -15.914 -2.985  -8.554  1.00 0.00 ? 30 THR B H    2  
ATOM 1567  H HA   . THR B 2 30 ? -17.039 -5.677  -9.117  1.00 0.00 ? 30 THR B HA   2  
ATOM 1568  H HB   . THR B 2 30 ? -18.743 -4.192  -9.984  1.00 0.00 ? 30 THR B HB   2  
ATOM 1569  H HG1  . THR B 2 30 ? -18.105 -5.910  -11.344 1.00 0.00 ? 30 THR B HG1  2  
ATOM 1570  H HG21 . THR B 2 30 ? -18.324 -2.165  -10.918 1.00 0.00 ? 30 THR B HG21 2  
ATOM 1571  H HG22 . THR B 2 30 ? -16.989 -2.786  -11.889 1.00 0.00 ? 30 THR B HG22 2  
ATOM 1572  H HG23 . THR B 2 30 ? -16.723 -2.353  -10.200 1.00 0.00 ? 30 THR B HG23 2  
ATOM 1573  N N    . GLY A 1 1  ? -2.116  3.011   10.211  1.00 0.00 ? 1  GLY A N    3  
ATOM 1574  C CA   . GLY A 1 1  ? -1.887  4.029   9.146   1.00 0.00 ? 1  GLY A CA   3  
ATOM 1575  C C    . GLY A 1 1  ? -3.068  4.026   8.175   1.00 0.00 ? 1  GLY A C    3  
ATOM 1576  O O    . GLY A 1 1  ? -4.189  3.741   8.546   1.00 0.00 ? 1  GLY A O    3  
ATOM 1577  H H1   . GLY A 1 1  ? -1.843  3.407   11.133  1.00 0.00 ? 1  GLY A H1   3  
ATOM 1578  H H2   . GLY A 1 1  ? -1.542  2.166   10.012  1.00 0.00 ? 1  GLY A H2   3  
ATOM 1579  H H3   . GLY A 1 1  ? -3.122  2.751   10.232  1.00 0.00 ? 1  GLY A H3   3  
ATOM 1580  H HA2  . GLY A 1 1  ? -1.792  5.006   9.598   1.00 0.00 ? 1  GLY A HA2  3  
ATOM 1581  H HA3  . GLY A 1 1  ? -0.982  3.790   8.608   1.00 0.00 ? 1  GLY A HA3  3  
ATOM 1582  N N    . ILE A 1 2  ? -2.826  4.341   6.932   1.00 0.00 ? 2  ILE A N    3  
ATOM 1583  C CA   . ILE A 1 2  ? -3.937  4.356   5.938   1.00 0.00 ? 2  ILE A CA   3  
ATOM 1584  C C    . ILE A 1 2  ? -4.447  2.932   5.721   1.00 0.00 ? 2  ILE A C    3  
ATOM 1585  O O    . ILE A 1 2  ? -5.613  2.712   5.459   1.00 0.00 ? 2  ILE A O    3  
ATOM 1586  C CB   . ILE A 1 2  ? -3.432  4.926   4.611   1.00 0.00 ? 2  ILE A CB   3  
ATOM 1587  C CG1  . ILE A 1 2  ? -2.024  4.394   4.326   1.00 0.00 ? 2  ILE A CG1  3  
ATOM 1588  C CG2  . ILE A 1 2  ? -3.391  6.453   4.694   1.00 0.00 ? 2  ILE A CG2  3  
ATOM 1589  C CD1  . ILE A 1 2  ? -1.821  4.276   2.815   1.00 0.00 ? 2  ILE A CD1  3  
ATOM 1590  H H    . ILE A 1 2  ? -1.915  4.569   6.652   1.00 0.00 ? 2  ILE A H    3  
ATOM 1591  H HA   . ILE A 1 2  ? -4.744  4.969   6.310   1.00 0.00 ? 2  ILE A HA   3  
ATOM 1592  H HB   . ILE A 1 2  ? -4.099  4.628   3.815   1.00 0.00 ? 2  ILE A HB   3  
ATOM 1593  H HG12 . ILE A 1 2  ? -1.292  5.075   4.736   1.00 0.00 ? 2  ILE A HG12 3  
ATOM 1594  H HG13 . ILE A 1 2  ? -1.907  3.422   4.780   1.00 0.00 ? 2  ILE A HG13 3  
ATOM 1595  H HG21 . ILE A 1 2  ? -4.261  6.864   4.203   1.00 0.00 ? 2  ILE A HG21 3  
ATOM 1596  H HG22 . ILE A 1 2  ? -2.498  6.816   4.206   1.00 0.00 ? 2  ILE A HG22 3  
ATOM 1597  H HG23 . ILE A 1 2  ? -3.384  6.758   5.730   1.00 0.00 ? 2  ILE A HG23 3  
ATOM 1598  H HD11 . ILE A 1 2  ? -2.736  3.936   2.354   1.00 0.00 ? 2  ILE A HD11 3  
ATOM 1599  H HD12 . ILE A 1 2  ? -1.031  3.567   2.612   1.00 0.00 ? 2  ILE A HD12 3  
ATOM 1600  H HD13 . ILE A 1 2  ? -1.550  5.240   2.411   1.00 0.00 ? 2  ILE A HD13 3  
ATOM 1601  N N    . VAL A 1 3  ? -3.585  1.960   5.832   1.00 0.00 ? 3  VAL A N    3  
ATOM 1602  C CA   . VAL A 1 3  ? -4.018  0.557   5.637   1.00 0.00 ? 3  VAL A CA   3  
ATOM 1603  C C    . VAL A 1 3  ? -4.896  0.138   6.820   1.00 0.00 ? 3  VAL A C    3  
ATOM 1604  O O    . VAL A 1 3  ? -5.918  -0.498  6.656   1.00 0.00 ? 3  VAL A O    3  
ATOM 1605  C CB   . VAL A 1 3  ? -2.766  -0.329  5.538   1.00 0.00 ? 3  VAL A CB   3  
ATOM 1606  C CG1  . VAL A 1 3  ? -3.055  -1.731  6.073   1.00 0.00 ? 3  VAL A CG1  3  
ATOM 1607  C CG2  . VAL A 1 3  ? -2.333  -0.429  4.074   1.00 0.00 ? 3  VAL A CG2  3  
ATOM 1608  H H    . VAL A 1 3  ? -2.651  2.152   6.047   1.00 0.00 ? 3  VAL A H    3  
ATOM 1609  H HA   . VAL A 1 3  ? -4.588  0.482   4.726   1.00 0.00 ? 3  VAL A HA   3  
ATOM 1610  H HB   . VAL A 1 3  ? -1.970  0.115   6.117   1.00 0.00 ? 3  VAL A HB   3  
ATOM 1611  H HG11 . VAL A 1 3  ? -2.529  -2.458  5.474   1.00 0.00 ? 3  VAL A HG11 3  
ATOM 1612  H HG12 . VAL A 1 3  ? -4.116  -1.921  6.026   1.00 0.00 ? 3  VAL A HG12 3  
ATOM 1613  H HG13 . VAL A 1 3  ? -2.721  -1.797  7.098   1.00 0.00 ? 3  VAL A HG13 3  
ATOM 1614  H HG21 . VAL A 1 3  ? -3.203  -0.376  3.437   1.00 0.00 ? 3  VAL A HG21 3  
ATOM 1615  H HG22 . VAL A 1 3  ? -1.825  -1.367  3.912   1.00 0.00 ? 3  VAL A HG22 3  
ATOM 1616  H HG23 . VAL A 1 3  ? -1.666  0.388   3.840   1.00 0.00 ? 3  VAL A HG23 3  
ATOM 1617  N N    . GLU A 1 4  ? -4.504  0.494   8.010   1.00 0.00 ? 4  GLU A N    3  
ATOM 1618  C CA   . GLU A 1 4  ? -5.312  0.122   9.204   1.00 0.00 ? 4  GLU A CA   3  
ATOM 1619  C C    . GLU A 1 4  ? -6.645  0.868   9.165   1.00 0.00 ? 4  GLU A C    3  
ATOM 1620  O O    . GLU A 1 4  ? -7.675  0.344   9.540   1.00 0.00 ? 4  GLU A O    3  
ATOM 1621  C CB   . GLU A 1 4  ? -4.550  0.502   10.476  1.00 0.00 ? 4  GLU A CB   3  
ATOM 1622  C CG   . GLU A 1 4  ? -5.081  -0.318  11.653  1.00 0.00 ? 4  GLU A CG   3  
ATOM 1623  C CD   . GLU A 1 4  ? -3.941  -1.141  12.257  1.00 0.00 ? 4  GLU A CD   3  
ATOM 1624  O OE1  . GLU A 1 4  ? -3.655  -2.200  11.725  1.00 0.00 ? 4  GLU A OE1  3  
ATOM 1625  O OE2  . GLU A 1 4  ? -3.374  -0.697  13.242  1.00 0.00 ? 4  GLU A OE2  3  
ATOM 1626  H H    . GLU A 1 4  ? -3.678  1.008   8.117   1.00 0.00 ? 4  GLU A H    3  
ATOM 1627  H HA   . GLU A 1 4  ? -5.495  -0.941  9.198   1.00 0.00 ? 4  GLU A HA   3  
ATOM 1628  H HB2  . GLU A 1 4  ? -3.498  0.299   10.339  1.00 0.00 ? 4  GLU A HB2  3  
ATOM 1629  H HB3  . GLU A 1 4  ? -4.691  1.553   10.679  1.00 0.00 ? 4  GLU A HB3  3  
ATOM 1630  H HG2  . GLU A 1 4  ? -5.483  0.347   12.403  1.00 0.00 ? 4  GLU A HG2  3  
ATOM 1631  H HG3  . GLU A 1 4  ? -5.858  -0.983  11.307  1.00 0.00 ? 4  GLU A HG3  3  
ATOM 1632  N N    . GLN A 1 5  ? -6.632  2.091   8.714   1.00 0.00 ? 5  GLN A N    3  
ATOM 1633  C CA   . GLN A 1 5  ? -7.896  2.877   8.649   1.00 0.00 ? 5  GLN A CA   3  
ATOM 1634  C C    . GLN A 1 5  ? -8.721  2.423   7.444   1.00 0.00 ? 5  GLN A C    3  
ATOM 1635  O O    . GLN A 1 5  ? -9.923  2.266   7.526   1.00 0.00 ? 5  GLN A O    3  
ATOM 1636  C CB   . GLN A 1 5  ? -7.564  4.364   8.509   1.00 0.00 ? 5  GLN A CB   3  
ATOM 1637  C CG   . GLN A 1 5  ? -8.635  5.197   9.218   1.00 0.00 ? 5  GLN A CG   3  
ATOM 1638  C CD   . GLN A 1 5  ? -7.969  6.345   9.978   1.00 0.00 ? 5  GLN A CD   3  
ATOM 1639  O OE1  . GLN A 1 5  ? -6.885  6.772   9.630   1.00 0.00 ? 5  GLN A OE1  3  
ATOM 1640  N NE2  . GLN A 1 5  ? -8.575  6.868   11.008  1.00 0.00 ? 5  GLN A NE2  3  
ATOM 1641  H H    . GLN A 1 5  ? -5.790  2.492   8.418   1.00 0.00 ? 5  GLN A H    3  
ATOM 1642  H HA   . GLN A 1 5  ? -8.463  2.719   9.551   1.00 0.00 ? 5  GLN A HA   3  
ATOM 1643  H HB2  . GLN A 1 5  ? -6.600  4.561   8.955   1.00 0.00 ? 5  GLN A HB2  3  
ATOM 1644  H HB3  . GLN A 1 5  ? -7.538  4.631   7.463   1.00 0.00 ? 5  GLN A HB3  3  
ATOM 1645  H HG2  . GLN A 1 5  ? -9.321  5.598   8.486   1.00 0.00 ? 5  GLN A HG2  3  
ATOM 1646  H HG3  . GLN A 1 5  ? -9.174  4.572   9.914   1.00 0.00 ? 5  GLN A HG3  3  
ATOM 1647  H HE21 . GLN A 1 5  ? -9.449  6.524   11.289  1.00 0.00 ? 5  GLN A HE21 3  
ATOM 1648  H HE22 . GLN A 1 5  ? -8.157  7.604   11.502  1.00 0.00 ? 5  GLN A HE22 3  
ATOM 1649  N N    . CYS A 1 6  ? -8.085  2.212   6.326   1.00 0.00 ? 6  CYS A N    3  
ATOM 1650  C CA   . CYS A 1 6  ? -8.835  1.771   5.115   1.00 0.00 ? 6  CYS A CA   3  
ATOM 1651  C C    . CYS A 1 6  ? -8.834  0.242   5.034   1.00 0.00 ? 6  CYS A C    3  
ATOM 1652  O O    . CYS A 1 6  ? -9.273  -0.335  4.059   1.00 0.00 ? 6  CYS A O    3  
ATOM 1653  C CB   . CYS A 1 6  ? -8.171  2.348   3.864   1.00 0.00 ? 6  CYS A CB   3  
ATOM 1654  S SG   . CYS A 1 6  ? -9.286  3.544   3.086   1.00 0.00 ? 6  CYS A SG   3  
ATOM 1655  H H    . CYS A 1 6  ? -7.115  2.348   6.283   1.00 0.00 ? 6  CYS A H    3  
ATOM 1656  H HA   . CYS A 1 6  ? -9.854  2.125   5.176   1.00 0.00 ? 6  CYS A HA   3  
ATOM 1657  H HB2  . CYS A 1 6  ? -7.250  2.840   4.139   1.00 0.00 ? 6  CYS A HB2  3  
ATOM 1658  H HB3  . CYS A 1 6  ? -7.958  1.549   3.168   1.00 0.00 ? 6  CYS A HB3  3  
ATOM 1659  N N    . CYS A 1 7  ? -8.342  -0.420  6.045   1.00 0.00 ? 7  CYS A N    3  
ATOM 1660  C CA   . CYS A 1 7  ? -8.315  -1.911  6.014   1.00 0.00 ? 7  CYS A CA   3  
ATOM 1661  C C    . CYS A 1 7  ? -9.704  -2.446  5.663   1.00 0.00 ? 7  CYS A C    3  
ATOM 1662  O O    . CYS A 1 7  ? -9.841  -3.524  5.122   1.00 0.00 ? 7  CYS A O    3  
ATOM 1663  C CB   . CYS A 1 7  ? -7.893  -2.452  7.381   1.00 0.00 ? 7  CYS A CB   3  
ATOM 1664  S SG   . CYS A 1 7  ? -7.382  -4.180  7.208   1.00 0.00 ? 7  CYS A SG   3  
ATOM 1665  H H    . CYS A 1 7  ? -7.989  0.061   6.823   1.00 0.00 ? 7  CYS A H    3  
ATOM 1666  H HA   . CYS A 1 7  ? -7.609  -2.239  5.267   1.00 0.00 ? 7  CYS A HA   3  
ATOM 1667  H HB2  . CYS A 1 7  ? -7.068  -1.868  7.761   1.00 0.00 ? 7  CYS A HB2  3  
ATOM 1668  H HB3  . CYS A 1 7  ? -8.725  -2.389  8.066   1.00 0.00 ? 7  CYS A HB3  3  
ATOM 1669  N N    . THR A 1 8  ? -10.736 -1.703  5.966   1.00 0.00 ? 8  THR A N    3  
ATOM 1670  C CA   . THR A 1 8  ? -12.114 -2.176  5.645   1.00 0.00 ? 8  THR A CA   3  
ATOM 1671  C C    . THR A 1 8  ? -12.120 -2.791  4.244   1.00 0.00 ? 8  THR A C    3  
ATOM 1672  O O    . THR A 1 8  ? -12.796 -3.767  3.984   1.00 0.00 ? 8  THR A O    3  
ATOM 1673  C CB   . THR A 1 8  ? -13.083 -0.992  5.687   1.00 0.00 ? 8  THR A CB   3  
ATOM 1674  O OG1  . THR A 1 8  ? -12.479 0.134   5.066   1.00 0.00 ? 8  THR A OG1  3  
ATOM 1675  C CG2  . THR A 1 8  ? -13.418 -0.657  7.141   1.00 0.00 ? 8  THR A CG2  3  
ATOM 1676  H H    . THR A 1 8  ? -10.604 -0.836  6.403   1.00 0.00 ? 8  THR A H    3  
ATOM 1677  H HA   . THR A 1 8  ? -12.418 -2.919  6.367   1.00 0.00 ? 8  THR A HA   3  
ATOM 1678  H HB   . THR A 1 8  ? -13.990 -1.249  5.163   1.00 0.00 ? 8  THR A HB   3  
ATOM 1679  H HG1  . THR A 1 8  ? -12.039 -0.168  4.268   1.00 0.00 ? 8  THR A HG1  3  
ATOM 1680  H HG21 . THR A 1 8  ? -14.333 -0.083  7.176   1.00 0.00 ? 8  THR A HG21 3  
ATOM 1681  H HG22 . THR A 1 8  ? -12.614 -0.079  7.572   1.00 0.00 ? 8  THR A HG22 3  
ATOM 1682  H HG23 . THR A 1 8  ? -13.546 -1.571  7.701   1.00 0.00 ? 8  THR A HG23 3  
ATOM 1683  N N    . SER A 1 9  ? -11.362 -2.228  3.344   1.00 0.00 ? 9  SER A N    3  
ATOM 1684  C CA   . SER A 1 9  ? -11.306 -2.773  1.959   1.00 0.00 ? 9  SER A CA   3  
ATOM 1685  C C    . SER A 1 9  ? -10.216 -2.042  1.179   1.00 0.00 ? 9  SER A C    3  
ATOM 1686  O O    . SER A 1 9  ? -9.228  -1.607  1.739   1.00 0.00 ? 9  SER A O    3  
ATOM 1687  C CB   . SER A 1 9  ? -12.648 -2.561  1.261   1.00 0.00 ? 9  SER A CB   3  
ATOM 1688  O OG   . SER A 1 9  ? -13.686 -2.509  2.231   1.00 0.00 ? 9  SER A OG   3  
ATOM 1689  H H    . SER A 1 9  ? -10.822 -1.445  3.582   1.00 0.00 ? 9  SER A H    3  
ATOM 1690  H HA   . SER A 1 9  ? -11.080 -3.829  1.995   1.00 0.00 ? 9  SER A HA   3  
ATOM 1691  H HB2  . SER A 1 9  ? -12.625 -1.633  0.715   1.00 0.00 ? 9  SER A HB2  3  
ATOM 1692  H HB3  . SER A 1 9  ? -12.823 -3.376  0.572   1.00 0.00 ? 9  SER A HB3  3  
ATOM 1693  H HG   . SER A 1 9  ? -13.743 -1.607  2.556   1.00 0.00 ? 9  SER A HG   3  
ATOM 1694  N N    . ILE A 1 10 ? -10.388 -1.894  -0.107  1.00 0.00 ? 10 ILE A N    3  
ATOM 1695  C CA   . ILE A 1 10 ? -9.360  -1.183  -0.920  1.00 0.00 ? 10 ILE A CA   3  
ATOM 1696  C C    . ILE A 1 10 ? -9.899  0.193   -1.297  1.00 0.00 ? 10 ILE A C    3  
ATOM 1697  O O    . ILE A 1 10 ? -10.843 0.321   -2.050  1.00 0.00 ? 10 ILE A O    3  
ATOM 1698  C CB   . ILE A 1 10 ? -9.030  -2.008  -2.194  1.00 0.00 ? 10 ILE A CB   3  
ATOM 1699  C CG1  . ILE A 1 10 ? -8.792  -1.094  -3.414  1.00 0.00 ? 10 ILE A CG1  3  
ATOM 1700  C CG2  . ILE A 1 10 ? -10.190 -2.954  -2.513  1.00 0.00 ? 10 ILE A CG2  3  
ATOM 1701  C CD1  . ILE A 1 10 ? -7.531  -0.247  -3.208  1.00 0.00 ? 10 ILE A CD1  3  
ATOM 1702  H H    . ILE A 1 10 ? -11.196 -2.245  -0.537  1.00 0.00 ? 10 ILE A H    3  
ATOM 1703  H HA   . ILE A 1 10 ? -8.462  -1.061  -0.332  1.00 0.00 ? 10 ILE A HA   3  
ATOM 1704  H HB   . ILE A 1 10 ? -8.142  -2.594  -2.013  1.00 0.00 ? 10 ILE A HB   3  
ATOM 1705  H HG12 . ILE A 1 10 ? -8.669  -1.705  -4.296  1.00 0.00 ? 10 ILE A HG12 3  
ATOM 1706  H HG13 . ILE A 1 10 ? -9.641  -0.444  -3.548  1.00 0.00 ? 10 ILE A HG13 3  
ATOM 1707  H HG21 . ILE A 1 10 ? -10.030 -3.406  -3.481  1.00 0.00 ? 10 ILE A HG21 3  
ATOM 1708  H HG22 . ILE A 1 10 ? -11.116 -2.398  -2.524  1.00 0.00 ? 10 ILE A HG22 3  
ATOM 1709  H HG23 . ILE A 1 10 ? -10.242 -3.726  -1.760  1.00 0.00 ? 10 ILE A HG23 3  
ATOM 1710  H HD11 . ILE A 1 10 ? -6.734  -0.629  -3.830  1.00 0.00 ? 10 ILE A HD11 3  
ATOM 1711  H HD12 . ILE A 1 10 ? -7.231  -0.289  -2.172  1.00 0.00 ? 10 ILE A HD12 3  
ATOM 1712  H HD13 . ILE A 1 10 ? -7.738  0.778   -3.482  1.00 0.00 ? 10 ILE A HD13 3  
ATOM 1713  N N    . CYS A 1 11 ? -9.290  1.226   -0.793  1.00 0.00 ? 11 CYS A N    3  
ATOM 1714  C CA   . CYS A 1 11 ? -9.751  2.588   -1.147  1.00 0.00 ? 11 CYS A CA   3  
ATOM 1715  C C    . CYS A 1 11 ? -8.786  3.134   -2.189  1.00 0.00 ? 11 CYS A C    3  
ATOM 1716  O O    . CYS A 1 11 ? -7.607  3.265   -1.935  1.00 0.00 ? 11 CYS A O    3  
ATOM 1717  C CB   . CYS A 1 11 ? -9.735  3.489   0.093   1.00 0.00 ? 11 CYS A CB   3  
ATOM 1718  S SG   . CYS A 1 11 ? -10.139 2.518   1.568   1.00 0.00 ? 11 CYS A SG   3  
ATOM 1719  H H    . CYS A 1 11 ? -8.520  1.104   -0.199  1.00 0.00 ? 11 CYS A H    3  
ATOM 1720  H HA   . CYS A 1 11 ? -10.750 2.542   -1.558  1.00 0.00 ? 11 CYS A HA   3  
ATOM 1721  H HB2  . CYS A 1 11 ? -8.752  3.922   0.208   1.00 0.00 ? 11 CYS A HB2  3  
ATOM 1722  H HB3  . CYS A 1 11 ? -10.462 4.278   -0.028  1.00 0.00 ? 11 CYS A HB3  3  
ATOM 1723  N N    . SER A 1 12 ? -9.278  3.447   -3.354  1.00 0.00 ? 12 SER A N    3  
ATOM 1724  C CA   . SER A 1 12 ? -8.400  3.978   -4.429  1.00 0.00 ? 12 SER A CA   3  
ATOM 1725  C C    . SER A 1 12 ? -7.030  3.291   -4.388  1.00 0.00 ? 12 SER A C    3  
ATOM 1726  O O    . SER A 1 12 ? -6.151  3.699   -3.660  1.00 0.00 ? 12 SER A O    3  
ATOM 1727  C CB   . SER A 1 12 ? -8.216  5.483   -4.235  1.00 0.00 ? 12 SER A CB   3  
ATOM 1728  O OG   . SER A 1 12 ? -8.308  6.134   -5.495  1.00 0.00 ? 12 SER A OG   3  
ATOM 1729  H H    . SER A 1 12 ? -10.231 3.328   -3.526  1.00 0.00 ? 12 SER A H    3  
ATOM 1730  H HA   . SER A 1 12 ? -8.860  3.797   -5.389  1.00 0.00 ? 12 SER A HA   3  
ATOM 1731  H HB2  . SER A 1 12 ? -8.987  5.860   -3.584  1.00 0.00 ? 12 SER A HB2  3  
ATOM 1732  H HB3  . SER A 1 12 ? -7.248  5.671   -3.790  1.00 0.00 ? 12 SER A HB3  3  
ATOM 1733  H HG   . SER A 1 12 ? -7.575  6.750   -5.565  1.00 0.00 ? 12 SER A HG   3  
ATOM 1734  N N    . LEU A 1 13 ? -6.817  2.278   -5.185  1.00 0.00 ? 13 LEU A N    3  
ATOM 1735  C CA   . LEU A 1 13 ? -5.476  1.631   -5.187  1.00 0.00 ? 13 LEU A CA   3  
ATOM 1736  C C    . LEU A 1 13 ? -4.475  2.746   -5.403  1.00 0.00 ? 13 LEU A C    3  
ATOM 1737  O O    . LEU A 1 13 ? -3.362  2.709   -4.928  1.00 0.00 ? 13 LEU A O    3  
ATOM 1738  C CB   . LEU A 1 13 ? -5.383  0.604   -6.322  1.00 0.00 ? 13 LEU A CB   3  
ATOM 1739  C CG   . LEU A 1 13 ? -5.375  1.321   -7.676  1.00 0.00 ? 13 LEU A CG   3  
ATOM 1740  C CD1  . LEU A 1 13 ? -4.911  0.351   -8.764  1.00 0.00 ? 13 LEU A CD1  3  
ATOM 1741  C CD2  . LEU A 1 13 ? -6.787  1.811   -8.003  1.00 0.00 ? 13 LEU A CD2  3  
ATOM 1742  H H    . LEU A 1 13 ? -7.519  1.966   -5.792  1.00 0.00 ? 13 LEU A H    3  
ATOM 1743  H HA   . LEU A 1 13 ? -5.281  1.157   -4.235  1.00 0.00 ? 13 LEU A HA   3  
ATOM 1744  H HB2  . LEU A 1 13 ? -4.473  0.032   -6.214  1.00 0.00 ? 13 LEU A HB2  3  
ATOM 1745  H HB3  . LEU A 1 13 ? -6.233  -0.060  -6.276  1.00 0.00 ? 13 LEU A HB3  3  
ATOM 1746  H HG   . LEU A 1 13 ? -4.699  2.163   -7.636  1.00 0.00 ? 13 LEU A HG   3  
ATOM 1747  H HD11 . LEU A 1 13 ? -5.204  -0.654  -8.498  1.00 0.00 ? 13 LEU A HD11 3  
ATOM 1748  H HD12 . LEU A 1 13 ? -3.837  0.401   -8.856  1.00 0.00 ? 13 LEU A HD12 3  
ATOM 1749  H HD13 . LEU A 1 13 ? -5.367  0.621   -9.705  1.00 0.00 ? 13 LEU A HD13 3  
ATOM 1750  H HD21 . LEU A 1 13 ? -6.929  2.801   -7.595  1.00 0.00 ? 13 LEU A HD21 3  
ATOM 1751  H HD22 . LEU A 1 13 ? -7.512  1.137   -7.572  1.00 0.00 ? 13 LEU A HD22 3  
ATOM 1752  H HD23 . LEU A 1 13 ? -6.918  1.843   -9.075  1.00 0.00 ? 13 LEU A HD23 3  
ATOM 1753  N N    . TYR A 1 14 ? -4.899  3.764   -6.090  1.00 0.00 ? 14 TYR A N    3  
ATOM 1754  C CA   . TYR A 1 14 ? -4.010  4.932   -6.314  1.00 0.00 ? 14 TYR A CA   3  
ATOM 1755  C C    . TYR A 1 14 ? -3.686  5.528   -4.948  1.00 0.00 ? 14 TYR A C    3  
ATOM 1756  O O    . TYR A 1 14 ? -2.585  5.972   -4.695  1.00 0.00 ? 14 TYR A O    3  
ATOM 1757  C CB   . TYR A 1 14 ? -4.723  5.972   -7.180  1.00 0.00 ? 14 TYR A CB   3  
ATOM 1758  C CG   . TYR A 1 14 ? -3.744  6.557   -8.170  1.00 0.00 ? 14 TYR A CG   3  
ATOM 1759  C CD1  . TYR A 1 14 ? -2.492  7.006   -7.733  1.00 0.00 ? 14 TYR A CD1  3  
ATOM 1760  C CD2  . TYR A 1 14 ? -4.088  6.650   -9.524  1.00 0.00 ? 14 TYR A CD2  3  
ATOM 1761  C CE1  . TYR A 1 14 ? -1.584  7.549   -8.650  1.00 0.00 ? 14 TYR A CE1  3  
ATOM 1762  C CE2  . TYR A 1 14 ? -3.180  7.192   -10.441 1.00 0.00 ? 14 TYR A CE2  3  
ATOM 1763  C CZ   . TYR A 1 14 ? -1.928  7.642   -10.004 1.00 0.00 ? 14 TYR A CZ   3  
ATOM 1764  O OH   . TYR A 1 14 ? -1.033  8.176   -10.908 1.00 0.00 ? 14 TYR A OH   3  
ATOM 1765  H H    . TYR A 1 14 ? -5.820  3.770   -6.425  1.00 0.00 ? 14 TYR A H    3  
ATOM 1766  H HA   . TYR A 1 14 ? -3.098  4.611   -6.794  1.00 0.00 ? 14 TYR A HA   3  
ATOM 1767  H HB2  . TYR A 1 14 ? -5.536  5.500   -7.713  1.00 0.00 ? 14 TYR A HB2  3  
ATOM 1768  H HB3  . TYR A 1 14 ? -5.112  6.759   -6.552  1.00 0.00 ? 14 TYR A HB3  3  
ATOM 1769  H HD1  . TYR A 1 14 ? -2.227  6.935   -6.689  1.00 0.00 ? 14 TYR A HD1  3  
ATOM 1770  H HD2  . TYR A 1 14 ? -5.054  6.304   -9.860  1.00 0.00 ? 14 TYR A HD2  3  
ATOM 1771  H HE1  . TYR A 1 14 ? -0.618  7.895   -8.313  1.00 0.00 ? 14 TYR A HE1  3  
ATOM 1772  H HE2  . TYR A 1 14 ? -3.445  7.264   -11.485 1.00 0.00 ? 14 TYR A HE2  3  
ATOM 1773  H HH   . TYR A 1 14 ? -0.707  7.462   -11.461 1.00 0.00 ? 14 TYR A HH   3  
ATOM 1774  N N    . GLN A 1 15 ? -4.636  5.506   -4.049  1.00 0.00 ? 15 GLN A N    3  
ATOM 1775  C CA   . GLN A 1 15 ? -4.372  6.035   -2.684  1.00 0.00 ? 15 GLN A CA   3  
ATOM 1776  C C    . GLN A 1 15 ? -3.300  5.153   -2.049  1.00 0.00 ? 15 GLN A C    3  
ATOM 1777  O O    . GLN A 1 15 ? -2.311  5.632   -1.530  1.00 0.00 ? 15 GLN A O    3  
ATOM 1778  C CB   . GLN A 1 15 ? -5.653  5.980   -1.847  1.00 0.00 ? 15 GLN A CB   3  
ATOM 1779  C CG   . GLN A 1 15 ? -6.524  7.196   -2.165  1.00 0.00 ? 15 GLN A CG   3  
ATOM 1780  C CD   . GLN A 1 15 ? -6.071  8.386   -1.317  1.00 0.00 ? 15 GLN A CD   3  
ATOM 1781  O OE1  . GLN A 1 15 ? -5.044  8.979   -1.582  1.00 0.00 ? 15 GLN A OE1  3  
ATOM 1782  N NE2  . GLN A 1 15 ? -6.798  8.762   -0.301  1.00 0.00 ? 15 GLN A NE2  3  
ATOM 1783  H H    . GLN A 1 15 ? -5.514  5.117   -4.266  1.00 0.00 ? 15 GLN A H    3  
ATOM 1784  H HA   . GLN A 1 15 ? -4.017  7.053   -2.749  1.00 0.00 ? 15 GLN A HA   3  
ATOM 1785  H HB2  . GLN A 1 15 ? -6.196  5.075   -2.078  1.00 0.00 ? 15 GLN A HB2  3  
ATOM 1786  H HB3  . GLN A 1 15 ? -5.397  5.987   -0.798  1.00 0.00 ? 15 GLN A HB3  3  
ATOM 1787  H HG2  . GLN A 1 15 ? -6.429  7.442   -3.213  1.00 0.00 ? 15 GLN A HG2  3  
ATOM 1788  H HG3  . GLN A 1 15 ? -7.556  6.969   -1.940  1.00 0.00 ? 15 GLN A HG3  3  
ATOM 1789  H HE21 . GLN A 1 15 ? -7.626  8.284   -0.087  1.00 0.00 ? 15 GLN A HE21 3  
ATOM 1790  H HE22 . GLN A 1 15 ? -6.516  9.523   0.248   1.00 0.00 ? 15 GLN A HE22 3  
ATOM 1791  N N    . LEU A 1 16 ? -3.473  3.858   -2.120  1.00 0.00 ? 16 LEU A N    3  
ATOM 1792  C CA   . LEU A 1 16 ? -2.447  2.940   -1.558  1.00 0.00 ? 16 LEU A CA   3  
ATOM 1793  C C    . LEU A 1 16 ? -1.189  3.088   -2.407  1.00 0.00 ? 16 LEU A C    3  
ATOM 1794  O O    . LEU A 1 16 ? -0.087  3.162   -1.904  1.00 0.00 ? 16 LEU A O    3  
ATOM 1795  C CB   . LEU A 1 16 ? -2.950  1.496   -1.621  1.00 0.00 ? 16 LEU A CB   3  
ATOM 1796  C CG   . LEU A 1 16 ? -2.352  0.697   -0.462  1.00 0.00 ? 16 LEU A CG   3  
ATOM 1797  C CD1  . LEU A 1 16 ? -3.063  1.074   0.838   1.00 0.00 ? 16 LEU A CD1  3  
ATOM 1798  C CD2  . LEU A 1 16 ? -2.536  -0.799  -0.728  1.00 0.00 ? 16 LEU A CD2  3  
ATOM 1799  H H    . LEU A 1 16 ? -4.265  3.492   -2.567  1.00 0.00 ? 16 LEU A H    3  
ATOM 1800  H HA   . LEU A 1 16 ? -2.233  3.213   -0.534  1.00 0.00 ? 16 LEU A HA   3  
ATOM 1801  H HB2  . LEU A 1 16 ? -4.028  1.486   -1.549  1.00 0.00 ? 16 LEU A HB2  3  
ATOM 1802  H HB3  . LEU A 1 16 ? -2.648  1.050   -2.557  1.00 0.00 ? 16 LEU A HB3  3  
ATOM 1803  H HG   . LEU A 1 16 ? -1.299  0.922   -0.375  1.00 0.00 ? 16 LEU A HG   3  
ATOM 1804  H HD11 . LEU A 1 16 ? -2.907  0.297   1.572   1.00 0.00 ? 16 LEU A HD11 3  
ATOM 1805  H HD12 . LEU A 1 16 ? -4.121  1.184   0.651   1.00 0.00 ? 16 LEU A HD12 3  
ATOM 1806  H HD13 . LEU A 1 16 ? -2.664  2.006   1.210   1.00 0.00 ? 16 LEU A HD13 3  
ATOM 1807  H HD21 . LEU A 1 16 ? -1.930  -1.092  -1.572  1.00 0.00 ? 16 LEU A HD21 3  
ATOM 1808  H HD22 . LEU A 1 16 ? -3.575  -1.002  -0.943  1.00 0.00 ? 16 LEU A HD22 3  
ATOM 1809  H HD23 . LEU A 1 16 ? -2.233  -1.359  0.145   1.00 0.00 ? 16 LEU A HD23 3  
ATOM 1810  N N    . GLU A 1 17 ? -1.355  3.161   -3.699  1.00 0.00 ? 17 GLU A N    3  
ATOM 1811  C CA   . GLU A 1 17 ? -0.181  3.340   -4.592  1.00 0.00 ? 17 GLU A CA   3  
ATOM 1812  C C    . GLU A 1 17 ? 0.476   4.675   -4.245  1.00 0.00 ? 17 GLU A C    3  
ATOM 1813  O O    . GLU A 1 17 ? 1.675   4.821   -4.273  1.00 0.00 ? 17 GLU A O    3  
ATOM 1814  C CB   . GLU A 1 17 ? -0.636  3.354   -6.054  1.00 0.00 ? 17 GLU A CB   3  
ATOM 1815  C CG   . GLU A 1 17 ? 0.227   2.386   -6.867  1.00 0.00 ? 17 GLU A CG   3  
ATOM 1816  C CD   . GLU A 1 17 ? 1.116   3.178   -7.827  1.00 0.00 ? 17 GLU A CD   3  
ATOM 1817  O OE1  . GLU A 1 17 ? 0.607   3.628   -8.840  1.00 0.00 ? 17 GLU A OE1  3  
ATOM 1818  O OE2  . GLU A 1 17 ? 2.292   3.321   -7.533  1.00 0.00 ? 17 GLU A OE2  3  
ATOM 1819  H H    . GLU A 1 17 ? -2.259  3.116   -4.080  1.00 0.00 ? 17 GLU A H    3  
ATOM 1820  H HA   . GLU A 1 17 ? 0.519   2.536   -4.434  1.00 0.00 ? 17 GLU A HA   3  
ATOM 1821  H HB2  . GLU A 1 17 ? -1.671  3.050   -6.112  1.00 0.00 ? 17 GLU A HB2  3  
ATOM 1822  H HB3  . GLU A 1 17 ? -0.530  4.350   -6.455  1.00 0.00 ? 17 GLU A HB3  3  
ATOM 1823  H HG2  . GLU A 1 17 ? 0.845   1.806   -6.197  1.00 0.00 ? 17 GLU A HG2  3  
ATOM 1824  H HG3  . GLU A 1 17 ? -0.411  1.724   -7.433  1.00 0.00 ? 17 GLU A HG3  3  
ATOM 1825  N N    . ASN A 1 18 ? -0.313  5.652   -3.911  1.00 0.00 ? 18 ASN A N    3  
ATOM 1826  C CA   . ASN A 1 18 ? 0.253   6.979   -3.544  1.00 0.00 ? 18 ASN A CA   3  
ATOM 1827  C C    . ASN A 1 18 ? 1.008   6.858   -2.214  1.00 0.00 ? 18 ASN A C    3  
ATOM 1828  O O    . ASN A 1 18 ? 1.820   7.695   -1.871  1.00 0.00 ? 18 ASN A O    3  
ATOM 1829  C CB   . ASN A 1 18 ? -0.881  7.996   -3.397  1.00 0.00 ? 18 ASN A CB   3  
ATOM 1830  C CG   . ASN A 1 18 ? -1.082  8.732   -4.722  1.00 0.00 ? 18 ASN A CG   3  
ATOM 1831  O OD1  . ASN A 1 18 ? -0.180  8.808   -5.532  1.00 0.00 ? 18 ASN A OD1  3  
ATOM 1832  N ND2  . ASN A 1 18 ? -2.238  9.281   -4.980  1.00 0.00 ? 18 ASN A ND2  3  
ATOM 1833  H H    . ASN A 1 18 ? -1.284  5.512   -3.893  1.00 0.00 ? 18 ASN A H    3  
ATOM 1834  H HA   . ASN A 1 18 ? 0.934   7.307   -4.316  1.00 0.00 ? 18 ASN A HA   3  
ATOM 1835  H HB2  . ASN A 1 18 ? -1.792  7.482   -3.127  1.00 0.00 ? 18 ASN A HB2  3  
ATOM 1836  H HB3  . ASN A 1 18 ? -0.627  8.709   -2.626  1.00 0.00 ? 18 ASN A HB3  3  
ATOM 1837  H HD21 . ASN A 1 18 ? -2.966  9.220   -4.327  1.00 0.00 ? 18 ASN A HD21 3  
ATOM 1838  H HD22 . ASN A 1 18 ? -2.377  9.755   -5.826  1.00 0.00 ? 18 ASN A HD22 3  
ATOM 1839  N N    . TYR A 1 19 ? 0.739   5.824   -1.457  1.00 0.00 ? 19 TYR A N    3  
ATOM 1840  C CA   . TYR A 1 19 ? 1.426   5.649   -0.148  1.00 0.00 ? 19 TYR A CA   3  
ATOM 1841  C C    . TYR A 1 19 ? 2.931   5.572   -0.368  1.00 0.00 ? 19 TYR A C    3  
ATOM 1842  O O    . TYR A 1 19 ? 3.680   6.419   0.075   1.00 0.00 ? 19 TYR A O    3  
ATOM 1843  C CB   . TYR A 1 19 ? 0.953   4.346   0.504   1.00 0.00 ? 19 TYR A CB   3  
ATOM 1844  C CG   . TYR A 1 19 ? 1.806   4.037   1.712   1.00 0.00 ? 19 TYR A CG   3  
ATOM 1845  C CD1  . TYR A 1 19 ? 2.450   5.073   2.400   1.00 0.00 ? 19 TYR A CD1  3  
ATOM 1846  C CD2  . TYR A 1 19 ? 1.946   2.714   2.151   1.00 0.00 ? 19 TYR A CD2  3  
ATOM 1847  C CE1  . TYR A 1 19 ? 3.232   4.787   3.525   1.00 0.00 ? 19 TYR A CE1  3  
ATOM 1848  C CE2  . TYR A 1 19 ? 2.730   2.428   3.275   1.00 0.00 ? 19 TYR A CE2  3  
ATOM 1849  C CZ   . TYR A 1 19 ? 3.372   3.464   3.962   1.00 0.00 ? 19 TYR A CZ   3  
ATOM 1850  O OH   . TYR A 1 19 ? 4.144   3.182   5.071   1.00 0.00 ? 19 TYR A OH   3  
ATOM 1851  H H    . TYR A 1 19 ? 0.085   5.162   -1.750  1.00 0.00 ? 19 TYR A H    3  
ATOM 1852  H HA   . TYR A 1 19 ? 1.194   6.481   0.497   1.00 0.00 ? 19 TYR A HA   3  
ATOM 1853  H HB2  . TYR A 1 19 ? -0.077  4.448   0.808   1.00 0.00 ? 19 TYR A HB2  3  
ATOM 1854  H HB3  . TYR A 1 19 ? 1.039   3.538   -0.206  1.00 0.00 ? 19 TYR A HB3  3  
ATOM 1855  H HD1  . TYR A 1 19 ? 2.345   6.091   2.060   1.00 0.00 ? 19 TYR A HD1  3  
ATOM 1856  H HD2  . TYR A 1 19 ? 1.454   1.912   1.618   1.00 0.00 ? 19 TYR A HD2  3  
ATOM 1857  H HE1  . TYR A 1 19 ? 3.727   5.586   4.055   1.00 0.00 ? 19 TYR A HE1  3  
ATOM 1858  H HE2  . TYR A 1 19 ? 2.837   1.408   3.613   1.00 0.00 ? 19 TYR A HE2  3  
ATOM 1859  H HH   . TYR A 1 19 ? 3.643   3.430   5.852   1.00 0.00 ? 19 TYR A HH   3  
ATOM 1860  N N    . CYS A 1 20 ? 3.370   4.551   -1.045  1.00 0.00 ? 20 CYS A N    3  
ATOM 1861  C CA   . CYS A 1 20 ? 4.832   4.388   -1.297  1.00 0.00 ? 20 CYS A CA   3  
ATOM 1862  C C    . CYS A 1 20 ? 5.607   4.760   -0.030  1.00 0.00 ? 20 CYS A C    3  
ATOM 1863  O O    . CYS A 1 20 ? 5.056   4.813   1.051   1.00 0.00 ? 20 CYS A O    3  
ATOM 1864  C CB   . CYS A 1 20 ? 5.260   5.301   -2.448  1.00 0.00 ? 20 CYS A CB   3  
ATOM 1865  S SG   . CYS A 1 20 ? 4.389   4.837   -3.971  1.00 0.00 ? 20 CYS A SG   3  
ATOM 1866  H H    . CYS A 1 20 ? 2.732   3.886   -1.385  1.00 0.00 ? 20 CYS A H    3  
ATOM 1867  H HA   . CYS A 1 20 ? 5.041   3.361   -1.556  1.00 0.00 ? 20 CYS A HA   3  
ATOM 1868  H HB2  . CYS A 1 20 ? 5.023   6.325   -2.199  1.00 0.00 ? 20 CYS A HB2  3  
ATOM 1869  H HB3  . CYS A 1 20 ? 6.325   5.208   -2.602  1.00 0.00 ? 20 CYS A HB3  3  
ATOM 1870  N N    . ASN A 1 21 ? 6.880   5.019   -0.151  1.00 0.00 ? 21 ASN A N    3  
ATOM 1871  C CA   . ASN A 1 21 ? 7.677   5.389   1.055   1.00 0.00 ? 21 ASN A CA   3  
ATOM 1872  C C    . ASN A 1 21 ? 8.090   6.863   0.968   1.00 0.00 ? 21 ASN A C    3  
ATOM 1873  O O    . ASN A 1 21 ? 7.745   7.497   -0.016  1.00 0.00 ? 21 ASN A O    3  
ATOM 1874  C CB   . ASN A 1 21 ? 8.921   4.491   1.150   1.00 0.00 ? 21 ASN A CB   3  
ATOM 1875  C CG   . ASN A 1 21 ? 10.069  5.057   0.303   1.00 0.00 ? 21 ASN A CG   3  
ATOM 1876  O OD1  . ASN A 1 21 ? 11.225  4.854   0.618   1.00 0.00 ? 21 ASN A OD1  3  
ATOM 1877  N ND2  . ASN A 1 21 ? 9.801   5.763   -0.763  1.00 0.00 ? 21 ASN A ND2  3  
ATOM 1878  O OXT  . ASN A 1 21 ? 8.743   7.330   1.886   1.00 0.00 ? 21 ASN A OXT  3  
ATOM 1879  H H    . ASN A 1 21 ? 7.307   4.970   -1.030  1.00 0.00 ? 21 ASN A H    3  
ATOM 1880  H HA   . ASN A 1 21 ? 7.069   5.246   1.936   1.00 0.00 ? 21 ASN A HA   3  
ATOM 1881  H HB2  . ASN A 1 21 ? 9.236   4.430   2.181   1.00 0.00 ? 21 ASN A HB2  3  
ATOM 1882  H HB3  . ASN A 1 21 ? 8.672   3.502   0.797   1.00 0.00 ? 21 ASN A HB3  3  
ATOM 1883  H HD21 . ASN A 1 21 ? 8.872   5.930   -1.020  1.00 0.00 ? 21 ASN A HD21 3  
ATOM 1884  H HD22 . ASN A 1 21 ? 10.532  6.125   -1.306  1.00 0.00 ? 21 ASN A HD22 3  
ATOM 1885  N N    . PHE B 2 1  ? -9.320  -5.429  -10.651 1.00 0.00 ? 1  PHE B N    3  
ATOM 1886  C CA   . PHE B 2 1  ? -7.942  -5.023  -10.256 1.00 0.00 ? 1  PHE B CA   3  
ATOM 1887  C C    . PHE B 2 1  ? -7.952  -4.524  -8.810  1.00 0.00 ? 1  PHE B C    3  
ATOM 1888  O O    . PHE B 2 1  ? -8.307  -3.395  -8.535  1.00 0.00 ? 1  PHE B O    3  
ATOM 1889  C CB   . PHE B 2 1  ? -7.456  -3.902  -11.178 1.00 0.00 ? 1  PHE B CB   3  
ATOM 1890  C CG   . PHE B 2 1  ? -5.972  -4.049  -11.411 1.00 0.00 ? 1  PHE B CG   3  
ATOM 1891  C CD1  . PHE B 2 1  ? -5.448  -5.277  -11.835 1.00 0.00 ? 1  PHE B CD1  3  
ATOM 1892  C CD2  . PHE B 2 1  ? -5.119  -2.959  -11.203 1.00 0.00 ? 1  PHE B CD2  3  
ATOM 1893  C CE1  . PHE B 2 1  ? -4.071  -5.413  -12.051 1.00 0.00 ? 1  PHE B CE1  3  
ATOM 1894  C CE2  . PHE B 2 1  ? -3.742  -3.095  -11.419 1.00 0.00 ? 1  PHE B CE2  3  
ATOM 1895  C CZ   . PHE B 2 1  ? -3.219  -4.322  -11.843 1.00 0.00 ? 1  PHE B CZ   3  
ATOM 1896  H H1   . PHE B 2 1  ? -9.368  -6.465  -10.726 1.00 0.00 ? 1  PHE B H1   3  
ATOM 1897  H H2   . PHE B 2 1  ? -9.556  -5.002  -11.571 1.00 0.00 ? 1  PHE B H2   3  
ATOM 1898  H H3   . PHE B 2 1  ? -9.997  -5.104  -9.933  1.00 0.00 ? 1  PHE B H3   3  
ATOM 1899  H HA   . PHE B 2 1  ? -7.278  -5.871  -10.340 1.00 0.00 ? 1  PHE B HA   3  
ATOM 1900  H HB2  . PHE B 2 1  ? -7.977  -3.963  -12.123 1.00 0.00 ? 1  PHE B HB2  3  
ATOM 1901  H HB3  . PHE B 2 1  ? -7.654  -2.946  -10.718 1.00 0.00 ? 1  PHE B HB3  3  
ATOM 1902  H HD1  . PHE B 2 1  ? -6.105  -6.118  -11.995 1.00 0.00 ? 1  PHE B HD1  3  
ATOM 1903  H HD2  . PHE B 2 1  ? -5.523  -2.012  -10.876 1.00 0.00 ? 1  PHE B HD2  3  
ATOM 1904  H HE1  . PHE B 2 1  ? -3.667  -6.360  -12.378 1.00 0.00 ? 1  PHE B HE1  3  
ATOM 1905  H HE2  . PHE B 2 1  ? -3.085  -2.254  -11.259 1.00 0.00 ? 1  PHE B HE2  3  
ATOM 1906  H HZ   . PHE B 2 1  ? -2.157  -4.427  -12.009 1.00 0.00 ? 1  PHE B HZ   3  
ATOM 1907  N N    . VAL B 2 2  ? -7.565  -5.357  -7.883  1.00 0.00 ? 2  VAL B N    3  
ATOM 1908  C CA   . VAL B 2 2  ? -7.553  -4.929  -6.455  1.00 0.00 ? 2  VAL B CA   3  
ATOM 1909  C C    . VAL B 2 2  ? -8.956  -4.479  -6.046  1.00 0.00 ? 2  VAL B C    3  
ATOM 1910  O O    . VAL B 2 2  ? -9.276  -3.307  -6.073  1.00 0.00 ? 2  VAL B O    3  
ATOM 1911  C CB   . VAL B 2 2  ? -6.573  -3.768  -6.279  1.00 0.00 ? 2  VAL B CB   3  
ATOM 1912  C CG1  . VAL B 2 2  ? -6.144  -3.680  -4.813  1.00 0.00 ? 2  VAL B CG1  3  
ATOM 1913  C CG2  . VAL B 2 2  ? -5.342  -4.003  -7.156  1.00 0.00 ? 2  VAL B CG2  3  
ATOM 1914  H H    . VAL B 2 2  ? -7.282  -6.263  -8.125  1.00 0.00 ? 2  VAL B H    3  
ATOM 1915  H HA   . VAL B 2 2  ? -7.244  -5.758  -5.834  1.00 0.00 ? 2  VAL B HA   3  
ATOM 1916  H HB   . VAL B 2 2  ? -7.054  -2.845  -6.569  1.00 0.00 ? 2  VAL B HB   3  
ATOM 1917  H HG11 . VAL B 2 2  ? -5.323  -4.359  -4.637  1.00 0.00 ? 2  VAL B HG11 3  
ATOM 1918  H HG12 . VAL B 2 2  ? -6.976  -3.947  -4.178  1.00 0.00 ? 2  VAL B HG12 3  
ATOM 1919  H HG13 . VAL B 2 2  ? -5.830  -2.671  -4.590  1.00 0.00 ? 2  VAL B HG13 3  
ATOM 1920  H HG21 . VAL B 2 2  ? -4.966  -5.002  -6.989  1.00 0.00 ? 2  VAL B HG21 3  
ATOM 1921  H HG22 . VAL B 2 2  ? -4.577  -3.284  -6.903  1.00 0.00 ? 2  VAL B HG22 3  
ATOM 1922  H HG23 . VAL B 2 2  ? -5.613  -3.890  -8.195  1.00 0.00 ? 2  VAL B HG23 3  
ATOM 1923  N N    . ASN B 2 3  ? -9.797  -5.402  -5.665  1.00 0.00 ? 3  ASN B N    3  
ATOM 1924  C CA   . ASN B 2 3  ? -11.179 -5.026  -5.253  1.00 0.00 ? 3  ASN B CA   3  
ATOM 1925  C C    . ASN B 2 3  ? -11.364 -5.321  -3.764  1.00 0.00 ? 3  ASN B C    3  
ATOM 1926  O O    . ASN B 2 3  ? -12.310 -4.875  -3.145  1.00 0.00 ? 3  ASN B O    3  
ATOM 1927  C CB   . ASN B 2 3  ? -12.191 -5.837  -6.064  1.00 0.00 ? 3  ASN B CB   3  
ATOM 1928  C CG   . ASN B 2 3  ? -13.594 -5.619  -5.494  1.00 0.00 ? 3  ASN B CG   3  
ATOM 1929  O OD1  . ASN B 2 3  ? -14.194 -4.584  -5.705  1.00 0.00 ? 3  ASN B OD1  3  
ATOM 1930  N ND2  . ASN B 2 3  ? -14.146 -6.558  -4.775  1.00 0.00 ? 3  ASN B ND2  3  
ATOM 1931  H H    . ASN B 2 3  ? -9.520  -6.341  -5.649  1.00 0.00 ? 3  ASN B H    3  
ATOM 1932  H HA   . ASN B 2 3  ? -11.334 -3.972  -5.433  1.00 0.00 ? 3  ASN B HA   3  
ATOM 1933  H HB2  . ASN B 2 3  ? -12.167 -5.515  -7.095  1.00 0.00 ? 3  ASN B HB2  3  
ATOM 1934  H HB3  . ASN B 2 3  ? -11.941 -6.886  -6.007  1.00 0.00 ? 3  ASN B HB3  3  
ATOM 1935  H HD21 . ASN B 2 3  ? -13.662 -7.393  -4.605  1.00 0.00 ? 3  ASN B HD21 3  
ATOM 1936  H HD22 . ASN B 2 3  ? -15.044 -6.428  -4.405  1.00 0.00 ? 3  ASN B HD22 3  
ATOM 1937  N N    . GLN B 2 4  ? -10.467 -6.070  -3.183  1.00 0.00 ? 4  GLN B N    3  
ATOM 1938  C CA   . GLN B 2 4  ? -10.591 -6.394  -1.734  1.00 0.00 ? 4  GLN B CA   3  
ATOM 1939  C C    . GLN B 2 4  ? -9.433  -7.301  -1.312  1.00 0.00 ? 4  GLN B C    3  
ATOM 1940  O O    . GLN B 2 4  ? -9.615  -8.480  -1.081  1.00 0.00 ? 4  GLN B O    3  
ATOM 1941  C CB   . GLN B 2 4  ? -11.918 -7.113  -1.483  1.00 0.00 ? 4  GLN B CB   3  
ATOM 1942  C CG   . GLN B 2 4  ? -12.199 -7.158  0.020   1.00 0.00 ? 4  GLN B CG   3  
ATOM 1943  C CD   . GLN B 2 4  ? -13.064 -5.960  0.415   1.00 0.00 ? 4  GLN B CD   3  
ATOM 1944  O OE1  . GLN B 2 4  ? -13.780 -5.417  -0.403  1.00 0.00 ? 4  GLN B OE1  3  
ATOM 1945  N NE2  . GLN B 2 4  ? -13.027 -5.521  1.643   1.00 0.00 ? 4  GLN B NE2  3  
ATOM 1946  H H    . GLN B 2 4  ? -9.711  -6.420  -3.700  1.00 0.00 ? 4  GLN B H    3  
ATOM 1947  H HA   . GLN B 2 4  ? -10.561 -5.481  -1.157  1.00 0.00 ? 4  GLN B HA   3  
ATOM 1948  H HB2  . GLN B 2 4  ? -12.715 -6.582  -1.983  1.00 0.00 ? 4  GLN B HB2  3  
ATOM 1949  H HB3  . GLN B 2 4  ? -11.860 -8.120  -1.867  1.00 0.00 ? 4  GLN B HB3  3  
ATOM 1950  H HG2  . GLN B 2 4  ? -12.719 -8.074  0.261   1.00 0.00 ? 4  GLN B HG2  3  
ATOM 1951  H HG3  . GLN B 2 4  ? -11.266 -7.120  0.562   1.00 0.00 ? 4  GLN B HG3  3  
ATOM 1952  H HE21 . GLN B 2 4  ? -12.450 -5.958  2.303   1.00 0.00 ? 4  GLN B HE21 3  
ATOM 1953  H HE22 . GLN B 2 4  ? -13.578 -4.754  1.906   1.00 0.00 ? 4  GLN B HE22 3  
ATOM 1954  N N    . HIS B 2 5  ? -8.245  -6.759  -1.224  1.00 0.00 ? 5  HIS B N    3  
ATOM 1955  C CA   . HIS B 2 5  ? -7.058  -7.590  -0.823  1.00 0.00 ? 5  HIS B CA   3  
ATOM 1956  C C    . HIS B 2 5  ? -7.469  -8.612  0.238   1.00 0.00 ? 5  HIS B C    3  
ATOM 1957  O O    . HIS B 2 5  ? -7.556  -9.795  -0.023  1.00 0.00 ? 5  HIS B O    3  
ATOM 1958  C CB   . HIS B 2 5  ? -5.933  -6.719  -0.229  1.00 0.00 ? 5  HIS B CB   3  
ATOM 1959  C CG   . HIS B 2 5  ? -6.273  -5.260  -0.328  1.00 0.00 ? 5  HIS B CG   3  
ATOM 1960  N ND1  . HIS B 2 5  ? -7.371  -4.716  0.315   1.00 0.00 ? 5  HIS B ND1  3  
ATOM 1961  C CD2  . HIS B 2 5  ? -5.675  -4.221  -0.996  1.00 0.00 ? 5  HIS B CD2  3  
ATOM 1962  C CE1  . HIS B 2 5  ? -7.402  -3.406  0.022   1.00 0.00 ? 5  HIS B CE1  3  
ATOM 1963  N NE2  . HIS B 2 5  ? -6.390  -3.050  -0.773  1.00 0.00 ? 5  HIS B NE2  3  
ATOM 1964  H H    . HIS B 2 5  ? -8.135  -5.806  -1.432  1.00 0.00 ? 5  HIS B H    3  
ATOM 1965  H HA   . HIS B 2 5  ? -6.682  -8.112  -1.691  1.00 0.00 ? 5  HIS B HA   3  
ATOM 1966  H HB2  . HIS B 2 5  ? -5.799  -6.979  0.812   1.00 0.00 ? 5  HIS B HB2  3  
ATOM 1967  H HB3  . HIS B 2 5  ? -5.015  -6.910  -0.763  1.00 0.00 ? 5  HIS B HB3  3  
ATOM 1968  H HD1  . HIS B 2 5  ? -8.009  -5.199  0.880   1.00 0.00 ? 5  HIS B HD1  3  
ATOM 1969  H HD2  . HIS B 2 5  ? -4.791  -4.302  -1.608  1.00 0.00 ? 5  HIS B HD2  3  
ATOM 1970  H HE1  . HIS B 2 5  ? -8.162  -2.729  0.372   1.00 0.00 ? 5  HIS B HE1  3  
ATOM 1971  N N    . LEU B 2 6  ? -7.712  -8.158  1.436   1.00 0.00 ? 6  LEU B N    3  
ATOM 1972  C CA   . LEU B 2 6  ? -8.106  -9.094  2.529   1.00 0.00 ? 6  LEU B CA   3  
ATOM 1973  C C    . LEU B 2 6  ? -8.229  -8.322  3.848   1.00 0.00 ? 6  LEU B C    3  
ATOM 1974  O O    . LEU B 2 6  ? -8.944  -8.726  4.741   1.00 0.00 ? 6  LEU B O    3  
ATOM 1975  C CB   . LEU B 2 6  ? -7.036  -10.180 2.673   1.00 0.00 ? 6  LEU B CB   3  
ATOM 1976  C CG   . LEU B 2 6  ? -7.681  -11.497 3.113   1.00 0.00 ? 6  LEU B CG   3  
ATOM 1977  C CD1  . LEU B 2 6  ? -8.673  -11.234 4.247   1.00 0.00 ? 6  LEU B CD1  3  
ATOM 1978  C CD2  . LEU B 2 6  ? -8.416  -12.124 1.926   1.00 0.00 ? 6  LEU B CD2  3  
ATOM 1979  H H    . LEU B 2 6  ? -7.630  -7.200  1.617   1.00 0.00 ? 6  LEU B H    3  
ATOM 1980  H HA   . LEU B 2 6  ? -9.054  -9.551  2.288   1.00 0.00 ? 6  LEU B HA   3  
ATOM 1981  H HB2  . LEU B 2 6  ? -6.545  -10.323 1.723   1.00 0.00 ? 6  LEU B HB2  3  
ATOM 1982  H HB3  . LEU B 2 6  ? -6.311  -9.874  3.411   1.00 0.00 ? 6  LEU B HB3  3  
ATOM 1983  H HG   . LEU B 2 6  ? -6.913  -12.173 3.459   1.00 0.00 ? 6  LEU B HG   3  
ATOM 1984  H HD11 . LEU B 2 6  ? -8.171  -10.713 5.050   1.00 0.00 ? 6  LEU B HD11 3  
ATOM 1985  H HD12 . LEU B 2 6  ? -9.058  -12.174 4.613   1.00 0.00 ? 6  LEU B HD12 3  
ATOM 1986  H HD13 . LEU B 2 6  ? -9.488  -10.628 3.879   1.00 0.00 ? 6  LEU B HD13 3  
ATOM 1987  H HD21 . LEU B 2 6  ? -8.620  -13.163 2.137   1.00 0.00 ? 6  LEU B HD21 3  
ATOM 1988  H HD22 . LEU B 2 6  ? -7.800  -12.050 1.042   1.00 0.00 ? 6  LEU B HD22 3  
ATOM 1989  H HD23 . LEU B 2 6  ? -9.346  -11.601 1.761   1.00 0.00 ? 6  LEU B HD23 3  
ATOM 1990  N N    . CYS B 2 7  ? -7.529  -7.221  3.977   1.00 0.00 ? 7  CYS B N    3  
ATOM 1991  C CA   . CYS B 2 7  ? -7.595  -6.417  5.235   1.00 0.00 ? 7  CYS B CA   3  
ATOM 1992  C C    . CYS B 2 7  ? -6.895  -7.172  6.365   1.00 0.00 ? 7  CYS B C    3  
ATOM 1993  O O    . CYS B 2 7  ? -7.418  -8.121  6.914   1.00 0.00 ? 7  CYS B O    3  
ATOM 1994  C CB   . CYS B 2 7  ? -9.054  -6.150  5.613   1.00 0.00 ? 7  CYS B CB   3  
ATOM 1995  S SG   . CYS B 2 7  ? -9.121  -5.209  7.161   1.00 0.00 ? 7  CYS B SG   3  
ATOM 1996  H H    . CYS B 2 7  ? -6.951  -6.922  3.245   1.00 0.00 ? 7  CYS B H    3  
ATOM 1997  H HA   . CYS B 2 7  ? -7.091  -5.475  5.077   1.00 0.00 ? 7  CYS B HA   3  
ATOM 1998  H HB2  . CYS B 2 7  ? -9.529  -5.583  4.827   1.00 0.00 ? 7  CYS B HB2  3  
ATOM 1999  H HB3  . CYS B 2 7  ? -9.573  -7.085  5.743   1.00 0.00 ? 7  CYS B HB3  3  
ATOM 2000  N N    . GLY B 2 8  ? -5.709  -6.754  6.706   1.00 0.00 ? 8  GLY B N    3  
ATOM 2001  C CA   . GLY B 2 8  ? -4.951  -7.435  7.793   1.00 0.00 ? 8  GLY B CA   3  
ATOM 2002  C C    . GLY B 2 8  ? -3.504  -7.616  7.344   1.00 0.00 ? 8  GLY B C    3  
ATOM 2003  O O    . GLY B 2 8  ? -2.606  -6.939  7.805   1.00 0.00 ? 8  GLY B O    3  
ATOM 2004  H H    . GLY B 2 8  ? -5.312  -5.989  6.240   1.00 0.00 ? 8  GLY B H    3  
ATOM 2005  H HA2  . GLY B 2 8  ? -4.982  -6.834  8.687   1.00 0.00 ? 8  GLY B HA2  3  
ATOM 2006  H HA3  . GLY B 2 8  ? -5.389  -8.402  7.989   1.00 0.00 ? 8  GLY B HA3  3  
ATOM 2007  N N    . SER B 2 9  ? -3.277  -8.519  6.435   1.00 0.00 ? 9  SER B N    3  
ATOM 2008  C CA   . SER B 2 9  ? -1.894  -8.748  5.933   1.00 0.00 ? 9  SER B CA   3  
ATOM 2009  C C    . SER B 2 9  ? -1.878  -8.543  4.416   1.00 0.00 ? 9  SER B C    3  
ATOM 2010  O O    . SER B 2 9  ? -0.893  -8.120  3.845   1.00 0.00 ? 9  SER B O    3  
ATOM 2011  C CB   . SER B 2 9  ? -1.459  -10.177 6.261   1.00 0.00 ? 9  SER B CB   3  
ATOM 2012  O OG   . SER B 2 9  ? -2.111  -11.081 5.379   1.00 0.00 ? 9  SER B OG   3  
ATOM 2013  H H    . SER B 2 9  ? -4.021  -9.043  6.076   1.00 0.00 ? 9  SER B H    3  
ATOM 2014  H HA   . SER B 2 9  ? -1.218  -8.046  6.400   1.00 0.00 ? 9  SER B HA   3  
ATOM 2015  H HB2  . SER B 2 9  ? -0.393  -10.268 6.138   1.00 0.00 ? 9  SER B HB2  3  
ATOM 2016  H HB3  . SER B 2 9  ? -1.722  -10.405 7.286   1.00 0.00 ? 9  SER B HB3  3  
ATOM 2017  H HG   . SER B 2 9  ? -1.445  -11.658 5.000   1.00 0.00 ? 9  SER B HG   3  
ATOM 2018  N N    . HIS B 2 10 ? -2.968  -8.841  3.763   1.00 0.00 ? 10 HIS B N    3  
ATOM 2019  C CA   . HIS B 2 10 ? -3.033  -8.669  2.288   1.00 0.00 ? 10 HIS B CA   3  
ATOM 2020  C C    . HIS B 2 10 ? -3.046  -7.179  1.942   1.00 0.00 ? 10 HIS B C    3  
ATOM 2021  O O    . HIS B 2 10 ? -2.450  -6.751  0.974   1.00 0.00 ? 10 HIS B O    3  
ATOM 2022  C CB   . HIS B 2 10 ? -4.311  -9.318  1.757   1.00 0.00 ? 10 HIS B CB   3  
ATOM 2023  C CG   . HIS B 2 10 ? -4.303  -10.790 2.070   1.00 0.00 ? 10 HIS B CG   3  
ATOM 2024  N ND1  . HIS B 2 10 ? -4.538  -11.751 1.099   1.00 0.00 ? 10 HIS B ND1  3  
ATOM 2025  C CD2  . HIS B 2 10 ? -4.109  -11.480 3.241   1.00 0.00 ? 10 HIS B CD2  3  
ATOM 2026  C CE1  . HIS B 2 10 ? -4.480  -12.954 1.697   1.00 0.00 ? 10 HIS B CE1  3  
ATOM 2027  N NE2  . HIS B 2 10 ? -4.221  -12.847 3.003   1.00 0.00 ? 10 HIS B NE2  3  
ATOM 2028  H H    . HIS B 2 10 ? -3.747  -9.180  4.244   1.00 0.00 ? 10 HIS B H    3  
ATOM 2029  H HA   . HIS B 2 10 ? -2.176  -9.137  1.835   1.00 0.00 ? 10 HIS B HA   3  
ATOM 2030  H HB2  . HIS B 2 10 ? -5.168  -8.855  2.225   1.00 0.00 ? 10 HIS B HB2  3  
ATOM 2031  H HB3  . HIS B 2 10 ? -4.368  -9.177  0.688   1.00 0.00 ? 10 HIS B HB3  3  
ATOM 2032  H HD1  . HIS B 2 10 ? -4.713  -11.584 0.149   1.00 0.00 ? 10 HIS B HD1  3  
ATOM 2033  H HD2  . HIS B 2 10 ? -3.906  -11.032 4.201   1.00 0.00 ? 10 HIS B HD2  3  
ATOM 2034  H HE1  . HIS B 2 10 ? -4.633  -13.892 1.186   1.00 0.00 ? 10 HIS B HE1  3  
ATOM 2035  N N    . LEU B 2 11 ? -3.728  -6.384  2.722   1.00 0.00 ? 11 LEU B N    3  
ATOM 2036  C CA   . LEU B 2 11 ? -3.781  -4.925  2.427   1.00 0.00 ? 11 LEU B CA   3  
ATOM 2037  C C    . LEU B 2 11 ? -2.360  -4.368  2.366   1.00 0.00 ? 11 LEU B C    3  
ATOM 2038  O O    . LEU B 2 11 ? -2.008  -3.641  1.458   1.00 0.00 ? 11 LEU B O    3  
ATOM 2039  C CB   . LEU B 2 11 ? -4.561  -4.205  3.529   1.00 0.00 ? 11 LEU B CB   3  
ATOM 2040  C CG   . LEU B 2 11 ? -5.147  -2.901  2.980   1.00 0.00 ? 11 LEU B CG   3  
ATOM 2041  C CD1  . LEU B 2 11 ? -5.582  -2.013  4.145   1.00 0.00 ? 11 LEU B CD1  3  
ATOM 2042  C CD2  . LEU B 2 11 ? -4.090  -2.164  2.154   1.00 0.00 ? 11 LEU B CD2  3  
ATOM 2043  H H    . LEU B 2 11 ? -4.207  -6.746  3.496   1.00 0.00 ? 11 LEU B H    3  
ATOM 2044  H HA   . LEU B 2 11 ? -4.271  -4.767  1.477   1.00 0.00 ? 11 LEU B HA   3  
ATOM 2045  H HB2  . LEU B 2 11 ? -5.362  -4.842  3.876   1.00 0.00 ? 11 LEU B HB2  3  
ATOM 2046  H HB3  . LEU B 2 11 ? -3.898  -3.981  4.351   1.00 0.00 ? 11 LEU B HB3  3  
ATOM 2047  H HG   . LEU B 2 11 ? -6.003  -3.125  2.359   1.00 0.00 ? 11 LEU B HG   3  
ATOM 2048  H HD11 . LEU B 2 11 ? -5.800  -2.629  5.005   1.00 0.00 ? 11 LEU B HD11 3  
ATOM 2049  H HD12 . LEU B 2 11 ? -6.466  -1.459  3.865   1.00 0.00 ? 11 LEU B HD12 3  
ATOM 2050  H HD13 . LEU B 2 11 ? -4.788  -1.325  4.387   1.00 0.00 ? 11 LEU B HD13 3  
ATOM 2051  H HD21 . LEU B 2 11 ? -3.155  -2.152  2.694   1.00 0.00 ? 11 LEU B HD21 3  
ATOM 2052  H HD22 . LEU B 2 11 ? -4.415  -1.150  1.975   1.00 0.00 ? 11 LEU B HD22 3  
ATOM 2053  H HD23 . LEU B 2 11 ? -3.953  -2.671  1.209   1.00 0.00 ? 11 LEU B HD23 3  
ATOM 2054  N N    . VAL B 2 12 ? -1.536  -4.709  3.317   1.00 0.00 ? 12 VAL B N    3  
ATOM 2055  C CA   . VAL B 2 12 ? -0.138  -4.199  3.296   1.00 0.00 ? 12 VAL B CA   3  
ATOM 2056  C C    . VAL B 2 12 ? 0.594   -4.828  2.116   1.00 0.00 ? 12 VAL B C    3  
ATOM 2057  O O    . VAL B 2 12 ? 1.259   -4.153  1.357   1.00 0.00 ? 12 VAL B O    3  
ATOM 2058  C CB   . VAL B 2 12 ? 0.568   -4.569  4.602   1.00 0.00 ? 12 VAL B CB   3  
ATOM 2059  C CG1  . VAL B 2 12 ? 1.851   -3.749  4.739   1.00 0.00 ? 12 VAL B CG1  3  
ATOM 2060  C CG2  . VAL B 2 12 ? -0.357  -4.266  5.783   1.00 0.00 ? 12 VAL B CG2  3  
ATOM 2061  H H    . VAL B 2 12 ? -1.834  -5.301  4.039   1.00 0.00 ? 12 VAL B H    3  
ATOM 2062  H HA   . VAL B 2 12 ? -0.149  -3.126  3.176   1.00 0.00 ? 12 VAL B HA   3  
ATOM 2063  H HB   . VAL B 2 12 ? 0.812   -5.621  4.594   1.00 0.00 ? 12 VAL B HB   3  
ATOM 2064  H HG11 . VAL B 2 12 ? 2.550   -4.277  5.371   1.00 0.00 ? 12 VAL B HG11 3  
ATOM 2065  H HG12 . VAL B 2 12 ? 1.621   -2.790  5.180   1.00 0.00 ? 12 VAL B HG12 3  
ATOM 2066  H HG13 . VAL B 2 12 ? 2.289   -3.600  3.763   1.00 0.00 ? 12 VAL B HG13 3  
ATOM 2067  H HG21 . VAL B 2 12 ? -0.556  -5.178  6.327   1.00 0.00 ? 12 VAL B HG21 3  
ATOM 2068  H HG22 . VAL B 2 12 ? -1.286  -3.855  5.417   1.00 0.00 ? 12 VAL B HG22 3  
ATOM 2069  H HG23 . VAL B 2 12 ? 0.119   -3.553  6.440   1.00 0.00 ? 12 VAL B HG23 3  
ATOM 2070  N N    . GLU B 2 13 ? 0.462   -6.112  1.937   1.00 0.00 ? 13 GLU B N    3  
ATOM 2071  C CA   . GLU B 2 13 ? 1.138   -6.756  0.784   1.00 0.00 ? 13 GLU B CA   3  
ATOM 2072  C C    . GLU B 2 13 ? 0.706   -6.015  -0.478  1.00 0.00 ? 13 GLU B C    3  
ATOM 2073  O O    . GLU B 2 13 ? 1.447   -5.898  -1.433  1.00 0.00 ? 13 GLU B O    3  
ATOM 2074  C CB   . GLU B 2 13 ? 0.719   -8.225  0.691   1.00 0.00 ? 13 GLU B CB   3  
ATOM 2075  C CG   . GLU B 2 13 ? 1.145   -8.793  -0.665  1.00 0.00 ? 13 GLU B CG   3  
ATOM 2076  C CD   . GLU B 2 13 ? 0.617   -10.222 -0.809  1.00 0.00 ? 13 GLU B CD   3  
ATOM 2077  O OE1  . GLU B 2 13 ? -0.560  -10.425 -0.563  1.00 0.00 ? 13 GLU B OE1  3  
ATOM 2078  O OE2  . GLU B 2 13 ? 1.400   -11.088 -1.163  1.00 0.00 ? 13 GLU B OE2  3  
ATOM 2079  H H    . GLU B 2 13 ? -0.092  -6.643  2.547   1.00 0.00 ? 13 GLU B H    3  
ATOM 2080  H HA   . GLU B 2 13 ? 2.210   -6.685  0.901   1.00 0.00 ? 13 GLU B HA   3  
ATOM 2081  H HB2  . GLU B 2 13 ? 1.195   -8.786  1.482   1.00 0.00 ? 13 GLU B HB2  3  
ATOM 2082  H HB3  . GLU B 2 13 ? -0.354  -8.301  0.789   1.00 0.00 ? 13 GLU B HB3  3  
ATOM 2083  H HG2  . GLU B 2 13 ? 0.740   -8.177  -1.456  1.00 0.00 ? 13 GLU B HG2  3  
ATOM 2084  H HG3  . GLU B 2 13 ? 2.222   -8.801  -0.730  1.00 0.00 ? 13 GLU B HG3  3  
ATOM 2085  N N    . ALA B 2 14 ? -0.492  -5.494  -0.473  1.00 0.00 ? 14 ALA B N    3  
ATOM 2086  C CA   . ALA B 2 14 ? -0.982  -4.736  -1.652  1.00 0.00 ? 14 ALA B CA   3  
ATOM 2087  C C    . ALA B 2 14 ? -0.201  -3.429  -1.751  1.00 0.00 ? 14 ALA B C    3  
ATOM 2088  O O    . ALA B 2 14 ? 0.277   -3.052  -2.802  1.00 0.00 ? 14 ALA B O    3  
ATOM 2089  C CB   . ALA B 2 14 ? -2.471  -4.433  -1.486  1.00 0.00 ? 14 ALA B CB   3  
ATOM 2090  H H    . ALA B 2 14 ? -1.063  -5.588  0.317   1.00 0.00 ? 14 ALA B H    3  
ATOM 2091  H HA   . ALA B 2 14 ? -0.827  -5.319  -2.541  1.00 0.00 ? 14 ALA B HA   3  
ATOM 2092  H HB1  . ALA B 2 14 ? -3.052  -5.215  -1.951  1.00 0.00 ? 14 ALA B HB1  3  
ATOM 2093  H HB2  . ALA B 2 14 ? -2.700  -3.487  -1.954  1.00 0.00 ? 14 ALA B HB2  3  
ATOM 2094  H HB3  . ALA B 2 14 ? -2.713  -4.382  -0.434  1.00 0.00 ? 14 ALA B HB3  3  
ATOM 2095  N N    . LEU B 2 15 ? -0.059  -2.744  -0.651  1.00 0.00 ? 15 LEU B N    3  
ATOM 2096  C CA   . LEU B 2 15 ? 0.704   -1.467  -0.660  1.00 0.00 ? 15 LEU B CA   3  
ATOM 2097  C C    . LEU B 2 15 ? 2.159   -1.782  -0.990  1.00 0.00 ? 15 LEU B C    3  
ATOM 2098  O O    . LEU B 2 15 ? 2.827   -1.043  -1.685  1.00 0.00 ? 15 LEU B O    3  
ATOM 2099  C CB   . LEU B 2 15 ? 0.585   -0.787  0.721   1.00 0.00 ? 15 LEU B CB   3  
ATOM 2100  C CG   . LEU B 2 15 ? 1.771   -1.158  1.622   1.00 0.00 ? 15 LEU B CG   3  
ATOM 2101  C CD1  . LEU B 2 15 ? 2.984   -0.298  1.255   1.00 0.00 ? 15 LEU B CD1  3  
ATOM 2102  C CD2  . LEU B 2 15 ? 1.396   -0.907  3.085   1.00 0.00 ? 15 LEU B CD2  3  
ATOM 2103  H H    . LEU B 2 15 ? -0.446  -3.078  0.184   1.00 0.00 ? 15 LEU B H    3  
ATOM 2104  H HA   . LEU B 2 15 ? 0.304   -0.815  -1.421  1.00 0.00 ? 15 LEU B HA   3  
ATOM 2105  H HB2  . LEU B 2 15 ? 0.560   0.283   0.590   1.00 0.00 ? 15 LEU B HB2  3  
ATOM 2106  H HB3  . LEU B 2 15 ? -0.332  -1.108  1.195   1.00 0.00 ? 15 LEU B HB3  3  
ATOM 2107  H HG   . LEU B 2 15 ? 2.016   -2.201  1.485   1.00 0.00 ? 15 LEU B HG   3  
ATOM 2108  H HD11 . LEU B 2 15 ? 3.882   -0.895  1.318   1.00 0.00 ? 15 LEU B HD11 3  
ATOM 2109  H HD12 . LEU B 2 15 ? 3.057   0.534   1.940   1.00 0.00 ? 15 LEU B HD12 3  
ATOM 2110  H HD13 . LEU B 2 15 ? 2.871   0.075   0.248   1.00 0.00 ? 15 LEU B HD13 3  
ATOM 2111  H HD21 . LEU B 2 15 ? 1.162   -1.847  3.562   1.00 0.00 ? 15 LEU B HD21 3  
ATOM 2112  H HD22 . LEU B 2 15 ? 0.535   -0.257  3.129   1.00 0.00 ? 15 LEU B HD22 3  
ATOM 2113  H HD23 . LEU B 2 15 ? 2.226   -0.441  3.595   1.00 0.00 ? 15 LEU B HD23 3  
ATOM 2114  N N    . TYR B 2 16 ? 2.648   -2.885  -0.502  1.00 0.00 ? 16 TYR B N    3  
ATOM 2115  C CA   . TYR B 2 16 ? 4.052   -3.257  -0.794  1.00 0.00 ? 16 TYR B CA   3  
ATOM 2116  C C    . TYR B 2 16 ? 4.185   -3.514  -2.292  1.00 0.00 ? 16 TYR B C    3  
ATOM 2117  O O    . TYR B 2 16 ? 5.048   -2.976  -2.956  1.00 0.00 ? 16 TYR B O    3  
ATOM 2118  C CB   . TYR B 2 16 ? 4.418   -4.527  -0.023  1.00 0.00 ? 16 TYR B CB   3  
ATOM 2119  C CG   . TYR B 2 16 ? 5.092   -4.152  1.275   1.00 0.00 ? 16 TYR B CG   3  
ATOM 2120  C CD1  . TYR B 2 16 ? 4.344   -3.589  2.315   1.00 0.00 ? 16 TYR B CD1  3  
ATOM 2121  C CD2  . TYR B 2 16 ? 6.466   -4.367  1.438   1.00 0.00 ? 16 TYR B CD2  3  
ATOM 2122  C CE1  . TYR B 2 16 ? 4.968   -3.242  3.518   1.00 0.00 ? 16 TYR B CE1  3  
ATOM 2123  C CE2  . TYR B 2 16 ? 7.091   -4.020  2.641   1.00 0.00 ? 16 TYR B CE2  3  
ATOM 2124  C CZ   . TYR B 2 16 ? 6.342   -3.457  3.682   1.00 0.00 ? 16 TYR B CZ   3  
ATOM 2125  O OH   . TYR B 2 16 ? 6.958   -3.115  4.868   1.00 0.00 ? 16 TYR B OH   3  
ATOM 2126  H H    . TYR B 2 16 ? 2.088   -3.470  0.049   1.00 0.00 ? 16 TYR B H    3  
ATOM 2127  H HA   . TYR B 2 16 ? 4.703   -2.457  -0.502  1.00 0.00 ? 16 TYR B HA   3  
ATOM 2128  H HB2  . TYR B 2 16 ? 3.521   -5.091  0.187   1.00 0.00 ? 16 TYR B HB2  3  
ATOM 2129  H HB3  . TYR B 2 16 ? 5.091   -5.127  -0.617  1.00 0.00 ? 16 TYR B HB3  3  
ATOM 2130  H HD1  . TYR B 2 16 ? 3.284   -3.423  2.189   1.00 0.00 ? 16 TYR B HD1  3  
ATOM 2131  H HD2  . TYR B 2 16 ? 7.044   -4.801  0.635   1.00 0.00 ? 16 TYR B HD2  3  
ATOM 2132  H HE1  . TYR B 2 16 ? 4.391   -2.808  4.321   1.00 0.00 ? 16 TYR B HE1  3  
ATOM 2133  H HE2  . TYR B 2 16 ? 8.151   -4.186  2.767   1.00 0.00 ? 16 TYR B HE2  3  
ATOM 2134  H HH   . TYR B 2 16 ? 7.818   -3.540  4.890   1.00 0.00 ? 16 TYR B HH   3  
ATOM 2135  N N    . LEU B 2 17 ? 3.329   -4.337  -2.823  1.00 0.00 ? 17 LEU B N    3  
ATOM 2136  C CA   . LEU B 2 17 ? 3.384   -4.645  -4.277  1.00 0.00 ? 17 LEU B CA   3  
ATOM 2137  C C    . LEU B 2 17 ? 2.952   -3.434  -5.104  1.00 0.00 ? 17 LEU B C    3  
ATOM 2138  O O    . LEU B 2 17 ? 3.544   -3.126  -6.119  1.00 0.00 ? 17 LEU B O    3  
ATOM 2139  C CB   . LEU B 2 17 ? 2.467   -5.831  -4.585  1.00 0.00 ? 17 LEU B CB   3  
ATOM 2140  C CG   . LEU B 2 17 ? 3.125   -6.728  -5.634  1.00 0.00 ? 17 LEU B CG   3  
ATOM 2141  C CD1  . LEU B 2 17 ? 4.126   -7.663  -4.953  1.00 0.00 ? 17 LEU B CD1  3  
ATOM 2142  C CD2  . LEU B 2 17 ? 2.051   -7.559  -6.339  1.00 0.00 ? 17 LEU B CD2  3  
ATOM 2143  H H    . LEU B 2 17 ? 2.644   -4.754  -2.260  1.00 0.00 ? 17 LEU B H    3  
ATOM 2144  H HA   . LEU B 2 17 ? 4.395   -4.899  -4.538  1.00 0.00 ? 17 LEU B HA   3  
ATOM 2145  H HB2  . LEU B 2 17 ? 2.296   -6.398  -3.681  1.00 0.00 ? 17 LEU B HB2  3  
ATOM 2146  H HB3  . LEU B 2 17 ? 1.524   -5.467  -4.965  1.00 0.00 ? 17 LEU B HB3  3  
ATOM 2147  H HG   . LEU B 2 17 ? 3.642   -6.114  -6.358  1.00 0.00 ? 17 LEU B HG   3  
ATOM 2148  H HD11 . LEU B 2 17 ? 4.202   -7.407  -3.906  1.00 0.00 ? 17 LEU B HD11 3  
ATOM 2149  H HD12 . LEU B 2 17 ? 5.093   -7.557  -5.420  1.00 0.00 ? 17 LEU B HD12 3  
ATOM 2150  H HD13 . LEU B 2 17 ? 3.788   -8.684  -5.050  1.00 0.00 ? 17 LEU B HD13 3  
ATOM 2151  H HD21 . LEU B 2 17 ? 1.082   -7.319  -5.929  1.00 0.00 ? 17 LEU B HD21 3  
ATOM 2152  H HD22 . LEU B 2 17 ? 2.254   -8.610  -6.191  1.00 0.00 ? 17 LEU B HD22 3  
ATOM 2153  H HD23 . LEU B 2 17 ? 2.060   -7.337  -7.396  1.00 0.00 ? 17 LEU B HD23 3  
ATOM 2154  N N    . VAL B 2 18 ? 1.916   -2.752  -4.698  1.00 0.00 ? 18 VAL B N    3  
ATOM 2155  C CA   . VAL B 2 18 ? 1.458   -1.580  -5.497  1.00 0.00 ? 18 VAL B CA   3  
ATOM 2156  C C    . VAL B 2 18 ? 2.613   -0.587  -5.635  1.00 0.00 ? 18 VAL B C    3  
ATOM 2157  O O    . VAL B 2 18 ? 2.899   -0.105  -6.713  1.00 0.00 ? 18 VAL B O    3  
ATOM 2158  C CB   . VAL B 2 18 ? 0.232   -0.926  -4.833  1.00 0.00 ? 18 VAL B CB   3  
ATOM 2159  C CG1  . VAL B 2 18 ? 0.659   0.086   -3.769  1.00 0.00 ? 18 VAL B CG1  3  
ATOM 2160  C CG2  . VAL B 2 18 ? -0.596  -0.209  -5.901  1.00 0.00 ? 18 VAL B CG2  3  
ATOM 2161  H H    . VAL B 2 18 ? 1.438   -3.018  -3.887  1.00 0.00 ? 18 VAL B H    3  
ATOM 2162  H HA   . VAL B 2 18 ? 1.183   -1.923  -6.481  1.00 0.00 ? 18 VAL B HA   3  
ATOM 2163  H HB   . VAL B 2 18 ? -0.372  -1.693  -4.371  1.00 0.00 ? 18 VAL B HB   3  
ATOM 2164  H HG11 . VAL B 2 18 ? 1.216   -0.418  -2.995  1.00 0.00 ? 18 VAL B HG11 3  
ATOM 2165  H HG12 . VAL B 2 18 ? -0.221  0.545   -3.339  1.00 0.00 ? 18 VAL B HG12 3  
ATOM 2166  H HG13 . VAL B 2 18 ? 1.275   0.846   -4.223  1.00 0.00 ? 18 VAL B HG13 3  
ATOM 2167  H HG21 . VAL B 2 18 ? -0.867  0.775   -5.546  1.00 0.00 ? 18 VAL B HG21 3  
ATOM 2168  H HG22 . VAL B 2 18 ? -1.491  -0.777  -6.105  1.00 0.00 ? 18 VAL B HG22 3  
ATOM 2169  H HG23 . VAL B 2 18 ? -0.013  -0.117  -6.806  1.00 0.00 ? 18 VAL B HG23 3  
ATOM 2170  N N    . CYS B 2 19 ? 3.300   -0.297  -4.566  1.00 0.00 ? 19 CYS B N    3  
ATOM 2171  C CA   . CYS B 2 19 ? 4.455   0.642   -4.672  1.00 0.00 ? 19 CYS B CA   3  
ATOM 2172  C C    . CYS B 2 19 ? 5.212   0.689   -3.343  1.00 0.00 ? 19 CYS B C    3  
ATOM 2173  O O    . CYS B 2 19 ? 5.846   1.673   -3.016  1.00 0.00 ? 19 CYS B O    3  
ATOM 2174  C CB   . CYS B 2 19 ? 3.950   2.045   -5.062  1.00 0.00 ? 19 CYS B CB   3  
ATOM 2175  S SG   . CYS B 2 19 ? 3.560   3.031   -3.588  1.00 0.00 ? 19 CYS B SG   3  
ATOM 2176  H H    . CYS B 2 19 ? 3.069   -0.707  -3.704  1.00 0.00 ? 19 CYS B H    3  
ATOM 2177  H HA   . CYS B 2 19 ? 5.125   0.285   -5.441  1.00 0.00 ? 19 CYS B HA   3  
ATOM 2178  H HB2  . CYS B 2 19 ? 4.714   2.551   -5.632  1.00 0.00 ? 19 CYS B HB2  3  
ATOM 2179  H HB3  . CYS B 2 19 ? 3.062   1.945   -5.670  1.00 0.00 ? 19 CYS B HB3  3  
ATOM 2180  N N    . GLY B 2 20 ? 5.155   -0.356  -2.569  1.00 0.00 ? 20 GLY B N    3  
ATOM 2181  C CA   . GLY B 2 20 ? 5.878   -0.327  -1.266  1.00 0.00 ? 20 GLY B CA   3  
ATOM 2182  C C    . GLY B 2 20 ? 7.204   -1.082  -1.391  1.00 0.00 ? 20 GLY B C    3  
ATOM 2183  O O    . GLY B 2 20 ? 8.250   -0.485  -1.532  1.00 0.00 ? 20 GLY B O    3  
ATOM 2184  H H    . GLY B 2 20 ? 4.640   -1.153  -2.841  1.00 0.00 ? 20 GLY B H    3  
ATOM 2185  H HA2  . GLY B 2 20 ? 6.074   0.703   -0.994  1.00 0.00 ? 20 GLY B HA2  3  
ATOM 2186  H HA3  . GLY B 2 20 ? 5.271   -0.783  -0.502  1.00 0.00 ? 20 GLY B HA3  3  
ATOM 2187  N N    . GLU B 2 21 ? 7.170   -2.388  -1.339  1.00 0.00 ? 21 GLU B N    3  
ATOM 2188  C CA   . GLU B 2 21 ? 8.429   -3.180  -1.450  1.00 0.00 ? 21 GLU B CA   3  
ATOM 2189  C C    . GLU B 2 21 ? 9.336   -2.573  -2.523  1.00 0.00 ? 21 GLU B C    3  
ATOM 2190  O O    . GLU B 2 21 ? 10.536  -2.486  -2.356  1.00 0.00 ? 21 GLU B O    3  
ATOM 2191  C CB   . GLU B 2 21 ? 8.089   -4.623  -1.828  1.00 0.00 ? 21 GLU B CB   3  
ATOM 2192  C CG   . GLU B 2 21 ? 9.277   -5.530  -1.502  1.00 0.00 ? 21 GLU B CG   3  
ATOM 2193  C CD   . GLU B 2 21 ? 9.591   -6.414  -2.710  1.00 0.00 ? 21 GLU B CD   3  
ATOM 2194  O OE1  . GLU B 2 21 ? 9.397   -5.953  -3.823  1.00 0.00 ? 21 GLU B OE1  3  
ATOM 2195  O OE2  . GLU B 2 21 ? 10.020  -7.537  -2.503  1.00 0.00 ? 21 GLU B OE2  3  
ATOM 2196  H H    . GLU B 2 21 ? 6.316   -2.849  -1.225  1.00 0.00 ? 21 GLU B H    3  
ATOM 2197  H HA   . GLU B 2 21 ? 8.943   -3.171  -0.500  1.00 0.00 ? 21 GLU B HA   3  
ATOM 2198  H HB2  . GLU B 2 21 ? 7.223   -4.946  -1.269  1.00 0.00 ? 21 GLU B HB2  3  
ATOM 2199  H HB3  . GLU B 2 21 ? 7.876   -4.677  -2.885  1.00 0.00 ? 21 GLU B HB3  3  
ATOM 2200  H HG2  . GLU B 2 21 ? 10.139  -4.923  -1.265  1.00 0.00 ? 21 GLU B HG2  3  
ATOM 2201  H HG3  . GLU B 2 21 ? 9.031   -6.154  -0.656  1.00 0.00 ? 21 GLU B HG3  3  
ATOM 2202  N N    . ARG B 2 22 ? 8.776   -2.157  -3.624  1.00 0.00 ? 22 ARG B N    3  
ATOM 2203  C CA   . ARG B 2 22 ? 9.611   -1.563  -4.703  1.00 0.00 ? 22 ARG B CA   3  
ATOM 2204  C C    . ARG B 2 22 ? 10.268  -0.281  -4.198  1.00 0.00 ? 22 ARG B C    3  
ATOM 2205  O O    . ARG B 2 22 ? 11.459  -0.083  -4.340  1.00 0.00 ? 22 ARG B O    3  
ATOM 2206  C CB   . ARG B 2 22 ? 8.733   -1.246  -5.915  1.00 0.00 ? 22 ARG B CB   3  
ATOM 2207  C CG   . ARG B 2 22 ? 8.820   -2.394  -6.923  1.00 0.00 ? 22 ARG B CG   3  
ATOM 2208  C CD   . ARG B 2 22 ? 9.998   -2.155  -7.869  1.00 0.00 ? 22 ARG B CD   3  
ATOM 2209  N NE   . ARG B 2 22 ? 11.029  -3.209  -7.657  1.00 0.00 ? 22 ARG B NE   3  
ATOM 2210  C CZ   . ARG B 2 22 ? 11.830  -3.544  -8.631  1.00 0.00 ? 22 ARG B CZ   3  
ATOM 2211  N NH1  . ARG B 2 22 ? 11.355  -3.725  -9.833  1.00 0.00 ? 22 ARG B NH1  3  
ATOM 2212  N NH2  . ARG B 2 22 ? 13.106  -3.697  -8.403  1.00 0.00 ? 22 ARG B NH2  3  
ATOM 2213  H H    . ARG B 2 22 ? 7.808   -2.239  -3.744  1.00 0.00 ? 22 ARG B H    3  
ATOM 2214  H HA   . ARG B 2 22 ? 10.373  -2.265  -4.985  1.00 0.00 ? 22 ARG B HA   3  
ATOM 2215  H HB2  . ARG B 2 22 ? 7.708   -1.124  -5.595  1.00 0.00 ? 22 ARG B HB2  3  
ATOM 2216  H HB3  . ARG B 2 22 ? 9.077   -0.335  -6.380  1.00 0.00 ? 22 ARG B HB3  3  
ATOM 2217  H HG2  . ARG B 2 22 ? 8.965   -3.326  -6.395  1.00 0.00 ? 22 ARG B HG2  3  
ATOM 2218  H HG3  . ARG B 2 22 ? 7.906   -2.442  -7.494  1.00 0.00 ? 22 ARG B HG3  3  
ATOM 2219  H HD2  . ARG B 2 22 ? 9.651   -2.191  -8.891  1.00 0.00 ? 22 ARG B HD2  3  
ATOM 2220  H HD3  . ARG B 2 22 ? 10.429  -1.185  -7.669  1.00 0.00 ? 22 ARG B HD3  3  
ATOM 2221  H HE   . ARG B 2 22 ? 11.105  -3.652  -6.786  1.00 0.00 ? 22 ARG B HE   3  
ATOM 2222  H HH11 . ARG B 2 22 ? 10.378  -3.607  -10.007 1.00 0.00 ? 22 ARG B HH11 3  
ATOM 2223  H HH12 . ARG B 2 22 ? 11.969  -3.981  -10.579 1.00 0.00 ? 22 ARG B HH12 3  
ATOM 2224  H HH21 . ARG B 2 22 ? 13.470  -3.558  -7.482  1.00 0.00 ? 22 ARG B HH21 3  
ATOM 2225  H HH22 . ARG B 2 22 ? 13.720  -3.954  -9.150  1.00 0.00 ? 22 ARG B HH22 3  
ATOM 2226  N N    . GLY B 2 23 ? 9.503   0.591   -3.610  1.00 0.00 ? 23 GLY B N    3  
ATOM 2227  C CA   . GLY B 2 23 ? 10.083  1.863   -3.095  1.00 0.00 ? 23 GLY B CA   3  
ATOM 2228  C C    . GLY B 2 23 ? 9.862   1.950   -1.585  1.00 0.00 ? 23 GLY B C    3  
ATOM 2229  O O    . GLY B 2 23 ? 9.461   2.972   -1.067  1.00 0.00 ? 23 GLY B O    3  
ATOM 2230  H H    . GLY B 2 23 ? 8.547   0.410   -3.507  1.00 0.00 ? 23 GLY B H    3  
ATOM 2231  H HA2  . GLY B 2 23 ? 11.143  1.887   -3.308  1.00 0.00 ? 23 GLY B HA2  3  
ATOM 2232  H HA3  . GLY B 2 23 ? 9.600   2.700   -3.575  1.00 0.00 ? 23 GLY B HA3  3  
ATOM 2233  N N    . PHE B 2 24 ? 10.117  0.885   -0.874  1.00 0.00 ? 24 PHE B N    3  
ATOM 2234  C CA   . PHE B 2 24 ? 9.917   0.913   0.603   1.00 0.00 ? 24 PHE B CA   3  
ATOM 2235  C C    . PHE B 2 24 ? 11.265  1.119   1.300   1.00 0.00 ? 24 PHE B C    3  
ATOM 2236  O O    . PHE B 2 24 ? 11.357  1.099   2.511   1.00 0.00 ? 24 PHE B O    3  
ATOM 2237  C CB   . PHE B 2 24 ? 9.301   -0.410  1.067   1.00 0.00 ? 24 PHE B CB   3  
ATOM 2238  C CG   . PHE B 2 24 ? 7.936   -0.151  1.663   1.00 0.00 ? 24 PHE B CG   3  
ATOM 2239  C CD1  . PHE B 2 24 ? 7.099   0.824   1.104   1.00 0.00 ? 24 PHE B CD1  3  
ATOM 2240  C CD2  . PHE B 2 24 ? 7.508   -0.885  2.776   1.00 0.00 ? 24 PHE B CD2  3  
ATOM 2241  C CE1  . PHE B 2 24 ? 5.837   1.065   1.660   1.00 0.00 ? 24 PHE B CE1  3  
ATOM 2242  C CE2  . PHE B 2 24 ? 6.245   -0.643  3.331   1.00 0.00 ? 24 PHE B CE2  3  
ATOM 2243  C CZ   . PHE B 2 24 ? 5.410   0.331   2.773   1.00 0.00 ? 24 PHE B CZ   3  
ATOM 2244  H H    . PHE B 2 24 ? 10.438  0.067   -1.313  1.00 0.00 ? 24 PHE B H    3  
ATOM 2245  H HA   . PHE B 2 24 ? 9.254   1.726   0.860   1.00 0.00 ? 24 PHE B HA   3  
ATOM 2246  H HB2  . PHE B 2 24 ? 9.207   -1.079  0.224   1.00 0.00 ? 24 PHE B HB2  3  
ATOM 2247  H HB3  . PHE B 2 24 ? 9.938   -0.861  1.813   1.00 0.00 ? 24 PHE B HB3  3  
ATOM 2248  H HD1  . PHE B 2 24 ? 7.427   1.390   0.245   1.00 0.00 ? 24 PHE B HD1  3  
ATOM 2249  H HD2  . PHE B 2 24 ? 8.150   -1.637  3.207   1.00 0.00 ? 24 PHE B HD2  3  
ATOM 2250  H HE1  . PHE B 2 24 ? 5.192   1.817   1.230   1.00 0.00 ? 24 PHE B HE1  3  
ATOM 2251  H HE2  . PHE B 2 24 ? 5.916   -1.209  4.189   1.00 0.00 ? 24 PHE B HE2  3  
ATOM 2252  H HZ   . PHE B 2 24 ? 4.437   0.517   3.202   1.00 0.00 ? 24 PHE B HZ   3  
ATOM 2253  N N    . PHE B 2 25 ? 12.311  1.319   0.545   1.00 0.00 ? 25 PHE B N    3  
ATOM 2254  C CA   . PHE B 2 25 ? 13.649  1.528   1.168   1.00 0.00 ? 25 PHE B CA   3  
ATOM 2255  C C    . PHE B 2 25 ? 13.984  3.021   1.160   1.00 0.00 ? 25 PHE B C    3  
ATOM 2256  O O    . PHE B 2 25 ? 13.521  3.766   0.319   1.00 0.00 ? 25 PHE B O    3  
ATOM 2257  C CB   . PHE B 2 25 ? 14.708  0.763   0.371   1.00 0.00 ? 25 PHE B CB   3  
ATOM 2258  C CG   . PHE B 2 25 ? 15.849  0.385   1.285   1.00 0.00 ? 25 PHE B CG   3  
ATOM 2259  C CD1  . PHE B 2 25 ? 16.852  1.318   1.575   1.00 0.00 ? 25 PHE B CD1  3  
ATOM 2260  C CD2  . PHE B 2 25 ? 15.904  -0.898  1.842   1.00 0.00 ? 25 PHE B CD2  3  
ATOM 2261  C CE1  . PHE B 2 25 ? 17.910  0.968   2.423   1.00 0.00 ? 25 PHE B CE1  3  
ATOM 2262  C CE2  . PHE B 2 25 ? 16.962  -1.248  2.690   1.00 0.00 ? 25 PHE B CE2  3  
ATOM 2263  C CZ   . PHE B 2 25 ? 17.965  -0.315  2.980   1.00 0.00 ? 25 PHE B CZ   3  
ATOM 2264  H H    . PHE B 2 25 ? 12.218  1.334   -0.430  1.00 0.00 ? 25 PHE B H    3  
ATOM 2265  H HA   . PHE B 2 25 ? 13.633  1.168   2.186   1.00 0.00 ? 25 PHE B HA   3  
ATOM 2266  H HB2  . PHE B 2 25 ? 14.268  -0.131  -0.045  1.00 0.00 ? 25 PHE B HB2  3  
ATOM 2267  H HB3  . PHE B 2 25 ? 15.079  1.388   -0.427  1.00 0.00 ? 25 PHE B HB3  3  
ATOM 2268  H HD1  . PHE B 2 25 ? 16.809  2.308   1.145   1.00 0.00 ? 25 PHE B HD1  3  
ATOM 2269  H HD2  . PHE B 2 25 ? 15.131  -1.617  1.619   1.00 0.00 ? 25 PHE B HD2  3  
ATOM 2270  H HE1  . PHE B 2 25 ? 18.683  1.688   2.646   1.00 0.00 ? 25 PHE B HE1  3  
ATOM 2271  H HE2  . PHE B 2 25 ? 17.005  -2.238  3.120   1.00 0.00 ? 25 PHE B HE2  3  
ATOM 2272  H HZ   . PHE B 2 25 ? 18.781  -0.585  3.634   1.00 0.00 ? 25 PHE B HZ   3  
ATOM 2273  N N    . TYR B 2 26 ? 14.783  3.466   2.091   1.00 0.00 ? 26 TYR B N    3  
ATOM 2274  C CA   . TYR B 2 26 ? 15.142  4.911   2.133   1.00 0.00 ? 26 TYR B CA   3  
ATOM 2275  C C    . TYR B 2 26 ? 16.231  5.197   1.090   1.00 0.00 ? 26 TYR B C    3  
ATOM 2276  O O    . TYR B 2 26 ? 17.238  4.517   1.053   1.00 0.00 ? 26 TYR B O    3  
ATOM 2277  C CB   . TYR B 2 26 ? 15.669  5.263   3.526   1.00 0.00 ? 26 TYR B CB   3  
ATOM 2278  C CG   . TYR B 2 26 ? 14.827  6.368   4.118   1.00 0.00 ? 26 TYR B CG   3  
ATOM 2279  C CD1  . TYR B 2 26 ? 13.586  6.070   4.693   1.00 0.00 ? 26 TYR B CD1  3  
ATOM 2280  C CD2  . TYR B 2 26 ? 15.287  7.690   4.090   1.00 0.00 ? 26 TYR B CD2  3  
ATOM 2281  C CE1  . TYR B 2 26 ? 12.805  7.094   5.242   1.00 0.00 ? 26 TYR B CE1  3  
ATOM 2282  C CE2  . TYR B 2 26 ? 14.506  8.714   4.638   1.00 0.00 ? 26 TYR B CE2  3  
ATOM 2283  C CZ   . TYR B 2 26 ? 13.265  8.416   5.214   1.00 0.00 ? 26 TYR B CZ   3  
ATOM 2284  O OH   . TYR B 2 26 ? 12.495  9.426   5.754   1.00 0.00 ? 26 TYR B OH   3  
ATOM 2285  H H    . TYR B 2 26 ? 15.145  2.850   2.762   1.00 0.00 ? 26 TYR B H    3  
ATOM 2286  H HA   . TYR B 2 26 ? 14.265  5.501   1.922   1.00 0.00 ? 26 TYR B HA   3  
ATOM 2287  H HB2  . TYR B 2 26 ? 15.618  4.391   4.161   1.00 0.00 ? 26 TYR B HB2  3  
ATOM 2288  H HB3  . TYR B 2 26 ? 16.694  5.594   3.450   1.00 0.00 ? 26 TYR B HB3  3  
ATOM 2289  H HD1  . TYR B 2 26 ? 13.232  5.050   4.715   1.00 0.00 ? 26 TYR B HD1  3  
ATOM 2290  H HD2  . TYR B 2 26 ? 16.244  7.919   3.645   1.00 0.00 ? 26 TYR B HD2  3  
ATOM 2291  H HE1  . TYR B 2 26 ? 11.848  6.864   5.686   1.00 0.00 ? 26 TYR B HE1  3  
ATOM 2292  H HE2  . TYR B 2 26 ? 14.860  9.734   4.616   1.00 0.00 ? 26 TYR B HE2  3  
ATOM 2293  H HH   . TYR B 2 26 ? 12.397  10.112  5.090   1.00 0.00 ? 26 TYR B HH   3  
ATOM 2294  N N    . PRO B 2 27 ? 16.000  6.194   0.271   1.00 0.00 ? 27 PRO B N    3  
ATOM 2295  C CA   . PRO B 2 27 ? 16.952  6.588   -0.783  1.00 0.00 ? 27 PRO B CA   3  
ATOM 2296  C C    . PRO B 2 27 ? 18.099  7.410   -0.187  1.00 0.00 ? 27 PRO B C    3  
ATOM 2297  O O    . PRO B 2 27 ? 17.946  8.066   0.824   1.00 0.00 ? 27 PRO B O    3  
ATOM 2298  C CB   . PRO B 2 27 ? 16.106  7.443   -1.730  1.00 0.00 ? 27 PRO B CB   3  
ATOM 2299  C CG   . PRO B 2 27 ? 14.907  7.959   -0.898  1.00 0.00 ? 27 PRO B CG   3  
ATOM 2300  C CD   . PRO B 2 27 ? 14.775  7.019   0.315   1.00 0.00 ? 27 PRO B CD   3  
ATOM 2301  H HA   . PRO B 2 27 ? 17.329  5.723   -1.302  1.00 0.00 ? 27 PRO B HA   3  
ATOM 2302  H HB2  . PRO B 2 27 ? 16.691  8.275   -2.100  1.00 0.00 ? 27 PRO B HB2  3  
ATOM 2303  H HB3  . PRO B 2 27 ? 15.747  6.844   -2.552  1.00 0.00 ? 27 PRO B HB3  3  
ATOM 2304  H HG2  . PRO B 2 27 ? 15.095  8.971   -0.568  1.00 0.00 ? 27 PRO B HG2  3  
ATOM 2305  H HG3  . PRO B 2 27 ? 14.004  7.922   -1.487  1.00 0.00 ? 27 PRO B HG3  3  
ATOM 2306  H HD2  . PRO B 2 27 ? 14.733  7.591   1.232   1.00 0.00 ? 27 PRO B HD2  3  
ATOM 2307  H HD3  . PRO B 2 27 ? 13.902  6.394   0.216   1.00 0.00 ? 27 PRO B HD3  3  
ATOM 2308  N N    . THR B 2 28 ? 19.246  7.382   -0.808  1.00 0.00 ? 28 THR B N    3  
ATOM 2309  C CA   . THR B 2 28 ? 20.400  8.163   -0.280  1.00 0.00 ? 28 THR B CA   3  
ATOM 2310  C C    . THR B 2 28 ? 20.503  7.963   1.233   1.00 0.00 ? 28 THR B C    3  
ATOM 2311  O O    . THR B 2 28 ? 19.980  8.739   2.009   1.00 0.00 ? 28 THR B O    3  
ATOM 2312  C CB   . THR B 2 28 ? 20.191  9.648   -0.585  1.00 0.00 ? 28 THR B CB   3  
ATOM 2313  O OG1  . THR B 2 28 ? 20.295  9.861   -1.985  1.00 0.00 ? 28 THR B OG1  3  
ATOM 2314  C CG2  . THR B 2 28 ? 21.255  10.474  0.140   1.00 0.00 ? 28 THR B CG2  3  
ATOM 2315  H H    . THR B 2 28 ? 19.349  6.848   -1.624  1.00 0.00 ? 28 THR B H    3  
ATOM 2316  H HA   . THR B 2 28 ? 21.310  7.823   -0.751  1.00 0.00 ? 28 THR B HA   3  
ATOM 2317  H HB   . THR B 2 28 ? 19.213  9.952   -0.245  1.00 0.00 ? 28 THR B HB   3  
ATOM 2318  H HG1  . THR B 2 28 ? 19.477  9.566   -2.392  1.00 0.00 ? 28 THR B HG1  3  
ATOM 2319  H HG21 . THR B 2 28 ? 21.119  10.380  1.207   1.00 0.00 ? 28 THR B HG21 3  
ATOM 2320  H HG22 . THR B 2 28 ? 21.161  11.512  -0.145  1.00 0.00 ? 28 THR B HG22 3  
ATOM 2321  H HG23 . THR B 2 28 ? 22.237  10.114  -0.131  1.00 0.00 ? 28 THR B HG23 3  
ATOM 2322  N N    . LYS B 2 29 ? 21.175  6.929   1.660   1.00 0.00 ? 29 LYS B N    3  
ATOM 2323  C CA   . LYS B 2 29 ? 21.312  6.682   3.123   1.00 0.00 ? 29 LYS B CA   3  
ATOM 2324  C C    . LYS B 2 29 ? 22.593  7.344   3.632   1.00 0.00 ? 29 LYS B C    3  
ATOM 2325  O O    . LYS B 2 29 ? 23.683  7.027   3.198   1.00 0.00 ? 29 LYS B O    3  
ATOM 2326  C CB   . LYS B 2 29 ? 21.377  5.176   3.383   1.00 0.00 ? 29 LYS B CB   3  
ATOM 2327  C CG   . LYS B 2 29 ? 20.689  4.857   4.712   1.00 0.00 ? 29 LYS B CG   3  
ATOM 2328  C CD   . LYS B 2 29 ? 21.742  4.477   5.755   1.00 0.00 ? 29 LYS B CD   3  
ATOM 2329  C CE   . LYS B 2 29 ? 21.170  3.412   6.693   1.00 0.00 ? 29 LYS B CE   3  
ATOM 2330  N NZ   . LYS B 2 29 ? 20.028  3.986   7.458   1.00 0.00 ? 29 LYS B NZ   3  
ATOM 2331  H H    . LYS B 2 29 ? 21.590  6.315   1.018   1.00 0.00 ? 29 LYS B H    3  
ATOM 2332  H HA   . LYS B 2 29 ? 20.461  7.100   3.640   1.00 0.00 ? 29 LYS B HA   3  
ATOM 2333  H HB2  . LYS B 2 29 ? 20.878  4.650   2.582   1.00 0.00 ? 29 LYS B HB2  3  
ATOM 2334  H HB3  . LYS B 2 29 ? 22.410  4.863   3.431   1.00 0.00 ? 29 LYS B HB3  3  
ATOM 2335  H HG2  . LYS B 2 29 ? 20.142  5.725   5.051   1.00 0.00 ? 29 LYS B HG2  3  
ATOM 2336  H HG3  . LYS B 2 29 ? 20.007  4.032   4.575   1.00 0.00 ? 29 LYS B HG3  3  
ATOM 2337  H HD2  . LYS B 2 29 ? 22.617  4.087   5.257   1.00 0.00 ? 29 LYS B HD2  3  
ATOM 2338  H HD3  . LYS B 2 29 ? 22.013  5.351   6.328   1.00 0.00 ? 29 LYS B HD3  3  
ATOM 2339  H HE2  . LYS B 2 29 ? 20.828  2.568   6.113   1.00 0.00 ? 29 LYS B HE2  3  
ATOM 2340  H HE3  . LYS B 2 29 ? 21.938  3.089   7.381   1.00 0.00 ? 29 LYS B HE3  3  
ATOM 2341  H HZ1  . LYS B 2 29 ? 19.491  3.218   7.909   1.00 0.00 ? 29 LYS B HZ1  3  
ATOM 2342  H HZ2  . LYS B 2 29 ? 19.406  4.511   6.810   1.00 0.00 ? 29 LYS B HZ2  3  
ATOM 2343  H HZ3  . LYS B 2 29 ? 20.389  4.629   8.191   1.00 0.00 ? 29 LYS B HZ3  3  
ATOM 2344  N N    . THR B 2 30 ? 22.473  8.264   4.550   1.00 0.00 ? 30 THR B N    3  
ATOM 2345  C CA   . THR B 2 30 ? 23.684  8.947   5.085   1.00 0.00 ? 30 THR B CA   3  
ATOM 2346  C C    . THR B 2 30 ? 24.321  9.793   3.981   1.00 0.00 ? 30 THR B C    3  
ATOM 2347  O O    . THR B 2 30 ? 25.496  9.597   3.715   1.00 0.00 ? 30 THR B O    3  
ATOM 2348  C CB   . THR B 2 30 ? 24.690  7.898   5.568   1.00 0.00 ? 30 THR B CB   3  
ATOM 2349  O OG1  . THR B 2 30 ? 24.030  6.650   5.725   1.00 0.00 ? 30 THR B OG1  3  
ATOM 2350  C CG2  . THR B 2 30 ? 25.283  8.337   6.907   1.00 0.00 ? 30 THR B CG2  3  
ATOM 2351  O OXT  . THR B 2 30 ? 23.624  10.622  3.421   1.00 0.00 ? 30 THR B OXT  3  
ATOM 2352  H H    . THR B 2 30 ? 21.585  8.507   4.887   1.00 0.00 ? 30 THR B H    3  
ATOM 2353  H HA   . THR B 2 30 ? 23.404  9.584   5.911   1.00 0.00 ? 30 THR B HA   3  
ATOM 2354  H HB   . THR B 2 30 ? 25.483  7.798   4.843   1.00 0.00 ? 30 THR B HB   3  
ATOM 2355  H HG1  . THR B 2 30 ? 24.637  5.957   5.454   1.00 0.00 ? 30 THR B HG1  3  
ATOM 2356  H HG21 . THR B 2 30 ? 26.355  8.431   6.813   1.00 0.00 ? 30 THR B HG21 3  
ATOM 2357  H HG22 . THR B 2 30 ? 25.052  7.600   7.662   1.00 0.00 ? 30 THR B HG22 3  
ATOM 2358  H HG23 . THR B 2 30 ? 24.862  9.289   7.193   1.00 0.00 ? 30 THR B HG23 3  
ATOM 2359  N N    . GLY A 1 1  ? -2.694  8.344   9.359   1.00 0.00 ? 1  GLY A N    4  
ATOM 2360  C CA   . GLY A 1 1  ? -2.054  8.371   8.013   1.00 0.00 ? 1  GLY A CA   4  
ATOM 2361  C C    . GLY A 1 1  ? -3.106  8.084   6.941   1.00 0.00 ? 1  GLY A C    4  
ATOM 2362  O O    . GLY A 1 1  ? -4.285  7.995   7.223   1.00 0.00 ? 1  GLY A O    4  
ATOM 2363  H H1   . GLY A 1 1  ? -2.186  8.986   9.998   1.00 0.00 ? 1  GLY A H1   4  
ATOM 2364  H H2   . GLY A 1 1  ? -2.659  7.375   9.739   1.00 0.00 ? 1  GLY A H2   4  
ATOM 2365  H H3   . GLY A 1 1  ? -3.684  8.650   9.279   1.00 0.00 ? 1  GLY A H3   4  
ATOM 2366  H HA2  . GLY A 1 1  ? -1.620  9.346   7.842   1.00 0.00 ? 1  GLY A HA2  4  
ATOM 2367  H HA3  . GLY A 1 1  ? -1.282  7.618   7.966   1.00 0.00 ? 1  GLY A HA3  4  
ATOM 2368  N N    . ILE A 1 2  ? -2.692  7.936   5.712   1.00 0.00 ? 2  ILE A N    4  
ATOM 2369  C CA   . ILE A 1 2  ? -3.671  7.654   4.625   1.00 0.00 ? 2  ILE A CA   4  
ATOM 2370  C C    . ILE A 1 2  ? -4.331  6.297   4.874   1.00 0.00 ? 2  ILE A C    4  
ATOM 2371  O O    . ILE A 1 2  ? -5.471  6.074   4.517   1.00 0.00 ? 2  ILE A O    4  
ATOM 2372  C CB   . ILE A 1 2  ? -2.948  7.632   3.277   1.00 0.00 ? 2  ILE A CB   4  
ATOM 2373  C CG1  . ILE A 1 2  ? -1.793  6.629   3.335   1.00 0.00 ? 2  ILE A CG1  4  
ATOM 2374  C CG2  . ILE A 1 2  ? -2.396  9.025   2.971   1.00 0.00 ? 2  ILE A CG2  4  
ATOM 2375  C CD1  . ILE A 1 2  ? -1.491  6.117   1.925   1.00 0.00 ? 2  ILE A CD1  4  
ATOM 2376  H H    . ILE A 1 2  ? -1.736  8.010   5.504   1.00 0.00 ? 2  ILE A H    4  
ATOM 2377  H HA   . ILE A 1 2  ? -4.428  8.424   4.615   1.00 0.00 ? 2  ILE A HA   4  
ATOM 2378  H HB   . ILE A 1 2  ? -3.642  7.341   2.502   1.00 0.00 ? 2  ILE A HB   4  
ATOM 2379  H HG12 . ILE A 1 2  ? -0.916  7.113   3.740   1.00 0.00 ? 2  ILE A HG12 4  
ATOM 2380  H HG13 . ILE A 1 2  ? -2.070  5.797   3.966   1.00 0.00 ? 2  ILE A HG13 4  
ATOM 2381  H HG21 . ILE A 1 2  ? -1.362  9.079   3.276   1.00 0.00 ? 2  ILE A HG21 4  
ATOM 2382  H HG22 . ILE A 1 2  ? -2.969  9.766   3.509   1.00 0.00 ? 2  ILE A HG22 4  
ATOM 2383  H HG23 . ILE A 1 2  ? -2.468  9.215   1.910   1.00 0.00 ? 2  ILE A HG23 4  
ATOM 2384  H HD11 . ILE A 1 2  ? -1.208  6.947   1.294   1.00 0.00 ? 2  ILE A HD11 4  
ATOM 2385  H HD12 . ILE A 1 2  ? -2.370  5.639   1.520   1.00 0.00 ? 2  ILE A HD12 4  
ATOM 2386  H HD13 . ILE A 1 2  ? -0.681  5.405   1.967   1.00 0.00 ? 2  ILE A HD13 4  
ATOM 2387  N N    . VAL A 1 3  ? -3.623  5.389   5.485   1.00 0.00 ? 3  VAL A N    4  
ATOM 2388  C CA   . VAL A 1 3  ? -4.198  4.051   5.761   1.00 0.00 ? 3  VAL A CA   4  
ATOM 2389  C C    . VAL A 1 3  ? -5.316  4.189   6.800   1.00 0.00 ? 3  VAL A C    4  
ATOM 2390  O O    . VAL A 1 3  ? -6.364  3.584   6.684   1.00 0.00 ? 3  VAL A O    4  
ATOM 2391  C CB   . VAL A 1 3  ? -3.076  3.146   6.286   1.00 0.00 ? 3  VAL A CB   4  
ATOM 2392  C CG1  . VAL A 1 3  ? -3.655  2.039   7.162   1.00 0.00 ? 3  VAL A CG1  4  
ATOM 2393  C CG2  . VAL A 1 3  ? -2.337  2.519   5.102   1.00 0.00 ? 3  VAL A CG2  4  
ATOM 2394  H H    . VAL A 1 3  ? -2.708  5.586   5.768   1.00 0.00 ? 3  VAL A H    4  
ATOM 2395  H HA   . VAL A 1 3  ? -4.600  3.638   4.851   1.00 0.00 ? 3  VAL A HA   4  
ATOM 2396  H HB   . VAL A 1 3  ? -2.384  3.736   6.869   1.00 0.00 ? 3  VAL A HB   4  
ATOM 2397  H HG11 . VAL A 1 3  ? -3.801  2.416   8.163   1.00 0.00 ? 3  VAL A HG11 4  
ATOM 2398  H HG12 . VAL A 1 3  ? -2.969  1.206   7.185   1.00 0.00 ? 3  VAL A HG12 4  
ATOM 2399  H HG13 . VAL A 1 3  ? -4.601  1.719   6.754   1.00 0.00 ? 3  VAL A HG13 4  
ATOM 2400  H HG21 . VAL A 1 3  ? -2.897  2.692   4.195   1.00 0.00 ? 3  VAL A HG21 4  
ATOM 2401  H HG22 . VAL A 1 3  ? -2.232  1.457   5.264   1.00 0.00 ? 3  VAL A HG22 4  
ATOM 2402  H HG23 . VAL A 1 3  ? -1.358  2.968   5.011   1.00 0.00 ? 3  VAL A HG23 4  
ATOM 2403  N N    . GLU A 1 4  ? -5.098  4.979   7.812   1.00 0.00 ? 4  GLU A N    4  
ATOM 2404  C CA   . GLU A 1 4  ? -6.143  5.156   8.861   1.00 0.00 ? 4  GLU A CA   4  
ATOM 2405  C C    . GLU A 1 4  ? -7.370  5.840   8.254   1.00 0.00 ? 4  GLU A C    4  
ATOM 2406  O O    . GLU A 1 4  ? -8.496  5.505   8.563   1.00 0.00 ? 4  GLU A O    4  
ATOM 2407  C CB   . GLU A 1 4  ? -5.586  6.018   9.995   1.00 0.00 ? 4  GLU A CB   4  
ATOM 2408  C CG   . GLU A 1 4  ? -5.243  5.129   11.192  1.00 0.00 ? 4  GLU A CG   4  
ATOM 2409  C CD   . GLU A 1 4  ? -3.724  5.060   11.359  1.00 0.00 ? 4  GLU A CD   4  
ATOM 2410  O OE1  . GLU A 1 4  ? -3.068  4.587   10.446  1.00 0.00 ? 4  GLU A OE1  4  
ATOM 2411  O OE2  . GLU A 1 4  ? -3.242  5.483   12.398  1.00 0.00 ? 4  GLU A OE2  4  
ATOM 2412  H H    . GLU A 1 4  ? -4.246  5.454   7.884   1.00 0.00 ? 4  GLU A H    4  
ATOM 2413  H HA   . GLU A 1 4  ? -6.428  4.192   9.249   1.00 0.00 ? 4  GLU A HA   4  
ATOM 2414  H HB2  . GLU A 1 4  ? -4.695  6.527   9.656   1.00 0.00 ? 4  GLU A HB2  4  
ATOM 2415  H HB3  . GLU A 1 4  ? -6.326  6.747   10.291  1.00 0.00 ? 4  GLU A HB3  4  
ATOM 2416  H HG2  . GLU A 1 4  ? -5.686  5.543   12.086  1.00 0.00 ? 4  GLU A HG2  4  
ATOM 2417  H HG3  . GLU A 1 4  ? -5.630  4.135   11.025  1.00 0.00 ? 4  GLU A HG3  4  
ATOM 2418  N N    . GLN A 1 5  ? -7.160  6.796   7.395   1.00 0.00 ? 5  GLN A N    4  
ATOM 2419  C CA   . GLN A 1 5  ? -8.314  7.503   6.769   1.00 0.00 ? 5  GLN A CA   4  
ATOM 2420  C C    . GLN A 1 5  ? -8.859  6.664   5.612   1.00 0.00 ? 5  GLN A C    4  
ATOM 2421  O O    . GLN A 1 5  ? -10.052 6.586   5.395   1.00 0.00 ? 5  GLN A O    4  
ATOM 2422  C CB   . GLN A 1 5  ? -7.856  8.864   6.241   1.00 0.00 ? 5  GLN A CB   4  
ATOM 2423  C CG   . GLN A 1 5  ? -8.997  9.523   5.463   1.00 0.00 ? 5  GLN A CG   4  
ATOM 2424  C CD   . GLN A 1 5  ? -8.474  10.023  4.115   1.00 0.00 ? 5  GLN A CD   4  
ATOM 2425  O OE1  . GLN A 1 5  ? -8.807  11.110  3.687   1.00 0.00 ? 5  GLN A OE1  4  
ATOM 2426  N NE2  . GLN A 1 5  ? -7.663  9.270   3.424   1.00 0.00 ? 5  GLN A NE2  4  
ATOM 2427  H H    . GLN A 1 5  ? -6.244  7.050   7.160   1.00 0.00 ? 5  GLN A H    4  
ATOM 2428  H HA   . GLN A 1 5  ? -9.090  7.645   7.505   1.00 0.00 ? 5  GLN A HA   4  
ATOM 2429  H HB2  . GLN A 1 5  ? -7.574  9.495   7.072   1.00 0.00 ? 5  GLN A HB2  4  
ATOM 2430  H HB3  . GLN A 1 5  ? -7.007  8.730   5.587   1.00 0.00 ? 5  GLN A HB3  4  
ATOM 2431  H HG2  . GLN A 1 5  ? -9.784  8.801   5.300   1.00 0.00 ? 5  GLN A HG2  4  
ATOM 2432  H HG3  . GLN A 1 5  ? -9.384  10.357  6.029   1.00 0.00 ? 5  GLN A HG3  4  
ATOM 2433  H HE21 . GLN A 1 5  ? -7.394  8.393   3.770   1.00 0.00 ? 5  GLN A HE21 4  
ATOM 2434  H HE22 . GLN A 1 5  ? -7.323  9.581   2.560   1.00 0.00 ? 5  GLN A HE22 4  
ATOM 2435  N N    . CYS A 1 6  ? -7.992  6.037   4.870   1.00 0.00 ? 6  CYS A N    4  
ATOM 2436  C CA   . CYS A 1 6  ? -8.452  5.200   3.725   1.00 0.00 ? 6  CYS A CA   4  
ATOM 2437  C C    . CYS A 1 6  ? -8.836  3.806   4.233   1.00 0.00 ? 6  CYS A C    4  
ATOM 2438  O O    . CYS A 1 6  ? -9.274  2.959   3.480   1.00 0.00 ? 6  CYS A O    4  
ATOM 2439  C CB   . CYS A 1 6  ? -7.320  5.085   2.701   1.00 0.00 ? 6  CYS A CB   4  
ATOM 2440  S SG   . CYS A 1 6  ? -7.780  3.910   1.402   1.00 0.00 ? 6  CYS A SG   4  
ATOM 2441  H H    . CYS A 1 6  ? -7.035  6.116   5.066   1.00 0.00 ? 6  CYS A H    4  
ATOM 2442  H HA   . CYS A 1 6  ? -9.311  5.664   3.263   1.00 0.00 ? 6  CYS A HA   4  
ATOM 2443  H HB2  . CYS A 1 6  ? -7.136  6.053   2.258   1.00 0.00 ? 6  CYS A HB2  4  
ATOM 2444  H HB3  . CYS A 1 6  ? -6.423  4.741   3.195   1.00 0.00 ? 6  CYS A HB3  4  
ATOM 2445  N N    . CYS A 1 7  ? -8.678  3.561   5.506   1.00 0.00 ? 7  CYS A N    4  
ATOM 2446  C CA   . CYS A 1 7  ? -9.035  2.222   6.058   1.00 0.00 ? 7  CYS A CA   4  
ATOM 2447  C C    . CYS A 1 7  ? -10.372 1.766   5.471   1.00 0.00 ? 7  CYS A C    4  
ATOM 2448  O O    . CYS A 1 7  ? -10.594 0.592   5.251   1.00 0.00 ? 7  CYS A O    4  
ATOM 2449  C CB   . CYS A 1 7  ? -9.154  2.310   7.580   1.00 0.00 ? 7  CYS A CB   4  
ATOM 2450  S SG   . CYS A 1 7  ? -9.721  0.719   8.229   1.00 0.00 ? 7  CYS A SG   4  
ATOM 2451  H H    . CYS A 1 7  ? -8.325  4.256   6.100   1.00 0.00 ? 7  CYS A H    4  
ATOM 2452  H HA   . CYS A 1 7  ? -8.266  1.510   5.798   1.00 0.00 ? 7  CYS A HA   4  
ATOM 2453  H HB2  . CYS A 1 7  ? -8.190  2.549   8.004   1.00 0.00 ? 7  CYS A HB2  4  
ATOM 2454  H HB3  . CYS A 1 7  ? -9.864  3.080   7.842   1.00 0.00 ? 7  CYS A HB3  4  
ATOM 2455  N N    . THR A 1 8  ? -11.265 2.683   5.219   1.00 0.00 ? 8  THR A N    4  
ATOM 2456  C CA   . THR A 1 8  ? -12.586 2.299   4.648   1.00 0.00 ? 8  THR A CA   4  
ATOM 2457  C C    . THR A 1 8  ? -12.371 1.431   3.407   1.00 0.00 ? 8  THR A C    4  
ATOM 2458  O O    . THR A 1 8  ? -12.273 1.926   2.301   1.00 0.00 ? 8  THR A O    4  
ATOM 2459  C CB   . THR A 1 8  ? -13.361 3.561   4.261   1.00 0.00 ? 8  THR A CB   4  
ATOM 2460  O OG1  . THR A 1 8  ? -12.618 4.293   3.296   1.00 0.00 ? 8  THR A OG1  4  
ATOM 2461  C CG2  . THR A 1 8  ? -13.584 4.426   5.502   1.00 0.00 ? 8  THR A CG2  4  
ATOM 2462  H H    . THR A 1 8  ? -11.066 3.625   5.405   1.00 0.00 ? 8  THR A H    4  
ATOM 2463  H HA   . THR A 1 8  ? -13.148 1.743   5.383   1.00 0.00 ? 8  THR A HA   4  
ATOM 2464  H HB   . THR A 1 8  ? -14.317 3.283   3.844   1.00 0.00 ? 8  THR A HB   4  
ATOM 2465  H HG1  . THR A 1 8  ? -13.201 4.950   2.908   1.00 0.00 ? 8  THR A HG1  4  
ATOM 2466  H HG21 . THR A 1 8  ? -13.373 3.846   6.388   1.00 0.00 ? 8  THR A HG21 4  
ATOM 2467  H HG22 . THR A 1 8  ? -14.610 4.762   5.527   1.00 0.00 ? 8  THR A HG22 4  
ATOM 2468  H HG23 . THR A 1 8  ? -12.926 5.282   5.467   1.00 0.00 ? 8  THR A HG23 4  
ATOM 2469  N N    . SER A 1 9  ? -12.294 0.140   3.580   1.00 0.00 ? 9  SER A N    4  
ATOM 2470  C CA   . SER A 1 9  ? -12.082 -0.757  2.410   1.00 0.00 ? 9  SER A CA   4  
ATOM 2471  C C    . SER A 1 9  ? -10.869 -0.274  1.612   1.00 0.00 ? 9  SER A C    4  
ATOM 2472  O O    . SER A 1 9  ? -9.905  0.215   2.168   1.00 0.00 ? 9  SER A O    4  
ATOM 2473  C CB   . SER A 1 9  ? -13.324 -0.733  1.520   1.00 0.00 ? 9  SER A CB   4  
ATOM 2474  O OG   . SER A 1 9  ? -14.470 -0.463  2.316   1.00 0.00 ? 9  SER A OG   4  
ATOM 2475  H H    . SER A 1 9  ? -12.374 -0.239  4.480   1.00 0.00 ? 9  SER A H    4  
ATOM 2476  H HA   . SER A 1 9  ? -11.907 -1.765  2.757   1.00 0.00 ? 9  SER A HA   4  
ATOM 2477  H HB2  . SER A 1 9  ? -13.219 0.039   0.775   1.00 0.00 ? 9  SER A HB2  4  
ATOM 2478  H HB3  . SER A 1 9  ? -13.430 -1.691  1.029   1.00 0.00 ? 9  SER A HB3  4  
ATOM 2479  H HG   . SER A 1 9  ? -14.464 0.471   2.538   1.00 0.00 ? 9  SER A HG   4  
ATOM 2480  N N    . ILE A 1 10 ? -10.905 -0.407  0.313   1.00 0.00 ? 10 ILE A N    4  
ATOM 2481  C CA   . ILE A 1 10 ? -9.750  0.044   -0.517  1.00 0.00 ? 10 ILE A CA   4  
ATOM 2482  C C    . ILE A 1 10 ? -10.142 1.320   -1.261  1.00 0.00 ? 10 ILE A C    4  
ATOM 2483  O O    . ILE A 1 10 ? -11.026 1.322   -2.094  1.00 0.00 ? 10 ILE A O    4  
ATOM 2484  C CB   . ILE A 1 10 ? -9.345  -1.076  -1.510  1.00 0.00 ? 10 ILE A CB   4  
ATOM 2485  C CG1  . ILE A 1 10 ? -8.970  -0.499  -2.889  1.00 0.00 ? 10 ILE A CG1  4  
ATOM 2486  C CG2  . ILE A 1 10 ? -10.507 -2.057  -1.691  1.00 0.00 ? 10 ILE A CG2  4  
ATOM 2487  C CD1  . ILE A 1 10 ? -7.686  0.330   -2.786  1.00 0.00 ? 10 ILE A CD1  4  
ATOM 2488  H H    . ILE A 1 10 ? -11.689 -0.804  -0.118  1.00 0.00 ? 10 ILE A H    4  
ATOM 2489  H HA   . ILE A 1 10 ? -8.914  0.263   0.132   1.00 0.00 ? 10 ILE A HA   4  
ATOM 2490  H HB   . ILE A 1 10 ? -8.496  -1.611  -1.106  1.00 0.00 ? 10 ILE A HB   4  
ATOM 2491  H HG12 . ILE A 1 10 ? -8.815  -1.311  -3.584  1.00 0.00 ? 10 ILE A HG12 4  
ATOM 2492  H HG13 . ILE A 1 10 ? -9.772  0.127   -3.246  1.00 0.00 ? 10 ILE A HG13 4  
ATOM 2493  H HG21 . ILE A 1 10 ? -10.197 -2.868  -2.333  1.00 0.00 ? 10 ILE A HG21 4  
ATOM 2494  H HG22 . ILE A 1 10 ? -11.345 -1.544  -2.139  1.00 0.00 ? 10 ILE A HG22 4  
ATOM 2495  H HG23 . ILE A 1 10 ? -10.799 -2.451  -0.729  1.00 0.00 ? 10 ILE A HG23 4  
ATOM 2496  H HD11 . ILE A 1 10 ? -7.071  -0.052  -1.986  1.00 0.00 ? 10 ILE A HD11 4  
ATOM 2497  H HD12 . ILE A 1 10 ? -7.938  1.362   -2.586  1.00 0.00 ? 10 ILE A HD12 4  
ATOM 2498  H HD13 . ILE A 1 10 ? -7.143  0.268   -3.719  1.00 0.00 ? 10 ILE A HD13 4  
ATOM 2499  N N    . CYS A 1 11 ? -9.479  2.403   -0.972  1.00 0.00 ? 11 CYS A N    4  
ATOM 2500  C CA   . CYS A 1 11 ? -9.801  3.672   -1.673  1.00 0.00 ? 11 CYS A CA   4  
ATOM 2501  C C    . CYS A 1 11 ? -8.768  3.862   -2.778  1.00 0.00 ? 11 CYS A C    4  
ATOM 2502  O O    . CYS A 1 11 ? -7.584  3.939   -2.518  1.00 0.00 ? 11 CYS A O    4  
ATOM 2503  C CB   . CYS A 1 11 ? -9.734  4.869   -0.706  1.00 0.00 ? 11 CYS A CB   4  
ATOM 2504  S SG   . CYS A 1 11 ? -9.725  4.310   1.021   1.00 0.00 ? 11 CYS A SG   4  
ATOM 2505  H H    . CYS A 1 11 ? -8.764  2.377   -0.304  1.00 0.00 ? 11 CYS A H    4  
ATOM 2506  H HA   . CYS A 1 11 ? -10.788 3.606   -2.107  1.00 0.00 ? 11 CYS A HA   4  
ATOM 2507  H HB2  . CYS A 1 11 ? -8.834  5.432   -0.900  1.00 0.00 ? 11 CYS A HB2  4  
ATOM 2508  H HB3  . CYS A 1 11 ? -10.592 5.505   -0.870  1.00 0.00 ? 11 CYS A HB3  4  
ATOM 2509  N N    . SER A 1 12 ? -9.209  3.936   -4.004  1.00 0.00 ? 12 SER A N    4  
ATOM 2510  C CA   . SER A 1 12 ? -8.267  4.112   -5.140  1.00 0.00 ? 12 SER A CA   4  
ATOM 2511  C C    . SER A 1 12 ? -6.978  3.331   -4.879  1.00 0.00 ? 12 SER A C    4  
ATOM 2512  O O    . SER A 1 12 ? -6.058  3.833   -4.270  1.00 0.00 ? 12 SER A O    4  
ATOM 2513  C CB   . SER A 1 12 ? -7.936  5.596   -5.299  1.00 0.00 ? 12 SER A CB   4  
ATOM 2514  O OG   . SER A 1 12 ? -8.993  6.241   -5.998  1.00 0.00 ? 12 SER A OG   4  
ATOM 2515  H H    . SER A 1 12 ? -10.166 3.870   -4.179  1.00 0.00 ? 12 SER A H    4  
ATOM 2516  H HA   . SER A 1 12 ? -8.728  3.750   -6.046  1.00 0.00 ? 12 SER A HA   4  
ATOM 2517  H HB2  . SER A 1 12 ? -7.826  6.049   -4.328  1.00 0.00 ? 12 SER A HB2  4  
ATOM 2518  H HB3  . SER A 1 12 ? -7.011  5.700   -5.850  1.00 0.00 ? 12 SER A HB3  4  
ATOM 2519  H HG   . SER A 1 12 ? -8.860  6.095   -6.937  1.00 0.00 ? 12 SER A HG   4  
ATOM 2520  N N    . LEU A 1 13 ? -6.884  2.116   -5.348  1.00 0.00 ? 13 LEU A N    4  
ATOM 2521  C CA   . LEU A 1 13 ? -5.624  1.358   -5.127  1.00 0.00 ? 13 LEU A CA   4  
ATOM 2522  C C    . LEU A 1 13 ? -4.503  2.237   -5.644  1.00 0.00 ? 13 LEU A C    4  
ATOM 2523  O O    . LEU A 1 13 ? -3.395  2.228   -5.146  1.00 0.00 ? 13 LEU A O    4  
ATOM 2524  C CB   . LEU A 1 13 ? -5.659  0.030   -5.894  1.00 0.00 ? 13 LEU A CB   4  
ATOM 2525  C CG   . LEU A 1 13 ? -5.967  0.289   -7.371  1.00 0.00 ? 13 LEU A CG   4  
ATOM 2526  C CD1  . LEU A 1 13 ? -5.256  -0.756  -8.232  1.00 0.00 ? 13 LEU A CD1  4  
ATOM 2527  C CD2  . LEU A 1 13 ? -7.477  0.191   -7.603  1.00 0.00 ? 13 LEU A CD2  4  
ATOM 2528  H H    . LEU A 1 13 ? -7.622  1.719   -5.851  1.00 0.00 ? 13 LEU A H    4  
ATOM 2529  H HA   . LEU A 1 13 ? -5.478  1.178   -4.073  1.00 0.00 ? 13 LEU A HA   4  
ATOM 2530  H HB2  . LEU A 1 13 ? -4.699  -0.458  -5.808  1.00 0.00 ? 13 LEU A HB2  4  
ATOM 2531  H HB3  . LEU A 1 13 ? -6.424  -0.606  -5.476  1.00 0.00 ? 13 LEU A HB3  4  
ATOM 2532  H HG   . LEU A 1 13 ? -5.622  1.275   -7.644  1.00 0.00 ? 13 LEU A HG   4  
ATOM 2533  H HD11 . LEU A 1 13 ? -5.988  -1.323  -8.787  1.00 0.00 ? 13 LEU A HD11 4  
ATOM 2534  H HD12 . LEU A 1 13 ? -4.692  -1.422  -7.596  1.00 0.00 ? 13 LEU A HD12 4  
ATOM 2535  H HD13 . LEU A 1 13 ? -4.587  -0.261  -8.919  1.00 0.00 ? 13 LEU A HD13 4  
ATOM 2536  H HD21 . LEU A 1 13 ? -7.869  1.167   -7.846  1.00 0.00 ? 13 LEU A HD21 4  
ATOM 2537  H HD22 . LEU A 1 13 ? -7.956  -0.176  -6.707  1.00 0.00 ? 13 LEU A HD22 4  
ATOM 2538  H HD23 . LEU A 1 13 ? -7.672  -0.489  -8.419  1.00 0.00 ? 13 LEU A HD23 4  
ATOM 2539  N N    . TYR A 1 14 ? -4.812  3.036   -6.621  1.00 0.00 ? 14 TYR A N    4  
ATOM 2540  C CA   . TYR A 1 14 ? -3.798  3.972   -7.163  1.00 0.00 ? 14 TYR A CA   4  
ATOM 2541  C C    . TYR A 1 14 ? -3.419  4.934   -6.041  1.00 0.00 ? 14 TYR A C    4  
ATOM 2542  O O    . TYR A 1 14 ? -2.287  5.359   -5.925  1.00 0.00 ? 14 TYR A O    4  
ATOM 2543  C CB   . TYR A 1 14 ? -4.390  4.755   -8.338  1.00 0.00 ? 14 TYR A CB   4  
ATOM 2544  C CG   . TYR A 1 14 ? -4.203  3.968   -9.613  1.00 0.00 ? 14 TYR A CG   4  
ATOM 2545  C CD1  . TYR A 1 14 ? -2.921  3.791   -10.145 1.00 0.00 ? 14 TYR A CD1  4  
ATOM 2546  C CD2  . TYR A 1 14 ? -5.313  3.416   -10.263 1.00 0.00 ? 14 TYR A CD2  4  
ATOM 2547  C CE1  . TYR A 1 14 ? -2.748  3.063   -11.328 1.00 0.00 ? 14 TYR A CE1  4  
ATOM 2548  C CE2  . TYR A 1 14 ? -5.141  2.687   -11.446 1.00 0.00 ? 14 TYR A CE2  4  
ATOM 2549  C CZ   . TYR A 1 14 ? -3.858  2.511   -11.978 1.00 0.00 ? 14 TYR A CZ   4  
ATOM 2550  O OH   . TYR A 1 14 ? -3.688  1.793   -13.145 1.00 0.00 ? 14 TYR A OH   4  
ATOM 2551  H H    . TYR A 1 14 ? -5.727  3.039   -6.970  1.00 0.00 ? 14 TYR A H    4  
ATOM 2552  H HA   . TYR A 1 14 ? -2.927  3.423   -7.486  1.00 0.00 ? 14 TYR A HA   4  
ATOM 2553  H HB2  . TYR A 1 14 ? -5.444  4.919   -8.166  1.00 0.00 ? 14 TYR A HB2  4  
ATOM 2554  H HB3  . TYR A 1 14 ? -3.887  5.706   -8.426  1.00 0.00 ? 14 TYR A HB3  4  
ATOM 2555  H HD1  . TYR A 1 14 ? -2.064  4.217   -9.643  1.00 0.00 ? 14 TYR A HD1  4  
ATOM 2556  H HD2  . TYR A 1 14 ? -6.303  3.552   -9.852  1.00 0.00 ? 14 TYR A HD2  4  
ATOM 2557  H HE1  . TYR A 1 14 ? -1.758  2.926   -11.738 1.00 0.00 ? 14 TYR A HE1  4  
ATOM 2558  H HE2  . TYR A 1 14 ? -5.997  2.261   -11.948 1.00 0.00 ? 14 TYR A HE2  4  
ATOM 2559  H HH   . TYR A 1 14 ? -3.659  2.416   -13.875 1.00 0.00 ? 14 TYR A HH   4  
ATOM 2560  N N    . GLN A 1 15 ? -4.363  5.258   -5.194  1.00 0.00 ? 15 GLN A N    4  
ATOM 2561  C CA   . GLN A 1 15 ? -4.060  6.169   -4.057  1.00 0.00 ? 15 GLN A CA   4  
ATOM 2562  C C    . GLN A 1 15 ? -3.132  5.435   -3.090  1.00 0.00 ? 15 GLN A C    4  
ATOM 2563  O O    . GLN A 1 15 ? -2.166  5.988   -2.601  1.00 0.00 ? 15 GLN A O    4  
ATOM 2564  C CB   . GLN A 1 15 ? -5.357  6.553   -3.340  1.00 0.00 ? 15 GLN A CB   4  
ATOM 2565  C CG   . GLN A 1 15 ? -5.892  7.863   -3.922  1.00 0.00 ? 15 GLN A CG   4  
ATOM 2566  C CD   . GLN A 1 15 ? -5.687  8.993   -2.911  1.00 0.00 ? 15 GLN A CD   4  
ATOM 2567  O OE1  . GLN A 1 15 ? -6.638  9.501   -2.350  1.00 0.00 ? 15 GLN A OE1  4  
ATOM 2568  N NE2  . GLN A 1 15 ? -4.478  9.410   -2.653  1.00 0.00 ? 15 GLN A NE2  4  
ATOM 2569  H H    . GLN A 1 15 ? -5.269  4.885   -5.297  1.00 0.00 ? 15 GLN A H    4  
ATOM 2570  H HA   . GLN A 1 15 ? -3.570  7.058   -4.426  1.00 0.00 ? 15 GLN A HA   4  
ATOM 2571  H HB2  . GLN A 1 15 ? -6.090  5.772   -3.476  1.00 0.00 ? 15 GLN A HB2  4  
ATOM 2572  H HB3  . GLN A 1 15 ? -5.160  6.684   -2.287  1.00 0.00 ? 15 GLN A HB3  4  
ATOM 2573  H HG2  . GLN A 1 15 ? -5.361  8.094   -4.834  1.00 0.00 ? 15 GLN A HG2  4  
ATOM 2574  H HG3  . GLN A 1 15 ? -6.945  7.759   -4.134  1.00 0.00 ? 15 GLN A HG3  4  
ATOM 2575  H HE21 . GLN A 1 15 ? -3.711  9.000   -3.106  1.00 0.00 ? 15 GLN A HE21 4  
ATOM 2576  H HE22 . GLN A 1 15 ? -4.337  10.133  -2.007  1.00 0.00 ? 15 GLN A HE22 4  
ATOM 2577  N N    . LEU A 1 16 ? -3.399  4.180   -2.831  1.00 0.00 ? 16 LEU A N    4  
ATOM 2578  C CA   . LEU A 1 16 ? -2.512  3.410   -1.924  1.00 0.00 ? 16 LEU A CA   4  
ATOM 2579  C C    . LEU A 1 16 ? -1.185  3.205   -2.646  1.00 0.00 ? 16 LEU A C    4  
ATOM 2580  O O    . LEU A 1 16 ? -0.124  3.463   -2.113  1.00 0.00 ? 16 LEU A O    4  
ATOM 2581  C CB   . LEU A 1 16 ? -3.148  2.054   -1.608  1.00 0.00 ? 16 LEU A CB   4  
ATOM 2582  C CG   . LEU A 1 16 ? -4.514  2.270   -0.955  1.00 0.00 ? 16 LEU A CG   4  
ATOM 2583  C CD1  . LEU A 1 16 ? -5.089  0.922   -0.516  1.00 0.00 ? 16 LEU A CD1  4  
ATOM 2584  C CD2  . LEU A 1 16 ? -4.358  3.178   0.266   1.00 0.00 ? 16 LEU A CD2  4  
ATOM 2585  H H    . LEU A 1 16 ? -4.167  3.741   -3.251  1.00 0.00 ? 16 LEU A H    4  
ATOM 2586  H HA   . LEU A 1 16 ? -2.350  3.964   -1.010  1.00 0.00 ? 16 LEU A HA   4  
ATOM 2587  H HB2  . LEU A 1 16 ? -3.270  1.492   -2.524  1.00 0.00 ? 16 LEU A HB2  4  
ATOM 2588  H HB3  . LEU A 1 16 ? -2.510  1.505   -0.932  1.00 0.00 ? 16 LEU A HB3  4  
ATOM 2589  H HG   . LEU A 1 16 ? -5.184  2.731   -1.667  1.00 0.00 ? 16 LEU A HG   4  
ATOM 2590  H HD11 . LEU A 1 16 ? -4.641  0.132   -1.101  1.00 0.00 ? 16 LEU A HD11 4  
ATOM 2591  H HD12 . LEU A 1 16 ? -6.159  0.920   -0.668  1.00 0.00 ? 16 LEU A HD12 4  
ATOM 2592  H HD13 . LEU A 1 16 ? -4.874  0.762   0.530   1.00 0.00 ? 16 LEU A HD13 4  
ATOM 2593  H HD21 . LEU A 1 16 ? -5.324  3.340   0.721   1.00 0.00 ? 16 LEU A HD21 4  
ATOM 2594  H HD22 . LEU A 1 16 ? -3.942  4.126   -0.041  1.00 0.00 ? 16 LEU A HD22 4  
ATOM 2595  H HD23 . LEU A 1 16 ? -3.697  2.710   0.981   1.00 0.00 ? 16 LEU A HD23 4  
ATOM 2596  N N    . GLU A 1 17 ? -1.244  2.764   -3.874  1.00 0.00 ? 17 GLU A N    4  
ATOM 2597  C CA   . GLU A 1 17 ? 0.009   2.567   -4.651  1.00 0.00 ? 17 GLU A CA   4  
ATOM 2598  C C    . GLU A 1 17 ? 0.702   3.921   -4.822  1.00 0.00 ? 17 GLU A C    4  
ATOM 2599  O O    . GLU A 1 17 ? 1.912   4.023   -4.776  1.00 0.00 ? 17 GLU A O    4  
ATOM 2600  C CB   . GLU A 1 17 ? -0.323  1.989   -6.031  1.00 0.00 ? 17 GLU A CB   4  
ATOM 2601  C CG   . GLU A 1 17 ? -1.243  0.776   -5.877  1.00 0.00 ? 17 GLU A CG   4  
ATOM 2602  C CD   . GLU A 1 17 ? -2.203  0.709   -7.065  1.00 0.00 ? 17 GLU A CD   4  
ATOM 2603  O OE1  . GLU A 1 17 ? -2.089  1.549   -7.942  1.00 0.00 ? 17 GLU A OE1  4  
ATOM 2604  O OE2  . GLU A 1 17 ? -3.036  -0.181  -7.077  1.00 0.00 ? 17 GLU A OE2  4  
ATOM 2605  H H    . GLU A 1 17 ? -2.117  2.577   -4.287  1.00 0.00 ? 17 GLU A H    4  
ATOM 2606  H HA   . GLU A 1 17 ? 0.659   1.893   -4.121  1.00 0.00 ? 17 GLU A HA   4  
ATOM 2607  H HB2  . GLU A 1 17 ? -0.818  2.743   -6.626  1.00 0.00 ? 17 GLU A HB2  4  
ATOM 2608  H HB3  . GLU A 1 17 ? 0.589   1.686   -6.522  1.00 0.00 ? 17 GLU A HB3  4  
ATOM 2609  H HG2  . GLU A 1 17 ? -0.648  -0.125  -5.844  1.00 0.00 ? 17 GLU A HG2  4  
ATOM 2610  H HG3  . GLU A 1 17 ? -1.810  0.866   -4.963  1.00 0.00 ? 17 GLU A HG3  4  
ATOM 2611  N N    . ASN A 1 18 ? -0.063  4.960   -5.019  1.00 0.00 ? 18 ASN A N    4  
ATOM 2612  C CA   . ASN A 1 18 ? 0.536   6.314   -5.196  1.00 0.00 ? 18 ASN A CA   4  
ATOM 2613  C C    . ASN A 1 18 ? 1.239   6.743   -3.906  1.00 0.00 ? 18 ASN A C    4  
ATOM 2614  O O    . ASN A 1 18 ? 2.088   7.613   -3.915  1.00 0.00 ? 18 ASN A O    4  
ATOM 2615  C CB   . ASN A 1 18 ? -0.568  7.319   -5.530  1.00 0.00 ? 18 ASN A CB   4  
ATOM 2616  C CG   . ASN A 1 18 ? -0.844  7.293   -7.035  1.00 0.00 ? 18 ASN A CG   4  
ATOM 2617  O OD1  . ASN A 1 18 ? -0.223  6.547   -7.765  1.00 0.00 ? 18 ASN A OD1  4  
ATOM 2618  N ND2  . ASN A 1 18 ? -1.758  8.081   -7.532  1.00 0.00 ? 18 ASN A ND2  4  
ATOM 2619  H H    . ASN A 1 18 ? -1.036  4.850   -5.052  1.00 0.00 ? 18 ASN A H    4  
ATOM 2620  H HA   . ASN A 1 18 ? 1.252   6.286   -6.003  1.00 0.00 ? 18 ASN A HA   4  
ATOM 2621  H HB2  . ASN A 1 18 ? -1.468  7.058   -4.993  1.00 0.00 ? 18 ASN A HB2  4  
ATOM 2622  H HB3  . ASN A 1 18 ? -0.251  8.311   -5.242  1.00 0.00 ? 18 ASN A HB3  4  
ATOM 2623  H HD21 . ASN A 1 18 ? -2.259  8.683   -6.943  1.00 0.00 ? 18 ASN A HD21 4  
ATOM 2624  H HD22 . ASN A 1 18 ? -1.943  8.072   -8.494  1.00 0.00 ? 18 ASN A HD22 4  
ATOM 2625  N N    . TYR A 1 19 ? 0.901   6.144   -2.796  1.00 0.00 ? 19 TYR A N    4  
ATOM 2626  C CA   . TYR A 1 19 ? 1.560   6.528   -1.520  1.00 0.00 ? 19 TYR A CA   4  
ATOM 2627  C C    . TYR A 1 19 ? 3.066   6.427   -1.705  1.00 0.00 ? 19 TYR A C    4  
ATOM 2628  O O    . TYR A 1 19 ? 3.789   7.394   -1.569  1.00 0.00 ? 19 TYR A O    4  
ATOM 2629  C CB   . TYR A 1 19 ? 1.125   5.570   -0.404  1.00 0.00 ? 19 TYR A CB   4  
ATOM 2630  C CG   . TYR A 1 19 ? 1.968   5.805   0.830   1.00 0.00 ? 19 TYR A CG   4  
ATOM 2631  C CD1  . TYR A 1 19 ? 2.617   7.032   1.016   1.00 0.00 ? 19 TYR A CD1  4  
ATOM 2632  C CD2  . TYR A 1 19 ? 2.094   4.796   1.792   1.00 0.00 ? 19 TYR A CD2  4  
ATOM 2633  C CE1  . TYR A 1 19 ? 3.391   7.249   2.162   1.00 0.00 ? 19 TYR A CE1  4  
ATOM 2634  C CE2  . TYR A 1 19 ? 2.869   5.013   2.938   1.00 0.00 ? 19 TYR A CE2  4  
ATOM 2635  C CZ   . TYR A 1 19 ? 3.517   6.240   3.123   1.00 0.00 ? 19 TYR A CZ   4  
ATOM 2636  O OH   . TYR A 1 19 ? 4.279   6.454   4.253   1.00 0.00 ? 19 TYR A OH   4  
ATOM 2637  H H    . TYR A 1 19 ? 0.223   5.440   -2.804  1.00 0.00 ? 19 TYR A H    4  
ATOM 2638  H HA   . TYR A 1 19 ? 1.289   7.540   -1.259  1.00 0.00 ? 19 TYR A HA   4  
ATOM 2639  H HB2  . TYR A 1 19 ? 0.086   5.741   -0.167  1.00 0.00 ? 19 TYR A HB2  4  
ATOM 2640  H HB3  . TYR A 1 19 ? 1.255   4.550   -0.736  1.00 0.00 ? 19 TYR A HB3  4  
ATOM 2641  H HD1  . TYR A 1 19 ? 2.523   7.809   0.273   1.00 0.00 ? 19 TYR A HD1  4  
ATOM 2642  H HD2  . TYR A 1 19 ? 1.596   3.849   1.649   1.00 0.00 ? 19 TYR A HD2  4  
ATOM 2643  H HE1  . TYR A 1 19 ? 3.891   8.196   2.304   1.00 0.00 ? 19 TYR A HE1  4  
ATOM 2644  H HE2  . TYR A 1 19 ? 2.965   4.234   3.680   1.00 0.00 ? 19 TYR A HE2  4  
ATOM 2645  H HH   . TYR A 1 19 ? 3.972   7.263   4.670   1.00 0.00 ? 19 TYR A HH   4  
ATOM 2646  N N    . CYS A 1 20 ? 3.530   5.253   -2.025  1.00 0.00 ? 20 CYS A N    4  
ATOM 2647  C CA   . CYS A 1 20 ? 4.989   5.041   -2.236  1.00 0.00 ? 20 CYS A CA   4  
ATOM 2648  C C    . CYS A 1 20 ? 5.794   5.871   -1.235  1.00 0.00 ? 20 CYS A C    4  
ATOM 2649  O O    . CYS A 1 20 ? 5.296   6.277   -0.203  1.00 0.00 ? 20 CYS A O    4  
ATOM 2650  C CB   . CYS A 1 20 ? 5.365   5.445   -3.662  1.00 0.00 ? 20 CYS A CB   4  
ATOM 2651  S SG   . CYS A 1 20 ? 6.480   4.201   -4.363  1.00 0.00 ? 20 CYS A SG   4  
ATOM 2652  H H    . CYS A 1 20 ? 2.905   4.503   -2.133  1.00 0.00 ? 20 CYS A H    4  
ATOM 2653  H HA   . CYS A 1 20 ? 5.217   4.000   -2.091  1.00 0.00 ? 20 CYS A HA   4  
ATOM 2654  H HB2  . CYS A 1 20 ? 4.472   5.510   -4.266  1.00 0.00 ? 20 CYS A HB2  4  
ATOM 2655  H HB3  . CYS A 1 20 ? 5.861   6.404   -3.646  1.00 0.00 ? 20 CYS A HB3  4  
ATOM 2656  N N    . ASN A 1 21 ? 7.039   6.120   -1.530  1.00 0.00 ? 21 ASN A N    4  
ATOM 2657  C CA   . ASN A 1 21 ? 7.881   6.920   -0.597  1.00 0.00 ? 21 ASN A CA   4  
ATOM 2658  C C    . ASN A 1 21 ? 9.191   7.299   -1.291  1.00 0.00 ? 21 ASN A C    4  
ATOM 2659  O O    . ASN A 1 21 ? 9.601   8.440   -1.156  1.00 0.00 ? 21 ASN A O    4  
ATOM 2660  C CB   . ASN A 1 21 ? 8.187   6.090   0.651   1.00 0.00 ? 21 ASN A CB   4  
ATOM 2661  C CG   . ASN A 1 21 ? 8.395   7.021   1.847   1.00 0.00 ? 21 ASN A CG   4  
ATOM 2662  O OD1  . ASN A 1 21 ? 8.409   8.227   1.698   1.00 0.00 ? 21 ASN A OD1  4  
ATOM 2663  N ND2  . ASN A 1 21 ? 8.557   6.509   3.036   1.00 0.00 ? 21 ASN A ND2  4  
ATOM 2664  O OXT  . ASN A 1 21 ? 9.761   6.442   -1.946  1.00 0.00 ? 21 ASN A OXT  4  
ATOM 2665  H H    . ASN A 1 21 ? 7.420   5.777   -2.365  1.00 0.00 ? 21 ASN A H    4  
ATOM 2666  H HA   . ASN A 1 21 ? 7.351   7.817   -0.313  1.00 0.00 ? 21 ASN A HA   4  
ATOM 2667  H HB2  . ASN A 1 21 ? 7.360   5.424   0.851   1.00 0.00 ? 21 ASN A HB2  4  
ATOM 2668  H HB3  . ASN A 1 21 ? 9.084   5.512   0.488   1.00 0.00 ? 21 ASN A HB3  4  
ATOM 2669  H HD21 . ASN A 1 21 ? 8.545   5.536   3.156   1.00 0.00 ? 21 ASN A HD21 4  
ATOM 2670  H HD22 . ASN A 1 21 ? 8.690   7.096   3.809   1.00 0.00 ? 21 ASN A HD22 4  
ATOM 2671  N N    . PHE B 2 1  ? -12.901 -4.589  -11.483 1.00 0.00 ? 1  PHE B N    4  
ATOM 2672  C CA   . PHE B 2 1  ? -11.861 -4.744  -10.428 1.00 0.00 ? 1  PHE B CA   4  
ATOM 2673  C C    . PHE B 2 1  ? -12.505 -5.300  -9.156  1.00 0.00 ? 1  PHE B C    4  
ATOM 2674  O O    . PHE B 2 1  ? -13.709 -5.273  -8.996  1.00 0.00 ? 1  PHE B O    4  
ATOM 2675  C CB   . PHE B 2 1  ? -11.231 -3.382  -10.128 1.00 0.00 ? 1  PHE B CB   4  
ATOM 2676  C CG   . PHE B 2 1  ? -10.567 -2.849  -11.375 1.00 0.00 ? 1  PHE B CG   4  
ATOM 2677  C CD1  . PHE B 2 1  ? -9.568  -3.597  -12.010 1.00 0.00 ? 1  PHE B CD1  4  
ATOM 2678  C CD2  . PHE B 2 1  ? -10.950 -1.608  -11.896 1.00 0.00 ? 1  PHE B CD2  4  
ATOM 2679  C CE1  . PHE B 2 1  ? -8.952  -3.104  -13.166 1.00 0.00 ? 1  PHE B CE1  4  
ATOM 2680  C CE2  . PHE B 2 1  ? -10.334 -1.114  -13.053 1.00 0.00 ? 1  PHE B CE2  4  
ATOM 2681  C CZ   . PHE B 2 1  ? -9.335  -1.862  -13.688 1.00 0.00 ? 1  PHE B CZ   4  
ATOM 2682  H H1   . PHE B 2 1  ? -13.510 -5.431  -11.496 1.00 0.00 ? 1  PHE B H1   4  
ATOM 2683  H H2   . PHE B 2 1  ? -12.440 -4.479  -12.410 1.00 0.00 ? 1  PHE B H2   4  
ATOM 2684  H H3   . PHE B 2 1  ? -13.479 -3.750  -11.280 1.00 0.00 ? 1  PHE B H3   4  
ATOM 2685  H HA   . PHE B 2 1  ? -11.097 -5.426  -10.772 1.00 0.00 ? 1  PHE B HA   4  
ATOM 2686  H HB2  . PHE B 2 1  ? -11.999 -2.694  -9.806  1.00 0.00 ? 1  PHE B HB2  4  
ATOM 2687  H HB3  . PHE B 2 1  ? -10.494 -3.490  -9.346  1.00 0.00 ? 1  PHE B HB3  4  
ATOM 2688  H HD1  . PHE B 2 1  ? -9.272  -4.555  -11.607 1.00 0.00 ? 1  PHE B HD1  4  
ATOM 2689  H HD2  . PHE B 2 1  ? -11.721 -1.031  -11.407 1.00 0.00 ? 1  PHE B HD2  4  
ATOM 2690  H HE1  . PHE B 2 1  ? -8.181  -3.680  -13.656 1.00 0.00 ? 1  PHE B HE1  4  
ATOM 2691  H HE2  . PHE B 2 1  ? -10.630 -0.157  -13.455 1.00 0.00 ? 1  PHE B HE2  4  
ATOM 2692  H HZ   . PHE B 2 1  ? -8.860  -1.481  -14.580 1.00 0.00 ? 1  PHE B HZ   4  
ATOM 2693  N N    . VAL B 2 2  ? -11.713 -5.806  -8.251  1.00 0.00 ? 2  VAL B N    4  
ATOM 2694  C CA   . VAL B 2 2  ? -12.283 -6.364  -6.992  1.00 0.00 ? 2  VAL B CA   4  
ATOM 2695  C C    . VAL B 2 2  ? -11.183 -6.466  -5.934  1.00 0.00 ? 2  VAL B C    4  
ATOM 2696  O O    . VAL B 2 2  ? -10.585 -7.507  -5.745  1.00 0.00 ? 2  VAL B O    4  
ATOM 2697  C CB   . VAL B 2 2  ? -12.858 -7.755  -7.267  1.00 0.00 ? 2  VAL B CB   4  
ATOM 2698  C CG1  . VAL B 2 2  ? -11.829 -8.591  -8.030  1.00 0.00 ? 2  VAL B CG1  4  
ATOM 2699  C CG2  . VAL B 2 2  ? -13.186 -8.440  -5.939  1.00 0.00 ? 2  VAL B CG2  4  
ATOM 2700  H H    . VAL B 2 2  ? -10.745 -5.820  -8.398  1.00 0.00 ? 2  VAL B H    4  
ATOM 2701  H HA   . VAL B 2 2  ? -13.068 -5.714  -6.634  1.00 0.00 ? 2  VAL B HA   4  
ATOM 2702  H HB   . VAL B 2 2  ? -13.757 -7.662  -7.859  1.00 0.00 ? 2  VAL B HB   4  
ATOM 2703  H HG11 . VAL B 2 2  ? -11.545 -8.074  -8.934  1.00 0.00 ? 2  VAL B HG11 4  
ATOM 2704  H HG12 . VAL B 2 2  ? -12.260 -9.548  -8.283  1.00 0.00 ? 2  VAL B HG12 4  
ATOM 2705  H HG13 . VAL B 2 2  ? -10.957 -8.740  -7.411  1.00 0.00 ? 2  VAL B HG13 4  
ATOM 2706  H HG21 . VAL B 2 2  ? -13.535 -7.704  -5.230  1.00 0.00 ? 2  VAL B HG21 4  
ATOM 2707  H HG22 . VAL B 2 2  ? -12.300 -8.921  -5.553  1.00 0.00 ? 2  VAL B HG22 4  
ATOM 2708  H HG23 . VAL B 2 2  ? -13.957 -9.181  -6.097  1.00 0.00 ? 2  VAL B HG23 4  
ATOM 2709  N N    . ASN B 2 3  ? -10.913 -5.395  -5.239  1.00 0.00 ? 3  ASN B N    4  
ATOM 2710  C CA   . ASN B 2 3  ? -9.854  -5.433  -4.192  1.00 0.00 ? 3  ASN B CA   4  
ATOM 2711  C C    . ASN B 2 3  ? -10.480 -5.145  -2.826  1.00 0.00 ? 3  ASN B C    4  
ATOM 2712  O O    . ASN B 2 3  ? -11.523 -4.530  -2.729  1.00 0.00 ? 3  ASN B O    4  
ATOM 2713  C CB   . ASN B 2 3  ? -8.792  -4.374  -4.500  1.00 0.00 ? 3  ASN B CB   4  
ATOM 2714  C CG   . ASN B 2 3  ? -7.493  -5.062  -4.923  1.00 0.00 ? 3  ASN B CG   4  
ATOM 2715  O OD1  . ASN B 2 3  ? -7.518  -6.073  -5.595  1.00 0.00 ? 3  ASN B OD1  4  
ATOM 2716  N ND2  . ASN B 2 3  ? -6.350  -4.552  -4.554  1.00 0.00 ? 3  ASN B ND2  4  
ATOM 2717  H H    . ASN B 2 3  ? -11.408 -4.565  -5.406  1.00 0.00 ? 3  ASN B H    4  
ATOM 2718  H HA   . ASN B 2 3  ? -9.395  -6.410  -4.180  1.00 0.00 ? 3  ASN B HA   4  
ATOM 2719  H HB2  . ASN B 2 3  ? -9.141  -3.738  -5.301  1.00 0.00 ? 3  ASN B HB2  4  
ATOM 2720  H HB3  . ASN B 2 3  ? -8.612  -3.778  -3.619  1.00 0.00 ? 3  ASN B HB3  4  
ATOM 2721  H HD21 . ASN B 2 3  ? -6.329  -3.736  -4.011  1.00 0.00 ? 3  ASN B HD21 4  
ATOM 2722  H HD22 . ASN B 2 3  ? -5.511  -4.985  -4.819  1.00 0.00 ? 3  ASN B HD22 4  
ATOM 2723  N N    . GLN B 2 4  ? -9.853  -5.586  -1.770  1.00 0.00 ? 4  GLN B N    4  
ATOM 2724  C CA   . GLN B 2 4  ? -10.417 -5.335  -0.414  1.00 0.00 ? 4  GLN B CA   4  
ATOM 2725  C C    . GLN B 2 4  ? -9.497  -5.944  0.647   1.00 0.00 ? 4  GLN B C    4  
ATOM 2726  O O    . GLN B 2 4  ? -9.867  -6.870  1.341   1.00 0.00 ? 4  GLN B O    4  
ATOM 2727  C CB   . GLN B 2 4  ? -11.803 -5.976  -0.313  1.00 0.00 ? 4  GLN B CB   4  
ATOM 2728  C CG   . GLN B 2 4  ? -12.742 -5.044  0.455   1.00 0.00 ? 4  GLN B CG   4  
ATOM 2729  C CD   . GLN B 2 4  ? -13.964 -4.727  -0.409  1.00 0.00 ? 4  GLN B CD   4  
ATOM 2730  O OE1  . GLN B 2 4  ? -14.347 -3.581  -0.542  1.00 0.00 ? 4  GLN B OE1  4  
ATOM 2731  N NE2  . GLN B 2 4  ? -14.596 -5.700  -1.006  1.00 0.00 ? 4  GLN B NE2  4  
ATOM 2732  H H    . GLN B 2 4  ? -9.013  -6.080  -1.868  1.00 0.00 ? 4  GLN B H    4  
ATOM 2733  H HA   . GLN B 2 4  ? -10.501 -4.271  -0.250  1.00 0.00 ? 4  GLN B HA   4  
ATOM 2734  H HB2  . GLN B 2 4  ? -12.194 -6.144  -1.307  1.00 0.00 ? 4  GLN B HB2  4  
ATOM 2735  H HB3  . GLN B 2 4  ? -11.727 -6.918  0.208   1.00 0.00 ? 4  GLN B HB3  4  
ATOM 2736  H HG2  . GLN B 2 4  ? -13.061 -5.527  1.367   1.00 0.00 ? 4  GLN B HG2  4  
ATOM 2737  H HG3  . GLN B 2 4  ? -12.225 -4.128  0.694   1.00 0.00 ? 4  GLN B HG3  4  
ATOM 2738  H HE21 . GLN B 2 4  ? -14.287 -6.623  -0.899  1.00 0.00 ? 4  GLN B HE21 4  
ATOM 2739  H HE22 . GLN B 2 4  ? -15.380 -5.507  -1.561  1.00 0.00 ? 4  GLN B HE22 4  
ATOM 2740  N N    . HIS B 2 5  ? -8.301  -5.432  0.772   1.00 0.00 ? 5  HIS B N    4  
ATOM 2741  C CA   . HIS B 2 5  ? -7.349  -5.982  1.789   1.00 0.00 ? 5  HIS B CA   4  
ATOM 2742  C C    . HIS B 2 5  ? -8.102  -6.297  3.086   1.00 0.00 ? 5  HIS B C    4  
ATOM 2743  O O    . HIS B 2 5  ? -8.552  -7.406  3.293   1.00 0.00 ? 5  HIS B O    4  
ATOM 2744  C CB   . HIS B 2 5  ? -6.226  -4.974  2.086   1.00 0.00 ? 5  HIS B CB   4  
ATOM 2745  C CG   . HIS B 2 5  ? -6.617  -3.598  1.619   1.00 0.00 ? 5  HIS B CG   4  
ATOM 2746  N ND1  . HIS B 2 5  ? -7.913  -3.123  1.731   1.00 0.00 ? 5  HIS B ND1  4  
ATOM 2747  C CD2  . HIS B 2 5  ? -5.899  -2.593  1.022   1.00 0.00 ? 5  HIS B CD2  4  
ATOM 2748  C CE1  . HIS B 2 5  ? -7.936  -1.884  1.212   1.00 0.00 ? 5  HIS B CE1  4  
ATOM 2749  N NE2  . HIS B 2 5  ? -6.734  -1.510  0.766   1.00 0.00 ? 5  HIS B NE2  4  
ATOM 2750  H H    . HIS B 2 5  ? -8.028  -4.689  0.193   1.00 0.00 ? 5  HIS B H    4  
ATOM 2751  H HA   . HIS B 2 5  ? -6.914  -6.894  1.406   1.00 0.00 ? 5  HIS B HA   4  
ATOM 2752  H HB2  . HIS B 2 5  ? -6.041  -4.949  3.150   1.00 0.00 ? 5  HIS B HB2  4  
ATOM 2753  H HB3  . HIS B 2 5  ? -5.326  -5.282  1.575   1.00 0.00 ? 5  HIS B HB3  4  
ATOM 2754  H HD1  . HIS B 2 5  ? -8.675  -3.603  2.119   1.00 0.00 ? 5  HIS B HD1  4  
ATOM 2755  H HD2  . HIS B 2 5  ? -4.846  -2.635  0.786   1.00 0.00 ? 5  HIS B HD2  4  
ATOM 2756  H HE1  . HIS B 2 5  ? -8.819  -1.269  1.158   1.00 0.00 ? 5  HIS B HE1  4  
ATOM 2757  N N    . LEU B 2 6  ? -8.248  -5.332  3.960   1.00 0.00 ? 6  LEU B N    4  
ATOM 2758  C CA   . LEU B 2 6  ? -8.978  -5.592  5.239   1.00 0.00 ? 6  LEU B CA   4  
ATOM 2759  C C    . LEU B 2 6  ? -8.666  -4.500  6.271   1.00 0.00 ? 6  LEU B C    4  
ATOM 2760  O O    . LEU B 2 6  ? -9.375  -4.348  7.244   1.00 0.00 ? 6  LEU B O    4  
ATOM 2761  C CB   . LEU B 2 6  ? -8.551  -6.949  5.804   1.00 0.00 ? 6  LEU B CB   4  
ATOM 2762  C CG   . LEU B 2 6  ? -9.712  -7.938  5.691   1.00 0.00 ? 6  LEU B CG   4  
ATOM 2763  C CD1  . LEU B 2 6  ? -9.223  -9.226  5.026   1.00 0.00 ? 6  LEU B CD1  4  
ATOM 2764  C CD2  . LEU B 2 6  ? -10.246 -8.258  7.089   1.00 0.00 ? 6  LEU B CD2  4  
ATOM 2765  H H    . LEU B 2 6  ? -7.883  -4.443  3.772   1.00 0.00 ? 6  LEU B H    4  
ATOM 2766  H HA   . LEU B 2 6  ? -10.041 -5.607  5.046   1.00 0.00 ? 6  LEU B HA   4  
ATOM 2767  H HB2  . LEU B 2 6  ? -7.704  -7.321  5.245   1.00 0.00 ? 6  LEU B HB2  4  
ATOM 2768  H HB3  . LEU B 2 6  ? -8.276  -6.837  6.842   1.00 0.00 ? 6  LEU B HB3  4  
ATOM 2769  H HG   . LEU B 2 6  ? -10.500 -7.502  5.093   1.00 0.00 ? 6  LEU B HG   4  
ATOM 2770  H HD11 . LEU B 2 6  ? -9.915  -9.515  4.248   1.00 0.00 ? 6  LEU B HD11 4  
ATOM 2771  H HD12 . LEU B 2 6  ? -9.164  -10.012 5.765   1.00 0.00 ? 6  LEU B HD12 4  
ATOM 2772  H HD13 . LEU B 2 6  ? -8.247  -9.061  4.596   1.00 0.00 ? 6  LEU B HD13 4  
ATOM 2773  H HD21 . LEU B 2 6  ? -10.101 -9.308  7.298   1.00 0.00 ? 6  LEU B HD21 4  
ATOM 2774  H HD22 . LEU B 2 6  ? -11.300 -8.025  7.134   1.00 0.00 ? 6  LEU B HD22 4  
ATOM 2775  H HD23 . LEU B 2 6  ? -9.715  -7.668  7.821   1.00 0.00 ? 6  LEU B HD23 4  
ATOM 2776  N N    . CYS B 2 7  ? -7.612  -3.748  6.072   1.00 0.00 ? 7  CYS B N    4  
ATOM 2777  C CA   . CYS B 2 7  ? -7.245  -2.670  7.038   1.00 0.00 ? 7  CYS B CA   4  
ATOM 2778  C C    . CYS B 2 7  ? -6.479  -3.265  8.222   1.00 0.00 ? 7  CYS B C    4  
ATOM 2779  O O    . CYS B 2 7  ? -5.493  -2.714  8.668   1.00 0.00 ? 7  CYS B O    4  
ATOM 2780  C CB   . CYS B 2 7  ? -8.503  -1.968  7.538   1.00 0.00 ? 7  CYS B CB   4  
ATOM 2781  S SG   . CYS B 2 7  ? -8.043  -0.401  8.320   1.00 0.00 ? 7  CYS B SG   4  
ATOM 2782  H H    . CYS B 2 7  ? -7.057  -3.894  5.287   1.00 0.00 ? 7  CYS B H    4  
ATOM 2783  H HA   . CYS B 2 7  ? -6.614  -1.949  6.540   1.00 0.00 ? 7  CYS B HA   4  
ATOM 2784  H HB2  . CYS B 2 7  ? -9.162  -1.779  6.704   1.00 0.00 ? 7  CYS B HB2  4  
ATOM 2785  H HB3  . CYS B 2 7  ? -9.002  -2.597  8.258   1.00 0.00 ? 7  CYS B HB3  4  
ATOM 2786  N N    . GLY B 2 8  ? -6.917  -4.382  8.735   1.00 0.00 ? 8  GLY B N    4  
ATOM 2787  C CA   . GLY B 2 8  ? -6.200  -5.000  9.886   1.00 0.00 ? 8  GLY B CA   4  
ATOM 2788  C C    . GLY B 2 8  ? -4.816  -5.459  9.428   1.00 0.00 ? 8  GLY B C    4  
ATOM 2789  O O    . GLY B 2 8  ? -4.539  -6.639  9.345   1.00 0.00 ? 8  GLY B O    4  
ATOM 2790  H H    . GLY B 2 8  ? -7.713  -4.815  8.364   1.00 0.00 ? 8  GLY B H    4  
ATOM 2791  H HA2  . GLY B 2 8  ? -6.098  -4.274  10.680  1.00 0.00 ? 8  GLY B HA2  4  
ATOM 2792  H HA3  . GLY B 2 8  ? -6.756  -5.850  10.244  1.00 0.00 ? 8  GLY B HA3  4  
ATOM 2793  N N    . SER B 2 9  ? -3.954  -4.525  9.122   1.00 0.00 ? 9  SER B N    4  
ATOM 2794  C CA   . SER B 2 9  ? -2.577  -4.872  8.656   1.00 0.00 ? 9  SER B CA   4  
ATOM 2795  C C    . SER B 2 9  ? -2.589  -5.144  7.147   1.00 0.00 ? 9  SER B C    4  
ATOM 2796  O O    . SER B 2 9  ? -1.594  -4.974  6.471   1.00 0.00 ? 9  SER B O    4  
ATOM 2797  C CB   . SER B 2 9  ? -2.069  -6.111  9.396   1.00 0.00 ? 9  SER B CB   4  
ATOM 2798  O OG   . SER B 2 9  ? -0.694  -5.936  9.716   1.00 0.00 ? 9  SER B OG   4  
ATOM 2799  H H    . SER B 2 9  ? -4.218  -3.586  9.195   1.00 0.00 ? 9  SER B H    4  
ATOM 2800  H HA   . SER B 2 9  ? -1.916  -4.041  8.859   1.00 0.00 ? 9  SER B HA   4  
ATOM 2801  H HB2  . SER B 2 9  ? -2.630  -6.244  10.306  1.00 0.00 ? 9  SER B HB2  4  
ATOM 2802  H HB3  . SER B 2 9  ? -2.195  -6.982  8.767   1.00 0.00 ? 9  SER B HB3  4  
ATOM 2803  H HG   . SER B 2 9  ? -0.178  -6.465  9.104   1.00 0.00 ? 9  SER B HG   4  
ATOM 2804  N N    . HIS B 2 10 ? -3.703  -5.568  6.611   1.00 0.00 ? 10 HIS B N    4  
ATOM 2805  C CA   . HIS B 2 10 ? -3.767  -5.850  5.152   1.00 0.00 ? 10 HIS B CA   4  
ATOM 2806  C C    . HIS B 2 10 ? -3.695  -4.539  4.366   1.00 0.00 ? 10 HIS B C    4  
ATOM 2807  O O    . HIS B 2 10 ? -2.965  -4.423  3.402   1.00 0.00 ? 10 HIS B O    4  
ATOM 2808  C CB   . HIS B 2 10 ? -5.080  -6.565  4.830   1.00 0.00 ? 10 HIS B CB   4  
ATOM 2809  C CG   . HIS B 2 10 ? -5.334  -7.635  5.855   1.00 0.00 ? 10 HIS B CG   4  
ATOM 2810  N ND1  . HIS B 2 10 ? -4.931  -8.948  5.669   1.00 0.00 ? 10 HIS B ND1  4  
ATOM 2811  C CD2  . HIS B 2 10 ? -5.950  -7.603  7.082   1.00 0.00 ? 10 HIS B CD2  4  
ATOM 2812  C CE1  . HIS B 2 10 ? -5.305  -9.646  6.758   1.00 0.00 ? 10 HIS B CE1  4  
ATOM 2813  N NE2  . HIS B 2 10 ? -5.930  -8.873  7.650   1.00 0.00 ? 10 HIS B NE2  4  
ATOM 2814  H H    . HIS B 2 10 ? -4.493  -5.703  7.165   1.00 0.00 ? 10 HIS B H    4  
ATOM 2815  H HA   . HIS B 2 10 ? -2.939  -6.481  4.877   1.00 0.00 ? 10 HIS B HA   4  
ATOM 2816  H HB2  . HIS B 2 10 ? -5.892  -5.852  4.845   1.00 0.00 ? 10 HIS B HB2  4  
ATOM 2817  H HB3  . HIS B 2 10 ? -5.014  -7.015  3.850   1.00 0.00 ? 10 HIS B HB3  4  
ATOM 2818  H HD1  . HIS B 2 10 ? -4.459  -9.304  4.887   1.00 0.00 ? 10 HIS B HD1  4  
ATOM 2819  H HD2  . HIS B 2 10 ? -6.383  -6.724  7.538   1.00 0.00 ? 10 HIS B HD2  4  
ATOM 2820  H HE1  . HIS B 2 10 ? -5.122  -10.701 6.893   1.00 0.00 ? 10 HIS B HE1  4  
ATOM 2821  N N    . LEU B 2 11 ? -4.449  -3.549  4.765   1.00 0.00 ? 11 LEU B N    4  
ATOM 2822  C CA   . LEU B 2 11 ? -4.418  -2.252  4.030   1.00 0.00 ? 11 LEU B CA   4  
ATOM 2823  C C    . LEU B 2 11 ? -3.020  -1.644  4.130   1.00 0.00 ? 11 LEU B C    4  
ATOM 2824  O O    . LEU B 2 11 ? -2.456  -1.202  3.149   1.00 0.00 ? 11 LEU B O    4  
ATOM 2825  C CB   . LEU B 2 11 ? -5.440  -1.289  4.637   1.00 0.00 ? 11 LEU B CB   4  
ATOM 2826  C CG   . LEU B 2 11 ? -5.555  -0.044  3.756   1.00 0.00 ? 11 LEU B CG   4  
ATOM 2827  C CD1  . LEU B 2 11 ? -6.827  0.723   4.121   1.00 0.00 ? 11 LEU B CD1  4  
ATOM 2828  C CD2  . LEU B 2 11 ? -4.337  0.855   3.980   1.00 0.00 ? 11 LEU B CD2  4  
ATOM 2829  H H    . LEU B 2 11 ? -5.034  -3.659  5.543   1.00 0.00 ? 11 LEU B H    4  
ATOM 2830  H HA   . LEU B 2 11 ? -4.660  -2.424  2.992   1.00 0.00 ? 11 LEU B HA   4  
ATOM 2831  H HB2  . LEU B 2 11 ? -6.401  -1.778  4.698   1.00 0.00 ? 11 LEU B HB2  4  
ATOM 2832  H HB3  . LEU B 2 11 ? -5.119  -1.000  5.627   1.00 0.00 ? 11 LEU B HB3  4  
ATOM 2833  H HG   . LEU B 2 11 ? -5.600  -0.341  2.718   1.00 0.00 ? 11 LEU B HG   4  
ATOM 2834  H HD11 . LEU B 2 11 ? -7.546  0.043   4.553   1.00 0.00 ? 11 LEU B HD11 4  
ATOM 2835  H HD12 . LEU B 2 11 ? -7.244  1.172   3.231   1.00 0.00 ? 11 LEU B HD12 4  
ATOM 2836  H HD13 . LEU B 2 11 ? -6.588  1.496   4.836   1.00 0.00 ? 11 LEU B HD13 4  
ATOM 2837  H HD21 . LEU B 2 11 ? -4.644  1.890   3.953   1.00 0.00 ? 11 LEU B HD21 4  
ATOM 2838  H HD22 . LEU B 2 11 ? -3.609  0.675   3.203   1.00 0.00 ? 11 LEU B HD22 4  
ATOM 2839  H HD23 . LEU B 2 11 ? -3.899  0.634   4.942   1.00 0.00 ? 11 LEU B HD23 4  
ATOM 2840  N N    . VAL B 2 12 ? -2.448  -1.625  5.303   1.00 0.00 ? 12 VAL B N    4  
ATOM 2841  C CA   . VAL B 2 12 ? -1.082  -1.052  5.445   1.00 0.00 ? 12 VAL B CA   4  
ATOM 2842  C C    . VAL B 2 12 ? -0.094  -1.959  4.721   1.00 0.00 ? 12 VAL B C    4  
ATOM 2843  O O    . VAL B 2 12 ? 0.717   -1.509  3.937   1.00 0.00 ? 12 VAL B O    4  
ATOM 2844  C CB   . VAL B 2 12 ? -0.710  -0.956  6.926   1.00 0.00 ? 12 VAL B CB   4  
ATOM 2845  C CG1  . VAL B 2 12 ? -0.772  -2.347  7.560   1.00 0.00 ? 12 VAL B CG1  4  
ATOM 2846  C CG2  . VAL B 2 12 ? 0.709   -0.399  7.057   1.00 0.00 ? 12 VAL B CG2  4  
ATOM 2847  H H    . VAL B 2 12 ? -2.913  -1.991  6.083   1.00 0.00 ? 12 VAL B H    4  
ATOM 2848  H HA   . VAL B 2 12 ? -1.056  -0.070  4.998   1.00 0.00 ? 12 VAL B HA   4  
ATOM 2849  H HB   . VAL B 2 12 ? -1.405  -0.300  7.430   1.00 0.00 ? 12 VAL B HB   4  
ATOM 2850  H HG11 . VAL B 2 12 ? -0.687  -2.258  8.633   1.00 0.00 ? 12 VAL B HG11 4  
ATOM 2851  H HG12 . VAL B 2 12 ? 0.042   -2.950  7.184   1.00 0.00 ? 12 VAL B HG12 4  
ATOM 2852  H HG13 . VAL B 2 12 ? -1.712  -2.815  7.311   1.00 0.00 ? 12 VAL B HG13 4  
ATOM 2853  H HG21 . VAL B 2 12 ? 1.108   -0.653  8.028   1.00 0.00 ? 12 VAL B HG21 4  
ATOM 2854  H HG22 . VAL B 2 12 ? 0.685   0.675   6.947   1.00 0.00 ? 12 VAL B HG22 4  
ATOM 2855  H HG23 . VAL B 2 12 ? 1.335   -0.826  6.287   1.00 0.00 ? 12 VAL B HG23 4  
ATOM 2856  N N    . GLU B 2 13 ? -0.170  -3.239  4.955   1.00 0.00 ? 13 GLU B N    4  
ATOM 2857  C CA   . GLU B 2 13 ? 0.751   -4.168  4.253   1.00 0.00 ? 13 GLU B CA   4  
ATOM 2858  C C    . GLU B 2 13 ? 0.607   -3.924  2.753   1.00 0.00 ? 13 GLU B C    4  
ATOM 2859  O O    . GLU B 2 13 ? 1.534   -4.097  1.988   1.00 0.00 ? 13 GLU B O    4  
ATOM 2860  C CB   . GLU B 2 13 ? 0.377   -5.615  4.581   1.00 0.00 ? 13 GLU B CB   4  
ATOM 2861  C CG   . GLU B 2 13 ? 1.495   -6.551  4.114   1.00 0.00 ? 13 GLU B CG   4  
ATOM 2862  C CD   . GLU B 2 13 ? 1.407   -7.874  4.877   1.00 0.00 ? 13 GLU B CD   4  
ATOM 2863  O OE1  . GLU B 2 13 ? 1.766   -7.887  6.043   1.00 0.00 ? 13 GLU B OE1  4  
ATOM 2864  O OE2  . GLU B 2 13 ? 0.982   -8.850  4.282   1.00 0.00 ? 13 GLU B OE2  4  
ATOM 2865  H H    . GLU B 2 13 ? -0.843  -3.588  5.576   1.00 0.00 ? 13 GLU B H    4  
ATOM 2866  H HA   . GLU B 2 13 ? 1.769   -3.973  4.558   1.00 0.00 ? 13 GLU B HA   4  
ATOM 2867  H HB2  . GLU B 2 13 ? 0.242   -5.719  5.648   1.00 0.00 ? 13 GLU B HB2  4  
ATOM 2868  H HB3  . GLU B 2 13 ? -0.541  -5.874  4.075   1.00 0.00 ? 13 GLU B HB3  4  
ATOM 2869  H HG2  . GLU B 2 13 ? 1.389   -6.737  3.055   1.00 0.00 ? 13 GLU B HG2  4  
ATOM 2870  H HG3  . GLU B 2 13 ? 2.453   -6.091  4.305   1.00 0.00 ? 13 GLU B HG3  4  
ATOM 2871  N N    . ALA B 2 14 ? -0.560  -3.511  2.334   1.00 0.00 ? 14 ALA B N    4  
ATOM 2872  C CA   . ALA B 2 14 ? -0.783  -3.239  0.891   1.00 0.00 ? 14 ALA B CA   4  
ATOM 2873  C C    . ALA B 2 14 ? 0.033   -2.015  0.483   1.00 0.00 ? 14 ALA B C    4  
ATOM 2874  O O    . ALA B 2 14 ? 0.645   -1.984  -0.563  1.00 0.00 ? 14 ALA B O    4  
ATOM 2875  C CB   . ALA B 2 14 ? -2.269  -2.970  0.643   1.00 0.00 ? 14 ALA B CB   4  
ATOM 2876  H H    . ALA B 2 14 ? -1.287  -3.369  2.974   1.00 0.00 ? 14 ALA B H    4  
ATOM 2877  H HA   . ALA B 2 14 ? -0.469  -4.091  0.315   1.00 0.00 ? 14 ALA B HA   4  
ATOM 2878  H HB1  . ALA B 2 14 ? -2.478  -1.924  0.809   1.00 0.00 ? 14 ALA B HB1  4  
ATOM 2879  H HB2  . ALA B 2 14 ? -2.861  -3.568  1.321   1.00 0.00 ? 14 ALA B HB2  4  
ATOM 2880  H HB3  . ALA B 2 14 ? -2.517  -3.230  -0.376  1.00 0.00 ? 14 ALA B HB3  4  
ATOM 2881  N N    . LEU B 2 15 ? 0.053   -1.009  1.311   1.00 0.00 ? 15 LEU B N    4  
ATOM 2882  C CA   . LEU B 2 15 ? 0.835   0.213   0.980   1.00 0.00 ? 15 LEU B CA   4  
ATOM 2883  C C    . LEU B 2 15 ? 2.294   -0.186  0.763   1.00 0.00 ? 15 LEU B C    4  
ATOM 2884  O O    . LEU B 2 15 ? 2.987   0.361   -0.072  1.00 0.00 ? 15 LEU B O    4  
ATOM 2885  C CB   . LEU B 2 15 ? 0.701   1.233   2.128   1.00 0.00 ? 15 LEU B CB   4  
ATOM 2886  C CG   . LEU B 2 15 ? 1.867   1.103   3.115   1.00 0.00 ? 15 LEU B CG   4  
ATOM 2887  C CD1  . LEU B 2 15 ? 3.091   1.834   2.558   1.00 0.00 ? 15 LEU B CD1  4  
ATOM 2888  C CD2  . LEU B 2 15 ? 1.472   1.724   4.457   1.00 0.00 ? 15 LEU B CD2  4  
ATOM 2889  H H    . LEU B 2 15 ? -0.443  -1.062  2.153   1.00 0.00 ? 15 LEU B H    4  
ATOM 2890  H HA   . LEU B 2 15 ? 0.451   0.644   0.065   1.00 0.00 ? 15 LEU B HA   4  
ATOM 2891  H HB2  . LEU B 2 15 ? 0.692   2.231   1.718   1.00 0.00 ? 15 LEU B HB2  4  
ATOM 2892  H HB3  . LEU B 2 15 ? -0.228  1.057   2.652   1.00 0.00 ? 15 LEU B HB3  4  
ATOM 2893  H HG   . LEU B 2 15 ? 2.105   0.058   3.256   1.00 0.00 ? 15 LEU B HG   4  
ATOM 2894  H HD11 . LEU B 2 15 ? 2.797   2.429   1.706   1.00 0.00 ? 15 LEU B HD11 4  
ATOM 2895  H HD12 . LEU B 2 15 ? 3.834   1.112   2.253   1.00 0.00 ? 15 LEU B HD12 4  
ATOM 2896  H HD13 . LEU B 2 15 ? 3.504   2.477   3.320   1.00 0.00 ? 15 LEU B HD13 4  
ATOM 2897  H HD21 . LEU B 2 15 ? 0.636   1.181   4.872   1.00 0.00 ? 15 LEU B HD21 4  
ATOM 2898  H HD22 . LEU B 2 15 ? 1.191   2.756   4.306   1.00 0.00 ? 15 LEU B HD22 4  
ATOM 2899  H HD23 . LEU B 2 15 ? 2.308   1.674   5.138   1.00 0.00 ? 15 LEU B HD23 4  
ATOM 2900  N N    . TYR B 2 16 ? 2.764   -1.145  1.501   1.00 0.00 ? 16 TYR B N    4  
ATOM 2901  C CA   . TYR B 2 16 ? 4.167   -1.586  1.315   1.00 0.00 ? 16 TYR B CA   4  
ATOM 2902  C C    . TYR B 2 16 ? 4.276   -2.265  -0.048  1.00 0.00 ? 16 TYR B C    4  
ATOM 2903  O O    . TYR B 2 16 ? 5.135   -1.954  -0.848  1.00 0.00 ? 16 TYR B O    4  
ATOM 2904  C CB   . TYR B 2 16 ? 4.544   -2.577  2.419   1.00 0.00 ? 16 TYR B CB   4  
ATOM 2905  C CG   . TYR B 2 16 ? 5.925   -3.128  2.157   1.00 0.00 ? 16 TYR B CG   4  
ATOM 2906  C CD1  . TYR B 2 16 ? 6.086   -4.248  1.331   1.00 0.00 ? 16 TYR B CD1  4  
ATOM 2907  C CD2  . TYR B 2 16 ? 7.043   -2.522  2.741   1.00 0.00 ? 16 TYR B CD2  4  
ATOM 2908  C CE1  . TYR B 2 16 ? 7.367   -4.760  1.090   1.00 0.00 ? 16 TYR B CE1  4  
ATOM 2909  C CE2  . TYR B 2 16 ? 8.324   -3.035  2.500   1.00 0.00 ? 16 TYR B CE2  4  
ATOM 2910  C CZ   . TYR B 2 16 ? 8.485   -4.154  1.675   1.00 0.00 ? 16 TYR B CZ   4  
ATOM 2911  O OH   . TYR B 2 16 ? 9.747   -4.660  1.437   1.00 0.00 ? 16 TYR B OH   4  
ATOM 2912  H H    . TYR B 2 16 ? 2.192   -1.583  2.165   1.00 0.00 ? 16 TYR B H    4  
ATOM 2913  H HA   . TYR B 2 16 ? 4.821   -0.735  1.348   1.00 0.00 ? 16 TYR B HA   4  
ATOM 2914  H HB2  . TYR B 2 16 ? 4.533   -2.071  3.374   1.00 0.00 ? 16 TYR B HB2  4  
ATOM 2915  H HB3  . TYR B 2 16 ? 3.830   -3.387  2.433   1.00 0.00 ? 16 TYR B HB3  4  
ATOM 2916  H HD1  . TYR B 2 16 ? 5.224   -4.715  0.880   1.00 0.00 ? 16 TYR B HD1  4  
ATOM 2917  H HD2  . TYR B 2 16 ? 6.919   -1.659  3.378   1.00 0.00 ? 16 TYR B HD2  4  
ATOM 2918  H HE1  . TYR B 2 16 ? 7.491   -5.624  0.453   1.00 0.00 ? 16 TYR B HE1  4  
ATOM 2919  H HE2  . TYR B 2 16 ? 9.186   -2.568  2.951   1.00 0.00 ? 16 TYR B HE2  4  
ATOM 2920  H HH   . TYR B 2 16 ? 10.321  -3.927  1.204   1.00 0.00 ? 16 TYR B HH   4  
ATOM 2921  N N    . LEU B 2 17 ? 3.402   -3.193  -0.313  1.00 0.00 ? 17 LEU B N    4  
ATOM 2922  C CA   . LEU B 2 17 ? 3.432   -3.906  -1.619  1.00 0.00 ? 17 LEU B CA   4  
ATOM 2923  C C    . LEU B 2 17 ? 3.005   -2.979  -2.761  1.00 0.00 ? 17 LEU B C    4  
ATOM 2924  O O    . LEU B 2 17 ? 3.575   -3.008  -3.834  1.00 0.00 ? 17 LEU B O    4  
ATOM 2925  C CB   . LEU B 2 17 ? 2.497   -5.116  -1.565  1.00 0.00 ? 17 LEU B CB   4  
ATOM 2926  C CG   . LEU B 2 17 ? 3.191   -6.324  -2.194  1.00 0.00 ? 17 LEU B CG   4  
ATOM 2927  C CD1  . LEU B 2 17 ? 4.388   -6.731  -1.333  1.00 0.00 ? 17 LEU B CD1  4  
ATOM 2928  C CD2  . LEU B 2 17 ? 2.205   -7.491  -2.280  1.00 0.00 ? 17 LEU B CD2  4  
ATOM 2929  H H    . LEU B 2 17 ? 2.720   -3.420  0.352   1.00 0.00 ? 17 LEU B H    4  
ATOM 2930  H HA   . LEU B 2 17 ? 4.436   -4.241  -1.805  1.00 0.00 ? 17 LEU B HA   4  
ATOM 2931  H HB2  . LEU B 2 17 ? 2.252   -5.335  -0.536  1.00 0.00 ? 17 LEU B HB2  4  
ATOM 2932  H HB3  . LEU B 2 17 ? 1.593   -4.897  -2.112  1.00 0.00 ? 17 LEU B HB3  4  
ATOM 2933  H HG   . LEU B 2 17 ? 3.534   -6.066  -3.186  1.00 0.00 ? 17 LEU B HG   4  
ATOM 2934  H HD11 . LEU B 2 17 ? 5.276   -6.772  -1.946  1.00 0.00 ? 17 LEU B HD11 4  
ATOM 2935  H HD12 . LEU B 2 17 ? 4.205   -7.703  -0.898  1.00 0.00 ? 17 LEU B HD12 4  
ATOM 2936  H HD13 . LEU B 2 17 ? 4.528   -6.005  -0.545  1.00 0.00 ? 17 LEU B HD13 4  
ATOM 2937  H HD21 . LEU B 2 17 ? 1.230   -7.119  -2.559  1.00 0.00 ? 17 LEU B HD21 4  
ATOM 2938  H HD22 . LEU B 2 17 ? 2.142   -7.980  -1.319  1.00 0.00 ? 17 LEU B HD22 4  
ATOM 2939  H HD23 . LEU B 2 17 ? 2.547   -8.198  -3.021  1.00 0.00 ? 17 LEU B HD23 4  
ATOM 2940  N N    . VAL B 2 18 ? 2.002   -2.170  -2.557  1.00 0.00 ? 18 VAL B N    4  
ATOM 2941  C CA   . VAL B 2 18 ? 1.553   -1.271  -3.660  1.00 0.00 ? 18 VAL B CA   4  
ATOM 2942  C C    . VAL B 2 18 ? 2.733   -0.413  -4.114  1.00 0.00 ? 18 VAL B C    4  
ATOM 2943  O O    . VAL B 2 18 ? 3.015   -0.308  -5.291  1.00 0.00 ? 18 VAL B O    4  
ATOM 2944  C CB   . VAL B 2 18 ? 0.411   -0.360  -3.190  1.00 0.00 ? 18 VAL B CB   4  
ATOM 2945  C CG1  . VAL B 2 18 ? -0.715  -1.191  -2.575  1.00 0.00 ? 18 VAL B CG1  4  
ATOM 2946  C CG2  . VAL B 2 18 ? 0.940   0.626   -2.159  1.00 0.00 ? 18 VAL B CG2  4  
ATOM 2947  H H    . VAL B 2 18 ? 1.542   -2.164  -1.693  1.00 0.00 ? 18 VAL B H    4  
ATOM 2948  H HA   . VAL B 2 18 ? 1.214   -1.872  -4.490  1.00 0.00 ? 18 VAL B HA   4  
ATOM 2949  H HB   . VAL B 2 18 ? 0.023   0.184   -4.029  1.00 0.00 ? 18 VAL B HB   4  
ATOM 2950  H HG11 . VAL B 2 18 ? -1.623  -1.040  -3.143  1.00 0.00 ? 18 VAL B HG11 4  
ATOM 2951  H HG12 . VAL B 2 18 ? -0.876  -0.878  -1.554  1.00 0.00 ? 18 VAL B HG12 4  
ATOM 2952  H HG13 . VAL B 2 18 ? -0.447  -2.235  -2.595  1.00 0.00 ? 18 VAL B HG13 4  
ATOM 2953  H HG21 . VAL B 2 18 ? 0.116   1.174   -1.727  1.00 0.00 ? 18 VAL B HG21 4  
ATOM 2954  H HG22 . VAL B 2 18 ? 1.623   1.314   -2.633  1.00 0.00 ? 18 VAL B HG22 4  
ATOM 2955  H HG23 . VAL B 2 18 ? 1.454   0.083   -1.387  1.00 0.00 ? 18 VAL B HG23 4  
ATOM 2956  N N    . CYS B 2 19 ? 3.431   0.200   -3.197  1.00 0.00 ? 19 CYS B N    4  
ATOM 2957  C CA   . CYS B 2 19 ? 4.593   1.042   -3.606  1.00 0.00 ? 19 CYS B CA   4  
ATOM 2958  C C    . CYS B 2 19 ? 5.473   1.353   -2.395  1.00 0.00 ? 19 CYS B C    4  
ATOM 2959  O O    . CYS B 2 19 ? 6.255   2.281   -2.417  1.00 0.00 ? 19 CYS B O    4  
ATOM 2960  C CB   . CYS B 2 19 ? 4.081   2.355   -4.203  1.00 0.00 ? 19 CYS B CB   4  
ATOM 2961  S SG   . CYS B 2 19 ? 5.269   2.975   -5.420  1.00 0.00 ? 19 CYS B SG   4  
ATOM 2962  H H    . CYS B 2 19 ? 3.192   0.107   -2.246  1.00 0.00 ? 19 CYS B H    4  
ATOM 2963  H HA   . CYS B 2 19 ? 5.175   0.515   -4.348  1.00 0.00 ? 19 CYS B HA   4  
ATOM 2964  H HB2  . CYS B 2 19 ? 3.130   2.183   -4.685  1.00 0.00 ? 19 CYS B HB2  4  
ATOM 2965  H HB3  . CYS B 2 19 ? 3.959   3.084   -3.416  1.00 0.00 ? 19 CYS B HB3  4  
ATOM 2966  N N    . GLY B 2 20 ? 5.367   0.595   -1.340  1.00 0.00 ? 20 GLY B N    4  
ATOM 2967  C CA   . GLY B 2 20 ? 6.214   0.890   -0.150  1.00 0.00 ? 20 GLY B CA   4  
ATOM 2968  C C    . GLY B 2 20 ? 7.424   -0.044  -0.132  1.00 0.00 ? 20 GLY B C    4  
ATOM 2969  O O    . GLY B 2 20 ? 8.377   0.173   0.589   1.00 0.00 ? 20 GLY B O    4  
ATOM 2970  H H    . GLY B 2 20 ? 4.740   -0.163  -1.329  1.00 0.00 ? 20 GLY B H    4  
ATOM 2971  H HA2  . GLY B 2 20 ? 6.552   1.917   -0.200  1.00 0.00 ? 20 GLY B HA2  4  
ATOM 2972  H HA3  . GLY B 2 20 ? 5.637   0.750   0.749   1.00 0.00 ? 20 GLY B HA3  4  
ATOM 2973  N N    . GLU B 2 21 ? 7.399   -1.081  -0.923  1.00 0.00 ? 21 GLU B N    4  
ATOM 2974  C CA   . GLU B 2 21 ? 8.553   -2.021  -0.950  1.00 0.00 ? 21 GLU B CA   4  
ATOM 2975  C C    . GLU B 2 21 ? 9.837   -1.230  -1.208  1.00 0.00 ? 21 GLU B C    4  
ATOM 2976  O O    . GLU B 2 21 ? 10.824  -1.385  -0.515  1.00 0.00 ? 21 GLU B O    4  
ATOM 2977  C CB   . GLU B 2 21 ? 8.351   -3.046  -2.068  1.00 0.00 ? 21 GLU B CB   4  
ATOM 2978  C CG   . GLU B 2 21 ? 9.368   -4.179  -1.912  1.00 0.00 ? 21 GLU B CG   4  
ATOM 2979  C CD   . GLU B 2 21 ? 8.837   -5.440  -2.596  1.00 0.00 ? 21 GLU B CD   4  
ATOM 2980  O OE1  . GLU B 2 21 ? 7.920   -5.318  -3.390  1.00 0.00 ? 21 GLU B OE1  4  
ATOM 2981  O OE2  . GLU B 2 21 ? 9.357   -6.507  -2.312  1.00 0.00 ? 21 GLU B OE2  4  
ATOM 2982  H H    . GLU B 2 21 ? 6.623   -1.239  -1.501  1.00 0.00 ? 21 GLU B H    4  
ATOM 2983  H HA   . GLU B 2 21 ? 8.627   -2.530  -0.001  1.00 0.00 ? 21 GLU B HA   4  
ATOM 2984  H HB2  . GLU B 2 21 ? 7.350   -3.449  -2.010  1.00 0.00 ? 21 GLU B HB2  4  
ATOM 2985  H HB3  . GLU B 2 21 ? 8.493   -2.568  -3.025  1.00 0.00 ? 21 GLU B HB3  4  
ATOM 2986  H HG2  . GLU B 2 21 ? 10.303  -3.887  -2.368  1.00 0.00 ? 21 GLU B HG2  4  
ATOM 2987  H HG3  . GLU B 2 21 ? 9.526   -4.380  -0.863  1.00 0.00 ? 21 GLU B HG3  4  
ATOM 2988  N N    . ARG B 2 22 ? 9.830   -0.383  -2.199  1.00 0.00 ? 22 ARG B N    4  
ATOM 2989  C CA   . ARG B 2 22 ? 11.041  0.419   -2.505  1.00 0.00 ? 22 ARG B CA   4  
ATOM 2990  C C    . ARG B 2 22 ? 10.990  1.735   -1.727  1.00 0.00 ? 22 ARG B C    4  
ATOM 2991  O O    . ARG B 2 22 ? 12.008  2.313   -1.399  1.00 0.00 ? 22 ARG B O    4  
ATOM 2992  C CB   . ARG B 2 22 ? 11.091  0.713   -4.006  1.00 0.00 ? 22 ARG B CB   4  
ATOM 2993  C CG   . ARG B 2 22 ? 12.383  1.463   -4.337  1.00 0.00 ? 22 ARG B CG   4  
ATOM 2994  C CD   . ARG B 2 22 ? 12.705  1.293   -5.823  1.00 0.00 ? 22 ARG B CD   4  
ATOM 2995  N NE   . ARG B 2 22 ? 12.223  2.485   -6.576  1.00 0.00 ? 22 ARG B NE   4  
ATOM 2996  C CZ   . ARG B 2 22 ? 11.295  2.352   -7.484  1.00 0.00 ? 22 ARG B CZ   4  
ATOM 2997  N NH1  . ARG B 2 22 ? 10.290  1.546   -7.276  1.00 0.00 ? 22 ARG B NH1  4  
ATOM 2998  N NH2  . ARG B 2 22 ? 11.373  3.025   -8.599  1.00 0.00 ? 22 ARG B NH2  4  
ATOM 2999  H H    . ARG B 2 22 ? 9.029   -0.275  -2.743  1.00 0.00 ? 22 ARG B H    4  
ATOM 3000  H HA   . ARG B 2 22 ? 11.914  -0.138  -2.218  1.00 0.00 ? 22 ARG B HA   4  
ATOM 3001  H HB2  . ARG B 2 22 ? 11.062  -0.217  -4.556  1.00 0.00 ? 22 ARG B HB2  4  
ATOM 3002  H HB3  . ARG B 2 22 ? 10.243  1.321   -4.282  1.00 0.00 ? 22 ARG B HB3  4  
ATOM 3003  H HG2  . ARG B 2 22 ? 12.257  2.513   -4.113  1.00 0.00 ? 22 ARG B HG2  4  
ATOM 3004  H HG3  . ARG B 2 22 ? 13.193  1.063   -3.747  1.00 0.00 ? 22 ARG B HG3  4  
ATOM 3005  H HD2  . ARG B 2 22 ? 13.773  1.194   -5.950  1.00 0.00 ? 22 ARG B HD2  4  
ATOM 3006  H HD3  . ARG B 2 22 ? 12.215  0.407   -6.198  1.00 0.00 ? 22 ARG B HD3  4  
ATOM 3007  H HE   . ARG B 2 22 ? 12.603  3.369   -6.389  1.00 0.00 ? 22 ARG B HE   4  
ATOM 3008  H HH11 . ARG B 2 22 ? 10.230  1.031   -6.421  1.00 0.00 ? 22 ARG B HH11 4  
ATOM 3009  H HH12 . ARG B 2 22 ? 9.579   1.444   -7.972  1.00 0.00 ? 22 ARG B HH12 4  
ATOM 3010  H HH21 . ARG B 2 22 ? 12.143  3.642   -8.758  1.00 0.00 ? 22 ARG B HH21 4  
ATOM 3011  H HH22 . ARG B 2 22 ? 10.662  2.922   -9.295  1.00 0.00 ? 22 ARG B HH22 4  
ATOM 3012  N N    . GLY B 2 23 ? 9.813   2.215   -1.432  1.00 0.00 ? 23 GLY B N    4  
ATOM 3013  C CA   . GLY B 2 23 ? 9.697   3.495   -0.678  1.00 0.00 ? 23 GLY B CA   4  
ATOM 3014  C C    . GLY B 2 23 ? 10.082  3.269   0.785   1.00 0.00 ? 23 GLY B C    4  
ATOM 3015  O O    . GLY B 2 23 ? 10.669  4.122   1.420   1.00 0.00 ? 23 GLY B O    4  
ATOM 3016  H H    . GLY B 2 23 ? 9.004   1.734   -1.708  1.00 0.00 ? 23 GLY B H    4  
ATOM 3017  H HA2  . GLY B 2 23 ? 10.357  4.231   -1.116  1.00 0.00 ? 23 GLY B HA2  4  
ATOM 3018  H HA3  . GLY B 2 23 ? 8.679   3.851   -0.727  1.00 0.00 ? 23 GLY B HA3  4  
ATOM 3019  N N    . PHE B 2 24 ? 9.758   2.127   1.326   1.00 0.00 ? 24 PHE B N    4  
ATOM 3020  C CA   . PHE B 2 24 ? 10.107  1.852   2.748   1.00 0.00 ? 24 PHE B CA   4  
ATOM 3021  C C    . PHE B 2 24 ? 11.494  1.208   2.818   1.00 0.00 ? 24 PHE B C    4  
ATOM 3022  O O    . PHE B 2 24 ? 12.413  1.753   3.397   1.00 0.00 ? 24 PHE B O    4  
ATOM 3023  C CB   . PHE B 2 24 ? 9.071   0.903   3.356   1.00 0.00 ? 24 PHE B CB   4  
ATOM 3024  C CG   . PHE B 2 24 ? 7.823   1.679   3.708   1.00 0.00 ? 24 PHE B CG   4  
ATOM 3025  C CD1  . PHE B 2 24 ? 7.108   2.349   2.707   1.00 0.00 ? 24 PHE B CD1  4  
ATOM 3026  C CD2  . PHE B 2 24 ? 7.381   1.728   5.035   1.00 0.00 ? 24 PHE B CD2  4  
ATOM 3027  C CE1  . PHE B 2 24 ? 5.952   3.068   3.034   1.00 0.00 ? 24 PHE B CE1  4  
ATOM 3028  C CE2  . PHE B 2 24 ? 6.225   2.447   5.362   1.00 0.00 ? 24 PHE B CE2  4  
ATOM 3029  C CZ   . PHE B 2 24 ? 5.511   3.117   4.362   1.00 0.00 ? 24 PHE B CZ   4  
ATOM 3030  H H    . PHE B 2 24 ? 9.285   1.450   0.797   1.00 0.00 ? 24 PHE B H    4  
ATOM 3031  H HA   . PHE B 2 24 ? 10.114  2.779   3.301   1.00 0.00 ? 24 PHE B HA   4  
ATOM 3032  H HB2  . PHE B 2 24 ? 8.826   0.131   2.641   1.00 0.00 ? 24 PHE B HB2  4  
ATOM 3033  H HB3  . PHE B 2 24 ? 9.477   0.452   4.248   1.00 0.00 ? 24 PHE B HB3  4  
ATOM 3034  H HD1  . PHE B 2 24 ? 7.448   2.311   1.683   1.00 0.00 ? 24 PHE B HD1  4  
ATOM 3035  H HD2  . PHE B 2 24 ? 7.931   1.211   5.807   1.00 0.00 ? 24 PHE B HD2  4  
ATOM 3036  H HE1  . PHE B 2 24 ? 5.401   3.585   2.263   1.00 0.00 ? 24 PHE B HE1  4  
ATOM 3037  H HE2  . PHE B 2 24 ? 5.884   2.485   6.386   1.00 0.00 ? 24 PHE B HE2  4  
ATOM 3038  H HZ   . PHE B 2 24 ? 4.619   3.672   4.614   1.00 0.00 ? 24 PHE B HZ   4  
ATOM 3039  N N    . PHE B 2 25 ? 11.654  0.052   2.233   1.00 0.00 ? 25 PHE B N    4  
ATOM 3040  C CA   . PHE B 2 25 ? 12.983  -0.622  2.269   1.00 0.00 ? 25 PHE B CA   4  
ATOM 3041  C C    . PHE B 2 25 ? 13.793  -0.221  1.035   1.00 0.00 ? 25 PHE B C    4  
ATOM 3042  O O    . PHE B 2 25 ? 13.289  -0.201  -0.071  1.00 0.00 ? 25 PHE B O    4  
ATOM 3043  C CB   . PHE B 2 25 ? 12.788  -2.140  2.277   1.00 0.00 ? 25 PHE B CB   4  
ATOM 3044  C CG   . PHE B 2 25 ? 14.015  -2.802  2.858   1.00 0.00 ? 25 PHE B CG   4  
ATOM 3045  C CD1  . PHE B 2 25 ? 14.128  -2.975  4.242   1.00 0.00 ? 25 PHE B CD1  4  
ATOM 3046  C CD2  . PHE B 2 25 ? 15.039  -3.242  2.011   1.00 0.00 ? 25 PHE B CD2  4  
ATOM 3047  C CE1  . PHE B 2 25 ? 15.267  -3.587  4.781   1.00 0.00 ? 25 PHE B CE1  4  
ATOM 3048  C CE2  . PHE B 2 25 ? 16.178  -3.855  2.549   1.00 0.00 ? 25 PHE B CE2  4  
ATOM 3049  C CZ   . PHE B 2 25 ? 16.291  -4.027  3.934   1.00 0.00 ? 25 PHE B CZ   4  
ATOM 3050  H H    . PHE B 2 25 ? 10.901  -0.372  1.771   1.00 0.00 ? 25 PHE B H    4  
ATOM 3051  H HA   . PHE B 2 25 ? 13.514  -0.323  3.160   1.00 0.00 ? 25 PHE B HA   4  
ATOM 3052  H HB2  . PHE B 2 25 ? 11.925  -2.389  2.878   1.00 0.00 ? 25 PHE B HB2  4  
ATOM 3053  H HB3  . PHE B 2 25 ? 12.635  -2.489  1.267   1.00 0.00 ? 25 PHE B HB3  4  
ATOM 3054  H HD1  . PHE B 2 25 ? 13.338  -2.635  4.895   1.00 0.00 ? 25 PHE B HD1  4  
ATOM 3055  H HD2  . PHE B 2 25 ? 14.952  -3.110  0.943   1.00 0.00 ? 25 PHE B HD2  4  
ATOM 3056  H HE1  . PHE B 2 25 ? 15.354  -3.720  5.849   1.00 0.00 ? 25 PHE B HE1  4  
ATOM 3057  H HE2  . PHE B 2 25 ? 16.968  -4.195  1.896   1.00 0.00 ? 25 PHE B HE2  4  
ATOM 3058  H HZ   . PHE B 2 25 ? 17.169  -4.500  4.349   1.00 0.00 ? 25 PHE B HZ   4  
ATOM 3059  N N    . TYR B 2 26 ? 15.045  0.100   1.214   1.00 0.00 ? 26 TYR B N    4  
ATOM 3060  C CA   . TYR B 2 26 ? 15.886  0.499   0.050   1.00 0.00 ? 26 TYR B CA   4  
ATOM 3061  C C    . TYR B 2 26 ? 16.584  -0.737  -0.525  1.00 0.00 ? 26 TYR B C    4  
ATOM 3062  O O    . TYR B 2 26 ? 16.908  -1.657  0.200   1.00 0.00 ? 26 TYR B O    4  
ATOM 3063  C CB   . TYR B 2 26 ? 16.937  1.514   0.504   1.00 0.00 ? 26 TYR B CB   4  
ATOM 3064  C CG   . TYR B 2 26 ? 17.701  0.957   1.681   1.00 0.00 ? 26 TYR B CG   4  
ATOM 3065  C CD1  . TYR B 2 26 ? 18.653  -0.050  1.485   1.00 0.00 ? 26 TYR B CD1  4  
ATOM 3066  C CD2  . TYR B 2 26 ? 17.458  1.449   2.970   1.00 0.00 ? 26 TYR B CD2  4  
ATOM 3067  C CE1  . TYR B 2 26 ? 19.362  -0.566  2.577   1.00 0.00 ? 26 TYR B CE1  4  
ATOM 3068  C CE2  . TYR B 2 26 ? 18.167  0.933   4.061   1.00 0.00 ? 26 TYR B CE2  4  
ATOM 3069  C CZ   . TYR B 2 26 ? 19.119  -0.074  3.865   1.00 0.00 ? 26 TYR B CZ   4  
ATOM 3070  O OH   . TYR B 2 26 ? 19.817  -0.583  4.941   1.00 0.00 ? 26 TYR B OH   4  
ATOM 3071  H H    . TYR B 2 26 ? 15.433  0.077   2.114   1.00 0.00 ? 26 TYR B H    4  
ATOM 3072  H HA   . TYR B 2 26 ? 15.260  0.945   -0.709  1.00 0.00 ? 26 TYR B HA   4  
ATOM 3073  H HB2  . TYR B 2 26 ? 17.621  1.712   -0.309  1.00 0.00 ? 26 TYR B HB2  4  
ATOM 3074  H HB3  . TYR B 2 26 ? 16.449  2.432   0.795   1.00 0.00 ? 26 TYR B HB3  4  
ATOM 3075  H HD1  . TYR B 2 26 ? 18.841  -0.430  0.492   1.00 0.00 ? 26 TYR B HD1  4  
ATOM 3076  H HD2  . TYR B 2 26 ? 16.724  2.226   3.121   1.00 0.00 ? 26 TYR B HD2  4  
ATOM 3077  H HE1  . TYR B 2 26 ? 20.096  -1.344  2.425   1.00 0.00 ? 26 TYR B HE1  4  
ATOM 3078  H HE2  . TYR B 2 26 ? 17.979  1.312   5.055   1.00 0.00 ? 26 TYR B HE2  4  
ATOM 3079  H HH   . TYR B 2 26 ? 20.380  0.115   5.286   1.00 0.00 ? 26 TYR B HH   4  
ATOM 3080  N N    . PRO B 2 27 ? 16.795  -0.718  -1.816  1.00 0.00 ? 27 PRO B N    4  
ATOM 3081  C CA   . PRO B 2 27 ? 17.456  -1.825  -2.530  1.00 0.00 ? 27 PRO B CA   4  
ATOM 3082  C C    . PRO B 2 27 ? 18.972  -1.766  -2.324  1.00 0.00 ? 27 PRO B C    4  
ATOM 3083  O O    . PRO B 2 27 ? 19.559  -0.704  -2.265  1.00 0.00 ? 27 PRO B O    4  
ATOM 3084  C CB   . PRO B 2 27 ? 17.094  -1.572  -3.996  1.00 0.00 ? 27 PRO B CB   4  
ATOM 3085  C CG   . PRO B 2 27 ? 16.747  -0.068  -4.107  1.00 0.00 ? 27 PRO B CG   4  
ATOM 3086  C CD   . PRO B 2 27 ? 16.395  0.408   -2.684  1.00 0.00 ? 27 PRO B CD   4  
ATOM 3087  H HA   . PRO B 2 27 ? 17.061  -2.776  -2.211  1.00 0.00 ? 27 PRO B HA   4  
ATOM 3088  H HB2  . PRO B 2 27 ? 17.938  -1.809  -4.631  1.00 0.00 ? 27 PRO B HB2  4  
ATOM 3089  H HB3  . PRO B 2 27 ? 16.238  -2.165  -4.277  1.00 0.00 ? 27 PRO B HB3  4  
ATOM 3090  H HG2  . PRO B 2 27 ? 17.598  0.481   -4.485  1.00 0.00 ? 27 PRO B HG2  4  
ATOM 3091  H HG3  . PRO B 2 27 ? 15.897  0.069   -4.757  1.00 0.00 ? 27 PRO B HG3  4  
ATOM 3092  H HD2  . PRO B 2 27 ? 16.956  1.299   -2.436  1.00 0.00 ? 27 PRO B HD2  4  
ATOM 3093  H HD3  . PRO B 2 27 ? 15.335  0.588   -2.596  1.00 0.00 ? 27 PRO B HD3  4  
ATOM 3094  N N    . THR B 2 28 ? 19.610  -2.899  -2.214  1.00 0.00 ? 28 THR B N    4  
ATOM 3095  C CA   . THR B 2 28 ? 21.086  -2.907  -2.012  1.00 0.00 ? 28 THR B CA   4  
ATOM 3096  C C    . THR B 2 28 ? 21.708  -4.027  -2.847  1.00 0.00 ? 28 THR B C    4  
ATOM 3097  O O    . THR B 2 28 ? 21.992  -5.100  -2.350  1.00 0.00 ? 28 THR B O    4  
ATOM 3098  C CB   . THR B 2 28 ? 21.398  -3.140  -0.532  1.00 0.00 ? 28 THR B CB   4  
ATOM 3099  O OG1  . THR B 2 28 ? 22.707  -3.675  -0.405  1.00 0.00 ? 28 THR B OG1  4  
ATOM 3100  C CG2  . THR B 2 28 ? 20.383  -4.121  0.057   1.00 0.00 ? 28 THR B CG2  4  
ATOM 3101  H H    . THR B 2 28 ? 19.118  -3.745  -2.264  1.00 0.00 ? 28 THR B H    4  
ATOM 3102  H HA   . THR B 2 28 ? 21.496  -1.957  -2.321  1.00 0.00 ? 28 THR B HA   4  
ATOM 3103  H HB   . THR B 2 28 ? 21.337  -2.203  0.001   1.00 0.00 ? 28 THR B HB   4  
ATOM 3104  H HG1  . THR B 2 28 ? 22.703  -4.561  -0.776  1.00 0.00 ? 28 THR B HG1  4  
ATOM 3105  H HG21 . THR B 2 28 ? 20.736  -4.473  1.015   1.00 0.00 ? 28 THR B HG21 4  
ATOM 3106  H HG22 . THR B 2 28 ? 20.263  -4.960  -0.613  1.00 0.00 ? 28 THR B HG22 4  
ATOM 3107  H HG23 . THR B 2 28 ? 19.433  -3.624  0.184   1.00 0.00 ? 28 THR B HG23 4  
ATOM 3108  N N    . LYS B 2 29 ? 21.924  -3.789  -4.111  1.00 0.00 ? 29 LYS B N    4  
ATOM 3109  C CA   . LYS B 2 29 ? 22.529  -4.842  -4.975  1.00 0.00 ? 29 LYS B CA   4  
ATOM 3110  C C    . LYS B 2 29 ? 24.052  -4.794  -4.846  1.00 0.00 ? 29 LYS B C    4  
ATOM 3111  O O    . LYS B 2 29 ? 24.683  -3.812  -5.184  1.00 0.00 ? 29 LYS B O    4  
ATOM 3112  C CB   . LYS B 2 29 ? 22.132  -4.599  -6.432  1.00 0.00 ? 29 LYS B CB   4  
ATOM 3113  C CG   . LYS B 2 29 ? 20.610  -4.473  -6.534  1.00 0.00 ? 29 LYS B CG   4  
ATOM 3114  C CD   . LYS B 2 29 ? 19.950  -5.650  -5.813  1.00 0.00 ? 29 LYS B CD   4  
ATOM 3115  C CE   . LYS B 2 29 ? 18.455  -5.672  -6.134  1.00 0.00 ? 29 LYS B CE   4  
ATOM 3116  N NZ   . LYS B 2 29 ? 17.764  -4.600  -5.364  1.00 0.00 ? 29 LYS B NZ   4  
ATOM 3117  H H    . LYS B 2 29 ? 21.689  -2.917  -4.493  1.00 0.00 ? 29 LYS B H    4  
ATOM 3118  H HA   . LYS B 2 29 ? 22.172  -5.812  -4.662  1.00 0.00 ? 29 LYS B HA   4  
ATOM 3119  H HB2  . LYS B 2 29 ? 22.593  -3.687  -6.784  1.00 0.00 ? 29 LYS B HB2  4  
ATOM 3120  H HB3  . LYS B 2 29 ? 22.463  -5.428  -7.039  1.00 0.00 ? 29 LYS B HB3  4  
ATOM 3121  H HG2  . LYS B 2 29 ? 20.294  -3.546  -6.077  1.00 0.00 ? 29 LYS B HG2  4  
ATOM 3122  H HG3  . LYS B 2 29 ? 20.317  -4.481  -7.573  1.00 0.00 ? 29 LYS B HG3  4  
ATOM 3123  H HD2  . LYS B 2 29 ? 20.404  -6.573  -6.141  1.00 0.00 ? 29 LYS B HD2  4  
ATOM 3124  H HD3  . LYS B 2 29 ? 20.085  -5.540  -4.747  1.00 0.00 ? 29 LYS B HD3  4  
ATOM 3125  H HE2  . LYS B 2 29 ? 18.311  -5.505  -7.192  1.00 0.00 ? 29 LYS B HE2  4  
ATOM 3126  H HE3  . LYS B 2 29 ? 18.043  -6.633  -5.863  1.00 0.00 ? 29 LYS B HE3  4  
ATOM 3127  H HZ1  . LYS B 2 29 ? 18.124  -3.671  -5.663  1.00 0.00 ? 29 LYS B HZ1  4  
ATOM 3128  H HZ2  . LYS B 2 29 ? 17.946  -4.732  -4.348  1.00 0.00 ? 29 LYS B HZ2  4  
ATOM 3129  H HZ3  . LYS B 2 29 ? 16.742  -4.647  -5.543  1.00 0.00 ? 29 LYS B HZ3  4  
ATOM 3130  N N    . THR B 2 30 ? 24.649  -5.847  -4.358  1.00 0.00 ? 30 THR B N    4  
ATOM 3131  C CA   . THR B 2 30 ? 26.131  -5.861  -4.207  1.00 0.00 ? 30 THR B CA   4  
ATOM 3132  C C    . THR B 2 30 ? 26.714  -7.029  -5.006  1.00 0.00 ? 30 THR B C    4  
ATOM 3133  O O    . THR B 2 30 ? 27.169  -7.976  -4.386  1.00 0.00 ? 30 THR B O    4  
ATOM 3134  C CB   . THR B 2 30 ? 26.492  -6.024  -2.728  1.00 0.00 ? 30 THR B CB   4  
ATOM 3135  O OG1  . THR B 2 30 ? 25.622  -6.977  -2.133  1.00 0.00 ? 30 THR B OG1  4  
ATOM 3136  C CG2  . THR B 2 30 ? 26.345  -4.680  -2.013  1.00 0.00 ? 30 THR B CG2  4  
ATOM 3137  O OXT  . THR B 2 30 ? 26.695  -6.956  -6.223  1.00 0.00 ? 30 THR B OXT  4  
ATOM 3138  H H    . THR B 2 30 ? 24.122  -6.628  -4.091  1.00 0.00 ? 30 THR B H    4  
ATOM 3139  H HA   . THR B 2 30 ? 26.540  -4.932  -4.577  1.00 0.00 ? 30 THR B HA   4  
ATOM 3140  H HB   . THR B 2 30 ? 27.512  -6.363  -2.641  1.00 0.00 ? 30 THR B HB   4  
ATOM 3141  H HG1  . THR B 2 30 ? 26.082  -7.374  -1.389  1.00 0.00 ? 30 THR B HG1  4  
ATOM 3142  H HG21 . THR B 2 30 ? 25.400  -4.232  -2.280  1.00 0.00 ? 30 THR B HG21 4  
ATOM 3143  H HG22 . THR B 2 30 ? 27.151  -4.025  -2.310  1.00 0.00 ? 30 THR B HG22 4  
ATOM 3144  H HG23 . THR B 2 30 ? 26.382  -4.835  -0.945  1.00 0.00 ? 30 THR B HG23 4  
ATOM 3145  N N    . GLY A 1 1  ? -0.059  11.193  3.654   1.00 0.00 ? 1  GLY A N    5  
ATOM 3146  C CA   . GLY A 1 1  ? 0.195   10.080  2.694   1.00 0.00 ? 1  GLY A CA   5  
ATOM 3147  C C    . GLY A 1 1  ? -1.111  9.701   1.994   1.00 0.00 ? 1  GLY A C    5  
ATOM 3148  O O    . GLY A 1 1  ? -2.184  10.098  2.404   1.00 0.00 ? 1  GLY A O    5  
ATOM 3149  H H1   . GLY A 1 1  ? 0.815   11.738  3.792   1.00 0.00 ? 1  GLY A H1   5  
ATOM 3150  H H2   . GLY A 1 1  ? -0.371  10.799  4.565   1.00 0.00 ? 1  GLY A H2   5  
ATOM 3151  H H3   . GLY A 1 1  ? -0.797  11.817  3.274   1.00 0.00 ? 1  GLY A H3   5  
ATOM 3152  H HA2  . GLY A 1 1  ? 0.921   10.398  1.959   1.00 0.00 ? 1  GLY A HA2  5  
ATOM 3153  H HA3  . GLY A 1 1  ? 0.574   9.223   3.229   1.00 0.00 ? 1  GLY A HA3  5  
ATOM 3154  N N    . ILE A 1 2  ? -1.030  8.936   0.940   1.00 0.00 ? 2  ILE A N    5  
ATOM 3155  C CA   . ILE A 1 2  ? -2.269  8.533   0.215   1.00 0.00 ? 2  ILE A CA   5  
ATOM 3156  C C    . ILE A 1 2  ? -3.098  7.602   1.098   1.00 0.00 ? 2  ILE A C    5  
ATOM 3157  O O    . ILE A 1 2  ? -4.311  7.600   1.044   1.00 0.00 ? 2  ILE A O    5  
ATOM 3158  C CB   . ILE A 1 2  ? -1.897  7.812   -1.085  1.00 0.00 ? 2  ILE A CB   5  
ATOM 3159  C CG1  . ILE A 1 2  ? -0.689  6.900   -0.847  1.00 0.00 ? 2  ILE A CG1  5  
ATOM 3160  C CG2  . ILE A 1 2  ? -1.549  8.845   -2.159  1.00 0.00 ? 2  ILE A CG2  5  
ATOM 3161  C CD1  . ILE A 1 2  ? -0.728  5.733   -1.836  1.00 0.00 ? 2  ILE A CD1  5  
ATOM 3162  H H    . ILE A 1 2  ? -0.155  8.628   0.625   1.00 0.00 ? 2  ILE A H    5  
ATOM 3163  H HA   . ILE A 1 2  ? -2.852  9.412   -0.015  1.00 0.00 ? 2  ILE A HA   5  
ATOM 3164  H HB   . ILE A 1 2  ? -2.737  7.220   -1.418  1.00 0.00 ? 2  ILE A HB   5  
ATOM 3165  H HG12 . ILE A 1 2  ? 0.223   7.463   -0.991  1.00 0.00 ? 2  ILE A HG12 5  
ATOM 3166  H HG13 . ILE A 1 2  ? -0.718  6.515   0.161   1.00 0.00 ? 2  ILE A HG13 5  
ATOM 3167  H HG21 . ILE A 1 2  ? -1.541  8.368   -3.127  1.00 0.00 ? 2  ILE A HG21 5  
ATOM 3168  H HG22 . ILE A 1 2  ? -0.573  9.261   -1.955  1.00 0.00 ? 2  ILE A HG22 5  
ATOM 3169  H HG23 . ILE A 1 2  ? -2.286  9.634   -2.152  1.00 0.00 ? 2  ILE A HG23 5  
ATOM 3170  H HD11 . ILE A 1 2  ? -0.186  6.001   -2.731  1.00 0.00 ? 2  ILE A HD11 5  
ATOM 3171  H HD12 . ILE A 1 2  ? -1.753  5.509   -2.089  1.00 0.00 ? 2  ILE A HD12 5  
ATOM 3172  H HD13 . ILE A 1 2  ? -0.271  4.864   -1.386  1.00 0.00 ? 2  ILE A HD13 5  
ATOM 3173  N N    . VAL A 1 3  ? -2.457  6.814   1.913   1.00 0.00 ? 3  VAL A N    5  
ATOM 3174  C CA   . VAL A 1 3  ? -3.207  5.888   2.796   1.00 0.00 ? 3  VAL A CA   5  
ATOM 3175  C C    . VAL A 1 3  ? -4.039  6.706   3.790   1.00 0.00 ? 3  VAL A C    5  
ATOM 3176  O O    . VAL A 1 3  ? -5.185  6.401   4.055   1.00 0.00 ? 3  VAL A O    5  
ATOM 3177  C CB   . VAL A 1 3  ? -2.196  4.993   3.528   1.00 0.00 ? 3  VAL A CB   5  
ATOM 3178  C CG1  . VAL A 1 3  ? -2.728  4.591   4.901   1.00 0.00 ? 3  VAL A CG1  5  
ATOM 3179  C CG2  . VAL A 1 3  ? -1.944  3.732   2.697   1.00 0.00 ? 3  VAL A CG2  5  
ATOM 3180  H H    . VAL A 1 3  ? -1.481  6.831   1.949   1.00 0.00 ? 3  VAL A H    5  
ATOM 3181  H HA   . VAL A 1 3  ? -3.863  5.278   2.198   1.00 0.00 ? 3  VAL A HA   5  
ATOM 3182  H HB   . VAL A 1 3  ? -1.267  5.531   3.650   1.00 0.00 ? 3  VAL A HB   5  
ATOM 3183  H HG11 . VAL A 1 3  ? -2.077  3.848   5.335   1.00 0.00 ? 3  VAL A HG11 5  
ATOM 3184  H HG12 . VAL A 1 3  ? -3.722  4.185   4.795   1.00 0.00 ? 3  VAL A HG12 5  
ATOM 3185  H HG13 . VAL A 1 3  ? -2.760  5.462   5.540   1.00 0.00 ? 3  VAL A HG13 5  
ATOM 3186  H HG21 . VAL A 1 3  ? -0.960  3.783   2.254   1.00 0.00 ? 3  VAL A HG21 5  
ATOM 3187  H HG22 . VAL A 1 3  ? -2.687  3.662   1.916   1.00 0.00 ? 3  VAL A HG22 5  
ATOM 3188  H HG23 . VAL A 1 3  ? -2.008  2.863   3.334   1.00 0.00 ? 3  VAL A HG23 5  
ATOM 3189  N N    . GLU A 1 4  ? -3.470  7.740   4.339   1.00 0.00 ? 4  GLU A N    5  
ATOM 3190  C CA   . GLU A 1 4  ? -4.226  8.576   5.313   1.00 0.00 ? 4  GLU A CA   5  
ATOM 3191  C C    . GLU A 1 4  ? -5.462  9.162   4.630   1.00 0.00 ? 4  GLU A C    5  
ATOM 3192  O O    . GLU A 1 4  ? -6.531  9.223   5.203   1.00 0.00 ? 4  GLU A O    5  
ATOM 3193  C CB   . GLU A 1 4  ? -3.331  9.714   5.812   1.00 0.00 ? 4  GLU A CB   5  
ATOM 3194  C CG   . GLU A 1 4  ? -3.514  9.885   7.321   1.00 0.00 ? 4  GLU A CG   5  
ATOM 3195  C CD   . GLU A 1 4  ? -3.580  11.374  7.662   1.00 0.00 ? 4  GLU A CD   5  
ATOM 3196  O OE1  . GLU A 1 4  ? -3.957  12.144  6.794   1.00 0.00 ? 4  GLU A OE1  5  
ATOM 3197  O OE2  . GLU A 1 4  ? -3.252  11.720  8.785   1.00 0.00 ? 4  GLU A OE2  5  
ATOM 3198  H H    . GLU A 1 4  ? -2.546  7.967   4.110   1.00 0.00 ? 4  GLU A H    5  
ATOM 3199  H HA   . GLU A 1 4  ? -4.532  7.967   6.148   1.00 0.00 ? 4  GLU A HA   5  
ATOM 3200  H HB2  . GLU A 1 4  ? -2.299  9.479   5.597   1.00 0.00 ? 4  GLU A HB2  5  
ATOM 3201  H HB3  . GLU A 1 4  ? -3.604  10.631  5.312   1.00 0.00 ? 4  GLU A HB3  5  
ATOM 3202  H HG2  . GLU A 1 4  ? -4.430  9.403   7.630   1.00 0.00 ? 4  GLU A HG2  5  
ATOM 3203  H HG3  . GLU A 1 4  ? -2.679  9.436   7.838   1.00 0.00 ? 4  GLU A HG3  5  
ATOM 3204  N N    . GLN A 1 5  ? -5.321  9.598   3.410   1.00 0.00 ? 5  GLN A N    5  
ATOM 3205  C CA   . GLN A 1 5  ? -6.486  10.184  2.688   1.00 0.00 ? 5  GLN A CA   5  
ATOM 3206  C C    . GLN A 1 5  ? -7.355  9.067   2.110   1.00 0.00 ? 5  GLN A C    5  
ATOM 3207  O O    . GLN A 1 5  ? -8.568  9.115   2.175   1.00 0.00 ? 5  GLN A O    5  
ATOM 3208  C CB   . GLN A 1 5  ? -5.984  11.076  1.550   1.00 0.00 ? 5  GLN A CB   5  
ATOM 3209  C CG   . GLN A 1 5  ? -7.124  11.971  1.062   1.00 0.00 ? 5  GLN A CG   5  
ATOM 3210  C CD   . GLN A 1 5  ? -6.808  13.430  1.398   1.00 0.00 ? 5  GLN A CD   5  
ATOM 3211  O OE1  . GLN A 1 5  ? -5.658  13.801  1.519   1.00 0.00 ? 5  GLN A OE1  5  
ATOM 3212  N NE2  . GLN A 1 5  ? -7.787  14.278  1.554   1.00 0.00 ? 5  GLN A NE2  5  
ATOM 3213  H H    . GLN A 1 5  ? -4.449  9.540   2.969   1.00 0.00 ? 5  GLN A H    5  
ATOM 3214  H HA   . GLN A 1 5  ? -7.071  10.774  3.373   1.00 0.00 ? 5  GLN A HA   5  
ATOM 3215  H HB2  . GLN A 1 5  ? -5.170  11.691  1.908   1.00 0.00 ? 5  GLN A HB2  5  
ATOM 3216  H HB3  . GLN A 1 5  ? -5.638  10.459  0.734   1.00 0.00 ? 5  GLN A HB3  5  
ATOM 3217  H HG2  . GLN A 1 5  ? -7.234  11.863  -0.008  1.00 0.00 ? 5  GLN A HG2  5  
ATOM 3218  H HG3  . GLN A 1 5  ? -8.043  11.683  1.549   1.00 0.00 ? 5  GLN A HG3  5  
ATOM 3219  H HE21 . GLN A 1 5  ? -8.715  13.978  1.456   1.00 0.00 ? 5  GLN A HE21 5  
ATOM 3220  H HE22 . GLN A 1 5  ? -7.595  15.214  1.771   1.00 0.00 ? 5  GLN A HE22 5  
ATOM 3221  N N    . CYS A 1 6  ? -6.748  8.067   1.538   1.00 0.00 ? 6  CYS A N    5  
ATOM 3222  C CA   . CYS A 1 6  ? -7.545  6.952   0.947   1.00 0.00 ? 6  CYS A CA   5  
ATOM 3223  C C    . CYS A 1 6  ? -7.970  5.972   2.044   1.00 0.00 ? 6  CYS A C    5  
ATOM 3224  O O    . CYS A 1 6  ? -8.552  4.941   1.772   1.00 0.00 ? 6  CYS A O    5  
ATOM 3225  C CB   . CYS A 1 6  ? -6.699  6.214   -0.092  1.00 0.00 ? 6  CYS A CB   5  
ATOM 3226  S SG   . CYS A 1 6  ? -6.928  6.983   -1.714  1.00 0.00 ? 6  CYS A SG   5  
ATOM 3227  H H    . CYS A 1 6  ? -5.768  8.053   1.490   1.00 0.00 ? 6  CYS A H    5  
ATOM 3228  H HA   . CYS A 1 6  ? -8.425  7.356   0.469   1.00 0.00 ? 6  CYS A HA   5  
ATOM 3229  H HB2  . CYS A 1 6  ? -5.659  6.265   0.187   1.00 0.00 ? 6  CYS A HB2  5  
ATOM 3230  H HB3  . CYS A 1 6  ? -7.008  5.180   -0.136  1.00 0.00 ? 6  CYS A HB3  5  
ATOM 3231  N N    . CYS A 1 7  ? -7.683  6.277   3.280   1.00 0.00 ? 7  CYS A N    5  
ATOM 3232  C CA   . CYS A 1 7  ? -8.073  5.350   4.382   1.00 0.00 ? 7  CYS A CA   5  
ATOM 3233  C C    . CYS A 1 7  ? -9.592  5.151   4.384   1.00 0.00 ? 7  CYS A C    5  
ATOM 3234  O O    . CYS A 1 7  ? -10.313 5.795   5.120   1.00 0.00 ? 7  CYS A O    5  
ATOM 3235  C CB   . CYS A 1 7  ? -7.633  5.933   5.725   1.00 0.00 ? 7  CYS A CB   5  
ATOM 3236  S SG   . CYS A 1 7  ? -7.153  4.584   6.833   1.00 0.00 ? 7  CYS A SG   5  
ATOM 3237  H H    . CYS A 1 7  ? -7.209  7.110   3.483   1.00 0.00 ? 7  CYS A H    5  
ATOM 3238  H HA   . CYS A 1 7  ? -7.591  4.396   4.232   1.00 0.00 ? 7  CYS A HA   5  
ATOM 3239  H HB2  . CYS A 1 7  ? -6.792  6.593   5.574   1.00 0.00 ? 7  CYS A HB2  5  
ATOM 3240  H HB3  . CYS A 1 7  ? -8.451  6.485   6.164   1.00 0.00 ? 7  CYS A HB3  5  
ATOM 3241  N N    . THR A 1 8  ? -10.079 4.255   3.569   1.00 0.00 ? 8  THR A N    5  
ATOM 3242  C CA   . THR A 1 8  ? -11.547 3.996   3.520   1.00 0.00 ? 8  THR A CA   5  
ATOM 3243  C C    . THR A 1 8  ? -11.782 2.604   2.931   1.00 0.00 ? 8  THR A C    5  
ATOM 3244  O O    . THR A 1 8  ? -10.953 1.725   3.056   1.00 0.00 ? 8  THR A O    5  
ATOM 3245  C CB   . THR A 1 8  ? -12.228 5.045   2.635   1.00 0.00 ? 8  THR A CB   5  
ATOM 3246  O OG1  . THR A 1 8  ? -11.890 4.805   1.276   1.00 0.00 ? 8  THR A OG1  5  
ATOM 3247  C CG2  . THR A 1 8  ? -11.759 6.443   3.040   1.00 0.00 ? 8  THR A CG2  5  
ATOM 3248  H H    . THR A 1 8  ? -9.475  3.745   2.990   1.00 0.00 ? 8  THR A H    5  
ATOM 3249  H HA   . THR A 1 8  ? -11.957 4.042   4.518   1.00 0.00 ? 8  THR A HA   5  
ATOM 3250  H HB   . THR A 1 8  ? -13.298 4.979   2.757   1.00 0.00 ? 8  THR A HB   5  
ATOM 3251  H HG1  . THR A 1 8  ? -12.689 4.897   0.751   1.00 0.00 ? 8  THR A HG1  5  
ATOM 3252  H HG21 . THR A 1 8  ? -11.958 6.600   4.090   1.00 0.00 ? 8  THR A HG21 5  
ATOM 3253  H HG22 . THR A 1 8  ? -12.290 7.183   2.459   1.00 0.00 ? 8  THR A HG22 5  
ATOM 3254  H HG23 . THR A 1 8  ? -10.699 6.535   2.856   1.00 0.00 ? 8  THR A HG23 5  
ATOM 3255  N N    . SER A 1 9  ? -12.894 2.394   2.280   1.00 0.00 ? 9  SER A N    5  
ATOM 3256  C CA   . SER A 1 9  ? -13.153 1.056   1.679   1.00 0.00 ? 9  SER A CA   5  
ATOM 3257  C C    . SER A 1 9  ? -12.032 0.753   0.677   1.00 0.00 ? 9  SER A C    5  
ATOM 3258  O O    . SER A 1 9  ? -10.901 0.532   1.059   1.00 0.00 ? 9  SER A O    5  
ATOM 3259  C CB   . SER A 1 9  ? -14.510 1.063   0.973   1.00 0.00 ? 9  SER A CB   5  
ATOM 3260  O OG   . SER A 1 9  ? -15.523 1.416   1.905   1.00 0.00 ? 9  SER A OG   5  
ATOM 3261  H H    . SER A 1 9  ? -13.550 3.115   2.179   1.00 0.00 ? 9  SER A H    5  
ATOM 3262  H HA   . SER A 1 9  ? -13.152 0.306   2.457   1.00 0.00 ? 9  SER A HA   5  
ATOM 3263  H HB2  . SER A 1 9  ? -14.498 1.784   0.173   1.00 0.00 ? 9  SER A HB2  5  
ATOM 3264  H HB3  . SER A 1 9  ? -14.708 0.080   0.565   1.00 0.00 ? 9  SER A HB3  5  
ATOM 3265  H HG   . SER A 1 9  ? -15.258 1.092   2.769   1.00 0.00 ? 9  SER A HG   5  
ATOM 3266  N N    . ILE A 1 10 ? -12.315 0.760   -0.601  1.00 0.00 ? 10 ILE A N    5  
ATOM 3267  C CA   . ILE A 1 10 ? -11.233 0.491   -1.588  1.00 0.00 ? 10 ILE A CA   5  
ATOM 3268  C C    . ILE A 1 10 ? -10.884 1.799   -2.294  1.00 0.00 ? 10 ILE A C    5  
ATOM 3269  O O    . ILE A 1 10 ? -11.673 2.344   -3.040  1.00 0.00 ? 10 ILE A O    5  
ATOM 3270  C CB   . ILE A 1 10 ? -11.709 -0.556  -2.613  1.00 0.00 ? 10 ILE A CB   5  
ATOM 3271  C CG1  . ILE A 1 10 ? -10.976 -0.376  -3.955  1.00 0.00 ? 10 ILE A CG1  5  
ATOM 3272  C CG2  . ILE A 1 10 ? -13.212 -0.394  -2.839  1.00 0.00 ? 10 ILE A CG2  5  
ATOM 3273  C CD1  . ILE A 1 10 ? -9.464  -0.552  -3.760  1.00 0.00 ? 10 ILE A CD1  5  
ATOM 3274  H H    . ILE A 1 10 ? -13.222 0.955   -0.909  1.00 0.00 ? 10 ILE A H    5  
ATOM 3275  H HA   . ILE A 1 10 ? -10.361 0.123   -1.071  1.00 0.00 ? 10 ILE A HA   5  
ATOM 3276  H HB   . ILE A 1 10 ? -11.515 -1.546  -2.229  1.00 0.00 ? 10 ILE A HB   5  
ATOM 3277  H HG12 . ILE A 1 10 ? -11.334 -1.112  -4.659  1.00 0.00 ? 10 ILE A HG12 5  
ATOM 3278  H HG13 . ILE A 1 10 ? -11.173 0.613   -4.340  1.00 0.00 ? 10 ILE A HG13 5  
ATOM 3279  H HG21 . ILE A 1 10 ? -13.517 -1.003  -3.678  1.00 0.00 ? 10 ILE A HG21 5  
ATOM 3280  H HG22 . ILE A 1 10 ? -13.436 0.642   -3.045  1.00 0.00 ? 10 ILE A HG22 5  
ATOM 3281  H HG23 . ILE A 1 10 ? -13.745 -0.709  -1.954  1.00 0.00 ? 10 ILE A HG23 5  
ATOM 3282  H HD11 . ILE A 1 10 ? -9.250  -1.579  -3.504  1.00 0.00 ? 10 ILE A HD11 5  
ATOM 3283  H HD12 . ILE A 1 10 ? -9.123  0.096   -2.967  1.00 0.00 ? 10 ILE A HD12 5  
ATOM 3284  H HD13 . ILE A 1 10 ? -8.951  -0.297  -4.678  1.00 0.00 ? 10 ILE A HD13 5  
ATOM 3285  N N    . CYS A 1 11 ? -9.702  2.297   -2.079  1.00 0.00 ? 11 CYS A N    5  
ATOM 3286  C CA   . CYS A 1 11 ? -9.302  3.554   -2.755  1.00 0.00 ? 11 CYS A CA   5  
ATOM 3287  C C    . CYS A 1 11 ? -8.300  3.208   -3.848  1.00 0.00 ? 11 CYS A C    5  
ATOM 3288  O O    . CYS A 1 11 ? -7.252  2.659   -3.574  1.00 0.00 ? 11 CYS A O    5  
ATOM 3289  C CB   . CYS A 1 11 ? -8.651  4.498   -1.744  1.00 0.00 ? 11 CYS A CB   5  
ATOM 3290  S SG   . CYS A 1 11 ? -8.651  6.183   -2.403  1.00 0.00 ? 11 CYS A SG   5  
ATOM 3291  H H    . CYS A 1 11 ? -9.074  1.836   -1.484  1.00 0.00 ? 11 CYS A H    5  
ATOM 3292  H HA   . CYS A 1 11 ? -10.170 4.027   -3.191  1.00 0.00 ? 11 CYS A HA   5  
ATOM 3293  H HB2  . CYS A 1 11 ? -9.206  4.472   -0.818  1.00 0.00 ? 11 CYS A HB2  5  
ATOM 3294  H HB3  . CYS A 1 11 ? -7.634  4.182   -1.563  1.00 0.00 ? 11 CYS A HB3  5  
ATOM 3295  N N    . SER A 1 12 ? -8.627  3.532   -5.076  1.00 0.00 ? 12 SER A N    5  
ATOM 3296  C CA   . SER A 1 12 ? -7.734  3.244   -6.236  1.00 0.00 ? 12 SER A CA   5  
ATOM 3297  C C    . SER A 1 12 ? -6.676  2.197   -5.883  1.00 0.00 ? 12 SER A C    5  
ATOM 3298  O O    . SER A 1 12 ? -5.518  2.516   -5.715  1.00 0.00 ? 12 SER A O    5  
ATOM 3299  C CB   . SER A 1 12 ? -7.045  4.535   -6.672  1.00 0.00 ? 12 SER A CB   5  
ATOM 3300  O OG   . SER A 1 12 ? -7.945  5.306   -7.457  1.00 0.00 ? 12 SER A OG   5  
ATOM 3301  H H    . SER A 1 12 ? -9.479  3.974   -5.239  1.00 0.00 ? 12 SER A H    5  
ATOM 3302  H HA   . SER A 1 12 ? -8.333  2.875   -7.056  1.00 0.00 ? 12 SER A HA   5  
ATOM 3303  H HB2  . SER A 1 12 ? -6.756  5.102   -5.804  1.00 0.00 ? 12 SER A HB2  5  
ATOM 3304  H HB3  . SER A 1 12 ? -6.163  4.293   -7.251  1.00 0.00 ? 12 SER A HB3  5  
ATOM 3305  H HG   . SER A 1 12 ? -8.258  4.755   -8.178  1.00 0.00 ? 12 SER A HG   5  
ATOM 3306  N N    . LEU A 1 13 ? -7.048  0.948   -5.789  1.00 0.00 ? 13 LEU A N    5  
ATOM 3307  C CA   . LEU A 1 13 ? -6.025  -0.083  -5.477  1.00 0.00 ? 13 LEU A CA   5  
ATOM 3308  C C    . LEU A 1 13 ? -4.931  0.089   -6.510  1.00 0.00 ? 13 LEU A C    5  
ATOM 3309  O O    . LEU A 1 13 ? -3.762  -0.119  -6.254  1.00 0.00 ? 13 LEU A O    5  
ATOM 3310  C CB   . LEU A 1 13 ? -6.636  -1.483  -5.583  1.00 0.00 ? 13 LEU A CB   5  
ATOM 3311  C CG   . LEU A 1 13 ? -6.215  -2.318  -4.373  1.00 0.00 ? 13 LEU A CG   5  
ATOM 3312  C CD1  . LEU A 1 13 ? -4.688  -2.358  -4.286  1.00 0.00 ? 13 LEU A CD1  5  
ATOM 3313  C CD2  . LEU A 1 13 ? -6.781  -1.687  -3.098  1.00 0.00 ? 13 LEU A CD2  5  
ATOM 3314  H H    . LEU A 1 13 ? -7.981  0.693   -5.941  1.00 0.00 ? 13 LEU A H    5  
ATOM 3315  H HA   . LEU A 1 13 ? -5.619  0.079   -4.490  1.00 0.00 ? 13 LEU A HA   5  
ATOM 3316  H HB2  . LEU A 1 13 ? -7.713  -1.404  -5.610  1.00 0.00 ? 13 LEU A HB2  5  
ATOM 3317  H HB3  . LEU A 1 13 ? -6.287  -1.961  -6.486  1.00 0.00 ? 13 LEU A HB3  5  
ATOM 3318  H HG   . LEU A 1 13 ? -6.596  -3.323  -4.480  1.00 0.00 ? 13 LEU A HG   5  
ATOM 3319  H HD11 . LEU A 1 13 ? -4.357  -3.386  -4.257  1.00 0.00 ? 13 LEU A HD11 5  
ATOM 3320  H HD12 . LEU A 1 13 ? -4.365  -1.850  -3.390  1.00 0.00 ? 13 LEU A HD12 5  
ATOM 3321  H HD13 . LEU A 1 13 ? -4.266  -1.868  -5.151  1.00 0.00 ? 13 LEU A HD13 5  
ATOM 3322  H HD21 . LEU A 1 13 ? -7.110  -0.681  -3.309  1.00 0.00 ? 13 LEU A HD21 5  
ATOM 3323  H HD22 . LEU A 1 13 ? -6.014  -1.663  -2.337  1.00 0.00 ? 13 LEU A HD22 5  
ATOM 3324  H HD23 . LEU A 1 13 ? -7.617  -2.274  -2.747  1.00 0.00 ? 13 LEU A HD23 5  
ATOM 3325  N N    . TYR A 1 14 ? -5.317  0.521   -7.674  1.00 0.00 ? 14 TYR A N    5  
ATOM 3326  C CA   . TYR A 1 14 ? -4.316  0.776   -8.738  1.00 0.00 ? 14 TYR A CA   5  
ATOM 3327  C C    . TYR A 1 14 ? -3.397  1.890   -8.244  1.00 0.00 ? 14 TYR A C    5  
ATOM 3328  O O    . TYR A 1 14 ? -2.212  1.899   -8.511  1.00 0.00 ? 14 TYR A O    5  
ATOM 3329  C CB   . TYR A 1 14 ? -5.025  1.217   -10.020 1.00 0.00 ? 14 TYR A CB   5  
ATOM 3330  C CG   . TYR A 1 14 ? -4.762  0.212   -11.116 1.00 0.00 ? 14 TYR A CG   5  
ATOM 3331  C CD1  . TYR A 1 14 ? -4.805  -1.159  -10.834 1.00 0.00 ? 14 TYR A CD1  5  
ATOM 3332  C CD2  . TYR A 1 14 ? -4.477  0.652   -12.414 1.00 0.00 ? 14 TYR A CD2  5  
ATOM 3333  C CE1  . TYR A 1 14 ? -4.562  -2.090  -11.851 1.00 0.00 ? 14 TYR A CE1  5  
ATOM 3334  C CE2  . TYR A 1 14 ? -4.235  -0.279  -13.431 1.00 0.00 ? 14 TYR A CE2  5  
ATOM 3335  C CZ   . TYR A 1 14 ? -4.277  -1.650  -13.150 1.00 0.00 ? 14 TYR A CZ   5  
ATOM 3336  O OH   . TYR A 1 14 ? -4.038  -2.567  -14.152 1.00 0.00 ? 14 TYR A OH   5  
ATOM 3337  H H    . TYR A 1 14 ? -6.268  0.711   -7.830  1.00 0.00 ? 14 TYR A H    5  
ATOM 3338  H HA   . TYR A 1 14 ? -3.740  -0.118  -8.921  1.00 0.00 ? 14 TYR A HA   5  
ATOM 3339  H HB2  . TYR A 1 14 ? -6.088  1.282   -9.839  1.00 0.00 ? 14 TYR A HB2  5  
ATOM 3340  H HB3  . TYR A 1 14 ? -4.652  2.184   -10.323 1.00 0.00 ? 14 TYR A HB3  5  
ATOM 3341  H HD1  . TYR A 1 14 ? -5.024  -1.498  -9.833  1.00 0.00 ? 14 TYR A HD1  5  
ATOM 3342  H HD2  . TYR A 1 14 ? -4.445  1.709   -12.631 1.00 0.00 ? 14 TYR A HD2  5  
ATOM 3343  H HE1  . TYR A 1 14 ? -4.594  -3.147  -11.635 1.00 0.00 ? 14 TYR A HE1  5  
ATOM 3344  H HE2  . TYR A 1 14 ? -4.015  0.060   -14.432 1.00 0.00 ? 14 TYR A HE2  5  
ATOM 3345  H HH   . TYR A 1 14 ? -4.869  -2.742  -14.599 1.00 0.00 ? 14 TYR A HH   5  
ATOM 3346  N N    . GLN A 1 15 ? -3.937  2.821   -7.497  1.00 0.00 ? 15 GLN A N    5  
ATOM 3347  C CA   . GLN A 1 15 ? -3.092  3.921   -6.958  1.00 0.00 ? 15 GLN A CA   5  
ATOM 3348  C C    . GLN A 1 15 ? -2.156  3.338   -5.900  1.00 0.00 ? 15 GLN A C    5  
ATOM 3349  O O    . GLN A 1 15 ? -0.971  3.604   -5.895  1.00 0.00 ? 15 GLN A O    5  
ATOM 3350  C CB   . GLN A 1 15 ? -3.974  4.997   -6.322  1.00 0.00 ? 15 GLN A CB   5  
ATOM 3351  C CG   . GLN A 1 15 ? -4.379  6.019   -7.387  1.00 0.00 ? 15 GLN A CG   5  
ATOM 3352  C CD   . GLN A 1 15 ? -3.876  7.406   -6.983  1.00 0.00 ? 15 GLN A CD   5  
ATOM 3353  O OE1  . GLN A 1 15 ? -2.916  7.527   -6.248  1.00 0.00 ? 15 GLN A OE1  5  
ATOM 3354  N NE2  . GLN A 1 15 ? -4.489  8.466   -7.435  1.00 0.00 ? 15 GLN A NE2  5  
ATOM 3355  H H    . GLN A 1 15 ? -4.897  2.784   -7.276  1.00 0.00 ? 15 GLN A H    5  
ATOM 3356  H HA   . GLN A 1 15 ? -2.509  4.354   -7.758  1.00 0.00 ? 15 GLN A HA   5  
ATOM 3357  H HB2  . GLN A 1 15 ? -4.856  4.538   -5.905  1.00 0.00 ? 15 GLN A HB2  5  
ATOM 3358  H HB3  . GLN A 1 15 ? -3.424  5.497   -5.539  1.00 0.00 ? 15 GLN A HB3  5  
ATOM 3359  H HG2  . GLN A 1 15 ? -3.945  5.740   -8.336  1.00 0.00 ? 15 GLN A HG2  5  
ATOM 3360  H HG3  . GLN A 1 15 ? -5.454  6.041   -7.476  1.00 0.00 ? 15 GLN A HG3  5  
ATOM 3361  H HE21 . GLN A 1 15 ? -5.263  8.369   -8.027  1.00 0.00 ? 15 GLN A HE21 5  
ATOM 3362  H HE22 . GLN A 1 15 ? -4.174  9.359   -7.182  1.00 0.00 ? 15 GLN A HE22 5  
ATOM 3363  N N    . LEU A 1 16 ? -2.672  2.523   -5.015  1.00 0.00 ? 16 LEU A N    5  
ATOM 3364  C CA   . LEU A 1 16 ? -1.795  1.910   -3.985  1.00 0.00 ? 16 LEU A CA   5  
ATOM 3365  C C    . LEU A 1 16 ? -0.783  1.032   -4.710  1.00 0.00 ? 16 LEU A C    5  
ATOM 3366  O O    . LEU A 1 16 ? 0.408   1.122   -4.490  1.00 0.00 ? 16 LEU A O    5  
ATOM 3367  C CB   . LEU A 1 16 ? -2.633  1.056   -3.031  1.00 0.00 ? 16 LEU A CB   5  
ATOM 3368  C CG   . LEU A 1 16 ? -2.508  1.607   -1.610  1.00 0.00 ? 16 LEU A CG   5  
ATOM 3369  C CD1  . LEU A 1 16 ? -3.550  2.705   -1.394  1.00 0.00 ? 16 LEU A CD1  5  
ATOM 3370  C CD2  . LEU A 1 16 ? -2.742  0.478   -0.603  1.00 0.00 ? 16 LEU A CD2  5  
ATOM 3371  H H    . LEU A 1 16 ? -3.626  2.302   -5.042  1.00 0.00 ? 16 LEU A H    5  
ATOM 3372  H HA   . LEU A 1 16 ? -1.281  2.684   -3.434  1.00 0.00 ? 16 LEU A HA   5  
ATOM 3373  H HB2  . LEU A 1 16 ? -3.668  1.083   -3.339  1.00 0.00 ? 16 LEU A HB2  5  
ATOM 3374  H HB3  . LEU A 1 16 ? -2.277  0.037   -3.052  1.00 0.00 ? 16 LEU A HB3  5  
ATOM 3375  H HG   . LEU A 1 16 ? -1.518  2.018   -1.469  1.00 0.00 ? 16 LEU A HG   5  
ATOM 3376  H HD11 . LEU A 1 16 ? -3.675  2.880   -0.335  1.00 0.00 ? 16 LEU A HD11 5  
ATOM 3377  H HD12 . LEU A 1 16 ? -4.493  2.396   -1.821  1.00 0.00 ? 16 LEU A HD12 5  
ATOM 3378  H HD13 . LEU A 1 16 ? -3.219  3.615   -1.872  1.00 0.00 ? 16 LEU A HD13 5  
ATOM 3379  H HD21 . LEU A 1 16 ? -3.439  0.809   0.153   1.00 0.00 ? 16 LEU A HD21 5  
ATOM 3380  H HD22 . LEU A 1 16 ? -1.805  0.211   -0.137  1.00 0.00 ? 16 LEU A HD22 5  
ATOM 3381  H HD23 . LEU A 1 16 ? -3.148  -0.382  -1.115  1.00 0.00 ? 16 LEU A HD23 5  
ATOM 3382  N N    . GLU A 1 17 ? -1.251  0.197   -5.596  1.00 0.00 ? 17 GLU A N    5  
ATOM 3383  C CA   . GLU A 1 17 ? -0.316  -0.669  -6.361  1.00 0.00 ? 17 GLU A CA   5  
ATOM 3384  C C    . GLU A 1 17 ? 0.598   0.224   -7.202  1.00 0.00 ? 17 GLU A C    5  
ATOM 3385  O O    . GLU A 1 17 ? 1.773   -0.042  -7.361  1.00 0.00 ? 17 GLU A O    5  
ATOM 3386  C CB   . GLU A 1 17 ? -1.111  -1.599  -7.281  1.00 0.00 ? 17 GLU A CB   5  
ATOM 3387  C CG   . GLU A 1 17 ? -2.071  -2.447  -6.445  1.00 0.00 ? 17 GLU A CG   5  
ATOM 3388  C CD   . GLU A 1 17 ? -3.261  -2.869  -7.308  1.00 0.00 ? 17 GLU A CD   5  
ATOM 3389  O OE1  . GLU A 1 17 ? -3.172  -2.726  -8.516  1.00 0.00 ? 17 GLU A OE1  5  
ATOM 3390  O OE2  . GLU A 1 17 ? -4.242  -3.329  -6.746  1.00 0.00 ? 17 GLU A OE2  5  
ATOM 3391  H H    . GLU A 1 17 ? -2.218  0.152   -5.767  1.00 0.00 ? 17 GLU A H    5  
ATOM 3392  H HA   . GLU A 1 17 ? 0.276   -1.252  -5.677  1.00 0.00 ? 17 GLU A HA   5  
ATOM 3393  H HB2  . GLU A 1 17 ? -1.674  -1.009  -7.989  1.00 0.00 ? 17 GLU A HB2  5  
ATOM 3394  H HB3  . GLU A 1 17 ? -0.430  -2.247  -7.812  1.00 0.00 ? 17 GLU A HB3  5  
ATOM 3395  H HG2  . GLU A 1 17 ? -1.555  -3.327  -6.087  1.00 0.00 ? 17 GLU A HG2  5  
ATOM 3396  H HG3  . GLU A 1 17 ? -2.425  -1.869  -5.605  1.00 0.00 ? 17 GLU A HG3  5  
ATOM 3397  N N    . ASN A 1 18 ? 0.063   1.288   -7.739  1.00 0.00 ? 18 ASN A N    5  
ATOM 3398  C CA   . ASN A 1 18 ? 0.891   2.210   -8.567  1.00 0.00 ? 18 ASN A CA   5  
ATOM 3399  C C    . ASN A 1 18 ? 1.745   3.094   -7.653  1.00 0.00 ? 18 ASN A C    5  
ATOM 3400  O O    . ASN A 1 18 ? 2.742   3.649   -8.069  1.00 0.00 ? 18 ASN A O    5  
ATOM 3401  C CB   . ASN A 1 18 ? -0.024  3.096   -9.415  1.00 0.00 ? 18 ASN A CB   5  
ATOM 3402  C CG   . ASN A 1 18 ? -0.660  2.261   -10.527 1.00 0.00 ? 18 ASN A CG   5  
ATOM 3403  O OD1  . ASN A 1 18 ? -0.022  1.400   -11.098 1.00 0.00 ? 18 ASN A OD1  5  
ATOM 3404  N ND2  . ASN A 1 18 ? -1.903  2.483   -10.861 1.00 0.00 ? 18 ASN A ND2  5  
ATOM 3405  H H    . ASN A 1 18 ? -0.888  1.481   -7.594  1.00 0.00 ? 18 ASN A H    5  
ATOM 3406  H HA   . ASN A 1 18 ? 1.535   1.633   -9.214  1.00 0.00 ? 18 ASN A HA   5  
ATOM 3407  H HB2  . ASN A 1 18 ? -0.799  3.515   -8.790  1.00 0.00 ? 18 ASN A HB2  5  
ATOM 3408  H HB3  . ASN A 1 18 ? 0.556   3.894   -9.854  1.00 0.00 ? 18 ASN A HB3  5  
ATOM 3409  H HD21 . ASN A 1 18 ? -2.417  3.178   -10.400 1.00 0.00 ? 18 ASN A HD21 5  
ATOM 3410  H HD22 . ASN A 1 18 ? -2.321  1.954   -11.572 1.00 0.00 ? 18 ASN A HD22 5  
ATOM 3411  N N    . TYR A 1 19 ? 1.365   3.227   -6.410  1.00 0.00 ? 19 TYR A N    5  
ATOM 3412  C CA   . TYR A 1 19 ? 2.158   4.072   -5.477  1.00 0.00 ? 19 TYR A CA   5  
ATOM 3413  C C    . TYR A 1 19 ? 3.613   3.627   -5.543  1.00 0.00 ? 19 TYR A C    5  
ATOM 3414  O O    . TYR A 1 19 ? 4.501   4.400   -5.842  1.00 0.00 ? 19 TYR A O    5  
ATOM 3415  C CB   . TYR A 1 19 ? 1.625   3.886   -4.050  1.00 0.00 ? 19 TYR A CB   5  
ATOM 3416  C CG   . TYR A 1 19 ? 2.639   4.388   -3.046  1.00 0.00 ? 19 TYR A CG   5  
ATOM 3417  C CD1  . TYR A 1 19 ? 3.683   3.555   -2.624  1.00 0.00 ? 19 TYR A CD1  5  
ATOM 3418  C CD2  . TYR A 1 19 ? 2.529   5.685   -2.535  1.00 0.00 ? 19 TYR A CD2  5  
ATOM 3419  C CE1  . TYR A 1 19 ? 4.617   4.023   -1.692  1.00 0.00 ? 19 TYR A CE1  5  
ATOM 3420  C CE2  . TYR A 1 19 ? 3.463   6.153   -1.603  1.00 0.00 ? 19 TYR A CE2  5  
ATOM 3421  C CZ   . TYR A 1 19 ? 4.507   5.322   -1.181  1.00 0.00 ? 19 TYR A CZ   5  
ATOM 3422  O OH   . TYR A 1 19 ? 5.427   5.783   -0.262  1.00 0.00 ? 19 TYR A OH   5  
ATOM 3423  H H    . TYR A 1 19 ? 0.565   2.767   -6.090  1.00 0.00 ? 19 TYR A H    5  
ATOM 3424  H HA   . TYR A 1 19 ? 2.079   5.109   -5.765  1.00 0.00 ? 19 TYR A HA   5  
ATOM 3425  H HB2  . TYR A 1 19 ? 0.705   4.440   -3.936  1.00 0.00 ? 19 TYR A HB2  5  
ATOM 3426  H HB3  . TYR A 1 19 ? 1.436   2.839   -3.871  1.00 0.00 ? 19 TYR A HB3  5  
ATOM 3427  H HD1  . TYR A 1 19 ? 3.770   2.551   -3.018  1.00 0.00 ? 19 TYR A HD1  5  
ATOM 3428  H HD2  . TYR A 1 19 ? 1.725   6.325   -2.860  1.00 0.00 ? 19 TYR A HD2  5  
ATOM 3429  H HE1  . TYR A 1 19 ? 5.422   3.382   -1.366  1.00 0.00 ? 19 TYR A HE1  5  
ATOM 3430  H HE2  . TYR A 1 19 ? 3.376   7.155   -1.209  1.00 0.00 ? 19 TYR A HE2  5  
ATOM 3431  H HH   . TYR A 1 19 ? 6.096   6.282   -0.737  1.00 0.00 ? 19 TYR A HH   5  
ATOM 3432  N N    . CYS A 1 20 ? 3.847   2.376   -5.272  1.00 0.00 ? 20 CYS A N    5  
ATOM 3433  C CA   . CYS A 1 20 ? 5.234   1.834   -5.313  1.00 0.00 ? 20 CYS A CA   5  
ATOM 3434  C C    . CYS A 1 20 ? 6.223   2.866   -4.767  1.00 0.00 ? 20 CYS A C    5  
ATOM 3435  O O    . CYS A 1 20 ? 5.855   3.784   -4.061  1.00 0.00 ? 20 CYS A O    5  
ATOM 3436  C CB   . CYS A 1 20 ? 5.603   1.479   -6.755  1.00 0.00 ? 20 CYS A CB   5  
ATOM 3437  S SG   . CYS A 1 20 ? 6.397   -0.148  -6.788  1.00 0.00 ? 20 CYS A SG   5  
ATOM 3438  H H    . CYS A 1 20 ? 3.097   1.784   -5.045  1.00 0.00 ? 20 CYS A H    5  
ATOM 3439  H HA   . CYS A 1 20 ? 5.282   0.948   -4.707  1.00 0.00 ? 20 CYS A HA   5  
ATOM 3440  H HB2  . CYS A 1 20 ? 4.709   1.456   -7.360  1.00 0.00 ? 20 CYS A HB2  5  
ATOM 3441  H HB3  . CYS A 1 20 ? 6.285   2.220   -7.145  1.00 0.00 ? 20 CYS A HB3  5  
ATOM 3442  N N    . ASN A 1 21 ? 7.479   2.717   -5.084  1.00 0.00 ? 21 ASN A N    5  
ATOM 3443  C CA   . ASN A 1 21 ? 8.496   3.684   -4.584  1.00 0.00 ? 21 ASN A CA   5  
ATOM 3444  C C    . ASN A 1 21 ? 9.879   3.283   -5.100  1.00 0.00 ? 21 ASN A C    5  
ATOM 3445  O O    . ASN A 1 21 ? 10.020  3.131   -6.302  1.00 0.00 ? 21 ASN A O    5  
ATOM 3446  C CB   . ASN A 1 21 ? 8.500   3.674   -3.054  1.00 0.00 ? 21 ASN A CB   5  
ATOM 3447  C CG   . ASN A 1 21 ? 8.762   5.089   -2.535  1.00 0.00 ? 21 ASN A CG   5  
ATOM 3448  O OD1  . ASN A 1 21 ? 8.103   5.546   -1.622  1.00 0.00 ? 21 ASN A OD1  5  
ATOM 3449  N ND2  . ASN A 1 21 ? 9.705   5.807   -3.082  1.00 0.00 ? 21 ASN A ND2  5  
ATOM 3450  O OXT  . ASN A 1 21 ? 10.774  3.134   -4.284  1.00 0.00 ? 21 ASN A OXT  5  
ATOM 3451  H H    . ASN A 1 21 ? 7.753   1.966   -5.650  1.00 0.00 ? 21 ASN A H    5  
ATOM 3452  H HA   . ASN A 1 21 ? 8.254   4.676   -4.937  1.00 0.00 ? 21 ASN A HA   5  
ATOM 3453  H HB2  . ASN A 1 21 ? 7.541   3.329   -2.694  1.00 0.00 ? 21 ASN A HB2  5  
ATOM 3454  H HB3  . ASN A 1 21 ? 9.277   3.013   -2.700  1.00 0.00 ? 21 ASN A HB3  5  
ATOM 3455  H HD21 . ASN A 1 21 ? 10.237  5.439   -3.818  1.00 0.00 ? 21 ASN A HD21 5  
ATOM 3456  H HD22 . ASN A 1 21 ? 9.881   6.715   -2.756  1.00 0.00 ? 21 ASN A HD22 5  
ATOM 3457  N N    . PHE B 2 1  ? -14.801 -5.748  -7.324  1.00 0.00 ? 1  PHE B N    5  
ATOM 3458  C CA   . PHE B 2 1  ? -13.592 -4.909  -7.091  1.00 0.00 ? 1  PHE B CA   5  
ATOM 3459  C C    . PHE B 2 1  ? -13.550 -4.472  -5.626  1.00 0.00 ? 1  PHE B C    5  
ATOM 3460  O O    . PHE B 2 1  ? -14.300 -3.616  -5.202  1.00 0.00 ? 1  PHE B O    5  
ATOM 3461  C CB   . PHE B 2 1  ? -13.647 -3.673  -7.990  1.00 0.00 ? 1  PHE B CB   5  
ATOM 3462  C CG   . PHE B 2 1  ? -12.335 -2.930  -7.907  1.00 0.00 ? 1  PHE B CG   5  
ATOM 3463  C CD1  . PHE B 2 1  ? -11.138 -3.589  -8.211  1.00 0.00 ? 1  PHE B CD1  5  
ATOM 3464  C CD2  . PHE B 2 1  ? -12.316 -1.583  -7.527  1.00 0.00 ? 1  PHE B CD2  5  
ATOM 3465  C CE1  . PHE B 2 1  ? -9.921  -2.900  -8.135  1.00 0.00 ? 1  PHE B CE1  5  
ATOM 3466  C CE2  . PHE B 2 1  ? -11.100 -0.894  -7.450  1.00 0.00 ? 1  PHE B CE2  5  
ATOM 3467  C CZ   . PHE B 2 1  ? -9.902  -1.553  -7.754  1.00 0.00 ? 1  PHE B CZ   5  
ATOM 3468  H H1   . PHE B 2 1  ? -14.626 -6.397  -8.118  1.00 0.00 ? 1  PHE B H1   5  
ATOM 3469  H H2   . PHE B 2 1  ? -15.610 -5.134  -7.550  1.00 0.00 ? 1  PHE B H2   5  
ATOM 3470  H H3   . PHE B 2 1  ? -15.012 -6.300  -6.469  1.00 0.00 ? 1  PHE B H3   5  
ATOM 3471  H HA   . PHE B 2 1  ? -12.706 -5.483  -7.321  1.00 0.00 ? 1  PHE B HA   5  
ATOM 3472  H HB2  . PHE B 2 1  ? -13.825 -3.977  -9.011  1.00 0.00 ? 1  PHE B HB2  5  
ATOM 3473  H HB3  . PHE B 2 1  ? -14.447 -3.025  -7.663  1.00 0.00 ? 1  PHE B HB3  5  
ATOM 3474  H HD1  . PHE B 2 1  ? -11.152 -4.628  -8.505  1.00 0.00 ? 1  PHE B HD1  5  
ATOM 3475  H HD2  . PHE B 2 1  ? -13.240 -1.075  -7.293  1.00 0.00 ? 1  PHE B HD2  5  
ATOM 3476  H HE1  . PHE B 2 1  ? -8.997  -3.408  -8.369  1.00 0.00 ? 1  PHE B HE1  5  
ATOM 3477  H HE2  . PHE B 2 1  ? -11.085 0.145   -7.157  1.00 0.00 ? 1  PHE B HE2  5  
ATOM 3478  H HZ   . PHE B 2 1  ? -8.964  -1.022  -7.695  1.00 0.00 ? 1  PHE B HZ   5  
ATOM 3479  N N    . VAL B 2 2  ? -12.678 -5.054  -4.849  1.00 0.00 ? 2  VAL B N    5  
ATOM 3480  C CA   . VAL B 2 2  ? -12.587 -4.671  -3.412  1.00 0.00 ? 2  VAL B CA   5  
ATOM 3481  C C    . VAL B 2 2  ? -11.405 -5.398  -2.767  1.00 0.00 ? 2  VAL B C    5  
ATOM 3482  O O    . VAL B 2 2  ? -11.118 -6.536  -3.080  1.00 0.00 ? 2  VAL B O    5  
ATOM 3483  C CB   . VAL B 2 2  ? -13.881 -5.062  -2.696  1.00 0.00 ? 2  VAL B CB   5  
ATOM 3484  C CG1  . VAL B 2 2  ? -14.228 -6.515  -3.021  1.00 0.00 ? 2  VAL B CG1  5  
ATOM 3485  C CG2  . VAL B 2 2  ? -13.691 -4.909  -1.185  1.00 0.00 ? 2  VAL B CG2  5  
ATOM 3486  H H    . VAL B 2 2  ? -12.081 -5.742  -5.211  1.00 0.00 ? 2  VAL B H    5  
ATOM 3487  H HA   . VAL B 2 2  ? -12.439 -3.604  -3.333  1.00 0.00 ? 2  VAL B HA   5  
ATOM 3488  H HB   . VAL B 2 2  ? -14.683 -4.418  -3.027  1.00 0.00 ? 2  VAL B HB   5  
ATOM 3489  H HG11 . VAL B 2 2  ? -14.259 -7.091  -2.108  1.00 0.00 ? 2  VAL B HG11 5  
ATOM 3490  H HG12 . VAL B 2 2  ? -13.478 -6.926  -3.681  1.00 0.00 ? 2  VAL B HG12 5  
ATOM 3491  H HG13 . VAL B 2 2  ? -15.193 -6.555  -3.505  1.00 0.00 ? 2  VAL B HG13 5  
ATOM 3492  H HG21 . VAL B 2 2  ? -14.651 -4.977  -0.693  1.00 0.00 ? 2  VAL B HG21 5  
ATOM 3493  H HG22 . VAL B 2 2  ? -13.246 -3.948  -0.973  1.00 0.00 ? 2  VAL B HG22 5  
ATOM 3494  H HG23 . VAL B 2 2  ? -13.044 -5.694  -0.822  1.00 0.00 ? 2  VAL B HG23 5  
ATOM 3495  N N    . ASN B 2 3  ? -10.716 -4.748  -1.871  1.00 0.00 ? 3  ASN B N    5  
ATOM 3496  C CA   . ASN B 2 3  ? -9.550  -5.401  -1.209  1.00 0.00 ? 3  ASN B CA   5  
ATOM 3497  C C    . ASN B 2 3  ? -9.706  -5.313  0.311   1.00 0.00 ? 3  ASN B C    5  
ATOM 3498  O O    . ASN B 2 3  ? -10.613 -4.683  0.817   1.00 0.00 ? 3  ASN B O    5  
ATOM 3499  C CB   . ASN B 2 3  ? -8.263  -4.691  -1.631  1.00 0.00 ? 3  ASN B CB   5  
ATOM 3500  C CG   . ASN B 2 3  ? -8.160  -4.685  -3.157  1.00 0.00 ? 3  ASN B CG   5  
ATOM 3501  O OD1  . ASN B 2 3  ? -7.308  -5.341  -3.723  1.00 0.00 ? 3  ASN B OD1  5  
ATOM 3502  N ND2  . ASN B 2 3  ? -8.999  -3.967  -3.853  1.00 0.00 ? 3  ASN B ND2  5  
ATOM 3503  H H    . ASN B 2 3  ? -10.963 -3.829  -1.635  1.00 0.00 ? 3  ASN B H    5  
ATOM 3504  H HA   . ASN B 2 3  ? -9.503  -6.438  -1.506  1.00 0.00 ? 3  ASN B HA   5  
ATOM 3505  H HB2  . ASN B 2 3  ? -8.277  -3.674  -1.266  1.00 0.00 ? 3  ASN B HB2  5  
ATOM 3506  H HB3  . ASN B 2 3  ? -7.412  -5.211  -1.217  1.00 0.00 ? 3  ASN B HB3  5  
ATOM 3507  H HD21 . ASN B 2 3  ? -9.686  -3.438  -3.396  1.00 0.00 ? 3  ASN B HD21 5  
ATOM 3508  H HD22 . ASN B 2 3  ? -8.942  -3.957  -4.831  1.00 0.00 ? 3  ASN B HD22 5  
ATOM 3509  N N    . GLN B 2 4  ? -8.825  -5.941  1.043   1.00 0.00 ? 4  GLN B N    5  
ATOM 3510  C CA   . GLN B 2 4  ? -8.920  -5.895  2.529   1.00 0.00 ? 4  GLN B CA   5  
ATOM 3511  C C    . GLN B 2 4  ? -8.120  -4.701  3.055   1.00 0.00 ? 4  GLN B C    5  
ATOM 3512  O O    . GLN B 2 4  ? -7.433  -4.793  4.052   1.00 0.00 ? 4  GLN B O    5  
ATOM 3513  C CB   . GLN B 2 4  ? -8.354  -7.189  3.117   1.00 0.00 ? 4  GLN B CB   5  
ATOM 3514  C CG   . GLN B 2 4  ? -7.062  -7.561  2.387   1.00 0.00 ? 4  GLN B CG   5  
ATOM 3515  C CD   . GLN B 2 4  ? -6.087  -8.211  3.370   1.00 0.00 ? 4  GLN B CD   5  
ATOM 3516  O OE1  . GLN B 2 4  ? -6.132  -9.405  3.588   1.00 0.00 ? 4  GLN B OE1  5  
ATOM 3517  N NE2  . GLN B 2 4  ? -5.202  -7.469  3.977   1.00 0.00 ? 4  GLN B NE2  5  
ATOM 3518  H H    . GLN B 2 4  ? -8.101  -6.443  0.613   1.00 0.00 ? 4  GLN B H    5  
ATOM 3519  H HA   . GLN B 2 4  ? -9.954  -5.789  2.820   1.00 0.00 ? 4  GLN B HA   5  
ATOM 3520  H HB2  . GLN B 2 4  ? -8.146  -7.046  4.168   1.00 0.00 ? 4  GLN B HB2  5  
ATOM 3521  H HB3  . GLN B 2 4  ? -9.074  -7.985  2.997   1.00 0.00 ? 4  GLN B HB3  5  
ATOM 3522  H HG2  . GLN B 2 4  ? -7.286  -8.254  1.589   1.00 0.00 ? 4  GLN B HG2  5  
ATOM 3523  H HG3  . GLN B 2 4  ? -6.613  -6.670  1.974   1.00 0.00 ? 4  GLN B HG3  5  
ATOM 3524  H HE21 . GLN B 2 4  ? -5.165  -6.506  3.802   1.00 0.00 ? 4  GLN B HE21 5  
ATOM 3525  H HE22 . GLN B 2 4  ? -4.572  -7.876  4.609   1.00 0.00 ? 4  GLN B HE22 5  
ATOM 3526  N N    . HIS B 2 5  ? -8.206  -3.584  2.384   1.00 0.00 ? 5  HIS B N    5  
ATOM 3527  C CA   . HIS B 2 5  ? -7.448  -2.370  2.837   1.00 0.00 ? 5  HIS B CA   5  
ATOM 3528  C C    . HIS B 2 5  ? -7.524  -2.264  4.362   1.00 0.00 ? 5  HIS B C    5  
ATOM 3529  O O    . HIS B 2 5  ? -6.519  -2.158  5.034   1.00 0.00 ? 5  HIS B O    5  
ATOM 3530  C CB   . HIS B 2 5  ? -8.039  -1.091  2.219   1.00 0.00 ? 5  HIS B CB   5  
ATOM 3531  C CG   . HIS B 2 5  ? -8.843  -1.429  0.995   1.00 0.00 ? 5  HIS B CG   5  
ATOM 3532  N ND1  . HIS B 2 5  ? -10.181 -1.776  1.072   1.00 0.00 ? 5  HIS B ND1  5  
ATOM 3533  C CD2  . HIS B 2 5  ? -8.507  -1.514  -0.333  1.00 0.00 ? 5  HIS B CD2  5  
ATOM 3534  C CE1  . HIS B 2 5  ? -10.599 -2.053  -0.174  1.00 0.00 ? 5  HIS B CE1  5  
ATOM 3535  N NE2  . HIS B 2 5  ? -9.618  -1.911  -1.070  1.00 0.00 ? 5  HIS B NE2  5  
ATOM 3536  H H    . HIS B 2 5  ? -8.765  -3.549  1.581   1.00 0.00 ? 5  HIS B H    5  
ATOM 3537  H HA   . HIS B 2 5  ? -6.414  -2.466  2.539   1.00 0.00 ? 5  HIS B HA   5  
ATOM 3538  H HB2  . HIS B 2 5  ? -8.678  -0.607  2.942   1.00 0.00 ? 5  HIS B HB2  5  
ATOM 3539  H HB3  . HIS B 2 5  ? -7.236  -0.422  1.946   1.00 0.00 ? 5  HIS B HB3  5  
ATOM 3540  H HD1  . HIS B 2 5  ? -10.725 -1.811  1.886   1.00 0.00 ? 5  HIS B HD1  5  
ATOM 3541  H HD2  . HIS B 2 5  ? -7.530  -1.303  -0.742  1.00 0.00 ? 5  HIS B HD2  5  
ATOM 3542  H HE1  . HIS B 2 5  ? -11.607 -2.352  -0.422  1.00 0.00 ? 5  HIS B HE1  5  
ATOM 3543  N N    . LEU B 2 6  ? -8.711  -2.296  4.910   1.00 0.00 ? 6  LEU B N    5  
ATOM 3544  C CA   . LEU B 2 6  ? -8.865  -2.206  6.394   1.00 0.00 ? 6  LEU B CA   5  
ATOM 3545  C C    . LEU B 2 6  ? -8.770  -0.749  6.853   1.00 0.00 ? 6  LEU B C    5  
ATOM 3546  O O    . LEU B 2 6  ? -9.552  -0.298  7.666   1.00 0.00 ? 6  LEU B O    5  
ATOM 3547  C CB   . LEU B 2 6  ? -7.770  -3.028  7.077   1.00 0.00 ? 6  LEU B CB   5  
ATOM 3548  C CG   . LEU B 2 6  ? -8.394  -3.913  8.156   1.00 0.00 ? 6  LEU B CG   5  
ATOM 3549  C CD1  . LEU B 2 6  ? -9.031  -5.141  7.503   1.00 0.00 ? 6  LEU B CD1  5  
ATOM 3550  C CD2  . LEU B 2 6  ? -7.307  -4.363  9.136   1.00 0.00 ? 6  LEU B CD2  5  
ATOM 3551  H H    . LEU B 2 6  ? -9.506  -2.385  4.343   1.00 0.00 ? 6  LEU B H    5  
ATOM 3552  H HA   . LEU B 2 6  ? -9.828  -2.600  6.673   1.00 0.00 ? 6  LEU B HA   5  
ATOM 3553  H HB2  . LEU B 2 6  ? -7.274  -3.647  6.343   1.00 0.00 ? 6  LEU B HB2  5  
ATOM 3554  H HB3  . LEU B 2 6  ? -7.052  -2.362  7.531   1.00 0.00 ? 6  LEU B HB3  5  
ATOM 3555  H HG   . LEU B 2 6  ? -9.151  -3.354  8.686   1.00 0.00 ? 6  LEU B HG   5  
ATOM 3556  H HD11 . LEU B 2 6  ? -9.885  -4.835  6.917   1.00 0.00 ? 6  LEU B HD11 5  
ATOM 3557  H HD12 . LEU B 2 6  ? -9.350  -5.832  8.270   1.00 0.00 ? 6  LEU B HD12 5  
ATOM 3558  H HD13 . LEU B 2 6  ? -8.308  -5.624  6.862   1.00 0.00 ? 6  LEU B HD13 5  
ATOM 3559  H HD21 . LEU B 2 6  ? -6.575  -3.576  9.246   1.00 0.00 ? 6  LEU B HD21 5  
ATOM 3560  H HD22 . LEU B 2 6  ? -6.826  -5.252  8.756   1.00 0.00 ? 6  LEU B HD22 5  
ATOM 3561  H HD23 . LEU B 2 6  ? -7.754  -4.576  10.095  1.00 0.00 ? 6  LEU B HD23 5  
ATOM 3562  N N    . CYS B 2 7  ? -7.812  -0.017  6.353   1.00 0.00 ? 7  CYS B N    5  
ATOM 3563  C CA   . CYS B 2 7  ? -7.655  1.409   6.768   1.00 0.00 ? 7  CYS B CA   5  
ATOM 3564  C C    . CYS B 2 7  ? -7.257  1.455   8.243   1.00 0.00 ? 7  CYS B C    5  
ATOM 3565  O O    . CYS B 2 7  ? -8.075  1.296   9.127   1.00 0.00 ? 7  CYS B O    5  
ATOM 3566  C CB   . CYS B 2 7  ? -8.970  2.171   6.548   1.00 0.00 ? 7  CYS B CB   5  
ATOM 3567  S SG   . CYS B 2 7  ? -8.909  3.767   7.407   1.00 0.00 ? 7  CYS B SG   5  
ATOM 3568  H H    . CYS B 2 7  ? -7.186  -0.409  5.715   1.00 0.00 ? 7  CYS B H    5  
ATOM 3569  H HA   . CYS B 2 7  ? -6.874  1.865   6.176   1.00 0.00 ? 7  CYS B HA   5  
ATOM 3570  H HB2  . CYS B 2 7  ? -9.112  2.340   5.491   1.00 0.00 ? 7  CYS B HB2  5  
ATOM 3571  H HB3  . CYS B 2 7  ? -9.794  1.590   6.930   1.00 0.00 ? 7  CYS B HB3  5  
ATOM 3572  N N    . GLY B 2 8  ? -5.998  1.660   8.508   1.00 0.00 ? 8  GLY B N    5  
ATOM 3573  C CA   . GLY B 2 8  ? -5.524  1.705   9.918   1.00 0.00 ? 8  GLY B CA   5  
ATOM 3574  C C    . GLY B 2 8  ? -4.410  0.676   10.090  1.00 0.00 ? 8  GLY B C    5  
ATOM 3575  O O    . GLY B 2 8  ? -4.630  -0.417  10.575  1.00 0.00 ? 8  GLY B O    5  
ATOM 3576  H H    . GLY B 2 8  ? -5.359  1.775   7.774   1.00 0.00 ? 8  GLY B H    5  
ATOM 3577  H HA2  . GLY B 2 8  ? -5.147  2.693   10.143  1.00 0.00 ? 8  GLY B HA2  5  
ATOM 3578  H HA3  . GLY B 2 8  ? -6.337  1.466   10.583  1.00 0.00 ? 8  GLY B HA3  5  
ATOM 3579  N N    . SER B 2 9  ? -3.219  1.015   9.678   1.00 0.00 ? 9  SER B N    5  
ATOM 3580  C CA   . SER B 2 9  ? -2.077  0.063   9.793   1.00 0.00 ? 9  SER B CA   5  
ATOM 3581  C C    . SER B 2 9  ? -2.126  -0.929  8.627   1.00 0.00 ? 9  SER B C    5  
ATOM 3582  O O    . SER B 2 9  ? -1.136  -1.171  7.965   1.00 0.00 ? 9  SER B O    5  
ATOM 3583  C CB   . SER B 2 9  ? -2.164  -0.697  11.118  1.00 0.00 ? 9  SER B CB   5  
ATOM 3584  O OG   . SER B 2 9  ? -0.867  -0.789  11.692  1.00 0.00 ? 9  SER B OG   5  
ATOM 3585  H H    . SER B 2 9  ? -3.078  1.899   9.280   1.00 0.00 ? 9  SER B H    5  
ATOM 3586  H HA   . SER B 2 9  ? -1.148  0.613   9.755   1.00 0.00 ? 9  SER B HA   5  
ATOM 3587  H HB2  . SER B 2 9  ? -2.815  -0.170  11.796  1.00 0.00 ? 9  SER B HB2  5  
ATOM 3588  H HB3  . SER B 2 9  ? -2.561  -1.688  10.938  1.00 0.00 ? 9  SER B HB3  5  
ATOM 3589  H HG   . SER B 2 9  ? -0.742  -1.690  12.001  1.00 0.00 ? 9  SER B HG   5  
ATOM 3590  N N    . HIS B 2 10 ? -3.270  -1.505  8.367   1.00 0.00 ? 10 HIS B N    5  
ATOM 3591  C CA   . HIS B 2 10 ? -3.378  -2.475  7.246   1.00 0.00 ? 10 HIS B CA   5  
ATOM 3592  C C    . HIS B 2 10 ? -3.272  -1.733  5.913   1.00 0.00 ? 10 HIS B C    5  
ATOM 3593  O O    . HIS B 2 10 ? -2.680  -2.217  4.969   1.00 0.00 ? 10 HIS B O    5  
ATOM 3594  C CB   . HIS B 2 10 ? -4.724  -3.197  7.327   1.00 0.00 ? 10 HIS B CB   5  
ATOM 3595  C CG   . HIS B 2 10 ? -4.495  -4.652  7.631   1.00 0.00 ? 10 HIS B CG   5  
ATOM 3596  N ND1  . HIS B 2 10 ? -4.468  -5.141  8.928   1.00 0.00 ? 10 HIS B ND1  5  
ATOM 3597  C CD2  . HIS B 2 10 ? -4.280  -5.737  6.817   1.00 0.00 ? 10 HIS B CD2  5  
ATOM 3598  C CE1  . HIS B 2 10 ? -4.244  -6.466  8.857   1.00 0.00 ? 10 HIS B CE1  5  
ATOM 3599  N NE2  . HIS B 2 10 ? -4.122  -6.881  7.594   1.00 0.00 ? 10 HIS B NE2  5  
ATOM 3600  H H    . HIS B 2 10 ? -4.057  -1.299  8.906   1.00 0.00 ? 10 HIS B H    5  
ATOM 3601  H HA   . HIS B 2 10 ? -2.580  -3.194  7.320   1.00 0.00 ? 10 HIS B HA   5  
ATOM 3602  H HB2  . HIS B 2 10 ? -5.323  -2.755  8.109   1.00 0.00 ? 10 HIS B HB2  5  
ATOM 3603  H HB3  . HIS B 2 10 ? -5.239  -3.105  6.383   1.00 0.00 ? 10 HIS B HB3  5  
ATOM 3604  H HD1  . HIS B 2 10 ? -4.589  -4.616  9.747   1.00 0.00 ? 10 HIS B HD1  5  
ATOM 3605  H HD2  . HIS B 2 10 ? -4.241  -5.707  5.738   1.00 0.00 ? 10 HIS B HD2  5  
ATOM 3606  H HE1  . HIS B 2 10 ? -4.171  -7.114  9.718   1.00 0.00 ? 10 HIS B HE1  5  
ATOM 3607  N N    . LEU B 2 11 ? -3.843  -0.562  5.826   1.00 0.00 ? 11 LEU B N    5  
ATOM 3608  C CA   . LEU B 2 11 ? -3.772  0.202   4.550   1.00 0.00 ? 11 LEU B CA   5  
ATOM 3609  C C    . LEU B 2 11 ? -2.308  0.400   4.160   1.00 0.00 ? 11 LEU B C    5  
ATOM 3610  O O    . LEU B 2 11 ? -1.924  0.184   3.028   1.00 0.00 ? 11 LEU B O    5  
ATOM 3611  C CB   . LEU B 2 11 ? -4.438  1.567   4.732   1.00 0.00 ? 11 LEU B CB   5  
ATOM 3612  C CG   . LEU B 2 11 ? -5.222  1.930   3.469   1.00 0.00 ? 11 LEU B CG   5  
ATOM 3613  C CD1  . LEU B 2 11 ? -5.592  3.412   3.511   1.00 0.00 ? 11 LEU B CD1  5  
ATOM 3614  C CD2  . LEU B 2 11 ? -4.360  1.657   2.233   1.00 0.00 ? 11 LEU B CD2  5  
ATOM 3615  H H    . LEU B 2 11 ? -4.318  -0.188  6.597   1.00 0.00 ? 11 LEU B H    5  
ATOM 3616  H HA   . LEU B 2 11 ? -4.281  -0.347  3.772   1.00 0.00 ? 11 LEU B HA   5  
ATOM 3617  H HB2  . LEU B 2 11 ? -5.112  1.528   5.576   1.00 0.00 ? 11 LEU B HB2  5  
ATOM 3618  H HB3  . LEU B 2 11 ? -3.681  2.316   4.911   1.00 0.00 ? 11 LEU B HB3  5  
ATOM 3619  H HG   . LEU B 2 11 ? -6.123  1.335   3.422   1.00 0.00 ? 11 LEU B HG   5  
ATOM 3620  H HD11 . LEU B 2 11 ? -4.736  4.004   3.223   1.00 0.00 ? 11 LEU B HD11 5  
ATOM 3621  H HD12 . LEU B 2 11 ? -5.893  3.680   4.513   1.00 0.00 ? 11 LEU B HD12 5  
ATOM 3622  H HD13 . LEU B 2 11 ? -6.406  3.600   2.827   1.00 0.00 ? 11 LEU B HD13 5  
ATOM 3623  H HD21 . LEU B 2 11 ? -3.324  1.849   2.466   1.00 0.00 ? 11 LEU B HD21 5  
ATOM 3624  H HD22 . LEU B 2 11 ? -4.674  2.303   1.426   1.00 0.00 ? 11 LEU B HD22 5  
ATOM 3625  H HD23 . LEU B 2 11 ? -4.476  0.626   1.934   1.00 0.00 ? 11 LEU B HD23 5  
ATOM 3626  N N    . VAL B 2 12 ? -1.483  0.799   5.089   1.00 0.00 ? 12 VAL B N    5  
ATOM 3627  C CA   . VAL B 2 12 ? -0.045  0.995   4.762   1.00 0.00 ? 12 VAL B CA   5  
ATOM 3628  C C    . VAL B 2 12 ? 0.568   -0.361  4.429   1.00 0.00 ? 12 VAL B C    5  
ATOM 3629  O O    . VAL B 2 12 ? 1.247   -0.519  3.434   1.00 0.00 ? 12 VAL B O    5  
ATOM 3630  C CB   . VAL B 2 12 ? 0.680   1.613   5.959   1.00 0.00 ? 12 VAL B CB   5  
ATOM 3631  C CG1  . VAL B 2 12 ? 2.111   1.977   5.558   1.00 0.00 ? 12 VAL B CG1  5  
ATOM 3632  C CG2  . VAL B 2 12 ? -0.061  2.876   6.403   1.00 0.00 ? 12 VAL B CG2  5  
ATOM 3633  H H    . VAL B 2 12 ? -1.807  0.961   6.000   1.00 0.00 ? 12 VAL B H    5  
ATOM 3634  H HA   . VAL B 2 12 ? 0.043   1.645   3.905   1.00 0.00 ? 12 VAL B HA   5  
ATOM 3635  H HB   . VAL B 2 12 ? 0.704   0.902   6.772   1.00 0.00 ? 12 VAL B HB   5  
ATOM 3636  H HG11 . VAL B 2 12 ? 2.127   2.977   5.149   1.00 0.00 ? 12 VAL B HG11 5  
ATOM 3637  H HG12 . VAL B 2 12 ? 2.466   1.279   4.815   1.00 0.00 ? 12 VAL B HG12 5  
ATOM 3638  H HG13 . VAL B 2 12 ? 2.750   1.934   6.428   1.00 0.00 ? 12 VAL B HG13 5  
ATOM 3639  H HG21 . VAL B 2 12 ? -1.097  2.637   6.595   1.00 0.00 ? 12 VAL B HG21 5  
ATOM 3640  H HG22 . VAL B 2 12 ? -0.003  3.621   5.623   1.00 0.00 ? 12 VAL B HG22 5  
ATOM 3641  H HG23 . VAL B 2 12 ? 0.392   3.261   7.304   1.00 0.00 ? 12 VAL B HG23 5  
ATOM 3642  N N    . GLU B 2 13 ? 0.315   -1.350  5.239   1.00 0.00 ? 13 GLU B N    5  
ATOM 3643  C CA   . GLU B 2 13 ? 0.865   -2.696  4.942   1.00 0.00 ? 13 GLU B CA   5  
ATOM 3644  C C    . GLU B 2 13 ? 0.429   -3.076  3.529   1.00 0.00 ? 13 GLU B C    5  
ATOM 3645  O O    . GLU B 2 13 ? 1.115   -3.786  2.821   1.00 0.00 ? 13 GLU B O    5  
ATOM 3646  C CB   . GLU B 2 13 ? 0.313   -3.713  5.944   1.00 0.00 ? 13 GLU B CB   5  
ATOM 3647  C CG   . GLU B 2 13 ? 1.445   -4.206  6.847   1.00 0.00 ? 13 GLU B CG   5  
ATOM 3648  C CD   . GLU B 2 13 ? 1.455   -5.736  6.865   1.00 0.00 ? 13 GLU B CD   5  
ATOM 3649  O OE1  . GLU B 2 13 ? 0.610   -6.306  7.534   1.00 0.00 ? 13 GLU B OE1  5  
ATOM 3650  O OE2  . GLU B 2 13 ? 2.307   -6.311  6.207   1.00 0.00 ? 13 GLU B OE2  5  
ATOM 3651  H H    . GLU B 2 13 ? -0.250  -1.211  6.027   1.00 0.00 ? 13 GLU B H    5  
ATOM 3652  H HA   . GLU B 2 13 ? 1.943   -2.672  4.998   1.00 0.00 ? 13 GLU B HA   5  
ATOM 3653  H HB2  . GLU B 2 13 ? -0.451  -3.245  6.547   1.00 0.00 ? 13 GLU B HB2  5  
ATOM 3654  H HB3  . GLU B 2 13 ? -0.111  -4.551  5.412   1.00 0.00 ? 13 GLU B HB3  5  
ATOM 3655  H HG2  . GLU B 2 13 ? 2.391   -3.843  6.470   1.00 0.00 ? 13 GLU B HG2  5  
ATOM 3656  H HG3  . GLU B 2 13 ? 1.293   -3.838  7.850   1.00 0.00 ? 13 GLU B HG3  5  
ATOM 3657  N N    . ALA B 2 14 ? -0.710  -2.590  3.113   1.00 0.00 ? 14 ALA B N    5  
ATOM 3658  C CA   . ALA B 2 14 ? -1.200  -2.900  1.745   1.00 0.00 ? 14 ALA B CA   5  
ATOM 3659  C C    . ALA B 2 14 ? -0.295  -2.209  0.726   1.00 0.00 ? 14 ALA B C    5  
ATOM 3660  O O    . ALA B 2 14 ? 0.139   -2.802  -0.241  1.00 0.00 ? 14 ALA B O    5  
ATOM 3661  C CB   . ALA B 2 14 ? -2.634  -2.392  1.585   1.00 0.00 ? 14 ALA B CB   5  
ATOM 3662  H H    . ALA B 2 14 ? -1.239  -2.011  3.701   1.00 0.00 ? 14 ALA B H    5  
ATOM 3663  H HA   . ALA B 2 14 ? -1.173  -3.963  1.589   1.00 0.00 ? 14 ALA B HA   5  
ATOM 3664  H HB1  . ALA B 2 14 ? -3.197  -3.087  0.979   1.00 0.00 ? 14 ALA B HB1  5  
ATOM 3665  H HB2  . ALA B 2 14 ? -2.622  -1.424  1.106   1.00 0.00 ? 14 ALA B HB2  5  
ATOM 3666  H HB3  . ALA B 2 14 ? -3.096  -2.307  2.557   1.00 0.00 ? 14 ALA B HB3  5  
ATOM 3667  N N    . LEU B 2 15 ? 0.004   -0.960  0.949   1.00 0.00 ? 15 LEU B N    5  
ATOM 3668  C CA   . LEU B 2 15 ? 0.891   -0.222  0.007   1.00 0.00 ? 15 LEU B CA   5  
ATOM 3669  C C    . LEU B 2 15 ? 2.225   -0.966  -0.078  1.00 0.00 ? 15 LEU B C    5  
ATOM 3670  O O    . LEU B 2 15 ? 2.860   -1.023  -1.112  1.00 0.00 ? 15 LEU B O    5  
ATOM 3671  C CB   . LEU B 2 15 ? 1.076   1.228   0.504   1.00 0.00 ? 15 LEU B CB   5  
ATOM 3672  C CG   . LEU B 2 15 ? 2.433   1.413   1.196   1.00 0.00 ? 15 LEU B CG   5  
ATOM 3673  C CD1  . LEU B 2 15 ? 3.506   1.696   0.143   1.00 0.00 ? 15 LEU B CD1  5  
ATOM 3674  C CD2  . LEU B 2 15 ? 2.351   2.593   2.167   1.00 0.00 ? 15 LEU B CD2  5  
ATOM 3675  H H    . LEU B 2 15 ? -0.351  -0.509  1.743   1.00 0.00 ? 15 LEU B H    5  
ATOM 3676  H HA   . LEU B 2 15 ? 0.434   -0.213  -0.974  1.00 0.00 ? 15 LEU B HA   5  
ATOM 3677  H HB2  . LEU B 2 15 ? 1.015   1.901   -0.338  1.00 0.00 ? 15 LEU B HB2  5  
ATOM 3678  H HB3  . LEU B 2 15 ? 0.287   1.465   1.204   1.00 0.00 ? 15 LEU B HB3  5  
ATOM 3679  H HG   . LEU B 2 15 ? 2.687   0.514   1.739   1.00 0.00 ? 15 LEU B HG   5  
ATOM 3680  H HD11 . LEU B 2 15 ? 3.074   1.608   -0.843  1.00 0.00 ? 15 LEU B HD11 5  
ATOM 3681  H HD12 . LEU B 2 15 ? 4.310   0.983   0.249   1.00 0.00 ? 15 LEU B HD12 5  
ATOM 3682  H HD13 . LEU B 2 15 ? 3.891   2.695   0.281   1.00 0.00 ? 15 LEU B HD13 5  
ATOM 3683  H HD21 . LEU B 2 15 ? 1.371   2.619   2.621   1.00 0.00 ? 15 LEU B HD21 5  
ATOM 3684  H HD22 . LEU B 2 15 ? 2.522   3.514   1.630   1.00 0.00 ? 15 LEU B HD22 5  
ATOM 3685  H HD23 . LEU B 2 15 ? 3.101   2.480   2.936   1.00 0.00 ? 15 LEU B HD23 5  
ATOM 3686  N N    . TYR B 2 16 ? 2.653   -1.549  1.000   1.00 0.00 ? 16 TYR B N    5  
ATOM 3687  C CA   . TYR B 2 16 ? 3.927   -2.303  0.957   1.00 0.00 ? 16 TYR B CA   5  
ATOM 3688  C C    . TYR B 2 16 ? 3.735   -3.494  0.021   1.00 0.00 ? 16 TYR B C    5  
ATOM 3689  O O    . TYR B 2 16 ? 4.516   -3.731  -0.878  1.00 0.00 ? 16 TYR B O    5  
ATOM 3690  C CB   . TYR B 2 16 ? 4.282   -2.799  2.360   1.00 0.00 ? 16 TYR B CB   5  
ATOM 3691  C CG   . TYR B 2 16 ? 5.702   -3.313  2.369   1.00 0.00 ? 16 TYR B CG   5  
ATOM 3692  C CD1  . TYR B 2 16 ? 6.769   -2.418  2.512   1.00 0.00 ? 16 TYR B CD1  5  
ATOM 3693  C CD2  . TYR B 2 16 ? 5.950   -4.684  2.234   1.00 0.00 ? 16 TYR B CD2  5  
ATOM 3694  C CE1  . TYR B 2 16 ? 8.085   -2.895  2.520   1.00 0.00 ? 16 TYR B CE1  5  
ATOM 3695  C CE2  . TYR B 2 16 ? 7.267   -5.161  2.242   1.00 0.00 ? 16 TYR B CE2  5  
ATOM 3696  C CZ   . TYR B 2 16 ? 8.334   -4.266  2.385   1.00 0.00 ? 16 TYR B CZ   5  
ATOM 3697  O OH   . TYR B 2 16 ? 9.632   -4.736  2.393   1.00 0.00 ? 16 TYR B OH   5  
ATOM 3698  H H    . TYR B 2 16 ? 2.130   -1.506  1.827   1.00 0.00 ? 16 TYR B H    5  
ATOM 3699  H HA   . TYR B 2 16 ? 4.710   -1.672  0.582   1.00 0.00 ? 16 TYR B HA   5  
ATOM 3700  H HB2  . TYR B 2 16 ? 4.189   -1.984  3.064   1.00 0.00 ? 16 TYR B HB2  5  
ATOM 3701  H HB3  . TYR B 2 16 ? 3.610   -3.596  2.642   1.00 0.00 ? 16 TYR B HB3  5  
ATOM 3702  H HD1  . TYR B 2 16 ? 6.577   -1.361  2.617   1.00 0.00 ? 16 TYR B HD1  5  
ATOM 3703  H HD2  . TYR B 2 16 ? 5.127   -5.374  2.124   1.00 0.00 ? 16 TYR B HD2  5  
ATOM 3704  H HE1  . TYR B 2 16 ? 8.909   -2.205  2.631   1.00 0.00 ? 16 TYR B HE1  5  
ATOM 3705  H HE2  . TYR B 2 16 ? 7.459   -6.218  2.138   1.00 0.00 ? 16 TYR B HE2  5  
ATOM 3706  H HH   . TYR B 2 16 ? 10.088  -4.361  1.636   1.00 0.00 ? 16 TYR B HH   5  
ATOM 3707  N N    . LEU B 2 17 ? 2.691   -4.243  0.234   1.00 0.00 ? 17 LEU B N    5  
ATOM 3708  C CA   . LEU B 2 17 ? 2.423   -5.425  -0.630  1.00 0.00 ? 17 LEU B CA   5  
ATOM 3709  C C    . LEU B 2 17 ? 1.998   -4.995  -2.037  1.00 0.00 ? 17 LEU B C    5  
ATOM 3710  O O    . LEU B 2 17 ? 2.407   -5.584  -3.018  1.00 0.00 ? 17 LEU B O    5  
ATOM 3711  C CB   . LEU B 2 17 ? 1.321   -6.280  -0.001  1.00 0.00 ? 17 LEU B CB   5  
ATOM 3712  C CG   . LEU B 2 17 ? 1.821   -7.716  0.164   1.00 0.00 ? 17 LEU B CG   5  
ATOM 3713  C CD1  . LEU B 2 17 ? 2.536   -7.858  1.508   1.00 0.00 ? 17 LEU B CD1  5  
ATOM 3714  C CD2  . LEU B 2 17 ? 0.631   -8.678  0.116   1.00 0.00 ? 17 LEU B CD2  5  
ATOM 3715  H H    . LEU B 2 17 ? 2.079   -4.024  0.966   1.00 0.00 ? 17 LEU B H    5  
ATOM 3716  H HA   . LEU B 2 17 ? 3.324   -6.005  -0.706  1.00 0.00 ? 17 LEU B HA   5  
ATOM 3717  H HB2  . LEU B 2 17 ? 1.060   -5.876  0.966   1.00 0.00 ? 17 LEU B HB2  5  
ATOM 3718  H HB3  . LEU B 2 17 ? 0.452   -6.275  -0.641  1.00 0.00 ? 17 LEU B HB3  5  
ATOM 3719  H HG   . LEU B 2 17 ? 2.509   -7.952  -0.636  1.00 0.00 ? 17 LEU B HG   5  
ATOM 3720  H HD11 . LEU B 2 17 ? 1.844   -7.642  2.309   1.00 0.00 ? 17 LEU B HD11 5  
ATOM 3721  H HD12 . LEU B 2 17 ? 3.363   -7.165  1.551   1.00 0.00 ? 17 LEU B HD12 5  
ATOM 3722  H HD13 . LEU B 2 17 ? 2.906   -8.867  1.615   1.00 0.00 ? 17 LEU B HD13 5  
ATOM 3723  H HD21 . LEU B 2 17 ? -0.276  -8.120  -0.061  1.00 0.00 ? 17 LEU B HD21 5  
ATOM 3724  H HD22 . LEU B 2 17 ? 0.553   -9.201  1.058   1.00 0.00 ? 17 LEU B HD22 5  
ATOM 3725  H HD23 . LEU B 2 17 ? 0.776   -9.392  -0.681  1.00 0.00 ? 17 LEU B HD23 5  
ATOM 3726  N N    . VAL B 2 18 ? 1.171   -3.991  -2.156  1.00 0.00 ? 18 VAL B N    5  
ATOM 3727  C CA   . VAL B 2 18 ? 0.732   -3.571  -3.520  1.00 0.00 ? 18 VAL B CA   5  
ATOM 3728  C C    . VAL B 2 18 ? 1.968   -3.252  -4.357  1.00 0.00 ? 18 VAL B C    5  
ATOM 3729  O O    . VAL B 2 18 ? 2.104   -3.705  -5.476  1.00 0.00 ? 18 VAL B O    5  
ATOM 3730  C CB   . VAL B 2 18 ? -0.178  -2.336  -3.444  1.00 0.00 ? 18 VAL B CB   5  
ATOM 3731  C CG1  . VAL B 2 18 ? -1.248  -2.532  -2.371  1.00 0.00 ? 18 VAL B CG1  5  
ATOM 3732  C CG2  . VAL B 2 18 ? 0.657   -1.106  -3.108  1.00 0.00 ? 18 VAL B CG2  5  
ATOM 3733  H H    . VAL B 2 18 ? 0.837   -3.530  -1.361  1.00 0.00 ? 18 VAL B H    5  
ATOM 3734  H HA   . VAL B 2 18 ? 0.194   -4.384  -3.982  1.00 0.00 ? 18 VAL B HA   5  
ATOM 3735  H HB   . VAL B 2 18 ? -0.659  -2.189  -4.396  1.00 0.00 ? 18 VAL B HB   5  
ATOM 3736  H HG11 . VAL B 2 18 ? -2.226  -2.500  -2.830  1.00 0.00 ? 18 VAL B HG11 5  
ATOM 3737  H HG12 . VAL B 2 18 ? -1.170  -1.743  -1.637  1.00 0.00 ? 18 VAL B HG12 5  
ATOM 3738  H HG13 . VAL B 2 18 ? -1.107  -3.488  -1.891  1.00 0.00 ? 18 VAL B HG13 5  
ATOM 3739  H HG21 . VAL B 2 18 ? 0.005   -0.264  -2.932  1.00 0.00 ? 18 VAL B HG21 5  
ATOM 3740  H HG22 . VAL B 2 18 ? 1.322   -0.884  -3.930  1.00 0.00 ? 18 VAL B HG22 5  
ATOM 3741  H HG23 . VAL B 2 18 ? 1.233   -1.304  -2.224  1.00 0.00 ? 18 VAL B HG23 5  
ATOM 3742  N N    . CYS B 2 19 ? 2.878   -2.485  -3.825  1.00 0.00 ? 19 CYS B N    5  
ATOM 3743  C CA   . CYS B 2 19 ? 4.109   -2.157  -4.601  1.00 0.00 ? 19 CYS B CA   5  
ATOM 3744  C C    . CYS B 2 19 ? 5.146   -1.499  -3.691  1.00 0.00 ? 19 CYS B C    5  
ATOM 3745  O O    . CYS B 2 19 ? 6.052   -0.838  -4.154  1.00 0.00 ? 19 CYS B O    5  
ATOM 3746  C CB   . CYS B 2 19 ? 3.753   -1.191  -5.733  1.00 0.00 ? 19 CYS B CB   5  
ATOM 3747  S SG   . CYS B 2 19 ? 4.882   -1.443  -7.126  1.00 0.00 ? 19 CYS B SG   5  
ATOM 3748  H H    . CYS B 2 19 ? 2.753   -2.130  -2.917  1.00 0.00 ? 19 CYS B H    5  
ATOM 3749  H HA   . CYS B 2 19 ? 4.522   -3.063  -5.020  1.00 0.00 ? 19 CYS B HA   5  
ATOM 3750  H HB2  . CYS B 2 19 ? 2.739   -1.373  -6.054  1.00 0.00 ? 19 CYS B HB2  5  
ATOM 3751  H HB3  . CYS B 2 19 ? 3.842   -0.175  -5.378  1.00 0.00 ? 19 CYS B HB3  5  
ATOM 3752  N N    . GLY B 2 20 ? 5.038   -1.668  -2.403  1.00 0.00 ? 20 GLY B N    5  
ATOM 3753  C CA   . GLY B 2 20 ? 6.037   -1.025  -1.504  1.00 0.00 ? 20 GLY B CA   5  
ATOM 3754  C C    . GLY B 2 20 ? 7.102   -2.046  -1.103  1.00 0.00 ? 20 GLY B C    5  
ATOM 3755  O O    . GLY B 2 20 ? 8.142   -1.698  -0.581  1.00 0.00 ? 20 GLY B O    5  
ATOM 3756  H H    . GLY B 2 20 ? 4.309   -2.215  -2.028  1.00 0.00 ? 20 GLY B H    5  
ATOM 3757  H HA2  . GLY B 2 20 ? 6.506   -0.202  -2.028  1.00 0.00 ? 20 GLY B HA2  5  
ATOM 3758  H HA3  . GLY B 2 20 ? 5.545   -0.650  -0.623  1.00 0.00 ? 20 GLY B HA3  5  
ATOM 3759  N N    . GLU B 2 21 ? 6.858   -3.303  -1.348  1.00 0.00 ? 21 GLU B N    5  
ATOM 3760  C CA   . GLU B 2 21 ? 7.866   -4.337  -0.983  1.00 0.00 ? 21 GLU B CA   5  
ATOM 3761  C C    . GLU B 2 21 ? 9.239   -3.896  -1.491  1.00 0.00 ? 21 GLU B C    5  
ATOM 3762  O O    . GLU B 2 21 ? 10.216  -3.915  -0.768  1.00 0.00 ? 21 GLU B O    5  
ATOM 3763  C CB   . GLU B 2 21 ? 7.486   -5.672  -1.625  1.00 0.00 ? 21 GLU B CB   5  
ATOM 3764  C CG   . GLU B 2 21 ? 7.649   -6.796  -0.601  1.00 0.00 ? 21 GLU B CG   5  
ATOM 3765  C CD   . GLU B 2 21 ? 8.380   -7.974  -1.247  1.00 0.00 ? 21 GLU B CD   5  
ATOM 3766  O OE1  . GLU B 2 21 ? 7.801   -8.599  -2.119  1.00 0.00 ? 21 GLU B OE1  5  
ATOM 3767  O OE2  . GLU B 2 21 ? 9.508   -8.232  -0.858  1.00 0.00 ? 21 GLU B OE2  5  
ATOM 3768  H H    . GLU B 2 21 ? 6.016   -3.567  -1.774  1.00 0.00 ? 21 GLU B H    5  
ATOM 3769  H HA   . GLU B 2 21 ? 7.896   -4.448  0.091   1.00 0.00 ? 21 GLU B HA   5  
ATOM 3770  H HB2  . GLU B 2 21 ? 6.458   -5.632  -1.957  1.00 0.00 ? 21 GLU B HB2  5  
ATOM 3771  H HB3  . GLU B 2 21 ? 8.130   -5.862  -2.471  1.00 0.00 ? 21 GLU B HB3  5  
ATOM 3772  H HG2  . GLU B 2 21 ? 8.221   -6.434  0.242   1.00 0.00 ? 21 GLU B HG2  5  
ATOM 3773  H HG3  . GLU B 2 21 ? 6.676   -7.120  -0.263  1.00 0.00 ? 21 GLU B HG3  5  
ATOM 3774  N N    . ARG B 2 22 ? 9.320   -3.496  -2.730  1.00 0.00 ? 22 ARG B N    5  
ATOM 3775  C CA   . ARG B 2 22 ? 10.622  -3.052  -3.287  1.00 0.00 ? 22 ARG B CA   5  
ATOM 3776  C C    . ARG B 2 22 ? 10.752  -1.535  -3.135  1.00 0.00 ? 22 ARG B C    5  
ATOM 3777  O O    . ARG B 2 22 ? 11.835  -1.008  -2.978  1.00 0.00 ? 22 ARG B O    5  
ATOM 3778  C CB   . ARG B 2 22 ? 10.700  -3.427  -4.768  1.00 0.00 ? 22 ARG B CB   5  
ATOM 3779  C CG   . ARG B 2 22 ? 11.210  -4.863  -4.905  1.00 0.00 ? 22 ARG B CG   5  
ATOM 3780  C CD   . ARG B 2 22 ? 10.675  -5.473  -6.201  1.00 0.00 ? 22 ARG B CD   5  
ATOM 3781  N NE   . ARG B 2 22 ? 11.793  -5.632  -7.173  1.00 0.00 ? 22 ARG B NE   5  
ATOM 3782  C CZ   . ARG B 2 22 ? 11.626  -5.292  -8.422  1.00 0.00 ? 22 ARG B CZ   5  
ATOM 3783  N NH1  . ARG B 2 22 ? 11.087  -4.141  -8.718  1.00 0.00 ? 22 ARG B NH1  5  
ATOM 3784  N NH2  . ARG B 2 22 ? 11.996  -6.104  -9.374  1.00 0.00 ? 22 ARG B NH2  5  
ATOM 3785  H H    . ARG B 2 22 ? 8.525   -3.488  -3.293  1.00 0.00 ? 22 ARG B H    5  
ATOM 3786  H HA   . ARG B 2 22 ? 11.416  -3.537  -2.752  1.00 0.00 ? 22 ARG B HA   5  
ATOM 3787  H HB2  . ARG B 2 22 ? 9.718   -3.348  -5.212  1.00 0.00 ? 22 ARG B HB2  5  
ATOM 3788  H HB3  . ARG B 2 22 ? 11.379  -2.756  -5.274  1.00 0.00 ? 22 ARG B HB3  5  
ATOM 3789  H HG2  . ARG B 2 22 ? 12.290  -4.860  -4.925  1.00 0.00 ? 22 ARG B HG2  5  
ATOM 3790  H HG3  . ARG B 2 22 ? 10.867  -5.448  -4.065  1.00 0.00 ? 22 ARG B HG3  5  
ATOM 3791  H HD2  . ARG B 2 22 ? 10.241  -6.439  -5.992  1.00 0.00 ? 22 ARG B HD2  5  
ATOM 3792  H HD3  . ARG B 2 22 ? 9.922   -4.823  -6.621  1.00 0.00 ? 22 ARG B HD3  5  
ATOM 3793  H HE   . ARG B 2 22 ? 12.655  -5.990  -6.874  1.00 0.00 ? 22 ARG B HE   5  
ATOM 3794  H HH11 . ARG B 2 22 ? 10.803  -3.519  -7.988  1.00 0.00 ? 22 ARG B HH11 5  
ATOM 3795  H HH12 . ARG B 2 22 ? 10.959  -3.880  -9.675  1.00 0.00 ? 22 ARG B HH12 5  
ATOM 3796  H HH21 . ARG B 2 22 ? 12.408  -6.986  -9.147  1.00 0.00 ? 22 ARG B HH21 5  
ATOM 3797  H HH22 . ARG B 2 22 ? 11.868  -5.843  -10.331 1.00 0.00 ? 22 ARG B HH22 5  
ATOM 3798  N N    . GLY B 2 23 ? 9.655   -0.828  -3.182  1.00 0.00 ? 23 GLY B N    5  
ATOM 3799  C CA   . GLY B 2 23 ? 9.717   0.654   -3.041  1.00 0.00 ? 23 GLY B CA   5  
ATOM 3800  C C    . GLY B 2 23 ? 10.060  1.019   -1.595  1.00 0.00 ? 23 GLY B C    5  
ATOM 3801  O O    . GLY B 2 23 ? 10.725  2.001   -1.334  1.00 0.00 ? 23 GLY B O    5  
ATOM 3802  H H    . GLY B 2 23 ? 8.790   -1.273  -3.311  1.00 0.00 ? 23 GLY B H    5  
ATOM 3803  H HA2  . GLY B 2 23 ? 10.477  1.046   -3.703  1.00 0.00 ? 23 GLY B HA2  5  
ATOM 3804  H HA3  . GLY B 2 23 ? 8.760   1.082   -3.299  1.00 0.00 ? 23 GLY B HA3  5  
ATOM 3805  N N    . PHE B 2 24 ? 9.612   0.235   -0.653  1.00 0.00 ? 24 PHE B N    5  
ATOM 3806  C CA   . PHE B 2 24 ? 9.914   0.538   0.774   1.00 0.00 ? 24 PHE B CA   5  
ATOM 3807  C C    . PHE B 2 24 ? 11.092  -0.320  1.240   1.00 0.00 ? 24 PHE B C    5  
ATOM 3808  O O    . PHE B 2 24 ? 11.387  -0.400  2.416   1.00 0.00 ? 24 PHE B O    5  
ATOM 3809  C CB   . PHE B 2 24 ? 8.686   0.228   1.634   1.00 0.00 ? 24 PHE B CB   5  
ATOM 3810  C CG   . PHE B 2 24 ? 7.762   1.422   1.644   1.00 0.00 ? 24 PHE B CG   5  
ATOM 3811  C CD1  . PHE B 2 24 ? 7.724   2.287   0.543   1.00 0.00 ? 24 PHE B CD1  5  
ATOM 3812  C CD2  . PHE B 2 24 ? 6.944   1.665   2.753   1.00 0.00 ? 24 PHE B CD2  5  
ATOM 3813  C CE1  . PHE B 2 24 ? 6.867   3.394   0.552   1.00 0.00 ? 24 PHE B CE1  5  
ATOM 3814  C CE2  . PHE B 2 24 ? 6.087   2.772   2.762   1.00 0.00 ? 24 PHE B CE2  5  
ATOM 3815  C CZ   . PHE B 2 24 ? 6.049   3.636   1.662   1.00 0.00 ? 24 PHE B CZ   5  
ATOM 3816  H H    . PHE B 2 24 ? 9.077   -0.554  -0.884  1.00 0.00 ? 24 PHE B H    5  
ATOM 3817  H HA   . PHE B 2 24 ? 10.168  1.583   0.874   1.00 0.00 ? 24 PHE B HA   5  
ATOM 3818  H HB2  . PHE B 2 24 ? 8.167   -0.626  1.224   1.00 0.00 ? 24 PHE B HB2  5  
ATOM 3819  H HB3  . PHE B 2 24 ? 9.000   0.008   2.643   1.00 0.00 ? 24 PHE B HB3  5  
ATOM 3820  H HD1  . PHE B 2 24 ? 8.355   2.100   -0.313  1.00 0.00 ? 24 PHE B HD1  5  
ATOM 3821  H HD2  . PHE B 2 24 ? 6.974   0.998   3.602   1.00 0.00 ? 24 PHE B HD2  5  
ATOM 3822  H HE1  . PHE B 2 24 ? 6.837   4.061   -0.297  1.00 0.00 ? 24 PHE B HE1  5  
ATOM 3823  H HE2  . PHE B 2 24 ? 5.456   2.959   3.619   1.00 0.00 ? 24 PHE B HE2  5  
ATOM 3824  H HZ   . PHE B 2 24 ? 5.388   4.490   1.669   1.00 0.00 ? 24 PHE B HZ   5  
ATOM 3825  N N    . PHE B 2 25 ? 11.769  -0.961  0.327   1.00 0.00 ? 25 PHE B N    5  
ATOM 3826  C CA   . PHE B 2 25 ? 12.927  -1.811  0.720   1.00 0.00 ? 25 PHE B CA   5  
ATOM 3827  C C    . PHE B 2 25 ? 14.130  -0.918  1.028   1.00 0.00 ? 25 PHE B C    5  
ATOM 3828  O O    . PHE B 2 25 ? 14.331  0.105   0.404   1.00 0.00 ? 25 PHE B O    5  
ATOM 3829  C CB   . PHE B 2 25 ? 13.277  -2.760  -0.429  1.00 0.00 ? 25 PHE B CB   5  
ATOM 3830  C CG   . PHE B 2 25 ? 13.163  -4.189  0.045   1.00 0.00 ? 25 PHE B CG   5  
ATOM 3831  C CD1  . PHE B 2 25 ? 13.603  -4.539  1.328   1.00 0.00 ? 25 PHE B CD1  5  
ATOM 3832  C CD2  . PHE B 2 25 ? 12.617  -5.165  -0.797  1.00 0.00 ? 25 PHE B CD2  5  
ATOM 3833  C CE1  . PHE B 2 25 ? 13.497  -5.864  1.767   1.00 0.00 ? 25 PHE B CE1  5  
ATOM 3834  C CE2  . PHE B 2 25 ? 12.511  -6.490  -0.357  1.00 0.00 ? 25 PHE B CE2  5  
ATOM 3835  C CZ   . PHE B 2 25 ? 12.951  -6.839  0.925   1.00 0.00 ? 25 PHE B CZ   5  
ATOM 3836  H H    . PHE B 2 25 ? 11.515  -0.883  -0.616  1.00 0.00 ? 25 PHE B H    5  
ATOM 3837  H HA   . PHE B 2 25 ? 12.671  -2.386  1.598   1.00 0.00 ? 25 PHE B HA   5  
ATOM 3838  H HB2  . PHE B 2 25 ? 12.595  -2.597  -1.250  1.00 0.00 ? 25 PHE B HB2  5  
ATOM 3839  H HB3  . PHE B 2 25 ? 14.288  -2.571  -0.757  1.00 0.00 ? 25 PHE B HB3  5  
ATOM 3840  H HD1  . PHE B 2 25 ? 14.024  -3.786  1.978   1.00 0.00 ? 25 PHE B HD1  5  
ATOM 3841  H HD2  . PHE B 2 25 ? 12.277  -4.895  -1.786  1.00 0.00 ? 25 PHE B HD2  5  
ATOM 3842  H HE1  . PHE B 2 25 ? 13.837  -6.133  2.757   1.00 0.00 ? 25 PHE B HE1  5  
ATOM 3843  H HE2  . PHE B 2 25 ? 12.090  -7.242  -1.007  1.00 0.00 ? 25 PHE B HE2  5  
ATOM 3844  H HZ   . PHE B 2 25 ? 12.870  -7.861  1.264   1.00 0.00 ? 25 PHE B HZ   5  
ATOM 3845  N N    . TYR B 2 26 ? 14.932  -1.294  1.986   1.00 0.00 ? 26 TYR B N    5  
ATOM 3846  C CA   . TYR B 2 26 ? 16.117  -0.461  2.332   1.00 0.00 ? 26 TYR B CA   5  
ATOM 3847  C C    . TYR B 2 26 ? 17.103  -0.463  1.155   1.00 0.00 ? 26 TYR B C    5  
ATOM 3848  O O    . TYR B 2 26 ? 17.425  -1.509  0.626   1.00 0.00 ? 26 TYR B O    5  
ATOM 3849  C CB   . TYR B 2 26 ? 16.802  -1.043  3.571   1.00 0.00 ? 26 TYR B CB   5  
ATOM 3850  C CG   . TYR B 2 26 ? 16.011  -0.672  4.802   1.00 0.00 ? 26 TYR B CG   5  
ATOM 3851  C CD1  . TYR B 2 26 ? 15.752  0.674   5.089   1.00 0.00 ? 26 TYR B CD1  5  
ATOM 3852  C CD2  . TYR B 2 26 ? 15.537  -1.674  5.658   1.00 0.00 ? 26 TYR B CD2  5  
ATOM 3853  C CE1  . TYR B 2 26 ? 15.018  1.018   6.230   1.00 0.00 ? 26 TYR B CE1  5  
ATOM 3854  C CE2  . TYR B 2 26 ? 14.803  -1.330  6.799   1.00 0.00 ? 26 TYR B CE2  5  
ATOM 3855  C CZ   . TYR B 2 26 ? 14.544  0.016   7.086   1.00 0.00 ? 26 TYR B CZ   5  
ATOM 3856  O OH   . TYR B 2 26 ? 13.820  0.355   8.211   1.00 0.00 ? 26 TYR B OH   5  
ATOM 3857  H H    . TYR B 2 26 ? 14.752  -2.121  2.479   1.00 0.00 ? 26 TYR B H    5  
ATOM 3858  H HA   . TYR B 2 26 ? 15.795  0.546   2.540   1.00 0.00 ? 26 TYR B HA   5  
ATOM 3859  H HB2  . TYR B 2 26 ? 16.850  -2.119  3.483   1.00 0.00 ? 26 TYR B HB2  5  
ATOM 3860  H HB3  . TYR B 2 26 ? 17.801  -0.643  3.651   1.00 0.00 ? 26 TYR B HB3  5  
ATOM 3861  H HD1  . TYR B 2 26 ? 16.118  1.446   4.429   1.00 0.00 ? 26 TYR B HD1  5  
ATOM 3862  H HD2  . TYR B 2 26 ? 15.737  -2.712  5.437   1.00 0.00 ? 26 TYR B HD2  5  
ATOM 3863  H HE1  . TYR B 2 26 ? 14.818  2.056   6.451   1.00 0.00 ? 26 TYR B HE1  5  
ATOM 3864  H HE2  . TYR B 2 26 ? 14.437  -2.103  7.459   1.00 0.00 ? 26 TYR B HE2  5  
ATOM 3865  H HH   . TYR B 2 26 ? 13.891  -0.369  8.838   1.00 0.00 ? 26 TYR B HH   5  
ATOM 3866  N N    . PRO B 2 27 ? 17.555  0.708   0.779   1.00 0.00 ? 27 PRO B N    5  
ATOM 3867  C CA   . PRO B 2 27 ? 18.506  0.869   -0.335  1.00 0.00 ? 27 PRO B CA   5  
ATOM 3868  C C    . PRO B 2 27 ? 19.927  0.529   0.124   1.00 0.00 ? 27 PRO B C    5  
ATOM 3869  O O    . PRO B 2 27 ? 20.265  0.664   1.283   1.00 0.00 ? 27 PRO B O    5  
ATOM 3870  C CB   . PRO B 2 27 ? 18.392  2.353   -0.694  1.00 0.00 ? 27 PRO B CB   5  
ATOM 3871  C CG   . PRO B 2 27 ? 17.837  3.064   0.563   1.00 0.00 ? 27 PRO B CG   5  
ATOM 3872  C CD   . PRO B 2 27 ? 17.161  1.979   1.422   1.00 0.00 ? 27 PRO B CD   5  
ATOM 3873  H HA   . PRO B 2 27 ? 18.218  0.261   -1.177  1.00 0.00 ? 27 PRO B HA   5  
ATOM 3874  H HB2  . PRO B 2 27 ? 19.366  2.748   -0.949  1.00 0.00 ? 27 PRO B HB2  5  
ATOM 3875  H HB3  . PRO B 2 27 ? 17.708  2.484   -1.518  1.00 0.00 ? 27 PRO B HB3  5  
ATOM 3876  H HG2  . PRO B 2 27 ? 18.645  3.526   1.113   1.00 0.00 ? 27 PRO B HG2  5  
ATOM 3877  H HG3  . PRO B 2 27 ? 17.109  3.808   0.277   1.00 0.00 ? 27 PRO B HG3  5  
ATOM 3878  H HD2  . PRO B 2 27 ? 17.527  2.021   2.439   1.00 0.00 ? 27 PRO B HD2  5  
ATOM 3879  H HD3  . PRO B 2 27 ? 16.088  2.091   1.399   1.00 0.00 ? 27 PRO B HD3  5  
ATOM 3880  N N    . THR B 2 28 ? 20.763  0.089   -0.777  1.00 0.00 ? 28 THR B N    5  
ATOM 3881  C CA   . THR B 2 28 ? 22.160  -0.257  -0.393  1.00 0.00 ? 28 THR B CA   5  
ATOM 3882  C C    . THR B 2 28 ? 22.142  -1.164  0.839   1.00 0.00 ? 28 THR B C    5  
ATOM 3883  O O    . THR B 2 28 ? 22.194  -0.703  1.962   1.00 0.00 ? 28 THR B O    5  
ATOM 3884  C CB   . THR B 2 28 ? 22.932  1.025   -0.071  1.00 0.00 ? 28 THR B CB   5  
ATOM 3885  O OG1  . THR B 2 28 ? 22.052  1.968   0.526   1.00 0.00 ? 28 THR B OG1  5  
ATOM 3886  C CG2  . THR B 2 28 ? 23.513  1.611   -1.359  1.00 0.00 ? 28 THR B CG2  5  
ATOM 3887  H H    . THR B 2 28 ? 20.471  -0.012  -1.708  1.00 0.00 ? 28 THR B H    5  
ATOM 3888  H HA   . THR B 2 28 ? 22.642  -0.771  -1.211  1.00 0.00 ? 28 THR B HA   5  
ATOM 3889  H HB   . THR B 2 28 ? 23.736  0.800   0.612   1.00 0.00 ? 28 THR B HB   5  
ATOM 3890  H HG1  . THR B 2 28 ? 22.022  1.790   1.469   1.00 0.00 ? 28 THR B HG1  5  
ATOM 3891  H HG21 . THR B 2 28 ? 22.730  2.106   -1.914  1.00 0.00 ? 28 THR B HG21 5  
ATOM 3892  H HG22 . THR B 2 28 ? 23.932  0.816   -1.958  1.00 0.00 ? 28 THR B HG22 5  
ATOM 3893  H HG23 . THR B 2 28 ? 24.286  2.323   -1.113  1.00 0.00 ? 28 THR B HG23 5  
ATOM 3894  N N    . LYS B 2 29 ? 22.070  -2.451  0.638   1.00 0.00 ? 29 LYS B N    5  
ATOM 3895  C CA   . LYS B 2 29 ? 22.050  -3.386  1.798   1.00 0.00 ? 29 LYS B CA   5  
ATOM 3896  C C    . LYS B 2 29 ? 23.481  -3.627  2.281   1.00 0.00 ? 29 LYS B C    5  
ATOM 3897  O O    . LYS B 2 29 ? 24.317  -4.127  1.554   1.00 0.00 ? 29 LYS B O    5  
ATOM 3898  C CB   . LYS B 2 29 ? 21.426  -4.716  1.369   1.00 0.00 ? 29 LYS B CB   5  
ATOM 3899  C CG   . LYS B 2 29 ? 22.075  -5.188  0.067   1.00 0.00 ? 29 LYS B CG   5  
ATOM 3900  C CD   . LYS B 2 29 ? 21.033  -5.184  -1.053  1.00 0.00 ? 29 LYS B CD   5  
ATOM 3901  C CE   . LYS B 2 29 ? 21.717  -4.874  -2.386  1.00 0.00 ? 29 LYS B CE   5  
ATOM 3902  N NZ   . LYS B 2 29 ? 22.874  -5.794  -2.577  1.00 0.00 ? 29 LYS B NZ   5  
ATOM 3903  H H    . LYS B 2 29 ? 22.030  -2.802  -0.276  1.00 0.00 ? 29 LYS B H    5  
ATOM 3904  H HA   . LYS B 2 29 ? 21.467  -2.956  2.598   1.00 0.00 ? 29 LYS B HA   5  
ATOM 3905  H HB2  . LYS B 2 29 ? 21.588  -5.454  2.142   1.00 0.00 ? 29 LYS B HB2  5  
ATOM 3906  H HB3  . LYS B 2 29 ? 20.366  -4.583  1.214   1.00 0.00 ? 29 LYS B HB3  5  
ATOM 3907  H HG2  . LYS B 2 29 ? 22.886  -4.522  -0.192  1.00 0.00 ? 29 LYS B HG2  5  
ATOM 3908  H HG3  . LYS B 2 29 ? 22.458  -6.189  0.197   1.00 0.00 ? 29 LYS B HG3  5  
ATOM 3909  H HD2  . LYS B 2 29 ? 20.560  -6.154  -1.107  1.00 0.00 ? 29 LYS B HD2  5  
ATOM 3910  H HD3  . LYS B 2 29 ? 20.288  -4.430  -0.850  1.00 0.00 ? 29 LYS B HD3  5  
ATOM 3911  H HE2  . LYS B 2 29 ? 21.012  -5.010  -3.193  1.00 0.00 ? 29 LYS B HE2  5  
ATOM 3912  H HE3  . LYS B 2 29 ? 22.066  -3.852  -2.382  1.00 0.00 ? 29 LYS B HE3  5  
ATOM 3913  H HZ1  . LYS B 2 29 ? 22.799  -6.589  -1.911  1.00 0.00 ? 29 LYS B HZ1  5  
ATOM 3914  H HZ2  . LYS B 2 29 ? 23.760  -5.277  -2.404  1.00 0.00 ? 29 LYS B HZ2  5  
ATOM 3915  H HZ3  . LYS B 2 29 ? 22.870  -6.160  -3.550  1.00 0.00 ? 29 LYS B HZ3  5  
ATOM 3916  N N    . THR B 2 30 ? 23.772  -3.275  3.504   1.00 0.00 ? 30 THR B N    5  
ATOM 3917  C CA   . THR B 2 30 ? 25.150  -3.484  4.032   1.00 0.00 ? 30 THR B CA   5  
ATOM 3918  C C    . THR B 2 30 ? 26.084  -2.421  3.451   1.00 0.00 ? 30 THR B C    5  
ATOM 3919  O O    . THR B 2 30 ? 26.920  -2.777  2.637   1.00 0.00 ? 30 THR B O    5  
ATOM 3920  C CB   . THR B 2 30 ? 25.645  -4.875  3.628   1.00 0.00 ? 30 THR B CB   5  
ATOM 3921  O OG1  . THR B 2 30 ? 24.531  -5.734  3.433   1.00 0.00 ? 30 THR B OG1  5  
ATOM 3922  C CG2  . THR B 2 30 ? 26.542  -5.440  4.730   1.00 0.00 ? 30 THR B CG2  5  
ATOM 3923  O OXT  . THR B 2 30 ? 25.948  -1.270  3.830   1.00 0.00 ? 30 THR B OXT  5  
ATOM 3924  H H    . THR B 2 30 ? 23.084  -2.873  4.075   1.00 0.00 ? 30 THR B H    5  
ATOM 3925  H HA   . THR B 2 30 ? 25.139  -3.404  5.109   1.00 0.00 ? 30 THR B HA   5  
ATOM 3926  H HB   . THR B 2 30 ? 26.210  -4.804  2.711   1.00 0.00 ? 30 THR B HB   5  
ATOM 3927  H HG1  . THR B 2 30 ? 24.134  -5.904  4.291   1.00 0.00 ? 30 THR B HG1  5  
ATOM 3928  H HG21 . THR B 2 30 ? 27.576  -5.240  4.491   1.00 0.00 ? 30 THR B HG21 5  
ATOM 3929  H HG22 . THR B 2 30 ? 26.390  -6.506  4.807   1.00 0.00 ? 30 THR B HG22 5  
ATOM 3930  H HG23 . THR B 2 30 ? 26.293  -4.972  5.671   1.00 0.00 ? 30 THR B HG23 5  
ATOM 3931  N N    . GLY A 1 1  ? 1.143   8.375   5.750   1.00 0.00 ? 1  GLY A N    6  
ATOM 3932  C CA   . GLY A 1 1  ? 1.794   8.088   4.440   1.00 0.00 ? 1  GLY A CA   6  
ATOM 3933  C C    . GLY A 1 1  ? 0.725   7.732   3.406   1.00 0.00 ? 1  GLY A C    6  
ATOM 3934  O O    . GLY A 1 1  ? -0.393  8.205   3.466   1.00 0.00 ? 1  GLY A O    6  
ATOM 3935  H H1   . GLY A 1 1  ? 1.164   7.521   6.342   1.00 0.00 ? 1  GLY A H1   6  
ATOM 3936  H H2   . GLY A 1 1  ? 0.156   8.664   5.590   1.00 0.00 ? 1  GLY A H2   6  
ATOM 3937  H H3   . GLY A 1 1  ? 1.655   9.141   6.232   1.00 0.00 ? 1  GLY A H3   6  
ATOM 3938  H HA2  . GLY A 1 1  ? 2.339   8.962   4.111   1.00 0.00 ? 1  GLY A HA2  6  
ATOM 3939  H HA3  . GLY A 1 1  ? 2.474   7.258   4.550   1.00 0.00 ? 1  GLY A HA3  6  
ATOM 3940  N N    . ILE A 1 2  ? 1.058   6.901   2.456   1.00 0.00 ? 2  ILE A N    6  
ATOM 3941  C CA   . ILE A 1 2  ? 0.060   6.516   1.419   1.00 0.00 ? 2  ILE A CA   6  
ATOM 3942  C C    . ILE A 1 2  ? -0.973  5.574   2.034   1.00 0.00 ? 2  ILE A C    6  
ATOM 3943  O O    . ILE A 1 2  ? -2.161  5.718   1.826   1.00 0.00 ? 2  ILE A O    6  
ATOM 3944  C CB   . ILE A 1 2  ? 0.776   5.817   0.259   1.00 0.00 ? 2  ILE A CB   6  
ATOM 3945  C CG1  . ILE A 1 2  ? -0.163  5.733   -0.948  1.00 0.00 ? 2  ILE A CG1  6  
ATOM 3946  C CG2  . ILE A 1 2  ? 1.186   4.405   0.683   1.00 0.00 ? 2  ILE A CG2  6  
ATOM 3947  C CD1  . ILE A 1 2  ? 0.434   4.792   -1.997  1.00 0.00 ? 2  ILE A CD1  6  
ATOM 3948  H H    . ILE A 1 2  ? 1.965   6.531   2.425   1.00 0.00 ? 2  ILE A H    6  
ATOM 3949  H HA   . ILE A 1 2  ? -0.438  7.399   1.058   1.00 0.00 ? 2  ILE A HA   6  
ATOM 3950  H HB   . ILE A 1 2  ? 1.659   6.380   -0.009  1.00 0.00 ? 2  ILE A HB   6  
ATOM 3951  H HG12 . ILE A 1 2  ? -1.124  5.356   -0.631  1.00 0.00 ? 2  ILE A HG12 6  
ATOM 3952  H HG13 . ILE A 1 2  ? -0.284  6.716   -1.379  1.00 0.00 ? 2  ILE A HG13 6  
ATOM 3953  H HG21 . ILE A 1 2  ? 1.753   3.941   -0.110  1.00 0.00 ? 2  ILE A HG21 6  
ATOM 3954  H HG22 . ILE A 1 2  ? 0.301   3.819   0.884   1.00 0.00 ? 2  ILE A HG22 6  
ATOM 3955  H HG23 . ILE A 1 2  ? 1.792   4.459   1.575   1.00 0.00 ? 2  ILE A HG23 6  
ATOM 3956  H HD11 . ILE A 1 2  ? -0.068  3.836   -1.950  1.00 0.00 ? 2  ILE A HD11 6  
ATOM 3957  H HD12 . ILE A 1 2  ? 1.487   4.655   -1.801  1.00 0.00 ? 2  ILE A HD12 6  
ATOM 3958  H HD13 . ILE A 1 2  ? 0.304   5.219   -2.980  1.00 0.00 ? 2  ILE A HD13 6  
ATOM 3959  N N    . VAL A 1 3  ? -0.532  4.616   2.795   1.00 0.00 ? 3  VAL A N    6  
ATOM 3960  C CA   . VAL A 1 3  ? -1.476  3.674   3.429   1.00 0.00 ? 3  VAL A CA   6  
ATOM 3961  C C    . VAL A 1 3  ? -2.301  4.418   4.475   1.00 0.00 ? 3  VAL A C    6  
ATOM 3962  O O    . VAL A 1 3  ? -3.497  4.237   4.581   1.00 0.00 ? 3  VAL A O    6  
ATOM 3963  C CB   . VAL A 1 3  ? -0.676  2.558   4.092   1.00 0.00 ? 3  VAL A CB   6  
ATOM 3964  C CG1  . VAL A 1 3  ? 0.316   3.157   5.092   1.00 0.00 ? 3  VAL A CG1  6  
ATOM 3965  C CG2  . VAL A 1 3  ? -1.629  1.631   4.823   1.00 0.00 ? 3  VAL A CG2  6  
ATOM 3966  H H    . VAL A 1 3  ? 0.423   4.516   2.956   1.00 0.00 ? 3  VAL A H    6  
ATOM 3967  H HA   . VAL A 1 3  ? -2.132  3.258   2.682   1.00 0.00 ? 3  VAL A HA   6  
ATOM 3968  H HB   . VAL A 1 3  ? -0.137  2.003   3.338   1.00 0.00 ? 3  VAL A HB   6  
ATOM 3969  H HG11 . VAL A 1 3  ? 0.870   2.361   5.569   1.00 0.00 ? 3  VAL A HG11 6  
ATOM 3970  H HG12 . VAL A 1 3  ? -0.221  3.719   5.841   1.00 0.00 ? 3  VAL A HG12 6  
ATOM 3971  H HG13 . VAL A 1 3  ? 1.001   3.811   4.574   1.00 0.00 ? 3  VAL A HG13 6  
ATOM 3972  H HG21 . VAL A 1 3  ? -1.851  0.783   4.195   1.00 0.00 ? 3  VAL A HG21 6  
ATOM 3973  H HG22 . VAL A 1 3  ? -2.540  2.164   5.049   1.00 0.00 ? 3  VAL A HG22 6  
ATOM 3974  H HG23 . VAL A 1 3  ? -1.168  1.295   5.738   1.00 0.00 ? 3  VAL A HG23 6  
ATOM 3975  N N    . GLU A 1 4  ? -1.671  5.259   5.245   1.00 0.00 ? 4  GLU A N    6  
ATOM 3976  C CA   . GLU A 1 4  ? -2.416  6.022   6.283   1.00 0.00 ? 4  GLU A CA   6  
ATOM 3977  C C    . GLU A 1 4  ? -3.362  7.009   5.601   1.00 0.00 ? 4  GLU A C    6  
ATOM 3978  O O    . GLU A 1 4  ? -4.491  7.189   6.012   1.00 0.00 ? 4  GLU A O    6  
ATOM 3979  C CB   . GLU A 1 4  ? -1.427  6.788   7.164   1.00 0.00 ? 4  GLU A CB   6  
ATOM 3980  C CG   . GLU A 1 4  ? -2.025  6.977   8.559   1.00 0.00 ? 4  GLU A CG   6  
ATOM 3981  C CD   . GLU A 1 4  ? -2.458  8.434   8.736   1.00 0.00 ? 4  GLU A CD   6  
ATOM 3982  O OE1  . GLU A 1 4  ? -2.567  9.125   7.737   1.00 0.00 ? 4  GLU A OE1  6  
ATOM 3983  O OE2  . GLU A 1 4  ? -2.673  8.834   9.869   1.00 0.00 ? 4  GLU A OE2  6  
ATOM 3984  H H    . GLU A 1 4  ? -0.707  5.390   5.137   1.00 0.00 ? 4  GLU A H    6  
ATOM 3985  H HA   . GLU A 1 4  ? -2.987  5.340   6.891   1.00 0.00 ? 4  GLU A HA   6  
ATOM 3986  H HB2  . GLU A 1 4  ? -0.505  6.230   7.238   1.00 0.00 ? 4  GLU A HB2  6  
ATOM 3987  H HB3  . GLU A 1 4  ? -1.228  7.754   6.725   1.00 0.00 ? 4  GLU A HB3  6  
ATOM 3988  H HG2  . GLU A 1 4  ? -2.882  6.329   8.674   1.00 0.00 ? 4  GLU A HG2  6  
ATOM 3989  H HG3  . GLU A 1 4  ? -1.284  6.731   9.305   1.00 0.00 ? 4  GLU A HG3  6  
ATOM 3990  N N    . GLN A 1 5  ? -2.911  7.647   4.557   1.00 0.00 ? 5  GLN A N    6  
ATOM 3991  C CA   . GLN A 1 5  ? -3.785  8.619   3.844   1.00 0.00 ? 5  GLN A CA   6  
ATOM 3992  C C    . GLN A 1 5  ? -4.714  7.860   2.895   1.00 0.00 ? 5  GLN A C    6  
ATOM 3993  O O    . GLN A 1 5  ? -5.803  8.303   2.590   1.00 0.00 ? 5  GLN A O    6  
ATOM 3994  C CB   . GLN A 1 5  ? -2.918  9.594   3.044   1.00 0.00 ? 5  GLN A CB   6  
ATOM 3995  C CG   . GLN A 1 5  ? -3.704  10.880  2.784   1.00 0.00 ? 5  GLN A CG   6  
ATOM 3996  C CD   . GLN A 1 5  ? -3.853  11.661  4.092   1.00 0.00 ? 5  GLN A CD   6  
ATOM 3997  O OE1  . GLN A 1 5  ? -2.873  12.026  4.709   1.00 0.00 ? 5  GLN A OE1  6  
ATOM 3998  N NE2  . GLN A 1 5  ? -5.047  11.933  4.542   1.00 0.00 ? 5  GLN A NE2  6  
ATOM 3999  H H    . GLN A 1 5  ? -1.998  7.482   4.240   1.00 0.00 ? 5  GLN A H    6  
ATOM 4000  H HA   . GLN A 1 5  ? -4.375  9.168   4.564   1.00 0.00 ? 5  GLN A HA   6  
ATOM 4001  H HB2  . GLN A 1 5  ? -2.024  9.824   3.605   1.00 0.00 ? 5  GLN A HB2  6  
ATOM 4002  H HB3  . GLN A 1 5  ? -2.647  9.144   2.101   1.00 0.00 ? 5  GLN A HB3  6  
ATOM 4003  H HG2  . GLN A 1 5  ? -3.176  11.485  2.061   1.00 0.00 ? 5  GLN A HG2  6  
ATOM 4004  H HG3  . GLN A 1 5  ? -4.683  10.633  2.402   1.00 0.00 ? 5  GLN A HG3  6  
ATOM 4005  H HE21 . GLN A 1 5  ? -5.838  11.638  4.044   1.00 0.00 ? 5  GLN A HE21 6  
ATOM 4006  H HE22 . GLN A 1 5  ? -5.153  12.433  5.379   1.00 0.00 ? 5  GLN A HE22 6  
ATOM 4007  N N    . CYS A 1 6  ? -4.288  6.720   2.422   1.00 0.00 ? 6  CYS A N    6  
ATOM 4008  C CA   . CYS A 1 6  ? -5.143  5.935   1.489   1.00 0.00 ? 6  CYS A CA   6  
ATOM 4009  C C    . CYS A 1 6  ? -5.729  4.719   2.214   1.00 0.00 ? 6  CYS A C    6  
ATOM 4010  O O    . CYS A 1 6  ? -6.226  3.800   1.595   1.00 0.00 ? 6  CYS A O    6  
ATOM 4011  C CB   . CYS A 1 6  ? -4.298  5.461   0.305   1.00 0.00 ? 6  CYS A CB   6  
ATOM 4012  S SG   . CYS A 1 6  ? -5.291  5.522   -1.207  1.00 0.00 ? 6  CYS A SG   6  
ATOM 4013  H H    . CYS A 1 6  ? -3.403  6.384   2.678   1.00 0.00 ? 6  CYS A H    6  
ATOM 4014  H HA   . CYS A 1 6  ? -5.947  6.558   1.128   1.00 0.00 ? 6  CYS A HA   6  
ATOM 4015  H HB2  . CYS A 1 6  ? -3.438  6.106   0.196   1.00 0.00 ? 6  CYS A HB2  6  
ATOM 4016  H HB3  . CYS A 1 6  ? -3.969  4.448   0.479   1.00 0.00 ? 6  CYS A HB3  6  
ATOM 4017  N N    . CYS A 1 7  ? -5.673  4.701   3.520   1.00 0.00 ? 7  CYS A N    6  
ATOM 4018  C CA   . CYS A 1 7  ? -6.231  3.538   4.272   1.00 0.00 ? 7  CYS A CA   6  
ATOM 4019  C C    . CYS A 1 7  ? -7.733  3.406   3.977   1.00 0.00 ? 7  CYS A C    6  
ATOM 4020  O O    . CYS A 1 7  ? -8.160  3.512   2.845   1.00 0.00 ? 7  CYS A O    6  
ATOM 4021  C CB   . CYS A 1 7  ? -6.012  3.739   5.775   1.00 0.00 ? 7  CYS A CB   6  
ATOM 4022  S SG   . CYS A 1 7  ? -5.954  2.124   6.602   1.00 0.00 ? 7  CYS A SG   6  
ATOM 4023  H H    . CYS A 1 7  ? -5.264  5.448   4.004   1.00 0.00 ? 7  CYS A H    6  
ATOM 4024  H HA   . CYS A 1 7  ? -5.727  2.637   3.955   1.00 0.00 ? 7  CYS A HA   6  
ATOM 4025  H HB2  . CYS A 1 7  ? -5.082  4.260   5.939   1.00 0.00 ? 7  CYS A HB2  6  
ATOM 4026  H HB3  . CYS A 1 7  ? -6.826  4.321   6.182   1.00 0.00 ? 7  CYS A HB3  6  
ATOM 4027  N N    . THR A 1 8  ? -8.541  3.164   4.980   1.00 0.00 ? 8  THR A N    6  
ATOM 4028  C CA   . THR A 1 8  ? -10.004 3.016   4.736   1.00 0.00 ? 8  THR A CA   6  
ATOM 4029  C C    . THR A 1 8  ? -10.245 1.743   3.922   1.00 0.00 ? 8  THR A C    6  
ATOM 4030  O O    . THR A 1 8  ? -9.445  0.829   3.935   1.00 0.00 ? 8  THR A O    6  
ATOM 4031  C CB   . THR A 1 8  ? -10.527 4.229   3.959   1.00 0.00 ? 8  THR A CB   6  
ATOM 4032  O OG1  . THR A 1 8  ? -10.424 3.978   2.565   1.00 0.00 ? 8  THR A OG1  6  
ATOM 4033  C CG2  . THR A 1 8  ? -9.703  5.467   4.320   1.00 0.00 ? 8  THR A CG2  6  
ATOM 4034  H H    . THR A 1 8  ? -8.188  3.070   5.888   1.00 0.00 ? 8  THR A H    6  
ATOM 4035  H HA   . THR A 1 8  ? -10.521 2.942   5.682   1.00 0.00 ? 8  THR A HA   6  
ATOM 4036  H HB   . THR A 1 8  ? -11.560 4.403   4.218   1.00 0.00 ? 8  THR A HB   6  
ATOM 4037  H HG1  . THR A 1 8  ? -11.254 4.233   2.155   1.00 0.00 ? 8  THR A HG1  6  
ATOM 4038  H HG21 . THR A 1 8  ? -8.845  5.531   3.667   1.00 0.00 ? 8  THR A HG21 6  
ATOM 4039  H HG22 . THR A 1 8  ? -9.371  5.392   5.345   1.00 0.00 ? 8  THR A HG22 6  
ATOM 4040  H HG23 . THR A 1 8  ? -10.312 6.351   4.202   1.00 0.00 ? 8  THR A HG23 6  
ATOM 4041  N N    . SER A 1 9  ? -11.336 1.675   3.210   1.00 0.00 ? 9  SER A N    6  
ATOM 4042  C CA   . SER A 1 9  ? -11.614 0.459   2.395   1.00 0.00 ? 9  SER A CA   6  
ATOM 4043  C C    . SER A 1 9  ? -10.507 0.304   1.341   1.00 0.00 ? 9  SER A C    6  
ATOM 4044  O O    . SER A 1 9  ? -9.336  0.375   1.655   1.00 0.00 ? 9  SER A O    6  
ATOM 4045  C CB   . SER A 1 9  ? -12.976 0.609   1.715   1.00 0.00 ? 9  SER A CB   6  
ATOM 4046  O OG   . SER A 1 9  ? -13.972 0.837   2.704   1.00 0.00 ? 9  SER A OG   6  
ATOM 4047  H H    . SER A 1 9  ? -11.969 2.423   3.208   1.00 0.00 ? 9  SER A H    6  
ATOM 4048  H HA   . SER A 1 9  ? -11.623 -0.410  3.037   1.00 0.00 ? 9  SER A HA   6  
ATOM 4049  H HB2  . SER A 1 9  ? -12.953 1.445   1.036   1.00 0.00 ? 9  SER A HB2  6  
ATOM 4050  H HB3  . SER A 1 9  ? -13.203 -0.293  1.162   1.00 0.00 ? 9  SER A HB3  6  
ATOM 4051  H HG   . SER A 1 9  ? -13.594 1.402   3.381   1.00 0.00 ? 9  SER A HG   6  
ATOM 4052  N N    . ILE A 1 10 ? -10.856 0.107   0.096   1.00 0.00 ? 10 ILE A N    6  
ATOM 4053  C CA   . ILE A 1 10 ? -9.804  -0.035  -0.952  1.00 0.00 ? 10 ILE A CA   6  
ATOM 4054  C C    . ILE A 1 10 ? -9.793  1.240   -1.797  1.00 0.00 ? 10 ILE A C    6  
ATOM 4055  O O    . ILE A 1 10 ? -10.738 1.542   -2.497  1.00 0.00 ? 10 ILE A O    6  
ATOM 4056  C CB   . ILE A 1 10 ? -10.101 -1.274  -1.831  1.00 0.00 ? 10 ILE A CB   6  
ATOM 4057  C CG1  . ILE A 1 10 ? -9.733  -1.012  -3.303  1.00 0.00 ? 10 ILE A CG1  6  
ATOM 4058  C CG2  . ILE A 1 10 ? -11.590 -1.621  -1.753  1.00 0.00 ? 10 ILE A CG2  6  
ATOM 4059  C CD1  . ILE A 1 10 ? -8.228  -0.756  -3.434  1.00 0.00 ? 10 ILE A CD1  6  
ATOM 4060  H H    . ILE A 1 10 ? -11.801 0.060   -0.152  1.00 0.00 ? 10 ILE A H    6  
ATOM 4061  H HA   . ILE A 1 10 ? -8.842  -0.155  -0.476  1.00 0.00 ? 10 ILE A HA   6  
ATOM 4062  H HB   . ILE A 1 10 ? -9.526  -2.112  -1.463  1.00 0.00 ? 10 ILE A HB   6  
ATOM 4063  H HG12 . ILE A 1 10 ? -10.003 -1.873  -3.898  1.00 0.00 ? 10 ILE A HG12 6  
ATOM 4064  H HG13 . ILE A 1 10 ? -10.274 -0.148  -3.659  1.00 0.00 ? 10 ILE A HG13 6  
ATOM 4065  H HG21 . ILE A 1 10 ? -12.176 -0.755  -2.024  1.00 0.00 ? 10 ILE A HG21 6  
ATOM 4066  H HG22 . ILE A 1 10 ? -11.838 -1.922  -0.745  1.00 0.00 ? 10 ILE A HG22 6  
ATOM 4067  H HG23 . ILE A 1 10 ? -11.808 -2.431  -2.434  1.00 0.00 ? 10 ILE A HG23 6  
ATOM 4068  H HD11 . ILE A 1 10 ? -7.961  0.125   -2.871  1.00 0.00 ? 10 ILE A HD11 6  
ATOM 4069  H HD12 . ILE A 1 10 ? -7.980  -0.606  -4.476  1.00 0.00 ? 10 ILE A HD12 6  
ATOM 4070  H HD13 . ILE A 1 10 ? -7.682  -1.607  -3.055  1.00 0.00 ? 10 ILE A HD13 6  
ATOM 4071  N N    . CYS A 1 11 ? -8.727  1.988   -1.739  1.00 0.00 ? 11 CYS A N    6  
ATOM 4072  C CA   . CYS A 1 11 ? -8.661  3.236   -2.542  1.00 0.00 ? 11 CYS A CA   6  
ATOM 4073  C C    . CYS A 1 11 ? -7.803  2.987   -3.779  1.00 0.00 ? 11 CYS A C    6  
ATOM 4074  O O    . CYS A 1 11 ? -6.644  2.642   -3.673  1.00 0.00 ? 11 CYS A O    6  
ATOM 4075  C CB   . CYS A 1 11 ? -8.036  4.351   -1.702  1.00 0.00 ? 11 CYS A CB   6  
ATOM 4076  S SG   . CYS A 1 11 ? -6.395  3.832   -1.141  1.00 0.00 ? 11 CYS A SG   6  
ATOM 4077  H H    . CYS A 1 11 ? -7.973  1.728   -1.170  1.00 0.00 ? 11 CYS A H    6  
ATOM 4078  H HA   . CYS A 1 11 ? -9.657  3.526   -2.844  1.00 0.00 ? 11 CYS A HA   6  
ATOM 4079  H HB2  . CYS A 1 11 ? -7.946  5.246   -2.300  1.00 0.00 ? 11 CYS A HB2  6  
ATOM 4080  H HB3  . CYS A 1 11 ? -8.662  4.551   -0.845  1.00 0.00 ? 11 CYS A HB3  6  
ATOM 4081  N N    . SER A 1 12 ? -8.378  3.176   -4.941  1.00 0.00 ? 12 SER A N    6  
ATOM 4082  C CA   . SER A 1 12 ? -7.651  2.974   -6.226  1.00 0.00 ? 12 SER A CA   6  
ATOM 4083  C C    . SER A 1 12 ? -6.435  2.064   -6.048  1.00 0.00 ? 12 SER A C    6  
ATOM 4084  O O    . SER A 1 12 ? -5.312  2.524   -6.031  1.00 0.00 ? 12 SER A O    6  
ATOM 4085  C CB   . SER A 1 12 ? -7.190  4.330   -6.759  1.00 0.00 ? 12 SER A CB   6  
ATOM 4086  O OG   . SER A 1 12 ? -8.266  4.952   -7.449  1.00 0.00 ? 12 SER A OG   6  
ATOM 4087  H H    . SER A 1 12 ? -9.308  3.462   -4.969  1.00 0.00 ? 12 SER A H    6  
ATOM 4088  H HA   . SER A 1 12 ? -8.322  2.527   -6.943  1.00 0.00 ? 12 SER A HA   6  
ATOM 4089  H HB2  . SER A 1 12 ? -6.886  4.957   -5.937  1.00 0.00 ? 12 SER A HB2  6  
ATOM 4090  H HB3  . SER A 1 12 ? -6.353  4.186   -7.429  1.00 0.00 ? 12 SER A HB3  6  
ATOM 4091  H HG   . SER A 1 12 ? -7.957  5.190   -8.326  1.00 0.00 ? 12 SER A HG   6  
ATOM 4092  N N    . LEU A 1 13 ? -6.630  0.775   -5.944  1.00 0.00 ? 13 LEU A N    6  
ATOM 4093  C CA   . LEU A 1 13 ? -5.448  -0.115  -5.811  1.00 0.00 ? 13 LEU A CA   6  
ATOM 4094  C C    . LEU A 1 13 ? -4.549  0.216   -6.983  1.00 0.00 ? 13 LEU A C    6  
ATOM 4095  O O    . LEU A 1 13 ? -3.340  0.192   -6.888  1.00 0.00 ? 13 LEU A O    6  
ATOM 4096  C CB   . LEU A 1 13 ? -5.876  -1.587  -5.865  1.00 0.00 ? 13 LEU A CB   6  
ATOM 4097  C CG   . LEU A 1 13 ? -6.364  -1.942  -7.274  1.00 0.00 ? 13 LEU A CG   6  
ATOM 4098  C CD1  . LEU A 1 13 ? -6.421  -3.463  -7.425  1.00 0.00 ? 13 LEU A CD1  6  
ATOM 4099  C CD2  . LEU A 1 13 ? -7.762  -1.360  -7.492  1.00 0.00 ? 13 LEU A CD2  6  
ATOM 4100  H H    . LEU A 1 13 ? -7.533  0.403   -5.979  1.00 0.00 ? 13 LEU A H    6  
ATOM 4101  H HA   . LEU A 1 13 ? -4.923  0.090   -4.888  1.00 0.00 ? 13 LEU A HA   6  
ATOM 4102  H HB2  . LEU A 1 13 ? -5.034  -2.214  -5.610  1.00 0.00 ? 13 LEU A HB2  6  
ATOM 4103  H HB3  . LEU A 1 13 ? -6.675  -1.755  -5.159  1.00 0.00 ? 13 LEU A HB3  6  
ATOM 4104  H HG   . LEU A 1 13 ? -5.683  -1.536  -8.007  1.00 0.00 ? 13 LEU A HG   6  
ATOM 4105  H HD11 . LEU A 1 13 ? -7.402  -3.817  -7.144  1.00 0.00 ? 13 LEU A HD11 6  
ATOM 4106  H HD12 . LEU A 1 13 ? -5.678  -3.916  -6.786  1.00 0.00 ? 13 LEU A HD12 6  
ATOM 4107  H HD13 . LEU A 1 13 ? -6.223  -3.730  -8.453  1.00 0.00 ? 13 LEU A HD13 6  
ATOM 4108  H HD21 . LEU A 1 13 ? -8.254  -1.237  -6.538  1.00 0.00 ? 13 LEU A HD21 6  
ATOM 4109  H HD22 . LEU A 1 13 ? -8.339  -2.031  -8.111  1.00 0.00 ? 13 LEU A HD22 6  
ATOM 4110  H HD23 . LEU A 1 13 ? -7.681  -0.400  -7.981  1.00 0.00 ? 13 LEU A HD23 6  
ATOM 4111  N N    . TYR A 1 14 ? -5.150  0.587   -8.077  1.00 0.00 ? 14 TYR A N    6  
ATOM 4112  C CA   . TYR A 1 14 ? -4.352  0.988   -9.259  1.00 0.00 ? 14 TYR A CA   6  
ATOM 4113  C C    . TYR A 1 14 ? -3.497  2.174   -8.837  1.00 0.00 ? 14 TYR A C    6  
ATOM 4114  O O    . TYR A 1 14 ? -2.348  2.295   -9.214  1.00 0.00 ? 14 TYR A O    6  
ATOM 4115  C CB   . TYR A 1 14 ? -5.286  1.391   -10.403 1.00 0.00 ? 14 TYR A CB   6  
ATOM 4116  C CG   . TYR A 1 14 ? -6.289  0.287   -10.640 1.00 0.00 ? 14 TYR A CG   6  
ATOM 4117  C CD1  . TYR A 1 14 ? -5.933  -1.045  -10.396 1.00 0.00 ? 14 TYR A CD1  6  
ATOM 4118  C CD2  . TYR A 1 14 ? -7.574  0.595   -11.101 1.00 0.00 ? 14 TYR A CD2  6  
ATOM 4119  C CE1  . TYR A 1 14 ? -6.862  -2.069  -10.614 1.00 0.00 ? 14 TYR A CE1  6  
ATOM 4120  C CE2  . TYR A 1 14 ? -8.503  -0.430  -11.319 1.00 0.00 ? 14 TYR A CE2  6  
ATOM 4121  C CZ   . TYR A 1 14 ? -8.147  -1.762  -11.075 1.00 0.00 ? 14 TYR A CZ   6  
ATOM 4122  O OH   . TYR A 1 14 ? -9.063  -2.771  -11.289 1.00 0.00 ? 14 TYR A OH   6  
ATOM 4123  H H    . TYR A 1 14 ? -6.130  0.637   -8.100  1.00 0.00 ? 14 TYR A H    6  
ATOM 4124  H HA   . TYR A 1 14 ? -3.717  0.173   -9.568  1.00 0.00 ? 14 TYR A HA   6  
ATOM 4125  H HB2  . TYR A 1 14 ? -5.806  2.301   -10.141 1.00 0.00 ? 14 TYR A HB2  6  
ATOM 4126  H HB3  . TYR A 1 14 ? -4.709  1.551   -11.301 1.00 0.00 ? 14 TYR A HB3  6  
ATOM 4127  H HD1  . TYR A 1 14 ? -4.941  -1.282  -10.040 1.00 0.00 ? 14 TYR A HD1  6  
ATOM 4128  H HD2  . TYR A 1 14 ? -7.849  1.622   -11.289 1.00 0.00 ? 14 TYR A HD2  6  
ATOM 4129  H HE1  . TYR A 1 14 ? -6.587  -3.097  -10.426 1.00 0.00 ? 14 TYR A HE1  6  
ATOM 4130  H HE2  . TYR A 1 14 ? -9.495  -0.193  -11.675 1.00 0.00 ? 14 TYR A HE2  6  
ATOM 4131  H HH   . TYR A 1 14 ? -9.565  -2.554  -12.078 1.00 0.00 ? 14 TYR A HH   6  
ATOM 4132  N N    . GLN A 1 15 ? -4.039  3.033   -8.012  1.00 0.00 ? 15 GLN A N    6  
ATOM 4133  C CA   . GLN A 1 15 ? -3.240  4.183   -7.522  1.00 0.00 ? 15 GLN A CA   6  
ATOM 4134  C C    . GLN A 1 15 ? -2.164  3.621   -6.597  1.00 0.00 ? 15 GLN A C    6  
ATOM 4135  O O    . GLN A 1 15 ? -1.039  4.080   -6.573  1.00 0.00 ? 15 GLN A O    6  
ATOM 4136  C CB   . GLN A 1 15 ? -4.136  5.150   -6.745  1.00 0.00 ? 15 GLN A CB   6  
ATOM 4137  C CG   . GLN A 1 15 ? -4.742  6.173   -7.709  1.00 0.00 ? 15 GLN A CG   6  
ATOM 4138  C CD   . GLN A 1 15 ? -4.753  7.552   -7.048  1.00 0.00 ? 15 GLN A CD   6  
ATOM 4139  O OE1  . GLN A 1 15 ? -5.598  7.836   -6.223  1.00 0.00 ? 15 GLN A OE1  6  
ATOM 4140  N NE2  . GLN A 1 15 ? -3.842  8.427   -7.377  1.00 0.00 ? 15 GLN A NE2  6  
ATOM 4141  H H    . GLN A 1 15 ? -4.962  2.898   -7.690  1.00 0.00 ? 15 GLN A H    6  
ATOM 4142  H HA   . GLN A 1 15 ? -2.778  4.693   -8.356  1.00 0.00 ? 15 GLN A HA   6  
ATOM 4143  H HB2  . GLN A 1 15 ? -4.927  4.596   -6.261  1.00 0.00 ? 15 GLN A HB2  6  
ATOM 4144  H HB3  . GLN A 1 15 ? -3.550  5.665   -6.000  1.00 0.00 ? 15 GLN A HB3  6  
ATOM 4145  H HG2  . GLN A 1 15 ? -4.151  6.210   -8.613  1.00 0.00 ? 15 GLN A HG2  6  
ATOM 4146  H HG3  . GLN A 1 15 ? -5.754  5.884   -7.952  1.00 0.00 ? 15 GLN A HG3  6  
ATOM 4147  H HE21 . GLN A 1 15 ? -3.160  8.198   -8.042  1.00 0.00 ? 15 GLN A HE21 6  
ATOM 4148  H HE22 . GLN A 1 15 ? -3.840  9.313   -6.958  1.00 0.00 ? 15 GLN A HE22 6  
ATOM 4149  N N    . LEU A 1 16 ? -2.505  2.600   -5.852  1.00 0.00 ? 16 LEU A N    6  
ATOM 4150  C CA   . LEU A 1 16 ? -1.511  1.968   -4.946  1.00 0.00 ? 16 LEU A CA   6  
ATOM 4151  C C    . LEU A 1 16 ? -0.484  1.236   -5.807  1.00 0.00 ? 16 LEU A C    6  
ATOM 4152  O O    . LEU A 1 16 ? 0.708   1.404   -5.648  1.00 0.00 ? 16 LEU A O    6  
ATOM 4153  C CB   . LEU A 1 16 ? -2.215  0.971   -4.022  1.00 0.00 ? 16 LEU A CB   6  
ATOM 4154  C CG   . LEU A 1 16 ? -3.250  1.705   -3.168  1.00 0.00 ? 16 LEU A CG   6  
ATOM 4155  C CD1  . LEU A 1 16 ? -3.911  0.718   -2.204  1.00 0.00 ? 16 LEU A CD1  6  
ATOM 4156  C CD2  . LEU A 1 16 ? -2.557  2.811   -2.367  1.00 0.00 ? 16 LEU A CD2  6  
ATOM 4157  H H    . LEU A 1 16 ? -3.414  2.238   -5.908  1.00 0.00 ? 16 LEU A H    6  
ATOM 4158  H HA   . LEU A 1 16 ? -1.018  2.729   -4.357  1.00 0.00 ? 16 LEU A HA   6  
ATOM 4159  H HB2  . LEU A 1 16 ? -2.708  0.216   -4.617  1.00 0.00 ? 16 LEU A HB2  6  
ATOM 4160  H HB3  . LEU A 1 16 ? -1.487  0.502   -3.377  1.00 0.00 ? 16 LEU A HB3  6  
ATOM 4161  H HG   . LEU A 1 16 ? -4.002  2.140   -3.810  1.00 0.00 ? 16 LEU A HG   6  
ATOM 4162  H HD11 . LEU A 1 16 ? -4.445  1.264   -1.440  1.00 0.00 ? 16 LEU A HD11 6  
ATOM 4163  H HD12 . LEU A 1 16 ? -3.153  0.103   -1.743  1.00 0.00 ? 16 LEU A HD12 6  
ATOM 4164  H HD13 . LEU A 1 16 ? -4.602  0.091   -2.748  1.00 0.00 ? 16 LEU A HD13 6  
ATOM 4165  H HD21 . LEU A 1 16 ? -1.713  2.396   -1.836  1.00 0.00 ? 16 LEU A HD21 6  
ATOM 4166  H HD22 . LEU A 1 16 ? -3.255  3.233   -1.659  1.00 0.00 ? 16 LEU A HD22 6  
ATOM 4167  H HD23 . LEU A 1 16 ? -2.215  3.582   -3.041  1.00 0.00 ? 16 LEU A HD23 6  
ATOM 4168  N N    . GLU A 1 17 ? -0.941  0.438   -6.739  1.00 0.00 ? 17 GLU A N    6  
ATOM 4169  C CA   . GLU A 1 17 ? 0.017   -0.281  -7.625  1.00 0.00 ? 17 GLU A CA   6  
ATOM 4170  C C    . GLU A 1 17 ? 0.811   0.761   -8.410  1.00 0.00 ? 17 GLU A C    6  
ATOM 4171  O O    . GLU A 1 17 ? 1.995   0.616   -8.641  1.00 0.00 ? 17 GLU A O    6  
ATOM 4172  C CB   . GLU A 1 17 ? -0.733  -1.183  -8.616  1.00 0.00 ? 17 GLU A CB   6  
ATOM 4173  C CG   . GLU A 1 17 ? -2.017  -1.719  -7.982  1.00 0.00 ? 17 GLU A CG   6  
ATOM 4174  C CD   . GLU A 1 17 ? -2.192  -3.194  -8.352  1.00 0.00 ? 17 GLU A CD   6  
ATOM 4175  O OE1  . GLU A 1 17 ? -1.466  -3.658  -9.216  1.00 0.00 ? 17 GLU A OE1  6  
ATOM 4176  O OE2  . GLU A 1 17 ? -3.048  -3.834  -7.764  1.00 0.00 ? 17 GLU A OE2  6  
ATOM 4177  H H    . GLU A 1 17 ? -1.908  0.326   -6.860  1.00 0.00 ? 17 GLU A H    6  
ATOM 4178  H HA   . GLU A 1 17 ? 0.687   -0.874  -7.025  1.00 0.00 ? 17 GLU A HA   6  
ATOM 4179  H HB2  . GLU A 1 17 ? -0.981  -0.613  -9.499  1.00 0.00 ? 17 GLU A HB2  6  
ATOM 4180  H HB3  . GLU A 1 17 ? -0.099  -2.012  -8.892  1.00 0.00 ? 17 GLU A HB3  6  
ATOM 4181  H HG2  . GLU A 1 17 ? -1.960  -1.618  -6.908  1.00 0.00 ? 17 GLU A HG2  6  
ATOM 4182  H HG3  . GLU A 1 17 ? -2.859  -1.159  -8.355  1.00 0.00 ? 17 GLU A HG3  6  
ATOM 4183  N N    . ASN A 1 18 ? 0.159   1.816   -8.816  1.00 0.00 ? 18 ASN A N    6  
ATOM 4184  C CA   . ASN A 1 18 ? 0.857   2.884   -9.584  1.00 0.00 ? 18 ASN A CA   6  
ATOM 4185  C C    . ASN A 1 18 ? 1.719   3.716   -8.632  1.00 0.00 ? 18 ASN A C    6  
ATOM 4186  O O    . ASN A 1 18 ? 2.640   4.392   -9.046  1.00 0.00 ? 18 ASN A O    6  
ATOM 4187  C CB   . ASN A 1 18 ? -0.177  3.788   -10.256 1.00 0.00 ? 18 ASN A CB   6  
ATOM 4188  C CG   . ASN A 1 18 ? -0.903  3.008   -11.354 1.00 0.00 ? 18 ASN A CG   6  
ATOM 4189  O OD1  . ASN A 1 18 ? -0.409  2.005   -11.829 1.00 0.00 ? 18 ASN A OD1  6  
ATOM 4190  N ND2  . ASN A 1 18 ? -2.063  3.428   -11.779 1.00 0.00 ? 18 ASN A ND2  6  
ATOM 4191  H H    . ASN A 1 18 ? -0.796  1.906   -8.613  1.00 0.00 ? 18 ASN A H    6  
ATOM 4192  H HA   . ASN A 1 18 ? 1.486   2.433   -10.338 1.00 0.00 ? 18 ASN A HA   6  
ATOM 4193  H HB2  . ASN A 1 18 ? -0.893  4.126   -9.520  1.00 0.00 ? 18 ASN A HB2  6  
ATOM 4194  H HB3  . ASN A 1 18 ? 0.320   4.641   -10.693 1.00 0.00 ? 18 ASN A HB3  6  
ATOM 4195  H HD21 . ASN A 1 18 ? -2.461  4.237   -11.395 1.00 0.00 ? 18 ASN A HD21 6  
ATOM 4196  H HD22 . ASN A 1 18 ? -2.535  2.936   -12.482 1.00 0.00 ? 18 ASN A HD22 6  
ATOM 4197  N N    . TYR A 1 19 ? 1.433   3.672   -7.357  1.00 0.00 ? 19 TYR A N    6  
ATOM 4198  C CA   . TYR A 1 19 ? 2.243   4.460   -6.390  1.00 0.00 ? 19 TYR A CA   6  
ATOM 4199  C C    . TYR A 1 19 ? 3.716   4.182   -6.662  1.00 0.00 ? 19 TYR A C    6  
ATOM 4200  O O    . TYR A 1 19 ? 4.495   5.081   -6.907  1.00 0.00 ? 19 TYR A O    6  
ATOM 4201  C CB   . TYR A 1 19 ? 1.895   4.032   -4.961  1.00 0.00 ? 19 TYR A CB   6  
ATOM 4202  C CG   . TYR A 1 19 ? 2.715   4.832   -3.978  1.00 0.00 ? 19 TYR A CG   6  
ATOM 4203  C CD1  . TYR A 1 19 ? 2.533   6.216   -3.880  1.00 0.00 ? 19 TYR A CD1  6  
ATOM 4204  C CD2  . TYR A 1 19 ? 3.657   4.191   -3.164  1.00 0.00 ? 19 TYR A CD2  6  
ATOM 4205  C CE1  . TYR A 1 19 ? 3.290   6.960   -2.968  1.00 0.00 ? 19 TYR A CE1  6  
ATOM 4206  C CE2  . TYR A 1 19 ? 4.415   4.935   -2.252  1.00 0.00 ? 19 TYR A CE2  6  
ATOM 4207  C CZ   . TYR A 1 19 ? 4.232   6.319   -2.154  1.00 0.00 ? 19 TYR A CZ   6  
ATOM 4208  O OH   . TYR A 1 19 ? 4.980   7.053   -1.255  1.00 0.00 ? 19 TYR A OH   6  
ATOM 4209  H H    . TYR A 1 19 ? 0.696   3.117   -7.037  1.00 0.00 ? 19 TYR A H    6  
ATOM 4210  H HA   . TYR A 1 19 ? 2.041   5.513   -6.517  1.00 0.00 ? 19 TYR A HA   6  
ATOM 4211  H HB2  . TYR A 1 19 ? 0.844   4.208   -4.778  1.00 0.00 ? 19 TYR A HB2  6  
ATOM 4212  H HB3  . TYR A 1 19 ? 2.111   2.982   -4.836  1.00 0.00 ? 19 TYR A HB3  6  
ATOM 4213  H HD1  . TYR A 1 19 ? 1.807   6.710   -4.507  1.00 0.00 ? 19 TYR A HD1  6  
ATOM 4214  H HD2  . TYR A 1 19 ? 3.799   3.122   -3.239  1.00 0.00 ? 19 TYR A HD2  6  
ATOM 4215  H HE1  . TYR A 1 19 ? 3.148   8.028   -2.892  1.00 0.00 ? 19 TYR A HE1  6  
ATOM 4216  H HE2  . TYR A 1 19 ? 5.141   4.441   -1.624  1.00 0.00 ? 19 TYR A HE2  6  
ATOM 4217  H HH   . TYR A 1 19 ? 5.146   6.501   -0.487  1.00 0.00 ? 19 TYR A HH   6  
ATOM 4218  N N    . CYS A 1 20 ? 4.086   2.933   -6.637  1.00 0.00 ? 20 CYS A N    6  
ATOM 4219  C CA   . CYS A 1 20 ? 5.504   2.554   -6.906  1.00 0.00 ? 20 CYS A CA   6  
ATOM 4220  C C    . CYS A 1 20 ? 6.452   3.580   -6.282  1.00 0.00 ? 20 CYS A C    6  
ATOM 4221  O O    . CYS A 1 20 ? 6.081   4.326   -5.397  1.00 0.00 ? 20 CYS A O    6  
ATOM 4222  C CB   . CYS A 1 20 ? 5.724   2.487   -8.417  1.00 0.00 ? 20 CYS A CB   6  
ATOM 4223  S SG   . CYS A 1 20 ? 4.628   1.226   -9.115  1.00 0.00 ? 20 CYS A SG   6  
ATOM 4224  H H    . CYS A 1 20 ? 3.419   2.236   -6.452  1.00 0.00 ? 20 CYS A H    6  
ATOM 4225  H HA   . CYS A 1 20 ? 5.702   1.586   -6.480  1.00 0.00 ? 20 CYS A HA   6  
ATOM 4226  H HB2  . CYS A 1 20 ? 5.499   3.447   -8.858  1.00 0.00 ? 20 CYS A HB2  6  
ATOM 4227  H HB3  . CYS A 1 20 ? 6.751   2.225   -8.622  1.00 0.00 ? 20 CYS A HB3  6  
ATOM 4228  N N    . ASN A 1 21 ? 7.675   3.621   -6.729  1.00 0.00 ? 21 ASN A N    6  
ATOM 4229  C CA   . ASN A 1 21 ? 8.645   4.597   -6.157  1.00 0.00 ? 21 ASN A CA   6  
ATOM 4230  C C    . ASN A 1 21 ? 10.030  4.356   -6.762  1.00 0.00 ? 21 ASN A C    6  
ATOM 4231  O O    . ASN A 1 21 ? 10.691  3.428   -6.327  1.00 0.00 ? 21 ASN A O    6  
ATOM 4232  C CB   . ASN A 1 21 ? 8.714   4.416   -4.639  1.00 0.00 ? 21 ASN A CB   6  
ATOM 4233  C CG   . ASN A 1 21 ? 9.830   5.293   -4.070  1.00 0.00 ? 21 ASN A CG   6  
ATOM 4234  O OD1  . ASN A 1 21 ? 10.519  5.973   -4.805  1.00 0.00 ? 21 ASN A OD1  6  
ATOM 4235  N ND2  . ASN A 1 21 ? 10.040  5.307   -2.782  1.00 0.00 ? 21 ASN A ND2  6  
ATOM 4236  O OXT  . ASN A 1 21 ? 10.405  5.105   -7.648  1.00 0.00 ? 21 ASN A OXT  6  
ATOM 4237  H H    . ASN A 1 21 ? 7.957   3.007   -7.439  1.00 0.00 ? 21 ASN A H    6  
ATOM 4238  H HA   . ASN A 1 21 ? 8.322   5.601   -6.385  1.00 0.00 ? 21 ASN A HA   6  
ATOM 4239  H HB2  . ASN A 1 21 ? 7.769   4.703   -4.200  1.00 0.00 ? 21 ASN A HB2  6  
ATOM 4240  H HB3  . ASN A 1 21 ? 8.919   3.381   -4.408  1.00 0.00 ? 21 ASN A HB3  6  
ATOM 4241  H HD21 . ASN A 1 21 ? 9.484   4.758   -2.190  1.00 0.00 ? 21 ASN A HD21 6  
ATOM 4242  H HD22 . ASN A 1 21 ? 10.752  5.866   -2.408  1.00 0.00 ? 21 ASN A HD22 6  
ATOM 4243  N N    . PHE B 2 1  ? -15.968 -8.908  -6.901  1.00 0.00 ? 1  PHE B N    6  
ATOM 4244  C CA   . PHE B 2 1  ? -16.173 -7.470  -7.232  1.00 0.00 ? 1  PHE B CA   6  
ATOM 4245  C C    . PHE B 2 1  ? -15.736 -6.607  -6.046  1.00 0.00 ? 1  PHE B C    6  
ATOM 4246  O O    . PHE B 2 1  ? -16.185 -6.791  -4.933  1.00 0.00 ? 1  PHE B O    6  
ATOM 4247  C CB   . PHE B 2 1  ? -17.653 -7.220  -7.527  1.00 0.00 ? 1  PHE B CB   6  
ATOM 4248  C CG   . PHE B 2 1  ? -18.084 -8.066  -8.701  1.00 0.00 ? 1  PHE B CG   6  
ATOM 4249  C CD1  . PHE B 2 1  ? -17.364 -8.017  -9.901  1.00 0.00 ? 1  PHE B CD1  6  
ATOM 4250  C CD2  . PHE B 2 1  ? -19.202 -8.901  -8.589  1.00 0.00 ? 1  PHE B CD2  6  
ATOM 4251  C CE1  . PHE B 2 1  ? -17.763 -8.802  -10.989 1.00 0.00 ? 1  PHE B CE1  6  
ATOM 4252  C CE2  . PHE B 2 1  ? -19.602 -9.685  -9.678  1.00 0.00 ? 1  PHE B CE2  6  
ATOM 4253  C CZ   . PHE B 2 1  ? -18.882 -9.636  -10.878 1.00 0.00 ? 1  PHE B CZ   6  
ATOM 4254  H H1   . PHE B 2 1  ? -15.289 -8.991  -6.119  1.00 0.00 ? 1  PHE B H1   6  
ATOM 4255  H H2   . PHE B 2 1  ? -15.598 -9.406  -7.737  1.00 0.00 ? 1  PHE B H2   6  
ATOM 4256  H H3   . PHE B 2 1  ? -16.874 -9.331  -6.617  1.00 0.00 ? 1  PHE B H3   6  
ATOM 4257  H HA   . PHE B 2 1  ? -15.584 -7.213  -8.100  1.00 0.00 ? 1  PHE B HA   6  
ATOM 4258  H HB2  . PHE B 2 1  ? -18.242 -7.481  -6.659  1.00 0.00 ? 1  PHE B HB2  6  
ATOM 4259  H HB3  . PHE B 2 1  ? -17.803 -6.177  -7.762  1.00 0.00 ? 1  PHE B HB3  6  
ATOM 4260  H HD1  . PHE B 2 1  ? -16.501 -7.374  -9.986  1.00 0.00 ? 1  PHE B HD1  6  
ATOM 4261  H HD2  . PHE B 2 1  ? -19.758 -8.939  -7.664  1.00 0.00 ? 1  PHE B HD2  6  
ATOM 4262  H HE1  . PHE B 2 1  ? -17.208 -8.764  -11.915 1.00 0.00 ? 1  PHE B HE1  6  
ATOM 4263  H HE2  . PHE B 2 1  ? -20.465 -10.329 -9.592  1.00 0.00 ? 1  PHE B HE2  6  
ATOM 4264  H HZ   . PHE B 2 1  ? -19.190 -10.241 -11.717 1.00 0.00 ? 1  PHE B HZ   6  
ATOM 4265  N N    . VAL B 2 2  ? -14.862 -5.665  -6.276  1.00 0.00 ? 2  VAL B N    6  
ATOM 4266  C CA   . VAL B 2 2  ? -14.397 -4.792  -5.161  1.00 0.00 ? 2  VAL B CA   6  
ATOM 4267  C C    . VAL B 2 2  ? -13.722 -5.651  -4.089  1.00 0.00 ? 2  VAL B C    6  
ATOM 4268  O O    . VAL B 2 2  ? -14.372 -6.362  -3.350  1.00 0.00 ? 2  VAL B O    6  
ATOM 4269  C CB   . VAL B 2 2  ? -15.596 -4.062  -4.552  1.00 0.00 ? 2  VAL B CB   6  
ATOM 4270  C CG1  . VAL B 2 2  ? -15.101 -2.937  -3.642  1.00 0.00 ? 2  VAL B CG1  6  
ATOM 4271  C CG2  . VAL B 2 2  ? -16.454 -3.470  -5.673  1.00 0.00 ? 2  VAL B CG2  6  
ATOM 4272  H H    . VAL B 2 2  ? -14.511 -5.532  -7.181  1.00 0.00 ? 2  VAL B H    6  
ATOM 4273  H HA   . VAL B 2 2  ? -13.691 -4.069  -5.541  1.00 0.00 ? 2  VAL B HA   6  
ATOM 4274  H HB   . VAL B 2 2  ? -16.186 -4.759  -3.974  1.00 0.00 ? 2  VAL B HB   6  
ATOM 4275  H HG11 . VAL B 2 2  ? -14.311 -2.394  -4.139  1.00 0.00 ? 2  VAL B HG11 6  
ATOM 4276  H HG12 . VAL B 2 2  ? -14.725 -3.358  -2.721  1.00 0.00 ? 2  VAL B HG12 6  
ATOM 4277  H HG13 . VAL B 2 2  ? -15.918 -2.265  -3.424  1.00 0.00 ? 2  VAL B HG13 6  
ATOM 4278  H HG21 . VAL B 2 2  ? -17.026 -2.640  -5.287  1.00 0.00 ? 2  VAL B HG21 6  
ATOM 4279  H HG22 . VAL B 2 2  ? -17.126 -4.226  -6.050  1.00 0.00 ? 2  VAL B HG22 6  
ATOM 4280  H HG23 . VAL B 2 2  ? -15.814 -3.126  -6.472  1.00 0.00 ? 2  VAL B HG23 6  
ATOM 4281  N N    . ASN B 2 3  ? -12.421 -5.591  -4.001  1.00 0.00 ? 3  ASN B N    6  
ATOM 4282  C CA   . ASN B 2 3  ? -11.704 -6.404  -2.979  1.00 0.00 ? 3  ASN B CA   6  
ATOM 4283  C C    . ASN B 2 3  ? -11.907 -5.783  -1.595  1.00 0.00 ? 3  ASN B C    6  
ATOM 4284  O O    . ASN B 2 3  ? -12.738 -4.917  -1.409  1.00 0.00 ? 3  ASN B O    6  
ATOM 4285  C CB   . ASN B 2 3  ? -10.210 -6.433  -3.310  1.00 0.00 ? 3  ASN B CB   6  
ATOM 4286  C CG   . ASN B 2 3  ? -9.705  -5.003  -3.514  1.00 0.00 ? 3  ASN B CG   6  
ATOM 4287  O OD1  . ASN B 2 3  ? -10.440 -4.145  -3.962  1.00 0.00 ? 3  ASN B OD1  6  
ATOM 4288  N ND2  . ASN B 2 3  ? -8.473  -4.708  -3.203  1.00 0.00 ? 3  ASN B ND2  6  
ATOM 4289  H H    . ASN B 2 3  ? -11.916 -5.011  -4.609  1.00 0.00 ? 3  ASN B H    6  
ATOM 4290  H HA   . ASN B 2 3  ? -12.093 -7.411  -2.982  1.00 0.00 ? 3  ASN B HA   6  
ATOM 4291  H HB2  . ASN B 2 3  ? -9.670  -6.894  -2.496  1.00 0.00 ? 3  ASN B HB2  6  
ATOM 4292  H HB3  . ASN B 2 3  ? -10.053 -7.001  -4.214  1.00 0.00 ? 3  ASN B HB3  6  
ATOM 4293  H HD21 . ASN B 2 3  ? -7.880  -5.400  -2.842  1.00 0.00 ? 3  ASN B HD21 6  
ATOM 4294  H HD22 . ASN B 2 3  ? -8.140  -3.795  -3.331  1.00 0.00 ? 3  ASN B HD22 6  
ATOM 4295  N N    . GLN B 2 4  ? -11.152 -6.219  -0.623  1.00 0.00 ? 4  GLN B N    6  
ATOM 4296  C CA   . GLN B 2 4  ? -11.302 -5.654  0.748   1.00 0.00 ? 4  GLN B CA   6  
ATOM 4297  C C    . GLN B 2 4  ? -10.126 -6.104  1.618   1.00 0.00 ? 4  GLN B C    6  
ATOM 4298  O O    . GLN B 2 4  ? -10.300 -6.801  2.597   1.00 0.00 ? 4  GLN B O    6  
ATOM 4299  C CB   . GLN B 2 4  ? -12.611 -6.151  1.364   1.00 0.00 ? 4  GLN B CB   6  
ATOM 4300  C CG   . GLN B 2 4  ? -13.057 -5.185  2.463   1.00 0.00 ? 4  GLN B CG   6  
ATOM 4301  C CD   . GLN B 2 4  ? -14.581 -5.056  2.443   1.00 0.00 ? 4  GLN B CD   6  
ATOM 4302  O OE1  . GLN B 2 4  ? -15.120 -4.182  1.794   1.00 0.00 ? 4  GLN B OE1  6  
ATOM 4303  N NE2  . GLN B 2 4  ? -15.304 -5.897  3.131   1.00 0.00 ? 4  GLN B NE2  6  
ATOM 4304  H H    . GLN B 2 4  ? -10.487 -6.918  -0.795  1.00 0.00 ? 4  GLN B H    6  
ATOM 4305  H HA   . GLN B 2 4  ? -11.317 -4.575  0.693   1.00 0.00 ? 4  GLN B HA   6  
ATOM 4306  H HB2  . GLN B 2 4  ? -13.372 -6.204  0.599   1.00 0.00 ? 4  GLN B HB2  6  
ATOM 4307  H HB3  . GLN B 2 4  ? -12.459 -7.131  1.790   1.00 0.00 ? 4  GLN B HB3  6  
ATOM 4308  H HG2  . GLN B 2 4  ? -12.739 -5.562  3.425   1.00 0.00 ? 4  GLN B HG2  6  
ATOM 4309  H HG3  . GLN B 2 4  ? -12.614 -4.215  2.292   1.00 0.00 ? 4  GLN B HG3  6  
ATOM 4310  H HE21 . GLN B 2 4  ? -14.870 -6.603  3.654   1.00 0.00 ? 4  GLN B HE21 6  
ATOM 4311  H HE22 . GLN B 2 4  ? -16.281 -5.823  3.123   1.00 0.00 ? 4  GLN B HE22 6  
ATOM 4312  N N    . HIS B 2 5  ? -8.930  -5.714  1.263   1.00 0.00 ? 5  HIS B N    6  
ATOM 4313  C CA   . HIS B 2 5  ? -7.737  -6.123  2.069   1.00 0.00 ? 5  HIS B CA   6  
ATOM 4314  C C    . HIS B 2 5  ? -8.063  -6.038  3.563   1.00 0.00 ? 5  HIS B C    6  
ATOM 4315  O O    . HIS B 2 5  ? -8.564  -6.976  4.150   1.00 0.00 ? 5  HIS B O    6  
ATOM 4316  C CB   . HIS B 2 5  ? -6.537  -5.211  1.763   1.00 0.00 ? 5  HIS B CB   6  
ATOM 4317  C CG   . HIS B 2 5  ? -6.997  -3.923  1.130   1.00 0.00 ? 5  HIS B CG   6  
ATOM 4318  N ND1  . HIS B 2 5  ? -8.191  -3.311  1.479   1.00 0.00 ? 5  HIS B ND1  6  
ATOM 4319  C CD2  . HIS B 2 5  ? -6.436  -3.128  0.162   1.00 0.00 ? 5  HIS B CD2  6  
ATOM 4320  C CE1  . HIS B 2 5  ? -8.308  -2.198  0.731   1.00 0.00 ? 5  HIS B CE1  6  
ATOM 4321  N NE2  . HIS B 2 5  ? -7.266  -2.039  -0.088  1.00 0.00 ? 5  HIS B NE2  6  
ATOM 4322  H H    . HIS B 2 5  ? -8.817  -5.157  0.464   1.00 0.00 ? 5  HIS B H    6  
ATOM 4323  H HA   . HIS B 2 5  ? -7.478  -7.142  1.822   1.00 0.00 ? 5  HIS B HA   6  
ATOM 4324  H HB2  . HIS B 2 5  ? -6.016  -4.988  2.682   1.00 0.00 ? 5  HIS B HB2  6  
ATOM 4325  H HB3  . HIS B 2 5  ? -5.866  -5.720  1.088   1.00 0.00 ? 5  HIS B HB3  6  
ATOM 4326  H HD1  . HIS B 2 5  ? -8.831  -3.629  2.149   1.00 0.00 ? 5  HIS B HD1  6  
ATOM 4327  H HD2  . HIS B 2 5  ? -5.494  -3.318  -0.330  1.00 0.00 ? 5  HIS B HD2  6  
ATOM 4328  H HE1  . HIS B 2 5  ? -9.147  -1.520  0.782   1.00 0.00 ? 5  HIS B HE1  6  
ATOM 4329  N N    . LEU B 2 6  ? -7.779  -4.924  4.184   1.00 0.00 ? 6  LEU B N    6  
ATOM 4330  C CA   . LEU B 2 6  ? -8.070  -4.790  5.642   1.00 0.00 ? 6  LEU B CA   6  
ATOM 4331  C C    . LEU B 2 6  ? -7.543  -3.448  6.160   1.00 0.00 ? 6  LEU B C    6  
ATOM 4332  O O    . LEU B 2 6  ? -8.045  -2.909  7.127   1.00 0.00 ? 6  LEU B O    6  
ATOM 4333  C CB   . LEU B 2 6  ? -7.385  -5.928  6.404   1.00 0.00 ? 6  LEU B CB   6  
ATOM 4334  C CG   . LEU B 2 6  ? -8.280  -6.381  7.558   1.00 0.00 ? 6  LEU B CG   6  
ATOM 4335  C CD1  . LEU B 2 6  ? -8.612  -7.865  7.394   1.00 0.00 ? 6  LEU B CD1  6  
ATOM 4336  C CD2  . LEU B 2 6  ? -7.545  -6.168  8.884   1.00 0.00 ? 6  LEU B CD2  6  
ATOM 4337  H H    . LEU B 2 6  ? -7.374  -4.181  3.693   1.00 0.00 ? 6  LEU B H    6  
ATOM 4338  H HA   . LEU B 2 6  ? -9.137  -4.844  5.801   1.00 0.00 ? 6  LEU B HA   6  
ATOM 4339  H HB2  . LEU B 2 6  ? -7.212  -6.757  5.734   1.00 0.00 ? 6  LEU B HB2  6  
ATOM 4340  H HB3  . LEU B 2 6  ? -6.442  -5.580  6.797   1.00 0.00 ? 6  LEU B HB3  6  
ATOM 4341  H HG   . LEU B 2 6  ? -9.194  -5.805  7.554   1.00 0.00 ? 6  LEU B HG   6  
ATOM 4342  H HD11 . LEU B 2 6  ? -9.377  -8.143  8.105   1.00 0.00 ? 6  LEU B HD11 6  
ATOM 4343  H HD12 . LEU B 2 6  ? -7.725  -8.455  7.571   1.00 0.00 ? 6  LEU B HD12 6  
ATOM 4344  H HD13 . LEU B 2 6  ? -8.970  -8.045  6.391   1.00 0.00 ? 6  LEU B HD13 6  
ATOM 4345  H HD21 . LEU B 2 6  ? -6.571  -5.742  8.692   1.00 0.00 ? 6  LEU B HD21 6  
ATOM 4346  H HD22 . LEU B 2 6  ? -7.430  -7.116  9.388   1.00 0.00 ? 6  LEU B HD22 6  
ATOM 4347  H HD23 . LEU B 2 6  ? -8.116  -5.496  9.508   1.00 0.00 ? 6  LEU B HD23 6  
ATOM 4348  N N    . CYS B 2 7  ? -6.537  -2.905  5.530   1.00 0.00 ? 7  CYS B N    6  
ATOM 4349  C CA   . CYS B 2 7  ? -5.980  -1.605  5.984   1.00 0.00 ? 7  CYS B CA   6  
ATOM 4350  C C    . CYS B 2 7  ? -5.133  -1.818  7.240   1.00 0.00 ? 7  CYS B C    6  
ATOM 4351  O O    . CYS B 2 7  ? -3.986  -1.421  7.299   1.00 0.00 ? 7  CYS B O    6  
ATOM 4352  C CB   . CYS B 2 7  ? -7.132  -0.659  6.288   1.00 0.00 ? 7  CYS B CB   6  
ATOM 4353  S SG   . CYS B 2 7  ? -6.923  0.871   5.344   1.00 0.00 ? 7  CYS B SG   6  
ATOM 4354  H H    . CYS B 2 7  ? -6.150  -3.349  4.759   1.00 0.00 ? 7  CYS B H    6  
ATOM 4355  H HA   . CYS B 2 7  ? -5.366  -1.183  5.204   1.00 0.00 ? 7  CYS B HA   6  
ATOM 4356  H HB2  . CYS B 2 7  ? -8.060  -1.134  6.004   1.00 0.00 ? 7  CYS B HB2  6  
ATOM 4357  H HB3  . CYS B 2 7  ? -7.144  -0.440  7.341   1.00 0.00 ? 7  CYS B HB3  6  
ATOM 4358  N N    . GLY B 2 8  ? -5.682  -2.444  8.245   1.00 0.00 ? 8  GLY B N    6  
ATOM 4359  C CA   . GLY B 2 8  ? -4.898  -2.682  9.489   1.00 0.00 ? 8  GLY B CA   6  
ATOM 4360  C C    . GLY B 2 8  ? -3.508  -3.204  9.119   1.00 0.00 ? 8  GLY B C    6  
ATOM 4361  O O    . GLY B 2 8  ? -2.558  -3.046  9.859   1.00 0.00 ? 8  GLY B O    6  
ATOM 4362  H H    . GLY B 2 8  ? -6.607  -2.761  8.180   1.00 0.00 ? 8  GLY B H    6  
ATOM 4363  H HA2  . GLY B 2 8  ? -4.804  -1.755  10.037  1.00 0.00 ? 8  GLY B HA2  6  
ATOM 4364  H HA3  . GLY B 2 8  ? -5.403  -3.414  10.100  1.00 0.00 ? 8  GLY B HA3  6  
ATOM 4365  N N    . SER B 2 9  ? -3.383  -3.825  7.977   1.00 0.00 ? 9  SER B N    6  
ATOM 4366  C CA   . SER B 2 9  ? -2.055  -4.356  7.558   1.00 0.00 ? 9  SER B CA   6  
ATOM 4367  C C    . SER B 2 9  ? -2.147  -4.886  6.125   1.00 0.00 ? 9  SER B C    6  
ATOM 4368  O O    . SER B 2 9  ? -1.211  -4.789  5.356   1.00 0.00 ? 9  SER B O    6  
ATOM 4369  C CB   . SER B 2 9  ? -1.642  -5.491  8.496   1.00 0.00 ? 9  SER B CB   6  
ATOM 4370  O OG   . SER B 2 9  ? -0.389  -5.178  9.088   1.00 0.00 ? 9  SER B OG   6  
ATOM 4371  H H    . SER B 2 9  ? -4.162  -3.941  7.395   1.00 0.00 ? 9  SER B H    6  
ATOM 4372  H HA   . SER B 2 9  ? -1.321  -3.566  7.604   1.00 0.00 ? 9  SER B HA   6  
ATOM 4373  H HB2  . SER B 2 9  ? -2.381  -5.608  9.271   1.00 0.00 ? 9  SER B HB2  6  
ATOM 4374  H HB3  . SER B 2 9  ? -1.566  -6.412  7.932   1.00 0.00 ? 9  SER B HB3  6  
ATOM 4375  H HG   . SER B 2 9  ? -0.385  -4.241  9.297   1.00 0.00 ? 9  SER B HG   6  
ATOM 4376  N N    . HIS B 2 10 ? -3.267  -5.448  5.761   1.00 0.00 ? 10 HIS B N    6  
ATOM 4377  C CA   . HIS B 2 10 ? -3.419  -5.986  4.381   1.00 0.00 ? 10 HIS B CA   6  
ATOM 4378  C C    . HIS B 2 10 ? -3.200  -4.866  3.364   1.00 0.00 ? 10 HIS B C    6  
ATOM 4379  O O    . HIS B 2 10 ? -2.503  -5.034  2.382   1.00 0.00 ? 10 HIS B O    6  
ATOM 4380  C CB   . HIS B 2 10 ? -4.827  -6.560  4.208   1.00 0.00 ? 10 HIS B CB   6  
ATOM 4381  C CG   . HIS B 2 10 ? -4.945  -7.844  4.982   1.00 0.00 ? 10 HIS B CG   6  
ATOM 4382  N ND1  . HIS B 2 10 ? -4.079  -8.169  6.013   1.00 0.00 ? 10 HIS B ND1  6  
ATOM 4383  C CD2  . HIS B 2 10 ? -5.824  -8.895  4.886   1.00 0.00 ? 10 HIS B CD2  6  
ATOM 4384  C CE1  . HIS B 2 10 ? -4.451  -9.369  6.493   1.00 0.00 ? 10 HIS B CE1  6  
ATOM 4385  N NE2  . HIS B 2 10 ? -5.510  -9.857  5.842   1.00 0.00 ? 10 HIS B NE2  6  
ATOM 4386  H H    . HIS B 2 10 ? -4.008  -5.518  6.396   1.00 0.00 ? 10 HIS B H    6  
ATOM 4387  H HA   . HIS B 2 10 ? -2.691  -6.765  4.218   1.00 0.00 ? 10 HIS B HA   6  
ATOM 4388  H HB2  . HIS B 2 10 ? -5.553  -5.850  4.576   1.00 0.00 ? 10 HIS B HB2  6  
ATOM 4389  H HB3  . HIS B 2 10 ? -5.011  -6.753  3.162   1.00 0.00 ? 10 HIS B HB3  6  
ATOM 4390  H HD1  . HIS B 2 10 ? -3.331  -7.623  6.334   1.00 0.00 ? 10 HIS B HD1  6  
ATOM 4391  H HD2  . HIS B 2 10 ? -6.636  -8.964  4.178   1.00 0.00 ? 10 HIS B HD2  6  
ATOM 4392  H HE1  . HIS B 2 10 ? -3.954  -9.877  7.307   1.00 0.00 ? 10 HIS B HE1  6  
ATOM 4393  N N    . LEU B 2 11 ? -3.788  -3.723  3.586   1.00 0.00 ? 11 LEU B N    6  
ATOM 4394  C CA   . LEU B 2 11 ? -3.609  -2.598  2.626   1.00 0.00 ? 11 LEU B CA   6  
ATOM 4395  C C    . LEU B 2 11 ? -2.130  -2.222  2.558   1.00 0.00 ? 11 LEU B C    6  
ATOM 4396  O O    . LEU B 2 11 ? -1.580  -2.025  1.493   1.00 0.00 ? 11 LEU B O    6  
ATOM 4397  C CB   . LEU B 2 11 ? -4.423  -1.389  3.088   1.00 0.00 ? 11 LEU B CB   6  
ATOM 4398  C CG   . LEU B 2 11 ? -4.445  -0.336  1.979   1.00 0.00 ? 11 LEU B CG   6  
ATOM 4399  C CD1  . LEU B 2 11 ? -5.833  0.302   1.906   1.00 0.00 ? 11 LEU B CD1  6  
ATOM 4400  C CD2  . LEU B 2 11 ? -3.404  0.744   2.282   1.00 0.00 ? 11 LEU B CD2  6  
ATOM 4401  H H    . LEU B 2 11 ? -4.346  -3.605  4.382   1.00 0.00 ? 11 LEU B H    6  
ATOM 4402  H HA   . LEU B 2 11 ? -3.946  -2.906  1.647   1.00 0.00 ? 11 LEU B HA   6  
ATOM 4403  H HB2  . LEU B 2 11 ? -5.433  -1.699  3.313   1.00 0.00 ? 11 LEU B HB2  6  
ATOM 4404  H HB3  . LEU B 2 11 ? -3.970  -0.967  3.973   1.00 0.00 ? 11 LEU B HB3  6  
ATOM 4405  H HG   . LEU B 2 11 ? -4.215  -0.806  1.033   1.00 0.00 ? 11 LEU B HG   6  
ATOM 4406  H HD11 . LEU B 2 11 ? -6.258  0.355   2.897   1.00 0.00 ? 11 LEU B HD11 6  
ATOM 4407  H HD12 . LEU B 2 11 ? -6.472  -0.296  1.273   1.00 0.00 ? 11 LEU B HD12 6  
ATOM 4408  H HD13 . LEU B 2 11 ? -5.751  1.298   1.495   1.00 0.00 ? 11 LEU B HD13 6  
ATOM 4409  H HD21 . LEU B 2 11 ? -3.415  1.485   1.496   1.00 0.00 ? 11 LEU B HD21 6  
ATOM 4410  H HD22 . LEU B 2 11 ? -2.424  0.293   2.337   1.00 0.00 ? 11 LEU B HD22 6  
ATOM 4411  H HD23 . LEU B 2 11 ? -3.638  1.215   3.225   1.00 0.00 ? 11 LEU B HD23 6  
ATOM 4412  N N    . VAL B 2 12 ? -1.476  -2.121  3.684   1.00 0.00 ? 12 VAL B N    6  
ATOM 4413  C CA   . VAL B 2 12 ? -0.033  -1.759  3.663   1.00 0.00 ? 12 VAL B CA   6  
ATOM 4414  C C    . VAL B 2 12 ? 0.743   -2.866  2.960   1.00 0.00 ? 12 VAL B C    6  
ATOM 4415  O O    . VAL B 2 12 ? 1.513   -2.617  2.053   1.00 0.00 ? 12 VAL B O    6  
ATOM 4416  C CB   . VAL B 2 12 ? 0.483   -1.594  5.094   1.00 0.00 ? 12 VAL B CB   6  
ATOM 4417  C CG1  . VAL B 2 12 ? 1.711   -0.682  5.092   1.00 0.00 ? 12 VAL B CG1  6  
ATOM 4418  C CG2  . VAL B 2 12 ? -0.612  -0.970  5.962   1.00 0.00 ? 12 VAL B CG2  6  
ATOM 4419  H H    . VAL B 2 12 ? -1.932  -2.284  4.536   1.00 0.00 ? 12 VAL B H    6  
ATOM 4420  H HA   . VAL B 2 12 ? 0.094   -0.839  3.120   1.00 0.00 ? 12 VAL B HA   6  
ATOM 4421  H HB   . VAL B 2 12 ? 0.754   -2.561  5.492   1.00 0.00 ? 12 VAL B HB   6  
ATOM 4422  H HG11 . VAL B 2 12 ? 2.260   -0.820  4.172   1.00 0.00 ? 12 VAL B HG11 6  
ATOM 4423  H HG12 . VAL B 2 12 ? 2.345   -0.930  5.930   1.00 0.00 ? 12 VAL B HG12 6  
ATOM 4424  H HG13 . VAL B 2 12 ? 1.395   0.348   5.172   1.00 0.00 ? 12 VAL B HG13 6  
ATOM 4425  H HG21 . VAL B 2 12 ? -1.427  -0.643  5.333   1.00 0.00 ? 12 VAL B HG21 6  
ATOM 4426  H HG22 . VAL B 2 12 ? -0.209  -0.123  6.497   1.00 0.00 ? 12 VAL B HG22 6  
ATOM 4427  H HG23 . VAL B 2 12 ? -0.974  -1.703  6.667   1.00 0.00 ? 12 VAL B HG23 6  
ATOM 4428  N N    . GLU B 2 13 ? 0.530   -4.089  3.348   1.00 0.00 ? 13 GLU B N    6  
ATOM 4429  C CA   . GLU B 2 13 ? 1.240   -5.202  2.673   1.00 0.00 ? 13 GLU B CA   6  
ATOM 4430  C C    . GLU B 2 13 ? 0.902   -5.133  1.186   1.00 0.00 ? 13 GLU B C    6  
ATOM 4431  O O    . GLU B 2 13 ? 1.682   -5.515  0.337   1.00 0.00 ? 13 GLU B O    6  
ATOM 4432  C CB   . GLU B 2 13 ? 0.771   -6.541  3.248   1.00 0.00 ? 13 GLU B CB   6  
ATOM 4433  C CG   . GLU B 2 13 ? 1.351   -7.686  2.416   1.00 0.00 ? 13 GLU B CG   6  
ATOM 4434  C CD   . GLU B 2 13 ? 1.146   -9.010  3.155   1.00 0.00 ? 13 GLU B CD   6  
ATOM 4435  O OE1  . GLU B 2 13 ? 1.956   -9.317  4.014   1.00 0.00 ? 13 GLU B OE1  6  
ATOM 4436  O OE2  . GLU B 2 13 ? 0.183   -9.693  2.850   1.00 0.00 ? 13 GLU B OE2  6  
ATOM 4437  H H    . GLU B 2 13 ? -0.109  -4.275  4.068   1.00 0.00 ? 13 GLU B H    6  
ATOM 4438  H HA   . GLU B 2 13 ? 2.306   -5.095  2.811   1.00 0.00 ? 13 GLU B HA   6  
ATOM 4439  H HB2  . GLU B 2 13 ? 1.108   -6.630  4.271   1.00 0.00 ? 13 GLU B HB2  6  
ATOM 4440  H HB3  . GLU B 2 13 ? -0.307  -6.587  3.218   1.00 0.00 ? 13 GLU B HB3  6  
ATOM 4441  H HG2  . GLU B 2 13 ? 0.851   -7.725  1.459   1.00 0.00 ? 13 GLU B HG2  6  
ATOM 4442  H HG3  . GLU B 2 13 ? 2.407   -7.521  2.264   1.00 0.00 ? 13 GLU B HG3  6  
ATOM 4443  N N    . ALA B 2 14 ? -0.266  -4.639  0.872   1.00 0.00 ? 14 ALA B N    6  
ATOM 4444  C CA   . ALA B 2 14 ? -0.675  -4.531  -0.552  1.00 0.00 ? 14 ALA B CA   6  
ATOM 4445  C C    . ALA B 2 14 ? 0.167   -3.460  -1.243  1.00 0.00 ? 14 ALA B C    6  
ATOM 4446  O O    . ALA B 2 14 ? 0.685   -3.662  -2.323  1.00 0.00 ? 14 ALA B O    6  
ATOM 4447  C CB   . ALA B 2 14 ? -2.154  -4.149  -0.633  1.00 0.00 ? 14 ALA B CB   6  
ATOM 4448  H H    . ALA B 2 14 ? -0.871  -4.331  1.579   1.00 0.00 ? 14 ALA B H    6  
ATOM 4449  H HA   . ALA B 2 14 ? -0.522  -5.477  -1.038  1.00 0.00 ? 14 ALA B HA   6  
ATOM 4450  H HB1  . ALA B 2 14 ? -2.324  -3.549  -1.515  1.00 0.00 ? 14 ALA B HB1  6  
ATOM 4451  H HB2  . ALA B 2 14 ? -2.428  -3.583  0.246   1.00 0.00 ? 14 ALA B HB2  6  
ATOM 4452  H HB3  . ALA B 2 14 ? -2.755  -5.044  -0.685  1.00 0.00 ? 14 ALA B HB3  6  
ATOM 4453  N N    . LEU B 2 15 ? 0.310   -2.323  -0.624  1.00 0.00 ? 15 LEU B N    6  
ATOM 4454  C CA   . LEU B 2 15 ? 1.120   -1.236  -1.239  1.00 0.00 ? 15 LEU B CA   6  
ATOM 4455  C C    . LEU B 2 15 ? 2.574   -1.686  -1.331  1.00 0.00 ? 15 LEU B C    6  
ATOM 4456  O O    . LEU B 2 15 ? 3.270   -1.386  -2.281  1.00 0.00 ? 15 LEU B O    6  
ATOM 4457  C CB   . LEU B 2 15 ? 1.029   0.026   -0.375  1.00 0.00 ? 15 LEU B CB   6  
ATOM 4458  C CG   . LEU B 2 15 ? 1.690   1.202   -1.100  1.00 0.00 ? 15 LEU B CG   6  
ATOM 4459  C CD1  . LEU B 2 15 ? 3.212   1.040   -1.067  1.00 0.00 ? 15 LEU B CD1  6  
ATOM 4460  C CD2  . LEU B 2 15 ? 1.214   1.240   -2.555  1.00 0.00 ? 15 LEU B CD2  6  
ATOM 4461  H H    . LEU B 2 15 ? -0.116  -2.186  0.247   1.00 0.00 ? 15 LEU B H    6  
ATOM 4462  H HA   . LEU B 2 15 ? 0.747   -1.024  -2.228  1.00 0.00 ? 15 LEU B HA   6  
ATOM 4463  H HB2  . LEU B 2 15 ? -0.009  0.257   -0.186  1.00 0.00 ? 15 LEU B HB2  6  
ATOM 4464  H HB3  . LEU B 2 15 ? 1.535   -0.145  0.564   1.00 0.00 ? 15 LEU B HB3  6  
ATOM 4465  H HG   . LEU B 2 15 ? 1.417   2.125   -0.608  1.00 0.00 ? 15 LEU B HG   6  
ATOM 4466  H HD11 . LEU B 2 15 ? 3.671   1.996   -0.859  1.00 0.00 ? 15 LEU B HD11 6  
ATOM 4467  H HD12 . LEU B 2 15 ? 3.557   0.677   -2.023  1.00 0.00 ? 15 LEU B HD12 6  
ATOM 4468  H HD13 . LEU B 2 15 ? 3.483   0.336   -0.294  1.00 0.00 ? 15 LEU B HD13 6  
ATOM 4469  H HD21 . LEU B 2 15 ? 1.395   2.221   -2.968  1.00 0.00 ? 15 LEU B HD21 6  
ATOM 4470  H HD22 . LEU B 2 15 ? 0.157   1.022   -2.594  1.00 0.00 ? 15 LEU B HD22 6  
ATOM 4471  H HD23 . LEU B 2 15 ? 1.755   0.502   -3.130  1.00 0.00 ? 15 LEU B HD23 6  
ATOM 4472  N N    . TYR B 2 16 ? 3.040   -2.408  -0.352  1.00 0.00 ? 16 TYR B N    6  
ATOM 4473  C CA   . TYR B 2 16 ? 4.450   -2.876  -0.390  1.00 0.00 ? 16 TYR B CA   6  
ATOM 4474  C C    . TYR B 2 16 ? 4.610   -3.909  -1.500  1.00 0.00 ? 16 TYR B C    6  
ATOM 4475  O O    . TYR B 2 16 ? 5.479   -3.805  -2.343  1.00 0.00 ? 16 TYR B O    6  
ATOM 4476  C CB   . TYR B 2 16 ? 4.810   -3.515  0.953   1.00 0.00 ? 16 TYR B CB   6  
ATOM 4477  C CG   . TYR B 2 16 ? 5.821   -2.651  1.668   1.00 0.00 ? 16 TYR B CG   6  
ATOM 4478  C CD1  . TYR B 2 16 ? 5.426   -1.432  2.232   1.00 0.00 ? 16 TYR B CD1  6  
ATOM 4479  C CD2  . TYR B 2 16 ? 7.154   -3.068  1.765   1.00 0.00 ? 16 TYR B CD2  6  
ATOM 4480  C CE1  . TYR B 2 16 ? 6.364   -0.631  2.894   1.00 0.00 ? 16 TYR B CE1  6  
ATOM 4481  C CE2  . TYR B 2 16 ? 8.092   -2.267  2.427   1.00 0.00 ? 16 TYR B CE2  6  
ATOM 4482  C CZ   . TYR B 2 16 ? 7.697   -1.048  2.992   1.00 0.00 ? 16 TYR B CZ   6  
ATOM 4483  O OH   . TYR B 2 16 ? 8.622   -0.258  3.644   1.00 0.00 ? 16 TYR B OH   6  
ATOM 4484  H H    . TYR B 2 16 ? 2.462   -2.641  0.404   1.00 0.00 ? 16 TYR B H    6  
ATOM 4485  H HA   . TYR B 2 16 ? 5.101   -2.045  -0.577  1.00 0.00 ? 16 TYR B HA   6  
ATOM 4486  H HB2  . TYR B 2 16 ? 3.920   -3.604  1.560   1.00 0.00 ? 16 TYR B HB2  6  
ATOM 4487  H HB3  . TYR B 2 16 ? 5.230   -4.495  0.785   1.00 0.00 ? 16 TYR B HB3  6  
ATOM 4488  H HD1  . TYR B 2 16 ? 4.398   -1.110  2.157   1.00 0.00 ? 16 TYR B HD1  6  
ATOM 4489  H HD2  . TYR B 2 16 ? 7.459   -4.008  1.329   1.00 0.00 ? 16 TYR B HD2  6  
ATOM 4490  H HE1  . TYR B 2 16 ? 6.060   0.309   3.330   1.00 0.00 ? 16 TYR B HE1  6  
ATOM 4491  H HE2  . TYR B 2 16 ? 9.120   -2.589  2.503   1.00 0.00 ? 16 TYR B HE2  6  
ATOM 4492  H HH   . TYR B 2 16 ? 8.753   -0.619  4.524   1.00 0.00 ? 16 TYR B HH   6  
ATOM 4493  N N    . LEU B 2 17 ? 3.779   -4.907  -1.504  1.00 0.00 ? 17 LEU B N    6  
ATOM 4494  C CA   . LEU B 2 17 ? 3.876   -5.955  -2.554  1.00 0.00 ? 17 LEU B CA   6  
ATOM 4495  C C    . LEU B 2 17 ? 3.441   -5.404  -3.912  1.00 0.00 ? 17 LEU B C    6  
ATOM 4496  O O    . LEU B 2 17 ? 4.080   -5.638  -4.919  1.00 0.00 ? 17 LEU B O    6  
ATOM 4497  C CB   . LEU B 2 17 ? 2.989   -7.143  -2.175  1.00 0.00 ? 17 LEU B CB   6  
ATOM 4498  C CG   . LEU B 2 17 ? 3.539   -8.417  -2.819  1.00 0.00 ? 17 LEU B CG   6  
ATOM 4499  C CD1  . LEU B 2 17 ? 4.612   -9.025  -1.915  1.00 0.00 ? 17 LEU B CD1  6  
ATOM 4500  C CD2  . LEU B 2 17 ? 2.401   -9.423  -3.007  1.00 0.00 ? 17 LEU B CD2  6  
ATOM 4501  H H    . LEU B 2 17 ? 3.089   -4.968  -0.812  1.00 0.00 ? 17 LEU B H    6  
ATOM 4502  H HA   . LEU B 2 17 ? 4.898   -6.281  -2.624  1.00 0.00 ? 17 LEU B HA   6  
ATOM 4503  H HB2  . LEU B 2 17 ? 2.979   -7.257  -1.101  1.00 0.00 ? 17 LEU B HB2  6  
ATOM 4504  H HB3  . LEU B 2 17 ? 1.983   -6.969  -2.528  1.00 0.00 ? 17 LEU B HB3  6  
ATOM 4505  H HG   . LEU B 2 17 ? 3.972   -8.176  -3.780  1.00 0.00 ? 17 LEU B HG   6  
ATOM 4506  H HD11 . LEU B 2 17 ? 5.221   -8.236  -1.498  1.00 0.00 ? 17 LEU B HD11 6  
ATOM 4507  H HD12 . LEU B 2 17 ? 5.233   -9.693  -2.493  1.00 0.00 ? 17 LEU B HD12 6  
ATOM 4508  H HD13 . LEU B 2 17 ? 4.139   -9.575  -1.115  1.00 0.00 ? 17 LEU B HD13 6  
ATOM 4509  H HD21 . LEU B 2 17 ? 2.286   -9.645  -4.058  1.00 0.00 ? 17 LEU B HD21 6  
ATOM 4510  H HD22 . LEU B 2 17 ? 1.483   -9.004  -2.625  1.00 0.00 ? 17 LEU B HD22 6  
ATOM 4511  H HD23 . LEU B 2 17 ? 2.633   -10.332 -2.471  1.00 0.00 ? 17 LEU B HD23 6  
ATOM 4512  N N    . VAL B 2 18 ? 2.346   -4.701  -3.958  1.00 0.00 ? 18 VAL B N    6  
ATOM 4513  C CA   . VAL B 2 18 ? 1.863   -4.171  -5.264  1.00 0.00 ? 18 VAL B CA   6  
ATOM 4514  C C    . VAL B 2 18 ? 2.935   -3.290  -5.907  1.00 0.00 ? 18 VAL B C    6  
ATOM 4515  O O    . VAL B 2 18 ? 3.201   -3.391  -7.089  1.00 0.00 ? 18 VAL B O    6  
ATOM 4516  C CB   . VAL B 2 18 ? 0.557   -3.387  -5.061  1.00 0.00 ? 18 VAL B CB   6  
ATOM 4517  C CG1  . VAL B 2 18 ? 0.850   -1.936  -4.668  1.00 0.00 ? 18 VAL B CG1  6  
ATOM 4518  C CG2  . VAL B 2 18 ? -0.242  -3.406  -6.363  1.00 0.00 ? 18 VAL B CG2  6  
ATOM 4519  H H    . VAL B 2 18 ? 1.832   -4.542  -3.140  1.00 0.00 ? 18 VAL B H    6  
ATOM 4520  H HA   . VAL B 2 18 ? 1.671   -5.004  -5.918  1.00 0.00 ? 18 VAL B HA   6  
ATOM 4521  H HB   . VAL B 2 18 ? -0.023  -3.857  -4.281  1.00 0.00 ? 18 VAL B HB   6  
ATOM 4522  H HG11 . VAL B 2 18 ? 1.383   -1.917  -3.731  1.00 0.00 ? 18 VAL B HG11 6  
ATOM 4523  H HG12 . VAL B 2 18 ? -0.082  -1.398  -4.564  1.00 0.00 ? 18 VAL B HG12 6  
ATOM 4524  H HG13 . VAL B 2 18 ? 1.449   -1.469  -5.434  1.00 0.00 ? 18 VAL B HG13 6  
ATOM 4525  H HG21 . VAL B 2 18 ? -0.169  -4.384  -6.816  1.00 0.00 ? 18 VAL B HG21 6  
ATOM 4526  H HG22 . VAL B 2 18 ? 0.156   -2.666  -7.040  1.00 0.00 ? 18 VAL B HG22 6  
ATOM 4527  H HG23 . VAL B 2 18 ? -1.277  -3.183  -6.153  1.00 0.00 ? 18 VAL B HG23 6  
ATOM 4528  N N    . CYS B 2 19 ? 3.564   -2.440  -5.150  1.00 0.00 ? 19 CYS B N    6  
ATOM 4529  C CA   . CYS B 2 19 ? 4.625   -1.577  -5.738  1.00 0.00 ? 19 CYS B CA   6  
ATOM 4530  C C    . CYS B 2 19 ? 5.268   -0.751  -4.632  1.00 0.00 ? 19 CYS B C    6  
ATOM 4531  O O    . CYS B 2 19 ? 5.651   0.382   -4.833  1.00 0.00 ? 19 CYS B O    6  
ATOM 4532  C CB   . CYS B 2 19 ? 4.020   -0.644  -6.793  1.00 0.00 ? 19 CYS B CB   6  
ATOM 4533  S SG   . CYS B 2 19 ? 5.175   -0.483  -8.182  1.00 0.00 ? 19 CYS B SG   6  
ATOM 4534  H H    . CYS B 2 19 ? 3.347   -2.375  -4.194  1.00 0.00 ? 19 CYS B H    6  
ATOM 4535  H HA   . CYS B 2 19 ? 5.376   -2.201  -6.201  1.00 0.00 ? 19 CYS B HA   6  
ATOM 4536  H HB2  . CYS B 2 19 ? 3.086   -1.055  -7.146  1.00 0.00 ? 19 CYS B HB2  6  
ATOM 4537  H HB3  . CYS B 2 19 ? 3.845   0.328   -6.356  1.00 0.00 ? 19 CYS B HB3  6  
ATOM 4538  N N    . GLY B 2 20 ? 5.396   -1.302  -3.462  1.00 0.00 ? 20 GLY B N    6  
ATOM 4539  C CA   . GLY B 2 20 ? 6.023   -0.518  -2.360  1.00 0.00 ? 20 GLY B CA   6  
ATOM 4540  C C    . GLY B 2 20 ? 7.406   -1.092  -2.042  1.00 0.00 ? 20 GLY B C    6  
ATOM 4541  O O    . GLY B 2 20 ? 8.415   -0.461  -2.278  1.00 0.00 ? 20 GLY B O    6  
ATOM 4542  H H    . GLY B 2 20 ? 5.081   -2.227  -3.308  1.00 0.00 ? 20 GLY B H    6  
ATOM 4543  H HA2  . GLY B 2 20 ? 6.126   0.512   -2.672  1.00 0.00 ? 20 GLY B HA2  6  
ATOM 4544  H HA3  . GLY B 2 20 ? 5.403   -0.562  -1.482  1.00 0.00 ? 20 GLY B HA3  6  
ATOM 4545  N N    . GLU B 2 21 ? 7.464   -2.282  -1.511  1.00 0.00 ? 21 GLU B N    6  
ATOM 4546  C CA   . GLU B 2 21 ? 8.786   -2.886  -1.184  1.00 0.00 ? 21 GLU B CA   6  
ATOM 4547  C C    . GLU B 2 21 ? 9.757   -2.652  -2.344  1.00 0.00 ? 21 GLU B C    6  
ATOM 4548  O O    . GLU B 2 21 ? 10.902  -2.297  -2.145  1.00 0.00 ? 21 GLU B O    6  
ATOM 4549  C CB   . GLU B 2 21 ? 8.619   -4.389  -0.954  1.00 0.00 ? 21 GLU B CB   6  
ATOM 4550  C CG   . GLU B 2 21 ? 9.766   -4.903  -0.081  1.00 0.00 ? 21 GLU B CG   6  
ATOM 4551  C CD   . GLU B 2 21 ? 10.777  -5.648  -0.954  1.00 0.00 ? 21 GLU B CD   6  
ATOM 4552  O OE1  . GLU B 2 21 ? 11.153  -5.109  -1.982  1.00 0.00 ? 21 GLU B OE1  6  
ATOM 4553  O OE2  . GLU B 2 21 ? 11.160  -6.744  -0.579  1.00 0.00 ? 21 GLU B OE2  6  
ATOM 4554  H H    . GLU B 2 21 ? 6.641   -2.778  -1.329  1.00 0.00 ? 21 GLU B H    6  
ATOM 4555  H HA   . GLU B 2 21 ? 9.179   -2.427  -0.288  1.00 0.00 ? 21 GLU B HA   6  
ATOM 4556  H HB2  . GLU B 2 21 ? 7.677   -4.575  -0.458  1.00 0.00 ? 21 GLU B HB2  6  
ATOM 4557  H HB3  . GLU B 2 21 ? 8.633   -4.903  -1.903  1.00 0.00 ? 21 GLU B HB3  6  
ATOM 4558  H HG2  . GLU B 2 21 ? 10.252  -4.068  0.402   1.00 0.00 ? 21 GLU B HG2  6  
ATOM 4559  H HG3  . GLU B 2 21 ? 9.375   -5.576  0.668   1.00 0.00 ? 21 GLU B HG3  6  
ATOM 4560  N N    . ARG B 2 22 ? 9.311   -2.850  -3.554  1.00 0.00 ? 22 ARG B N    6  
ATOM 4561  C CA   . ARG B 2 22 ? 10.209  -2.641  -4.723  1.00 0.00 ? 22 ARG B CA   6  
ATOM 4562  C C    . ARG B 2 22 ? 10.751  -1.211  -4.706  1.00 0.00 ? 22 ARG B C    6  
ATOM 4563  O O    . ARG B 2 22 ? 11.930  -0.980  -4.887  1.00 0.00 ? 22 ARG B O    6  
ATOM 4564  C CB   . ARG B 2 22 ? 9.426   -2.874  -6.017  1.00 0.00 ? 22 ARG B CB   6  
ATOM 4565  C CG   . ARG B 2 22 ? 10.348  -2.656  -7.218  1.00 0.00 ? 22 ARG B CG   6  
ATOM 4566  C CD   . ARG B 2 22 ? 9.666   -1.726  -8.224  1.00 0.00 ? 22 ARG B CD   6  
ATOM 4567  N NE   . ARG B 2 22 ? 10.693  -0.882  -8.896  1.00 0.00 ? 22 ARG B NE   6  
ATOM 4568  C CZ   . ARG B 2 22 ? 10.333  -0.011  -9.799  1.00 0.00 ? 22 ARG B CZ   6  
ATOM 4569  N NH1  . ARG B 2 22 ? 9.485   0.933   -9.494  1.00 0.00 ? 22 ARG B NH1  6  
ATOM 4570  N NH2  . ARG B 2 22 ? 10.822  -0.084  -11.007 1.00 0.00 ? 22 ARG B NH2  6  
ATOM 4571  H H    . ARG B 2 22 ? 8.386   -3.137  -3.694  1.00 0.00 ? 22 ARG B H    6  
ATOM 4572  H HA   . ARG B 2 22 ? 11.030  -3.335  -4.671  1.00 0.00 ? 22 ARG B HA   6  
ATOM 4573  H HB2  . ARG B 2 22 ? 9.048   -3.886  -6.031  1.00 0.00 ? 22 ARG B HB2  6  
ATOM 4574  H HB3  . ARG B 2 22 ? 8.601   -2.180  -6.068  1.00 0.00 ? 22 ARG B HB3  6  
ATOM 4575  H HG2  . ARG B 2 22 ? 11.274  -2.210  -6.885  1.00 0.00 ? 22 ARG B HG2  6  
ATOM 4576  H HG3  . ARG B 2 22 ? 10.554  -3.604  -7.691  1.00 0.00 ? 22 ARG B HG3  6  
ATOM 4577  H HD2  . ARG B 2 22 ? 9.144   -2.316  -8.963  1.00 0.00 ? 22 ARG B HD2  6  
ATOM 4578  H HD3  . ARG B 2 22 ? 8.961   -1.092  -7.707  1.00 0.00 ? 22 ARG B HD3  6  
ATOM 4579  H HE   . ARG B 2 22 ? 11.639  -0.980  -8.660  1.00 0.00 ? 22 ARG B HE   6  
ATOM 4580  H HH11 . ARG B 2 22 ? 9.110   0.989   -8.569  1.00 0.00 ? 22 ARG B HH11 6  
ATOM 4581  H HH12 . ARG B 2 22 ? 9.209   1.600   -10.186 1.00 0.00 ? 22 ARG B HH12 6  
ATOM 4582  H HH21 . ARG B 2 22 ? 11.472  -0.807  -11.241 1.00 0.00 ? 22 ARG B HH21 6  
ATOM 4583  H HH22 . ARG B 2 22 ? 10.546  0.583   -11.699 1.00 0.00 ? 22 ARG B HH22 6  
ATOM 4584  N N    . GLY B 2 23 ? 9.897   -0.251  -4.491  1.00 0.00 ? 23 GLY B N    6  
ATOM 4585  C CA   . GLY B 2 23 ? 10.358  1.167   -4.463  1.00 0.00 ? 23 GLY B CA   6  
ATOM 4586  C C    . GLY B 2 23 ? 10.358  1.677   -3.021  1.00 0.00 ? 23 GLY B C    6  
ATOM 4587  O O    . GLY B 2 23 ? 10.252  2.862   -2.771  1.00 0.00 ? 23 GLY B O    6  
ATOM 4588  H H    . GLY B 2 23 ? 8.952   -0.463  -4.349  1.00 0.00 ? 23 GLY B H    6  
ATOM 4589  H HA2  . GLY B 2 23 ? 11.358  1.227   -4.869  1.00 0.00 ? 23 GLY B HA2  6  
ATOM 4590  H HA3  . GLY B 2 23 ? 9.691   1.774   -5.056  1.00 0.00 ? 23 GLY B HA3  6  
ATOM 4591  N N    . PHE B 2 24 ? 10.477  0.792   -2.070  1.00 0.00 ? 24 PHE B N    6  
ATOM 4592  C CA   . PHE B 2 24 ? 10.485  1.224   -0.644  1.00 0.00 ? 24 PHE B CA   6  
ATOM 4593  C C    . PHE B 2 24 ? 11.840  0.882   -0.020  1.00 0.00 ? 24 PHE B C    6  
ATOM 4594  O O    . PHE B 2 24 ? 12.216  -0.270  0.075   1.00 0.00 ? 24 PHE B O    6  
ATOM 4595  C CB   . PHE B 2 24 ? 9.374   0.494   0.115   1.00 0.00 ? 24 PHE B CB   6  
ATOM 4596  C CG   . PHE B 2 24 ? 8.097   1.299   0.050   1.00 0.00 ? 24 PHE B CG   6  
ATOM 4597  C CD1  . PHE B 2 24 ? 7.645   1.803   -1.177  1.00 0.00 ? 24 PHE B CD1  6  
ATOM 4598  C CD2  . PHE B 2 24 ? 7.363   1.542   1.218   1.00 0.00 ? 24 PHE B CD2  6  
ATOM 4599  C CE1  . PHE B 2 24 ? 6.461   2.548   -1.234  1.00 0.00 ? 24 PHE B CE1  6  
ATOM 4600  C CE2  . PHE B 2 24 ? 6.180   2.288   1.160   1.00 0.00 ? 24 PHE B CE2  6  
ATOM 4601  C CZ   . PHE B 2 24 ? 5.729   2.791   -0.066  1.00 0.00 ? 24 PHE B CZ   6  
ATOM 4602  H H    . PHE B 2 24 ? 10.562  -0.158  -2.294  1.00 0.00 ? 24 PHE B H    6  
ATOM 4603  H HA   . PHE B 2 24 ? 10.321  2.290   -0.588  1.00 0.00 ? 24 PHE B HA   6  
ATOM 4604  H HB2  . PHE B 2 24 ? 9.211   -0.476  -0.332  1.00 0.00 ? 24 PHE B HB2  6  
ATOM 4605  H HB3  . PHE B 2 24 ? 9.667   0.369   1.147   1.00 0.00 ? 24 PHE B HB3  6  
ATOM 4606  H HD1  . PHE B 2 24 ? 8.208   1.616   -2.079  1.00 0.00 ? 24 PHE B HD1  6  
ATOM 4607  H HD2  . PHE B 2 24 ? 7.709   1.154   2.164   1.00 0.00 ? 24 PHE B HD2  6  
ATOM 4608  H HE1  . PHE B 2 24 ? 6.113   2.937   -2.180  1.00 0.00 ? 24 PHE B HE1  6  
ATOM 4609  H HE2  . PHE B 2 24 ? 5.614   2.475   2.061   1.00 0.00 ? 24 PHE B HE2  6  
ATOM 4610  H HZ   . PHE B 2 24 ? 4.816   3.367   -0.111  1.00 0.00 ? 24 PHE B HZ   6  
ATOM 4611  N N    . PHE B 2 25 ? 12.578  1.872   0.402   1.00 0.00 ? 25 PHE B N    6  
ATOM 4612  C CA   . PHE B 2 25 ? 13.909  1.600   1.015   1.00 0.00 ? 25 PHE B CA   6  
ATOM 4613  C C    . PHE B 2 25 ? 13.798  1.675   2.539   1.00 0.00 ? 25 PHE B C    6  
ATOM 4614  O O    . PHE B 2 25 ? 13.291  2.633   3.088   1.00 0.00 ? 25 PHE B O    6  
ATOM 4615  C CB   . PHE B 2 25 ? 14.918  2.641   0.526   1.00 0.00 ? 25 PHE B CB   6  
ATOM 4616  C CG   . PHE B 2 25 ? 16.286  2.315   1.076   1.00 0.00 ? 25 PHE B CG   6  
ATOM 4617  C CD1  . PHE B 2 25 ? 16.733  0.988   1.098   1.00 0.00 ? 25 PHE B CD1  6  
ATOM 4618  C CD2  . PHE B 2 25 ? 17.108  3.338   1.563   1.00 0.00 ? 25 PHE B CD2  6  
ATOM 4619  C CE1  . PHE B 2 25 ? 18.001  0.685   1.607   1.00 0.00 ? 25 PHE B CE1  6  
ATOM 4620  C CE2  . PHE B 2 25 ? 18.376  3.035   2.072   1.00 0.00 ? 25 PHE B CE2  6  
ATOM 4621  C CZ   . PHE B 2 25 ? 18.822  1.709   2.095   1.00 0.00 ? 25 PHE B CZ   6  
ATOM 4622  H H    . PHE B 2 25 ? 12.258  2.793   0.314   1.00 0.00 ? 25 PHE B H    6  
ATOM 4623  H HA   . PHE B 2 25 ? 14.243  0.614   0.727   1.00 0.00 ? 25 PHE B HA   6  
ATOM 4624  H HB2  . PHE B 2 25 ? 14.952  2.631   -0.554  1.00 0.00 ? 25 PHE B HB2  6  
ATOM 4625  H HB3  . PHE B 2 25 ? 14.618  3.621   0.867   1.00 0.00 ? 25 PHE B HB3  6  
ATOM 4626  H HD1  . PHE B 2 25 ? 16.099  0.199   0.722   1.00 0.00 ? 25 PHE B HD1  6  
ATOM 4627  H HD2  . PHE B 2 25 ? 16.763  4.362   1.546   1.00 0.00 ? 25 PHE B HD2  6  
ATOM 4628  H HE1  . PHE B 2 25 ? 18.346  -0.338  1.625   1.00 0.00 ? 25 PHE B HE1  6  
ATOM 4629  H HE2  . PHE B 2 25 ? 19.010  3.825   2.448   1.00 0.00 ? 25 PHE B HE2  6  
ATOM 4630  H HZ   . PHE B 2 25 ? 19.801  1.475   2.488   1.00 0.00 ? 25 PHE B HZ   6  
ATOM 4631  N N    . TYR B 2 26 ? 14.269  0.670   3.226   1.00 0.00 ? 26 TYR B N    6  
ATOM 4632  C CA   . TYR B 2 26 ? 14.192  0.682   4.713   1.00 0.00 ? 26 TYR B CA   6  
ATOM 4633  C C    . TYR B 2 26 ? 15.376  1.481   5.277   1.00 0.00 ? 26 TYR B C    6  
ATOM 4634  O O    . TYR B 2 26 ? 16.507  1.245   4.903   1.00 0.00 ? 26 TYR B O    6  
ATOM 4635  C CB   . TYR B 2 26 ? 14.256  -0.755  5.235   1.00 0.00 ? 26 TYR B CB   6  
ATOM 4636  C CG   . TYR B 2 26 ? 13.232  -0.943  6.328   1.00 0.00 ? 26 TYR B CG   6  
ATOM 4637  C CD1  . TYR B 2 26 ? 11.909  -1.262  6.001   1.00 0.00 ? 26 TYR B CD1  6  
ATOM 4638  C CD2  . TYR B 2 26 ? 13.606  -0.799  7.670   1.00 0.00 ? 26 TYR B CD2  6  
ATOM 4639  C CE1  . TYR B 2 26 ? 10.959  -1.437  7.014   1.00 0.00 ? 26 TYR B CE1  6  
ATOM 4640  C CE2  . TYR B 2 26 ? 12.656  -0.974  8.684   1.00 0.00 ? 26 TYR B CE2  6  
ATOM 4641  C CZ   . TYR B 2 26 ? 11.333  -1.293  8.356   1.00 0.00 ? 26 TYR B CZ   6  
ATOM 4642  O OH   . TYR B 2 26 ? 10.397  -1.465  9.355   1.00 0.00 ? 26 TYR B OH   6  
ATOM 4643  H H    . TYR B 2 26 ? 14.675  -0.092  2.763   1.00 0.00 ? 26 TYR B H    6  
ATOM 4644  H HA   . TYR B 2 26 ? 13.262  1.135   5.018   1.00 0.00 ? 26 TYR B HA   6  
ATOM 4645  H HB2  . TYR B 2 26 ? 14.049  -1.441  4.426   1.00 0.00 ? 26 TYR B HB2  6  
ATOM 4646  H HB3  . TYR B 2 26 ? 15.242  -0.951  5.629   1.00 0.00 ? 26 TYR B HB3  6  
ATOM 4647  H HD1  . TYR B 2 26 ? 11.621  -1.374  4.966   1.00 0.00 ? 26 TYR B HD1  6  
ATOM 4648  H HD2  . TYR B 2 26 ? 14.626  -0.553  7.923   1.00 0.00 ? 26 TYR B HD2  6  
ATOM 4649  H HE1  . TYR B 2 26 ? 9.939   -1.684  6.761   1.00 0.00 ? 26 TYR B HE1  6  
ATOM 4650  H HE2  . TYR B 2 26 ? 12.944  -0.863  9.718   1.00 0.00 ? 26 TYR B HE2  6  
ATOM 4651  H HH   . TYR B 2 26 ? 10.508  -2.348  9.717   1.00 0.00 ? 26 TYR B HH   6  
ATOM 4652  N N    . PRO B 2 27 ? 15.083  2.402   6.163   1.00 0.00 ? 27 PRO B N    6  
ATOM 4653  C CA   . PRO B 2 27 ? 16.112  3.246   6.793   1.00 0.00 ? 27 PRO B CA   6  
ATOM 4654  C C    . PRO B 2 27 ? 16.831  2.470   7.901   1.00 0.00 ? 27 PRO B C    6  
ATOM 4655  O O    . PRO B 2 27 ? 16.213  1.792   8.698   1.00 0.00 ? 27 PRO B O    6  
ATOM 4656  C CB   . PRO B 2 27 ? 15.312  4.414   7.376   1.00 0.00 ? 27 PRO B CB   6  
ATOM 4657  C CG   . PRO B 2 27 ? 13.862  3.904   7.550   1.00 0.00 ? 27 PRO B CG   6  
ATOM 4658  C CD   . PRO B 2 27 ? 13.707  2.689   6.617   1.00 0.00 ? 27 PRO B CD   6  
ATOM 4659  H HA   . PRO B 2 27 ? 16.814  3.608   6.060   1.00 0.00 ? 27 PRO B HA   6  
ATOM 4660  H HB2  . PRO B 2 27 ? 15.725  4.704   8.333   1.00 0.00 ? 27 PRO B HB2  6  
ATOM 4661  H HB3  . PRO B 2 27 ? 15.324  5.250   6.696   1.00 0.00 ? 27 PRO B HB3  6  
ATOM 4662  H HG2  . PRO B 2 27 ? 13.694  3.610   8.577   1.00 0.00 ? 27 PRO B HG2  6  
ATOM 4663  H HG3  . PRO B 2 27 ? 13.161  4.674   7.265   1.00 0.00 ? 27 PRO B HG3  6  
ATOM 4664  H HD2  . PRO B 2 27 ? 13.301  1.846   7.159   1.00 0.00 ? 27 PRO B HD2  6  
ATOM 4665  H HD3  . PRO B 2 27 ? 13.081  2.936   5.773   1.00 0.00 ? 27 PRO B HD3  6  
ATOM 4666  N N    . THR B 2 28 ? 18.131  2.562   7.956   1.00 0.00 ? 28 THR B N    6  
ATOM 4667  C CA   . THR B 2 28 ? 18.884  1.828   9.012   1.00 0.00 ? 28 THR B CA   6  
ATOM 4668  C C    . THR B 2 28 ? 20.177  2.579   9.332   1.00 0.00 ? 28 THR B C    6  
ATOM 4669  O O    . THR B 2 28 ? 21.263  2.053   9.188   1.00 0.00 ? 28 THR B O    6  
ATOM 4670  C CB   . THR B 2 28 ? 19.221  0.421   8.512   1.00 0.00 ? 28 THR B CB   6  
ATOM 4671  O OG1  . THR B 2 28 ? 18.055  -0.175  7.961   1.00 0.00 ? 28 THR B OG1  6  
ATOM 4672  C CG2  . THR B 2 28 ? 19.729  -0.428  9.678   1.00 0.00 ? 28 THR B CG2  6  
ATOM 4673  H H    . THR B 2 28 ? 18.612  3.114   7.305   1.00 0.00 ? 28 THR B H    6  
ATOM 4674  H HA   . THR B 2 28 ? 18.278  1.758   9.903   1.00 0.00 ? 28 THR B HA   6  
ATOM 4675  H HB   . THR B 2 28 ? 19.987  0.482   7.755   1.00 0.00 ? 28 THR B HB   6  
ATOM 4676  H HG1  . THR B 2 28 ? 17.597  -0.638  8.666   1.00 0.00 ? 28 THR B HG1  6  
ATOM 4677  H HG21 . THR B 2 28 ? 20.515  -1.083  9.331   1.00 0.00 ? 28 THR B HG21 6  
ATOM 4678  H HG22 . THR B 2 28 ? 18.917  -1.019  10.074  1.00 0.00 ? 28 THR B HG22 6  
ATOM 4679  H HG23 . THR B 2 28 ? 20.115  0.218   10.453  1.00 0.00 ? 28 THR B HG23 6  
ATOM 4680  N N    . LYS B 2 29 ? 20.071  3.804   9.768   1.00 0.00 ? 29 LYS B N    6  
ATOM 4681  C CA   . LYS B 2 29 ? 21.296  4.585   10.100  1.00 0.00 ? 29 LYS B CA   6  
ATOM 4682  C C    . LYS B 2 29 ? 21.488  4.605   11.617  1.00 0.00 ? 29 LYS B C    6  
ATOM 4683  O O    . LYS B 2 29 ? 20.569  4.874   12.365  1.00 0.00 ? 29 LYS B O    6  
ATOM 4684  C CB   . LYS B 2 29 ? 21.145  6.017   9.584   1.00 0.00 ? 29 LYS B CB   6  
ATOM 4685  C CG   . LYS B 2 29 ? 22.320  6.354   8.664   1.00 0.00 ? 29 LYS B CG   6  
ATOM 4686  C CD   . LYS B 2 29 ? 21.800  6.643   7.255   1.00 0.00 ? 29 LYS B CD   6  
ATOM 4687  C CE   . LYS B 2 29 ? 21.228  5.360   6.648   1.00 0.00 ? 29 LYS B CE   6  
ATOM 4688  N NZ   . LYS B 2 29 ? 22.291  4.662   5.870   1.00 0.00 ? 29 LYS B NZ   6  
ATOM 4689  H H    . LYS B 2 29 ? 19.186  4.210   9.880   1.00 0.00 ? 29 LYS B H    6  
ATOM 4690  H HA   . LYS B 2 29 ? 22.154  4.123   9.634   1.00 0.00 ? 29 LYS B HA   6  
ATOM 4691  H HB2  . LYS B 2 29 ? 20.219  6.106   9.035   1.00 0.00 ? 29 LYS B HB2  6  
ATOM 4692  H HB3  . LYS B 2 29 ? 21.137  6.702   10.419  1.00 0.00 ? 29 LYS B HB3  6  
ATOM 4693  H HG2  . LYS B 2 29 ? 22.837  7.224   9.044   1.00 0.00 ? 29 LYS B HG2  6  
ATOM 4694  H HG3  . LYS B 2 29 ? 23.001  5.517   8.629   1.00 0.00 ? 29 LYS B HG3  6  
ATOM 4695  H HD2  . LYS B 2 29 ? 21.025  7.395   7.305   1.00 0.00 ? 29 LYS B HD2  6  
ATOM 4696  H HD3  . LYS B 2 29 ? 22.610  7.001   6.638   1.00 0.00 ? 29 LYS B HD3  6  
ATOM 4697  H HE2  . LYS B 2 29 ? 20.877  4.714   7.438   1.00 0.00 ? 29 LYS B HE2  6  
ATOM 4698  H HE3  . LYS B 2 29 ? 20.406  5.607   5.993   1.00 0.00 ? 29 LYS B HE3  6  
ATOM 4699  H HZ1  . LYS B 2 29 ? 23.208  5.115   6.052   1.00 0.00 ? 29 LYS B HZ1  6  
ATOM 4700  H HZ2  . LYS B 2 29 ? 22.070  4.719   4.854   1.00 0.00 ? 29 LYS B HZ2  6  
ATOM 4701  H HZ3  . LYS B 2 29 ? 22.335  3.665   6.161   1.00 0.00 ? 29 LYS B HZ3  6  
ATOM 4702  N N    . THR B 2 30 ? 22.675  4.320   12.078  1.00 0.00 ? 30 THR B N    6  
ATOM 4703  C CA   . THR B 2 30 ? 22.925  4.319   13.546  1.00 0.00 ? 30 THR B CA   6  
ATOM 4704  C C    . THR B 2 30 ? 22.336  3.048   14.161  1.00 0.00 ? 30 THR B C    6  
ATOM 4705  O O    . THR B 2 30 ? 21.137  3.025   14.390  1.00 0.00 ? 30 THR B O    6  
ATOM 4706  C CB   . THR B 2 30 ? 22.263  5.546   14.179  1.00 0.00 ? 30 THR B CB   6  
ATOM 4707  O OG1  . THR B 2 30 ? 22.397  6.658   13.305  1.00 0.00 ? 30 THR B OG1  6  
ATOM 4708  C CG2  . THR B 2 30 ? 22.937  5.860   15.515  1.00 0.00 ? 30 THR B CG2  6  
ATOM 4709  O OXT  . THR B 2 30 ? 23.092  2.120   14.392  1.00 0.00 ? 30 THR B OXT  6  
ATOM 4710  H H    . THR B 2 30 ? 23.402  4.103   11.457  1.00 0.00 ? 30 THR B H    6  
ATOM 4711  H HA   . THR B 2 30 ? 23.988  4.349   13.731  1.00 0.00 ? 30 THR B HA   6  
ATOM 4712  H HB   . THR B 2 30 ? 21.216  5.345   14.347  1.00 0.00 ? 30 THR B HB   6  
ATOM 4713  H HG1  . THR B 2 30 ? 21.879  7.382   13.664  1.00 0.00 ? 30 THR B HG1  6  
ATOM 4714  H HG21 . THR B 2 30 ? 23.939  6.221   15.337  1.00 0.00 ? 30 THR B HG21 6  
ATOM 4715  H HG22 . THR B 2 30 ? 22.979  4.964   16.117  1.00 0.00 ? 30 THR B HG22 6  
ATOM 4716  H HG23 . THR B 2 30 ? 22.369  6.617   16.036  1.00 0.00 ? 30 THR B HG23 6  
ATOM 4717  N N    . GLY A 1 1  ? 1.483   5.073   -9.838  1.00 0.00 ? 1  GLY A N    7  
ATOM 4718  C CA   . GLY A 1 1  ? 1.136   5.158   -8.390  1.00 0.00 ? 1  GLY A CA   7  
ATOM 4719  C C    . GLY A 1 1  ? 2.416   5.103   -7.554  1.00 0.00 ? 1  GLY A C    7  
ATOM 4720  O O    . GLY A 1 1  ? 3.509   5.037   -8.079  1.00 0.00 ? 1  GLY A O    7  
ATOM 4721  H H1   . GLY A 1 1  ? 1.540   6.031   -10.238 1.00 0.00 ? 1  GLY A H1   7  
ATOM 4722  H H2   . GLY A 1 1  ? 0.749   4.531   -10.338 1.00 0.00 ? 1  GLY A H2   7  
ATOM 4723  H H3   . GLY A 1 1  ? 2.401   4.599   -9.947  1.00 0.00 ? 1  GLY A H3   7  
ATOM 4724  H HA2  . GLY A 1 1  ? 0.619   6.088   -8.199  1.00 0.00 ? 1  GLY A HA2  7  
ATOM 4725  H HA3  . GLY A 1 1  ? 0.499   4.329   -8.123  1.00 0.00 ? 1  GLY A HA3  7  
ATOM 4726  N N    . ILE A 1 2  ? 2.289   5.129   -6.255  1.00 0.00 ? 2  ILE A N    7  
ATOM 4727  C CA   . ILE A 1 2  ? 3.500   5.079   -5.388  1.00 0.00 ? 2  ILE A CA   7  
ATOM 4728  C C    . ILE A 1 2  ? 4.119   3.682   -5.456  1.00 0.00 ? 2  ILE A C    7  
ATOM 4729  O O    . ILE A 1 2  ? 5.316   3.517   -5.332  1.00 0.00 ? 2  ILE A O    7  
ATOM 4730  C CB   . ILE A 1 2  ? 3.112   5.399   -3.941  1.00 0.00 ? 2  ILE A CB   7  
ATOM 4731  C CG1  . ILE A 1 2  ? 1.784   4.716   -3.598  1.00 0.00 ? 2  ILE A CG1  7  
ATOM 4732  C CG2  . ILE A 1 2  ? 2.960   6.912   -3.779  1.00 0.00 ? 2  ILE A CG2  7  
ATOM 4733  C CD1  . ILE A 1 2  ? 1.796   4.284   -2.131  1.00 0.00 ? 2  ILE A CD1  7  
ATOM 4734  H H    . ILE A 1 2  ? 1.398   5.183   -5.852  1.00 0.00 ? 2  ILE A H    7  
ATOM 4735  H HA   . ILE A 1 2  ? 4.220   5.804   -5.735  1.00 0.00 ? 2  ILE A HA   7  
ATOM 4736  H HB   . ILE A 1 2  ? 3.885   5.043   -3.275  1.00 0.00 ? 2  ILE A HB   7  
ATOM 4737  H HG12 . ILE A 1 2  ? 0.970   5.408   -3.764  1.00 0.00 ? 2  ILE A HG12 7  
ATOM 4738  H HG13 . ILE A 1 2  ? 1.652   3.848   -4.226  1.00 0.00 ? 2  ILE A HG13 7  
ATOM 4739  H HG21 . ILE A 1 2  ? 2.889   7.157   -2.729  1.00 0.00 ? 2  ILE A HG21 7  
ATOM 4740  H HG22 . ILE A 1 2  ? 2.064   7.241   -4.285  1.00 0.00 ? 2  ILE A HG22 7  
ATOM 4741  H HG23 . ILE A 1 2  ? 3.818   7.409   -4.207  1.00 0.00 ? 2  ILE A HG23 7  
ATOM 4742  H HD11 . ILE A 1 2  ? 1.131   4.918   -1.563  1.00 0.00 ? 2  ILE A HD11 7  
ATOM 4743  H HD12 . ILE A 1 2  ? 2.799   4.371   -1.738  1.00 0.00 ? 2  ILE A HD12 7  
ATOM 4744  H HD13 . ILE A 1 2  ? 1.468   3.258   -2.055  1.00 0.00 ? 2  ILE A HD13 7  
ATOM 4745  N N    . VAL A 1 3  ? 3.315   2.675   -5.654  1.00 0.00 ? 3  VAL A N    7  
ATOM 4746  C CA   . VAL A 1 3  ? 3.849   1.296   -5.732  1.00 0.00 ? 3  VAL A CA   7  
ATOM 4747  C C    . VAL A 1 3  ? 4.834   1.192   -6.901  1.00 0.00 ? 3  VAL A C    7  
ATOM 4748  O O    . VAL A 1 3  ? 5.881   0.586   -6.790  1.00 0.00 ? 3  VAL A O    7  
ATOM 4749  C CB   . VAL A 1 3  ? 2.676   0.329   -5.929  1.00 0.00 ? 3  VAL A CB   7  
ATOM 4750  C CG1  . VAL A 1 3  ? 1.669   0.923   -6.918  1.00 0.00 ? 3  VAL A CG1  7  
ATOM 4751  C CG2  . VAL A 1 3  ? 3.190   -0.995  -6.476  1.00 0.00 ? 3  VAL A CG2  7  
ATOM 4752  H H    . VAL A 1 3  ? 2.356   2.824   -5.753  1.00 0.00 ? 3  VAL A H    7  
ATOM 4753  H HA   . VAL A 1 3  ? 4.361   1.058   -4.815  1.00 0.00 ? 3  VAL A HA   7  
ATOM 4754  H HB   . VAL A 1 3  ? 2.188   0.162   -4.980  1.00 0.00 ? 3  VAL A HB   7  
ATOM 4755  H HG11 . VAL A 1 3  ? 0.728   1.091   -6.415  1.00 0.00 ? 3  VAL A HG11 7  
ATOM 4756  H HG12 . VAL A 1 3  ? 1.521   0.235   -7.737  1.00 0.00 ? 3  VAL A HG12 7  
ATOM 4757  H HG13 . VAL A 1 3  ? 2.045   1.860   -7.299  1.00 0.00 ? 3  VAL A HG13 7  
ATOM 4758  H HG21 . VAL A 1 3  ? 2.552   -1.794  -6.135  1.00 0.00 ? 3  VAL A HG21 7  
ATOM 4759  H HG22 . VAL A 1 3  ? 4.197   -1.158  -6.123  1.00 0.00 ? 3  VAL A HG22 7  
ATOM 4760  H HG23 . VAL A 1 3  ? 3.185   -0.960  -7.554  1.00 0.00 ? 3  VAL A HG23 7  
ATOM 4761  N N    . GLU A 1 4  ? 4.509   1.777   -8.019  1.00 0.00 ? 4  GLU A N    7  
ATOM 4762  C CA   . GLU A 1 4  ? 5.427   1.709   -9.190  1.00 0.00 ? 4  GLU A CA   7  
ATOM 4763  C C    . GLU A 1 4  ? 6.690   2.520   -8.897  1.00 0.00 ? 4  GLU A C    7  
ATOM 4764  O O    . GLU A 1 4  ? 7.784   2.139   -9.263  1.00 0.00 ? 4  GLU A O    7  
ATOM 4765  C CB   . GLU A 1 4  ? 4.726   2.285   -10.422 1.00 0.00 ? 4  GLU A CB   7  
ATOM 4766  C CG   . GLU A 1 4  ? 4.510   1.174   -11.452 1.00 0.00 ? 4  GLU A CG   7  
ATOM 4767  C CD   . GLU A 1 4  ? 4.527   1.773   -12.860 1.00 0.00 ? 4  GLU A CD   7  
ATOM 4768  O OE1  . GLU A 1 4  ? 5.016   2.881   -13.006 1.00 0.00 ? 4  GLU A OE1  7  
ATOM 4769  O OE2  . GLU A 1 4  ? 4.050   1.113   -13.768 1.00 0.00 ? 4  GLU A OE2  7  
ATOM 4770  H H    . GLU A 1 4  ? 3.662   2.260   -8.087  1.00 0.00 ? 4  GLU A H    7  
ATOM 4771  H HA   . GLU A 1 4  ? 5.696   0.682   -9.376  1.00 0.00 ? 4  GLU A HA   7  
ATOM 4772  H HB2  . GLU A 1 4  ? 3.772   2.700   -10.132 1.00 0.00 ? 4  GLU A HB2  7  
ATOM 4773  H HB3  . GLU A 1 4  ? 5.340   3.060   -10.856 1.00 0.00 ? 4  GLU A HB3  7  
ATOM 4774  H HG2  . GLU A 1 4  ? 5.299   0.441   -11.362 1.00 0.00 ? 4  GLU A HG2  7  
ATOM 4775  H HG3  . GLU A 1 4  ? 3.556   0.701   -11.276 1.00 0.00 ? 4  GLU A HG3  7  
ATOM 4776  N N    . GLN A 1 5  ? 6.546   3.636   -8.240  1.00 0.00 ? 5  GLN A N    7  
ATOM 4777  C CA   . GLN A 1 5  ? 7.737   4.475   -7.924  1.00 0.00 ? 5  GLN A CA   7  
ATOM 4778  C C    . GLN A 1 5  ? 8.445   3.917   -6.688  1.00 0.00 ? 5  GLN A C    7  
ATOM 4779  O O    . GLN A 1 5  ? 9.653   3.977   -6.572  1.00 0.00 ? 5  GLN A O    7  
ATOM 4780  C CB   . GLN A 1 5  ? 7.290   5.912   -7.650  1.00 0.00 ? 5  GLN A CB   7  
ATOM 4781  C CG   . GLN A 1 5  ? 8.275   6.886   -8.300  1.00 0.00 ? 5  GLN A CG   7  
ATOM 4782  C CD   . GLN A 1 5  ? 9.702   6.528   -7.878  1.00 0.00 ? 5  GLN A CD   7  
ATOM 4783  O OE1  . GLN A 1 5  ? 10.491  6.077   -8.684  1.00 0.00 ? 5  GLN A OE1  7  
ATOM 4784  N NE2  . GLN A 1 5  ? 10.068  6.712   -6.639  1.00 0.00 ? 5  GLN A NE2  7  
ATOM 4785  H H    . GLN A 1 5  ? 5.654   3.923   -7.956  1.00 0.00 ? 5  GLN A H    7  
ATOM 4786  H HA   . GLN A 1 5  ? 8.417   4.463   -8.761  1.00 0.00 ? 5  GLN A HA   7  
ATOM 4787  H HB2  . GLN A 1 5  ? 6.304   6.067   -8.063  1.00 0.00 ? 5  GLN A HB2  7  
ATOM 4788  H HB3  . GLN A 1 5  ? 7.266   6.085   -6.585  1.00 0.00 ? 5  GLN A HB3  7  
ATOM 4789  H HG2  . GLN A 1 5  ? 8.190   6.821   -9.375  1.00 0.00 ? 5  GLN A HG2  7  
ATOM 4790  H HG3  . GLN A 1 5  ? 8.050   7.893   -7.981  1.00 0.00 ? 5  GLN A HG3  7  
ATOM 4791  H HE21 . GLN A 1 5  ? 9.432   7.076   -5.988  1.00 0.00 ? 5  GLN A HE21 7  
ATOM 4792  H HE22 . GLN A 1 5  ? 10.980  6.486   -6.358  1.00 0.00 ? 5  GLN A HE22 7  
ATOM 4793  N N    . CYS A 1 6  ? 7.703   3.378   -5.761  1.00 0.00 ? 6  CYS A N    7  
ATOM 4794  C CA   . CYS A 1 6  ? 8.335   2.822   -4.531  1.00 0.00 ? 6  CYS A CA   7  
ATOM 4795  C C    . CYS A 1 6  ? 8.458   1.301   -4.653  1.00 0.00 ? 6  CYS A C    7  
ATOM 4796  O O    . CYS A 1 6  ? 8.764   0.618   -3.696  1.00 0.00 ? 6  CYS A O    7  
ATOM 4797  C CB   . CYS A 1 6  ? 7.474   3.168   -3.315  1.00 0.00 ? 6  CYS A CB   7  
ATOM 4798  S SG   . CYS A 1 6  ? 7.894   4.829   -2.734  1.00 0.00 ? 6  CYS A SG   7  
ATOM 4799  H H    . CYS A 1 6  ? 6.730   3.343   -5.872  1.00 0.00 ? 6  CYS A H    7  
ATOM 4800  H HA   . CYS A 1 6  ? 9.318   3.252   -4.407  1.00 0.00 ? 6  CYS A HA   7  
ATOM 4801  H HB2  . CYS A 1 6  ? 6.431   3.136   -3.591  1.00 0.00 ? 6  CYS A HB2  7  
ATOM 4802  H HB3  . CYS A 1 6  ? 7.660   2.453   -2.527  1.00 0.00 ? 6  CYS A HB3  7  
ATOM 4803  N N    . CYS A 1 7  ? 8.222   0.768   -5.821  1.00 0.00 ? 7  CYS A N    7  
ATOM 4804  C CA   . CYS A 1 7  ? 8.326   -0.709  -6.006  1.00 0.00 ? 7  CYS A CA   7  
ATOM 4805  C C    . CYS A 1 7  ? 9.559   -1.236  -5.267  1.00 0.00 ? 7  CYS A C    7  
ATOM 4806  O O    . CYS A 1 7  ? 9.455   -2.051  -4.372  1.00 0.00 ? 7  CYS A O    7  
ATOM 4807  C CB   . CYS A 1 7  ? 8.452   -1.029  -7.497  1.00 0.00 ? 7  CYS A CB   7  
ATOM 4808  S SG   . CYS A 1 7  ? 7.494   -2.518  -7.873  1.00 0.00 ? 7  CYS A SG   7  
ATOM 4809  H H    . CYS A 1 7  ? 7.974   1.339   -6.578  1.00 0.00 ? 7  CYS A H    7  
ATOM 4810  H HA   . CYS A 1 7  ? 7.442   -1.184  -5.612  1.00 0.00 ? 7  CYS A HA   7  
ATOM 4811  H HB2  . CYS A 1 7  ? 8.073   -0.201  -8.076  1.00 0.00 ? 7  CYS A HB2  7  
ATOM 4812  H HB3  . CYS A 1 7  ? 9.490   -1.197  -7.743  1.00 0.00 ? 7  CYS A HB3  7  
ATOM 4813  N N    . THR A 1 8  ? 10.725  -0.777  -5.632  1.00 0.00 ? 8  THR A N    7  
ATOM 4814  C CA   . THR A 1 8  ? 11.962  -1.254  -4.950  1.00 0.00 ? 8  THR A CA   7  
ATOM 4815  C C    . THR A 1 8  ? 11.730  -1.299  -3.437  1.00 0.00 ? 8  THR A C    7  
ATOM 4816  O O    . THR A 1 8  ? 11.536  -0.283  -2.799  1.00 0.00 ? 8  THR A O    7  
ATOM 4817  C CB   . THR A 1 8  ? 13.116  -0.298  -5.260  1.00 0.00 ? 8  THR A CB   7  
ATOM 4818  O OG1  . THR A 1 8  ? 12.713  0.618   -6.268  1.00 0.00 ? 8  THR A OG1  7  
ATOM 4819  C CG2  . THR A 1 8  ? 14.326  -1.097  -5.748  1.00 0.00 ? 8  THR A CG2  7  
ATOM 4820  H H    . THR A 1 8  ? 10.788  -0.120  -6.356  1.00 0.00 ? 8  THR A H    7  
ATOM 4821  H HA   . THR A 1 8  ? 12.210  -2.244  -5.305  1.00 0.00 ? 8  THR A HA   7  
ATOM 4822  H HB   . THR A 1 8  ? 13.385  0.244   -4.367  1.00 0.00 ? 8  THR A HB   7  
ATOM 4823  H HG1  . THR A 1 8  ? 12.610  0.130   -7.089  1.00 0.00 ? 8  THR A HG1  7  
ATOM 4824  H HG21 . THR A 1 8  ? 14.574  -1.855  -5.019  1.00 0.00 ? 8  THR A HG21 7  
ATOM 4825  H HG22 . THR A 1 8  ? 15.167  -0.433  -5.877  1.00 0.00 ? 8  THR A HG22 7  
ATOM 4826  H HG23 . THR A 1 8  ? 14.090  -1.568  -6.690  1.00 0.00 ? 8  THR A HG23 7  
ATOM 4827  N N    . SER A 1 9  ? 11.748  -2.470  -2.860  1.00 0.00 ? 9  SER A N    7  
ATOM 4828  C CA   . SER A 1 9  ? 11.529  -2.583  -1.389  1.00 0.00 ? 9  SER A CA   7  
ATOM 4829  C C    . SER A 1 9  ? 10.377  -1.667  -0.971  1.00 0.00 ? 9  SER A C    7  
ATOM 4830  O O    . SER A 1 9  ? 9.419   -1.492  -1.698  1.00 0.00 ? 9  SER A O    7  
ATOM 4831  C CB   . SER A 1 9  ? 12.800  -2.169  -0.650  1.00 0.00 ? 9  SER A CB   7  
ATOM 4832  O OG   . SER A 1 9  ? 13.928  -2.416  -1.478  1.00 0.00 ? 9  SER A OG   7  
ATOM 4833  H H    . SER A 1 9  ? 11.907  -3.276  -3.394  1.00 0.00 ? 9  SER A H    7  
ATOM 4834  H HA   . SER A 1 9  ? 11.284  -3.605  -1.139  1.00 0.00 ? 9  SER A HA   7  
ATOM 4835  H HB2  . SER A 1 9  ? 12.753  -1.119  -0.414  1.00 0.00 ? 9  SER A HB2  7  
ATOM 4836  H HB3  . SER A 1 9  ? 12.879  -2.738  0.267   1.00 0.00 ? 9  SER A HB3  7  
ATOM 4837  H HG   . SER A 1 9  ? 14.084  -1.631  -2.008  1.00 0.00 ? 9  SER A HG   7  
ATOM 4838  N N    . ILE A 1 10 ? 10.457  -1.081  0.195   1.00 0.00 ? 10 ILE A N    7  
ATOM 4839  C CA   . ILE A 1 10 ? 9.358   -0.183  0.645   1.00 0.00 ? 10 ILE A CA   7  
ATOM 4840  C C    . ILE A 1 10 ? 9.909   1.191   1.006   1.00 0.00 ? 10 ILE A C    7  
ATOM 4841  O O    . ILE A 1 10 ? 10.888  1.312   1.715   1.00 0.00 ? 10 ILE A O    7  
ATOM 4842  C CB   . ILE A 1 10 ? 8.683   -0.766  1.891   1.00 0.00 ? 10 ILE A CB   7  
ATOM 4843  C CG1  . ILE A 1 10 ? 7.390   0.016   2.158   1.00 0.00 ? 10 ILE A CG1  7  
ATOM 4844  C CG2  . ILE A 1 10 ? 9.628   -0.638  3.092   1.00 0.00 ? 10 ILE A CG2  7  
ATOM 4845  C CD1  . ILE A 1 10 ? 6.940   -0.187  3.605   1.00 0.00 ? 10 ILE A CD1  7  
ATOM 4846  H H    . ILE A 1 10 ? 11.233  -1.232  0.772   1.00 0.00 ? 10 ILE A H    7  
ATOM 4847  H HA   . ILE A 1 10 ? 8.628   -0.084  -0.144  1.00 0.00 ? 10 ILE A HA   7  
ATOM 4848  H HB   . ILE A 1 10 ? 8.452   -1.806  1.730   1.00 0.00 ? 10 ILE A HB   7  
ATOM 4849  H HG12 . ILE A 1 10 ? 7.565   1.067   1.982   1.00 0.00 ? 10 ILE A HG12 7  
ATOM 4850  H HG13 . ILE A 1 10 ? 6.616   -0.333  1.491   1.00 0.00 ? 10 ILE A HG13 7  
ATOM 4851  H HG21 . ILE A 1 10 ? 9.831   0.406   3.281   1.00 0.00 ? 10 ILE A HG21 7  
ATOM 4852  H HG22 . ILE A 1 10 ? 10.554  -1.152  2.879   1.00 0.00 ? 10 ILE A HG22 7  
ATOM 4853  H HG23 . ILE A 1 10 ? 9.165   -1.077  3.963   1.00 0.00 ? 10 ILE A HG23 7  
ATOM 4854  H HD11 . ILE A 1 10 ? 5.866   -0.102  3.663   1.00 0.00 ? 10 ILE A HD11 7  
ATOM 4855  H HD12 . ILE A 1 10 ? 7.396   0.566   4.230   1.00 0.00 ? 10 ILE A HD12 7  
ATOM 4856  H HD13 . ILE A 1 10 ? 7.243   -1.167  3.941   1.00 0.00 ? 10 ILE A HD13 7  
ATOM 4857  N N    . CYS A 1 11 ? 9.261   2.230   0.569   1.00 0.00 ? 11 CYS A N    7  
ATOM 4858  C CA   . CYS A 1 11 ? 9.725   3.584   0.947   1.00 0.00 ? 11 CYS A CA   7  
ATOM 4859  C C    . CYS A 1 11 ? 8.833   4.050   2.093   1.00 0.00 ? 11 CYS A C    7  
ATOM 4860  O O    . CYS A 1 11 ? 7.632   4.148   1.946   1.00 0.00 ? 11 CYS A O    7  
ATOM 4861  C CB   . CYS A 1 11 ? 9.591   4.537   -0.245  1.00 0.00 ? 11 CYS A CB   7  
ATOM 4862  S SG   . CYS A 1 11 ? 7.849   4.673   -0.722  1.00 0.00 ? 11 CYS A SG   7  
ATOM 4863  H H    . CYS A 1 11 ? 8.450   2.117   0.029   1.00 0.00 ? 11 CYS A H    7  
ATOM 4864  H HA   . CYS A 1 11 ? 10.754  3.542   1.275   1.00 0.00 ? 11 CYS A HA   7  
ATOM 4865  H HB2  . CYS A 1 11 ? 9.965   5.512   0.030   1.00 0.00 ? 11 CYS A HB2  7  
ATOM 4866  H HB3  . CYS A 1 11 ? 10.163  4.155   -1.078  1.00 0.00 ? 11 CYS A HB3  7  
ATOM 4867  N N    . SER A 1 12 ? 9.405   4.321   3.233   1.00 0.00 ? 12 SER A N    7  
ATOM 4868  C CA   . SER A 1 12 ? 8.591   4.758   4.397   1.00 0.00 ? 12 SER A CA   7  
ATOM 4869  C C    . SER A 1 12 ? 7.280   3.965   4.439   1.00 0.00 ? 12 SER A C    7  
ATOM 4870  O O    . SER A 1 12 ? 6.305   4.342   3.827   1.00 0.00 ? 12 SER A O    7  
ATOM 4871  C CB   . SER A 1 12 ? 8.278   6.249   4.267   1.00 0.00 ? 12 SER A CB   7  
ATOM 4872  O OG   . SER A 1 12 ? 7.149   6.564   5.071   1.00 0.00 ? 12 SER A OG   7  
ATOM 4873  H H    . SER A 1 12 ? 10.369  4.224   3.329   1.00 0.00 ? 12 SER A H    7  
ATOM 4874  H HA   . SER A 1 12 ? 9.144   4.586   5.308   1.00 0.00 ? 12 SER A HA   7  
ATOM 4875  H HB2  . SER A 1 12 ? 9.124   6.827   4.601   1.00 0.00 ? 12 SER A HB2  7  
ATOM 4876  H HB3  . SER A 1 12 ? 8.071   6.484   3.231   1.00 0.00 ? 12 SER A HB3  7  
ATOM 4877  H HG   . SER A 1 12 ? 7.428   6.555   5.990   1.00 0.00 ? 12 SER A HG   7  
ATOM 4878  N N    . LEU A 1 13 ? 7.228   2.881   5.168   1.00 0.00 ? 13 LEU A N    7  
ATOM 4879  C CA   . LEU A 1 13 ? 5.948   2.123   5.232   1.00 0.00 ? 13 LEU A CA   7  
ATOM 4880  C C    . LEU A 1 13 ? 4.884   3.122   5.638   1.00 0.00 ? 13 LEU A C    7  
ATOM 4881  O O    . LEU A 1 13 ? 3.738   3.042   5.241   1.00 0.00 ? 13 LEU A O    7  
ATOM 4882  C CB   . LEU A 1 13 ? 6.046   1.007   6.275   1.00 0.00 ? 13 LEU A CB   7  
ATOM 4883  C CG   . LEU A 1 13 ? 4.707   0.272   6.363   1.00 0.00 ? 13 LEU A CG   7  
ATOM 4884  C CD1  . LEU A 1 13 ? 4.957   -1.231  6.498   1.00 0.00 ? 13 LEU A CD1  7  
ATOM 4885  C CD2  . LEU A 1 13 ? 3.932   0.771   7.585   1.00 0.00 ? 13 LEU A CD2  7  
ATOM 4886  H H    . LEU A 1 13 ? 8.009   2.582   5.675   1.00 0.00 ? 13 LEU A H    7  
ATOM 4887  H HA   . LEU A 1 13 ? 5.706   1.714   4.263   1.00 0.00 ? 13 LEU A HA   7  
ATOM 4888  H HB2  . LEU A 1 13 ? 6.821   0.312   5.988   1.00 0.00 ? 13 LEU A HB2  7  
ATOM 4889  H HB3  . LEU A 1 13 ? 6.283   1.434   7.238   1.00 0.00 ? 13 LEU A HB3  7  
ATOM 4890  H HG   . LEU A 1 13 ? 4.133   0.463   5.468   1.00 0.00 ? 13 LEU A HG   7  
ATOM 4891  H HD11 . LEU A 1 13 ? 5.405   -1.436  7.459   1.00 0.00 ? 13 LEU A HD11 7  
ATOM 4892  H HD12 . LEU A 1 13 ? 5.623   -1.557  5.713   1.00 0.00 ? 13 LEU A HD12 7  
ATOM 4893  H HD13 . LEU A 1 13 ? 4.019   -1.760  6.418   1.00 0.00 ? 13 LEU A HD13 7  
ATOM 4894  H HD21 . LEU A 1 13 ? 3.760   -0.052  8.263   1.00 0.00 ? 13 LEU A HD21 7  
ATOM 4895  H HD22 . LEU A 1 13 ? 2.984   1.180   7.268   1.00 0.00 ? 13 LEU A HD22 7  
ATOM 4896  H HD23 . LEU A 1 13 ? 4.505   1.537   8.087   1.00 0.00 ? 13 LEU A HD23 7  
ATOM 4897  N N    . TYR A 1 14 ? 5.284   4.094   6.397   1.00 0.00 ? 14 TYR A N    7  
ATOM 4898  C CA   . TYR A 1 14 ? 4.334   5.155   6.810   1.00 0.00 ? 14 TYR A CA   7  
ATOM 4899  C C    . TYR A 1 14 ? 3.830   5.838   5.541   1.00 0.00 ? 14 TYR A C    7  
ATOM 4900  O O    . TYR A 1 14 ? 2.691   6.250   5.453   1.00 0.00 ? 14 TYR A O    7  
ATOM 4901  C CB   . TYR A 1 14 ? 5.048   6.174   7.701   1.00 0.00 ? 14 TYR A CB   7  
ATOM 4902  C CG   . TYR A 1 14 ? 5.750   5.454   8.827   1.00 0.00 ? 14 TYR A CG   7  
ATOM 4903  C CD1  . TYR A 1 14 ? 5.003   4.791   9.808   1.00 0.00 ? 14 TYR A CD1  7  
ATOM 4904  C CD2  . TYR A 1 14 ? 7.148   5.451   8.891   1.00 0.00 ? 14 TYR A CD2  7  
ATOM 4905  C CE1  . TYR A 1 14 ? 5.654   4.124   10.852  1.00 0.00 ? 14 TYR A CE1  7  
ATOM 4906  C CE2  . TYR A 1 14 ? 7.800   4.784   9.935   1.00 0.00 ? 14 TYR A CE2  7  
ATOM 4907  C CZ   . TYR A 1 14 ? 7.053   4.121   10.916  1.00 0.00 ? 14 TYR A CZ   7  
ATOM 4908  O OH   . TYR A 1 14 ? 7.695   3.464   11.946  1.00 0.00 ? 14 TYR A OH   7  
ATOM 4909  H H    . TYR A 1 14 ? 6.225   4.139   6.666   1.00 0.00 ? 14 TYR A H    7  
ATOM 4910  H HA   . TYR A 1 14 ? 3.504   4.716   7.342   1.00 0.00 ? 14 TYR A HA   7  
ATOM 4911  H HB2  . TYR A 1 14 ? 5.772   6.719   7.114   1.00 0.00 ? 14 TYR A HB2  7  
ATOM 4912  H HB3  . TYR A 1 14 ? 4.324   6.863   8.110   1.00 0.00 ? 14 TYR A HB3  7  
ATOM 4913  H HD1  . TYR A 1 14 ? 3.924   4.794   9.759   1.00 0.00 ? 14 TYR A HD1  7  
ATOM 4914  H HD2  . TYR A 1 14 ? 7.725   5.962   8.134   1.00 0.00 ? 14 TYR A HD2  7  
ATOM 4915  H HE1  . TYR A 1 14 ? 5.078   3.613   11.609  1.00 0.00 ? 14 TYR A HE1  7  
ATOM 4916  H HE2  . TYR A 1 14 ? 8.879   4.781   9.985   1.00 0.00 ? 14 TYR A HE2  7  
ATOM 4917  H HH   . TYR A 1 14 ? 7.033   3.205   12.591  1.00 0.00 ? 14 TYR A HH   7  
ATOM 4918  N N    . GLN A 1 15 ? 4.673   5.939   4.542   1.00 0.00 ? 15 GLN A N    7  
ATOM 4919  C CA   . GLN A 1 15 ? 4.237   6.569   3.266   1.00 0.00 ? 15 GLN A CA   7  
ATOM 4920  C C    . GLN A 1 15 ? 3.191   5.662   2.617   1.00 0.00 ? 15 GLN A C    7  
ATOM 4921  O O    . GLN A 1 15 ? 2.140   6.110   2.204   1.00 0.00 ? 15 GLN A O    7  
ATOM 4922  C CB   . GLN A 1 15 ? 5.435   6.732   2.326   1.00 0.00 ? 15 GLN A CB   7  
ATOM 4923  C CG   . GLN A 1 15 ? 6.063   8.112   2.534   1.00 0.00 ? 15 GLN A CG   7  
ATOM 4924  C CD   . GLN A 1 15 ? 5.385   9.127   1.612   1.00 0.00 ? 15 GLN A CD   7  
ATOM 4925  O OE1  . GLN A 1 15 ? 5.315   8.926   0.416   1.00 0.00 ? 15 GLN A OE1  7  
ATOM 4926  N NE2  . GLN A 1 15 ? 4.880   10.217  2.121   1.00 0.00 ? 15 GLN A NE2  7  
ATOM 4927  H H    . GLN A 1 15 ? 5.588   5.581   4.629   1.00 0.00 ? 15 GLN A H    7  
ATOM 4928  H HA   . GLN A 1 15 ? 3.800   7.535   3.470   1.00 0.00 ? 15 GLN A HA   7  
ATOM 4929  H HB2  . GLN A 1 15 ? 6.167   5.967   2.536   1.00 0.00 ? 15 GLN A HB2  7  
ATOM 4930  H HB3  . GLN A 1 15 ? 5.104   6.642   1.302   1.00 0.00 ? 15 GLN A HB3  7  
ATOM 4931  H HG2  . GLN A 1 15 ? 5.931   8.415   3.563   1.00 0.00 ? 15 GLN A HG2  7  
ATOM 4932  H HG3  . GLN A 1 15 ? 7.117   8.066   2.304   1.00 0.00 ? 15 GLN A HG3  7  
ATOM 4933  H HE21 . GLN A 1 15 ? 4.936   10.379  3.085   1.00 0.00 ? 15 GLN A HE21 7  
ATOM 4934  H HE22 . GLN A 1 15 ? 4.443   10.873  1.538   1.00 0.00 ? 15 GLN A HE22 7  
ATOM 4935  N N    . LEU A 1 16 ? 3.456   4.381   2.549   1.00 0.00 ? 16 LEU A N    7  
ATOM 4936  C CA   . LEU A 1 16 ? 2.456   3.454   1.959   1.00 0.00 ? 16 LEU A CA   7  
ATOM 4937  C C    . LEU A 1 16 ? 1.241   3.452   2.878   1.00 0.00 ? 16 LEU A C    7  
ATOM 4938  O O    . LEU A 1 16 ? 0.113   3.577   2.443   1.00 0.00 ? 16 LEU A O    7  
ATOM 4939  C CB   . LEU A 1 16 ? 3.044   2.044   1.871   1.00 0.00 ? 16 LEU A CB   7  
ATOM 4940  C CG   . LEU A 1 16 ? 3.215   1.652   0.403   1.00 0.00 ? 16 LEU A CG   7  
ATOM 4941  C CD1  . LEU A 1 16 ? 1.845   1.592   -0.273  1.00 0.00 ? 16 LEU A CD1  7  
ATOM 4942  C CD2  . LEU A 1 16 ? 4.086   2.694   -0.303  1.00 0.00 ? 16 LEU A CD2  7  
ATOM 4943  H H    . LEU A 1 16 ? 4.296   4.030   2.909   1.00 0.00 ? 16 LEU A H    7  
ATOM 4944  H HA   . LEU A 1 16 ? 2.172   3.799   0.975   1.00 0.00 ? 16 LEU A HA   7  
ATOM 4945  H HB2  . LEU A 1 16 ? 4.005   2.023   2.365   1.00 0.00 ? 16 LEU A HB2  7  
ATOM 4946  H HB3  . LEU A 1 16 ? 2.376   1.345   2.353   1.00 0.00 ? 16 LEU A HB3  7  
ATOM 4947  H HG   . LEU A 1 16 ? 3.689   0.683   0.342   1.00 0.00 ? 16 LEU A HG   7  
ATOM 4948  H HD11 . LEU A 1 16 ? 1.330   0.694   0.035   1.00 0.00 ? 16 LEU A HD11 7  
ATOM 4949  H HD12 . LEU A 1 16 ? 1.972   1.584   -1.346  1.00 0.00 ? 16 LEU A HD12 7  
ATOM 4950  H HD13 . LEU A 1 16 ? 1.263   2.456   0.013   1.00 0.00 ? 16 LEU A HD13 7  
ATOM 4951  H HD21 . LEU A 1 16 ? 4.004   3.640   0.211   1.00 0.00 ? 16 LEU A HD21 7  
ATOM 4952  H HD22 . LEU A 1 16 ? 3.754   2.809   -1.324  1.00 0.00 ? 16 LEU A HD22 7  
ATOM 4953  H HD23 . LEU A 1 16 ? 5.116   2.368   -0.294  1.00 0.00 ? 16 LEU A HD23 7  
ATOM 4954  N N    . GLU A 1 17 ? 1.472   3.337   4.157   1.00 0.00 ? 17 GLU A N    7  
ATOM 4955  C CA   . GLU A 1 17 ? 0.342   3.356   5.123   1.00 0.00 ? 17 GLU A CA   7  
ATOM 4956  C C    . GLU A 1 17 ? -0.360  4.711   5.029   1.00 0.00 ? 17 GLU A C    7  
ATOM 4957  O O    . GLU A 1 17 ? -1.568  4.807   5.123   1.00 0.00 ? 17 GLU A O    7  
ATOM 4958  C CB   . GLU A 1 17 ? 0.878   3.152   6.542   1.00 0.00 ? 17 GLU A CB   7  
ATOM 4959  C CG   . GLU A 1 17 ? 0.064   2.065   7.247   1.00 0.00 ? 17 GLU A CG   7  
ATOM 4960  C CD   . GLU A 1 17 ? -0.934  2.716   8.207   1.00 0.00 ? 17 GLU A CD   7  
ATOM 4961  O OE1  . GLU A 1 17 ? -1.938  3.222   7.734   1.00 0.00 ? 17 GLU A OE1  7  
ATOM 4962  O OE2  . GLU A 1 17 ? -0.677  2.696   9.400   1.00 0.00 ? 17 GLU A OE2  7  
ATOM 4963  H H    . GLU A 1 17 ? 2.397   3.252   4.483   1.00 0.00 ? 17 GLU A H    7  
ATOM 4964  H HA   . GLU A 1 17 ? -0.355  2.573   4.881   1.00 0.00 ? 17 GLU A HA   7  
ATOM 4965  H HB2  . GLU A 1 17 ? 1.915   2.853   6.495   1.00 0.00 ? 17 GLU A HB2  7  
ATOM 4966  H HB3  . GLU A 1 17 ? 0.794   4.076   7.094   1.00 0.00 ? 17 GLU A HB3  7  
ATOM 4967  H HG2  . GLU A 1 17 ? -0.470  1.483   6.511   1.00 0.00 ? 17 GLU A HG2  7  
ATOM 4968  H HG3  . GLU A 1 17 ? 0.728   1.422   7.803   1.00 0.00 ? 17 GLU A HG3  7  
ATOM 4969  N N    . ASN A 1 18 ? 0.393   5.758   4.837   1.00 0.00 ? 18 ASN A N    7  
ATOM 4970  C CA   . ASN A 1 18 ? -0.216  7.112   4.728   1.00 0.00 ? 18 ASN A CA   7  
ATOM 4971  C C    . ASN A 1 18 ? -1.023  7.207   3.430   1.00 0.00 ? 18 ASN A C    7  
ATOM 4972  O O    . ASN A 1 18 ? -1.887  8.049   3.288   1.00 0.00 ? 18 ASN A O    7  
ATOM 4973  C CB   . ASN A 1 18 ? 0.890   8.169   4.719   1.00 0.00 ? 18 ASN A CB   7  
ATOM 4974  C CG   . ASN A 1 18 ? 1.321   8.470   6.155   1.00 0.00 ? 18 ASN A CG   7  
ATOM 4975  O OD1  . ASN A 1 18 ? 0.744   7.959   7.095   1.00 0.00 ? 18 ASN A OD1  7  
ATOM 4976  N ND2  . ASN A 1 18 ? 2.320   9.283   6.367   1.00 0.00 ? 18 ASN A ND2  7  
ATOM 4977  H H    . ASN A 1 18 ? 1.364   5.652   4.760   1.00 0.00 ? 18 ASN A H    7  
ATOM 4978  H HA   . ASN A 1 18 ? -0.869  7.282   5.571   1.00 0.00 ? 18 ASN A HA   7  
ATOM 4979  H HB2  . ASN A 1 18 ? 1.736   7.800   4.157   1.00 0.00 ? 18 ASN A HB2  7  
ATOM 4980  H HB3  . ASN A 1 18 ? 0.520   9.073   4.259   1.00 0.00 ? 18 ASN A HB3  7  
ATOM 4981  H HD21 . ASN A 1 18 ? 2.785   9.694   5.609   1.00 0.00 ? 18 ASN A HD21 7  
ATOM 4982  H HD22 . ASN A 1 18 ? 2.603   9.482   7.283   1.00 0.00 ? 18 ASN A HD22 7  
ATOM 4983  N N    . TYR A 1 19 ? -0.752  6.350   2.481   1.00 0.00 ? 19 TYR A N    7  
ATOM 4984  C CA   . TYR A 1 19 ? -1.511  6.399   1.201   1.00 0.00 ? 19 TYR A CA   7  
ATOM 4985  C C    . TYR A 1 19 ? -2.998  6.479   1.522   1.00 0.00 ? 19 TYR A C    7  
ATOM 4986  O O    . TYR A 1 19 ? -3.708  7.335   1.033   1.00 0.00 ? 19 TYR A O    7  
ATOM 4987  C CB   . TYR A 1 19 ? -1.232  5.131   0.387   1.00 0.00 ? 19 TYR A CB   7  
ATOM 4988  C CG   . TYR A 1 19 ? -2.090  5.125   -0.857  1.00 0.00 ? 19 TYR A CG   7  
ATOM 4989  C CD1  . TYR A 1 19 ? -2.536  6.333   -1.407  1.00 0.00 ? 19 TYR A CD1  7  
ATOM 4990  C CD2  . TYR A 1 19 ? -2.437  3.911   -1.462  1.00 0.00 ? 19 TYR A CD2  7  
ATOM 4991  C CE1  . TYR A 1 19 ? -3.328  6.327   -2.561  1.00 0.00 ? 19 TYR A CE1  7  
ATOM 4992  C CE2  . TYR A 1 19 ? -3.229  3.905   -2.616  1.00 0.00 ? 19 TYR A CE2  7  
ATOM 4993  C CZ   . TYR A 1 19 ? -3.674  5.113   -3.166  1.00 0.00 ? 19 TYR A CZ   7  
ATOM 4994  O OH   . TYR A 1 19 ? -4.455  5.107   -4.304  1.00 0.00 ? 19 TYR A OH   7  
ATOM 4995  H H    . TYR A 1 19 ? -0.059  5.673   2.614   1.00 0.00 ? 19 TYR A H    7  
ATOM 4996  H HA   . TYR A 1 19 ? -1.213  7.269   0.635   1.00 0.00 ? 19 TYR A HA   7  
ATOM 4997  H HB2  . TYR A 1 19 ? -0.190  5.106   0.103   1.00 0.00 ? 19 TYR A HB2  7  
ATOM 4998  H HB3  . TYR A 1 19 ? -1.463  4.261   0.984   1.00 0.00 ? 19 TYR A HB3  7  
ATOM 4999  H HD1  . TYR A 1 19 ? -2.270  7.269   -0.940  1.00 0.00 ? 19 TYR A HD1  7  
ATOM 5000  H HD2  . TYR A 1 19 ? -2.094  2.978   -1.037  1.00 0.00 ? 19 TYR A HD2  7  
ATOM 5001  H HE1  . TYR A 1 19 ? -3.671  7.258   -2.985  1.00 0.00 ? 19 TYR A HE1  7  
ATOM 5002  H HE2  . TYR A 1 19 ? -3.496  2.968   -3.083  1.00 0.00 ? 19 TYR A HE2  7  
ATOM 5003  H HH   . TYR A 1 19 ? -4.148  5.813   -4.878  1.00 0.00 ? 19 TYR A HH   7  
ATOM 5004  N N    . CYS A 1 20 ? -3.465  5.591   2.354   1.00 0.00 ? 20 CYS A N    7  
ATOM 5005  C CA   . CYS A 1 20 ? -4.906  5.596   2.734   1.00 0.00 ? 20 CYS A CA   7  
ATOM 5006  C C    . CYS A 1 20 ? -5.768  5.889   1.502   1.00 0.00 ? 20 CYS A C    7  
ATOM 5007  O O    . CYS A 1 20 ? -5.313  5.798   0.379   1.00 0.00 ? 20 CYS A O    7  
ATOM 5008  C CB   . CYS A 1 20 ? -5.141  6.665   3.803   1.00 0.00 ? 20 CYS A CB   7  
ATOM 5009  S SG   . CYS A 1 20 ? -4.399  6.120   5.363   1.00 0.00 ? 20 CYS A SG   7  
ATOM 5010  H H    . CYS A 1 20 ? -2.858  4.921   2.737   1.00 0.00 ? 20 CYS A H    7  
ATOM 5011  H HA   . CYS A 1 20 ? -5.171  4.631   3.133   1.00 0.00 ? 20 CYS A HA   7  
ATOM 5012  H HB2  . CYS A 1 20 ? -4.686  7.593   3.492   1.00 0.00 ? 20 CYS A HB2  7  
ATOM 5013  H HB3  . CYS A 1 20 ? -6.201  6.812   3.942   1.00 0.00 ? 20 CYS A HB3  7  
ATOM 5014  N N    . ASN A 1 21 ? -7.012  6.232   1.699   1.00 0.00 ? 21 ASN A N    7  
ATOM 5015  C CA   . ASN A 1 21 ? -7.896  6.524   0.536   1.00 0.00 ? 21 ASN A CA   7  
ATOM 5016  C C    . ASN A 1 21 ? -7.789  8.007   0.173   1.00 0.00 ? 21 ASN A C    7  
ATOM 5017  O O    . ASN A 1 21 ? -7.281  8.299   -0.898  1.00 0.00 ? 21 ASN A O    7  
ATOM 5018  C CB   . ASN A 1 21 ? -9.345  6.192   0.900   1.00 0.00 ? 21 ASN A CB   7  
ATOM 5019  C CG   . ASN A 1 21 ? -9.693  6.835   2.244   1.00 0.00 ? 21 ASN A CG   7  
ATOM 5020  O OD1  . ASN A 1 21 ? -9.003  6.634   3.224   1.00 0.00 ? 21 ASN A OD1  7  
ATOM 5021  N ND2  . ASN A 1 21 ? -10.744 7.604   2.333   1.00 0.00 ? 21 ASN A ND2  7  
ATOM 5022  O OXT  . ASN A 1 21 ? -8.216  8.824   0.971   1.00 0.00 ? 21 ASN A OXT  7  
ATOM 5023  H H    . ASN A 1 21 ? -7.366  6.295   2.610   1.00 0.00 ? 21 ASN A H    7  
ATOM 5024  H HA   . ASN A 1 21 ? -7.591  5.924   -0.309  1.00 0.00 ? 21 ASN A HA   7  
ATOM 5025  H HB2  . ASN A 1 21 ? -10.005 6.575   0.135   1.00 0.00 ? 21 ASN A HB2  7  
ATOM 5026  H HB3  . ASN A 1 21 ? -9.460  5.122   0.974   1.00 0.00 ? 21 ASN A HB3  7  
ATOM 5027  H HD21 . ASN A 1 21 ? -11.301 7.766   1.543   1.00 0.00 ? 21 ASN A HD21 7  
ATOM 5028  H HD22 . ASN A 1 21 ? -10.975 8.020   3.189   1.00 0.00 ? 21 ASN A HD22 7  
ATOM 5029  N N    . PHE B 2 1  ? 12.522  -0.902  10.306  1.00 0.00 ? 1  PHE B N    7  
ATOM 5030  C CA   . PHE B 2 1  ? 11.301  -1.262  9.531   1.00 0.00 ? 1  PHE B CA   7  
ATOM 5031  C C    . PHE B 2 1  ? 11.682  -2.208  8.390   1.00 0.00 ? 1  PHE B C    7  
ATOM 5032  O O    . PHE B 2 1  ? 12.845  -2.443  8.128   1.00 0.00 ? 1  PHE B O    7  
ATOM 5033  C CB   . PHE B 2 1  ? 10.671  0.006   8.953   1.00 0.00 ? 1  PHE B CB   7  
ATOM 5034  C CG   . PHE B 2 1  ? 11.756  0.909   8.418   1.00 0.00 ? 1  PHE B CG   7  
ATOM 5035  C CD1  . PHE B 2 1  ? 12.437  1.774   9.283   1.00 0.00 ? 1  PHE B CD1  7  
ATOM 5036  C CD2  . PHE B 2 1  ? 12.082  0.881   7.057   1.00 0.00 ? 1  PHE B CD2  7  
ATOM 5037  C CE1  . PHE B 2 1  ? 13.444  2.611   8.787   1.00 0.00 ? 1  PHE B CE1  7  
ATOM 5038  C CE2  . PHE B 2 1  ? 13.089  1.718   6.560   1.00 0.00 ? 1  PHE B CE2  7  
ATOM 5039  C CZ   . PHE B 2 1  ? 13.769  2.582   7.425   1.00 0.00 ? 1  PHE B CZ   7  
ATOM 5040  H H1   . PHE B 2 1  ? 13.250  -0.541  9.659   1.00 0.00 ? 1  PHE B H1   7  
ATOM 5041  H H2   . PHE B 2 1  ? 12.881  -1.746  10.799  1.00 0.00 ? 1  PHE B H2   7  
ATOM 5042  H H3   . PHE B 2 1  ? 12.286  -0.167  11.003  1.00 0.00 ? 1  PHE B H3   7  
ATOM 5043  H HA   . PHE B 2 1  ? 10.592  -1.752  10.183  1.00 0.00 ? 1  PHE B HA   7  
ATOM 5044  H HB2  . PHE B 2 1  ? 9.996   -0.260  8.153   1.00 0.00 ? 1  PHE B HB2  7  
ATOM 5045  H HB3  . PHE B 2 1  ? 10.124  0.523   9.729   1.00 0.00 ? 1  PHE B HB3  7  
ATOM 5046  H HD1  . PHE B 2 1  ? 12.185  1.796   10.333  1.00 0.00 ? 1  PHE B HD1  7  
ATOM 5047  H HD2  . PHE B 2 1  ? 11.557  0.214   6.390   1.00 0.00 ? 1  PHE B HD2  7  
ATOM 5048  H HE1  . PHE B 2 1  ? 13.969  3.278   9.454   1.00 0.00 ? 1  PHE B HE1  7  
ATOM 5049  H HE2  . PHE B 2 1  ? 13.340  1.696   5.510   1.00 0.00 ? 1  PHE B HE2  7  
ATOM 5050  H HZ   . PHE B 2 1  ? 14.546  3.228   7.043   1.00 0.00 ? 1  PHE B HZ   7  
ATOM 5051  N N    . VAL B 2 2  ? 10.711  -2.753  7.710   1.00 0.00 ? 2  VAL B N    7  
ATOM 5052  C CA   . VAL B 2 2  ? 11.019  -3.682  6.587   1.00 0.00 ? 2  VAL B CA   7  
ATOM 5053  C C    . VAL B 2 2  ? 9.886   -3.635  5.559   1.00 0.00 ? 2  VAL B C    7  
ATOM 5054  O O    . VAL B 2 2  ? 8.724   -3.550  5.905   1.00 0.00 ? 2  VAL B O    7  
ATOM 5055  C CB   . VAL B 2 2  ? 11.158  -5.107  7.126   1.00 0.00 ? 2  VAL B CB   7  
ATOM 5056  C CG1  . VAL B 2 2  ? 12.483  -5.241  7.878   1.00 0.00 ? 2  VAL B CG1  7  
ATOM 5057  C CG2  . VAL B 2 2  ? 9.999   -5.406  8.080   1.00 0.00 ? 2  VAL B CG2  7  
ATOM 5058  H H    . VAL B 2 2  ? 9.779   -2.551  7.937   1.00 0.00 ? 2  VAL B H    7  
ATOM 5059  H HA   . VAL B 2 2  ? 11.944  -3.384  6.116   1.00 0.00 ? 2  VAL B HA   7  
ATOM 5060  H HB   . VAL B 2 2  ? 11.139  -5.806  6.303   1.00 0.00 ? 2  VAL B HB   7  
ATOM 5061  H HG11 . VAL B 2 2  ? 12.879  -6.236  7.735   1.00 0.00 ? 2  VAL B HG11 7  
ATOM 5062  H HG12 . VAL B 2 2  ? 12.319  -5.067  8.931   1.00 0.00 ? 2  VAL B HG12 7  
ATOM 5063  H HG13 . VAL B 2 2  ? 13.188  -4.516  7.499   1.00 0.00 ? 2  VAL B HG13 7  
ATOM 5064  H HG21 . VAL B 2 2  ? 9.242   -4.643  7.976   1.00 0.00 ? 2  VAL B HG21 7  
ATOM 5065  H HG22 . VAL B 2 2  ? 10.363  -5.415  9.097   1.00 0.00 ? 2  VAL B HG22 7  
ATOM 5066  H HG23 . VAL B 2 2  ? 9.576   -6.370  7.841   1.00 0.00 ? 2  VAL B HG23 7  
ATOM 5067  N N    . ASN B 2 3  ? 10.215  -3.689  4.298   1.00 0.00 ? 3  ASN B N    7  
ATOM 5068  C CA   . ASN B 2 3  ? 9.157   -3.647  3.249   1.00 0.00 ? 3  ASN B CA   7  
ATOM 5069  C C    . ASN B 2 3  ? 8.221   -4.845  3.418   1.00 0.00 ? 3  ASN B C    7  
ATOM 5070  O O    . ASN B 2 3  ? 8.656   -5.974  3.520   1.00 0.00 ? 3  ASN B O    7  
ATOM 5071  C CB   . ASN B 2 3  ? 9.810   -3.703  1.865   1.00 0.00 ? 3  ASN B CB   7  
ATOM 5072  C CG   . ASN B 2 3  ? 10.778  -4.886  1.805   1.00 0.00 ? 3  ASN B CG   7  
ATOM 5073  O OD1  . ASN B 2 3  ? 10.362  -6.022  1.704   1.00 0.00 ? 3  ASN B OD1  7  
ATOM 5074  N ND2  . ASN B 2 3  ? 12.063  -4.664  1.861   1.00 0.00 ? 3  ASN B ND2  7  
ATOM 5075  H H    . ASN B 2 3  ? 11.158  -3.758  4.040   1.00 0.00 ? 3  ASN B H    7  
ATOM 5076  H HA   . ASN B 2 3  ? 8.592   -2.733  3.344   1.00 0.00 ? 3  ASN B HA   7  
ATOM 5077  H HB2  . ASN B 2 3  ? 9.045   -3.824  1.112   1.00 0.00 ? 3  ASN B HB2  7  
ATOM 5078  H HB3  . ASN B 2 3  ? 10.351  -2.787  1.686   1.00 0.00 ? 3  ASN B HB3  7  
ATOM 5079  H HD21 . ASN B 2 3  ? 12.399  -3.747  1.941   1.00 0.00 ? 3  ASN B HD21 7  
ATOM 5080  H HD22 . ASN B 2 3  ? 12.692  -5.415  1.823   1.00 0.00 ? 3  ASN B HD22 7  
ATOM 5081  N N    . GLN B 2 4  ? 6.937   -4.609  3.449   1.00 0.00 ? 4  GLN B N    7  
ATOM 5082  C CA   . GLN B 2 4  ? 5.982   -5.739  3.610   1.00 0.00 ? 4  GLN B CA   7  
ATOM 5083  C C    . GLN B 2 4  ? 5.551   -6.239  2.234   1.00 0.00 ? 4  GLN B C    7  
ATOM 5084  O O    . GLN B 2 4  ? 4.447   -6.711  2.045   1.00 0.00 ? 4  GLN B O    7  
ATOM 5085  C CB   . GLN B 2 4  ? 4.756   -5.273  4.398   1.00 0.00 ? 4  GLN B CB   7  
ATOM 5086  C CG   . GLN B 2 4  ? 3.898   -4.363  3.519   1.00 0.00 ? 4  GLN B CG   7  
ATOM 5087  C CD   . GLN B 2 4  ? 2.991   -3.507  4.404   1.00 0.00 ? 4  GLN B CD   7  
ATOM 5088  O OE1  . GLN B 2 4  ? 3.012   -2.295  4.324   1.00 0.00 ? 4  GLN B OE1  7  
ATOM 5089  N NE2  . GLN B 2 4  ? 2.189   -4.090  5.253   1.00 0.00 ? 4  GLN B NE2  7  
ATOM 5090  H H    . GLN B 2 4  ? 6.604   -3.691  3.364   1.00 0.00 ? 4  GLN B H    7  
ATOM 5091  H HA   . GLN B 2 4  ? 6.469   -6.541  4.139   1.00 0.00 ? 4  GLN B HA   7  
ATOM 5092  H HB2  . GLN B 2 4  ? 4.177   -6.132  4.703   1.00 0.00 ? 4  GLN B HB2  7  
ATOM 5093  H HB3  . GLN B 2 4  ? 5.077   -4.727  5.273   1.00 0.00 ? 4  GLN B HB3  7  
ATOM 5094  H HG2  . GLN B 2 4  ? 4.539   -3.721  2.931   1.00 0.00 ? 4  GLN B HG2  7  
ATOM 5095  H HG3  . GLN B 2 4  ? 3.290   -4.966  2.861   1.00 0.00 ? 4  GLN B HG3  7  
ATOM 5096  H HE21 . GLN B 2 4  ? 2.173   -5.068  5.319   1.00 0.00 ? 4  GLN B HE21 7  
ATOM 5097  H HE22 . GLN B 2 4  ? 1.604   -3.551  5.825   1.00 0.00 ? 4  GLN B HE22 7  
ATOM 5098  N N    . HIS B 2 5  ? 6.425   -6.145  1.276   1.00 0.00 ? 5  HIS B N    7  
ATOM 5099  C CA   . HIS B 2 5  ? 6.091   -6.619  -0.094  1.00 0.00 ? 5  HIS B CA   7  
ATOM 5100  C C    . HIS B 2 5  ? 7.384   -6.925  -0.855  1.00 0.00 ? 5  HIS B C    7  
ATOM 5101  O O    . HIS B 2 5  ? 8.453   -6.977  -0.279  1.00 0.00 ? 5  HIS B O    7  
ATOM 5102  C CB   . HIS B 2 5  ? 5.299   -5.541  -0.835  1.00 0.00 ? 5  HIS B CB   7  
ATOM 5103  C CG   . HIS B 2 5  ? 5.824   -4.186  -0.456  1.00 0.00 ? 5  HIS B CG   7  
ATOM 5104  N ND1  . HIS B 2 5  ? 7.172   -3.874  -0.519  1.00 0.00 ? 5  HIS B ND1  7  
ATOM 5105  C CD2  . HIS B 2 5  ? 5.197   -3.052  -0.004  1.00 0.00 ? 5  HIS B CD2  7  
ATOM 5106  C CE1  . HIS B 2 5  ? 7.310   -2.599  -0.115  1.00 0.00 ? 5  HIS B CE1  7  
ATOM 5107  N NE2  . HIS B 2 5  ? 6.138   -2.051  0.211   1.00 0.00 ? 5  HIS B NE2  7  
ATOM 5108  H H    . HIS B 2 5  ? 7.304   -5.768  1.463   1.00 0.00 ? 5  HIS B H    7  
ATOM 5109  H HA   . HIS B 2 5  ? 5.500   -7.514  -0.022  1.00 0.00 ? 5  HIS B HA   7  
ATOM 5110  H HB2  . HIS B 2 5  ? 5.406   -5.683  -1.901  1.00 0.00 ? 5  HIS B HB2  7  
ATOM 5111  H HB3  . HIS B 2 5  ? 4.256   -5.610  -0.565  1.00 0.00 ? 5  HIS B HB3  7  
ATOM 5112  H HD1  . HIS B 2 5  ? 7.892   -4.472  -0.807  1.00 0.00 ? 5  HIS B HD1  7  
ATOM 5113  H HD2  . HIS B 2 5  ? 4.135   -2.952  0.159   1.00 0.00 ? 5  HIS B HD2  7  
ATOM 5114  H HE1  . HIS B 2 5  ? 8.256   -2.085  -0.051  1.00 0.00 ? 5  HIS B HE1  7  
ATOM 5115  N N    . LEU B 2 6  ? 7.300   -7.133  -2.142  1.00 0.00 ? 6  LEU B N    7  
ATOM 5116  C CA   . LEU B 2 6  ? 8.531   -7.441  -2.924  1.00 0.00 ? 6  LEU B CA   7  
ATOM 5117  C C    . LEU B 2 6  ? 8.459   -6.771  -4.299  1.00 0.00 ? 6  LEU B C    7  
ATOM 5118  O O    . LEU B 2 6  ? 9.111   -7.190  -5.234  1.00 0.00 ? 6  LEU B O    7  
ATOM 5119  C CB   . LEU B 2 6  ? 8.655   -8.955  -3.103  1.00 0.00 ? 6  LEU B CB   7  
ATOM 5120  C CG   . LEU B 2 6  ? 8.242   -9.657  -1.808  1.00 0.00 ? 6  LEU B CG   7  
ATOM 5121  C CD1  . LEU B 2 6  ? 6.729   -9.886  -1.812  1.00 0.00 ? 6  LEU B CD1  7  
ATOM 5122  C CD2  . LEU B 2 6  ? 8.960   -11.005 -1.709  1.00 0.00 ? 6  LEU B CD2  7  
ATOM 5123  H H    . LEU B 2 6  ? 6.429   -7.092  -2.590  1.00 0.00 ? 6  LEU B H    7  
ATOM 5124  H HA   . LEU B 2 6  ? 9.395   -7.072  -2.391  1.00 0.00 ? 6  LEU B HA   7  
ATOM 5125  H HB2  . LEU B 2 6  ? 8.011   -9.276  -3.909  1.00 0.00 ? 6  LEU B HB2  7  
ATOM 5126  H HB3  . LEU B 2 6  ? 9.678   -9.208  -3.336  1.00 0.00 ? 6  LEU B HB3  7  
ATOM 5127  H HG   . LEU B 2 6  ? 8.510   -9.040  -0.963  1.00 0.00 ? 6  LEU B HG   7  
ATOM 5128  H HD11 . LEU B 2 6  ? 6.343   -9.752  -0.813  1.00 0.00 ? 6  LEU B HD11 7  
ATOM 5129  H HD12 . LEU B 2 6  ? 6.518   -10.890 -2.149  1.00 0.00 ? 6  LEU B HD12 7  
ATOM 5130  H HD13 . LEU B 2 6  ? 6.261   -9.176  -2.478  1.00 0.00 ? 6  LEU B HD13 7  
ATOM 5131  H HD21 . LEU B 2 6  ? 9.304   -11.156 -0.696  1.00 0.00 ? 6  LEU B HD21 7  
ATOM 5132  H HD22 . LEU B 2 6  ? 9.805   -11.014 -2.381  1.00 0.00 ? 6  LEU B HD22 7  
ATOM 5133  H HD23 . LEU B 2 6  ? 8.278   -11.798 -1.979  1.00 0.00 ? 6  LEU B HD23 7  
ATOM 5134  N N    . CYS B 2 7  ? 7.674   -5.735  -4.431  1.00 0.00 ? 7  CYS B N    7  
ATOM 5135  C CA   . CYS B 2 7  ? 7.567   -5.042  -5.747  1.00 0.00 ? 7  CYS B CA   7  
ATOM 5136  C C    . CYS B 2 7  ? 6.985   -6.004  -6.782  1.00 0.00 ? 7  CYS B C    7  
ATOM 5137  O O    . CYS B 2 7  ? 7.681   -6.828  -7.342  1.00 0.00 ? 7  CYS B O    7  
ATOM 5138  C CB   . CYS B 2 7  ? 8.955   -4.576  -6.201  1.00 0.00 ? 7  CYS B CB   7  
ATOM 5139  S SG   . CYS B 2 7  ? 8.870   -3.996  -7.914  1.00 0.00 ? 7  CYS B SG   7  
ATOM 5140  H H    . CYS B 2 7  ? 7.154   -5.414  -3.666  1.00 0.00 ? 7  CYS B H    7  
ATOM 5141  H HA   . CYS B 2 7  ? 6.916   -4.186  -5.648  1.00 0.00 ? 7  CYS B HA   7  
ATOM 5142  H HB2  . CYS B 2 7  ? 9.289   -3.770  -5.565  1.00 0.00 ? 7  CYS B HB2  7  
ATOM 5143  H HB3  . CYS B 2 7  ? 9.651   -5.398  -6.134  1.00 0.00 ? 7  CYS B HB3  7  
ATOM 5144  N N    . GLY B 2 8  ? 5.711   -5.906  -7.037  1.00 0.00 ? 8  GLY B N    7  
ATOM 5145  C CA   . GLY B 2 8  ? 5.076   -6.813  -8.033  1.00 0.00 ? 8  GLY B CA   7  
ATOM 5146  C C    . GLY B 2 8  ? 3.801   -7.401  -7.435  1.00 0.00 ? 8  GLY B C    7  
ATOM 5147  O O    . GLY B 2 8  ? 3.747   -8.563  -7.087  1.00 0.00 ? 8  GLY B O    7  
ATOM 5148  H H    . GLY B 2 8  ? 5.170   -5.235  -6.571  1.00 0.00 ? 8  GLY B H    7  
ATOM 5149  H HA2  . GLY B 2 8  ? 4.834   -6.254  -8.927  1.00 0.00 ? 8  GLY B HA2  7  
ATOM 5150  H HA3  . GLY B 2 8  ? 5.755   -7.611  -8.280  1.00 0.00 ? 8  GLY B HA3  7  
ATOM 5151  N N    . SER B 2 9  ? 2.779   -6.597  -7.310  1.00 0.00 ? 9  SER B N    7  
ATOM 5152  C CA   . SER B 2 9  ? 1.490   -7.082  -6.730  1.00 0.00 ? 9  SER B CA   7  
ATOM 5153  C C    . SER B 2 9  ? 1.554   -7.034  -5.199  1.00 0.00 ? 9  SER B C    7  
ATOM 5154  O O    . SER B 2 9  ? 0.580   -6.730  -4.541  1.00 0.00 ? 9  SER B O    7  
ATOM 5155  C CB   . SER B 2 9  ? 1.219   -8.517  -7.186  1.00 0.00 ? 9  SER B CB   7  
ATOM 5156  O OG   . SER B 2 9  ? 1.682   -9.421  -6.191  1.00 0.00 ? 9  SER B OG   7  
ATOM 5157  H H    . SER B 2 9  ? 2.862   -5.665  -7.596  1.00 0.00 ? 9  SER B H    7  
ATOM 5158  H HA   . SER B 2 9  ? 0.687   -6.444  -7.070  1.00 0.00 ? 9  SER B HA   7  
ATOM 5159  H HB2  . SER B 2 9  ? 0.161   -8.659  -7.329  1.00 0.00 ? 9  SER B HB2  7  
ATOM 5160  H HB3  . SER B 2 9  ? 1.734   -8.700  -8.120  1.00 0.00 ? 9  SER B HB3  7  
ATOM 5161  H HG   . SER B 2 9  ? 0.929   -9.684  -5.656  1.00 0.00 ? 9  SER B HG   7  
ATOM 5162  N N    . HIS B 2 10 ? 2.688   -7.336  -4.624  1.00 0.00 ? 10 HIS B N    7  
ATOM 5163  C CA   . HIS B 2 10 ? 2.799   -7.309  -3.142  1.00 0.00 ? 10 HIS B CA   7  
ATOM 5164  C C    . HIS B 2 10 ? 2.743   -5.863  -2.645  1.00 0.00 ? 10 HIS B C    7  
ATOM 5165  O O    . HIS B 2 10 ? 2.065   -5.555  -1.685  1.00 0.00 ? 10 HIS B O    7  
ATOM 5166  C CB   . HIS B 2 10 ? 4.124   -7.945  -2.718  1.00 0.00 ? 10 HIS B CB   7  
ATOM 5167  C CG   . HIS B 2 10 ? 3.934   -9.427  -2.546  1.00 0.00 ? 10 HIS B CG   7  
ATOM 5168  N ND1  . HIS B 2 10 ? 3.609   -9.994  -1.323  1.00 0.00 ? 10 HIS B ND1  7  
ATOM 5169  C CD2  . HIS B 2 10 ? 4.019   -10.472 -3.433  1.00 0.00 ? 10 HIS B CD2  7  
ATOM 5170  C CE1  . HIS B 2 10 ? 3.511   -11.323 -1.506  1.00 0.00 ? 10 HIS B CE1  7  
ATOM 5171  N NE2  . HIS B 2 10 ? 3.752   -11.669 -2.774  1.00 0.00 ? 10 HIS B NE2  7  
ATOM 5172  H H    . HIS B 2 10 ? 3.463   -7.582  -5.162  1.00 0.00 ? 10 HIS B H    7  
ATOM 5173  H HA   . HIS B 2 10 ? 1.982   -7.866  -2.715  1.00 0.00 ? 10 HIS B HA   7  
ATOM 5174  H HB2  . HIS B 2 10 ? 4.870   -7.763  -3.477  1.00 0.00 ? 10 HIS B HB2  7  
ATOM 5175  H HB3  . HIS B 2 10 ? 4.448   -7.514  -1.782  1.00 0.00 ? 10 HIS B HB3  7  
ATOM 5176  H HD1  . HIS B 2 10 ? 3.475   -9.514  -0.480  1.00 0.00 ? 10 HIS B HD1  7  
ATOM 5177  H HD2  . HIS B 2 10 ? 4.256   -10.380 -4.482  1.00 0.00 ? 10 HIS B HD2  7  
ATOM 5178  H HE1  . HIS B 2 10 ? 3.268   -12.026 -0.723  1.00 0.00 ? 10 HIS B HE1  7  
ATOM 5179  N N    . LEU B 2 11 ? 3.449   -4.972  -3.286  1.00 0.00 ? 11 LEU B N    7  
ATOM 5180  C CA   . LEU B 2 11 ? 3.428   -3.552  -2.836  1.00 0.00 ? 11 LEU B CA   7  
ATOM 5181  C C    . LEU B 2 11 ? 1.990   -3.037  -2.847  1.00 0.00 ? 11 LEU B C    7  
ATOM 5182  O O    . LEU B 2 11 ? 1.537   -2.417  -1.905  1.00 0.00 ? 11 LEU B O    7  
ATOM 5183  C CB   . LEU B 2 11 ? 4.285   -2.698  -3.772  1.00 0.00 ? 11 LEU B CB   7  
ATOM 5184  C CG   . LEU B 2 11 ? 4.898   -1.540  -2.981  1.00 0.00 ? 11 LEU B CG   7  
ATOM 5185  C CD1  . LEU B 2 11 ? 6.026   -0.903  -3.792  1.00 0.00 ? 11 LEU B CD1  7  
ATOM 5186  C CD2  . LEU B 2 11 ? 3.822   -0.489  -2.698  1.00 0.00 ? 11 LEU B CD2  7  
ATOM 5187  H H    . LEU B 2 11 ? 3.992   -5.236  -4.058  1.00 0.00 ? 11 LEU B H    7  
ATOM 5188  H HA   . LEU B 2 11 ? 3.821   -3.490  -1.833  1.00 0.00 ? 11 LEU B HA   7  
ATOM 5189  H HB2  . LEU B 2 11 ? 5.073   -3.305  -4.194  1.00 0.00 ? 11 LEU B HB2  7  
ATOM 5190  H HB3  . LEU B 2 11 ? 3.669   -2.303  -4.566  1.00 0.00 ? 11 LEU B HB3  7  
ATOM 5191  H HG   . LEU B 2 11 ? 5.293   -1.913  -2.047  1.00 0.00 ? 11 LEU B HG   7  
ATOM 5192  H HD11 . LEU B 2 11 ? 6.303   0.040   -3.344  1.00 0.00 ? 11 LEU B HD11 7  
ATOM 5193  H HD12 . LEU B 2 11 ? 5.691   -0.736  -4.805  1.00 0.00 ? 11 LEU B HD12 7  
ATOM 5194  H HD13 . LEU B 2 11 ? 6.881   -1.563  -3.799  1.00 0.00 ? 11 LEU B HD13 7  
ATOM 5195  H HD21 . LEU B 2 11 ? 4.245   0.309   -2.106  1.00 0.00 ? 11 LEU B HD21 7  
ATOM 5196  H HD22 . LEU B 2 11 ? 3.006   -0.944  -2.158  1.00 0.00 ? 11 LEU B HD22 7  
ATOM 5197  H HD23 . LEU B 2 11 ? 3.457   -0.088  -3.632  1.00 0.00 ? 11 LEU B HD23 7  
ATOM 5198  N N    . VAL B 2 12 ? 1.260   -3.289  -3.899  1.00 0.00 ? 12 VAL B N    7  
ATOM 5199  C CA   . VAL B 2 12 ? -0.147  -2.810  -3.947  1.00 0.00 ? 12 VAL B CA   7  
ATOM 5200  C C    . VAL B 2 12 ? -0.945  -3.516  -2.856  1.00 0.00 ? 12 VAL B C    7  
ATOM 5201  O O    . VAL B 2 12 ? -1.628  -2.890  -2.070  1.00 0.00 ? 12 VAL B O    7  
ATOM 5202  C CB   . VAL B 2 12 ? -0.756  -3.118  -5.316  1.00 0.00 ? 12 VAL B CB   7  
ATOM 5203  C CG1  . VAL B 2 12 ? -2.270  -2.907  -5.261  1.00 0.00 ? 12 VAL B CG1  7  
ATOM 5204  C CG2  . VAL B 2 12 ? -0.149  -2.183  -6.365  1.00 0.00 ? 12 VAL B CG2  7  
ATOM 5205  H H    . VAL B 2 12 ? 1.636   -3.794  -4.651  1.00 0.00 ? 12 VAL B H    7  
ATOM 5206  H HA   . VAL B 2 12 ? -0.168  -1.747  -3.768  1.00 0.00 ? 12 VAL B HA   7  
ATOM 5207  H HB   . VAL B 2 12 ? -0.545  -4.145  -5.580  1.00 0.00 ? 12 VAL B HB   7  
ATOM 5208  H HG11 . VAL B 2 12 ? -2.765  -3.865  -5.205  1.00 0.00 ? 12 VAL B HG11 7  
ATOM 5209  H HG12 . VAL B 2 12 ? -2.593  -2.386  -6.150  1.00 0.00 ? 12 VAL B HG12 7  
ATOM 5210  H HG13 . VAL B 2 12 ? -2.520  -2.320  -4.390  1.00 0.00 ? 12 VAL B HG13 7  
ATOM 5211  H HG21 . VAL B 2 12 ? -0.055  -1.190  -5.951  1.00 0.00 ? 12 VAL B HG21 7  
ATOM 5212  H HG22 . VAL B 2 12 ? -0.791  -2.152  -7.233  1.00 0.00 ? 12 VAL B HG22 7  
ATOM 5213  H HG23 . VAL B 2 12 ? 0.826   -2.548  -6.651  1.00 0.00 ? 12 VAL B HG23 7  
ATOM 5214  N N    . GLU B 2 13 ? -0.846  -4.812  -2.781  1.00 0.00 ? 13 GLU B N    7  
ATOM 5215  C CA   . GLU B 2 13 ? -1.582  -5.539  -1.716  1.00 0.00 ? 13 GLU B CA   7  
ATOM 5216  C C    . GLU B 2 13 ? -1.182  -4.930  -0.376  1.00 0.00 ? 13 GLU B C    7  
ATOM 5217  O O    . GLU B 2 13 ? -1.950  -4.901  0.566   1.00 0.00 ? 13 GLU B O    7  
ATOM 5218  C CB   . GLU B 2 13 ? -1.204  -7.021  -1.745  1.00 0.00 ? 13 GLU B CB   7  
ATOM 5219  C CG   . GLU B 2 13 ? -2.377  -7.857  -1.231  1.00 0.00 ? 13 GLU B CG   7  
ATOM 5220  C CD   . GLU B 2 13 ? -2.367  -9.226  -1.913  1.00 0.00 ? 13 GLU B CD   7  
ATOM 5221  O OE1  . GLU B 2 13 ? -1.703  -10.114 -1.406  1.00 0.00 ? 13 GLU B OE1  7  
ATOM 5222  O OE2  . GLU B 2 13 ? -3.024  -9.363  -2.932  1.00 0.00 ? 13 GLU B OE2  7  
ATOM 5223  H H    . GLU B 2 13 ? -0.276  -5.302  -3.410  1.00 0.00 ? 13 GLU B H    7  
ATOM 5224  H HA   . GLU B 2 13 ? -2.646  -5.427  -1.866  1.00 0.00 ? 13 GLU B HA   7  
ATOM 5225  H HB2  . GLU B 2 13 ? -0.969  -7.313  -2.758  1.00 0.00 ? 13 GLU B HB2  7  
ATOM 5226  H HB3  . GLU B 2 13 ? -0.344  -7.186  -1.113  1.00 0.00 ? 13 GLU B HB3  7  
ATOM 5227  H HG2  . GLU B 2 13 ? -2.286  -7.986  -0.162  1.00 0.00 ? 13 GLU B HG2  7  
ATOM 5228  H HG3  . GLU B 2 13 ? -3.305  -7.352  -1.455  1.00 0.00 ? 13 GLU B HG3  7  
ATOM 5229  N N    . ALA B 2 14 ? 0.023   -4.433  -0.293  1.00 0.00 ? 14 ALA B N    7  
ATOM 5230  C CA   . ALA B 2 14 ? 0.493   -3.811  0.972   1.00 0.00 ? 14 ALA B CA   7  
ATOM 5231  C C    . ALA B 2 14 ? -0.270  -2.509  1.203   1.00 0.00 ? 14 ALA B C    7  
ATOM 5232  O O    . ALA B 2 14 ? -0.708  -2.217  2.297   1.00 0.00 ? 14 ALA B O    7  
ATOM 5233  C CB   . ALA B 2 14 ? 1.990   -3.518  0.875   1.00 0.00 ? 14 ALA B CB   7  
ATOM 5234  H H    . ALA B 2 14 ? 0.617   -4.460  -1.072  1.00 0.00 ? 14 ALA B H    7  
ATOM 5235  H HA   . ALA B 2 14 ? 0.309   -4.486  1.789   1.00 0.00 ? 14 ALA B HA   7  
ATOM 5236  H HB1  . ALA B 2 14 ? 2.138   -2.520  0.489   1.00 0.00 ? 14 ALA B HB1  7  
ATOM 5237  H HB2  . ALA B 2 14 ? 2.455   -4.233  0.212   1.00 0.00 ? 14 ALA B HB2  7  
ATOM 5238  H HB3  . ALA B 2 14 ? 2.436   -3.594  1.856   1.00 0.00 ? 14 ALA B HB3  7  
ATOM 5239  N N    . LEU B 2 15 ? -0.436  -1.728  0.173   1.00 0.00 ? 15 LEU B N    7  
ATOM 5240  C CA   . LEU B 2 15 ? -1.174  -0.444  0.321   1.00 0.00 ? 15 LEU B CA   7  
ATOM 5241  C C    . LEU B 2 15 ? -2.575  -0.749  0.858   1.00 0.00 ? 15 LEU B C    7  
ATOM 5242  O O    . LEU B 2 15 ? -3.140  0.002   1.628   1.00 0.00 ? 15 LEU B O    7  
ATOM 5243  C CB   . LEU B 2 15 ? -1.239  0.273   -1.042  1.00 0.00 ? 15 LEU B CB   7  
ATOM 5244  C CG   . LEU B 2 15 ? -2.541  -0.064  -1.779  1.00 0.00 ? 15 LEU B CG   7  
ATOM 5245  C CD1  . LEU B 2 15 ? -3.648  0.882   -1.309  1.00 0.00 ? 15 LEU B CD1  7  
ATOM 5246  C CD2  . LEU B 2 15 ? -2.331  0.106   -3.285  1.00 0.00 ? 15 LEU B CD2  7  
ATOM 5247  H H    . LEU B 2 15 ? -0.078  -1.990  -0.700  1.00 0.00 ? 15 LEU B H    7  
ATOM 5248  H HA   . LEU B 2 15 ? -0.650  0.182   1.032   1.00 0.00 ? 15 LEU B HA   7  
ATOM 5249  H HB2  . LEU B 2 15 ? -1.187  1.340   -0.885  1.00 0.00 ? 15 LEU B HB2  7  
ATOM 5250  H HB3  . LEU B 2 15 ? -0.400  -0.038  -1.647  1.00 0.00 ? 15 LEU B HB3  7  
ATOM 5251  H HG   . LEU B 2 15 ? -2.823  -1.085  -1.564  1.00 0.00 ? 15 LEU B HG   7  
ATOM 5252  H HD11 . LEU B 2 15 ? -4.033  1.433   -2.154  1.00 0.00 ? 15 LEU B HD11 7  
ATOM 5253  H HD12 . LEU B 2 15 ? -3.246  1.573   -0.582  1.00 0.00 ? 15 LEU B HD12 7  
ATOM 5254  H HD13 . LEU B 2 15 ? -4.444  0.309   -0.859  1.00 0.00 ? 15 LEU B HD13 7  
ATOM 5255  H HD21 . LEU B 2 15 ? -3.290  0.162   -3.778  1.00 0.00 ? 15 LEU B HD21 7  
ATOM 5256  H HD22 . LEU B 2 15 ? -1.777  -0.739  -3.669  1.00 0.00 ? 15 LEU B HD22 7  
ATOM 5257  H HD23 . LEU B 2 15 ? -1.777  1.014   -3.471  1.00 0.00 ? 15 LEU B HD23 7  
ATOM 5258  N N    . TYR B 2 16 ? -3.138  -1.853  0.464   1.00 0.00 ? 16 TYR B N    7  
ATOM 5259  C CA   . TYR B 2 16 ? -4.487  -2.208  0.970   1.00 0.00 ? 16 TYR B CA   7  
ATOM 5260  C C    . TYR B 2 16 ? -4.388  -2.441  2.476   1.00 0.00 ? 16 TYR B C    7  
ATOM 5261  O O    . TYR B 2 16 ? -5.144  -1.898  3.257   1.00 0.00 ? 16 TYR B O    7  
ATOM 5262  C CB   . TYR B 2 16 ? -4.974  -3.485  0.284   1.00 0.00 ? 16 TYR B CB   7  
ATOM 5263  C CG   . TYR B 2 16 ? -6.378  -3.276  -0.230  1.00 0.00 ? 16 TYR B CG   7  
ATOM 5264  C CD1  . TYR B 2 16 ? -6.584  -2.763  -1.515  1.00 0.00 ? 16 TYR B CD1  7  
ATOM 5265  C CD2  . TYR B 2 16 ? -7.475  -3.596  0.580   1.00 0.00 ? 16 TYR B CD2  7  
ATOM 5266  C CE1  . TYR B 2 16 ? -7.886  -2.568  -1.992  1.00 0.00 ? 16 TYR B CE1  7  
ATOM 5267  C CE2  . TYR B 2 16 ? -8.777  -3.402  0.104   1.00 0.00 ? 16 TYR B CE2  7  
ATOM 5268  C CZ   . TYR B 2 16 ? -8.982  -2.888  -1.182  1.00 0.00 ? 16 TYR B CZ   7  
ATOM 5269  O OH   . TYR B 2 16 ? -10.265 -2.696  -1.652  1.00 0.00 ? 16 TYR B OH   7  
ATOM 5270  H H    . TYR B 2 16 ? -2.668  -2.452  -0.152  1.00 0.00 ? 16 TYR B H    7  
ATOM 5271  H HA   . TYR B 2 16 ? -5.173  -1.405  0.773   1.00 0.00 ? 16 TYR B HA   7  
ATOM 5272  H HB2  . TYR B 2 16 ? -4.320  -3.722  -0.542  1.00 0.00 ? 16 TYR B HB2  7  
ATOM 5273  H HB3  . TYR B 2 16 ? -4.969  -4.300  0.993   1.00 0.00 ? 16 TYR B HB3  7  
ATOM 5274  H HD1  . TYR B 2 16 ? -5.738  -2.516  -2.140  1.00 0.00 ? 16 TYR B HD1  7  
ATOM 5275  H HD2  . TYR B 2 16 ? -7.316  -3.992  1.572   1.00 0.00 ? 16 TYR B HD2  7  
ATOM 5276  H HE1  . TYR B 2 16 ? -8.044  -2.172  -2.984  1.00 0.00 ? 16 TYR B HE1  7  
ATOM 5277  H HE2  . TYR B 2 16 ? -9.623  -3.648  0.728   1.00 0.00 ? 16 TYR B HE2  7  
ATOM 5278  H HH   . TYR B 2 16 ? -10.785 -3.469  -1.419  1.00 0.00 ? 16 TYR B HH   7  
ATOM 5279  N N    . LEU B 2 17 ? -3.451  -3.250  2.884   1.00 0.00 ? 17 LEU B N    7  
ATOM 5280  C CA   . LEU B 2 17 ? -3.279  -3.536  4.336   1.00 0.00 ? 17 LEU B CA   7  
ATOM 5281  C C    . LEU B 2 17 ? -2.748  -2.304  5.074   1.00 0.00 ? 17 LEU B C    7  
ATOM 5282  O O    . LEU B 2 17 ? -3.205  -1.974  6.151   1.00 0.00 ? 17 LEU B O    7  
ATOM 5283  C CB   . LEU B 2 17 ? -2.303  -4.700  4.516   1.00 0.00 ? 17 LEU B CB   7  
ATOM 5284  C CG   . LEU B 2 17 ? -3.076  -6.020  4.501   1.00 0.00 ? 17 LEU B CG   7  
ATOM 5285  C CD1  . LEU B 2 17 ? -4.135  -6.004  5.605   1.00 0.00 ? 17 LEU B CD1  7  
ATOM 5286  C CD2  . LEU B 2 17 ? -3.759  -6.194  3.143   1.00 0.00 ? 17 LEU B CD2  7  
ATOM 5287  H H    . LEU B 2 17 ? -2.857  -3.671  2.230   1.00 0.00 ? 17 LEU B H    7  
ATOM 5288  H HA   . LEU B 2 17 ? -4.233  -3.804  4.752   1.00 0.00 ? 17 LEU B HA   7  
ATOM 5289  H HB2  . LEU B 2 17 ? -1.583  -4.694  3.710   1.00 0.00 ? 17 LEU B HB2  7  
ATOM 5290  H HB3  . LEU B 2 17 ? -1.789  -4.597  5.459   1.00 0.00 ? 17 LEU B HB3  7  
ATOM 5291  H HG   . LEU B 2 17 ? -2.392  -6.839  4.670   1.00 0.00 ? 17 LEU B HG   7  
ATOM 5292  H HD11 . LEU B 2 17 ? -3.891  -5.240  6.327   1.00 0.00 ? 17 LEU B HD11 7  
ATOM 5293  H HD12 . LEU B 2 17 ? -4.159  -6.967  6.094   1.00 0.00 ? 17 LEU B HD12 7  
ATOM 5294  H HD13 . LEU B 2 17 ? -5.102  -5.796  5.172   1.00 0.00 ? 17 LEU B HD13 7  
ATOM 5295  H HD21 . LEU B 2 17 ? -3.336  -5.497  2.435   1.00 0.00 ? 17 LEU B HD21 7  
ATOM 5296  H HD22 . LEU B 2 17 ? -4.817  -6.005  3.245   1.00 0.00 ? 17 LEU B HD22 7  
ATOM 5297  H HD23 . LEU B 2 17 ? -3.606  -7.203  2.790   1.00 0.00 ? 17 LEU B HD23 7  
ATOM 5298  N N    . VAL B 2 18 ? -1.779  -1.627  4.520   1.00 0.00 ? 18 VAL B N    7  
ATOM 5299  C CA   . VAL B 2 18 ? -1.227  -0.431  5.221   1.00 0.00 ? 18 VAL B CA   7  
ATOM 5300  C C    . VAL B 2 18 ? -2.366  0.554   5.493   1.00 0.00 ? 18 VAL B C    7  
ATOM 5301  O O    . VAL B 2 18 ? -2.521  1.054   6.589   1.00 0.00 ? 18 VAL B O    7  
ATOM 5302  C CB   . VAL B 2 18 ? -0.151  0.244   4.357   1.00 0.00 ? 18 VAL B CB   7  
ATOM 5303  C CG1  . VAL B 2 18 ? 0.812   -0.804  3.799   1.00 0.00 ? 18 VAL B CG1  7  
ATOM 5304  C CG2  . VAL B 2 18 ? -0.816  0.985   3.202   1.00 0.00 ? 18 VAL B CG2  7  
ATOM 5305  H H    . VAL B 2 18 ? -1.413  -1.909  3.658   1.00 0.00 ? 18 VAL B H    7  
ATOM 5306  H HA   . VAL B 2 18 ? -0.793  -0.738  6.160   1.00 0.00 ? 18 VAL B HA   7  
ATOM 5307  H HB   . VAL B 2 18 ? 0.405   0.942   4.955   1.00 0.00 ? 18 VAL B HB   7  
ATOM 5308  H HG11 . VAL B 2 18 ? 1.817   -0.576  4.126   1.00 0.00 ? 18 VAL B HG11 7  
ATOM 5309  H HG12 . VAL B 2 18 ? 0.774   -0.789  2.720   1.00 0.00 ? 18 VAL B HG12 7  
ATOM 5310  H HG13 . VAL B 2 18 ? 0.530   -1.781  4.158   1.00 0.00 ? 18 VAL B HG13 7  
ATOM 5311  H HG21 . VAL B 2 18 ? -0.058  1.384   2.543   1.00 0.00 ? 18 VAL B HG21 7  
ATOM 5312  H HG22 . VAL B 2 18 ? -1.420  1.792   3.588   1.00 0.00 ? 18 VAL B HG22 7  
ATOM 5313  H HG23 . VAL B 2 18 ? -1.439  0.300   2.659   1.00 0.00 ? 18 VAL B HG23 7  
ATOM 5314  N N    . CYS B 2 19 ? -3.172  0.826   4.506   1.00 0.00 ? 19 CYS B N    7  
ATOM 5315  C CA   . CYS B 2 19 ? -4.309  1.768   4.709   1.00 0.00 ? 19 CYS B CA   7  
ATOM 5316  C C    . CYS B 2 19 ? -5.213  1.743   3.477   1.00 0.00 ? 19 CYS B C    7  
ATOM 5317  O O    . CYS B 2 19 ? -5.890  2.703   3.176   1.00 0.00 ? 19 CYS B O    7  
ATOM 5318  C CB   . CYS B 2 19 ? -3.774  3.187   4.918   1.00 0.00 ? 19 CYS B CB   7  
ATOM 5319  S SG   . CYS B 2 19 ? -5.082  4.233   5.609   1.00 0.00 ? 19 CYS B SG   7  
ATOM 5320  H H    . CYS B 2 19 ? -3.034  0.406   3.631   1.00 0.00 ? 19 CYS B H    7  
ATOM 5321  H HA   . CYS B 2 19 ? -4.876  1.465   5.578   1.00 0.00 ? 19 CYS B HA   7  
ATOM 5322  H HB2  . CYS B 2 19 ? -2.938  3.160   5.599   1.00 0.00 ? 19 CYS B HB2  7  
ATOM 5323  H HB3  . CYS B 2 19 ? -3.453  3.593   3.969   1.00 0.00 ? 19 CYS B HB3  7  
ATOM 5324  N N    . GLY B 2 20 ? -5.236  0.655   2.760   1.00 0.00 ? 20 GLY B N    7  
ATOM 5325  C CA   . GLY B 2 20 ? -6.104  0.597   1.551   1.00 0.00 ? 20 GLY B CA   7  
ATOM 5326  C C    . GLY B 2 20 ? -7.171  -0.480  1.739   1.00 0.00 ? 20 GLY B C    7  
ATOM 5327  O O    . GLY B 2 20 ? -7.707  -1.013  0.789   1.00 0.00 ? 20 GLY B O    7  
ATOM 5328  H H    . GLY B 2 20 ? -4.687  -0.122  3.016   1.00 0.00 ? 20 GLY B H    7  
ATOM 5329  H HA2  . GLY B 2 20 ? -6.582  1.557   1.410   1.00 0.00 ? 20 GLY B HA2  7  
ATOM 5330  H HA3  . GLY B 2 20 ? -5.505  0.365   0.685   1.00 0.00 ? 20 GLY B HA3  7  
ATOM 5331  N N    . GLU B 2 21 ? -7.487  -0.797  2.964   1.00 0.00 ? 21 GLU B N    7  
ATOM 5332  C CA   . GLU B 2 21 ? -8.526  -1.831  3.225   1.00 0.00 ? 21 GLU B CA   7  
ATOM 5333  C C    . GLU B 2 21 ? -9.681  -1.189  3.994   1.00 0.00 ? 21 GLU B C    7  
ATOM 5334  O O    . GLU B 2 21 ? -10.811 -1.629  3.923   1.00 0.00 ? 21 GLU B O    7  
ATOM 5335  C CB   . GLU B 2 21 ? -7.924  -2.964  4.058   1.00 0.00 ? 21 GLU B CB   7  
ATOM 5336  C CG   . GLU B 2 21 ? -8.970  -4.062  4.259   1.00 0.00 ? 21 GLU B CG   7  
ATOM 5337  C CD   . GLU B 2 21 ? -8.589  -4.914  5.471   1.00 0.00 ? 21 GLU B CD   7  
ATOM 5338  O OE1  . GLU B 2 21 ? -7.430  -5.282  5.571   1.00 0.00 ? 21 GLU B OE1  7  
ATOM 5339  O OE2  . GLU B 2 21 ? -9.463  -5.185  6.278   1.00 0.00 ? 21 GLU B OE2  7  
ATOM 5340  H H    . GLU B 2 21 ? -7.044  -0.349  3.714   1.00 0.00 ? 21 GLU B H    7  
ATOM 5341  H HA   . GLU B 2 21 ? -8.890  -2.223  2.287   1.00 0.00 ? 21 GLU B HA   7  
ATOM 5342  H HB2  . GLU B 2 21 ? -7.067  -3.373  3.542   1.00 0.00 ? 21 GLU B HB2  7  
ATOM 5343  H HB3  . GLU B 2 21 ? -7.617  -2.581  5.019   1.00 0.00 ? 21 GLU B HB3  7  
ATOM 5344  H HG2  . GLU B 2 21 ? -9.938  -3.610  4.426   1.00 0.00 ? 21 GLU B HG2  7  
ATOM 5345  H HG3  . GLU B 2 21 ? -9.011  -4.687  3.380   1.00 0.00 ? 21 GLU B HG3  7  
ATOM 5346  N N    . ARG B 2 22 ? -9.403  -0.145  4.727   1.00 0.00 ? 22 ARG B N    7  
ATOM 5347  C CA   . ARG B 2 22 ? -10.473 0.533   5.499   1.00 0.00 ? 22 ARG B CA   7  
ATOM 5348  C C    . ARG B 2 22 ? -10.981 1.740   4.711   1.00 0.00 ? 22 ARG B C    7  
ATOM 5349  O O    . ARG B 2 22 ? -12.168 1.924   4.532   1.00 0.00 ? 22 ARG B O    7  
ATOM 5350  C CB   . ARG B 2 22 ? -9.918  0.999   6.847   1.00 0.00 ? 22 ARG B CB   7  
ATOM 5351  C CG   . ARG B 2 22 ? -9.346  -0.200  7.606   1.00 0.00 ? 22 ARG B CG   7  
ATOM 5352  C CD   . ARG B 2 22 ? -8.544  0.295   8.811   1.00 0.00 ? 22 ARG B CD   7  
ATOM 5353  N NE   . ARG B 2 22 ? -7.727  -0.825  9.358   1.00 0.00 ? 22 ARG B NE   7  
ATOM 5354  C CZ   . ARG B 2 22 ? -7.689  -1.036  10.646  1.00 0.00 ? 22 ARG B CZ   7  
ATOM 5355  N NH1  . ARG B 2 22 ? -7.587  -0.029  11.469  1.00 0.00 ? 22 ARG B NH1  7  
ATOM 5356  N NH2  . ARG B 2 22 ? -7.752  -2.254  11.109  1.00 0.00 ? 22 ARG B NH2  7  
ATOM 5357  H H    . ARG B 2 22 ? -8.490  0.193   4.768   1.00 0.00 ? 22 ARG B H    7  
ATOM 5358  H HA   . ARG B 2 22 ? -11.278 -0.155  5.660   1.00 0.00 ? 22 ARG B HA   7  
ATOM 5359  H HB2  . ARG B 2 22 ? -9.137  1.727   6.681   1.00 0.00 ? 22 ARG B HB2  7  
ATOM 5360  H HB3  . ARG B 2 22 ? -10.711 1.445   7.427   1.00 0.00 ? 22 ARG B HB3  7  
ATOM 5361  H HG2  . ARG B 2 22 ? -10.155 -0.830  7.945   1.00 0.00 ? 22 ARG B HG2  7  
ATOM 5362  H HG3  . ARG B 2 22 ? -8.698  -0.765  6.953   1.00 0.00 ? 22 ARG B HG3  7  
ATOM 5363  H HD2  . ARG B 2 22 ? -7.892  1.099   8.504   1.00 0.00 ? 22 ARG B HD2  7  
ATOM 5364  H HD3  . ARG B 2 22 ? -9.222  0.652   9.572   1.00 0.00 ? 22 ARG B HD3  7  
ATOM 5365  H HE   . ARG B 2 22 ? -7.219  -1.402  8.752   1.00 0.00 ? 22 ARG B HE   7  
ATOM 5366  H HH11 . ARG B 2 22 ? -7.539  0.905   11.114  1.00 0.00 ? 22 ARG B HH11 7  
ATOM 5367  H HH12 . ARG B 2 22 ? -7.558  -0.191  12.456  1.00 0.00 ? 22 ARG B HH12 7  
ATOM 5368  H HH21 . ARG B 2 22 ? -7.830  -3.026  10.478  1.00 0.00 ? 22 ARG B HH21 7  
ATOM 5369  H HH22 . ARG B 2 22 ? -7.723  -2.416  12.095  1.00 0.00 ? 22 ARG B HH22 7  
ATOM 5370  N N    . GLY B 2 23 ? -10.088 2.563   4.239   1.00 0.00 ? 23 GLY B N    7  
ATOM 5371  C CA   . GLY B 2 23 ? -10.514 3.762   3.462   1.00 0.00 ? 23 GLY B CA   7  
ATOM 5372  C C    . GLY B 2 23 ? -10.818 3.355   2.018   1.00 0.00 ? 23 GLY B C    7  
ATOM 5373  O O    . GLY B 2 23 ? -11.304 4.143   1.231   1.00 0.00 ? 23 GLY B O    7  
ATOM 5374  H H    . GLY B 2 23 ? -9.136  2.393   4.397   1.00 0.00 ? 23 GLY B H    7  
ATOM 5375  H HA2  . GLY B 2 23 ? -11.400 4.185   3.912   1.00 0.00 ? 23 GLY B HA2  7  
ATOM 5376  H HA3  . GLY B 2 23 ? -9.722  4.494   3.466   1.00 0.00 ? 23 GLY B HA3  7  
ATOM 5377  N N    . PHE B 2 24 ? -10.534 2.132   1.663   1.00 0.00 ? 24 PHE B N    7  
ATOM 5378  C CA   . PHE B 2 24 ? -10.806 1.678   0.270   1.00 0.00 ? 24 PHE B CA   7  
ATOM 5379  C C    . PHE B 2 24 ? -12.204 1.060   0.200   1.00 0.00 ? 24 PHE B C    7  
ATOM 5380  O O    . PHE B 2 24 ? -12.545 0.181   0.967   1.00 0.00 ? 24 PHE B O    7  
ATOM 5381  C CB   . PHE B 2 24 ? -9.767  0.631   -0.138  1.00 0.00 ? 24 PHE B CB   7  
ATOM 5382  C CG   . PHE B 2 24 ? -8.506  1.322   -0.598  1.00 0.00 ? 24 PHE B CG   7  
ATOM 5383  C CD1  . PHE B 2 24 ? -8.140  2.556   -0.045  1.00 0.00 ? 24 PHE B CD1  7  
ATOM 5384  C CD2  . PHE B 2 24 ? -7.701  0.729   -1.578  1.00 0.00 ? 24 PHE B CD2  7  
ATOM 5385  C CE1  . PHE B 2 24 ? -6.970  3.195   -0.472  1.00 0.00 ? 24 PHE B CE1  7  
ATOM 5386  C CE2  . PHE B 2 24 ? -6.531  1.369   -2.005  1.00 0.00 ? 24 PHE B CE2  7  
ATOM 5387  C CZ   . PHE B 2 24 ? -6.166  2.602   -1.452  1.00 0.00 ? 24 PHE B CZ   7  
ATOM 5388  H H    . PHE B 2 24 ? -10.142 1.511   2.311   1.00 0.00 ? 24 PHE B H    7  
ATOM 5389  H HA   . PHE B 2 24 ? -10.751 2.521   -0.401  1.00 0.00 ? 24 PHE B HA   7  
ATOM 5390  H HB2  . PHE B 2 24 ? -9.544  -0.001  0.708   1.00 0.00 ? 24 PHE B HB2  7  
ATOM 5391  H HB3  . PHE B 2 24 ? -10.161 0.029   -0.943  1.00 0.00 ? 24 PHE B HB3  7  
ATOM 5392  H HD1  . PHE B 2 24 ? -8.760  3.014   0.711   1.00 0.00 ? 24 PHE B HD1  7  
ATOM 5393  H HD2  . PHE B 2 24 ? -7.982  -0.222  -2.005  1.00 0.00 ? 24 PHE B HD2  7  
ATOM 5394  H HE1  . PHE B 2 24 ? -6.688  4.147   -0.045  1.00 0.00 ? 24 PHE B HE1  7  
ATOM 5395  H HE2  . PHE B 2 24 ? -5.910  0.911   -2.761  1.00 0.00 ? 24 PHE B HE2  7  
ATOM 5396  H HZ   . PHE B 2 24 ? -5.263  3.095   -1.781  1.00 0.00 ? 24 PHE B HZ   7  
ATOM 5397  N N    . PHE B 2 25 ? -13.016 1.511   -0.716  1.00 0.00 ? 25 PHE B N    7  
ATOM 5398  C CA   . PHE B 2 25 ? -14.390 0.948   -0.836  1.00 0.00 ? 25 PHE B CA   7  
ATOM 5399  C C    . PHE B 2 25 ? -14.417 -0.097  -1.954  1.00 0.00 ? 25 PHE B C    7  
ATOM 5400  O O    . PHE B 2 25 ? -13.581 -0.099  -2.835  1.00 0.00 ? 25 PHE B O    7  
ATOM 5401  C CB   . PHE B 2 25 ? -15.375 2.072   -1.164  1.00 0.00 ? 25 PHE B CB   7  
ATOM 5402  C CG   . PHE B 2 25 ? -16.203 2.388   0.058   1.00 0.00 ? 25 PHE B CG   7  
ATOM 5403  C CD1  . PHE B 2 25 ? -15.615 2.357   1.328   1.00 0.00 ? 25 PHE B CD1  7  
ATOM 5404  C CD2  . PHE B 2 25 ? -17.558 2.713   -0.078  1.00 0.00 ? 25 PHE B CD2  7  
ATOM 5405  C CE1  . PHE B 2 25 ? -16.382 2.651   2.462   1.00 0.00 ? 25 PHE B CE1  7  
ATOM 5406  C CE2  . PHE B 2 25 ? -18.325 3.006   1.056   1.00 0.00 ? 25 PHE B CE2  7  
ATOM 5407  C CZ   . PHE B 2 25 ? -17.737 2.975   2.326   1.00 0.00 ? 25 PHE B CZ   7  
ATOM 5408  H H    . PHE B 2 25 ? -12.721 2.219   -1.325  1.00 0.00 ? 25 PHE B H    7  
ATOM 5409  H HA   . PHE B 2 25 ? -14.672 0.484   0.097   1.00 0.00 ? 25 PHE B HA   7  
ATOM 5410  H HB2  . PHE B 2 25 ? -14.829 2.953   -1.468  1.00 0.00 ? 25 PHE B HB2  7  
ATOM 5411  H HB3  . PHE B 2 25 ? -16.026 1.758   -1.967  1.00 0.00 ? 25 PHE B HB3  7  
ATOM 5412  H HD1  . PHE B 2 25 ? -14.569 2.107   1.434   1.00 0.00 ? 25 PHE B HD1  7  
ATOM 5413  H HD2  . PHE B 2 25 ? -18.011 2.737   -1.058  1.00 0.00 ? 25 PHE B HD2  7  
ATOM 5414  H HE1  . PHE B 2 25 ? -15.928 2.627   3.442   1.00 0.00 ? 25 PHE B HE1  7  
ATOM 5415  H HE2  . PHE B 2 25 ? -19.370 3.257   0.950   1.00 0.00 ? 25 PHE B HE2  7  
ATOM 5416  H HZ   . PHE B 2 25 ? -18.329 3.202   3.200   1.00 0.00 ? 25 PHE B HZ   7  
ATOM 5417  N N    . TYR B 2 26 ? -15.372 -0.986  -1.925  1.00 0.00 ? 26 TYR B N    7  
ATOM 5418  C CA   . TYR B 2 26 ? -15.450 -2.030  -2.985  1.00 0.00 ? 26 TYR B CA   7  
ATOM 5419  C C    . TYR B 2 26 ? -15.791 -1.372  -4.326  1.00 0.00 ? 26 TYR B C    7  
ATOM 5420  O O    . TYR B 2 26 ? -16.491 -0.379  -4.367  1.00 0.00 ? 26 TYR B O    7  
ATOM 5421  C CB   . TYR B 2 26 ? -16.537 -3.044  -2.624  1.00 0.00 ? 26 TYR B CB   7  
ATOM 5422  C CG   . TYR B 2 26 ? -15.940 -4.145  -1.781  1.00 0.00 ? 26 TYR B CG   7  
ATOM 5423  C CD1  . TYR B 2 26 ? -14.932 -3.848  -0.856  1.00 0.00 ? 26 TYR B CD1  7  
ATOM 5424  C CD2  . TYR B 2 26 ? -16.393 -5.461  -1.924  1.00 0.00 ? 26 TYR B CD2  7  
ATOM 5425  C CE1  . TYR B 2 26 ? -14.378 -4.868  -0.073  1.00 0.00 ? 26 TYR B CE1  7  
ATOM 5426  C CE2  . TYR B 2 26 ? -15.839 -6.482  -1.142  1.00 0.00 ? 26 TYR B CE2  7  
ATOM 5427  C CZ   . TYR B 2 26 ? -14.831 -6.185  -0.216  1.00 0.00 ? 26 TYR B CZ   7  
ATOM 5428  O OH   . TYR B 2 26 ? -14.285 -7.191  0.555   1.00 0.00 ? 26 TYR B OH   7  
ATOM 5429  H H    . TYR B 2 26 ? -16.037 -0.968  -1.205  1.00 0.00 ? 26 TYR B H    7  
ATOM 5430  H HA   . TYR B 2 26 ? -14.498 -2.535  -3.063  1.00 0.00 ? 26 TYR B HA   7  
ATOM 5431  H HB2  . TYR B 2 26 ? -17.321 -2.549  -2.069  1.00 0.00 ? 26 TYR B HB2  7  
ATOM 5432  H HB3  . TYR B 2 26 ? -16.949 -3.468  -3.528  1.00 0.00 ? 26 TYR B HB3  7  
ATOM 5433  H HD1  . TYR B 2 26 ? -14.582 -2.832  -0.745  1.00 0.00 ? 26 TYR B HD1  7  
ATOM 5434  H HD2  . TYR B 2 26 ? -17.171 -5.690  -2.638  1.00 0.00 ? 26 TYR B HD2  7  
ATOM 5435  H HE1  . TYR B 2 26 ? -13.600 -4.640  0.641   1.00 0.00 ? 26 TYR B HE1  7  
ATOM 5436  H HE2  . TYR B 2 26 ? -16.189 -7.497  -1.252  1.00 0.00 ? 26 TYR B HE2  7  
ATOM 5437  H HH   . TYR B 2 26 ? -13.602 -6.804  1.107   1.00 0.00 ? 26 TYR B HH   7  
ATOM 5438  N N    . PRO B 2 27 ? -15.282 -1.949  -5.385  1.00 0.00 ? 27 PRO B N    7  
ATOM 5439  C CA   . PRO B 2 27 ? -15.510 -1.446  -6.751  1.00 0.00 ? 27 PRO B CA   7  
ATOM 5440  C C    . PRO B 2 27 ? -16.901 -1.856  -7.246  1.00 0.00 ? 27 PRO B C    7  
ATOM 5441  O O    . PRO B 2 27 ? -17.367 -2.946  -6.982  1.00 0.00 ? 27 PRO B O    7  
ATOM 5442  C CB   . PRO B 2 27 ? -14.415 -2.130  -7.573  1.00 0.00 ? 27 PRO B CB   7  
ATOM 5443  C CG   . PRO B 2 27 ? -13.995 -3.389  -6.777  1.00 0.00 ? 27 PRO B CG   7  
ATOM 5444  C CD   . PRO B 2 27 ? -14.432 -3.155  -5.319  1.00 0.00 ? 27 PRO B CD   7  
ATOM 5445  H HA   . PRO B 2 27 ? -15.389 -0.376  -6.791  1.00 0.00 ? 27 PRO B HA   7  
ATOM 5446  H HB2  . PRO B 2 27 ? -14.801 -2.411  -8.543  1.00 0.00 ? 27 PRO B HB2  7  
ATOM 5447  H HB3  . PRO B 2 27 ? -13.568 -1.472  -7.685  1.00 0.00 ? 27 PRO B HB3  7  
ATOM 5448  H HG2  . PRO B 2 27 ? -14.490 -4.262  -7.180  1.00 0.00 ? 27 PRO B HG2  7  
ATOM 5449  H HG3  . PRO B 2 27 ? -12.924 -3.516  -6.821  1.00 0.00 ? 27 PRO B HG3  7  
ATOM 5450  H HD2  . PRO B 2 27 ? -14.999 -4.002  -4.955  1.00 0.00 ? 27 PRO B HD2  7  
ATOM 5451  H HD3  . PRO B 2 27 ? -13.574 -2.973  -4.691  1.00 0.00 ? 27 PRO B HD3  7  
ATOM 5452  N N    . THR B 2 28 ? -17.565 -0.990  -7.962  1.00 0.00 ? 28 THR B N    7  
ATOM 5453  C CA   . THR B 2 28 ? -18.923 -1.331  -8.472  1.00 0.00 ? 28 THR B CA   7  
ATOM 5454  C C    . THR B 2 28 ? -19.761 -1.922  -7.337  1.00 0.00 ? 28 THR B C    7  
ATOM 5455  O O    . THR B 2 28 ? -20.404 -2.942  -7.493  1.00 0.00 ? 28 THR B O    7  
ATOM 5456  C CB   . THR B 2 28 ? -18.800 -2.356  -9.602  1.00 0.00 ? 28 THR B CB   7  
ATOM 5457  O OG1  . THR B 2 28 ? -18.489 -3.629  -9.053  1.00 0.00 ? 28 THR B OG1  7  
ATOM 5458  C CG2  . THR B 2 28 ? -17.691 -1.928  -10.564 1.00 0.00 ? 28 THR B CG2  7  
ATOM 5459  H H    . THR B 2 28 ? -17.171 -0.116  -8.164  1.00 0.00 ? 28 THR B H    7  
ATOM 5460  H HA   . THR B 2 28 ? -19.401 -0.438  -8.846  1.00 0.00 ? 28 THR B HA   7  
ATOM 5461  H HB   . THR B 2 28 ? -19.734 -2.414  -10.140 1.00 0.00 ? 28 THR B HB   7  
ATOM 5462  H HG1  . THR B 2 28 ? -17.534 -3.732  -9.065  1.00 0.00 ? 28 THR B HG1  7  
ATOM 5463  H HG21 . THR B 2 28 ? -17.514 -0.868  -10.460 1.00 0.00 ? 28 THR B HG21 7  
ATOM 5464  H HG22 . THR B 2 28 ? -17.991 -2.145  -11.579 1.00 0.00 ? 28 THR B HG22 7  
ATOM 5465  H HG23 . THR B 2 28 ? -16.785 -2.469  -10.333 1.00 0.00 ? 28 THR B HG23 7  
ATOM 5466  N N    . LYS B 2 29 ? -19.761 -1.290  -6.195  1.00 0.00 ? 29 LYS B N    7  
ATOM 5467  C CA   . LYS B 2 29 ? -20.558 -1.817  -5.052  1.00 0.00 ? 29 LYS B CA   7  
ATOM 5468  C C    . LYS B 2 29 ? -22.013 -1.366  -5.194  1.00 0.00 ? 29 LYS B C    7  
ATOM 5469  O O    . LYS B 2 29 ? -22.316 -0.190  -5.150  1.00 0.00 ? 29 LYS B O    7  
ATOM 5470  C CB   . LYS B 2 29 ? -19.984 -1.281  -3.739  1.00 0.00 ? 29 LYS B CB   7  
ATOM 5471  C CG   . LYS B 2 29 ? -20.865 -1.732  -2.573  1.00 0.00 ? 29 LYS B CG   7  
ATOM 5472  C CD   . LYS B 2 29 ? -20.139 -1.472  -1.252  1.00 0.00 ? 29 LYS B CD   7  
ATOM 5473  C CE   . LYS B 2 29 ? -20.219 0.017   -0.910  1.00 0.00 ? 29 LYS B CE   7  
ATOM 5474  N NZ   . LYS B 2 29 ? -20.977 0.195   0.360   1.00 0.00 ? 29 LYS B NZ   7  
ATOM 5475  H H    . LYS B 2 29 ? -19.236 -0.470  -6.090  1.00 0.00 ? 29 LYS B H    7  
ATOM 5476  H HA   . LYS B 2 29 ? -20.515 -2.896  -5.050  1.00 0.00 ? 29 LYS B HA   7  
ATOM 5477  H HB2  . LYS B 2 29 ? -18.982 -1.662  -3.603  1.00 0.00 ? 29 LYS B HB2  7  
ATOM 5478  H HB3  . LYS B 2 29 ? -19.958 -0.202  -3.772  1.00 0.00 ? 29 LYS B HB3  7  
ATOM 5479  H HG2  . LYS B 2 29 ? -21.794 -1.179  -2.590  1.00 0.00 ? 29 LYS B HG2  7  
ATOM 5480  H HG3  . LYS B 2 29 ? -21.073 -2.788  -2.666  1.00 0.00 ? 29 LYS B HG3  7  
ATOM 5481  H HD2  . LYS B 2 29 ? -20.604 -2.049  -0.466  1.00 0.00 ? 29 LYS B HD2  7  
ATOM 5482  H HD3  . LYS B 2 29 ? -19.103 -1.762  -1.348  1.00 0.00 ? 29 LYS B HD3  7  
ATOM 5483  H HE2  . LYS B 2 29 ? -19.221 0.414   -0.792  1.00 0.00 ? 29 LYS B HE2  7  
ATOM 5484  H HE3  . LYS B 2 29 ? -20.723 0.543   -1.707  1.00 0.00 ? 29 LYS B HE3  7  
ATOM 5485  H HZ1  . LYS B 2 29 ? -20.338 0.547   1.100   1.00 0.00 ? 29 LYS B HZ1  7  
ATOM 5486  H HZ2  . LYS B 2 29 ? -21.379 -0.719  0.654   1.00 0.00 ? 29 LYS B HZ2  7  
ATOM 5487  H HZ3  . LYS B 2 29 ? -21.745 0.880   0.213   1.00 0.00 ? 29 LYS B HZ3  7  
ATOM 5488  N N    . THR B 2 30 ? -22.918 -2.291  -5.365  1.00 0.00 ? 30 THR B N    7  
ATOM 5489  C CA   . THR B 2 30 ? -24.352 -1.914  -5.510  1.00 0.00 ? 30 THR B CA   7  
ATOM 5490  C C    . THR B 2 30 ? -24.739 -0.943  -4.393  1.00 0.00 ? 30 THR B C    7  
ATOM 5491  O O    . THR B 2 30 ? -24.086 -0.966  -3.362  1.00 0.00 ? 30 THR B O    7  
ATOM 5492  C CB   . THR B 2 30 ? -25.222 -3.170  -5.419  1.00 0.00 ? 30 THR B CB   7  
ATOM 5493  O OG1  . THR B 2 30 ? -26.528 -2.809  -4.994  1.00 0.00 ? 30 THR B OG1  7  
ATOM 5494  C CG2  . THR B 2 30 ? -24.608 -4.147  -4.414  1.00 0.00 ? 30 THR B CG2  7  
ATOM 5495  O OXT  . THR B 2 30 ? -25.682 -0.194  -4.586  1.00 0.00 ? 30 THR B OXT  7  
ATOM 5496  H H    . THR B 2 30 ? -22.653 -3.234  -5.398  1.00 0.00 ? 30 THR B H    7  
ATOM 5497  H HA   . THR B 2 30 ? -24.504 -1.440  -6.468  1.00 0.00 ? 30 THR B HA   7  
ATOM 5498  H HB   . THR B 2 30 ? -25.275 -3.643  -6.387  1.00 0.00 ? 30 THR B HB   7  
ATOM 5499  H HG1  . THR B 2 30 ? -26.489 -2.603  -4.057  1.00 0.00 ? 30 THR B HG1  7  
ATOM 5500  H HG21 . THR B 2 30 ? -24.037 -3.597  -3.681  1.00 0.00 ? 30 THR B HG21 7  
ATOM 5501  H HG22 . THR B 2 30 ? -23.958 -4.836  -4.933  1.00 0.00 ? 30 THR B HG22 7  
ATOM 5502  H HG23 . THR B 2 30 ? -25.395 -4.696  -3.920  1.00 0.00 ? 30 THR B HG23 7  
ATOM 5503  N N    . GLY A 1 1  ? -0.517  0.741   -11.835 1.00 0.00 ? 1  GLY A N    8  
ATOM 5504  C CA   . GLY A 1 1  ? -0.744  1.283   -10.465 1.00 0.00 ? 1  GLY A CA   8  
ATOM 5505  C C    . GLY A 1 1  ? 0.579   1.790   -9.888  1.00 0.00 ? 1  GLY A C    8  
ATOM 5506  O O    . GLY A 1 1  ? 1.634   1.581   -10.454 1.00 0.00 ? 1  GLY A O    8  
ATOM 5507  H H1   . GLY A 1 1  ? -0.356  -0.284  -11.780 1.00 0.00 ? 1  GLY A H1   8  
ATOM 5508  H H2   . GLY A 1 1  ? 0.315   1.202   -12.256 1.00 0.00 ? 1  GLY A H2   8  
ATOM 5509  H H3   . GLY A 1 1  ? -1.353  0.926   -12.424 1.00 0.00 ? 1  GLY A H3   8  
ATOM 5510  H HA2  . GLY A 1 1  ? -1.453  2.098   -10.514 1.00 0.00 ? 1  GLY A HA2  8  
ATOM 5511  H HA3  . GLY A 1 1  ? -1.135  0.504   -9.829  1.00 0.00 ? 1  GLY A HA3  8  
ATOM 5512  N N    . ILE A 1 2  ? 0.531   2.454   -8.767  1.00 0.00 ? 2  ILE A N    8  
ATOM 5513  C CA   . ILE A 1 2  ? 1.786   2.974   -8.154  1.00 0.00 ? 2  ILE A CA   8  
ATOM 5514  C C    . ILE A 1 2  ? 2.727   1.809   -7.849  1.00 0.00 ? 2  ILE A C    8  
ATOM 5515  O O    . ILE A 1 2  ? 3.932   1.927   -7.955  1.00 0.00 ? 2  ILE A O    8  
ATOM 5516  C CB   . ILE A 1 2  ? 1.452   3.716   -6.858  1.00 0.00 ? 2  ILE A CB   8  
ATOM 5517  C CG1  . ILE A 1 2  ? 0.343   2.967   -6.114  1.00 0.00 ? 2  ILE A CG1  8  
ATOM 5518  C CG2  . ILE A 1 2  ? 0.977   5.132   -7.187  1.00 0.00 ? 2  ILE A CG2  8  
ATOM 5519  C CD1  . ILE A 1 2  ? 0.369   3.354   -4.634  1.00 0.00 ? 2  ILE A CD1  8  
ATOM 5520  H H    . ILE A 1 2  ? -0.331  2.612   -8.327  1.00 0.00 ? 2  ILE A H    8  
ATOM 5521  H HA   . ILE A 1 2  ? 2.268   3.651   -8.842  1.00 0.00 ? 2  ILE A HA   8  
ATOM 5522  H HB   . ILE A 1 2  ? 2.334   3.768   -6.236  1.00 0.00 ? 2  ILE A HB   8  
ATOM 5523  H HG12 . ILE A 1 2  ? -0.615  3.229   -6.538  1.00 0.00 ? 2  ILE A HG12 8  
ATOM 5524  H HG13 . ILE A 1 2  ? 0.500   1.903   -6.208  1.00 0.00 ? 2  ILE A HG13 8  
ATOM 5525  H HG21 . ILE A 1 2  ? 1.189   5.350   -8.223  1.00 0.00 ? 2  ILE A HG21 8  
ATOM 5526  H HG22 . ILE A 1 2  ? 1.493   5.840   -6.557  1.00 0.00 ? 2  ILE A HG22 8  
ATOM 5527  H HG23 . ILE A 1 2  ? -0.087  5.204   -7.015  1.00 0.00 ? 2  ILE A HG23 8  
ATOM 5528  H HD11 . ILE A 1 2  ? 0.351   4.430   -4.542  1.00 0.00 ? 2  ILE A HD11 8  
ATOM 5529  H HD12 . ILE A 1 2  ? 1.269   2.968   -4.177  1.00 0.00 ? 2  ILE A HD12 8  
ATOM 5530  H HD13 . ILE A 1 2  ? -0.494  2.936   -4.137  1.00 0.00 ? 2  ILE A HD13 8  
ATOM 5531  N N    . VAL A 1 3  ? 2.188   0.684   -7.471  1.00 0.00 ? 3  VAL A N    8  
ATOM 5532  C CA   . VAL A 1 3  ? 3.042   -0.485  -7.161  1.00 0.00 ? 3  VAL A CA   8  
ATOM 5533  C C    . VAL A 1 3  ? 3.830   -0.885  -8.411  1.00 0.00 ? 3  VAL A C    8  
ATOM 5534  O O    . VAL A 1 3  ? 5.005   -1.183  -8.346  1.00 0.00 ? 3  VAL A O    8  
ATOM 5535  C CB   . VAL A 1 3  ? 2.146   -1.640  -6.696  1.00 0.00 ? 3  VAL A CB   8  
ATOM 5536  C CG1  . VAL A 1 3  ? 0.864   -1.680  -7.532  1.00 0.00 ? 3  VAL A CG1  8  
ATOM 5537  C CG2  . VAL A 1 3  ? 2.886   -2.961  -6.857  1.00 0.00 ? 3  VAL A CG2  8  
ATOM 5538  H H    . VAL A 1 3  ? 1.219   0.607   -7.391  1.00 0.00 ? 3  VAL A H    8  
ATOM 5539  H HA   . VAL A 1 3  ? 3.730   -0.226  -6.374  1.00 0.00 ? 3  VAL A HA   8  
ATOM 5540  H HB   . VAL A 1 3  ? 1.889   -1.496  -5.657  1.00 0.00 ? 3  VAL A HB   8  
ATOM 5541  H HG11 . VAL A 1 3  ? 0.930   -0.960  -8.332  1.00 0.00 ? 3  VAL A HG11 8  
ATOM 5542  H HG12 . VAL A 1 3  ? 0.018   -1.443  -6.904  1.00 0.00 ? 3  VAL A HG12 8  
ATOM 5543  H HG13 . VAL A 1 3  ? 0.737   -2.669  -7.947  1.00 0.00 ? 3  VAL A HG13 8  
ATOM 5544  H HG21 . VAL A 1 3  ? 3.015   -3.170  -7.909  1.00 0.00 ? 3  VAL A HG21 8  
ATOM 5545  H HG22 . VAL A 1 3  ? 2.311   -3.750  -6.399  1.00 0.00 ? 3  VAL A HG22 8  
ATOM 5546  H HG23 . VAL A 1 3  ? 3.851   -2.889  -6.381  1.00 0.00 ? 3  VAL A HG23 8  
ATOM 5547  N N    . GLU A 1 4  ? 3.194   -0.893  -9.547  1.00 0.00 ? 4  GLU A N    8  
ATOM 5548  C CA   . GLU A 1 4  ? 3.907   -1.273  -10.799 1.00 0.00 ? 4  GLU A CA   8  
ATOM 5549  C C    . GLU A 1 4  ? 4.922   -0.188  -11.158 1.00 0.00 ? 4  GLU A C    8  
ATOM 5550  O O    . GLU A 1 4  ? 6.001   -0.467  -11.640 1.00 0.00 ? 4  GLU A O    8  
ATOM 5551  C CB   . GLU A 1 4  ? 2.897   -1.424  -11.938 1.00 0.00 ? 4  GLU A CB   8  
ATOM 5552  C CG   . GLU A 1 4  ? 3.611   -1.944  -13.186 1.00 0.00 ? 4  GLU A CG   8  
ATOM 5553  C CD   . GLU A 1 4  ? 2.620   -2.021  -14.349 1.00 0.00 ? 4  GLU A CD   8  
ATOM 5554  O OE1  . GLU A 1 4  ? 2.302   -0.980  -14.900 1.00 0.00 ? 4  GLU A OE1  8  
ATOM 5555  O OE2  . GLU A 1 4  ? 2.195   -3.119  -14.667 1.00 0.00 ? 4  GLU A OE2  8  
ATOM 5556  H H    . GLU A 1 4  ? 2.248   -0.647  -9.578  1.00 0.00 ? 4  GLU A H    8  
ATOM 5557  H HA   . GLU A 1 4  ? 4.421   -2.209  -10.648 1.00 0.00 ? 4  GLU A HA   8  
ATOM 5558  H HB2  . GLU A 1 4  ? 2.126   -2.122  -11.645 1.00 0.00 ? 4  GLU A HB2  8  
ATOM 5559  H HB3  . GLU A 1 4  ? 2.451   -0.465  -12.154 1.00 0.00 ? 4  GLU A HB3  8  
ATOM 5560  H HG2  . GLU A 1 4  ? 4.418   -1.273  -13.444 1.00 0.00 ? 4  GLU A HG2  8  
ATOM 5561  H HG3  . GLU A 1 4  ? 4.010   -2.928  -12.990 1.00 0.00 ? 4  GLU A HG3  8  
ATOM 5562  N N    . GLN A 1 5  ? 4.580   1.049   -10.932 1.00 0.00 ? 5  GLN A N    8  
ATOM 5563  C CA   . GLN A 1 5  ? 5.521   2.156   -11.265 1.00 0.00 ? 5  GLN A CA   8  
ATOM 5564  C C    . GLN A 1 5  ? 6.560   2.302   -10.152 1.00 0.00 ? 5  GLN A C    8  
ATOM 5565  O O    . GLN A 1 5  ? 7.700   2.641   -10.397 1.00 0.00 ? 5  GLN A O    8  
ATOM 5566  C CB   . GLN A 1 5  ? 4.739   3.463   -11.408 1.00 0.00 ? 5  GLN A CB   8  
ATOM 5567  C CG   . GLN A 1 5  ? 5.096   4.129   -12.738 1.00 0.00 ? 5  GLN A CG   8  
ATOM 5568  C CD   . GLN A 1 5  ? 4.980   5.648   -12.597 1.00 0.00 ? 5  GLN A CD   8  
ATOM 5569  O OE1  . GLN A 1 5  ? 4.435   6.139   -11.628 1.00 0.00 ? 5  GLN A OE1  8  
ATOM 5570  N NE2  . GLN A 1 5  ? 5.472   6.417   -13.529 1.00 0.00 ? 5  GLN A NE2  8  
ATOM 5571  H H    . GLN A 1 5  ? 3.703   1.250   -10.546 1.00 0.00 ? 5  GLN A H    8  
ATOM 5572  H HA   . GLN A 1 5  ? 6.021   1.933   -12.194 1.00 0.00 ? 5  GLN A HA   8  
ATOM 5573  H HB2  . GLN A 1 5  ? 3.679   3.253   -11.382 1.00 0.00 ? 5  GLN A HB2  8  
ATOM 5574  H HB3  . GLN A 1 5  ? 4.994   4.126   -10.595 1.00 0.00 ? 5  GLN A HB3  8  
ATOM 5575  H HG2  . GLN A 1 5  ? 6.108   3.868   -13.010 1.00 0.00 ? 5  GLN A HG2  8  
ATOM 5576  H HG3  . GLN A 1 5  ? 4.417   3.788   -13.505 1.00 0.00 ? 5  GLN A HG3  8  
ATOM 5577  H HE21 . GLN A 1 5  ? 5.912   6.021   -14.310 1.00 0.00 ? 5  GLN A HE21 8  
ATOM 5578  H HE22 . GLN A 1 5  ? 5.403   7.391   -13.447 1.00 0.00 ? 5  GLN A HE22 8  
ATOM 5579  N N    . CYS A 1 6  ? 6.176   2.054   -8.931  1.00 0.00 ? 6  CYS A N    8  
ATOM 5580  C CA   . CYS A 1 6  ? 7.147   2.187   -7.808  1.00 0.00 ? 6  CYS A CA   8  
ATOM 5581  C C    . CYS A 1 6  ? 7.470   0.805   -7.233  1.00 0.00 ? 6  CYS A C    8  
ATOM 5582  O O    . CYS A 1 6  ? 7.933   0.683   -6.117  1.00 0.00 ? 6  CYS A O    8  
ATOM 5583  C CB   . CYS A 1 6  ? 6.543   3.065   -6.710  1.00 0.00 ? 6  CYS A CB   8  
ATOM 5584  S SG   . CYS A 1 6  ? 7.671   4.433   -6.344  1.00 0.00 ? 6  CYS A SG   8  
ATOM 5585  H H    . CYS A 1 6  ? 5.251   1.786   -8.753  1.00 0.00 ? 6  CYS A H    8  
ATOM 5586  H HA   . CYS A 1 6  ? 8.055   2.644   -8.172  1.00 0.00 ? 6  CYS A HA   8  
ATOM 5587  H HB2  . CYS A 1 6  ? 5.595   3.458   -7.045  1.00 0.00 ? 6  CYS A HB2  8  
ATOM 5588  H HB3  . CYS A 1 6  ? 6.393   2.473   -5.818  1.00 0.00 ? 6  CYS A HB3  8  
ATOM 5589  N N    . CYS A 1 7  ? 7.232   -0.238  -7.982  1.00 0.00 ? 7  CYS A N    8  
ATOM 5590  C CA   . CYS A 1 7  ? 7.532   -1.602  -7.464  1.00 0.00 ? 7  CYS A CA   8  
ATOM 5591  C C    . CYS A 1 7  ? 8.959   -1.633  -6.914  1.00 0.00 ? 7  CYS A C    8  
ATOM 5592  O O    . CYS A 1 7  ? 9.264   -2.365  -5.994  1.00 0.00 ? 7  CYS A O    8  
ATOM 5593  C CB   . CYS A 1 7  ? 7.405   -2.627  -8.592  1.00 0.00 ? 7  CYS A CB   8  
ATOM 5594  S SG   . CYS A 1 7  ? 7.645   -4.291  -7.919  1.00 0.00 ? 7  CYS A SG   8  
ATOM 5595  H H    . CYS A 1 7  ? 6.859   -0.123  -8.881  1.00 0.00 ? 7  CYS A H    8  
ATOM 5596  H HA   . CYS A 1 7  ? 6.837   -1.847  -6.674  1.00 0.00 ? 7  CYS A HA   8  
ATOM 5597  H HB2  . CYS A 1 7  ? 6.424   -2.557  -9.037  1.00 0.00 ? 7  CYS A HB2  8  
ATOM 5598  H HB3  . CYS A 1 7  ? 8.156   -2.431  -9.344  1.00 0.00 ? 7  CYS A HB3  8  
ATOM 5599  N N    . THR A 1 8  ? 9.836   -0.843  -7.471  1.00 0.00 ? 8  THR A N    8  
ATOM 5600  C CA   . THR A 1 8  ? 11.243  -0.827  -6.981  1.00 0.00 ? 8  THR A CA   8  
ATOM 5601  C C    . THR A 1 8  ? 11.250  -0.656  -5.461  1.00 0.00 ? 8  THR A C    8  
ATOM 5602  O O    . THR A 1 8  ? 11.265  0.447   -4.950  1.00 0.00 ? 8  THR A O    8  
ATOM 5603  C CB   . THR A 1 8  ? 11.997  0.336   -7.630  1.00 0.00 ? 8  THR A CB   8  
ATOM 5604  O OG1  . THR A 1 8  ? 11.373  0.674   -8.861  1.00 0.00 ? 8  THR A OG1  8  
ATOM 5605  C CG2  . THR A 1 8  ? 13.448  -0.075  -7.888  1.00 0.00 ? 8  THR A CG2  8  
ATOM 5606  H H    . THR A 1 8  ? 9.569   -0.260  -8.212  1.00 0.00 ? 8  THR A H    8  
ATOM 5607  H HA   . THR A 1 8  ? 11.724  -1.758  -7.240  1.00 0.00 ? 8  THR A HA   8  
ATOM 5608  H HB   . THR A 1 8  ? 11.981  1.189   -6.971  1.00 0.00 ? 8  THR A HB   8  
ATOM 5609  H HG1  . THR A 1 8  ? 11.885  1.376   -9.270  1.00 0.00 ? 8  THR A HG1  8  
ATOM 5610  H HG21 . THR A 1 8  ? 13.986  -0.104  -6.952  1.00 0.00 ? 8  THR A HG21 8  
ATOM 5611  H HG22 . THR A 1 8  ? 13.913  0.641   -8.549  1.00 0.00 ? 8  THR A HG22 8  
ATOM 5612  H HG23 . THR A 1 8  ? 13.469  -1.053  -8.345  1.00 0.00 ? 8  THR A HG23 8  
ATOM 5613  N N    . SER A 1 9  ? 11.240  -1.739  -4.735  1.00 0.00 ? 9  SER A N    8  
ATOM 5614  C CA   . SER A 1 9  ? 11.246  -1.641  -3.249  1.00 0.00 ? 9  SER A CA   8  
ATOM 5615  C C    . SER A 1 9  ? 10.129  -0.707  -2.791  1.00 0.00 ? 9  SER A C    8  
ATOM 5616  O O    . SER A 1 9  ? 9.126   -0.548  -3.459  1.00 0.00 ? 9  SER A O    8  
ATOM 5617  C CB   . SER A 1 9  ? 12.583  -1.079  -2.779  1.00 0.00 ? 9  SER A CB   8  
ATOM 5618  O OG   . SER A 1 9  ? 13.602  -1.452  -3.697  1.00 0.00 ? 9  SER A OG   8  
ATOM 5619  H H    . SER A 1 9  ? 11.228  -2.619  -5.167  1.00 0.00 ? 9  SER A H    8  
ATOM 5620  H HA   . SER A 1 9  ? 11.097  -2.621  -2.821  1.00 0.00 ? 9  SER A HA   8  
ATOM 5621  H HB2  . SER A 1 9  ? 12.522  -0.005  -2.730  1.00 0.00 ? 9  SER A HB2  8  
ATOM 5622  H HB3  . SER A 1 9  ? 12.806  -1.468  -1.796  1.00 0.00 ? 9  SER A HB3  8  
ATOM 5623  H HG   . SER A 1 9  ? 13.916  -2.326  -3.452  1.00 0.00 ? 9  SER A HG   8  
ATOM 5624  N N    . ILE A 1 10 ? 10.301  -0.081  -1.655  1.00 0.00 ? 10 ILE A N    8  
ATOM 5625  C CA   . ILE A 1 10 ? 9.254   0.850   -1.141  1.00 0.00 ? 10 ILE A CA   8  
ATOM 5626  C C    . ILE A 1 10 ? 9.740   2.285   -1.330  1.00 0.00 ? 10 ILE A C    8  
ATOM 5627  O O    . ILE A 1 10 ? 10.701  2.714   -0.723  1.00 0.00 ? 10 ILE A O    8  
ATOM 5628  C CB   . ILE A 1 10 ? 8.982   0.561   0.361   1.00 0.00 ? 10 ILE A CB   8  
ATOM 5629  C CG1  . ILE A 1 10 ? 8.698   1.854   1.146   1.00 0.00 ? 10 ILE A CG1  8  
ATOM 5630  C CG2  . ILE A 1 10 ? 10.195  -0.121  0.990   1.00 0.00 ? 10 ILE A CG2  8  
ATOM 5631  C CD1  . ILE A 1 10 ? 7.349   2.433   0.727   1.00 0.00 ? 10 ILE A CD1  8  
ATOM 5632  H H    . ILE A 1 10 ? 11.124  -0.223  -1.142  1.00 0.00 ? 10 ILE A H    8  
ATOM 5633  H HA   . ILE A 1 10 ? 8.343   0.708   -1.704  1.00 0.00 ? 10 ILE A HA   8  
ATOM 5634  H HB   . ILE A 1 10 ? 8.130   -0.096  0.445   1.00 0.00 ? 10 ILE A HB   8  
ATOM 5635  H HG12 . ILE A 1 10 ? 8.677   1.630   2.203   1.00 0.00 ? 10 ILE A HG12 8  
ATOM 5636  H HG13 . ILE A 1 10 ? 9.475   2.576   0.952   1.00 0.00 ? 10 ILE A HG13 8  
ATOM 5637  H HG21 . ILE A 1 10 ? 10.024  -0.261  2.049   1.00 0.00 ? 10 ILE A HG21 8  
ATOM 5638  H HG22 . ILE A 1 10 ? 11.070  0.498   0.850   1.00 0.00 ? 10 ILE A HG22 8  
ATOM 5639  H HG23 . ILE A 1 10 ? 10.357  -1.081  0.523   1.00 0.00 ? 10 ILE A HG23 8  
ATOM 5640  H HD11 . ILE A 1 10 ? 6.818   2.776   1.604   1.00 0.00 ? 10 ILE A HD11 8  
ATOM 5641  H HD12 . ILE A 1 10 ? 6.769   1.670   0.231   1.00 0.00 ? 10 ILE A HD12 8  
ATOM 5642  H HD13 . ILE A 1 10 ? 7.507   3.262   0.055   1.00 0.00 ? 10 ILE A HD13 8  
ATOM 5643  N N    . CYS A 1 11 ? 9.072   3.035   -2.158  1.00 0.00 ? 11 CYS A N    8  
ATOM 5644  C CA   . CYS A 1 11 ? 9.486   4.443   -2.364  1.00 0.00 ? 11 CYS A CA   8  
ATOM 5645  C C    . CYS A 1 11 ? 8.578   5.321   -1.513  1.00 0.00 ? 11 CYS A C    8  
ATOM 5646  O O    . CYS A 1 11 ? 7.374   5.324   -1.680  1.00 0.00 ? 11 CYS A O    8  
ATOM 5647  C CB   . CYS A 1 11 ? 9.330   4.816   -3.840  1.00 0.00 ? 11 CYS A CB   8  
ATOM 5648  S SG   . CYS A 1 11 ? 7.599   4.612   -4.332  1.00 0.00 ? 11 CYS A SG   8  
ATOM 5649  H H    . CYS A 1 11 ? 8.292   2.676   -2.631  1.00 0.00 ? 11 CYS A H    8  
ATOM 5650  H HA   . CYS A 1 11 ? 10.514  4.572   -2.057  1.00 0.00 ? 11 CYS A HA   8  
ATOM 5651  H HB2  . CYS A 1 11 ? 9.628   5.844   -3.985  1.00 0.00 ? 11 CYS A HB2  8  
ATOM 5652  H HB3  . CYS A 1 11 ? 9.954   4.172   -4.441  1.00 0.00 ? 11 CYS A HB3  8  
ATOM 5653  N N    . SER A 1 12 ? 9.146   6.059   -0.602  1.00 0.00 ? 12 SER A N    8  
ATOM 5654  C CA   . SER A 1 12 ? 8.329   6.933   0.275   1.00 0.00 ? 12 SER A CA   8  
ATOM 5655  C C    . SER A 1 12 ? 7.028   6.221   0.654   1.00 0.00 ? 12 SER A C    8  
ATOM 5656  O O    . SER A 1 12 ? 6.041   6.313   -0.045  1.00 0.00 ? 12 SER A O    8  
ATOM 5657  C CB   . SER A 1 12 ? 8.004   8.231   -0.464  1.00 0.00 ? 12 SER A CB   8  
ATOM 5658  O OG   . SER A 1 12 ? 8.302   9.337   0.377   1.00 0.00 ? 12 SER A OG   8  
ATOM 5659  H H    . SER A 1 12 ? 10.113  6.033   -0.489  1.00 0.00 ? 12 SER A H    8  
ATOM 5660  H HA   . SER A 1 12 ? 8.886   7.162   1.172   1.00 0.00 ? 12 SER A HA   8  
ATOM 5661  H HB2  . SER A 1 12 ? 8.599   8.296   -1.360  1.00 0.00 ? 12 SER A HB2  8  
ATOM 5662  H HB3  . SER A 1 12 ? 6.955   8.239   -0.730  1.00 0.00 ? 12 SER A HB3  8  
ATOM 5663  H HG   . SER A 1 12 ? 7.820   9.223   1.199   1.00 0.00 ? 12 SER A HG   8  
ATOM 5664  N N    . LEU A 1 13 ? 6.999   5.531   1.764   1.00 0.00 ? 13 LEU A N    8  
ATOM 5665  C CA   . LEU A 1 13 ? 5.732   4.861   2.163   1.00 0.00 ? 13 LEU A CA   8  
ATOM 5666  C C    . LEU A 1 13 ? 4.663   5.933   2.140   1.00 0.00 ? 13 LEU A C    8  
ATOM 5667  O O    . LEU A 1 13 ? 3.510   5.682   1.868   1.00 0.00 ? 13 LEU A O    8  
ATOM 5668  C CB   . LEU A 1 13 ? 5.862   4.269   3.571   1.00 0.00 ? 13 LEU A CB   8  
ATOM 5669  C CG   . LEU A 1 13 ? 5.937   5.394   4.608   1.00 0.00 ? 13 LEU A CG   8  
ATOM 5670  C CD1  . LEU A 1 13 ? 5.714   4.814   6.005   1.00 0.00 ? 13 LEU A CD1  8  
ATOM 5671  C CD2  . LEU A 1 13 ? 7.317   6.053   4.549   1.00 0.00 ? 13 LEU A CD2  8  
ATOM 5672  H H    . LEU A 1 13 ? 7.791   5.474   2.334   1.00 0.00 ? 13 LEU A H    8  
ATOM 5673  H HA   . LEU A 1 13 ? 5.475   4.089   1.453   1.00 0.00 ? 13 LEU A HA   8  
ATOM 5674  H HB2  . LEU A 1 13 ? 5.004   3.647   3.779   1.00 0.00 ? 13 LEU A HB2  8  
ATOM 5675  H HB3  . LEU A 1 13 ? 6.760   3.671   3.627   1.00 0.00 ? 13 LEU A HB3  8  
ATOM 5676  H HG   . LEU A 1 13 ? 5.174   6.130   4.400   1.00 0.00 ? 13 LEU A HG   8  
ATOM 5677  H HD11 . LEU A 1 13 ? 5.270   3.833   5.921   1.00 0.00 ? 13 LEU A HD11 8  
ATOM 5678  H HD12 . LEU A 1 13 ? 5.054   5.461   6.563   1.00 0.00 ? 13 LEU A HD12 8  
ATOM 5679  H HD13 . LEU A 1 13 ? 6.662   4.737   6.519   1.00 0.00 ? 13 LEU A HD13 8  
ATOM 5680  H HD21 . LEU A 1 13 ? 7.283   6.902   3.883   1.00 0.00 ? 13 LEU A HD21 8  
ATOM 5681  H HD22 . LEU A 1 13 ? 8.042   5.340   4.185   1.00 0.00 ? 13 LEU A HD22 8  
ATOM 5682  H HD23 . LEU A 1 13 ? 7.601   6.382   5.537   1.00 0.00 ? 13 LEU A HD23 8  
ATOM 5683  N N    . TYR A 1 14 ? 5.065   7.142   2.387   1.00 0.00 ? 14 TYR A N    8  
ATOM 5684  C CA   . TYR A 1 14 ? 4.103   8.270   2.341   1.00 0.00 ? 14 TYR A CA   8  
ATOM 5685  C C    . TYR A 1 14 ? 3.592   8.382   0.907   1.00 0.00 ? 14 TYR A C    8  
ATOM 5686  O O    . TYR A 1 14 ? 2.439   8.681   0.667   1.00 0.00 ? 14 TYR A O    8  
ATOM 5687  C CB   . TYR A 1 14 ? 4.803   9.569   2.745   1.00 0.00 ? 14 TYR A CB   8  
ATOM 5688  C CG   . TYR A 1 14 ? 4.179   10.103  4.012   1.00 0.00 ? 14 TYR A CG   8  
ATOM 5689  C CD1  . TYR A 1 14 ? 4.307   9.389   5.210   1.00 0.00 ? 14 TYR A CD1  8  
ATOM 5690  C CD2  . TYR A 1 14 ? 3.470   11.310  3.988   1.00 0.00 ? 14 TYR A CD2  8  
ATOM 5691  C CE1  . TYR A 1 14 ? 3.727   9.884   6.384   1.00 0.00 ? 14 TYR A CE1  8  
ATOM 5692  C CE2  . TYR A 1 14 ? 2.889   11.804  5.162   1.00 0.00 ? 14 TYR A CE2  8  
ATOM 5693  C CZ   . TYR A 1 14 ? 3.018   11.091  6.360   1.00 0.00 ? 14 TYR A CZ   8  
ATOM 5694  O OH   . TYR A 1 14 ? 2.446   11.578  7.518   1.00 0.00 ? 14 TYR A OH   8  
ATOM 5695  H H    . TYR A 1 14 ? 6.013   7.306   2.568   1.00 0.00 ? 14 TYR A H    8  
ATOM 5696  H HA   . TYR A 1 14 ? 3.276   8.074   3.006   1.00 0.00 ? 14 TYR A HA   8  
ATOM 5697  H HB2  . TYR A 1 14 ? 5.852   9.375   2.915   1.00 0.00 ? 14 TYR A HB2  8  
ATOM 5698  H HB3  . TYR A 1 14 ? 4.695   10.298  1.957   1.00 0.00 ? 14 TYR A HB3  8  
ATOM 5699  H HD1  . TYR A 1 14 ? 4.854   8.458   5.228   1.00 0.00 ? 14 TYR A HD1  8  
ATOM 5700  H HD2  . TYR A 1 14 ? 3.371   11.860  3.064   1.00 0.00 ? 14 TYR A HD2  8  
ATOM 5701  H HE1  . TYR A 1 14 ? 3.826   9.333   7.308   1.00 0.00 ? 14 TYR A HE1  8  
ATOM 5702  H HE2  . TYR A 1 14 ? 2.343   12.735  5.144   1.00 0.00 ? 14 TYR A HE2  8  
ATOM 5703  H HH   . TYR A 1 14 ? 2.861   12.419  7.722   1.00 0.00 ? 14 TYR A HH   8  
ATOM 5704  N N    . GLN A 1 15 ? 4.441   8.110   -0.052  1.00 0.00 ? 15 GLN A N    8  
ATOM 5705  C CA   . GLN A 1 15 ? 3.994   8.166   -1.470  1.00 0.00 ? 15 GLN A CA   8  
ATOM 5706  C C    . GLN A 1 15 ? 2.933   7.086   -1.664  1.00 0.00 ? 15 GLN A C    8  
ATOM 5707  O O    . GLN A 1 15 ? 1.878   7.326   -2.217  1.00 0.00 ? 15 GLN A O    8  
ATOM 5708  C CB   . GLN A 1 15 ? 5.180   7.905   -2.402  1.00 0.00 ? 15 GLN A CB   8  
ATOM 5709  C CG   . GLN A 1 15 ? 5.862   9.231   -2.745  1.00 0.00 ? 15 GLN A CG   8  
ATOM 5710  C CD   . GLN A 1 15 ? 5.994   9.362   -4.263  1.00 0.00 ? 15 GLN A CD   8  
ATOM 5711  O OE1  . GLN A 1 15 ? 6.109   8.375   -4.963  1.00 0.00 ? 15 GLN A OE1  8  
ATOM 5712  N NE2  . GLN A 1 15 ? 5.981   10.549  -4.807  1.00 0.00 ? 15 GLN A NE2  8  
ATOM 5713  H H    . GLN A 1 15 ? 5.365   7.846   0.165   1.00 0.00 ? 15 GLN A H    8  
ATOM 5714  H HA   . GLN A 1 15 ? 3.569   9.137   -1.680  1.00 0.00 ? 15 GLN A HA   8  
ATOM 5715  H HB2  . GLN A 1 15 ? 5.887   7.252   -1.912  1.00 0.00 ? 15 GLN A HB2  8  
ATOM 5716  H HB3  . GLN A 1 15 ? 4.829   7.438   -3.310  1.00 0.00 ? 15 GLN A HB3  8  
ATOM 5717  H HG2  . GLN A 1 15 ? 5.269   10.049  -2.362  1.00 0.00 ? 15 GLN A HG2  8  
ATOM 5718  H HG3  . GLN A 1 15 ? 6.844   9.258   -2.297  1.00 0.00 ? 15 GLN A HG3  8  
ATOM 5719  H HE21 . GLN A 1 15 ? 5.888   11.345  -4.243  1.00 0.00 ? 15 GLN A HE21 8  
ATOM 5720  H HE22 . GLN A 1 15 ? 6.065   10.644  -5.779  1.00 0.00 ? 15 GLN A HE22 8  
ATOM 5721  N N    . LEU A 1 16 ? 3.193   5.901   -1.174  1.00 0.00 ? 16 LEU A N    8  
ATOM 5722  C CA   . LEU A 1 16 ? 2.188   4.816   -1.287  1.00 0.00 ? 16 LEU A CA   8  
ATOM 5723  C C    . LEU A 1 16 ? 1.040   5.171   -0.351  1.00 0.00 ? 16 LEU A C    8  
ATOM 5724  O O    . LEU A 1 16 ? -0.121  4.994   -0.665  1.00 0.00 ? 16 LEU A O    8  
ATOM 5725  C CB   . LEU A 1 16 ? 2.815   3.486   -0.861  1.00 0.00 ? 16 LEU A CB   8  
ATOM 5726  C CG   . LEU A 1 16 ? 3.973   3.143   -1.799  1.00 0.00 ? 16 LEU A CG   8  
ATOM 5727  C CD1  . LEU A 1 16 ? 4.860   2.079   -1.149  1.00 0.00 ? 16 LEU A CD1  8  
ATOM 5728  C CD2  . LEU A 1 16 ? 3.418   2.605   -3.119  1.00 0.00 ? 16 LEU A CD2  8  
ATOM 5729  H H    . LEU A 1 16 ? 4.035   5.738   -0.704  1.00 0.00 ? 16 LEU A H    8  
ATOM 5730  H HA   . LEU A 1 16 ? 1.828   4.749   -2.304  1.00 0.00 ? 16 LEU A HA   8  
ATOM 5731  H HB2  . LEU A 1 16 ? 3.183   3.570   0.152   1.00 0.00 ? 16 LEU A HB2  8  
ATOM 5732  H HB3  . LEU A 1 16 ? 2.072   2.704   -0.910  1.00 0.00 ? 16 LEU A HB3  8  
ATOM 5733  H HG   . LEU A 1 16 ? 4.558   4.032   -1.987  1.00 0.00 ? 16 LEU A HG   8  
ATOM 5734  H HD11 . LEU A 1 16 ? 5.802   2.026   -1.674  1.00 0.00 ? 16 LEU A HD11 8  
ATOM 5735  H HD12 . LEU A 1 16 ? 4.366   1.120   -1.197  1.00 0.00 ? 16 LEU A HD12 8  
ATOM 5736  H HD13 . LEU A 1 16 ? 5.038   2.341   -0.116  1.00 0.00 ? 16 LEU A HD13 8  
ATOM 5737  H HD21 . LEU A 1 16 ? 3.024   3.423   -3.704  1.00 0.00 ? 16 LEU A HD21 8  
ATOM 5738  H HD22 . LEU A 1 16 ? 2.630   1.895   -2.916  1.00 0.00 ? 16 LEU A HD22 8  
ATOM 5739  H HD23 . LEU A 1 16 ? 4.209   2.117   -3.670  1.00 0.00 ? 16 LEU A HD23 8  
ATOM 5740  N N    . GLU A 1 17 ? 1.371   5.696   0.798   1.00 0.00 ? 17 GLU A N    8  
ATOM 5741  C CA   . GLU A 1 17 ? 0.322   6.097   1.770   1.00 0.00 ? 17 GLU A CA   8  
ATOM 5742  C C    . GLU A 1 17 ? -0.540  7.191   1.141   1.00 0.00 ? 17 GLU A C    8  
ATOM 5743  O O    . GLU A 1 17 ? -1.738  7.211   1.291   1.00 0.00 ? 17 GLU A O    8  
ATOM 5744  C CB   . GLU A 1 17 ? 0.979   6.640   3.042   1.00 0.00 ? 17 GLU A CB   8  
ATOM 5745  C CG   . GLU A 1 17 ? 0.094   6.327   4.250   1.00 0.00 ? 17 GLU A CG   8  
ATOM 5746  C CD   . GLU A 1 17 ? -1.028  7.362   4.345   1.00 0.00 ? 17 GLU A CD   8  
ATOM 5747  O OE1  . GLU A 1 17 ? -1.129  8.182   3.448   1.00 0.00 ? 17 GLU A OE1  8  
ATOM 5748  O OE2  . GLU A 1 17 ? -1.769  7.316   5.313   1.00 0.00 ? 17 GLU A OE2  8  
ATOM 5749  H H    . GLU A 1 17 ? 2.319   5.834   1.017   1.00 0.00 ? 17 GLU A H    8  
ATOM 5750  H HA   . GLU A 1 17 ? -0.290  5.244   2.012   1.00 0.00 ? 17 GLU A HA   8  
ATOM 5751  H HB2  . GLU A 1 17 ? 1.946   6.177   3.173   1.00 0.00 ? 17 GLU A HB2  8  
ATOM 5752  H HB3  . GLU A 1 17 ? 1.101   7.709   2.956   1.00 0.00 ? 17 GLU A HB3  8  
ATOM 5753  H HG2  . GLU A 1 17 ? -0.332  5.341   4.138   1.00 0.00 ? 17 GLU A HG2  8  
ATOM 5754  H HG3  . GLU A 1 17 ? 0.690   6.361   5.150   1.00 0.00 ? 17 GLU A HG3  8  
ATOM 5755  N N    . ASN A 1 18 ? 0.056   8.098   0.420   1.00 0.00 ? 18 ASN A N    8  
ATOM 5756  C CA   . ASN A 1 18 ? -0.756  9.171   -0.217  1.00 0.00 ? 18 ASN A CA   8  
ATOM 5757  C C    . ASN A 1 18 ? -1.861  8.518   -1.049  1.00 0.00 ? 18 ASN A C    8  
ATOM 5758  O O    . ASN A 1 18 ? -2.863  9.127   -1.366  1.00 0.00 ? 18 ASN A O    8  
ATOM 5759  C CB   . ASN A 1 18 ? 0.138   10.020  -1.124  1.00 0.00 ? 18 ASN A CB   8  
ATOM 5760  C CG   . ASN A 1 18 ? 0.416   11.365  -0.450  1.00 0.00 ? 18 ASN A CG   8  
ATOM 5761  O OD1  . ASN A 1 18 ? -0.472  12.183  -0.310  1.00 0.00 ? 18 ASN A OD1  8  
ATOM 5762  N ND2  . ASN A 1 18 ? 1.621   11.632  -0.024  1.00 0.00 ? 18 ASN A ND2  8  
ATOM 5763  H H    . ASN A 1 18 ? 1.028   8.069   0.294   1.00 0.00 ? 18 ASN A H    8  
ATOM 5764  H HA   . ASN A 1 18 ? -1.197  9.795   0.547   1.00 0.00 ? 18 ASN A HA   8  
ATOM 5765  H HB2  . ASN A 1 18 ? 1.070   9.503   -1.297  1.00 0.00 ? 18 ASN A HB2  8  
ATOM 5766  H HB3  . ASN A 1 18 ? -0.362  10.188  -2.066  1.00 0.00 ? 18 ASN A HB3  8  
ATOM 5767  H HD21 . ASN A 1 18 ? 2.337   10.973  -0.137  1.00 0.00 ? 18 ASN A HD21 8  
ATOM 5768  H HD22 . ASN A 1 18 ? 1.809   12.491  0.408   1.00 0.00 ? 18 ASN A HD22 8  
ATOM 5769  N N    . TYR A 1 19 ? -1.679  7.274   -1.399  1.00 0.00 ? 19 TYR A N    8  
ATOM 5770  C CA   . TYR A 1 19 ? -2.701  6.555   -2.206  1.00 0.00 ? 19 TYR A CA   8  
ATOM 5771  C C    . TYR A 1 19 ? -4.013  6.453   -1.425  1.00 0.00 ? 19 TYR A C    8  
ATOM 5772  O O    . TYR A 1 19 ? -5.031  6.084   -1.974  1.00 0.00 ? 19 TYR A O    8  
ATOM 5773  C CB   . TYR A 1 19 ? -2.190  5.148   -2.501  1.00 0.00 ? 19 TYR A CB   8  
ATOM 5774  C CG   . TYR A 1 19 ? -3.154  4.433   -3.419  1.00 0.00 ? 19 TYR A CG   8  
ATOM 5775  C CD1  . TYR A 1 19 ? -3.823  5.139   -4.427  1.00 0.00 ? 19 TYR A CD1  8  
ATOM 5776  C CD2  . TYR A 1 19 ? -3.378  3.061   -3.259  1.00 0.00 ? 19 TYR A CD2  8  
ATOM 5777  C CE1  . TYR A 1 19 ? -4.714  4.471   -5.275  1.00 0.00 ? 19 TYR A CE1  8  
ATOM 5778  C CE2  . TYR A 1 19 ? -4.270  2.393   -4.107  1.00 0.00 ? 19 TYR A CE2  8  
ATOM 5779  C CZ   . TYR A 1 19 ? -4.938  3.098   -5.114  1.00 0.00 ? 19 TYR A CZ   8  
ATOM 5780  O OH   . TYR A 1 19 ? -5.817  2.440   -5.950  1.00 0.00 ? 19 TYR A OH   8  
ATOM 5781  H H    . TYR A 1 19 ? -0.863  6.809   -1.130  1.00 0.00 ? 19 TYR A H    8  
ATOM 5782  H HA   . TYR A 1 19 ? -2.866  7.081   -3.130  1.00 0.00 ? 19 TYR A HA   8  
ATOM 5783  H HB2  . TYR A 1 19 ? -1.222  5.212   -2.972  1.00 0.00 ? 19 TYR A HB2  8  
ATOM 5784  H HB3  . TYR A 1 19 ? -2.105  4.601   -1.574  1.00 0.00 ? 19 TYR A HB3  8  
ATOM 5785  H HD1  . TYR A 1 19 ? -3.651  6.197   -4.552  1.00 0.00 ? 19 TYR A HD1  8  
ATOM 5786  H HD2  . TYR A 1 19 ? -2.862  2.517   -2.482  1.00 0.00 ? 19 TYR A HD2  8  
ATOM 5787  H HE1  . TYR A 1 19 ? -5.230  5.015   -6.052  1.00 0.00 ? 19 TYR A HE1  8  
ATOM 5788  H HE2  . TYR A 1 19 ? -4.442  1.334   -3.983  1.00 0.00 ? 19 TYR A HE2  8  
ATOM 5789  H HH   . TYR A 1 19 ? -5.430  1.592   -6.178  1.00 0.00 ? 19 TYR A HH   8  
ATOM 5790  N N    . CYS A 1 20 ? -3.980  6.761   -0.148  1.00 0.00 ? 20 CYS A N    8  
ATOM 5791  C CA   . CYS A 1 20 ? -5.214  6.682   0.712   1.00 0.00 ? 20 CYS A CA   8  
ATOM 5792  C C    . CYS A 1 20 ? -6.478  6.825   -0.142  1.00 0.00 ? 20 CYS A C    8  
ATOM 5793  O O    . CYS A 1 20 ? -6.532  7.623   -1.057  1.00 0.00 ? 20 CYS A O    8  
ATOM 5794  C CB   . CYS A 1 20 ? -5.204  7.817   1.744   1.00 0.00 ? 20 CYS A CB   8  
ATOM 5795  S SG   . CYS A 1 20 ? -3.851  7.601   2.934   1.00 0.00 ? 20 CYS A SG   8  
ATOM 5796  H H    . CYS A 1 20 ? -3.129  7.037   0.252   1.00 0.00 ? 20 CYS A H    8  
ATOM 5797  H HA   . CYS A 1 20 ? -5.236  5.730   1.224   1.00 0.00 ? 20 CYS A HA   8  
ATOM 5798  H HB2  . CYS A 1 20 ? -5.078  8.760   1.234   1.00 0.00 ? 20 CYS A HB2  8  
ATOM 5799  H HB3  . CYS A 1 20 ? -6.146  7.823   2.273   1.00 0.00 ? 20 CYS A HB3  8  
ATOM 5800  N N    . ASN A 1 21 ? -7.493  6.059   0.148   1.00 0.00 ? 21 ASN A N    8  
ATOM 5801  C CA   . ASN A 1 21 ? -8.749  6.152   -0.648  1.00 0.00 ? 21 ASN A CA   8  
ATOM 5802  C C    . ASN A 1 21 ? -9.303  7.576   -0.564  1.00 0.00 ? 21 ASN A C    8  
ATOM 5803  O O    . ASN A 1 21 ? -9.630  8.126   -1.603  1.00 0.00 ? 21 ASN A O    8  
ATOM 5804  C CB   . ASN A 1 21 ? -9.781  5.169   -0.092  1.00 0.00 ? 21 ASN A CB   8  
ATOM 5805  C CG   . ASN A 1 21 ? -10.588 4.570   -1.244  1.00 0.00 ? 21 ASN A CG   8  
ATOM 5806  O OD1  . ASN A 1 21 ? -10.034 4.188   -2.256  1.00 0.00 ? 21 ASN A OD1  8  
ATOM 5807  N ND2  . ASN A 1 21 ? -11.885 4.471   -1.134  1.00 0.00 ? 21 ASN A ND2  8  
ATOM 5808  O OXT  . ASN A 1 21 ? -9.391  8.092   0.538   1.00 0.00 ? 21 ASN A OXT  8  
ATOM 5809  H H    . ASN A 1 21 ? -7.429  5.421   0.890   1.00 0.00 ? 21 ASN A H    8  
ATOM 5810  H HA   . ASN A 1 21 ? -8.540  5.909   -1.680  1.00 0.00 ? 21 ASN A HA   8  
ATOM 5811  H HB2  . ASN A 1 21 ? -9.273  4.379   0.443   1.00 0.00 ? 21 ASN A HB2  8  
ATOM 5812  H HB3  . ASN A 1 21 ? -10.447 5.689   0.580   1.00 0.00 ? 21 ASN A HB3  8  
ATOM 5813  H HD21 . ASN A 1 21 ? -12.333 4.779   -0.319  1.00 0.00 ? 21 ASN A HD21 8  
ATOM 5814  H HD22 . ASN A 1 21 ? -12.411 4.088   -1.867  1.00 0.00 ? 21 ASN A HD22 8  
ATOM 5815  N N    . PHE B 2 1  ? 12.252  -3.516  10.502  1.00 0.00 ? 1  PHE B N    8  
ATOM 5816  C CA   . PHE B 2 1  ? 12.308  -2.033  10.359  1.00 0.00 ? 1  PHE B CA   8  
ATOM 5817  C C    . PHE B 2 1  ? 13.221  -1.673  9.185   1.00 0.00 ? 1  PHE B C    8  
ATOM 5818  O O    . PHE B 2 1  ? 14.411  -1.491  9.345   1.00 0.00 ? 1  PHE B O    8  
ATOM 5819  C CB   . PHE B 2 1  ? 12.861  -1.415  11.645  1.00 0.00 ? 1  PHE B CB   8  
ATOM 5820  C CG   . PHE B 2 1  ? 12.041  -1.885  12.821  1.00 0.00 ? 1  PHE B CG   8  
ATOM 5821  C CD1  . PHE B 2 1  ? 10.771  -1.343  13.051  1.00 0.00 ? 1  PHE B CD1  8  
ATOM 5822  C CD2  . PHE B 2 1  ? 12.550  -2.865  13.682  1.00 0.00 ? 1  PHE B CD2  8  
ATOM 5823  C CE1  . PHE B 2 1  ? 10.009  -1.782  14.140  1.00 0.00 ? 1  PHE B CE1  8  
ATOM 5824  C CE2  . PHE B 2 1  ? 11.788  -3.303  14.772  1.00 0.00 ? 1  PHE B CE2  8  
ATOM 5825  C CZ   . PHE B 2 1  ? 10.518  -2.762  15.001  1.00 0.00 ? 1  PHE B CZ   8  
ATOM 5826  H H1   . PHE B 2 1  ? 11.322  -3.860  10.189  1.00 0.00 ? 1  PHE B H1   8  
ATOM 5827  H H2   . PHE B 2 1  ? 12.400  -3.774  11.499  1.00 0.00 ? 1  PHE B H2   8  
ATOM 5828  H H3   . PHE B 2 1  ? 12.993  -3.949  9.917   1.00 0.00 ? 1  PHE B H3   8  
ATOM 5829  H HA   . PHE B 2 1  ? 11.315  -1.651  10.173  1.00 0.00 ? 1  PHE B HA   8  
ATOM 5830  H HB2  . PHE B 2 1  ? 13.889  -1.719  11.777  1.00 0.00 ? 1  PHE B HB2  8  
ATOM 5831  H HB3  . PHE B 2 1  ? 12.810  -0.339  11.578  1.00 0.00 ? 1  PHE B HB3  8  
ATOM 5832  H HD1  . PHE B 2 1  ? 10.379  -0.587  12.387  1.00 0.00 ? 1  PHE B HD1  8  
ATOM 5833  H HD2  . PHE B 2 1  ? 13.530  -3.283  13.505  1.00 0.00 ? 1  PHE B HD2  8  
ATOM 5834  H HE1  . PHE B 2 1  ? 9.029   -1.364  14.317  1.00 0.00 ? 1  PHE B HE1  8  
ATOM 5835  H HE2  . PHE B 2 1  ? 12.180  -4.060  15.436  1.00 0.00 ? 1  PHE B HE2  8  
ATOM 5836  H HZ   . PHE B 2 1  ? 9.930   -3.100  15.841  1.00 0.00 ? 1  PHE B HZ   8  
ATOM 5837  N N    . VAL B 2 2  ? 12.673  -1.574  8.006   1.00 0.00 ? 2  VAL B N    8  
ATOM 5838  C CA   . VAL B 2 2  ? 13.510  -1.232  6.822   1.00 0.00 ? 2  VAL B CA   8  
ATOM 5839  C C    . VAL B 2 2  ? 12.642  -0.560  5.760   1.00 0.00 ? 2  VAL B C    8  
ATOM 5840  O O    . VAL B 2 2  ? 11.619  0.026   6.056   1.00 0.00 ? 2  VAL B O    8  
ATOM 5841  C CB   . VAL B 2 2  ? 14.132  -2.507  6.244   1.00 0.00 ? 2  VAL B CB   8  
ATOM 5842  C CG1  . VAL B 2 2  ? 15.490  -2.175  5.622   1.00 0.00 ? 2  VAL B CG1  8  
ATOM 5843  C CG2  . VAL B 2 2  ? 14.327  -3.537  7.360   1.00 0.00 ? 2  VAL B CG2  8  
ATOM 5844  H H    . VAL B 2 2  ? 11.711  -1.729  7.897   1.00 0.00 ? 2  VAL B H    8  
ATOM 5845  H HA   . VAL B 2 2  ? 14.295  -0.555  7.116   1.00 0.00 ? 2  VAL B HA   8  
ATOM 5846  H HB   . VAL B 2 2  ? 13.479  -2.914  5.485   1.00 0.00 ? 2  VAL B HB   8  
ATOM 5847  H HG11 . VAL B 2 2  ? 16.278  -2.501  6.284   1.00 0.00 ? 2  VAL B HG11 8  
ATOM 5848  H HG12 . VAL B 2 2  ? 15.566  -1.109  5.470   1.00 0.00 ? 2  VAL B HG12 8  
ATOM 5849  H HG13 . VAL B 2 2  ? 15.585  -2.682  4.673   1.00 0.00 ? 2  VAL B HG13 8  
ATOM 5850  H HG21 . VAL B 2 2  ? 14.663  -4.471  6.934   1.00 0.00 ? 2  VAL B HG21 8  
ATOM 5851  H HG22 . VAL B 2 2  ? 13.390  -3.693  7.874   1.00 0.00 ? 2  VAL B HG22 8  
ATOM 5852  H HG23 . VAL B 2 2  ? 15.066  -3.174  8.060   1.00 0.00 ? 2  VAL B HG23 8  
ATOM 5853  N N    . ASN B 2 3  ? 13.043  -0.643  4.526   1.00 0.00 ? 3  ASN B N    8  
ATOM 5854  C CA   . ASN B 2 3  ? 12.257  -0.019  3.438   1.00 0.00 ? 3  ASN B CA   8  
ATOM 5855  C C    . ASN B 2 3  ? 12.600  -0.716  2.124   1.00 0.00 ? 3  ASN B C    8  
ATOM 5856  O O    . ASN B 2 3  ? 13.388  -0.231  1.338   1.00 0.00 ? 3  ASN B O    8  
ATOM 5857  C CB   . ASN B 2 3  ? 12.607  1.468   3.337   1.00 0.00 ? 3  ASN B CB   8  
ATOM 5858  C CG   . ASN B 2 3  ? 11.764  2.259   4.337   1.00 0.00 ? 3  ASN B CG   8  
ATOM 5859  O OD1  . ASN B 2 3  ? 10.673  2.692   4.022   1.00 0.00 ? 3  ASN B OD1  8  
ATOM 5860  N ND2  . ASN B 2 3  ? 12.225  2.468   5.540   1.00 0.00 ? 3  ASN B ND2  8  
ATOM 5861  H H    . ASN B 2 3  ? 13.864  -1.119  4.312   1.00 0.00 ? 3  ASN B H    8  
ATOM 5862  H HA   . ASN B 2 3  ? 11.203  -0.130  3.643   1.00 0.00 ? 3  ASN B HA   8  
ATOM 5863  H HB2  . ASN B 2 3  ? 13.656  1.606   3.558   1.00 0.00 ? 3  ASN B HB2  8  
ATOM 5864  H HB3  . ASN B 2 3  ? 12.400  1.819   2.337   1.00 0.00 ? 3  ASN B HB3  8  
ATOM 5865  H HD21 . ASN B 2 3  ? 13.105  2.119   5.795   1.00 0.00 ? 3  ASN B HD21 8  
ATOM 5866  H HD22 . ASN B 2 3  ? 11.692  2.974   6.188   1.00 0.00 ? 3  ASN B HD22 8  
ATOM 5867  N N    . GLN B 2 4  ? 11.997  -1.848  1.875   1.00 0.00 ? 4  GLN B N    8  
ATOM 5868  C CA   . GLN B 2 4  ? 12.271  -2.574  0.606   1.00 0.00 ? 4  GLN B CA   8  
ATOM 5869  C C    . GLN B 2 4  ? 11.487  -3.887  0.584   1.00 0.00 ? 4  GLN B C    8  
ATOM 5870  O O    . GLN B 2 4  ? 12.052  -4.947  0.399   1.00 0.00 ? 4  GLN B O    8  
ATOM 5871  C CB   . GLN B 2 4  ? 13.768  -2.879  0.501   1.00 0.00 ? 4  GLN B CB   8  
ATOM 5872  C CG   . GLN B 2 4  ? 14.123  -3.211  -0.949  1.00 0.00 ? 4  GLN B CG   8  
ATOM 5873  C CD   . GLN B 2 4  ? 15.266  -4.226  -0.976  1.00 0.00 ? 4  GLN B CD   8  
ATOM 5874  O OE1  . GLN B 2 4  ? 15.120  -5.336  -0.505  1.00 0.00 ? 4  GLN B OE1  8  
ATOM 5875  N NE2  . GLN B 2 4  ? 16.408  -3.888  -1.510  1.00 0.00 ? 4  GLN B NE2  8  
ATOM 5876  H H    . GLN B 2 4  ? 11.355  -2.213  2.520   1.00 0.00 ? 4  GLN B H    8  
ATOM 5877  H HA   . GLN B 2 4  ? 11.969  -1.962  -0.230  1.00 0.00 ? 4  GLN B HA   8  
ATOM 5878  H HB2  . GLN B 2 4  ? 14.335  -2.018  0.823   1.00 0.00 ? 4  GLN B HB2  8  
ATOM 5879  H HB3  . GLN B 2 4  ? 14.007  -3.723  1.130   1.00 0.00 ? 4  GLN B HB3  8  
ATOM 5880  H HG2  . GLN B 2 4  ? 13.258  -3.628  -1.445  1.00 0.00 ? 4  GLN B HG2  8  
ATOM 5881  H HG3  . GLN B 2 4  ? 14.432  -2.311  -1.459  1.00 0.00 ? 4  GLN B HG3  8  
ATOM 5882  H HE21 . GLN B 2 4  ? 16.525  -2.992  -1.890  1.00 0.00 ? 4  GLN B HE21 8  
ATOM 5883  H HE22 . GLN B 2 4  ? 17.147  -4.531  -1.533  1.00 0.00 ? 4  GLN B HE22 8  
ATOM 5884  N N    . HIS B 2 5  ? 10.192  -3.840  0.769   1.00 0.00 ? 5  HIS B N    8  
ATOM 5885  C CA   . HIS B 2 5  ? 9.413   -5.114  0.750   1.00 0.00 ? 5  HIS B CA   8  
ATOM 5886  C C    . HIS B 2 5  ? 9.637   -5.824  -0.590  1.00 0.00 ? 5  HIS B C    8  
ATOM 5887  O O    . HIS B 2 5  ? 10.252  -5.289  -1.490  1.00 0.00 ? 5  HIS B O    8  
ATOM 5888  C CB   . HIS B 2 5  ? 7.918   -4.837  0.942   1.00 0.00 ? 5  HIS B CB   8  
ATOM 5889  C CG   . HIS B 2 5  ? 7.553   -3.526  0.310   1.00 0.00 ? 5  HIS B CG   8  
ATOM 5890  N ND1  . HIS B 2 5  ? 8.300   -2.962  -0.710  1.00 0.00 ? 5  HIS B ND1  8  
ATOM 5891  C CD2  . HIS B 2 5  ? 6.522   -2.651  0.549   1.00 0.00 ? 5  HIS B CD2  8  
ATOM 5892  C CE1  . HIS B 2 5  ? 7.716   -1.798  -1.041  1.00 0.00 ? 5  HIS B CE1  8  
ATOM 5893  N NE2  . HIS B 2 5  ? 6.628   -1.560  -0.306  1.00 0.00 ? 5  HIS B NE2  8  
ATOM 5894  H H    . HIS B 2 5  ? 9.739   -2.976  0.919   1.00 0.00 ? 5  HIS B H    8  
ATOM 5895  H HA   . HIS B 2 5  ? 9.763   -5.749  1.549   1.00 0.00 ? 5  HIS B HA   8  
ATOM 5896  H HB2  . HIS B 2 5  ? 7.346   -5.628  0.481   1.00 0.00 ? 5  HIS B HB2  8  
ATOM 5897  H HB3  . HIS B 2 5  ? 7.694   -4.801  1.998   1.00 0.00 ? 5  HIS B HB3  8  
ATOM 5898  H HD1  . HIS B 2 5  ? 9.106   -3.343  -1.117  1.00 0.00 ? 5  HIS B HD1  8  
ATOM 5899  H HD2  . HIS B 2 5  ? 5.748   -2.789  1.289   1.00 0.00 ? 5  HIS B HD2  8  
ATOM 5900  H HE1  . HIS B 2 5  ? 8.095   -1.126  -1.791  1.00 0.00 ? 5  HIS B HE1  8  
ATOM 5901  N N    . LEU B 2 6  ? 9.152   -7.029  -0.725  1.00 0.00 ? 6  LEU B N    8  
ATOM 5902  C CA   . LEU B 2 6  ? 9.347   -7.776  -2.003  1.00 0.00 ? 6  LEU B CA   8  
ATOM 5903  C C    . LEU B 2 6  ? 8.483   -7.161  -3.107  1.00 0.00 ? 6  LEU B C    8  
ATOM 5904  O O    . LEU B 2 6  ? 8.540   -7.573  -4.248  1.00 0.00 ? 6  LEU B O    8  
ATOM 5905  C CB   . LEU B 2 6  ? 8.947   -9.239  -1.803  1.00 0.00 ? 6  LEU B CB   8  
ATOM 5906  C CG   . LEU B 2 6  ? 9.463   -9.732  -0.451  1.00 0.00 ? 6  LEU B CG   8  
ATOM 5907  C CD1  . LEU B 2 6  ? 8.296   -9.841  0.532   1.00 0.00 ? 6  LEU B CD1  8  
ATOM 5908  C CD2  . LEU B 2 6  ? 10.110  -11.108 -0.625  1.00 0.00 ? 6  LEU B CD2  8  
ATOM 5909  H H    . LEU B 2 6  ? 8.665   -7.447  0.016   1.00 0.00 ? 6  LEU B H    8  
ATOM 5910  H HA   . LEU B 2 6  ? 10.387  -7.725  -2.292  1.00 0.00 ? 6  LEU B HA   8  
ATOM 5911  H HB2  . LEU B 2 6  ? 7.870   -9.324  -1.832  1.00 0.00 ? 6  LEU B HB2  8  
ATOM 5912  H HB3  . LEU B 2 6  ? 9.377   -9.840  -2.591  1.00 0.00 ? 6  LEU B HB3  8  
ATOM 5913  H HG   . LEU B 2 6  ? 10.193  -9.034  -0.067  1.00 0.00 ? 6  LEU B HG   8  
ATOM 5914  H HD11 . LEU B 2 6  ? 8.345   -10.790 1.046   1.00 0.00 ? 6  LEU B HD11 8  
ATOM 5915  H HD12 . LEU B 2 6  ? 7.363   -9.772  -0.007  1.00 0.00 ? 6  LEU B HD12 8  
ATOM 5916  H HD13 . LEU B 2 6  ? 8.356   -9.038  1.253   1.00 0.00 ? 6  LEU B HD13 8  
ATOM 5917  H HD21 . LEU B 2 6  ? 9.861   -11.732 0.221   1.00 0.00 ? 6  LEU B HD21 8  
ATOM 5918  H HD22 . LEU B 2 6  ? 11.183  -10.996 -0.685  1.00 0.00 ? 6  LEU B HD22 8  
ATOM 5919  H HD23 . LEU B 2 6  ? 9.744   -11.566 -1.531  1.00 0.00 ? 6  LEU B HD23 8  
ATOM 5920  N N    . CYS B 2 7  ? 7.680   -6.187  -2.777  1.00 0.00 ? 7  CYS B N    8  
ATOM 5921  C CA   . CYS B 2 7  ? 6.803   -5.542  -3.798  1.00 0.00 ? 7  CYS B CA   8  
ATOM 5922  C C    . CYS B 2 7  ? 5.740   -6.536  -4.270  1.00 0.00 ? 7  CYS B C    8  
ATOM 5923  O O    . CYS B 2 7  ? 4.556   -6.275  -4.190  1.00 0.00 ? 7  CYS B O    8  
ATOM 5924  C CB   . CYS B 2 7  ? 7.642   -5.086  -4.994  1.00 0.00 ? 7  CYS B CB   8  
ATOM 5925  S SG   . CYS B 2 7  ? 6.562   -4.295  -6.213  1.00 0.00 ? 7  CYS B SG   8  
ATOM 5926  H H    . CYS B 2 7  ? 7.649   -5.880  -1.853  1.00 0.00 ? 7  CYS B H    8  
ATOM 5927  H HA   . CYS B 2 7  ? 6.317   -4.685  -3.357  1.00 0.00 ? 7  CYS B HA   8  
ATOM 5928  H HB2  . CYS B 2 7  ? 8.389   -4.380  -4.661  1.00 0.00 ? 7  CYS B HB2  8  
ATOM 5929  H HB3  . CYS B 2 7  ? 8.127   -5.938  -5.443  1.00 0.00 ? 7  CYS B HB3  8  
ATOM 5930  N N    . GLY B 2 8  ? 6.150   -7.673  -4.759  1.00 0.00 ? 8  GLY B N    8  
ATOM 5931  C CA   . GLY B 2 8  ? 5.158   -8.680  -5.233  1.00 0.00 ? 8  GLY B CA   8  
ATOM 5932  C C    . GLY B 2 8  ? 4.030   -8.794  -4.208  1.00 0.00 ? 8  GLY B C    8  
ATOM 5933  O O    . GLY B 2 8  ? 4.140   -9.509  -3.232  1.00 0.00 ? 8  GLY B O    8  
ATOM 5934  H H    . GLY B 2 8  ? 7.108   -7.864  -4.812  1.00 0.00 ? 8  GLY B H    8  
ATOM 5935  H HA2  . GLY B 2 8  ? 4.753   -8.367  -6.185  1.00 0.00 ? 8  GLY B HA2  8  
ATOM 5936  H HA3  . GLY B 2 8  ? 5.640   -9.639  -5.342  1.00 0.00 ? 8  GLY B HA3  8  
ATOM 5937  N N    . SER B 2 9  ? 2.953   -8.084  -4.415  1.00 0.00 ? 9  SER B N    8  
ATOM 5938  C CA   . SER B 2 9  ? 1.818   -8.137  -3.447  1.00 0.00 ? 9  SER B CA   8  
ATOM 5939  C C    . SER B 2 9  ? 2.134   -7.243  -2.243  1.00 0.00 ? 9  SER B C    8  
ATOM 5940  O O    . SER B 2 9  ? 1.317   -6.452  -1.815  1.00 0.00 ? 9  SER B O    8  
ATOM 5941  C CB   . SER B 2 9  ? 1.604   -9.576  -2.975  1.00 0.00 ? 9  SER B CB   8  
ATOM 5942  O OG   . SER B 2 9  ? 2.089   -10.473 -3.966  1.00 0.00 ? 9  SER B OG   8  
ATOM 5943  H H    . SER B 2 9  ? 2.893   -7.507  -5.205  1.00 0.00 ? 9  SER B H    8  
ATOM 5944  H HA   . SER B 2 9  ? 0.919   -7.781  -3.930  1.00 0.00 ? 9  SER B HA   8  
ATOM 5945  H HB2  . SER B 2 9  ? 2.141   -9.740  -2.056  1.00 0.00 ? 9  SER B HB2  8  
ATOM 5946  H HB3  . SER B 2 9  ? 0.548   -9.745  -2.807  1.00 0.00 ? 9  SER B HB3  8  
ATOM 5947  H HG   . SER B 2 9  ? 2.747   -11.039 -3.557  1.00 0.00 ? 9  SER B HG   8  
ATOM 5948  N N    . HIS B 2 10 ? 3.315   -7.361  -1.696  1.00 0.00 ? 10 HIS B N    8  
ATOM 5949  C CA   . HIS B 2 10 ? 3.685   -6.520  -0.525  1.00 0.00 ? 10 HIS B CA   8  
ATOM 5950  C C    . HIS B 2 10 ? 3.551   -5.041  -0.891  1.00 0.00 ? 10 HIS B C    8  
ATOM 5951  O O    . HIS B 2 10 ? 3.141   -4.229  -0.085  1.00 0.00 ? 10 HIS B O    8  
ATOM 5952  C CB   . HIS B 2 10 ? 5.131   -6.815  -0.123  1.00 0.00 ? 10 HIS B CB   8  
ATOM 5953  C CG   . HIS B 2 10 ? 5.180   -8.081  0.686   1.00 0.00 ? 10 HIS B CG   8  
ATOM 5954  N ND1  . HIS B 2 10 ? 4.601   -9.262  0.248   1.00 0.00 ? 10 HIS B ND1  8  
ATOM 5955  C CD2  . HIS B 2 10 ? 5.736   -8.367  1.909   1.00 0.00 ? 10 HIS B CD2  8  
ATOM 5956  C CE1  . HIS B 2 10 ? 4.821   -10.195 1.192   1.00 0.00 ? 10 HIS B CE1  8  
ATOM 5957  N NE2  . HIS B 2 10 ? 5.508   -9.703  2.226   1.00 0.00 ? 10 HIS B NE2  8  
ATOM 5958  H H    . HIS B 2 10 ? 3.958   -8.003  -2.053  1.00 0.00 ? 10 HIS B H    8  
ATOM 5959  H HA   . HIS B 2 10 ? 3.029   -6.748  0.301   1.00 0.00 ? 10 HIS B HA   8  
ATOM 5960  H HB2  . HIS B 2 10 ? 5.735   -6.931  -1.011  1.00 0.00 ? 10 HIS B HB2  8  
ATOM 5961  H HB3  . HIS B 2 10 ? 5.513   -5.996  0.468   1.00 0.00 ? 10 HIS B HB3  8  
ATOM 5962  H HD1  . HIS B 2 10 ? 4.120   -9.393  -0.596  1.00 0.00 ? 10 HIS B HD1  8  
ATOM 5963  H HD2  . HIS B 2 10 ? 6.269   -7.662  2.529   1.00 0.00 ? 10 HIS B HD2  8  
ATOM 5964  H HE1  . HIS B 2 10 ? 4.483   -11.219 1.122   1.00 0.00 ? 10 HIS B HE1  8  
ATOM 5965  N N    . LEU B 2 11 ? 3.893   -4.678  -2.099  1.00 0.00 ? 11 LEU B N    8  
ATOM 5966  C CA   . LEU B 2 11 ? 3.782   -3.247  -2.498  1.00 0.00 ? 11 LEU B CA   8  
ATOM 5967  C C    . LEU B 2 11 ? 2.345   -2.778  -2.273  1.00 0.00 ? 11 LEU B C    8  
ATOM 5968  O O    . LEU B 2 11 ? 2.105   -1.738  -1.693  1.00 0.00 ? 11 LEU B O    8  
ATOM 5969  C CB   . LEU B 2 11 ? 4.141   -3.099  -3.978  1.00 0.00 ? 11 LEU B CB   8  
ATOM 5970  C CG   . LEU B 2 11 ? 4.598   -1.665  -4.254  1.00 0.00 ? 11 LEU B CG   8  
ATOM 5971  C CD1  . LEU B 2 11 ? 3.565   -0.683  -3.698  1.00 0.00 ? 11 LEU B CD1  8  
ATOM 5972  C CD2  . LEU B 2 11 ? 5.947   -1.421  -3.575  1.00 0.00 ? 11 LEU B CD2  8  
ATOM 5973  H H    . LEU B 2 11 ? 4.224   -5.344  -2.738  1.00 0.00 ? 11 LEU B H    8  
ATOM 5974  H HA   . LEU B 2 11 ? 4.456   -2.651  -1.900  1.00 0.00 ? 11 LEU B HA   8  
ATOM 5975  H HB2  . LEU B 2 11 ? 4.937   -3.785  -4.226  1.00 0.00 ? 11 LEU B HB2  8  
ATOM 5976  H HB3  . LEU B 2 11 ? 3.274   -3.320  -4.581  1.00 0.00 ? 11 LEU B HB3  8  
ATOM 5977  H HG   . LEU B 2 11 ? 4.696   -1.518  -5.319  1.00 0.00 ? 11 LEU B HG   8  
ATOM 5978  H HD11 . LEU B 2 11 ? 3.746   0.300   -4.107  1.00 0.00 ? 11 LEU B HD11 8  
ATOM 5979  H HD12 . LEU B 2 11 ? 3.648   -0.645  -2.621  1.00 0.00 ? 11 LEU B HD12 8  
ATOM 5980  H HD13 . LEU B 2 11 ? 2.573   -1.010  -3.971  1.00 0.00 ? 11 LEU B HD13 8  
ATOM 5981  H HD21 . LEU B 2 11 ? 6.075   -2.123  -2.765  1.00 0.00 ? 11 LEU B HD21 8  
ATOM 5982  H HD22 . LEU B 2 11 ? 5.978   -0.414  -3.187  1.00 0.00 ? 11 LEU B HD22 8  
ATOM 5983  H HD23 . LEU B 2 11 ? 6.741   -1.554  -4.295  1.00 0.00 ? 11 LEU B HD23 8  
ATOM 5984  N N    . VAL B 2 12 ? 1.385   -3.545  -2.712  1.00 0.00 ? 12 VAL B N    8  
ATOM 5985  C CA   . VAL B 2 12 ? -0.033  -3.148  -2.502  1.00 0.00 ? 12 VAL B CA   8  
ATOM 5986  C C    . VAL B 2 12 ? -0.381  -3.344  -1.029  1.00 0.00 ? 12 VAL B C    8  
ATOM 5987  O O    . VAL B 2 12 ? -1.039  -2.524  -0.422  1.00 0.00 ? 12 VAL B O    8  
ATOM 5988  C CB   . VAL B 2 12 ? -0.946  -4.015  -3.371  1.00 0.00 ? 12 VAL B CB   8  
ATOM 5989  C CG1  . VAL B 2 12 ? -2.399  -3.570  -3.191  1.00 0.00 ? 12 VAL B CG1  8  
ATOM 5990  C CG2  . VAL B 2 12 ? -0.545  -3.860  -4.840  1.00 0.00 ? 12 VAL B CG2  8  
ATOM 5991  H H    . VAL B 2 12 ? 1.598   -4.387  -3.166  1.00 0.00 ? 12 VAL B H    8  
ATOM 5992  H HA   . VAL B 2 12 ? -0.160  -2.105  -2.763  1.00 0.00 ? 12 VAL B HA   8  
ATOM 5993  H HB   . VAL B 2 12 ? -0.848  -5.049  -3.076  1.00 0.00 ? 12 VAL B HB   8  
ATOM 5994  H HG11 . VAL B 2 12 ? -3.013  -4.429  -2.968  1.00 0.00 ? 12 VAL B HG11 8  
ATOM 5995  H HG12 . VAL B 2 12 ? -2.748  -3.103  -4.100  1.00 0.00 ? 12 VAL B HG12 8  
ATOM 5996  H HG13 . VAL B 2 12 ? -2.460  -2.863  -2.377  1.00 0.00 ? 12 VAL B HG13 8  
ATOM 5997  H HG21 . VAL B 2 12 ? -0.454  -2.811  -5.080  1.00 0.00 ? 12 VAL B HG21 8  
ATOM 5998  H HG22 . VAL B 2 12 ? -1.300  -4.308  -5.469  1.00 0.00 ? 12 VAL B HG22 8  
ATOM 5999  H HG23 . VAL B 2 12 ? 0.402   -4.352  -5.008  1.00 0.00 ? 12 VAL B HG23 8  
ATOM 6000  N N    . GLU B 2 13 ? 0.073   -4.415  -0.440  1.00 0.00 ? 13 GLU B N    8  
ATOM 6001  C CA   . GLU B 2 13 ? -0.223  -4.637  0.999   1.00 0.00 ? 13 GLU B CA   8  
ATOM 6002  C C    . GLU B 2 13 ? 0.237   -3.403  1.768   1.00 0.00 ? 13 GLU B C    8  
ATOM 6003  O O    . GLU B 2 13 ? -0.335  -3.029  2.773   1.00 0.00 ? 13 GLU B O    8  
ATOM 6004  C CB   . GLU B 2 13 ? 0.534   -5.870  1.499   1.00 0.00 ? 13 GLU B CB   8  
ATOM 6005  C CG   . GLU B 2 13 ? -0.314  -7.122  1.266   1.00 0.00 ? 13 GLU B CG   8  
ATOM 6006  C CD   . GLU B 2 13 ? -0.869  -7.618  2.603   1.00 0.00 ? 13 GLU B CD   8  
ATOM 6007  O OE1  . GLU B 2 13 ? -0.107  -7.673  3.554   1.00 0.00 ? 13 GLU B OE1  8  
ATOM 6008  O OE2  . GLU B 2 13 ? -2.046  -7.936  2.652   1.00 0.00 ? 13 GLU B OE2  8  
ATOM 6009  H H    . GLU B 2 13 ? 0.615   -5.062  -0.938  1.00 0.00 ? 13 GLU B H    8  
ATOM 6010  H HA   . GLU B 2 13 ? -1.285  -4.778  1.136   1.00 0.00 ? 13 GLU B HA   8  
ATOM 6011  H HB2  . GLU B 2 13 ? 1.467   -5.961  0.961   1.00 0.00 ? 13 GLU B HB2  8  
ATOM 6012  H HB3  . GLU B 2 13 ? 0.736   -5.765  2.554   1.00 0.00 ? 13 GLU B HB3  8  
ATOM 6013  H HG2  . GLU B 2 13 ? -1.132  -6.883  0.602   1.00 0.00 ? 13 GLU B HG2  8  
ATOM 6014  H HG3  . GLU B 2 13 ? 0.296   -7.894  0.823   1.00 0.00 ? 13 GLU B HG3  8  
ATOM 6015  N N    . ALA B 2 14 ? 1.263   -2.755  1.285   1.00 0.00 ? 14 ALA B N    8  
ATOM 6016  C CA   . ALA B 2 14 ? 1.759   -1.532  1.962   1.00 0.00 ? 14 ALA B CA   8  
ATOM 6017  C C    . ALA B 2 14 ? 0.719   -0.429  1.794   1.00 0.00 ? 14 ALA B C    8  
ATOM 6018  O O    . ALA B 2 14 ? 0.367   0.260   2.729   1.00 0.00 ? 14 ALA B O    8  
ATOM 6019  C CB   . ALA B 2 14 ? 3.082   -1.094  1.331   1.00 0.00 ? 14 ALA B CB   8  
ATOM 6020  H H    . ALA B 2 14 ? 1.697   -3.068  0.466   1.00 0.00 ? 14 ALA B H    8  
ATOM 6021  H HA   . ALA B 2 14 ? 1.905   -1.736  3.007   1.00 0.00 ? 14 ALA B HA   8  
ATOM 6022  H HB1  . ALA B 2 14 ? 3.764   -1.931  1.306   1.00 0.00 ? 14 ALA B HB1  8  
ATOM 6023  H HB2  . ALA B 2 14 ? 3.514   -0.296  1.917   1.00 0.00 ? 14 ALA B HB2  8  
ATOM 6024  H HB3  . ALA B 2 14 ? 2.903   -0.746  0.324   1.00 0.00 ? 14 ALA B HB3  8  
ATOM 6025  N N    . LEU B 2 15 ? 0.217   -0.266  0.603   1.00 0.00 ? 15 LEU B N    8  
ATOM 6026  C CA   . LEU B 2 15 ? -0.811  0.782   0.361   1.00 0.00 ? 15 LEU B CA   8  
ATOM 6027  C C    . LEU B 2 15 ? -2.070  0.430   1.151   1.00 0.00 ? 15 LEU B C    8  
ATOM 6028  O O    . LEU B 2 15 ? -2.724  1.285   1.714   1.00 0.00 ? 15 LEU B O    8  
ATOM 6029  C CB   . LEU B 2 15 ? -1.105  0.865   -1.151  1.00 0.00 ? 15 LEU B CB   8  
ATOM 6030  C CG   . LEU B 2 15 ? -2.307  -0.012  -1.528  1.00 0.00 ? 15 LEU B CG   8  
ATOM 6031  C CD1  . LEU B 2 15 ? -3.605  0.721   -1.184  1.00 0.00 ? 15 LEU B CD1  8  
ATOM 6032  C CD2  . LEU B 2 15 ? -2.271  -0.305  -3.030  1.00 0.00 ? 15 LEU B CD2  8  
ATOM 6033  H H    . LEU B 2 15 ? 0.513   -0.842  -0.132  1.00 0.00 ? 15 LEU B H    8  
ATOM 6034  H HA   . LEU B 2 15 ? -0.438  1.734   0.710   1.00 0.00 ? 15 LEU B HA   8  
ATOM 6035  H HB2  . LEU B 2 15 ? -1.316  1.888   -1.418  1.00 0.00 ? 15 LEU B HB2  8  
ATOM 6036  H HB3  . LEU B 2 15 ? -0.237  0.526   -1.699  1.00 0.00 ? 15 LEU B HB3  8  
ATOM 6037  H HG   . LEU B 2 15 ? -2.264  -0.939  -0.978  1.00 0.00 ? 15 LEU B HG   8  
ATOM 6038  H HD11 . LEU B 2 15 ? -4.120  0.988   -2.096  1.00 0.00 ? 15 LEU B HD11 8  
ATOM 6039  H HD12 . LEU B 2 15 ? -3.375  1.616   -0.625  1.00 0.00 ? 15 LEU B HD12 8  
ATOM 6040  H HD13 . LEU B 2 15 ? -4.236  0.078   -0.590  1.00 0.00 ? 15 LEU B HD13 8  
ATOM 6041  H HD21 . LEU B 2 15 ? -1.825  -1.274  -3.197  1.00 0.00 ? 15 LEU B HD21 8  
ATOM 6042  H HD22 . LEU B 2 15 ? -1.684  0.452   -3.530  1.00 0.00 ? 15 LEU B HD22 8  
ATOM 6043  H HD23 . LEU B 2 15 ? -3.277  -0.298  -3.422  1.00 0.00 ? 15 LEU B HD23 8  
ATOM 6044  N N    . TYR B 2 16 ? -2.407  -0.826  1.207   1.00 0.00 ? 16 TYR B N    8  
ATOM 6045  C CA   . TYR B 2 16 ? -3.612  -1.231  1.972   1.00 0.00 ? 16 TYR B CA   8  
ATOM 6046  C C    . TYR B 2 16 ? -3.337  -1.029  3.457   1.00 0.00 ? 16 TYR B C    8  
ATOM 6047  O O    . TYR B 2 16 ? -4.100  -0.404  4.167   1.00 0.00 ? 16 TYR B O    8  
ATOM 6048  C CB   . TYR B 2 16 ? -3.918  -2.706  1.705   1.00 0.00 ? 16 TYR B CB   8  
ATOM 6049  C CG   . TYR B 2 16 ? -5.067  -2.813  0.731   1.00 0.00 ? 16 TYR B CG   8  
ATOM 6050  C CD1  . TYR B 2 16 ? -6.385  -2.815  1.202   1.00 0.00 ? 16 TYR B CD1  8  
ATOM 6051  C CD2  . TYR B 2 16 ? -4.814  -2.910  -0.643  1.00 0.00 ? 16 TYR B CD2  8  
ATOM 6052  C CE1  . TYR B 2 16 ? -7.451  -2.914  0.299   1.00 0.00 ? 16 TYR B CE1  8  
ATOM 6053  C CE2  . TYR B 2 16 ? -5.879  -3.009  -1.545  1.00 0.00 ? 16 TYR B CE2  8  
ATOM 6054  C CZ   . TYR B 2 16 ? -7.198  -3.011  -1.075  1.00 0.00 ? 16 TYR B CZ   8  
ATOM 6055  O OH   . TYR B 2 16 ? -8.248  -3.108  -1.964  1.00 0.00 ? 16 TYR B OH   8  
ATOM 6056  H H    . TYR B 2 16 ? -1.860  -1.502  0.755   1.00 0.00 ? 16 TYR B H    8  
ATOM 6057  H HA   . TYR B 2 16 ? -4.450  -0.629  1.674   1.00 0.00 ? 16 TYR B HA   8  
ATOM 6058  H HB2  . TYR B 2 16 ? -3.045  -3.185  1.286   1.00 0.00 ? 16 TYR B HB2  8  
ATOM 6059  H HB3  . TYR B 2 16 ? -4.186  -3.191  2.631   1.00 0.00 ? 16 TYR B HB3  8  
ATOM 6060  H HD1  . TYR B 2 16 ? -6.581  -2.740  2.261   1.00 0.00 ? 16 TYR B HD1  8  
ATOM 6061  H HD2  . TYR B 2 16 ? -3.797  -2.909  -1.006  1.00 0.00 ? 16 TYR B HD2  8  
ATOM 6062  H HE1  . TYR B 2 16 ? -8.468  -2.915  0.662   1.00 0.00 ? 16 TYR B HE1  8  
ATOM 6063  H HE2  . TYR B 2 16 ? -5.684  -3.084  -2.605  1.00 0.00 ? 16 TYR B HE2  8  
ATOM 6064  H HH   . TYR B 2 16 ? -7.909  -3.474  -2.785  1.00 0.00 ? 16 TYR B HH   8  
ATOM 6065  N N    . LEU B 2 17 ? -2.246  -1.557  3.928   1.00 0.00 ? 17 LEU B N    8  
ATOM 6066  C CA   . LEU B 2 17 ? -1.902  -1.407  5.367   1.00 0.00 ? 17 LEU B CA   8  
ATOM 6067  C C    . LEU B 2 17 ? -1.513  0.036   5.686   1.00 0.00 ? 17 LEU B C    8  
ATOM 6068  O O    . LEU B 2 17 ? -1.912  0.582   6.695   1.00 0.00 ? 17 LEU B O    8  
ATOM 6069  C CB   . LEU B 2 17 ? -0.743  -2.341  5.718   1.00 0.00 ? 17 LEU B CB   8  
ATOM 6070  C CG   . LEU B 2 17 ? -0.951  -2.906  7.124   1.00 0.00 ? 17 LEU B CG   8  
ATOM 6071  C CD1  . LEU B 2 17 ? -0.385  -4.325  7.193   1.00 0.00 ? 17 LEU B CD1  8  
ATOM 6072  C CD2  . LEU B 2 17 ? -0.229  -2.019  8.141   1.00 0.00 ? 17 LEU B CD2  8  
ATOM 6073  H H    . LEU B 2 17 ? -1.650  -2.054  3.332   1.00 0.00 ? 17 LEU B H    8  
ATOM 6074  H HA   . LEU B 2 17 ? -2.763  -1.669  5.954   1.00 0.00 ? 17 LEU B HA   8  
ATOM 6075  H HB2  . LEU B 2 17 ? -0.706  -3.152  5.005   1.00 0.00 ? 17 LEU B HB2  8  
ATOM 6076  H HB3  . LEU B 2 17 ? 0.185   -1.791  5.687   1.00 0.00 ? 17 LEU B HB3  8  
ATOM 6077  H HG   . LEU B 2 17 ? -2.008  -2.929  7.349   1.00 0.00 ? 17 LEU B HG   8  
ATOM 6078  H HD11 . LEU B 2 17 ? 0.507   -4.387  6.586   1.00 0.00 ? 17 LEU B HD11 8  
ATOM 6079  H HD12 . LEU B 2 17 ? -1.120  -5.025  6.825   1.00 0.00 ? 17 LEU B HD12 8  
ATOM 6080  H HD13 . LEU B 2 17 ? -0.140  -4.565  8.217   1.00 0.00 ? 17 LEU B HD13 8  
ATOM 6081  H HD21 . LEU B 2 17 ? -0.953  -1.570  8.805   1.00 0.00 ? 17 LEU B HD21 8  
ATOM 6082  H HD22 . LEU B 2 17 ? 0.312   -1.242  7.621   1.00 0.00 ? 17 LEU B HD22 8  
ATOM 6083  H HD23 . LEU B 2 17 ? 0.463   -2.618  8.714   1.00 0.00 ? 17 LEU B HD23 8  
ATOM 6084  N N    . VAL B 2 18 ? -0.723  0.657   4.855   1.00 0.00 ? 18 VAL B N    8  
ATOM 6085  C CA   . VAL B 2 18 ? -0.310  2.055   5.156   1.00 0.00 ? 18 VAL B CA   8  
ATOM 6086  C C    . VAL B 2 18 ? -1.558  2.920   5.311   1.00 0.00 ? 18 VAL B C    8  
ATOM 6087  O O    . VAL B 2 18 ? -1.670  3.696   6.239   1.00 0.00 ? 18 VAL B O    8  
ATOM 6088  C CB   . VAL B 2 18 ? 0.605   2.599   4.049   1.00 0.00 ? 18 VAL B CB   8  
ATOM 6089  C CG1  . VAL B 2 18 ? -0.216  3.051   2.842   1.00 0.00 ? 18 VAL B CG1  8  
ATOM 6090  C CG2  . VAL B 2 18 ? 1.397   3.789   4.595   1.00 0.00 ? 18 VAL B CG2  8  
ATOM 6091  H H    . VAL B 2 18 ? -0.395  0.202   4.053   1.00 0.00 ? 18 VAL B H    8  
ATOM 6092  H HA   . VAL B 2 18 ? 0.225   2.059   6.090   1.00 0.00 ? 18 VAL B HA   8  
ATOM 6093  H HB   . VAL B 2 18 ? 1.293   1.825   3.744   1.00 0.00 ? 18 VAL B HB   8  
ATOM 6094  H HG11 . VAL B 2 18 ? -0.868  3.861   3.131   1.00 0.00 ? 18 VAL B HG11 8  
ATOM 6095  H HG12 . VAL B 2 18 ? -0.805  2.225   2.476   1.00 0.00 ? 18 VAL B HG12 8  
ATOM 6096  H HG13 . VAL B 2 18 ? 0.452   3.390   2.061   1.00 0.00 ? 18 VAL B HG13 8  
ATOM 6097  H HG21 . VAL B 2 18 ? 1.691   4.430   3.778   1.00 0.00 ? 18 VAL B HG21 8  
ATOM 6098  H HG22 . VAL B 2 18 ? 2.278   3.430   5.107   1.00 0.00 ? 18 VAL B HG22 8  
ATOM 6099  H HG23 . VAL B 2 18 ? 0.781   4.344   5.286   1.00 0.00 ? 18 VAL B HG23 8  
ATOM 6100  N N    . CYS B 2 19 ? -2.512  2.775   4.439   1.00 0.00 ? 19 CYS B N    8  
ATOM 6101  C CA   . CYS B 2 19 ? -3.760  3.576   4.583   1.00 0.00 ? 19 CYS B CA   8  
ATOM 6102  C C    . CYS B 2 19 ? -4.744  3.201   3.476   1.00 0.00 ? 19 CYS B C    8  
ATOM 6103  O O    . CYS B 2 19 ? -5.524  4.015   3.023   1.00 0.00 ? 19 CYS B O    8  
ATOM 6104  C CB   . CYS B 2 19 ? -3.428  5.075   4.530   1.00 0.00 ? 19 CYS B CB   8  
ATOM 6105  S SG   . CYS B 2 19 ? -3.337  5.651   2.815   1.00 0.00 ? 19 CYS B SG   8  
ATOM 6106  H H    . CYS B 2 19 ? -2.417  2.128   3.703   1.00 0.00 ? 19 CYS B H    8  
ATOM 6107  H HA   . CYS B 2 19 ? -4.210  3.350   5.539   1.00 0.00 ? 19 CYS B HA   8  
ATOM 6108  H HB2  . CYS B 2 19 ? -4.197  5.627   5.049   1.00 0.00 ? 19 CYS B HB2  8  
ATOM 6109  H HB3  . CYS B 2 19 ? -2.479  5.246   5.016   1.00 0.00 ? 19 CYS B HB3  8  
ATOM 6110  N N    . GLY B 2 20 ? -4.715  1.977   3.035   1.00 0.00 ? 20 GLY B N    8  
ATOM 6111  C CA   . GLY B 2 20 ? -5.656  1.569   1.952   1.00 0.00 ? 20 GLY B CA   8  
ATOM 6112  C C    . GLY B 2 20 ? -6.818  0.774   2.550   1.00 0.00 ? 20 GLY B C    8  
ATOM 6113  O O    . GLY B 2 20 ? -7.956  1.199   2.514   1.00 0.00 ? 20 GLY B O    8  
ATOM 6114  H H    . GLY B 2 20 ? -4.074  1.328   3.415   1.00 0.00 ? 20 GLY B H    8  
ATOM 6115  H HA2  . GLY B 2 20 ? -6.041  2.453   1.463   1.00 0.00 ? 20 GLY B HA2  8  
ATOM 6116  H HA3  . GLY B 2 20 ? -5.138  0.960   1.230   1.00 0.00 ? 20 GLY B HA3  8  
ATOM 6117  N N    . GLU B 2 21 ? -6.546  -0.377  3.101   1.00 0.00 ? 21 GLU B N    8  
ATOM 6118  C CA   . GLU B 2 21 ? -7.641  -1.192  3.698   1.00 0.00 ? 21 GLU B CA   8  
ATOM 6119  C C    . GLU B 2 21 ? -8.546  -0.289  4.539   1.00 0.00 ? 21 GLU B C    8  
ATOM 6120  O O    . GLU B 2 21 ? -9.753  -0.433  4.543   1.00 0.00 ? 21 GLU B O    8  
ATOM 6121  C CB   . GLU B 2 21 ? -7.040  -2.282  4.588   1.00 0.00 ? 21 GLU B CB   8  
ATOM 6122  C CG   . GLU B 2 21 ? -8.091  -3.362  4.852   1.00 0.00 ? 21 GLU B CG   8  
ATOM 6123  C CD   . GLU B 2 21 ? -7.423  -4.738  4.845   1.00 0.00 ? 21 GLU B CD   8  
ATOM 6124  O OE1  . GLU B 2 21 ? -6.364  -4.857  4.250   1.00 0.00 ? 21 GLU B OE1  8  
ATOM 6125  O OE2  . GLU B 2 21 ? -7.981  -5.649  5.433   1.00 0.00 ? 21 GLU B OE2  8  
ATOM 6126  H H    . GLU B 2 21 ? -5.624  -0.705  3.122   1.00 0.00 ? 21 GLU B H    8  
ATOM 6127  H HA   . GLU B 2 21 ? -8.221  -1.649  2.910   1.00 0.00 ? 21 GLU B HA   8  
ATOM 6128  H HB2  . GLU B 2 21 ? -6.187  -2.721  4.092   1.00 0.00 ? 21 GLU B HB2  8  
ATOM 6129  H HB3  . GLU B 2 21 ? -6.728  -1.849  5.527   1.00 0.00 ? 21 GLU B HB3  8  
ATOM 6130  H HG2  . GLU B 2 21 ? -8.551  -3.189  5.815   1.00 0.00 ? 21 GLU B HG2  8  
ATOM 6131  H HG3  . GLU B 2 21 ? -8.846  -3.326  4.081   1.00 0.00 ? 21 GLU B HG3  8  
ATOM 6132  N N    . ARG B 2 22 ? -7.973  0.641   5.253   1.00 0.00 ? 22 ARG B N    8  
ATOM 6133  C CA   . ARG B 2 22 ? -8.799  1.551   6.094   1.00 0.00 ? 22 ARG B CA   8  
ATOM 6134  C C    . ARG B 2 22 ? -9.865  2.222   5.228   1.00 0.00 ? 22 ARG B C    8  
ATOM 6135  O O    . ARG B 2 22 ? -11.026 2.276   5.583   1.00 0.00 ? 22 ARG B O    8  
ATOM 6136  C CB   . ARG B 2 22 ? -7.902  2.622   6.720   1.00 0.00 ? 22 ARG B CB   8  
ATOM 6137  C CG   . ARG B 2 22 ? -8.238  2.766   8.205   1.00 0.00 ? 22 ARG B CG   8  
ATOM 6138  C CD   . ARG B 2 22 ? -8.346  4.250   8.562   1.00 0.00 ? 22 ARG B CD   8  
ATOM 6139  N NE   . ARG B 2 22 ? -9.420  4.880   7.745   1.00 0.00 ? 22 ARG B NE   8  
ATOM 6140  C CZ   . ARG B 2 22 ? -10.639 4.945   8.208   1.00 0.00 ? 22 ARG B CZ   8  
ATOM 6141  N NH1  . ARG B 2 22 ? -11.028 4.116   9.138   1.00 0.00 ? 22 ARG B NH1  8  
ATOM 6142  N NH2  . ARG B 2 22 ? -11.468 5.837   7.741   1.00 0.00 ? 22 ARG B NH2  8  
ATOM 6143  H H    . ARG B 2 22 ? -6.999  0.740   5.237   1.00 0.00 ? 22 ARG B H    8  
ATOM 6144  H HA   . ARG B 2 22 ? -9.277  0.983   6.874   1.00 0.00 ? 22 ARG B HA   8  
ATOM 6145  H HB2  . ARG B 2 22 ? -6.867  2.333   6.610   1.00 0.00 ? 22 ARG B HB2  8  
ATOM 6146  H HB3  . ARG B 2 22 ? -8.067  3.566   6.222   1.00 0.00 ? 22 ARG B HB3  8  
ATOM 6147  H HG2  . ARG B 2 22 ? -9.179  2.276   8.410   1.00 0.00 ? 22 ARG B HG2  8  
ATOM 6148  H HG3  . ARG B 2 22 ? -7.458  2.311   8.797   1.00 0.00 ? 22 ARG B HG3  8  
ATOM 6149  H HD2  . ARG B 2 22 ? -8.584  4.351   9.611   1.00 0.00 ? 22 ARG B HD2  8  
ATOM 6150  H HD3  . ARG B 2 22 ? -7.404  4.738   8.358   1.00 0.00 ? 22 ARG B HD3  8  
ATOM 6151  H HE   . ARG B 2 22 ? -9.212  5.246   6.860   1.00 0.00 ? 22 ARG B HE   8  
ATOM 6152  H HH11 . ARG B 2 22 ? -10.392 3.432   9.496   1.00 0.00 ? 22 ARG B HH11 8  
ATOM 6153  H HH12 . ARG B 2 22 ? -11.961 4.165   9.493   1.00 0.00 ? 22 ARG B HH12 8  
ATOM 6154  H HH21 . ARG B 2 22 ? -11.170 6.472   7.028   1.00 0.00 ? 22 ARG B HH21 8  
ATOM 6155  H HH22 . ARG B 2 22 ? -12.401 5.887   8.096   1.00 0.00 ? 22 ARG B HH22 8  
ATOM 6156  N N    . GLY B 2 23 ? -9.478  2.734   4.095   1.00 0.00 ? 23 GLY B N    8  
ATOM 6157  C CA   . GLY B 2 23 ? -10.467 3.404   3.203   1.00 0.00 ? 23 GLY B CA   8  
ATOM 6158  C C    . GLY B 2 23 ? -10.618 2.601   1.909   1.00 0.00 ? 23 GLY B C    8  
ATOM 6159  O O    . GLY B 2 23 ? -11.004 3.126   0.883   1.00 0.00 ? 23 GLY B O    8  
ATOM 6160  H H    . GLY B 2 23 ? -8.537  2.678   3.831   1.00 0.00 ? 23 GLY B H    8  
ATOM 6161  H HA2  . GLY B 2 23 ? -11.422 3.463   3.705   1.00 0.00 ? 23 GLY B HA2  8  
ATOM 6162  H HA3  . GLY B 2 23 ? -10.121 4.398   2.966   1.00 0.00 ? 23 GLY B HA3  8  
ATOM 6163  N N    . PHE B 2 24 ? -10.319 1.332   1.947   1.00 0.00 ? 24 PHE B N    8  
ATOM 6164  C CA   . PHE B 2 24 ? -10.447 0.500   0.718   1.00 0.00 ? 24 PHE B CA   8  
ATOM 6165  C C    . PHE B 2 24 ? -11.554 -0.540  0.913   1.00 0.00 ? 24 PHE B C    8  
ATOM 6166  O O    . PHE B 2 24 ? -11.804 -1.361  0.053   1.00 0.00 ? 24 PHE B O    8  
ATOM 6167  C CB   . PHE B 2 24 ? -9.121  -0.214  0.446   1.00 0.00 ? 24 PHE B CB   8  
ATOM 6168  C CG   . PHE B 2 24 ? -8.225  0.683   -0.375  1.00 0.00 ? 24 PHE B CG   8  
ATOM 6169  C CD1  . PHE B 2 24 ? -8.030  2.016   0.006   1.00 0.00 ? 24 PHE B CD1  8  
ATOM 6170  C CD2  . PHE B 2 24 ? -7.589  0.181   -1.516  1.00 0.00 ? 24 PHE B CD2  8  
ATOM 6171  C CE1  . PHE B 2 24 ? -7.199  2.847   -0.755  1.00 0.00 ? 24 PHE B CE1  8  
ATOM 6172  C CE2  . PHE B 2 24 ? -6.758  1.013   -2.277  1.00 0.00 ? 24 PHE B CE2  8  
ATOM 6173  C CZ   . PHE B 2 24 ? -6.563  2.346   -1.896  1.00 0.00 ? 24 PHE B CZ   8  
ATOM 6174  H H    . PHE B 2 24 ? -10.009 0.926   2.784   1.00 0.00 ? 24 PHE B H    8  
ATOM 6175  H HA   . PHE B 2 24 ? -10.692 1.133   -0.121  1.00 0.00 ? 24 PHE B HA   8  
ATOM 6176  H HB2  . PHE B 2 24 ? -8.637  -0.445  1.384   1.00 0.00 ? 24 PHE B HB2  8  
ATOM 6177  H HB3  . PHE B 2 24 ? -9.308  -1.128  -0.098  1.00 0.00 ? 24 PHE B HB3  8  
ATOM 6178  H HD1  . PHE B 2 24 ? -8.521  2.404   0.886   1.00 0.00 ? 24 PHE B HD1  8  
ATOM 6179  H HD2  . PHE B 2 24 ? -7.739  -0.847  -1.810  1.00 0.00 ? 24 PHE B HD2  8  
ATOM 6180  H HE1  . PHE B 2 24 ? -7.048  3.876   -0.461  1.00 0.00 ? 24 PHE B HE1  8  
ATOM 6181  H HE2  . PHE B 2 24 ? -6.267  0.625   -3.158  1.00 0.00 ? 24 PHE B HE2  8  
ATOM 6182  H HZ   . PHE B 2 24 ? -5.922  2.987   -2.483  1.00 0.00 ? 24 PHE B HZ   8  
ATOM 6183  N N    . PHE B 2 25 ? -12.220 -0.512  2.035   1.00 0.00 ? 25 PHE B N    8  
ATOM 6184  C CA   . PHE B 2 25 ? -13.309 -1.500  2.279   1.00 0.00 ? 25 PHE B CA   8  
ATOM 6185  C C    . PHE B 2 25 ? -14.582 -1.043  1.565   1.00 0.00 ? 25 PHE B C    8  
ATOM 6186  O O    . PHE B 2 25 ? -15.148 -0.016  1.882   1.00 0.00 ? 25 PHE B O    8  
ATOM 6187  C CB   . PHE B 2 25 ? -13.577 -1.606  3.782   1.00 0.00 ? 25 PHE B CB   8  
ATOM 6188  C CG   . PHE B 2 25 ? -14.679 -2.609  4.027   1.00 0.00 ? 25 PHE B CG   8  
ATOM 6189  C CD1  . PHE B 2 25 ? -14.497 -3.950  3.669   1.00 0.00 ? 25 PHE B CD1  8  
ATOM 6190  C CD2  . PHE B 2 25 ? -15.882 -2.198  4.612   1.00 0.00 ? 25 PHE B CD2  8  
ATOM 6191  C CE1  . PHE B 2 25 ? -15.518 -4.880  3.895   1.00 0.00 ? 25 PHE B CE1  8  
ATOM 6192  C CE2  . PHE B 2 25 ? -16.904 -3.128  4.838   1.00 0.00 ? 25 PHE B CE2  8  
ATOM 6193  C CZ   . PHE B 2 25 ? -16.722 -4.469  4.480   1.00 0.00 ? 25 PHE B CZ   8  
ATOM 6194  H H    . PHE B 2 25 ? -12.005 0.158   2.718   1.00 0.00 ? 25 PHE B H    8  
ATOM 6195  H HA   . PHE B 2 25 ? -13.010 -2.466  1.898   1.00 0.00 ? 25 PHE B HA   8  
ATOM 6196  H HB2  . PHE B 2 25 ? -12.677 -1.928  4.286   1.00 0.00 ? 25 PHE B HB2  8  
ATOM 6197  H HB3  . PHE B 2 25 ? -13.878 -0.641  4.163   1.00 0.00 ? 25 PHE B HB3  8  
ATOM 6198  H HD1  . PHE B 2 25 ? -13.568 -4.267  3.218   1.00 0.00 ? 25 PHE B HD1  8  
ATOM 6199  H HD2  . PHE B 2 25 ? -16.023 -1.163  4.888   1.00 0.00 ? 25 PHE B HD2  8  
ATOM 6200  H HE1  . PHE B 2 25 ? -15.378 -5.915  3.619   1.00 0.00 ? 25 PHE B HE1  8  
ATOM 6201  H HE2  . PHE B 2 25 ? -17.833 -2.810  5.290   1.00 0.00 ? 25 PHE B HE2  8  
ATOM 6202  H HZ   . PHE B 2 25 ? -17.511 -5.186  4.655   1.00 0.00 ? 25 PHE B HZ   8  
ATOM 6203  N N    . TYR B 2 26 ? -15.038 -1.798  0.603   1.00 0.00 ? 26 TYR B N    8  
ATOM 6204  C CA   . TYR B 2 26 ? -16.275 -1.405  -0.128  1.00 0.00 ? 26 TYR B CA   8  
ATOM 6205  C C    . TYR B 2 26 ? -17.387 -2.419  0.172   1.00 0.00 ? 26 TYR B C    8  
ATOM 6206  O O    . TYR B 2 26 ? -17.211 -3.602  -0.043  1.00 0.00 ? 26 TYR B O    8  
ATOM 6207  C CB   . TYR B 2 26 ? -15.992 -1.393  -1.632  1.00 0.00 ? 26 TYR B CB   8  
ATOM 6208  C CG   . TYR B 2 26 ? -16.280 -0.019  -2.188  1.00 0.00 ? 26 TYR B CG   8  
ATOM 6209  C CD1  . TYR B 2 26 ? -17.603 0.403   -2.362  1.00 0.00 ? 26 TYR B CD1  8  
ATOM 6210  C CD2  . TYR B 2 26 ? -15.223 0.834   -2.528  1.00 0.00 ? 26 TYR B CD2  8  
ATOM 6211  C CE1  . TYR B 2 26 ? -17.870 1.677   -2.878  1.00 0.00 ? 26 TYR B CE1  8  
ATOM 6212  C CE2  . TYR B 2 26 ? -15.489 2.108   -3.043  1.00 0.00 ? 26 TYR B CE2  8  
ATOM 6213  C CZ   . TYR B 2 26 ? -16.813 2.529   -3.218  1.00 0.00 ? 26 TYR B CZ   8  
ATOM 6214  O OH   . TYR B 2 26 ? -17.076 3.785   -3.726  1.00 0.00 ? 26 TYR B OH   8  
ATOM 6215  H H    . TYR B 2 26 ? -14.568 -2.623  0.362   1.00 0.00 ? 26 TYR B H    8  
ATOM 6216  H HA   . TYR B 2 26 ? -16.578 -0.419  0.187   1.00 0.00 ? 26 TYR B HA   8  
ATOM 6217  H HB2  . TYR B 2 26 ? -14.955 -1.642  -1.805  1.00 0.00 ? 26 TYR B HB2  8  
ATOM 6218  H HB3  . TYR B 2 26 ? -16.624 -2.118  -2.123  1.00 0.00 ? 26 TYR B HB3  8  
ATOM 6219  H HD1  . TYR B 2 26 ? -18.419 -0.255  -2.100  1.00 0.00 ? 26 TYR B HD1  8  
ATOM 6220  H HD2  . TYR B 2 26 ? -14.202 0.509   -2.393  1.00 0.00 ? 26 TYR B HD2  8  
ATOM 6221  H HE1  . TYR B 2 26 ? -18.891 2.002   -3.013  1.00 0.00 ? 26 TYR B HE1  8  
ATOM 6222  H HE2  . TYR B 2 26 ? -14.674 2.766   -3.306  1.00 0.00 ? 26 TYR B HE2  8  
ATOM 6223  H HH   . TYR B 2 26 ? -16.267 4.300   -3.679  1.00 0.00 ? 26 TYR B HH   8  
ATOM 6224  N N    . PRO B 2 27 ? -18.502 -1.931  0.661   1.00 0.00 ? 27 PRO B N    8  
ATOM 6225  C CA   . PRO B 2 27 ? -19.656 -2.782  0.997   1.00 0.00 ? 27 PRO B CA   8  
ATOM 6226  C C    . PRO B 2 27 ? -20.426 -3.163  -0.271  1.00 0.00 ? 27 PRO B C    8  
ATOM 6227  O O    . PRO B 2 27 ? -20.390 -2.463  -1.263  1.00 0.00 ? 27 PRO B O    8  
ATOM 6228  C CB   . PRO B 2 27 ? -20.507 -1.892  1.907   1.00 0.00 ? 27 PRO B CB   8  
ATOM 6229  C CG   . PRO B 2 27 ? -20.106 -0.432  1.587   1.00 0.00 ? 27 PRO B CG   8  
ATOM 6230  C CD   . PRO B 2 27 ? -18.717 -0.493  0.923   1.00 0.00 ? 27 PRO B CD   8  
ATOM 6231  H HA   . PRO B 2 27 ? -19.339 -3.662  1.533   1.00 0.00 ? 27 PRO B HA   8  
ATOM 6232  H HB2  . PRO B 2 27 ? -21.557 -2.046  1.698   1.00 0.00 ? 27 PRO B HB2  8  
ATOM 6233  H HB3  . PRO B 2 27 ? -20.297 -2.108  2.942   1.00 0.00 ? 27 PRO B HB3  8  
ATOM 6234  H HG2  . PRO B 2 27 ? -20.825 0.008   0.909   1.00 0.00 ? 27 PRO B HG2  8  
ATOM 6235  H HG3  . PRO B 2 27 ? -20.050 0.145   2.496   1.00 0.00 ? 27 PRO B HG3  8  
ATOM 6236  H HD2  . PRO B 2 27 ? -18.717 0.068   -0.002  1.00 0.00 ? 27 PRO B HD2  8  
ATOM 6237  H HD3  . PRO B 2 27 ? -17.960 -0.119  1.594   1.00 0.00 ? 27 PRO B HD3  8  
ATOM 6238  N N    . THR B 2 28 ? -21.122 -4.266  -0.245  1.00 0.00 ? 28 THR B N    8  
ATOM 6239  C CA   . THR B 2 28 ? -21.892 -4.688  -1.449  1.00 0.00 ? 28 THR B CA   8  
ATOM 6240  C C    . THR B 2 28 ? -23.304 -5.103  -1.031  1.00 0.00 ? 28 THR B C    8  
ATOM 6241  O O    . THR B 2 28 ? -23.684 -6.251  -1.145  1.00 0.00 ? 28 THR B O    8  
ATOM 6242  C CB   . THR B 2 28 ? -21.188 -5.873  -2.115  1.00 0.00 ? 28 THR B CB   8  
ATOM 6243  O OG1  . THR B 2 28 ? -19.785 -5.755  -1.927  1.00 0.00 ? 28 THR B OG1  8  
ATOM 6244  C CG2  . THR B 2 28 ? -21.506 -5.882  -3.611  1.00 0.00 ? 28 THR B CG2  8  
ATOM 6245  H H    . THR B 2 28 ? -21.138 -4.817  0.565   1.00 0.00 ? 28 THR B H    8  
ATOM 6246  H HA   . THR B 2 28 ? -21.950 -3.866  -2.146  1.00 0.00 ? 28 THR B HA   8  
ATOM 6247  H HB   . THR B 2 28 ? -21.535 -6.794  -1.672  1.00 0.00 ? 28 THR B HB   8  
ATOM 6248  H HG1  . THR B 2 28 ? -19.361 -6.475  -2.399  1.00 0.00 ? 28 THR B HG1  8  
ATOM 6249  H HG21 . THR B 2 28 ? -21.613 -6.902  -3.950  1.00 0.00 ? 28 THR B HG21 8  
ATOM 6250  H HG22 . THR B 2 28 ? -20.703 -5.404  -4.152  1.00 0.00 ? 28 THR B HG22 8  
ATOM 6251  H HG23 . THR B 2 28 ? -22.427 -5.346  -3.786  1.00 0.00 ? 28 THR B HG23 8  
ATOM 6252  N N    . LYS B 2 29 ? -24.085 -4.176  -0.547  1.00 0.00 ? 29 LYS B N    8  
ATOM 6253  C CA   . LYS B 2 29 ? -25.472 -4.519  -0.124  1.00 0.00 ? 29 LYS B CA   8  
ATOM 6254  C C    . LYS B 2 29 ? -26.441 -4.230  -1.272  1.00 0.00 ? 29 LYS B C    8  
ATOM 6255  O O    . LYS B 2 29 ? -26.559 -3.111  -1.730  1.00 0.00 ? 29 LYS B O    8  
ATOM 6256  C CB   . LYS B 2 29 ? -25.856 -3.675  1.093   1.00 0.00 ? 29 LYS B CB   8  
ATOM 6257  C CG   . LYS B 2 29 ? -24.621 -3.446  1.966   1.00 0.00 ? 29 LYS B CG   8  
ATOM 6258  C CD   . LYS B 2 29 ? -24.988 -3.656  3.437   1.00 0.00 ? 29 LYS B CD   8  
ATOM 6259  C CE   . LYS B 2 29 ? -23.719 -3.614  4.291   1.00 0.00 ? 29 LYS B CE   8  
ATOM 6260  N NZ   . LYS B 2 29 ? -22.903 -4.833  4.030   1.00 0.00 ? 29 LYS B NZ   8  
ATOM 6261  H H    . LYS B 2 29 ? -23.760 -3.256  -0.463  1.00 0.00 ? 29 LYS B H    8  
ATOM 6262  H HA   . LYS B 2 29 ? -25.521 -5.566  0.134   1.00 0.00 ? 29 LYS B HA   8  
ATOM 6263  H HB2  . LYS B 2 29 ? -26.245 -2.723  0.762   1.00 0.00 ? 29 LYS B HB2  8  
ATOM 6264  H HB3  . LYS B 2 29 ? -26.609 -4.193  1.668   1.00 0.00 ? 29 LYS B HB3  8  
ATOM 6265  H HG2  . LYS B 2 29 ? -23.846 -4.145  1.684   1.00 0.00 ? 29 LYS B HG2  8  
ATOM 6266  H HG3  . LYS B 2 29 ? -24.263 -2.437  1.827   1.00 0.00 ? 29 LYS B HG3  8  
ATOM 6267  H HD2  . LYS B 2 29 ? -25.663 -2.875  3.754   1.00 0.00 ? 29 LYS B HD2  8  
ATOM 6268  H HD3  . LYS B 2 29 ? -25.466 -4.617  3.555   1.00 0.00 ? 29 LYS B HD3  8  
ATOM 6269  H HE2  . LYS B 2 29 ? -23.144 -2.735  4.038   1.00 0.00 ? 29 LYS B HE2  8  
ATOM 6270  H HE3  . LYS B 2 29 ? -23.990 -3.578  5.336   1.00 0.00 ? 29 LYS B HE3  8  
ATOM 6271  H HZ1  . LYS B 2 29 ? -22.015 -4.563  3.561   1.00 0.00 ? 29 LYS B HZ1  8  
ATOM 6272  H HZ2  . LYS B 2 29 ? -23.437 -5.482  3.415   1.00 0.00 ? 29 LYS B HZ2  8  
ATOM 6273  H HZ3  . LYS B 2 29 ? -22.688 -5.306  4.930   1.00 0.00 ? 29 LYS B HZ3  8  
ATOM 6274  N N    . THR B 2 30 ? -27.135 -5.230  -1.740  1.00 0.00 ? 30 THR B N    8  
ATOM 6275  C CA   . THR B 2 30 ? -28.095 -5.011  -2.859  1.00 0.00 ? 30 THR B CA   8  
ATOM 6276  C C    . THR B 2 30 ? -29.109 -3.938  -2.458  1.00 0.00 ? 30 THR B C    8  
ATOM 6277  O O    . THR B 2 30 ? -29.263 -3.711  -1.269  1.00 0.00 ? 30 THR B O    8  
ATOM 6278  C CB   . THR B 2 30 ? -28.830 -6.319  -3.163  1.00 0.00 ? 30 THR B CB   8  
ATOM 6279  O OG1  . THR B 2 30 ? -29.898 -6.060  -4.063  1.00 0.00 ? 30 THR B OG1  8  
ATOM 6280  C CG2  . THR B 2 30 ? -29.384 -6.910  -1.866  1.00 0.00 ? 30 THR B CG2  8  
ATOM 6281  O OXT  . THR B 2 30 ? -29.713 -3.360  -3.347  1.00 0.00 ? 30 THR B OXT  8  
ATOM 6282  H H    . THR B 2 30 ? -27.026 -6.125  -1.357  1.00 0.00 ? 30 THR B H    8  
ATOM 6283  H HA   . THR B 2 30 ? -27.557 -4.688  -3.737  1.00 0.00 ? 30 THR B HA   8  
ATOM 6284  H HB   . THR B 2 30 ? -28.144 -7.022  -3.610  1.00 0.00 ? 30 THR B HB   8  
ATOM 6285  H HG1  . THR B 2 30 ? -29.576 -5.464  -4.743  1.00 0.00 ? 30 THR B HG1  8  
ATOM 6286  H HG21 . THR B 2 30 ? -30.259 -7.503  -2.086  1.00 0.00 ? 30 THR B HG21 8  
ATOM 6287  H HG22 . THR B 2 30 ? -29.650 -6.110  -1.191  1.00 0.00 ? 30 THR B HG22 8  
ATOM 6288  H HG23 . THR B 2 30 ? -28.632 -7.534  -1.406  1.00 0.00 ? 30 THR B HG23 8  
ATOM 6289  N N    . GLY A 1 1  ? 1.492   3.926   -10.667 1.00 0.00 ? 1  GLY A N    9  
ATOM 6290  C CA   . GLY A 1 1  ? 1.474   4.603   -9.339  1.00 0.00 ? 1  GLY A CA   9  
ATOM 6291  C C    . GLY A 1 1  ? 2.824   4.406   -8.646  1.00 0.00 ? 1  GLY A C    9  
ATOM 6292  O O    . GLY A 1 1  ? 3.833   4.183   -9.284  1.00 0.00 ? 1  GLY A O    9  
ATOM 6293  H H1   . GLY A 1 1  ? 2.245   3.210   -10.681 1.00 0.00 ? 1  GLY A H1   9  
ATOM 6294  H H2   . GLY A 1 1  ? 1.668   4.631   -11.412 1.00 0.00 ? 1  GLY A H2   9  
ATOM 6295  H H3   . GLY A 1 1  ? 0.575   3.466   -10.833 1.00 0.00 ? 1  GLY A H3   9  
ATOM 6296  H HA2  . GLY A 1 1  ? 1.289   5.659   -9.476  1.00 0.00 ? 1  GLY A HA2  9  
ATOM 6297  H HA3  . GLY A 1 1  ? 0.694   4.177   -8.727  1.00 0.00 ? 1  GLY A HA3  9  
ATOM 6298  N N    . ILE A 1 2  ? 2.850   4.486   -7.344  1.00 0.00 ? 2  ILE A N    9  
ATOM 6299  C CA   . ILE A 1 2  ? 4.135   4.302   -6.611  1.00 0.00 ? 2  ILE A CA   9  
ATOM 6300  C C    . ILE A 1 2  ? 4.553   2.833   -6.677  1.00 0.00 ? 2  ILE A C    9  
ATOM 6301  O O    . ILE A 1 2  ? 5.724   2.510   -6.670  1.00 0.00 ? 2  ILE A O    9  
ATOM 6302  C CB   . ILE A 1 2  ? 3.956   4.717   -5.149  1.00 0.00 ? 2  ILE A CB   9  
ATOM 6303  C CG1  . ILE A 1 2  ? 2.610   4.203   -4.633  1.00 0.00 ? 2  ILE A CG1  9  
ATOM 6304  C CG2  . ILE A 1 2  ? 3.994   6.243   -5.042  1.00 0.00 ? 2  ILE A CG2  9  
ATOM 6305  C CD1  . ILE A 1 2  ? 2.716   3.905   -3.136  1.00 0.00 ? 2  ILE A CD1  9  
ATOM 6306  H H    . ILE A 1 2  ? 2.024   4.666   -6.848  1.00 0.00 ? 2  ILE A H    9  
ATOM 6307  H HA   . ILE A 1 2  ? 4.898   4.913   -7.068  1.00 0.00 ? 2  ILE A HA   9  
ATOM 6308  H HB   . ILE A 1 2  ? 4.756   4.296   -4.556  1.00 0.00 ? 2  ILE A HB   9  
ATOM 6309  H HG12 . ILE A 1 2  ? 1.851   4.955   -4.798  1.00 0.00 ? 2  ILE A HG12 9  
ATOM 6310  H HG13 . ILE A 1 2  ? 2.343   3.300   -5.160  1.00 0.00 ? 2  ILE A HG13 9  
ATOM 6311  H HG21 . ILE A 1 2  ? 3.242   6.573   -4.341  1.00 0.00 ? 2  ILE A HG21 9  
ATOM 6312  H HG22 . ILE A 1 2  ? 3.796   6.676   -6.012  1.00 0.00 ? 2  ILE A HG22 9  
ATOM 6313  H HG23 . ILE A 1 2  ? 4.969   6.556   -4.700  1.00 0.00 ? 2  ILE A HG23 9  
ATOM 6314  H HD11 . ILE A 1 2  ? 1.760   4.078   -2.666  1.00 0.00 ? 2  ILE A HD11 9  
ATOM 6315  H HD12 . ILE A 1 2  ? 3.458   4.552   -2.692  1.00 0.00 ? 2  ILE A HD12 9  
ATOM 6316  H HD13 . ILE A 1 2  ? 3.006   2.874   -2.995  1.00 0.00 ? 2  ILE A HD13 9  
ATOM 6317  N N    . VAL A 1 3  ? 3.606   1.939   -6.738  1.00 0.00 ? 3  VAL A N    9  
ATOM 6318  C CA   . VAL A 1 3  ? 3.941   0.497   -6.802  1.00 0.00 ? 3  VAL A CA   9  
ATOM 6319  C C    . VAL A 1 3  ? 4.750   0.214   -8.067  1.00 0.00 ? 3  VAL A C    9  
ATOM 6320  O O    . VAL A 1 3  ? 5.779   -0.432  -8.028  1.00 0.00 ? 3  VAL A O    9  
ATOM 6321  C CB   . VAL A 1 3  ? 2.644   -0.310  -6.831  1.00 0.00 ? 3  VAL A CB   9  
ATOM 6322  C CG1  . VAL A 1 3  ? 2.924   -1.719  -6.338  1.00 0.00 ? 3  VAL A CG1  9  
ATOM 6323  C CG2  . VAL A 1 3  ? 1.606   0.345   -5.916  1.00 0.00 ? 3  VAL A CG2  9  
ATOM 6324  H H    . VAL A 1 3  ? 2.670   2.215   -6.741  1.00 0.00 ? 3  VAL A H    9  
ATOM 6325  H HA   . VAL A 1 3  ? 4.519   0.222   -5.937  1.00 0.00 ? 3  VAL A HA   9  
ATOM 6326  H HB   . VAL A 1 3  ? 2.265   -0.347  -7.842  1.00 0.00 ? 3  VAL A HB   9  
ATOM 6327  H HG11 . VAL A 1 3  ? 2.824   -2.411  -7.159  1.00 0.00 ? 3  VAL A HG11 9  
ATOM 6328  H HG12 . VAL A 1 3  ? 2.218   -1.971  -5.561  1.00 0.00 ? 3  VAL A HG12 9  
ATOM 6329  H HG13 . VAL A 1 3  ? 3.928   -1.766  -5.945  1.00 0.00 ? 3  VAL A HG13 9  
ATOM 6330  H HG21 . VAL A 1 3  ? 0.815   0.771   -6.516  1.00 0.00 ? 3  VAL A HG21 9  
ATOM 6331  H HG22 . VAL A 1 3  ? 2.078   1.124   -5.336  1.00 0.00 ? 3  VAL A HG22 9  
ATOM 6332  H HG23 . VAL A 1 3  ? 1.193   -0.399  -5.251  1.00 0.00 ? 3  VAL A HG23 9  
ATOM 6333  N N    . GLU A 1 4  ? 4.294   0.694   -9.186  1.00 0.00 ? 4  GLU A N    9  
ATOM 6334  C CA   . GLU A 1 4  ? 5.033   0.456   -10.457 1.00 0.00 ? 4  GLU A CA   9  
ATOM 6335  C C    . GLU A 1 4  ? 6.349   1.235   -10.433 1.00 0.00 ? 4  GLU A C    9  
ATOM 6336  O O    . GLU A 1 4  ? 7.362   0.778   -10.924 1.00 0.00 ? 4  GLU A O    9  
ATOM 6337  C CB   . GLU A 1 4  ? 4.182   0.928   -11.638 1.00 0.00 ? 4  GLU A CB   9  
ATOM 6338  C CG   . GLU A 1 4  ? 4.340   -0.049  -12.805 1.00 0.00 ? 4  GLU A CG   9  
ATOM 6339  C CD   . GLU A 1 4  ? 5.348   0.513   -13.809 1.00 0.00 ? 4  GLU A CD   9  
ATOM 6340  O OE1  . GLU A 1 4  ? 6.533   0.449   -13.527 1.00 0.00 ? 4  GLU A OE1  9  
ATOM 6341  O OE2  . GLU A 1 4  ? 4.917   0.998   -14.842 1.00 0.00 ? 4  GLU A OE2  9  
ATOM 6342  H H    . GLU A 1 4  ? 3.463   1.211   -9.191  1.00 0.00 ? 4  GLU A H    9  
ATOM 6343  H HA   . GLU A 1 4  ? 5.241   -0.597  -10.560 1.00 0.00 ? 4  GLU A HA   9  
ATOM 6344  H HB2  . GLU A 1 4  ? 3.144   0.969   -11.339 1.00 0.00 ? 4  GLU A HB2  9  
ATOM 6345  H HB3  . GLU A 1 4  ? 4.507   1.910   -11.946 1.00 0.00 ? 4  GLU A HB3  9  
ATOM 6346  H HG2  . GLU A 1 4  ? 4.693   -1.000  -12.433 1.00 0.00 ? 4  GLU A HG2  9  
ATOM 6347  H HG3  . GLU A 1 4  ? 3.386   -0.184  -13.293 1.00 0.00 ? 4  GLU A HG3  9  
ATOM 6348  N N    . GLN A 1 5  ? 6.338   2.410   -9.870  1.00 0.00 ? 5  GLN A N    9  
ATOM 6349  C CA   . GLN A 1 5  ? 7.584   3.226   -9.817  1.00 0.00 ? 5  GLN A CA   9  
ATOM 6350  C C    . GLN A 1 5  ? 8.491   2.720   -8.692  1.00 0.00 ? 5  GLN A C    9  
ATOM 6351  O O    . GLN A 1 5  ? 9.700   2.814   -8.769  1.00 0.00 ? 5  GLN A O    9  
ATOM 6352  C CB   . GLN A 1 5  ? 7.220   4.689   -9.558  1.00 0.00 ? 5  GLN A CB   9  
ATOM 6353  C CG   . GLN A 1 5  ? 7.971   5.584   -10.545 1.00 0.00 ? 5  GLN A CG   9  
ATOM 6354  C CD   . GLN A 1 5  ? 6.973   6.241   -11.501 1.00 0.00 ? 5  GLN A CD   9  
ATOM 6355  O OE1  . GLN A 1 5  ? 6.794   5.789   -12.615 1.00 0.00 ? 5  GLN A OE1  9  
ATOM 6356  N NE2  . GLN A 1 5  ? 6.312   7.296   -11.110 1.00 0.00 ? 5  GLN A NE2  9  
ATOM 6357  H H    . GLN A 1 5  ? 5.508   2.758   -9.484  1.00 0.00 ? 5  GLN A H    9  
ATOM 6358  H HA   . GLN A 1 5  ? 8.104   3.147   -10.759 1.00 0.00 ? 5  GLN A HA   9  
ATOM 6359  H HB2  . GLN A 1 5  ? 6.156   4.823   -9.687  1.00 0.00 ? 5  GLN A HB2  9  
ATOM 6360  H HB3  . GLN A 1 5  ? 7.497   4.956   -8.550  1.00 0.00 ? 5  GLN A HB3  9  
ATOM 6361  H HG2  . GLN A 1 5  ? 8.507   6.349   -10.001 1.00 0.00 ? 5  GLN A HG2  9  
ATOM 6362  H HG3  . GLN A 1 5  ? 8.670   4.988   -11.112 1.00 0.00 ? 5  GLN A HG3  9  
ATOM 6363  H HE21 . GLN A 1 5  ? 6.457   7.660   -10.212 1.00 0.00 ? 5  GLN A HE21 9  
ATOM 6364  H HE22 . GLN A 1 5  ? 5.671   7.723   -11.715 1.00 0.00 ? 5  GLN A HE22 9  
ATOM 6365  N N    . CYS A 1 6  ? 7.921   2.187   -7.647  1.00 0.00 ? 6  CYS A N    9  
ATOM 6366  C CA   . CYS A 1 6  ? 8.759   1.682   -6.521  1.00 0.00 ? 6  CYS A CA   9  
ATOM 6367  C C    . CYS A 1 6  ? 8.756   0.152   -6.519  1.00 0.00 ? 6  CYS A C    9  
ATOM 6368  O O    . CYS A 1 6  ? 9.256   -0.476  -5.607  1.00 0.00 ? 6  CYS A O    9  
ATOM 6369  C CB   . CYS A 1 6  ? 8.195   2.191   -5.193  1.00 0.00 ? 6  CYS A CB   9  
ATOM 6370  S SG   . CYS A 1 6  ? 9.251   1.623   -3.836  1.00 0.00 ? 6  CYS A SG   9  
ATOM 6371  H H    . CYS A 1 6  ? 6.945   2.121   -7.600  1.00 0.00 ? 6  CYS A H    9  
ATOM 6372  H HA   . CYS A 1 6  ? 9.772   2.038   -6.640  1.00 0.00 ? 6  CYS A HA   9  
ATOM 6373  H HB2  . CYS A 1 6  ? 8.168   3.270   -5.202  1.00 0.00 ? 6  CYS A HB2  9  
ATOM 6374  H HB3  . CYS A 1 6  ? 7.195   1.806   -5.055  1.00 0.00 ? 6  CYS A HB3  9  
ATOM 6375  N N    . CYS A 1 7  ? 8.196   -0.453  -7.530  1.00 0.00 ? 7  CYS A N    9  
ATOM 6376  C CA   . CYS A 1 7  ? 8.163   -1.942  -7.581  1.00 0.00 ? 7  CYS A CA   9  
ATOM 6377  C C    . CYS A 1 7  ? 9.528   -2.498  -7.168  1.00 0.00 ? 7  CYS A C    9  
ATOM 6378  O O    . CYS A 1 7  ? 9.633   -3.596  -6.658  1.00 0.00 ? 7  CYS A O    9  
ATOM 6379  C CB   . CYS A 1 7  ? 7.839   -2.398  -9.005  1.00 0.00 ? 7  CYS A CB   9  
ATOM 6380  S SG   . CYS A 1 7  ? 8.055   -4.191  -9.127  1.00 0.00 ? 7  CYS A SG   9  
ATOM 6381  H H    . CYS A 1 7  ? 7.795   0.072   -8.255  1.00 0.00 ? 7  CYS A H    9  
ATOM 6382  H HA   . CYS A 1 7  ? 7.406   -2.308  -6.904  1.00 0.00 ? 7  CYS A HA   9  
ATOM 6383  H HB2  . CYS A 1 7  ? 6.817   -2.141  -9.241  1.00 0.00 ? 7  CYS A HB2  9  
ATOM 6384  H HB3  . CYS A 1 7  ? 8.503   -1.907  -9.700  1.00 0.00 ? 7  CYS A HB3  9  
ATOM 6385  N N    . THR A 1 8  ? 10.576  -1.750  -7.386  1.00 0.00 ? 8  THR A N    9  
ATOM 6386  C CA   . THR A 1 8  ? 11.932  -2.240  -7.007  1.00 0.00 ? 8  THR A CA   9  
ATOM 6387  C C    . THR A 1 8  ? 11.910  -2.742  -5.562  1.00 0.00 ? 8  THR A C    9  
ATOM 6388  O O    . THR A 1 8  ? 12.328  -3.846  -5.272  1.00 0.00 ? 8  THR A O    9  
ATOM 6389  C CB   . THR A 1 8  ? 12.942  -1.097  -7.134  1.00 0.00 ? 8  THR A CB   9  
ATOM 6390  O OG1  . THR A 1 8  ? 12.806  -0.487  -8.410  1.00 0.00 ? 8  THR A OG1  9  
ATOM 6391  C CG2  . THR A 1 8  ? 14.360  -1.648  -6.977  1.00 0.00 ? 8  THR A CG2  9  
ATOM 6392  H H    . THR A 1 8  ? 10.471  -0.868  -7.800  1.00 0.00 ? 8  THR A H    9  
ATOM 6393  H HA   . THR A 1 8  ? 12.218  -3.048  -7.664  1.00 0.00 ? 8  THR A HA   9  
ATOM 6394  H HB   . THR A 1 8  ? 12.758  -0.365  -6.363  1.00 0.00 ? 8  THR A HB   9  
ATOM 6395  H HG1  . THR A 1 8  ? 13.582  0.058   -8.561  1.00 0.00 ? 8  THR A HG1  9  
ATOM 6396  H HG21 . THR A 1 8  ? 14.492  -2.022  -5.973  1.00 0.00 ? 8  THR A HG21 9  
ATOM 6397  H HG22 . THR A 1 8  ? 15.075  -0.860  -7.164  1.00 0.00 ? 8  THR A HG22 9  
ATOM 6398  H HG23 . THR A 1 8  ? 14.515  -2.450  -7.683  1.00 0.00 ? 8  THR A HG23 9  
ATOM 6399  N N    . SER A 1 9  ? 11.431  -1.939  -4.651  1.00 0.00 ? 9  SER A N    9  
ATOM 6400  C CA   . SER A 1 9  ? 11.388  -2.372  -3.226  1.00 0.00 ? 9  SER A CA   9  
ATOM 6401  C C    . SER A 1 9  ? 10.350  -1.538  -2.468  1.00 0.00 ? 9  SER A C    9  
ATOM 6402  O O    . SER A 1 9  ? 9.298   -1.224  -2.988  1.00 0.00 ? 9  SER A O    9  
ATOM 6403  C CB   . SER A 1 9  ? 12.768  -2.176  -2.599  1.00 0.00 ? 9  SER A CB   9  
ATOM 6404  O OG   . SER A 1 9  ? 13.765  -2.316  -3.603  1.00 0.00 ? 9  SER A OG   9  
ATOM 6405  H H    . SER A 1 9  ? 11.101  -1.052  -4.904  1.00 0.00 ? 9  SER A H    9  
ATOM 6406  H HA   . SER A 1 9  ? 11.116  -3.416  -3.177  1.00 0.00 ? 9  SER A HA   9  
ATOM 6407  H HB2  . SER A 1 9  ? 12.833  -1.190  -2.170  1.00 0.00 ? 9  SER A HB2  9  
ATOM 6408  H HB3  . SER A 1 9  ? 12.917  -2.914  -1.823  1.00 0.00 ? 9  SER A HB3  9  
ATOM 6409  H HG   . SER A 1 9  ? 14.092  -1.439  -3.821  1.00 0.00 ? 9  SER A HG   9  
ATOM 6410  N N    . ILE A 1 10 ? 10.633  -1.176  -1.243  1.00 0.00 ? 10 ILE A N    9  
ATOM 6411  C CA   . ILE A 1 10 ? 9.656   -0.365  -0.457  1.00 0.00 ? 10 ILE A CA   9  
ATOM 6412  C C    . ILE A 1 10 ? 10.178  1.067   -0.343  1.00 0.00 ? 10 ILE A C    9  
ATOM 6413  O O    . ILE A 1 10 ? 11.189  1.326   0.279   1.00 0.00 ? 10 ILE A O    9  
ATOM 6414  C CB   . ILE A 1 10 ? 9.461   -0.999  0.946   1.00 0.00 ? 10 ILE A CB   9  
ATOM 6415  C CG1  . ILE A 1 10 ? 9.293   0.076   2.040   1.00 0.00 ? 10 ILE A CG1  9  
ATOM 6416  C CG2  . ILE A 1 10 ? 10.674  -1.862  1.301   1.00 0.00 ? 10 ILE A CG2  9  
ATOM 6417  C CD1  . ILE A 1 10 ? 7.941   0.780   1.895   1.00 0.00 ? 10 ILE A CD1  9  
ATOM 6418  H H    . ILE A 1 10 ? 11.485  -1.438  -0.838  1.00 0.00 ? 10 ILE A H    9  
ATOM 6419  H HA   . ILE A 1 10 ? 8.709   -0.352  -0.977  1.00 0.00 ? 10 ILE A HA   9  
ATOM 6420  H HB   . ILE A 1 10 ? 8.580   -1.626  0.927   1.00 0.00 ? 10 ILE A HB   9  
ATOM 6421  H HG12 . ILE A 1 10 ? 9.345   -0.396  3.010   1.00 0.00 ? 10 ILE A HG12 9  
ATOM 6422  H HG13 . ILE A 1 10 ? 10.086  0.803   1.958   1.00 0.00 ? 10 ILE A HG13 9  
ATOM 6423  H HG21 . ILE A 1 10 ? 10.795  -2.636  0.558   1.00 0.00 ? 10 ILE A HG21 9  
ATOM 6424  H HG22 . ILE A 1 10 ? 10.523  -2.313  2.270   1.00 0.00 ? 10 ILE A HG22 9  
ATOM 6425  H HG23 . ILE A 1 10 ? 11.559  -1.244  1.326   1.00 0.00 ? 10 ILE A HG23 9  
ATOM 6426  H HD11 . ILE A 1 10 ? 8.001   1.521   1.113   1.00 0.00 ? 10 ILE A HD11 9  
ATOM 6427  H HD12 . ILE A 1 10 ? 7.689   1.263   2.829   1.00 0.00 ? 10 ILE A HD12 9  
ATOM 6428  H HD13 . ILE A 1 10 ? 7.180   0.055   1.650   1.00 0.00 ? 10 ILE A HD13 9  
ATOM 6429  N N    . CYS A 1 11 ? 9.483   2.001   -0.928  1.00 0.00 ? 11 CYS A N    9  
ATOM 6430  C CA   . CYS A 1 11 ? 9.925   3.414   -0.834  1.00 0.00 ? 11 CYS A CA   9  
ATOM 6431  C C    . CYS A 1 11 ? 9.085   4.094   0.241   1.00 0.00 ? 11 CYS A C    9  
ATOM 6432  O O    . CYS A 1 11 ? 7.875   4.152   0.142   1.00 0.00 ? 11 CYS A O    9  
ATOM 6433  C CB   . CYS A 1 11 ? 9.708   4.116   -2.178  1.00 0.00 ? 11 CYS A CB   9  
ATOM 6434  S SG   . CYS A 1 11 ? 10.508  3.168   -3.496  1.00 0.00 ? 11 CYS A SG   9  
ATOM 6435  H H    . CYS A 1 11 ? 8.663   1.774   -1.413  1.00 0.00 ? 11 CYS A H    9  
ATOM 6436  H HA   . CYS A 1 11 ? 10.970  3.454   -0.562  1.00 0.00 ? 11 CYS A HA   9  
ATOM 6437  H HB2  . CYS A 1 11 ? 8.649   4.188   -2.379  1.00 0.00 ? 11 CYS A HB2  9  
ATOM 6438  H HB3  . CYS A 1 11 ? 10.134  5.108   -2.138  1.00 0.00 ? 11 CYS A HB3  9  
ATOM 6439  N N    . SER A 1 12 ? 9.716   4.603   1.264   1.00 0.00 ? 12 SER A N    9  
ATOM 6440  C CA   . SER A 1 12 ? 8.967   5.273   2.359   1.00 0.00 ? 12 SER A CA   9  
ATOM 6441  C C    . SER A 1 12 ? 7.641   4.550   2.604   1.00 0.00 ? 12 SER A C    9  
ATOM 6442  O O    . SER A 1 12 ? 6.640   4.864   1.994   1.00 0.00 ? 12 SER A O    9  
ATOM 6443  C CB   . SER A 1 12 ? 8.687   6.725   1.969   1.00 0.00 ? 12 SER A CB   9  
ATOM 6444  O OG   . SER A 1 12 ? 9.821   7.522   2.283   1.00 0.00 ? 12 SER A OG   9  
ATOM 6445  H H    . SER A 1 12 ? 10.687  4.539   1.315   1.00 0.00 ? 12 SER A H    9  
ATOM 6446  H HA   . SER A 1 12 ? 9.558   5.254   3.262   1.00 0.00 ? 12 SER A HA   9  
ATOM 6447  H HB2  . SER A 1 12 ? 8.493   6.785   0.911   1.00 0.00 ? 12 SER A HB2  9  
ATOM 6448  H HB3  . SER A 1 12 ? 7.822   7.082   2.512   1.00 0.00 ? 12 SER A HB3  9  
ATOM 6449  H HG   . SER A 1 12 ? 10.016  7.406   3.216   1.00 0.00 ? 12 SER A HG   9  
ATOM 6450  N N    . LEU A 1 13 ? 7.609   3.598   3.497   1.00 0.00 ? 13 LEU A N    9  
ATOM 6451  C CA   . LEU A 1 13 ? 6.320   2.906   3.761   1.00 0.00 ? 13 LEU A CA   9  
ATOM 6452  C C    . LEU A 1 13 ? 5.312   3.990   4.082   1.00 0.00 ? 13 LEU A C    9  
ATOM 6453  O O    . LEU A 1 13 ? 4.141   3.893   3.780   1.00 0.00 ? 13 LEU A O    9  
ATOM 6454  C CB   . LEU A 1 13 ? 6.466   1.946   4.948   1.00 0.00 ? 13 LEU A CB   9  
ATOM 6455  C CG   . LEU A 1 13 ? 6.649   2.742   6.244   1.00 0.00 ? 13 LEU A CG   9  
ATOM 6456  C CD1  . LEU A 1 13 ? 6.410   1.822   7.443   1.00 0.00 ? 13 LEU A CD1  9  
ATOM 6457  C CD2  . LEU A 1 13 ? 8.073   3.297   6.307   1.00 0.00 ? 13 LEU A CD2  9  
ATOM 6458  H H    . LEU A 1 13 ? 8.415   3.354   3.995   1.00 0.00 ? 13 LEU A H    9  
ATOM 6459  H HA   . LEU A 1 13 ? 6.000   2.368   2.881   1.00 0.00 ? 13 LEU A HA   9  
ATOM 6460  H HB2  . LEU A 1 13 ? 5.580   1.334   5.024   1.00 0.00 ? 13 LEU A HB2  9  
ATOM 6461  H HB3  . LEU A 1 13 ? 7.327   1.314   4.793   1.00 0.00 ? 13 LEU A HB3  9  
ATOM 6462  H HG   . LEU A 1 13 ? 5.940   3.557   6.272   1.00 0.00 ? 13 LEU A HG   9  
ATOM 6463  H HD11 . LEU A 1 13 ? 5.597   1.147   7.222   1.00 0.00 ? 13 LEU A HD11 9  
ATOM 6464  H HD12 . LEU A 1 13 ? 6.158   2.417   8.308   1.00 0.00 ? 13 LEU A HD12 9  
ATOM 6465  H HD13 . LEU A 1 13 ? 7.306   1.254   7.644   1.00 0.00 ? 13 LEU A HD13 9  
ATOM 6466  H HD21 . LEU A 1 13 ? 8.747   2.616   5.809   1.00 0.00 ? 13 LEU A HD21 9  
ATOM 6467  H HD22 . LEU A 1 13 ? 8.371   3.407   7.340   1.00 0.00 ? 13 LEU A HD22 9  
ATOM 6468  H HD23 . LEU A 1 13 ? 8.107   4.259   5.819   1.00 0.00 ? 13 LEU A HD23 9  
ATOM 6469  N N    . TYR A 1 14 ? 5.790   5.052   4.657   1.00 0.00 ? 14 TYR A N    9  
ATOM 6470  C CA   . TYR A 1 14 ? 4.895   6.193   4.968   1.00 0.00 ? 14 TYR A CA   9  
ATOM 6471  C C    . TYR A 1 14 ? 4.373   6.730   3.640   1.00 0.00 ? 14 TYR A C    9  
ATOM 6472  O O    . TYR A 1 14 ? 3.242   7.159   3.526   1.00 0.00 ? 14 TYR A O    9  
ATOM 6473  C CB   . TYR A 1 14 ? 5.680   7.284   5.701   1.00 0.00 ? 14 TYR A CB   9  
ATOM 6474  C CG   . TYR A 1 14 ? 5.975   6.831   7.111   1.00 0.00 ? 14 TYR A CG   9  
ATOM 6475  C CD1  . TYR A 1 14 ? 4.924   6.486   7.969   1.00 0.00 ? 14 TYR A CD1  9  
ATOM 6476  C CD2  . TYR A 1 14 ? 7.299   6.755   7.560   1.00 0.00 ? 14 TYR A CD2  9  
ATOM 6477  C CE1  . TYR A 1 14 ? 5.197   6.066   9.277   1.00 0.00 ? 14 TYR A CE1  9  
ATOM 6478  C CE2  . TYR A 1 14 ? 7.572   6.335   8.868   1.00 0.00 ? 14 TYR A CE2  9  
ATOM 6479  C CZ   . TYR A 1 14 ? 6.521   5.991   9.726   1.00 0.00 ? 14 TYR A CZ   9  
ATOM 6480  O OH   . TYR A 1 14 ? 6.789   5.576   11.015  1.00 0.00 ? 14 TYR A OH   9  
ATOM 6481  H H    . TYR A 1 14 ? 6.749   5.106   4.849   1.00 0.00 ? 14 TYR A H    9  
ATOM 6482  H HA   . TYR A 1 14 ? 4.069   5.857   5.576   1.00 0.00 ? 14 TYR A HA   9  
ATOM 6483  H HB2  . TYR A 1 14 ? 6.608   7.471   5.181   1.00 0.00 ? 14 TYR A HB2  9  
ATOM 6484  H HB3  . TYR A 1 14 ? 5.094   8.191   5.730   1.00 0.00 ? 14 TYR A HB3  9  
ATOM 6485  H HD1  . TYR A 1 14 ? 3.902   6.545   7.623   1.00 0.00 ? 14 TYR A HD1  9  
ATOM 6486  H HD2  . TYR A 1 14 ? 8.110   7.021   6.898   1.00 0.00 ? 14 TYR A HD2  9  
ATOM 6487  H HE1  . TYR A 1 14 ? 4.386   5.800   9.939   1.00 0.00 ? 14 TYR A HE1  9  
ATOM 6488  H HE2  . TYR A 1 14 ? 8.593   6.277   9.214   1.00 0.00 ? 14 TYR A HE2  9  
ATOM 6489  H HH   . TYR A 1 14 ? 6.506   6.270   11.615  1.00 0.00 ? 14 TYR A HH   9  
ATOM 6490  N N    . GLN A 1 15 ? 5.192   6.676   2.620   1.00 0.00 ? 15 GLN A N    9  
ATOM 6491  C CA   . GLN A 1 15 ? 4.745   7.145   1.283   1.00 0.00 ? 15 GLN A CA   9  
ATOM 6492  C C    . GLN A 1 15 ? 3.714   6.149   0.753   1.00 0.00 ? 15 GLN A C    9  
ATOM 6493  O O    . GLN A 1 15 ? 2.713   6.522   0.174   1.00 0.00 ? 15 GLN A O    9  
ATOM 6494  C CB   . GLN A 1 15 ? 5.941   7.207   0.330   1.00 0.00 ? 15 GLN A CB   9  
ATOM 6495  C CG   . GLN A 1 15 ? 6.701   8.518   0.547   1.00 0.00 ? 15 GLN A CG   9  
ATOM 6496  C CD   . GLN A 1 15 ? 5.767   9.700   0.282   1.00 0.00 ? 15 GLN A CD   9  
ATOM 6497  O OE1  . GLN A 1 15 ? 5.779   10.674  1.008   1.00 0.00 ? 15 GLN A OE1  9  
ATOM 6498  N NE2  . GLN A 1 15 ? 4.952   9.656   -0.737  1.00 0.00 ? 15 GLN A NE2  9  
ATOM 6499  H H    . GLN A 1 15 ? 6.095   6.301   2.732   1.00 0.00 ? 15 GLN A H    9  
ATOM 6500  H HA   . GLN A 1 15 ? 4.295   8.124   1.371   1.00 0.00 ? 15 GLN A HA   9  
ATOM 6501  H HB2  . GLN A 1 15 ? 6.599   6.372   0.524   1.00 0.00 ? 15 GLN A HB2  9  
ATOM 6502  H HB3  . GLN A 1 15 ? 5.592   7.161   -0.690  1.00 0.00 ? 15 GLN A HB3  9  
ATOM 6503  H HG2  . GLN A 1 15 ? 7.059   8.562   1.566   1.00 0.00 ? 15 GLN A HG2  9  
ATOM 6504  H HG3  . GLN A 1 15 ? 7.539   8.565   -0.131  1.00 0.00 ? 15 GLN A HG3  9  
ATOM 6505  H HE21 . GLN A 1 15 ? 4.942   8.871   -1.323  1.00 0.00 ? 15 GLN A HE21 9  
ATOM 6506  H HE22 . GLN A 1 15 ? 4.350   10.409  -0.915  1.00 0.00 ? 15 GLN A HE22 9  
ATOM 6507  N N    . LEU A 1 16 ? 3.942   4.878   0.971   1.00 0.00 ? 16 LEU A N    9  
ATOM 6508  C CA   . LEU A 1 16 ? 2.967   3.858   0.507   1.00 0.00 ? 16 LEU A CA   9  
ATOM 6509  C C    . LEU A 1 16 ? 1.716   3.980   1.372   1.00 0.00 ? 16 LEU A C    9  
ATOM 6510  O O    . LEU A 1 16 ? 0.605   4.003   0.881   1.00 0.00 ? 16 LEU A O    9  
ATOM 6511  C CB   . LEU A 1 16 ? 3.570   2.460   0.661   1.00 0.00 ? 16 LEU A CB   9  
ATOM 6512  C CG   . LEU A 1 16 ? 3.364   1.670   -0.633  1.00 0.00 ? 16 LEU A CG   9  
ATOM 6513  C CD1  . LEU A 1 16 ? 4.698   1.539   -1.369  1.00 0.00 ? 16 LEU A CD1  9  
ATOM 6514  C CD2  . LEU A 1 16 ? 2.829   0.276   -0.297  1.00 0.00 ? 16 LEU A CD2  9  
ATOM 6515  H H    . LEU A 1 16 ? 4.745   4.598   1.458   1.00 0.00 ? 16 LEU A H    9  
ATOM 6516  H HA   . LEU A 1 16 ? 2.714   4.038   -0.528  1.00 0.00 ? 16 LEU A HA   9  
ATOM 6517  H HB2  . LEU A 1 16 ? 4.627   2.545   0.867   1.00 0.00 ? 16 LEU A HB2  9  
ATOM 6518  H HB3  . LEU A 1 16 ? 3.084   1.946   1.476   1.00 0.00 ? 16 LEU A HB3  9  
ATOM 6519  H HG   . LEU A 1 16 ? 2.655   2.188   -1.262  1.00 0.00 ? 16 LEU A HG   9  
ATOM 6520  H HD11 . LEU A 1 16 ? 5.510   1.617   -0.661  1.00 0.00 ? 16 LEU A HD11 9  
ATOM 6521  H HD12 . LEU A 1 16 ? 4.783   2.328   -2.102  1.00 0.00 ? 16 LEU A HD12 9  
ATOM 6522  H HD13 . LEU A 1 16 ? 4.743   0.581   -1.865  1.00 0.00 ? 16 LEU A HD13 9  
ATOM 6523  H HD21 . LEU A 1 16 ? 2.155   0.341   0.544   1.00 0.00 ? 16 LEU A HD21 9  
ATOM 6524  H HD22 . LEU A 1 16 ? 3.654   -0.376  -0.048  1.00 0.00 ? 16 LEU A HD22 9  
ATOM 6525  H HD23 . LEU A 1 16 ? 2.302   -0.123  -1.151  1.00 0.00 ? 16 LEU A HD23 9  
ATOM 6526  N N    . GLU A 1 17 ? 1.894   4.080   2.663   1.00 0.00 ? 17 GLU A N    9  
ATOM 6527  C CA   . GLU A 1 17 ? 0.718   4.224   3.563   1.00 0.00 ? 17 GLU A CA   9  
ATOM 6528  C C    . GLU A 1 17 ? -0.008  5.525   3.214   1.00 0.00 ? 17 GLU A C    9  
ATOM 6529  O O    . GLU A 1 17 ? -1.219  5.571   3.128   1.00 0.00 ? 17 GLU A O    9  
ATOM 6530  C CB   . GLU A 1 17 ? 1.183   4.278   5.021   1.00 0.00 ? 17 GLU A CB   9  
ATOM 6531  C CG   . GLU A 1 17 ? 2.190   3.156   5.285   1.00 0.00 ? 17 GLU A CG   9  
ATOM 6532  C CD   . GLU A 1 17 ? 1.537   2.080   6.155   1.00 0.00 ? 17 GLU A CD   9  
ATOM 6533  O OE1  . GLU A 1 17 ? 0.574   2.398   6.832   1.00 0.00 ? 17 GLU A OE1  9  
ATOM 6534  O OE2  . GLU A 1 17 ? 2.012   0.957   6.130   1.00 0.00 ? 17 GLU A OE2  9  
ATOM 6535  H H    . GLU A 1 17 ? 2.803   4.069   3.036   1.00 0.00 ? 17 GLU A H    9  
ATOM 6536  H HA   . GLU A 1 17 ? 0.053   3.388   3.423   1.00 0.00 ? 17 GLU A HA   9  
ATOM 6537  H HB2  . GLU A 1 17 ? 1.650   5.233   5.214   1.00 0.00 ? 17 GLU A HB2  9  
ATOM 6538  H HB3  . GLU A 1 17 ? 0.332   4.155   5.674   1.00 0.00 ? 17 GLU A HB3  9  
ATOM 6539  H HG2  . GLU A 1 17 ? 2.499   2.722   4.346   1.00 0.00 ? 17 GLU A HG2  9  
ATOM 6540  H HG3  . GLU A 1 17 ? 3.050   3.557   5.798   1.00 0.00 ? 17 GLU A HG3  9  
ATOM 6541  N N    . ASN A 1 18 ? 0.727   6.582   2.999   1.00 0.00 ? 18 ASN A N    9  
ATOM 6542  C CA   . ASN A 1 18 ? 0.086   7.879   2.640   1.00 0.00 ? 18 ASN A CA   9  
ATOM 6543  C C    . ASN A 1 18 ? -0.789  7.679   1.401   1.00 0.00 ? 18 ASN A C    9  
ATOM 6544  O O    . ASN A 1 18 ? -1.672  8.464   1.116   1.00 0.00 ? 18 ASN A O    9  
ATOM 6545  C CB   . ASN A 1 18 ? 1.169   8.919   2.341   1.00 0.00 ? 18 ASN A CB   9  
ATOM 6546  C CG   . ASN A 1 18 ? 1.529   9.665   3.627   1.00 0.00 ? 18 ASN A CG   9  
ATOM 6547  O OD1  . ASN A 1 18 ? 0.672   10.238  4.271   1.00 0.00 ? 18 ASN A OD1  9  
ATOM 6548  N ND2  . ASN A 1 18 ? 2.769   9.683   4.031   1.00 0.00 ? 18 ASN A ND2  9  
ATOM 6549  H H    . ASN A 1 18 ? 1.703   6.520   3.065   1.00 0.00 ? 18 ASN A H    9  
ATOM 6550  H HA   . ASN A 1 18 ? -0.525  8.220   3.463   1.00 0.00 ? 18 ASN A HA   9  
ATOM 6551  H HB2  . ASN A 1 18 ? 2.047   8.423   1.953   1.00 0.00 ? 18 ASN A HB2  9  
ATOM 6552  H HB3  . ASN A 1 18 ? 0.800   9.623   1.610   1.00 0.00 ? 18 ASN A HB3  9  
ATOM 6553  H HD21 . ASN A 1 18 ? 3.460   9.221   3.513   1.00 0.00 ? 18 ASN A HD21 9  
ATOM 6554  H HD22 . ASN A 1 18 ? 3.010   10.158  4.854   1.00 0.00 ? 18 ASN A HD22 9  
ATOM 6555  N N    . TYR A 1 19 ? -0.546  6.629   0.664   1.00 0.00 ? 19 TYR A N    9  
ATOM 6556  C CA   . TYR A 1 19 ? -1.351  6.359   -0.563  1.00 0.00 ? 19 TYR A CA   9  
ATOM 6557  C C    . TYR A 1 19 ? -2.849  6.387   -0.239  1.00 0.00 ? 19 TYR A C    9  
ATOM 6558  O O    . TYR A 1 19 ? -3.672  6.469   -1.128  1.00 0.00 ? 19 TYR A O    9  
ATOM 6559  C CB   . TYR A 1 19 ? -0.986  4.979   -1.109  1.00 0.00 ? 19 TYR A CB   9  
ATOM 6560  C CG   . TYR A 1 19 ? -1.584  4.808   -2.485  1.00 0.00 ? 19 TYR A CG   9  
ATOM 6561  C CD1  . TYR A 1 19 ? -2.945  4.513   -2.626  1.00 0.00 ? 19 TYR A CD1  9  
ATOM 6562  C CD2  . TYR A 1 19 ? -0.777  4.948   -3.620  1.00 0.00 ? 19 TYR A CD2  9  
ATOM 6563  C CE1  . TYR A 1 19 ? -3.498  4.358   -3.903  1.00 0.00 ? 19 TYR A CE1  9  
ATOM 6564  C CE2  . TYR A 1 19 ? -1.330  4.792   -4.896  1.00 0.00 ? 19 TYR A CE2  9  
ATOM 6565  C CZ   . TYR A 1 19 ? -2.691  4.497   -5.038  1.00 0.00 ? 19 TYR A CZ   9  
ATOM 6566  O OH   . TYR A 1 19 ? -3.237  4.344   -6.296  1.00 0.00 ? 19 TYR A OH   9  
ATOM 6567  H H    . TYR A 1 19 ? 0.173   6.014   0.917   1.00 0.00 ? 19 TYR A H    9  
ATOM 6568  H HA   . TYR A 1 19 ? -1.131  7.108   -1.309  1.00 0.00 ? 19 TYR A HA   9  
ATOM 6569  H HB2  . TYR A 1 19 ? 0.088   4.889   -1.167  1.00 0.00 ? 19 TYR A HB2  9  
ATOM 6570  H HB3  . TYR A 1 19 ? -1.378  4.218   -0.451  1.00 0.00 ? 19 TYR A HB3  9  
ATOM 6571  H HD1  . TYR A 1 19 ? -3.568  4.404   -1.750  1.00 0.00 ? 19 TYR A HD1  9  
ATOM 6572  H HD2  . TYR A 1 19 ? 0.273   5.175   -3.510  1.00 0.00 ? 19 TYR A HD2  9  
ATOM 6573  H HE1  . TYR A 1 19 ? -4.549  4.130   -4.011  1.00 0.00 ? 19 TYR A HE1  9  
ATOM 6574  H HE2  . TYR A 1 19 ? -0.707  4.900   -5.772  1.00 0.00 ? 19 TYR A HE2  9  
ATOM 6575  H HH   . TYR A 1 19 ? -3.641  3.474   -6.340  1.00 0.00 ? 19 TYR A HH   9  
ATOM 6576  N N    . CYS A 1 20 ? -3.202  6.301   1.021   1.00 0.00 ? 20 CYS A N    9  
ATOM 6577  C CA   . CYS A 1 20 ? -4.646  6.309   1.421   1.00 0.00 ? 20 CYS A CA   9  
ATOM 6578  C C    . CYS A 1 20 ? -5.469  7.170   0.462   1.00 0.00 ? 20 CYS A C    9  
ATOM 6579  O O    . CYS A 1 20 ? -4.975  8.101   -0.144  1.00 0.00 ? 20 CYS A O    9  
ATOM 6580  C CB   . CYS A 1 20 ? -4.784  6.876   2.834   1.00 0.00 ? 20 CYS A CB   9  
ATOM 6581  S SG   . CYS A 1 20 ? -5.551  5.641   3.912   1.00 0.00 ? 20 CYS A SG   9  
ATOM 6582  H H    . CYS A 1 20 ? -2.513  6.216   1.710   1.00 0.00 ? 20 CYS A H    9  
ATOM 6583  H HA   . CYS A 1 20 ? -5.024  5.300   1.405   1.00 0.00 ? 20 CYS A HA   9  
ATOM 6584  H HB2  . CYS A 1 20 ? -3.809  7.131   3.215   1.00 0.00 ? 20 CYS A HB2  9  
ATOM 6585  H HB3  . CYS A 1 20 ? -5.403  7.760   2.804   1.00 0.00 ? 20 CYS A HB3  9  
ATOM 6586  N N    . ASN A 1 21 ? -6.727  6.860   0.324   1.00 0.00 ? 21 ASN A N    9  
ATOM 6587  C CA   . ASN A 1 21 ? -7.598  7.645   -0.593  1.00 0.00 ? 21 ASN A CA   9  
ATOM 6588  C C    . ASN A 1 21 ? -8.806  8.179   0.180   1.00 0.00 ? 21 ASN A C    9  
ATOM 6589  O O    . ASN A 1 21 ? -8.672  9.217   0.806   1.00 0.00 ? 21 ASN A O    9  
ATOM 6590  C CB   . ASN A 1 21 ? -8.078  6.741   -1.732  1.00 0.00 ? 21 ASN A CB   9  
ATOM 6591  C CG   . ASN A 1 21 ? -8.654  7.601   -2.859  1.00 0.00 ? 21 ASN A CG   9  
ATOM 6592  O OD1  . ASN A 1 21 ? -8.288  8.749   -3.011  1.00 0.00 ? 21 ASN A OD1  9  
ATOM 6593  N ND2  . ASN A 1 21 ? -9.547  7.089   -3.662  1.00 0.00 ? 21 ASN A ND2  9  
ATOM 6594  O OXT  . ASN A 1 21 ? -9.845  7.541   0.131   1.00 0.00 ? 21 ASN A OXT  9  
ATOM 6595  H H    . ASN A 1 21 ? -7.098  6.107   0.828   1.00 0.00 ? 21 ASN A H    9  
ATOM 6596  H HA   . ASN A 1 21 ? -7.037  8.473   -1.003  1.00 0.00 ? 21 ASN A HA   9  
ATOM 6597  H HB2  . ASN A 1 21 ? -7.246  6.163   -2.108  1.00 0.00 ? 21 ASN A HB2  9  
ATOM 6598  H HB3  . ASN A 1 21 ? -8.843  6.073   -1.365  1.00 0.00 ? 21 ASN A HB3  9  
ATOM 6599  H HD21 . ASN A 1 21 ? -9.842  6.162   -3.540  1.00 0.00 ? 21 ASN A HD21 9  
ATOM 6600  H HD22 . ASN A 1 21 ? -9.922  7.631   -4.387  1.00 0.00 ? 21 ASN A HD22 9  
ATOM 6601  N N    . PHE B 2 1  ? 11.859  -2.792  12.289  1.00 0.00 ? 1  PHE B N    9  
ATOM 6602  C CA   . PHE B 2 1  ? 10.496  -2.270  11.986  1.00 0.00 ? 1  PHE B CA   9  
ATOM 6603  C C    . PHE B 2 1  ? 10.479  -1.676  10.577  1.00 0.00 ? 1  PHE B C    9  
ATOM 6604  O O    . PHE B 2 1  ? 9.973   -0.593  10.354  1.00 0.00 ? 1  PHE B O    9  
ATOM 6605  C CB   . PHE B 2 1  ? 10.126  -1.186  13.001  1.00 0.00 ? 1  PHE B CB   9  
ATOM 6606  C CG   . PHE B 2 1  ? 11.363  -0.415  13.395  1.00 0.00 ? 1  PHE B CG   9  
ATOM 6607  C CD1  . PHE B 2 1  ? 12.047  0.348   12.440  1.00 0.00 ? 1  PHE B CD1  9  
ATOM 6608  C CD2  . PHE B 2 1  ? 11.826  -0.462  14.715  1.00 0.00 ? 1  PHE B CD2  9  
ATOM 6609  C CE1  . PHE B 2 1  ? 13.194  1.063   12.806  1.00 0.00 ? 1  PHE B CE1  9  
ATOM 6610  C CE2  . PHE B 2 1  ? 12.973  0.253   15.081  1.00 0.00 ? 1  PHE B CE2  9  
ATOM 6611  C CZ   . PHE B 2 1  ? 13.657  1.015   14.126  1.00 0.00 ? 1  PHE B CZ   9  
ATOM 6612  H H1   . PHE B 2 1  ? 11.886  -3.146  13.266  1.00 0.00 ? 1  PHE B H1   9  
ATOM 6613  H H2   . PHE B 2 1  ? 12.556  -2.027  12.176  1.00 0.00 ? 1  PHE B H2   9  
ATOM 6614  H H3   . PHE B 2 1  ? 12.086  -3.568  11.636  1.00 0.00 ? 1  PHE B H3   9  
ATOM 6615  H HA   . PHE B 2 1  ? 9.781   -3.077  12.045  1.00 0.00 ? 1  PHE B HA   9  
ATOM 6616  H HB2  . PHE B 2 1  ? 9.406   -0.511  12.560  1.00 0.00 ? 1  PHE B HB2  9  
ATOM 6617  H HB3  . PHE B 2 1  ? 9.696   -1.647  13.878  1.00 0.00 ? 1  PHE B HB3  9  
ATOM 6618  H HD1  . PHE B 2 1  ? 11.690  0.384   11.421  1.00 0.00 ? 1  PHE B HD1  9  
ATOM 6619  H HD2  . PHE B 2 1  ? 11.299  -1.050  15.451  1.00 0.00 ? 1  PHE B HD2  9  
ATOM 6620  H HE1  . PHE B 2 1  ? 13.721  1.651   12.069  1.00 0.00 ? 1  PHE B HE1  9  
ATOM 6621  H HE2  . PHE B 2 1  ? 13.330  0.216   16.099  1.00 0.00 ? 1  PHE B HE2  9  
ATOM 6622  H HZ   . PHE B 2 1  ? 14.541  1.567   14.408  1.00 0.00 ? 1  PHE B HZ   9  
ATOM 6623  N N    . VAL B 2 2  ? 11.027  -2.376  9.622   1.00 0.00 ? 2  VAL B N    9  
ATOM 6624  C CA   . VAL B 2 2  ? 11.040  -1.852  8.227   1.00 0.00 ? 2  VAL B CA   9  
ATOM 6625  C C    . VAL B 2 2  ? 10.314  -2.838  7.310   1.00 0.00 ? 2  VAL B C    9  
ATOM 6626  O O    . VAL B 2 2  ? 10.043  -3.962  7.683   1.00 0.00 ? 2  VAL B O    9  
ATOM 6627  C CB   . VAL B 2 2  ? 12.487  -1.690  7.757   1.00 0.00 ? 2  VAL B CB   9  
ATOM 6628  C CG1  . VAL B 2 2  ? 13.287  -0.925  8.814   1.00 0.00 ? 2  VAL B CG1  9  
ATOM 6629  C CG2  . VAL B 2 2  ? 13.111  -3.071  7.548   1.00 0.00 ? 2  VAL B CG2  9  
ATOM 6630  H H    . VAL B 2 2  ? 11.429  -3.247  9.822   1.00 0.00 ? 2  VAL B H    9  
ATOM 6631  H HA   . VAL B 2 2  ? 10.541  -0.895  8.196   1.00 0.00 ? 2  VAL B HA   9  
ATOM 6632  H HB   . VAL B 2 2  ? 12.504  -1.140  6.827   1.00 0.00 ? 2  VAL B HB   9  
ATOM 6633  H HG11 . VAL B 2 2  ? 13.757  -0.067  8.359   1.00 0.00 ? 2  VAL B HG11 9  
ATOM 6634  H HG12 . VAL B 2 2  ? 14.045  -1.573  9.230   1.00 0.00 ? 2  VAL B HG12 9  
ATOM 6635  H HG13 . VAL B 2 2  ? 12.623  -0.598  9.601   1.00 0.00 ? 2  VAL B HG13 9  
ATOM 6636  H HG21 . VAL B 2 2  ? 13.006  -3.361  6.513   1.00 0.00 ? 2  VAL B HG21 9  
ATOM 6637  H HG22 . VAL B 2 2  ? 12.609  -3.792  8.177   1.00 0.00 ? 2  VAL B HG22 9  
ATOM 6638  H HG23 . VAL B 2 2  ? 14.159  -3.036  7.807   1.00 0.00 ? 2  VAL B HG23 9  
ATOM 6639  N N    . ASN B 2 3  ? 9.998   -2.429  6.111   1.00 0.00 ? 3  ASN B N    9  
ATOM 6640  C CA   . ASN B 2 3  ? 9.294   -3.349  5.175   1.00 0.00 ? 3  ASN B CA   9  
ATOM 6641  C C    . ASN B 2 3  ? 10.259  -3.775  4.070   1.00 0.00 ? 3  ASN B C    9  
ATOM 6642  O O    . ASN B 2 3  ? 11.378  -3.307  3.998   1.00 0.00 ? 3  ASN B O    9  
ATOM 6643  C CB   . ASN B 2 3  ? 8.093   -2.630  4.556   1.00 0.00 ? 3  ASN B CB   9  
ATOM 6644  C CG   . ASN B 2 3  ? 7.130   -3.661  3.965   1.00 0.00 ? 3  ASN B CG   9  
ATOM 6645  O OD1  . ASN B 2 3  ? 6.472   -4.380  4.690   1.00 0.00 ? 3  ASN B OD1  9  
ATOM 6646  N ND2  . ASN B 2 3  ? 7.020   -3.765  2.669   1.00 0.00 ? 3  ASN B ND2  9  
ATOM 6647  H H    . ASN B 2 3  ? 10.227  -1.520  5.825   1.00 0.00 ? 3  ASN B H    9  
ATOM 6648  H HA   . ASN B 2 3  ? 8.954   -4.221  5.714   1.00 0.00 ? 3  ASN B HA   9  
ATOM 6649  H HB2  . ASN B 2 3  ? 7.585   -2.056  5.318   1.00 0.00 ? 3  ASN B HB2  9  
ATOM 6650  H HB3  . ASN B 2 3  ? 8.434   -1.968  3.774   1.00 0.00 ? 3  ASN B HB3  9  
ATOM 6651  H HD21 . ASN B 2 3  ? 7.551   -3.185  2.084   1.00 0.00 ? 3  ASN B HD21 9  
ATOM 6652  H HD22 . ASN B 2 3  ? 6.406   -4.423  2.281   1.00 0.00 ? 3  ASN B HD22 9  
ATOM 6653  N N    . GLN B 2 4  ? 9.840   -4.657  3.207   1.00 0.00 ? 4  GLN B N    9  
ATOM 6654  C CA   . GLN B 2 4  ? 10.741  -5.106  2.109   1.00 0.00 ? 4  GLN B CA   9  
ATOM 6655  C C    . GLN B 2 4  ? 10.026  -6.152  1.254   1.00 0.00 ? 4  GLN B C    9  
ATOM 6656  O O    . GLN B 2 4  ? 10.575  -7.190  0.941   1.00 0.00 ? 4  GLN B O    9  
ATOM 6657  C CB   . GLN B 2 4  ? 12.007  -5.722  2.709   1.00 0.00 ? 4  GLN B CB   9  
ATOM 6658  C CG   . GLN B 2 4  ? 13.076  -5.851  1.622   1.00 0.00 ? 4  GLN B CG   9  
ATOM 6659  C CD   . GLN B 2 4  ? 13.851  -4.538  1.508   1.00 0.00 ? 4  GLN B CD   9  
ATOM 6660  O OE1  . GLN B 2 4  ? 13.903  -3.767  2.445   1.00 0.00 ? 4  GLN B OE1  9  
ATOM 6661  N NE2  . GLN B 2 4  ? 14.460  -4.249  0.390   1.00 0.00 ? 4  GLN B NE2  9  
ATOM 6662  H H    . GLN B 2 4  ? 8.933   -5.023  3.279   1.00 0.00 ? 4  GLN B H    9  
ATOM 6663  H HA   . GLN B 2 4  ? 11.009  -4.260  1.494   1.00 0.00 ? 4  GLN B HA   9  
ATOM 6664  H HB2  . GLN B 2 4  ? 12.375  -5.088  3.502   1.00 0.00 ? 4  GLN B HB2  9  
ATOM 6665  H HB3  . GLN B 2 4  ? 11.780  -6.700  3.105   1.00 0.00 ? 4  GLN B HB3  9  
ATOM 6666  H HG2  . GLN B 2 4  ? 13.756  -6.651  1.879   1.00 0.00 ? 4  GLN B HG2  9  
ATOM 6667  H HG3  . GLN B 2 4  ? 12.603  -6.070  0.676   1.00 0.00 ? 4  GLN B HG3  9  
ATOM 6668  H HE21 . GLN B 2 4  ? 14.417  -4.872  -0.365  1.00 0.00 ? 4  GLN B HE21 9  
ATOM 6669  H HE22 . GLN B 2 4  ? 14.959  -3.410  0.307   1.00 0.00 ? 4  GLN B HE22 9  
ATOM 6670  N N    . HIS B 2 5  ? 8.805   -5.893  0.871   1.00 0.00 ? 5  HIS B N    9  
ATOM 6671  C CA   . HIS B 2 5  ? 8.070   -6.887  0.033   1.00 0.00 ? 5  HIS B CA   9  
ATOM 6672  C C    . HIS B 2 5  ? 8.903   -7.213  -1.210  1.00 0.00 ? 5  HIS B C    9  
ATOM 6673  O O    . HIS B 2 5  ? 10.057  -6.845  -1.307  1.00 0.00 ? 5  HIS B O    9  
ATOM 6674  C CB   . HIS B 2 5  ? 6.710   -6.321  -0.393  1.00 0.00 ? 5  HIS B CB   9  
ATOM 6675  C CG   . HIS B 2 5  ? 6.800   -4.828  -0.524  1.00 0.00 ? 5  HIS B CG   9  
ATOM 6676  N ND1  . HIS B 2 5  ? 7.925   -4.199  -1.029  1.00 0.00 ? 5  HIS B ND1  9  
ATOM 6677  C CD2  . HIS B 2 5  ? 5.919   -3.824  -0.208  1.00 0.00 ? 5  HIS B CD2  9  
ATOM 6678  C CE1  . HIS B 2 5  ? 7.695   -2.876  -1.001  1.00 0.00 ? 5  HIS B CE1  9  
ATOM 6679  N NE2  . HIS B 2 5  ? 6.487   -2.591  -0.510  1.00 0.00 ? 5  HIS B NE2  9  
ATOM 6680  H H    . HIS B 2 5  ? 8.376   -5.050  1.134   1.00 0.00 ? 5  HIS B H    9  
ATOM 6681  H HA   . HIS B 2 5  ? 7.918   -7.789  0.606   1.00 0.00 ? 5  HIS B HA   9  
ATOM 6682  H HB2  . HIS B 2 5  ? 6.425   -6.749  -1.343  1.00 0.00 ? 5  HIS B HB2  9  
ATOM 6683  H HB3  . HIS B 2 5  ? 5.968   -6.572  0.351   1.00 0.00 ? 5  HIS B HB3  9  
ATOM 6684  H HD1  . HIS B 2 5  ? 8.740   -4.640  -1.349  1.00 0.00 ? 5  HIS B HD1  9  
ATOM 6685  H HD2  . HIS B 2 5  ? 4.934   -3.970  0.211   1.00 0.00 ? 5  HIS B HD2  9  
ATOM 6686  H HE1  . HIS B 2 5  ? 8.403   -2.134  -1.332  1.00 0.00 ? 5  HIS B HE1  9  
ATOM 6687  N N    . LEU B 2 6  ? 8.335   -7.905  -2.161  1.00 0.00 ? 6  LEU B N    9  
ATOM 6688  C CA   . LEU B 2 6  ? 9.109   -8.254  -3.388  1.00 0.00 ? 6  LEU B CA   9  
ATOM 6689  C C    . LEU B 2 6  ? 8.364   -7.763  -4.632  1.00 0.00 ? 6  LEU B C    9  
ATOM 6690  O O    . LEU B 2 6  ? 8.705   -8.111  -5.745  1.00 0.00 ? 6  LEU B O    9  
ATOM 6691  C CB   . LEU B 2 6  ? 9.278   -9.772  -3.466  1.00 0.00 ? 6  LEU B CB   9  
ATOM 6692  C CG   . LEU B 2 6  ? 8.015   -10.454 -2.939  1.00 0.00 ? 6  LEU B CG   9  
ATOM 6693  C CD1  . LEU B 2 6  ? 7.805   -11.780 -3.673  1.00 0.00 ? 6  LEU B CD1  9  
ATOM 6694  C CD2  . LEU B 2 6  ? 8.167   -10.721 -1.440  1.00 0.00 ? 6  LEU B CD2  9  
ATOM 6695  H H    . LEU B 2 6  ? 7.405   -8.199  -2.066  1.00 0.00 ? 6  LEU B H    9  
ATOM 6696  H HA   . LEU B 2 6  ? 10.081  -7.787  -3.344  1.00 0.00 ? 6  LEU B HA   9  
ATOM 6697  H HB2  . LEU B 2 6  ? 9.445   -10.064 -4.493  1.00 0.00 ? 6  LEU B HB2  9  
ATOM 6698  H HB3  . LEU B 2 6  ? 10.124  -10.072 -2.865  1.00 0.00 ? 6  LEU B HB3  9  
ATOM 6699  H HG   . LEU B 2 6  ? 7.163   -9.811  -3.108  1.00 0.00 ? 6  LEU B HG   9  
ATOM 6700  H HD11 . LEU B 2 6  ? 8.013   -12.599 -3.001  1.00 0.00 ? 6  LEU B HD11 9  
ATOM 6701  H HD12 . LEU B 2 6  ? 8.473   -11.831 -4.520  1.00 0.00 ? 6  LEU B HD12 9  
ATOM 6702  H HD13 . LEU B 2 6  ? 6.783   -11.844 -4.014  1.00 0.00 ? 6  LEU B HD13 9  
ATOM 6703  H HD21 . LEU B 2 6  ? 7.267   -11.185 -1.064  1.00 0.00 ? 6  LEU B HD21 9  
ATOM 6704  H HD22 . LEU B 2 6  ? 8.334   -9.787  -0.923  1.00 0.00 ? 6  LEU B HD22 9  
ATOM 6705  H HD23 . LEU B 2 6  ? 9.007   -11.379 -1.275  1.00 0.00 ? 6  LEU B HD23 9  
ATOM 6706  N N    . CYS B 2 7  ? 7.352   -6.958  -4.455  1.00 0.00 ? 7  CYS B N    9  
ATOM 6707  C CA   . CYS B 2 7  ? 6.588   -6.444  -5.627  1.00 0.00 ? 7  CYS B CA   9  
ATOM 6708  C C    . CYS B 2 7  ? 5.779   -7.578  -6.263  1.00 0.00 ? 7  CYS B C    9  
ATOM 6709  O O    . CYS B 2 7  ? 5.116   -7.392  -7.263  1.00 0.00 ? 7  CYS B O    9  
ATOM 6710  C CB   . CYS B 2 7  ? 7.559   -5.869  -6.656  1.00 0.00 ? 7  CYS B CB   9  
ATOM 6711  S SG   . CYS B 2 7  ? 6.632   -4.944  -7.906  1.00 0.00 ? 7  CYS B SG   9  
ATOM 6712  H H    . CYS B 2 7  ? 7.096   -6.690  -3.550  1.00 0.00 ? 7  CYS B H    9  
ATOM 6713  H HA   . CYS B 2 7  ? 5.914   -5.667  -5.300  1.00 0.00 ? 7  CYS B HA   9  
ATOM 6714  H HB2  . CYS B 2 7  ? 8.256   -5.209  -6.161  1.00 0.00 ? 7  CYS B HB2  9  
ATOM 6715  H HB3  . CYS B 2 7  ? 8.099   -6.674  -7.130  1.00 0.00 ? 7  CYS B HB3  9  
ATOM 6716  N N    . GLY B 2 8  ? 5.818   -8.749  -5.688  1.00 0.00 ? 8  GLY B N    9  
ATOM 6717  C CA   . GLY B 2 8  ? 5.040   -9.885  -6.259  1.00 0.00 ? 8  GLY B CA   9  
ATOM 6718  C C    . GLY B 2 8  ? 3.710   -9.990  -5.519  1.00 0.00 ? 8  GLY B C    9  
ATOM 6719  O O    . GLY B 2 8  ? 3.443   -10.959 -4.837  1.00 0.00 ? 8  GLY B O    9  
ATOM 6720  H H    . GLY B 2 8  ? 6.350   -8.881  -4.876  1.00 0.00 ? 8  GLY B H    9  
ATOM 6721  H HA2  . GLY B 2 8  ? 4.861   -9.709  -7.310  1.00 0.00 ? 8  GLY B HA2  9  
ATOM 6722  H HA3  . GLY B 2 8  ? 5.591   -10.801 -6.133  1.00 0.00 ? 8  GLY B HA3  9  
ATOM 6723  N N    . SER B 2 9  ? 2.887   -8.982  -5.641  1.00 0.00 ? 9  SER B N    9  
ATOM 6724  C CA   . SER B 2 9  ? 1.566   -8.977  -4.944  1.00 0.00 ? 9  SER B CA   9  
ATOM 6725  C C    . SER B 2 9  ? 1.744   -8.440  -3.520  1.00 0.00 ? 9  SER B C    9  
ATOM 6726  O O    . SER B 2 9  ? 0.814   -7.951  -2.911  1.00 0.00 ? 9  SER B O    9  
ATOM 6727  C CB   . SER B 2 9  ? 0.989   -10.394 -4.892  1.00 0.00 ? 9  SER B CB   9  
ATOM 6728  O OG   . SER B 2 9  ? -0.412  -10.323 -4.663  1.00 0.00 ? 9  SER B OG   9  
ATOM 6729  H H    . SER B 2 9  ? 3.148   -8.214  -6.190  1.00 0.00 ? 9  SER B H    9  
ATOM 6730  H HA   . SER B 2 9  ? 0.884   -8.334  -5.482  1.00 0.00 ? 9  SER B HA   9  
ATOM 6731  H HB2  . SER B 2 9  ? 1.170   -10.893 -5.830  1.00 0.00 ? 9  SER B HB2  9  
ATOM 6732  H HB3  . SER B 2 9  ? 1.468   -10.947 -4.095  1.00 0.00 ? 9  SER B HB3  9  
ATOM 6733  H HG   . SER B 2 9  ? -0.815  -11.107 -5.043  1.00 0.00 ? 9  SER B HG   9  
ATOM 6734  N N    . HIS B 2 10 ? 2.934   -8.523  -2.984  1.00 0.00 ? 10 HIS B N    9  
ATOM 6735  C CA   . HIS B 2 10 ? 3.172   -8.016  -1.608  1.00 0.00 ? 10 HIS B CA   9  
ATOM 6736  C C    . HIS B 2 10 ? 3.098   -6.488  -1.607  1.00 0.00 ? 10 HIS B C    9  
ATOM 6737  O O    . HIS B 2 10 ? 2.466   -5.888  -0.760  1.00 0.00 ? 10 HIS B O    9  
ATOM 6738  C CB   . HIS B 2 10 ? 4.558   -8.459  -1.134  1.00 0.00 ? 10 HIS B CB   9  
ATOM 6739  C CG   . HIS B 2 10 ? 4.545   -9.938  -0.856  1.00 0.00 ? 10 HIS B CG   9  
ATOM 6740  N ND1  . HIS B 2 10 ? 4.703   -10.450 0.422   1.00 0.00 ? 10 HIS B ND1  9  
ATOM 6741  C CD2  . HIS B 2 10 ? 4.398   -11.026 -1.680  1.00 0.00 ? 10 HIS B CD2  9  
ATOM 6742  C CE1  . HIS B 2 10 ? 4.646   -11.792 0.331   1.00 0.00 ? 10 HIS B CE1  9  
ATOM 6743  N NE2  . HIS B 2 10 ? 4.461   -12.195 -0.928  1.00 0.00 ? 10 HIS B NE2  9  
ATOM 6744  H H    . HIS B 2 10 ? 3.671   -8.916  -3.487  1.00 0.00 ? 10 HIS B H    9  
ATOM 6745  H HA   . HIS B 2 10 ? 2.421   -8.415  -0.947  1.00 0.00 ? 10 HIS B HA   9  
ATOM 6746  H HB2  . HIS B 2 10 ? 5.286   -8.244  -1.902  1.00 0.00 ? 10 HIS B HB2  9  
ATOM 6747  H HB3  . HIS B 2 10 ? 4.817   -7.926  -0.232  1.00 0.00 ? 10 HIS B HB3  9  
ATOM 6748  H HD1  . HIS B 2 10 ? 4.831   -9.930  1.243   1.00 0.00 ? 10 HIS B HD1  9  
ATOM 6749  H HD2  . HIS B 2 10 ? 4.254   -10.981 -2.750  1.00 0.00 ? 10 HIS B HD2  9  
ATOM 6750  H HE1  . HIS B 2 10 ? 4.739   -12.460 1.174   1.00 0.00 ? 10 HIS B HE1  9  
ATOM 6751  N N    . LEU B 2 11 ? 3.741   -5.851  -2.549  1.00 0.00 ? 11 LEU B N    9  
ATOM 6752  C CA   . LEU B 2 11 ? 3.705   -4.362  -2.596  1.00 0.00 ? 11 LEU B CA   9  
ATOM 6753  C C    . LEU B 2 11 ? 2.259   -3.896  -2.753  1.00 0.00 ? 11 LEU B C    9  
ATOM 6754  O O    . LEU B 2 11 ? 1.809   -3.002  -2.065  1.00 0.00 ? 11 LEU B O    9  
ATOM 6755  C CB   . LEU B 2 11 ? 4.536   -3.862  -3.781  1.00 0.00 ? 11 LEU B CB   9  
ATOM 6756  C CG   . LEU B 2 11 ? 5.049   -2.450  -3.487  1.00 0.00 ? 11 LEU B CG   9  
ATOM 6757  C CD1  . LEU B 2 11 ? 6.145   -2.082  -4.489  1.00 0.00 ? 11 LEU B CD1  9  
ATOM 6758  C CD2  . LEU B 2 11 ? 3.895   -1.450  -3.609  1.00 0.00 ? 11 LEU B CD2  9  
ATOM 6759  H H    . LEU B 2 11 ? 4.247   -6.351  -3.223  1.00 0.00 ? 11 LEU B H    9  
ATOM 6760  H HA   . LEU B 2 11 ? 4.112   -3.964  -1.679  1.00 0.00 ? 11 LEU B HA   9  
ATOM 6761  H HB2  . LEU B 2 11 ? 5.375   -4.524  -3.935  1.00 0.00 ? 11 LEU B HB2  9  
ATOM 6762  H HB3  . LEU B 2 11 ? 3.923   -3.843  -4.669  1.00 0.00 ? 11 LEU B HB3  9  
ATOM 6763  H HG   . LEU B 2 11 ? 5.452   -2.415  -2.485  1.00 0.00 ? 11 LEU B HG   9  
ATOM 6764  H HD11 . LEU B 2 11 ? 7.055   -2.607  -4.236  1.00 0.00 ? 11 LEU B HD11 9  
ATOM 6765  H HD12 . LEU B 2 11 ? 6.322   -1.017  -4.454  1.00 0.00 ? 11 LEU B HD12 9  
ATOM 6766  H HD13 . LEU B 2 11 ? 5.832   -2.363  -5.484  1.00 0.00 ? 11 LEU B HD13 9  
ATOM 6767  H HD21 . LEU B 2 11 ? 4.119   -0.737  -4.388  1.00 0.00 ? 11 LEU B HD21 9  
ATOM 6768  H HD22 . LEU B 2 11 ? 3.768   -0.930  -2.671  1.00 0.00 ? 11 LEU B HD22 9  
ATOM 6769  H HD23 . LEU B 2 11 ? 2.986   -1.977  -3.855  1.00 0.00 ? 11 LEU B HD23 9  
ATOM 6770  N N    . VAL B 2 12 ? 1.521   -4.496  -3.647  1.00 0.00 ? 12 VAL B N    9  
ATOM 6771  C CA   . VAL B 2 12 ? 0.104   -4.080  -3.827  1.00 0.00 ? 12 VAL B CA   9  
ATOM 6772  C C    . VAL B 2 12 ? -0.670  -4.422  -2.558  1.00 0.00 ? 12 VAL B C    9  
ATOM 6773  O O    . VAL B 2 12 ? -1.366  -3.597  -2.001  1.00 0.00 ? 12 VAL B O    9  
ATOM 6774  C CB   . VAL B 2 12 ? -0.506  -4.810  -5.027  1.00 0.00 ? 12 VAL B CB   9  
ATOM 6775  C CG1  . VAL B 2 12 ? -0.393  -6.321  -4.823  1.00 0.00 ? 12 VAL B CG1  9  
ATOM 6776  C CG2  . VAL B 2 12 ? -1.981  -4.423  -5.164  1.00 0.00 ? 12 VAL B CG2  9  
ATOM 6777  H H    . VAL B 2 12 ? 1.895   -5.220  -4.191  1.00 0.00 ? 12 VAL B H    9  
ATOM 6778  H HA   . VAL B 2 12 ? 0.064   -3.016  -3.989  1.00 0.00 ? 12 VAL B HA   9  
ATOM 6779  H HB   . VAL B 2 12 ? 0.026   -4.529  -5.925  1.00 0.00 ? 12 VAL B HB   9  
ATOM 6780  H HG11 . VAL B 2 12 ? 0.621   -6.573  -4.549  1.00 0.00 ? 12 VAL B HG11 9  
ATOM 6781  H HG12 . VAL B 2 12 ? -0.655  -6.829  -5.740  1.00 0.00 ? 12 VAL B HG12 9  
ATOM 6782  H HG13 . VAL B 2 12 ? -1.065  -6.629  -4.036  1.00 0.00 ? 12 VAL B HG13 9  
ATOM 6783  H HG21 . VAL B 2 12 ? -2.593  -5.311  -5.098  1.00 0.00 ? 12 VAL B HG21 9  
ATOM 6784  H HG22 . VAL B 2 12 ? -2.141  -3.946  -6.119  1.00 0.00 ? 12 VAL B HG22 9  
ATOM 6785  H HG23 . VAL B 2 12 ? -2.249  -3.741  -4.371  1.00 0.00 ? 12 VAL B HG23 9  
ATOM 6786  N N    . GLU B 2 13 ? -0.531  -5.624  -2.080  1.00 0.00 ? 13 GLU B N    9  
ATOM 6787  C CA   . GLU B 2 13 ? -1.233  -6.005  -0.829  1.00 0.00 ? 13 GLU B CA   9  
ATOM 6788  C C    . GLU B 2 13 ? -0.815  -5.026  0.266   1.00 0.00 ? 13 GLU B C    9  
ATOM 6789  O O    . GLU B 2 13 ? -1.553  -4.750  1.191   1.00 0.00 ? 13 GLU B O    9  
ATOM 6790  C CB   . GLU B 2 13 ? -0.835  -7.428  -0.429  1.00 0.00 ? 13 GLU B CB   9  
ATOM 6791  C CG   . GLU B 2 13 ? -1.628  -7.856  0.808   1.00 0.00 ? 13 GLU B CG   9  
ATOM 6792  C CD   . GLU B 2 13 ? -1.666  -9.383  0.886   1.00 0.00 ? 13 GLU B CD   9  
ATOM 6793  O OE1  . GLU B 2 13 ? -0.641  -9.995  0.633   1.00 0.00 ? 13 GLU B OE1  9  
ATOM 6794  O OE2  . GLU B 2 13 ? -2.719  -9.915  1.197   1.00 0.00 ? 13 GLU B OE2  9  
ATOM 6795  H H    . GLU B 2 13 ? 0.052   -6.269  -2.531  1.00 0.00 ? 13 GLU B H    9  
ATOM 6796  H HA   . GLU B 2 13 ? -2.302  -5.952  -0.978  1.00 0.00 ? 13 GLU B HA   9  
ATOM 6797  H HB2  . GLU B 2 13 ? -1.047  -8.104  -1.245  1.00 0.00 ? 13 GLU B HB2  9  
ATOM 6798  H HB3  . GLU B 2 13 ? 0.221   -7.456  -0.204  1.00 0.00 ? 13 GLU B HB3  9  
ATOM 6799  H HG2  . GLU B 2 13 ? -1.153  -7.461  1.694   1.00 0.00 ? 13 GLU B HG2  9  
ATOM 6800  H HG3  . GLU B 2 13 ? -2.636  -7.476  0.739   1.00 0.00 ? 13 GLU B HG3  9  
ATOM 6801  N N    . ALA B 2 14 ? 0.377   -4.500  0.160   1.00 0.00 ? 14 ALA B N    9  
ATOM 6802  C CA   . ALA B 2 14 ? 0.869   -3.538  1.182   1.00 0.00 ? 14 ALA B CA   9  
ATOM 6803  C C    . ALA B 2 14 ? 0.071   -2.239  1.091   1.00 0.00 ? 14 ALA B C    9  
ATOM 6804  O O    . ALA B 2 14 ? -0.296  -1.653  2.088   1.00 0.00 ? 14 ALA B O    9  
ATOM 6805  C CB   . ALA B 2 14 ? 2.351   -3.247  0.936   1.00 0.00 ? 14 ALA B CB   9  
ATOM 6806  H H    . ALA B 2 14 ? 0.949   -4.739  -0.598  1.00 0.00 ? 14 ALA B H    9  
ATOM 6807  H HA   . ALA B 2 14 ? 0.746   -3.967  2.160   1.00 0.00 ? 14 ALA B HA   9  
ATOM 6808  H HB1  . ALA B 2 14 ? 2.953   -3.932  1.514   1.00 0.00 ? 14 ALA B HB1  9  
ATOM 6809  H HB2  . ALA B 2 14 ? 2.573   -2.233  1.234   1.00 0.00 ? 14 ALA B HB2  9  
ATOM 6810  H HB3  . ALA B 2 14 ? 2.573   -3.370  -0.114  1.00 0.00 ? 14 ALA B HB3  9  
ATOM 6811  N N    . LEU B 2 15 ? -0.203  -1.784  -0.098  1.00 0.00 ? 15 LEU B N    9  
ATOM 6812  C CA   . LEU B 2 15 ? -0.978  -0.521  -0.252  1.00 0.00 ? 15 LEU B CA   9  
ATOM 6813  C C    . LEU B 2 15 ? -2.322  -0.672  0.453   1.00 0.00 ? 15 LEU B C    9  
ATOM 6814  O O    . LEU B 2 15 ? -2.832  0.257   1.047   1.00 0.00 ? 15 LEU B O    9  
ATOM 6815  C CB   . LEU B 2 15 ? -1.203  -0.236  -1.739  1.00 0.00 ? 15 LEU B CB   9  
ATOM 6816  C CG   . LEU B 2 15 ? -1.523  1.246   -1.937  1.00 0.00 ? 15 LEU B CG   9  
ATOM 6817  C CD1  . LEU B 2 15 ? -2.866  1.571   -1.280  1.00 0.00 ? 15 LEU B CD1  9  
ATOM 6818  C CD2  . LEU B 2 15 ? -0.422  2.094   -1.296  1.00 0.00 ? 15 LEU B CD2  9  
ATOM 6819  H H    . LEU B 2 15 ? 0.101   -2.274  -0.890  1.00 0.00 ? 15 LEU B H    9  
ATOM 6820  H HA   . LEU B 2 15 ? -0.430  0.294   0.198   1.00 0.00 ? 15 LEU B HA   9  
ATOM 6821  H HB2  . LEU B 2 15 ? -0.310  -0.489  -2.293  1.00 0.00 ? 15 LEU B HB2  9  
ATOM 6822  H HB3  . LEU B 2 15 ? -2.029  -0.832  -2.098  1.00 0.00 ? 15 LEU B HB3  9  
ATOM 6823  H HG   . LEU B 2 15 ? -1.578  1.463   -2.994  1.00 0.00 ? 15 LEU B HG   9  
ATOM 6824  H HD11 . LEU B 2 15 ? -3.479  0.682   -1.255  1.00 0.00 ? 15 LEU B HD11 9  
ATOM 6825  H HD12 . LEU B 2 15 ? -3.368  2.339   -1.850  1.00 0.00 ? 15 LEU B HD12 9  
ATOM 6826  H HD13 . LEU B 2 15 ? -2.699  1.921   -0.273  1.00 0.00 ? 15 LEU B HD13 9  
ATOM 6827  H HD21 . LEU B 2 15 ? -0.198  2.935   -1.935  1.00 0.00 ? 15 LEU B HD21 9  
ATOM 6828  H HD22 . LEU B 2 15 ? 0.466   1.493   -1.168  1.00 0.00 ? 15 LEU B HD22 9  
ATOM 6829  H HD23 . LEU B 2 15 ? -0.757  2.452   -0.334  1.00 0.00 ? 15 LEU B HD23 9  
ATOM 6830  N N    . TYR B 2 16 ? -2.894  -1.837  0.408   1.00 0.00 ? 16 TYR B N    9  
ATOM 6831  C CA   . TYR B 2 16 ? -4.193  -2.041  1.096   1.00 0.00 ? 16 TYR B CA   9  
ATOM 6832  C C    . TYR B 2 16 ? -3.961  -1.955  2.603   1.00 0.00 ? 16 TYR B C    9  
ATOM 6833  O O    . TYR B 2 16 ? -4.634  -1.232  3.310   1.00 0.00 ? 16 TYR B O    9  
ATOM 6834  C CB   . TYR B 2 16 ? -4.746  -3.423  0.736   1.00 0.00 ? 16 TYR B CB   9  
ATOM 6835  C CG   . TYR B 2 16 ? -6.135  -3.584  1.308   1.00 0.00 ? 16 TYR B CG   9  
ATOM 6836  C CD1  . TYR B 2 16 ? -6.304  -3.857  2.671   1.00 0.00 ? 16 TYR B CD1  9  
ATOM 6837  C CD2  . TYR B 2 16 ? -7.253  -3.467  0.474   1.00 0.00 ? 16 TYR B CD2  9  
ATOM 6838  C CE1  . TYR B 2 16 ? -7.591  -4.014  3.199   1.00 0.00 ? 16 TYR B CE1  9  
ATOM 6839  C CE2  . TYR B 2 16 ? -8.540  -3.622  1.003   1.00 0.00 ? 16 TYR B CE2  9  
ATOM 6840  C CZ   . TYR B 2 16 ? -8.709  -3.896  2.365   1.00 0.00 ? 16 TYR B CZ   9  
ATOM 6841  O OH   . TYR B 2 16 ? -9.978  -4.050  2.885   1.00 0.00 ? 16 TYR B OH   9  
ATOM 6842  H H    . TYR B 2 16 ? -2.464  -2.579  -0.066  1.00 0.00 ? 16 TYR B H    9  
ATOM 6843  H HA   . TYR B 2 16 ? -4.890  -1.280  0.793   1.00 0.00 ? 16 TYR B HA   9  
ATOM 6844  H HB2  . TYR B 2 16 ? -4.787  -3.524  -0.338  1.00 0.00 ? 16 TYR B HB2  9  
ATOM 6845  H HB3  . TYR B 2 16 ? -4.100  -4.185  1.145   1.00 0.00 ? 16 TYR B HB3  9  
ATOM 6846  H HD1  . TYR B 2 16 ? -5.442  -3.948  3.315   1.00 0.00 ? 16 TYR B HD1  9  
ATOM 6847  H HD2  . TYR B 2 16 ? -7.123  -3.255  -0.577  1.00 0.00 ? 16 TYR B HD2  9  
ATOM 6848  H HE1  . TYR B 2 16 ? -7.722  -4.224  4.250   1.00 0.00 ? 16 TYR B HE1  9  
ATOM 6849  H HE2  . TYR B 2 16 ? -9.403  -3.531  0.359   1.00 0.00 ? 16 TYR B HE2  9  
ATOM 6850  H HH   . TYR B 2 16 ? -10.333 -4.881  2.560   1.00 0.00 ? 16 TYR B HH   9  
ATOM 6851  N N    . LEU B 2 17 ? -3.006  -2.692  3.093   1.00 0.00 ? 17 LEU B N    9  
ATOM 6852  C CA   . LEU B 2 17 ? -2.711  -2.669  4.553   1.00 0.00 ? 17 LEU B CA   9  
ATOM 6853  C C    . LEU B 2 17 ? -2.075  -1.339  4.966   1.00 0.00 ? 17 LEU B C    9  
ATOM 6854  O O    . LEU B 2 17 ? -2.400  -0.787  5.998   1.00 0.00 ? 17 LEU B O    9  
ATOM 6855  C CB   . LEU B 2 17 ? -1.768  -3.821  4.905   1.00 0.00 ? 17 LEU B CB   9  
ATOM 6856  C CG   . LEU B 2 17 ? -2.089  -4.331  6.311   1.00 0.00 ? 17 LEU B CG   9  
ATOM 6857  C CD1  . LEU B 2 17 ? -3.371  -5.165  6.271   1.00 0.00 ? 17 LEU B CD1  9  
ATOM 6858  C CD2  . LEU B 2 17 ? -0.933  -5.199  6.814   1.00 0.00 ? 17 LEU B CD2  9  
ATOM 6859  H H    . LEU B 2 17 ? -2.481  -3.264  2.498   1.00 0.00 ? 17 LEU B H    9  
ATOM 6860  H HA   . LEU B 2 17 ? -3.634  -2.789  5.090   1.00 0.00 ? 17 LEU B HA   9  
ATOM 6861  H HB2  . LEU B 2 17 ? -1.896  -4.622  4.191   1.00 0.00 ? 17 LEU B HB2  9  
ATOM 6862  H HB3  . LEU B 2 17 ? -0.747  -3.472  4.875   1.00 0.00 ? 17 LEU B HB3  9  
ATOM 6863  H HG   . LEU B 2 17 ? -2.227  -3.490  6.975   1.00 0.00 ? 17 LEU B HG   9  
ATOM 6864  H HD11 . LEU B 2 17 ? -3.611  -5.408  5.247   1.00 0.00 ? 17 LEU B HD11 9  
ATOM 6865  H HD12 . LEU B 2 17 ? -4.181  -4.600  6.707   1.00 0.00 ? 17 LEU B HD12 9  
ATOM 6866  H HD13 . LEU B 2 17 ? -3.225  -6.076  6.832   1.00 0.00 ? 17 LEU B HD13 9  
ATOM 6867  H HD21 . LEU B 2 17 ? -1.029  -5.342  7.880   1.00 0.00 ? 17 LEU B HD21 9  
ATOM 6868  H HD22 . LEU B 2 17 ? 0.005   -4.708  6.600   1.00 0.00 ? 17 LEU B HD22 9  
ATOM 6869  H HD23 . LEU B 2 17 ? -0.960  -6.157  6.318   1.00 0.00 ? 17 LEU B HD23 9  
ATOM 6870  N N    . VAL B 2 18 ? -1.163  -0.823  4.189   1.00 0.00 ? 18 VAL B N    9  
ATOM 6871  C CA   . VAL B 2 18 ? -0.515  0.463   4.579   1.00 0.00 ? 18 VAL B CA   9  
ATOM 6872  C C    . VAL B 2 18 ? -1.599  1.512   4.780   1.00 0.00 ? 18 VAL B C    9  
ATOM 6873  O O    . VAL B 2 18 ? -1.611  2.232   5.758   1.00 0.00 ? 18 VAL B O    9  
ATOM 6874  C CB   . VAL B 2 18 ? 0.447   0.939   3.484   1.00 0.00 ? 18 VAL B CB   9  
ATOM 6875  C CG1  . VAL B 2 18 ? 1.472   -0.150  3.166   1.00 0.00 ? 18 VAL B CG1  9  
ATOM 6876  C CG2  . VAL B 2 18 ? -0.346  1.278   2.230   1.00 0.00 ? 18 VAL B CG2  9  
ATOM 6877  H H    . VAL B 2 18 ? -0.900  -1.282  3.365   1.00 0.00 ? 18 VAL B H    9  
ATOM 6878  H HA   . VAL B 2 18 ? 0.022   0.327   5.500   1.00 0.00 ? 18 VAL B HA   9  
ATOM 6879  H HB   . VAL B 2 18 ? 0.963   1.818   3.819   1.00 0.00 ? 18 VAL B HB   9  
ATOM 6880  H HG11 . VAL B 2 18 ? 1.251   -1.034  3.744   1.00 0.00 ? 18 VAL B HG11 9  
ATOM 6881  H HG12 . VAL B 2 18 ? 2.462   0.205   3.415   1.00 0.00 ? 18 VAL B HG12 9  
ATOM 6882  H HG13 . VAL B 2 18 ? 1.430   -0.387  2.113   1.00 0.00 ? 18 VAL B HG13 9  
ATOM 6883  H HG21 . VAL B 2 18 ? -0.957  2.150   2.415   1.00 0.00 ? 18 VAL B HG21 9  
ATOM 6884  H HG22 . VAL B 2 18 ? -0.977  0.445   1.973   1.00 0.00 ? 18 VAL B HG22 9  
ATOM 6885  H HG23 . VAL B 2 18 ? 0.335   1.482   1.417   1.00 0.00 ? 18 VAL B HG23 9  
ATOM 6886  N N    . CYS B 2 19 ? -2.516  1.597   3.865   1.00 0.00 ? 19 CYS B N    9  
ATOM 6887  C CA   . CYS B 2 19 ? -3.609  2.592   4.004   1.00 0.00 ? 19 CYS B CA   9  
ATOM 6888  C C    . CYS B 2 19 ? -4.532  2.478   2.798   1.00 0.00 ? 19 CYS B C    9  
ATOM 6889  O O    . CYS B 2 19 ? -5.093  3.449   2.338   1.00 0.00 ? 19 CYS B O    9  
ATOM 6890  C CB   . CYS B 2 19 ? -3.017  4.001   4.067   1.00 0.00 ? 19 CYS B CB   9  
ATOM 6891  S SG   . CYS B 2 19 ? -4.052  5.042   5.125   1.00 0.00 ? 19 CYS B SG   9  
ATOM 6892  H H    . CYS B 2 19 ? -2.488  1.000   3.082   1.00 0.00 ? 19 CYS B H    9  
ATOM 6893  H HA   . CYS B 2 19 ? -4.167  2.393   4.907   1.00 0.00 ? 19 CYS B HA   9  
ATOM 6894  H HB2  . CYS B 2 19 ? -2.018  3.954   4.474   1.00 0.00 ? 19 CYS B HB2  9  
ATOM 6895  H HB3  . CYS B 2 19 ? -2.981  4.421   3.072   1.00 0.00 ? 19 CYS B HB3  9  
ATOM 6896  N N    . GLY B 2 20 ? -4.692  1.296   2.277   1.00 0.00 ? 20 GLY B N    9  
ATOM 6897  C CA   . GLY B 2 20 ? -5.582  1.138   1.092   1.00 0.00 ? 20 GLY B CA   9  
ATOM 6898  C C    . GLY B 2 20 ? -6.932  0.571   1.534   1.00 0.00 ? 20 GLY B C    9  
ATOM 6899  O O    . GLY B 2 20 ? -7.945  0.789   0.900   1.00 0.00 ? 20 GLY B O    9  
ATOM 6900  H H    . GLY B 2 20 ? -4.227  0.514   2.664   1.00 0.00 ? 20 GLY B H    9  
ATOM 6901  H HA2  . GLY B 2 20 ? -5.732  2.103   0.628   1.00 0.00 ? 20 GLY B HA2  9  
ATOM 6902  H HA3  . GLY B 2 20 ? -5.126  0.468   0.381   1.00 0.00 ? 20 GLY B HA3  9  
ATOM 6903  N N    . GLU B 2 21 ? -6.958  -0.152  2.619   1.00 0.00 ? 21 GLU B N    9  
ATOM 6904  C CA   . GLU B 2 21 ? -8.247  -0.728  3.096   1.00 0.00 ? 21 GLU B CA   9  
ATOM 6905  C C    . GLU B 2 21 ? -9.344  0.337   3.015   1.00 0.00 ? 21 GLU B C    9  
ATOM 6906  O O    . GLU B 2 21 ? -10.410 0.103   2.481   1.00 0.00 ? 21 GLU B O    9  
ATOM 6907  C CB   . GLU B 2 21 ? -8.094  -1.193  4.546   1.00 0.00 ? 21 GLU B CB   9  
ATOM 6908  C CG   . GLU B 2 21 ? -9.471  -1.531  5.121   1.00 0.00 ? 21 GLU B CG   9  
ATOM 6909  C CD   . GLU B 2 21 ? -9.311  -2.478  6.311   1.00 0.00 ? 21 GLU B CD   9  
ATOM 6910  O OE1  . GLU B 2 21 ? -8.185  -2.676  6.738   1.00 0.00 ? 21 GLU B OE1  9  
ATOM 6911  O OE2  . GLU B 2 21 ? -10.316 -2.990  6.776   1.00 0.00 ? 21 GLU B OE2  9  
ATOM 6912  H H    . GLU B 2 21 ? -6.132  -0.316  3.120   1.00 0.00 ? 21 GLU B H    9  
ATOM 6913  H HA   . GLU B 2 21 ? -8.516  -1.568  2.475   1.00 0.00 ? 21 GLU B HA   9  
ATOM 6914  H HB2  . GLU B 2 21 ? -7.465  -2.071  4.577   1.00 0.00 ? 21 GLU B HB2  9  
ATOM 6915  H HB3  . GLU B 2 21 ? -7.644  -0.406  5.132   1.00 0.00 ? 21 GLU B HB3  9  
ATOM 6916  H HG2  . GLU B 2 21 ? -9.957  -0.622  5.446   1.00 0.00 ? 21 GLU B HG2  9  
ATOM 6917  H HG3  . GLU B 2 21 ? -10.072 -2.008  4.362   1.00 0.00 ? 21 GLU B HG3  9  
ATOM 6918  N N    . ARG B 2 22 ? -9.094  1.504   3.543   1.00 0.00 ? 22 ARG B N    9  
ATOM 6919  C CA   . ARG B 2 22 ? -10.121 2.577   3.501   1.00 0.00 ? 22 ARG B CA   9  
ATOM 6920  C C    . ARG B 2 22 ? -10.060 3.301   2.155   1.00 0.00 ? 22 ARG B C    9  
ATOM 6921  O O    . ARG B 2 22 ? -11.062 3.743   1.631   1.00 0.00 ? 22 ARG B O    9  
ATOM 6922  C CB   . ARG B 2 22 ? -9.862  3.578   4.628   1.00 0.00 ? 22 ARG B CB   9  
ATOM 6923  C CG   . ARG B 2 22 ? -11.133 4.385   4.895   1.00 0.00 ? 22 ARG B CG   9  
ATOM 6924  C CD   . ARG B 2 22 ? -11.809 3.866   6.165   1.00 0.00 ? 22 ARG B CD   9  
ATOM 6925  N NE   . ARG B 2 22 ? -11.953 2.386   6.081   1.00 0.00 ? 22 ARG B NE   9  
ATOM 6926  C CZ   . ARG B 2 22 ? -12.995 1.800   6.604   1.00 0.00 ? 22 ARG B CZ   9  
ATOM 6927  N NH1  . ARG B 2 22 ? -14.175 2.346   6.493   1.00 0.00 ? 22 ARG B NH1  9  
ATOM 6928  N NH2  . ARG B 2 22 ? -12.857 0.669   7.239   1.00 0.00 ? 22 ARG B NH2  9  
ATOM 6929  H H    . ARG B 2 22 ? -8.234  1.672   3.972   1.00 0.00 ? 22 ARG B H    9  
ATOM 6930  H HA   . ARG B 2 22 ? -11.093 2.138   3.629   1.00 0.00 ? 22 ARG B HA   9  
ATOM 6931  H HB2  . ARG B 2 22 ? -9.577  3.045   5.524   1.00 0.00 ? 22 ARG B HB2  9  
ATOM 6932  H HB3  . ARG B 2 22 ? -9.066  4.248   4.339   1.00 0.00 ? 22 ARG B HB3  9  
ATOM 6933  H HG2  . ARG B 2 22 ? -10.878 5.428   5.022   1.00 0.00 ? 22 ARG B HG2  9  
ATOM 6934  H HG3  . ARG B 2 22 ? -11.809 4.279   4.060   1.00 0.00 ? 22 ARG B HG3  9  
ATOM 6935  H HD2  . ARG B 2 22 ? -11.206 4.121   7.024   1.00 0.00 ? 22 ARG B HD2  9  
ATOM 6936  H HD3  . ARG B 2 22 ? -12.785 4.318   6.263   1.00 0.00 ? 22 ARG B HD3  9  
ATOM 6937  H HE   . ARG B 2 22 ? -11.264 1.851   5.632   1.00 0.00 ? 22 ARG B HE   9  
ATOM 6938  H HH11 . ARG B 2 22 ? -14.280 3.214   6.007   1.00 0.00 ? 22 ARG B HH11 9  
ATOM 6939  H HH12 . ARG B 2 22 ? -14.973 1.898   6.895   1.00 0.00 ? 22 ARG B HH12 9  
ATOM 6940  H HH21 . ARG B 2 22 ? -11.952 0.250   7.325   1.00 0.00 ? 22 ARG B HH21 9  
ATOM 6941  H HH22 . ARG B 2 22 ? -13.655 0.220   7.641   1.00 0.00 ? 22 ARG B HH22 9  
ATOM 6942  N N    . GLY B 2 23 ? -8.890  3.429   1.593   1.00 0.00 ? 23 GLY B N    9  
ATOM 6943  C CA   . GLY B 2 23 ? -8.765  4.129   0.283   1.00 0.00 ? 23 GLY B CA   9  
ATOM 6944  C C    . GLY B 2 23 ? -9.102  3.163   -0.854  1.00 0.00 ? 23 GLY B C    9  
ATOM 6945  O O    . GLY B 2 23 ? -8.982  3.495   -2.017  1.00 0.00 ? 23 GLY B O    9  
ATOM 6946  H H    . GLY B 2 23 ? -8.094  3.067   2.034   1.00 0.00 ? 23 GLY B H    9  
ATOM 6947  H HA2  . GLY B 2 23 ? -9.445  4.968   0.258   1.00 0.00 ? 23 GLY B HA2  9  
ATOM 6948  H HA3  . GLY B 2 23 ? -7.752  4.483   0.160   1.00 0.00 ? 23 GLY B HA3  9  
ATOM 6949  N N    . PHE B 2 24 ? -9.519  1.970   -0.532  1.00 0.00 ? 24 PHE B N    9  
ATOM 6950  C CA   . PHE B 2 24 ? -9.858  0.988   -1.601  1.00 0.00 ? 24 PHE B CA   9  
ATOM 6951  C C    . PHE B 2 24 ? -11.174 0.280   -1.263  1.00 0.00 ? 24 PHE B C    9  
ATOM 6952  O O    . PHE B 2 24 ? -11.943 -0.067  -2.137  1.00 0.00 ? 24 PHE B O    9  
ATOM 6953  C CB   . PHE B 2 24 ? -8.738  -0.048  -1.713  1.00 0.00 ? 24 PHE B CB   9  
ATOM 6954  C CG   . PHE B 2 24 ? -7.522  0.587   -2.346  1.00 0.00 ? 24 PHE B CG   9  
ATOM 6955  C CD1  . PHE B 2 24 ? -6.813  1.585   -1.663  1.00 0.00 ? 24 PHE B CD1  9  
ATOM 6956  C CD2  . PHE B 2 24 ? -7.102  0.176   -3.616  1.00 0.00 ? 24 PHE B CD2  9  
ATOM 6957  C CE1  . PHE B 2 24 ? -5.686  2.168   -2.252  1.00 0.00 ? 24 PHE B CE1  9  
ATOM 6958  C CE2  . PHE B 2 24 ? -5.974  0.759   -4.204  1.00 0.00 ? 24 PHE B CE2  9  
ATOM 6959  C CZ   . PHE B 2 24 ? -5.266  1.755   -3.522  1.00 0.00 ? 24 PHE B CZ   9  
ATOM 6960  H H    . PHE B 2 24 ? -9.607  1.719   0.411   1.00 0.00 ? 24 PHE B H    9  
ATOM 6961  H HA   . PHE B 2 24 ? -9.962  1.505   -2.543  1.00 0.00 ? 24 PHE B HA   9  
ATOM 6962  H HB2  . PHE B 2 24 ? -8.484  -0.412  -0.728  1.00 0.00 ? 24 PHE B HB2  9  
ATOM 6963  H HB3  . PHE B 2 24 ? -9.071  -0.873  -2.326  1.00 0.00 ? 24 PHE B HB3  9  
ATOM 6964  H HD1  . PHE B 2 24 ? -7.136  1.905   -0.683  1.00 0.00 ? 24 PHE B HD1  9  
ATOM 6965  H HD2  . PHE B 2 24 ? -7.649  -0.592  -4.142  1.00 0.00 ? 24 PHE B HD2  9  
ATOM 6966  H HE1  . PHE B 2 24 ? -5.139  2.937   -1.727  1.00 0.00 ? 24 PHE B HE1  9  
ATOM 6967  H HE2  . PHE B 2 24 ? -5.651  0.441   -5.184  1.00 0.00 ? 24 PHE B HE2  9  
ATOM 6968  H HZ   . PHE B 2 24 ? -4.396  2.204   -3.977  1.00 0.00 ? 24 PHE B HZ   9  
ATOM 6969  N N    . PHE B 2 25 ? -11.441 0.059   -0.003  1.00 0.00 ? 25 PHE B N    9  
ATOM 6970  C CA   . PHE B 2 25 ? -12.706 -0.629  0.380   1.00 0.00 ? 25 PHE B CA   9  
ATOM 6971  C C    . PHE B 2 25 ? -13.876 0.351   0.270   1.00 0.00 ? 25 PHE B C    9  
ATOM 6972  O O    . PHE B 2 25 ? -13.816 1.462   0.758   1.00 0.00 ? 25 PHE B O    9  
ATOM 6973  C CB   . PHE B 2 25 ? -12.596 -1.133  1.821   1.00 0.00 ? 25 PHE B CB   9  
ATOM 6974  C CG   . PHE B 2 25 ? -13.771 -2.026  2.135   1.00 0.00 ? 25 PHE B CG   9  
ATOM 6975  C CD1  . PHE B 2 25 ? -13.740 -3.378  1.772   1.00 0.00 ? 25 PHE B CD1  9  
ATOM 6976  C CD2  . PHE B 2 25 ? -14.892 -1.503  2.792   1.00 0.00 ? 25 PHE B CD2  9  
ATOM 6977  C CE1  . PHE B 2 25 ? -14.830 -4.207  2.065   1.00 0.00 ? 25 PHE B CE1  9  
ATOM 6978  C CE2  . PHE B 2 25 ? -15.981 -2.332  3.085   1.00 0.00 ? 25 PHE B CE2  9  
ATOM 6979  C CZ   . PHE B 2 25 ? -15.951 -3.684  2.722   1.00 0.00 ? 25 PHE B CZ   9  
ATOM 6980  H H    . PHE B 2 25 ? -10.809 0.342   0.689   1.00 0.00 ? 25 PHE B H    9  
ATOM 6981  H HA   . PHE B 2 25 ? -12.875 -1.466  -0.282  1.00 0.00 ? 25 PHE B HA   9  
ATOM 6982  H HB2  . PHE B 2 25 ? -11.678 -1.690  1.937   1.00 0.00 ? 25 PHE B HB2  9  
ATOM 6983  H HB3  . PHE B 2 25 ? -12.594 -0.291  2.497   1.00 0.00 ? 25 PHE B HB3  9  
ATOM 6984  H HD1  . PHE B 2 25 ? -12.876 -3.782  1.266   1.00 0.00 ? 25 PHE B HD1  9  
ATOM 6985  H HD2  . PHE B 2 25 ? -14.915 -0.461  3.072   1.00 0.00 ? 25 PHE B HD2  9  
ATOM 6986  H HE1  . PHE B 2 25 ? -14.807 -5.250  1.785   1.00 0.00 ? 25 PHE B HE1  9  
ATOM 6987  H HE2  . PHE B 2 25 ? -16.846 -1.929  3.591   1.00 0.00 ? 25 PHE B HE2  9  
ATOM 6988  H HZ   . PHE B 2 25 ? -16.791 -4.323  2.948   1.00 0.00 ? 25 PHE B HZ   9  
ATOM 6989  N N    . TYR B 2 26 ? -14.941 -0.051  -0.369  1.00 0.00 ? 26 TYR B N    9  
ATOM 6990  C CA   . TYR B 2 26 ? -16.115 0.856   -0.513  1.00 0.00 ? 26 TYR B CA   9  
ATOM 6991  C C    . TYR B 2 26 ? -17.223 0.417   0.449   1.00 0.00 ? 26 TYR B C    9  
ATOM 6992  O O    . TYR B 2 26 ? -17.353 -0.753  0.750   1.00 0.00 ? 26 TYR B O    9  
ATOM 6993  C CB   . TYR B 2 26 ? -16.634 0.793   -1.951  1.00 0.00 ? 26 TYR B CB   9  
ATOM 6994  C CG   . TYR B 2 26 ? -16.010 1.903   -2.762  1.00 0.00 ? 26 TYR B CG   9  
ATOM 6995  C CD1  . TYR B 2 26 ? -14.634 2.148   -2.671  1.00 0.00 ? 26 TYR B CD1  9  
ATOM 6996  C CD2  . TYR B 2 26 ? -16.807 2.688   -3.604  1.00 0.00 ? 26 TYR B CD2  9  
ATOM 6997  C CE1  . TYR B 2 26 ? -14.055 3.177   -3.424  1.00 0.00 ? 26 TYR B CE1  9  
ATOM 6998  C CE2  . TYR B 2 26 ? -16.228 3.718   -4.356  1.00 0.00 ? 26 TYR B CE2  9  
ATOM 6999  C CZ   . TYR B 2 26 ? -14.852 3.962   -4.266  1.00 0.00 ? 26 TYR B CZ   9  
ATOM 7000  O OH   . TYR B 2 26 ? -14.282 4.977   -5.007  1.00 0.00 ? 26 TYR B OH   9  
ATOM 7001  H H    . TYR B 2 26 ? -14.968 -0.952  -0.756  1.00 0.00 ? 26 TYR B H    9  
ATOM 7002  H HA   . TYR B 2 26 ? -15.817 1.868   -0.281  1.00 0.00 ? 26 TYR B HA   9  
ATOM 7003  H HB2  . TYR B 2 26 ? -16.374 -0.160  -2.386  1.00 0.00 ? 26 TYR B HB2  9  
ATOM 7004  H HB3  . TYR B 2 26 ? -17.708 0.909   -1.951  1.00 0.00 ? 26 TYR B HB3  9  
ATOM 7005  H HD1  . TYR B 2 26 ? -14.019 1.542   -2.022  1.00 0.00 ? 26 TYR B HD1  9  
ATOM 7006  H HD2  . TYR B 2 26 ? -17.868 2.499   -3.673  1.00 0.00 ? 26 TYR B HD2  9  
ATOM 7007  H HE1  . TYR B 2 26 ? -12.994 3.366   -3.354  1.00 0.00 ? 26 TYR B HE1  9  
ATOM 7008  H HE2  . TYR B 2 26 ? -16.843 4.323   -5.005  1.00 0.00 ? 26 TYR B HE2  9  
ATOM 7009  H HH   . TYR B 2 26 ? -14.137 4.648   -5.897  1.00 0.00 ? 26 TYR B HH   9  
ATOM 7010  N N    . PRO B 2 27 ? -17.992 1.375   0.902   1.00 0.00 ? 27 PRO B N    9  
ATOM 7011  C CA   . PRO B 2 27 ? -19.105 1.127   1.834   1.00 0.00 ? 27 PRO B CA   9  
ATOM 7012  C C    . PRO B 2 27 ? -20.313 0.555   1.084   1.00 0.00 ? 27 PRO B C    9  
ATOM 7013  O O    . PRO B 2 27 ? -20.547 0.869   -0.066  1.00 0.00 ? 27 PRO B O    9  
ATOM 7014  C CB   . PRO B 2 27 ? -19.418 2.516   2.397   1.00 0.00 ? 27 PRO B CB   9  
ATOM 7015  C CG   . PRO B 2 27 ? -18.877 3.536   1.367   1.00 0.00 ? 27 PRO B CG   9  
ATOM 7016  C CD   . PRO B 2 27 ? -17.822 2.794   0.525   1.00 0.00 ? 27 PRO B CD   9  
ATOM 7017  H HA   . PRO B 2 27 ? -18.799 0.466   2.628   1.00 0.00 ? 27 PRO B HA   9  
ATOM 7018  H HB2  . PRO B 2 27 ? -20.487 2.634   2.516   1.00 0.00 ? 27 PRO B HB2  9  
ATOM 7019  H HB3  . PRO B 2 27 ? -18.920 2.655   3.343   1.00 0.00 ? 27 PRO B HB3  9  
ATOM 7020  H HG2  . PRO B 2 27 ? -19.682 3.885   0.735   1.00 0.00 ? 27 PRO B HG2  9  
ATOM 7021  H HG3  . PRO B 2 27 ? -18.416 4.368   1.876   1.00 0.00 ? 27 PRO B HG3  9  
ATOM 7022  H HD2  . PRO B 2 27 ? -18.015 2.934   -0.530  1.00 0.00 ? 27 PRO B HD2  9  
ATOM 7023  H HD3  . PRO B 2 27 ? -16.829 3.130   0.779   1.00 0.00 ? 27 PRO B HD3  9  
ATOM 7024  N N    . THR B 2 28 ? -21.080 -0.281  1.728   1.00 0.00 ? 28 THR B N    9  
ATOM 7025  C CA   . THR B 2 28 ? -22.270 -0.872  1.052   1.00 0.00 ? 28 THR B CA   9  
ATOM 7026  C C    . THR B 2 28 ? -23.462 -0.856  2.012   1.00 0.00 ? 28 THR B C    9  
ATOM 7027  O O    . THR B 2 28 ? -23.896 -1.883  2.495   1.00 0.00 ? 28 THR B O    9  
ATOM 7028  C CB   . THR B 2 28 ? -21.962 -2.315  0.646   1.00 0.00 ? 28 THR B CB   9  
ATOM 7029  O OG1  . THR B 2 28 ? -21.482 -3.030  1.777   1.00 0.00 ? 28 THR B OG1  9  
ATOM 7030  C CG2  . THR B 2 28 ? -20.898 -2.322  -0.453  1.00 0.00 ? 28 THR B CG2  9  
ATOM 7031  H H    . THR B 2 28 ? -20.874 -0.522  2.655   1.00 0.00 ? 28 THR B H    9  
ATOM 7032  H HA   . THR B 2 28 ? -22.509 -0.293  0.172   1.00 0.00 ? 28 THR B HA   9  
ATOM 7033  H HB   . THR B 2 28 ? -22.859 -2.785  0.276   1.00 0.00 ? 28 THR B HB   9  
ATOM 7034  H HG1  . THR B 2 28 ? -22.020 -3.819  1.878   1.00 0.00 ? 28 THR B HG1  9  
ATOM 7035  H HG21 . THR B 2 28 ? -21.032 -3.192  -1.078  1.00 0.00 ? 28 THR B HG21 9  
ATOM 7036  H HG22 . THR B 2 28 ? -19.916 -2.349  -0.004  1.00 0.00 ? 28 THR B HG22 9  
ATOM 7037  H HG23 . THR B 2 28 ? -20.995 -1.429  -1.053  1.00 0.00 ? 28 THR B HG23 9  
ATOM 7038  N N    . LYS B 2 29 ? -23.995 0.302   2.292   1.00 0.00 ? 29 LYS B N    9  
ATOM 7039  C CA   . LYS B 2 29 ? -25.157 0.382   3.220   1.00 0.00 ? 29 LYS B CA   9  
ATOM 7040  C C    . LYS B 2 29 ? -26.450 0.501   2.410   1.00 0.00 ? 29 LYS B C    9  
ATOM 7041  O O    . LYS B 2 29 ? -26.596 1.376   1.580   1.00 0.00 ? 29 LYS B O    9  
ATOM 7042  C CB   . LYS B 2 29 ? -25.006 1.609   4.122   1.00 0.00 ? 29 LYS B CB   9  
ATOM 7043  C CG   . LYS B 2 29 ? -24.914 2.869   3.260   1.00 0.00 ? 29 LYS B CG   9  
ATOM 7044  C CD   . LYS B 2 29 ? -26.163 3.726   3.472   1.00 0.00 ? 29 LYS B CD   9  
ATOM 7045  C CE   . LYS B 2 29 ? -25.815 4.928   4.352   1.00 0.00 ? 29 LYS B CE   9  
ATOM 7046  N NZ   . LYS B 2 29 ? -26.755 4.988   5.506   1.00 0.00 ? 29 LYS B NZ   9  
ATOM 7047  H H    . LYS B 2 29 ? -23.630 1.119   1.892   1.00 0.00 ? 29 LYS B H    9  
ATOM 7048  H HA   . LYS B 2 29 ? -25.195 -0.509  3.828   1.00 0.00 ? 29 LYS B HA   9  
ATOM 7049  H HB2  . LYS B 2 29 ? -25.863 1.681   4.777   1.00 0.00 ? 29 LYS B HB2  9  
ATOM 7050  H HB3  . LYS B 2 29 ? -24.108 1.513   4.713   1.00 0.00 ? 29 LYS B HB3  9  
ATOM 7051  H HG2  . LYS B 2 29 ? -24.036 3.434   3.541   1.00 0.00 ? 29 LYS B HG2  9  
ATOM 7052  H HG3  . LYS B 2 29 ? -24.844 2.589   2.220   1.00 0.00 ? 29 LYS B HG3  9  
ATOM 7053  H HD2  . LYS B 2 29 ? -26.528 4.072   2.516   1.00 0.00 ? 29 LYS B HD2  9  
ATOM 7054  H HD3  . LYS B 2 29 ? -26.926 3.137   3.958   1.00 0.00 ? 29 LYS B HD3  9  
ATOM 7055  H HE2  . LYS B 2 29 ? -24.803 4.827   4.716   1.00 0.00 ? 29 LYS B HE2  9  
ATOM 7056  H HE3  . LYS B 2 29 ? -25.899 5.835   3.771   1.00 0.00 ? 29 LYS B HE3  9  
ATOM 7057  H HZ1  . LYS B 2 29 ? -27.372 4.152   5.495   1.00 0.00 ? 29 LYS B HZ1  9  
ATOM 7058  H HZ2  . LYS B 2 29 ? -27.335 5.850   5.435   1.00 0.00 ? 29 LYS B HZ2  9  
ATOM 7059  H HZ3  . LYS B 2 29 ? -26.214 5.005   6.394   1.00 0.00 ? 29 LYS B HZ3  9  
ATOM 7060  N N    . THR B 2 30 ? -27.390 -0.373  2.645   1.00 0.00 ? 30 THR B N    9  
ATOM 7061  C CA   . THR B 2 30 ? -28.672 -0.311  1.888   1.00 0.00 ? 30 THR B CA   9  
ATOM 7062  C C    . THR B 2 30 ? -29.368 1.022   2.173   1.00 0.00 ? 30 THR B C    9  
ATOM 7063  O O    . THR B 2 30 ? -29.307 1.893   1.321   1.00 0.00 ? 30 THR B O    9  
ATOM 7064  C CB   . THR B 2 30 ? -29.579 -1.464  2.325   1.00 0.00 ? 30 THR B CB   9  
ATOM 7065  O OG1  . THR B 2 30 ? -29.227 -1.867  3.641   1.00 0.00 ? 30 THR B OG1  9  
ATOM 7066  C CG2  . THR B 2 30 ? -29.408 -2.642  1.364   1.00 0.00 ? 30 THR B CG2  9  
ATOM 7067  O OXT  . THR B 2 30 ? -29.950 1.148   3.238   1.00 0.00 ? 30 THR B OXT  9  
ATOM 7068  H H    . THR B 2 30 ? -27.253 -1.071  3.319   1.00 0.00 ? 30 THR B H    9  
ATOM 7069  H HA   . THR B 2 30 ? -28.470 -0.392  0.830   1.00 0.00 ? 30 THR B HA   9  
ATOM 7070  H HB   . THR B 2 30 ? -30.608 -1.139  2.310   1.00 0.00 ? 30 THR B HB   9  
ATOM 7071  H HG1  . THR B 2 30 ? -29.613 -1.240  4.257   1.00 0.00 ? 30 THR B HG1  9  
ATOM 7072  H HG21 . THR B 2 30 ? -30.380 -2.989  1.044   1.00 0.00 ? 30 THR B HG21 9  
ATOM 7073  H HG22 . THR B 2 30 ? -28.887 -3.443  1.866   1.00 0.00 ? 30 THR B HG22 9  
ATOM 7074  H HG23 . THR B 2 30 ? -28.838 -2.325  0.504   1.00 0.00 ? 30 THR B HG23 9  
ATOM 7075  N N    . GLY A 1 1  ? -3.903  1.589   10.671  1.00 0.00 ? 1  GLY A N    10 
ATOM 7076  C CA   . GLY A 1 1  ? -3.371  1.695   9.282   1.00 0.00 ? 1  GLY A CA   10 
ATOM 7077  C C    . GLY A 1 1  ? -4.506  1.473   8.281   1.00 0.00 ? 1  GLY A C    10 
ATOM 7078  O O    . GLY A 1 1  ? -5.453  0.762   8.551   1.00 0.00 ? 1  GLY A O    10 
ATOM 7079  H H1   . GLY A 1 1  ? -3.112  1.494   11.339  1.00 0.00 ? 1  GLY A H1   10 
ATOM 7080  H H2   . GLY A 1 1  ? -4.520  0.754   10.742  1.00 0.00 ? 1  GLY A H2   10 
ATOM 7081  H H3   . GLY A 1 1  ? -4.447  2.444   10.900  1.00 0.00 ? 1  GLY A H3   10 
ATOM 7082  H HA2  . GLY A 1 1  ? -2.946  2.678   9.135   1.00 0.00 ? 1  GLY A HA2  10 
ATOM 7083  H HA3  . GLY A 1 1  ? -2.609  0.946   9.129   1.00 0.00 ? 1  GLY A HA3  10 
ATOM 7084  N N    . ILE A 1 2  ? -4.418  2.076   7.128   1.00 0.00 ? 2  ILE A N    10 
ATOM 7085  C CA   . ILE A 1 2  ? -5.493  1.898   6.112   1.00 0.00 ? 2  ILE A CA   10 
ATOM 7086  C C    . ILE A 1 2  ? -5.420  0.486   5.531   1.00 0.00 ? 2  ILE A C    10 
ATOM 7087  O O    . ILE A 1 2  ? -6.419  -0.092  5.156   1.00 0.00 ? 2  ILE A O    10 
ATOM 7088  C CB   . ILE A 1 2  ? -5.316  2.925   4.989   1.00 0.00 ? 2  ILE A CB   10 
ATOM 7089  C CG1  . ILE A 1 2  ? -3.829  3.057   4.640   1.00 0.00 ? 2  ILE A CG1  10 
ATOM 7090  C CG2  . ILE A 1 2  ? -5.850  4.282   5.450   1.00 0.00 ? 2  ILE A CG2  10 
ATOM 7091  C CD1  . ILE A 1 2  ? -3.681  3.365   3.148   1.00 0.00 ? 2  ILE A CD1  10 
ATOM 7092  H H    . ILE A 1 2  ? -3.646  2.646   6.931   1.00 0.00 ? 2  ILE A H    10 
ATOM 7093  H HA   . ILE A 1 2  ? -6.456  2.040   6.579   1.00 0.00 ? 2  ILE A HA   10 
ATOM 7094  H HB   . ILE A 1 2  ? -5.865  2.601   4.116   1.00 0.00 ? 2  ILE A HB   10 
ATOM 7095  H HG12 . ILE A 1 2  ? -3.393  3.859   5.218   1.00 0.00 ? 2  ILE A HG12 10 
ATOM 7096  H HG13 . ILE A 1 2  ? -3.321  2.132   4.866   1.00 0.00 ? 2  ILE A HG13 10 
ATOM 7097  H HG21 . ILE A 1 2  ? -6.702  4.133   6.096   1.00 0.00 ? 2  ILE A HG21 10 
ATOM 7098  H HG22 . ILE A 1 2  ? -6.147  4.863   4.590   1.00 0.00 ? 2  ILE A HG22 10 
ATOM 7099  H HG23 . ILE A 1 2  ? -5.077  4.808   5.990   1.00 0.00 ? 2  ILE A HG23 10 
ATOM 7100  H HD11 . ILE A 1 2  ? -3.715  4.434   2.996   1.00 0.00 ? 2  ILE A HD11 10 
ATOM 7101  H HD12 . ILE A 1 2  ? -4.487  2.898   2.602   1.00 0.00 ? 2  ILE A HD12 10 
ATOM 7102  H HD13 . ILE A 1 2  ? -2.736  2.981   2.794   1.00 0.00 ? 2  ILE A HD13 10 
ATOM 7103  N N    . VAL A 1 3  ? -4.245  -0.076  5.456   1.00 0.00 ? 3  VAL A N    10 
ATOM 7104  C CA   . VAL A 1 3  ? -4.105  -1.448  4.902   1.00 0.00 ? 3  VAL A CA   10 
ATOM 7105  C C    . VAL A 1 3  ? -4.776  -2.447  5.851   1.00 0.00 ? 3  VAL A C    10 
ATOM 7106  O O    . VAL A 1 3  ? -5.470  -3.350  5.428   1.00 0.00 ? 3  VAL A O    10 
ATOM 7107  C CB   . VAL A 1 3  ? -2.605  -1.755  4.737   1.00 0.00 ? 3  VAL A CB   10 
ATOM 7108  C CG1  . VAL A 1 3  ? -2.305  -3.220  5.062   1.00 0.00 ? 3  VAL A CG1  10 
ATOM 7109  C CG2  . VAL A 1 3  ? -2.189  -1.467  3.293   1.00 0.00 ? 3  VAL A CG2  10 
ATOM 7110  H H    . VAL A 1 3  ? -3.451  0.404   5.767   1.00 0.00 ? 3  VAL A H    10 
ATOM 7111  H HA   . VAL A 1 3  ? -4.590  -1.495  3.940   1.00 0.00 ? 3  VAL A HA   10 
ATOM 7112  H HB   . VAL A 1 3  ? -2.038  -1.121  5.403   1.00 0.00 ? 3  VAL A HB   10 
ATOM 7113  H HG11 . VAL A 1 3  ? -2.910  -3.857  4.436   1.00 0.00 ? 3  VAL A HG11 10 
ATOM 7114  H HG12 . VAL A 1 3  ? -2.535  -3.410  6.100   1.00 0.00 ? 3  VAL A HG12 10 
ATOM 7115  H HG13 . VAL A 1 3  ? -1.260  -3.421  4.881   1.00 0.00 ? 3  VAL A HG13 10 
ATOM 7116  H HG21 . VAL A 1 3  ? -1.632  -2.307  2.905   1.00 0.00 ? 3  VAL A HG21 10 
ATOM 7117  H HG22 . VAL A 1 3  ? -1.571  -0.582  3.266   1.00 0.00 ? 3  VAL A HG22 10 
ATOM 7118  H HG23 . VAL A 1 3  ? -3.070  -1.309  2.689   1.00 0.00 ? 3  VAL A HG23 10 
ATOM 7119  N N    . GLU A 1 4  ? -4.575  -2.292  7.127   1.00 0.00 ? 4  GLU A N    10 
ATOM 7120  C CA   . GLU A 1 4  ? -5.201  -3.232  8.097   1.00 0.00 ? 4  GLU A CA   10 
ATOM 7121  C C    . GLU A 1 4  ? -6.722  -3.141  7.980   1.00 0.00 ? 4  GLU A C    10 
ATOM 7122  O O    . GLU A 1 4  ? -7.421  -4.134  8.025   1.00 0.00 ? 4  GLU A O    10 
ATOM 7123  C CB   . GLU A 1 4  ? -4.774  -2.862  9.518   1.00 0.00 ? 4  GLU A CB   10 
ATOM 7124  C CG   . GLU A 1 4  ? -3.546  -3.685  9.913   1.00 0.00 ? 4  GLU A CG   10 
ATOM 7125  C CD   . GLU A 1 4  ? -3.904  -4.609  11.077  1.00 0.00 ? 4  GLU A CD   10 
ATOM 7126  O OE1  . GLU A 1 4  ? -4.444  -4.117  12.054  1.00 0.00 ? 4  GLU A OE1  10 
ATOM 7127  O OE2  . GLU A 1 4  ? -3.633  -5.794  10.972  1.00 0.00 ? 4  GLU A OE2  10 
ATOM 7128  H H    . GLU A 1 4  ? -4.012  -1.557  7.447   1.00 0.00 ? 4  GLU A H    10 
ATOM 7129  H HA   . GLU A 1 4  ? -4.885  -4.239  7.876   1.00 0.00 ? 4  GLU A HA   10 
ATOM 7130  H HB2  . GLU A 1 4  ? -4.532  -1.809  9.558   1.00 0.00 ? 4  GLU A HB2  10 
ATOM 7131  H HB3  . GLU A 1 4  ? -5.581  -3.072  10.204  1.00 0.00 ? 4  GLU A HB3  10 
ATOM 7132  H HG2  . GLU A 1 4  ? -3.223  -4.276  9.068   1.00 0.00 ? 4  GLU A HG2  10 
ATOM 7133  H HG3  . GLU A 1 4  ? -2.750  -3.022  10.214  1.00 0.00 ? 4  GLU A HG3  10 
ATOM 7134  N N    . GLN A 1 5  ? -7.240  -1.955  7.832   1.00 0.00 ? 5  GLN A N    10 
ATOM 7135  C CA   . GLN A 1 5  ? -8.716  -1.793  7.713   1.00 0.00 ? 5  GLN A CA   10 
ATOM 7136  C C    . GLN A 1 5  ? -9.157  -2.080  6.277   1.00 0.00 ? 5  GLN A C    10 
ATOM 7137  O O    . GLN A 1 5  ? -10.178 -2.695  6.042   1.00 0.00 ? 5  GLN A O    10 
ATOM 7138  C CB   . GLN A 1 5  ? -9.102  -0.360  8.088   1.00 0.00 ? 5  GLN A CB   10 
ATOM 7139  C CG   . GLN A 1 5  ? -10.569 -0.117  7.729   1.00 0.00 ? 5  GLN A CG   10 
ATOM 7140  C CD   . GLN A 1 5  ? -11.342 0.289   8.985   1.00 0.00 ? 5  GLN A CD   10 
ATOM 7141  O OE1  . GLN A 1 5  ? -11.151 1.370   9.507   1.00 0.00 ? 5  GLN A OE1  10 
ATOM 7142  N NE2  . GLN A 1 5  ? -12.213 -0.537  9.497   1.00 0.00 ? 5  GLN A NE2  10 
ATOM 7143  H H    . GLN A 1 5  ? -6.656  -1.170  7.799   1.00 0.00 ? 5  GLN A H    10 
ATOM 7144  H HA   . GLN A 1 5  ? -9.206  -2.482  8.381   1.00 0.00 ? 5  GLN A HA   10 
ATOM 7145  H HB2  . GLN A 1 5  ? -8.962  -0.216  9.149   1.00 0.00 ? 5  GLN A HB2  10 
ATOM 7146  H HB3  . GLN A 1 5  ? -8.481  0.335   7.544   1.00 0.00 ? 5  GLN A HB3  10 
ATOM 7147  H HG2  . GLN A 1 5  ? -10.634 0.672   6.994   1.00 0.00 ? 5  GLN A HG2  10 
ATOM 7148  H HG3  . GLN A 1 5  ? -10.996 -1.023  7.324   1.00 0.00 ? 5  GLN A HG3  10 
ATOM 7149  H HE21 . GLN A 1 5  ? -12.367 -1.409  9.076   1.00 0.00 ? 5  GLN A HE21 10 
ATOM 7150  H HE22 . GLN A 1 5  ? -12.713 -0.286  10.301  1.00 0.00 ? 5  GLN A HE22 10 
ATOM 7151  N N    . CYS A 1 6  ? -8.401  -1.633  5.314   1.00 0.00 ? 6  CYS A N    10 
ATOM 7152  C CA   . CYS A 1 6  ? -8.786  -1.873  3.892   1.00 0.00 ? 6  CYS A CA   10 
ATOM 7153  C C    . CYS A 1 6  ? -8.610  -3.351  3.541   1.00 0.00 ? 6  CYS A C    10 
ATOM 7154  O O    . CYS A 1 6  ? -9.019  -3.794  2.486   1.00 0.00 ? 6  CYS A O    10 
ATOM 7155  C CB   . CYS A 1 6  ? -7.910  -1.026  2.970   1.00 0.00 ? 6  CYS A CB   10 
ATOM 7156  S SG   . CYS A 1 6  ? -8.574  0.655   2.896   1.00 0.00 ? 6  CYS A SG   10 
ATOM 7157  H H    . CYS A 1 6  ? -7.585  -1.132  5.525   1.00 0.00 ? 6  CYS A H    10 
ATOM 7158  H HA   . CYS A 1 6  ? -9.821  -1.596  3.753   1.00 0.00 ? 6  CYS A HA   10 
ATOM 7159  H HB2  . CYS A 1 6  ? -6.901  -1.002  3.351   1.00 0.00 ? 6  CYS A HB2  10 
ATOM 7160  H HB3  . CYS A 1 6  ? -7.910  -1.457  1.980   1.00 0.00 ? 6  CYS A HB3  10 
ATOM 7161  N N    . CYS A 1 7  ? -8.005  -4.118  4.410   1.00 0.00 ? 7  CYS A N    10 
ATOM 7162  C CA   . CYS A 1 7  ? -7.809  -5.569  4.116   1.00 0.00 ? 7  CYS A CA   10 
ATOM 7163  C C    . CYS A 1 7  ? -9.080  -6.132  3.473   1.00 0.00 ? 7  CYS A C    10 
ATOM 7164  O O    . CYS A 1 7  ? -9.035  -7.072  2.705   1.00 0.00 ? 7  CYS A O    10 
ATOM 7165  C CB   . CYS A 1 7  ? -7.516  -6.321  5.419   1.00 0.00 ? 7  CYS A CB   10 
ATOM 7166  S SG   . CYS A 1 7  ? -7.627  -8.107  5.134   1.00 0.00 ? 7  CYS A SG   10 
ATOM 7167  H H    . CYS A 1 7  ? -7.679  -3.740  5.254   1.00 0.00 ? 7  CYS A H    10 
ATOM 7168  H HA   . CYS A 1 7  ? -6.979  -5.690  3.436   1.00 0.00 ? 7  CYS A HA   10 
ATOM 7169  H HB2  . CYS A 1 7  ? -6.522  -6.073  5.761   1.00 0.00 ? 7  CYS A HB2  10 
ATOM 7170  H HB3  . CYS A 1 7  ? -8.236  -6.031  6.171   1.00 0.00 ? 7  CYS A HB3  10 
ATOM 7171  N N    . THR A 1 8  ? -10.213 -5.561  3.779   1.00 0.00 ? 8  THR A N    10 
ATOM 7172  C CA   . THR A 1 8  ? -11.484 -6.059  3.183   1.00 0.00 ? 8  THR A CA   10 
ATOM 7173  C C    . THR A 1 8  ? -11.508 -5.725  1.690   1.00 0.00 ? 8  THR A C    10 
ATOM 7174  O O    . THR A 1 8  ? -12.175 -4.804  1.261   1.00 0.00 ? 8  THR A O    10 
ATOM 7175  C CB   . THR A 1 8  ? -12.671 -5.385  3.875   1.00 0.00 ? 8  THR A CB   10 
ATOM 7176  O OG1  . THR A 1 8  ? -13.881 -5.831  3.277   1.00 0.00 ? 8  THR A OG1  10 
ATOM 7177  C CG2  . THR A 1 8  ? -12.555 -3.868  3.727   1.00 0.00 ? 8  THR A CG2  10 
ATOM 7178  H H    . THR A 1 8  ? -10.228 -4.803  4.399   1.00 0.00 ? 8  THR A H    10 
ATOM 7179  H HA   . THR A 1 8  ? -11.549 -7.129  3.314   1.00 0.00 ? 8  THR A HA   10 
ATOM 7180  H HB   . THR A 1 8  ? -12.671 -5.642  4.923   1.00 0.00 ? 8  THR A HB   10 
ATOM 7181  H HG1  . THR A 1 8  ? -14.056 -6.722  3.589   1.00 0.00 ? 8  THR A HG1  10 
ATOM 7182  H HG21 . THR A 1 8  ? -12.938 -3.389  4.616   1.00 0.00 ? 8  THR A HG21 10 
ATOM 7183  H HG22 . THR A 1 8  ? -13.126 -3.545  2.869   1.00 0.00 ? 8  THR A HG22 10 
ATOM 7184  H HG23 . THR A 1 8  ? -11.518 -3.598  3.591   1.00 0.00 ? 8  THR A HG23 10 
ATOM 7185  N N    . SER A 1 9  ? -10.782 -6.465  0.897   1.00 0.00 ? 9  SER A N    10 
ATOM 7186  C CA   . SER A 1 9  ? -10.757 -6.196  -0.569  1.00 0.00 ? 9  SER A CA   10 
ATOM 7187  C C    . SER A 1 9  ? -9.846  -5.003  -0.861  1.00 0.00 ? 9  SER A C    10 
ATOM 7188  O O    . SER A 1 9  ? -8.947  -4.695  -0.104  1.00 0.00 ? 9  SER A O    10 
ATOM 7189  C CB   . SER A 1 9  ? -12.168 -5.882  -1.063  1.00 0.00 ? 9  SER A CB   10 
ATOM 7190  O OG   . SER A 1 9  ? -13.108 -6.643  -0.316  1.00 0.00 ? 9  SER A OG   10 
ATOM 7191  H H    . SER A 1 9  ? -10.251 -7.201  1.267   1.00 0.00 ? 9  SER A H    10 
ATOM 7192  H HA   . SER A 1 9  ? -10.383 -7.067  -1.087  1.00 0.00 ? 9  SER A HA   10 
ATOM 7193  H HB2  . SER A 1 9  ? -12.372 -4.833  -0.927  1.00 0.00 ? 9  SER A HB2  10 
ATOM 7194  H HB3  . SER A 1 9  ? -12.241 -6.127  -2.114  1.00 0.00 ? 9  SER A HB3  10 
ATOM 7195  H HG   . SER A 1 9  ? -13.683 -7.096  -0.938  1.00 0.00 ? 9  SER A HG   10 
ATOM 7196  N N    . ILE A 1 10 ? -10.068 -4.335  -1.961  1.00 0.00 ? 10 ILE A N    10 
ATOM 7197  C CA   . ILE A 1 10 ? -9.212  -3.164  -2.315  1.00 0.00 ? 10 ILE A CA   10 
ATOM 7198  C C    . ILE A 1 10 ? -10.017 -1.877  -2.136  1.00 0.00 ? 10 ILE A C    10 
ATOM 7199  O O    . ILE A 1 10 ? -11.026 -1.669  -2.780  1.00 0.00 ? 10 ILE A O    10 
ATOM 7200  C CB   . ILE A 1 10 ? -8.710  -3.309  -3.777  1.00 0.00 ? 10 ILE A CB   10 
ATOM 7201  C CG1  . ILE A 1 10 ? -8.723  -1.958  -4.520  1.00 0.00 ? 10 ILE A CG1  10 
ATOM 7202  C CG2  . ILE A 1 10 ? -9.602  -4.292  -4.540  1.00 0.00 ? 10 ILE A CG2  10 
ATOM 7203  C CD1  . ILE A 1 10 ? -7.620  -1.045  -3.976  1.00 0.00 ? 10 ILE A CD1  10 
ATOM 7204  H H    . ILE A 1 10 ? -10.795 -4.606  -2.558  1.00 0.00 ? 10 ILE A H    10 
ATOM 7205  H HA   . ILE A 1 10 ? -8.360  -3.139  -1.651  1.00 0.00 ? 10 ILE A HA   10 
ATOM 7206  H HB   . ILE A 1 10 ? -7.700  -3.695  -3.762  1.00 0.00 ? 10 ILE A HB   10 
ATOM 7207  H HG12 . ILE A 1 10 ? -8.555  -2.130  -5.573  1.00 0.00 ? 10 ILE A HG12 10 
ATOM 7208  H HG13 . ILE A 1 10 ? -9.682  -1.480  -4.387  1.00 0.00 ? 10 ILE A HG13 10 
ATOM 7209  H HG21 . ILE A 1 10 ? -9.211  -4.434  -5.537  1.00 0.00 ? 10 ILE A HG21 10 
ATOM 7210  H HG22 . ILE A 1 10 ? -10.605 -3.895  -4.601  1.00 0.00 ? 10 ILE A HG22 10 
ATOM 7211  H HG23 . ILE A 1 10 ? -9.620  -5.239  -4.022  1.00 0.00 ? 10 ILE A HG23 10 
ATOM 7212  H HD11 . ILE A 1 10 ? -7.980  -0.026  -3.943  1.00 0.00 ? 10 ILE A HD11 10 
ATOM 7213  H HD12 . ILE A 1 10 ? -6.757  -1.098  -4.624  1.00 0.00 ? 10 ILE A HD12 10 
ATOM 7214  H HD13 . ILE A 1 10 ? -7.345  -1.362  -2.982  1.00 0.00 ? 10 ILE A HD13 10 
ATOM 7215  N N    . CYS A 1 11 ? -9.567  -1.003  -1.281  1.00 0.00 ? 11 CYS A N    10 
ATOM 7216  C CA   . CYS A 1 11 ? -10.298 0.274   -1.088  1.00 0.00 ? 11 CYS A CA   10 
ATOM 7217  C C    . CYS A 1 11 ? -9.588  1.349   -1.907  1.00 0.00 ? 11 CYS A C    10 
ATOM 7218  O O    . CYS A 1 11 ? -8.419  1.610   -1.711  1.00 0.00 ? 11 CYS A O    10 
ATOM 7219  C CB   . CYS A 1 11 ? -10.295 0.656   0.398   1.00 0.00 ? 11 CYS A CB   10 
ATOM 7220  S SG   . CYS A 1 11 ? -8.612  1.077   0.923   1.00 0.00 ? 11 CYS A SG   10 
ATOM 7221  H H    . CYS A 1 11 ? -8.743  -1.180  -0.781  1.00 0.00 ? 11 CYS A H    10 
ATOM 7222  H HA   . CYS A 1 11 ? -11.315 0.165   -1.435  1.00 0.00 ? 11 CYS A HA   10 
ATOM 7223  H HB2  . CYS A 1 11 ? -10.941 1.507   0.551   1.00 0.00 ? 11 CYS A HB2  10 
ATOM 7224  H HB3  . CYS A 1 11 ? -10.655 -0.177  0.984   1.00 0.00 ? 11 CYS A HB3  10 
ATOM 7225  N N    . SER A 1 12 ? -10.295 1.958   -2.827  1.00 0.00 ? 12 SER A N    10 
ATOM 7226  C CA   . SER A 1 12 ? -9.702  3.019   -3.698  1.00 0.00 ? 12 SER A CA   10 
ATOM 7227  C C    . SER A 1 12 ? -8.175  2.902   -3.745  1.00 0.00 ? 12 SER A C    10 
ATOM 7228  O O    . SER A 1 12 ? -7.479  3.522   -2.967  1.00 0.00 ? 12 SER A O    10 
ATOM 7229  C CB   . SER A 1 12 ? -10.091 4.392   -3.150  1.00 0.00 ? 12 SER A CB   10 
ATOM 7230  O OG   . SER A 1 12 ? -11.402 4.719   -3.592  1.00 0.00 ? 12 SER A OG   10 
ATOM 7231  H H    . SER A 1 12 ? -11.230 1.710   -2.954  1.00 0.00 ? 12 SER A H    10 
ATOM 7232  H HA   . SER A 1 12 ? -10.095 2.915   -4.698  1.00 0.00 ? 12 SER A HA   10 
ATOM 7233  H HB2  . SER A 1 12 ? -10.075 4.370   -2.074  1.00 0.00 ? 12 SER A HB2  10 
ATOM 7234  H HB3  . SER A 1 12 ? -9.386  5.133   -3.504  1.00 0.00 ? 12 SER A HB3  10 
ATOM 7235  H HG   . SER A 1 12 ? -11.527 4.332   -4.462  1.00 0.00 ? 12 SER A HG   10 
ATOM 7236  N N    . LEU A 1 13 ? -7.639  2.129   -4.653  1.00 0.00 ? 13 LEU A N    10 
ATOM 7237  C CA   . LEU A 1 13 ? -6.157  2.022   -4.725  1.00 0.00 ? 13 LEU A CA   10 
ATOM 7238  C C    . LEU A 1 13 ? -5.632  3.440   -4.826  1.00 0.00 ? 13 LEU A C    10 
ATOM 7239  O O    . LEU A 1 13 ? -4.570  3.770   -4.337  1.00 0.00 ? 13 LEU A O    10 
ATOM 7240  C CB   . LEU A 1 13 ? -5.748  1.219   -5.963  1.00 0.00 ? 13 LEU A CB   10 
ATOM 7241  C CG   . LEU A 1 13 ? -4.229  1.041   -5.977  1.00 0.00 ? 13 LEU A CG   10 
ATOM 7242  C CD1  . LEU A 1 13 ? -3.806  0.158   -4.801  1.00 0.00 ? 13 LEU A CD1  10 
ATOM 7243  C CD2  . LEU A 1 13 ? -3.807  0.376   -7.290  1.00 0.00 ? 13 LEU A CD2  10 
ATOM 7244  H H    . LEU A 1 13 ? -8.203  1.638   -5.284  1.00 0.00 ? 13 LEU A H    10 
ATOM 7245  H HA   . LEU A 1 13 ? -5.771  1.556   -3.830  1.00 0.00 ? 13 LEU A HA   10 
ATOM 7246  H HB2  . LEU A 1 13 ? -6.225  0.250   -5.937  1.00 0.00 ? 13 LEU A HB2  10 
ATOM 7247  H HB3  . LEU A 1 13 ? -6.054  1.749   -6.853  1.00 0.00 ? 13 LEU A HB3  10 
ATOM 7248  H HG   . LEU A 1 13 ? -3.752  2.007   -5.891  1.00 0.00 ? 13 LEU A HG   10 
ATOM 7249  H HD11 . LEU A 1 13 ? -4.666  -0.377  -4.425  1.00 0.00 ? 13 LEU A HD11 10 
ATOM 7250  H HD12 . LEU A 1 13 ? -3.395  0.776   -4.017  1.00 0.00 ? 13 LEU A HD12 10 
ATOM 7251  H HD13 . LEU A 1 13 ? -3.059  -0.549  -5.132  1.00 0.00 ? 13 LEU A HD13 10 
ATOM 7252  H HD21 . LEU A 1 13 ? -4.155  0.970   -8.122  1.00 0.00 ? 13 LEU A HD21 10 
ATOM 7253  H HD22 . LEU A 1 13 ? -4.239  -0.612  -7.348  1.00 0.00 ? 13 LEU A HD22 10 
ATOM 7254  H HD23 . LEU A 1 13 ? -2.730  0.301   -7.326  1.00 0.00 ? 13 LEU A HD23 10 
ATOM 7255  N N    . TYR A 1 14 ? -6.410  4.290   -5.423  1.00 0.00 ? 14 TYR A N    10 
ATOM 7256  C CA   . TYR A 1 14 ? -6.010  5.716   -5.526  1.00 0.00 ? 14 TYR A CA   10 
ATOM 7257  C C    . TYR A 1 14 ? -5.965  6.275   -4.109  1.00 0.00 ? 14 TYR A C    10 
ATOM 7258  O O    . TYR A 1 14 ? -5.113  7.069   -3.766  1.00 0.00 ? 14 TYR A O    10 
ATOM 7259  C CB   . TYR A 1 14 ? -7.036  6.487   -6.360  1.00 0.00 ? 14 TYR A CB   10 
ATOM 7260  C CG   . TYR A 1 14 ? -6.608  6.489   -7.808  1.00 0.00 ? 14 TYR A CG   10 
ATOM 7261  C CD1  . TYR A 1 14 ? -6.919  5.401   -8.631  1.00 0.00 ? 14 TYR A CD1  10 
ATOM 7262  C CD2  . TYR A 1 14 ? -5.900  7.580   -8.327  1.00 0.00 ? 14 TYR A CD2  10 
ATOM 7263  C CE1  . TYR A 1 14 ? -6.522  5.403   -9.974  1.00 0.00 ? 14 TYR A CE1  10 
ATOM 7264  C CE2  . TYR A 1 14 ? -5.504  7.582   -9.670  1.00 0.00 ? 14 TYR A CE2  10 
ATOM 7265  C CZ   . TYR A 1 14 ? -5.815  6.494   -10.493 1.00 0.00 ? 14 TYR A CZ   10 
ATOM 7266  O OH   . TYR A 1 14 ? -5.424  6.496   -11.817 1.00 0.00 ? 14 TYR A OH   10 
ATOM 7267  H H    . TYR A 1 14 ? -7.278  3.990   -5.771  1.00 0.00 ? 14 TYR A H    10 
ATOM 7268  H HA   . TYR A 1 14 ? -5.032  5.792   -5.976  1.00 0.00 ? 14 TYR A HA   10 
ATOM 7269  H HB2  . TYR A 1 14 ? -8.002  6.013   -6.271  1.00 0.00 ? 14 TYR A HB2  10 
ATOM 7270  H HB3  . TYR A 1 14 ? -7.099  7.504   -6.003  1.00 0.00 ? 14 TYR A HB3  10 
ATOM 7271  H HD1  . TYR A 1 14 ? -7.464  4.559   -8.231  1.00 0.00 ? 14 TYR A HD1  10 
ATOM 7272  H HD2  . TYR A 1 14 ? -5.660  8.420   -7.692  1.00 0.00 ? 14 TYR A HD2  10 
ATOM 7273  H HE1  . TYR A 1 14 ? -6.762  4.563   -10.609 1.00 0.00 ? 14 TYR A HE1  10 
ATOM 7274  H HE2  . TYR A 1 14 ? -4.959  8.424   -10.070 1.00 0.00 ? 14 TYR A HE2  10 
ATOM 7275  H HH   . TYR A 1 14 ? -4.868  7.265   -11.961 1.00 0.00 ? 14 TYR A HH   10 
ATOM 7276  N N    . GLN A 1 15 ? -6.863  5.831   -3.268  1.00 0.00 ? 15 GLN A N    10 
ATOM 7277  C CA   . GLN A 1 15 ? -6.853  6.302   -1.859  1.00 0.00 ? 15 GLN A CA   10 
ATOM 7278  C C    . GLN A 1 15 ? -5.594  5.749   -1.198  1.00 0.00 ? 15 GLN A C    10 
ATOM 7279  O O    . GLN A 1 15 ? -4.852  6.461   -0.550  1.00 0.00 ? 15 GLN A O    10 
ATOM 7280  C CB   . GLN A 1 15 ? -8.092  5.782   -1.127  1.00 0.00 ? 15 GLN A CB   10 
ATOM 7281  C CG   . GLN A 1 15 ? -9.259  6.747   -1.349  1.00 0.00 ? 15 GLN A CG   10 
ATOM 7282  C CD   . GLN A 1 15 ? -10.312 6.532   -0.261  1.00 0.00 ? 15 GLN A CD   10 
ATOM 7283  O OE1  . GLN A 1 15 ? -10.656 5.411   0.055   1.00 0.00 ? 15 GLN A OE1  10 
ATOM 7284  N NE2  . GLN A 1 15 ? -10.843 7.568   0.330   1.00 0.00 ? 15 GLN A NE2  10 
ATOM 7285  H H    . GLN A 1 15 ? -7.526  5.166   -3.559  1.00 0.00 ? 15 GLN A H    10 
ATOM 7286  H HA   . GLN A 1 15 ? -6.835  7.382   -1.834  1.00 0.00 ? 15 GLN A HA   10 
ATOM 7287  H HB2  . GLN A 1 15 ? -8.352  4.806   -1.510  1.00 0.00 ? 15 GLN A HB2  10 
ATOM 7288  H HB3  . GLN A 1 15 ? -7.883  5.710   -0.071  1.00 0.00 ? 15 GLN A HB3  10 
ATOM 7289  H HG2  . GLN A 1 15 ? -8.897  7.764   -1.306  1.00 0.00 ? 15 GLN A HG2  10 
ATOM 7290  H HG3  . GLN A 1 15 ? -9.700  6.562   -2.316  1.00 0.00 ? 15 GLN A HG3  10 
ATOM 7291  H HE21 . GLN A 1 15 ? -10.566 8.473   0.075   1.00 0.00 ? 15 GLN A HE21 10 
ATOM 7292  H HE22 . GLN A 1 15 ? -11.519 7.441   1.028   1.00 0.00 ? 15 GLN A HE22 10 
ATOM 7293  N N    . LEU A 1 16 ? -5.328  4.482   -1.389  1.00 0.00 ? 16 LEU A N    10 
ATOM 7294  C CA   . LEU A 1 16 ? -4.097  3.890   -0.807  1.00 0.00 ? 16 LEU A CA   10 
ATOM 7295  C C    . LEU A 1 16 ? -2.909  4.567   -1.479  1.00 0.00 ? 16 LEU A C    10 
ATOM 7296  O O    . LEU A 1 16 ? -1.934  4.916   -0.845  1.00 0.00 ? 16 LEU A O    10 
ATOM 7297  C CB   . LEU A 1 16 ? -4.063  2.385   -1.083  1.00 0.00 ? 16 LEU A CB   10 
ATOM 7298  C CG   . LEU A 1 16 ? -4.349  1.622   0.212   1.00 0.00 ? 16 LEU A CG   10 
ATOM 7299  C CD1  . LEU A 1 16 ? -5.151  0.359   -0.106  1.00 0.00 ? 16 LEU A CD1  10 
ATOM 7300  C CD2  . LEU A 1 16 ? -3.027  1.232   0.876   1.00 0.00 ? 16 LEU A CD2  10 
ATOM 7301  H H    . LEU A 1 16 ? -5.924  3.932   -1.937  1.00 0.00 ? 16 LEU A H    10 
ATOM 7302  H HA   . LEU A 1 16 ? -4.070  4.072   0.257   1.00 0.00 ? 16 LEU A HA   10 
ATOM 7303  H HB2  . LEU A 1 16 ? -4.812  2.137   -1.821  1.00 0.00 ? 16 LEU A HB2  10 
ATOM 7304  H HB3  . LEU A 1 16 ? -3.087  2.109   -1.453  1.00 0.00 ? 16 LEU A HB3  10 
ATOM 7305  H HG   . LEU A 1 16 ? -4.919  2.251   0.881   1.00 0.00 ? 16 LEU A HG   10 
ATOM 7306  H HD11 . LEU A 1 16 ? -6.205  0.560   0.020   1.00 0.00 ? 16 LEU A HD11 10 
ATOM 7307  H HD12 . LEU A 1 16 ? -4.853  -0.434  0.565   1.00 0.00 ? 16 LEU A HD12 10 
ATOM 7308  H HD13 . LEU A 1 16 ? -4.961  0.058   -1.125  1.00 0.00 ? 16 LEU A HD13 10 
ATOM 7309  H HD21 . LEU A 1 16 ? -3.213  0.921   1.893   1.00 0.00 ? 16 LEU A HD21 10 
ATOM 7310  H HD22 . LEU A 1 16 ? -2.359  2.081   0.875   1.00 0.00 ? 16 LEU A HD22 10 
ATOM 7311  H HD23 . LEU A 1 16 ? -2.575  0.419   0.327   1.00 0.00 ? 16 LEU A HD23 10 
ATOM 7312  N N    . GLU A 1 17 ? -3.000  4.781   -2.765  1.00 0.00 ? 17 GLU A N    10 
ATOM 7313  C CA   . GLU A 1 17 ? -1.895  5.466   -3.482  1.00 0.00 ? 17 GLU A CA   10 
ATOM 7314  C C    . GLU A 1 17 ? -1.754  6.872   -2.903  1.00 0.00 ? 17 GLU A C    10 
ATOM 7315  O O    . GLU A 1 17 ? -0.669  7.332   -2.608  1.00 0.00 ? 17 GLU A O    10 
ATOM 7316  C CB   . GLU A 1 17 ? -2.226  5.559   -4.973  1.00 0.00 ? 17 GLU A CB   10 
ATOM 7317  C CG   . GLU A 1 17 ? -0.952  5.873   -5.760  1.00 0.00 ? 17 GLU A CG   10 
ATOM 7318  C CD   . GLU A 1 17 ? -0.922  7.361   -6.112  1.00 0.00 ? 17 GLU A CD   10 
ATOM 7319  O OE1  . GLU A 1 17 ? -0.911  8.167   -5.196  1.00 0.00 ? 17 GLU A OE1  10 
ATOM 7320  O OE2  . GLU A 1 17 ? -0.911  7.670   -7.292  1.00 0.00 ? 17 GLU A OE2  10 
ATOM 7321  H H    . GLU A 1 17 ? -3.806  4.504   -3.252  1.00 0.00 ? 17 GLU A H    10 
ATOM 7322  H HA   . GLU A 1 17 ? -0.978  4.919   -3.343  1.00 0.00 ? 17 GLU A HA   10 
ATOM 7323  H HB2  . GLU A 1 17 ? -2.638  4.620   -5.311  1.00 0.00 ? 17 GLU A HB2  10 
ATOM 7324  H HB3  . GLU A 1 17 ? -2.947  6.346   -5.133  1.00 0.00 ? 17 GLU A HB3  10 
ATOM 7325  H HG2  . GLU A 1 17 ? -0.088  5.627   -5.158  1.00 0.00 ? 17 GLU A HG2  10 
ATOM 7326  H HG3  . GLU A 1 17 ? -0.936  5.290   -6.668  1.00 0.00 ? 17 GLU A HG3  10 
ATOM 7327  N N    . ASN A 1 18 ? -2.855  7.552   -2.727  1.00 0.00 ? 18 ASN A N    10 
ATOM 7328  C CA   . ASN A 1 18 ? -2.803  8.925   -2.153  1.00 0.00 ? 18 ASN A CA   10 
ATOM 7329  C C    . ASN A 1 18 ? -2.112  8.874   -0.788  1.00 0.00 ? 18 ASN A C    10 
ATOM 7330  O O    . ASN A 1 18 ? -1.619  9.868   -0.293  1.00 0.00 ? 18 ASN A O    10 
ATOM 7331  C CB   . ASN A 1 18 ? -4.225  9.465   -1.981  1.00 0.00 ? 18 ASN A CB   10 
ATOM 7332  C CG   . ASN A 1 18 ? -4.911  9.595   -3.347  1.00 0.00 ? 18 ASN A CG   10 
ATOM 7333  O OD1  . ASN A 1 18 ? -6.047  10.017  -3.425  1.00 0.00 ? 18 ASN A OD1  10 
ATOM 7334  N ND2  . ASN A 1 18 ? -4.273  9.250   -4.435  1.00 0.00 ? 18 ASN A ND2  10 
ATOM 7335  H H    . ASN A 1 18 ? -3.720  7.154   -2.967  1.00 0.00 ? 18 ASN A H    10 
ATOM 7336  H HA   . ASN A 1 18 ? -2.247  9.573   -2.815  1.00 0.00 ? 18 ASN A HA   10 
ATOM 7337  H HB2  . ASN A 1 18 ? -4.792  8.787   -1.359  1.00 0.00 ? 18 ASN A HB2  10 
ATOM 7338  H HB3  . ASN A 1 18 ? -4.185  10.435  -1.509  1.00 0.00 ? 18 ASN A HB3  10 
ATOM 7339  H HD21 . ASN A 1 18 ? -3.357  8.909   -4.383  1.00 0.00 ? 18 ASN A HD21 10 
ATOM 7340  H HD22 . ASN A 1 18 ? -4.714  9.332   -5.305  1.00 0.00 ? 18 ASN A HD22 10 
ATOM 7341  N N    . TYR A 1 19 ? -2.067  7.719   -0.177  1.00 0.00 ? 19 TYR A N    10 
ATOM 7342  C CA   . TYR A 1 19 ? -1.403  7.606   1.149   1.00 0.00 ? 19 TYR A CA   10 
ATOM 7343  C C    . TYR A 1 19 ? -0.013  8.217   1.044   1.00 0.00 ? 19 TYR A C    10 
ATOM 7344  O O    . TYR A 1 19 ? 0.341   9.120   1.776   1.00 0.00 ? 19 TYR A O    10 
ATOM 7345  C CB   . TYR A 1 19 ? -1.284  6.127   1.534   1.00 0.00 ? 19 TYR A CB   10 
ATOM 7346  C CG   . TYR A 1 19 ? -0.511  5.995   2.825   1.00 0.00 ? 19 TYR A CG   10 
ATOM 7347  C CD1  . TYR A 1 19 ? -0.515  7.041   3.754   1.00 0.00 ? 19 TYR A CD1  10 
ATOM 7348  C CD2  . TYR A 1 19 ? 0.207   4.822   3.092   1.00 0.00 ? 19 TYR A CD2  10 
ATOM 7349  C CE1  . TYR A 1 19 ? 0.199   6.915   4.952   1.00 0.00 ? 19 TYR A CE1  10 
ATOM 7350  C CE2  . TYR A 1 19 ? 0.920   4.697   4.290   1.00 0.00 ? 19 TYR A CE2  10 
ATOM 7351  C CZ   . TYR A 1 19 ? 0.916   5.743   5.220   1.00 0.00 ? 19 TYR A CZ   10 
ATOM 7352  O OH   . TYR A 1 19 ? 1.619   5.619   6.401   1.00 0.00 ? 19 TYR A OH   10 
ATOM 7353  H H    . TYR A 1 19 ? -2.460  6.928   -0.595  1.00 0.00 ? 19 TYR A H    10 
ATOM 7354  H HA   . TYR A 1 19 ? -1.980  8.133   1.894   1.00 0.00 ? 19 TYR A HA   10 
ATOM 7355  H HB2  . TYR A 1 19 ? -2.271  5.708   1.663   1.00 0.00 ? 19 TYR A HB2  10 
ATOM 7356  H HB3  . TYR A 1 19 ? -0.766  5.593   0.752   1.00 0.00 ? 19 TYR A HB3  10 
ATOM 7357  H HD1  . TYR A 1 19 ? -1.066  7.945   3.547   1.00 0.00 ? 19 TYR A HD1  10 
ATOM 7358  H HD2  . TYR A 1 19 ? 0.211   4.015   2.374   1.00 0.00 ? 19 TYR A HD2  10 
ATOM 7359  H HE1  . TYR A 1 19 ? 0.195   7.722   5.669   1.00 0.00 ? 19 TYR A HE1  10 
ATOM 7360  H HE2  . TYR A 1 19 ? 1.472   3.792   4.497   1.00 0.00 ? 19 TYR A HE2  10 
ATOM 7361  H HH   . TYR A 1 19 ? 1.237   4.893   6.899   1.00 0.00 ? 19 TYR A HH   10 
ATOM 7362  N N    . CYS A 1 20 ? 0.766   7.733   0.119   1.00 0.00 ? 20 CYS A N    10 
ATOM 7363  C CA   . CYS A 1 20 ? 2.142   8.273   -0.074  1.00 0.00 ? 20 CYS A CA   10 
ATOM 7364  C C    . CYS A 1 20 ? 2.787   8.570   1.283   1.00 0.00 ? 20 CYS A C    10 
ATOM 7365  O O    . CYS A 1 20 ? 2.346   8.092   2.309   1.00 0.00 ? 20 CYS A O    10 
ATOM 7366  C CB   . CYS A 1 20 ? 2.064   9.549   -0.909  1.00 0.00 ? 20 CYS A CB   10 
ATOM 7367  S SG   . CYS A 1 20 ? 1.397   9.142   -2.543  1.00 0.00 ? 20 CYS A SG   10 
ATOM 7368  H H    . CYS A 1 20 ? 0.437   7.013   -0.462  1.00 0.00 ? 20 CYS A H    10 
ATOM 7369  H HA   . CYS A 1 20 ? 2.737   7.547   -0.598  1.00 0.00 ? 20 CYS A HA   10 
ATOM 7370  H HB2  . CYS A 1 20 ? 1.417   10.263  -0.420  1.00 0.00 ? 20 CYS A HB2  10 
ATOM 7371  H HB3  . CYS A 1 20 ? 3.052   9.972   -1.018  1.00 0.00 ? 20 CYS A HB3  10 
ATOM 7372  N N    . ASN A 1 21 ? 3.832   9.349   1.295   1.00 0.00 ? 21 ASN A N    10 
ATOM 7373  C CA   . ASN A 1 21 ? 4.506   9.671   2.585   1.00 0.00 ? 21 ASN A CA   10 
ATOM 7374  C C    . ASN A 1 21 ? 5.840   10.365  2.305   1.00 0.00 ? 21 ASN A C    10 
ATOM 7375  O O    . ASN A 1 21 ? 6.449   10.837  3.251   1.00 0.00 ? 21 ASN A O    10 
ATOM 7376  C CB   . ASN A 1 21 ? 4.756   8.378   3.367   1.00 0.00 ? 21 ASN A CB   10 
ATOM 7377  C CG   . ASN A 1 21 ? 4.140   8.498   4.763   1.00 0.00 ? 21 ASN A CG   10 
ATOM 7378  O OD1  . ASN A 1 21 ? 3.241   9.286   4.977   1.00 0.00 ? 21 ASN A OD1  10 
ATOM 7379  N ND2  . ASN A 1 21 ? 4.590   7.743   5.728   1.00 0.00 ? 21 ASN A ND2  10 
ATOM 7380  O OXT  . ASN A 1 21 ? 6.230   10.412  1.150   1.00 0.00 ? 21 ASN A OXT  10 
ATOM 7381  H H    . ASN A 1 21 ? 4.176   9.721   0.457   1.00 0.00 ? 21 ASN A H    10 
ATOM 7382  H HA   . ASN A 1 21 ? 3.875   10.326  3.167   1.00 0.00 ? 21 ASN A HA   10 
ATOM 7383  H HB2  . ASN A 1 21 ? 4.304   7.547   2.844   1.00 0.00 ? 21 ASN A HB2  10 
ATOM 7384  H HB3  . ASN A 1 21 ? 5.818   8.211   3.458   1.00 0.00 ? 21 ASN A HB3  10 
ATOM 7385  H HD21 . ASN A 1 21 ? 5.315   7.107   5.556   1.00 0.00 ? 21 ASN A HD21 10 
ATOM 7386  H HD22 . ASN A 1 21 ? 4.202   7.813   6.626   1.00 0.00 ? 21 ASN A HD22 10 
ATOM 7387  N N    . PHE B 2 1  ? -6.832  1.435   -11.168 1.00 0.00 ? 1  PHE B N    10 
ATOM 7388  C CA   . PHE B 2 1  ? -6.882  0.038   -11.684 1.00 0.00 ? 1  PHE B CA   10 
ATOM 7389  C C    . PHE B 2 1  ? -7.302  -0.907  -10.557 1.00 0.00 ? 1  PHE B C    10 
ATOM 7390  O O    . PHE B 2 1  ? -7.817  -0.487  -9.540  1.00 0.00 ? 1  PHE B O    10 
ATOM 7391  C CB   . PHE B 2 1  ? -5.499  -0.365  -12.199 1.00 0.00 ? 1  PHE B CB   10 
ATOM 7392  C CG   . PHE B 2 1  ? -5.653  -1.239  -13.420 1.00 0.00 ? 1  PHE B CG   10 
ATOM 7393  C CD1  . PHE B 2 1  ? -6.266  -0.731  -14.572 1.00 0.00 ? 1  PHE B CD1  10 
ATOM 7394  C CD2  . PHE B 2 1  ? -5.185  -2.558  -13.400 1.00 0.00 ? 1  PHE B CD2  10 
ATOM 7395  C CE1  . PHE B 2 1  ? -6.410  -1.543  -15.704 1.00 0.00 ? 1  PHE B CE1  10 
ATOM 7396  C CE2  . PHE B 2 1  ? -5.329  -3.370  -14.532 1.00 0.00 ? 1  PHE B CE2  10 
ATOM 7397  C CZ   . PHE B 2 1  ? -5.941  -2.862  -15.684 1.00 0.00 ? 1  PHE B CZ   10 
ATOM 7398  H H1   . PHE B 2 1  ? -5.845  1.700   -10.977 1.00 0.00 ? 1  PHE B H1   10 
ATOM 7399  H H2   . PHE B 2 1  ? -7.386  1.499   -10.289 1.00 0.00 ? 1  PHE B H2   10 
ATOM 7400  H H3   . PHE B 2 1  ? -7.231  2.082   -11.877 1.00 0.00 ? 1  PHE B H3   10 
ATOM 7401  H HA   . PHE B 2 1  ? -7.597  -0.022  -12.490 1.00 0.00 ? 1  PHE B HA   10 
ATOM 7402  H HB2  . PHE B 2 1  ? -4.939  0.522   -12.459 1.00 0.00 ? 1  PHE B HB2  10 
ATOM 7403  H HB3  . PHE B 2 1  ? -4.973  -0.911  -11.430 1.00 0.00 ? 1  PHE B HB3  10 
ATOM 7404  H HD1  . PHE B 2 1  ? -6.627  0.286   -14.587 1.00 0.00 ? 1  PHE B HD1  10 
ATOM 7405  H HD2  . PHE B 2 1  ? -4.712  -2.950  -12.511 1.00 0.00 ? 1  PHE B HD2  10 
ATOM 7406  H HE1  . PHE B 2 1  ? -6.882  -1.151  -16.592 1.00 0.00 ? 1  PHE B HE1  10 
ATOM 7407  H HE2  . PHE B 2 1  ? -4.968  -4.387  -14.516 1.00 0.00 ? 1  PHE B HE2  10 
ATOM 7408  H HZ   . PHE B 2 1  ? -6.053  -3.487  -16.557 1.00 0.00 ? 1  PHE B HZ   10 
ATOM 7409  N N    . VAL B 2 2  ? -7.088  -2.183  -10.731 1.00 0.00 ? 2  VAL B N    10 
ATOM 7410  C CA   . VAL B 2 2  ? -7.476  -3.155  -9.670  1.00 0.00 ? 2  VAL B CA   10 
ATOM 7411  C C    . VAL B 2 2  ? -6.322  -4.127  -9.421  1.00 0.00 ? 2  VAL B C    10 
ATOM 7412  O O    . VAL B 2 2  ? -5.816  -4.752  -10.332 1.00 0.00 ? 2  VAL B O    10 
ATOM 7413  C CB   . VAL B 2 2  ? -8.711  -3.935  -10.123 1.00 0.00 ? 2  VAL B CB   10 
ATOM 7414  C CG1  . VAL B 2 2  ? -8.978  -5.082  -9.147  1.00 0.00 ? 2  VAL B CG1  10 
ATOM 7415  C CG2  . VAL B 2 2  ? -9.922  -3.000  -10.152 1.00 0.00 ? 2  VAL B CG2  10 
ATOM 7416  H H    . VAL B 2 2  ? -6.672  -2.501  -11.559 1.00 0.00 ? 2  VAL B H    10 
ATOM 7417  H HA   . VAL B 2 2  ? -7.702  -2.622  -8.759  1.00 0.00 ? 2  VAL B HA   10 
ATOM 7418  H HB   . VAL B 2 2  ? -8.540  -4.337  -11.112 1.00 0.00 ? 2  VAL B HB   10 
ATOM 7419  H HG11 . VAL B 2 2  ? -8.334  -4.979  -8.286  1.00 0.00 ? 2  VAL B HG11 10 
ATOM 7420  H HG12 . VAL B 2 2  ? -8.778  -6.024  -9.635  1.00 0.00 ? 2  VAL B HG12 10 
ATOM 7421  H HG13 . VAL B 2 2  ? -10.010 -5.053  -8.830  1.00 0.00 ? 2  VAL B HG13 10 
ATOM 7422  H HG21 . VAL B 2 2  ? -10.454 -3.129  -11.083 1.00 0.00 ? 2  VAL B HG21 10 
ATOM 7423  H HG22 . VAL B 2 2  ? -9.588  -1.976  -10.068 1.00 0.00 ? 2  VAL B HG22 10 
ATOM 7424  H HG23 . VAL B 2 2  ? -10.578 -3.234  -9.327  1.00 0.00 ? 2  VAL B HG23 10 
ATOM 7425  N N    . ASN B 2 3  ? -5.903  -4.263  -8.192  1.00 0.00 ? 3  ASN B N    10 
ATOM 7426  C CA   . ASN B 2 3  ? -4.783  -5.197  -7.886  1.00 0.00 ? 3  ASN B CA   10 
ATOM 7427  C C    . ASN B 2 3  ? -5.352  -6.508  -7.342  1.00 0.00 ? 3  ASN B C    10 
ATOM 7428  O O    . ASN B 2 3  ? -4.860  -7.580  -7.633  1.00 0.00 ? 3  ASN B O    10 
ATOM 7429  C CB   . ASN B 2 3  ? -3.862  -4.567  -6.839  1.00 0.00 ? 3  ASN B CB   10 
ATOM 7430  C CG   . ASN B 2 3  ? -4.672  -4.224  -5.587  1.00 0.00 ? 3  ASN B CG   10 
ATOM 7431  O OD1  . ASN B 2 3  ? -4.883  -5.066  -4.737  1.00 0.00 ? 3  ASN B OD1  10 
ATOM 7432  N ND2  . ASN B 2 3  ? -5.137  -3.014  -5.437  1.00 0.00 ? 3  ASN B ND2  10 
ATOM 7433  H H    . ASN B 2 3  ? -6.326  -3.752  -7.471  1.00 0.00 ? 3  ASN B H    10 
ATOM 7434  H HA   . ASN B 2 3  ? -4.223  -5.395  -8.786  1.00 0.00 ? 3  ASN B HA   10 
ATOM 7435  H HB2  . ASN B 2 3  ? -3.078  -5.265  -6.582  1.00 0.00 ? 3  ASN B HB2  10 
ATOM 7436  H HB3  . ASN B 2 3  ? -3.424  -3.665  -7.241  1.00 0.00 ? 3  ASN B HB3  10 
ATOM 7437  H HD21 . ASN B 2 3  ? -4.966  -2.335  -6.123  1.00 0.00 ? 3  ASN B HD21 10 
ATOM 7438  H HD22 . ASN B 2 3  ? -5.657  -2.784  -4.639  1.00 0.00 ? 3  ASN B HD22 10 
ATOM 7439  N N    . GLN B 2 4  ? -6.389  -6.427  -6.558  1.00 0.00 ? 4  GLN B N    10 
ATOM 7440  C CA   . GLN B 2 4  ? -6.999  -7.663  -5.994  1.00 0.00 ? 4  GLN B CA   10 
ATOM 7441  C C    . GLN B 2 4  ? -6.020  -8.327  -5.026  1.00 0.00 ? 4  GLN B C    10 
ATOM 7442  O O    . GLN B 2 4  ? -5.884  -9.534  -4.996  1.00 0.00 ? 4  GLN B O    10 
ATOM 7443  C CB   . GLN B 2 4  ? -7.330  -8.633  -7.131  1.00 0.00 ? 4  GLN B CB   10 
ATOM 7444  C CG   . GLN B 2 4  ? -8.773  -9.119  -6.986  1.00 0.00 ? 4  GLN B CG   10 
ATOM 7445  C CD   . GLN B 2 4  ? -8.902  -10.522 -7.581  1.00 0.00 ? 4  GLN B CD   10 
ATOM 7446  O OE1  . GLN B 2 4  ? -8.235  -11.441 -7.149  1.00 0.00 ? 4  GLN B OE1  10 
ATOM 7447  N NE2  . GLN B 2 4  ? -9.737  -10.727 -8.563  1.00 0.00 ? 4  GLN B NE2  10 
ATOM 7448  H H    . GLN B 2 4  ? -6.769  -5.550  -6.341  1.00 0.00 ? 4  GLN B H    10 
ATOM 7449  H HA   . GLN B 2 4  ? -7.904  -7.406  -5.465  1.00 0.00 ? 4  GLN B HA   10 
ATOM 7450  H HB2  . GLN B 2 4  ? -7.212  -8.128  -8.079  1.00 0.00 ? 4  GLN B HB2  10 
ATOM 7451  H HB3  . GLN B 2 4  ? -6.661  -9.479  -7.087  1.00 0.00 ? 4  GLN B HB3  10 
ATOM 7452  H HG2  . GLN B 2 4  ? -9.041  -9.144  -5.939  1.00 0.00 ? 4  GLN B HG2  10 
ATOM 7453  H HG3  . GLN B 2 4  ? -9.434  -8.445  -7.510  1.00 0.00 ? 4  GLN B HG3  10 
ATOM 7454  H HE21 . GLN B 2 4  ? -10.274 -9.986  -8.912  1.00 0.00 ? 4  GLN B HE21 10 
ATOM 7455  H HE22 . GLN B 2 4  ? -9.826  -11.622 -8.952  1.00 0.00 ? 4  GLN B HE22 10 
ATOM 7456  N N    . HIS B 2 5  ? -5.338  -7.550  -4.231  1.00 0.00 ? 5  HIS B N    10 
ATOM 7457  C CA   . HIS B 2 5  ? -4.370  -8.146  -3.263  1.00 0.00 ? 5  HIS B CA   10 
ATOM 7458  C C    . HIS B 2 5  ? -5.107  -9.135  -2.355  1.00 0.00 ? 5  HIS B C    10 
ATOM 7459  O O    . HIS B 2 5  ? -6.292  -9.009  -2.118  1.00 0.00 ? 5  HIS B O    10 
ATOM 7460  C CB   . HIS B 2 5  ? -3.737  -7.042  -2.411  1.00 0.00 ? 5  HIS B CB   10 
ATOM 7461  C CG   . HIS B 2 5  ? -4.747  -5.960  -2.163  1.00 0.00 ? 5  HIS B CG   10 
ATOM 7462  N ND1  . HIS B 2 5  ? -6.109  -6.203  -2.207  1.00 0.00 ? 5  HIS B ND1  10 
ATOM 7463  C CD2  . HIS B 2 5  ? -4.613  -4.623  -1.881  1.00 0.00 ? 5  HIS B CD2  10 
ATOM 7464  C CE1  . HIS B 2 5  ? -6.736  -5.041  -1.960  1.00 0.00 ? 5  HIS B CE1  10 
ATOM 7465  N NE2  . HIS B 2 5  ? -5.871  -4.044  -1.753  1.00 0.00 ? 5  HIS B NE2  10 
ATOM 7466  H H    . HIS B 2 5  ? -5.464  -6.578  -4.270  1.00 0.00 ? 5  HIS B H    10 
ATOM 7467  H HA   . HIS B 2 5  ? -3.598  -8.666  -3.808  1.00 0.00 ? 5  HIS B HA   10 
ATOM 7468  H HB2  . HIS B 2 5  ? -3.415  -7.457  -1.467  1.00 0.00 ? 5  HIS B HB2  10 
ATOM 7469  H HB3  . HIS B 2 5  ? -2.887  -6.628  -2.931  1.00 0.00 ? 5  HIS B HB3  10 
ATOM 7470  H HD1  . HIS B 2 5  ? -6.538  -7.066  -2.386  1.00 0.00 ? 5  HIS B HD1  10 
ATOM 7471  H HD2  . HIS B 2 5  ? -3.673  -4.101  -1.775  1.00 0.00 ? 5  HIS B HD2  10 
ATOM 7472  H HE1  . HIS B 2 5  ? -7.806  -4.928  -1.939  1.00 0.00 ? 5  HIS B HE1  10 
ATOM 7473  N N    . LEU B 2 6  ? -4.417  -10.122 -1.850  1.00 0.00 ? 6  LEU B N    10 
ATOM 7474  C CA   . LEU B 2 6  ? -5.081  -11.121 -0.964  1.00 0.00 ? 6  LEU B CA   10 
ATOM 7475  C C    . LEU B 2 6  ? -5.003  -10.658 0.493   1.00 0.00 ? 6  LEU B C    10 
ATOM 7476  O O    . LEU B 2 6  ? -5.198  -11.433 1.408   1.00 0.00 ? 6  LEU B O    10 
ATOM 7477  C CB   . LEU B 2 6  ? -4.377  -12.473 -1.105  1.00 0.00 ? 6  LEU B CB   10 
ATOM 7478  C CG   . LEU B 2 6  ? -4.310  -12.863 -2.582  1.00 0.00 ? 6  LEU B CG   10 
ATOM 7479  C CD1  . LEU B 2 6  ? -3.094  -12.202 -3.232  1.00 0.00 ? 6  LEU B CD1  10 
ATOM 7480  C CD2  . LEU B 2 6  ? -4.186  -14.384 -2.700  1.00 0.00 ? 6  LEU B CD2  10 
ATOM 7481  H H    . LEU B 2 6  ? -3.463  -10.209 -2.058  1.00 0.00 ? 6  LEU B H    10 
ATOM 7482  H HA   . LEU B 2 6  ? -6.116  -11.225 -1.253  1.00 0.00 ? 6  LEU B HA   10 
ATOM 7483  H HB2  . LEU B 2 6  ? -3.375  -12.400 -0.706  1.00 0.00 ? 6  LEU B HB2  10 
ATOM 7484  H HB3  . LEU B 2 6  ? -4.928  -13.224 -0.560  1.00 0.00 ? 6  LEU B HB3  10 
ATOM 7485  H HG   . LEU B 2 6  ? -5.210  -12.533 -3.082  1.00 0.00 ? 6  LEU B HG   10 
ATOM 7486  H HD11 . LEU B 2 6  ? -2.600  -12.912 -3.879  1.00 0.00 ? 6  LEU B HD11 10 
ATOM 7487  H HD12 . LEU B 2 6  ? -2.408  -11.876 -2.464  1.00 0.00 ? 6  LEU B HD12 10 
ATOM 7488  H HD13 . LEU B 2 6  ? -3.415  -11.350 -3.813  1.00 0.00 ? 6  LEU B HD13 10 
ATOM 7489  H HD21 . LEU B 2 6  ? -5.086  -14.849 -2.326  1.00 0.00 ? 6  LEU B HD21 10 
ATOM 7490  H HD22 . LEU B 2 6  ? -3.339  -14.722 -2.123  1.00 0.00 ? 6  LEU B HD22 10 
ATOM 7491  H HD23 . LEU B 2 6  ? -4.046  -14.654 -3.737  1.00 0.00 ? 6  LEU B HD23 10 
ATOM 7492  N N    . CYS B 2 7  ? -4.718  -9.404  0.717   1.00 0.00 ? 7  CYS B N    10 
ATOM 7493  C CA   . CYS B 2 7  ? -4.626  -8.894  2.116   1.00 0.00 ? 7  CYS B CA   10 
ATOM 7494  C C    . CYS B 2 7  ? -3.464  -9.579  2.835   1.00 0.00 ? 7  CYS B C    10 
ATOM 7495  O O    . CYS B 2 7  ? -3.569  -10.703 3.284   1.00 0.00 ? 7  CYS B O    10 
ATOM 7496  C CB   . CYS B 2 7  ? -5.930  -9.180  2.864   1.00 0.00 ? 7  CYS B CB   10 
ATOM 7497  S SG   . CYS B 2 7  ? -5.759  -8.644  4.585   1.00 0.00 ? 7  CYS B SG   10 
ATOM 7498  H H    . CYS B 2 7  ? -4.558  -8.797  -0.035  1.00 0.00 ? 7  CYS B H    10 
ATOM 7499  H HA   . CYS B 2 7  ? -4.453  -7.828  2.095   1.00 0.00 ? 7  CYS B HA   10 
ATOM 7500  H HB2  . CYS B 2 7  ? -6.740  -8.639  2.396   1.00 0.00 ? 7  CYS B HB2  10 
ATOM 7501  H HB3  . CYS B 2 7  ? -6.139  -10.238 2.835   1.00 0.00 ? 7  CYS B HB3  10 
ATOM 7502  N N    . GLY B 2 8  ? -2.356  -8.904  2.940   1.00 0.00 ? 8  GLY B N    10 
ATOM 7503  C CA   . GLY B 2 8  ? -1.171  -9.498  3.622   1.00 0.00 ? 8  GLY B CA   10 
ATOM 7504  C C    . GLY B 2 8  ? 0.093   -8.999  2.927   1.00 0.00 ? 8  GLY B C    10 
ATOM 7505  O O    . GLY B 2 8  ? 0.552   -7.900  3.167   1.00 0.00 ? 8  GLY B O    10 
ATOM 7506  H H    . GLY B 2 8  ? -2.300  -8.002  2.564   1.00 0.00 ? 8  GLY B H    10 
ATOM 7507  H HA2  . GLY B 2 8  ? -1.162  -9.195  4.660   1.00 0.00 ? 8  GLY B HA2  10 
ATOM 7508  H HA3  . GLY B 2 8  ? -1.215  -10.574 3.557   1.00 0.00 ? 8  GLY B HA3  10 
ATOM 7509  N N    . SER B 2 9  ? 0.649   -9.787  2.051   1.00 0.00 ? 9  SER B N    10 
ATOM 7510  C CA   . SER B 2 9  ? 1.870   -9.344  1.327   1.00 0.00 ? 9  SER B CA   10 
ATOM 7511  C C    . SER B 2 9  ? 1.441   -8.496  0.128   1.00 0.00 ? 9  SER B C    10 
ATOM 7512  O O    . SER B 2 9  ? 2.082   -7.527  -0.225  1.00 0.00 ? 9  SER B O    10 
ATOM 7513  C CB   . SER B 2 9  ? 2.652   -10.565 0.840   1.00 0.00 ? 9  SER B CB   10 
ATOM 7514  O OG   . SER B 2 9  ? 3.889   -10.638 1.536   1.00 0.00 ? 9  SER B OG   10 
ATOM 7515  H H    . SER B 2 9  ? 0.256   -10.664 1.860   1.00 0.00 ? 9  SER B H    10 
ATOM 7516  H HA   . SER B 2 9  ? 2.489   -8.753  1.986   1.00 0.00 ? 9  SER B HA   10 
ATOM 7517  H HB2  . SER B 2 9  ? 2.083   -11.459 1.033   1.00 0.00 ? 9  SER B HB2  10 
ATOM 7518  H HB3  . SER B 2 9  ? 2.830   -10.476 -0.224  1.00 0.00 ? 9  SER B HB3  10 
ATOM 7519  H HG   . SER B 2 9  ? 4.396   -11.364 1.165   1.00 0.00 ? 9  SER B HG   10 
ATOM 7520  N N    . HIS B 2 10 ? 0.353   -8.859  -0.495  1.00 0.00 ? 10 HIS B N    10 
ATOM 7521  C CA   . HIS B 2 10 ? -0.137  -8.087  -1.666  1.00 0.00 ? 10 HIS B CA   10 
ATOM 7522  C C    . HIS B 2 10 ? -0.670  -6.729  -1.202  1.00 0.00 ? 10 HIS B C    10 
ATOM 7523  O O    . HIS B 2 10 ? -0.370  -5.703  -1.779  1.00 0.00 ? 10 HIS B O    10 
ATOM 7524  C CB   . HIS B 2 10 ? -1.263  -8.866  -2.348  1.00 0.00 ? 10 HIS B CB   10 
ATOM 7525  C CG   . HIS B 2 10 ? -0.678  -10.004 -3.138  1.00 0.00 ? 10 HIS B CG   10 
ATOM 7526  N ND1  . HIS B 2 10 ? -0.939  -10.177 -4.488  1.00 0.00 ? 10 HIS B ND1  10 
ATOM 7527  C CD2  . HIS B 2 10 ? 0.155   -11.036 -2.782  1.00 0.00 ? 10 HIS B CD2  10 
ATOM 7528  C CE1  . HIS B 2 10 ? -0.274  -11.275 -4.892  1.00 0.00 ? 10 HIS B CE1  10 
ATOM 7529  N NE2  . HIS B 2 10 ? 0.409   -11.837 -3.891  1.00 0.00 ? 10 HIS B NE2  10 
ATOM 7530  H H    . HIS B 2 10 ? -0.145  -9.641  -0.189  1.00 0.00 ? 10 HIS B H    10 
ATOM 7531  H HA   . HIS B 2 10 ? 0.672   -7.941  -2.361  1.00 0.00 ? 10 HIS B HA   10 
ATOM 7532  H HB2  . HIS B 2 10 ? -1.935  -9.255  -1.597  1.00 0.00 ? 10 HIS B HB2  10 
ATOM 7533  H HB3  . HIS B 2 10 ? -1.805  -8.209  -3.011  1.00 0.00 ? 10 HIS B HB3  10 
ATOM 7534  H HD1  . HIS B 2 10 ? -1.505  -9.604  -5.047  1.00 0.00 ? 10 HIS B HD1  10 
ATOM 7535  H HD2  . HIS B 2 10 ? 0.553   -11.200 -1.791  1.00 0.00 ? 10 HIS B HD2  10 
ATOM 7536  H HE1  . HIS B 2 10 ? -0.290  -11.656 -5.902  1.00 0.00 ? 10 HIS B HE1  10 
ATOM 7537  N N    . LEU B 2 11 ? -1.462  -6.715  -0.163  1.00 0.00 ? 11 LEU B N    10 
ATOM 7538  C CA   . LEU B 2 11 ? -2.017  -5.424  0.334   1.00 0.00 ? 11 LEU B CA   10 
ATOM 7539  C C    . LEU B 2 11 ? -0.870  -4.504  0.751   1.00 0.00 ? 11 LEU B C    10 
ATOM 7540  O O    . LEU B 2 11 ? -0.842  -3.339  0.410   1.00 0.00 ? 11 LEU B O    10 
ATOM 7541  C CB   . LEU B 2 11 ? -2.924  -5.686  1.539   1.00 0.00 ? 11 LEU B CB   10 
ATOM 7542  C CG   . LEU B 2 11 ? -3.485  -4.361  2.060   1.00 0.00 ? 11 LEU B CG   10 
ATOM 7543  C CD1  . LEU B 2 11 ? -4.026  -3.536  0.892   1.00 0.00 ? 11 LEU B CD1  10 
ATOM 7544  C CD2  . LEU B 2 11 ? -4.619  -4.644  3.048   1.00 0.00 ? 11 LEU B CD2  10 
ATOM 7545  H H    . LEU B 2 11 ? -1.694  -7.554  0.287   1.00 0.00 ? 11 LEU B H    10 
ATOM 7546  H HA   . LEU B 2 11 ? -2.589  -4.953  -0.451  1.00 0.00 ? 11 LEU B HA   10 
ATOM 7547  H HB2  . LEU B 2 11 ? -3.738  -6.331  1.242   1.00 0.00 ? 11 LEU B HB2  10 
ATOM 7548  H HB3  . LEU B 2 11 ? -2.353  -6.163  2.321   1.00 0.00 ? 11 LEU B HB3  10 
ATOM 7549  H HG   . LEU B 2 11 ? -2.701  -3.809  2.558   1.00 0.00 ? 11 LEU B HG   10 
ATOM 7550  H HD11 . LEU B 2 11 ? -4.435  -2.609  1.266   1.00 0.00 ? 11 LEU B HD11 10 
ATOM 7551  H HD12 . LEU B 2 11 ? -4.801  -4.093  0.387   1.00 0.00 ? 11 LEU B HD12 10 
ATOM 7552  H HD13 . LEU B 2 11 ? -3.225  -3.323  0.200   1.00 0.00 ? 11 LEU B HD13 10 
ATOM 7553  H HD21 . LEU B 2 11 ? -5.353  -5.283  2.580   1.00 0.00 ? 11 LEU B HD21 10 
ATOM 7554  H HD22 . LEU B 2 11 ? -5.084  -3.714  3.338   1.00 0.00 ? 11 LEU B HD22 10 
ATOM 7555  H HD23 . LEU B 2 11 ? -4.219  -5.135  3.923   1.00 0.00 ? 11 LEU B HD23 10 
ATOM 7556  N N    . VAL B 2 12 ? 0.080   -5.017  1.484   1.00 0.00 ? 12 VAL B N    10 
ATOM 7557  C CA   . VAL B 2 12 ? 1.222   -4.164  1.913   1.00 0.00 ? 12 VAL B CA   10 
ATOM 7558  C C    . VAL B 2 12 ? 2.083   -3.838  0.698   1.00 0.00 ? 12 VAL B C    10 
ATOM 7559  O O    . VAL B 2 12 ? 2.412   -2.696  0.448   1.00 0.00 ? 12 VAL B O    10 
ATOM 7560  C CB   . VAL B 2 12 ? 2.058   -4.905  2.958   1.00 0.00 ? 12 VAL B CB   10 
ATOM 7561  C CG1  . VAL B 2 12 ? 3.338   -4.116  3.241   1.00 0.00 ? 12 VAL B CG1  10 
ATOM 7562  C CG2  . VAL B 2 12 ? 1.250   -5.046  4.250   1.00 0.00 ? 12 VAL B CG2  10 
ATOM 7563  H H    . VAL B 2 12 ? 0.043   -5.960  1.749   1.00 0.00 ? 12 VAL B H    10 
ATOM 7564  H HA   . VAL B 2 12 ? 0.843   -3.247  2.334   1.00 0.00 ? 12 VAL B HA   10 
ATOM 7565  H HB   . VAL B 2 12 ? 2.315   -5.886  2.583   1.00 0.00 ? 12 VAL B HB   10 
ATOM 7566  H HG11 . VAL B 2 12 ? 3.298   -3.168  2.725   1.00 0.00 ? 12 VAL B HG11 10 
ATOM 7567  H HG12 . VAL B 2 12 ? 4.192   -4.679  2.894   1.00 0.00 ? 12 VAL B HG12 10 
ATOM 7568  H HG13 . VAL B 2 12 ? 3.427   -3.944  4.303   1.00 0.00 ? 12 VAL B HG13 10 
ATOM 7569  H HG21 . VAL B 2 12 ? 0.404   -5.693  4.076   1.00 0.00 ? 12 VAL B HG21 10 
ATOM 7570  H HG22 . VAL B 2 12 ? 0.901   -4.073  4.563   1.00 0.00 ? 12 VAL B HG22 10 
ATOM 7571  H HG23 . VAL B 2 12 ? 1.876   -5.469  5.022   1.00 0.00 ? 12 VAL B HG23 10 
ATOM 7572  N N    . GLU B 2 13 ? 2.436   -4.827  -0.072  1.00 0.00 ? 13 GLU B N    10 
ATOM 7573  C CA   . GLU B 2 13 ? 3.255   -4.556  -1.279  1.00 0.00 ? 13 GLU B CA   10 
ATOM 7574  C C    . GLU B 2 13 ? 2.532   -3.503  -2.115  1.00 0.00 ? 13 GLU B C    10 
ATOM 7575  O O    . GLU B 2 13 ? 3.142   -2.714  -2.810  1.00 0.00 ? 13 GLU B O    10 
ATOM 7576  C CB   . GLU B 2 13 ? 3.415   -5.841  -2.094  1.00 0.00 ? 13 GLU B CB   10 
ATOM 7577  C CG   . GLU B 2 13 ? 4.553   -6.680  -1.508  1.00 0.00 ? 13 GLU B CG   10 
ATOM 7578  C CD   . GLU B 2 13 ? 5.878   -6.266  -2.152  1.00 0.00 ? 13 GLU B CD   10 
ATOM 7579  O OE1  . GLU B 2 13 ? 5.834   -5.591  -3.167  1.00 0.00 ? 13 GLU B OE1  10 
ATOM 7580  O OE2  . GLU B 2 13 ? 6.913   -6.630  -1.618  1.00 0.00 ? 13 GLU B OE2  10 
ATOM 7581  H H    . GLU B 2 13 ? 2.149   -5.741  0.136   1.00 0.00 ? 13 GLU B H    10 
ATOM 7582  H HA   . GLU B 2 13 ? 4.226   -4.185  -0.985  1.00 0.00 ? 13 GLU B HA   10 
ATOM 7583  H HB2  . GLU B 2 13 ? 2.495   -6.406  -2.058  1.00 0.00 ? 13 GLU B HB2  10 
ATOM 7584  H HB3  . GLU B 2 13 ? 3.646   -5.592  -3.119  1.00 0.00 ? 13 GLU B HB3  10 
ATOM 7585  H HG2  . GLU B 2 13 ? 4.605   -6.520  -0.440  1.00 0.00 ? 13 GLU B HG2  10 
ATOM 7586  H HG3  . GLU B 2 13 ? 4.370   -7.725  -1.707  1.00 0.00 ? 13 GLU B HG3  10 
ATOM 7587  N N    . ALA B 2 14 ? 1.228   -3.483  -2.042  1.00 0.00 ? 14 ALA B N    10 
ATOM 7588  C CA   . ALA B 2 14 ? 0.450   -2.482  -2.818  1.00 0.00 ? 14 ALA B CA   10 
ATOM 7589  C C    . ALA B 2 14 ? 0.696   -1.093  -2.233  1.00 0.00 ? 14 ALA B C    10 
ATOM 7590  O O    . ALA B 2 14 ? 0.954   -0.143  -2.944  1.00 0.00 ? 14 ALA B O    10 
ATOM 7591  C CB   . ALA B 2 14 ? -1.040  -2.817  -2.738  1.00 0.00 ? 14 ALA B CB   10 
ATOM 7592  H H    . ALA B 2 14 ? 0.761   -4.123  -1.466  1.00 0.00 ? 14 ALA B H    10 
ATOM 7593  H HA   . ALA B 2 14 ? 0.770   -2.503  -3.843  1.00 0.00 ? 14 ALA B HA   10 
ATOM 7594  H HB1  . ALA B 2 14 ? -1.165  -3.816  -2.347  1.00 0.00 ? 14 ALA B HB1  10 
ATOM 7595  H HB2  . ALA B 2 14 ? -1.476  -2.759  -3.724  1.00 0.00 ? 14 ALA B HB2  10 
ATOM 7596  H HB3  . ALA B 2 14 ? -1.533  -2.111  -2.085  1.00 0.00 ? 14 ALA B HB3  10 
ATOM 7597  N N    . LEU B 2 15 ? 0.623   -0.972  -0.938  1.00 0.00 ? 15 LEU B N    10 
ATOM 7598  C CA   . LEU B 2 15 ? 0.856   0.351   -0.299  1.00 0.00 ? 15 LEU B CA   10 
ATOM 7599  C C    . LEU B 2 15 ? 2.285   0.801   -0.615  1.00 0.00 ? 15 LEU B C    10 
ATOM 7600  O O    . LEU B 2 15 ? 2.541   1.961   -0.868  1.00 0.00 ? 15 LEU B O    10 
ATOM 7601  C CB   . LEU B 2 15 ? 0.619   0.226   1.224   1.00 0.00 ? 15 LEU B CB   10 
ATOM 7602  C CG   . LEU B 2 15 ? 1.897   0.523   2.022   1.00 0.00 ? 15 LEU B CG   10 
ATOM 7603  C CD1  . LEU B 2 15 ? 2.138   2.033   2.058   1.00 0.00 ? 15 LEU B CD1  10 
ATOM 7604  C CD2  . LEU B 2 15 ? 1.736   -0.001  3.451   1.00 0.00 ? 15 LEU B CD2  10 
ATOM 7605  H H    . LEU B 2 15 ? 0.418   -1.755  -0.386  1.00 0.00 ? 15 LEU B H    10 
ATOM 7606  H HA   . LEU B 2 15 ? 0.165   1.069   -0.711  1.00 0.00 ? 15 LEU B HA   10 
ATOM 7607  H HB2  . LEU B 2 15 ? -0.150  0.923   1.520   1.00 0.00 ? 15 LEU B HB2  10 
ATOM 7608  H HB3  . LEU B 2 15 ? 0.289   -0.779  1.447   1.00 0.00 ? 15 LEU B HB3  10 
ATOM 7609  H HG   . LEU B 2 15 ? 2.738   0.035   1.550   1.00 0.00 ? 15 LEU B HG   10 
ATOM 7610  H HD11 . LEU B 2 15 ? 1.941   2.405   3.053   1.00 0.00 ? 15 LEU B HD11 10 
ATOM 7611  H HD12 . LEU B 2 15 ? 1.479   2.520   1.354   1.00 0.00 ? 15 LEU B HD12 10 
ATOM 7612  H HD13 . LEU B 2 15 ? 3.164   2.240   1.793   1.00 0.00 ? 15 LEU B HD13 10 
ATOM 7613  H HD21 . LEU B 2 15 ? 0.813   -0.557  3.529   1.00 0.00 ? 15 LEU B HD21 10 
ATOM 7614  H HD22 . LEU B 2 15 ? 1.714   0.831   4.139   1.00 0.00 ? 15 LEU B HD22 10 
ATOM 7615  H HD23 . LEU B 2 15 ? 2.567   -0.647  3.694   1.00 0.00 ? 15 LEU B HD23 10 
ATOM 7616  N N    . TYR B 2 16 ? 3.212   -0.113  -0.612  1.00 0.00 ? 16 TYR B N    10 
ATOM 7617  C CA   . TYR B 2 16 ? 4.618   0.257   -0.922  1.00 0.00 ? 16 TYR B CA   10 
ATOM 7618  C C    . TYR B 2 16 ? 4.718   0.635   -2.398  1.00 0.00 ? 16 TYR B C    10 
ATOM 7619  O O    . TYR B 2 16 ? 5.222   1.680   -2.755  1.00 0.00 ? 16 TYR B O    10 
ATOM 7620  C CB   . TYR B 2 16 ? 5.531   -0.938  -0.641  1.00 0.00 ? 16 TYR B CB   10 
ATOM 7621  C CG   . TYR B 2 16 ? 6.652   -0.517  0.279   1.00 0.00 ? 16 TYR B CG   10 
ATOM 7622  C CD1  . TYR B 2 16 ? 6.439   -0.456  1.661   1.00 0.00 ? 16 TYR B CD1  10 
ATOM 7623  C CD2  . TYR B 2 16 ? 7.906   -0.189  -0.251  1.00 0.00 ? 16 TYR B CD2  10 
ATOM 7624  C CE1  . TYR B 2 16 ? 7.479   -0.068  2.513   1.00 0.00 ? 16 TYR B CE1  10 
ATOM 7625  C CE2  . TYR B 2 16 ? 8.946   0.199   0.601   1.00 0.00 ? 16 TYR B CE2  10 
ATOM 7626  C CZ   . TYR B 2 16 ? 8.733   0.260   1.984   1.00 0.00 ? 16 TYR B CZ   10 
ATOM 7627  O OH   . TYR B 2 16 ? 9.759   0.642   2.824   1.00 0.00 ? 16 TYR B OH   10 
ATOM 7628  H H    . TYR B 2 16 ? 2.981   -1.044  -0.413  1.00 0.00 ? 16 TYR B H    10 
ATOM 7629  H HA   . TYR B 2 16 ? 4.918   1.091   -0.313  1.00 0.00 ? 16 TYR B HA   10 
ATOM 7630  H HB2  . TYR B 2 16 ? 4.958   -1.725  -0.172  1.00 0.00 ? 16 TYR B HB2  10 
ATOM 7631  H HB3  . TYR B 2 16 ? 5.945   -1.300  -1.570  1.00 0.00 ? 16 TYR B HB3  10 
ATOM 7632  H HD1  . TYR B 2 16 ? 5.471   -0.709  2.070   1.00 0.00 ? 16 TYR B HD1  10 
ATOM 7633  H HD2  . TYR B 2 16 ? 8.070   -0.235  -1.318  1.00 0.00 ? 16 TYR B HD2  10 
ATOM 7634  H HE1  . TYR B 2 16 ? 7.315   -0.021  3.580   1.00 0.00 ? 16 TYR B HE1  10 
ATOM 7635  H HE2  . TYR B 2 16 ? 9.913   0.452   0.192   1.00 0.00 ? 16 TYR B HE2  10 
ATOM 7636  H HH   . TYR B 2 16 ? 9.927   -0.080  3.434   1.00 0.00 ? 16 TYR B HH   10 
ATOM 7637  N N    . LEU B 2 17 ? 4.239   -0.211  -3.260  1.00 0.00 ? 17 LEU B N    10 
ATOM 7638  C CA   . LEU B 2 17 ? 4.305   0.090   -4.716  1.00 0.00 ? 17 LEU B CA   10 
ATOM 7639  C C    . LEU B 2 17 ? 3.355   1.233   -5.075  1.00 0.00 ? 17 LEU B C    10 
ATOM 7640  O O    . LEU B 2 17 ? 3.698   2.118   -5.833  1.00 0.00 ? 17 LEU B O    10 
ATOM 7641  C CB   . LEU B 2 17 ? 3.933   -1.160  -5.516  1.00 0.00 ? 17 LEU B CB   10 
ATOM 7642  C CG   . LEU B 2 17 ? 4.823   -1.255  -6.756  1.00 0.00 ? 17 LEU B CG   10 
ATOM 7643  C CD1  . LEU B 2 17 ? 4.688   0.025   -7.582  1.00 0.00 ? 17 LEU B CD1  10 
ATOM 7644  C CD2  . LEU B 2 17 ? 6.281   -1.430  -6.324  1.00 0.00 ? 17 LEU B CD2  10 
ATOM 7645  H H    . LEU B 2 17 ? 3.837   -1.047  -2.948  1.00 0.00 ? 17 LEU B H    10 
ATOM 7646  H HA   . LEU B 2 17 ? 5.308   0.386   -4.961  1.00 0.00 ? 17 LEU B HA   10 
ATOM 7647  H HB2  . LEU B 2 17 ? 4.076   -2.037  -4.901  1.00 0.00 ? 17 LEU B HB2  10 
ATOM 7648  H HB3  . LEU B 2 17 ? 2.899   -1.098  -5.821  1.00 0.00 ? 17 LEU B HB3  10 
ATOM 7649  H HG   . LEU B 2 17 ? 4.518   -2.102  -7.354  1.00 0.00 ? 17 LEU B HG   10 
ATOM 7650  H HD11 . LEU B 2 17 ? 5.402   0.756   -7.233  1.00 0.00 ? 17 LEU B HD11 10 
ATOM 7651  H HD12 . LEU B 2 17 ? 3.688   0.419   -7.474  1.00 0.00 ? 17 LEU B HD12 10 
ATOM 7652  H HD13 . LEU B 2 17 ? 4.877   -0.196  -8.622  1.00 0.00 ? 17 LEU B HD13 10 
ATOM 7653  H HD21 . LEU B 2 17 ? 6.701   -2.294  -6.817  1.00 0.00 ? 17 LEU B HD21 10 
ATOM 7654  H HD22 . LEU B 2 17 ? 6.325   -1.568  -5.254  1.00 0.00 ? 17 LEU B HD22 10 
ATOM 7655  H HD23 . LEU B 2 17 ? 6.845   -0.550  -6.597  1.00 0.00 ? 17 LEU B HD23 10 
ATOM 7656  N N    . VAL B 2 18 ? 2.160   1.217   -4.557  1.00 0.00 ? 18 VAL B N    10 
ATOM 7657  C CA   . VAL B 2 18 ? 1.197   2.301   -4.898  1.00 0.00 ? 18 VAL B CA   10 
ATOM 7658  C C    . VAL B 2 18 ? 1.807   3.655   -4.528  1.00 0.00 ? 18 VAL B C    10 
ATOM 7659  O O    . VAL B 2 18 ? 1.799   4.583   -5.311  1.00 0.00 ? 18 VAL B O    10 
ATOM 7660  C CB   . VAL B 2 18 ? -0.127  2.074   -4.153  1.00 0.00 ? 18 VAL B CB   10 
ATOM 7661  C CG1  . VAL B 2 18 ? -0.041  2.622   -2.726  1.00 0.00 ? 18 VAL B CG1  10 
ATOM 7662  C CG2  . VAL B 2 18 ? -1.257  2.784   -4.901  1.00 0.00 ? 18 VAL B CG2  10 
ATOM 7663  H H    . VAL B 2 18 ? 1.895   0.489   -3.958  1.00 0.00 ? 18 VAL B H    10 
ATOM 7664  H HA   . VAL B 2 18 ? 1.014   2.282   -5.959  1.00 0.00 ? 18 VAL B HA   10 
ATOM 7665  H HB   . VAL B 2 18 ? -0.337  1.015   -4.115  1.00 0.00 ? 18 VAL B HB   10 
ATOM 7666  H HG11 . VAL B 2 18 ? -1.003  2.521   -2.244  1.00 0.00 ? 18 VAL B HG11 10 
ATOM 7667  H HG12 . VAL B 2 18 ? 0.239   3.663   -2.756  1.00 0.00 ? 18 VAL B HG12 10 
ATOM 7668  H HG13 . VAL B 2 18 ? 0.700   2.067   -2.173  1.00 0.00 ? 18 VAL B HG13 10 
ATOM 7669  H HG21 . VAL B 2 18 ? -0.840  3.548   -5.541  1.00 0.00 ? 18 VAL B HG21 10 
ATOM 7670  H HG22 . VAL B 2 18 ? -1.930  3.238   -4.189  1.00 0.00 ? 18 VAL B HG22 10 
ATOM 7671  H HG23 . VAL B 2 18 ? -1.797  2.067   -5.500  1.00 0.00 ? 18 VAL B HG23 10 
ATOM 7672  N N    . CYS B 2 19 ? 2.352   3.770   -3.352  1.00 0.00 ? 19 CYS B N    10 
ATOM 7673  C CA   . CYS B 2 19 ? 2.982   5.058   -2.949  1.00 0.00 ? 19 CYS B CA   10 
ATOM 7674  C C    . CYS B 2 19 ? 3.660   4.879   -1.595  1.00 0.00 ? 19 CYS B C    10 
ATOM 7675  O O    . CYS B 2 19 ? 3.730   5.789   -0.799  1.00 0.00 ? 19 CYS B O    10 
ATOM 7676  C CB   . CYS B 2 19 ? 1.921   6.160   -2.849  1.00 0.00 ? 19 CYS B CB   10 
ATOM 7677  S SG   . CYS B 2 19 ? 2.674   7.754   -3.273  1.00 0.00 ? 19 CYS B SG   10 
ATOM 7678  H H    . CYS B 2 19 ? 2.361   3.004   -2.737  1.00 0.00 ? 19 CYS B H    10 
ATOM 7679  H HA   . CYS B 2 19 ? 3.723   5.339   -3.684  1.00 0.00 ? 19 CYS B HA   10 
ATOM 7680  H HB2  . CYS B 2 19 ? 1.115   5.947   -3.536  1.00 0.00 ? 19 CYS B HB2  10 
ATOM 7681  H HB3  . CYS B 2 19 ? 1.536   6.200   -1.841  1.00 0.00 ? 19 CYS B HB3  10 
ATOM 7682  N N    . GLY B 2 20 ? 4.163   3.711   -1.320  1.00 0.00 ? 20 GLY B N    10 
ATOM 7683  C CA   . GLY B 2 20 ? 4.829   3.505   -0.002  1.00 0.00 ? 20 GLY B CA   10 
ATOM 7684  C C    . GLY B 2 20 ? 6.336   3.338   -0.206  1.00 0.00 ? 20 GLY B C    10 
ATOM 7685  O O    . GLY B 2 20 ? 7.123   3.598   0.680   1.00 0.00 ? 20 GLY B O    10 
ATOM 7686  H H    . GLY B 2 20 ? 4.103   2.974   -1.976  1.00 0.00 ? 20 GLY B H    10 
ATOM 7687  H HA2  . GLY B 2 20 ? 4.644   4.365   0.627   1.00 0.00 ? 20 GLY B HA2  10 
ATOM 7688  H HA3  . GLY B 2 20 ? 4.429   2.625   0.473   1.00 0.00 ? 20 GLY B HA3  10 
ATOM 7689  N N    . GLU B 2 21 ? 6.746   2.910   -1.366  1.00 0.00 ? 21 GLU B N    10 
ATOM 7690  C CA   . GLU B 2 21 ? 8.203   2.732   -1.621  1.00 0.00 ? 21 GLU B CA   10 
ATOM 7691  C C    . GLU B 2 21 ? 8.939   4.034   -1.297  1.00 0.00 ? 21 GLU B C    10 
ATOM 7692  O O    . GLU B 2 21 ? 9.955   4.034   -0.631  1.00 0.00 ? 21 GLU B O    10 
ATOM 7693  C CB   . GLU B 2 21 ? 8.422   2.375   -3.093  1.00 0.00 ? 21 GLU B CB   10 
ATOM 7694  C CG   . GLU B 2 21 ? 9.843   1.839   -3.283  1.00 0.00 ? 21 GLU B CG   10 
ATOM 7695  C CD   . GLU B 2 21 ? 10.714  2.917   -3.930  1.00 0.00 ? 21 GLU B CD   10 
ATOM 7696  O OE1  . GLU B 2 21 ? 10.195  3.658   -4.748  1.00 0.00 ? 21 GLU B OE1  10 
ATOM 7697  O OE2  . GLU B 2 21 ? 11.885  2.984   -3.595  1.00 0.00 ? 21 GLU B OE2  10 
ATOM 7698  H H    . GLU B 2 21 ? 6.097   2.708   -2.072  1.00 0.00 ? 21 GLU B H    10 
ATOM 7699  H HA   . GLU B 2 21 ? 8.584   1.937   -0.997  1.00 0.00 ? 21 GLU B HA   10 
ATOM 7700  H HB2  . GLU B 2 21 ? 7.709   1.620   -3.390  1.00 0.00 ? 21 GLU B HB2  10 
ATOM 7701  H HB3  . GLU B 2 21 ? 8.288   3.257   -3.701  1.00 0.00 ? 21 GLU B HB3  10 
ATOM 7702  H HG2  . GLU B 2 21 ? 10.257  1.567   -2.323  1.00 0.00 ? 21 GLU B HG2  10 
ATOM 7703  H HG3  . GLU B 2 21 ? 9.817   0.969   -3.923  1.00 0.00 ? 21 GLU B HG3  10 
ATOM 7704  N N    . ARG B 2 22 ? 8.434   5.142   -1.765  1.00 0.00 ? 22 ARG B N    10 
ATOM 7705  C CA   . ARG B 2 22 ? 9.102   6.440   -1.489  1.00 0.00 ? 22 ARG B CA   10 
ATOM 7706  C C    . ARG B 2 22 ? 8.700   6.943   -0.101  1.00 0.00 ? 22 ARG B C    10 
ATOM 7707  O O    . ARG B 2 22 ? 9.497   7.510   0.620   1.00 0.00 ? 22 ARG B O    10 
ATOM 7708  C CB   . ARG B 2 22 ? 8.682   7.464   -2.545  1.00 0.00 ? 22 ARG B CB   10 
ATOM 7709  C CG   . ARG B 2 22 ? 9.330   8.815   -2.234  1.00 0.00 ? 22 ARG B CG   10 
ATOM 7710  C CD   . ARG B 2 22 ? 10.225  9.232   -3.401  1.00 0.00 ? 22 ARG B CD   10 
ATOM 7711  N NE   . ARG B 2 22 ? 11.592  8.673   -3.203  1.00 0.00 ? 22 ARG B NE   10 
ATOM 7712  C CZ   . ARG B 2 22 ? 12.453  8.693   -4.184  1.00 0.00 ? 22 ARG B CZ   10 
ATOM 7713  N NH1  . ARG B 2 22 ? 13.180  9.757   -4.391  1.00 0.00 ? 22 ARG B NH1  10 
ATOM 7714  N NH2  . ARG B 2 22 ? 12.588  7.650   -4.956  1.00 0.00 ? 22 ARG B NH2  10 
ATOM 7715  H H    . ARG B 2 22 ? 7.620   5.121   -2.300  1.00 0.00 ? 22 ARG B H    10 
ATOM 7716  H HA   . ARG B 2 22 ? 10.166  6.303   -1.527  1.00 0.00 ? 22 ARG B HA   10 
ATOM 7717  H HB2  . ARG B 2 22 ? 9.001   7.127   -3.520  1.00 0.00 ? 22 ARG B HB2  10 
ATOM 7718  H HB3  . ARG B 2 22 ? 7.608   7.572   -2.535  1.00 0.00 ? 22 ARG B HB3  10 
ATOM 7719  H HG2  . ARG B 2 22 ? 8.559   9.558   -2.085  1.00 0.00 ? 22 ARG B HG2  10 
ATOM 7720  H HG3  . ARG B 2 22 ? 9.926   8.730   -1.338  1.00 0.00 ? 22 ARG B HG3  10 
ATOM 7721  H HD2  . ARG B 2 22 ? 9.812   8.855   -4.325  1.00 0.00 ? 22 ARG B HD2  10 
ATOM 7722  H HD3  . ARG B 2 22 ? 10.280  10.310  -3.445  1.00 0.00 ? 22 ARG B HD3  10 
ATOM 7723  H HE   . ARG B 2 22 ? 11.844  8.290   -2.337  1.00 0.00 ? 22 ARG B HE   10 
ATOM 7724  H HH11 . ARG B 2 22 ? 13.077  10.557  -3.800  1.00 0.00 ? 22 ARG B HH11 10 
ATOM 7725  H HH12 . ARG B 2 22 ? 13.840  9.773   -5.142  1.00 0.00 ? 22 ARG B HH12 10 
ATOM 7726  H HH21 . ARG B 2 22 ? 12.031  6.835   -4.796  1.00 0.00 ? 22 ARG B HH21 10 
ATOM 7727  H HH22 . ARG B 2 22 ? 13.248  7.666   -5.707  1.00 0.00 ? 22 ARG B HH22 10 
ATOM 7728  N N    . GLY B 2 23 ? 7.468   6.745   0.276   1.00 0.00 ? 23 GLY B N    10 
ATOM 7729  C CA   . GLY B 2 23 ? 7.012   7.214   1.615   1.00 0.00 ? 23 GLY B CA   10 
ATOM 7730  C C    . GLY B 2 23 ? 7.621   6.332   2.707   1.00 0.00 ? 23 GLY B C    10 
ATOM 7731  O O    . GLY B 2 23 ? 7.789   6.751   3.835   1.00 0.00 ? 23 GLY B O    10 
ATOM 7732  H H    . GLY B 2 23 ? 6.842   6.288   -0.323  1.00 0.00 ? 23 GLY B H    10 
ATOM 7733  H HA2  . GLY B 2 23 ? 7.326   8.238   1.762   1.00 0.00 ? 23 GLY B HA2  10 
ATOM 7734  H HA3  . GLY B 2 23 ? 5.936   7.156   1.670   1.00 0.00 ? 23 GLY B HA3  10 
ATOM 7735  N N    . PHE B 2 24 ? 7.953   5.112   2.382   1.00 0.00 ? 24 PHE B N    10 
ATOM 7736  C CA   . PHE B 2 24 ? 8.549   4.206   3.404   1.00 0.00 ? 24 PHE B CA   10 
ATOM 7737  C C    . PHE B 2 24 ? 10.072  4.208   3.260   1.00 0.00 ? 24 PHE B C    10 
ATOM 7738  O O    . PHE B 2 24 ? 10.611  3.796   2.252   1.00 0.00 ? 24 PHE B O    10 
ATOM 7739  C CB   . PHE B 2 24 ? 8.020   2.783   3.199   1.00 0.00 ? 24 PHE B CB   10 
ATOM 7740  C CG   . PHE B 2 24 ? 6.568   2.716   3.612   1.00 0.00 ? 24 PHE B CG   10 
ATOM 7741  C CD1  . PHE B 2 24 ? 5.626   3.570   3.023   1.00 0.00 ? 24 PHE B CD1  10 
ATOM 7742  C CD2  . PHE B 2 24 ? 6.164   1.798   4.589   1.00 0.00 ? 24 PHE B CD2  10 
ATOM 7743  C CE1  . PHE B 2 24 ? 4.283   3.505   3.411   1.00 0.00 ? 24 PHE B CE1  10 
ATOM 7744  C CE2  . PHE B 2 24 ? 4.821   1.734   4.977   1.00 0.00 ? 24 PHE B CE2  10 
ATOM 7745  C CZ   . PHE B 2 24 ? 3.880   2.587   4.389   1.00 0.00 ? 24 PHE B CZ   10 
ATOM 7746  H H    . PHE B 2 24 ? 7.809   4.792   1.467   1.00 0.00 ? 24 PHE B H    10 
ATOM 7747  H HA   . PHE B 2 24 ? 8.280   4.551   4.391   1.00 0.00 ? 24 PHE B HA   10 
ATOM 7748  H HB2  . PHE B 2 24 ? 8.112   2.511   2.158   1.00 0.00 ? 24 PHE B HB2  10 
ATOM 7749  H HB3  . PHE B 2 24 ? 8.596   2.097   3.801   1.00 0.00 ? 24 PHE B HB3  10 
ATOM 7750  H HD1  . PHE B 2 24 ? 5.933   4.277   2.267   1.00 0.00 ? 24 PHE B HD1  10 
ATOM 7751  H HD2  . PHE B 2 24 ? 6.888   1.139   5.042   1.00 0.00 ? 24 PHE B HD2  10 
ATOM 7752  H HE1  . PHE B 2 24 ? 3.557   4.163   2.957   1.00 0.00 ? 24 PHE B HE1  10 
ATOM 7753  H HE2  . PHE B 2 24 ? 4.510   1.026   5.731   1.00 0.00 ? 24 PHE B HE2  10 
ATOM 7754  H HZ   . PHE B 2 24 ? 2.844   2.537   4.689   1.00 0.00 ? 24 PHE B HZ   10 
ATOM 7755  N N    . PHE B 2 25 ? 10.771  4.668   4.261   1.00 0.00 ? 25 PHE B N    10 
ATOM 7756  C CA   . PHE B 2 25 ? 12.259  4.695   4.181   1.00 0.00 ? 25 PHE B CA   10 
ATOM 7757  C C    . PHE B 2 25 ? 12.832  3.507   4.956   1.00 0.00 ? 25 PHE B C    10 
ATOM 7758  O O    . PHE B 2 25 ? 12.339  3.142   6.004   1.00 0.00 ? 25 PHE B O    10 
ATOM 7759  C CB   . PHE B 2 25 ? 12.779  5.999   4.790   1.00 0.00 ? 25 PHE B CB   10 
ATOM 7760  C CG   . PHE B 2 25 ? 12.056  6.272   6.088   1.00 0.00 ? 25 PHE B CG   10 
ATOM 7761  C CD1  . PHE B 2 25 ? 12.523  5.708   7.281   1.00 0.00 ? 25 PHE B CD1  10 
ATOM 7762  C CD2  . PHE B 2 25 ? 10.919  7.089   6.097   1.00 0.00 ? 25 PHE B CD2  10 
ATOM 7763  C CE1  . PHE B 2 25 ? 11.853  5.961   8.484   1.00 0.00 ? 25 PHE B CE1  10 
ATOM 7764  C CE2  . PHE B 2 25 ? 10.249  7.342   7.300   1.00 0.00 ? 25 PHE B CE2  10 
ATOM 7765  C CZ   . PHE B 2 25 ? 10.716  6.778   8.494   1.00 0.00 ? 25 PHE B CZ   10 
ATOM 7766  H H    . PHE B 2 25 ? 10.318  4.995   5.066   1.00 0.00 ? 25 PHE B H    10 
ATOM 7767  H HA   . PHE B 2 25 ? 12.565  4.633   3.147   1.00 0.00 ? 25 PHE B HA   10 
ATOM 7768  H HB2  . PHE B 2 25 ? 13.839  5.910   4.980   1.00 0.00 ? 25 PHE B HB2  10 
ATOM 7769  H HB3  . PHE B 2 25 ? 12.603  6.813   4.103   1.00 0.00 ? 25 PHE B HB3  10 
ATOM 7770  H HD1  . PHE B 2 25 ? 13.401  5.078   7.274   1.00 0.00 ? 25 PHE B HD1  10 
ATOM 7771  H HD2  . PHE B 2 25 ? 10.559  7.523   5.177   1.00 0.00 ? 25 PHE B HD2  10 
ATOM 7772  H HE1  . PHE B 2 25 ? 12.214  5.526   9.405   1.00 0.00 ? 25 PHE B HE1  10 
ATOM 7773  H HE2  . PHE B 2 25 ? 9.372   7.972   7.308   1.00 0.00 ? 25 PHE B HE2  10 
ATOM 7774  H HZ   . PHE B 2 25 ? 10.199  6.973   9.422   1.00 0.00 ? 25 PHE B HZ   10 
ATOM 7775  N N    . TYR B 2 26 ? 13.870  2.899   4.448   1.00 0.00 ? 26 TYR B N    10 
ATOM 7776  C CA   . TYR B 2 26 ? 14.471  1.735   5.158   1.00 0.00 ? 26 TYR B CA   10 
ATOM 7777  C C    . TYR B 2 26 ? 15.381  2.239   6.282   1.00 0.00 ? 26 TYR B C    10 
ATOM 7778  O O    . TYR B 2 26 ? 16.020  3.264   6.147   1.00 0.00 ? 26 TYR B O    10 
ATOM 7779  C CB   . TYR B 2 26 ? 15.291  0.903   4.171   1.00 0.00 ? 26 TYR B CB   10 
ATOM 7780  C CG   . TYR B 2 26 ? 14.474  -0.279  3.708   1.00 0.00 ? 26 TYR B CG   10 
ATOM 7781  C CD1  . TYR B 2 26 ? 13.503  -0.112  2.713   1.00 0.00 ? 26 TYR B CD1  10 
ATOM 7782  C CD2  . TYR B 2 26 ? 14.686  -1.542  4.274   1.00 0.00 ? 26 TYR B CD2  10 
ATOM 7783  C CE1  . TYR B 2 26 ? 12.745  -1.208  2.284   1.00 0.00 ? 26 TYR B CE1  10 
ATOM 7784  C CE2  . TYR B 2 26 ? 13.928  -2.638  3.844   1.00 0.00 ? 26 TYR B CE2  10 
ATOM 7785  C CZ   . TYR B 2 26 ? 12.958  -2.471  2.849   1.00 0.00 ? 26 TYR B CZ   10 
ATOM 7786  O OH   . TYR B 2 26 ? 12.210  -3.551  2.426   1.00 0.00 ? 26 TYR B OH   10 
ATOM 7787  H H    . TYR B 2 26 ? 14.253  3.208   3.601   1.00 0.00 ? 26 TYR B H    10 
ATOM 7788  H HA   . TYR B 2 26 ? 13.684  1.126   5.576   1.00 0.00 ? 26 TYR B HA   10 
ATOM 7789  H HB2  . TYR B 2 26 ? 15.558  1.513   3.320   1.00 0.00 ? 26 TYR B HB2  10 
ATOM 7790  H HB3  . TYR B 2 26 ? 16.189  0.550   4.657   1.00 0.00 ? 26 TYR B HB3  10 
ATOM 7791  H HD1  . TYR B 2 26 ? 13.340  0.862   2.276   1.00 0.00 ? 26 TYR B HD1  10 
ATOM 7792  H HD2  . TYR B 2 26 ? 15.435  -1.671  5.041   1.00 0.00 ? 26 TYR B HD2  10 
ATOM 7793  H HE1  . TYR B 2 26 ? 11.997  -1.080  1.516   1.00 0.00 ? 26 TYR B HE1  10 
ATOM 7794  H HE2  . TYR B 2 26 ? 14.092  -3.612  4.281   1.00 0.00 ? 26 TYR B HE2  10 
ATOM 7795  H HH   . TYR B 2 26 ? 12.588  -3.869  1.603   1.00 0.00 ? 26 TYR B HH   10 
ATOM 7796  N N    . PRO B 2 27 ? 15.412  1.501   7.363   1.00 0.00 ? 27 PRO B N    10 
ATOM 7797  C CA   . PRO B 2 27 ? 16.235  1.844   8.535   1.00 0.00 ? 27 PRO B CA   10 
ATOM 7798  C C    . PRO B 2 27 ? 17.700  1.470   8.290   1.00 0.00 ? 27 PRO B C    10 
ATOM 7799  O O    . PRO B 2 27 ? 17.999  0.500   7.621   1.00 0.00 ? 27 PRO B O    10 
ATOM 7800  C CB   . PRO B 2 27 ? 15.635  0.992   9.657   1.00 0.00 ? 27 PRO B CB   10 
ATOM 7801  C CG   . PRO B 2 27 ? 14.904  -0.185  8.966   1.00 0.00 ? 27 PRO B CG   10 
ATOM 7802  C CD   . PRO B 2 27 ? 14.631  0.256   7.516   1.00 0.00 ? 27 PRO B CD   10 
ATOM 7803  H HA   . PRO B 2 27 ? 16.142  2.891   8.776   1.00 0.00 ? 27 PRO B HA   10 
ATOM 7804  H HB2  . PRO B 2 27 ? 16.422  0.619   10.299  1.00 0.00 ? 27 PRO B HB2  10 
ATOM 7805  H HB3  . PRO B 2 27 ? 14.930  1.573   10.229  1.00 0.00 ? 27 PRO B HB3  10 
ATOM 7806  H HG2  . PRO B 2 27 ? 15.531  -1.066  8.977   1.00 0.00 ? 27 PRO B HG2  10 
ATOM 7807  H HG3  . PRO B 2 27 ? 13.970  -0.386  9.468   1.00 0.00 ? 27 PRO B HG3  10 
ATOM 7808  H HD2  . PRO B 2 27 ? 14.975  -0.498  6.822   1.00 0.00 ? 27 PRO B HD2  10 
ATOM 7809  H HD3  . PRO B 2 27 ? 13.581  0.456   7.372   1.00 0.00 ? 27 PRO B HD3  10 
ATOM 7810  N N    . THR B 2 28 ? 18.615  2.229   8.828   1.00 0.00 ? 28 THR B N    10 
ATOM 7811  C CA   . THR B 2 28 ? 20.057  1.915   8.628   1.00 0.00 ? 28 THR B CA   10 
ATOM 7812  C C    . THR B 2 28 ? 20.398  2.003   7.139   1.00 0.00 ? 28 THR B C    10 
ATOM 7813  O O    . THR B 2 28 ? 20.200  1.067   6.390   1.00 0.00 ? 28 THR B O    10 
ATOM 7814  C CB   . THR B 2 28 ? 20.345  0.500   9.135   1.00 0.00 ? 28 THR B CB   10 
ATOM 7815  O OG1  . THR B 2 28 ? 19.447  0.186   10.190  1.00 0.00 ? 28 THR B OG1  10 
ATOM 7816  C CG2  . THR B 2 28 ? 21.784  0.422   9.647   1.00 0.00 ? 28 THR B CG2  10 
ATOM 7817  H H    . THR B 2 28 ? 18.352  3.006   9.366   1.00 0.00 ? 28 THR B H    10 
ATOM 7818  H HA   . THR B 2 28 ? 20.659  2.623   9.177   1.00 0.00 ? 28 THR B HA   10 
ATOM 7819  H HB   . THR B 2 28 ? 20.216  -0.205  8.329   1.00 0.00 ? 28 THR B HB   10 
ATOM 7820  H HG1  . THR B 2 28 ? 19.553  -0.744  10.403  1.00 0.00 ? 28 THR B HG1  10 
ATOM 7821  H HG21 . THR B 2 28 ? 21.920  -0.494  10.203  1.00 0.00 ? 28 THR B HG21 10 
ATOM 7822  H HG22 . THR B 2 28 ? 21.984  1.266   10.290  1.00 0.00 ? 28 THR B HG22 10 
ATOM 7823  H HG23 . THR B 2 28 ? 22.466  0.439   8.809   1.00 0.00 ? 28 THR B HG23 10 
ATOM 7824  N N    . LYS B 2 29 ? 20.911  3.122   6.703   1.00 0.00 ? 29 LYS B N    10 
ATOM 7825  C CA   . LYS B 2 29 ? 21.265  3.268   5.263   1.00 0.00 ? 29 LYS B CA   10 
ATOM 7826  C C    . LYS B 2 29 ? 22.648  2.663   5.013   1.00 0.00 ? 29 LYS B C    10 
ATOM 7827  O O    . LYS B 2 29 ? 23.643  3.129   5.531   1.00 0.00 ? 29 LYS B O    10 
ATOM 7828  C CB   . LYS B 2 29 ? 21.283  4.752   4.891   1.00 0.00 ? 29 LYS B CB   10 
ATOM 7829  C CG   . LYS B 2 29 ? 19.887  5.183   4.437   1.00 0.00 ? 29 LYS B CG   10 
ATOM 7830  C CD   . LYS B 2 29 ? 19.546  4.499   3.112   1.00 0.00 ? 29 LYS B CD   10 
ATOM 7831  C CE   . LYS B 2 29 ? 19.690  5.504   1.967   1.00 0.00 ? 29 LYS B CE   10 
ATOM 7832  N NZ   . LYS B 2 29 ? 19.653  4.781   0.664   1.00 0.00 ? 29 LYS B NZ   10 
ATOM 7833  H H    . LYS B 2 29 ? 21.063  3.865   7.323   1.00 0.00 ? 29 LYS B H    10 
ATOM 7834  H HA   . LYS B 2 29 ? 20.532  2.754   4.658   1.00 0.00 ? 29 LYS B HA   10 
ATOM 7835  H HB2  . LYS B 2 29 ? 21.579  5.335   5.751   1.00 0.00 ? 29 LYS B HB2  10 
ATOM 7836  H HB3  . LYS B 2 29 ? 21.986  4.913   4.087   1.00 0.00 ? 29 LYS B HB3  10 
ATOM 7837  H HG2  . LYS B 2 29 ? 19.162  4.900   5.187   1.00 0.00 ? 29 LYS B HG2  10 
ATOM 7838  H HG3  . LYS B 2 29 ? 19.866  6.254   4.303   1.00 0.00 ? 29 LYS B HG3  10 
ATOM 7839  H HD2  . LYS B 2 29 ? 20.219  3.670   2.952   1.00 0.00 ? 29 LYS B HD2  10 
ATOM 7840  H HD3  . LYS B 2 29 ? 18.529  4.137   3.144   1.00 0.00 ? 29 LYS B HD3  10 
ATOM 7841  H HE2  . LYS B 2 29 ? 18.878  6.214   2.007   1.00 0.00 ? 29 LYS B HE2  10 
ATOM 7842  H HE3  . LYS B 2 29 ? 20.630  6.026   2.062   1.00 0.00 ? 29 LYS B HE3  10 
ATOM 7843  H HZ1  . LYS B 2 29 ? 18.898  4.066   0.685   1.00 0.00 ? 29 LYS B HZ1  10 
ATOM 7844  H HZ2  . LYS B 2 29 ? 20.569  4.314   0.501   1.00 0.00 ? 29 LYS B HZ2  10 
ATOM 7845  H HZ3  . LYS B 2 29 ? 19.465  5.457   -0.103  1.00 0.00 ? 29 LYS B HZ3  10 
ATOM 7846  N N    . THR B 2 30 ? 22.718  1.626   4.223   1.00 0.00 ? 30 THR B N    10 
ATOM 7847  C CA   . THR B 2 30 ? 24.037  0.993   3.942   1.00 0.00 ? 30 THR B CA   10 
ATOM 7848  C C    . THR B 2 30 ? 24.944  1.998   3.229   1.00 0.00 ? 30 THR B C    10 
ATOM 7849  O O    . THR B 2 30 ? 25.900  2.443   3.843   1.00 0.00 ? 30 THR B O    10 
ATOM 7850  C CB   . THR B 2 30 ? 23.833  -0.234  3.048   1.00 0.00 ? 30 THR B CB   10 
ATOM 7851  O OG1  . THR B 2 30 ? 22.832  0.049   2.080   1.00 0.00 ? 30 THR B OG1  10 
ATOM 7852  C CG2  . THR B 2 30 ? 23.397  -1.424  3.904   1.00 0.00 ? 30 THR B CG2  10 
ATOM 7853  O OXT  . THR B 2 30 ? 24.668  2.304   2.081   1.00 0.00 ? 30 THR B OXT  10 
ATOM 7854  H H    . THR B 2 30 ? 21.904  1.265   3.815   1.00 0.00 ? 30 THR B H    10 
ATOM 7855  H HA   . THR B 2 30 ? 24.496  0.689   4.871   1.00 0.00 ? 30 THR B HA   10 
ATOM 7856  H HB   . THR B 2 30 ? 24.759  -0.475  2.550   1.00 0.00 ? 30 THR B HB   10 
ATOM 7857  H HG1  . THR B 2 30 ? 22.925  0.968   1.818   1.00 0.00 ? 30 THR B HG1  10 
ATOM 7858  H HG21 . THR B 2 30 ? 24.264  -2.005  4.181   1.00 0.00 ? 30 THR B HG21 10 
ATOM 7859  H HG22 . THR B 2 30 ? 22.714  -2.042  3.340   1.00 0.00 ? 30 THR B HG22 10 
ATOM 7860  H HG23 . THR B 2 30 ? 22.905  -1.065  4.796   1.00 0.00 ? 30 THR B HG23 10 
ATOM 7861  N N    . GLY A 1 1  ? -0.125  7.474   -8.281  1.00 0.00 ? 1  GLY A N    11 
ATOM 7862  C CA   . GLY A 1 1  ? -0.205  7.113   -6.837  1.00 0.00 ? 1  GLY A CA   11 
ATOM 7863  C C    . GLY A 1 1  ? 1.198   6.813   -6.307  1.00 0.00 ? 1  GLY A C    11 
ATOM 7864  O O    . GLY A 1 1  ? 2.133   6.634   -7.062  1.00 0.00 ? 1  GLY A O    11 
ATOM 7865  H H1   . GLY A 1 1  ? -0.599  6.744   -8.848  1.00 0.00 ? 1  GLY A H1   11 
ATOM 7866  H H2   . GLY A 1 1  ? 0.874   7.541   -8.566  1.00 0.00 ? 1  GLY A H2   11 
ATOM 7867  H H3   . GLY A 1 1  ? -0.593  8.389   -8.437  1.00 0.00 ? 1  GLY A H3   11 
ATOM 7868  H HA2  . GLY A 1 1  ? -0.632  7.938   -6.284  1.00 0.00 ? 1  GLY A HA2  11 
ATOM 7869  H HA3  . GLY A 1 1  ? -0.826  6.239   -6.718  1.00 0.00 ? 1  GLY A HA3  11 
ATOM 7870  N N    . ILE A 1 2  ? 1.353   6.757   -5.012  1.00 0.00 ? 2  ILE A N    11 
ATOM 7871  C CA   . ILE A 1 2  ? 2.697   6.468   -4.435  1.00 0.00 ? 2  ILE A CA   11 
ATOM 7872  C C    . ILE A 1 2  ? 3.064   5.008   -4.699  1.00 0.00 ? 2  ILE A C    11 
ATOM 7873  O O    . ILE A 1 2  ? 4.219   4.667   -4.852  1.00 0.00 ? 2  ILE A O    11 
ATOM 7874  C CB   . ILE A 1 2  ? 2.670   6.724   -2.926  1.00 0.00 ? 2  ILE A CB   11 
ATOM 7875  C CG1  . ILE A 1 2  ? 1.572   5.873   -2.280  1.00 0.00 ? 2  ILE A CG1  11 
ATOM 7876  C CG2  . ILE A 1 2  ? 2.385   8.204   -2.664  1.00 0.00 ? 2  ILE A CG2  11 
ATOM 7877  C CD1  . ILE A 1 2  ? 1.737   5.897   -0.760  1.00 0.00 ? 2  ILE A CD1  11 
ATOM 7878  H H    . ILE A 1 2  ? 0.587   6.904   -4.420  1.00 0.00 ? 2  ILE A H    11 
ATOM 7879  H HA   . ILE A 1 2  ? 3.431   7.111   -4.895  1.00 0.00 ? 2  ILE A HA   11 
ATOM 7880  H HB   . ILE A 1 2  ? 3.628   6.462   -2.500  1.00 0.00 ? 2  ILE A HB   11 
ATOM 7881  H HG12 . ILE A 1 2  ? 0.603   6.274   -2.544  1.00 0.00 ? 2  ILE A HG12 11 
ATOM 7882  H HG13 . ILE A 1 2  ? 1.649   4.855   -2.633  1.00 0.00 ? 2  ILE A HG13 11 
ATOM 7883  H HG21 . ILE A 1 2  ? 1.320   8.377   -2.700  1.00 0.00 ? 2  ILE A HG21 11 
ATOM 7884  H HG22 . ILE A 1 2  ? 2.873   8.803   -3.419  1.00 0.00 ? 2  ILE A HG22 11 
ATOM 7885  H HG23 . ILE A 1 2  ? 2.762   8.476   -1.689  1.00 0.00 ? 2  ILE A HG23 11 
ATOM 7886  H HD11 . ILE A 1 2  ? 1.761   6.920   -0.416  1.00 0.00 ? 2  ILE A HD11 11 
ATOM 7887  H HD12 . ILE A 1 2  ? 2.659   5.404   -0.490  1.00 0.00 ? 2  ILE A HD12 11 
ATOM 7888  H HD13 . ILE A 1 2  ? 0.906   5.382   -0.300  1.00 0.00 ? 2  ILE A HD13 11 
ATOM 7889  N N    . VAL A 1 3  ? 2.091   4.144   -4.758  1.00 0.00 ? 3  VAL A N    11 
ATOM 7890  C CA   . VAL A 1 3  ? 2.380   2.711   -5.012  1.00 0.00 ? 3  VAL A CA   11 
ATOM 7891  C C    . VAL A 1 3  ? 2.922   2.553   -6.437  1.00 0.00 ? 3  VAL A C    11 
ATOM 7892  O O    . VAL A 1 3  ? 3.871   1.833   -6.676  1.00 0.00 ? 3  VAL A O    11 
ATOM 7893  C CB   . VAL A 1 3  ? 1.076   1.914   -4.819  1.00 0.00 ? 3  VAL A CB   11 
ATOM 7894  C CG1  . VAL A 1 3  ? 0.986   0.754   -5.812  1.00 0.00 ? 3  VAL A CG1  11 
ATOM 7895  C CG2  . VAL A 1 3  ? 1.032   1.361   -3.393  1.00 0.00 ? 3  VAL A CG2  11 
ATOM 7896  H H    . VAL A 1 3  ? 1.166   4.438   -4.636  1.00 0.00 ? 3  VAL A H    11 
ATOM 7897  H HA   . VAL A 1 3  ? 3.121   2.366   -4.311  1.00 0.00 ? 3  VAL A HA   11 
ATOM 7898  H HB   . VAL A 1 3  ? 0.233   2.574   -4.969  1.00 0.00 ? 3  VAL A HB   11 
ATOM 7899  H HG11 . VAL A 1 3  ? 0.023   0.276   -5.719  1.00 0.00 ? 3  VAL A HG11 11 
ATOM 7900  H HG12 . VAL A 1 3  ? 1.766   0.040   -5.601  1.00 0.00 ? 3  VAL A HG12 11 
ATOM 7901  H HG13 . VAL A 1 3  ? 1.105   1.132   -6.817  1.00 0.00 ? 3  VAL A HG13 11 
ATOM 7902  H HG21 . VAL A 1 3  ? 0.483   2.042   -2.759  1.00 0.00 ? 3  VAL A HG21 11 
ATOM 7903  H HG22 . VAL A 1 3  ? 2.039   1.253   -3.018  1.00 0.00 ? 3  VAL A HG22 11 
ATOM 7904  H HG23 . VAL A 1 3  ? 0.544   0.398   -3.396  1.00 0.00 ? 3  VAL A HG23 11 
ATOM 7905  N N    . GLU A 1 4  ? 2.324   3.220   -7.380  1.00 0.00 ? 4  GLU A N    11 
ATOM 7906  C CA   . GLU A 1 4  ? 2.800   3.112   -8.787  1.00 0.00 ? 4  GLU A CA   11 
ATOM 7907  C C    . GLU A 1 4  ? 4.169   3.780   -8.919  1.00 0.00 ? 4  GLU A C    11 
ATOM 7908  O O    . GLU A 1 4  ? 5.021   3.332   -9.661  1.00 0.00 ? 4  GLU A O    11 
ATOM 7909  C CB   . GLU A 1 4  ? 1.802   3.806   -9.716  1.00 0.00 ? 4  GLU A CB   11 
ATOM 7910  C CG   . GLU A 1 4  ? 1.307   2.812   -10.768 1.00 0.00 ? 4  GLU A CG   11 
ATOM 7911  C CD   . GLU A 1 4  ? 0.585   1.654   -10.077 1.00 0.00 ? 4  GLU A CD   11 
ATOM 7912  O OE1  . GLU A 1 4  ? -0.534  1.859   -9.637  1.00 0.00 ? 4  GLU A OE1  11 
ATOM 7913  O OE2  . GLU A 1 4  ? 1.164   0.583   -9.998  1.00 0.00 ? 4  GLU A OE2  11 
ATOM 7914  H H    . GLU A 1 4  ? 1.561   3.793   -7.162  1.00 0.00 ? 4  GLU A H    11 
ATOM 7915  H HA   . GLU A 1 4  ? 2.881   2.072   -9.059  1.00 0.00 ? 4  GLU A HA   11 
ATOM 7916  H HB2  . GLU A 1 4  ? 0.964   4.168   -9.139  1.00 0.00 ? 4  GLU A HB2  11 
ATOM 7917  H HB3  . GLU A 1 4  ? 2.286   4.637   -10.208 1.00 0.00 ? 4  GLU A HB3  11 
ATOM 7918  H HG2  . GLU A 1 4  ? 0.627   3.311   -11.443 1.00 0.00 ? 4  GLU A HG2  11 
ATOM 7919  H HG3  . GLU A 1 4  ? 2.149   2.428   -11.325 1.00 0.00 ? 4  GLU A HG3  11 
ATOM 7920  N N    . GLN A 1 5  ? 4.382   4.858   -8.218  1.00 0.00 ? 5  GLN A N    11 
ATOM 7921  C CA   . GLN A 1 5  ? 5.690   5.566   -8.314  1.00 0.00 ? 5  GLN A CA   11 
ATOM 7922  C C    . GLN A 1 5  ? 6.739   4.874   -7.440  1.00 0.00 ? 5  GLN A C    11 
ATOM 7923  O O    . GLN A 1 5  ? 7.900   4.808   -7.793  1.00 0.00 ? 5  GLN A O    11 
ATOM 7924  C CB   . GLN A 1 5  ? 5.519   7.014   -7.851  1.00 0.00 ? 5  GLN A CB   11 
ATOM 7925  C CG   . GLN A 1 5  ? 6.755   7.824   -8.247  1.00 0.00 ? 5  GLN A CG   11 
ATOM 7926  C CD   . GLN A 1 5  ? 6.441   9.318   -8.147  1.00 0.00 ? 5  GLN A CD   11 
ATOM 7927  O OE1  . GLN A 1 5  ? 5.513   9.711   -7.469  1.00 0.00 ? 5  GLN A OE1  11 
ATOM 7928  N NE2  . GLN A 1 5  ? 7.181   10.172  -8.798  1.00 0.00 ? 5  GLN A NE2  11 
ATOM 7929  H H    . GLN A 1 5  ? 3.677   5.207   -7.635  1.00 0.00 ? 5  GLN A H    11 
ATOM 7930  H HA   . GLN A 1 5  ? 6.022   5.558   -9.339  1.00 0.00 ? 5  GLN A HA   11 
ATOM 7931  H HB2  . GLN A 1 5  ? 4.643   7.440   -8.318  1.00 0.00 ? 5  GLN A HB2  11 
ATOM 7932  H HB3  . GLN A 1 5  ? 5.404   7.038   -6.778  1.00 0.00 ? 5  GLN A HB3  11 
ATOM 7933  H HG2  . GLN A 1 5  ? 7.572   7.582   -7.583  1.00 0.00 ? 5  GLN A HG2  11 
ATOM 7934  H HG3  . GLN A 1 5  ? 7.033   7.584   -9.262  1.00 0.00 ? 5  GLN A HG3  11 
ATOM 7935  H HE21 . GLN A 1 5  ? 7.930   9.855   -9.345  1.00 0.00 ? 5  GLN A HE21 11 
ATOM 7936  H HE22 . GLN A 1 5  ? 6.989   11.132  -8.741  1.00 0.00 ? 5  GLN A HE22 11 
ATOM 7937  N N    . CYS A 1 6  ? 6.353   4.367   -6.302  1.00 0.00 ? 6  CYS A N    11 
ATOM 7938  C CA   . CYS A 1 6  ? 7.353   3.696   -5.420  1.00 0.00 ? 6  CYS A CA   11 
ATOM 7939  C C    . CYS A 1 6  ? 7.305   2.180   -5.630  1.00 0.00 ? 6  CYS A C    11 
ATOM 7940  O O    . CYS A 1 6  ? 7.975   1.433   -4.946  1.00 0.00 ? 6  CYS A O    11 
ATOM 7941  C CB   . CYS A 1 6  ? 7.049   4.017   -3.954  1.00 0.00 ? 6  CYS A CB   11 
ATOM 7942  S SG   . CYS A 1 6  ? 8.131   5.356   -3.389  1.00 0.00 ? 6  CYS A SG   11 
ATOM 7943  H H    . CYS A 1 6  ? 5.414   4.433   -6.026  1.00 0.00 ? 6  CYS A H    11 
ATOM 7944  H HA   . CYS A 1 6  ? 8.341   4.057   -5.665  1.00 0.00 ? 6  CYS A HA   11 
ATOM 7945  H HB2  . CYS A 1 6  ? 6.019   4.322   -3.857  1.00 0.00 ? 6  CYS A HB2  11 
ATOM 7946  H HB3  . CYS A 1 6  ? 7.221   3.137   -3.350  1.00 0.00 ? 6  CYS A HB3  11 
ATOM 7947  N N    . CYS A 1 7  ? 6.525   1.713   -6.567  1.00 0.00 ? 7  CYS A N    11 
ATOM 7948  C CA   . CYS A 1 7  ? 6.456   0.242   -6.799  1.00 0.00 ? 7  CYS A CA   11 
ATOM 7949  C C    . CYS A 1 7  ? 7.873   -0.331  -6.825  1.00 0.00 ? 7  CYS A C    11 
ATOM 7950  O O    . CYS A 1 7  ? 8.105   -1.452  -6.418  1.00 0.00 ? 7  CYS A O    11 
ATOM 7951  C CB   . CYS A 1 7  ? 5.762   -0.048  -8.131  1.00 0.00 ? 7  CYS A CB   11 
ATOM 7952  S SG   . CYS A 1 7  ? 4.753   -1.544  -7.965  1.00 0.00 ? 7  CYS A SG   11 
ATOM 7953  H H    . CYS A 1 7  ? 5.989   2.325   -7.114  1.00 0.00 ? 7  CYS A H    11 
ATOM 7954  H HA   . CYS A 1 7  ? 5.900   -0.220  -5.997  1.00 0.00 ? 7  CYS A HA   11 
ATOM 7955  H HB2  . CYS A 1 7  ? 5.130   0.786   -8.397  1.00 0.00 ? 7  CYS A HB2  11 
ATOM 7956  H HB3  . CYS A 1 7  ? 6.505   -0.198  -8.900  1.00 0.00 ? 7  CYS A HB3  11 
ATOM 7957  N N    . THR A 1 8  ? 8.826   0.431   -7.293  1.00 0.00 ? 8  THR A N    11 
ATOM 7958  C CA   . THR A 1 8  ? 10.226  -0.075  -7.332  1.00 0.00 ? 8  THR A CA   11 
ATOM 7959  C C    . THR A 1 8  ? 10.537  -0.755  -5.999  1.00 0.00 ? 8  THR A C    11 
ATOM 7960  O O    . THR A 1 8  ? 11.238  -1.745  -5.940  1.00 0.00 ? 8  THR A O    11 
ATOM 7961  C CB   . THR A 1 8  ? 11.189  1.096   -7.548  1.00 0.00 ? 8  THR A CB   11 
ATOM 7962  O OG1  . THR A 1 8  ? 10.985  2.068   -6.532  1.00 0.00 ? 8  THR A OG1  11 
ATOM 7963  C CG2  . THR A 1 8  ? 10.933  1.725   -8.918  1.00 0.00 ? 8  THR A CG2  11 
ATOM 7964  H H    . THR A 1 8  ? 8.621   1.335   -7.612  1.00 0.00 ? 8  THR A H    11 
ATOM 7965  H HA   . THR A 1 8  ? 10.333  -0.787  -8.136  1.00 0.00 ? 8  THR A HA   11 
ATOM 7966  H HB   . THR A 1 8  ? 12.207  0.738   -7.505  1.00 0.00 ? 8  THR A HB   11 
ATOM 7967  H HG1  . THR A 1 8  ? 10.975  1.615   -5.685  1.00 0.00 ? 8  THR A HG1  11 
ATOM 7968  H HG21 . THR A 1 8  ? 9.973   2.220   -8.913  1.00 0.00 ? 8  THR A HG21 11 
ATOM 7969  H HG22 . THR A 1 8  ? 10.937  0.954   -9.674  1.00 0.00 ? 8  THR A HG22 11 
ATOM 7970  H HG23 . THR A 1 8  ? 11.708  2.445   -9.134  1.00 0.00 ? 8  THR A HG23 11 
ATOM 7971  N N    . SER A 1 9  ? 10.006  -0.230  -4.929  1.00 0.00 ? 9  SER A N    11 
ATOM 7972  C CA   . SER A 1 9  ? 10.248  -0.838  -3.592  1.00 0.00 ? 9  SER A CA   11 
ATOM 7973  C C    . SER A 1 9  ? 9.366   -0.148  -2.556  1.00 0.00 ? 9  SER A C    11 
ATOM 7974  O O    . SER A 1 9  ? 8.341   0.420   -2.879  1.00 0.00 ? 9  SER A O    11 
ATOM 7975  C CB   . SER A 1 9  ? 11.707  -0.658  -3.190  1.00 0.00 ? 9  SER A CB   11 
ATOM 7976  O OG   . SER A 1 9  ? 12.518  -0.611  -4.356  1.00 0.00 ? 9  SER A OG   11 
ATOM 7977  H H    . SER A 1 9  ? 9.438   0.565   -5.007  1.00 0.00 ? 9  SER A H    11 
ATOM 7978  H HA   . SER A 1 9  ? 10.010  -1.890  -3.625  1.00 0.00 ? 9  SER A HA   11 
ATOM 7979  H HB2  . SER A 1 9  ? 11.815  0.263   -2.642  1.00 0.00 ? 9  SER A HB2  11 
ATOM 7980  H HB3  . SER A 1 9  ? 12.004  -1.486  -2.561  1.00 0.00 ? 9  SER A HB3  11 
ATOM 7981  H HG   . SER A 1 9  ? 12.796  0.299   -4.488  1.00 0.00 ? 9  SER A HG   11 
ATOM 7982  N N    . ILE A 1 10 ? 9.762   -0.188  -1.312  1.00 0.00 ? 10 ILE A N    11 
ATOM 7983  C CA   . ILE A 1 10 ? 8.949   0.463   -0.246  1.00 0.00 ? 10 ILE A CA   11 
ATOM 7984  C C    . ILE A 1 10 ? 9.652   1.733   0.219   1.00 0.00 ? 10 ILE A C    11 
ATOM 7985  O O    . ILE A 1 10 ? 10.709  1.696   0.817   1.00 0.00 ? 10 ILE A O    11 
ATOM 7986  C CB   . ILE A 1 10 ? 8.749   -0.529  0.929   1.00 0.00 ? 10 ILE A CB   11 
ATOM 7987  C CG1  . ILE A 1 10 ? 8.733   0.196   2.289   1.00 0.00 ? 10 ILE A CG1  11 
ATOM 7988  C CG2  . ILE A 1 10 ? 9.882   -1.558  0.940   1.00 0.00 ? 10 ILE A CG2  11 
ATOM 7989  C CD1  . ILE A 1 10 ? 7.435   0.991   2.447   1.00 0.00 ? 10 ILE A CD1  11 
ATOM 7990  H H    . ILE A 1 10 ? 10.595  -0.648  -1.080  1.00 0.00 ? 10 ILE A H    11 
ATOM 7991  H HA   . ILE A 1 10 ? 7.985   0.732   -0.650  1.00 0.00 ? 10 ILE A HA   11 
ATOM 7992  H HB   . ILE A 1 10 ? 7.809   -1.046  0.792   1.00 0.00 ? 10 ILE A HB   11 
ATOM 7993  H HG12 . ILE A 1 10 ? 8.799   -0.536  3.081   1.00 0.00 ? 10 ILE A HG12 11 
ATOM 7994  H HG13 . ILE A 1 10 ? 9.574   0.867   2.354   1.00 0.00 ? 10 ILE A HG13 11 
ATOM 7995  H HG21 . ILE A 1 10 ? 10.828  -1.051  1.059   1.00 0.00 ? 10 ILE A HG21 11 
ATOM 7996  H HG22 . ILE A 1 10 ? 9.881   -2.105  0.009   1.00 0.00 ? 10 ILE A HG22 11 
ATOM 7997  H HG23 . ILE A 1 10 ? 9.735   -2.244  1.761   1.00 0.00 ? 10 ILE A HG23 11 
ATOM 7998  H HD11 . ILE A 1 10 ? 7.661   1.976   2.830   1.00 0.00 ? 10 ILE A HD11 11 
ATOM 7999  H HD12 . ILE A 1 10 ? 6.782   0.479   3.139   1.00 0.00 ? 10 ILE A HD12 11 
ATOM 8000  H HD13 . ILE A 1 10 ? 6.946   1.081   1.489   1.00 0.00 ? 10 ILE A HD13 11 
ATOM 8001  N N    . CYS A 1 11 ? 9.050   2.859   -0.034  1.00 0.00 ? 11 CYS A N    11 
ATOM 8002  C CA   . CYS A 1 11 ? 9.651   4.137   0.412   1.00 0.00 ? 11 CYS A CA   11 
ATOM 8003  C C    . CYS A 1 11 ? 8.905   4.567   1.668   1.00 0.00 ? 11 CYS A C    11 
ATOM 8004  O O    . CYS A 1 11 ? 7.705   4.747   1.649   1.00 0.00 ? 11 CYS A O    11 
ATOM 8005  C CB   . CYS A 1 11 ? 9.485   5.202   -0.680  1.00 0.00 ? 11 CYS A CB   11 
ATOM 8006  S SG   . CYS A 1 11 ? 9.569   4.424   -2.317  1.00 0.00 ? 11 CYS A SG   11 
ATOM 8007  H H    . CYS A 1 11 ? 8.189   2.859   -0.502  1.00 0.00 ? 11 CYS A H    11 
ATOM 8008  H HA   . CYS A 1 11 ? 10.698  3.994   0.635   1.00 0.00 ? 11 CYS A HA   11 
ATOM 8009  H HB2  . CYS A 1 11 ? 8.528   5.689   -0.564  1.00 0.00 ? 11 CYS A HB2  11 
ATOM 8010  H HB3  . CYS A 1 11 ? 10.273  5.934   -0.589  1.00 0.00 ? 11 CYS A HB3  11 
ATOM 8011  N N    . SER A 1 12 ? 9.592   4.716   2.762   1.00 0.00 ? 12 SER A N    11 
ATOM 8012  C CA   . SER A 1 12 ? 8.906   5.112   4.015   1.00 0.00 ? 12 SER A CA   11 
ATOM 8013  C C    . SER A 1 12 ? 7.641   4.268   4.187   1.00 0.00 ? 12 SER A C    11 
ATOM 8014  O O    . SER A 1 12 ? 6.600   4.584   3.654   1.00 0.00 ? 12 SER A O    11 
ATOM 8015  C CB   . SER A 1 12 ? 8.527   6.592   3.944   1.00 0.00 ? 12 SER A CB   11 
ATOM 8016  O OG   . SER A 1 12 ? 8.260   7.072   5.255   1.00 0.00 ? 12 SER A OG   11 
ATOM 8017  H H    . SER A 1 12 ? 10.553  4.555   2.763   1.00 0.00 ? 12 SER A H    11 
ATOM 8018  H HA   . SER A 1 12 ? 9.562   4.949   4.855   1.00 0.00 ? 12 SER A HA   11 
ATOM 8019  H HB2  . SER A 1 12 ? 9.342   7.154   3.520   1.00 0.00 ? 12 SER A HB2  11 
ATOM 8020  H HB3  . SER A 1 12 ? 7.650   6.709   3.321   1.00 0.00 ? 12 SER A HB3  11 
ATOM 8021  H HG   . SER A 1 12 ? 8.385   8.023   5.254   1.00 0.00 ? 12 SER A HG   11 
ATOM 8022  N N    . LEU A 1 13 ? 7.705   3.208   4.946   1.00 0.00 ? 13 LEU A N    11 
ATOM 8023  C CA   . LEU A 1 13 ? 6.478   2.391   5.147   1.00 0.00 ? 13 LEU A CA   11 
ATOM 8024  C C    . LEU A 1 13 ? 5.399   3.349   5.613   1.00 0.00 ? 13 LEU A C    11 
ATOM 8025  O O    . LEU A 1 13 ? 4.227   3.181   5.341   1.00 0.00 ? 13 LEU A O    11 
ATOM 8026  C CB   . LEU A 1 13 ? 6.728   1.321   6.213   1.00 0.00 ? 13 LEU A CB   11 
ATOM 8027  C CG   . LEU A 1 13 ? 5.433   0.553   6.480   1.00 0.00 ? 13 LEU A CG   11 
ATOM 8028  C CD1  . LEU A 1 13 ? 5.306   -0.599  5.481   1.00 0.00 ? 13 LEU A CD1  11 
ATOM 8029  C CD2  . LEU A 1 13 ? 5.460   -0.010  7.903   1.00 0.00 ? 13 LEU A CD2  11 
ATOM 8030  H H    . LEU A 1 13 ? 8.542   2.963   5.390   1.00 0.00 ? 13 LEU A H    11 
ATOM 8031  H HA   . LEU A 1 13 ? 6.178   1.934   4.217   1.00 0.00 ? 13 LEU A HA   11 
ATOM 8032  H HB2  . LEU A 1 13 ? 7.488   0.636   5.863   1.00 0.00 ? 13 LEU A HB2  11 
ATOM 8033  H HB3  . LEU A 1 13 ? 7.060   1.792   7.126   1.00 0.00 ? 13 LEU A HB3  11 
ATOM 8034  H HG   . LEU A 1 13 ? 4.590   1.219   6.370   1.00 0.00 ? 13 LEU A HG   11 
ATOM 8035  H HD11 . LEU A 1 13 ? 5.524   -1.533  5.979   1.00 0.00 ? 13 LEU A HD11 11 
ATOM 8036  H HD12 . LEU A 1 13 ? 6.005   -0.451  4.671   1.00 0.00 ? 13 LEU A HD12 11 
ATOM 8037  H HD13 . LEU A 1 13 ? 4.300   -0.627  5.089   1.00 0.00 ? 13 LEU A HD13 11 
ATOM 8038  H HD21 . LEU A 1 13 ? 5.485   -1.089  7.863   1.00 0.00 ? 13 LEU A HD21 11 
ATOM 8039  H HD22 . LEU A 1 13 ? 4.575   0.310   8.433   1.00 0.00 ? 13 LEU A HD22 11 
ATOM 8040  H HD23 . LEU A 1 13 ? 6.338   0.352   8.417   1.00 0.00 ? 13 LEU A HD23 11 
ATOM 8041  N N    . TYR A 1 14 ? 5.810   4.383   6.282   1.00 0.00 ? 14 TYR A N    11 
ATOM 8042  C CA   . TYR A 1 14 ? 4.841   5.405   6.742   1.00 0.00 ? 14 TYR A CA   11 
ATOM 8043  C C    . TYR A 1 14 ? 4.198   6.018   5.502   1.00 0.00 ? 14 TYR A C    11 
ATOM 8044  O O    . TYR A 1 14 ? 3.034   6.365   5.497   1.00 0.00 ? 14 TYR A O    11 
ATOM 8045  C CB   . TYR A 1 14 ? 5.570   6.490   7.540   1.00 0.00 ? 14 TYR A CB   11 
ATOM 8046  C CG   . TYR A 1 14 ? 5.045   6.513   8.955   1.00 0.00 ? 14 TYR A CG   11 
ATOM 8047  C CD1  . TYR A 1 14 ? 5.174   5.380   9.768   1.00 0.00 ? 14 TYR A CD1  11 
ATOM 8048  C CD2  . TYR A 1 14 ? 4.430   7.667   9.455   1.00 0.00 ? 14 TYR A CD2  11 
ATOM 8049  C CE1  . TYR A 1 14 ? 4.688   5.401   11.081  1.00 0.00 ? 14 TYR A CE1  11 
ATOM 8050  C CE2  . TYR A 1 14 ? 3.944   7.688   10.768  1.00 0.00 ? 14 TYR A CE2  11 
ATOM 8051  C CZ   . TYR A 1 14 ? 4.073   6.555   11.581  1.00 0.00 ? 14 TYR A CZ   11 
ATOM 8052  O OH   . TYR A 1 14 ? 3.593   6.577   12.875  1.00 0.00 ? 14 TYR A OH   11 
ATOM 8053  H H    . TYR A 1 14 ? 6.767   4.498   6.449   1.00 0.00 ? 14 TYR A H    11 
ATOM 8054  H HA   . TYR A 1 14 ? 4.083   4.942   7.356   1.00 0.00 ? 14 TYR A HA   11 
ATOM 8055  H HB2  . TYR A 1 14 ? 6.629   6.277   7.551   1.00 0.00 ? 14 TYR A HB2  11 
ATOM 8056  H HB3  . TYR A 1 14 ? 5.400   7.451   7.078   1.00 0.00 ? 14 TYR A HB3  11 
ATOM 8057  H HD1  . TYR A 1 14 ? 5.648   4.490   9.383   1.00 0.00 ? 14 TYR A HD1  11 
ATOM 8058  H HD2  . TYR A 1 14 ? 4.331   8.540   8.828   1.00 0.00 ? 14 TYR A HD2  11 
ATOM 8059  H HE1  . TYR A 1 14 ? 4.787   4.528   11.708  1.00 0.00 ? 14 TYR A HE1  11 
ATOM 8060  H HE2  . TYR A 1 14 ? 3.470   8.579   11.154  1.00 0.00 ? 14 TYR A HE2  11 
ATOM 8061  H HH   . TYR A 1 14 ? 4.345   6.633   13.469  1.00 0.00 ? 14 TYR A HH   11 
ATOM 8062  N N    . GLN A 1 15 ? 4.950   6.131   4.435   1.00 0.00 ? 15 GLN A N    11 
ATOM 8063  C CA   . GLN A 1 15 ? 4.377   6.694   3.183   1.00 0.00 ? 15 GLN A CA   11 
ATOM 8064  C C    . GLN A 1 15 ? 3.313   5.726   2.663   1.00 0.00 ? 15 GLN A C    11 
ATOM 8065  O O    . GLN A 1 15 ? 2.220   6.122   2.313   1.00 0.00 ? 15 GLN A O    11 
ATOM 8066  C CB   . GLN A 1 15 ? 5.478   6.862   2.133   1.00 0.00 ? 15 GLN A CB   11 
ATOM 8067  C CG   . GLN A 1 15 ? 6.117   8.244   2.280   1.00 0.00 ? 15 GLN A CG   11 
ATOM 8068  C CD   . GLN A 1 15 ? 5.470   9.213   1.290   1.00 0.00 ? 15 GLN A CD   11 
ATOM 8069  O OE1  . GLN A 1 15 ? 4.337   9.615   1.468   1.00 0.00 ? 15 GLN A OE1  11 
ATOM 8070  N NE2  . GLN A 1 15 ? 6.146   9.608   0.246   1.00 0.00 ? 15 GLN A NE2  11 
ATOM 8071  H H    . GLN A 1 15 ? 5.889   5.825   4.456   1.00 0.00 ? 15 GLN A H    11 
ATOM 8072  H HA   . GLN A 1 15 ? 3.923   7.652   3.392   1.00 0.00 ? 15 GLN A HA   11 
ATOM 8073  H HB2  . GLN A 1 15 ? 6.229   6.100   2.272   1.00 0.00 ? 15 GLN A HB2  11 
ATOM 8074  H HB3  . GLN A 1 15 ? 5.050   6.770   1.146   1.00 0.00 ? 15 GLN A HB3  11 
ATOM 8075  H HG2  . GLN A 1 15 ? 5.968   8.603   3.288   1.00 0.00 ? 15 GLN A HG2  11 
ATOM 8076  H HG3  . GLN A 1 15 ? 7.175   8.175   2.074   1.00 0.00 ? 15 GLN A HG3  11 
ATOM 8077  H HE21 . GLN A 1 15 ? 7.059   9.284   0.102   1.00 0.00 ? 15 GLN A HE21 11 
ATOM 8078  H HE22 . GLN A 1 15 ? 5.740   10.229  -0.394  1.00 0.00 ? 15 GLN A HE22 11 
ATOM 8079  N N    . LEU A 1 16 ? 3.614   4.452   2.640   1.00 0.00 ? 16 LEU A N    11 
ATOM 8080  C CA   . LEU A 1 16 ? 2.605   3.466   2.178   1.00 0.00 ? 16 LEU A CA   11 
ATOM 8081  C C    . LEU A 1 16 ? 1.521   3.395   3.243   1.00 0.00 ? 16 LEU A C    11 
ATOM 8082  O O    . LEU A 1 16 ? 0.341   3.389   2.953   1.00 0.00 ? 16 LEU A O    11 
ATOM 8083  C CB   . LEU A 1 16 ? 3.258   2.092   2.010   1.00 0.00 ? 16 LEU A CB   11 
ATOM 8084  C CG   . LEU A 1 16 ? 3.710   1.916   0.560   1.00 0.00 ? 16 LEU A CG   11 
ATOM 8085  C CD1  . LEU A 1 16 ? 4.494   0.610   0.424   1.00 0.00 ? 16 LEU A CD1  11 
ATOM 8086  C CD2  . LEU A 1 16 ? 2.483   1.871   -0.354  1.00 0.00 ? 16 LEU A CD2  11 
ATOM 8087  H H    . LEU A 1 16 ? 4.490   4.145   2.952   1.00 0.00 ? 16 LEU A H    11 
ATOM 8088  H HA   . LEU A 1 16 ? 2.175   3.789   1.241   1.00 0.00 ? 16 LEU A HA   11 
ATOM 8089  H HB2  . LEU A 1 16 ? 4.113   2.018   2.666   1.00 0.00 ? 16 LEU A HB2  11 
ATOM 8090  H HB3  . LEU A 1 16 ? 2.545   1.321   2.258   1.00 0.00 ? 16 LEU A HB3  11 
ATOM 8091  H HG   . LEU A 1 16 ? 4.342   2.746   0.277   1.00 0.00 ? 16 LEU A HG   11 
ATOM 8092  H HD11 . LEU A 1 16 ? 5.226   0.710   -0.363  1.00 0.00 ? 16 LEU A HD11 11 
ATOM 8093  H HD12 . LEU A 1 16 ? 3.814   -0.194  0.183   1.00 0.00 ? 16 LEU A HD12 11 
ATOM 8094  H HD13 . LEU A 1 16 ? 4.994   0.392   1.356   1.00 0.00 ? 16 LEU A HD13 11 
ATOM 8095  H HD21 . LEU A 1 16 ? 2.217   0.842   -0.548  1.00 0.00 ? 16 LEU A HD21 11 
ATOM 8096  H HD22 . LEU A 1 16 ? 2.710   2.365   -1.287  1.00 0.00 ? 16 LEU A HD22 11 
ATOM 8097  H HD23 . LEU A 1 16 ? 1.657   2.372   0.128   1.00 0.00 ? 16 LEU A HD23 11 
ATOM 8098  N N    . GLU A 1 17 ? 1.920   3.365   4.485   1.00 0.00 ? 17 GLU A N    11 
ATOM 8099  C CA   . GLU A 1 17 ? 0.921   3.322   5.581   1.00 0.00 ? 17 GLU A CA   11 
ATOM 8100  C C    . GLU A 1 17 ? 0.079   4.599   5.523   1.00 0.00 ? 17 GLU A C    11 
ATOM 8101  O O    . GLU A 1 17 ? -1.118  4.573   5.703   1.00 0.00 ? 17 GLU A O    11 
ATOM 8102  C CB   . GLU A 1 17 ? 1.640   3.241   6.930   1.00 0.00 ? 17 GLU A CB   11 
ATOM 8103  C CG   . GLU A 1 17 ? 0.619   2.973   8.038   1.00 0.00 ? 17 GLU A CG   11 
ATOM 8104  C CD   . GLU A 1 17 ? 0.813   3.988   9.167   1.00 0.00 ? 17 GLU A CD   11 
ATOM 8105  O OE1  . GLU A 1 17 ? 0.834   5.172   8.876   1.00 0.00 ? 17 GLU A OE1  11 
ATOM 8106  O OE2  . GLU A 1 17 ? 0.937   3.563   10.304  1.00 0.00 ? 17 GLU A OE2  11 
ATOM 8107  H H    . GLU A 1 17 ? 2.881   3.382   4.694   1.00 0.00 ? 17 GLU A H    11 
ATOM 8108  H HA   . GLU A 1 17 ? 0.285   2.461   5.455   1.00 0.00 ? 17 GLU A HA   11 
ATOM 8109  H HB2  . GLU A 1 17 ? 2.363   2.438   6.904   1.00 0.00 ? 17 GLU A HB2  11 
ATOM 8110  H HB3  . GLU A 1 17 ? 2.144   4.175   7.126   1.00 0.00 ? 17 GLU A HB3  11 
ATOM 8111  H HG2  . GLU A 1 17 ? -0.380  3.066   7.637   1.00 0.00 ? 17 GLU A HG2  11 
ATOM 8112  H HG3  . GLU A 1 17 ? 0.760   1.976   8.426   1.00 0.00 ? 17 GLU A HG3  11 
ATOM 8113  N N    . ASN A 1 18 ? 0.701   5.717   5.260   1.00 0.00 ? 18 ASN A N    11 
ATOM 8114  C CA   . ASN A 1 18 ? -0.060  6.998   5.177   1.00 0.00 ? 18 ASN A CA   11 
ATOM 8115  C C    . ASN A 1 18 ? -1.182  6.857   4.145   1.00 0.00 ? 18 ASN A C    11 
ATOM 8116  O O    . ASN A 1 18 ? -2.137  7.608   4.142   1.00 0.00 ? 18 ASN A O    11 
ATOM 8117  C CB   . ASN A 1 18 ? 0.884   8.125   4.753   1.00 0.00 ? 18 ASN A CB   11 
ATOM 8118  C CG   . ASN A 1 18 ? 1.611   8.672   5.982   1.00 0.00 ? 18 ASN A CG   11 
ATOM 8119  O OD1  . ASN A 1 18 ? 1.470   8.148   7.069   1.00 0.00 ? 18 ASN A OD1  11 
ATOM 8120  N ND2  . ASN A 1 18 ? 2.389   9.713   5.855   1.00 0.00 ? 18 ASN A ND2  11 
ATOM 8121  H H    . ASN A 1 18 ? 1.669   5.713   5.108   1.00 0.00 ? 18 ASN A H    11 
ATOM 8122  H HA   . ASN A 1 18 ? -0.485  7.227   6.143   1.00 0.00 ? 18 ASN A HA   11 
ATOM 8123  H HB2  . ASN A 1 18 ? 1.606   7.742   4.046   1.00 0.00 ? 18 ASN A HB2  11 
ATOM 8124  H HB3  . ASN A 1 18 ? 0.314   8.917   4.292   1.00 0.00 ? 18 ASN A HB3  11 
ATOM 8125  H HD21 . ASN A 1 18 ? 2.502   10.136  4.978   1.00 0.00 ? 18 ASN A HD21 11 
ATOM 8126  H HD22 . ASN A 1 18 ? 2.859   10.071  6.637   1.00 0.00 ? 18 ASN A HD22 11 
ATOM 8127  N N    . TYR A 1 19 ? -1.068  5.898   3.266   1.00 0.00 ? 19 TYR A N    11 
ATOM 8128  C CA   . TYR A 1 19 ? -2.117  5.696   2.224   1.00 0.00 ? 19 TYR A CA   11 
ATOM 8129  C C    . TYR A 1 19 ? -3.479  5.426   2.880   1.00 0.00 ? 19 TYR A C    11 
ATOM 8130  O O    . TYR A 1 19 ? -4.494  5.409   2.213   1.00 0.00 ? 19 TYR A O    11 
ATOM 8131  C CB   . TYR A 1 19 ? -1.724  4.503   1.348   1.00 0.00 ? 19 TYR A CB   11 
ATOM 8132  C CG   . TYR A 1 19 ? -2.404  4.590   -0.004  1.00 0.00 ? 19 TYR A CG   11 
ATOM 8133  C CD1  . TYR A 1 19 ? -3.389  5.558   -0.245  1.00 0.00 ? 19 TYR A CD1  11 
ATOM 8134  C CD2  . TYR A 1 19 ? -2.042  3.697   -1.020  1.00 0.00 ? 19 TYR A CD2  11 
ATOM 8135  C CE1  . TYR A 1 19 ? -4.006  5.633   -1.500  1.00 0.00 ? 19 TYR A CE1  11 
ATOM 8136  C CE2  . TYR A 1 19 ? -2.661  3.771   -2.274  1.00 0.00 ? 19 TYR A CE2  11 
ATOM 8137  C CZ   . TYR A 1 19 ? -3.641  4.740   -2.514  1.00 0.00 ? 19 TYR A CZ   11 
ATOM 8138  O OH   . TYR A 1 19 ? -4.249  4.815   -3.750  1.00 0.00 ? 19 TYR A OH   11 
ATOM 8139  H H    . TYR A 1 19 ? -0.287  5.309   3.288   1.00 0.00 ? 19 TYR A H    11 
ATOM 8140  H HA   . TYR A 1 19 ? -2.183  6.581   1.611   1.00 0.00 ? 19 TYR A HA   11 
ATOM 8141  H HB2  . TYR A 1 19 ? -0.654  4.503   1.210   1.00 0.00 ? 19 TYR A HB2  11 
ATOM 8142  H HB3  . TYR A 1 19 ? -2.016  3.592   1.839   1.00 0.00 ? 19 TYR A HB3  11 
ATOM 8143  H HD1  . TYR A 1 19 ? -3.673  6.246   0.536   1.00 0.00 ? 19 TYR A HD1  11 
ATOM 8144  H HD2  . TYR A 1 19 ? -1.290  2.944   -0.832  1.00 0.00 ? 19 TYR A HD2  11 
ATOM 8145  H HE1  . TYR A 1 19 ? -4.764  6.380   -1.685  1.00 0.00 ? 19 TYR A HE1  11 
ATOM 8146  H HE2  . TYR A 1 19 ? -2.379  3.082   -3.056  1.00 0.00 ? 19 TYR A HE2  11 
ATOM 8147  H HH   . TYR A 1 19 ? -5.194  4.912   -3.611  1.00 0.00 ? 19 TYR A HH   11 
ATOM 8148  N N    . CYS A 1 20 ? -3.502  5.206   4.175   1.00 0.00 ? 20 CYS A N    11 
ATOM 8149  C CA   . CYS A 1 20 ? -4.793  4.932   4.898   1.00 0.00 ? 20 CYS A CA   11 
ATOM 8150  C C    . CYS A 1 20 ? -5.971  5.574   4.160   1.00 0.00 ? 20 CYS A C    11 
ATOM 8151  O O    . CYS A 1 20 ? -5.884  6.689   3.685   1.00 0.00 ? 20 CYS A O    11 
ATOM 8152  C CB   . CYS A 1 20 ? -4.728  5.526   6.309   1.00 0.00 ? 20 CYS A CB   11 
ATOM 8153  S SG   . CYS A 1 20 ? -3.355  4.794   7.233   1.00 0.00 ? 20 CYS A SG   11 
ATOM 8154  H H    . CYS A 1 20 ? -2.663  5.211   4.676   1.00 0.00 ? 20 CYS A H    11 
ATOM 8155  H HA   . CYS A 1 20 ? -4.949  3.866   4.965   1.00 0.00 ? 20 CYS A HA   11 
ATOM 8156  H HB2  . CYS A 1 20 ? -4.583  6.594   6.241   1.00 0.00 ? 20 CYS A HB2  11 
ATOM 8157  H HB3  . CYS A 1 20 ? -5.656  5.324   6.825   1.00 0.00 ? 20 CYS A HB3  11 
ATOM 8158  N N    . ASN A 1 21 ? -7.071  4.880   4.059   1.00 0.00 ? 21 ASN A N    11 
ATOM 8159  C CA   . ASN A 1 21 ? -8.250  5.454   3.350   1.00 0.00 ? 21 ASN A CA   11 
ATOM 8160  C C    . ASN A 1 21 ? -8.557  6.844   3.912   1.00 0.00 ? 21 ASN A C    11 
ATOM 8161  O O    . ASN A 1 21 ? -8.424  7.019   5.112   1.00 0.00 ? 21 ASN A O    11 
ATOM 8162  C CB   . ASN A 1 21 ? -9.461  4.540   3.550   1.00 0.00 ? 21 ASN A CB   11 
ATOM 8163  C CG   . ASN A 1 21 ? -9.975  4.676   4.986   1.00 0.00 ? 21 ASN A CG   11 
ATOM 8164  O OD1  . ASN A 1 21 ? -9.422  4.095   5.898   1.00 0.00 ? 21 ASN A OD1  11 
ATOM 8165  N ND2  . ASN A 1 21 ? -11.017 5.424   5.224   1.00 0.00 ? 21 ASN A ND2  11 
ATOM 8166  O OXT  . ASN A 1 21 ? -8.921  7.710   3.133   1.00 0.00 ? 21 ASN A OXT  11 
ATOM 8167  H H    . ASN A 1 21 ? -7.122  3.982   4.448   1.00 0.00 ? 21 ASN A H    11 
ATOM 8168  H HA   . ASN A 1 21 ? -8.030  5.534   2.295   1.00 0.00 ? 21 ASN A HA   11 
ATOM 8169  H HB2  . ASN A 1 21 ? -10.243 4.823   2.860   1.00 0.00 ? 21 ASN A HB2  11 
ATOM 8170  H HB3  . ASN A 1 21 ? -9.174  3.516   3.369   1.00 0.00 ? 21 ASN A HB3  11 
ATOM 8171  H HD21 . ASN A 1 21 ? -11.463 5.892   4.488   1.00 0.00 ? 21 ASN A HD21 11 
ATOM 8172  H HD22 . ASN A 1 21 ? -11.353 5.518   6.140   1.00 0.00 ? 21 ASN A HD22 11 
ATOM 8173  N N    . PHE B 2 1  ? 10.845  -7.019  10.107  1.00 0.00 ? 1  PHE B N    11 
ATOM 8174  C CA   . PHE B 2 1  ? 10.119  -6.093  9.193   1.00 0.00 ? 1  PHE B CA   11 
ATOM 8175  C C    . PHE B 2 1  ? 10.646  -6.267  7.767   1.00 0.00 ? 1  PHE B C    11 
ATOM 8176  O O    . PHE B 2 1  ? 11.838  -6.335  7.539   1.00 0.00 ? 1  PHE B O    11 
ATOM 8177  C CB   . PHE B 2 1  ? 10.343  -4.649  9.646   1.00 0.00 ? 1  PHE B CB   11 
ATOM 8178  C CG   . PHE B 2 1  ? 11.789  -4.463  10.040  1.00 0.00 ? 1  PHE B CG   11 
ATOM 8179  C CD1  . PHE B 2 1  ? 12.758  -4.232  9.056   1.00 0.00 ? 1  PHE B CD1  11 
ATOM 8180  C CD2  . PHE B 2 1  ? 12.159  -4.521  11.388  1.00 0.00 ? 1  PHE B CD2  11 
ATOM 8181  C CE1  . PHE B 2 1  ? 14.099  -4.060  9.422   1.00 0.00 ? 1  PHE B CE1  11 
ATOM 8182  C CE2  . PHE B 2 1  ? 13.500  -4.349  11.754  1.00 0.00 ? 1  PHE B CE2  11 
ATOM 8183  C CZ   . PHE B 2 1  ? 14.469  -4.118  10.771  1.00 0.00 ? 1  PHE B CZ   11 
ATOM 8184  H H1   . PHE B 2 1  ? 10.383  -7.950  10.098  1.00 0.00 ? 1  PHE B H1   11 
ATOM 8185  H H2   . PHE B 2 1  ? 10.831  -6.633  11.074  1.00 0.00 ? 1  PHE B H2   11 
ATOM 8186  H H3   . PHE B 2 1  ? 11.830  -7.121  9.789   1.00 0.00 ? 1  PHE B H3   11 
ATOM 8187  H HA   . PHE B 2 1  ? 9.063   -6.319  9.216   1.00 0.00 ? 1  PHE B HA   11 
ATOM 8188  H HB2  . PHE B 2 1  ? 10.100  -3.976  8.836   1.00 0.00 ? 1  PHE B HB2  11 
ATOM 8189  H HB3  . PHE B 2 1  ? 9.709   -4.436  10.494  1.00 0.00 ? 1  PHE B HB3  11 
ATOM 8190  H HD1  . PHE B 2 1  ? 12.472  -4.187  8.016   1.00 0.00 ? 1  PHE B HD1  11 
ATOM 8191  H HD2  . PHE B 2 1  ? 11.412  -4.699  12.147  1.00 0.00 ? 1  PHE B HD2  11 
ATOM 8192  H HE1  . PHE B 2 1  ? 14.846  -3.882  8.663   1.00 0.00 ? 1  PHE B HE1  11 
ATOM 8193  H HE2  . PHE B 2 1  ? 13.786  -4.394  12.794  1.00 0.00 ? 1  PHE B HE2  11 
ATOM 8194  H HZ   . PHE B 2 1  ? 15.504  -3.985  11.052  1.00 0.00 ? 1  PHE B HZ   11 
ATOM 8195  N N    . VAL B 2 2  ? 9.768   -6.340  6.805   1.00 0.00 ? 2  VAL B N    11 
ATOM 8196  C CA   . VAL B 2 2  ? 10.219  -6.509  5.395   1.00 0.00 ? 2  VAL B CA   11 
ATOM 8197  C C    . VAL B 2 2  ? 10.769  -5.180  4.872   1.00 0.00 ? 2  VAL B C    11 
ATOM 8198  O O    . VAL B 2 2  ? 11.067  -4.279  5.631   1.00 0.00 ? 2  VAL B O    11 
ATOM 8199  C CB   . VAL B 2 2  ? 9.035   -6.946  4.530   1.00 0.00 ? 2  VAL B CB   11 
ATOM 8200  C CG1  . VAL B 2 2  ? 8.371   -8.173  5.156   1.00 0.00 ? 2  VAL B CG1  11 
ATOM 8201  C CG2  . VAL B 2 2  ? 8.018   -5.806  4.444   1.00 0.00 ? 2  VAL B CG2  11 
ATOM 8202  H H    . VAL B 2 2  ? 8.811   -6.283  7.010   1.00 0.00 ? 2  VAL B H    11 
ATOM 8203  H HA   . VAL B 2 2  ? 10.993  -7.261  5.352   1.00 0.00 ? 2  VAL B HA   11 
ATOM 8204  H HB   . VAL B 2 2  ? 9.387   -7.194  3.539   1.00 0.00 ? 2  VAL B HB   11 
ATOM 8205  H HG11 . VAL B 2 2  ? 7.297   -8.056  5.126   1.00 0.00 ? 2  VAL B HG11 11 
ATOM 8206  H HG12 . VAL B 2 2  ? 8.693   -8.273  6.182   1.00 0.00 ? 2  VAL B HG12 11 
ATOM 8207  H HG13 . VAL B 2 2  ? 8.652   -9.057  4.603   1.00 0.00 ? 2  VAL B HG13 11 
ATOM 8208  H HG21 . VAL B 2 2  ? 8.001   -5.414  3.437   1.00 0.00 ? 2  VAL B HG21 11 
ATOM 8209  H HG22 . VAL B 2 2  ? 8.299   -5.021  5.130   1.00 0.00 ? 2  VAL B HG22 11 
ATOM 8210  H HG23 . VAL B 2 2  ? 7.038   -6.177  4.703   1.00 0.00 ? 2  VAL B HG23 11 
ATOM 8211  N N    . ASN B 2 3  ? 10.908  -5.052  3.581   1.00 0.00 ? 3  ASN B N    11 
ATOM 8212  C CA   . ASN B 2 3  ? 11.439  -3.783  3.010   1.00 0.00 ? 3  ASN B CA   11 
ATOM 8213  C C    . ASN B 2 3  ? 11.403  -3.861  1.483   1.00 0.00 ? 3  ASN B C    11 
ATOM 8214  O O    . ASN B 2 3  ? 12.228  -3.284  0.803   1.00 0.00 ? 3  ASN B O    11 
ATOM 8215  C CB   . ASN B 2 3  ? 12.881  -3.576  3.477   1.00 0.00 ? 3  ASN B CB   11 
ATOM 8216  C CG   . ASN B 2 3  ? 13.359  -2.184  3.058   1.00 0.00 ? 3  ASN B CG   11 
ATOM 8217  O OD1  . ASN B 2 3  ? 13.829  -1.997  1.954   1.00 0.00 ? 3  ASN B OD1  11 
ATOM 8218  N ND2  . ASN B 2 3  ? 13.256  -1.192  3.900   1.00 0.00 ? 3  ASN B ND2  11 
ATOM 8219  H H    . ASN B 2 3  ? 10.662  -5.791  2.987   1.00 0.00 ? 3  ASN B H    11 
ATOM 8220  H HA   . ASN B 2 3  ? 10.830  -2.955  3.343   1.00 0.00 ? 3  ASN B HA   11 
ATOM 8221  H HB2  . ASN B 2 3  ? 12.928  -3.666  4.552   1.00 0.00 ? 3  ASN B HB2  11 
ATOM 8222  H HB3  . ASN B 2 3  ? 13.517  -4.323  3.025   1.00 0.00 ? 3  ASN B HB3  11 
ATOM 8223  H HD21 . ASN B 2 3  ? 12.876  -1.342  4.791   1.00 0.00 ? 3  ASN B HD21 11 
ATOM 8224  H HD22 . ASN B 2 3  ? 13.559  -0.296  3.642   1.00 0.00 ? 3  ASN B HD22 11 
ATOM 8225  N N    . GLN B 2 4  ? 10.453  -4.571  0.939   1.00 0.00 ? 4  GLN B N    11 
ATOM 8226  C CA   . GLN B 2 4  ? 10.365  -4.685  -0.544  1.00 0.00 ? 4  GLN B CA   11 
ATOM 8227  C C    . GLN B 2 4  ? 9.184   -5.582  -0.919  1.00 0.00 ? 4  GLN B C    11 
ATOM 8228  O O    . GLN B 2 4  ? 9.363   -6.706  -1.344  1.00 0.00 ? 4  GLN B O    11 
ATOM 8229  C CB   . GLN B 2 4  ? 11.661  -5.291  -1.087  1.00 0.00 ? 4  GLN B CB   11 
ATOM 8230  C CG   . GLN B 2 4  ? 12.048  -6.507  -0.244  1.00 0.00 ? 4  GLN B CG   11 
ATOM 8231  C CD   . GLN B 2 4  ? 13.556  -6.744  -0.353  1.00 0.00 ? 4  GLN B CD   11 
ATOM 8232  O OE1  . GLN B 2 4  ? 14.156  -6.456  -1.369  1.00 0.00 ? 4  GLN B OE1  11 
ATOM 8233  N NE2  . GLN B 2 4  ? 14.197  -7.260  0.660   1.00 0.00 ? 4  GLN B NE2  11 
ATOM 8234  H H    . GLN B 2 4  ? 9.797   -5.028  1.506   1.00 0.00 ? 4  GLN B H    11 
ATOM 8235  H HA   . GLN B 2 4  ? 10.220  -3.704  -0.971  1.00 0.00 ? 4  GLN B HA   11 
ATOM 8236  H HB2  . GLN B 2 4  ? 11.513  -5.594  -2.113  1.00 0.00 ? 4  GLN B HB2  11 
ATOM 8237  H HB3  . GLN B 2 4  ? 12.450  -4.556  -1.038  1.00 0.00 ? 4  GLN B HB3  11 
ATOM 8238  H HG2  . GLN B 2 4  ? 11.784  -6.329  0.788   1.00 0.00 ? 4  GLN B HG2  11 
ATOM 8239  H HG3  . GLN B 2 4  ? 11.522  -7.378  -0.606  1.00 0.00 ? 4  GLN B HG3  11 
ATOM 8240  H HE21 . GLN B 2 4  ? 13.714  -7.492  1.480   1.00 0.00 ? 4  GLN B HE21 11 
ATOM 8241  H HE22 . GLN B 2 4  ? 15.163  -7.415  0.600   1.00 0.00 ? 4  GLN B HE22 11 
ATOM 8242  N N    . HIS B 2 5  ? 7.981   -5.090  -0.753  1.00 0.00 ? 5  HIS B N    11 
ATOM 8243  C CA   . HIS B 2 5  ? 6.765   -5.902  -1.091  1.00 0.00 ? 5  HIS B CA   11 
ATOM 8244  C C    . HIS B 2 5  ? 7.042   -6.809  -2.297  1.00 0.00 ? 5  HIS B C    11 
ATOM 8245  O O    . HIS B 2 5  ? 7.338   -7.978  -2.151  1.00 0.00 ? 5  HIS B O    11 
ATOM 8246  C CB   . HIS B 2 5  ? 5.586   -4.974  -1.427  1.00 0.00 ? 5  HIS B CB   11 
ATOM 8247  C CG   . HIS B 2 5  ? 6.093   -3.653  -1.942  1.00 0.00 ? 5  HIS B CG   11 
ATOM 8248  N ND1  . HIS B 2 5  ? 6.584   -2.673  -1.098  1.00 0.00 ? 5  HIS B ND1  11 
ATOM 8249  C CD2  . HIS B 2 5  ? 6.201   -3.139  -3.211  1.00 0.00 ? 5  HIS B CD2  11 
ATOM 8250  C CE1  . HIS B 2 5  ? 6.966   -1.638  -1.860  1.00 0.00 ? 5  HIS B CE1  11 
ATOM 8251  N NE2  . HIS B 2 5  ? 6.753   -1.866  -3.156  1.00 0.00 ? 5  HIS B NE2  11 
ATOM 8252  H H    . HIS B 2 5  ? 7.877   -4.181  -0.394  1.00 0.00 ? 5  HIS B H    11 
ATOM 8253  H HA   . HIS B 2 5  ? 6.502   -6.515  -0.241  1.00 0.00 ? 5  HIS B HA   11 
ATOM 8254  H HB2  . HIS B 2 5  ? 4.971   -5.439  -2.184  1.00 0.00 ? 5  HIS B HB2  11 
ATOM 8255  H HB3  . HIS B 2 5  ? 4.996   -4.810  -0.538  1.00 0.00 ? 5  HIS B HB3  11 
ATOM 8256  H HD1  . HIS B 2 5  ? 6.643   -2.726  -0.121  1.00 0.00 ? 5  HIS B HD1  11 
ATOM 8257  H HD2  . HIS B 2 5  ? 5.901   -3.646  -4.115  1.00 0.00 ? 5  HIS B HD2  11 
ATOM 8258  H HE1  . HIS B 2 5  ? 7.409   -0.741  -1.473  1.00 0.00 ? 5  HIS B HE1  11 
ATOM 8259  N N    . LEU B 2 6  ? 6.945   -6.277  -3.484  1.00 0.00 ? 6  LEU B N    11 
ATOM 8260  C CA   . LEU B 2 6  ? 7.196   -7.100  -4.702  1.00 0.00 ? 6  LEU B CA   11 
ATOM 8261  C C    . LEU B 2 6  ? 6.700   -6.343  -5.940  1.00 0.00 ? 6  LEU B C    11 
ATOM 8262  O O    . LEU B 2 6  ? 7.151   -6.582  -7.042  1.00 0.00 ? 6  LEU B O    11 
ATOM 8263  C CB   . LEU B 2 6  ? 6.448   -8.430  -4.587  1.00 0.00 ? 6  LEU B CB   11 
ATOM 8264  C CG   . LEU B 2 6  ? 7.443   -9.586  -4.699  1.00 0.00 ? 6  LEU B CG   11 
ATOM 8265  C CD1  . LEU B 2 6  ? 7.615   -10.248 -3.330  1.00 0.00 ? 6  LEU B CD1  11 
ATOM 8266  C CD2  . LEU B 2 6  ? 6.916   -10.618 -5.700  1.00 0.00 ? 6  LEU B CD2  11 
ATOM 8267  H H    . LEU B 2 6  ? 6.706   -5.337  -3.575  1.00 0.00 ? 6  LEU B H    11 
ATOM 8268  H HA   . LEU B 2 6  ? 8.255   -7.289  -4.796  1.00 0.00 ? 6  LEU B HA   11 
ATOM 8269  H HB2  . LEU B 2 6  ? 5.943   -8.479  -3.633  1.00 0.00 ? 6  LEU B HB2  11 
ATOM 8270  H HB3  . LEU B 2 6  ? 5.722   -8.505  -5.383  1.00 0.00 ? 6  LEU B HB3  11 
ATOM 8271  H HG   . LEU B 2 6  ? 8.397   -9.208  -5.038  1.00 0.00 ? 6  LEU B HG   11 
ATOM 8272  H HD11 . LEU B 2 6  ? 8.486   -9.839  -2.840  1.00 0.00 ? 6  LEU B HD11 11 
ATOM 8273  H HD12 . LEU B 2 6  ? 7.740   -11.313 -3.458  1.00 0.00 ? 6  LEU B HD12 11 
ATOM 8274  H HD13 . LEU B 2 6  ? 6.740   -10.058 -2.727  1.00 0.00 ? 6  LEU B HD13 11 
ATOM 8275  H HD21 . LEU B 2 6  ? 7.618   -11.434 -5.779  1.00 0.00 ? 6  LEU B HD21 11 
ATOM 8276  H HD22 . LEU B 2 6  ? 6.795   -10.152 -6.667  1.00 0.00 ? 6  LEU B HD22 11 
ATOM 8277  H HD23 . LEU B 2 6  ? 5.962   -10.994 -5.360  1.00 0.00 ? 6  LEU B HD23 11 
ATOM 8278  N N    . CYS B 2 7  ? 5.773   -5.436  -5.765  1.00 0.00 ? 7  CYS B N    11 
ATOM 8279  C CA   . CYS B 2 7  ? 5.243   -4.663  -6.926  1.00 0.00 ? 7  CYS B CA   11 
ATOM 8280  C C    . CYS B 2 7  ? 4.413   -5.589  -7.816  1.00 0.00 ? 7  CYS B C    11 
ATOM 8281  O O    . CYS B 2 7  ? 4.939   -6.366  -8.587  1.00 0.00 ? 7  CYS B O    11 
ATOM 8282  C CB   . CYS B 2 7  ? 6.407   -4.077  -7.728  1.00 0.00 ? 7  CYS B CB   11 
ATOM 8283  S SG   . CYS B 2 7  ? 5.769   -2.953  -8.998  1.00 0.00 ? 7  CYS B SG   11 
ATOM 8284  H H    . CYS B 2 7  ? 5.421   -5.265  -4.869  1.00 0.00 ? 7  CYS B H    11 
ATOM 8285  H HA   . CYS B 2 7  ? 4.618   -3.861  -6.564  1.00 0.00 ? 7  CYS B HA   11 
ATOM 8286  H HB2  . CYS B 2 7  ? 7.062   -3.534  -7.063  1.00 0.00 ? 7  CYS B HB2  11 
ATOM 8287  H HB3  . CYS B 2 7  ? 6.957   -4.876  -8.200  1.00 0.00 ? 7  CYS B HB3  11 
ATOM 8288  N N    . GLY B 2 8  ? 3.115   -5.512  -7.706  1.00 0.00 ? 8  GLY B N    11 
ATOM 8289  C CA   . GLY B 2 8  ? 2.239   -6.386  -8.535  1.00 0.00 ? 8  GLY B CA   11 
ATOM 8290  C C    . GLY B 2 8  ? 1.184   -7.042  -7.640  1.00 0.00 ? 8  GLY B C    11 
ATOM 8291  O O    . GLY B 2 8  ? 0.327   -7.768  -8.103  1.00 0.00 ? 8  GLY B O    11 
ATOM 8292  H H    . GLY B 2 8  ? 2.716   -4.879  -7.073  1.00 0.00 ? 8  GLY B H    11 
ATOM 8293  H HA2  . GLY B 2 8  ? 1.751   -5.791  -9.294  1.00 0.00 ? 8  GLY B HA2  11 
ATOM 8294  H HA3  . GLY B 2 8  ? 2.835   -7.153  -9.005  1.00 0.00 ? 8  GLY B HA3  11 
ATOM 8295  N N    . SER B 2 9  ? 1.242   -6.792  -6.359  1.00 0.00 ? 9  SER B N    11 
ATOM 8296  C CA   . SER B 2 9  ? 0.247   -7.398  -5.432  1.00 0.00 ? 9  SER B CA   11 
ATOM 8297  C C    . SER B 2 9  ? 0.685   -7.142  -3.988  1.00 0.00 ? 9  SER B C    11 
ATOM 8298  O O    . SER B 2 9  ? -0.109  -6.783  -3.141  1.00 0.00 ? 9  SER B O    11 
ATOM 8299  C CB   . SER B 2 9  ? 0.167   -8.905  -5.682  1.00 0.00 ? 9  SER B CB   11 
ATOM 8300  O OG   . SER B 2 9  ? -1.140  -9.237  -6.132  1.00 0.00 ? 9  SER B OG   11 
ATOM 8301  H H    . SER B 2 9  ? 1.941   -6.205  -6.006  1.00 0.00 ? 9  SER B H    11 
ATOM 8302  H HA   . SER B 2 9  ? -0.722  -6.952  -5.600  1.00 0.00 ? 9  SER B HA   11 
ATOM 8303  H HB2  . SER B 2 9  ? 0.883   -9.185  -6.436  1.00 0.00 ? 9  SER B HB2  11 
ATOM 8304  H HB3  . SER B 2 9  ? 0.388   -9.433  -4.764  1.00 0.00 ? 9  SER B HB3  11 
ATOM 8305  H HG   . SER B 2 9  ? -1.451  -8.523  -6.694  1.00 0.00 ? 9  SER B HG   11 
ATOM 8306  N N    . HIS B 2 10 ? 1.945   -7.324  -3.703  1.00 0.00 ? 10 HIS B N    11 
ATOM 8307  C CA   . HIS B 2 10 ? 2.438   -7.093  -2.320  1.00 0.00 ? 10 HIS B CA   11 
ATOM 8308  C C    . HIS B 2 10 ? 2.413   -5.596  -2.009  1.00 0.00 ? 10 HIS B C    11 
ATOM 8309  O O    . HIS B 2 10 ? 2.087   -5.188  -0.912  1.00 0.00 ? 10 HIS B O    11 
ATOM 8310  C CB   . HIS B 2 10 ? 3.871   -7.615  -2.194  1.00 0.00 ? 10 HIS B CB   11 
ATOM 8311  C CG   . HIS B 2 10 ? 3.850   -9.114  -2.064  1.00 0.00 ? 10 HIS B CG   11 
ATOM 8312  N ND1  . HIS B 2 10 ? 3.112   -9.919  -2.917  1.00 0.00 ? 10 HIS B ND1  11 
ATOM 8313  C CD2  . HIS B 2 10 ? 4.472   -9.967  -1.187  1.00 0.00 ? 10 HIS B CD2  11 
ATOM 8314  C CE1  . HIS B 2 10 ? 3.306   -11.196 -2.538  1.00 0.00 ? 10 HIS B CE1  11 
ATOM 8315  N NE2  . HIS B 2 10 ? 4.127   -11.281 -1.487  1.00 0.00 ? 10 HIS B NE2  11 
ATOM 8316  H H    . HIS B 2 10 ? 2.567   -7.614  -4.398  1.00 0.00 ? 10 HIS B H    11 
ATOM 8317  H HA   . HIS B 2 10 ? 1.803   -7.614  -1.623  1.00 0.00 ? 10 HIS B HA   11 
ATOM 8318  H HB2  . HIS B 2 10 ? 4.433   -7.338  -3.074  1.00 0.00 ? 10 HIS B HB2  11 
ATOM 8319  H HB3  . HIS B 2 10 ? 4.335   -7.185  -1.319  1.00 0.00 ? 10 HIS B HB3  11 
ATOM 8320  H HD1  . HIS B 2 10 ? 2.551   -9.615  -3.661  1.00 0.00 ? 10 HIS B HD1  11 
ATOM 8321  H HD2  . HIS B 2 10 ? 5.129   -9.665  -0.385  1.00 0.00 ? 10 HIS B HD2  11 
ATOM 8322  H HE1  . HIS B 2 10 ? 2.853   -12.047 -3.023  1.00 0.00 ? 10 HIS B HE1  11 
ATOM 8323  N N    . LEU B 2 11 ? 2.754   -4.771  -2.962  1.00 0.00 ? 11 LEU B N    11 
ATOM 8324  C CA   . LEU B 2 11 ? 2.746   -3.306  -2.701  1.00 0.00 ? 11 LEU B CA   11 
ATOM 8325  C C    . LEU B 2 11 ? 1.343   -2.877  -2.276  1.00 0.00 ? 11 LEU B C    11 
ATOM 8326  O O    . LEU B 2 11 ? 1.171   -2.166  -1.306  1.00 0.00 ? 11 LEU B O    11 
ATOM 8327  C CB   . LEU B 2 11 ? 3.146   -2.548  -3.969  1.00 0.00 ? 11 LEU B CB   11 
ATOM 8328  C CG   . LEU B 2 11 ? 3.101   -1.039  -3.703  1.00 0.00 ? 11 LEU B CG   11 
ATOM 8329  C CD1  . LEU B 2 11 ? 3.692   -0.729  -2.323  1.00 0.00 ? 11 LEU B CD1  11 
ATOM 8330  C CD2  . LEU B 2 11 ? 3.916   -0.313  -4.773  1.00 0.00 ? 11 LEU B CD2  11 
ATOM 8331  H H    . LEU B 2 11 ? 3.016   -5.115  -3.841  1.00 0.00 ? 11 LEU B H    11 
ATOM 8332  H HA   . LEU B 2 11 ? 3.446   -3.078  -1.911  1.00 0.00 ? 11 LEU B HA   11 
ATOM 8333  H HB2  . LEU B 2 11 ? 4.145   -2.834  -4.259  1.00 0.00 ? 11 LEU B HB2  11 
ATOM 8334  H HB3  . LEU B 2 11 ? 2.457   -2.790  -4.764  1.00 0.00 ? 11 LEU B HB3  11 
ATOM 8335  H HG   . LEU B 2 11 ? 2.076   -0.700  -3.739  1.00 0.00 ? 11 LEU B HG   11 
ATOM 8336  H HD11 . LEU B 2 11 ? 4.506   -1.409  -2.119  1.00 0.00 ? 11 LEU B HD11 11 
ATOM 8337  H HD12 . LEU B 2 11 ? 2.927   -0.848  -1.570  1.00 0.00 ? 11 LEU B HD12 11 
ATOM 8338  H HD13 . LEU B 2 11 ? 4.057   0.287   -2.307  1.00 0.00 ? 11 LEU B HD13 11 
ATOM 8339  H HD21 . LEU B 2 11 ? 3.965   -0.923  -5.663  1.00 0.00 ? 11 LEU B HD21 11 
ATOM 8340  H HD22 . LEU B 2 11 ? 4.915   -0.134  -4.404  1.00 0.00 ? 11 LEU B HD22 11 
ATOM 8341  H HD23 . LEU B 2 11 ? 3.445   0.629   -5.007  1.00 0.00 ? 11 LEU B HD23 11 
ATOM 8342  N N    . VAL B 2 12 ? 0.336   -3.311  -2.982  1.00 0.00 ? 12 VAL B N    11 
ATOM 8343  C CA   . VAL B 2 12 ? -1.049  -2.932  -2.595  1.00 0.00 ? 12 VAL B CA   11 
ATOM 8344  C C    . VAL B 2 12 ? -1.366  -3.587  -1.256  1.00 0.00 ? 12 VAL B C    11 
ATOM 8345  O O    . VAL B 2 12 ? -1.889  -2.963  -0.354  1.00 0.00 ? 12 VAL B O    11 
ATOM 8346  C CB   . VAL B 2 12 ? -2.039  -3.411  -3.659  1.00 0.00 ? 12 VAL B CB   11 
ATOM 8347  C CG1  . VAL B 2 12 ? -1.872  -4.917  -3.875  1.00 0.00 ? 12 VAL B CG1  11 
ATOM 8348  C CG2  . VAL B 2 12 ? -3.467  -3.120  -3.193  1.00 0.00 ? 12 VAL B CG2  11 
ATOM 8349  H H    . VAL B 2 12 ? 0.490   -3.892  -3.756  1.00 0.00 ? 12 VAL B H    11 
ATOM 8350  H HA   . VAL B 2 12 ? -1.112  -1.859  -2.491  1.00 0.00 ? 12 VAL B HA   11 
ATOM 8351  H HB   . VAL B 2 12 ? -1.848  -2.892  -4.587  1.00 0.00 ? 12 VAL B HB   11 
ATOM 8352  H HG11 . VAL B 2 12 ? -2.561  -5.250  -4.638  1.00 0.00 ? 12 VAL B HG11 11 
ATOM 8353  H HG12 . VAL B 2 12 ? -2.079  -5.438  -2.952  1.00 0.00 ? 12 VAL B HG12 11 
ATOM 8354  H HG13 . VAL B 2 12 ? -0.860  -5.125  -4.188  1.00 0.00 ? 12 VAL B HG13 11 
ATOM 8355  H HG21 . VAL B 2 12 ? -3.456  -2.847  -2.148  1.00 0.00 ? 12 VAL B HG21 11 
ATOM 8356  H HG22 . VAL B 2 12 ? -4.077  -4.001  -3.329  1.00 0.00 ? 12 VAL B HG22 11 
ATOM 8357  H HG23 . VAL B 2 12 ? -3.876  -2.306  -3.773  1.00 0.00 ? 12 VAL B HG23 11 
ATOM 8358  N N    . GLU B 2 13 ? -1.028  -4.837  -1.109  1.00 0.00 ? 13 GLU B N    11 
ATOM 8359  C CA   . GLU B 2 13 ? -1.283  -5.519  0.183   1.00 0.00 ? 13 GLU B CA   11 
ATOM 8360  C C    . GLU B 2 13 ? -0.613  -4.704  1.285   1.00 0.00 ? 13 GLU B C    11 
ATOM 8361  O O    . GLU B 2 13 ? -1.062  -4.673  2.414   1.00 0.00 ? 13 GLU B O    11 
ATOM 8362  C CB   . GLU B 2 13 ? -0.689  -6.929  0.148   1.00 0.00 ? 13 GLU B CB   11 
ATOM 8363  C CG   . GLU B 2 13 ? -1.455  -7.830  1.119   1.00 0.00 ? 13 GLU B CG   11 
ATOM 8364  C CD   . GLU B 2 13 ? -2.826  -8.165  0.529   1.00 0.00 ? 13 GLU B CD   11 
ATOM 8365  O OE1  . GLU B 2 13 ? -2.913  -9.138  -0.202  1.00 0.00 ? 13 GLU B OE1  11 
ATOM 8366  O OE2  . GLU B 2 13 ? -3.766  -7.443  0.819   1.00 0.00 ? 13 GLU B OE2  11 
ATOM 8367  H H    . GLU B 2 13 ? -0.587  -5.317  -1.841  1.00 0.00 ? 13 GLU B H    11 
ATOM 8368  H HA   . GLU B 2 13 ? -2.346  -5.573  0.363   1.00 0.00 ? 13 GLU B HA   11 
ATOM 8369  H HB2  . GLU B 2 13 ? -0.767  -7.328  -0.853  1.00 0.00 ? 13 GLU B HB2  11 
ATOM 8370  H HB3  . GLU B 2 13 ? 0.350   -6.890  0.441   1.00 0.00 ? 13 GLU B HB3  11 
ATOM 8371  H HG2  . GLU B 2 13 ? -0.898  -8.741  1.280   1.00 0.00 ? 13 GLU B HG2  11 
ATOM 8372  H HG3  . GLU B 2 13 ? -1.586  -7.316  2.060   1.00 0.00 ? 13 GLU B HG3  11 
ATOM 8373  N N    . ALA B 2 14 ? 0.463   -4.036  0.959   1.00 0.00 ? 14 ALA B N    11 
ATOM 8374  C CA   . ALA B 2 14 ? 1.165   -3.214  1.980   1.00 0.00 ? 14 ALA B CA   11 
ATOM 8375  C C    . ALA B 2 14 ? 0.226   -2.110  2.460   1.00 0.00 ? 14 ALA B C    11 
ATOM 8376  O O    . ALA B 2 14 ? 0.062   -1.890  3.643   1.00 0.00 ? 14 ALA B O    11 
ATOM 8377  C CB   . ALA B 2 14 ? 2.418   -2.589  1.363   1.00 0.00 ? 14 ALA B CB   11 
ATOM 8378  H H    . ALA B 2 14 ? 0.802   -4.073  0.040   1.00 0.00 ? 14 ALA B H    11 
ATOM 8379  H HA   . ALA B 2 14 ? 1.443   -3.837  2.811   1.00 0.00 ? 14 ALA B HA   11 
ATOM 8380  H HB1  . ALA B 2 14 ? 2.718   -3.163  0.498   1.00 0.00 ? 14 ALA B HB1  11 
ATOM 8381  H HB2  . ALA B 2 14 ? 3.216   -2.590  2.090   1.00 0.00 ? 14 ALA B HB2  11 
ATOM 8382  H HB3  . ALA B 2 14 ? 2.204   -1.573  1.064   1.00 0.00 ? 14 ALA B HB3  11 
ATOM 8383  N N    . LEU B 2 15 ? -0.409  -1.429  1.547   1.00 0.00 ? 15 LEU B N    11 
ATOM 8384  C CA   . LEU B 2 15 ? -1.359  -0.353  1.948   1.00 0.00 ? 15 LEU B CA   11 
ATOM 8385  C C    . LEU B 2 15 ? -2.575  -1.008  2.594   1.00 0.00 ? 15 LEU B C    11 
ATOM 8386  O O    . LEU B 2 15 ? -3.053  -0.581  3.621   1.00 0.00 ? 15 LEU B O    11 
ATOM 8387  C CB   . LEU B 2 15 ? -1.776  0.452   0.707   1.00 0.00 ? 15 LEU B CB   11 
ATOM 8388  C CG   . LEU B 2 15 ? -3.055  1.278   0.961   1.00 0.00 ? 15 LEU B CG   11 
ATOM 8389  C CD1  . LEU B 2 15 ? -4.278  0.460   0.564   1.00 0.00 ? 15 LEU B CD1  11 
ATOM 8390  C CD2  . LEU B 2 15 ? -3.182  1.692   2.435   1.00 0.00 ? 15 LEU B CD2  11 
ATOM 8391  H H    . LEU B 2 15 ? -0.270  -1.635  0.599   1.00 0.00 ? 15 LEU B H    11 
ATOM 8392  H HA   . LEU B 2 15 ? -0.882  0.300   2.661   1.00 0.00 ? 15 LEU B HA   11 
ATOM 8393  H HB2  . LEU B 2 15 ? -0.973  1.121   0.435   1.00 0.00 ? 15 LEU B HB2  11 
ATOM 8394  H HB3  . LEU B 2 15 ? -1.955  -0.231  -0.111  1.00 0.00 ? 15 LEU B HB3  11 
ATOM 8395  H HG   . LEU B 2 15 ? -3.024  2.164   0.350   1.00 0.00 ? 15 LEU B HG   11 
ATOM 8396  H HD11 . LEU B 2 15 ? -4.141  -0.564  0.868   1.00 0.00 ? 15 LEU B HD11 11 
ATOM 8397  H HD12 . LEU B 2 15 ? -4.406  0.505   -0.507  1.00 0.00 ? 15 LEU B HD12 11 
ATOM 8398  H HD13 . LEU B 2 15 ? -5.153  0.866   1.048   1.00 0.00 ? 15 LEU B HD13 11 
ATOM 8399  H HD21 . LEU B 2 15 ? -3.943  1.095   2.910   1.00 0.00 ? 15 LEU B HD21 11 
ATOM 8400  H HD22 . LEU B 2 15 ? -3.464  2.732   2.493   1.00 0.00 ? 15 LEU B HD22 11 
ATOM 8401  H HD23 . LEU B 2 15 ? -2.239  1.546   2.939   1.00 0.00 ? 15 LEU B HD23 11 
ATOM 8402  N N    . TYR B 2 16 ? -3.070  -2.055  2.013   1.00 0.00 ? 16 TYR B N    11 
ATOM 8403  C CA   . TYR B 2 16 ? -4.245  -2.731  2.614   1.00 0.00 ? 16 TYR B CA   11 
ATOM 8404  C C    . TYR B 2 16 ? -3.903  -3.118  4.052   1.00 0.00 ? 16 TYR B C    11 
ATOM 8405  O O    . TYR B 2 16 ? -4.663  -2.885  4.971   1.00 0.00 ? 16 TYR B O    11 
ATOM 8406  C CB   . TYR B 2 16 ? -4.574  -3.992  1.812   1.00 0.00 ? 16 TYR B CB   11 
ATOM 8407  C CG   . TYR B 2 16 ? -5.747  -3.721  0.900   1.00 0.00 ? 16 TYR B CG   11 
ATOM 8408  C CD1  . TYR B 2 16 ? -5.600  -2.860  -0.194  1.00 0.00 ? 16 TYR B CD1  11 
ATOM 8409  C CD2  . TYR B 2 16 ? -6.982  -4.333  1.149   1.00 0.00 ? 16 TYR B CD2  11 
ATOM 8410  C CE1  . TYR B 2 16 ? -6.688  -2.611  -1.040  1.00 0.00 ? 16 TYR B CE1  11 
ATOM 8411  C CE2  . TYR B 2 16 ? -8.069  -4.084  0.303   1.00 0.00 ? 16 TYR B CE2  11 
ATOM 8412  C CZ   . TYR B 2 16 ? -7.922  -3.223  -0.791  1.00 0.00 ? 16 TYR B CZ   11 
ATOM 8413  O OH   . TYR B 2 16 ? -8.994  -2.978  -1.625  1.00 0.00 ? 16 TYR B OH   11 
ATOM 8414  H H    . TYR B 2 16 ? -2.666  -2.399  1.190   1.00 0.00 ? 16 TYR B H    11 
ATOM 8415  H HA   . TYR B 2 16 ? -5.091  -2.063  2.606   1.00 0.00 ? 16 TYR B HA   11 
ATOM 8416  H HB2  . TYR B 2 16 ? -3.717  -4.275  1.219   1.00 0.00 ? 16 TYR B HB2  11 
ATOM 8417  H HB3  . TYR B 2 16 ? -4.825  -4.794  2.490   1.00 0.00 ? 16 TYR B HB3  11 
ATOM 8418  H HD1  . TYR B 2 16 ? -4.648  -2.388  -0.385  1.00 0.00 ? 16 TYR B HD1  11 
ATOM 8419  H HD2  . TYR B 2 16 ? -7.095  -4.997  1.993   1.00 0.00 ? 16 TYR B HD2  11 
ATOM 8420  H HE1  . TYR B 2 16 ? -6.574  -1.947  -1.884  1.00 0.00 ? 16 TYR B HE1  11 
ATOM 8421  H HE2  . TYR B 2 16 ? -9.022  -4.556  0.494   1.00 0.00 ? 16 TYR B HE2  11 
ATOM 8422  H HH   . TYR B 2 16 ? -8.694  -3.084  -2.531  1.00 0.00 ? 16 TYR B HH   11 
ATOM 8423  N N    . LEU B 2 17 ? -2.766  -3.724  4.245   1.00 0.00 ? 17 LEU B N    11 
ATOM 8424  C CA   . LEU B 2 17 ? -2.360  -4.152  5.615   1.00 0.00 ? 17 LEU B CA   11 
ATOM 8425  C C    . LEU B 2 17 ? -2.030  -2.953  6.508   1.00 0.00 ? 17 LEU B C    11 
ATOM 8426  O O    . LEU B 2 17 ? -2.459  -2.887  7.643   1.00 0.00 ? 17 LEU B O    11 
ATOM 8427  C CB   . LEU B 2 17 ? -1.142  -5.072  5.522   1.00 0.00 ? 17 LEU B CB   11 
ATOM 8428  C CG   . LEU B 2 17 ? -1.244  -6.164  6.588   1.00 0.00 ? 17 LEU B CG   11 
ATOM 8429  C CD1  . LEU B 2 17 ? 0.073   -6.941  6.651   1.00 0.00 ? 17 LEU B CD1  11 
ATOM 8430  C CD2  . LEU B 2 17 ? -1.521  -5.522  7.949   1.00 0.00 ? 17 LEU B CD2  11 
ATOM 8431  H H    . LEU B 2 17 ? -2.180  -3.908  3.483   1.00 0.00 ? 17 LEU B H    11 
ATOM 8432  H HA   . LEU B 2 17 ? -3.177  -4.689  6.056   1.00 0.00 ? 17 LEU B HA   11 
ATOM 8433  H HB2  . LEU B 2 17 ? -1.108  -5.526  4.542   1.00 0.00 ? 17 LEU B HB2  11 
ATOM 8434  H HB3  . LEU B 2 17 ? -0.243  -4.497  5.684   1.00 0.00 ? 17 LEU B HB3  11 
ATOM 8435  H HG   . LEU B 2 17 ? -2.048  -6.840  6.335   1.00 0.00 ? 17 LEU B HG   11 
ATOM 8436  H HD11 . LEU B 2 17 ? 0.592   -6.696  7.566   1.00 0.00 ? 17 LEU B HD11 11 
ATOM 8437  H HD12 . LEU B 2 17 ? 0.689   -6.674  5.805   1.00 0.00 ? 17 LEU B HD12 11 
ATOM 8438  H HD13 . LEU B 2 17 ? -0.133  -8.001  6.626   1.00 0.00 ? 17 LEU B HD13 11 
ATOM 8439  H HD21 . LEU B 2 17 ? -2.538  -5.158  7.975   1.00 0.00 ? 17 LEU B HD21 11 
ATOM 8440  H HD22 . LEU B 2 17 ? -0.840  -4.699  8.104   1.00 0.00 ? 17 LEU B HD22 11 
ATOM 8441  H HD23 . LEU B 2 17 ? -1.382  -6.257  8.728   1.00 0.00 ? 17 LEU B HD23 11 
ATOM 8442  N N    . VAL B 2 18 ? -1.267  -2.012  6.028   1.00 0.00 ? 18 VAL B N    11 
ATOM 8443  C CA   . VAL B 2 18 ? -0.924  -0.844  6.893   1.00 0.00 ? 18 VAL B CA   11 
ATOM 8444  C C    . VAL B 2 18 ? -2.223  -0.211  7.372   1.00 0.00 ? 18 VAL B C    11 
ATOM 8445  O O    . VAL B 2 18 ? -2.389  0.106   8.533   1.00 0.00 ? 18 VAL B O    11 
ATOM 8446  C CB   . VAL B 2 18 ? -0.127  0.192   6.095   1.00 0.00 ? 18 VAL B CB   11 
ATOM 8447  C CG1  . VAL B 2 18 ? 1.234   -0.376  5.685   1.00 0.00 ? 18 VAL B CG1  11 
ATOM 8448  C CG2  . VAL B 2 18 ? -0.915  0.556   4.853   1.00 0.00 ? 18 VAL B CG2  11 
ATOM 8449  H H    . VAL B 2 18 ? -0.918  -2.077  5.117   1.00 0.00 ? 18 VAL B H    11 
ATOM 8450  H HA   . VAL B 2 18 ? -0.352  -1.177  7.740   1.00 0.00 ? 18 VAL B HA   11 
ATOM 8451  H HB   . VAL B 2 18 ? 0.018   1.074   6.689   1.00 0.00 ? 18 VAL B HB   11 
ATOM 8452  H HG11 . VAL B 2 18 ? 1.153   -1.443  5.545   1.00 0.00 ? 18 VAL B HG11 11 
ATOM 8453  H HG12 . VAL B 2 18 ? 1.959   -0.167  6.458   1.00 0.00 ? 18 VAL B HG12 11 
ATOM 8454  H HG13 . VAL B 2 18 ? 1.552   0.085   4.761   1.00 0.00 ? 18 VAL B HG13 11 
ATOM 8455  H HG21 . VAL B 2 18 ? -0.312  1.185   4.214   1.00 0.00 ? 18 VAL B HG21 11 
ATOM 8456  H HG22 . VAL B 2 18 ? -1.814  1.084   5.135   1.00 0.00 ? 18 VAL B HG22 11 
ATOM 8457  H HG23 . VAL B 2 18 ? -1.173  -0.346  4.329   1.00 0.00 ? 18 VAL B HG23 11 
ATOM 8458  N N    . CYS B 2 19 ? -3.147  -0.036  6.479   1.00 0.00 ? 19 CYS B N    11 
ATOM 8459  C CA   . CYS B 2 19 ? -4.452  0.565   6.858   1.00 0.00 ? 19 CYS B CA   11 
ATOM 8460  C C    . CYS B 2 19 ? -5.270  0.755   5.590   1.00 0.00 ? 19 CYS B C    11 
ATOM 8461  O O    . CYS B 2 19 ? -5.984  1.726   5.432   1.00 0.00 ? 19 CYS B O    11 
ATOM 8462  C CB   . CYS B 2 19 ? -4.222  1.918   7.528   1.00 0.00 ? 19 CYS B CB   11 
ATOM 8463  S SG   . CYS B 2 19 ? -3.170  2.936   6.468   1.00 0.00 ? 19 CYS B SG   11 
ATOM 8464  H H    . CYS B 2 19 ? -2.983  -0.307  5.546   1.00 0.00 ? 19 CYS B H    11 
ATOM 8465  H HA   . CYS B 2 19 ? -4.976  -0.095  7.534   1.00 0.00 ? 19 CYS B HA   11 
ATOM 8466  H HB2  . CYS B 2 19 ? -5.171  2.412   7.678   1.00 0.00 ? 19 CYS B HB2  11 
ATOM 8467  H HB3  . CYS B 2 19 ? -3.737  1.770   8.482   1.00 0.00 ? 19 CYS B HB3  11 
ATOM 8468  N N    . GLY B 2 20 ? -5.157  -0.164  4.676   1.00 0.00 ? 20 GLY B N    11 
ATOM 8469  C CA   . GLY B 2 20 ? -5.916  -0.036  3.401   1.00 0.00 ? 20 GLY B CA   11 
ATOM 8470  C C    . GLY B 2 20 ? -7.046  -1.065  3.377   1.00 0.00 ? 20 GLY B C    11 
ATOM 8471  O O    . GLY B 2 20 ? -7.474  -1.509  2.330   1.00 0.00 ? 20 GLY B O    11 
ATOM 8472  H H    . GLY B 2 20 ? -4.560  -0.942  4.827   1.00 0.00 ? 20 GLY B H    11 
ATOM 8473  H HA2  . GLY B 2 20 ? -6.328  0.963   3.327   1.00 0.00 ? 20 GLY B HA2  11 
ATOM 8474  H HA3  . GLY B 2 20 ? -5.252  -0.211  2.568   1.00 0.00 ? 20 GLY B HA3  11 
ATOM 8475  N N    . GLU B 2 21 ? -7.525  -1.455  4.526   1.00 0.00 ? 21 GLU B N    11 
ATOM 8476  C CA   . GLU B 2 21 ? -8.625  -2.461  4.574   1.00 0.00 ? 21 GLU B CA   11 
ATOM 8477  C C    . GLU B 2 21 ? -9.731  -1.988  5.526   1.00 0.00 ? 21 GLU B C    11 
ATOM 8478  O O    . GLU B 2 21 ? -10.839 -2.486  5.495   1.00 0.00 ? 21 GLU B O    11 
ATOM 8479  C CB   . GLU B 2 21 ? -8.069  -3.798  5.067   1.00 0.00 ? 21 GLU B CB   11 
ATOM 8480  C CG   . GLU B 2 21 ? -8.797  -4.945  4.364   1.00 0.00 ? 21 GLU B CG   11 
ATOM 8481  C CD   . GLU B 2 21 ? -8.676  -6.218  5.203   1.00 0.00 ? 21 GLU B CD   11 
ATOM 8482  O OE1  . GLU B 2 21 ? -9.231  -6.243  6.289   1.00 0.00 ? 21 GLU B OE1  11 
ATOM 8483  O OE2  . GLU B 2 21 ? -8.031  -7.146  4.745   1.00 0.00 ? 21 GLU B OE2  11 
ATOM 8484  H H    . GLU B 2 21 ? -7.157  -1.090  5.356   1.00 0.00 ? 21 GLU B H    11 
ATOM 8485  H HA   . GLU B 2 21 ? -9.036  -2.589  3.583   1.00 0.00 ? 21 GLU B HA   11 
ATOM 8486  H HB2  . GLU B 2 21 ? -7.013  -3.851  4.846   1.00 0.00 ? 21 GLU B HB2  11 
ATOM 8487  H HB3  . GLU B 2 21 ? -8.219  -3.879  6.133   1.00 0.00 ? 21 GLU B HB3  11 
ATOM 8488  H HG2  . GLU B 2 21 ? -9.840  -4.689  4.245   1.00 0.00 ? 21 GLU B HG2  11 
ATOM 8489  H HG3  . GLU B 2 21 ? -8.354  -5.112  3.394   1.00 0.00 ? 21 GLU B HG3  11 
ATOM 8490  N N    . ARG B 2 22 ? -9.445  -1.037  6.376   1.00 0.00 ? 22 ARG B N    11 
ATOM 8491  C CA   . ARG B 2 22 ? -10.483 -0.550  7.324   1.00 0.00 ? 22 ARG B CA   11 
ATOM 8492  C C    . ARG B 2 22 ? -11.473 0.349   6.584   1.00 0.00 ? 22 ARG B C    11 
ATOM 8493  O O    . ARG B 2 22 ? -12.670 0.143   6.628   1.00 0.00 ? 22 ARG B O    11 
ATOM 8494  C CB   . ARG B 2 22 ? -9.815  0.244   8.448   1.00 0.00 ? 22 ARG B CB   11 
ATOM 8495  C CG   . ARG B 2 22 ? -8.935  -0.689  9.281   1.00 0.00 ? 22 ARG B CG   11 
ATOM 8496  C CD   . ARG B 2 22 ? -8.157  0.129   10.313  1.00 0.00 ? 22 ARG B CD   11 
ATOM 8497  N NE   . ARG B 2 22 ? -9.036  0.422   11.480  1.00 0.00 ? 22 ARG B NE   11 
ATOM 8498  C CZ   . ARG B 2 22 ? -8.759  -0.086  12.649  1.00 0.00 ? 22 ARG B CZ   11 
ATOM 8499  N NH1  . ARG B 2 22 ? -7.722  0.341   13.317  1.00 0.00 ? 22 ARG B NH1  11 
ATOM 8500  N NH2  . ARG B 2 22 ? -9.518  -1.022  13.151  1.00 0.00 ? 22 ARG B NH2  11 
ATOM 8501  H H    . ARG B 2 22 ? -8.552  -0.648  6.395   1.00 0.00 ? 22 ARG B H    11 
ATOM 8502  H HA   . ARG B 2 22 ? -11.004 -1.391  7.739   1.00 0.00 ? 22 ARG B HA   11 
ATOM 8503  H HB2  . ARG B 2 22 ? -9.207  1.029   8.023   1.00 0.00 ? 22 ARG B HB2  11 
ATOM 8504  H HB3  . ARG B 2 22 ? -10.574 0.680   9.081   1.00 0.00 ? 22 ARG B HB3  11 
ATOM 8505  H HG2  . ARG B 2 22 ? -9.558  -1.413  9.788   1.00 0.00 ? 22 ARG B HG2  11 
ATOM 8506  H HG3  . ARG B 2 22 ? -8.241  -1.202  8.633   1.00 0.00 ? 22 ARG B HG3  11 
ATOM 8507  H HD2  . ARG B 2 22 ? -7.296  -0.434  10.643  1.00 0.00 ? 22 ARG B HD2  11 
ATOM 8508  H HD3  . ARG B 2 22 ? -7.831  1.056   9.866   1.00 0.00 ? 22 ARG B HD3  11 
ATOM 8509  H HE   . ARG B 2 22 ? -9.823  0.996   11.369  1.00 0.00 ? 22 ARG B HE   11 
ATOM 8510  H HH11 . ARG B 2 22 ? -7.141  1.058   12.932  1.00 0.00 ? 22 ARG B HH11 11 
ATOM 8511  H HH12 . ARG B 2 22 ? -7.510  -0.048  14.213  1.00 0.00 ? 22 ARG B HH12 11 
ATOM 8512  H HH21 . ARG B 2 22 ? -10.312 -1.349  12.639  1.00 0.00 ? 22 ARG B HH21 11 
ATOM 8513  H HH22 . ARG B 2 22 ? -9.306  -1.411  14.048  1.00 0.00 ? 22 ARG B HH22 11 
ATOM 8514  N N    . GLY B 2 23 ? -10.981 1.343   5.903   1.00 0.00 ? 23 GLY B N    11 
ATOM 8515  C CA   . GLY B 2 23 ? -11.887 2.259   5.154   1.00 0.00 ? 23 GLY B CA   11 
ATOM 8516  C C    . GLY B 2 23 ? -11.533 2.213   3.668   1.00 0.00 ? 23 GLY B C    11 
ATOM 8517  O O    . GLY B 2 23 ? -11.736 3.164   2.940   1.00 0.00 ? 23 GLY B O    11 
ATOM 8518  H H    . GLY B 2 23 ? -10.012 1.485   5.883   1.00 0.00 ? 23 GLY B H    11 
ATOM 8519  H HA2  . GLY B 2 23 ? -12.912 1.945   5.293   1.00 0.00 ? 23 GLY B HA2  11 
ATOM 8520  H HA3  . GLY B 2 23 ? -11.765 3.267   5.520   1.00 0.00 ? 23 GLY B HA3  11 
ATOM 8521  N N    . PHE B 2 24 ? -10.999 1.112   3.216   1.00 0.00 ? 24 PHE B N    11 
ATOM 8522  C CA   . PHE B 2 24 ? -10.625 0.995   1.780   1.00 0.00 ? 24 PHE B CA   11 
ATOM 8523  C C    . PHE B 2 24 ? -11.821 0.479   0.979   1.00 0.00 ? 24 PHE B C    11 
ATOM 8524  O O    . PHE B 2 24 ? -11.687 0.048   -0.149  1.00 0.00 ? 24 PHE B O    11 
ATOM 8525  C CB   . PHE B 2 24 ? -9.457  0.017   1.644   1.00 0.00 ? 24 PHE B CB   11 
ATOM 8526  C CG   . PHE B 2 24 ? -8.362  0.652   0.822   1.00 0.00 ? 24 PHE B CG   11 
ATOM 8527  C CD1  . PHE B 2 24 ? -7.781  1.855   1.241   1.00 0.00 ? 24 PHE B CD1  11 
ATOM 8528  C CD2  . PHE B 2 24 ? -7.934  0.044   -0.364  1.00 0.00 ? 24 PHE B CD2  11 
ATOM 8529  C CE1  . PHE B 2 24 ? -6.775  2.452   0.473   1.00 0.00 ? 24 PHE B CE1  11 
ATOM 8530  C CE2  . PHE B 2 24 ? -6.925  0.639   -1.131  1.00 0.00 ? 24 PHE B CE2  11 
ATOM 8531  C CZ   . PHE B 2 24 ? -6.347  1.844   -0.714  1.00 0.00 ? 24 PHE B CZ   11 
ATOM 8532  H H    . PHE B 2 24 ? -10.843 0.360   3.824   1.00 0.00 ? 24 PHE B H    11 
ATOM 8533  H HA   . PHE B 2 24 ? -10.329 1.964   1.403   1.00 0.00 ? 24 PHE B HA   11 
ATOM 8534  H HB2  . PHE B 2 24 ? -9.081  -0.224  2.626   1.00 0.00 ? 24 PHE B HB2  11 
ATOM 8535  H HB3  . PHE B 2 24 ? -9.797  -0.885  1.156   1.00 0.00 ? 24 PHE B HB3  11 
ATOM 8536  H HD1  . PHE B 2 24 ? -8.109  2.321   2.158   1.00 0.00 ? 24 PHE B HD1  11 
ATOM 8537  H HD2  . PHE B 2 24 ? -8.376  -0.888  -0.684  1.00 0.00 ? 24 PHE B HD2  11 
ATOM 8538  H HE1  . PHE B 2 24 ? -6.328  3.380   0.796   1.00 0.00 ? 24 PHE B HE1  11 
ATOM 8539  H HE2  . PHE B 2 24 ? -6.595  0.171   -2.047  1.00 0.00 ? 24 PHE B HE2  11 
ATOM 8540  H HZ   . PHE B 2 24 ? -5.571  2.305   -1.307  1.00 0.00 ? 24 PHE B HZ   11 
ATOM 8541  N N    . PHE B 2 25 ? -12.992 0.517   1.555   1.00 0.00 ? 25 PHE B N    11 
ATOM 8542  C CA   . PHE B 2 25 ? -14.196 0.027   0.828   1.00 0.00 ? 25 PHE B CA   11 
ATOM 8543  C C    . PHE B 2 25 ? -15.005 1.222   0.318   1.00 0.00 ? 25 PHE B C    11 
ATOM 8544  O O    . PHE B 2 25 ? -15.506 2.018   1.088   1.00 0.00 ? 25 PHE B O    11 
ATOM 8545  C CB   . PHE B 2 25 ? -15.059 -0.807  1.777   1.00 0.00 ? 25 PHE B CB   11 
ATOM 8546  C CG   . PHE B 2 25 ? -15.648 0.090   2.839   1.00 0.00 ? 25 PHE B CG   11 
ATOM 8547  C CD1  . PHE B 2 25 ? -14.887 0.443   3.959   1.00 0.00 ? 25 PHE B CD1  11 
ATOM 8548  C CD2  . PHE B 2 25 ? -16.957 0.569   2.703   1.00 0.00 ? 25 PHE B CD2  11 
ATOM 8549  C CE1  . PHE B 2 25 ? -15.433 1.275   4.943   1.00 0.00 ? 25 PHE B CE1  11 
ATOM 8550  C CE2  . PHE B 2 25 ? -17.503 1.401   3.687   1.00 0.00 ? 25 PHE B CE2  11 
ATOM 8551  C CZ   . PHE B 2 25 ? -16.742 1.754   4.807   1.00 0.00 ? 25 PHE B CZ   11 
ATOM 8552  H H    . PHE B 2 25 ? -13.078 0.867   2.466   1.00 0.00 ? 25 PHE B H    11 
ATOM 8553  H HA   . PHE B 2 25 ? -13.889 -0.583  -0.009  1.00 0.00 ? 25 PHE B HA   11 
ATOM 8554  H HB2  . PHE B 2 25 ? -15.856 -1.278  1.220   1.00 0.00 ? 25 PHE B HB2  11 
ATOM 8555  H HB3  . PHE B 2 25 ? -14.450 -1.565  2.245   1.00 0.00 ? 25 PHE B HB3  11 
ATOM 8556  H HD1  . PHE B 2 25 ? -13.877 0.073   4.064   1.00 0.00 ? 25 PHE B HD1  11 
ATOM 8557  H HD2  . PHE B 2 25 ? -17.544 0.296   1.838   1.00 0.00 ? 25 PHE B HD2  11 
ATOM 8558  H HE1  . PHE B 2 25 ? -14.846 1.547   5.808   1.00 0.00 ? 25 PHE B HE1  11 
ATOM 8559  H HE2  . PHE B 2 25 ? -18.513 1.770   3.582   1.00 0.00 ? 25 PHE B HE2  11 
ATOM 8560  H HZ   . PHE B 2 25 ? -17.163 2.395   5.567   1.00 0.00 ? 25 PHE B HZ   11 
ATOM 8561  N N    . TYR B 2 26 ? -15.138 1.354   -0.973  1.00 0.00 ? 26 TYR B N    11 
ATOM 8562  C CA   . TYR B 2 26 ? -15.915 2.497   -1.529  1.00 0.00 ? 26 TYR B CA   11 
ATOM 8563  C C    . TYR B 2 26 ? -17.298 2.007   -1.972  1.00 0.00 ? 26 TYR B C    11 
ATOM 8564  O O    . TYR B 2 26 ? -17.444 0.881   -2.405  1.00 0.00 ? 26 TYR B O    11 
ATOM 8565  C CB   . TYR B 2 26 ? -15.172 3.081   -2.732  1.00 0.00 ? 26 TYR B CB   11 
ATOM 8566  C CG   . TYR B 2 26 ? -13.709 3.236   -2.393  1.00 0.00 ? 26 TYR B CG   11 
ATOM 8567  C CD1  . TYR B 2 26 ? -13.329 3.915   -1.229  1.00 0.00 ? 26 TYR B CD1  11 
ATOM 8568  C CD2  . TYR B 2 26 ? -12.734 2.701   -3.243  1.00 0.00 ? 26 TYR B CD2  11 
ATOM 8569  C CE1  . TYR B 2 26 ? -11.972 4.059   -0.915  1.00 0.00 ? 26 TYR B CE1  11 
ATOM 8570  C CE2  . TYR B 2 26 ? -11.377 2.845   -2.928  1.00 0.00 ? 26 TYR B CE2  11 
ATOM 8571  C CZ   . TYR B 2 26 ? -10.996 3.523   -1.765  1.00 0.00 ? 26 TYR B CZ   11 
ATOM 8572  O OH   . TYR B 2 26 ? -9.659  3.665   -1.455  1.00 0.00 ? 26 TYR B OH   11 
ATOM 8573  H H    . TYR B 2 26 ? -14.727 0.701   -1.577  1.00 0.00 ? 26 TYR B H    11 
ATOM 8574  H HA   . TYR B 2 26 ? -16.028 3.257   -0.771  1.00 0.00 ? 26 TYR B HA   11 
ATOM 8575  H HB2  . TYR B 2 26 ? -15.278 2.418   -3.578  1.00 0.00 ? 26 TYR B HB2  11 
ATOM 8576  H HB3  . TYR B 2 26 ? -15.588 4.047   -2.978  1.00 0.00 ? 26 TYR B HB3  11 
ATOM 8577  H HD1  . TYR B 2 26 ? -14.081 4.328   -0.574  1.00 0.00 ? 26 TYR B HD1  11 
ATOM 8578  H HD2  . TYR B 2 26 ? -13.028 2.178   -4.140  1.00 0.00 ? 26 TYR B HD2  11 
ATOM 8579  H HE1  . TYR B 2 26 ? -11.678 4.582   -0.017  1.00 0.00 ? 26 TYR B HE1  11 
ATOM 8580  H HE2  . TYR B 2 26 ? -10.625 2.432   -3.584  1.00 0.00 ? 26 TYR B HE2  11 
ATOM 8581  H HH   . TYR B 2 26 ? -9.163  3.041   -1.991  1.00 0.00 ? 26 TYR B HH   11 
ATOM 8582  N N    . PRO B 2 27 ? -18.272 2.873   -1.849  1.00 0.00 ? 27 PRO B N    11 
ATOM 8583  C CA   . PRO B 2 27 ? -19.661 2.564   -2.228  1.00 0.00 ? 27 PRO B CA   11 
ATOM 8584  C C    . PRO B 2 27 ? -19.833 2.650   -3.747  1.00 0.00 ? 27 PRO B C    11 
ATOM 8585  O O    . PRO B 2 27 ? -19.269 3.507   -4.398  1.00 0.00 ? 27 PRO B O    11 
ATOM 8586  C CB   . PRO B 2 27 ? -20.475 3.653   -1.523  1.00 0.00 ? 27 PRO B CB   11 
ATOM 8587  C CG   . PRO B 2 27 ? -19.500 4.827   -1.263  1.00 0.00 ? 27 PRO B CG   11 
ATOM 8588  C CD   . PRO B 2 27 ? -18.078 4.239   -1.321  1.00 0.00 ? 27 PRO B CD   11 
ATOM 8589  H HA   . PRO B 2 27 ? -19.951 1.592   -1.863  1.00 0.00 ? 27 PRO B HA   11 
ATOM 8590  H HB2  . PRO B 2 27 ? -21.289 3.976   -2.159  1.00 0.00 ? 27 PRO B HB2  11 
ATOM 8591  H HB3  . PRO B 2 27 ? -20.858 3.284   -0.585  1.00 0.00 ? 27 PRO B HB3  11 
ATOM 8592  H HG2  . PRO B 2 27 ? -19.623 5.584   -2.026  1.00 0.00 ? 27 PRO B HG2  11 
ATOM 8593  H HG3  . PRO B 2 27 ? -19.681 5.249   -0.287  1.00 0.00 ? 27 PRO B HG3  11 
ATOM 8594  H HD2  . PRO B 2 27 ? -17.456 4.820   -1.987  1.00 0.00 ? 27 PRO B HD2  11 
ATOM 8595  H HD3  . PRO B 2 27 ? -17.644 4.198   -0.334  1.00 0.00 ? 27 PRO B HD3  11 
ATOM 8596  N N    . THR B 2 28 ? -20.610 1.769   -4.316  1.00 0.00 ? 28 THR B N    11 
ATOM 8597  C CA   . THR B 2 28 ? -20.818 1.800   -5.792  1.00 0.00 ? 28 THR B CA   11 
ATOM 8598  C C    . THR B 2 28 ? -19.475 2.015   -6.492  1.00 0.00 ? 28 THR B C    11 
ATOM 8599  O O    . THR B 2 28 ? -19.168 3.099   -6.948  1.00 0.00 ? 28 THR B O    11 
ATOM 8600  C CB   . THR B 2 28 ? -21.769 2.945   -6.148  1.00 0.00 ? 28 THR B CB   11 
ATOM 8601  O OG1  . THR B 2 28 ? -21.095 4.186   -5.984  1.00 0.00 ? 28 THR B OG1  11 
ATOM 8602  C CG2  . THR B 2 28 ? -22.990 2.901   -5.228  1.00 0.00 ? 28 THR B CG2  11 
ATOM 8603  H H    . THR B 2 28 ? -21.056 1.086   -3.773  1.00 0.00 ? 28 THR B H    11 
ATOM 8604  H HA   . THR B 2 28 ? -21.246 0.863   -6.115  1.00 0.00 ? 28 THR B HA   11 
ATOM 8605  H HB   . THR B 2 28 ? -22.091 2.842   -7.172  1.00 0.00 ? 28 THR B HB   11 
ATOM 8606  H HG1  . THR B 2 28 ? -21.089 4.399   -5.048  1.00 0.00 ? 28 THR B HG1  11 
ATOM 8607  H HG21 . THR B 2 28 ? -22.839 3.572   -4.396  1.00 0.00 ? 28 THR B HG21 11 
ATOM 8608  H HG22 . THR B 2 28 ? -23.127 1.895   -4.860  1.00 0.00 ? 28 THR B HG22 11 
ATOM 8609  H HG23 . THR B 2 28 ? -23.868 3.204   -5.781  1.00 0.00 ? 28 THR B HG23 11 
ATOM 8610  N N    . LYS B 2 29 ? -18.672 0.991   -6.583  1.00 0.00 ? 29 LYS B N    11 
ATOM 8611  C CA   . LYS B 2 29 ? -17.350 1.137   -7.254  1.00 0.00 ? 29 LYS B CA   11 
ATOM 8612  C C    . LYS B 2 29 ? -17.545 1.128   -8.772  1.00 0.00 ? 29 LYS B C    11 
ATOM 8613  O O    . LYS B 2 29 ? -17.991 0.154   -9.345  1.00 0.00 ? 29 LYS B O    11 
ATOM 8614  C CB   . LYS B 2 29 ? -16.442 -0.026  -6.849  1.00 0.00 ? 29 LYS B CB   11 
ATOM 8615  C CG   . LYS B 2 29 ? -15.383 0.472   -5.864  1.00 0.00 ? 29 LYS B CG   11 
ATOM 8616  C CD   . LYS B 2 29 ? -14.023 0.529   -6.561  1.00 0.00 ? 29 LYS B CD   11 
ATOM 8617  C CE   . LYS B 2 29 ? -13.804 1.927   -7.140  1.00 0.00 ? 29 LYS B CE   11 
ATOM 8618  N NZ   . LYS B 2 29 ? -12.515 1.958   -7.888  1.00 0.00 ? 29 LYS B NZ   11 
ATOM 8619  H H    . LYS B 2 29 ? -18.939 0.125   -6.209  1.00 0.00 ? 29 LYS B H    11 
ATOM 8620  H HA   . LYS B 2 29 ? -16.896 2.070   -6.955  1.00 0.00 ? 29 LYS B HA   11 
ATOM 8621  H HB2  . LYS B 2 29 ? -17.034 -0.799  -6.382  1.00 0.00 ? 29 LYS B HB2  11 
ATOM 8622  H HB3  . LYS B 2 29 ? -15.955 -0.425  -7.726  1.00 0.00 ? 29 LYS B HB3  11 
ATOM 8623  H HG2  . LYS B 2 29 ? -15.652 1.459   -5.516  1.00 0.00 ? 29 LYS B HG2  11 
ATOM 8624  H HG3  . LYS B 2 29 ? -15.327 -0.203  -5.023  1.00 0.00 ? 29 LYS B HG3  11 
ATOM 8625  H HD2  . LYS B 2 29 ? -13.243 0.308   -5.846  1.00 0.00 ? 29 LYS B HD2  11 
ATOM 8626  H HD3  . LYS B 2 29 ? -13.996 -0.198  -7.359  1.00 0.00 ? 29 LYS B HD3  11 
ATOM 8627  H HE2  . LYS B 2 29 ? -14.615 2.170   -7.811  1.00 0.00 ? 29 LYS B HE2  11 
ATOM 8628  H HE3  . LYS B 2 29 ? -13.771 2.649   -6.338  1.00 0.00 ? 29 LYS B HE3  11 
ATOM 8629  H HZ1  . LYS B 2 29 ? -12.347 2.918   -8.250  1.00 0.00 ? 29 LYS B HZ1  11 
ATOM 8630  H HZ2  . LYS B 2 29 ? -12.561 1.290   -8.685  1.00 0.00 ? 29 LYS B HZ2  11 
ATOM 8631  H HZ3  . LYS B 2 29 ? -11.738 1.689   -7.253  1.00 0.00 ? 29 LYS B HZ3  11 
ATOM 8632  N N    . THR B 2 30 ? -17.212 2.206   -9.428  1.00 0.00 ? 30 THR B N    11 
ATOM 8633  C CA   . THR B 2 30 ? -17.378 2.259   -10.908 1.00 0.00 ? 30 THR B CA   11 
ATOM 8634  C C    . THR B 2 30 ? -18.868 2.286   -11.254 1.00 0.00 ? 30 THR B C    11 
ATOM 8635  O O    . THR B 2 30 ? -19.458 1.221   -11.331 1.00 0.00 ? 30 THR B O    11 
ATOM 8636  C CB   . THR B 2 30 ? -16.731 1.024   -11.539 1.00 0.00 ? 30 THR B CB   11 
ATOM 8637  O OG1  . THR B 2 30 ? -15.485 0.768   -10.905 1.00 0.00 ? 30 THR B OG1  11 
ATOM 8638  C CG2  . THR B 2 30 ? -16.504 1.270   -13.032 1.00 0.00 ? 30 THR B CG2  11 
ATOM 8639  O OXT  . THR B 2 30 ? -19.394 3.372   -11.437 1.00 0.00 ? 30 THR B OXT  11 
ATOM 8640  H H    . THR B 2 30 ? -16.854 2.981   -8.948  1.00 0.00 ? 30 THR B H    11 
ATOM 8641  H HA   . THR B 2 30 ? -16.903 3.150   -11.292 1.00 0.00 ? 30 THR B HA   11 
ATOM 8642  H HB   . THR B 2 30 ? -17.381 0.172   -11.414 1.00 0.00 ? 30 THR B HB   11 
ATOM 8643  H HG1  . THR B 2 30 ? -15.645 0.181   -10.162 1.00 0.00 ? 30 THR B HG1  11 
ATOM 8644  H HG21 . THR B 2 30 ? -16.649 2.318   -13.249 1.00 0.00 ? 30 THR B HG21 11 
ATOM 8645  H HG22 . THR B 2 30 ? -17.208 0.684   -13.604 1.00 0.00 ? 30 THR B HG22 11 
ATOM 8646  H HG23 . THR B 2 30 ? -15.497 0.983   -13.295 1.00 0.00 ? 30 THR B HG23 11 
ATOM 8647  N N    . GLY A 1 1  ? -0.920  11.175  -1.760  1.00 0.00 ? 1  GLY A N    12 
ATOM 8648  C CA   . GLY A 1 1  ? -0.847  9.805   -1.178  1.00 0.00 ? 1  GLY A CA   12 
ATOM 8649  C C    . GLY A 1 1  ? 0.556   9.561   -0.618  1.00 0.00 ? 1  GLY A C    12 
ATOM 8650  O O    . GLY A 1 1  ? 1.493   10.265  -0.938  1.00 0.00 ? 1  GLY A O    12 
ATOM 8651  H H1   . GLY A 1 1  ? -1.913  11.480  -1.807  1.00 0.00 ? 1  GLY A H1   12 
ATOM 8652  H H2   . GLY A 1 1  ? -0.513  11.167  -2.718  1.00 0.00 ? 1  GLY A H2   12 
ATOM 8653  H H3   . GLY A 1 1  ? -0.386  11.836  -1.161  1.00 0.00 ? 1  GLY A H3   12 
ATOM 8654  H HA2  . GLY A 1 1  ? -1.574  9.712   -0.384  1.00 0.00 ? 1  GLY A HA2  12 
ATOM 8655  H HA3  . GLY A 1 1  ? -1.056  9.076   -1.946  1.00 0.00 ? 1  GLY A HA3  12 
ATOM 8656  N N    . ILE A 1 2  ? 0.709   8.569   0.216   1.00 0.00 ? 2  ILE A N    12 
ATOM 8657  C CA   . ILE A 1 2  ? 2.052   8.284   0.794   1.00 0.00 ? 2  ILE A CA   12 
ATOM 8658  C C    . ILE A 1 2  ? 2.944   7.653   -0.276  1.00 0.00 ? 2  ILE A C    12 
ATOM 8659  O O    . ILE A 1 2  ? 4.147   7.824   -0.275  1.00 0.00 ? 2  ILE A O    12 
ATOM 8660  C CB   . ILE A 1 2  ? 1.909   7.324   1.979   1.00 0.00 ? 2  ILE A CB   12 
ATOM 8661  C CG1  . ILE A 1 2  ? 0.920   6.209   1.627   1.00 0.00 ? 2  ILE A CG1  12 
ATOM 8662  C CG2  . ILE A 1 2  ? 1.393   8.093   3.197   1.00 0.00 ? 2  ILE A CG2  12 
ATOM 8663  C CD1  . ILE A 1 2  ? 1.305   4.932   2.375   1.00 0.00 ? 2  ILE A CD1  12 
ATOM 8664  H H    . ILE A 1 2  ? -0.059  8.013   0.463   1.00 0.00 ? 2  ILE A H    12 
ATOM 8665  H HA   . ILE A 1 2  ? 2.499   9.206   1.132   1.00 0.00 ? 2  ILE A HA   12 
ATOM 8666  H HB   . ILE A 1 2  ? 2.873   6.893   2.210   1.00 0.00 ? 2  ILE A HB   12 
ATOM 8667  H HG12 . ILE A 1 2  ? -0.078  6.508   1.914   1.00 0.00 ? 2  ILE A HG12 12 
ATOM 8668  H HG13 . ILE A 1 2  ? 0.949   6.023   0.564   1.00 0.00 ? 2  ILE A HG13 12 
ATOM 8669  H HG21 . ILE A 1 2  ? 0.740   7.455   3.775   1.00 0.00 ? 2  ILE A HG21 12 
ATOM 8670  H HG22 . ILE A 1 2  ? 0.845   8.964   2.867   1.00 0.00 ? 2  ILE A HG22 12 
ATOM 8671  H HG23 . ILE A 1 2  ? 2.228   8.402   3.808   1.00 0.00 ? 2  ILE A HG23 12 
ATOM 8672  H HD11 . ILE A 1 2  ? 2.054   5.162   3.118   1.00 0.00 ? 2  ILE A HD11 12 
ATOM 8673  H HD12 . ILE A 1 2  ? 1.700   4.210   1.676   1.00 0.00 ? 2  ILE A HD12 12 
ATOM 8674  H HD13 . ILE A 1 2  ? 0.431   4.522   2.860   1.00 0.00 ? 2  ILE A HD13 12 
ATOM 8675  N N    . VAL A 1 3  ? 2.365   6.925   -1.190  1.00 0.00 ? 3  VAL A N    12 
ATOM 8676  C CA   . VAL A 1 3  ? 3.169   6.285   -2.257  1.00 0.00 ? 3  VAL A CA   12 
ATOM 8677  C C    . VAL A 1 3  ? 3.824   7.363   -3.127  1.00 0.00 ? 3  VAL A C    12 
ATOM 8678  O O    . VAL A 1 3  ? 4.978   7.261   -3.492  1.00 0.00 ? 3  VAL A O    12 
ATOM 8679  C CB   . VAL A 1 3  ? 2.247   5.400   -3.104  1.00 0.00 ? 3  VAL A CB   12 
ATOM 8680  C CG1  . VAL A 1 3  ? 0.910   6.107   -3.341  1.00 0.00 ? 3  VAL A CG1  12 
ATOM 8681  C CG2  . VAL A 1 3  ? 2.904   5.114   -4.447  1.00 0.00 ? 3  VAL A CG2  12 
ATOM 8682  H H    . VAL A 1 3  ? 1.398   6.797   -1.176  1.00 0.00 ? 3  VAL A H    12 
ATOM 8683  H HA   . VAL A 1 3  ? 3.937   5.677   -1.809  1.00 0.00 ? 3  VAL A HA   12 
ATOM 8684  H HB   . VAL A 1 3  ? 2.071   4.468   -2.584  1.00 0.00 ? 3  VAL A HB   12 
ATOM 8685  H HG11 . VAL A 1 3  ? 0.952   7.107   -2.937  1.00 0.00 ? 3  VAL A HG11 12 
ATOM 8686  H HG12 . VAL A 1 3  ? 0.120   5.556   -2.853  1.00 0.00 ? 3  VAL A HG12 12 
ATOM 8687  H HG13 . VAL A 1 3  ? 0.712   6.156   -4.401  1.00 0.00 ? 3  VAL A HG13 12 
ATOM 8688  H HG21 . VAL A 1 3  ? 2.582   4.150   -4.804  1.00 0.00 ? 3  VAL A HG21 12 
ATOM 8689  H HG22 . VAL A 1 3  ? 3.976   5.120   -4.327  1.00 0.00 ? 3  VAL A HG22 12 
ATOM 8690  H HG23 . VAL A 1 3  ? 2.614   5.878   -5.153  1.00 0.00 ? 3  VAL A HG23 12 
ATOM 8691  N N    . GLU A 1 4  ? 3.100   8.394   -3.460  1.00 0.00 ? 4  GLU A N    12 
ATOM 8692  C CA   . GLU A 1 4  ? 3.687   9.471   -4.305  1.00 0.00 ? 4  GLU A CA   12 
ATOM 8693  C C    . GLU A 1 4  ? 4.762   10.211  -3.508  1.00 0.00 ? 4  GLU A C    12 
ATOM 8694  O O    . GLU A 1 4  ? 5.794   10.581  -4.031  1.00 0.00 ? 4  GLU A O    12 
ATOM 8695  C CB   . GLU A 1 4  ? 2.590   10.454  -4.719  1.00 0.00 ? 4  GLU A CB   12 
ATOM 8696  C CG   . GLU A 1 4  ? 2.880   10.980  -6.127  1.00 0.00 ? 4  GLU A CG   12 
ATOM 8697  C CD   . GLU A 1 4  ? 2.848   12.510  -6.118  1.00 0.00 ? 4  GLU A CD   12 
ATOM 8698  O OE1  . GLU A 1 4  ? 3.759   13.099  -5.560  1.00 0.00 ? 4  GLU A OE1  12 
ATOM 8699  O OE2  . GLU A 1 4  ? 1.913   13.066  -6.670  1.00 0.00 ? 4  GLU A OE2  12 
ATOM 8700  H H    . GLU A 1 4  ? 2.174   8.459   -3.156  1.00 0.00 ? 4  GLU A H    12 
ATOM 8701  H HA   . GLU A 1 4  ? 4.131   9.035   -5.186  1.00 0.00 ? 4  GLU A HA   12 
ATOM 8702  H HB2  . GLU A 1 4  ? 1.634   9.950   -4.711  1.00 0.00 ? 4  GLU A HB2  12 
ATOM 8703  H HB3  . GLU A 1 4  ? 2.567   11.281  -4.026  1.00 0.00 ? 4  GLU A HB3  12 
ATOM 8704  H HG2  . GLU A 1 4  ? 3.856   10.641  -6.443  1.00 0.00 ? 4  GLU A HG2  12 
ATOM 8705  H HG3  . GLU A 1 4  ? 2.131   10.610  -6.811  1.00 0.00 ? 4  GLU A HG3  12 
ATOM 8706  N N    . GLN A 1 5  ? 4.526   10.427  -2.245  1.00 0.00 ? 5  GLN A N    12 
ATOM 8707  C CA   . GLN A 1 5  ? 5.532   11.140  -1.410  1.00 0.00 ? 5  GLN A CA   12 
ATOM 8708  C C    . GLN A 1 5  ? 6.618   10.158  -0.970  1.00 0.00 ? 5  GLN A C    12 
ATOM 8709  O O    . GLN A 1 5  ? 7.770   10.517  -0.821  1.00 0.00 ? 5  GLN A O    12 
ATOM 8710  C CB   . GLN A 1 5  ? 4.845   11.728  -0.175  1.00 0.00 ? 5  GLN A CB   12 
ATOM 8711  C CG   . GLN A 1 5  ? 5.492   13.069  0.179   1.00 0.00 ? 5  GLN A CG   12 
ATOM 8712  C CD   . GLN A 1 5  ? 6.608   12.844  1.200   1.00 0.00 ? 5  GLN A CD   12 
ATOM 8713  O OE1  . GLN A 1 5  ? 7.770   12.797  0.847   1.00 0.00 ? 5  GLN A OE1  12 
ATOM 8714  N NE2  . GLN A 1 5  ? 6.304   12.700  2.461   1.00 0.00 ? 5  GLN A NE2  12 
ATOM 8715  H H    . GLN A 1 5  ? 3.687   10.118  -1.846  1.00 0.00 ? 5  GLN A H    12 
ATOM 8716  H HA   . GLN A 1 5  ? 5.978   11.935  -1.986  1.00 0.00 ? 5  GLN A HA   12 
ATOM 8717  H HB2  . GLN A 1 5  ? 3.795   11.878  -0.384  1.00 0.00 ? 5  GLN A HB2  12 
ATOM 8718  H HB3  . GLN A 1 5  ? 4.954   11.048  0.656   1.00 0.00 ? 5  GLN A HB3  12 
ATOM 8719  H HG2  . GLN A 1 5  ? 5.904   13.517  -0.713  1.00 0.00 ? 5  GLN A HG2  12 
ATOM 8720  H HG3  . GLN A 1 5  ? 4.748   13.727  0.602   1.00 0.00 ? 5  GLN A HG3  12 
ATOM 8721  H HE21 . GLN A 1 5  ? 5.367   12.738  2.746   1.00 0.00 ? 5  GLN A HE21 12 
ATOM 8722  H HE22 . GLN A 1 5  ? 7.012   12.555  3.123   1.00 0.00 ? 5  GLN A HE22 12 
ATOM 8723  N N    . CYS A 1 6  ? 6.262   8.921   -0.759  1.00 0.00 ? 6  CYS A N    12 
ATOM 8724  C CA   . CYS A 1 6  ? 7.275   7.917   -0.326  1.00 0.00 ? 6  CYS A CA   12 
ATOM 8725  C C    . CYS A 1 6  ? 7.553   6.935   -1.469  1.00 0.00 ? 6  CYS A C    12 
ATOM 8726  O O    . CYS A 1 6  ? 8.019   5.835   -1.250  1.00 0.00 ? 6  CYS A O    12 
ATOM 8727  C CB   . CYS A 1 6  ? 6.746   7.149   0.888   1.00 0.00 ? 6  CYS A CB   12 
ATOM 8728  S SG   . CYS A 1 6  ? 7.908   7.320   2.266   1.00 0.00 ? 6  CYS A SG   12 
ATOM 8729  H H    . CYS A 1 6  ? 5.327   8.654   -0.883  1.00 0.00 ? 6  CYS A H    12 
ATOM 8730  H HA   . CYS A 1 6  ? 8.190   8.424   -0.059  1.00 0.00 ? 6  CYS A HA   12 
ATOM 8731  H HB2  . CYS A 1 6  ? 5.785   7.550   1.177   1.00 0.00 ? 6  CYS A HB2  12 
ATOM 8732  H HB3  . CYS A 1 6  ? 6.639   6.105   0.635   1.00 0.00 ? 6  CYS A HB3  12 
ATOM 8733  N N    . CYS A 1 7  ? 7.271   7.320   -2.686  1.00 0.00 ? 7  CYS A N    12 
ATOM 8734  C CA   . CYS A 1 7  ? 7.524   6.399   -3.832  1.00 0.00 ? 7  CYS A CA   12 
ATOM 8735  C C    . CYS A 1 7  ? 8.892   5.739   -3.663  1.00 0.00 ? 7  CYS A C    12 
ATOM 8736  O O    . CYS A 1 7  ? 9.003   4.531   -3.616  1.00 0.00 ? 7  CYS A O    12 
ATOM 8737  C CB   . CYS A 1 7  ? 7.499   7.181   -5.146  1.00 0.00 ? 7  CYS A CB   12 
ATOM 8738  S SG   . CYS A 1 7  ? 7.424   6.017   -6.532  1.00 0.00 ? 7  CYS A SG   12 
ATOM 8739  H H    . CYS A 1 7  ? 6.893   8.210   -2.844  1.00 0.00 ? 7  CYS A H    12 
ATOM 8740  H HA   . CYS A 1 7  ? 6.759   5.637   -3.854  1.00 0.00 ? 7  CYS A HA   12 
ATOM 8741  H HB2  . CYS A 1 7  ? 6.631   7.824   -5.167  1.00 0.00 ? 7  CYS A HB2  12 
ATOM 8742  H HB3  . CYS A 1 7  ? 8.394   7.780   -5.227  1.00 0.00 ? 7  CYS A HB3  12 
ATOM 8743  N N    . THR A 1 8  ? 9.937   6.520   -3.568  1.00 0.00 ? 8  THR A N    12 
ATOM 8744  C CA   . THR A 1 8  ? 11.293  5.926   -3.396  1.00 0.00 ? 8  THR A CA   12 
ATOM 8745  C C    . THR A 1 8  ? 11.212  4.815   -2.350  1.00 0.00 ? 8  THR A C    12 
ATOM 8746  O O    . THR A 1 8  ? 11.256  5.064   -1.161  1.00 0.00 ? 8  THR A O    12 
ATOM 8747  C CB   . THR A 1 8  ? 12.270  7.006   -2.924  1.00 0.00 ? 8  THR A CB   12 
ATOM 8748  O OG1  . THR A 1 8  ? 11.950  8.239   -3.552  1.00 0.00 ? 8  THR A OG1  12 
ATOM 8749  C CG2  . THR A 1 8  ? 13.699  6.600   -3.289  1.00 0.00 ? 8  THR A CG2  12 
ATOM 8750  H H    . THR A 1 8  ? 9.827   7.493   -3.606  1.00 0.00 ? 8  THR A H    12 
ATOM 8751  H HA   . THR A 1 8  ? 11.631  5.515   -4.336  1.00 0.00 ? 8  THR A HA   12 
ATOM 8752  H HB   . THR A 1 8  ? 12.195  7.117   -1.853  1.00 0.00 ? 8  THR A HB   12 
ATOM 8753  H HG1  . THR A 1 8  ? 11.569  8.045   -4.411  1.00 0.00 ? 8  THR A HG1  12 
ATOM 8754  H HG21 . THR A 1 8  ? 13.923  5.638   -2.852  1.00 0.00 ? 8  THR A HG21 12 
ATOM 8755  H HG22 . THR A 1 8  ? 14.391  7.337   -2.911  1.00 0.00 ? 8  THR A HG22 12 
ATOM 8756  H HG23 . THR A 1 8  ? 13.792  6.537   -4.364  1.00 0.00 ? 8  THR A HG23 12 
ATOM 8757  N N    . SER A 1 9  ? 11.074  3.593   -2.780  1.00 0.00 ? 9  SER A N    12 
ATOM 8758  C CA   . SER A 1 9  ? 10.967  2.475   -1.806  1.00 0.00 ? 9  SER A CA   12 
ATOM 8759  C C    . SER A 1 9  ? 9.824   2.780   -0.838  1.00 0.00 ? 9  SER A C    12 
ATOM 8760  O O    . SER A 1 9  ? 9.111   3.750   -1.000  1.00 0.00 ? 9  SER A O    12 
ATOM 8761  C CB   . SER A 1 9  ? 12.277  2.338   -1.028  1.00 0.00 ? 9  SER A CB   12 
ATOM 8762  O OG   . SER A 1 9  ? 13.221  3.276   -1.530  1.00 0.00 ? 9  SER A OG   12 
ATOM 8763  H H    . SER A 1 9  ? 11.025  3.413   -3.742  1.00 0.00 ? 9  SER A H    12 
ATOM 8764  H HA   . SER A 1 9  ? 10.759  1.558   -2.334  1.00 0.00 ? 9  SER A HA   12 
ATOM 8765  H HB2  . SER A 1 9  ? 12.101  2.536   0.016   1.00 0.00 ? 9  SER A HB2  12 
ATOM 8766  H HB3  . SER A 1 9  ? 12.659  1.331   -1.142  1.00 0.00 ? 9  SER A HB3  12 
ATOM 8767  H HG   . SER A 1 9  ? 13.075  4.112   -1.081  1.00 0.00 ? 9  SER A HG   12 
ATOM 8768  N N    . ILE A 1 10 ? 9.638   1.972   0.168   1.00 0.00 ? 10 ILE A N    12 
ATOM 8769  C CA   . ILE A 1 10 ? 8.534   2.246   1.128   1.00 0.00 ? 10 ILE A CA   12 
ATOM 8770  C C    . ILE A 1 10 ? 9.115   2.747   2.445   1.00 0.00 ? 10 ILE A C    12 
ATOM 8771  O O    . ILE A 1 10 ? 10.210  2.388   2.830   1.00 0.00 ? 10 ILE A O    12 
ATOM 8772  C CB   . ILE A 1 10 ? 7.723   0.966   1.384   1.00 0.00 ? 10 ILE A CB   12 
ATOM 8773  C CG1  . ILE A 1 10 ? 8.537   -0.025  2.232   1.00 0.00 ? 10 ILE A CG1  12 
ATOM 8774  C CG2  . ILE A 1 10 ? 7.371   0.312   0.049   1.00 0.00 ? 10 ILE A CG2  12 
ATOM 8775  C CD1  . ILE A 1 10 ? 7.618   -0.700  3.255   1.00 0.00 ? 10 ILE A CD1  12 
ATOM 8776  H H    . ILE A 1 10 ? 10.220  1.194   0.292   1.00 0.00 ? 10 ILE A H    12 
ATOM 8777  H HA   . ILE A 1 10 ? 7.883   3.003   0.715   1.00 0.00 ? 10 ILE A HA   12 
ATOM 8778  H HB   . ILE A 1 10 ? 6.812   1.221   1.905   1.00 0.00 ? 10 ILE A HB   12 
ATOM 8779  H HG12 . ILE A 1 10 ? 8.967   -0.776  1.590   1.00 0.00 ? 10 ILE A HG12 12 
ATOM 8780  H HG13 . ILE A 1 10 ? 9.325   0.495   2.750   1.00 0.00 ? 10 ILE A HG13 12 
ATOM 8781  H HG21 . ILE A 1 10 ? 7.317   -0.759  0.177   1.00 0.00 ? 10 ILE A HG21 12 
ATOM 8782  H HG22 . ILE A 1 10 ? 8.132   0.550   -0.678  1.00 0.00 ? 10 ILE A HG22 12 
ATOM 8783  H HG23 . ILE A 1 10 ? 6.417   0.682   -0.293  1.00 0.00 ? 10 ILE A HG23 12 
ATOM 8784  H HD11 . ILE A 1 10 ? 8.096   -1.591  3.636   1.00 0.00 ? 10 ILE A HD11 12 
ATOM 8785  H HD12 . ILE A 1 10 ? 6.685   -0.966  2.782   1.00 0.00 ? 10 ILE A HD12 12 
ATOM 8786  H HD13 . ILE A 1 10 ? 7.427   -0.019  4.072   1.00 0.00 ? 10 ILE A HD13 12 
ATOM 8787  N N    . CYS A 1 11 ? 8.381   3.552   3.153   1.00 0.00 ? 11 CYS A N    12 
ATOM 8788  C CA   . CYS A 1 11 ? 8.887   4.041   4.462   1.00 0.00 ? 11 CYS A CA   12 
ATOM 8789  C C    . CYS A 1 11 ? 8.135   3.293   5.557   1.00 0.00 ? 11 CYS A C    12 
ATOM 8790  O O    . CYS A 1 11 ? 6.924   3.338   5.629   1.00 0.00 ? 11 CYS A O    12 
ATOM 8791  C CB   . CYS A 1 11 ? 8.662   5.556   4.608   1.00 0.00 ? 11 CYS A CB   12 
ATOM 8792  S SG   . CYS A 1 11 ? 7.190   6.075   3.688   1.00 0.00 ? 11 CYS A SG   12 
ATOM 8793  H H    . CYS A 1 11 ? 7.491   3.807   2.837   1.00 0.00 ? 11 CYS A H    12 
ATOM 8794  H HA   . CYS A 1 11 ? 9.943   3.823   4.541   1.00 0.00 ? 11 CYS A HA   12 
ATOM 8795  H HB2  . CYS A 1 11 ? 8.531   5.797   5.652   1.00 0.00 ? 11 CYS A HB2  12 
ATOM 8796  H HB3  . CYS A 1 11 ? 9.526   6.082   4.228   1.00 0.00 ? 11 CYS A HB3  12 
ATOM 8797  N N    . SER A 1 12 ? 8.839   2.589   6.397   1.00 0.00 ? 12 SER A N    12 
ATOM 8798  C CA   . SER A 1 12 ? 8.162   1.820   7.468   1.00 0.00 ? 12 SER A CA   12 
ATOM 8799  C C    . SER A 1 12 ? 7.024   1.003   6.853   1.00 0.00 ? 12 SER A C    12 
ATOM 8800  O O    . SER A 1 12 ? 5.940   1.502   6.636   1.00 0.00 ? 12 SER A O    12 
ATOM 8801  C CB   . SER A 1 12 ? 7.601   2.788   8.512   1.00 0.00 ? 12 SER A CB   12 
ATOM 8802  O OG   . SER A 1 12 ? 8.168   2.490   9.781   1.00 0.00 ? 12 SER A OG   12 
ATOM 8803  H H    . SER A 1 12 ? 9.809   2.554   6.313   1.00 0.00 ? 12 SER A H    12 
ATOM 8804  H HA   . SER A 1 12 ? 8.870   1.154   7.938   1.00 0.00 ? 12 SER A HA   12 
ATOM 8805  H HB2  . SER A 1 12 ? 7.852   3.799   8.240   1.00 0.00 ? 12 SER A HB2  12 
ATOM 8806  H HB3  . SER A 1 12 ? 6.525   2.687   8.555   1.00 0.00 ? 12 SER A HB3  12 
ATOM 8807  H HG   . SER A 1 12 ? 8.461   3.315   10.175  1.00 0.00 ? 12 SER A HG   12 
ATOM 8808  N N    . LEU A 1 13 ? 7.250   -0.255  6.578   1.00 0.00 ? 13 LEU A N    12 
ATOM 8809  C CA   . LEU A 1 13 ? 6.157   -1.078  5.993   1.00 0.00 ? 13 LEU A CA   12 
ATOM 8810  C C    . LEU A 1 13 ? 4.958   -0.931  6.911   1.00 0.00 ? 13 LEU A C    12 
ATOM 8811  O O    . LEU A 1 13 ? 3.819   -0.947  6.489   1.00 0.00 ? 13 LEU A O    12 
ATOM 8812  C CB   . LEU A 1 13 ? 6.588   -2.545  5.920   1.00 0.00 ? 13 LEU A CB   12 
ATOM 8813  C CG   . LEU A 1 13 ? 5.368   -3.425  5.642   1.00 0.00 ? 13 LEU A CG   12 
ATOM 8814  C CD1  . LEU A 1 13 ? 4.593   -2.865  4.448   1.00 0.00 ? 13 LEU A CD1  12 
ATOM 8815  C CD2  . LEU A 1 13 ? 5.830   -4.849  5.325   1.00 0.00 ? 13 LEU A CD2  12 
ATOM 8816  H H    . LEU A 1 13 ? 8.124   -0.654  6.763   1.00 0.00 ? 13 LEU A H    12 
ATOM 8817  H HA   . LEU A 1 13 ? 5.904   -0.713  5.009   1.00 0.00 ? 13 LEU A HA   12 
ATOM 8818  H HB2  . LEU A 1 13 ? 7.310   -2.668  5.126   1.00 0.00 ? 13 LEU A HB2  12 
ATOM 8819  H HB3  . LEU A 1 13 ? 7.033   -2.836  6.860   1.00 0.00 ? 13 LEU A HB3  12 
ATOM 8820  H HG   . LEU A 1 13 ? 4.728   -3.438  6.513   1.00 0.00 ? 13 LEU A HG   12 
ATOM 8821  H HD11 . LEU A 1 13 ? 3.699   -3.451  4.292   1.00 0.00 ? 13 LEU A HD11 12 
ATOM 8822  H HD12 . LEU A 1 13 ? 5.212   -2.910  3.564   1.00 0.00 ? 13 LEU A HD12 12 
ATOM 8823  H HD13 . LEU A 1 13 ? 4.321   -1.838  4.645   1.00 0.00 ? 13 LEU A HD13 12 
ATOM 8824  H HD21 . LEU A 1 13 ? 6.865   -4.831  5.014   1.00 0.00 ? 13 LEU A HD21 12 
ATOM 8825  H HD22 . LEU A 1 13 ? 5.223   -5.256  4.530   1.00 0.00 ? 13 LEU A HD22 12 
ATOM 8826  H HD23 . LEU A 1 13 ? 5.730   -5.465  6.207   1.00 0.00 ? 13 LEU A HD23 12 
ATOM 8827  N N    . TYR A 1 14 ? 5.221   -0.741  8.168   1.00 0.00 ? 14 TYR A N    12 
ATOM 8828  C CA   . TYR A 1 14 ? 4.117   -0.537  9.135   1.00 0.00 ? 14 TYR A CA   12 
ATOM 8829  C C    . TYR A 1 14 ? 3.411   0.761   8.751   1.00 0.00 ? 14 TYR A C    12 
ATOM 8830  O O    . TYR A 1 14 ? 2.212   0.898   8.894   1.00 0.00 ? 14 TYR A O    12 
ATOM 8831  C CB   . TYR A 1 14 ? 4.683   -0.424  10.552  1.00 0.00 ? 14 TYR A CB   12 
ATOM 8832  C CG   . TYR A 1 14 ? 5.544   -1.628  10.847  1.00 0.00 ? 14 TYR A CG   12 
ATOM 8833  C CD1  . TYR A 1 14 ? 4.970   -2.904  10.893  1.00 0.00 ? 14 TYR A CD1  12 
ATOM 8834  C CD2  . TYR A 1 14 ? 6.917   -1.470  11.072  1.00 0.00 ? 14 TYR A CD2  12 
ATOM 8835  C CE1  . TYR A 1 14 ? 5.768   -4.022  11.165  1.00 0.00 ? 14 TYR A CE1  12 
ATOM 8836  C CE2  . TYR A 1 14 ? 7.715   -2.588  11.344  1.00 0.00 ? 14 TYR A CE2  12 
ATOM 8837  C CZ   . TYR A 1 14 ? 7.141   -3.864  11.390  1.00 0.00 ? 14 TYR A CZ   12 
ATOM 8838  O OH   . TYR A 1 14 ? 7.928   -4.965  11.657  1.00 0.00 ? 14 TYR A OH   12 
ATOM 8839  H H    . TYR A 1 14 ? 6.153   -0.700  8.467   1.00 0.00 ? 14 TYR A H    12 
ATOM 8840  H HA   . TYR A 1 14 ? 3.422   -1.361  9.078   1.00 0.00 ? 14 TYR A HA   12 
ATOM 8841  H HB2  . TYR A 1 14 ? 5.279   0.474   10.632  1.00 0.00 ? 14 TYR A HB2  12 
ATOM 8842  H HB3  . TYR A 1 14 ? 3.870   -0.381  11.262  1.00 0.00 ? 14 TYR A HB3  12 
ATOM 8843  H HD1  . TYR A 1 14 ? 3.911   -3.026  10.720  1.00 0.00 ? 14 TYR A HD1  12 
ATOM 8844  H HD2  . TYR A 1 14 ? 7.360   -0.486  11.036  1.00 0.00 ? 14 TYR A HD2  12 
ATOM 8845  H HE1  . TYR A 1 14 ? 5.325   -5.006  11.201  1.00 0.00 ? 14 TYR A HE1  12 
ATOM 8846  H HE2  . TYR A 1 14 ? 8.774   -2.465  11.517  1.00 0.00 ? 14 TYR A HE2  12 
ATOM 8847  H HH   . TYR A 1 14 ? 7.613   -5.364  12.472  1.00 0.00 ? 14 TYR A HH   12 
ATOM 8848  N N    . GLN A 1 15 ? 4.154   1.710   8.240   1.00 0.00 ? 15 GLN A N    12 
ATOM 8849  C CA   . GLN A 1 15 ? 3.533   2.994   7.818   1.00 0.00 ? 15 GLN A CA   12 
ATOM 8850  C C    . GLN A 1 15 ? 2.667   2.732   6.586   1.00 0.00 ? 15 GLN A C    12 
ATOM 8851  O O    . GLN A 1 15 ? 1.533   3.162   6.509   1.00 0.00 ? 15 GLN A O    12 
ATOM 8852  C CB   . GLN A 1 15 ? 4.626   4.008   7.473   1.00 0.00 ? 15 GLN A CB   12 
ATOM 8853  C CG   . GLN A 1 15 ? 4.907   4.888   8.692   1.00 0.00 ? 15 GLN A CG   12 
ATOM 8854  C CD   . GLN A 1 15 ? 4.608   6.348   8.347   1.00 0.00 ? 15 GLN A CD   12 
ATOM 8855  O OE1  . GLN A 1 15 ? 3.602   6.646   7.735   1.00 0.00 ? 15 GLN A OE1  12 
ATOM 8856  N NE2  . GLN A 1 15 ? 5.446   7.278   8.716   1.00 0.00 ? 15 GLN A NE2  12 
ATOM 8857  H H    . GLN A 1 15 ? 5.121   1.568   8.117   1.00 0.00 ? 15 GLN A H    12 
ATOM 8858  H HA   . GLN A 1 15 ? 2.918   3.379   8.617   1.00 0.00 ? 15 GLN A HA   12 
ATOM 8859  H HB2  . GLN A 1 15 ? 5.527   3.484   7.190   1.00 0.00 ? 15 GLN A HB2  12 
ATOM 8860  H HB3  . GLN A 1 15 ? 4.297   4.627   6.652   1.00 0.00 ? 15 GLN A HB3  12 
ATOM 8861  H HG2  . GLN A 1 15 ? 4.280   4.575   9.514   1.00 0.00 ? 15 GLN A HG2  12 
ATOM 8862  H HG3  . GLN A 1 15 ? 5.945   4.792   8.973   1.00 0.00 ? 15 GLN A HG3  12 
ATOM 8863  H HE21 . GLN A 1 15 ? 6.258   7.038   9.209   1.00 0.00 ? 15 GLN A HE21 12 
ATOM 8864  H HE22 . GLN A 1 15 ? 5.263   8.216   8.500   1.00 0.00 ? 15 GLN A HE22 12 
ATOM 8865  N N    . LEU A 1 16 ? 3.183   2.006   5.626   1.00 0.00 ? 16 LEU A N    12 
ATOM 8866  C CA   . LEU A 1 16 ? 2.374   1.699   4.419   1.00 0.00 ? 16 LEU A CA   12 
ATOM 8867  C C    . LEU A 1 16 ? 1.239   0.774   4.842   1.00 0.00 ? 16 LEU A C    12 
ATOM 8868  O O    . LEU A 1 16 ? 0.102   0.942   4.447   1.00 0.00 ? 16 LEU A O    12 
ATOM 8869  C CB   . LEU A 1 16 ? 3.247   1.004   3.372   1.00 0.00 ? 16 LEU A CB   12 
ATOM 8870  C CG   . LEU A 1 16 ? 3.155   1.763   2.048   1.00 0.00 ? 16 LEU A CG   12 
ATOM 8871  C CD1  . LEU A 1 16 ? 4.204   2.876   2.022   1.00 0.00 ? 16 LEU A CD1  12 
ATOM 8872  C CD2  . LEU A 1 16 ? 3.409   0.797   0.889   1.00 0.00 ? 16 LEU A CD2  12 
ATOM 8873  H H    . LEU A 1 16 ? 4.091   1.649   5.710   1.00 0.00 ? 16 LEU A H    12 
ATOM 8874  H HA   . LEU A 1 16 ? 1.967   2.613   4.010   1.00 0.00 ? 16 LEU A HA   12 
ATOM 8875  H HB2  . LEU A 1 16 ? 4.273   0.991   3.711   1.00 0.00 ? 16 LEU A HB2  12 
ATOM 8876  H HB3  . LEU A 1 16 ? 2.901   -0.008  3.230   1.00 0.00 ? 16 LEU A HB3  12 
ATOM 8877  H HG   . LEU A 1 16 ? 2.169   2.196   1.949   1.00 0.00 ? 16 LEU A HG   12 
ATOM 8878  H HD11 . LEU A 1 16 ? 3.744   3.797   1.696   1.00 0.00 ? 16 LEU A HD11 12 
ATOM 8879  H HD12 . LEU A 1 16 ? 4.996   2.608   1.339   1.00 0.00 ? 16 LEU A HD12 12 
ATOM 8880  H HD13 . LEU A 1 16 ? 4.612   3.008   3.014   1.00 0.00 ? 16 LEU A HD13 12 
ATOM 8881  H HD21 . LEU A 1 16 ? 4.462   0.792   0.649   1.00 0.00 ? 16 LEU A HD21 12 
ATOM 8882  H HD22 . LEU A 1 16 ? 2.844   1.115   0.025   1.00 0.00 ? 16 LEU A HD22 12 
ATOM 8883  H HD23 . LEU A 1 16 ? 3.100   -0.198  1.175   1.00 0.00 ? 16 LEU A HD23 12 
ATOM 8884  N N    . GLU A 1 17 ? 1.540   -0.194  5.664   1.00 0.00 ? 17 GLU A N    12 
ATOM 8885  C CA   . GLU A 1 17 ? 0.479   -1.121  6.137   1.00 0.00 ? 17 GLU A CA   12 
ATOM 8886  C C    . GLU A 1 17 ? -0.557  -0.316  6.924   1.00 0.00 ? 17 GLU A C    12 
ATOM 8887  O O    . GLU A 1 17 ? -1.745  -0.492  6.767   1.00 0.00 ? 17 GLU A O    12 
ATOM 8888  C CB   . GLU A 1 17 ? 1.095   -2.188  7.046   1.00 0.00 ? 17 GLU A CB   12 
ATOM 8889  C CG   . GLU A 1 17 ? 1.980   -3.120  6.216   1.00 0.00 ? 17 GLU A CG   12 
ATOM 8890  C CD   . GLU A 1 17 ? 1.216   -4.411  5.912   1.00 0.00 ? 17 GLU A CD   12 
ATOM 8891  O OE1  . GLU A 1 17 ? 0.287   -4.712  6.643   1.00 0.00 ? 17 GLU A OE1  12 
ATOM 8892  O OE2  . GLU A 1 17 ? 1.573   -5.075  4.954   1.00 0.00 ? 17 GLU A OE2  12 
ATOM 8893  H H    . GLU A 1 17 ? 2.464   -0.303  5.978   1.00 0.00 ? 17 GLU A H    12 
ATOM 8894  H HA   . GLU A 1 17 ? 0.007   -1.591  5.290   1.00 0.00 ? 17 GLU A HA   12 
ATOM 8895  H HB2  . GLU A 1 17 ? 1.692   -1.709  7.808   1.00 0.00 ? 17 GLU A HB2  12 
ATOM 8896  H HB3  . GLU A 1 17 ? 0.308   -2.761  7.512   1.00 0.00 ? 17 GLU A HB3  12 
ATOM 8897  H HG2  . GLU A 1 17 ? 2.249   -2.633  5.291   1.00 0.00 ? 17 GLU A HG2  12 
ATOM 8898  H HG3  . GLU A 1 17 ? 2.874   -3.357  6.773   1.00 0.00 ? 17 GLU A HG3  12 
ATOM 8899  N N    . ASN A 1 18 ? -0.110  0.578   7.763   1.00 0.00 ? 18 ASN A N    12 
ATOM 8900  C CA   . ASN A 1 18 ? -1.066  1.405   8.553   1.00 0.00 ? 18 ASN A CA   12 
ATOM 8901  C C    . ASN A 1 18 ? -2.023  2.123   7.597   1.00 0.00 ? 18 ASN A C    12 
ATOM 8902  O O    . ASN A 1 18 ? -3.085  2.570   7.983   1.00 0.00 ? 18 ASN A O    12 
ATOM 8903  C CB   . ASN A 1 18 ? -0.291  2.439   9.372   1.00 0.00 ? 18 ASN A CB   12 
ATOM 8904  C CG   . ASN A 1 18 ? 0.317   1.763   10.604  1.00 0.00 ? 18 ASN A CG   12 
ATOM 8905  O OD1  . ASN A 1 18 ? -0.150  0.728   11.035  1.00 0.00 ? 18 ASN A OD1  12 
ATOM 8906  N ND2  . ASN A 1 18 ? 1.345   2.310   11.193  1.00 0.00 ? 18 ASN A ND2  12 
ATOM 8907  H H    . ASN A 1 18 ? 0.855   0.710   7.869   1.00 0.00 ? 18 ASN A H    12 
ATOM 8908  H HA   . ASN A 1 18 ? -1.631  0.768   9.217   1.00 0.00 ? 18 ASN A HA   12 
ATOM 8909  H HB2  . ASN A 1 18 ? 0.498   2.860   8.766   1.00 0.00 ? 18 ASN A HB2  12 
ATOM 8910  H HB3  . ASN A 1 18 ? -0.961  3.224   9.689   1.00 0.00 ? 18 ASN A HB3  12 
ATOM 8911  H HD21 . ASN A 1 18 ? 1.722   3.146   10.845  1.00 0.00 ? 18 ASN A HD21 12 
ATOM 8912  H HD22 . ASN A 1 18 ? 1.741   1.885   11.982  1.00 0.00 ? 18 ASN A HD22 12 
ATOM 8913  N N    . TYR A 1 19 ? -1.648  2.240   6.352   1.00 0.00 ? 19 TYR A N    12 
ATOM 8914  C CA   . TYR A 1 19 ? -2.522  2.933   5.358   1.00 0.00 ? 19 TYR A CA   12 
ATOM 8915  C C    . TYR A 1 19 ? -3.941  2.352   5.396   1.00 0.00 ? 19 TYR A C    12 
ATOM 8916  O O    . TYR A 1 19 ? -4.865  2.960   4.896   1.00 0.00 ? 19 TYR A O    12 
ATOM 8917  C CB   . TYR A 1 19 ? -1.935  2.746   3.955   1.00 0.00 ? 19 TYR A CB   12 
ATOM 8918  C CG   . TYR A 1 19 ? -2.674  3.609   2.951   1.00 0.00 ? 19 TYR A CG   12 
ATOM 8919  C CD1  . TYR A 1 19 ? -3.588  4.584   3.380   1.00 0.00 ? 19 TYR A CD1  12 
ATOM 8920  C CD2  . TYR A 1 19 ? -2.439  3.430   1.582   1.00 0.00 ? 19 TYR A CD2  12 
ATOM 8921  C CE1  . TYR A 1 19 ? -4.262  5.374   2.441   1.00 0.00 ? 19 TYR A CE1  12 
ATOM 8922  C CE2  . TYR A 1 19 ? -3.114  4.221   0.644   1.00 0.00 ? 19 TYR A CE2  12 
ATOM 8923  C CZ   . TYR A 1 19 ? -4.025  5.193   1.074   1.00 0.00 ? 19 TYR A CZ   12 
ATOM 8924  O OH   . TYR A 1 19 ? -4.690  5.972   0.149   1.00 0.00 ? 19 TYR A OH   12 
ATOM 8925  H H    . TYR A 1 19 ? -0.785  1.874   6.067   1.00 0.00 ? 19 TYR A H    12 
ATOM 8926  H HA   . TYR A 1 19 ? -2.558  3.985   5.593   1.00 0.00 ? 19 TYR A HA   12 
ATOM 8927  H HB2  . TYR A 1 19 ? -0.892  3.026   3.965   1.00 0.00 ? 19 TYR A HB2  12 
ATOM 8928  H HB3  . TYR A 1 19 ? -2.024  1.709   3.667   1.00 0.00 ? 19 TYR A HB3  12 
ATOM 8929  H HD1  . TYR A 1 19 ? -3.773  4.725   4.434   1.00 0.00 ? 19 TYR A HD1  12 
ATOM 8930  H HD2  . TYR A 1 19 ? -1.737  2.681   1.249   1.00 0.00 ? 19 TYR A HD2  12 
ATOM 8931  H HE1  . TYR A 1 19 ? -4.965  6.124   2.772   1.00 0.00 ? 19 TYR A HE1  12 
ATOM 8932  H HE2  . TYR A 1 19 ? -2.931  4.082   -0.411  1.00 0.00 ? 19 TYR A HE2  12 
ATOM 8933  H HH   . TYR A 1 19 ? -4.817  6.843   0.532   1.00 0.00 ? 19 TYR A HH   12 
ATOM 8934  N N    . CYS A 1 20 ? -4.107  1.178   5.972   1.00 0.00 ? 20 CYS A N    12 
ATOM 8935  C CA   . CYS A 1 20 ? -5.460  0.518   6.051   1.00 0.00 ? 20 CYS A CA   12 
ATOM 8936  C C    . CYS A 1 20 ? -6.585  1.542   5.868   1.00 0.00 ? 20 CYS A C    12 
ATOM 8937  O O    . CYS A 1 20 ? -6.566  2.609   6.448   1.00 0.00 ? 20 CYS A O    12 
ATOM 8938  C CB   . CYS A 1 20 ? -5.635  -0.142  7.423   1.00 0.00 ? 20 CYS A CB   12 
ATOM 8939  S SG   . CYS A 1 20 ? -4.168  -1.115  7.841   1.00 0.00 ? 20 CYS A SG   12 
ATOM 8940  H H    . CYS A 1 20 ? -3.329  0.717   6.346   1.00 0.00 ? 20 CYS A H    12 
ATOM 8941  H HA   . CYS A 1 20 ? -5.534  -0.237  5.281   1.00 0.00 ? 20 CYS A HA   12 
ATOM 8942  H HB2  . CYS A 1 20 ? -5.780  0.622   8.172   1.00 0.00 ? 20 CYS A HB2  12 
ATOM 8943  H HB3  . CYS A 1 20 ? -6.500  -0.789  7.400   1.00 0.00 ? 20 CYS A HB3  12 
ATOM 8944  N N    . ASN A 1 21 ? -7.565  1.224   5.068   1.00 0.00 ? 21 ASN A N    12 
ATOM 8945  C CA   . ASN A 1 21 ? -8.688  2.181   4.850   1.00 0.00 ? 21 ASN A CA   12 
ATOM 8946  C C    . ASN A 1 21 ? -10.018 1.470   5.108   1.00 0.00 ? 21 ASN A C    12 
ATOM 8947  O O    . ASN A 1 21 ? -10.098 0.739   6.081   1.00 0.00 ? 21 ASN A O    12 
ATOM 8948  C CB   . ASN A 1 21 ? -8.656  2.694   3.408   1.00 0.00 ? 21 ASN A CB   12 
ATOM 8949  C CG   . ASN A 1 21 ? -7.213  2.714   2.901   1.00 0.00 ? 21 ASN A CG   12 
ATOM 8950  O OD1  . ASN A 1 21 ? -6.527  3.709   3.021   1.00 0.00 ? 21 ASN A OD1  12 
ATOM 8951  N ND2  . ASN A 1 21 ? -6.720  1.646   2.334   1.00 0.00 ? 21 ASN A ND2  12 
ATOM 8952  O OXT  . ASN A 1 21 ? -10.935 1.670   4.327   1.00 0.00 ? 21 ASN A OXT  12 
ATOM 8953  H H    . ASN A 1 21 ? -7.563  0.358   4.610   1.00 0.00 ? 21 ASN A H    12 
ATOM 8954  H HA   . ASN A 1 21 ? -8.588  3.013   5.531   1.00 0.00 ? 21 ASN A HA   12 
ATOM 8955  H HB2  . ASN A 1 21 ? -9.249  2.043   2.782   1.00 0.00 ? 21 ASN A HB2  12 
ATOM 8956  H HB3  . ASN A 1 21 ? -9.061  3.694   3.373   1.00 0.00 ? 21 ASN A HB3  12 
ATOM 8957  H HD21 . ASN A 1 21 ? -7.273  0.843   2.236   1.00 0.00 ? 21 ASN A HD21 12 
ATOM 8958  H HD22 . ASN A 1 21 ? -5.797  1.648   2.004   1.00 0.00 ? 21 ASN A HD22 12 
ATOM 8959  N N    . PHE B 2 1  ? 9.180   -4.428  8.879   1.00 0.00 ? 1  PHE B N    12 
ATOM 8960  C CA   . PHE B 2 1  ? 9.306   -5.306  7.681   1.00 0.00 ? 1  PHE B CA   12 
ATOM 8961  C C    . PHE B 2 1  ? 9.377   -4.442  6.420   1.00 0.00 ? 1  PHE B C    12 
ATOM 8962  O O    . PHE B 2 1  ? 9.324   -3.230  6.483   1.00 0.00 ? 1  PHE B O    12 
ATOM 8963  C CB   . PHE B 2 1  ? 8.092   -6.234  7.598   1.00 0.00 ? 1  PHE B CB   12 
ATOM 8964  C CG   . PHE B 2 1  ? 8.474   -7.609  8.089   1.00 0.00 ? 1  PHE B CG   12 
ATOM 8965  C CD1  . PHE B 2 1  ? 9.227   -7.750  9.260   1.00 0.00 ? 1  PHE B CD1  12 
ATOM 8966  C CD2  . PHE B 2 1  ? 8.076   -8.744  7.372   1.00 0.00 ? 1  PHE B CD2  12 
ATOM 8967  C CE1  . PHE B 2 1  ? 9.582   -9.026  9.715   1.00 0.00 ? 1  PHE B CE1  12 
ATOM 8968  C CE2  . PHE B 2 1  ? 8.431   -10.020 7.827   1.00 0.00 ? 1  PHE B CE2  12 
ATOM 8969  C CZ   . PHE B 2 1  ? 9.184   -10.160 8.999   1.00 0.00 ? 1  PHE B CZ   12 
ATOM 8970  H H1   . PHE B 2 1  ? 10.057  -4.472  9.435   1.00 0.00 ? 1  PHE B H1   12 
ATOM 8971  H H2   . PHE B 2 1  ? 8.381   -4.752  9.462   1.00 0.00 ? 1  PHE B H2   12 
ATOM 8972  H H3   . PHE B 2 1  ? 9.014   -3.448  8.575   1.00 0.00 ? 1  PHE B H3   12 
ATOM 8973  H HA   . PHE B 2 1  ? 10.206  -5.898  7.762   1.00 0.00 ? 1  PHE B HA   12 
ATOM 8974  H HB2  . PHE B 2 1  ? 7.296   -5.840  8.213   1.00 0.00 ? 1  PHE B HB2  12 
ATOM 8975  H HB3  . PHE B 2 1  ? 7.757   -6.298  6.573   1.00 0.00 ? 1  PHE B HB3  12 
ATOM 8976  H HD1  . PHE B 2 1  ? 9.534   -6.875  9.813   1.00 0.00 ? 1  PHE B HD1  12 
ATOM 8977  H HD2  . PHE B 2 1  ? 7.495   -8.636  6.468   1.00 0.00 ? 1  PHE B HD2  12 
ATOM 8978  H HE1  . PHE B 2 1  ? 10.163  -9.134  10.619  1.00 0.00 ? 1  PHE B HE1  12 
ATOM 8979  H HE2  . PHE B 2 1  ? 8.124   -10.895 7.274   1.00 0.00 ? 1  PHE B HE2  12 
ATOM 8980  H HZ   . PHE B 2 1  ? 9.458   -11.144 9.350   1.00 0.00 ? 1  PHE B HZ   12 
ATOM 8981  N N    . VAL B 2 2  ? 9.496   -5.057  5.275   1.00 0.00 ? 2  VAL B N    12 
ATOM 8982  C CA   . VAL B 2 2  ? 9.570   -4.270  4.011   1.00 0.00 ? 2  VAL B CA   12 
ATOM 8983  C C    . VAL B 2 2  ? 9.222   -5.175  2.827   1.00 0.00 ? 2  VAL B C    12 
ATOM 8984  O O    . VAL B 2 2  ? 9.552   -6.344  2.810   1.00 0.00 ? 2  VAL B O    12 
ATOM 8985  C CB   . VAL B 2 2  ? 10.988  -3.722  3.837   1.00 0.00 ? 2  VAL B CB   12 
ATOM 8986  C CG1  . VAL B 2 2  ? 11.213  -2.569  4.817   1.00 0.00 ? 2  VAL B CG1  12 
ATOM 8987  C CG2  . VAL B 2 2  ? 12.002  -4.833  4.118   1.00 0.00 ? 2  VAL B CG2  12 
ATOM 8988  H H    . VAL B 2 2  ? 9.537   -6.035  5.246   1.00 0.00 ? 2  VAL B H    12 
ATOM 8989  H HA   . VAL B 2 2  ? 8.869   -3.450  4.056   1.00 0.00 ? 2  VAL B HA   12 
ATOM 8990  H HB   . VAL B 2 2  ? 11.113  -3.364  2.825   1.00 0.00 ? 2  VAL B HB   12 
ATOM 8991  H HG11 . VAL B 2 2  ? 11.936  -1.882  4.404   1.00 0.00 ? 2  VAL B HG11 12 
ATOM 8992  H HG12 . VAL B 2 2  ? 11.581  -2.960  5.754   1.00 0.00 ? 2  VAL B HG12 12 
ATOM 8993  H HG13 . VAL B 2 2  ? 10.280  -2.052  4.984   1.00 0.00 ? 2  VAL B HG13 12 
ATOM 8994  H HG21 . VAL B 2 2  ? 11.478  -5.758  4.311   1.00 0.00 ? 2  VAL B HG21 12 
ATOM 8995  H HG22 . VAL B 2 2  ? 12.595  -4.569  4.981   1.00 0.00 ? 2  VAL B HG22 12 
ATOM 8996  H HG23 . VAL B 2 2  ? 12.647  -4.957  3.261   1.00 0.00 ? 2  VAL B HG23 12 
ATOM 8997  N N    . ASN B 2 3  ? 8.556   -4.646  1.836   1.00 0.00 ? 3  ASN B N    12 
ATOM 8998  C CA   . ASN B 2 3  ? 8.188   -5.481  0.657   1.00 0.00 ? 3  ASN B CA   12 
ATOM 8999  C C    . ASN B 2 3  ? 9.148   -5.186  -0.497  1.00 0.00 ? 3  ASN B C    12 
ATOM 9000  O O    . ASN B 2 3  ? 10.095  -4.438  -0.354  1.00 0.00 ? 3  ASN B O    12 
ATOM 9001  C CB   . ASN B 2 3  ? 6.757   -5.152  0.226   1.00 0.00 ? 3  ASN B CB   12 
ATOM 9002  C CG   . ASN B 2 3  ? 5.799   -5.418  1.388   1.00 0.00 ? 3  ASN B CG   12 
ATOM 9003  O OD1  . ASN B 2 3  ? 5.938   -6.397  2.094   1.00 0.00 ? 3  ASN B OD1  12 
ATOM 9004  N ND2  . ASN B 2 3  ? 4.823   -4.582  1.617   1.00 0.00 ? 3  ASN B ND2  12 
ATOM 9005  H H    . ASN B 2 3  ? 8.297   -3.700  1.868   1.00 0.00 ? 3  ASN B H    12 
ATOM 9006  H HA   . ASN B 2 3  ? 8.253   -6.526  0.921   1.00 0.00 ? 3  ASN B HA   12 
ATOM 9007  H HB2  . ASN B 2 3  ? 6.698   -4.111  -0.060  1.00 0.00 ? 3  ASN B HB2  12 
ATOM 9008  H HB3  . ASN B 2 3  ? 6.483   -5.772  -0.614  1.00 0.00 ? 3  ASN B HB3  12 
ATOM 9009  H HD21 . ASN B 2 3  ? 4.710   -3.793  1.047   1.00 0.00 ? 3  ASN B HD21 12 
ATOM 9010  H HD22 . ASN B 2 3  ? 4.203   -4.744  2.359   1.00 0.00 ? 3  ASN B HD22 12 
ATOM 9011  N N    . GLN B 2 4  ? 8.911   -5.766  -1.642  1.00 0.00 ? 4  GLN B N    12 
ATOM 9012  C CA   . GLN B 2 4  ? 9.809   -5.515  -2.804  1.00 0.00 ? 4  GLN B CA   12 
ATOM 9013  C C    . GLN B 2 4  ? 9.323   -4.279  -3.563  1.00 0.00 ? 4  GLN B C    12 
ATOM 9014  O O    . GLN B 2 4  ? 9.305   -4.248  -4.777  1.00 0.00 ? 4  GLN B O    12 
ATOM 9015  C CB   . GLN B 2 4  ? 9.793   -6.729  -3.736  1.00 0.00 ? 4  GLN B CB   12 
ATOM 9016  C CG   . GLN B 2 4  ? 10.638  -7.850  -3.128  1.00 0.00 ? 4  GLN B CG   12 
ATOM 9017  C CD   . GLN B 2 4  ? 10.158  -9.201  -3.662  1.00 0.00 ? 4  GLN B CD   12 
ATOM 9018  O OE1  . GLN B 2 4  ? 10.769  -9.769  -4.546  1.00 0.00 ? 4  GLN B OE1  12 
ATOM 9019  N NE2  . GLN B 2 4  ? 9.083   -9.743  -3.160  1.00 0.00 ? 4  GLN B NE2  12 
ATOM 9020  H H    . GLN B 2 4  ? 8.141   -6.365  -1.738  1.00 0.00 ? 4  GLN B H    12 
ATOM 9021  H HA   . GLN B 2 4  ? 10.815  -5.346  -2.450  1.00 0.00 ? 4  GLN B HA   12 
ATOM 9022  H HB2  . GLN B 2 4  ? 8.776   -7.071  -3.863  1.00 0.00 ? 4  GLN B HB2  12 
ATOM 9023  H HB3  . GLN B 2 4  ? 10.203  -6.452  -4.696  1.00 0.00 ? 4  GLN B HB3  12 
ATOM 9024  H HG2  . GLN B 2 4  ? 11.675  -7.704  -3.394  1.00 0.00 ? 4  GLN B HG2  12 
ATOM 9025  H HG3  . GLN B 2 4  ? 10.537  -7.835  -2.053  1.00 0.00 ? 4  GLN B HG3  12 
ATOM 9026  H HE21 . GLN B 2 4  ? 8.591   -9.285  -2.447  1.00 0.00 ? 4  GLN B HE21 12 
ATOM 9027  H HE22 . GLN B 2 4  ? 8.768   -10.608 -3.495  1.00 0.00 ? 4  GLN B HE22 12 
ATOM 9028  N N    . HIS B 2 5  ? 8.930   -3.260  -2.851  1.00 0.00 ? 5  HIS B N    12 
ATOM 9029  C CA   . HIS B 2 5  ? 8.443   -2.018  -3.516  1.00 0.00 ? 5  HIS B CA   12 
ATOM 9030  C C    . HIS B 2 5  ? 9.385   -1.624  -4.656  1.00 0.00 ? 5  HIS B C    12 
ATOM 9031  O O    . HIS B 2 5  ? 10.520  -2.055  -4.716  1.00 0.00 ? 5  HIS B O    12 
ATOM 9032  C CB   . HIS B 2 5  ? 8.414   -0.892  -2.486  1.00 0.00 ? 5  HIS B CB   12 
ATOM 9033  C CG   . HIS B 2 5  ? 9.609   -1.030  -1.582  1.00 0.00 ? 5  HIS B CG   12 
ATOM 9034  N ND1  . HIS B 2 5  ? 9.522   -1.614  -0.329  1.00 0.00 ? 5  HIS B ND1  12 
ATOM 9035  C CD2  . HIS B 2 5  ? 10.925  -0.674  -1.739  1.00 0.00 ? 5  HIS B CD2  12 
ATOM 9036  C CE1  . HIS B 2 5  ? 10.753  -1.592  0.214   1.00 0.00 ? 5  HIS B CE1  12 
ATOM 9037  N NE2  . HIS B 2 5  ? 11.646  -1.030  -0.603  1.00 0.00 ? 5  HIS B NE2  12 
ATOM 9038  H H    . HIS B 2 5  ? 8.955   -3.309  -1.869  1.00 0.00 ? 5  HIS B H    12 
ATOM 9039  H HA   . HIS B 2 5  ? 7.448   -2.178  -3.903  1.00 0.00 ? 5  HIS B HA   12 
ATOM 9040  H HB2  . HIS B 2 5  ? 8.449   0.062   -2.992  1.00 0.00 ? 5  HIS B HB2  12 
ATOM 9041  H HB3  . HIS B 2 5  ? 7.509   -0.960  -1.902  1.00 0.00 ? 5  HIS B HB3  12 
ATOM 9042  H HD1  . HIS B 2 5  ? 8.714   -1.981  0.084   1.00 0.00 ? 5  HIS B HD1  12 
ATOM 9043  H HD2  . HIS B 2 5  ? 11.340  -0.195  -2.613  1.00 0.00 ? 5  HIS B HD2  12 
ATOM 9044  H HE1  . HIS B 2 5  ? 10.988  -1.978  1.195   1.00 0.00 ? 5  HIS B HE1  12 
ATOM 9045  N N    . LEU B 2 6  ? 8.922   -0.798  -5.557  1.00 0.00 ? 6  LEU B N    12 
ATOM 9046  C CA   . LEU B 2 6  ? 9.788   -0.362  -6.690  1.00 0.00 ? 6  LEU B CA   12 
ATOM 9047  C C    . LEU B 2 6  ? 9.506   1.110   -7.020  1.00 0.00 ? 6  LEU B C    12 
ATOM 9048  O O    . LEU B 2 6  ? 9.991   1.638   -8.002  1.00 0.00 ? 6  LEU B O    12 
ATOM 9049  C CB   . LEU B 2 6  ? 9.497   -1.225  -7.919  1.00 0.00 ? 6  LEU B CB   12 
ATOM 9050  C CG   . LEU B 2 6  ? 10.816  -1.684  -8.544  1.00 0.00 ? 6  LEU B CG   12 
ATOM 9051  C CD1  . LEU B 2 6  ? 11.435  -2.783  -7.679  1.00 0.00 ? 6  LEU B CD1  12 
ATOM 9052  C CD2  . LEU B 2 6  ? 10.551  -2.231  -9.948  1.00 0.00 ? 6  LEU B CD2  12 
ATOM 9053  H H    . LEU B 2 6  ? 8.005   -0.461  -5.484  1.00 0.00 ? 6  LEU B H    12 
ATOM 9054  H HA   . LEU B 2 6  ? 10.826  -0.473  -6.412  1.00 0.00 ? 6  LEU B HA   12 
ATOM 9055  H HB2  . LEU B 2 6  ? 8.918   -2.087  -7.624  1.00 0.00 ? 6  LEU B HB2  12 
ATOM 9056  H HB3  . LEU B 2 6  ? 8.941   -0.647  -8.642  1.00 0.00 ? 6  LEU B HB3  12 
ATOM 9057  H HG   . LEU B 2 6  ? 11.496  -0.847  -8.603  1.00 0.00 ? 6  LEU B HG   12 
ATOM 9058  H HD11 . LEU B 2 6  ? 10.649  -3.380  -7.238  1.00 0.00 ? 6  LEU B HD11 12 
ATOM 9059  H HD12 . LEU B 2 6  ? 12.028  -2.334  -6.896  1.00 0.00 ? 6  LEU B HD12 12 
ATOM 9060  H HD13 . LEU B 2 6  ? 12.064  -3.412  -8.292  1.00 0.00 ? 6  LEU B HD13 12 
ATOM 9061  H HD21 . LEU B 2 6  ? 9.772   -1.650  -10.420 1.00 0.00 ? 6  LEU B HD21 12 
ATOM 9062  H HD22 . LEU B 2 6  ? 10.240  -3.263  -9.880  1.00 0.00 ? 6  LEU B HD22 12 
ATOM 9063  H HD23 . LEU B 2 6  ? 11.455  -2.165  -10.536 1.00 0.00 ? 6  LEU B HD23 12 
ATOM 9064  N N    . CYS B 2 7  ? 8.726   1.776   -6.210  1.00 0.00 ? 7  CYS B N    12 
ATOM 9065  C CA   . CYS B 2 7  ? 8.415   3.211   -6.478  1.00 0.00 ? 7  CYS B CA   12 
ATOM 9066  C C    . CYS B 2 7  ? 7.675   3.332   -7.811  1.00 0.00 ? 7  CYS B C    12 
ATOM 9067  O O    . CYS B 2 7  ? 8.275   3.351   -8.867  1.00 0.00 ? 7  CYS B O    12 
ATOM 9068  C CB   . CYS B 2 7  ? 9.714   4.018   -6.536  1.00 0.00 ? 7  CYS B CB   12 
ATOM 9069  S SG   . CYS B 2 7  ? 9.356   5.721   -7.046  1.00 0.00 ? 7  CYS B SG   12 
ATOM 9070  H H    . CYS B 2 7  ? 8.345   1.333   -5.425  1.00 0.00 ? 7  CYS B H    12 
ATOM 9071  H HA   . CYS B 2 7  ? 7.789   3.595   -5.685  1.00 0.00 ? 7  CYS B HA   12 
ATOM 9072  H HB2  . CYS B 2 7  ? 10.175  4.025   -5.559  1.00 0.00 ? 7  CYS B HB2  12 
ATOM 9073  H HB3  . CYS B 2 7  ? 10.387  3.563   -7.248  1.00 0.00 ? 7  CYS B HB3  12 
ATOM 9074  N N    . GLY B 2 8  ? 6.374   3.412   -7.768  1.00 0.00 ? 8  GLY B N    12 
ATOM 9075  C CA   . GLY B 2 8  ? 5.589   3.530   -9.028  1.00 0.00 ? 8  GLY B CA   12 
ATOM 9076  C C    . GLY B 2 8  ? 4.405   2.564   -8.974  1.00 0.00 ? 8  GLY B C    12 
ATOM 9077  O O    . GLY B 2 8  ? 3.398   2.837   -8.352  1.00 0.00 ? 8  GLY B O    12 
ATOM 9078  H H    . GLY B 2 8  ? 5.912   3.393   -6.904  1.00 0.00 ? 8  GLY B H    12 
ATOM 9079  H HA2  . GLY B 2 8  ? 5.228   4.543   -9.135  1.00 0.00 ? 8  GLY B HA2  12 
ATOM 9080  H HA3  . GLY B 2 8  ? 6.216   3.279   -9.870  1.00 0.00 ? 8  GLY B HA3  12 
ATOM 9081  N N    . SER B 2 9  ? 4.520   1.434   -9.615  1.00 0.00 ? 9  SER B N    12 
ATOM 9082  C CA   . SER B 2 9  ? 3.403   0.450   -9.591  1.00 0.00 ? 9  SER B CA   12 
ATOM 9083  C C    . SER B 2 9  ? 3.632   -0.539  -8.447  1.00 0.00 ? 9  SER B C    12 
ATOM 9084  O O    . SER B 2 9  ? 2.701   -1.073  -7.877  1.00 0.00 ? 9  SER B O    12 
ATOM 9085  C CB   . SER B 2 9  ? 3.358   -0.305  -10.920 1.00 0.00 ? 9  SER B CB   12 
ATOM 9086  O OG   . SER B 2 9  ? 2.161   0.031   -11.610 1.00 0.00 ? 9  SER B OG   12 
ATOM 9087  H H    . SER B 2 9  ? 5.343   1.230   -10.107 1.00 0.00 ? 9  SER B H    12 
ATOM 9088  H HA   . SER B 2 9  ? 2.468   0.968   -9.438  1.00 0.00 ? 9  SER B HA   12 
ATOM 9089  H HB2  . SER B 2 9  ? 4.205   -0.027  -11.524 1.00 0.00 ? 9  SER B HB2  12 
ATOM 9090  H HB3  . SER B 2 9  ? 3.389   -1.370  -10.729 1.00 0.00 ? 9  SER B HB3  12 
ATOM 9091  H HG   . SER B 2 9  ? 2.018   -0.627  -12.295 1.00 0.00 ? 9  SER B HG   12 
ATOM 9092  N N    . HIS B 2 10 ? 4.868   -0.788  -8.107  1.00 0.00 ? 10 HIS B N    12 
ATOM 9093  C CA   . HIS B 2 10 ? 5.162   -1.739  -7.003  1.00 0.00 ? 10 HIS B CA   12 
ATOM 9094  C C    . HIS B 2 10 ? 4.746   -1.123  -5.668  1.00 0.00 ? 10 HIS B C    12 
ATOM 9095  O O    . HIS B 2 10 ? 4.109   -1.761  -4.853  1.00 0.00 ? 10 HIS B O    12 
ATOM 9096  C CB   . HIS B 2 10 ? 6.661   -2.042  -6.980  1.00 0.00 ? 10 HIS B CB   12 
ATOM 9097  C CG   . HIS B 2 10 ? 6.928   -3.304  -7.753  1.00 0.00 ? 10 HIS B CG   12 
ATOM 9098  N ND1  . HIS B 2 10 ? 7.454   -4.440  -7.158  1.00 0.00 ? 10 HIS B ND1  12 
ATOM 9099  C CD2  . HIS B 2 10 ? 6.747   -3.625  -9.076  1.00 0.00 ? 10 HIS B CD2  12 
ATOM 9100  C CE1  . HIS B 2 10 ? 7.571   -5.381  -8.112  1.00 0.00 ? 10 HIS B CE1  12 
ATOM 9101  N NE2  . HIS B 2 10 ? 7.154   -4.937  -9.300  1.00 0.00 ? 10 HIS B NE2  12 
ATOM 9102  H H    . HIS B 2 10 ? 5.602   -0.349  -8.579  1.00 0.00 ? 10 HIS B H    12 
ATOM 9103  H HA   . HIS B 2 10 ? 4.613   -2.651  -7.163  1.00 0.00 ? 10 HIS B HA   12 
ATOM 9104  H HB2  . HIS B 2 10 ? 7.201   -1.222  -7.430  1.00 0.00 ? 10 HIS B HB2  12 
ATOM 9105  H HB3  . HIS B 2 10 ? 6.987   -2.170  -5.958  1.00 0.00 ? 10 HIS B HB3  12 
ATOM 9106  H HD1  . HIS B 2 10 ? 7.697   -4.539  -6.213  1.00 0.00 ? 10 HIS B HD1  12 
ATOM 9107  H HD2  . HIS B 2 10 ? 6.350   -2.959  -9.828  1.00 0.00 ? 10 HIS B HD2  12 
ATOM 9108  H HE1  . HIS B 2 10 ? 7.955   -6.376  -7.938  1.00 0.00 ? 10 HIS B HE1  12 
ATOM 9109  N N    . LEU B 2 11 ? 5.097   0.112   -5.434  1.00 0.00 ? 11 LEU B N    12 
ATOM 9110  C CA   . LEU B 2 11 ? 4.713   0.752   -4.148  1.00 0.00 ? 11 LEU B CA   12 
ATOM 9111  C C    . LEU B 2 11 ? 3.190   0.813   -4.052  1.00 0.00 ? 11 LEU B C    12 
ATOM 9112  O O    . LEU B 2 11 ? 2.610   0.473   -3.040  1.00 0.00 ? 11 LEU B O    12 
ATOM 9113  C CB   . LEU B 2 11 ? 5.286   2.167   -4.079  1.00 0.00 ? 11 LEU B CB   12 
ATOM 9114  C CG   . LEU B 2 11 ? 5.682   2.478   -2.636  1.00 0.00 ? 11 LEU B CG   12 
ATOM 9115  C CD1  . LEU B 2 11 ? 7.084   3.086   -2.612  1.00 0.00 ? 11 LEU B CD1  12 
ATOM 9116  C CD2  . LEU B 2 11 ? 4.683   3.469   -2.035  1.00 0.00 ? 11 LEU B CD2  12 
ATOM 9117  H H    . LEU B 2 11 ? 5.610   0.614   -6.102  1.00 0.00 ? 11 LEU B H    12 
ATOM 9118  H HA   . LEU B 2 11 ? 5.100   0.167   -3.327  1.00 0.00 ? 11 LEU B HA   12 
ATOM 9119  H HB2  . LEU B 2 11 ? 6.156   2.235   -4.717  1.00 0.00 ? 11 LEU B HB2  12 
ATOM 9120  H HB3  . LEU B 2 11 ? 4.541   2.875   -4.407  1.00 0.00 ? 11 LEU B HB3  12 
ATOM 9121  H HG   . LEU B 2 11 ? 5.678   1.564   -2.058  1.00 0.00 ? 11 LEU B HG   12 
ATOM 9122  H HD11 . LEU B 2 11 ? 7.028   4.105   -2.259  1.00 0.00 ? 11 LEU B HD11 12 
ATOM 9123  H HD12 . LEU B 2 11 ? 7.498   3.072   -3.610  1.00 0.00 ? 11 LEU B HD12 12 
ATOM 9124  H HD13 . LEU B 2 11 ? 7.714   2.509   -1.953  1.00 0.00 ? 11 LEU B HD13 12 
ATOM 9125  H HD21 . LEU B 2 11 ? 5.216   4.221   -1.473  1.00 0.00 ? 11 LEU B HD21 12 
ATOM 9126  H HD22 . LEU B 2 11 ? 4.005   2.943   -1.379  1.00 0.00 ? 11 LEU B HD22 12 
ATOM 9127  H HD23 . LEU B 2 11 ? 4.123   3.941   -2.828  1.00 0.00 ? 11 LEU B HD23 12 
ATOM 9128  N N    . VAL B 2 12 ? 2.533   1.231   -5.099  1.00 0.00 ? 12 VAL B N    12 
ATOM 9129  C CA   . VAL B 2 12 ? 1.048   1.293   -5.052  1.00 0.00 ? 12 VAL B CA   12 
ATOM 9130  C C    . VAL B 2 12 ? 0.514   -0.118  -4.845  1.00 0.00 ? 12 VAL B C    12 
ATOM 9131  O O    . VAL B 2 12 ? -0.284  -0.368  -3.963  1.00 0.00 ? 12 VAL B O    12 
ATOM 9132  C CB   . VAL B 2 12 ? 0.508   1.864   -6.364  1.00 0.00 ? 12 VAL B CB   12 
ATOM 9133  C CG1  . VAL B 2 12 ? -1.020  1.914   -6.311  1.00 0.00 ? 12 VAL B CG1  12 
ATOM 9134  C CG2  . VAL B 2 12 ? 1.057   3.279   -6.568  1.00 0.00 ? 12 VAL B CG2  12 
ATOM 9135  H H    . VAL B 2 12 ? 3.013   1.494   -5.912  1.00 0.00 ? 12 VAL B H    12 
ATOM 9136  H HA   . VAL B 2 12 ? 0.741   1.913   -4.225  1.00 0.00 ? 12 VAL B HA   12 
ATOM 9137  H HB   . VAL B 2 12 ? 0.819   1.234   -7.185  1.00 0.00 ? 12 VAL B HB   12 
ATOM 9138  H HG11 . VAL B 2 12 ? -1.349  1.788   -5.290  1.00 0.00 ? 12 VAL B HG11 12 
ATOM 9139  H HG12 . VAL B 2 12 ? -1.427  1.122   -6.921  1.00 0.00 ? 12 VAL B HG12 12 
ATOM 9140  H HG13 . VAL B 2 12 ? -1.362  2.868   -6.684  1.00 0.00 ? 12 VAL B HG13 12 
ATOM 9141  H HG21 . VAL B 2 12 ? 0.855   3.601   -7.579  1.00 0.00 ? 12 VAL B HG21 12 
ATOM 9142  H HG22 . VAL B 2 12 ? 2.123   3.279   -6.396  1.00 0.00 ? 12 VAL B HG22 12 
ATOM 9143  H HG23 . VAL B 2 12 ? 0.580   3.954   -5.873  1.00 0.00 ? 12 VAL B HG23 12 
ATOM 9144  N N    . GLU B 2 13 ? 0.971   -1.054  -5.628  1.00 0.00 ? 13 GLU B N    12 
ATOM 9145  C CA   . GLU B 2 13 ? 0.509   -2.449  -5.440  1.00 0.00 ? 13 GLU B CA   12 
ATOM 9146  C C    . GLU B 2 13 ? 0.809   -2.836  -3.996  1.00 0.00 ? 13 GLU B C    12 
ATOM 9147  O O    . GLU B 2 13 ? 0.112   -3.624  -3.388  1.00 0.00 ? 13 GLU B O    12 
ATOM 9148  C CB   . GLU B 2 13 ? 1.261   -3.380  -6.394  1.00 0.00 ? 13 GLU B CB   12 
ATOM 9149  C CG   . GLU B 2 13 ? 0.467   -4.676  -6.575  1.00 0.00 ? 13 GLU B CG   12 
ATOM 9150  C CD   . GLU B 2 13 ? 1.360   -5.737  -7.222  1.00 0.00 ? 13 GLU B CD   12 
ATOM 9151  O OE1  . GLU B 2 13 ? 2.487   -5.884  -6.778  1.00 0.00 ? 13 GLU B OE1  12 
ATOM 9152  O OE2  . GLU B 2 13 ? 0.901   -6.384  -8.149  1.00 0.00 ? 13 GLU B OE2  12 
ATOM 9153  H H    . GLU B 2 13 ? 1.633   -0.841  -6.319  1.00 0.00 ? 13 GLU B H    12 
ATOM 9154  H HA   . GLU B 2 13 ? -0.554  -2.512  -5.623  1.00 0.00 ? 13 GLU B HA   12 
ATOM 9155  H HB2  . GLU B 2 13 ? 1.381   -2.894  -7.351  1.00 0.00 ? 13 GLU B HB2  12 
ATOM 9156  H HB3  . GLU B 2 13 ? 2.232   -3.610  -5.982  1.00 0.00 ? 13 GLU B HB3  12 
ATOM 9157  H HG2  . GLU B 2 13 ? 0.128   -5.028  -5.612  1.00 0.00 ? 13 GLU B HG2  12 
ATOM 9158  H HG3  . GLU B 2 13 ? -0.385  -4.490  -7.211  1.00 0.00 ? 13 GLU B HG3  12 
ATOM 9159  N N    . ALA B 2 14 ? 1.848   -2.268  -3.441  1.00 0.00 ? 14 ALA B N    12 
ATOM 9160  C CA   . ALA B 2 14 ? 2.206   -2.576  -2.033  1.00 0.00 ? 14 ALA B CA   12 
ATOM 9161  C C    . ALA B 2 14 ? 1.145   -1.984  -1.108  1.00 0.00 ? 14 ALA B C    12 
ATOM 9162  O O    . ALA B 2 14 ? 0.654   -2.636  -0.210  1.00 0.00 ? 14 ALA B O    12 
ATOM 9163  C CB   . ALA B 2 14 ? 3.571   -1.967  -1.705  1.00 0.00 ? 14 ALA B CB   12 
ATOM 9164  H H    . ALA B 2 14 ? 2.385   -1.627  -3.952  1.00 0.00 ? 14 ALA B H    12 
ATOM 9165  H HA   . ALA B 2 14 ? 2.245   -3.641  -1.901  1.00 0.00 ? 14 ALA B HA   12 
ATOM 9166  H HB1  . ALA B 2 14 ? 4.233   -2.740  -1.343  1.00 0.00 ? 14 ALA B HB1  12 
ATOM 9167  H HB2  . ALA B 2 14 ? 3.454   -1.209  -0.944  1.00 0.00 ? 14 ALA B HB2  12 
ATOM 9168  H HB3  . ALA B 2 14 ? 3.990   -1.522  -2.595  1.00 0.00 ? 14 ALA B HB3  12 
ATOM 9169  N N    . LEU B 2 15 ? 0.780   -0.753  -1.333  1.00 0.00 ? 15 LEU B N    12 
ATOM 9170  C CA   . LEU B 2 15 ? -0.258  -0.116  -0.477  1.00 0.00 ? 15 LEU B CA   12 
ATOM 9171  C C    . LEU B 2 15 ? -1.533  -0.958  -0.553  1.00 0.00 ? 15 LEU B C    12 
ATOM 9172  O O    . LEU B 2 15 ? -2.259  -1.102  0.410   1.00 0.00 ? 15 LEU B O    12 
ATOM 9173  C CB   . LEU B 2 15 ? -0.507  1.329   -0.959  1.00 0.00 ? 15 LEU B CB   12 
ATOM 9174  C CG   . LEU B 2 15 ? -1.749  1.406   -1.856  1.00 0.00 ? 15 LEU B CG   12 
ATOM 9175  C CD1  . LEU B 2 15 ? -3.003  1.478   -0.983  1.00 0.00 ? 15 LEU B CD1  12 
ATOM 9176  C CD2  . LEU B 2 15 ? -1.665  2.659   -2.732  1.00 0.00 ? 15 LEU B CD2  12 
ATOM 9177  H H    . LEU B 2 15 ? 1.186   -0.251  -2.070  1.00 0.00 ? 15 LEU B H    12 
ATOM 9178  H HA   . LEU B 2 15 ? 0.090   -0.100  0.548   1.00 0.00 ? 15 LEU B HA   12 
ATOM 9179  H HB2  . LEU B 2 15 ? -0.650  1.969   -0.102  1.00 0.00 ? 15 LEU B HB2  12 
ATOM 9180  H HB3  . LEU B 2 15 ? 0.354   1.669   -1.516  1.00 0.00 ? 15 LEU B HB3  12 
ATOM 9181  H HG   . LEU B 2 15 ? -1.796  0.527   -2.483  1.00 0.00 ? 15 LEU B HG   12 
ATOM 9182  H HD11 . LEU B 2 15 ? -3.672  0.672   -1.245  1.00 0.00 ? 15 LEU B HD11 12 
ATOM 9183  H HD12 . LEU B 2 15 ? -3.500  2.424   -1.143  1.00 0.00 ? 15 LEU B HD12 12 
ATOM 9184  H HD13 . LEU B 2 15 ? -2.724  1.390   0.057   1.00 0.00 ? 15 LEU B HD13 12 
ATOM 9185  H HD21 . LEU B 2 15 ? -1.882  3.531   -2.133  1.00 0.00 ? 15 LEU B HD21 12 
ATOM 9186  H HD22 . LEU B 2 15 ? -2.384  2.585   -3.535  1.00 0.00 ? 15 LEU B HD22 12 
ATOM 9187  H HD23 . LEU B 2 15 ? -0.671  2.743   -3.145  1.00 0.00 ? 15 LEU B HD23 12 
ATOM 9188  N N    . TYR B 2 16 ? -1.803  -1.525  -1.691  1.00 0.00 ? 16 TYR B N    12 
ATOM 9189  C CA   . TYR B 2 16 ? -3.015  -2.370  -1.815  1.00 0.00 ? 16 TYR B CA   12 
ATOM 9190  C C    . TYR B 2 16 ? -2.818  -3.616  -0.955  1.00 0.00 ? 16 TYR B C    12 
ATOM 9191  O O    . TYR B 2 16 ? -3.653  -3.973  -0.149  1.00 0.00 ? 16 TYR B O    12 
ATOM 9192  C CB   . TYR B 2 16 ? -3.203  -2.781  -3.278  1.00 0.00 ? 16 TYR B CB   12 
ATOM 9193  C CG   . TYR B 2 16 ? -4.602  -2.439  -3.730  1.00 0.00 ? 16 TYR B CG   12 
ATOM 9194  C CD1  . TYR B 2 16 ? -5.707  -2.994  -3.072  1.00 0.00 ? 16 TYR B CD1  12 
ATOM 9195  C CD2  . TYR B 2 16 ? -4.795  -1.569  -4.809  1.00 0.00 ? 16 TYR B CD2  12 
ATOM 9196  C CE1  . TYR B 2 16 ? -7.004  -2.678  -3.495  1.00 0.00 ? 16 TYR B CE1  12 
ATOM 9197  C CE2  . TYR B 2 16 ? -6.091  -1.253  -5.231  1.00 0.00 ? 16 TYR B CE2  12 
ATOM 9198  C CZ   . TYR B 2 16 ? -7.196  -1.807  -4.575  1.00 0.00 ? 16 TYR B CZ   12 
ATOM 9199  O OH   . TYR B 2 16 ? -8.474  -1.496  -4.992  1.00 0.00 ? 16 TYR B OH   12 
ATOM 9200  H H    . TYR B 2 16 ? -1.203  -1.406  -2.455  1.00 0.00 ? 16 TYR B H    12 
ATOM 9201  H HA   . TYR B 2 16 ? -3.875  -1.825  -1.474  1.00 0.00 ? 16 TYR B HA   12 
ATOM 9202  H HB2  . TYR B 2 16 ? -2.488  -2.255  -3.893  1.00 0.00 ? 16 TYR B HB2  12 
ATOM 9203  H HB3  . TYR B 2 16 ? -3.045  -3.845  -3.374  1.00 0.00 ? 16 TYR B HB3  12 
ATOM 9204  H HD1  . TYR B 2 16 ? -5.559  -3.665  -2.240  1.00 0.00 ? 16 TYR B HD1  12 
ATOM 9205  H HD2  . TYR B 2 16 ? -3.943  -1.142  -5.316  1.00 0.00 ? 16 TYR B HD2  12 
ATOM 9206  H HE1  . TYR B 2 16 ? -7.856  -3.105  -2.989  1.00 0.00 ? 16 TYR B HE1  12 
ATOM 9207  H HE2  . TYR B 2 16 ? -6.239  -0.582  -6.064  1.00 0.00 ? 16 TYR B HE2  12 
ATOM 9208  H HH   . TYR B 2 16 ? -8.493  -0.564  -5.218  1.00 0.00 ? 16 TYR B HH   12 
ATOM 9209  N N    . LEU B 2 17 ? -1.708  -4.276  -1.128  1.00 0.00 ? 17 LEU B N    12 
ATOM 9210  C CA   . LEU B 2 17 ? -1.426  -5.503  -0.334  1.00 0.00 ? 17 LEU B CA   12 
ATOM 9211  C C    . LEU B 2 17 ? -1.159  -5.155  1.133   1.00 0.00 ? 17 LEU B C    12 
ATOM 9212  O O    . LEU B 2 17 ? -1.604  -5.844  2.030   1.00 0.00 ? 17 LEU B O    12 
ATOM 9213  C CB   . LEU B 2 17 ? -0.207  -6.219  -0.919  1.00 0.00 ? 17 LEU B CB   12 
ATOM 9214  C CG   . LEU B 2 17 ? -0.531  -7.701  -1.117  1.00 0.00 ? 17 LEU B CG   12 
ATOM 9215  C CD1  . LEU B 2 17 ? 0.558   -8.353  -1.970  1.00 0.00 ? 17 LEU B CD1  12 
ATOM 9216  C CD2  . LEU B 2 17 ? -0.594  -8.394  0.246   1.00 0.00 ? 17 LEU B CD2  12 
ATOM 9217  H H    . LEU B 2 17 ? -1.056  -3.960  -1.786  1.00 0.00 ? 17 LEU B H    12 
ATOM 9218  H HA   . LEU B 2 17 ? -2.280  -6.155  -0.386  1.00 0.00 ? 17 LEU B HA   12 
ATOM 9219  H HB2  . LEU B 2 17 ? 0.049   -5.775  -1.870  1.00 0.00 ? 17 LEU B HB2  12 
ATOM 9220  H HB3  . LEU B 2 17 ? 0.627   -6.123  -0.240  1.00 0.00 ? 17 LEU B HB3  12 
ATOM 9221  H HG   . LEU B 2 17 ? -1.484  -7.797  -1.616  1.00 0.00 ? 17 LEU B HG   12 
ATOM 9222  H HD11 . LEU B 2 17 ? 1.502   -7.861  -1.787  1.00 0.00 ? 17 LEU B HD11 12 
ATOM 9223  H HD12 . LEU B 2 17 ? 0.301   -8.261  -3.015  1.00 0.00 ? 17 LEU B HD12 12 
ATOM 9224  H HD13 . LEU B 2 17 ? 0.641   -9.398  -1.711  1.00 0.00 ? 17 LEU B HD13 12 
ATOM 9225  H HD21 . LEU B 2 17 ? 0.316   -8.954  0.407   1.00 0.00 ? 17 LEU B HD21 12 
ATOM 9226  H HD22 . LEU B 2 17 ? -1.439  -9.066  0.269   1.00 0.00 ? 17 LEU B HD22 12 
ATOM 9227  H HD23 . LEU B 2 17 ? -0.702  -7.652  1.022   1.00 0.00 ? 17 LEU B HD23 12 
ATOM 9228  N N    . VAL B 2 18 ? -0.421  -4.110  1.394   1.00 0.00 ? 18 VAL B N    12 
ATOM 9229  C CA   . VAL B 2 18 ? -0.122  -3.761  2.815   1.00 0.00 ? 18 VAL B CA   12 
ATOM 9230  C C    . VAL B 2 18 ? -1.427  -3.565  3.577   1.00 0.00 ? 18 VAL B C    12 
ATOM 9231  O O    . VAL B 2 18 ? -1.606  -4.091  4.658   1.00 0.00 ? 18 VAL B O    12 
ATOM 9232  C CB   . VAL B 2 18 ? 0.706   -2.473  2.899   1.00 0.00 ? 18 VAL B CB   12 
ATOM 9233  C CG1  . VAL B 2 18 ? 1.936   -2.571  1.997   1.00 0.00 ? 18 VAL B CG1  12 
ATOM 9234  C CG2  . VAL B 2 18 ? -0.154  -1.295  2.466   1.00 0.00 ? 18 VAL B CG2  12 
ATOM 9235  H H    . VAL B 2 18 ? -0.055  -3.572  0.663   1.00 0.00 ? 18 VAL B H    12 
ATOM 9236  H HA   . VAL B 2 18 ? 0.427   -4.569  3.265   1.00 0.00 ? 18 VAL B HA   12 
ATOM 9237  H HB   . VAL B 2 18 ? 1.026   -2.320  3.913   1.00 0.00 ? 18 VAL B HB   12 
ATOM 9238  H HG11 . VAL B 2 18 ? 1.924   -1.760  1.284   1.00 0.00 ? 18 VAL B HG11 12 
ATOM 9239  H HG12 . VAL B 2 18 ? 1.925   -3.513  1.473   1.00 0.00 ? 18 VAL B HG12 12 
ATOM 9240  H HG13 . VAL B 2 18 ? 2.830   -2.504  2.601   1.00 0.00 ? 18 VAL B HG13 12 
ATOM 9241  H HG21 . VAL B 2 18 ? -0.600  -1.516  1.513   1.00 0.00 ? 18 VAL B HG21 12 
ATOM 9242  H HG22 . VAL B 2 18 ? 0.460   -0.410  2.382   1.00 0.00 ? 18 VAL B HG22 12 
ATOM 9243  H HG23 . VAL B 2 18 ? -0.931  -1.126  3.197   1.00 0.00 ? 18 VAL B HG23 12 
ATOM 9244  N N    . CYS B 2 19 ? -2.343  -2.814  3.036   1.00 0.00 ? 19 CYS B N    12 
ATOM 9245  C CA   . CYS B 2 19 ? -3.625  -2.602  3.759   1.00 0.00 ? 19 CYS B CA   12 
ATOM 9246  C C    . CYS B 2 19 ? -4.611  -1.871  2.856   1.00 0.00 ? 19 CYS B C    12 
ATOM 9247  O O    . CYS B 2 19 ? -5.402  -1.066  3.306   1.00 0.00 ? 19 CYS B O    12 
ATOM 9248  C CB   . CYS B 2 19 ? -3.362  -1.767  5.009   1.00 0.00 ? 19 CYS B CB   12 
ATOM 9249  S SG   . CYS B 2 19 ? -4.122  -2.568  6.441   1.00 0.00 ? 19 CYS B SG   12 
ATOM 9250  H H    . CYS B 2 19 ? -2.187  -2.389  2.161   1.00 0.00 ? 19 CYS B H    12 
ATOM 9251  H HA   . CYS B 2 19 ? -4.040  -3.557  4.046   1.00 0.00 ? 19 CYS B HA   12 
ATOM 9252  H HB2  . CYS B 2 19 ? -2.298  -1.686  5.164   1.00 0.00 ? 19 CYS B HB2  12 
ATOM 9253  H HB3  . CYS B 2 19 ? -3.785  -0.781  4.880   1.00 0.00 ? 19 CYS B HB3  12 
ATOM 9254  N N    . GLY B 2 20 ? -4.571  -2.142  1.586   1.00 0.00 ? 20 GLY B N    12 
ATOM 9255  C CA   . GLY B 2 20 ? -5.515  -1.455  0.660   1.00 0.00 ? 20 GLY B CA   12 
ATOM 9256  C C    . GLY B 2 20 ? -6.651  -2.407  0.282   1.00 0.00 ? 20 GLY B C    12 
ATOM 9257  O O    . GLY B 2 20 ? -7.812  -2.080  0.408   1.00 0.00 ? 20 GLY B O    12 
ATOM 9258  H H    . GLY B 2 20 ? -3.921  -2.798  1.243   1.00 0.00 ? 20 GLY B H    12 
ATOM 9259  H HA2  . GLY B 2 20 ? -5.925  -0.584  1.151   1.00 0.00 ? 20 GLY B HA2  12 
ATOM 9260  H HA3  . GLY B 2 20 ? -4.993  -1.151  -0.230  1.00 0.00 ? 20 GLY B HA3  12 
ATOM 9261  N N    . GLU B 2 21 ? -6.327  -3.582  -0.181  1.00 0.00 ? 21 GLU B N    12 
ATOM 9262  C CA   . GLU B 2 21 ? -7.391  -4.553  -0.570  1.00 0.00 ? 21 GLU B CA   12 
ATOM 9263  C C    . GLU B 2 21 ? -8.511  -4.550  0.476   1.00 0.00 ? 21 GLU B C    12 
ATOM 9264  O O    . GLU B 2 21 ? -9.644  -4.877  0.184   1.00 0.00 ? 21 GLU B O    12 
ATOM 9265  C CB   . GLU B 2 21 ? -6.789  -5.956  -0.663  1.00 0.00 ? 21 GLU B CB   12 
ATOM 9266  C CG   . GLU B 2 21 ? -5.953  -6.070  -1.940  1.00 0.00 ? 21 GLU B CG   12 
ATOM 9267  C CD   . GLU B 2 21 ? -5.509  -7.521  -2.133  1.00 0.00 ? 21 GLU B CD   12 
ATOM 9268  O OE1  . GLU B 2 21 ? -4.579  -7.930  -1.458  1.00 0.00 ? 21 GLU B OE1  12 
ATOM 9269  O OE2  . GLU B 2 21 ? -6.108  -8.199  -2.952  1.00 0.00 ? 21 GLU B OE2  12 
ATOM 9270  H H    . GLU B 2 21 ? -5.383  -3.828  -0.276  1.00 0.00 ? 21 GLU B H    12 
ATOM 9271  H HA   . GLU B 2 21 ? -7.798  -4.273  -1.530  1.00 0.00 ? 21 GLU B HA   12 
ATOM 9272  H HB2  . GLU B 2 21 ? -6.160  -6.136  0.197   1.00 0.00 ? 21 GLU B HB2  12 
ATOM 9273  H HB3  . GLU B 2 21 ? -7.582  -6.688  -0.689  1.00 0.00 ? 21 GLU B HB3  12 
ATOM 9274  H HG2  . GLU B 2 21 ? -6.546  -5.757  -2.787  1.00 0.00 ? 21 GLU B HG2  12 
ATOM 9275  H HG3  . GLU B 2 21 ? -5.082  -5.437  -1.857  1.00 0.00 ? 21 GLU B HG3  12 
ATOM 9276  N N    . ARG B 2 22 ? -8.203  -4.197  1.694   1.00 0.00 ? 22 ARG B N    12 
ATOM 9277  C CA   . ARG B 2 22 ? -9.247  -4.189  2.754   1.00 0.00 ? 22 ARG B CA   12 
ATOM 9278  C C    . ARG B 2 22 ? -10.106 -2.927  2.647   1.00 0.00 ? 22 ARG B C    12 
ATOM 9279  O O    . ARG B 2 22 ? -11.318 -2.993  2.600   1.00 0.00 ? 22 ARG B O    12 
ATOM 9280  C CB   . ARG B 2 22 ? -8.576  -4.229  4.128   1.00 0.00 ? 22 ARG B CB   12 
ATOM 9281  C CG   . ARG B 2 22 ? -8.413  -5.683  4.575   1.00 0.00 ? 22 ARG B CG   12 
ATOM 9282  C CD   . ARG B 2 22 ? -9.731  -6.185  5.168   1.00 0.00 ? 22 ARG B CD   12 
ATOM 9283  N NE   . ARG B 2 22 ? -9.496  -6.682  6.553   1.00 0.00 ? 22 ARG B NE   12 
ATOM 9284  C CZ   . ARG B 2 22 ? -9.653  -5.879  7.570   1.00 0.00 ? 22 ARG B CZ   12 
ATOM 9285  N NH1  . ARG B 2 22 ? -8.713  -5.030  7.881   1.00 0.00 ? 22 ARG B NH1  12 
ATOM 9286  N NH2  . ARG B 2 22 ? -10.750 -5.927  8.275   1.00 0.00 ? 22 ARG B NH2  12 
ATOM 9287  H H    . ARG B 2 22 ? -7.286  -3.948  1.915   1.00 0.00 ? 22 ARG B H    12 
ATOM 9288  H HA   . ARG B 2 22 ? -9.869  -5.055  2.638   1.00 0.00 ? 22 ARG B HA   12 
ATOM 9289  H HB2  . ARG B 2 22 ? -7.605  -3.759  4.068   1.00 0.00 ? 22 ARG B HB2  12 
ATOM 9290  H HB3  . ARG B 2 22 ? -9.188  -3.701  4.843   1.00 0.00 ? 22 ARG B HB3  12 
ATOM 9291  H HG2  . ARG B 2 22 ? -8.144  -6.293  3.725   1.00 0.00 ? 22 ARG B HG2  12 
ATOM 9292  H HG3  . ARG B 2 22 ? -7.638  -5.745  5.324   1.00 0.00 ? 22 ARG B HG3  12 
ATOM 9293  H HD2  . ARG B 2 22 ? -10.447 -5.377  5.192   1.00 0.00 ? 22 ARG B HD2  12 
ATOM 9294  H HD3  . ARG B 2 22 ? -10.117 -6.989  4.558   1.00 0.00 ? 22 ARG B HD3  12 
ATOM 9295  H HE   . ARG B 2 22 ? -9.223  -7.612  6.700   1.00 0.00 ? 22 ARG B HE   12 
ATOM 9296  H HH11 . ARG B 2 22 ? -7.873  -4.993  7.341   1.00 0.00 ? 22 ARG B HH11 12 
ATOM 9297  H HH12 . ARG B 2 22 ? -8.834  -4.414  8.661   1.00 0.00 ? 22 ARG B HH12 12 
ATOM 9298  H HH21 . ARG B 2 22 ? -11.470 -6.578  8.037   1.00 0.00 ? 22 ARG B HH21 12 
ATOM 9299  H HH22 . ARG B 2 22 ? -10.870 -5.312  9.054   1.00 0.00 ? 22 ARG B HH22 12 
ATOM 9300  N N    . GLY B 2 23 ? -9.490  -1.780  2.622   1.00 0.00 ? 23 GLY B N    12 
ATOM 9301  C CA   . GLY B 2 23 ? -10.273 -0.513  2.535   1.00 0.00 ? 23 GLY B CA   12 
ATOM 9302  C C    . GLY B 2 23 ? -10.440 -0.093  1.073   1.00 0.00 ? 23 GLY B C    12 
ATOM 9303  O O    . GLY B 2 23 ? -11.109 0.875   0.770   1.00 0.00 ? 23 GLY B O    12 
ATOM 9304  H H    . GLY B 2 23 ? -8.513  -1.752  2.671   1.00 0.00 ? 23 GLY B H    12 
ATOM 9305  H HA2  . GLY B 2 23 ? -11.247 -0.664  2.978   1.00 0.00 ? 23 GLY B HA2  12 
ATOM 9306  H HA3  . GLY B 2 23 ? -9.753  0.266   3.071   1.00 0.00 ? 23 GLY B HA3  12 
ATOM 9307  N N    . PHE B 2 24 ? -9.840  -0.809  0.163   1.00 0.00 ? 24 PHE B N    12 
ATOM 9308  C CA   . PHE B 2 24 ? -9.969  -0.442  -1.275  1.00 0.00 ? 24 PHE B CA   12 
ATOM 9309  C C    . PHE B 2 24 ? -11.042 -1.314  -1.932  1.00 0.00 ? 24 PHE B C    12 
ATOM 9310  O O    . PHE B 2 24 ? -11.373 -1.140  -3.088  1.00 0.00 ? 24 PHE B O    12 
ATOM 9311  C CB   . PHE B 2 24 ? -8.629  -0.664  -1.982  1.00 0.00 ? 24 PHE B CB   12 
ATOM 9312  C CG   . PHE B 2 24 ? -7.726  0.524   -1.744  1.00 0.00 ? 24 PHE B CG   12 
ATOM 9313  C CD1  . PHE B 2 24 ? -7.824  1.253   -0.553  1.00 0.00 ? 24 PHE B CD1  12 
ATOM 9314  C CD2  . PHE B 2 24 ? -6.791  0.898   -2.717  1.00 0.00 ? 24 PHE B CD2  12 
ATOM 9315  C CE1  . PHE B 2 24 ? -6.987  2.354   -0.336  1.00 0.00 ? 24 PHE B CE1  12 
ATOM 9316  C CE2  . PHE B 2 24 ? -5.954  1.999   -2.499  1.00 0.00 ? 24 PHE B CE2  12 
ATOM 9317  C CZ   . PHE B 2 24 ? -6.052  2.727   -1.308  1.00 0.00 ? 24 PHE B CZ   12 
ATOM 9318  H H    . PHE B 2 24 ? -9.304  -1.586  0.426   1.00 0.00 ? 24 PHE B H    12 
ATOM 9319  H HA   . PHE B 2 24 ? -10.250 0.597   -1.357  1.00 0.00 ? 24 PHE B HA   12 
ATOM 9320  H HB2  . PHE B 2 24 ? -8.160  -1.556  -1.593  1.00 0.00 ? 24 PHE B HB2  12 
ATOM 9321  H HB3  . PHE B 2 24 ? -8.797  -0.780  -3.042  1.00 0.00 ? 24 PHE B HB3  12 
ATOM 9322  H HD1  . PHE B 2 24 ? -8.544  0.966   0.199   1.00 0.00 ? 24 PHE B HD1  12 
ATOM 9323  H HD2  . PHE B 2 24 ? -6.715  0.337   -3.636  1.00 0.00 ? 24 PHE B HD2  12 
ATOM 9324  H HE1  . PHE B 2 24 ? -7.063  2.918   0.581   1.00 0.00 ? 24 PHE B HE1  12 
ATOM 9325  H HE2  . PHE B 2 24 ? -5.233  2.286   -3.250  1.00 0.00 ? 24 PHE B HE2  12 
ATOM 9326  H HZ   . PHE B 2 24 ? -5.407  3.576   -1.139  1.00 0.00 ? 24 PHE B HZ   12 
ATOM 9327  N N    . PHE B 2 25 ? -11.590 -2.250  -1.205  1.00 0.00 ? 25 PHE B N    12 
ATOM 9328  C CA   . PHE B 2 25 ? -12.641 -3.129  -1.791  1.00 0.00 ? 25 PHE B CA   12 
ATOM 9329  C C    . PHE B 2 25 ? -13.980 -2.388  -1.800  1.00 0.00 ? 25 PHE B C    12 
ATOM 9330  O O    . PHE B 2 25 ? -14.293 -1.641  -0.893  1.00 0.00 ? 25 PHE B O    12 
ATOM 9331  C CB   . PHE B 2 25 ? -12.769 -4.402  -0.953  1.00 0.00 ? 25 PHE B CB   12 
ATOM 9332  C CG   . PHE B 2 25 ? -13.856 -5.277  -1.530  1.00 0.00 ? 25 PHE B CG   12 
ATOM 9333  C CD1  . PHE B 2 25 ? -13.795 -5.677  -2.870  1.00 0.00 ? 25 PHE B CD1  12 
ATOM 9334  C CD2  . PHE B 2 25 ? -14.925 -5.689  -0.725  1.00 0.00 ? 25 PHE B CD2  12 
ATOM 9335  C CE1  . PHE B 2 25 ? -14.802 -6.488  -3.406  1.00 0.00 ? 25 PHE B CE1  12 
ATOM 9336  C CE2  . PHE B 2 25 ? -15.932 -6.501  -1.260  1.00 0.00 ? 25 PHE B CE2  12 
ATOM 9337  C CZ   . PHE B 2 25 ? -15.871 -6.900  -2.601  1.00 0.00 ? 25 PHE B CZ   12 
ATOM 9338  H H    . PHE B 2 25 ? -11.311 -2.375  -0.274  1.00 0.00 ? 25 PHE B H    12 
ATOM 9339  H HA   . PHE B 2 25 ? -12.368 -3.390  -2.803  1.00 0.00 ? 25 PHE B HA   12 
ATOM 9340  H HB2  . PHE B 2 25 ? -11.830 -4.937  -0.966  1.00 0.00 ? 25 PHE B HB2  12 
ATOM 9341  H HB3  . PHE B 2 25 ? -13.021 -4.141  0.064   1.00 0.00 ? 25 PHE B HB3  12 
ATOM 9342  H HD1  . PHE B 2 25 ? -12.970 -5.359  -3.492  1.00 0.00 ? 25 PHE B HD1  12 
ATOM 9343  H HD2  . PHE B 2 25 ? -14.972 -5.381  0.309   1.00 0.00 ? 25 PHE B HD2  12 
ATOM 9344  H HE1  . PHE B 2 25 ? -14.755 -6.796  -4.440  1.00 0.00 ? 25 PHE B HE1  12 
ATOM 9345  H HE2  . PHE B 2 25 ? -16.757 -6.819  -0.640  1.00 0.00 ? 25 PHE B HE2  12 
ATOM 9346  H HZ   . PHE B 2 25 ? -16.648 -7.526  -3.014  1.00 0.00 ? 25 PHE B HZ   12 
ATOM 9347  N N    . TYR B 2 26 ? -14.772 -2.587  -2.817  1.00 0.00 ? 26 TYR B N    12 
ATOM 9348  C CA   . TYR B 2 26 ? -16.089 -1.894  -2.883  1.00 0.00 ? 26 TYR B CA   12 
ATOM 9349  C C    . TYR B 2 26 ? -17.204 -2.881  -2.527  1.00 0.00 ? 26 TYR B C    12 
ATOM 9350  O O    . TYR B 2 26 ? -17.089 -4.063  -2.783  1.00 0.00 ? 26 TYR B O    12 
ATOM 9351  C CB   . TYR B 2 26 ? -16.313 -1.358  -4.299  1.00 0.00 ? 26 TYR B CB   12 
ATOM 9352  C CG   . TYR B 2 26 ? -15.473 -0.121  -4.506  1.00 0.00 ? 26 TYR B CG   12 
ATOM 9353  C CD1  . TYR B 2 26 ? -15.596 0.963   -3.629  1.00 0.00 ? 26 TYR B CD1  12 
ATOM 9354  C CD2  . TYR B 2 26 ? -14.571 -0.057  -5.576  1.00 0.00 ? 26 TYR B CD2  12 
ATOM 9355  C CE1  . TYR B 2 26 ? -14.818 2.111   -3.821  1.00 0.00 ? 26 TYR B CE1  12 
ATOM 9356  C CE2  . TYR B 2 26 ? -13.793 1.090   -5.767  1.00 0.00 ? 26 TYR B CE2  12 
ATOM 9357  C CZ   . TYR B 2 26 ? -13.916 2.175   -4.890  1.00 0.00 ? 26 TYR B CZ   12 
ATOM 9358  O OH   . TYR B 2 26 ? -13.149 3.306   -5.079  1.00 0.00 ? 26 TYR B OH   12 
ATOM 9359  H H    . TYR B 2 26 ? -14.500 -3.193  -3.538  1.00 0.00 ? 26 TYR B H    12 
ATOM 9360  H HA   . TYR B 2 26 ? -16.098 -1.073  -2.182  1.00 0.00 ? 26 TYR B HA   12 
ATOM 9361  H HB2  . TYR B 2 26 ? -16.028 -2.112  -5.018  1.00 0.00 ? 26 TYR B HB2  12 
ATOM 9362  H HB3  . TYR B 2 26 ? -17.355 -1.111  -4.430  1.00 0.00 ? 26 TYR B HB3  12 
ATOM 9363  H HD1  . TYR B 2 26 ? -16.292 0.914   -2.805  1.00 0.00 ? 26 TYR B HD1  12 
ATOM 9364  H HD2  . TYR B 2 26 ? -14.476 -0.894  -6.252  1.00 0.00 ? 26 TYR B HD2  12 
ATOM 9365  H HE1  . TYR B 2 26 ? -14.913 2.947   -3.144  1.00 0.00 ? 26 TYR B HE1  12 
ATOM 9366  H HE2  . TYR B 2 26 ? -13.097 1.139   -6.592  1.00 0.00 ? 26 TYR B HE2  12 
ATOM 9367  H HH   . TYR B 2 26 ? -12.403 3.263   -4.475  1.00 0.00 ? 26 TYR B HH   12 
ATOM 9368  N N    . PRO B 2 27 ? -18.254 -2.361  -1.944  1.00 0.00 ? 27 PRO B N    12 
ATOM 9369  C CA   . PRO B 2 27 ? -19.416 -3.169  -1.534  1.00 0.00 ? 27 PRO B CA   12 
ATOM 9370  C C    . PRO B 2 27 ? -20.293 -3.498  -2.746  1.00 0.00 ? 27 PRO B C    12 
ATOM 9371  O O    . PRO B 2 27 ? -20.178 -2.890  -3.791  1.00 0.00 ? 27 PRO B O    12 
ATOM 9372  C CB   . PRO B 2 27 ? -20.159 -2.257  -0.554  1.00 0.00 ? 27 PRO B CB   12 
ATOM 9373  C CG   . PRO B 2 27 ? -19.717 -0.811  -0.883  1.00 0.00 ? 27 PRO B CG   12 
ATOM 9374  C CD   . PRO B 2 27 ? -18.380 -0.921  -1.640  1.00 0.00 ? 27 PRO B CD   12 
ATOM 9375  H HA   . PRO B 2 27 ? -19.099 -4.069  -1.033  1.00 0.00 ? 27 PRO B HA   12 
ATOM 9376  H HB2  . PRO B 2 27 ? -21.227 -2.362  -0.687  1.00 0.00 ? 27 PRO B HB2  12 
ATOM 9377  H HB3  . PRO B 2 27 ? -19.884 -2.499  0.461   1.00 0.00 ? 27 PRO B HB3  12 
ATOM 9378  H HG2  . PRO B 2 27 ? -20.460 -0.330  -1.505  1.00 0.00 ? 27 PRO B HG2  12 
ATOM 9379  H HG3  . PRO B 2 27 ? -19.575 -0.249  0.027   1.00 0.00 ? 27 PRO B HG3  12 
ATOM 9380  H HD2  . PRO B 2 27 ? -18.414 -0.340  -2.552  1.00 0.00 ? 27 PRO B HD2  12 
ATOM 9381  H HD3  . PRO B 2 27 ? -17.562 -0.599  -1.014  1.00 0.00 ? 27 PRO B HD3  12 
ATOM 9382  N N    . THR B 2 28 ? -21.167 -4.458  -2.614  1.00 0.00 ? 28 THR B N    12 
ATOM 9383  C CA   . THR B 2 28 ? -22.048 -4.825  -3.758  1.00 0.00 ? 28 THR B CA   12 
ATOM 9384  C C    . THR B 2 28 ? -23.492 -4.957  -3.268  1.00 0.00 ? 28 THR B C    12 
ATOM 9385  O O    . THR B 2 28 ? -24.087 -6.014  -3.339  1.00 0.00 ? 28 THR B O    12 
ATOM 9386  C CB   . THR B 2 28 ? -21.586 -6.159  -4.349  1.00 0.00 ? 28 THR B CB   12 
ATOM 9387  O OG1  . THR B 2 28 ? -20.170 -6.246  -4.266  1.00 0.00 ? 28 THR B OG1  12 
ATOM 9388  C CG2  . THR B 2 28 ? -22.019 -6.248  -5.813  1.00 0.00 ? 28 THR B CG2  12 
ATOM 9389  H H    . THR B 2 28 ? -21.244 -4.937  -1.762  1.00 0.00 ? 28 THR B H    12 
ATOM 9390  H HA   . THR B 2 28 ? -21.994 -4.057  -4.515  1.00 0.00 ? 28 THR B HA   12 
ATOM 9391  H HB   . THR B 2 28 ? -22.030 -6.972  -3.797  1.00 0.00 ? 28 THR B HB   12 
ATOM 9392  H HG1  . THR B 2 28 ? -19.811 -5.362  -4.372  1.00 0.00 ? 28 THR B HG1  12 
ATOM 9393  H HG21 . THR B 2 28 ? -21.683 -5.369  -6.342  1.00 0.00 ? 28 THR B HG21 12 
ATOM 9394  H HG22 . THR B 2 28 ? -23.096 -6.311  -5.866  1.00 0.00 ? 28 THR B HG22 12 
ATOM 9395  H HG23 . THR B 2 28 ? -21.585 -7.128  -6.264  1.00 0.00 ? 28 THR B HG23 12 
ATOM 9396  N N    . LYS B 2 29 ? -24.059 -3.892  -2.771  1.00 0.00 ? 29 LYS B N    12 
ATOM 9397  C CA   . LYS B 2 29 ? -25.464 -3.959  -2.278  1.00 0.00 ? 29 LYS B CA   12 
ATOM 9398  C C    . LYS B 2 29 ? -26.410 -3.434  -3.360  1.00 0.00 ? 29 LYS B C    12 
ATOM 9399  O O    . LYS B 2 29 ? -26.276 -2.321  -3.828  1.00 0.00 ? 29 LYS B O    12 
ATOM 9400  C CB   . LYS B 2 29 ? -25.603 -3.101  -1.018  1.00 0.00 ? 29 LYS B CB   12 
ATOM 9401  C CG   . LYS B 2 29 ? -26.244 -3.931  0.096   1.00 0.00 ? 29 LYS B CG   12 
ATOM 9402  C CD   . LYS B 2 29 ? -26.521 -3.037  1.305   1.00 0.00 ? 29 LYS B CD   12 
ATOM 9403  C CE   . LYS B 2 29 ? -25.720 -3.541  2.507   1.00 0.00 ? 29 LYS B CE   12 
ATOM 9404  N NZ   . LYS B 2 29 ? -25.990 -2.669  3.685   1.00 0.00 ? 29 LYS B NZ   12 
ATOM 9405  H H    . LYS B 2 29 ? -23.562 -3.049  -2.722  1.00 0.00 ? 29 LYS B H    12 
ATOM 9406  H HA   . LYS B 2 29 ? -25.715 -4.983  -2.045  1.00 0.00 ? 29 LYS B HA   12 
ATOM 9407  H HB2  . LYS B 2 29 ? -24.626 -2.764  -0.702  1.00 0.00 ? 29 LYS B HB2  12 
ATOM 9408  H HB3  . LYS B 2 29 ? -26.227 -2.247  -1.232  1.00 0.00 ? 29 LYS B HB3  12 
ATOM 9409  H HG2  . LYS B 2 29 ? -27.172 -4.355  -0.260  1.00 0.00 ? 29 LYS B HG2  12 
ATOM 9410  H HG3  . LYS B 2 29 ? -25.572 -4.726  0.385   1.00 0.00 ? 29 LYS B HG3  12 
ATOM 9411  H HD2  . LYS B 2 29 ? -26.228 -2.022  1.077   1.00 0.00 ? 29 LYS B HD2  12 
ATOM 9412  H HD3  . LYS B 2 29 ? -27.574 -3.064  1.540   1.00 0.00 ? 29 LYS B HD3  12 
ATOM 9413  H HE2  . LYS B 2 29 ? -26.013 -4.555  2.736   1.00 0.00 ? 29 LYS B HE2  12 
ATOM 9414  H HE3  . LYS B 2 29 ? -24.666 -3.515  2.274   1.00 0.00 ? 29 LYS B HE3  12 
ATOM 9415  H HZ1  . LYS B 2 29 ? -26.508 -3.210  4.406   1.00 0.00 ? 29 LYS B HZ1  12 
ATOM 9416  H HZ2  . LYS B 2 29 ? -26.561 -1.851  3.387   1.00 0.00 ? 29 LYS B HZ2  12 
ATOM 9417  H HZ3  . LYS B 2 29 ? -25.090 -2.336  4.085   1.00 0.00 ? 29 LYS B HZ3  12 
ATOM 9418  N N    . THR B 2 30 ? -27.365 -4.227  -3.761  1.00 0.00 ? 30 THR B N    12 
ATOM 9419  C CA   . THR B 2 30 ? -28.318 -3.774  -4.812  1.00 0.00 ? 30 THR B CA   12 
ATOM 9420  C C    . THR B 2 30 ? -28.891 -2.408  -4.426  1.00 0.00 ? 30 THR B C    12 
ATOM 9421  O O    . THR B 2 30 ? -28.635 -1.973  -3.316  1.00 0.00 ? 30 THR B O    12 
ATOM 9422  C CB   . THR B 2 30 ? -29.458 -4.788  -4.939  1.00 0.00 ? 30 THR B CB   12 
ATOM 9423  O OG1  . THR B 2 30 ? -28.941 -6.101  -4.776  1.00 0.00 ? 30 THR B OG1  12 
ATOM 9424  C CG2  . THR B 2 30 ? -30.106 -4.660  -6.318  1.00 0.00 ? 30 THR B CG2  12 
ATOM 9425  O OXT  . THR B 2 30 ? -29.577 -1.822  -5.248  1.00 0.00 ? 30 THR B OXT  12 
ATOM 9426  H H    . THR B 2 30 ? -27.455 -5.122  -3.370  1.00 0.00 ? 30 THR B H    12 
ATOM 9427  H HA   . THR B 2 30 ? -27.801 -3.693  -5.756  1.00 0.00 ? 30 THR B HA   12 
ATOM 9428  H HB   . THR B 2 30 ? -30.199 -4.595  -4.179  1.00 0.00 ? 30 THR B HB   12 
ATOM 9429  H HG1  . THR B 2 30 ? -29.460 -6.695  -5.322  1.00 0.00 ? 30 THR B HG1  12 
ATOM 9430  H HG21 . THR B 2 30 ? -31.180 -4.622  -6.209  1.00 0.00 ? 30 THR B HG21 12 
ATOM 9431  H HG22 . THR B 2 30 ? -29.835 -5.513  -6.923  1.00 0.00 ? 30 THR B HG22 12 
ATOM 9432  H HG23 . THR B 2 30 ? -29.760 -3.756  -6.796  1.00 0.00 ? 30 THR B HG23 12 
ATOM 9433  N N    . GLY A 1 1  ? -6.239  -0.984  -8.112  1.00 0.00 ? 1  GLY A N    13 
ATOM 9434  C CA   . GLY A 1 1  ? -5.447  -0.529  -6.934  1.00 0.00 ? 1  GLY A CA   13 
ATOM 9435  C C    . GLY A 1 1  ? -3.988  -0.326  -7.347  1.00 0.00 ? 1  GLY A C    13 
ATOM 9436  O O    . GLY A 1 1  ? -3.480  -1.001  -8.220  1.00 0.00 ? 1  GLY A O    13 
ATOM 9437  H H1   . GLY A 1 1  ? -5.916  -0.482  -8.963  1.00 0.00 ? 1  GLY A H1   13 
ATOM 9438  H H2   . GLY A 1 1  ? -7.247  -0.780  -7.951  1.00 0.00 ? 1  GLY A H2   13 
ATOM 9439  H H3   . GLY A 1 1  ? -6.108  -2.006  -8.245  1.00 0.00 ? 1  GLY A H3   13 
ATOM 9440  H HA2  . GLY A 1 1  ? -5.852  0.403   -6.566  1.00 0.00 ? 1  GLY A HA2  13 
ATOM 9441  H HA3  . GLY A 1 1  ? -5.497  -1.276  -6.157  1.00 0.00 ? 1  GLY A HA3  13 
ATOM 9442  N N    . ILE A 1 2  ? -3.310  0.600   -6.726  1.00 0.00 ? 2  ILE A N    13 
ATOM 9443  C CA   . ILE A 1 2  ? -1.884  0.849   -7.083  1.00 0.00 ? 2  ILE A CA   13 
ATOM 9444  C C    . ILE A 1 2  ? -1.033  -0.349  -6.659  1.00 0.00 ? 2  ILE A C    13 
ATOM 9445  O O    . ILE A 1 2  ? -0.035  -0.664  -7.277  1.00 0.00 ? 2  ILE A O    13 
ATOM 9446  C CB   . ILE A 1 2  ? -1.389  2.103   -6.360  1.00 0.00 ? 2  ILE A CB   13 
ATOM 9447  C CG1  . ILE A 1 2  ? -1.874  2.079   -4.908  1.00 0.00 ? 2  ILE A CG1  13 
ATOM 9448  C CG2  . ILE A 1 2  ? -1.939  3.347   -7.059  1.00 0.00 ? 2  ILE A CG2  13 
ATOM 9449  C CD1  . ILE A 1 2  ? -1.052  3.066   -4.079  1.00 0.00 ? 2  ILE A CD1  13 
ATOM 9450  H H    . ILE A 1 2  ? -3.739  1.134   -6.025  1.00 0.00 ? 2  ILE A H    13 
ATOM 9451  H HA   . ILE A 1 2  ? -1.799  0.990   -8.149  1.00 0.00 ? 2  ILE A HA   13 
ATOM 9452  H HB   . ILE A 1 2  ? -0.309  2.127   -6.381  1.00 0.00 ? 2  ILE A HB   13 
ATOM 9453  H HG12 . ILE A 1 2  ? -2.917  2.359   -4.872  1.00 0.00 ? 2  ILE A HG12 13 
ATOM 9454  H HG13 . ILE A 1 2  ? -1.753  1.085   -4.504  1.00 0.00 ? 2  ILE A HG13 13 
ATOM 9455  H HG21 . ILE A 1 2  ? -1.974  3.176   -8.124  1.00 0.00 ? 2  ILE A HG21 13 
ATOM 9456  H HG22 . ILE A 1 2  ? -1.296  4.190   -6.850  1.00 0.00 ? 2  ILE A HG22 13 
ATOM 9457  H HG23 . ILE A 1 2  ? -2.934  3.554   -6.694  1.00 0.00 ? 2  ILE A HG23 13 
ATOM 9458  H HD11 . ILE A 1 2  ? -0.924  3.984   -4.634  1.00 0.00 ? 2  ILE A HD11 13 
ATOM 9459  H HD12 . ILE A 1 2  ? -0.084  2.638   -3.865  1.00 0.00 ? 2  ILE A HD12 13 
ATOM 9460  H HD13 . ILE A 1 2  ? -1.566  3.274   -3.153  1.00 0.00 ? 2  ILE A HD13 13 
ATOM 9461  N N    . VAL A 1 3  ? -1.418  -1.019  -5.610  1.00 0.00 ? 3  VAL A N    13 
ATOM 9462  C CA   . VAL A 1 3  ? -0.639  -2.190  -5.144  1.00 0.00 ? 3  VAL A CA   13 
ATOM 9463  C C    . VAL A 1 3  ? -0.717  -3.296  -6.200  1.00 0.00 ? 3  VAL A C    13 
ATOM 9464  O O    . VAL A 1 3  ? 0.265   -3.938  -6.517  1.00 0.00 ? 3  VAL A O    13 
ATOM 9465  C CB   . VAL A 1 3  ? -1.235  -2.665  -3.814  1.00 0.00 ? 3  VAL A CB   13 
ATOM 9466  C CG1  . VAL A 1 3  ? -0.913  -4.137  -3.589  1.00 0.00 ? 3  VAL A CG1  13 
ATOM 9467  C CG2  . VAL A 1 3  ? -0.644  -1.837  -2.670  1.00 0.00 ? 3  VAL A CG2  13 
ATOM 9468  H H    . VAL A 1 3  ? -2.223  -0.755  -5.124  1.00 0.00 ? 3  VAL A H    13 
ATOM 9469  H HA   . VAL A 1 3  ? 0.390   -1.904  -5.000  1.00 0.00 ? 3  VAL A HA   13 
ATOM 9470  H HB   . VAL A 1 3  ? -2.306  -2.533  -3.836  1.00 0.00 ? 3  VAL A HB   13 
ATOM 9471  H HG11 . VAL A 1 3  ? -1.782  -4.732  -3.828  1.00 0.00 ? 3  VAL A HG11 13 
ATOM 9472  H HG12 . VAL A 1 3  ? -0.641  -4.290  -2.557  1.00 0.00 ? 3  VAL A HG12 13 
ATOM 9473  H HG13 . VAL A 1 3  ? -0.092  -4.425  -4.228  1.00 0.00 ? 3  VAL A HG13 13 
ATOM 9474  H HG21 . VAL A 1 3  ? -1.170  -2.062  -1.754  1.00 0.00 ? 3  VAL A HG21 13 
ATOM 9475  H HG22 . VAL A 1 3  ? -0.747  -0.786  -2.896  1.00 0.00 ? 3  VAL A HG22 13 
ATOM 9476  H HG23 . VAL A 1 3  ? 0.402   -2.079  -2.553  1.00 0.00 ? 3  VAL A HG23 13 
ATOM 9477  N N    . GLU A 1 4  ? -1.876  -3.518  -6.748  1.00 0.00 ? 4  GLU A N    13 
ATOM 9478  C CA   . GLU A 1 4  ? -2.019  -4.576  -7.785  1.00 0.00 ? 4  GLU A CA   13 
ATOM 9479  C C    . GLU A 1 4  ? -1.258  -4.155  -9.043  1.00 0.00 ? 4  GLU A C    13 
ATOM 9480  O O    . GLU A 1 4  ? -0.657  -4.966  -9.719  1.00 0.00 ? 4  GLU A O    13 
ATOM 9481  C CB   . GLU A 1 4  ? -3.500  -4.766  -8.122  1.00 0.00 ? 4  GLU A CB   13 
ATOM 9482  C CG   . GLU A 1 4  ? -4.153  -5.658  -7.064  1.00 0.00 ? 4  GLU A CG   13 
ATOM 9483  C CD   . GLU A 1 4  ? -5.277  -6.472  -7.706  1.00 0.00 ? 4  GLU A CD   13 
ATOM 9484  O OE1  . GLU A 1 4  ? -5.710  -6.101  -8.784  1.00 0.00 ? 4  GLU A OE1  13 
ATOM 9485  O OE2  . GLU A 1 4  ? -5.687  -7.454  -7.108  1.00 0.00 ? 4  GLU A OE2  13 
ATOM 9486  H H    . GLU A 1 4  ? -2.653  -2.985  -6.479  1.00 0.00 ? 4  GLU A H    13 
ATOM 9487  H HA   . GLU A 1 4  ? -1.612  -5.503  -7.412  1.00 0.00 ? 4  GLU A HA   13 
ATOM 9488  H HB2  . GLU A 1 4  ? -3.992  -3.804  -8.137  1.00 0.00 ? 4  GLU A HB2  13 
ATOM 9489  H HB3  . GLU A 1 4  ? -3.592  -5.234  -9.090  1.00 0.00 ? 4  GLU A HB3  13 
ATOM 9490  H HG2  . GLU A 1 4  ? -3.413  -6.327  -6.651  1.00 0.00 ? 4  GLU A HG2  13 
ATOM 9491  H HG3  . GLU A 1 4  ? -4.562  -5.042  -6.276  1.00 0.00 ? 4  GLU A HG3  13 
ATOM 9492  N N    . GLN A 1 5  ? -1.281  -2.891  -9.359  1.00 0.00 ? 5  GLN A N    13 
ATOM 9493  C CA   . GLN A 1 5  ? -0.560  -2.410  -10.571 1.00 0.00 ? 5  GLN A CA   13 
ATOM 9494  C C    . GLN A 1 5  ? 0.932   -2.279  -10.260 1.00 0.00 ? 5  GLN A C    13 
ATOM 9495  O O    . GLN A 1 5  ? 1.776   -2.583  -11.079 1.00 0.00 ? 5  GLN A O    13 
ATOM 9496  C CB   . GLN A 1 5  ? -1.116  -1.046  -10.985 1.00 0.00 ? 5  GLN A CB   13 
ATOM 9497  C CG   . GLN A 1 5  ? -0.351  -0.530  -12.205 1.00 0.00 ? 5  GLN A CG   13 
ATOM 9498  C CD   . GLN A 1 5  ? -1.003  0.759   -12.709 1.00 0.00 ? 5  GLN A CD   13 
ATOM 9499  O OE1  . GLN A 1 5  ? -0.633  1.841   -12.298 1.00 0.00 ? 5  GLN A OE1  13 
ATOM 9500  N NE2  . GLN A 1 5  ? -1.965  0.688   -13.588 1.00 0.00 ? 5  GLN A NE2  13 
ATOM 9501  H H    . GLN A 1 5  ? -1.772  -2.257  -8.797  1.00 0.00 ? 5  GLN A H    13 
ATOM 9502  H HA   . GLN A 1 5  ? -0.698  -3.115  -11.374 1.00 0.00 ? 5  GLN A HA   13 
ATOM 9503  H HB2  . GLN A 1 5  ? -2.164  -1.145  -11.231 1.00 0.00 ? 5  GLN A HB2  13 
ATOM 9504  H HB3  . GLN A 1 5  ? -1.002  -0.348  -10.169 1.00 0.00 ? 5  GLN A HB3  13 
ATOM 9505  H HG2  . GLN A 1 5  ? 0.675   -0.332  -11.928 1.00 0.00 ? 5  GLN A HG2  13 
ATOM 9506  H HG3  . GLN A 1 5  ? -0.376  -1.274  -12.987 1.00 0.00 ? 5  GLN A HG3  13 
ATOM 9507  H HE21 . GLN A 1 5  ? -2.263  -0.185  -13.919 1.00 0.00 ? 5  GLN A HE21 13 
ATOM 9508  H HE22 . GLN A 1 5  ? -2.389  1.508   -13.917 1.00 0.00 ? 5  GLN A HE22 13 
ATOM 9509  N N    . CYS A 1 6  ? 1.262   -1.828  -9.082  1.00 0.00 ? 6  CYS A N    13 
ATOM 9510  C CA   . CYS A 1 6  ? 2.699   -1.676  -8.717  1.00 0.00 ? 6  CYS A CA   13 
ATOM 9511  C C    . CYS A 1 6  ? 3.150   -2.887  -7.897  1.00 0.00 ? 6  CYS A C    13 
ATOM 9512  O O    . CYS A 1 6  ? 4.215   -2.890  -7.312  1.00 0.00 ? 6  CYS A O    13 
ATOM 9513  C CB   . CYS A 1 6  ? 2.884   -0.402  -7.890  1.00 0.00 ? 6  CYS A CB   13 
ATOM 9514  S SG   . CYS A 1 6  ? 3.843   0.803   -8.841  1.00 0.00 ? 6  CYS A SG   13 
ATOM 9515  H H    . CYS A 1 6  ? 0.563   -1.589  -8.438  1.00 0.00 ? 6  CYS A H    13 
ATOM 9516  H HA   . CYS A 1 6  ? 3.293   -1.610  -9.617  1.00 0.00 ? 6  CYS A HA   13 
ATOM 9517  H HB2  . CYS A 1 6  ? 1.918   0.015   -7.650  1.00 0.00 ? 6  CYS A HB2  13 
ATOM 9518  H HB3  . CYS A 1 6  ? 3.410   -0.640  -6.976  1.00 0.00 ? 6  CYS A HB3  13 
ATOM 9519  N N    . CYS A 1 7  ? 2.346   -3.915  -7.845  1.00 0.00 ? 7  CYS A N    13 
ATOM 9520  C CA   . CYS A 1 7  ? 2.730   -5.122  -7.059  1.00 0.00 ? 7  CYS A CA   13 
ATOM 9521  C C    . CYS A 1 7  ? 4.199   -5.463  -7.313  1.00 0.00 ? 7  CYS A C    13 
ATOM 9522  O O    . CYS A 1 7  ? 4.853   -6.064  -6.486  1.00 0.00 ? 7  CYS A O    13 
ATOM 9523  C CB   . CYS A 1 7  ? 1.858   -6.308  -7.472  1.00 0.00 ? 7  CYS A CB   13 
ATOM 9524  S SG   . CYS A 1 7  ? 2.435   -7.797  -6.618  1.00 0.00 ? 7  CYS A SG   13 
ATOM 9525  H H    . CYS A 1 7  ? 1.490   -3.891  -8.320  1.00 0.00 ? 7  CYS A H    13 
ATOM 9526  H HA   . CYS A 1 7  ? 2.586   -4.924  -6.008  1.00 0.00 ? 7  CYS A HA   13 
ATOM 9527  H HB2  . CYS A 1 7  ? 0.830   -6.113  -7.203  1.00 0.00 ? 7  CYS A HB2  13 
ATOM 9528  H HB3  . CYS A 1 7  ? 1.930   -6.454  -8.540  1.00 0.00 ? 7  CYS A HB3  13 
ATOM 9529  N N    . THR A 1 8  ? 4.724   -5.087  -8.448  1.00 0.00 ? 8  THR A N    13 
ATOM 9530  C CA   . THR A 1 8  ? 6.152   -5.395  -8.746  1.00 0.00 ? 8  THR A CA   13 
ATOM 9531  C C    . THR A 1 8  ? 6.998   -5.132  -7.498  1.00 0.00 ? 8  THR A C    13 
ATOM 9532  O O    . THR A 1 8  ? 7.858   -5.913  -7.141  1.00 0.00 ? 8  THR A O    13 
ATOM 9533  C CB   . THR A 1 8  ? 6.637   -4.502  -9.891  1.00 0.00 ? 8  THR A CB   13 
ATOM 9534  O OG1  . THR A 1 8  ? 6.364   -3.144  -9.578  1.00 0.00 ? 8  THR A OG1  13 
ATOM 9535  C CG2  . THR A 1 8  ? 5.910   -4.886  -11.181 1.00 0.00 ? 8  THR A CG2  13 
ATOM 9536  H H    . THR A 1 8  ? 4.179   -4.604  -9.104  1.00 0.00 ? 8  THR A H    13 
ATOM 9537  H HA   . THR A 1 8  ? 6.245   -6.432  -9.033  1.00 0.00 ? 8  THR A HA   13 
ATOM 9538  H HB   . THR A 1 8  ? 7.699   -4.635  -10.028 1.00 0.00 ? 8  THR A HB   13 
ATOM 9539  H HG1  . THR A 1 8  ? 5.416   -3.009  -9.641  1.00 0.00 ? 8  THR A HG1  13 
ATOM 9540  H HG21 . THR A 1 8  ? 5.363   -4.033  -11.553 1.00 0.00 ? 8  THR A HG21 13 
ATOM 9541  H HG22 . THR A 1 8  ? 5.224   -5.695  -10.980 1.00 0.00 ? 8  THR A HG22 13 
ATOM 9542  H HG23 . THR A 1 8  ? 6.632   -5.201  -11.921 1.00 0.00 ? 8  THR A HG23 13 
ATOM 9543  N N    . SER A 1 9  ? 6.752   -4.040  -6.829  1.00 0.00 ? 9  SER A N    13 
ATOM 9544  C CA   . SER A 1 9  ? 7.528   -3.719  -5.597  1.00 0.00 ? 9  SER A CA   13 
ATOM 9545  C C    . SER A 1 9  ? 6.898   -2.501  -4.918  1.00 0.00 ? 9  SER A C    13 
ATOM 9546  O O    . SER A 1 9  ? 5.693   -2.356  -4.888  1.00 0.00 ? 9  SER A O    13 
ATOM 9547  C CB   . SER A 1 9  ? 8.976   -3.404  -5.967  1.00 0.00 ? 9  SER A CB   13 
ATOM 9548  O OG   . SER A 1 9  ? 9.325   -4.101  -7.156  1.00 0.00 ? 9  SER A OG   13 
ATOM 9549  H H    . SER A 1 9  ? 6.048   -3.429  -7.134  1.00 0.00 ? 9  SER A H    13 
ATOM 9550  H HA   . SER A 1 9  ? 7.501   -4.563  -4.923  1.00 0.00 ? 9  SER A HA   13 
ATOM 9551  H HB2  . SER A 1 9  ? 9.083   -2.345  -6.131  1.00 0.00 ? 9  SER A HB2  13 
ATOM 9552  H HB3  . SER A 1 9  ? 9.624   -3.707  -5.154  1.00 0.00 ? 9  SER A HB3  13 
ATOM 9553  H HG   . SER A 1 9  ? 9.019   -3.583  -7.904  1.00 0.00 ? 9  SER A HG   13 
ATOM 9554  N N    . ILE A 1 10 ? 7.696   -1.620  -4.375  1.00 0.00 ? 10 ILE A N    13 
ATOM 9555  C CA   . ILE A 1 10 ? 7.119   -0.421  -3.711  1.00 0.00 ? 10 ILE A CA   13 
ATOM 9556  C C    . ILE A 1 10 ? 7.384   0.813   -4.574  1.00 0.00 ? 10 ILE A C    13 
ATOM 9557  O O    . ILE A 1 10 ? 8.511   1.225   -4.768  1.00 0.00 ? 10 ILE A O    13 
ATOM 9558  C CB   . ILE A 1 10 ? 7.742   -0.259  -2.312  1.00 0.00 ? 10 ILE A CB   13 
ATOM 9559  C CG1  . ILE A 1 10 ? 6.747   0.461   -1.393  1.00 0.00 ? 10 ILE A CG1  13 
ATOM 9560  C CG2  . ILE A 1 10 ? 9.047   0.542   -2.384  1.00 0.00 ? 10 ILE A CG2  13 
ATOM 9561  C CD1  . ILE A 1 10 ? 6.737   1.961   -1.701  1.00 0.00 ? 10 ILE A CD1  13 
ATOM 9562  H H    . ILE A 1 10 ? 8.667   -1.744  -4.406  1.00 0.00 ? 10 ILE A H    13 
ATOM 9563  H HA   . ILE A 1 10 ? 6.052   -0.554  -3.610  1.00 0.00 ? 10 ILE A HA   13 
ATOM 9564  H HB   . ILE A 1 10 ? 7.954   -1.237  -1.906  1.00 0.00 ? 10 ILE A HB   13 
ATOM 9565  H HG12 . ILE A 1 10 ? 5.758   0.056   -1.551  1.00 0.00 ? 10 ILE A HG12 13 
ATOM 9566  H HG13 . ILE A 1 10 ? 7.036   0.309   -0.364  1.00 0.00 ? 10 ILE A HG13 13 
ATOM 9567  H HG21 . ILE A 1 10 ? 9.714   0.079   -3.096  1.00 0.00 ? 10 ILE A HG21 13 
ATOM 9568  H HG22 . ILE A 1 10 ? 9.514   0.557   -1.411  1.00 0.00 ? 10 ILE A HG22 13 
ATOM 9569  H HG23 . ILE A 1 10 ? 8.832   1.553   -2.696  1.00 0.00 ? 10 ILE A HG23 13 
ATOM 9570  H HD11 . ILE A 1 10 ? 5.872   2.415   -1.242  1.00 0.00 ? 10 ILE A HD11 13 
ATOM 9571  H HD12 . ILE A 1 10 ? 6.697   2.112   -2.769  1.00 0.00 ? 10 ILE A HD12 13 
ATOM 9572  H HD13 . ILE A 1 10 ? 7.633   2.417   -1.306  1.00 0.00 ? 10 ILE A HD13 13 
ATOM 9573  N N    . CYS A 1 11 ? 6.350   1.412   -5.092  1.00 0.00 ? 11 CYS A N    13 
ATOM 9574  C CA   . CYS A 1 11 ? 6.546   2.622   -5.930  1.00 0.00 ? 11 CYS A CA   13 
ATOM 9575  C C    . CYS A 1 11 ? 6.255   3.850   -5.074  1.00 0.00 ? 11 CYS A C    13 
ATOM 9576  O O    . CYS A 1 11 ? 5.169   4.007   -4.554  1.00 0.00 ? 11 CYS A O    13 
ATOM 9577  C CB   . CYS A 1 11 ? 5.585   2.582   -7.121  1.00 0.00 ? 11 CYS A CB   13 
ATOM 9578  S SG   . CYS A 1 11 ? 5.603   0.928   -7.856  1.00 0.00 ? 11 CYS A SG   13 
ATOM 9579  H H    . CYS A 1 11 ? 5.447   1.070   -4.925  1.00 0.00 ? 11 CYS A H    13 
ATOM 9580  H HA   . CYS A 1 11 ? 7.566   2.658   -6.285  1.00 0.00 ? 11 CYS A HA   13 
ATOM 9581  H HB2  . CYS A 1 11 ? 4.585   2.816   -6.784  1.00 0.00 ? 11 CYS A HB2  13 
ATOM 9582  H HB3  . CYS A 1 11 ? 5.895   3.307   -7.858  1.00 0.00 ? 11 CYS A HB3  13 
ATOM 9583  N N    . SER A 1 12 ? 7.216   4.719   -4.927  1.00 0.00 ? 12 SER A N    13 
ATOM 9584  C CA   . SER A 1 12 ? 7.013   5.939   -4.105  1.00 0.00 ? 12 SER A CA   13 
ATOM 9585  C C    . SER A 1 12 ? 6.204   5.598   -2.852  1.00 0.00 ? 12 SER A C    13 
ATOM 9586  O O    . SER A 1 12 ? 4.991   5.580   -2.877  1.00 0.00 ? 12 SER A O    13 
ATOM 9587  C CB   . SER A 1 12 ? 6.258   6.984   -4.927  1.00 0.00 ? 12 SER A CB   13 
ATOM 9588  O OG   . SER A 1 12 ? 6.143   6.531   -6.270  1.00 0.00 ? 12 SER A OG   13 
ATOM 9589  H H    . SER A 1 12 ? 8.077   4.567   -5.358  1.00 0.00 ? 12 SER A H    13 
ATOM 9590  H HA   . SER A 1 12 ? 7.972   6.339   -3.813  1.00 0.00 ? 12 SER A HA   13 
ATOM 9591  H HB2  . SER A 1 12 ? 5.273   7.126   -4.516  1.00 0.00 ? 12 SER A HB2  13 
ATOM 9592  H HB3  . SER A 1 12 ? 6.797   7.922   -4.898  1.00 0.00 ? 12 SER A HB3  13 
ATOM 9593  H HG   . SER A 1 12 ? 5.925   7.286   -6.820  1.00 0.00 ? 12 SER A HG   13 
ATOM 9594  N N    . LEU A 1 13 ? 6.852   5.354   -1.745  1.00 0.00 ? 13 LEU A N    13 
ATOM 9595  C CA   . LEU A 1 13 ? 6.081   5.053   -0.511  1.00 0.00 ? 13 LEU A CA   13 
ATOM 9596  C C    . LEU A 1 13 ? 5.096   6.193   -0.336  1.00 0.00 ? 13 LEU A C    13 
ATOM 9597  O O    . LEU A 1 13 ? 3.999   6.028   0.159   1.00 0.00 ? 13 LEU A O    13 
ATOM 9598  C CB   . LEU A 1 13 ? 7.021   4.980   0.696   1.00 0.00 ? 13 LEU A CB   13 
ATOM 9599  C CG   . LEU A 1 13 ? 6.269   4.399   1.895   1.00 0.00 ? 13 LEU A CG   13 
ATOM 9600  C CD1  . LEU A 1 13 ? 5.213   5.398   2.371   1.00 0.00 ? 13 LEU A CD1  13 
ATOM 9601  C CD2  . LEU A 1 13 ? 5.586   3.093   1.483   1.00 0.00 ? 13 LEU A CD2  13 
ATOM 9602  H H    . LEU A 1 13 ? 7.830   5.389   -1.723  1.00 0.00 ? 13 LEU A H    13 
ATOM 9603  H HA   . LEU A 1 13 ? 5.544   4.125   -0.625  1.00 0.00 ? 13 LEU A HA   13 
ATOM 9604  H HB2  . LEU A 1 13 ? 7.864   4.348   0.457   1.00 0.00 ? 13 LEU A HB2  13 
ATOM 9605  H HB3  . LEU A 1 13 ? 7.372   5.972   0.939   1.00 0.00 ? 13 LEU A HB3  13 
ATOM 9606  H HG   . LEU A 1 13 ? 6.967   4.206   2.697   1.00 0.00 ? 13 LEU A HG   13 
ATOM 9607  H HD11 . LEU A 1 13 ? 5.213   5.435   3.450   1.00 0.00 ? 13 LEU A HD11 13 
ATOM 9608  H HD12 . LEU A 1 13 ? 4.240   5.086   2.022   1.00 0.00 ? 13 LEU A HD12 13 
ATOM 9609  H HD13 . LEU A 1 13 ? 5.440   6.377   1.977   1.00 0.00 ? 13 LEU A HD13 13 
ATOM 9610  H HD21 . LEU A 1 13 ? 6.147   2.630   0.685   1.00 0.00 ? 13 LEU A HD21 13 
ATOM 9611  H HD22 . LEU A 1 13 ? 4.583   3.304   1.144   1.00 0.00 ? 13 LEU A HD22 13 
ATOM 9612  H HD23 . LEU A 1 13 ? 5.547   2.425   2.330   1.00 0.00 ? 13 LEU A HD23 13 
ATOM 9613  N N    . TYR A 1 14 ? 5.481   7.347   -0.789  1.00 0.00 ? 14 TYR A N    13 
ATOM 9614  C CA   . TYR A 1 14 ? 4.576   8.520   -0.713  1.00 0.00 ? 14 TYR A CA   13 
ATOM 9615  C C    . TYR A 1 14 ? 3.341   8.202   -1.548  1.00 0.00 ? 14 TYR A C    13 
ATOM 9616  O O    . TYR A 1 14 ? 2.238   8.598   -1.227  1.00 0.00 ? 14 TYR A O    13 
ATOM 9617  C CB   . TYR A 1 14 ? 5.284   9.752   -1.280  1.00 0.00 ? 14 TYR A CB   13 
ATOM 9618  C CG   . TYR A 1 14 ? 4.834   10.986  -0.535  1.00 0.00 ? 14 TYR A CG   13 
ATOM 9619  C CD1  . TYR A 1 14 ? 4.816   10.991  0.865   1.00 0.00 ? 14 TYR A CD1  13 
ATOM 9620  C CD2  . TYR A 1 14 ? 4.437   12.125  -1.245  1.00 0.00 ? 14 TYR A CD2  13 
ATOM 9621  C CE1  . TYR A 1 14 ? 4.400   12.137  1.555   1.00 0.00 ? 14 TYR A CE1  13 
ATOM 9622  C CE2  . TYR A 1 14 ? 4.022   13.270  -0.555  1.00 0.00 ? 14 TYR A CE2  13 
ATOM 9623  C CZ   . TYR A 1 14 ? 4.003   13.276  0.845   1.00 0.00 ? 14 TYR A CZ   13 
ATOM 9624  O OH   . TYR A 1 14 ? 3.594   14.405  1.524   1.00 0.00 ? 14 TYR A OH   13 
ATOM 9625  H H    . TYR A 1 14 ? 6.361   7.429   -1.214  1.00 0.00 ? 14 TYR A H    13 
ATOM 9626  H HA   . TYR A 1 14 ? 4.288   8.696   0.312   1.00 0.00 ? 14 TYR A HA   13 
ATOM 9627  H HB2  . TYR A 1 14 ? 6.352   9.635   -1.170  1.00 0.00 ? 14 TYR A HB2  13 
ATOM 9628  H HB3  . TYR A 1 14 ? 5.040   9.857   -2.327  1.00 0.00 ? 14 TYR A HB3  13 
ATOM 9629  H HD1  . TYR A 1 14 ? 5.122   10.112  1.413   1.00 0.00 ? 14 TYR A HD1  13 
ATOM 9630  H HD2  . TYR A 1 14 ? 4.452   12.120  -2.324  1.00 0.00 ? 14 TYR A HD2  13 
ATOM 9631  H HE1  . TYR A 1 14 ? 4.386   12.142  2.635   1.00 0.00 ? 14 TYR A HE1  13 
ATOM 9632  H HE2  . TYR A 1 14 ? 3.716   14.149  -1.103  1.00 0.00 ? 14 TYR A HE2  13 
ATOM 9633  H HH   . TYR A 1 14 ? 2.635   14.405  1.549   1.00 0.00 ? 14 TYR A HH   13 
ATOM 9634  N N    . GLN A 1 15 ? 3.519   7.466   -2.614  1.00 0.00 ? 15 GLN A N    13 
ATOM 9635  C CA   . GLN A 1 15 ? 2.354   7.097   -3.462  1.00 0.00 ? 15 GLN A CA   13 
ATOM 9636  C C    . GLN A 1 15 ? 1.471   6.127   -2.677  1.00 0.00 ? 15 GLN A C    13 
ATOM 9637  O O    . GLN A 1 15 ? 0.267   6.275   -2.619  1.00 0.00 ? 15 GLN A O    13 
ATOM 9638  C CB   . GLN A 1 15 ? 2.842   6.423   -4.746  1.00 0.00 ? 15 GLN A CB   13 
ATOM 9639  C CG   . GLN A 1 15 ? 2.964   7.467   -5.857  1.00 0.00 ? 15 GLN A CG   13 
ATOM 9640  C CD   . GLN A 1 15 ? 1.954   7.154   -6.963  1.00 0.00 ? 15 GLN A CD   13 
ATOM 9641  O OE1  . GLN A 1 15 ? 0.796   6.908   -6.693  1.00 0.00 ? 15 GLN A OE1  13 
ATOM 9642  N NE2  . GLN A 1 15 ? 2.348   7.154   -8.207  1.00 0.00 ? 15 GLN A NE2  13 
ATOM 9643  H H    . GLN A 1 15 ? 4.420   7.141   -2.847  1.00 0.00 ? 15 GLN A H    13 
ATOM 9644  H HA   . GLN A 1 15 ? 1.788   7.984   -3.707  1.00 0.00 ? 15 GLN A HA   13 
ATOM 9645  H HB2  . GLN A 1 15 ? 3.806   5.968   -4.570  1.00 0.00 ? 15 GLN A HB2  13 
ATOM 9646  H HB3  . GLN A 1 15 ? 2.135   5.663   -5.045  1.00 0.00 ? 15 GLN A HB3  13 
ATOM 9647  H HG2  . GLN A 1 15 ? 2.763   8.448   -5.452  1.00 0.00 ? 15 GLN A HG2  13 
ATOM 9648  H HG3  . GLN A 1 15 ? 3.962   7.443   -6.266  1.00 0.00 ? 15 GLN A HG3  13 
ATOM 9649  H HE21 . GLN A 1 15 ? 3.283   7.352   -8.426  1.00 0.00 ? 15 GLN A HE21 13 
ATOM 9650  H HE22 . GLN A 1 15 ? 1.709   6.955   -8.923  1.00 0.00 ? 15 GLN A HE22 13 
ATOM 9651  N N    . LEU A 1 16 ? 2.066   5.144   -2.052  1.00 0.00 ? 16 LEU A N    13 
ATOM 9652  C CA   . LEU A 1 16 ? 1.263   4.181   -1.253  1.00 0.00 ? 16 LEU A CA   13 
ATOM 9653  C C    . LEU A 1 16 ? 0.747   4.907   -0.013  1.00 0.00 ? 16 LEU A C    13 
ATOM 9654  O O    . LEU A 1 16 ? -0.397  4.768   0.373   1.00 0.00 ? 16 LEU A O    13 
ATOM 9655  C CB   . LEU A 1 16 ? 2.142   3.001   -0.833  1.00 0.00 ? 16 LEU A CB   13 
ATOM 9656  C CG   . LEU A 1 16 ? 2.348   2.069   -2.028  1.00 0.00 ? 16 LEU A CG   13 
ATOM 9657  C CD1  . LEU A 1 16 ? 3.505   1.111   -1.737  1.00 0.00 ? 16 LEU A CD1  13 
ATOM 9658  C CD2  . LEU A 1 16 ? 1.070   1.264   -2.272  1.00 0.00 ? 16 LEU A CD2  13 
ATOM 9659  H H    . LEU A 1 16 ? 3.040   5.050   -2.096  1.00 0.00 ? 16 LEU A H    13 
ATOM 9660  H HA   . LEU A 1 16 ? 0.429   3.826   -1.840  1.00 0.00 ? 16 LEU A HA   13 
ATOM 9661  H HB2  . LEU A 1 16 ? 3.100   3.369   -0.493  1.00 0.00 ? 16 LEU A HB2  13 
ATOM 9662  H HB3  . LEU A 1 16 ? 1.660   2.459   -0.034  1.00 0.00 ? 16 LEU A HB3  13 
ATOM 9663  H HG   . LEU A 1 16 ? 2.579   2.655   -2.906  1.00 0.00 ? 16 LEU A HG   13 
ATOM 9664  H HD11 . LEU A 1 16 ? 3.121   0.211   -1.281  1.00 0.00 ? 16 LEU A HD11 13 
ATOM 9665  H HD12 . LEU A 1 16 ? 4.204   1.585   -1.064  1.00 0.00 ? 16 LEU A HD12 13 
ATOM 9666  H HD13 . LEU A 1 16 ? 4.006   0.861   -2.660  1.00 0.00 ? 16 LEU A HD13 13 
ATOM 9667  H HD21 . LEU A 1 16 ? 0.223   1.806   -1.877  1.00 0.00 ? 16 LEU A HD21 13 
ATOM 9668  H HD22 . LEU A 1 16 ? 1.147   0.307   -1.777  1.00 0.00 ? 16 LEU A HD22 13 
ATOM 9669  H HD23 . LEU A 1 16 ? 0.937   1.111   -3.333  1.00 0.00 ? 16 LEU A HD23 13 
ATOM 9670  N N    . GLU A 1 17 ? 1.584   5.695   0.607   1.00 0.00 ? 17 GLU A N    13 
ATOM 9671  C CA   . GLU A 1 17 ? 1.144   6.446   1.813   1.00 0.00 ? 17 GLU A CA   13 
ATOM 9672  C C    . GLU A 1 17 ? 0.018   7.403   1.415   1.00 0.00 ? 17 GLU A C    13 
ATOM 9673  O O    . GLU A 1 17 ? -0.944  7.582   2.136   1.00 0.00 ? 17 GLU A O    13 
ATOM 9674  C CB   . GLU A 1 17 ? 2.322   7.246   2.375   1.00 0.00 ? 17 GLU A CB   13 
ATOM 9675  C CG   . GLU A 1 17 ? 2.424   7.017   3.884   1.00 0.00 ? 17 GLU A CG   13 
ATOM 9676  C CD   . GLU A 1 17 ? 1.204   7.627   4.577   1.00 0.00 ? 17 GLU A CD   13 
ATOM 9677  O OE1  . GLU A 1 17 ? 0.439   8.297   3.903   1.00 0.00 ? 17 GLU A OE1  13 
ATOM 9678  O OE2  . GLU A 1 17 ? 1.056   7.415   5.769   1.00 0.00 ? 17 GLU A OE2  13 
ATOM 9679  H H    . GLU A 1 17 ? 2.501   5.796   0.273   1.00 0.00 ? 17 GLU A H    13 
ATOM 9680  H HA   . GLU A 1 17 ? 0.787   5.754   2.557   1.00 0.00 ? 17 GLU A HA   13 
ATOM 9681  H HB2  . GLU A 1 17 ? 3.237   6.922   1.899   1.00 0.00 ? 17 GLU A HB2  13 
ATOM 9682  H HB3  . GLU A 1 17 ? 2.169   8.297   2.183   1.00 0.00 ? 17 GLU A HB3  13 
ATOM 9683  H HG2  . GLU A 1 17 ? 2.461   5.956   4.086   1.00 0.00 ? 17 GLU A HG2  13 
ATOM 9684  H HG3  . GLU A 1 17 ? 3.321   7.485   4.260   1.00 0.00 ? 17 GLU A HG3  13 
ATOM 9685  N N    . ASN A 1 18 ? 0.129   8.013   0.265   1.00 0.00 ? 18 ASN A N    13 
ATOM 9686  C CA   . ASN A 1 18 ? -0.934  8.953   -0.193  1.00 0.00 ? 18 ASN A CA   13 
ATOM 9687  C C    . ASN A 1 18 ? -2.250  8.188   -0.371  1.00 0.00 ? 18 ASN A C    13 
ATOM 9688  O O    . ASN A 1 18 ? -3.318  8.766   -0.399  1.00 0.00 ? 18 ASN A O    13 
ATOM 9689  C CB   . ASN A 1 18 ? -0.523  9.575   -1.529  1.00 0.00 ? 18 ASN A CB   13 
ATOM 9690  C CG   . ASN A 1 18 ? 0.544   10.643  -1.289  1.00 0.00 ? 18 ASN A CG   13 
ATOM 9691  O OD1  . ASN A 1 18 ? 0.771   11.051  -0.167  1.00 0.00 ? 18 ASN A OD1  13 
ATOM 9692  N ND2  . ASN A 1 18 ? 1.214   11.118  -2.304  1.00 0.00 ? 18 ASN A ND2  13 
ATOM 9693  H H    . ASN A 1 18 ? 0.913   7.849   -0.302  1.00 0.00 ? 18 ASN A H    13 
ATOM 9694  H HA   . ASN A 1 18 ? -1.067  9.733   0.542   1.00 0.00 ? 18 ASN A HA   13 
ATOM 9695  H HB2  . ASN A 1 18 ? -0.125  8.806   -2.176  1.00 0.00 ? 18 ASN A HB2  13 
ATOM 9696  H HB3  . ASN A 1 18 ? -1.385  10.028  -1.996  1.00 0.00 ? 18 ASN A HB3  13 
ATOM 9697  H HD21 . ASN A 1 18 ? 1.031   10.789  -3.209  1.00 0.00 ? 18 ASN A HD21 13 
ATOM 9698  H HD22 . ASN A 1 18 ? 1.899   11.803  -2.161  1.00 0.00 ? 18 ASN A HD22 13 
ATOM 9699  N N    . TYR A 1 19 ? -2.176  6.890   -0.501  1.00 0.00 ? 19 TYR A N    13 
ATOM 9700  C CA   . TYR A 1 19 ? -3.413  6.076   -0.690  1.00 0.00 ? 19 TYR A CA   13 
ATOM 9701  C C    . TYR A 1 19 ? -4.393  6.300   0.468   1.00 0.00 ? 19 TYR A C    13 
ATOM 9702  O O    . TYR A 1 19 ? -5.534  5.891   0.400   1.00 0.00 ? 19 TYR A O    13 
ATOM 9703  C CB   . TYR A 1 19 ? -3.037  4.597   -0.749  1.00 0.00 ? 19 TYR A CB   13 
ATOM 9704  C CG   . TYR A 1 19 ? -3.883  3.905   -1.790  1.00 0.00 ? 19 TYR A CG   13 
ATOM 9705  C CD1  . TYR A 1 19 ? -3.868  4.357   -3.114  1.00 0.00 ? 19 TYR A CD1  13 
ATOM 9706  C CD2  . TYR A 1 19 ? -4.681  2.813   -1.432  1.00 0.00 ? 19 TYR A CD2  13 
ATOM 9707  C CE1  . TYR A 1 19 ? -4.652  3.718   -4.081  1.00 0.00 ? 19 TYR A CE1  13 
ATOM 9708  C CE2  . TYR A 1 19 ? -5.466  2.172   -2.399  1.00 0.00 ? 19 TYR A CE2  13 
ATOM 9709  C CZ   . TYR A 1 19 ? -5.451  2.625   -3.724  1.00 0.00 ? 19 TYR A CZ   13 
ATOM 9710  O OH   . TYR A 1 19 ? -6.224  1.994   -4.678  1.00 0.00 ? 19 TYR A OH   13 
ATOM 9711  H H    . TYR A 1 19 ? -1.303  6.449   -0.483  1.00 0.00 ? 19 TYR A H    13 
ATOM 9712  H HA   . TYR A 1 19 ? -3.886  6.359   -1.617  1.00 0.00 ? 19 TYR A HA   13 
ATOM 9713  H HB2  . TYR A 1 19 ? -1.993  4.502   -1.011  1.00 0.00 ? 19 TYR A HB2  13 
ATOM 9714  H HB3  . TYR A 1 19 ? -3.210  4.142   0.214   1.00 0.00 ? 19 TYR A HB3  13 
ATOM 9715  H HD1  . TYR A 1 19 ? -3.252  5.200   -3.389  1.00 0.00 ? 19 TYR A HD1  13 
ATOM 9716  H HD2  . TYR A 1 19 ? -4.693  2.464   -0.409  1.00 0.00 ? 19 TYR A HD2  13 
ATOM 9717  H HE1  . TYR A 1 19 ? -4.640  4.067   -5.104  1.00 0.00 ? 19 TYR A HE1  13 
ATOM 9718  H HE2  . TYR A 1 19 ? -6.083  1.329   -2.123  1.00 0.00 ? 19 TYR A HE2  13 
ATOM 9719  H HH   . TYR A 1 19 ? -6.092  1.048   -4.589  1.00 0.00 ? 19 TYR A HH   13 
ATOM 9720  N N    . CYS A 1 20 ? -3.955  6.933   1.529   1.00 0.00 ? 20 CYS A N    13 
ATOM 9721  C CA   . CYS A 1 20 ? -4.859  7.181   2.697   1.00 0.00 ? 20 CYS A CA   13 
ATOM 9722  C C    . CYS A 1 20 ? -6.280  7.479   2.213   1.00 0.00 ? 20 CYS A C    13 
ATOM 9723  O O    . CYS A 1 20 ? -6.495  7.881   1.087   1.00 0.00 ? 20 CYS A O    13 
ATOM 9724  C CB   . CYS A 1 20 ? -4.347  8.385   3.488   1.00 0.00 ? 20 CYS A CB   13 
ATOM 9725  S SG   . CYS A 1 20 ? -4.289  7.977   5.250   1.00 0.00 ? 20 CYS A SG   13 
ATOM 9726  H H    . CYS A 1 20 ? -3.028  7.239   1.563   1.00 0.00 ? 20 CYS A H    13 
ATOM 9727  H HA   . CYS A 1 20 ? -4.871  6.308   3.336   1.00 0.00 ? 20 CYS A HA   13 
ATOM 9728  H HB2  . CYS A 1 20 ? -3.358  8.645   3.147   1.00 0.00 ? 20 CYS A HB2  13 
ATOM 9729  H HB3  . CYS A 1 20 ? -5.013  9.222   3.336   1.00 0.00 ? 20 CYS A HB3  13 
ATOM 9730  N N    . ASN A 1 21 ? -7.250  7.288   3.061   1.00 0.00 ? 21 ASN A N    13 
ATOM 9731  C CA   . ASN A 1 21 ? -8.659  7.559   2.660   1.00 0.00 ? 21 ASN A CA   13 
ATOM 9732  C C    . ASN A 1 21 ? -9.356  8.364   3.759   1.00 0.00 ? 21 ASN A C    13 
ATOM 9733  O O    . ASN A 1 21 ? -9.476  9.568   3.599   1.00 0.00 ? 21 ASN A O    13 
ATOM 9734  C CB   . ASN A 1 21 ? -9.392  6.230   2.456   1.00 0.00 ? 21 ASN A CB   13 
ATOM 9735  C CG   . ASN A 1 21 ? -10.875 6.499   2.189   1.00 0.00 ? 21 ASN A CG   13 
ATOM 9736  O OD1  . ASN A 1 21 ? -11.328 7.622   2.286   1.00 0.00 ? 21 ASN A OD1  13 
ATOM 9737  N ND2  . ASN A 1 21 ? -11.654 5.508   1.854   1.00 0.00 ? 21 ASN A ND2  13 
ATOM 9738  O OXT  . ASN A 1 21 ? -9.758  7.763   4.742   1.00 0.00 ? 21 ASN A OXT  13 
ATOM 9739  H H    . ASN A 1 21 ? -7.051  6.968   3.965   1.00 0.00 ? 21 ASN A H    13 
ATOM 9740  H HA   . ASN A 1 21 ? -8.670  8.122   1.738   1.00 0.00 ? 21 ASN A HA   13 
ATOM 9741  H HB2  . ASN A 1 21 ? -8.962  5.708   1.612   1.00 0.00 ? 21 ASN A HB2  13 
ATOM 9742  H HB3  . ASN A 1 21 ? -9.293  5.624   3.343   1.00 0.00 ? 21 ASN A HB3  13 
ATOM 9743  H HD21 . ASN A 1 21 ? -11.288 4.602   1.775   1.00 0.00 ? 21 ASN A HD21 13 
ATOM 9744  H HD22 . ASN A 1 21 ? -12.605 5.669   1.680   1.00 0.00 ? 21 ASN A HD22 13 
ATOM 9745  N N    . PHE B 2 1  ? 17.169  4.678   2.464   1.00 0.00 ? 1  PHE B N    13 
ATOM 9746  C CA   . PHE B 2 1  ? 16.643  4.743   1.071   1.00 0.00 ? 1  PHE B CA   13 
ATOM 9747  C C    . PHE B 2 1  ? 15.219  4.184   1.036   1.00 0.00 ? 1  PHE B C    13 
ATOM 9748  O O    . PHE B 2 1  ? 14.769  3.548   1.969   1.00 0.00 ? 1  PHE B O    13 
ATOM 9749  C CB   . PHE B 2 1  ? 17.538  3.914   0.148   1.00 0.00 ? 1  PHE B CB   13 
ATOM 9750  C CG   . PHE B 2 1  ? 18.957  4.422   0.232   1.00 0.00 ? 1  PHE B CG   13 
ATOM 9751  C CD1  . PHE B 2 1  ? 19.300  5.641   -0.364  1.00 0.00 ? 1  PHE B CD1  13 
ATOM 9752  C CD2  . PHE B 2 1  ? 19.929  3.673   0.905   1.00 0.00 ? 1  PHE B CD2  13 
ATOM 9753  C CE1  . PHE B 2 1  ? 20.616  6.112   -0.286  1.00 0.00 ? 1  PHE B CE1  13 
ATOM 9754  C CE2  . PHE B 2 1  ? 21.245  4.144   0.983   1.00 0.00 ? 1  PHE B CE2  13 
ATOM 9755  C CZ   . PHE B 2 1  ? 21.589  5.363   0.387   1.00 0.00 ? 1  PHE B CZ   13 
ATOM 9756  H H1   . PHE B 2 1  ? 17.890  5.414   2.598   1.00 0.00 ? 1  PHE B H1   13 
ATOM 9757  H H2   . PHE B 2 1  ? 17.592  3.741   2.630   1.00 0.00 ? 1  PHE B H2   13 
ATOM 9758  H H3   . PHE B 2 1  ? 16.391  4.832   3.136   1.00 0.00 ? 1  PHE B H3   13 
ATOM 9759  H HA   . PHE B 2 1  ? 16.634  5.770   0.737   1.00 0.00 ? 1  PHE B HA   13 
ATOM 9760  H HB2  . PHE B 2 1  ? 17.507  2.878   0.452   1.00 0.00 ? 1  PHE B HB2  13 
ATOM 9761  H HB3  . PHE B 2 1  ? 17.185  4.001   -0.869  1.00 0.00 ? 1  PHE B HB3  13 
ATOM 9762  H HD1  . PHE B 2 1  ? 18.550  6.219   -0.883  1.00 0.00 ? 1  PHE B HD1  13 
ATOM 9763  H HD2  . PHE B 2 1  ? 19.664  2.732   1.365   1.00 0.00 ? 1  PHE B HD2  13 
ATOM 9764  H HE1  . PHE B 2 1  ? 20.881  7.052   -0.746  1.00 0.00 ? 1  PHE B HE1  13 
ATOM 9765  H HE2  . PHE B 2 1  ? 21.996  3.566   1.503   1.00 0.00 ? 1  PHE B HE2  13 
ATOM 9766  H HZ   . PHE B 2 1  ? 22.604  5.726   0.447   1.00 0.00 ? 1  PHE B HZ   13 
ATOM 9767  N N    . VAL B 2 2  ? 14.507  4.415   -0.033  1.00 0.00 ? 2  VAL B N    13 
ATOM 9768  C CA   . VAL B 2 2  ? 13.113  3.895   -0.127  1.00 0.00 ? 2  VAL B CA   13 
ATOM 9769  C C    . VAL B 2 2  ? 13.117  2.384   0.117   1.00 0.00 ? 2  VAL B C    13 
ATOM 9770  O O    . VAL B 2 2  ? 14.144  1.738   0.048   1.00 0.00 ? 2  VAL B O    13 
ATOM 9771  C CB   . VAL B 2 2  ? 12.552  4.187   -1.519  1.00 0.00 ? 2  VAL B CB   13 
ATOM 9772  C CG1  . VAL B 2 2  ? 12.580  5.695   -1.775  1.00 0.00 ? 2  VAL B CG1  13 
ATOM 9773  C CG2  . VAL B 2 2  ? 13.406  3.477   -2.573  1.00 0.00 ? 2  VAL B CG2  13 
ATOM 9774  H H    . VAL B 2 2  ? 14.889  4.929   -0.774  1.00 0.00 ? 2  VAL B H    13 
ATOM 9775  H HA   . VAL B 2 2  ? 12.498  4.377   0.618   1.00 0.00 ? 2  VAL B HA   13 
ATOM 9776  H HB   . VAL B 2 2  ? 11.533  3.831   -1.579  1.00 0.00 ? 2  VAL B HB   13 
ATOM 9777  H HG11 . VAL B 2 2  ? 11.768  5.963   -2.435  1.00 0.00 ? 2  VAL B HG11 13 
ATOM 9778  H HG12 . VAL B 2 2  ? 13.520  5.966   -2.232  1.00 0.00 ? 2  VAL B HG12 13 
ATOM 9779  H HG13 . VAL B 2 2  ? 12.470  6.221   -0.838  1.00 0.00 ? 2  VAL B HG13 13 
ATOM 9780  H HG21 . VAL B 2 2  ? 14.345  3.999   -2.686  1.00 0.00 ? 2  VAL B HG21 13 
ATOM 9781  H HG22 . VAL B 2 2  ? 12.881  3.471   -3.517  1.00 0.00 ? 2  VAL B HG22 13 
ATOM 9782  H HG23 . VAL B 2 2  ? 13.594  2.461   -2.258  1.00 0.00 ? 2  VAL B HG23 13 
ATOM 9783  N N    . ASN B 2 3  ? 11.978  1.816   0.404   1.00 0.00 ? 3  ASN B N    13 
ATOM 9784  C CA   . ASN B 2 3  ? 11.920  0.348   0.654   1.00 0.00 ? 3  ASN B CA   13 
ATOM 9785  C C    . ASN B 2 3  ? 11.681  -0.388  -0.666  1.00 0.00 ? 3  ASN B C    13 
ATOM 9786  O O    . ASN B 2 3  ? 11.970  0.118   -1.733  1.00 0.00 ? 3  ASN B O    13 
ATOM 9787  C CB   . ASN B 2 3  ? 10.776  0.041   1.622   1.00 0.00 ? 3  ASN B CB   13 
ATOM 9788  C CG   . ASN B 2 3  ? 9.437   0.282   0.922   1.00 0.00 ? 3  ASN B CG   13 
ATOM 9789  O OD1  . ASN B 2 3  ? 8.922   -0.591  0.252   1.00 0.00 ? 3  ASN B OD1  13 
ATOM 9790  N ND2  . ASN B 2 3  ? 8.846   1.438   1.051   1.00 0.00 ? 3  ASN B ND2  13 
ATOM 9791  H H    . ASN B 2 3  ? 11.161  2.355   0.456   1.00 0.00 ? 3  ASN B H    13 
ATOM 9792  H HA   . ASN B 2 3  ? 12.854  0.020   1.085   1.00 0.00 ? 3  ASN B HA   13 
ATOM 9793  H HB2  . ASN B 2 3  ? 10.838  -0.991  1.937   1.00 0.00 ? 3  ASN B HB2  13 
ATOM 9794  H HB3  . ASN B 2 3  ? 10.850  0.687   2.484   1.00 0.00 ? 3  ASN B HB3  13 
ATOM 9795  H HD21 . ASN B 2 3  ? 9.260   2.142   1.593   1.00 0.00 ? 3  ASN B HD21 13 
ATOM 9796  H HD22 . ASN B 2 3  ? 7.988   1.602   0.607   1.00 0.00 ? 3  ASN B HD22 13 
ATOM 9797  N N    . GLN B 2 4  ? 11.156  -1.581  -0.602  1.00 0.00 ? 4  GLN B N    13 
ATOM 9798  C CA   . GLN B 2 4  ? 10.899  -2.353  -1.850  1.00 0.00 ? 4  GLN B CA   13 
ATOM 9799  C C    . GLN B 2 4  ? 10.506  -3.786  -1.486  1.00 0.00 ? 4  GLN B C    13 
ATOM 9800  O O    . GLN B 2 4  ? 11.165  -4.735  -1.861  1.00 0.00 ? 4  GLN B O    13 
ATOM 9801  C CB   . GLN B 2 4  ? 12.167  -2.375  -2.707  1.00 0.00 ? 4  GLN B CB   13 
ATOM 9802  C CG   . GLN B 2 4  ? 11.928  -1.583  -3.994  1.00 0.00 ? 4  GLN B CG   13 
ATOM 9803  C CD   . GLN B 2 4  ? 13.244  -0.961  -4.463  1.00 0.00 ? 4  GLN B CD   13 
ATOM 9804  O OE1  . GLN B 2 4  ? 13.700  -1.226  -5.557  1.00 0.00 ? 4  GLN B OE1  13 
ATOM 9805  N NE2  . GLN B 2 4  ? 13.880  -0.138  -3.674  1.00 0.00 ? 4  GLN B NE2  13 
ATOM 9806  H H    . GLN B 2 4  ? 10.932  -1.971  0.269   1.00 0.00 ? 4  GLN B H    13 
ATOM 9807  H HA   . GLN B 2 4  ? 10.097  -1.888  -2.404  1.00 0.00 ? 4  GLN B HA   13 
ATOM 9808  H HB2  . GLN B 2 4  ? 12.982  -1.929  -2.155  1.00 0.00 ? 4  GLN B HB2  13 
ATOM 9809  H HB3  . GLN B 2 4  ? 12.416  -3.395  -2.956  1.00 0.00 ? 4  GLN B HB3  13 
ATOM 9810  H HG2  . GLN B 2 4  ? 11.549  -2.245  -4.759  1.00 0.00 ? 4  GLN B HG2  13 
ATOM 9811  H HG3  . GLN B 2 4  ? 11.208  -0.800  -3.807  1.00 0.00 ? 4  GLN B HG3  13 
ATOM 9812  H HE21 . GLN B 2 4  ? 13.513  0.077   -2.791  1.00 0.00 ? 4  GLN B HE21 13 
ATOM 9813  H HE22 . GLN B 2 4  ? 14.724  0.266   -3.965  1.00 0.00 ? 4  GLN B HE22 13 
ATOM 9814  N N    . HIS B 2 5  ? 9.439   -3.947  -0.752  1.00 0.00 ? 5  HIS B N    13 
ATOM 9815  C CA   . HIS B 2 5  ? 9.006   -5.321  -0.356  1.00 0.00 ? 5  HIS B CA   13 
ATOM 9816  C C    . HIS B 2 5  ? 8.896   -6.208  -1.600  1.00 0.00 ? 5  HIS B C    13 
ATOM 9817  O O    . HIS B 2 5  ? 9.274   -5.819  -2.688  1.00 0.00 ? 5  HIS B O    13 
ATOM 9818  C CB   . HIS B 2 5  ? 7.646   -5.258  0.347   1.00 0.00 ? 5  HIS B CB   13 
ATOM 9819  C CG   . HIS B 2 5  ? 6.838   -4.122  -0.214  1.00 0.00 ? 5  HIS B CG   13 
ATOM 9820  N ND1  . HIS B 2 5  ? 6.970   -3.702  -1.527  1.00 0.00 ? 5  HIS B ND1  13 
ATOM 9821  C CD2  . HIS B 2 5  ? 5.892   -3.303  0.349   1.00 0.00 ? 5  HIS B CD2  13 
ATOM 9822  C CE1  . HIS B 2 5  ? 6.126   -2.671  -1.709  1.00 0.00 ? 5  HIS B CE1  13 
ATOM 9823  N NE2  . HIS B 2 5  ? 5.443   -2.387  -0.597  1.00 0.00 ? 5  HIS B NE2  13 
ATOM 9824  H H    . HIS B 2 5  ? 8.927   -3.165  -0.456  1.00 0.00 ? 5  HIS B H    13 
ATOM 9825  H HA   . HIS B 2 5  ? 9.736   -5.743  0.318   1.00 0.00 ? 5  HIS B HA   13 
ATOM 9826  H HB2  . HIS B 2 5  ? 7.117   -6.187  0.191   1.00 0.00 ? 5  HIS B HB2  13 
ATOM 9827  H HB3  . HIS B 2 5  ? 7.796   -5.104  1.405   1.00 0.00 ? 5  HIS B HB3  13 
ATOM 9828  H HD1  . HIS B 2 5  ? 7.570   -4.085  -2.200  1.00 0.00 ? 5  HIS B HD1  13 
ATOM 9829  H HD2  . HIS B 2 5  ? 5.549   -3.361  1.371   1.00 0.00 ? 5  HIS B HD2  13 
ATOM 9830  H HE1  . HIS B 2 5  ? 6.021   -2.134  -2.639  1.00 0.00 ? 5  HIS B HE1  13 
ATOM 9831  N N    . LEU B 2 6  ? 8.387   -7.401  -1.445  1.00 0.00 ? 6  LEU B N    13 
ATOM 9832  C CA   . LEU B 2 6  ? 8.259   -8.318  -2.614  1.00 0.00 ? 6  LEU B CA   13 
ATOM 9833  C C    . LEU B 2 6  ? 6.789   -8.429  -3.031  1.00 0.00 ? 6  LEU B C    13 
ATOM 9834  O O    . LEU B 2 6  ? 6.448   -9.160  -3.940  1.00 0.00 ? 6  LEU B O    13 
ATOM 9835  C CB   . LEU B 2 6  ? 8.779   -9.704  -2.227  1.00 0.00 ? 6  LEU B CB   13 
ATOM 9836  C CG   . LEU B 2 6  ? 8.232   -10.084 -0.850  1.00 0.00 ? 6  LEU B CG   13 
ATOM 9837  C CD1  . LEU B 2 6  ? 7.824   -11.559 -0.851  1.00 0.00 ? 6  LEU B CD1  13 
ATOM 9838  C CD2  . LEU B 2 6  ? 9.312   -9.855  0.209   1.00 0.00 ? 6  LEU B CD2  13 
ATOM 9839  H H    . LEU B 2 6  ? 8.092   -7.695  -0.558  1.00 0.00 ? 6  LEU B H    13 
ATOM 9840  H HA   . LEU B 2 6  ? 8.840   -7.934  -3.439  1.00 0.00 ? 6  LEU B HA   13 
ATOM 9841  H HB2  . LEU B 2 6  ? 8.453   -10.428 -2.959  1.00 0.00 ? 6  LEU B HB2  13 
ATOM 9842  H HB3  . LEU B 2 6  ? 9.858   -9.687  -2.191  1.00 0.00 ? 6  LEU B HB3  13 
ATOM 9843  H HG   . LEU B 2 6  ? 7.369   -9.474  -0.625  1.00 0.00 ? 6  LEU B HG   13 
ATOM 9844  H HD11 . LEU B 2 6  ? 8.315   -12.067 -1.667  1.00 0.00 ? 6  LEU B HD11 13 
ATOM 9845  H HD12 . LEU B 2 6  ? 6.754   -11.636 -0.969  1.00 0.00 ? 6  LEU B HD12 13 
ATOM 9846  H HD13 . LEU B 2 6  ? 8.116   -12.013 0.085   1.00 0.00 ? 6  LEU B HD13 13 
ATOM 9847  H HD21 . LEU B 2 6  ? 9.302   -10.671 0.917   1.00 0.00 ? 6  LEU B HD21 13 
ATOM 9848  H HD22 . LEU B 2 6  ? 9.117   -8.927  0.727   1.00 0.00 ? 6  LEU B HD22 13 
ATOM 9849  H HD23 . LEU B 2 6  ? 10.279  -9.804  -0.268  1.00 0.00 ? 6  LEU B HD23 13 
ATOM 9850  N N    . CYS B 2 7  ? 5.918   -7.710  -2.377  1.00 0.00 ? 7  CYS B N    13 
ATOM 9851  C CA   . CYS B 2 7  ? 4.474   -7.770  -2.735  1.00 0.00 ? 7  CYS B CA   13 
ATOM 9852  C C    . CYS B 2 7  ? 3.850   -9.057  -2.186  1.00 0.00 ? 7  CYS B C    13 
ATOM 9853  O O    . CYS B 2 7  ? 2.658   -9.269  -2.286  1.00 0.00 ? 7  CYS B O    13 
ATOM 9854  C CB   . CYS B 2 7  ? 4.333   -7.740  -4.253  1.00 0.00 ? 7  CYS B CB   13 
ATOM 9855  S SG   . CYS B 2 7  ? 2.658   -7.211  -4.697  1.00 0.00 ? 7  CYS B SG   13 
ATOM 9856  H H    . CYS B 2 7  ? 6.214   -7.127  -1.653  1.00 0.00 ? 7  CYS B H    13 
ATOM 9857  H HA   . CYS B 2 7  ? 3.964   -6.917  -2.312  1.00 0.00 ? 7  CYS B HA   13 
ATOM 9858  H HB2  . CYS B 2 7  ? 5.052   -7.046  -4.660  1.00 0.00 ? 7  CYS B HB2  13 
ATOM 9859  H HB3  . CYS B 2 7  ? 4.519   -8.726  -4.649  1.00 0.00 ? 7  CYS B HB3  13 
ATOM 9860  N N    . GLY B 2 8  ? 4.640   -9.916  -1.600  1.00 0.00 ? 8  GLY B N    13 
ATOM 9861  C CA   . GLY B 2 8  ? 4.079   -11.179 -1.043  1.00 0.00 ? 8  GLY B CA   13 
ATOM 9862  C C    . GLY B 2 8  ? 3.401   -10.876 0.291   1.00 0.00 ? 8  GLY B C    13 
ATOM 9863  O O    . GLY B 2 8  ? 3.855   -11.293 1.338   1.00 0.00 ? 8  GLY B O    13 
ATOM 9864  H H    . GLY B 2 8  ? 5.598   -9.729  -1.521  1.00 0.00 ? 8  GLY B H    13 
ATOM 9865  H HA2  . GLY B 2 8  ? 3.357   -11.590 -1.734  1.00 0.00 ? 8  GLY B HA2  13 
ATOM 9866  H HA3  . GLY B 2 8  ? 4.873   -11.889 -0.885  1.00 0.00 ? 8  GLY B HA3  13 
ATOM 9867  N N    . SER B 2 9  ? 2.324   -10.136 0.251   1.00 0.00 ? 9  SER B N    13 
ATOM 9868  C CA   . SER B 2 9  ? 1.594   -9.771  1.503   1.00 0.00 ? 9  SER B CA   13 
ATOM 9869  C C    . SER B 2 9  ? 2.235   -8.526  2.127   1.00 0.00 ? 9  SER B C    13 
ATOM 9870  O O    . SER B 2 9  ? 1.595   -7.784  2.845   1.00 0.00 ? 9  SER B O    13 
ATOM 9871  C CB   . SER B 2 9  ? 1.645   -10.930 2.501   1.00 0.00 ? 9  SER B CB   13 
ATOM 9872  O OG   . SER B 2 9  ? 0.600   -10.776 3.453   1.00 0.00 ? 9  SER B OG   13 
ATOM 9873  H H    . SER B 2 9  ? 1.997   -9.810  -0.612  1.00 0.00 ? 9  SER B H    13 
ATOM 9874  H HA   . SER B 2 9  ? 0.563   -9.555  1.262   1.00 0.00 ? 9  SER B HA   13 
ATOM 9875  H HB2  . SER B 2 9  ? 1.514   -11.863 1.979   1.00 0.00 ? 9  SER B HB2  13 
ATOM 9876  H HB3  . SER B 2 9  ? 2.605   -10.931 3.001   1.00 0.00 ? 9  SER B HB3  13 
ATOM 9877  H HG   . SER B 2 9  ? 0.508   -9.840  3.643   1.00 0.00 ? 9  SER B HG   13 
ATOM 9878  N N    . HIS B 2 10 ? 3.492   -8.288  1.859   1.00 0.00 ? 10 HIS B N    13 
ATOM 9879  C CA   . HIS B 2 10 ? 4.163   -7.093  2.434   1.00 0.00 ? 10 HIS B CA   13 
ATOM 9880  C C    . HIS B 2 10 ? 3.615   -5.829  1.769   1.00 0.00 ? 10 HIS B C    13 
ATOM 9881  O O    . HIS B 2 10 ? 3.303   -4.856  2.426   1.00 0.00 ? 10 HIS B O    13 
ATOM 9882  C CB   . HIS B 2 10 ? 5.670   -7.184  2.183   1.00 0.00 ? 10 HIS B CB   13 
ATOM 9883  C CG   . HIS B 2 10 ? 6.239   -8.351  2.942   1.00 0.00 ? 10 HIS B CG   13 
ATOM 9884  N ND1  . HIS B 2 10 ? 7.485   -8.301  3.547   1.00 0.00 ? 10 HIS B ND1  13 
ATOM 9885  C CD2  . HIS B 2 10 ? 5.747   -9.606  3.201   1.00 0.00 ? 10 HIS B CD2  13 
ATOM 9886  C CE1  . HIS B 2 10 ? 7.699   -9.492  4.134   1.00 0.00 ? 10 HIS B CE1  13 
ATOM 9887  N NE2  . HIS B 2 10 ? 6.670   -10.325 3.955   1.00 0.00 ? 10 HIS B NE2  13 
ATOM 9888  H H    . HIS B 2 10 ? 3.992   -8.892  1.282   1.00 0.00 ? 10 HIS B H    13 
ATOM 9889  H HA   . HIS B 2 10 ? 3.977   -7.055  3.494   1.00 0.00 ? 10 HIS B HA   13 
ATOM 9890  H HB2  . HIS B 2 10 ? 5.851   -7.317  1.127   1.00 0.00 ? 10 HIS B HB2  13 
ATOM 9891  H HB3  . HIS B 2 10 ? 6.144   -6.273  2.517   1.00 0.00 ? 10 HIS B HB3  13 
ATOM 9892  H HD1  . HIS B 2 10 ? 8.099   -7.536  3.547   1.00 0.00 ? 10 HIS B HD1  13 
ATOM 9893  H HD2  . HIS B 2 10 ? 4.789   -9.979  2.871   1.00 0.00 ? 10 HIS B HD2  13 
ATOM 9894  H HE1  . HIS B 2 10 ? 8.593   -9.744  4.685   1.00 0.00 ? 10 HIS B HE1  13 
ATOM 9895  N N    . LEU B 2 11 ? 3.504   -5.833  0.467   1.00 0.00 ? 11 LEU B N    13 
ATOM 9896  C CA   . LEU B 2 11 ? 2.986   -4.627  -0.238  1.00 0.00 ? 11 LEU B CA   13 
ATOM 9897  C C    . LEU B 2 11 ? 1.595   -4.278  0.289   1.00 0.00 ? 11 LEU B C    13 
ATOM 9898  O O    . LEU B 2 11 ? 1.308   -3.136  0.589   1.00 0.00 ? 11 LEU B O    13 
ATOM 9899  C CB   . LEU B 2 11 ? 2.900   -4.904  -1.739  1.00 0.00 ? 11 LEU B CB   13 
ATOM 9900  C CG   . LEU B 2 11 ? 2.147   -3.761  -2.419  1.00 0.00 ? 11 LEU B CG   13 
ATOM 9901  C CD1  . LEU B 2 11 ? 2.804   -2.428  -2.053  1.00 0.00 ? 11 LEU B CD1  13 
ATOM 9902  C CD2  . LEU B 2 11 ? 2.194   -3.950  -3.935  1.00 0.00 ? 11 LEU B CD2  13 
ATOM 9903  H H    . LEU B 2 11 ? 3.767   -6.625  -0.045  1.00 0.00 ? 11 LEU B H    13 
ATOM 9904  H HA   . LEU B 2 11 ? 3.652   -3.796  -0.065  1.00 0.00 ? 11 LEU B HA   13 
ATOM 9905  H HB2  . LEU B 2 11 ? 3.897   -4.977  -2.149  1.00 0.00 ? 11 LEU B HB2  13 
ATOM 9906  H HB3  . LEU B 2 11 ? 2.372   -5.831  -1.906  1.00 0.00 ? 11 LEU B HB3  13 
ATOM 9907  H HG   . LEU B 2 11 ? 1.119   -3.758  -2.086  1.00 0.00 ? 11 LEU B HG   13 
ATOM 9908  H HD11 . LEU B 2 11 ? 2.214   -1.615  -2.449  1.00 0.00 ? 11 LEU B HD11 13 
ATOM 9909  H HD12 . LEU B 2 11 ? 3.798   -2.389  -2.473  1.00 0.00 ? 11 LEU B HD12 13 
ATOM 9910  H HD13 . LEU B 2 11 ? 2.863   -2.340  -0.979  1.00 0.00 ? 11 LEU B HD13 13 
ATOM 9911  H HD21 . LEU B 2 11 ? 1.620   -3.171  -4.413  1.00 0.00 ? 11 LEU B HD21 13 
ATOM 9912  H HD22 . LEU B 2 11 ? 1.777   -4.913  -4.191  1.00 0.00 ? 11 LEU B HD22 13 
ATOM 9913  H HD23 . LEU B 2 11 ? 3.219   -3.900  -4.273  1.00 0.00 ? 11 LEU B HD23 13 
ATOM 9914  N N    . VAL B 2 12 ? 0.727   -5.244  0.411   1.00 0.00 ? 12 VAL B N    13 
ATOM 9915  C CA   . VAL B 2 12 ? -0.635  -4.939  0.924   1.00 0.00 ? 12 VAL B CA   13 
ATOM 9916  C C    . VAL B 2 12 ? -0.514  -4.431  2.354   1.00 0.00 ? 12 VAL B C    13 
ATOM 9917  O O    . VAL B 2 12 ? -1.045  -3.395  2.703   1.00 0.00 ? 12 VAL B O    13 
ATOM 9918  C CB   . VAL B 2 12 ? -1.507  -6.196  0.886   1.00 0.00 ? 12 VAL B CB   13 
ATOM 9919  C CG1  . VAL B 2 12 ? -1.718  -6.626  -0.567  1.00 0.00 ? 12 VAL B CG1  13 
ATOM 9920  C CG2  . VAL B 2 12 ? -0.814  -7.324  1.655   1.00 0.00 ? 12 VAL B CG2  13 
ATOM 9921  H H    . VAL B 2 12 ? 0.970   -6.162  0.167   1.00 0.00 ? 12 VAL B H    13 
ATOM 9922  H HA   . VAL B 2 12 ? -1.077  -4.169  0.316   1.00 0.00 ? 12 VAL B HA   13 
ATOM 9923  H HB   . VAL B 2 12 ? -2.464  -5.983  1.340   1.00 0.00 ? 12 VAL B HB   13 
ATOM 9924  H HG11 . VAL B 2 12 ? -2.714  -6.350  -0.882  1.00 0.00 ? 12 VAL B HG11 13 
ATOM 9925  H HG12 . VAL B 2 12 ? -1.599  -7.696  -0.647  1.00 0.00 ? 12 VAL B HG12 13 
ATOM 9926  H HG13 . VAL B 2 12 ? -0.992  -6.134  -1.197  1.00 0.00 ? 12 VAL B HG13 13 
ATOM 9927  H HG21 . VAL B 2 12 ? -0.822  -7.097  2.711   1.00 0.00 ? 12 VAL B HG21 13 
ATOM 9928  H HG22 . VAL B 2 12 ? 0.206   -7.418  1.315   1.00 0.00 ? 12 VAL B HG22 13 
ATOM 9929  H HG23 . VAL B 2 12 ? -1.338  -8.252  1.482   1.00 0.00 ? 12 VAL B HG23 13 
ATOM 9930  N N    . GLU B 2 13 ? 0.206   -5.132  3.178   1.00 0.00 ? 13 GLU B N    13 
ATOM 9931  C CA   . GLU B 2 13 ? 0.385   -4.661  4.571   1.00 0.00 ? 13 GLU B CA   13 
ATOM 9932  C C    . GLU B 2 13 ? 1.036   -3.282  4.512   1.00 0.00 ? 13 GLU B C    13 
ATOM 9933  O O    . GLU B 2 13 ? 0.838   -2.447  5.372   1.00 0.00 ? 13 GLU B O    13 
ATOM 9934  C CB   . GLU B 2 13 ? 1.293   -5.629  5.335   1.00 0.00 ? 13 GLU B CB   13 
ATOM 9935  C CG   . GLU B 2 13 ? 1.333   -5.234  6.812   1.00 0.00 ? 13 GLU B CG   13 
ATOM 9936  C CD   . GLU B 2 13 ? 2.221   -6.215  7.579   1.00 0.00 ? 13 GLU B CD   13 
ATOM 9937  O OE1  . GLU B 2 13 ? 2.305   -7.358  7.162   1.00 0.00 ? 13 GLU B OE1  13 
ATOM 9938  O OE2  . GLU B 2 13 ? 2.804   -5.806  8.570   1.00 0.00 ? 13 GLU B OE2  13 
ATOM 9939  H H    . GLU B 2 13 ? 0.648   -5.952  2.874   1.00 0.00 ? 13 GLU B H    13 
ATOM 9940  H HA   . GLU B 2 13 ? -0.575  -4.592  5.061   1.00 0.00 ? 13 GLU B HA   13 
ATOM 9941  H HB2  . GLU B 2 13 ? 0.907   -6.634  5.240   1.00 0.00 ? 13 GLU B HB2  13 
ATOM 9942  H HB3  . GLU B 2 13 ? 2.291   -5.585  4.926   1.00 0.00 ? 13 GLU B HB3  13 
ATOM 9943  H HG2  . GLU B 2 13 ? 1.732   -4.235  6.907   1.00 0.00 ? 13 GLU B HG2  13 
ATOM 9944  H HG3  . GLU B 2 13 ? 0.333   -5.263  7.220   1.00 0.00 ? 13 GLU B HG3  13 
ATOM 9945  N N    . ALA B 2 14 ? 1.814   -3.041  3.488   1.00 0.00 ? 14 ALA B N    13 
ATOM 9946  C CA   . ALA B 2 14 ? 2.484   -1.721  3.352   1.00 0.00 ? 14 ALA B CA   13 
ATOM 9947  C C    . ALA B 2 14 ? 1.440   -0.652  3.041   1.00 0.00 ? 14 ALA B C    13 
ATOM 9948  O O    . ALA B 2 14 ? 1.405   0.393   3.657   1.00 0.00 ? 14 ALA B O    13 
ATOM 9949  C CB   . ALA B 2 14 ? 3.508   -1.783  2.218   1.00 0.00 ? 14 ALA B CB   13 
ATOM 9950  H H    . ALA B 2 14 ? 1.948   -3.729  2.804   1.00 0.00 ? 14 ALA B H    13 
ATOM 9951  H HA   . ALA B 2 14 ? 2.982   -1.480  4.273   1.00 0.00 ? 14 ALA B HA   13 
ATOM 9952  H HB1  . ALA B 2 14 ? 4.031   -0.840  2.153   1.00 0.00 ? 14 ALA B HB1  13 
ATOM 9953  H HB2  . ALA B 2 14 ? 3.001   -1.979  1.285   1.00 0.00 ? 14 ALA B HB2  13 
ATOM 9954  H HB3  . ALA B 2 14 ? 4.217   -2.574  2.416   1.00 0.00 ? 14 ALA B HB3  13 
ATOM 9955  N N    . LEU B 2 15 ? 0.580   -0.914  2.099   1.00 0.00 ? 15 LEU B N    13 
ATOM 9956  C CA   . LEU B 2 15 ? -0.473  0.081   1.755   1.00 0.00 ? 15 LEU B CA   13 
ATOM 9957  C C    . LEU B 2 15 ? -1.430  0.192   2.932   1.00 0.00 ? 15 LEU B C    13 
ATOM 9958  O O    . LEU B 2 15 ? -1.911  1.259   3.260   1.00 0.00 ? 15 LEU B O    13 
ATOM 9959  C CB   . LEU B 2 15 ? -1.232  -0.378  0.507   1.00 0.00 ? 15 LEU B CB   13 
ATOM 9960  C CG   . LEU B 2 15 ? -2.183  0.728   0.043   1.00 0.00 ? 15 LEU B CG   13 
ATOM 9961  C CD1  . LEU B 2 15 ? -3.371  0.822   1.003   1.00 0.00 ? 15 LEU B CD1  13 
ATOM 9962  C CD2  . LEU B 2 15 ? -1.439  2.065   0.019   1.00 0.00 ? 15 LEU B CD2  13 
ATOM 9963  H H    . LEU B 2 15 ? 0.621   -1.769  1.625   1.00 0.00 ? 15 LEU B H    13 
ATOM 9964  H HA   . LEU B 2 15 ? -0.017  1.045   1.577   1.00 0.00 ? 15 LEU B HA   13 
ATOM 9965  H HB2  . LEU B 2 15 ? -0.526  -0.599  -0.281  1.00 0.00 ? 15 LEU B HB2  13 
ATOM 9966  H HB3  . LEU B 2 15 ? -1.802  -1.265  0.739   1.00 0.00 ? 15 LEU B HB3  13 
ATOM 9967  H HG   . LEU B 2 15 ? -2.543  0.497   -0.950  1.00 0.00 ? 15 LEU B HG   13 
ATOM 9968  H HD11 . LEU B 2 15 ? -3.286  1.721   1.595   1.00 0.00 ? 15 LEU B HD11 13 
ATOM 9969  H HD12 . LEU B 2 15 ? -3.376  -0.039  1.656   1.00 0.00 ? 15 LEU B HD12 13 
ATOM 9970  H HD13 . LEU B 2 15 ? -4.291  0.849   0.438   1.00 0.00 ? 15 LEU B HD13 13 
ATOM 9971  H HD21 . LEU B 2 15 ? -0.376  1.884   -0.052  1.00 0.00 ? 15 LEU B HD21 13 
ATOM 9972  H HD22 . LEU B 2 15 ? -1.651  2.612   0.925   1.00 0.00 ? 15 LEU B HD22 13 
ATOM 9973  H HD23 . LEU B 2 15 ? -1.763  2.641   -0.835  1.00 0.00 ? 15 LEU B HD23 13 
ATOM 9974  N N    . TYR B 2 16 ? -1.694  -0.898  3.586   1.00 0.00 ? 16 TYR B N    13 
ATOM 9975  C CA   . TYR B 2 16 ? -2.597  -0.843  4.757   1.00 0.00 ? 16 TYR B CA   13 
ATOM 9976  C C    . TYR B 2 16 ? -1.889  -0.058  5.860   1.00 0.00 ? 16 TYR B C    13 
ATOM 9977  O O    . TYR B 2 16 ? -2.447  0.835   6.467   1.00 0.00 ? 16 TYR B O    13 
ATOM 9978  C CB   . TYR B 2 16 ? -2.900  -2.262  5.241   1.00 0.00 ? 16 TYR B CB   13 
ATOM 9979  C CG   . TYR B 2 16 ? -4.153  -2.766  4.564   1.00 0.00 ? 16 TYR B CG   13 
ATOM 9980  C CD1  . TYR B 2 16 ? -4.236  -2.780  3.167   1.00 0.00 ? 16 TYR B CD1  13 
ATOM 9981  C CD2  . TYR B 2 16 ? -5.233  -3.217  5.334   1.00 0.00 ? 16 TYR B CD2  13 
ATOM 9982  C CE1  . TYR B 2 16 ? -5.398  -3.245  2.539   1.00 0.00 ? 16 TYR B CE1  13 
ATOM 9983  C CE2  . TYR B 2 16 ? -6.394  -3.681  4.706   1.00 0.00 ? 16 TYR B CE2  13 
ATOM 9984  C CZ   . TYR B 2 16 ? -6.477  -3.695  3.308   1.00 0.00 ? 16 TYR B CZ   13 
ATOM 9985  O OH   . TYR B 2 16 ? -7.622  -4.153  2.689   1.00 0.00 ? 16 TYR B OH   13 
ATOM 9986  H H    . TYR B 2 16 ? -1.283  -1.746  3.317   1.00 0.00 ? 16 TYR B H    13 
ATOM 9987  H HA   . TYR B 2 16 ? -3.511  -0.348  4.485   1.00 0.00 ? 16 TYR B HA   13 
ATOM 9988  H HB2  . TYR B 2 16 ? -2.072  -2.911  4.996   1.00 0.00 ? 16 TYR B HB2  13 
ATOM 9989  H HB3  . TYR B 2 16 ? -3.048  -2.254  6.311   1.00 0.00 ? 16 TYR B HB3  13 
ATOM 9990  H HD1  . TYR B 2 16 ? -3.403  -2.433  2.573   1.00 0.00 ? 16 TYR B HD1  13 
ATOM 9991  H HD2  . TYR B 2 16 ? -5.169  -3.206  6.412   1.00 0.00 ? 16 TYR B HD2  13 
ATOM 9992  H HE1  . TYR B 2 16 ? -5.462  -3.255  1.460   1.00 0.00 ? 16 TYR B HE1  13 
ATOM 9993  H HE2  . TYR B 2 16 ? -7.227  -4.029  5.299   1.00 0.00 ? 16 TYR B HE2  13 
ATOM 9994  H HH   . TYR B 2 16 ? -7.600  -3.867  1.773   1.00 0.00 ? 16 TYR B HH   13 
ATOM 9995  N N    . LEU B 2 17 ? -0.656  -0.395  6.119   1.00 0.00 ? 17 LEU B N    13 
ATOM 9996  C CA   . LEU B 2 17 ? 0.118   0.311   7.178   1.00 0.00 ? 17 LEU B CA   13 
ATOM 9997  C C    . LEU B 2 17 ? 0.449   1.747   6.757   1.00 0.00 ? 17 LEU B C    13 
ATOM 9998  O O    . LEU B 2 17 ? 0.337   2.667   7.543   1.00 0.00 ? 17 LEU B O    13 
ATOM 9999  C CB   . LEU B 2 17 ? 1.413   -0.453  7.459   1.00 0.00 ? 17 LEU B CB   13 
ATOM 10000 C CG   . LEU B 2 17 ? 2.003   0.016   8.791   1.00 0.00 ? 17 LEU B CG   13 
ATOM 10001 C CD1  . LEU B 2 17 ? 1.395   -0.800  9.934   1.00 0.00 ? 17 LEU B CD1  13 
ATOM 10002 C CD2  . LEU B 2 17 ? 3.519   -0.185  8.774   1.00 0.00 ? 17 LEU B CD2  13 
ATOM 10003 H H    . LEU B 2 17 ? -0.237  -1.120  5.611   1.00 0.00 ? 17 LEU B H    13 
ATOM 10004 H HA   . LEU B 2 17 ? -0.475  0.344   8.073   1.00 0.00 ? 17 LEU B HA   13 
ATOM 10005 H HB2  . LEU B 2 17 ? 1.202   -1.511  7.511   1.00 0.00 ? 17 LEU B HB2  13 
ATOM 10006 H HB3  . LEU B 2 17 ? 2.122   -0.264  6.668   1.00 0.00 ? 17 LEU B HB3  13 
ATOM 10007 H HG   . LEU B 2 17 ? 1.777   1.062   8.936   1.00 0.00 ? 17 LEU B HG   13 
ATOM 10008 H HD11 . LEU B 2 17 ? 1.858   -1.774  9.967   1.00 0.00 ? 17 LEU B HD11 13 
ATOM 10009 H HD12 . LEU B 2 17 ? 0.333   -0.911  9.771   1.00 0.00 ? 17 LEU B HD12 13 
ATOM 10010 H HD13 . LEU B 2 17 ? 1.564   -0.289  10.870  1.00 0.00 ? 17 LEU B HD13 13 
ATOM 10011 H HD21 . LEU B 2 17 ? 3.747   -1.228  8.938   1.00 0.00 ? 17 LEU B HD21 13 
ATOM 10012 H HD22 . LEU B 2 17 ? 3.970   0.409   9.556   1.00 0.00 ? 17 LEU B HD22 13 
ATOM 10013 H HD23 . LEU B 2 17 ? 3.913   0.123   7.816   1.00 0.00 ? 17 LEU B HD23 13 
ATOM 10014 N N    . VAL B 2 18 ? 0.866   1.957   5.536   1.00 0.00 ? 18 VAL B N    13 
ATOM 10015 C CA   . VAL B 2 18 ? 1.206   3.348   5.112   1.00 0.00 ? 18 VAL B CA   13 
ATOM 10016 C C    . VAL B 2 18 ? -0.010  4.235   5.346   1.00 0.00 ? 18 VAL B C    13 
ATOM 10017 O O    . VAL B 2 18 ? 0.083   5.302   5.919   1.00 0.00 ? 18 VAL B O    13 
ATOM 10018 C CB   . VAL B 2 18 ? 1.576   3.383   3.624   1.00 0.00 ? 18 VAL B CB   13 
ATOM 10019 C CG1  . VAL B 2 18 ? 2.802   2.508   3.362   1.00 0.00 ? 18 VAL B CG1  13 
ATOM 10020 C CG2  . VAL B 2 18 ? 0.401   2.878   2.802   1.00 0.00 ? 18 VAL B CG2  13 
ATOM 10021 H H    . VAL B 2 18 ? 0.961   1.208   4.913   1.00 0.00 ? 18 VAL B H    13 
ATOM 10022 H HA   . VAL B 2 18 ? 2.033   3.711   5.700   1.00 0.00 ? 18 VAL B HA   13 
ATOM 10023 H HB   . VAL B 2 18 ? 1.797   4.392   3.332   1.00 0.00 ? 18 VAL B HB   13 
ATOM 10024 H HG11 . VAL B 2 18 ? 3.065   1.976   4.264   1.00 0.00 ? 18 VAL B HG11 13 
ATOM 10025 H HG12 . VAL B 2 18 ? 3.630   3.132   3.058   1.00 0.00 ? 18 VAL B HG12 13 
ATOM 10026 H HG13 . VAL B 2 18 ? 2.578   1.801   2.578   1.00 0.00 ? 18 VAL B HG13 13 
ATOM 10027 H HG21 . VAL B 2 18 ? 0.711   2.740   1.777   1.00 0.00 ? 18 VAL B HG21 13 
ATOM 10028 H HG22 . VAL B 2 18 ? -0.403  3.599   2.841   1.00 0.00 ? 18 VAL B HG22 13 
ATOM 10029 H HG23 . VAL B 2 18 ? 0.062   1.939   3.206   1.00 0.00 ? 18 VAL B HG23 13 
ATOM 10030 N N    . CYS B 2 19 ? -1.154  3.793   4.917   1.00 0.00 ? 19 CYS B N    13 
ATOM 10031 C CA   . CYS B 2 19 ? -2.386  4.598   5.124   1.00 0.00 ? 19 CYS B CA   13 
ATOM 10032 C C    . CYS B 2 19 ? -3.581  3.805   4.612   1.00 0.00 ? 19 CYS B C    13 
ATOM 10033 O O    . CYS B 2 19 ? -4.546  4.355   4.121   1.00 0.00 ? 19 CYS B O    13 
ATOM 10034 C CB   . CYS B 2 19 ? -2.279  5.915   4.361   1.00 0.00 ? 19 CYS B CB   13 
ATOM 10035 S SG   . CYS B 2 19 ? -2.410  7.293   5.525   1.00 0.00 ? 19 CYS B SG   13 
ATOM 10036 H H    . CYS B 2 19 ? -1.205  2.922   4.461   1.00 0.00 ? 19 CYS B H    13 
ATOM 10037 H HA   . CYS B 2 19 ? -2.513  4.799   6.178   1.00 0.00 ? 19 CYS B HA   13 
ATOM 10038 H HB2  . CYS B 2 19 ? -1.329  5.960   3.854   1.00 0.00 ? 19 CYS B HB2  13 
ATOM 10039 H HB3  . CYS B 2 19 ? -3.078  5.977   3.639   1.00 0.00 ? 19 CYS B HB3  13 
ATOM 10040 N N    . GLY B 2 20 ? -3.520  2.510   4.724   1.00 0.00 ? 20 GLY B N    13 
ATOM 10041 C CA   . GLY B 2 20 ? -4.650  1.672   4.245   1.00 0.00 ? 20 GLY B CA   13 
ATOM 10042 C C    . GLY B 2 20 ? -5.222  0.879   5.420   1.00 0.00 ? 20 GLY B C    13 
ATOM 10043 O O    . GLY B 2 20 ? -5.839  -0.152  5.247   1.00 0.00 ? 20 GLY B O    13 
ATOM 10044 H H    . GLY B 2 20 ? -2.727  2.089   5.127   1.00 0.00 ? 20 GLY B H    13 
ATOM 10045 H HA2  . GLY B 2 20 ? -5.417  2.311   3.831   1.00 0.00 ? 20 GLY B HA2  13 
ATOM 10046 H HA3  . GLY B 2 20 ? -4.301  0.990   3.486   1.00 0.00 ? 20 GLY B HA3  13 
ATOM 10047 N N    . GLU B 2 21 ? -5.016  1.356   6.616   1.00 0.00 ? 21 GLU B N    13 
ATOM 10048 C CA   . GLU B 2 21 ? -5.547  0.642   7.808   1.00 0.00 ? 21 GLU B CA   13 
ATOM 10049 C C    . GLU B 2 21 ? -6.564  1.545   8.503   1.00 0.00 ? 21 GLU B C    13 
ATOM 10050 O O    . GLU B 2 21 ? -7.482  1.085   9.152   1.00 0.00 ? 21 GLU B O    13 
ATOM 10051 C CB   . GLU B 2 21 ? -4.401  0.323   8.770   1.00 0.00 ? 21 GLU B CB   13 
ATOM 10052 C CG   . GLU B 2 21 ? -4.951  -0.412  9.995   1.00 0.00 ? 21 GLU B CG   13 
ATOM 10053 C CD   . GLU B 2 21 ? -3.808  -0.718  10.964  1.00 0.00 ? 21 GLU B CD   13 
ATOM 10054 O OE1  . GLU B 2 21 ? -2.739  -1.075  10.495  1.00 0.00 ? 21 GLU B OE1  13 
ATOM 10055 O OE2  . GLU B 2 21 ? -4.020  -0.590  12.158  1.00 0.00 ? 21 GLU B OE2  13 
ATOM 10056 H H    . GLU B 2 21 ? -4.514  2.190   6.730   1.00 0.00 ? 21 GLU B H    13 
ATOM 10057 H HA   . GLU B 2 21 ? -6.028  -0.274  7.498   1.00 0.00 ? 21 GLU B HA   13 
ATOM 10058 H HB2  . GLU B 2 21 ? -3.675  -0.303  8.270   1.00 0.00 ? 21 GLU B HB2  13 
ATOM 10059 H HB3  . GLU B 2 21 ? -3.929  1.241   9.086   1.00 0.00 ? 21 GLU B HB3  13 
ATOM 10060 H HG2  . GLU B 2 21 ? -5.685  0.210   10.487  1.00 0.00 ? 21 GLU B HG2  13 
ATOM 10061 H HG3  . GLU B 2 21 ? -5.413  -1.336  9.683   1.00 0.00 ? 21 GLU B HG3  13 
ATOM 10062 N N    . ARG B 2 22 ? -6.405  2.833   8.363   1.00 0.00 ? 22 ARG B N    13 
ATOM 10063 C CA   . ARG B 2 22 ? -7.356  3.776   9.000   1.00 0.00 ? 22 ARG B CA   13 
ATOM 10064 C C    . ARG B 2 22 ? -8.553  3.981   8.075   1.00 0.00 ? 22 ARG B C    13 
ATOM 10065 O O    . ARG B 2 22 ? -9.692  3.838   8.474   1.00 0.00 ? 22 ARG B O    13 
ATOM 10066 C CB   . ARG B 2 22 ? -6.660  5.116   9.249   1.00 0.00 ? 22 ARG B CB   13 
ATOM 10067 C CG   . ARG B 2 22 ? -5.983  5.092   10.620  1.00 0.00 ? 22 ARG B CG   13 
ATOM 10068 C CD   . ARG B 2 22 ? -6.711  6.048   11.566  1.00 0.00 ? 22 ARG B CD   13 
ATOM 10069 N NE   . ARG B 2 22 ? -5.793  7.153   11.959  1.00 0.00 ? 22 ARG B NE   13 
ATOM 10070 C CZ   . ARG B 2 22 ? -6.130  7.972   12.918  1.00 0.00 ? 22 ARG B CZ   13 
ATOM 10071 N NH1  . ARG B 2 22 ? -7.381  8.306   13.080  1.00 0.00 ? 22 ARG B NH1  13 
ATOM 10072 N NH2  . ARG B 2 22 ? -5.217  8.457   13.714  1.00 0.00 ? 22 ARG B NH2  13 
ATOM 10073 H H    . ARG B 2 22 ? -5.663  3.178   7.833   1.00 0.00 ? 22 ARG B H    13 
ATOM 10074 H HA   . ARG B 2 22 ? -7.688  3.364   9.933   1.00 0.00 ? 22 ARG B HA   13 
ATOM 10075 H HB2  . ARG B 2 22 ? -5.917  5.283   8.482   1.00 0.00 ? 22 ARG B HB2  13 
ATOM 10076 H HB3  . ARG B 2 22 ? -7.389  5.911   9.223   1.00 0.00 ? 22 ARG B HB3  13 
ATOM 10077 H HG2  . ARG B 2 22 ? -6.020  4.089   11.022  1.00 0.00 ? 22 ARG B HG2  13 
ATOM 10078 H HG3  . ARG B 2 22 ? -4.954  5.402   10.520  1.00 0.00 ? 22 ARG B HG3  13 
ATOM 10079 H HD2  . ARG B 2 22 ? -7.576  6.460   11.066  1.00 0.00 ? 22 ARG B HD2  13 
ATOM 10080 H HD3  . ARG B 2 22 ? -7.027  5.512   12.448  1.00 0.00 ? 22 ARG B HD3  13 
ATOM 10081 H HE   . ARG B 2 22 ? -4.936  7.266   11.497  1.00 0.00 ? 22 ARG B HE   13 
ATOM 10082 H HH11 . ARG B 2 22 ? -8.081  7.934   12.470  1.00 0.00 ? 22 ARG B HH11 13 
ATOM 10083 H HH12 . ARG B 2 22 ? -7.640  8.933   13.815  1.00 0.00 ? 22 ARG B HH12 13 
ATOM 10084 H HH21 . ARG B 2 22 ? -4.258  8.201   13.589  1.00 0.00 ? 22 ARG B HH21 13 
ATOM 10085 H HH22 . ARG B 2 22 ? -5.476  9.084   14.449  1.00 0.00 ? 22 ARG B HH22 13 
ATOM 10086 N N    . GLY B 2 23 ? -8.303  4.308   6.839   1.00 0.00 ? 23 GLY B N    13 
ATOM 10087 C CA   . GLY B 2 23 ? -9.427  4.514   5.881   1.00 0.00 ? 23 GLY B CA   13 
ATOM 10088 C C    . GLY B 2 23 ? -9.549  3.287   4.976   1.00 0.00 ? 23 GLY B C    13 
ATOM 10089 O O    . GLY B 2 23 ? -9.535  3.394   3.766   1.00 0.00 ? 23 GLY B O    13 
ATOM 10090 H H    . GLY B 2 23 ? -7.373  4.413   6.539   1.00 0.00 ? 23 GLY B H    13 
ATOM 10091 H HA2  . GLY B 2 23 ? -10.348 4.653   6.431   1.00 0.00 ? 23 GLY B HA2  13 
ATOM 10092 H HA3  . GLY B 2 23 ? -9.231  5.387   5.277   1.00 0.00 ? 23 GLY B HA3  13 
ATOM 10093 N N    . PHE B 2 24 ? -9.661  2.121   5.553   1.00 0.00 ? 24 PHE B N    13 
ATOM 10094 C CA   . PHE B 2 24 ? -9.772  0.886   4.725   1.00 0.00 ? 24 PHE B CA   13 
ATOM 10095 C C    . PHE B 2 24 ? -10.748 -0.094  5.383   1.00 0.00 ? 24 PHE B C    13 
ATOM 10096 O O    . PHE B 2 24 ? -10.794 -1.259  5.040   1.00 0.00 ? 24 PHE B O    13 
ATOM 10097 C CB   . PHE B 2 24 ? -8.395  0.230   4.620   1.00 0.00 ? 24 PHE B CB   13 
ATOM 10098 C CG   . PHE B 2 24 ? -7.811  0.483   3.250   1.00 0.00 ? 24 PHE B CG   13 
ATOM 10099 C CD1  . PHE B 2 24 ? -7.464  1.783   2.865   1.00 0.00 ? 24 PHE B CD1  13 
ATOM 10100 C CD2  . PHE B 2 24 ? -7.619  -0.583  2.364   1.00 0.00 ? 24 PHE B CD2  13 
ATOM 10101 C CE1  . PHE B 2 24 ? -6.924  2.018   1.595   1.00 0.00 ? 24 PHE B CE1  13 
ATOM 10102 C CE2  . PHE B 2 24 ? -7.079  -0.349  1.094   1.00 0.00 ? 24 PHE B CE2  13 
ATOM 10103 C CZ   . PHE B 2 24 ? -6.732  0.951   0.709   1.00 0.00 ? 24 PHE B CZ   13 
ATOM 10104 H H    . PHE B 2 24 ? -9.664  2.057   6.531   1.00 0.00 ? 24 PHE B H    13 
ATOM 10105 H HA   . PHE B 2 24 ? -10.126 1.142   3.738   1.00 0.00 ? 24 PHE B HA   13 
ATOM 10106 H HB2  . PHE B 2 24 ? -7.744  0.650   5.372   1.00 0.00 ? 24 PHE B HB2  13 
ATOM 10107 H HB3  . PHE B 2 24 ? -8.490  -0.834  4.780   1.00 0.00 ? 24 PHE B HB3  13 
ATOM 10108 H HD1  . PHE B 2 24 ? -7.608  2.605   3.549   1.00 0.00 ? 24 PHE B HD1  13 
ATOM 10109 H HD2  . PHE B 2 24 ? -7.884  -1.587  2.661   1.00 0.00 ? 24 PHE B HD2  13 
ATOM 10110 H HE1  . PHE B 2 24 ? -6.656  3.022   1.299   1.00 0.00 ? 24 PHE B HE1  13 
ATOM 10111 H HE2  . PHE B 2 24 ? -6.931  -1.172  0.410   1.00 0.00 ? 24 PHE B HE2  13 
ATOM 10112 H HZ   . PHE B 2 24 ? -6.316  1.131   -0.271  1.00 0.00 ? 24 PHE B HZ   13 
ATOM 10113 N N    . PHE B 2 25 ? -11.528 0.363   6.325   1.00 0.00 ? 25 PHE B N    13 
ATOM 10114 C CA   . PHE B 2 25 ? -12.493 -0.554  6.998   1.00 0.00 ? 25 PHE B CA   13 
ATOM 10115 C C    . PHE B 2 25 ? -13.823 -0.548  6.239   1.00 0.00 ? 25 PHE B C    13 
ATOM 10116 O O    . PHE B 2 25 ? -14.583 0.398   6.301   1.00 0.00 ? 25 PHE B O    13 
ATOM 10117 C CB   . PHE B 2 25 ? -12.717 -0.104  8.448   1.00 0.00 ? 25 PHE B CB   13 
ATOM 10118 C CG   . PHE B 2 25 ? -13.295 1.293   8.480   1.00 0.00 ? 25 PHE B CG   13 
ATOM 10119 C CD1  . PHE B 2 25 ? -12.449 2.404   8.381   1.00 0.00 ? 25 PHE B CD1  13 
ATOM 10120 C CD2  . PHE B 2 25 ? -14.677 1.476   8.617   1.00 0.00 ? 25 PHE B CD2  13 
ATOM 10121 C CE1  . PHE B 2 25 ? -12.984 3.697   8.417   1.00 0.00 ? 25 PHE B CE1  13 
ATOM 10122 C CE2  . PHE B 2 25 ? -15.212 2.770   8.653   1.00 0.00 ? 25 PHE B CE2  13 
ATOM 10123 C CZ   . PHE B 2 25 ? -14.365 3.880   8.552   1.00 0.00 ? 25 PHE B CZ   13 
ATOM 10124 H H    . PHE B 2 25 ? -11.476 1.304   6.589   1.00 0.00 ? 25 PHE B H    13 
ATOM 10125 H HA   . PHE B 2 25 ? -12.090 -1.556  6.995   1.00 0.00 ? 25 PHE B HA   13 
ATOM 10126 H HB2  . PHE B 2 25 ? -13.403 -0.785  8.931   1.00 0.00 ? 25 PHE B HB2  13 
ATOM 10127 H HB3  . PHE B 2 25 ? -11.775 -0.113  8.974   1.00 0.00 ? 25 PHE B HB3  13 
ATOM 10128 H HD1  . PHE B 2 25 ? -11.384 2.264   8.275   1.00 0.00 ? 25 PHE B HD1  13 
ATOM 10129 H HD2  . PHE B 2 25 ? -15.330 0.620   8.695   1.00 0.00 ? 25 PHE B HD2  13 
ATOM 10130 H HE1  . PHE B 2 25 ? -12.331 4.554   8.340   1.00 0.00 ? 25 PHE B HE1  13 
ATOM 10131 H HE2  . PHE B 2 25 ? -16.277 2.911   8.757   1.00 0.00 ? 25 PHE B HE2  13 
ATOM 10132 H HZ   . PHE B 2 25 ? -14.778 4.878   8.580   1.00 0.00 ? 25 PHE B HZ   13 
ATOM 10133 N N    . TYR B 2 26 ? -14.108 -1.599  5.519   1.00 0.00 ? 26 TYR B N    13 
ATOM 10134 C CA   . TYR B 2 26 ? -15.386 -1.657  4.756   1.00 0.00 ? 26 TYR B CA   13 
ATOM 10135 C C    . TYR B 2 26 ? -16.031 -3.038  4.944   1.00 0.00 ? 26 TYR B C    13 
ATOM 10136 O O    . TYR B 2 26 ? -15.429 -4.043  4.621   1.00 0.00 ? 26 TYR B O    13 
ATOM 10137 C CB   . TYR B 2 26 ? -15.099 -1.432  3.270   1.00 0.00 ? 26 TYR B CB   13 
ATOM 10138 C CG   . TYR B 2 26 ? -14.697 0.006   3.048   1.00 0.00 ? 26 TYR B CG   13 
ATOM 10139 C CD1  . TYR B 2 26 ? -15.531 1.042   3.487   1.00 0.00 ? 26 TYR B CD1  13 
ATOM 10140 C CD2  . TYR B 2 26 ? -13.491 0.305   2.404   1.00 0.00 ? 26 TYR B CD2  13 
ATOM 10141 C CE1  . TYR B 2 26 ? -15.159 2.375   3.282   1.00 0.00 ? 26 TYR B CE1  13 
ATOM 10142 C CE2  . TYR B 2 26 ? -13.118 1.639   2.199   1.00 0.00 ? 26 TYR B CE2  13 
ATOM 10143 C CZ   . TYR B 2 26 ? -13.952 2.674   2.638   1.00 0.00 ? 26 TYR B CZ   13 
ATOM 10144 O OH   . TYR B 2 26 ? -13.585 3.989   2.436   1.00 0.00 ? 26 TYR B OH   13 
ATOM 10145 H H    . TYR B 2 26 ? -13.480 -2.351  5.481   1.00 0.00 ? 26 TYR B H    13 
ATOM 10146 H HA   . TYR B 2 26 ? -16.050 -0.887  5.113   1.00 0.00 ? 26 TYR B HA   13 
ATOM 10147 H HB2  . TYR B 2 26 ? -14.297 -2.083  2.955   1.00 0.00 ? 26 TYR B HB2  13 
ATOM 10148 H HB3  . TYR B 2 26 ? -15.986 -1.650  2.694   1.00 0.00 ? 26 TYR B HB3  13 
ATOM 10149 H HD1  . TYR B 2 26 ? -16.462 0.811   3.984   1.00 0.00 ? 26 TYR B HD1  13 
ATOM 10150 H HD2  . TYR B 2 26 ? -12.848 -0.494  2.065   1.00 0.00 ? 26 TYR B HD2  13 
ATOM 10151 H HE1  . TYR B 2 26 ? -15.802 3.174   3.622   1.00 0.00 ? 26 TYR B HE1  13 
ATOM 10152 H HE2  . TYR B 2 26 ? -12.188 1.869   1.702   1.00 0.00 ? 26 TYR B HE2  13 
ATOM 10153 H HH   . TYR B 2 26 ? -14.111 4.537   3.022   1.00 0.00 ? 26 TYR B HH   13 
ATOM 10154 N N    . PRO B 2 27 ? -17.236 -3.052  5.460   1.00 0.00 ? 27 PRO B N    13 
ATOM 10155 C CA   . PRO B 2 27 ? -17.980 -4.303  5.698   1.00 0.00 ? 27 PRO B CA   13 
ATOM 10156 C C    . PRO B 2 27 ? -18.576 -4.827  4.387   1.00 0.00 ? 27 PRO B C    13 
ATOM 10157 O O    . PRO B 2 27 ? -19.164 -4.088  3.623   1.00 0.00 ? 27 PRO B O    13 
ATOM 10158 C CB   . PRO B 2 27 ? -19.085 -3.885  6.670   1.00 0.00 ? 27 PRO B CB   13 
ATOM 10159 C CG   . PRO B 2 27 ? -19.268 -2.359  6.493   1.00 0.00 ? 27 PRO B CG   13 
ATOM 10160 C CD   . PRO B 2 27 ? -17.970 -1.831  5.853   1.00 0.00 ? 27 PRO B CD   13 
ATOM 10161 H HA   . PRO B 2 27 ? -17.345 -5.045  6.154   1.00 0.00 ? 27 PRO B HA   13 
ATOM 10162 H HB2  . PRO B 2 27 ? -20.004 -4.403  6.431   1.00 0.00 ? 27 PRO B HB2  13 
ATOM 10163 H HB3  . PRO B 2 27 ? -18.789 -4.100  7.685   1.00 0.00 ? 27 PRO B HB3  13 
ATOM 10164 H HG2  . PRO B 2 27 ? -20.111 -2.161  5.845   1.00 0.00 ? 27 PRO B HG2  13 
ATOM 10165 H HG3  . PRO B 2 27 ? -19.418 -1.889  7.452   1.00 0.00 ? 27 PRO B HG3  13 
ATOM 10166 H HD2  . PRO B 2 27 ? -18.196 -1.226  4.986   1.00 0.00 ? 27 PRO B HD2  13 
ATOM 10167 H HD3  . PRO B 2 27 ? -17.395 -1.267  6.572   1.00 0.00 ? 27 PRO B HD3  13 
ATOM 10168 N N    . THR B 2 28 ? -18.429 -6.097  4.123   1.00 0.00 ? 28 THR B N    13 
ATOM 10169 C CA   . THR B 2 28 ? -18.988 -6.665  2.864   1.00 0.00 ? 28 THR B CA   13 
ATOM 10170 C C    . THR B 2 28 ? -18.111 -6.247  1.681   1.00 0.00 ? 28 THR B C    13 
ATOM 10171 O O    . THR B 2 28 ? -18.182 -5.130  1.208   1.00 0.00 ? 28 THR B O    13 
ATOM 10172 C CB   . THR B 2 28 ? -20.411 -6.142  2.653   1.00 0.00 ? 28 THR B CB   13 
ATOM 10173 O OG1  . THR B 2 28 ? -21.088 -6.102  3.902   1.00 0.00 ? 28 THR B OG1  13 
ATOM 10174 C CG2  . THR B 2 28 ? -21.160 -7.068  1.693   1.00 0.00 ? 28 THR B CG2  13 
ATOM 10175 H H    . THR B 2 28 ? -17.952 -6.676  4.752   1.00 0.00 ? 28 THR B H    13 
ATOM 10176 H HA   . THR B 2 28 ? -19.007 -7.743  2.933   1.00 0.00 ? 28 THR B HA   13 
ATOM 10177 H HB   . THR B 2 28 ? -20.372 -5.150  2.232   1.00 0.00 ? 28 THR B HB   13 
ATOM 10178 H HG1  . THR B 2 28 ? -21.934 -5.667  3.767   1.00 0.00 ? 28 THR B HG1  13 
ATOM 10179 H HG21 . THR B 2 28 ? -20.463 -7.495  0.988   1.00 0.00 ? 28 THR B HG21 13 
ATOM 10180 H HG22 . THR B 2 28 ? -21.911 -6.503  1.161   1.00 0.00 ? 28 THR B HG22 13 
ATOM 10181 H HG23 . THR B 2 28 ? -21.636 -7.859  2.254   1.00 0.00 ? 28 THR B HG23 13 
ATOM 10182 N N    . LYS B 2 29 ? -17.287 -7.136  1.199   1.00 0.00 ? 29 LYS B N    13 
ATOM 10183 C CA   . LYS B 2 29 ? -16.409 -6.790  0.047   1.00 0.00 ? 29 LYS B CA   13 
ATOM 10184 C C    . LYS B 2 29 ? -17.155 -7.061  -1.260  1.00 0.00 ? 29 LYS B C    13 
ATOM 10185 O O    . LYS B 2 29 ? -17.646 -8.148  -1.493  1.00 0.00 ? 29 LYS B O    13 
ATOM 10186 C CB   . LYS B 2 29 ? -15.138 -7.644  0.097   1.00 0.00 ? 29 LYS B CB   13 
ATOM 10187 C CG   . LYS B 2 29 ? -14.387 -7.527  -1.231  1.00 0.00 ? 29 LYS B CG   13 
ATOM 10188 C CD   . LYS B 2 29 ? -12.976 -6.991  -0.976  1.00 0.00 ? 29 LYS B CD   13 
ATOM 10189 C CE   . LYS B 2 29 ? -11.980 -8.151  -0.977  1.00 0.00 ? 29 LYS B CE   13 
ATOM 10190 N NZ   . LYS B 2 29 ? -10.613 -7.633  -1.271  1.00 0.00 ? 29 LYS B NZ   13 
ATOM 10191 H H    . LYS B 2 29 ? -17.246 -8.032  1.594   1.00 0.00 ? 29 LYS B H    13 
ATOM 10192 H HA   . LYS B 2 29 ? -16.142 -5.744  0.099   1.00 0.00 ? 29 LYS B HA   13 
ATOM 10193 H HB2  . LYS B 2 29 ? -14.505 -7.298  0.902   1.00 0.00 ? 29 LYS B HB2  13 
ATOM 10194 H HB3  . LYS B 2 29 ? -15.405 -8.676  0.268   1.00 0.00 ? 29 LYS B HB3  13 
ATOM 10195 H HG2  . LYS B 2 29 ? -14.324 -8.500  -1.696  1.00 0.00 ? 29 LYS B HG2  13 
ATOM 10196 H HG3  . LYS B 2 29 ? -14.914 -6.849  -1.885  1.00 0.00 ? 29 LYS B HG3  13 
ATOM 10197 H HD2  . LYS B 2 29 ? -12.713 -6.288  -1.754  1.00 0.00 ? 29 LYS B HD2  13 
ATOM 10198 H HD3  . LYS B 2 29 ? -12.948 -6.495  -0.018  1.00 0.00 ? 29 LYS B HD3  13 
ATOM 10199 H HE2  . LYS B 2 29 ? -11.983 -8.630  -0.009  1.00 0.00 ? 29 LYS B HE2  13 
ATOM 10200 H HE3  . LYS B 2 29 ? -12.263 -8.868  -1.734  1.00 0.00 ? 29 LYS B HE3  13 
ATOM 10201 H HZ1  . LYS B 2 29 ? -10.085 -8.339  -1.821  1.00 0.00 ? 29 LYS B HZ1  13 
ATOM 10202 H HZ2  . LYS B 2 29 ? -10.115 -7.445  -0.376  1.00 0.00 ? 29 LYS B HZ2  13 
ATOM 10203 H HZ3  . LYS B 2 29 ? -10.686 -6.753  -1.819  1.00 0.00 ? 29 LYS B HZ3  13 
ATOM 10204 N N    . THR B 2 30 ? -17.243 -6.082  -2.117  1.00 0.00 ? 30 THR B N    13 
ATOM 10205 C CA   . THR B 2 30 ? -17.956 -6.283  -3.409  1.00 0.00 ? 30 THR B CA   13 
ATOM 10206 C C    . THR B 2 30 ? -19.267 -7.031  -3.158  1.00 0.00 ? 30 THR B C    13 
ATOM 10207 O O    . THR B 2 30 ? -19.611 -7.873  -3.971  1.00 0.00 ? 30 THR B O    13 
ATOM 10208 C CB   . THR B 2 30 ? -17.073 -7.103  -4.354  1.00 0.00 ? 30 THR B CB   13 
ATOM 10209 O OG1  . THR B 2 30 ? -15.822 -7.356  -3.728  1.00 0.00 ? 30 THR B OG1  13 
ATOM 10210 C CG2  . THR B 2 30 ? -16.848 -6.324  -5.650  1.00 0.00 ? 30 THR B CG2  13 
ATOM 10211 O OXT  . THR B 2 30 ? -19.904 -6.749  -2.157  1.00 0.00 ? 30 THR B OXT  13 
ATOM 10212 H H    . THR B 2 30 ? -16.839 -5.213  -1.910  1.00 0.00 ? 30 THR B H    13 
ATOM 10213 H HA   . THR B 2 30 ? -18.169 -5.324  -3.857  1.00 0.00 ? 30 THR B HA   13 
ATOM 10214 H HB   . THR B 2 30 ? -17.559 -8.039  -4.581  1.00 0.00 ? 30 THR B HB   13 
ATOM 10215 H HG1  . THR B 2 30 ? -15.678 -8.305  -3.726  1.00 0.00 ? 30 THR B HG1  13 
ATOM 10216 H HG21 . THR B 2 30 ? -16.606 -5.298  -5.416  1.00 0.00 ? 30 THR B HG21 13 
ATOM 10217 H HG22 . THR B 2 30 ? -17.746 -6.355  -6.249  1.00 0.00 ? 30 THR B HG22 13 
ATOM 10218 H HG23 . THR B 2 30 ? -16.033 -6.769  -6.201  1.00 0.00 ? 30 THR B HG23 13 
ATOM 10219 N N    . GLY A 1 1  ? -0.125  -2.147  -9.553  1.00 0.00 ? 1  GLY A N    14 
ATOM 10220 C CA   . GLY A 1 1  ? 0.137   -0.811  -8.947  1.00 0.00 ? 1  GLY A CA   14 
ATOM 10221 C C    . GLY A 1 1  ? 1.562   -0.767  -8.394  1.00 0.00 ? 1  GLY A C    14 
ATOM 10222 O O    . GLY A 1 1  ? 2.410   -1.553  -8.769  1.00 0.00 ? 1  GLY A O    14 
ATOM 10223 H H1   . GLY A 1 1  ? -0.265  -2.849  -8.800  1.00 0.00 ? 1  GLY A H1   14 
ATOM 10224 H H2   . GLY A 1 1  ? 0.688   -2.426  -10.141 1.00 0.00 ? 1  GLY A H2   14 
ATOM 10225 H H3   . GLY A 1 1  ? -0.980  -2.099  -10.143 1.00 0.00 ? 1  GLY A H3   14 
ATOM 10226 H HA2  . GLY A 1 1  ? 0.017   -0.045  -9.700  1.00 0.00 ? 1  GLY A HA2  14 
ATOM 10227 H HA3  . GLY A 1 1  ? -0.563  -0.637  -8.143  1.00 0.00 ? 1  GLY A HA3  14 
ATOM 10228 N N    . ILE A 1 2  ? 1.833   0.148   -7.504  1.00 0.00 ? 2  ILE A N    14 
ATOM 10229 C CA   . ILE A 1 2  ? 3.203   0.247   -6.924  1.00 0.00 ? 2  ILE A CA   14 
ATOM 10230 C C    . ILE A 1 2  ? 3.431   -0.907  -5.947  1.00 0.00 ? 2  ILE A C    14 
ATOM 10231 O O    . ILE A 1 2  ? 4.539   -1.374  -5.772  1.00 0.00 ? 2  ILE A O    14 
ATOM 10232 C CB   . ILE A 1 2  ? 3.351   1.580   -6.185  1.00 0.00 ? 2  ILE A CB   14 
ATOM 10233 C CG1  . ILE A 1 2  ? 2.079   1.861   -5.378  1.00 0.00 ? 2  ILE A CG1  14 
ATOM 10234 C CG2  . ILE A 1 2  ? 3.569   2.705   -7.198  1.00 0.00 ? 2  ILE A CG2  14 
ATOM 10235 C CD1  . ILE A 1 2  ? 2.372   2.925   -4.317  1.00 0.00 ? 2  ILE A CD1  14 
ATOM 10236 H H    . ILE A 1 2  ? 1.134   0.772   -7.217  1.00 0.00 ? 2  ILE A H    14 
ATOM 10237 H HA   . ILE A 1 2  ? 3.933   0.193   -7.717  1.00 0.00 ? 2  ILE A HA   14 
ATOM 10238 H HB   . ILE A 1 2  ? 4.199   1.528   -5.518  1.00 0.00 ? 2  ILE A HB   14 
ATOM 10239 H HG12 . ILE A 1 2  ? 1.303   2.217   -6.041  1.00 0.00 ? 2  ILE A HG12 14 
ATOM 10240 H HG13 . ILE A 1 2  ? 1.751   0.954   -4.893  1.00 0.00 ? 2  ILE A HG13 14 
ATOM 10241 H HG21 . ILE A 1 2  ? 2.676   2.832   -7.792  1.00 0.00 ? 2  ILE A HG21 14 
ATOM 10242 H HG22 . ILE A 1 2  ? 4.397   2.453   -7.843  1.00 0.00 ? 2  ILE A HG22 14 
ATOM 10243 H HG23 . ILE A 1 2  ? 3.787   3.624   -6.674  1.00 0.00 ? 2  ILE A HG23 14 
ATOM 10244 H HD11 . ILE A 1 2  ? 1.454   3.197   -3.817  1.00 0.00 ? 2  ILE A HD11 14 
ATOM 10245 H HD12 . ILE A 1 2  ? 2.796   3.799   -4.791  1.00 0.00 ? 2  ILE A HD12 14 
ATOM 10246 H HD13 . ILE A 1 2  ? 3.072   2.532   -3.595  1.00 0.00 ? 2  ILE A HD13 14 
ATOM 10247 N N    . VAL A 1 3  ? 2.393   -1.368  -5.308  1.00 0.00 ? 3  VAL A N    14 
ATOM 10248 C CA   . VAL A 1 3  ? 2.543   -2.482  -4.345  1.00 0.00 ? 3  VAL A CA   14 
ATOM 10249 C C    . VAL A 1 3  ? 2.906   -3.764  -5.102  1.00 0.00 ? 3  VAL A C    14 
ATOM 10250 O O    . VAL A 1 3  ? 3.792   -4.498  -4.713  1.00 0.00 ? 3  VAL A O    14 
ATOM 10251 C CB   . VAL A 1 3  ? 1.215   -2.656  -3.601  1.00 0.00 ? 3  VAL A CB   14 
ATOM 10252 C CG1  . VAL A 1 3  ? 1.106   -4.072  -3.049  1.00 0.00 ? 3  VAL A CG1  14 
ATOM 10253 C CG2  . VAL A 1 3  ? 1.146   -1.656  -2.445  1.00 0.00 ? 3  VAL A CG2  14 
ATOM 10254 H H    . VAL A 1 3  ? 1.509   -0.981  -5.460  1.00 0.00 ? 3  VAL A H    14 
ATOM 10255 H HA   . VAL A 1 3  ? 3.324   -2.248  -3.641  1.00 0.00 ? 3  VAL A HA   14 
ATOM 10256 H HB   . VAL A 1 3  ? 0.397   -2.474  -4.283  1.00 0.00 ? 3  VAL A HB   14 
ATOM 10257 H HG11 . VAL A 1 3  ? 0.555   -4.684  -3.747  1.00 0.00 ? 3  VAL A HG11 14 
ATOM 10258 H HG12 . VAL A 1 3  ? 0.590   -4.047  -2.102  1.00 0.00 ? 3  VAL A HG12 14 
ATOM 10259 H HG13 . VAL A 1 3  ? 2.095   -4.479  -2.915  1.00 0.00 ? 3  VAL A HG13 14 
ATOM 10260 H HG21 . VAL A 1 3  ? 1.153   -2.190  -1.507  1.00 0.00 ? 3  VAL A HG21 14 
ATOM 10261 H HG22 . VAL A 1 3  ? 0.237   -1.078  -2.524  1.00 0.00 ? 3  VAL A HG22 14 
ATOM 10262 H HG23 . VAL A 1 3  ? 1.998   -0.994  -2.489  1.00 0.00 ? 3  VAL A HG23 14 
ATOM 10263 N N    . GLU A 1 4  ? 2.225   -4.038  -6.178  1.00 0.00 ? 4  GLU A N    14 
ATOM 10264 C CA   . GLU A 1 4  ? 2.527   -5.272  -6.956  1.00 0.00 ? 4  GLU A CA   14 
ATOM 10265 C C    . GLU A 1 4  ? 3.912   -5.150  -7.593  1.00 0.00 ? 4  GLU A C    14 
ATOM 10266 O O    . GLU A 1 4  ? 4.654   -6.108  -7.678  1.00 0.00 ? 4  GLU A O    14 
ATOM 10267 C CB   . GLU A 1 4  ? 1.471   -5.462  -8.049  1.00 0.00 ? 4  GLU A CB   14 
ATOM 10268 C CG   . GLU A 1 4  ? 1.702   -4.450  -9.173  1.00 0.00 ? 4  GLU A CG   14 
ATOM 10269 C CD   . GLU A 1 4  ? 0.762   -4.761  -10.339 1.00 0.00 ? 4  GLU A CD   14 
ATOM 10270 O OE1  . GLU A 1 4  ? -0.004  -5.704  -10.221 1.00 0.00 ? 4  GLU A OE1  14 
ATOM 10271 O OE2  . GLU A 1 4  ? 0.823   -4.051  -11.329 1.00 0.00 ? 4  GLU A OE2  14 
ATOM 10272 H H    . GLU A 1 4  ? 1.513   -3.433  -6.471  1.00 0.00 ? 4  GLU A H    14 
ATOM 10273 H HA   . GLU A 1 4  ? 2.514   -6.123  -6.294  1.00 0.00 ? 4  GLU A HA   14 
ATOM 10274 H HB2  . GLU A 1 4  ? 1.542   -6.464  -8.446  1.00 0.00 ? 4  GLU A HB2  14 
ATOM 10275 H HB3  . GLU A 1 4  ? 0.488   -5.311  -7.628  1.00 0.00 ? 4  GLU A HB3  14 
ATOM 10276 H HG2  . GLU A 1 4  ? 1.506   -3.453  -8.806  1.00 0.00 ? 4  GLU A HG2  14 
ATOM 10277 H HG3  . GLU A 1 4  ? 2.725   -4.515  -9.511  1.00 0.00 ? 4  GLU A HG3  14 
ATOM 10278 N N    . GLN A 1 5  ? 4.267   -3.977  -8.038  1.00 0.00 ? 5  GLN A N    14 
ATOM 10279 C CA   . GLN A 1 5  ? 5.605   -3.794  -8.666  1.00 0.00 ? 5  GLN A CA   14 
ATOM 10280 C C    . GLN A 1 5  ? 6.665   -3.657  -7.572  1.00 0.00 ? 5  GLN A C    14 
ATOM 10281 O O    . GLN A 1 5  ? 7.789   -4.092  -7.724  1.00 0.00 ? 5  GLN A O    14 
ATOM 10282 C CB   . GLN A 1 5  ? 5.596   -2.531  -9.531  1.00 0.00 ? 5  GLN A CB   14 
ATOM 10283 C CG   . GLN A 1 5  ? 6.475   -2.750  -10.764 1.00 0.00 ? 5  GLN A CG   14 
ATOM 10284 C CD   . GLN A 1 5  ? 6.476   -1.484  -11.622 1.00 0.00 ? 5  GLN A CD   14 
ATOM 10285 O OE1  . GLN A 1 5  ? 7.008   -0.466  -11.224 1.00 0.00 ? 5  GLN A OE1  14 
ATOM 10286 N NE2  . GLN A 1 5  ? 5.898   -1.503  -12.792 1.00 0.00 ? 5  GLN A NE2  14 
ATOM 10287 H H    . GLN A 1 5  ? 3.653   -3.218  -7.957  1.00 0.00 ? 5  GLN A H    14 
ATOM 10288 H HA   . GLN A 1 5  ? 5.833   -4.650  -9.282  1.00 0.00 ? 5  GLN A HA   14 
ATOM 10289 H HB2  . GLN A 1 5  ? 4.584   -2.315  -9.842  1.00 0.00 ? 5  GLN A HB2  14 
ATOM 10290 H HB3  . GLN A 1 5  ? 5.982   -1.701  -8.959  1.00 0.00 ? 5  GLN A HB3  14 
ATOM 10291 H HG2  . GLN A 1 5  ? 7.484   -2.975  -10.451 1.00 0.00 ? 5  GLN A HG2  14 
ATOM 10292 H HG3  . GLN A 1 5  ? 6.085   -3.574  -11.342 1.00 0.00 ? 5  GLN A HG3  14 
ATOM 10293 H HE21 . GLN A 1 5  ? 5.469   -2.323  -13.113 1.00 0.00 ? 5  GLN A HE21 14 
ATOM 10294 H HE22 . GLN A 1 5  ? 5.894   -0.696  -13.349 1.00 0.00 ? 5  GLN A HE22 14 
ATOM 10295 N N    . CYS A 1 6  ? 6.314   -3.056  -6.469  1.00 0.00 ? 6  CYS A N    14 
ATOM 10296 C CA   . CYS A 1 6  ? 7.300   -2.891  -5.363  1.00 0.00 ? 6  CYS A CA   14 
ATOM 10297 C C    . CYS A 1 6  ? 7.398   -4.194  -4.563  1.00 0.00 ? 6  CYS A C    14 
ATOM 10298 O O    . CYS A 1 6  ? 8.307   -4.382  -3.779  1.00 0.00 ? 6  CYS A O    14 
ATOM 10299 C CB   . CYS A 1 6  ? 6.845   -1.756  -4.441  1.00 0.00 ? 6  CYS A CB   14 
ATOM 10300 S SG   . CYS A 1 6  ? 7.859   -1.745  -2.940  1.00 0.00 ? 6  CYS A SG   14 
ATOM 10301 H H    . CYS A 1 6  ? 5.401   -2.713  -6.368  1.00 0.00 ? 6  CYS A H    14 
ATOM 10302 H HA   . CYS A 1 6  ? 8.268   -2.650  -5.778  1.00 0.00 ? 6  CYS A HA   14 
ATOM 10303 H HB2  . CYS A 1 6  ? 6.952   -0.812  -4.953  1.00 0.00 ? 6  CYS A HB2  14 
ATOM 10304 H HB3  . CYS A 1 6  ? 5.809   -1.904  -4.174  1.00 0.00 ? 6  CYS A HB3  14 
ATOM 10305 N N    . CYS A 1 7  ? 6.472   -5.095  -4.751  1.00 0.00 ? 7  CYS A N    14 
ATOM 10306 C CA   . CYS A 1 7  ? 6.522   -6.379  -3.994  1.00 0.00 ? 7  CYS A CA   14 
ATOM 10307 C C    . CYS A 1 7  ? 7.917   -6.995  -4.121  1.00 0.00 ? 7  CYS A C    14 
ATOM 10308 O O    . CYS A 1 7  ? 8.269   -7.560  -5.136  1.00 0.00 ? 7  CYS A O    14 
ATOM 10309 C CB   . CYS A 1 7  ? 5.480   -7.350  -4.550  1.00 0.00 ? 7  CYS A CB   14 
ATOM 10310 S SG   . CYS A 1 7  ? 4.951   -8.475  -3.234  1.00 0.00 ? 7  CYS A SG   14 
ATOM 10311 H H    . CYS A 1 7  ? 5.744   -4.926  -5.385  1.00 0.00 ? 7  CYS A H    14 
ATOM 10312 H HA   . CYS A 1 7  ? 6.311   -6.187  -2.952  1.00 0.00 ? 7  CYS A HA   14 
ATOM 10313 H HB2  . CYS A 1 7  ? 4.628   -6.795  -4.916  1.00 0.00 ? 7  CYS A HB2  14 
ATOM 10314 H HB3  . CYS A 1 7  ? 5.914   -7.920  -5.359  1.00 0.00 ? 7  CYS A HB3  14 
ATOM 10315 N N    . THR A 1 8  ? 8.710   -6.882  -3.092  1.00 0.00 ? 8  THR A N    14 
ATOM 10316 C CA   . THR A 1 8  ? 10.090  -7.448  -3.122  1.00 0.00 ? 8  THR A CA   14 
ATOM 10317 C C    . THR A 1 8  ? 10.899  -6.800  -2.000  1.00 0.00 ? 8  THR A C    14 
ATOM 10318 O O    . THR A 1 8  ? 11.832  -7.373  -1.471  1.00 0.00 ? 8  THR A O    14 
ATOM 10319 C CB   . THR A 1 8  ? 10.756  -7.143  -4.470  1.00 0.00 ? 8  THR A CB   14 
ATOM 10320 O OG1  . THR A 1 8  ? 10.086  -6.059  -5.098  1.00 0.00 ? 8  THR A OG1  14 
ATOM 10321 C CG2  . THR A 1 8  ? 10.688  -8.380  -5.368  1.00 0.00 ? 8  THR A CG2  14 
ATOM 10322 H H    . THR A 1 8  ? 8.395   -6.419  -2.288  1.00 0.00 ? 8  THR A H    14 
ATOM 10323 H HA   . THR A 1 8  ? 10.048  -8.517  -2.970  1.00 0.00 ? 8  THR A HA   14 
ATOM 10324 H HB   . THR A 1 8  ? 11.789  -6.880  -4.307  1.00 0.00 ? 8  THR A HB   14 
ATOM 10325 H HG1  . THR A 1 8  ? 10.260  -5.266  -4.586  1.00 0.00 ? 8  THR A HG1  14 
ATOM 10326 H HG21 . THR A 1 8  ? 11.658  -8.853  -5.404  1.00 0.00 ? 8  THR A HG21 14 
ATOM 10327 H HG22 . THR A 1 8  ? 10.394  -8.085  -6.364  1.00 0.00 ? 8  THR A HG22 14 
ATOM 10328 H HG23 . THR A 1 8  ? 9.963   -9.075  -4.970  1.00 0.00 ? 8  THR A HG23 14 
ATOM 10329 N N    . SER A 1 9  ? 10.532  -5.605  -1.633  1.00 0.00 ? 9  SER A N    14 
ATOM 10330 C CA   . SER A 1 9  ? 11.246  -4.887  -0.544  1.00 0.00 ? 9  SER A CA   14 
ATOM 10331 C C    . SER A 1 9  ? 10.387  -3.701  -0.109  1.00 0.00 ? 9  SER A C    14 
ATOM 10332 O O    . SER A 1 9  ? 9.194   -3.677  -0.339  1.00 0.00 ? 9  SER A O    14 
ATOM 10333 C CB   . SER A 1 9  ? 12.596  -4.385  -1.057  1.00 0.00 ? 9  SER A CB   14 
ATOM 10334 O OG   . SER A 1 9  ? 13.046  -5.235  -2.104  1.00 0.00 ? 9  SER A OG   14 
ATOM 10335 H H    . SER A 1 9  ? 9.772   -5.175  -2.078  1.00 0.00 ? 9  SER A H    14 
ATOM 10336 H HA   . SER A 1 9  ? 11.398  -5.553  0.294   1.00 0.00 ? 9  SER A HA   14 
ATOM 10337 H HB2  . SER A 1 9  ? 12.489  -3.382  -1.434  1.00 0.00 ? 9  SER A HB2  14 
ATOM 10338 H HB3  . SER A 1 9  ? 13.312  -4.387  -0.245  1.00 0.00 ? 9  SER A HB3  14 
ATOM 10339 H HG   . SER A 1 9  ? 13.706  -4.757  -2.611  1.00 0.00 ? 9  SER A HG   14 
ATOM 10340 N N    . ILE A 1 10 ? 10.969  -2.710  0.508   1.00 0.00 ? 10 ILE A N    14 
ATOM 10341 C CA   . ILE A 1 10 ? 10.155  -1.535  0.934   1.00 0.00 ? 10 ILE A CA   14 
ATOM 10342 C C    . ILE A 1 10 ? 10.486  -0.356  0.024   1.00 0.00 ? 10 ILE A C    14 
ATOM 10343 O O    . ILE A 1 10 ? 11.581  0.171   0.045   1.00 0.00 ? 10 ILE A O    14 
ATOM 10344 C CB   . ILE A 1 10 ? 10.463  -1.191  2.411   1.00 0.00 ? 10 ILE A CB   14 
ATOM 10345 C CG1  . ILE A 1 10 ? 10.375  0.328   2.663   1.00 0.00 ? 10 ILE A CG1  14 
ATOM 10346 C CG2  . ILE A 1 10 ? 11.873  -1.667  2.766   1.00 0.00 ? 10 ILE A CG2  14 
ATOM 10347 C CD1  . ILE A 1 10 ? 8.924   0.807   2.536   1.00 0.00 ? 10 ILE A CD1  14 
ATOM 10348 H H    . ILE A 1 10 ? 11.932  -2.735  0.683   1.00 0.00 ? 10 ILE A H    14 
ATOM 10349 H HA   . ILE A 1 10 ? 9.107   -1.775  0.834   1.00 0.00 ? 10 ILE A HA   14 
ATOM 10350 H HB   . ILE A 1 10 ? 9.751   -1.700  3.045   1.00 0.00 ? 10 ILE A HB   14 
ATOM 10351 H HG12 . ILE A 1 10 ? 10.734  0.544   3.659   1.00 0.00 ? 10 ILE A HG12 14 
ATOM 10352 H HG13 . ILE A 1 10 ? 10.988  0.849   1.944   1.00 0.00 ? 10 ILE A HG13 14 
ATOM 10353 H HG21 . ILE A 1 10 ? 12.138  -1.304  3.748   1.00 0.00 ? 10 ILE A HG21 14 
ATOM 10354 H HG22 . ILE A 1 10 ? 12.575  -1.286  2.040   1.00 0.00 ? 10 ILE A HG22 14 
ATOM 10355 H HG23 . ILE A 1 10 ? 11.900  -2.746  2.763   1.00 0.00 ? 10 ILE A HG23 14 
ATOM 10356 H HD11 . ILE A 1 10 ? 8.908   1.798   2.103   1.00 0.00 ? 10 ILE A HD11 14 
ATOM 10357 H HD12 . ILE A 1 10 ? 8.467   0.838   3.515   1.00 0.00 ? 10 ILE A HD12 14 
ATOM 10358 H HD13 . ILE A 1 10 ? 8.372   0.129   1.903   1.00 0.00 ? 10 ILE A HD13 14 
ATOM 10359 N N    . CYS A 1 11 ? 9.543   0.073   -0.764  1.00 0.00 ? 11 CYS A N    14 
ATOM 10360 C CA   . CYS A 1 11 ? 9.805   1.229   -1.654  1.00 0.00 ? 11 CYS A CA   14 
ATOM 10361 C C    . CYS A 1 11 ? 9.114   2.451   -1.064  1.00 0.00 ? 11 CYS A C    14 
ATOM 10362 O O    . CYS A 1 11 ? 7.910   2.470   -0.906  1.00 0.00 ? 11 CYS A O    14 
ATOM 10363 C CB   . CYS A 1 11 ? 9.244   0.944   -3.050  1.00 0.00 ? 11 CYS A CB   14 
ATOM 10364 S SG   . CYS A 1 11 ? 9.551   -0.786  -3.486  1.00 0.00 ? 11 CYS A SG   14 
ATOM 10365 H H    . CYS A 1 11 ? 8.662   -0.356  -0.758  1.00 0.00 ? 11 CYS A H    14 
ATOM 10366 H HA   . CYS A 1 11 ? 10.868  1.406   -1.717  1.00 0.00 ? 11 CYS A HA   14 
ATOM 10367 H HB2  . CYS A 1 11 ? 8.180   1.132   -3.055  1.00 0.00 ? 11 CYS A HB2  14 
ATOM 10368 H HB3  . CYS A 1 11 ? 9.727   1.588   -3.770  1.00 0.00 ? 11 CYS A HB3  14 
ATOM 10369 N N    . SER A 1 12 ? 9.877   3.465   -0.749  1.00 0.00 ? 12 SER A N    14 
ATOM 10370 C CA   . SER A 1 12 ? 9.318   4.715   -0.164  1.00 0.00 ? 12 SER A CA   14 
ATOM 10371 C C    . SER A 1 12 ? 7.988   4.452   0.548   1.00 0.00 ? 12 SER A C    14 
ATOM 10372 O O    . SER A 1 12 ? 6.934   4.708   0.008   1.00 0.00 ? 12 SER A O    14 
ATOM 10373 C CB   . SER A 1 12 ? 9.099   5.735   -1.282  1.00 0.00 ? 12 SER A CB   14 
ATOM 10374 O OG   . SER A 1 12 ? 8.880   5.050   -2.507  1.00 0.00 ? 12 SER A OG   14 
ATOM 10375 H H    . SER A 1 12 ? 10.838  3.403   -0.901  1.00 0.00 ? 12 SER A H    14 
ATOM 10376 H HA   . SER A 1 12 ? 10.024  5.119   0.545   1.00 0.00 ? 12 SER A HA   14 
ATOM 10377 H HB2  . SER A 1 12 ? 8.239   6.342   -1.056  1.00 0.00 ? 12 SER A HB2  14 
ATOM 10378 H HB3  . SER A 1 12 ? 9.973   6.370   -1.363  1.00 0.00 ? 12 SER A HB3  14 
ATOM 10379 H HG   . SER A 1 12 ? 8.293   4.310   -2.333  1.00 0.00 ? 12 SER A HG   14 
ATOM 10380 N N    . LEU A 1 13 ? 8.011   3.974   1.764   1.00 0.00 ? 13 LEU A N    14 
ATOM 10381 C CA   . LEU A 1 13 ? 6.720   3.761   2.470   1.00 0.00 ? 13 LEU A CA   14 
ATOM 10382 C C    . LEU A 1 13 ? 5.996   5.091   2.419   1.00 0.00 ? 13 LEU A C    14 
ATOM 10383 O O    . LEU A 1 13 ? 4.786   5.164   2.341   1.00 0.00 ? 13 LEU A O    14 
ATOM 10384 C CB   . LEU A 1 13 ? 6.970   3.349   3.923   1.00 0.00 ? 13 LEU A CB   14 
ATOM 10385 C CG   . LEU A 1 13 ? 5.636   3.271   4.667   1.00 0.00 ? 13 LEU A CG   14 
ATOM 10386 C CD1  . LEU A 1 13 ? 5.578   1.976   5.479   1.00 0.00 ? 13 LEU A CD1  14 
ATOM 10387 C CD2  . LEU A 1 13 ? 5.508   4.469   5.611   1.00 0.00 ? 13 LEU A CD2  14 
ATOM 10388 H H    . LEU A 1 13 ? 8.861   3.787   2.211   1.00 0.00 ? 13 LEU A H    14 
ATOM 10389 H HA   . LEU A 1 13 ? 6.131   3.015   1.960   1.00 0.00 ? 13 LEU A HA   14 
ATOM 10390 H HB2  . LEU A 1 13 ? 7.452   2.382   3.944   1.00 0.00 ? 13 LEU A HB2  14 
ATOM 10391 H HB3  . LEU A 1 13 ? 7.604   4.080   4.401   1.00 0.00 ? 13 LEU A HB3  14 
ATOM 10392 H HG   . LEU A 1 13 ? 4.825   3.284   3.953   1.00 0.00 ? 13 LEU A HG   14 
ATOM 10393 H HD11 . LEU A 1 13 ? 5.340   2.206   6.507   1.00 0.00 ? 13 LEU A HD11 14 
ATOM 10394 H HD12 . LEU A 1 13 ? 6.535   1.479   5.433   1.00 0.00 ? 13 LEU A HD12 14 
ATOM 10395 H HD13 . LEU A 1 13 ? 4.816   1.329   5.069   1.00 0.00 ? 13 LEU A HD13 14 
ATOM 10396 H HD21 . LEU A 1 13 ? 6.170   4.335   6.454   1.00 0.00 ? 13 LEU A HD21 14 
ATOM 10397 H HD22 . LEU A 1 13 ? 4.490   4.544   5.961   1.00 0.00 ? 13 LEU A HD22 14 
ATOM 10398 H HD23 . LEU A 1 13 ? 5.775   5.373   5.083   1.00 0.00 ? 13 LEU A HD23 14 
ATOM 10399 N N    . TYR A 1 14 ? 6.754   6.146   2.412   1.00 0.00 ? 14 TYR A N    14 
ATOM 10400 C CA   . TYR A 1 14 ? 6.146   7.494   2.307   1.00 0.00 ? 14 TYR A CA   14 
ATOM 10401 C C    . TYR A 1 14 ? 5.421   7.559   0.965   1.00 0.00 ? 14 TYR A C    14 
ATOM 10402 O O    . TYR A 1 14 ? 4.384   8.174   0.833   1.00 0.00 ? 14 TYR A O    14 
ATOM 10403 C CB   . TYR A 1 14 ? 7.237   8.566   2.364   1.00 0.00 ? 14 TYR A CB   14 
ATOM 10404 C CG   . TYR A 1 14 ? 6.890   9.581   3.427   1.00 0.00 ? 14 TYR A CG   14 
ATOM 10405 C CD1  . TYR A 1 14 ? 6.478   9.154   4.695   1.00 0.00 ? 14 TYR A CD1  14 
ATOM 10406 C CD2  . TYR A 1 14 ? 6.980   10.949  3.145   1.00 0.00 ? 14 TYR A CD2  14 
ATOM 10407 C CE1  . TYR A 1 14 ? 6.157   10.094  5.681   1.00 0.00 ? 14 TYR A CE1  14 
ATOM 10408 C CE2  . TYR A 1 14 ? 6.659   11.890  4.130   1.00 0.00 ? 14 TYR A CE2  14 
ATOM 10409 C CZ   . TYR A 1 14 ? 6.247   11.463  5.398   1.00 0.00 ? 14 TYR A CZ   14 
ATOM 10410 O OH   . TYR A 1 14 ? 5.930   12.390  6.370   1.00 0.00 ? 14 TYR A OH   14 
ATOM 10411 H H    . TYR A 1 14 ? 7.731   6.041   2.439   1.00 0.00 ? 14 TYR A H    14 
ATOM 10412 H HA   . TYR A 1 14 ? 5.439   7.641   3.110   1.00 0.00 ? 14 TYR A HA   14 
ATOM 10413 H HB2  . TYR A 1 14 ? 8.184   8.104   2.601   1.00 0.00 ? 14 TYR A HB2  14 
ATOM 10414 H HB3  . TYR A 1 14 ? 7.307   9.060   1.406   1.00 0.00 ? 14 TYR A HB3  14 
ATOM 10415 H HD1  . TYR A 1 14 ? 6.409   8.098   4.913   1.00 0.00 ? 14 TYR A HD1  14 
ATOM 10416 H HD2  . TYR A 1 14 ? 7.298   11.279  2.166   1.00 0.00 ? 14 TYR A HD2  14 
ATOM 10417 H HE1  . TYR A 1 14 ? 5.839   9.765   6.659   1.00 0.00 ? 14 TYR A HE1  14 
ATOM 10418 H HE2  . TYR A 1 14 ? 6.728   12.946  3.913   1.00 0.00 ? 14 TYR A HE2  14 
ATOM 10419 H HH   . TYR A 1 14 ? 5.133   12.094  6.814   1.00 0.00 ? 14 TYR A HH   14 
ATOM 10420 N N    . GLN A 1 15 ? 5.956   6.894   -0.030  1.00 0.00 ? 15 GLN A N    14 
ATOM 10421 C CA   . GLN A 1 15 ? 5.289   6.882   -1.359  1.00 0.00 ? 15 GLN A CA   14 
ATOM 10422 C C    . GLN A 1 15 ? 3.992   6.081   -1.234  1.00 0.00 ? 15 GLN A C    14 
ATOM 10423 O O    . GLN A 1 15 ? 2.963   6.465   -1.754  1.00 0.00 ? 15 GLN A O    14 
ATOM 10424 C CB   . GLN A 1 15 ? 6.203   6.226   -2.399  1.00 0.00 ? 15 GLN A CB   14 
ATOM 10425 C CG   . GLN A 1 15 ? 7.094   7.292   -3.039  1.00 0.00 ? 15 GLN A CG   14 
ATOM 10426 C CD   . GLN A 1 15 ? 6.587   7.601   -4.449  1.00 0.00 ? 15 GLN A CD   14 
ATOM 10427 O OE1  . GLN A 1 15 ? 6.204   6.708   -5.179  1.00 0.00 ? 15 GLN A OE1  14 
ATOM 10428 N NE2  . GLN A 1 15 ? 6.568   8.838   -4.866  1.00 0.00 ? 15 GLN A NE2  14 
ATOM 10429 H H    . GLN A 1 15 ? 6.786   6.386   0.108   1.00 0.00 ? 15 GLN A H    14 
ATOM 10430 H HA   . GLN A 1 15 ? 5.061   7.894   -1.660  1.00 0.00 ? 15 GLN A HA   14 
ATOM 10431 H HB2  . GLN A 1 15 ? 6.820   5.482   -1.920  1.00 0.00 ? 15 GLN A HB2  14 
ATOM 10432 H HB3  . GLN A 1 15 ? 5.601   5.758   -3.163  1.00 0.00 ? 15 GLN A HB3  14 
ATOM 10433 H HG2  . GLN A 1 15 ? 7.066   8.191   -2.441  1.00 0.00 ? 15 GLN A HG2  14 
ATOM 10434 H HG3  . GLN A 1 15 ? 8.108   6.927   -3.096  1.00 0.00 ? 15 GLN A HG3  14 
ATOM 10435 H HE21 . GLN A 1 15 ? 6.876   9.558   -4.278  1.00 0.00 ? 15 GLN A HE21 14 
ATOM 10436 H HE22 . GLN A 1 15 ? 6.244   9.046   -5.767  1.00 0.00 ? 15 GLN A HE22 14 
ATOM 10437 N N    . LEU A 1 16 ? 4.021   4.985   -0.515  1.00 0.00 ? 16 LEU A N    14 
ATOM 10438 C CA   . LEU A 1 16 ? 2.778   4.196   -0.330  1.00 0.00 ? 16 LEU A CA   14 
ATOM 10439 C C    . LEU A 1 16 ? 1.849   5.036   0.534   1.00 0.00 ? 16 LEU A C    14 
ATOM 10440 O O    . LEU A 1 16 ? 0.690   5.228   0.227   1.00 0.00 ? 16 LEU A O    14 
ATOM 10441 C CB   . LEU A 1 16 ? 3.097   2.877   0.378   1.00 0.00 ? 16 LEU A CB   14 
ATOM 10442 C CG   . LEU A 1 16 ? 3.100   1.738   -0.642  1.00 0.00 ? 16 LEU A CG   14 
ATOM 10443 C CD1  . LEU A 1 16 ? 4.458   1.683   -1.344  1.00 0.00 ? 16 LEU A CD1  14 
ATOM 10444 C CD2  . LEU A 1 16 ? 2.845   0.411   0.077   1.00 0.00 ? 16 LEU A CD2  14 
ATOM 10445 H H    . LEU A 1 16 ? 4.850   4.702   -0.075  1.00 0.00 ? 16 LEU A H    14 
ATOM 10446 H HA   . LEU A 1 16 ? 2.317   4.003   -1.288  1.00 0.00 ? 16 LEU A HA   14 
ATOM 10447 H HB2  . LEU A 1 16 ? 4.069   2.946   0.845   1.00 0.00 ? 16 LEU A HB2  14 
ATOM 10448 H HB3  . LEU A 1 16 ? 2.349   2.682   1.131   1.00 0.00 ? 16 LEU A HB3  14 
ATOM 10449 H HG   . LEU A 1 16 ? 2.323   1.908   -1.373  1.00 0.00 ? 16 LEU A HG   14 
ATOM 10450 H HD11 . LEU A 1 16 ? 5.027   0.847   -0.964  1.00 0.00 ? 16 LEU A HD11 14 
ATOM 10451 H HD12 . LEU A 1 16 ? 4.997   2.600   -1.157  1.00 0.00 ? 16 LEU A HD12 14 
ATOM 10452 H HD13 . LEU A 1 16 ? 4.309   1.564   -2.407  1.00 0.00 ? 16 LEU A HD13 14 
ATOM 10453 H HD21 . LEU A 1 16 ? 2.022   0.528   0.767   1.00 0.00 ? 16 LEU A HD21 14 
ATOM 10454 H HD22 . LEU A 1 16 ? 3.732   0.120   0.621   1.00 0.00 ? 16 LEU A HD22 14 
ATOM 10455 H HD23 . LEU A 1 16 ? 2.602   -0.351  -0.648  1.00 0.00 ? 16 LEU A HD23 14 
ATOM 10456 N N    . GLU A 1 17 ? 2.371   5.566   1.605   1.00 0.00 ? 17 GLU A N    14 
ATOM 10457 C CA   . GLU A 1 17 ? 1.540   6.430   2.483   1.00 0.00 ? 17 GLU A CA   14 
ATOM 10458 C C    . GLU A 1 17 ? 1.103   7.657   1.681   1.00 0.00 ? 17 GLU A C    14 
ATOM 10459 O O    . GLU A 1 17 ? 0.003   8.149   1.823   1.00 0.00 ? 17 GLU A O    14 
ATOM 10460 C CB   . GLU A 1 17 ? 2.358   6.872   3.699   1.00 0.00 ? 17 GLU A CB   14 
ATOM 10461 C CG   . GLU A 1 17 ? 1.556   6.612   4.975   1.00 0.00 ? 17 GLU A CG   14 
ATOM 10462 C CD   . GLU A 1 17 ? 2.010   7.579   6.070   1.00 0.00 ? 17 GLU A CD   14 
ATOM 10463 O OE1  . GLU A 1 17 ? 2.476   8.653   5.728   1.00 0.00 ? 17 GLU A OE1  14 
ATOM 10464 O OE2  . GLU A 1 17 ? 1.883   7.229   7.232   1.00 0.00 ? 17 GLU A OE2  14 
ATOM 10465 H H    . GLU A 1 17 ? 3.319   5.407   1.820   1.00 0.00 ? 17 GLU A H    14 
ATOM 10466 H HA   . GLU A 1 17 ? 0.672   5.885   2.805   1.00 0.00 ? 17 GLU A HA   14 
ATOM 10467 H HB2  . GLU A 1 17 ? 3.282   6.312   3.733   1.00 0.00 ? 17 GLU A HB2  14 
ATOM 10468 H HB3  . GLU A 1 17 ? 2.578   7.926   3.622   1.00 0.00 ? 17 GLU A HB3  14 
ATOM 10469 H HG2  . GLU A 1 17 ? 0.505   6.760   4.775   1.00 0.00 ? 17 GLU A HG2  14 
ATOM 10470 H HG3  . GLU A 1 17 ? 1.721   5.596   5.303   1.00 0.00 ? 17 GLU A HG3  14 
ATOM 10471 N N    . ASN A 1 18 ? 1.961   8.151   0.833   1.00 0.00 ? 18 ASN A N    14 
ATOM 10472 C CA   . ASN A 1 18 ? 1.605   9.340   0.009   1.00 0.00 ? 18 ASN A CA   14 
ATOM 10473 C C    . ASN A 1 18 ? 0.752   8.895   -1.185  1.00 0.00 ? 18 ASN A C    14 
ATOM 10474 O O    . ASN A 1 18 ? 0.058   9.685   -1.793  1.00 0.00 ? 18 ASN A O    14 
ATOM 10475 C CB   . ASN A 1 18 ? 2.883   10.010  -0.501  1.00 0.00 ? 18 ASN A CB   14 
ATOM 10476 C CG   . ASN A 1 18 ? 3.624   10.656  0.671   1.00 0.00 ? 18 ASN A CG   14 
ATOM 10477 O OD1  . ASN A 1 18 ? 3.015   11.067  1.638   1.00 0.00 ? 18 ASN A OD1  14 
ATOM 10478 N ND2  . ASN A 1 18 ? 4.924   10.764  0.624   1.00 0.00 ? 18 ASN A ND2  14 
ATOM 10479 H H    . ASN A 1 18 ? 2.844   7.735   0.735   1.00 0.00 ? 18 ASN A H    14 
ATOM 10480 H HA   . ASN A 1 18 ? 1.045   10.041  0.610   1.00 0.00 ? 18 ASN A HA   14 
ATOM 10481 H HB2  . ASN A 1 18 ? 3.517   9.268   -0.964  1.00 0.00 ? 18 ASN A HB2  14 
ATOM 10482 H HB3  . ASN A 1 18 ? 2.628   10.769  -1.225  1.00 0.00 ? 18 ASN A HB3  14 
ATOM 10483 H HD21 . ASN A 1 18 ? 5.416   10.433  -0.156  1.00 0.00 ? 18 ASN A HD21 14 
ATOM 10484 H HD22 . ASN A 1 18 ? 5.408   11.177  1.369   1.00 0.00 ? 18 ASN A HD22 14 
ATOM 10485 N N    . TYR A 1 19 ? 0.802   7.633   -1.526  1.00 0.00 ? 19 TYR A N    14 
ATOM 10486 C CA   . TYR A 1 19 ? 0.002   7.133   -2.678  1.00 0.00 ? 19 TYR A CA   14 
ATOM 10487 C C    . TYR A 1 19 ? -1.472  7.455   -2.443  1.00 0.00 ? 19 TYR A C    14 
ATOM 10488 O O    . TYR A 1 19 ? -2.101  8.145   -3.220  1.00 0.00 ? 19 TYR A O    14 
ATOM 10489 C CB   . TYR A 1 19 ? 0.192   5.613   -2.794  1.00 0.00 ? 19 TYR A CB   14 
ATOM 10490 C CG   . TYR A 1 19 ? -0.931  5.002   -3.603  1.00 0.00 ? 19 TYR A CG   14 
ATOM 10491 C CD1  . TYR A 1 19 ? -2.141  4.664   -2.981  1.00 0.00 ? 19 TYR A CD1  14 
ATOM 10492 C CD2  . TYR A 1 19 ? -0.761  4.772   -4.972  1.00 0.00 ? 19 TYR A CD2  14 
ATOM 10493 C CE1  . TYR A 1 19 ? -3.178  4.096   -3.731  1.00 0.00 ? 19 TYR A CE1  14 
ATOM 10494 C CE2  . TYR A 1 19 ? -1.798  4.204   -5.722  1.00 0.00 ? 19 TYR A CE2  14 
ATOM 10495 C CZ   . TYR A 1 19 ? -3.006  3.866   -5.101  1.00 0.00 ? 19 TYR A CZ   14 
ATOM 10496 O OH   . TYR A 1 19 ? -4.029  3.307   -5.840  1.00 0.00 ? 19 TYR A OH   14 
ATOM 10497 H H    . TYR A 1 19 ? 1.364   7.013   -1.022  1.00 0.00 ? 19 TYR A H    14 
ATOM 10498 H HA   . TYR A 1 19 ? 0.338   7.611   -3.585  1.00 0.00 ? 19 TYR A HA   14 
ATOM 10499 H HB2  . TYR A 1 19 ? 1.134   5.408   -3.281  1.00 0.00 ? 19 TYR A HB2  14 
ATOM 10500 H HB3  . TYR A 1 19 ? 0.199   5.178   -1.807  1.00 0.00 ? 19 TYR A HB3  14 
ATOM 10501 H HD1  . TYR A 1 19 ? -2.274  4.840   -1.923  1.00 0.00 ? 19 TYR A HD1  14 
ATOM 10502 H HD2  . TYR A 1 19 ? 0.169   5.032   -5.451  1.00 0.00 ? 19 TYR A HD2  14 
ATOM 10503 H HE1  . TYR A 1 19 ? -4.110  3.835   -3.252  1.00 0.00 ? 19 TYR A HE1  14 
ATOM 10504 H HE2  . TYR A 1 19 ? -1.665  4.026   -6.779  1.00 0.00 ? 19 TYR A HE2  14 
ATOM 10505 H HH   . TYR A 1 19 ? -4.815  3.843   -5.713  1.00 0.00 ? 19 TYR A HH   14 
ATOM 10506 N N    . CYS A 1 20 ? -2.020  6.956   -1.373  1.00 0.00 ? 20 CYS A N    14 
ATOM 10507 C CA   . CYS A 1 20 ? -3.457  7.221   -1.071  1.00 0.00 ? 20 CYS A CA   14 
ATOM 10508 C C    . CYS A 1 20 ? -4.280  7.131   -2.358  1.00 0.00 ? 20 CYS A C    14 
ATOM 10509 O O    . CYS A 1 20 ? -3.837  6.592   -3.353  1.00 0.00 ? 20 CYS A O    14 
ATOM 10510 C CB   . CYS A 1 20 ? -3.599  8.618   -0.467  1.00 0.00 ? 20 CYS A CB   14 
ATOM 10511 S SG   . CYS A 1 20 ? -2.541  8.750   0.996   1.00 0.00 ? 20 CYS A SG   14 
ATOM 10512 H H    . CYS A 1 20 ? -1.481  6.405   -0.764  1.00 0.00 ? 20 CYS A H    14 
ATOM 10513 H HA   . CYS A 1 20 ? -3.816  6.487   -0.365  1.00 0.00 ? 20 CYS A HA   14 
ATOM 10514 H HB2  . CYS A 1 20 ? -3.301  9.358   -1.195  1.00 0.00 ? 20 CYS A HB2  14 
ATOM 10515 H HB3  . CYS A 1 20 ? -4.628  8.786   -0.184  1.00 0.00 ? 20 CYS A HB3  14 
ATOM 10516 N N    . ASN A 1 21 ? -5.475  7.653   -2.346  1.00 0.00 ? 21 ASN A N    14 
ATOM 10517 C CA   . ASN A 1 21 ? -6.325  7.597   -3.569  1.00 0.00 ? 21 ASN A CA   14 
ATOM 10518 C C    . ASN A 1 21 ? -7.615  8.383   -3.331  1.00 0.00 ? 21 ASN A C    14 
ATOM 10519 O O    . ASN A 1 21 ? -7.544  9.420   -2.692  1.00 0.00 ? 21 ASN A O    14 
ATOM 10520 C CB   . ASN A 1 21 ? -6.668  6.139   -3.886  1.00 0.00 ? 21 ASN A CB   14 
ATOM 10521 C CG   . ASN A 1 21 ? -6.348  5.847   -5.353  1.00 0.00 ? 21 ASN A CG   14 
ATOM 10522 O OD1  . ASN A 1 21 ? -5.394  6.368   -5.895  1.00 0.00 ? 21 ASN A OD1  14 
ATOM 10523 N ND2  . ASN A 1 21 ? -7.112  5.028   -6.024  1.00 0.00 ? 21 ASN A ND2  14 
ATOM 10524 O OXT  . ASN A 1 21 ? -8.652  7.935   -3.791  1.00 0.00 ? 21 ASN A OXT  14 
ATOM 10525 H H    . ASN A 1 21 ? -5.814  8.082   -1.533  1.00 0.00 ? 21 ASN A H    14 
ATOM 10526 H HA   . ASN A 1 21 ? -5.788  8.029   -4.401  1.00 0.00 ? 21 ASN A HA   14 
ATOM 10527 H HB2  . ASN A 1 21 ? -6.085  5.487   -3.253  1.00 0.00 ? 21 ASN A HB2  14 
ATOM 10528 H HB3  . ASN A 1 21 ? -7.719  5.970   -3.709  1.00 0.00 ? 21 ASN A HB3  14 
ATOM 10529 H HD21 . ASN A 1 21 ? -7.881  4.607   -5.586  1.00 0.00 ? 21 ASN A HD21 14 
ATOM 10530 H HD22 . ASN A 1 21 ? -6.916  4.834   -6.964  1.00 0.00 ? 21 ASN A HD22 14 
ATOM 10531 N N    . PHE B 2 1  ? 13.572  2.708   12.725  1.00 0.00 ? 1  PHE B N    14 
ATOM 10532 C CA   . PHE B 2 1  ? 13.421  1.297   12.269  1.00 0.00 ? 1  PHE B CA   14 
ATOM 10533 C C    . PHE B 2 1  ? 12.678  1.271   10.931  1.00 0.00 ? 1  PHE B C    14 
ATOM 10534 O O    . PHE B 2 1  ? 11.742  2.013   10.715  1.00 0.00 ? 1  PHE B O    14 
ATOM 10535 C CB   . PHE B 2 1  ? 12.625  0.507   13.310  1.00 0.00 ? 1  PHE B CB   14 
ATOM 10536 C CG   . PHE B 2 1  ? 13.119  0.856   14.693  1.00 0.00 ? 1  PHE B CG   14 
ATOM 10537 C CD1  . PHE B 2 1  ? 14.330  0.329   15.158  1.00 0.00 ? 1  PHE B CD1  14 
ATOM 10538 C CD2  . PHE B 2 1  ? 12.366  1.706   15.512  1.00 0.00 ? 1  PHE B CD2  14 
ATOM 10539 C CE1  . PHE B 2 1  ? 14.788  0.652   16.441  1.00 0.00 ? 1  PHE B CE1  14 
ATOM 10540 C CE2  . PHE B 2 1  ? 12.825  2.030   16.795  1.00 0.00 ? 1  PHE B CE2  14 
ATOM 10541 C CZ   . PHE B 2 1  ? 14.036  1.503   17.259  1.00 0.00 ? 1  PHE B CZ   14 
ATOM 10542 H H1   . PHE B 2 1  ? 14.103  3.248   12.013  1.00 0.00 ? 1  PHE B H1   14 
ATOM 10543 H H2   . PHE B 2 1  ? 14.086  2.725   13.630  1.00 0.00 ? 1  PHE B H2   14 
ATOM 10544 H H3   . PHE B 2 1  ? 12.632  3.134   12.851  1.00 0.00 ? 1  PHE B H3   14 
ATOM 10545 H HA   . PHE B 2 1  ? 14.397  0.851   12.148  1.00 0.00 ? 1  PHE B HA   14 
ATOM 10546 H HB2  . PHE B 2 1  ? 11.577  0.757   13.227  1.00 0.00 ? 1  PHE B HB2  14 
ATOM 10547 H HB3  . PHE B 2 1  ? 12.757  -0.551  13.138  1.00 0.00 ? 1  PHE B HB3  14 
ATOM 10548 H HD1  . PHE B 2 1  ? 14.911  -0.328  14.527  1.00 0.00 ? 1  PHE B HD1  14 
ATOM 10549 H HD2  . PHE B 2 1  ? 11.432  2.113   15.154  1.00 0.00 ? 1  PHE B HD2  14 
ATOM 10550 H HE1  . PHE B 2 1  ? 15.723  0.246   16.799  1.00 0.00 ? 1  PHE B HE1  14 
ATOM 10551 H HE2  . PHE B 2 1  ? 12.244  2.686   17.426  1.00 0.00 ? 1  PHE B HE2  14 
ATOM 10552 H HZ   . PHE B 2 1  ? 14.389  1.753   18.249  1.00 0.00 ? 1  PHE B HZ   14 
ATOM 10553 N N    . VAL B 2 2  ? 13.089  0.420   10.030  1.00 0.00 ? 2  VAL B N    14 
ATOM 10554 C CA   . VAL B 2 2  ? 12.406  0.347   8.708   1.00 0.00 ? 2  VAL B CA   14 
ATOM 10555 C C    . VAL B 2 2  ? 11.315  -0.724  8.757   1.00 0.00 ? 2  VAL B C    14 
ATOM 10556 O O    . VAL B 2 2  ? 11.128  -1.387  9.759   1.00 0.00 ? 2  VAL B O    14 
ATOM 10557 C CB   . VAL B 2 2  ? 13.426  -0.016  7.626   1.00 0.00 ? 2  VAL B CB   14 
ATOM 10558 C CG1  . VAL B 2 2  ? 14.620  0.938   7.708   1.00 0.00 ? 2  VAL B CG1  14 
ATOM 10559 C CG2  . VAL B 2 2  ? 13.908  -1.452  7.842   1.00 0.00 ? 2  VAL B CG2  14 
ATOM 10560 H H    . VAL B 2 2  ? 13.847  -0.171  10.224  1.00 0.00 ? 2  VAL B H    14 
ATOM 10561 H HA   . VAL B 2 2  ? 11.962  1.304   8.478   1.00 0.00 ? 2  VAL B HA   14 
ATOM 10562 H HB   . VAL B 2 2  ? 12.964  0.069   6.653   1.00 0.00 ? 2  VAL B HB   14 
ATOM 10563 H HG11 . VAL B 2 2  ? 14.665  1.374   8.695   1.00 0.00 ? 2  VAL B HG11 14 
ATOM 10564 H HG12 . VAL B 2 2  ? 14.505  1.721   6.973   1.00 0.00 ? 2  VAL B HG12 14 
ATOM 10565 H HG13 . VAL B 2 2  ? 15.531  0.392   7.513   1.00 0.00 ? 2  VAL B HG13 14 
ATOM 10566 H HG21 . VAL B 2 2  ? 13.546  -1.814  8.793   1.00 0.00 ? 2  VAL B HG21 14 
ATOM 10567 H HG22 . VAL B 2 2  ? 14.988  -1.475  7.835   1.00 0.00 ? 2  VAL B HG22 14 
ATOM 10568 H HG23 . VAL B 2 2  ? 13.530  -2.081  7.050   1.00 0.00 ? 2  VAL B HG23 14 
ATOM 10569 N N    . ASN B 2 3  ? 10.594  -0.903  7.684   1.00 0.00 ? 3  ASN B N    14 
ATOM 10570 C CA   . ASN B 2 3  ? 9.519   -1.935  7.673   1.00 0.00 ? 3  ASN B CA   14 
ATOM 10571 C C    . ASN B 2 3  ? 10.015  -3.169  6.919   1.00 0.00 ? 3  ASN B C    14 
ATOM 10572 O O    . ASN B 2 3  ? 11.132  -3.208  6.442   1.00 0.00 ? 3  ASN B O    14 
ATOM 10573 C CB   . ASN B 2 3  ? 8.273   -1.376  6.981   1.00 0.00 ? 3  ASN B CB   14 
ATOM 10574 C CG   . ASN B 2 3  ? 8.691   -0.480  5.814   1.00 0.00 ? 3  ASN B CG   14 
ATOM 10575 O OD1  . ASN B 2 3  ? 8.687   -0.904  4.675   1.00 0.00 ? 3  ASN B OD1  14 
ATOM 10576 N ND2  . ASN B 2 3  ? 9.054   0.751   6.050   1.00 0.00 ? 3  ASN B ND2  14 
ATOM 10577 H H    . ASN B 2 3  ? 10.763  -0.361  6.885   1.00 0.00 ? 3  ASN B H    14 
ATOM 10578 H HA   . ASN B 2 3  ? 9.275   -2.209  8.689   1.00 0.00 ? 3  ASN B HA   14 
ATOM 10579 H HB2  . ASN B 2 3  ? 7.672   -2.194  6.610   1.00 0.00 ? 3  ASN B HB2  14 
ATOM 10580 H HB3  . ASN B 2 3  ? 7.698   -0.798  7.688   1.00 0.00 ? 3  ASN B HB3  14 
ATOM 10581 H HD21 . ASN B 2 3  ? 9.056   1.093   6.969   1.00 0.00 ? 3  ASN B HD21 14 
ATOM 10582 H HD22 . ASN B 2 3  ? 9.323   1.333   5.310   1.00 0.00 ? 3  ASN B HD22 14 
ATOM 10583 N N    . GLN B 2 4  ? 9.199   -4.181  6.807   1.00 0.00 ? 4  GLN B N    14 
ATOM 10584 C CA   . GLN B 2 4  ? 9.639   -5.406  6.083   1.00 0.00 ? 4  GLN B CA   14 
ATOM 10585 C C    . GLN B 2 4  ? 8.419   -6.211  5.629   1.00 0.00 ? 4  GLN B C    14 
ATOM 10586 O O    . GLN B 2 4  ? 8.346   -7.405  5.841   1.00 0.00 ? 4  GLN B O    14 
ATOM 10587 C CB   . GLN B 2 4  ? 10.496  -6.265  7.014   1.00 0.00 ? 4  GLN B CB   14 
ATOM 10588 C CG   . GLN B 2 4  ? 11.898  -5.663  7.121   1.00 0.00 ? 4  GLN B CG   14 
ATOM 10589 C CD   . GLN B 2 4  ? 12.931  -6.787  7.226   1.00 0.00 ? 4  GLN B CD   14 
ATOM 10590 O OE1  . GLN B 2 4  ? 12.588  -7.950  7.155   1.00 0.00 ? 4  GLN B OE1  14 
ATOM 10591 N NE2  . GLN B 2 4  ? 14.190  -6.487  7.393   1.00 0.00 ? 4  GLN B NE2  14 
ATOM 10592 H H    . GLN B 2 4  ? 8.301   -4.136  7.198   1.00 0.00 ? 4  GLN B H    14 
ATOM 10593 H HA   . GLN B 2 4  ? 10.223  -5.122  5.221   1.00 0.00 ? 4  GLN B HA   14 
ATOM 10594 H HB2  . GLN B 2 4  ? 10.042  -6.298  7.994   1.00 0.00 ? 4  GLN B HB2  14 
ATOM 10595 H HB3  . GLN B 2 4  ? 10.566  -7.267  6.617   1.00 0.00 ? 4  GLN B HB3  14 
ATOM 10596 H HG2  . GLN B 2 4  ? 12.102  -5.067  6.243   1.00 0.00 ? 4  GLN B HG2  14 
ATOM 10597 H HG3  . GLN B 2 4  ? 11.957  -5.040  8.001   1.00 0.00 ? 4  GLN B HG3  14 
ATOM 10598 H HE21 . GLN B 2 4  ? 14.467  -5.549  7.450   1.00 0.00 ? 4  GLN B HE21 14 
ATOM 10599 H HE22 . GLN B 2 4  ? 14.858  -7.201  7.462   1.00 0.00 ? 4  GLN B HE22 14 
ATOM 10600 N N    . HIS B 2 5  ? 7.466   -5.569  5.003   1.00 0.00 ? 5  HIS B N    14 
ATOM 10601 C CA   . HIS B 2 5  ? 6.250   -6.306  4.528   1.00 0.00 ? 5  HIS B CA   14 
ATOM 10602 C C    . HIS B 2 5  ? 6.665   -7.669  3.962   1.00 0.00 ? 5  HIS B C    14 
ATOM 10603 O O    . HIS B 2 5  ? 7.809   -7.887  3.616   1.00 0.00 ? 5  HIS B O    14 
ATOM 10604 C CB   . HIS B 2 5  ? 5.522   -5.506  3.433   1.00 0.00 ? 5  HIS B CB   14 
ATOM 10605 C CG   . HIS B 2 5  ? 6.443   -4.478  2.835   1.00 0.00 ? 5  HIS B CG   14 
ATOM 10606 N ND1  . HIS B 2 5  ? 7.801   -4.702  2.684   1.00 0.00 ? 5  HIS B ND1  14 
ATOM 10607 C CD2  . HIS B 2 5  ? 6.220   -3.205  2.372   1.00 0.00 ? 5  HIS B CD2  14 
ATOM 10608 C CE1  . HIS B 2 5  ? 8.340   -3.591  2.158   1.00 0.00 ? 5  HIS B CE1  14 
ATOM 10609 N NE2  . HIS B 2 5  ? 7.420   -2.646  1.945   1.00 0.00 ? 5  HIS B NE2  14 
ATOM 10610 H H    . HIS B 2 5  ? 7.550   -4.602  4.846   1.00 0.00 ? 5  HIS B H    14 
ATOM 10611 H HA   . HIS B 2 5  ? 5.580   -6.459  5.362   1.00 0.00 ? 5  HIS B HA   14 
ATOM 10612 H HB2  . HIS B 2 5  ? 5.190   -6.182  2.659   1.00 0.00 ? 5  HIS B HB2  14 
ATOM 10613 H HB3  . HIS B 2 5  ? 4.664   -5.011  3.865   1.00 0.00 ? 5  HIS B HB3  14 
ATOM 10614 H HD1  . HIS B 2 5  ? 8.282   -5.523  2.920   1.00 0.00 ? 5  HIS B HD1  14 
ATOM 10615 H HD2  . HIS B 2 5  ? 5.259   -2.712  2.344   1.00 0.00 ? 5  HIS B HD2  14 
ATOM 10616 H HE1  . HIS B 2 5  ? 9.391   -3.471  1.954   1.00 0.00 ? 5  HIS B HE1  14 
ATOM 10617 N N    . LEU B 2 6  ? 5.745   -8.593  3.878   1.00 0.00 ? 6  LEU B N    14 
ATOM 10618 C CA   . LEU B 2 6  ? 6.085   -9.946  3.351   1.00 0.00 ? 6  LEU B CA   14 
ATOM 10619 C C    . LEU B 2 6  ? 6.015   -9.955  1.820   1.00 0.00 ? 6  LEU B C    14 
ATOM 10620 O O    . LEU B 2 6  ? 6.448   -10.893 1.181   1.00 0.00 ? 6  LEU B O    14 
ATOM 10621 C CB   . LEU B 2 6  ? 5.093   -10.970 3.907   1.00 0.00 ? 6  LEU B CB   14 
ATOM 10622 C CG   . LEU B 2 6  ? 5.329   -11.149 5.408   1.00 0.00 ? 6  LEU B CG   14 
ATOM 10623 C CD1  . LEU B 2 6  ? 6.799   -11.487 5.657   1.00 0.00 ? 6  LEU B CD1  14 
ATOM 10624 C CD2  . LEU B 2 6  ? 4.976   -9.851  6.138   1.00 0.00 ? 6  LEU B CD2  14 
ATOM 10625 H H    . LEU B 2 6  ? 4.833   -8.399  4.173   1.00 0.00 ? 6  LEU B H    14 
ATOM 10626 H HA   . LEU B 2 6  ? 7.084   -10.211 3.664   1.00 0.00 ? 6  LEU B HA   14 
ATOM 10627 H HB2  . LEU B 2 6  ? 4.085   -10.621 3.740   1.00 0.00 ? 6  LEU B HB2  14 
ATOM 10628 H HB3  . LEU B 2 6  ? 5.235   -11.916 3.408   1.00 0.00 ? 6  LEU B HB3  14 
ATOM 10629 H HG   . LEU B 2 6  ? 4.708   -11.952 5.776   1.00 0.00 ? 6  LEU B HG   14 
ATOM 10630 H HD11 . LEU B 2 6  ? 7.266   -11.774 4.726   1.00 0.00 ? 6  LEU B HD11 14 
ATOM 10631 H HD12 . LEU B 2 6  ? 6.866   -12.305 6.360   1.00 0.00 ? 6  LEU B HD12 14 
ATOM 10632 H HD13 . LEU B 2 6  ? 7.304   -10.623 6.062   1.00 0.00 ? 6  LEU B HD13 14 
ATOM 10633 H HD21 . LEU B 2 6  ? 4.158   -9.363  5.629   1.00 0.00 ? 6  LEU B HD21 14 
ATOM 10634 H HD22 . LEU B 2 6  ? 5.836   -9.197  6.146   1.00 0.00 ? 6  LEU B HD22 14 
ATOM 10635 H HD23 . LEU B 2 6  ? 4.685   -10.077 7.153   1.00 0.00 ? 6  LEU B HD23 14 
ATOM 10636 N N    . CYS B 2 7  ? 5.469   -8.929  1.224   1.00 0.00 ? 7  CYS B N    14 
ATOM 10637 C CA   . CYS B 2 7  ? 5.374   -8.898  -0.266  1.00 0.00 ? 7  CYS B CA   14 
ATOM 10638 C C    . CYS B 2 7  ? 4.495   -10.058 -0.740  1.00 0.00 ? 7  CYS B C    14 
ATOM 10639 O O    . CYS B 2 7  ? 4.936   -11.185 -0.846  1.00 0.00 ? 7  CYS B O    14 
ATOM 10640 C CB   . CYS B 2 7  ? 6.777   -9.023  -0.873  1.00 0.00 ? 7  CYS B CB   14 
ATOM 10641 S SG   . CYS B 2 7  ? 6.657   -9.383  -2.646  1.00 0.00 ? 7  CYS B SG   14 
ATOM 10642 H H    . CYS B 2 7  ? 5.117   -8.182  1.753   1.00 0.00 ? 7  CYS B H    14 
ATOM 10643 H HA   . CYS B 2 7  ? 4.931   -7.963  -0.577  1.00 0.00 ? 7  CYS B HA   14 
ATOM 10644 H HB2  . CYS B 2 7  ? 7.312   -8.096  -0.733  1.00 0.00 ? 7  CYS B HB2  14 
ATOM 10645 H HB3  . CYS B 2 7  ? 7.312   -9.822  -0.382  1.00 0.00 ? 7  CYS B HB3  14 
ATOM 10646 N N    . GLY B 2 8  ? 3.251   -9.786  -1.020  1.00 0.00 ? 8  GLY B N    14 
ATOM 10647 C CA   . GLY B 2 8  ? 2.330   -10.864 -1.483  1.00 0.00 ? 8  GLY B CA   14 
ATOM 10648 C C    . GLY B 2 8  ? 0.942   -10.620 -0.890  1.00 0.00 ? 8  GLY B C    14 
ATOM 10649 O O    . GLY B 2 8  ? -0.045  -11.175 -1.333  1.00 0.00 ? 8  GLY B O    14 
ATOM 10650 H H    . GLY B 2 8  ? 2.919   -8.869  -0.921  1.00 0.00 ? 8  GLY B H    14 
ATOM 10651 H HA2  . GLY B 2 8  ? 2.273   -10.852 -2.562  1.00 0.00 ? 8  GLY B HA2  14 
ATOM 10652 H HA3  . GLY B 2 8  ? 2.697   -11.822 -1.150  1.00 0.00 ? 8  GLY B HA3  14 
ATOM 10653 N N    . SER B 2 9  ? 0.865   -9.787  0.109   1.00 0.00 ? 9  SER B N    14 
ATOM 10654 C CA   . SER B 2 9  ? -0.446  -9.486  0.747   1.00 0.00 ? 9  SER B CA   14 
ATOM 10655 C C    . SER B 2 9  ? -0.253  -8.332  1.729   1.00 0.00 ? 9  SER B C    14 
ATOM 10656 O O    . SER B 2 9  ? -1.068  -7.435  1.825   1.00 0.00 ? 9  SER B O    14 
ATOM 10657 C CB   . SER B 2 9  ? -0.947  -10.721 1.497   1.00 0.00 ? 9  SER B CB   14 
ATOM 10658 O OG   . SER B 2 9  ? -2.127  -10.386 2.217   1.00 0.00 ? 9  SER B OG   14 
ATOM 10659 H H    . SER B 2 9  ? 1.677   -9.353  0.444   1.00 0.00 ? 9  SER B H    14 
ATOM 10660 H HA   . SER B 2 9  ? -1.163  -9.204  -0.011  1.00 0.00 ? 9  SER B HA   14 
ATOM 10661 H HB2  . SER B 2 9  ? -1.171  -11.506 0.795   1.00 0.00 ? 9  SER B HB2  14 
ATOM 10662 H HB3  . SER B 2 9  ? -0.180  -11.061 2.181   1.00 0.00 ? 9  SER B HB3  14 
ATOM 10663 H HG   . SER B 2 9  ? -2.494  -11.197 2.578   1.00 0.00 ? 9  SER B HG   14 
ATOM 10664 N N    . HIS B 2 10 ? 0.832   -8.348  2.452   1.00 0.00 ? 10 HIS B N    14 
ATOM 10665 C CA   . HIS B 2 10 ? 1.106   -7.261  3.425   1.00 0.00 ? 10 HIS B CA   14 
ATOM 10666 C C    . HIS B 2 10 ? 1.438   -5.973  2.667   1.00 0.00 ? 10 HIS B C    14 
ATOM 10667 O O    . HIS B 2 10 ? 1.069   -4.889  3.072   1.00 0.00 ? 10 HIS B O    14 
ATOM 10668 C CB   . HIS B 2 10 ? 2.297   -7.652  4.300   1.00 0.00 ? 10 HIS B CB   14 
ATOM 10669 C CG   . HIS B 2 10 ? 1.932   -8.838  5.151   1.00 0.00 ? 10 HIS B CG   14 
ATOM 10670 N ND1  . HIS B 2 10 ? 1.749   -10.104 4.616   1.00 0.00 ? 10 HIS B ND1  14 
ATOM 10671 C CD2  . HIS B 2 10 ? 1.721   -8.968  6.502   1.00 0.00 ? 10 HIS B CD2  14 
ATOM 10672 C CE1  . HIS B 2 10 ? 1.442   -10.932 5.631   1.00 0.00 ? 10 HIS B CE1  14 
ATOM 10673 N NE2  . HIS B 2 10 ? 1.411   -10.291 6.803   1.00 0.00 ? 10 HIS B NE2  14 
ATOM 10674 H H    . HIS B 2 10 ? 1.473   -9.078  2.351   1.00 0.00 ? 10 HIS B H    14 
ATOM 10675 H HA   . HIS B 2 10 ? 0.238   -7.106  4.044   1.00 0.00 ? 10 HIS B HA   14 
ATOM 10676 H HB2  . HIS B 2 10 ? 3.134   -7.907  3.668   1.00 0.00 ? 10 HIS B HB2  14 
ATOM 10677 H HB3  . HIS B 2 10 ? 2.566   -6.822  4.936   1.00 0.00 ? 10 HIS B HB3  14 
ATOM 10678 H HD1  . HIS B 2 10 ? 1.829   -10.351 3.672   1.00 0.00 ? 10 HIS B HD1  14 
ATOM 10679 H HD2  . HIS B 2 10 ? 1.788   -8.166  7.221   1.00 0.00 ? 10 HIS B HD2  14 
ATOM 10680 H HE1  . HIS B 2 10 ? 1.247   -11.988 5.514   1.00 0.00 ? 10 HIS B HE1  14 
ATOM 10681 N N    . LEU B 2 11 ? 2.140   -6.085  1.570   1.00 0.00 ? 11 LEU B N    14 
ATOM 10682 C CA   . LEU B 2 11 ? 2.504   -4.868  0.791   1.00 0.00 ? 11 LEU B CA   14 
ATOM 10683 C C    . LEU B 2 11 ? 1.234   -4.100  0.425   1.00 0.00 ? 11 LEU B C    14 
ATOM 10684 O O    . LEU B 2 11 ? 1.156   -2.899  0.593   1.00 0.00 ? 11 LEU B O    14 
ATOM 10685 C CB   . LEU B 2 11 ? 3.239   -5.282  -0.486  1.00 0.00 ? 11 LEU B CB   14 
ATOM 10686 C CG   . LEU B 2 11 ? 4.332   -4.259  -0.801  1.00 0.00 ? 11 LEU B CG   14 
ATOM 10687 C CD1  . LEU B 2 11 ? 4.865   -4.499  -2.215  1.00 0.00 ? 11 LEU B CD1  14 
ATOM 10688 C CD2  . LEU B 2 11 ? 3.749   -2.846  -0.711  1.00 0.00 ? 11 LEU B CD2  14 
ATOM 10689 H H    . LEU B 2 11 ? 2.433   -6.969  1.264   1.00 0.00 ? 11 LEU B H    14 
ATOM 10690 H HA   . LEU B 2 11 ? 3.146   -4.238  1.387   1.00 0.00 ? 11 LEU B HA   14 
ATOM 10691 H HB2  . LEU B 2 11 ? 3.686   -6.255  -0.345  1.00 0.00 ? 11 LEU B HB2  14 
ATOM 10692 H HB3  . LEU B 2 11 ? 2.540   -5.323  -1.308  1.00 0.00 ? 11 LEU B HB3  14 
ATOM 10693 H HG   . LEU B 2 11 ? 5.139   -4.364  -0.090  1.00 0.00 ? 11 LEU B HG   14 
ATOM 10694 H HD11 . LEU B 2 11 ? 4.514   -5.455  -2.574  1.00 0.00 ? 11 LEU B HD11 14 
ATOM 10695 H HD12 . LEU B 2 11 ? 5.945   -4.494  -2.198  1.00 0.00 ? 11 LEU B HD12 14 
ATOM 10696 H HD13 . LEU B 2 11 ? 4.512   -3.716  -2.870  1.00 0.00 ? 11 LEU B HD13 14 
ATOM 10697 H HD21 . LEU B 2 11 ? 2.979   -2.727  -1.458  1.00 0.00 ? 11 LEU B HD21 14 
ATOM 10698 H HD22 . LEU B 2 11 ? 4.532   -2.122  -0.883  1.00 0.00 ? 11 LEU B HD22 14 
ATOM 10699 H HD23 . LEU B 2 11 ? 3.326   -2.693  0.270   1.00 0.00 ? 11 LEU B HD23 14 
ATOM 10700 N N    . VAL B 2 12 ? 0.230   -4.780  -0.059  1.00 0.00 ? 12 VAL B N    14 
ATOM 10701 C CA   . VAL B 2 12 ? -1.033  -4.074  -0.411  1.00 0.00 ? 12 VAL B CA   14 
ATOM 10702 C C    . VAL B 2 12 ? -1.713  -3.631  0.879   1.00 0.00 ? 12 VAL B C    14 
ATOM 10703 O O    . VAL B 2 12 ? -2.166  -2.510  1.003   1.00 0.00 ? 12 VAL B O    14 
ATOM 10704 C CB   . VAL B 2 12 ? -1.961  -5.014  -1.186  1.00 0.00 ? 12 VAL B CB   14 
ATOM 10705 C CG1  . VAL B 2 12 ? -1.317  -5.385  -2.522  1.00 0.00 ? 12 VAL B CG1  14 
ATOM 10706 C CG2  . VAL B 2 12 ? -2.201  -6.286  -0.368  1.00 0.00 ? 12 VAL B CG2  14 
ATOM 10707 H H    . VAL B 2 12 ? 0.303   -5.749  -0.178  1.00 0.00 ? 12 VAL B H    14 
ATOM 10708 H HA   . VAL B 2 12 ? -0.806  -3.205  -1.011  1.00 0.00 ? 12 VAL B HA   14 
ATOM 10709 H HB   . VAL B 2 12 ? -2.903  -4.518  -1.367  1.00 0.00 ? 12 VAL B HB   14 
ATOM 10710 H HG11 . VAL B 2 12 ? -0.332  -5.792  -2.347  1.00 0.00 ? 12 VAL B HG11 14 
ATOM 10711 H HG12 . VAL B 2 12 ? -1.237  -4.502  -3.140  1.00 0.00 ? 12 VAL B HG12 14 
ATOM 10712 H HG13 . VAL B 2 12 ? -1.927  -6.121  -3.024  1.00 0.00 ? 12 VAL B HG13 14 
ATOM 10713 H HG21 . VAL B 2 12 ? -1.256  -6.764  -0.159  1.00 0.00 ? 12 VAL B HG21 14 
ATOM 10714 H HG22 . VAL B 2 12 ? -2.829  -6.961  -0.929  1.00 0.00 ? 12 VAL B HG22 14 
ATOM 10715 H HG23 . VAL B 2 12 ? -2.688  -6.030  0.561   1.00 0.00 ? 12 VAL B HG23 14 
ATOM 10716 N N    . GLU B 2 13 ? -1.769  -4.496  1.851   1.00 0.00 ? 13 GLU B N    14 
ATOM 10717 C CA   . GLU B 2 13 ? -2.397  -4.116  3.140   1.00 0.00 ? 13 GLU B CA   14 
ATOM 10718 C C    . GLU B 2 13 ? -1.711  -2.852  3.653   1.00 0.00 ? 13 GLU B C    14 
ATOM 10719 O O    . GLU B 2 13 ? -2.304  -2.040  4.334   1.00 0.00 ? 13 GLU B O    14 
ATOM 10720 C CB   . GLU B 2 13 ? -2.219  -5.249  4.153   1.00 0.00 ? 13 GLU B CB   14 
ATOM 10721 C CG   . GLU B 2 13 ? -3.345  -6.271  3.980   1.00 0.00 ? 13 GLU B CG   14 
ATOM 10722 C CD   . GLU B 2 13 ? -3.830  -6.734  5.355   1.00 0.00 ? 13 GLU B CD   14 
ATOM 10723 O OE1  . GLU B 2 13 ? -4.053  -5.883  6.200   1.00 0.00 ? 13 GLU B OE1  14 
ATOM 10724 O OE2  . GLU B 2 13 ? -3.971  -7.931  5.539   1.00 0.00 ? 13 GLU B OE2  14 
ATOM 10725 H H    . GLU B 2 13 ? -1.384  -5.390  1.736   1.00 0.00 ? 13 GLU B H    14 
ATOM 10726 H HA   . GLU B 2 13 ? -3.449  -3.923  2.989   1.00 0.00 ? 13 GLU B HA   14 
ATOM 10727 H HB2  . GLU B 2 13 ? -1.266  -5.731  3.990   1.00 0.00 ? 13 GLU B HB2  14 
ATOM 10728 H HB3  . GLU B 2 13 ? -2.253  -4.846  5.154   1.00 0.00 ? 13 GLU B HB3  14 
ATOM 10729 H HG2  . GLU B 2 13 ? -4.164  -5.815  3.442   1.00 0.00 ? 13 GLU B HG2  14 
ATOM 10730 H HG3  . GLU B 2 13 ? -2.978  -7.121  3.425   1.00 0.00 ? 13 GLU B HG3  14 
ATOM 10731 N N    . ALA B 2 14 ? -0.458  -2.680  3.322   1.00 0.00 ? 14 ALA B N    14 
ATOM 10732 C CA   . ALA B 2 14 ? 0.272   -1.470  3.782   1.00 0.00 ? 14 ALA B CA   14 
ATOM 10733 C C    . ALA B 2 14 ? -0.308  -0.243  3.084   1.00 0.00 ? 14 ALA B C    14 
ATOM 10734 O O    . ALA B 2 14 ? -0.607  0.754   3.706   1.00 0.00 ? 14 ALA B O    14 
ATOM 10735 C CB   . ALA B 2 14 ? 1.755   -1.604  3.434   1.00 0.00 ? 14 ALA B CB   14 
ATOM 10736 H H    . ALA B 2 14 ? -0.002  -3.344  2.768   1.00 0.00 ? 14 ALA B H    14 
ATOM 10737 H HA   . ALA B 2 14 ? 0.158   -1.368  4.845   1.00 0.00 ? 14 ALA B HA   14 
ATOM 10738 H HB1  . ALA B 2 14 ? 1.946   -2.593  3.045   1.00 0.00 ? 14 ALA B HB1  14 
ATOM 10739 H HB2  . ALA B 2 14 ? 2.349   -1.445  4.322   1.00 0.00 ? 14 ALA B HB2  14 
ATOM 10740 H HB3  . ALA B 2 14 ? 2.018   -0.867  2.689   1.00 0.00 ? 14 ALA B HB3  14 
ATOM 10741 N N    . LEU B 2 15 ? -0.489  -0.317  1.797   1.00 0.00 ? 15 LEU B N    14 
ATOM 10742 C CA   . LEU B 2 15 ? -1.069  0.840   1.060   1.00 0.00 ? 15 LEU B CA   14 
ATOM 10743 C C    . LEU B 2 15 ? -2.483  1.077   1.572   1.00 0.00 ? 15 LEU B C    14 
ATOM 10744 O O    . LEU B 2 15 ? -2.931  2.197   1.699   1.00 0.00 ? 15 LEU B O    14 
ATOM 10745 C CB   . LEU B 2 15 ? -1.100  0.530   -0.439  1.00 0.00 ? 15 LEU B CB   14 
ATOM 10746 C CG   . LEU B 2 15 ? -1.351  1.816   -1.225  1.00 0.00 ? 15 LEU B CG   14 
ATOM 10747 C CD1  . LEU B 2 15 ? -2.760  2.331   -0.928  1.00 0.00 ? 15 LEU B CD1  14 
ATOM 10748 C CD2  . LEU B 2 15 ? -0.322  2.871   -0.814  1.00 0.00 ? 15 LEU B CD2  14 
ATOM 10749 H H    . LEU B 2 15 ? -0.254  -1.138  1.319   1.00 0.00 ? 15 LEU B H    14 
ATOM 10750 H HA   . LEU B 2 15 ? -0.473  1.725   1.245   1.00 0.00 ? 15 LEU B HA   14 
ATOM 10751 H HB2  . LEU B 2 15 ? -0.154  0.104   -0.737  1.00 0.00 ? 15 LEU B HB2  14 
ATOM 10752 H HB3  . LEU B 2 15 ? -1.893  -0.174  -0.644  1.00 0.00 ? 15 LEU B HB3  14 
ATOM 10753 H HG   . LEU B 2 15 ? -1.259  1.614   -2.283  1.00 0.00 ? 15 LEU B HG   14 
ATOM 10754 H HD11 . LEU B 2 15 ? -2.709  3.108   -0.180  1.00 0.00 ? 15 LEU B HD11 14 
ATOM 10755 H HD12 . LEU B 2 15 ? -3.371  1.519   -0.562  1.00 0.00 ? 15 LEU B HD12 14 
ATOM 10756 H HD13 . LEU B 2 15 ? -3.196  2.730   -1.831  1.00 0.00 ? 15 LEU B HD13 14 
ATOM 10757 H HD21 . LEU B 2 15 ? 0.112   3.314   -1.698  1.00 0.00 ? 15 LEU B HD21 14 
ATOM 10758 H HD22 . LEU B 2 15 ? 0.455   2.405   -0.226  1.00 0.00 ? 15 LEU B HD22 14 
ATOM 10759 H HD23 . LEU B 2 15 ? -0.807  3.638   -0.228  1.00 0.00 ? 15 LEU B HD23 14 
ATOM 10760 N N    . TYR B 2 16 ? -3.184  0.031   1.891   1.00 0.00 ? 16 TYR B N    14 
ATOM 10761 C CA   . TYR B 2 16 ? -4.554  0.208   2.425   1.00 0.00 ? 16 TYR B CA   14 
ATOM 10762 C C    . TYR B 2 16 ? -4.438  0.847   3.805   1.00 0.00 ? 16 TYR B C    14 
ATOM 10763 O O    . TYR B 2 16 ? -5.090  1.825   4.114   1.00 0.00 ? 16 TYR B O    14 
ATOM 10764 C CB   . TYR B 2 16 ? -5.241  -1.155  2.547   1.00 0.00 ? 16 TYR B CB   14 
ATOM 10765 C CG   . TYR B 2 16 ? -5.689  -1.624  1.184   1.00 0.00 ? 16 TYR B CG   14 
ATOM 10766 C CD1  . TYR B 2 16 ? -4.779  -1.660  0.120   1.00 0.00 ? 16 TYR B CD1  14 
ATOM 10767 C CD2  . TYR B 2 16 ? -7.015  -2.026  0.984   1.00 0.00 ? 16 TYR B CD2  14 
ATOM 10768 C CE1  . TYR B 2 16 ? -5.196  -2.096  -1.143  1.00 0.00 ? 16 TYR B CE1  14 
ATOM 10769 C CE2  . TYR B 2 16 ? -7.432  -2.462  -0.280  1.00 0.00 ? 16 TYR B CE2  14 
ATOM 10770 C CZ   . TYR B 2 16 ? -6.522  -2.498  -1.343  1.00 0.00 ? 16 TYR B CZ   14 
ATOM 10771 O OH   . TYR B 2 16 ? -6.933  -2.927  -2.589  1.00 0.00 ? 16 TYR B OH   14 
ATOM 10772 H H    . TYR B 2 16 ? -2.800  -0.865  1.799   1.00 0.00 ? 16 TYR B H    14 
ATOM 10773 H HA   . TYR B 2 16 ? -5.123  0.849   1.772   1.00 0.00 ? 16 TYR B HA   14 
ATOM 10774 H HB2  . TYR B 2 16 ? -4.547  -1.870  2.964   1.00 0.00 ? 16 TYR B HB2  14 
ATOM 10775 H HB3  . TYR B 2 16 ? -6.099  -1.068  3.197   1.00 0.00 ? 16 TYR B HB3  14 
ATOM 10776 H HD1  . TYR B 2 16 ? -3.757  -1.350  0.273   1.00 0.00 ? 16 TYR B HD1  14 
ATOM 10777 H HD2  . TYR B 2 16 ? -7.717  -1.999  1.804   1.00 0.00 ? 16 TYR B HD2  14 
ATOM 10778 H HE1  . TYR B 2 16 ? -4.494  -2.124  -1.964  1.00 0.00 ? 16 TYR B HE1  14 
ATOM 10779 H HE2  . TYR B 2 16 ? -8.455  -2.772  -0.434  1.00 0.00 ? 16 TYR B HE2  14 
ATOM 10780 H HH   . TYR B 2 16 ? -7.130  -3.865  -2.529  1.00 0.00 ? 16 TYR B HH   14 
ATOM 10781 N N    . LEU B 2 17 ? -3.606  0.288   4.638   1.00 0.00 ? 17 LEU B N    14 
ATOM 10782 C CA   . LEU B 2 17 ? -3.426  0.837   6.009   1.00 0.00 ? 17 LEU B CA   14 
ATOM 10783 C C    . LEU B 2 17 ? -2.706  2.187   5.976   1.00 0.00 ? 17 LEU B C    14 
ATOM 10784 O O    . LEU B 2 17 ? -3.063  3.098   6.696   1.00 0.00 ? 17 LEU B O    14 
ATOM 10785 C CB   . LEU B 2 17 ? -2.626  -0.152  6.858   1.00 0.00 ? 17 LEU B CB   14 
ATOM 10786 C CG   . LEU B 2 17 ? -3.379  -0.432  8.160   1.00 0.00 ? 17 LEU B CG   14 
ATOM 10787 C CD1  . LEU B 2 17 ? -2.630  -1.494  8.966   1.00 0.00 ? 17 LEU B CD1  14 
ATOM 10788 C CD2  . LEU B 2 17 ? -3.474  0.857   8.980   1.00 0.00 ? 17 LEU B CD2  14 
ATOM 10789 H H    . LEU B 2 17 ? -3.098  -0.500  4.357   1.00 0.00 ? 17 LEU B H    14 
ATOM 10790 H HA   . LEU B 2 17 ? -4.396  0.980   6.447   1.00 0.00 ? 17 LEU B HA   14 
ATOM 10791 H HB2  . LEU B 2 17 ? -2.497  -1.075  6.311   1.00 0.00 ? 17 LEU B HB2  14 
ATOM 10792 H HB3  . LEU B 2 17 ? -1.659  0.269   7.088   1.00 0.00 ? 17 LEU B HB3  14 
ATOM 10793 H HG   . LEU B 2 17 ? -4.373  -0.789  7.930   1.00 0.00 ? 17 LEU B HG   14 
ATOM 10794 H HD11 . LEU B 2 17 ? -1.914  -1.013  9.616   1.00 0.00 ? 17 LEU B HD11 14 
ATOM 10795 H HD12 . LEU B 2 17 ? -2.113  -2.160  8.291   1.00 0.00 ? 17 LEU B HD12 14 
ATOM 10796 H HD13 . LEU B 2 17 ? -3.334  -2.058  9.560   1.00 0.00 ? 17 LEU B HD13 14 
ATOM 10797 H HD21 . LEU B 2 17 ? -3.910  0.639   9.944   1.00 0.00 ? 17 LEU B HD21 14 
ATOM 10798 H HD22 . LEU B 2 17 ? -4.093  1.571   8.458   1.00 0.00 ? 17 LEU B HD22 14 
ATOM 10799 H HD23 . LEU B 2 17 ? -2.486  1.269   9.117   1.00 0.00 ? 17 LEU B HD23 14 
ATOM 10800 N N    . VAL B 2 18 ? -1.695  2.337   5.164   1.00 0.00 ? 18 VAL B N    14 
ATOM 10801 C CA   . VAL B 2 18 ? -0.985  3.648   5.136   1.00 0.00 ? 18 VAL B CA   14 
ATOM 10802 C C    . VAL B 2 18 ? -2.018  4.727   4.841   1.00 0.00 ? 18 VAL B C    14 
ATOM 10803 O O    . VAL B 2 18 ? -2.094  5.735   5.514   1.00 0.00 ? 18 VAL B O    14 
ATOM 10804 C CB   . VAL B 2 18 ? 0.101   3.666   4.048   1.00 0.00 ? 18 VAL B CB   14 
ATOM 10805 C CG1  . VAL B 2 18 ? 1.116   2.546   4.277   1.00 0.00 ? 18 VAL B CG1  14 
ATOM 10806 C CG2  . VAL B 2 18 ? -0.547  3.491   2.682   1.00 0.00 ? 18 VAL B CG2  14 
ATOM 10807 H H    . VAL B 2 18 ? -1.407  1.599   4.589   1.00 0.00 ? 18 VAL B H    14 
ATOM 10808 H HA   . VAL B 2 18 ? -0.542  3.834   6.098   1.00 0.00 ? 18 VAL B HA   14 
ATOM 10809 H HB   . VAL B 2 18 ? 0.612   4.607   4.075   1.00 0.00 ? 18 VAL B HB   14 
ATOM 10810 H HG11 . VAL B 2 18 ? 1.291   2.024   3.347   1.00 0.00 ? 18 VAL B HG11 14 
ATOM 10811 H HG12 . VAL B 2 18 ? 0.734   1.855   5.012   1.00 0.00 ? 18 VAL B HG12 14 
ATOM 10812 H HG13 . VAL B 2 18 ? 2.046   2.970   4.629   1.00 0.00 ? 18 VAL B HG13 14 
ATOM 10813 H HG21 . VAL B 2 18 ? -1.138  4.365   2.448   1.00 0.00 ? 18 VAL B HG21 14 
ATOM 10814 H HG22 . VAL B 2 18 ? -1.181  2.623   2.703   1.00 0.00 ? 18 VAL B HG22 14 
ATOM 10815 H HG23 . VAL B 2 18 ? 0.219   3.362   1.933   1.00 0.00 ? 18 VAL B HG23 14 
ATOM 10816 N N    . CYS B 2 19 ? -2.829  4.502   3.851   1.00 0.00 ? 19 CYS B N    14 
ATOM 10817 C CA   . CYS B 2 19 ? -3.889  5.484   3.502   1.00 0.00 ? 19 CYS B CA   14 
ATOM 10818 C C    . CYS B 2 19 ? -4.598  4.987   2.249   1.00 0.00 ? 19 CYS B C    14 
ATOM 10819 O O    . CYS B 2 19 ? -4.974  5.755   1.386   1.00 0.00 ? 19 CYS B O    14 
ATOM 10820 C CB   . CYS B 2 19 ? -3.272  6.863   3.241   1.00 0.00 ? 19 CYS B CB   14 
ATOM 10821 S SG   . CYS B 2 19 ? -2.379  6.850   1.667   1.00 0.00 ? 19 CYS B SG   14 
ATOM 10822 H H    . CYS B 2 19 ? -2.749  3.665   3.337   1.00 0.00 ? 19 CYS B H    14 
ATOM 10823 H HA   . CYS B 2 19 ? -4.599  5.552   4.314   1.00 0.00 ? 19 CYS B HA   14 
ATOM 10824 H HB2  . CYS B 2 19 ? -4.056  7.604   3.201   1.00 0.00 ? 19 CYS B HB2  14 
ATOM 10825 H HB3  . CYS B 2 19 ? -2.588  7.109   4.039   1.00 0.00 ? 19 CYS B HB3  14 
ATOM 10826 N N    . GLY B 2 20 ? -4.768  3.700   2.138   1.00 0.00 ? 20 GLY B N    14 
ATOM 10827 C CA   . GLY B 2 20 ? -5.439  3.149   0.925   1.00 0.00 ? 20 GLY B CA   14 
ATOM 10828 C C    . GLY B 2 20 ? -6.892  2.799   1.249   1.00 0.00 ? 20 GLY B C    14 
ATOM 10829 O O    . GLY B 2 20 ? -7.749  2.815   0.389   1.00 0.00 ? 20 GLY B O    14 
ATOM 10830 H H    . GLY B 2 20 ? -4.442  3.093   2.852   1.00 0.00 ? 20 GLY B H    14 
ATOM 10831 H HA2  . GLY B 2 20 ? -5.413  3.889   0.136   1.00 0.00 ? 20 GLY B HA2  14 
ATOM 10832 H HA3  . GLY B 2 20 ? -4.920  2.261   0.598   1.00 0.00 ? 20 GLY B HA3  14 
ATOM 10833 N N    . GLU B 2 21 ? -7.177  2.484   2.482   1.00 0.00 ? 21 GLU B N    14 
ATOM 10834 C CA   . GLU B 2 21 ? -8.577  2.134   2.855   1.00 0.00 ? 21 GLU B CA   14 
ATOM 10835 C C    . GLU B 2 21 ? -9.527  3.232   2.368   1.00 0.00 ? 21 GLU B C    14 
ATOM 10836 O O    . GLU B 2 21 ? -10.575 2.959   1.817   1.00 0.00 ? 21 GLU B O    14 
ATOM 10837 C CB   . GLU B 2 21 ? -8.683  2.007   4.376   1.00 0.00 ? 21 GLU B CB   14 
ATOM 10838 C CG   . GLU B 2 21 ? -10.069 1.477   4.749   1.00 0.00 ? 21 GLU B CG   14 
ATOM 10839 C CD   . GLU B 2 21 ? -10.614 2.266   5.940   1.00 0.00 ? 21 GLU B CD   14 
ATOM 10840 O OE1  . GLU B 2 21 ? -9.817  2.858   6.649   1.00 0.00 ? 21 GLU B OE1  14 
ATOM 10841 O OE2  . GLU B 2 21 ? -11.821 2.266   6.124   1.00 0.00 ? 21 GLU B OE2  14 
ATOM 10842 H H    . GLU B 2 21 ? -6.472  2.477   3.163   1.00 0.00 ? 21 GLU B H    14 
ATOM 10843 H HA   . GLU B 2 21 ? -8.848  1.195   2.396   1.00 0.00 ? 21 GLU B HA   14 
ATOM 10844 H HB2  . GLU B 2 21 ? -7.927  1.323   4.734   1.00 0.00 ? 21 GLU B HB2  14 
ATOM 10845 H HB3  . GLU B 2 21 ? -8.536  2.975   4.830   1.00 0.00 ? 21 GLU B HB3  14 
ATOM 10846 H HG2  . GLU B 2 21 ? -10.735 1.589   3.906   1.00 0.00 ? 21 GLU B HG2  14 
ATOM 10847 H HG3  . GLU B 2 21 ? -9.996  0.433   5.014   1.00 0.00 ? 21 GLU B HG3  14 
ATOM 10848 N N    . ARG B 2 22 ? -9.172  4.470   2.573   1.00 0.00 ? 22 ARG B N    14 
ATOM 10849 C CA   . ARG B 2 22 ? -10.054 5.583   2.129   1.00 0.00 ? 22 ARG B CA   14 
ATOM 10850 C C    . ARG B 2 22 ? -10.105 5.630   0.601   1.00 0.00 ? 22 ARG B C    14 
ATOM 10851 O O    . ARG B 2 22 ? -11.162 5.634   0.003   1.00 0.00 ? 22 ARG B O    14 
ATOM 10852 C CB   . ARG B 2 22 ? -9.507  6.910   2.660   1.00 0.00 ? 22 ARG B CB   14 
ATOM 10853 C CG   . ARG B 2 22 ? -10.395 7.407   3.802   1.00 0.00 ? 22 ARG B CG   14 
ATOM 10854 C CD   . ARG B 2 22 ? -10.870 8.829   3.498   1.00 0.00 ? 22 ARG B CD   14 
ATOM 10855 N NE   . ARG B 2 22 ? -12.357 8.881   3.562   1.00 0.00 ? 22 ARG B NE   14 
ATOM 10856 C CZ   . ARG B 2 22 ? -13.068 8.510   2.532   1.00 0.00 ? 22 ARG B CZ   14 
ATOM 10857 N NH1  . ARG B 2 22 ? -13.239 7.241   2.280   1.00 0.00 ? 22 ARG B NH1  14 
ATOM 10858 N NH2  . ARG B 2 22 ? -13.608 9.408   1.754   1.00 0.00 ? 22 ARG B NH2  14 
ATOM 10859 H H    . ARG B 2 22 ? -8.327  4.669   3.023   1.00 0.00 ? 22 ARG B H    14 
ATOM 10860 H HA   . ARG B 2 22 ? -11.044 5.425   2.515   1.00 0.00 ? 22 ARG B HA   14 
ATOM 10861 H HB2  . ARG B 2 22 ? -8.500  6.764   3.023   1.00 0.00 ? 22 ARG B HB2  14 
ATOM 10862 H HB3  . ARG B 2 22 ? -9.502  7.641   1.866   1.00 0.00 ? 22 ARG B HB3  14 
ATOM 10863 H HG2  . ARG B 2 22 ? -11.251 6.755   3.904   1.00 0.00 ? 22 ARG B HG2  14 
ATOM 10864 H HG3  . ARG B 2 22 ? -9.832  7.408   4.723   1.00 0.00 ? 22 ARG B HG3  14 
ATOM 10865 H HD2  . ARG B 2 22 ? -10.454 9.511   4.225   1.00 0.00 ? 22 ARG B HD2  14 
ATOM 10866 H HD3  . ARG B 2 22 ? -10.542 9.114   2.509   1.00 0.00 ? 22 ARG B HD3  14 
ATOM 10867 H HE   . ARG B 2 22 ? -12.802 9.194   4.377   1.00 0.00 ? 22 ARG B HE   14 
ATOM 10868 H HH11 . ARG B 2 22 ? -12.825 6.553   2.876   1.00 0.00 ? 22 ARG B HH11 14 
ATOM 10869 H HH12 . ARG B 2 22 ? -13.783 6.957   1.491   1.00 0.00 ? 22 ARG B HH12 14 
ATOM 10870 H HH21 . ARG B 2 22 ? -13.477 10.380  1.948   1.00 0.00 ? 22 ARG B HH21 14 
ATOM 10871 H HH22 . ARG B 2 22 ? -14.152 9.124   0.965   1.00 0.00 ? 22 ARG B HH22 14 
ATOM 10872 N N    . GLY B 2 23 ? -8.968  5.672   -0.033  1.00 0.00 ? 23 GLY B N    14 
ATOM 10873 C CA   . GLY B 2 23 ? -8.943  5.726   -1.523  1.00 0.00 ? 23 GLY B CA   14 
ATOM 10874 C C    . GLY B 2 23 ? -9.335  4.364   -2.098  1.00 0.00 ? 23 GLY B C    14 
ATOM 10875 O O    . GLY B 2 23 ? -9.530  4.217   -3.289  1.00 0.00 ? 23 GLY B O    14 
ATOM 10876 H H    . GLY B 2 23 ? -8.130  5.672   0.473   1.00 0.00 ? 23 GLY B H    14 
ATOM 10877 H HA2  . GLY B 2 23 ? -9.640  6.477   -1.867  1.00 0.00 ? 23 GLY B HA2  14 
ATOM 10878 H HA3  . GLY B 2 23 ? -7.948  5.980   -1.855  1.00 0.00 ? 23 GLY B HA3  14 
ATOM 10879 N N    . PHE B 2 24 ? -9.450  3.367   -1.266  1.00 0.00 ? 24 PHE B N    14 
ATOM 10880 C CA   . PHE B 2 24 ? -9.826  2.016   -1.771  1.00 0.00 ? 24 PHE B CA   14 
ATOM 10881 C C    . PHE B 2 24 ? -11.244 1.673   -1.314  1.00 0.00 ? 24 PHE B C    14 
ATOM 10882 O O    . PHE B 2 24 ? -11.621 0.521   -1.234  1.00 0.00 ? 24 PHE B O    14 
ATOM 10883 C CB   . PHE B 2 24 ? -8.853  0.978   -1.214  1.00 0.00 ? 24 PHE B CB   14 
ATOM 10884 C CG   . PHE B 2 24 ? -7.471  1.184   -1.803  1.00 0.00 ? 24 PHE B CG   14 
ATOM 10885 C CD1  . PHE B 2 24 ? -7.267  2.108   -2.839  1.00 0.00 ? 24 PHE B CD1  14 
ATOM 10886 C CD2  . PHE B 2 24 ? -6.391  0.443   -1.311  1.00 0.00 ? 24 PHE B CD2  14 
ATOM 10887 C CE1  . PHE B 2 24 ? -5.987  2.287   -3.377  1.00 0.00 ? 24 PHE B CE1  14 
ATOM 10888 C CE2  . PHE B 2 24 ? -5.112  0.622   -1.849  1.00 0.00 ? 24 PHE B CE2  14 
ATOM 10889 C CZ   . PHE B 2 24 ? -4.910  1.544   -2.882  1.00 0.00 ? 24 PHE B CZ   14 
ATOM 10890 H H    . PHE B 2 24 ? -9.287  3.505   -0.310  1.00 0.00 ? 24 PHE B H    14 
ATOM 10891 H HA   . PHE B 2 24 ? -9.784  2.007   -2.849  1.00 0.00 ? 24 PHE B HA   14 
ATOM 10892 H HB2  . PHE B 2 24 ? -8.804  1.079   -0.140  1.00 0.00 ? 24 PHE B HB2  14 
ATOM 10893 H HB3  . PHE B 2 24 ? -9.206  -0.010  -1.465  1.00 0.00 ? 24 PHE B HB3  14 
ATOM 10894 H HD1  . PHE B 2 24 ? -8.096  2.683   -3.221  1.00 0.00 ? 24 PHE B HD1  14 
ATOM 10895 H HD2  . PHE B 2 24 ? -6.546  -0.268  -0.514  1.00 0.00 ? 24 PHE B HD2  14 
ATOM 10896 H HE1  . PHE B 2 24 ? -5.832  2.999   -4.174  1.00 0.00 ? 24 PHE B HE1  14 
ATOM 10897 H HE2  . PHE B 2 24 ? -4.280  0.049   -1.467  1.00 0.00 ? 24 PHE B HE2  14 
ATOM 10898 H HZ   . PHE B 2 24 ? -3.923  1.682   -3.298  1.00 0.00 ? 24 PHE B HZ   14 
ATOM 10899 N N    . PHE B 2 25 ? -12.030 2.665   -1.015  1.00 0.00 ? 25 PHE B N    14 
ATOM 10900 C CA   . PHE B 2 25 ? -13.425 2.401   -0.563  1.00 0.00 ? 25 PHE B CA   14 
ATOM 10901 C C    . PHE B 2 25 ? -14.288 2.027   -1.771  1.00 0.00 ? 25 PHE B C    14 
ATOM 10902 O O    . PHE B 2 25 ? -14.655 2.866   -2.569  1.00 0.00 ? 25 PHE B O    14 
ATOM 10903 C CB   . PHE B 2 25 ? -13.993 3.658   0.099   1.00 0.00 ? 25 PHE B CB   14 
ATOM 10904 C CG   . PHE B 2 25 ? -14.777 3.272   1.330   1.00 0.00 ? 25 PHE B CG   14 
ATOM 10905 C CD1  . PHE B 2 25 ? -15.808 2.330   1.236   1.00 0.00 ? 25 PHE B CD1  14 
ATOM 10906 C CD2  . PHE B 2 25 ? -14.472 3.856   2.565   1.00 0.00 ? 25 PHE B CD2  14 
ATOM 10907 C CE1  . PHE B 2 25 ? -16.535 1.973   2.378   1.00 0.00 ? 25 PHE B CE1  14 
ATOM 10908 C CE2  . PHE B 2 25 ? -15.199 3.499   3.707   1.00 0.00 ? 25 PHE B CE2  14 
ATOM 10909 C CZ   . PHE B 2 25 ? -16.230 2.558   3.614   1.00 0.00 ? 25 PHE B CZ   14 
ATOM 10910 H H    . PHE B 2 25 ? -11.703 3.584   -1.086  1.00 0.00 ? 25 PHE B H    14 
ATOM 10911 H HA   . PHE B 2 25 ? -13.427 1.587   0.147   1.00 0.00 ? 25 PHE B HA   14 
ATOM 10912 H HB2  . PHE B 2 25 ? -13.182 4.314   0.379   1.00 0.00 ? 25 PHE B HB2  14 
ATOM 10913 H HB3  . PHE B 2 25 ? -14.644 4.167   -0.596  1.00 0.00 ? 25 PHE B HB3  14 
ATOM 10914 H HD1  . PHE B 2 25 ? -16.043 1.879   0.284   1.00 0.00 ? 25 PHE B HD1  14 
ATOM 10915 H HD2  . PHE B 2 25 ? -13.676 4.583   2.636   1.00 0.00 ? 25 PHE B HD2  14 
ATOM 10916 H HE1  . PHE B 2 25 ? -17.331 1.247   2.307   1.00 0.00 ? 25 PHE B HE1  14 
ATOM 10917 H HE2  . PHE B 2 25 ? -14.963 3.950   4.659   1.00 0.00 ? 25 PHE B HE2  14 
ATOM 10918 H HZ   . PHE B 2 25 ? -16.791 2.282   4.494   1.00 0.00 ? 25 PHE B HZ   14 
ATOM 10919 N N    . TYR B 2 26 ? -14.611 0.770   -1.913  1.00 0.00 ? 26 TYR B N    14 
ATOM 10920 C CA   . TYR B 2 26 ? -15.446 0.339   -3.070  1.00 0.00 ? 26 TYR B CA   14 
ATOM 10921 C C    . TYR B 2 26 ? -16.922 0.619   -2.770  1.00 0.00 ? 26 TYR B C    14 
ATOM 10922 O O    . TYR B 2 26 ? -17.340 0.579   -1.630  1.00 0.00 ? 26 TYR B O    14 
ATOM 10923 C CB   . TYR B 2 26 ? -15.252 -1.160  -3.308  1.00 0.00 ? 26 TYR B CB   14 
ATOM 10924 C CG   . TYR B 2 26 ? -13.937 -1.394  -4.013  1.00 0.00 ? 26 TYR B CG   14 
ATOM 10925 C CD1  . TYR B 2 26 ? -13.666 -0.747  -5.225  1.00 0.00 ? 26 TYR B CD1  14 
ATOM 10926 C CD2  . TYR B 2 26 ? -12.989 -2.260  -3.455  1.00 0.00 ? 26 TYR B CD2  14 
ATOM 10927 C CE1  . TYR B 2 26 ? -12.448 -0.967  -5.878  1.00 0.00 ? 26 TYR B CE1  14 
ATOM 10928 C CE2  . TYR B 2 26 ? -11.770 -2.479  -4.108  1.00 0.00 ? 26 TYR B CE2  14 
ATOM 10929 C CZ   . TYR B 2 26 ? -11.500 -1.832  -5.320  1.00 0.00 ? 26 TYR B CZ   14 
ATOM 10930 O OH   . TYR B 2 26 ? -10.298 -2.049  -5.964  1.00 0.00 ? 26 TYR B OH   14 
ATOM 10931 H H    . TYR B 2 26 ? -14.302 0.109   -1.259  1.00 0.00 ? 26 TYR B H    14 
ATOM 10932 H HA   . TYR B 2 26 ? -15.148 0.885   -3.952  1.00 0.00 ? 26 TYR B HA   14 
ATOM 10933 H HB2  . TYR B 2 26 ? -15.250 -1.678  -2.361  1.00 0.00 ? 26 TYR B HB2  14 
ATOM 10934 H HB3  . TYR B 2 26 ? -16.059 -1.534  -3.921  1.00 0.00 ? 26 TYR B HB3  14 
ATOM 10935 H HD1  . TYR B 2 26 ? -14.398 -0.080  -5.656  1.00 0.00 ? 26 TYR B HD1  14 
ATOM 10936 H HD2  . TYR B 2 26 ? -13.198 -2.759  -2.520  1.00 0.00 ? 26 TYR B HD2  14 
ATOM 10937 H HE1  . TYR B 2 26 ? -12.239 -0.468  -6.813  1.00 0.00 ? 26 TYR B HE1  14 
ATOM 10938 H HE2  . TYR B 2 26 ? -11.039 -3.146  -3.677  1.00 0.00 ? 26 TYR B HE2  14 
ATOM 10939 H HH   . TYR B 2 26 ? -10.013 -1.216  -6.347  1.00 0.00 ? 26 TYR B HH   14 
ATOM 10940 N N    . PRO B 2 27 ? -17.667 0.894   -3.810  1.00 0.00 ? 27 PRO B N    14 
ATOM 10941 C CA   . PRO B 2 27 ? -19.106 1.188   -3.703  1.00 0.00 ? 27 PRO B CA   14 
ATOM 10942 C C    . PRO B 2 27 ? -19.903 -0.109  -3.530  1.00 0.00 ? 27 PRO B C    14 
ATOM 10943 O O    . PRO B 2 27 ? -19.409 -1.190  -3.780  1.00 0.00 ? 27 PRO B O    14 
ATOM 10944 C CB   . PRO B 2 27 ? -19.436 1.857   -5.039  1.00 0.00 ? 27 PRO B CB   14 
ATOM 10945 C CG   . PRO B 2 27 ? -18.342 1.405   -6.036  1.00 0.00 ? 27 PRO B CG   14 
ATOM 10946 C CD   . PRO B 2 27 ? -17.142 0.939   -5.191  1.00 0.00 ? 27 PRO B CD   14 
ATOM 10947 H HA   . PRO B 2 27 ? -19.299 1.868   -2.890  1.00 0.00 ? 27 PRO B HA   14 
ATOM 10948 H HB2  . PRO B 2 27 ? -20.411 1.538   -5.382  1.00 0.00 ? 27 PRO B HB2  14 
ATOM 10949 H HB3  . PRO B 2 27 ? -19.411 2.930   -4.934  1.00 0.00 ? 27 PRO B HB3  14 
ATOM 10950 H HG2  . PRO B 2 27 ? -18.711 0.590   -6.644  1.00 0.00 ? 27 PRO B HG2  14 
ATOM 10951 H HG3  . PRO B 2 27 ? -18.046 2.232   -6.663  1.00 0.00 ? 27 PRO B HG3  14 
ATOM 10952 H HD2  . PRO B 2 27 ? -16.818 -0.044  -5.507  1.00 0.00 ? 27 PRO B HD2  14 
ATOM 10953 H HD3  . PRO B 2 27 ? -16.332 1.647   -5.259  1.00 0.00 ? 27 PRO B HD3  14 
ATOM 10954 N N    . THR B 2 28 ? -21.134 -0.009  -3.106  1.00 0.00 ? 28 THR B N    14 
ATOM 10955 C CA   . THR B 2 28 ? -21.959 -1.235  -2.920  1.00 0.00 ? 28 THR B CA   14 
ATOM 10956 C C    . THR B 2 28 ? -22.831 -1.455  -4.159  1.00 0.00 ? 28 THR B C    14 
ATOM 10957 O O    . THR B 2 28 ? -24.043 -1.472  -4.081  1.00 0.00 ? 28 THR B O    14 
ATOM 10958 C CB   . THR B 2 28 ? -22.854 -1.067  -1.690  1.00 0.00 ? 28 THR B CB   14 
ATOM 10959 O OG1  . THR B 2 28 ? -22.275 -0.110  -0.814  1.00 0.00 ? 28 THR B OG1  14 
ATOM 10960 C CG2  . THR B 2 28 ? -22.990 -2.408  -0.968  1.00 0.00 ? 28 THR B CG2  14 
ATOM 10961 H H    . THR B 2 28 ? -21.514 0.872   -2.911  1.00 0.00 ? 28 THR B H    14 
ATOM 10962 H HA   . THR B 2 28 ? -21.312 -2.088  -2.781  1.00 0.00 ? 28 THR B HA   14 
ATOM 10963 H HB   . THR B 2 28 ? -23.831 -0.729  -1.998  1.00 0.00 ? 28 THR B HB   14 
ATOM 10964 H HG1  . THR B 2 28 ? -22.988 0.356   -0.371  1.00 0.00 ? 28 THR B HG1  14 
ATOM 10965 H HG21 . THR B 2 28 ? -22.015 -2.862  -0.866  1.00 0.00 ? 28 THR B HG21 14 
ATOM 10966 H HG22 . THR B 2 28 ? -23.633 -3.061  -1.539  1.00 0.00 ? 28 THR B HG22 14 
ATOM 10967 H HG23 . THR B 2 28 ? -23.417 -2.248  0.011   1.00 0.00 ? 28 THR B HG23 14 
ATOM 10968 N N    . LYS B 2 29 ? -22.223 -1.621  -5.301  1.00 0.00 ? 29 LYS B N    14 
ATOM 10969 C CA   . LYS B 2 29 ? -23.017 -1.838  -6.543  1.00 0.00 ? 29 LYS B CA   14 
ATOM 10970 C C    . LYS B 2 29 ? -23.197 -3.339  -6.779  1.00 0.00 ? 29 LYS B C    14 
ATOM 10971 O O    . LYS B 2 29 ? -22.239 -4.080  -6.884  1.00 0.00 ? 29 LYS B O    14 
ATOM 10972 C CB   . LYS B 2 29 ? -22.281 -1.219  -7.733  1.00 0.00 ? 29 LYS B CB   14 
ATOM 10973 C CG   . LYS B 2 29 ? -23.150 -1.332  -8.987  1.00 0.00 ? 29 LYS B CG   14 
ATOM 10974 C CD   . LYS B 2 29 ? -22.398 -2.118  -10.062 1.00 0.00 ? 29 LYS B CD   14 
ATOM 10975 C CE   . LYS B 2 29 ? -21.126 -1.363  -10.451 1.00 0.00 ? 29 LYS B CE   14 
ATOM 10976 N NZ   . LYS B 2 29 ? -20.533 -1.982  -11.670 1.00 0.00 ? 29 LYS B NZ   14 
ATOM 10977 H H    . LYS B 2 29 ? -21.244 -1.603  -5.343  1.00 0.00 ? 29 LYS B H    14 
ATOM 10978 H HA   . LYS B 2 29 ? -23.985 -1.372  -6.437  1.00 0.00 ? 29 LYS B HA   14 
ATOM 10979 H HB2  . LYS B 2 29 ? -22.076 -0.179  -7.528  1.00 0.00 ? 29 LYS B HB2  14 
ATOM 10980 H HB3  . LYS B 2 29 ? -21.351 -1.744  -7.894  1.00 0.00 ? 29 LYS B HB3  14 
ATOM 10981 H HG2  . LYS B 2 29 ? -24.070 -1.844  -8.742  1.00 0.00 ? 29 LYS B HG2  14 
ATOM 10982 H HG3  . LYS B 2 29 ? -23.376 -0.344  -9.358  1.00 0.00 ? 29 LYS B HG3  14 
ATOM 10983 H HD2  . LYS B 2 29 ? -22.135 -3.093  -9.677  1.00 0.00 ? 29 LYS B HD2  14 
ATOM 10984 H HD3  . LYS B 2 29 ? -23.027 -2.232  -10.932 1.00 0.00 ? 29 LYS B HD3  14 
ATOM 10985 H HE2  . LYS B 2 29 ? -21.368 -0.330  -10.654 1.00 0.00 ? 29 LYS B HE2  14 
ATOM 10986 H HE3  . LYS B 2 29 ? -20.415 -1.413  -9.640  1.00 0.00 ? 29 LYS B HE3  14 
ATOM 10987 H HZ1  . LYS B 2 29 ? -20.680 -3.011  -11.643 1.00 0.00 ? 29 LYS B HZ1  14 
ATOM 10988 H HZ2  . LYS B 2 29 ? -19.513 -1.777  -11.701 1.00 0.00 ? 29 LYS B HZ2  14 
ATOM 10989 H HZ3  . LYS B 2 29 ? -20.993 -1.591  -12.516 1.00 0.00 ? 29 LYS B HZ3  14 
ATOM 10990 N N    . THR B 2 30 ? -24.417 -3.794  -6.864  1.00 0.00 ? 30 THR B N    14 
ATOM 10991 C CA   . THR B 2 30 ? -24.656 -5.247  -7.094  1.00 0.00 ? 30 THR B CA   14 
ATOM 10992 C C    . THR B 2 30 ? -24.436 -5.572  -8.573  1.00 0.00 ? 30 THR B C    14 
ATOM 10993 O O    . THR B 2 30 ? -24.431 -4.647  -9.368  1.00 0.00 ? 30 THR B O    14 
ATOM 10994 C CB   . THR B 2 30 ? -26.095 -5.595  -6.704  1.00 0.00 ? 30 THR B CB   14 
ATOM 10995 O OG1  . THR B 2 30 ? -26.816 -4.398  -6.446  1.00 0.00 ? 30 THR B OG1  14 
ATOM 10996 C CG2  . THR B 2 30 ? -26.088 -6.469  -5.448  1.00 0.00 ? 30 THR B CG2  14 
ATOM 10997 O OXT  . THR B 2 30 ? -24.277 -6.741  -8.884  1.00 0.00 ? 30 THR B OXT  14 
ATOM 10998 H H    . THR B 2 30 ? -25.176 -3.180  -6.778  1.00 0.00 ? 30 THR B H    14 
ATOM 10999 H HA   . THR B 2 30 ? -23.970 -5.824  -6.492  1.00 0.00 ? 30 THR B HA   14 
ATOM 11000 H HB   . THR B 2 30 ? -26.567 -6.134  -7.510  1.00 0.00 ? 30 THR B HB   14 
ATOM 11001 H HG1  . THR B 2 30 ? -26.587 -4.098  -5.564  1.00 0.00 ? 30 THR B HG1  14 
ATOM 11002 H HG21 . THR B 2 30 ? -25.831 -5.865  -4.591  1.00 0.00 ? 30 THR B HG21 14 
ATOM 11003 H HG22 . THR B 2 30 ? -25.360 -7.258  -5.564  1.00 0.00 ? 30 THR B HG22 14 
ATOM 11004 H HG23 . THR B 2 30 ? -27.067 -6.900  -5.305  1.00 0.00 ? 30 THR B HG23 14 
ATOM 11005 N N    . GLY A 1 1  ? 1.876   7.099   8.694   1.00 0.00 ? 1  GLY A N    15 
ATOM 11006 C CA   . GLY A 1 1  ? 1.934   6.791   7.236   1.00 0.00 ? 1  GLY A CA   15 
ATOM 11007 C C    . GLY A 1 1  ? 0.599   7.153   6.584   1.00 0.00 ? 1  GLY A C    15 
ATOM 11008 O O    . GLY A 1 1  ? -0.423  7.223   7.237   1.00 0.00 ? 1  GLY A O    15 
ATOM 11009 H H1   . GLY A 1 1  ? 1.472   6.289   9.204   1.00 0.00 ? 1  GLY A H1   15 
ATOM 11010 H H2   . GLY A 1 1  ? 1.280   7.939   8.847   1.00 0.00 ? 1  GLY A H2   15 
ATOM 11011 H H3   . GLY A 1 1  ? 2.836   7.285   9.047   1.00 0.00 ? 1  GLY A H3   15 
ATOM 11012 H HA2  . GLY A 1 1  ? 2.728   7.364   6.779   1.00 0.00 ? 1  GLY A HA2  15 
ATOM 11013 H HA3  . GLY A 1 1  ? 2.124   5.738   7.098   1.00 0.00 ? 1  GLY A HA3  15 
ATOM 11014 N N    . ILE A 1 2  ? 0.598   7.383   5.299   1.00 0.00 ? 2  ILE A N    15 
ATOM 11015 C CA   . ILE A 1 2  ? -0.673  7.739   4.608   1.00 0.00 ? 2  ILE A CA   15 
ATOM 11016 C C    . ILE A 1 2  ? -1.727  6.669   4.898   1.00 0.00 ? 2  ILE A C    15 
ATOM 11017 O O    . ILE A 1 2  ? -2.908  6.944   4.942   1.00 0.00 ? 2  ILE A O    15 
ATOM 11018 C CB   . ILE A 1 2  ? -0.432  7.832   3.099   1.00 0.00 ? 2  ILE A CB   15 
ATOM 11019 C CG1  . ILE A 1 2  ? 0.294   6.574   2.612   1.00 0.00 ? 2  ILE A CG1  15 
ATOM 11020 C CG2  . ILE A 1 2  ? 0.426   9.061   2.796   1.00 0.00 ? 2  ILE A CG2  15 
ATOM 11021 C CD1  . ILE A 1 2  ? -0.182  6.226   1.201   1.00 0.00 ? 2  ILE A CD1  15 
ATOM 11022 H H    . ILE A 1 2  ? 1.433   7.321   4.789   1.00 0.00 ? 2  ILE A H    15 
ATOM 11023 H HA   . ILE A 1 2  ? -1.024  8.693   4.975   1.00 0.00 ? 2  ILE A HA   15 
ATOM 11024 H HB   . ILE A 1 2  ? -1.380  7.923   2.589   1.00 0.00 ? 2  ILE A HB   15 
ATOM 11025 H HG12 . ILE A 1 2  ? 1.360   6.756   2.597   1.00 0.00 ? 2  ILE A HG12 15 
ATOM 11026 H HG13 . ILE A 1 2  ? 0.078   5.751   3.276   1.00 0.00 ? 2  ILE A HG13 15 
ATOM 11027 H HG21 . ILE A 1 2  ? 1.304   9.052   3.427   1.00 0.00 ? 2  ILE A HG21 15 
ATOM 11028 H HG22 . ILE A 1 2  ? -0.146  9.956   2.990   1.00 0.00 ? 2  ILE A HG22 15 
ATOM 11029 H HG23 . ILE A 1 2  ? 0.728   9.044   1.760   1.00 0.00 ? 2  ILE A HG23 15 
ATOM 11030 H HD11 . ILE A 1 2  ? -1.210  5.896   1.239   1.00 0.00 ? 2  ILE A HD11 15 
ATOM 11031 H HD12 . ILE A 1 2  ? 0.435   5.437   0.797   1.00 0.00 ? 2  ILE A HD12 15 
ATOM 11032 H HD13 . ILE A 1 2  ? -0.108  7.099   0.570   1.00 0.00 ? 2  ILE A HD13 15 
ATOM 11033 N N    . VAL A 1 3  ? -1.307  5.451   5.096   1.00 0.00 ? 3  VAL A N    15 
ATOM 11034 C CA   . VAL A 1 3  ? -2.272  4.363   5.383   1.00 0.00 ? 3  VAL A CA   15 
ATOM 11035 C C    . VAL A 1 3  ? -3.001  4.653   6.701   1.00 0.00 ? 3  VAL A C    15 
ATOM 11036 O O    . VAL A 1 3  ? -4.196  4.462   6.814   1.00 0.00 ? 3  VAL A O    15 
ATOM 11037 C CB   . VAL A 1 3  ? -1.505  3.038   5.473   1.00 0.00 ? 3  VAL A CB   15 
ATOM 11038 C CG1  . VAL A 1 3  ? -0.181  3.247   6.213   1.00 0.00 ? 3  VAL A CG1  15 
ATOM 11039 C CG2  . VAL A 1 3  ? -2.339  2.011   6.227   1.00 0.00 ? 3  VAL A CG2  15 
ATOM 11040 H H    . VAL A 1 3  ? -0.354  5.247   5.057   1.00 0.00 ? 3  VAL A H    15 
ATOM 11041 H HA   . VAL A 1 3  ? -2.994  4.306   4.585   1.00 0.00 ? 3  VAL A HA   15 
ATOM 11042 H HB   . VAL A 1 3  ? -1.302  2.674   4.476   1.00 0.00 ? 3  VAL A HB   15 
ATOM 11043 H HG11 . VAL A 1 3  ? -0.109  2.541   7.028   1.00 0.00 ? 3  VAL A HG11 15 
ATOM 11044 H HG12 . VAL A 1 3  ? -0.138  4.251   6.603   1.00 0.00 ? 3  VAL A HG12 15 
ATOM 11045 H HG13 . VAL A 1 3  ? 0.641   3.091   5.530   1.00 0.00 ? 3  VAL A HG13 15 
ATOM 11046 H HG21 . VAL A 1 3  ? -1.961  1.023   6.020   1.00 0.00 ? 3  VAL A HG21 15 
ATOM 11047 H HG22 . VAL A 1 3  ? -3.366  2.083   5.907   1.00 0.00 ? 3  VAL A HG22 15 
ATOM 11048 H HG23 . VAL A 1 3  ? -2.274  2.210   7.286   1.00 0.00 ? 3  VAL A HG23 15 
ATOM 11049 N N    . GLU A 1 4  ? -2.294  5.106   7.696   1.00 0.00 ? 4  GLU A N    15 
ATOM 11050 C CA   . GLU A 1 4  ? -2.947  5.400   9.002   1.00 0.00 ? 4  GLU A CA   15 
ATOM 11051 C C    . GLU A 1 4  ? -3.931  6.560   8.839   1.00 0.00 ? 4  GLU A C    15 
ATOM 11052 O O    . GLU A 1 4  ? -5.039  6.522   9.335   1.00 0.00 ? 4  GLU A O    15 
ATOM 11053 C CB   . GLU A 1 4  ? -1.881  5.779   10.032  1.00 0.00 ? 4  GLU A CB   15 
ATOM 11054 C CG   . GLU A 1 4  ? -1.253  4.509   10.608  1.00 0.00 ? 4  GLU A CG   15 
ATOM 11055 C CD   . GLU A 1 4  ? 0.177   4.808   11.062  1.00 0.00 ? 4  GLU A CD   15 
ATOM 11056 O OE1  . GLU A 1 4  ? 0.770   5.726   10.521  1.00 0.00 ? 4  GLU A OE1  15 
ATOM 11057 O OE2  . GLU A 1 4  ? 0.655   4.113   11.944  1.00 0.00 ? 4  GLU A OE2  15 
ATOM 11058 H H    . GLU A 1 4  ? -1.333  5.251   7.585   1.00 0.00 ? 4  GLU A H    15 
ATOM 11059 H HA   . GLU A 1 4  ? -3.479  4.527   9.341   1.00 0.00 ? 4  GLU A HA   15 
ATOM 11060 H HB2  . GLU A 1 4  ? -1.117  6.376   9.556   1.00 0.00 ? 4  GLU A HB2  15 
ATOM 11061 H HB3  . GLU A 1 4  ? -2.337  6.346   10.830  1.00 0.00 ? 4  GLU A HB3  15 
ATOM 11062 H HG2  . GLU A 1 4  ? -1.836  4.169   11.452  1.00 0.00 ? 4  GLU A HG2  15 
ATOM 11063 H HG3  . GLU A 1 4  ? -1.234  3.740   9.850   1.00 0.00 ? 4  GLU A HG3  15 
ATOM 11064 N N    . GLN A 1 5  ? -3.532  7.591   8.151   1.00 0.00 ? 5  GLN A N    15 
ATOM 11065 C CA   . GLN A 1 5  ? -4.440  8.756   7.959   1.00 0.00 ? 5  GLN A CA   15 
ATOM 11066 C C    . GLN A 1 5  ? -5.425  8.462   6.826   1.00 0.00 ? 5  GLN A C    15 
ATOM 11067 O O    . GLN A 1 5  ? -6.541  8.940   6.822   1.00 0.00 ? 5  GLN A O    15 
ATOM 11068 C CB   . GLN A 1 5  ? -3.612  9.994   7.606   1.00 0.00 ? 5  GLN A CB   15 
ATOM 11069 C CG   . GLN A 1 5  ? -3.242  10.743  8.888   1.00 0.00 ? 5  GLN A CG   15 
ATOM 11070 C CD   . GLN A 1 5  ? -1.918  10.203  9.431   1.00 0.00 ? 5  GLN A CD   15 
ATOM 11071 O OE1  . GLN A 1 5  ? -1.194  9.521   8.733   1.00 0.00 ? 5  GLN A OE1  15 
ATOM 11072 N NE2  . GLN A 1 5  ? -1.569  10.480  10.658  1.00 0.00 ? 5  GLN A NE2  15 
ATOM 11073 H H    . GLN A 1 5  ? -2.633  7.599   7.763   1.00 0.00 ? 5  GLN A H    15 
ATOM 11074 H HA   . GLN A 1 5  ? -4.987  8.939   8.871   1.00 0.00 ? 5  GLN A HA   15 
ATOM 11075 H HB2  . GLN A 1 5  ? -2.710  9.689   7.093   1.00 0.00 ? 5  GLN A HB2  15 
ATOM 11076 H HB3  . GLN A 1 5  ? -4.189  10.643  6.965   1.00 0.00 ? 5  GLN A HB3  15 
ATOM 11077 H HG2  . GLN A 1 5  ? -3.141  11.797  8.671   1.00 0.00 ? 5  GLN A HG2  15 
ATOM 11078 H HG3  . GLN A 1 5  ? -4.017  10.599  9.625   1.00 0.00 ? 5  GLN A HG3  15 
ATOM 11079 H HE21 . GLN A 1 5  ? -2.153  11.029  11.221  1.00 0.00 ? 5  GLN A HE21 15 
ATOM 11080 H HE22 . GLN A 1 5  ? -0.723  10.138  11.015  1.00 0.00 ? 5  GLN A HE22 15 
ATOM 11081 N N    . CYS A 1 6  ? -5.020  7.682   5.862   1.00 0.00 ? 6  CYS A N    15 
ATOM 11082 C CA   . CYS A 1 6  ? -5.934  7.362   4.730   1.00 0.00 ? 6  CYS A CA   15 
ATOM 11083 C C    . CYS A 1 6  ? -6.619  6.019   4.981   1.00 0.00 ? 6  CYS A C    15 
ATOM 11084 O O    . CYS A 1 6  ? -7.280  5.483   4.115   1.00 0.00 ? 6  CYS A O    15 
ATOM 11085 C CB   . CYS A 1 6  ? -5.134  7.283   3.429   1.00 0.00 ? 6  CYS A CB   15 
ATOM 11086 S SG   . CYS A 1 6  ? -6.195  7.755   2.039   1.00 0.00 ? 6  CYS A SG   15 
ATOM 11087 H H    . CYS A 1 6  ? -4.114  7.308   5.883   1.00 0.00 ? 6  CYS A H    15 
ATOM 11088 H HA   . CYS A 1 6  ? -6.683  8.136   4.643   1.00 0.00 ? 6  CYS A HA   15 
ATOM 11089 H HB2  . CYS A 1 6  ? -4.290  7.954   3.483   1.00 0.00 ? 6  CYS A HB2  15 
ATOM 11090 H HB3  . CYS A 1 6  ? -4.781  6.272   3.285   1.00 0.00 ? 6  CYS A HB3  15 
ATOM 11091 N N    . CYS A 1 7  ? -6.466  5.466   6.153   1.00 0.00 ? 7  CYS A N    15 
ATOM 11092 C CA   . CYS A 1 7  ? -7.113  4.156   6.439   1.00 0.00 ? 7  CYS A CA   15 
ATOM 11093 C C    . CYS A 1 7  ? -8.625  4.269   6.199   1.00 0.00 ? 7  CYS A C    15 
ATOM 11094 O O    . CYS A 1 7  ? -9.067  4.362   5.072   1.00 0.00 ? 7  CYS A O    15 
ATOM 11095 C CB   . CYS A 1 7  ? -6.835  3.744   7.888   1.00 0.00 ? 7  CYS A CB   15 
ATOM 11096 S SG   . CYS A 1 7  ? -7.608  2.138   8.233   1.00 0.00 ? 7  CYS A SG   15 
ATOM 11097 H H    . CYS A 1 7  ? -5.924  5.909   6.839   1.00 0.00 ? 7  CYS A H    15 
ATOM 11098 H HA   . CYS A 1 7  ? -6.706  3.409   5.773   1.00 0.00 ? 7  CYS A HA   15 
ATOM 11099 H HB2  . CYS A 1 7  ? -5.769  3.668   8.041   1.00 0.00 ? 7  CYS A HB2  15 
ATOM 11100 H HB3  . CYS A 1 7  ? -7.241  4.489   8.557   1.00 0.00 ? 7  CYS A HB3  15 
ATOM 11101 N N    . THR A 1 8  ? -9.424  4.260   7.239   1.00 0.00 ? 8  THR A N    15 
ATOM 11102 C CA   . THR A 1 8  ? -10.899 4.364   7.043   1.00 0.00 ? 8  THR A CA   15 
ATOM 11103 C C    . THR A 1 8  ? -11.314 3.489   5.858   1.00 0.00 ? 8  THR A C    15 
ATOM 11104 O O    . THR A 1 8  ? -11.915 3.956   4.911   1.00 0.00 ? 8  THR A O    15 
ATOM 11105 C CB   . THR A 1 8  ? -11.276 5.820   6.760   1.00 0.00 ? 8  THR A CB   15 
ATOM 11106 O OG1  . THR A 1 8  ? -10.719 6.217   5.515   1.00 0.00 ? 8  THR A OG1  15 
ATOM 11107 C CG2  . THR A 1 8  ? -10.732 6.716   7.874   1.00 0.00 ? 8  THR A CG2  15 
ATOM 11108 H H    . THR A 1 8  ? -9.058  4.184   8.143   1.00 0.00 ? 8  THR A H    15 
ATOM 11109 H HA   . THR A 1 8  ? -11.407 4.026   7.935   1.00 0.00 ? 8  THR A HA   15 
ATOM 11110 H HB   . THR A 1 8  ? -12.350 5.914   6.721   1.00 0.00 ? 8  THR A HB   15 
ATOM 11111 H HG1  . THR A 1 8  ? -10.572 7.166   5.545   1.00 0.00 ? 8  THR A HG1  15 
ATOM 11112 H HG21 . THR A 1 8  ? -10.545 7.705   7.482   1.00 0.00 ? 8  THR A HG21 15 
ATOM 11113 H HG22 . THR A 1 8  ? -9.810  6.299   8.253   1.00 0.00 ? 8  THR A HG22 15 
ATOM 11114 H HG23 . THR A 1 8  ? -11.455 6.776   8.673   1.00 0.00 ? 8  THR A HG23 15 
ATOM 11115 N N    . SER A 1 9  ? -10.981 2.227   5.898   1.00 0.00 ? 9  SER A N    15 
ATOM 11116 C CA   . SER A 1 9  ? -11.340 1.322   4.770   1.00 0.00 ? 9  SER A CA   15 
ATOM 11117 C C    . SER A 1 9  ? -10.358 1.553   3.616   1.00 0.00 ? 9  SER A C    15 
ATOM 11118 O O    . SER A 1 9  ? -9.177  1.743   3.830   1.00 0.00 ? 9  SER A O    15 
ATOM 11119 C CB   . SER A 1 9  ? -12.767 1.620   4.308   1.00 0.00 ? 9  SER A CB   15 
ATOM 11120 O OG   . SER A 1 9  ? -13.521 2.121   5.405   1.00 0.00 ? 9  SER A OG   15 
ATOM 11121 H H    . SER A 1 9  ? -10.486 1.876   6.668   1.00 0.00 ? 9  SER A H    15 
ATOM 11122 H HA   . SER A 1 9  ? -11.273 0.295   5.098   1.00 0.00 ? 9  SER A HA   15 
ATOM 11123 H HB2  . SER A 1 9  ? -12.747 2.359   3.525   1.00 0.00 ? 9  SER A HB2  15 
ATOM 11124 H HB3  . SER A 1 9  ? -13.219 0.711   3.931   1.00 0.00 ? 9  SER A HB3  15 
ATOM 11125 H HG   . SER A 1 9  ? -13.434 1.500   6.132   1.00 0.00 ? 9  SER A HG   15 
ATOM 11126 N N    . ILE A 1 10 ? -10.827 1.544   2.396   1.00 0.00 ? 10 ILE A N    15 
ATOM 11127 C CA   . ILE A 1 10 ? -9.905  1.768   1.244   1.00 0.00 ? 10 ILE A CA   15 
ATOM 11128 C C    . ILE A 1 10 ? -10.163 3.160   0.665   1.00 0.00 ? 10 ILE A C    15 
ATOM 11129 O O    . ILE A 1 10 ? -11.215 3.435   0.123   1.00 0.00 ? 10 ILE A O    15 
ATOM 11130 C CB   . ILE A 1 10 ? -10.128 0.671   0.172   1.00 0.00 ? 10 ILE A CB   15 
ATOM 11131 C CG1  . ILE A 1 10 ? -10.024 1.247   -1.255  1.00 0.00 ? 10 ILE A CG1  15 
ATOM 11132 C CG2  . ILE A 1 10 ? -11.516 0.049   0.346   1.00 0.00 ? 10 ILE A CG2  15 
ATOM 11133 C CD1  . ILE A 1 10 ? -8.600  1.744   -1.526  1.00 0.00 ? 10 ILE A CD1  15 
ATOM 11134 H H    . ILE A 1 10 ? -11.781 1.392   2.236   1.00 0.00 ? 10 ILE A H    15 
ATOM 11135 H HA   . ILE A 1 10 ? -8.884  1.719   1.595   1.00 0.00 ? 10 ILE A HA   15 
ATOM 11136 H HB   . ILE A 1 10 ? -9.381  -0.100  0.299   1.00 0.00 ? 10 ILE A HB   15 
ATOM 11137 H HG12 . ILE A 1 10 ? -10.275 0.476   -1.968  1.00 0.00 ? 10 ILE A HG12 15 
ATOM 11138 H HG13 . ILE A 1 10 ? -10.715 2.069   -1.361  1.00 0.00 ? 10 ILE A HG13 15 
ATOM 11139 H HG21 . ILE A 1 10 ? -11.602 -0.368  1.339   1.00 0.00 ? 10 ILE A HG21 15 
ATOM 11140 H HG22 . ILE A 1 10 ? -11.655 -0.733  -0.386  1.00 0.00 ? 10 ILE A HG22 15 
ATOM 11141 H HG23 . ILE A 1 10 ? -12.271 0.809   0.208   1.00 0.00 ? 10 ILE A HG23 15 
ATOM 11142 H HD11 . ILE A 1 10 ? -8.141  2.053   -0.601  1.00 0.00 ? 10 ILE A HD11 15 
ATOM 11143 H HD12 . ILE A 1 10 ? -8.636  2.582   -2.208  1.00 0.00 ? 10 ILE A HD12 15 
ATOM 11144 H HD13 . ILE A 1 10 ? -8.019  0.947   -1.970  1.00 0.00 ? 10 ILE A HD13 15 
ATOM 11145 N N    . CYS A 1 11 ? -9.203  4.036   0.765   1.00 0.00 ? 11 CYS A N    15 
ATOM 11146 C CA   . CYS A 1 11 ? -9.389  5.397   0.203   1.00 0.00 ? 11 CYS A CA   15 
ATOM 11147 C C    . CYS A 1 11 ? -8.686  5.452   -1.148  1.00 0.00 ? 11 CYS A C    15 
ATOM 11148 O O    . CYS A 1 11 ? -7.493  5.242   -1.239  1.00 0.00 ? 11 CYS A O    15 
ATOM 11149 C CB   . CYS A 1 11 ? -8.769  6.432   1.146   1.00 0.00 ? 11 CYS A CB   15 
ATOM 11150 S SG   . CYS A 1 11 ? -7.031  6.016   1.438   1.00 0.00 ? 11 CYS A SG   15 
ATOM 11151 H H    . CYS A 1 11 ? -8.358  3.793   1.197   1.00 0.00 ? 11 CYS A H    15 
ATOM 11152 H HA   . CYS A 1 11 ? -10.442 5.600   0.077   1.00 0.00 ? 11 CYS A HA   15 
ATOM 11153 H HB2  . CYS A 1 11 ? -8.835  7.412   0.697   1.00 0.00 ? 11 CYS A HB2  15 
ATOM 11154 H HB3  . CYS A 1 11 ? -9.303  6.430   2.085   1.00 0.00 ? 11 CYS A HB3  15 
ATOM 11155 N N    . SER A 1 12 ? -9.418  5.732   -2.193  1.00 0.00 ? 12 SER A N    15 
ATOM 11156 C CA   . SER A 1 12 ? -8.813  5.800   -3.550  1.00 0.00 ? 12 SER A CA   15 
ATOM 11157 C C    . SER A 1 12 ? -7.703  4.755   -3.682  1.00 0.00 ? 12 SER A C    15 
ATOM 11158 O O    . SER A 1 12 ? -6.552  5.034   -3.418  1.00 0.00 ? 12 SER A O    15 
ATOM 11159 C CB   . SER A 1 12 ? -8.227  7.194   -3.776  1.00 0.00 ? 12 SER A CB   15 
ATOM 11160 O OG   . SER A 1 12 ? -7.277  7.139   -4.832  1.00 0.00 ? 12 SER A OG   15 
ATOM 11161 H H    . SER A 1 12 ? -10.372 5.896   -2.086  1.00 0.00 ? 12 SER A H    15 
ATOM 11162 H HA   . SER A 1 12 ? -9.574  5.608   -4.291  1.00 0.00 ? 12 SER A HA   15 
ATOM 11163 H HB2  . SER A 1 12 ? -9.015  7.879   -4.043  1.00 0.00 ? 12 SER A HB2  15 
ATOM 11164 H HB3  . SER A 1 12 ? -7.750  7.534   -2.866  1.00 0.00 ? 12 SER A HB3  15 
ATOM 11165 H HG   . SER A 1 12 ? -7.705  7.453   -5.632  1.00 0.00 ? 12 SER A HG   15 
ATOM 11166 N N    . LEU A 1 13 ? -8.021  3.561   -4.101  1.00 0.00 ? 13 LEU A N    15 
ATOM 11167 C CA   . LEU A 1 13 ? -6.947  2.545   -4.256  1.00 0.00 ? 13 LEU A CA   15 
ATOM 11168 C C    . LEU A 1 13 ? -5.889  3.174   -5.142  1.00 0.00 ? 13 LEU A C    15 
ATOM 11169 O O    . LEU A 1 13 ? -4.708  2.920   -5.015  1.00 0.00 ? 13 LEU A O    15 
ATOM 11170 C CB   . LEU A 1 13 ? -7.504  1.282   -4.916  1.00 0.00 ? 13 LEU A CB   15 
ATOM 11171 C CG   . LEU A 1 13 ? -6.346  0.396   -5.376  1.00 0.00 ? 13 LEU A CG   15 
ATOM 11172 C CD1  . LEU A 1 13 ? -6.465  -0.981  -4.721  1.00 0.00 ? 13 LEU A CD1  15 
ATOM 11173 C CD2  . LEU A 1 13 ? -6.396  0.242   -6.897  1.00 0.00 ? 13 LEU A CD2  15 
ATOM 11174 H H    . LEU A 1 13 ? -8.948  3.341   -4.324  1.00 0.00 ? 13 LEU A H    15 
ATOM 11175 H HA   . LEU A 1 13 ? -6.519  2.308   -3.293  1.00 0.00 ? 13 LEU A HA   15 
ATOM 11176 H HB2  . LEU A 1 13 ? -8.113  0.742   -4.205  1.00 0.00 ? 13 LEU A HB2  15 
ATOM 11177 H HB3  . LEU A 1 13 ? -8.106  1.557   -5.770  1.00 0.00 ? 13 LEU A HB3  15 
ATOM 11178 H HG   . LEU A 1 13 ? -5.409  0.851   -5.088  1.00 0.00 ? 13 LEU A HG   15 
ATOM 11179 H HD11 . LEU A 1 13 ? -7.360  -1.017  -4.118  1.00 0.00 ? 13 LEU A HD11 15 
ATOM 11180 H HD12 . LEU A 1 13 ? -5.602  -1.158  -4.096  1.00 0.00 ? 13 LEU A HD12 15 
ATOM 11181 H HD13 . LEU A 1 13 ? -6.516  -1.741  -5.487  1.00 0.00 ? 13 LEU A HD13 15 
ATOM 11182 H HD21 . LEU A 1 13 ? -6.960  -0.644  -7.151  1.00 0.00 ? 13 LEU A HD21 15 
ATOM 11183 H HD22 . LEU A 1 13 ? -5.391  0.152   -7.283  1.00 0.00 ? 13 LEU A HD22 15 
ATOM 11184 H HD23 . LEU A 1 13 ? -6.873  1.108   -7.332  1.00 0.00 ? 13 LEU A HD23 15 
ATOM 11185 N N    . TYR A 1 14 ? -6.319  4.034   -6.014  1.00 0.00 ? 14 TYR A N    15 
ATOM 11186 C CA   . TYR A 1 14 ? -5.361  4.743   -6.897  1.00 0.00 ? 14 TYR A CA   15 
ATOM 11187 C C    . TYR A 1 14 ? -4.489  5.626   -6.010  1.00 0.00 ? 14 TYR A C    15 
ATOM 11188 O O    . TYR A 1 14 ? -3.318  5.824   -6.266  1.00 0.00 ? 14 TYR A O    15 
ATOM 11189 C CB   . TYR A 1 14 ? -6.122  5.609   -7.904  1.00 0.00 ? 14 TYR A CB   15 
ATOM 11190 C CG   . TYR A 1 14 ? -7.130  4.760   -8.642  1.00 0.00 ? 14 TYR A CG   15 
ATOM 11191 C CD1  . TYR A 1 14 ? -6.752  4.075   -9.803  1.00 0.00 ? 14 TYR A CD1  15 
ATOM 11192 C CD2  . TYR A 1 14 ? -8.443  4.660   -8.166  1.00 0.00 ? 14 TYR A CD2  15 
ATOM 11193 C CE1  . TYR A 1 14 ? -7.687  3.290   -10.488 1.00 0.00 ? 14 TYR A CE1  15 
ATOM 11194 C CE2  . TYR A 1 14 ? -9.378  3.874   -8.851  1.00 0.00 ? 14 TYR A CE2  15 
ATOM 11195 C CZ   . TYR A 1 14 ? -8.999  3.189   -10.012 1.00 0.00 ? 14 TYR A CZ   15 
ATOM 11196 O OH   . TYR A 1 14 ? -9.921  2.415   -10.687 1.00 0.00 ? 14 TYR A OH   15 
ATOM 11197 H H    . TYR A 1 14 ? -7.277  4.236   -6.061  1.00 0.00 ? 14 TYR A H    15 
ATOM 11198 H HA   . TYR A 1 14 ? -4.743  4.027   -7.417  1.00 0.00 ? 14 TYR A HA   15 
ATOM 11199 H HB2  . TYR A 1 14 ? -6.634  6.403   -7.380  1.00 0.00 ? 14 TYR A HB2  15 
ATOM 11200 H HB3  . TYR A 1 14 ? -5.426  6.035   -8.611  1.00 0.00 ? 14 TYR A HB3  15 
ATOM 11201 H HD1  . TYR A 1 14 ? -5.739  4.153   -10.170 1.00 0.00 ? 14 TYR A HD1  15 
ATOM 11202 H HD2  . TYR A 1 14 ? -8.735  5.188   -7.270  1.00 0.00 ? 14 TYR A HD2  15 
ATOM 11203 H HE1  . TYR A 1 14 ? -7.395  2.761   -11.383 1.00 0.00 ? 14 TYR A HE1  15 
ATOM 11204 H HE2  . TYR A 1 14 ? -10.390 3.796   -8.484  1.00 0.00 ? 14 TYR A HE2  15 
ATOM 11205 H HH   . TYR A 1 14 ? -9.584  1.517   -10.723 1.00 0.00 ? 14 TYR A HH   15 
ATOM 11206 N N    . GLN A 1 15 ? -5.054  6.143   -4.948  1.00 0.00 ? 15 GLN A N    15 
ATOM 11207 C CA   . GLN A 1 15 ? -4.257  6.994   -4.024  1.00 0.00 ? 15 GLN A CA   15 
ATOM 11208 C C    . GLN A 1 15 ? -3.206  6.118   -3.342  1.00 0.00 ? 15 GLN A C    15 
ATOM 11209 O O    . GLN A 1 15 ? -2.047  6.473   -3.263  1.00 0.00 ? 15 GLN A O    15 
ATOM 11210 C CB   . GLN A 1 15 ? -5.176  7.616   -2.969  1.00 0.00 ? 15 GLN A CB   15 
ATOM 11211 C CG   . GLN A 1 15 ? -5.769  8.918   -3.512  1.00 0.00 ? 15 GLN A CG   15 
ATOM 11212 C CD   . GLN A 1 15 ? -4.771  10.059  -3.309  1.00 0.00 ? 15 GLN A CD   15 
ATOM 11213 O OE1  . GLN A 1 15 ? -3.577  9.836   -3.262  1.00 0.00 ? 15 GLN A OE1  15 
ATOM 11214 N NE2  . GLN A 1 15 ? -5.212  11.281  -3.187  1.00 0.00 ? 15 GLN A NE2  15 
ATOM 11215 H H    . GLN A 1 15 ? -6.000  5.955   -4.751  1.00 0.00 ? 15 GLN A H    15 
ATOM 11216 H HA   . GLN A 1 15 ? -3.767  7.776   -4.586  1.00 0.00 ? 15 GLN A HA   15 
ATOM 11217 H HB2  . GLN A 1 15 ? -5.973  6.927   -2.733  1.00 0.00 ? 15 GLN A HB2  15 
ATOM 11218 H HB3  . GLN A 1 15 ? -4.607  7.828   -2.076  1.00 0.00 ? 15 GLN A HB3  15 
ATOM 11219 H HG2  . GLN A 1 15 ? -5.980  8.805   -4.566  1.00 0.00 ? 15 GLN A HG2  15 
ATOM 11220 H HG3  . GLN A 1 15 ? -6.684  9.144   -2.985  1.00 0.00 ? 15 GLN A HG3  15 
ATOM 11221 H HE21 . GLN A 1 15 ? -6.174  11.461  -3.225  1.00 0.00 ? 15 GLN A HE21 15 
ATOM 11222 H HE22 . GLN A 1 15 ? -4.580  12.019  -3.057  1.00 0.00 ? 15 GLN A HE22 15 
ATOM 11223 N N    . LEU A 1 16 ? -3.594  4.958   -2.873  1.00 0.00 ? 16 LEU A N    15 
ATOM 11224 C CA   . LEU A 1 16 ? -2.607  4.056   -2.234  1.00 0.00 ? 16 LEU A CA   15 
ATOM 11225 C C    . LEU A 1 16 ? -1.715  3.513   -3.337  1.00 0.00 ? 16 LEU A C    15 
ATOM 11226 O O    . LEU A 1 16 ? -0.513  3.400   -3.193  1.00 0.00 ? 16 LEU A O    15 
ATOM 11227 C CB   . LEU A 1 16 ? -3.335  2.904   -1.539  1.00 0.00 ? 16 LEU A CB   15 
ATOM 11228 C CG   . LEU A 1 16 ? -2.495  2.404   -0.364  1.00 0.00 ? 16 LEU A CG   15 
ATOM 11229 C CD1  . LEU A 1 16 ? -1.170  1.847   -0.886  1.00 0.00 ? 16 LEU A CD1  15 
ATOM 11230 C CD2  . LEU A 1 16 ? -2.218  3.564   0.594   1.00 0.00 ? 16 LEU A CD2  15 
ATOM 11231 H H    . LEU A 1 16 ? -4.523  4.669   -2.971  1.00 0.00 ? 16 LEU A H    15 
ATOM 11232 H HA   . LEU A 1 16 ? -2.014  4.606   -1.518  1.00 0.00 ? 16 LEU A HA   15 
ATOM 11233 H HB2  . LEU A 1 16 ? -4.293  3.250   -1.176  1.00 0.00 ? 16 LEU A HB2  15 
ATOM 11234 H HB3  . LEU A 1 16 ? -3.486  2.097   -2.240  1.00 0.00 ? 16 LEU A HB3  15 
ATOM 11235 H HG   . LEU A 1 16 ? -3.032  1.624   0.156   1.00 0.00 ? 16 LEU A HG   15 
ATOM 11236 H HD11 . LEU A 1 16 ? -0.820  1.071   -0.222  1.00 0.00 ? 16 LEU A HD11 15 
ATOM 11237 H HD12 . LEU A 1 16 ? -0.438  2.641   -0.929  1.00 0.00 ? 16 LEU A HD12 15 
ATOM 11238 H HD13 . LEU A 1 16 ? -1.315  1.437   -1.874  1.00 0.00 ? 16 LEU A HD13 15 
ATOM 11239 H HD21 . LEU A 1 16 ? -3.008  4.296   0.511   1.00 0.00 ? 16 LEU A HD21 15 
ATOM 11240 H HD22 . LEU A 1 16 ? -1.274  4.023   0.340   1.00 0.00 ? 16 LEU A HD22 15 
ATOM 11241 H HD23 . LEU A 1 16 ? -2.177  3.192   1.607   1.00 0.00 ? 16 LEU A HD23 15 
ATOM 11242 N N    . GLU A 1 17 ? -2.308  3.186   -4.451  1.00 0.00 ? 17 GLU A N    15 
ATOM 11243 C CA   . GLU A 1 17 ? -1.518  2.659   -5.589  1.00 0.00 ? 17 GLU A CA   15 
ATOM 11244 C C    . GLU A 1 17 ? -0.534  3.732   -6.060  1.00 0.00 ? 17 GLU A C    15 
ATOM 11245 O O    . GLU A 1 17 ? 0.586   3.444   -6.434  1.00 0.00 ? 17 GLU A O    15 
ATOM 11246 C CB   . GLU A 1 17 ? -2.459  2.284   -6.736  1.00 0.00 ? 17 GLU A CB   15 
ATOM 11247 C CG   . GLU A 1 17 ? -1.777  1.258   -7.645  1.00 0.00 ? 17 GLU A CG   15 
ATOM 11248 C CD   . GLU A 1 17 ? -2.749  0.823   -8.743  1.00 0.00 ? 17 GLU A CD   15 
ATOM 11249 O OE1  . GLU A 1 17 ? -3.544  1.647   -9.164  1.00 0.00 ? 17 GLU A OE1  15 
ATOM 11250 O OE2  . GLU A 1 17 ? -2.683  -0.328  -9.143  1.00 0.00 ? 17 GLU A OE2  15 
ATOM 11251 H H    . GLU A 1 17 ? -3.281  3.292   -4.538  1.00 0.00 ? 17 GLU A H    15 
ATOM 11252 H HA   . GLU A 1 17 ? -0.978  1.793   -5.267  1.00 0.00 ? 17 GLU A HA   15 
ATOM 11253 H HB2  . GLU A 1 17 ? -3.367  1.860   -6.332  1.00 0.00 ? 17 GLU A HB2  15 
ATOM 11254 H HB3  . GLU A 1 17 ? -2.697  3.167   -7.310  1.00 0.00 ? 17 GLU A HB3  15 
ATOM 11255 H HG2  . GLU A 1 17 ? -0.900  1.702   -8.094  1.00 0.00 ? 17 GLU A HG2  15 
ATOM 11256 H HG3  . GLU A 1 17 ? -1.487  0.397   -7.062  1.00 0.00 ? 17 GLU A HG3  15 
ATOM 11257 N N    . ASN A 1 18 ? -0.950  4.968   -6.048  1.00 0.00 ? 18 ASN A N    15 
ATOM 11258 C CA   . ASN A 1 18 ? -0.051  6.069   -6.497  1.00 0.00 ? 18 ASN A CA   15 
ATOM 11259 C C    . ASN A 1 18 ? 1.088   6.268   -5.490  1.00 0.00 ? 18 ASN A C    15 
ATOM 11260 O O    . ASN A 1 18 ? 2.109   6.845   -5.809  1.00 0.00 ? 18 ASN A O    15 
ATOM 11261 C CB   . ASN A 1 18 ? -0.857  7.365   -6.612  1.00 0.00 ? 18 ASN A CB   15 
ATOM 11262 C CG   . ASN A 1 18 ? -1.799  7.276   -7.814  1.00 0.00 ? 18 ASN A CG   15 
ATOM 11263 O OD1  . ASN A 1 18 ? -1.753  6.324   -8.568  1.00 0.00 ? 18 ASN A OD1  15 
ATOM 11264 N ND2  . ASN A 1 18 ? -2.659  8.234   -8.025  1.00 0.00 ? 18 ASN A ND2  15 
ATOM 11265 H H    . ASN A 1 18 ? -1.860  5.173   -5.746  1.00 0.00 ? 18 ASN A H    15 
ATOM 11266 H HA   . ASN A 1 18 ? 0.364   5.821   -7.462  1.00 0.00 ? 18 ASN A HA   15 
ATOM 11267 H HB2  . ASN A 1 18 ? -1.434  7.511   -5.711  1.00 0.00 ? 18 ASN A HB2  15 
ATOM 11268 H HB3  . ASN A 1 18 ? -0.183  8.197   -6.747  1.00 0.00 ? 18 ASN A HB3  15 
ATOM 11269 H HD21 . ASN A 1 18 ? -2.697  9.002   -7.417  1.00 0.00 ? 18 ASN A HD21 15 
ATOM 11270 H HD22 . ASN A 1 18 ? -3.267  8.186   -8.792  1.00 0.00 ? 18 ASN A HD22 15 
ATOM 11271 N N    . TYR A 1 19 ? 0.928   5.804   -4.279  1.00 0.00 ? 19 TYR A N    15 
ATOM 11272 C CA   . TYR A 1 19 ? 2.011   5.984   -3.271  1.00 0.00 ? 19 TYR A CA   15 
ATOM 11273 C C    . TYR A 1 19 ? 3.326   5.491   -3.867  1.00 0.00 ? 19 TYR A C    15 
ATOM 11274 O O    . TYR A 1 19 ? 4.310   6.202   -3.903  1.00 0.00 ? 19 TYR A O    15 
ATOM 11275 C CB   . TYR A 1 19 ? 1.688   5.177   -2.009  1.00 0.00 ? 19 TYR A CB   15 
ATOM 11276 C CG   . TYR A 1 19 ? 2.885   5.184   -1.089  1.00 0.00 ? 19 TYR A CG   15 
ATOM 11277 C CD1  . TYR A 1 19 ? 3.880   4.208   -1.222  1.00 0.00 ? 19 TYR A CD1  15 
ATOM 11278 C CD2  . TYR A 1 19 ? 3.000   6.170   -0.102  1.00 0.00 ? 19 TYR A CD2  15 
ATOM 11279 C CE1  . TYR A 1 19 ? 4.989   4.218   -0.369  1.00 0.00 ? 19 TYR A CE1  15 
ATOM 11280 C CE2  . TYR A 1 19 ? 4.109   6.180   0.752   1.00 0.00 ? 19 TYR A CE2  15 
ATOM 11281 C CZ   . TYR A 1 19 ? 5.104   5.204   0.619   1.00 0.00 ? 19 TYR A CZ   15 
ATOM 11282 O OH   . TYR A 1 19 ? 6.198   5.214   1.460   1.00 0.00 ? 19 TYR A OH   15 
ATOM 11283 H H    . TYR A 1 19 ? 0.104   5.340   -4.034  1.00 0.00 ? 19 TYR A H    15 
ATOM 11284 H HA   . TYR A 1 19 ? 2.099   7.030   -3.019  1.00 0.00 ? 19 TYR A HA   15 
ATOM 11285 H HB2  . TYR A 1 19 ? 0.843   5.620   -1.503  1.00 0.00 ? 19 TYR A HB2  15 
ATOM 11286 H HB3  . TYR A 1 19 ? 1.452   4.159   -2.281  1.00 0.00 ? 19 TYR A HB3  15 
ATOM 11287 H HD1  . TYR A 1 19 ? 3.791   3.447   -1.984  1.00 0.00 ? 19 TYR A HD1  15 
ATOM 11288 H HD2  . TYR A 1 19 ? 2.233   6.922   0.002   1.00 0.00 ? 19 TYR A HD2  15 
ATOM 11289 H HE1  . TYR A 1 19 ? 5.756   3.465   -0.471  1.00 0.00 ? 19 TYR A HE1  15 
ATOM 11290 H HE2  . TYR A 1 19 ? 4.198   6.941   1.514   1.00 0.00 ? 19 TYR A HE2  15 
ATOM 11291 H HH   . TYR A 1 19 ? 6.841   5.832   1.104   1.00 0.00 ? 19 TYR A HH   15 
ATOM 11292 N N    . CYS A 1 20 ? 3.338   4.277   -4.341  1.00 0.00 ? 20 CYS A N    15 
ATOM 11293 C CA   . CYS A 1 20 ? 4.580   3.714   -4.950  1.00 0.00 ? 20 CYS A CA   15 
ATOM 11294 C C    . CYS A 1 20 ? 5.804   4.149   -4.140  1.00 0.00 ? 20 CYS A C    15 
ATOM 11295 O O    . CYS A 1 20 ? 5.695   4.566   -3.004  1.00 0.00 ? 20 CYS A O    15 
ATOM 11296 C CB   . CYS A 1 20 ? 4.713   4.219   -6.388  1.00 0.00 ? 20 CYS A CB   15 
ATOM 11297 S SG   . CYS A 1 20 ? 3.272   3.691   -7.347  1.00 0.00 ? 20 CYS A SG   15 
ATOM 11298 H H    . CYS A 1 20 ? 2.520   3.735   -4.304  1.00 0.00 ? 20 CYS A H    15 
ATOM 11299 H HA   . CYS A 1 20 ? 4.522   2.637   -4.954  1.00 0.00 ? 20 CYS A HA   15 
ATOM 11300 H HB2  . CYS A 1 20 ? 4.770   5.298   -6.387  1.00 0.00 ? 20 CYS A HB2  15 
ATOM 11301 H HB3  . CYS A 1 20 ? 5.609   3.812   -6.832  1.00 0.00 ? 20 CYS A HB3  15 
ATOM 11302 N N    . ASN A 1 21 ? 6.971   4.054   -4.716  1.00 0.00 ? 21 ASN A N    15 
ATOM 11303 C CA   . ASN A 1 21 ? 8.202   4.461   -3.980  1.00 0.00 ? 21 ASN A CA   15 
ATOM 11304 C C    . ASN A 1 21 ? 9.333   4.711   -4.980  1.00 0.00 ? 21 ASN A C    15 
ATOM 11305 O O    . ASN A 1 21 ? 10.463  4.380   -4.660  1.00 0.00 ? 21 ASN A O    15 
ATOM 11306 C CB   . ASN A 1 21 ? 8.612   3.349   -3.013  1.00 0.00 ? 21 ASN A CB   15 
ATOM 11307 C CG   . ASN A 1 21 ? 8.522   1.996   -3.722  1.00 0.00 ? 21 ASN A CG   15 
ATOM 11308 O OD1  . ASN A 1 21 ? 8.241   1.934   -4.902  1.00 0.00 ? 21 ASN A OD1  15 
ATOM 11309 N ND2  . ASN A 1 21 ? 8.755   0.903   -3.047  1.00 0.00 ? 21 ASN A ND2  15 
ATOM 11310 O OXT  . ASN A 1 21 ? 9.050   5.229   -6.048  1.00 0.00 ? 21 ASN A OXT  15 
ATOM 11311 H H    . ASN A 1 21 ? 7.038   3.713   -5.632  1.00 0.00 ? 21 ASN A H    15 
ATOM 11312 H HA   . ASN A 1 21 ? 8.006   5.367   -3.425  1.00 0.00 ? 21 ASN A HA   15 
ATOM 11313 H HB2  . ASN A 1 21 ? 9.627   3.516   -2.682  1.00 0.00 ? 21 ASN A HB2  15 
ATOM 11314 H HB3  . ASN A 1 21 ? 7.950   3.350   -2.160  1.00 0.00 ? 21 ASN A HB3  15 
ATOM 11315 H HD21 . ASN A 1 21 ? 8.985   0.953   -2.096  1.00 0.00 ? 21 ASN A HD21 15 
ATOM 11316 H HD22 . ASN A 1 21 ? 8.698   0.032   -3.492  1.00 0.00 ? 21 ASN A HD22 15 
ATOM 11317 N N    . PHE B 2 1  ? -15.084 -6.700  -7.384  1.00 0.00 ? 1  PHE B N    15 
ATOM 11318 C CA   . PHE B 2 1  ? -14.831 -5.331  -7.915  1.00 0.00 ? 1  PHE B CA   15 
ATOM 11319 C C    . PHE B 2 1  ? -14.327 -4.430  -6.785  1.00 0.00 ? 1  PHE B C    15 
ATOM 11320 O O    . PHE B 2 1  ? -14.304 -4.818  -5.634  1.00 0.00 ? 1  PHE B O    15 
ATOM 11321 C CB   . PHE B 2 1  ? -16.129 -4.757  -8.485  1.00 0.00 ? 1  PHE B CB   15 
ATOM 11322 C CG   . PHE B 2 1  ? -16.380 -5.341  -9.855  1.00 0.00 ? 1  PHE B CG   15 
ATOM 11323 C CD1  . PHE B 2 1  ? -15.359 -5.341  -10.813 1.00 0.00 ? 1  PHE B CD1  15 
ATOM 11324 C CD2  . PHE B 2 1  ? -17.633 -5.882  -10.166 1.00 0.00 ? 1  PHE B CD2  15 
ATOM 11325 C CE1  . PHE B 2 1  ? -15.592 -5.883  -12.083 1.00 0.00 ? 1  PHE B CE1  15 
ATOM 11326 C CE2  . PHE B 2 1  ? -17.865 -6.423  -11.436 1.00 0.00 ? 1  PHE B CE2  15 
ATOM 11327 C CZ   . PHE B 2 1  ? -16.845 -6.424  -12.395 1.00 0.00 ? 1  PHE B CZ   15 
ATOM 11328 H H1   . PHE B 2 1  ? -15.913 -7.109  -7.860  1.00 0.00 ? 1  PHE B H1   15 
ATOM 11329 H H2   . PHE B 2 1  ? -15.262 -6.647  -6.360  1.00 0.00 ? 1  PHE B H2   15 
ATOM 11330 H H3   . PHE B 2 1  ? -14.254 -7.300  -7.561  1.00 0.00 ? 1  PHE B H3   15 
ATOM 11331 H HA   . PHE B 2 1  ? -14.085 -5.380  -8.695  1.00 0.00 ? 1  PHE B HA   15 
ATOM 11332 H HB2  . PHE B 2 1  ? -16.951 -5.007  -7.830  1.00 0.00 ? 1  PHE B HB2  15 
ATOM 11333 H HB3  . PHE B 2 1  ? -16.044 -3.683  -8.563  1.00 0.00 ? 1  PHE B HB3  15 
ATOM 11334 H HD1  . PHE B 2 1  ? -14.392 -4.924  -10.573 1.00 0.00 ? 1  PHE B HD1  15 
ATOM 11335 H HD2  . PHE B 2 1  ? -18.420 -5.881  -9.427  1.00 0.00 ? 1  PHE B HD2  15 
ATOM 11336 H HE1  . PHE B 2 1  ? -14.805 -5.883  -12.822 1.00 0.00 ? 1  PHE B HE1  15 
ATOM 11337 H HE2  . PHE B 2 1  ? -18.832 -6.841  -11.676 1.00 0.00 ? 1  PHE B HE2  15 
ATOM 11338 H HZ   . PHE B 2 1  ? -17.025 -6.841  -13.374 1.00 0.00 ? 1  PHE B HZ   15 
ATOM 11339 N N    . VAL B 2 2  ? -13.924 -3.229  -7.108  1.00 0.00 ? 2  VAL B N    15 
ATOM 11340 C CA   . VAL B 2 2  ? -13.421 -2.296  -6.058  1.00 0.00 ? 2  VAL B CA   15 
ATOM 11341 C C    . VAL B 2 2  ? -12.529 -3.057  -5.074  1.00 0.00 ? 2  VAL B C    15 
ATOM 11342 O O    . VAL B 2 2  ? -12.086 -4.156  -5.344  1.00 0.00 ? 2  VAL B O    15 
ATOM 11343 C CB   . VAL B 2 2  ? -14.605 -1.682  -5.308  1.00 0.00 ? 2  VAL B CB   15 
ATOM 11344 C CG1  . VAL B 2 2  ? -15.603 -1.106  -6.314  1.00 0.00 ? 2  VAL B CG1  15 
ATOM 11345 C CG2  . VAL B 2 2  ? -15.294 -2.759  -4.468  1.00 0.00 ? 2  VAL B CG2  15 
ATOM 11346 H H    . VAL B 2 2  ? -13.953 -2.940  -8.043  1.00 0.00 ? 2  VAL B H    15 
ATOM 11347 H HA   . VAL B 2 2  ? -12.847 -1.510  -6.525  1.00 0.00 ? 2  VAL B HA   15 
ATOM 11348 H HB   . VAL B 2 2  ? -14.249 -0.891  -4.662  1.00 0.00 ? 2  VAL B HB   15 
ATOM 11349 H HG11 . VAL B 2 2  ? -15.851 -0.093  -6.034  1.00 0.00 ? 2  VAL B HG11 15 
ATOM 11350 H HG12 . VAL B 2 2  ? -16.499 -1.709  -6.317  1.00 0.00 ? 2  VAL B HG12 15 
ATOM 11351 H HG13 . VAL B 2 2  ? -15.163 -1.110  -7.300  1.00 0.00 ? 2  VAL B HG13 15 
ATOM 11352 H HG21 . VAL B 2 2  ? -14.550 -3.319  -3.920  1.00 0.00 ? 2  VAL B HG21 15 
ATOM 11353 H HG22 . VAL B 2 2  ? -15.841 -3.426  -5.117  1.00 0.00 ? 2  VAL B HG22 15 
ATOM 11354 H HG23 . VAL B 2 2  ? -15.976 -2.292  -3.773  1.00 0.00 ? 2  VAL B HG23 15 
ATOM 11355 N N    . ASN B 2 3  ? -12.260 -2.481  -3.934  1.00 0.00 ? 3  ASN B N    15 
ATOM 11356 C CA   . ASN B 2 3  ? -11.396 -3.170  -2.935  1.00 0.00 ? 3  ASN B CA   15 
ATOM 11357 C C    . ASN B 2 3  ? -12.091 -3.172  -1.572  1.00 0.00 ? 3  ASN B C    15 
ATOM 11358 O O    . ASN B 2 3  ? -13.243 -2.806  -1.452  1.00 0.00 ? 3  ASN B O    15 
ATOM 11359 C CB   . ASN B 2 3  ? -10.059 -2.435  -2.824  1.00 0.00 ? 3  ASN B CB   15 
ATOM 11360 C CG   . ASN B 2 3  ? -9.619  -1.959  -4.210  1.00 0.00 ? 3  ASN B CG   15 
ATOM 11361 O OD1  . ASN B 2 3  ? -8.849  -2.622  -4.876  1.00 0.00 ? 3  ASN B OD1  15 
ATOM 11362 N ND2  . ASN B 2 3  ? -10.080 -0.830  -4.675  1.00 0.00 ? 3  ASN B ND2  15 
ATOM 11363 H H    . ASN B 2 3  ? -12.625 -1.593  -3.735  1.00 0.00 ? 3  ASN B H    15 
ATOM 11364 H HA   . ASN B 2 3  ? -11.221 -4.188  -3.252  1.00 0.00 ? 3  ASN B HA   15 
ATOM 11365 H HB2  . ASN B 2 3  ? -10.171 -1.583  -2.169  1.00 0.00 ? 3  ASN B HB2  15 
ATOM 11366 H HB3  . ASN B 2 3  ? -9.312  -3.103  -2.421  1.00 0.00 ? 3  ASN B HB3  15 
ATOM 11367 H HD21 . ASN B 2 3  ? -10.701 -0.296  -4.138  1.00 0.00 ? 3  ASN B HD21 15 
ATOM 11368 H HD22 . ASN B 2 3  ? -9.804  -0.517  -5.562  1.00 0.00 ? 3  ASN B HD22 15 
ATOM 11369 N N    . GLN B 2 4  ? -11.400 -3.581  -0.543  1.00 0.00 ? 4  GLN B N    15 
ATOM 11370 C CA   . GLN B 2 4  ? -12.023 -3.605  0.811   1.00 0.00 ? 4  GLN B CA   15 
ATOM 11371 C C    . GLN B 2 4  ? -11.102 -4.344  1.785   1.00 0.00 ? 4  GLN B C    15 
ATOM 11372 O O    . GLN B 2 4  ? -11.540 -5.168  2.564   1.00 0.00 ? 4  GLN B O    15 
ATOM 11373 C CB   . GLN B 2 4  ? -13.373 -4.324  0.739   1.00 0.00 ? 4  GLN B CB   15 
ATOM 11374 C CG   . GLN B 2 4  ? -13.235 -5.591  -0.108  1.00 0.00 ? 4  GLN B CG   15 
ATOM 11375 C CD   . GLN B 2 4  ? -12.472 -6.655  0.683   1.00 0.00 ? 4  GLN B CD   15 
ATOM 11376 O OE1  . GLN B 2 4  ? -13.001 -7.235  1.611   1.00 0.00 ? 4  GLN B OE1  15 
ATOM 11377 N NE2  . GLN B 2 4  ? -11.241 -6.938  0.353   1.00 0.00 ? 4  GLN B NE2  15 
ATOM 11378 H H    . GLN B 2 4  ? -10.472 -3.872  -0.660  1.00 0.00 ? 4  GLN B H    15 
ATOM 11379 H HA   . GLN B 2 4  ? -12.173 -2.593  1.156   1.00 0.00 ? 4  GLN B HA   15 
ATOM 11380 H HB2  . GLN B 2 4  ? -13.692 -4.589  1.737   1.00 0.00 ? 4  GLN B HB2  15 
ATOM 11381 H HB3  . GLN B 2 4  ? -14.105 -3.670  0.289   1.00 0.00 ? 4  GLN B HB3  15 
ATOM 11382 H HG2  . GLN B 2 4  ? -14.217 -5.964  -0.359  1.00 0.00 ? 4  GLN B HG2  15 
ATOM 11383 H HG3  . GLN B 2 4  ? -12.694 -5.362  -1.013  1.00 0.00 ? 4  GLN B HG3  15 
ATOM 11384 H HE21 . GLN B 2 4  ? -10.815 -6.470  -0.395  1.00 0.00 ? 4  GLN B HE21 15 
ATOM 11385 H HE22 . GLN B 2 4  ? -10.744 -7.618  0.854   1.00 0.00 ? 4  GLN B HE22 15 
ATOM 11386 N N    . HIS B 2 5  ? -9.829  -4.058  1.748   1.00 0.00 ? 5  HIS B N    15 
ATOM 11387 C CA   . HIS B 2 5  ? -8.885  -4.746  2.672   1.00 0.00 ? 5  HIS B CA   15 
ATOM 11388 C C    . HIS B 2 5  ? -9.251  -4.413  4.120   1.00 0.00 ? 5  HIS B C    15 
ATOM 11389 O O    . HIS B 2 5  ? -10.191 -3.688  4.382   1.00 0.00 ? 5  HIS B O    15 
ATOM 11390 C CB   . HIS B 2 5  ? -7.458  -4.274  2.385   1.00 0.00 ? 5  HIS B CB   15 
ATOM 11391 C CG   . HIS B 2 5  ? -7.451  -2.780  2.229   1.00 0.00 ? 5  HIS B CG   15 
ATOM 11392 N ND1  . HIS B 2 5  ? -8.526  -1.994  2.610   1.00 0.00 ? 5  HIS B ND1  15 
ATOM 11393 C CD2  . HIS B 2 5  ? -6.509  -1.912  1.735   1.00 0.00 ? 5  HIS B CD2  15 
ATOM 11394 C CE1  . HIS B 2 5  ? -8.210  -0.716  2.341   1.00 0.00 ? 5  HIS B CE1  15 
ATOM 11395 N NE2  . HIS B 2 5  ? -6.991  -0.608  1.806   1.00 0.00 ? 5  HIS B NE2  15 
ATOM 11396 H H    . HIS B 2 5  ? -9.494  -3.392  1.113   1.00 0.00 ? 5  HIS B H    15 
ATOM 11397 H HA   . HIS B 2 5  ? -8.948  -5.811  2.519   1.00 0.00 ? 5  HIS B HA   15 
ATOM 11398 H HB2  . HIS B 2 5  ? -6.814  -4.555  3.205   1.00 0.00 ? 5  HIS B HB2  15 
ATOM 11399 H HB3  . HIS B 2 5  ? -7.103  -4.732  1.474   1.00 0.00 ? 5  HIS B HB3  15 
ATOM 11400 H HD1  . HIS B 2 5  ? -9.365  -2.312  3.005   1.00 0.00 ? 5  HIS B HD1  15 
ATOM 11401 H HD2  . HIS B 2 5  ? -5.541  -2.198  1.349   1.00 0.00 ? 5  HIS B HD2  15 
ATOM 11402 H HE1  . HIS B 2 5  ? -8.862  0.121   2.533   1.00 0.00 ? 5  HIS B HE1  15 
ATOM 11403 N N    . LEU B 2 6  ? -8.516  -4.935  5.065   1.00 0.00 ? 6  LEU B N    15 
ATOM 11404 C CA   . LEU B 2 6  ? -8.822  -4.646  6.495   1.00 0.00 ? 6  LEU B CA   15 
ATOM 11405 C C    . LEU B 2 6  ? -8.406  -3.212  6.825   1.00 0.00 ? 6  LEU B C    15 
ATOM 11406 O O    . LEU B 2 6  ? -8.802  -2.656  7.830   1.00 0.00 ? 6  LEU B O    15 
ATOM 11407 C CB   . LEU B 2 6  ? -8.049  -5.618  7.389   1.00 0.00 ? 6  LEU B CB   15 
ATOM 11408 C CG   . LEU B 2 6  ? -9.020  -6.622  8.011   1.00 0.00 ? 6  LEU B CG   15 
ATOM 11409 C CD1  . LEU B 2 6  ? -8.965  -7.935  7.230   1.00 0.00 ? 6  LEU B CD1  15 
ATOM 11410 C CD2  . LEU B 2 6  ? -8.624  -6.878  9.467   1.00 0.00 ? 6  LEU B CD2  15 
ATOM 11411 H H    . LEU B 2 6  ? -7.761  -5.517  4.833   1.00 0.00 ? 6  LEU B H    15 
ATOM 11412 H HA   . LEU B 2 6  ? -9.882  -4.763  6.668   1.00 0.00 ? 6  LEU B HA   15 
ATOM 11413 H HB2  . LEU B 2 6  ? -7.314  -6.144  6.798   1.00 0.00 ? 6  LEU B HB2  15 
ATOM 11414 H HB3  . LEU B 2 6  ? -7.553  -5.067  8.174   1.00 0.00 ? 6  LEU B HB3  15 
ATOM 11415 H HG   . LEU B 2 6  ? -10.023 -6.222  7.974   1.00 0.00 ? 6  LEU B HG   15 
ATOM 11416 H HD11 . LEU B 2 6  ? -8.020  -8.425  7.415   1.00 0.00 ? 6  LEU B HD11 15 
ATOM 11417 H HD12 . LEU B 2 6  ? -9.064  -7.731  6.175   1.00 0.00 ? 6  LEU B HD12 15 
ATOM 11418 H HD13 . LEU B 2 6  ? -9.772  -8.578  7.550   1.00 0.00 ? 6  LEU B HD13 15 
ATOM 11419 H HD21 . LEU B 2 6  ? -8.866  -7.896  9.732   1.00 0.00 ? 6  LEU B HD21 15 
ATOM 11420 H HD22 . LEU B 2 6  ? -9.164  -6.200  10.112  1.00 0.00 ? 6  LEU B HD22 15 
ATOM 11421 H HD23 . LEU B 2 6  ? -7.562  -6.718  9.585   1.00 0.00 ? 6  LEU B HD23 15 
ATOM 11422 N N    . CYS B 2 7  ? -7.611  -2.610  5.980   1.00 0.00 ? 7  CYS B N    15 
ATOM 11423 C CA   . CYS B 2 7  ? -7.165  -1.212  6.226   1.00 0.00 ? 7  CYS B CA   15 
ATOM 11424 C C    . CYS B 2 7  ? -6.039  -1.191  7.265   1.00 0.00 ? 7  CYS B C    15 
ATOM 11425 O O    . CYS B 2 7  ? -5.425  -0.169  7.503   1.00 0.00 ? 7  CYS B O    15 
ATOM 11426 C CB   . CYS B 2 7  ? -8.345  -0.393  6.733   1.00 0.00 ? 7  CYS B CB   15 
ATOM 11427 S SG   . CYS B 2 7  ? -8.040  1.362   6.415   1.00 0.00 ? 7  CYS B SG   15 
ATOM 11428 H H    . CYS B 2 7  ? -7.313  -3.078  5.179   1.00 0.00 ? 7  CYS B H    15 
ATOM 11429 H HA   . CYS B 2 7  ? -6.805  -0.785  5.302   1.00 0.00 ? 7  CYS B HA   15 
ATOM 11430 H HB2  . CYS B 2 7  ? -9.241  -0.704  6.215   1.00 0.00 ? 7  CYS B HB2  15 
ATOM 11431 H HB3  . CYS B 2 7  ? -8.464  -0.555  7.792   1.00 0.00 ? 7  CYS B HB3  15 
ATOM 11432 N N    . GLY B 2 8  ? -5.755  -2.306  7.881   1.00 0.00 ? 8  GLY B N    15 
ATOM 11433 C CA   . GLY B 2 8  ? -4.662  -2.336  8.894   1.00 0.00 ? 8  GLY B CA   15 
ATOM 11434 C C    . GLY B 2 8  ? -3.345  -2.671  8.196   1.00 0.00 ? 8  GLY B C    15 
ATOM 11435 O O    . GLY B 2 8  ? -2.734  -1.830  7.567   1.00 0.00 ? 8  GLY B O    15 
ATOM 11436 H H    . GLY B 2 8  ? -6.253  -3.122  7.674   1.00 0.00 ? 8  GLY B H    15 
ATOM 11437 H HA2  . GLY B 2 8  ? -4.586  -1.369  9.371   1.00 0.00 ? 8  GLY B HA2  15 
ATOM 11438 H HA3  . GLY B 2 8  ? -4.876  -3.091  9.635   1.00 0.00 ? 8  GLY B HA3  15 
ATOM 11439 N N    . SER B 2 9  ? -2.907  -3.895  8.292   1.00 0.00 ? 9  SER B N    15 
ATOM 11440 C CA   . SER B 2 9  ? -1.636  -4.281  7.622   1.00 0.00 ? 9  SER B CA   15 
ATOM 11441 C C    . SER B 2 9  ? -1.900  -4.473  6.128   1.00 0.00 ? 9  SER B C    15 
ATOM 11442 O O    . SER B 2 9  ? -1.003  -4.399  5.312   1.00 0.00 ? 9  SER B O    15 
ATOM 11443 C CB   . SER B 2 9  ? -1.118  -5.589  8.222   1.00 0.00 ? 9  SER B CB   15 
ATOM 11444 O OG   . SER B 2 9  ? 0.215   -5.813  7.781   1.00 0.00 ? 9  SER B OG   15 
ATOM 11445 H H    . SER B 2 9  ? -3.418  -4.561  8.797   1.00 0.00 ? 9  SER B H    15 
ATOM 11446 H HA   . SER B 2 9  ? -0.901  -3.502  7.763   1.00 0.00 ? 9  SER B HA   15 
ATOM 11447 H HB2  . SER B 2 9  ? -1.129  -5.523  9.298   1.00 0.00 ? 9  SER B HB2  15 
ATOM 11448 H HB3  . SER B 2 9  ? -1.755  -6.405  7.908   1.00 0.00 ? 9  SER B HB3  15 
ATOM 11449 H HG   . SER B 2 9  ? 0.733   -6.099  8.537   1.00 0.00 ? 9  SER B HG   15 
ATOM 11450 N N    . HIS B 2 10 ? -3.130  -4.720  5.767   1.00 0.00 ? 10 HIS B N    15 
ATOM 11451 C CA   . HIS B 2 10 ? -3.464  -4.919  4.332   1.00 0.00 ? 10 HIS B CA   15 
ATOM 11452 C C    . HIS B 2 10 ? -3.337  -3.591  3.583   1.00 0.00 ? 10 HIS B C    15 
ATOM 11453 O O    . HIS B 2 10 ? -2.848  -3.541  2.472   1.00 0.00 ? 10 HIS B O    15 
ATOM 11454 C CB   . HIS B 2 10 ? -4.897  -5.440  4.210   1.00 0.00 ? 10 HIS B CB   15 
ATOM 11455 C CG   . HIS B 2 10 ? -5.009  -6.770  4.902   1.00 0.00 ? 10 HIS B CG   15 
ATOM 11456 N ND1  . HIS B 2 10 ? -5.611  -7.866  4.304   1.00 0.00 ? 10 HIS B ND1  15 
ATOM 11457 C CD2  . HIS B 2 10 ? -4.602  -7.197  6.142   1.00 0.00 ? 10 HIS B CD2  15 
ATOM 11458 C CE1  . HIS B 2 10 ? -5.550  -8.889  5.177   1.00 0.00 ? 10 HIS B CE1  15 
ATOM 11459 N NE2  . HIS B 2 10 ? -4.945  -8.535  6.314   1.00 0.00 ? 10 HIS B NE2  15 
ATOM 11460 H H    . HIS B 2 10 ? -3.835  -4.777  6.441   1.00 0.00 ? 10 HIS B H    15 
ATOM 11461 H HA   . HIS B 2 10 ? -2.784  -5.637  3.906   1.00 0.00 ? 10 HIS B HA   15 
ATOM 11462 H HB2  . HIS B 2 10 ? -5.576  -4.736  4.669   1.00 0.00 ? 10 HIS B HB2  15 
ATOM 11463 H HB3  . HIS B 2 10 ? -5.150  -5.556  3.166   1.00 0.00 ? 10 HIS B HB3  15 
ATOM 11464 H HD1  . HIS B 2 10 ? -6.010  -7.892  3.409   1.00 0.00 ? 10 HIS B HD1  15 
ATOM 11465 H HD2  . HIS B 2 10 ? -4.094  -6.586  6.874   1.00 0.00 ? 10 HIS B HD2  15 
ATOM 11466 H HE1  . HIS B 2 10 ? -5.942  -9.876  4.981   1.00 0.00 ? 10 HIS B HE1  15 
ATOM 11467 N N    . LEU B 2 11 ? -3.771  -2.511  4.177   1.00 0.00 ? 11 LEU B N    15 
ATOM 11468 C CA   . LEU B 2 11 ? -3.667  -1.197  3.483   1.00 0.00 ? 11 LEU B CA   15 
ATOM 11469 C C    . LEU B 2 11 ? -2.205  -0.943  3.116   1.00 0.00 ? 11 LEU B C    15 
ATOM 11470 O O    . LEU B 2 11 ? -1.892  -0.563  2.005   1.00 0.00 ? 11 LEU B O    15 
ATOM 11471 C CB   . LEU B 2 11 ? -4.166  -0.081  4.402   1.00 0.00 ? 11 LEU B CB   15 
ATOM 11472 C CG   . LEU B 2 11 ? -4.689  1.079   3.552   1.00 0.00 ? 11 LEU B CG   15 
ATOM 11473 C CD1  . LEU B 2 11 ? -5.203  2.193   4.464   1.00 0.00 ? 11 LEU B CD1  15 
ATOM 11474 C CD2  . LEU B 2 11 ? -3.556  1.620   2.678   1.00 0.00 ? 11 LEU B CD2  15 
ATOM 11475 H H    . LEU B 2 11 ? -4.163  -2.565  5.073   1.00 0.00 ? 11 LEU B H    15 
ATOM 11476 H HA   . LEU B 2 11 ? -4.264  -1.217  2.583   1.00 0.00 ? 11 LEU B HA   15 
ATOM 11477 H HB2  . LEU B 2 11 ? -4.962  -0.458  5.028   1.00 0.00 ? 11 LEU B HB2  15 
ATOM 11478 H HB3  . LEU B 2 11 ? -3.354  0.267   5.022   1.00 0.00 ? 11 LEU B HB3  15 
ATOM 11479 H HG   . LEU B 2 11 ? -5.495  0.728   2.924   1.00 0.00 ? 11 LEU B HG   15 
ATOM 11480 H HD11 . LEU B 2 11 ? -5.188  1.856   5.490   1.00 0.00 ? 11 LEU B HD11 15 
ATOM 11481 H HD12 . LEU B 2 11 ? -6.214  2.450   4.184   1.00 0.00 ? 11 LEU B HD12 15 
ATOM 11482 H HD13 . LEU B 2 11 ? -4.570  3.063   4.361   1.00 0.00 ? 11 LEU B HD13 15 
ATOM 11483 H HD21 . LEU B 2 11 ? -2.659  1.722   3.272   1.00 0.00 ? 11 LEU B HD21 15 
ATOM 11484 H HD22 . LEU B 2 11 ? -3.836  2.584   2.281   1.00 0.00 ? 11 LEU B HD22 15 
ATOM 11485 H HD23 . LEU B 2 11 ? -3.371  0.935   1.863   1.00 0.00 ? 11 LEU B HD23 15 
ATOM 11486 N N    . VAL B 2 12 ? -1.306  -1.164  4.034   1.00 0.00 ? 12 VAL B N    15 
ATOM 11487 C CA   . VAL B 2 12 ? 0.134   -0.950  3.725   1.00 0.00 ? 12 VAL B CA   15 
ATOM 11488 C C    . VAL B 2 12 ? 0.590   -2.047  2.768   1.00 0.00 ? 12 VAL B C    15 
ATOM 11489 O O    . VAL B 2 12 ? 1.307   -1.799  1.819   1.00 0.00 ? 12 VAL B O    15 
ATOM 11490 C CB   . VAL B 2 12 ? 0.955   -1.014  5.013   1.00 0.00 ? 12 VAL B CB   15 
ATOM 11491 C CG1  . VAL B 2 12 ? 0.737   -2.367  5.692   1.00 0.00 ? 12 VAL B CG1  15 
ATOM 11492 C CG2  . VAL B 2 12 ? 2.439   -0.846  4.679   1.00 0.00 ? 12 VAL B CG2  15 
ATOM 11493 H H    . VAL B 2 12 ? -1.576  -1.482  4.921   1.00 0.00 ? 12 VAL B H    15 
ATOM 11494 H HA   . VAL B 2 12 ? 0.263   0.013   3.253   1.00 0.00 ? 12 VAL B HA   15 
ATOM 11495 H HB   . VAL B 2 12 ? 0.642   -0.222  5.679   1.00 0.00 ? 12 VAL B HB   15 
ATOM 11496 H HG11 . VAL B 2 12 ? 1.070   -3.157  5.035   1.00 0.00 ? 12 VAL B HG11 15 
ATOM 11497 H HG12 . VAL B 2 12 ? -0.314  -2.496  5.907   1.00 0.00 ? 12 VAL B HG12 15 
ATOM 11498 H HG13 . VAL B 2 12 ? 1.300   -2.403  6.613   1.00 0.00 ? 12 VAL B HG13 15 
ATOM 11499 H HG21 . VAL B 2 12 ? 2.540   -0.285  3.762   1.00 0.00 ? 12 VAL B HG21 15 
ATOM 11500 H HG22 . VAL B 2 12 ? 2.893   -1.818  4.558   1.00 0.00 ? 12 VAL B HG22 15 
ATOM 11501 H HG23 . VAL B 2 12 ? 2.931   -0.316  5.481   1.00 0.00 ? 12 VAL B HG23 15 
ATOM 11502 N N    . GLU B 2 13 ? 0.161   -3.258  2.996   1.00 0.00 ? 13 GLU B N    15 
ATOM 11503 C CA   . GLU B 2 13 ? 0.553   -4.361  2.082   1.00 0.00 ? 13 GLU B CA   15 
ATOM 11504 C C    . GLU B 2 13 ? 0.165   -3.957  0.662   1.00 0.00 ? 13 GLU B C    15 
ATOM 11505 O O    . GLU B 2 13 ? 0.805   -4.328  -0.302  1.00 0.00 ? 13 GLU B O    15 
ATOM 11506 C CB   . GLU B 2 13 ? -0.187  -5.642  2.474   1.00 0.00 ? 13 GLU B CB   15 
ATOM 11507 C CG   . GLU B 2 13 ? 0.790   -6.611  3.144   1.00 0.00 ? 13 GLU B CG   15 
ATOM 11508 C CD   . GLU B 2 13 ? 0.132   -7.985  3.282   1.00 0.00 ? 13 GLU B CD   15 
ATOM 11509 O OE1  . GLU B 2 13 ? 0.075   -8.694  2.291   1.00 0.00 ? 13 GLU B OE1  15 
ATOM 11510 O OE2  . GLU B 2 13 ? -0.303  -8.304  4.376   1.00 0.00 ? 13 GLU B OE2  15 
ATOM 11511 H H    . GLU B 2 13 ? -0.430  -3.436  3.758   1.00 0.00 ? 13 GLU B H    15 
ATOM 11512 H HA   . GLU B 2 13 ? 1.620   -4.520  2.138   1.00 0.00 ? 13 GLU B HA   15 
ATOM 11513 H HB2  . GLU B 2 13 ? -0.985  -5.401  3.161   1.00 0.00 ? 13 GLU B HB2  15 
ATOM 11514 H HB3  . GLU B 2 13 ? -0.599  -6.105  1.590   1.00 0.00 ? 13 GLU B HB3  15 
ATOM 11515 H HG2  . GLU B 2 13 ? 1.682   -6.696  2.540   1.00 0.00 ? 13 GLU B HG2  15 
ATOM 11516 H HG3  . GLU B 2 13 ? 1.051   -6.239  4.123   1.00 0.00 ? 13 GLU B HG3  15 
ATOM 11517 N N    . ALA B 2 14 ? -0.879  -3.182  0.533   1.00 0.00 ? 14 ALA B N    15 
ATOM 11518 C CA   . ALA B 2 14 ? -1.313  -2.733  -0.814  1.00 0.00 ? 14 ALA B CA   15 
ATOM 11519 C C    . ALA B 2 14 ? -0.264  -1.775  -1.376  1.00 0.00 ? 14 ALA B C    15 
ATOM 11520 O O    . ALA B 2 14 ? 0.141   -1.879  -2.515  1.00 0.00 ? 14 ALA B O    15 
ATOM 11521 C CB   . ALA B 2 14 ? -2.661  -2.016  -0.708  1.00 0.00 ? 14 ALA B CB   15 
ATOM 11522 H H    . ALA B 2 14 ? -1.371  -2.890  1.327   1.00 0.00 ? 14 ALA B H    15 
ATOM 11523 H HA   . ALA B 2 14 ? -1.406  -3.585  -1.461  1.00 0.00 ? 14 ALA B HA   15 
ATOM 11524 H HB1  . ALA B 2 14 ? -3.068  -1.867  -1.698  1.00 0.00 ? 14 ALA B HB1  15 
ATOM 11525 H HB2  . ALA B 2 14 ? -2.524  -1.059  -0.228  1.00 0.00 ? 14 ALA B HB2  15 
ATOM 11526 H HB3  . ALA B 2 14 ? -3.343  -2.618  -0.126  1.00 0.00 ? 14 ALA B HB3  15 
ATOM 11527 N N    . LEU B 2 15 ? 0.185   -0.849  -0.575  1.00 0.00 ? 15 LEU B N    15 
ATOM 11528 C CA   . LEU B 2 15 ? 1.219   0.112   -1.051  1.00 0.00 ? 15 LEU B CA   15 
ATOM 11529 C C    . LEU B 2 15 ? 2.454   -0.680  -1.482  1.00 0.00 ? 15 LEU B C    15 
ATOM 11530 O O    . LEU B 2 15 ? 3.112   -0.351  -2.448  1.00 0.00 ? 15 LEU B O    15 
ATOM 11531 C CB   . LEU B 2 15 ? 1.547   1.111   0.079   1.00 0.00 ? 15 LEU B CB   15 
ATOM 11532 C CG   . LEU B 2 15 ? 2.856   0.740   0.788   1.00 0.00 ? 15 LEU B CG   15 
ATOM 11533 C CD1  . LEU B 2 15 ? 4.040   1.242   -0.038  1.00 0.00 ? 15 LEU B CD1  15 
ATOM 11534 C CD2  . LEU B 2 15 ? 2.888   1.395   2.170   1.00 0.00 ? 15 LEU B CD2  15 
ATOM 11535 H H    . LEU B 2 15 ? -0.152  -0.792  0.342   1.00 0.00 ? 15 LEU B H    15 
ATOM 11536 H HA   . LEU B 2 15 ? 0.837   0.648   -1.909  1.00 0.00 ? 15 LEU B HA   15 
ATOM 11537 H HB2  . LEU B 2 15 ? 1.640   2.102   -0.339  1.00 0.00 ? 15 LEU B HB2  15 
ATOM 11538 H HB3  . LEU B 2 15 ? 0.742   1.106   0.800   1.00 0.00 ? 15 LEU B HB3  15 
ATOM 11539 H HG   . LEU B 2 15 ? 2.918   -0.333  0.893   1.00 0.00 ? 15 LEU B HG   15 
ATOM 11540 H HD11 . LEU B 2 15 ? 3.697   1.537   -1.019  1.00 0.00 ? 15 LEU B HD11 15 
ATOM 11541 H HD12 . LEU B 2 15 ? 4.772   0.454   -0.135  1.00 0.00 ? 15 LEU B HD12 15 
ATOM 11542 H HD13 . LEU B 2 15 ? 4.488   2.091   0.456   1.00 0.00 ? 15 LEU B HD13 15 
ATOM 11543 H HD21 . LEU B 2 15 ? 3.620   0.897   2.788   1.00 0.00 ? 15 LEU B HD21 15 
ATOM 11544 H HD22 . LEU B 2 15 ? 1.914   1.314   2.629   1.00 0.00 ? 15 LEU B HD22 15 
ATOM 11545 H HD23 . LEU B 2 15 ? 3.152   2.437   2.068   1.00 0.00 ? 15 LEU B HD23 15 
ATOM 11546 N N    . TYR B 2 16 ? 2.754   -1.737  -0.789  1.00 0.00 ? 16 TYR B N    15 
ATOM 11547 C CA   . TYR B 2 16 ? 3.921   -2.563  -1.182  1.00 0.00 ? 16 TYR B CA   15 
ATOM 11548 C C    . TYR B 2 16 ? 3.583   -3.252  -2.502  1.00 0.00 ? 16 TYR B C    15 
ATOM 11549 O O    . TYR B 2 16 ? 4.362   -3.261  -3.434  1.00 0.00 ? 16 TYR B O    15 
ATOM 11550 C CB   . TYR B 2 16 ? 4.191   -3.615  -0.102  1.00 0.00 ? 16 TYR B CB   15 
ATOM 11551 C CG   . TYR B 2 16 ? 5.134   -4.665  -0.642  1.00 0.00 ? 16 TYR B CG   15 
ATOM 11552 C CD1  . TYR B 2 16 ? 4.636   -5.722  -1.412  1.00 0.00 ? 16 TYR B CD1  15 
ATOM 11553 C CD2  . TYR B 2 16 ? 6.505   -4.581  -0.371  1.00 0.00 ? 16 TYR B CD2  15 
ATOM 11554 C CE1  . TYR B 2 16 ? 5.508   -6.696  -1.912  1.00 0.00 ? 16 TYR B CE1  15 
ATOM 11555 C CE2  . TYR B 2 16 ? 7.378   -5.554  -0.871  1.00 0.00 ? 16 TYR B CE2  15 
ATOM 11556 C CZ   . TYR B 2 16 ? 6.879   -6.612  -1.642  1.00 0.00 ? 16 TYR B CZ   15 
ATOM 11557 O OH   . TYR B 2 16 ? 7.740   -7.571  -2.134  1.00 0.00 ? 16 TYR B OH   15 
ATOM 11558 H H    . TYR B 2 16 ? 2.199   -1.999  -0.025  1.00 0.00 ? 16 TYR B H    15 
ATOM 11559 H HA   . TYR B 2 16 ? 4.787   -1.938  -1.308  1.00 0.00 ? 16 TYR B HA   15 
ATOM 11560 H HB2  . TYR B 2 16 ? 4.637   -3.140  0.759   1.00 0.00 ? 16 TYR B HB2  15 
ATOM 11561 H HB3  . TYR B 2 16 ? 3.261   -4.083  0.186   1.00 0.00 ? 16 TYR B HB3  15 
ATOM 11562 H HD1  . TYR B 2 16 ? 3.578   -5.787  -1.621  1.00 0.00 ? 16 TYR B HD1  15 
ATOM 11563 H HD2  . TYR B 2 16 ? 6.889   -3.765  0.223   1.00 0.00 ? 16 TYR B HD2  15 
ATOM 11564 H HE1  . TYR B 2 16 ? 5.124   -7.512  -2.506  1.00 0.00 ? 16 TYR B HE1  15 
ATOM 11565 H HE2  . TYR B 2 16 ? 8.435   -5.490  -0.663  1.00 0.00 ? 16 TYR B HE2  15 
ATOM 11566 H HH   . TYR B 2 16 ? 7.301   -8.423  -2.073  1.00 0.00 ? 16 TYR B HH   15 
ATOM 11567 N N    . LEU B 2 17 ? 2.417   -3.829  -2.577  1.00 0.00 ? 17 LEU B N    15 
ATOM 11568 C CA   . LEU B 2 17 ? 1.998   -4.526  -3.823  1.00 0.00 ? 17 LEU B CA   15 
ATOM 11569 C C    . LEU B 2 17 ? 1.744   -3.524  -4.952  1.00 0.00 ? 17 LEU B C    15 
ATOM 11570 O O    . LEU B 2 17 ? 2.136   -3.745  -6.080  1.00 0.00 ? 17 LEU B O    15 
ATOM 11571 C CB   . LEU B 2 17 ? 0.726   -5.333  -3.557  1.00 0.00 ? 17 LEU B CB   15 
ATOM 11572 C CG   . LEU B 2 17 ? 0.482   -6.302  -4.715  1.00 0.00 ? 17 LEU B CG   15 
ATOM 11573 C CD1  . LEU B 2 17 ? -0.167  -7.582  -4.183  1.00 0.00 ? 17 LEU B CD1  15 
ATOM 11574 C CD2  . LEU B 2 17 ? -0.449  -5.648  -5.738  1.00 0.00 ? 17 LEU B CD2  15 
ATOM 11575 H H    . LEU B 2 17 ? 1.813   -3.802  -1.806  1.00 0.00 ? 17 LEU B H    15 
ATOM 11576 H HA   . LEU B 2 17 ? 2.786   -5.190  -4.125  1.00 0.00 ? 17 LEU B HA   15 
ATOM 11577 H HB2  . LEU B 2 17 ? 0.840   -5.891  -2.638  1.00 0.00 ? 17 LEU B HB2  15 
ATOM 11578 H HB3  . LEU B 2 17 ? -0.115  -4.662  -3.469  1.00 0.00 ? 17 LEU B HB3  15 
ATOM 11579 H HG   . LEU B 2 17 ? 1.424   -6.545  -5.185  1.00 0.00 ? 17 LEU B HG   15 
ATOM 11580 H HD11 . LEU B 2 17 ? -0.722  -7.357  -3.284  1.00 0.00 ? 17 LEU B HD11 15 
ATOM 11581 H HD12 . LEU B 2 17 ? 0.600   -8.309  -3.961  1.00 0.00 ? 17 LEU B HD12 15 
ATOM 11582 H HD13 . LEU B 2 17 ? -0.837  -7.983  -4.929  1.00 0.00 ? 17 LEU B HD13 15 
ATOM 11583 H HD21 . LEU B 2 17 ? -0.561  -6.300  -6.592  1.00 0.00 ? 17 LEU B HD21 15 
ATOM 11584 H HD22 . LEU B 2 17 ? -0.028  -4.706  -6.057  1.00 0.00 ? 17 LEU B HD22 15 
ATOM 11585 H HD23 . LEU B 2 17 ? -1.415  -5.476  -5.287  1.00 0.00 ? 17 LEU B HD23 15 
ATOM 11586 N N    . VAL B 2 18 ? 1.088   -2.429  -4.675  1.00 0.00 ? 18 VAL B N    15 
ATOM 11587 C CA   . VAL B 2 18 ? 0.825   -1.450  -5.768  1.00 0.00 ? 18 VAL B CA   15 
ATOM 11588 C C    . VAL B 2 18 ? 2.161   -1.059  -6.387  1.00 0.00 ? 18 VAL B C    15 
ATOM 11589 O O    . VAL B 2 18 ? 2.334   -1.072  -7.589  1.00 0.00 ? 18 VAL B O    15 
ATOM 11590 C CB   . VAL B 2 18 ? 0.149   -0.185  -5.224  1.00 0.00 ? 18 VAL B CB   15 
ATOM 11591 C CG1  . VAL B 2 18 ? -1.243  -0.495  -4.660  1.00 0.00 ? 18 VAL B CG1  15 
ATOM 11592 C CG2  . VAL B 2 18 ? 1.010   0.418   -4.129  1.00 0.00 ? 18 VAL B CG2  15 
ATOM 11593 H H    . VAL B 2 18 ? 0.770   -2.261  -3.765  1.00 0.00 ? 18 VAL B H    15 
ATOM 11594 H HA   . VAL B 2 18 ? 0.202   -1.905  -6.517  1.00 0.00 ? 18 VAL B HA   15 
ATOM 11595 H HB   . VAL B 2 18 ? 0.055   0.529   -6.020  1.00 0.00 ? 18 VAL B HB   15 
ATOM 11596 H HG11 . VAL B 2 18 ? -1.998  -0.145  -5.350  1.00 0.00 ? 18 VAL B HG11 15 
ATOM 11597 H HG12 . VAL B 2 18 ? -1.367  0.012   -3.712  1.00 0.00 ? 18 VAL B HG12 15 
ATOM 11598 H HG13 . VAL B 2 18 ? -1.350  -1.557  -4.515  1.00 0.00 ? 18 VAL B HG13 15 
ATOM 11599 H HG21 . VAL B 2 18 ? 1.263   -0.349  -3.418  1.00 0.00 ? 18 VAL B HG21 15 
ATOM 11600 H HG22 . VAL B 2 18 ? 0.461   1.205   -3.633  1.00 0.00 ? 18 VAL B HG22 15 
ATOM 11601 H HG23 . VAL B 2 18 ? 1.912   0.824   -4.559  1.00 0.00 ? 18 VAL B HG23 15 
ATOM 11602 N N    . CYS B 2 19 ? 3.109   -0.723  -5.565  1.00 0.00 ? 19 CYS B N    15 
ATOM 11603 C CA   . CYS B 2 19 ? 4.448   -0.339  -6.084  1.00 0.00 ? 19 CYS B CA   15 
ATOM 11604 C C    . CYS B 2 19 ? 5.339   -0.006  -4.898  1.00 0.00 ? 19 CYS B C    15 
ATOM 11605 O O    . CYS B 2 19 ? 6.171   0.876   -4.958  1.00 0.00 ? 19 CYS B O    15 
ATOM 11606 C CB   . CYS B 2 19 ? 4.346   0.880   -7.015  1.00 0.00 ? 19 CYS B CB   15 
ATOM 11607 S SG   . CYS B 2 19 ? 2.856   1.844   -6.642  1.00 0.00 ? 19 CYS B SG   15 
ATOM 11608 H H    . CYS B 2 19 ? 2.942   -0.728  -4.594  1.00 0.00 ? 19 CYS B H    15 
ATOM 11609 H HA   . CYS B 2 19 ? 4.873   -1.172  -6.626  1.00 0.00 ? 19 CYS B HA   15 
ATOM 11610 H HB2  . CYS B 2 19 ? 5.216   1.505   -6.878  1.00 0.00 ? 19 CYS B HB2  15 
ATOM 11611 H HB3  . CYS B 2 19 ? 4.308   0.543   -8.040  1.00 0.00 ? 19 CYS B HB3  15 
ATOM 11612 N N    . GLY B 2 20 ? 5.166   -0.707  -3.812  1.00 0.00 ? 20 GLY B N    15 
ATOM 11613 C CA   . GLY B 2 20 ? 6.006   -0.426  -2.613  1.00 0.00 ? 20 GLY B CA   15 
ATOM 11614 C C    . GLY B 2 20 ? 6.930   -1.614  -2.347  1.00 0.00 ? 20 GLY B C    15 
ATOM 11615 O O    . GLY B 2 20 ? 7.197   -1.967  -1.216  1.00 0.00 ? 20 GLY B O    15 
ATOM 11616 H H    . GLY B 2 20 ? 4.480   -1.420  -3.787  1.00 0.00 ? 20 GLY B H    15 
ATOM 11617 H HA2  . GLY B 2 20 ? 6.599   0.460   -2.792  1.00 0.00 ? 20 GLY B HA2  15 
ATOM 11618 H HA3  . GLY B 2 20 ? 5.371   -0.264  -1.756  1.00 0.00 ? 20 GLY B HA3  15 
ATOM 11619 N N    . GLU B 2 21 ? 7.423   -2.232  -3.385  1.00 0.00 ? 21 GLU B N    15 
ATOM 11620 C CA   . GLU B 2 21 ? 8.334   -3.396  -3.199  1.00 0.00 ? 21 GLU B CA   15 
ATOM 11621 C C    . GLU B 2 21 ? 9.693   -3.078  -3.826  1.00 0.00 ? 21 GLU B C    15 
ATOM 11622 O O    . GLU B 2 21 ? 10.714  -3.588  -3.411  1.00 0.00 ? 21 GLU B O    15 
ATOM 11623 C CB   . GLU B 2 21 ? 7.734   -4.627  -3.881  1.00 0.00 ? 21 GLU B CB   15 
ATOM 11624 C CG   . GLU B 2 21 ? 8.783   -5.739  -3.944  1.00 0.00 ? 21 GLU B CG   15 
ATOM 11625 C CD   . GLU B 2 21 ? 9.638   -5.564  -5.201  1.00 0.00 ? 21 GLU B CD   15 
ATOM 11626 O OE1  . GLU B 2 21 ? 9.393   -4.620  -5.934  1.00 0.00 ? 21 GLU B OE1  15 
ATOM 11627 O OE2  . GLU B 2 21 ? 10.523  -6.378  -5.409  1.00 0.00 ? 21 GLU B OE2  15 
ATOM 11628 H H    . GLU B 2 21 ? 7.196   -1.928  -4.289  1.00 0.00 ? 21 GLU B H    15 
ATOM 11629 H HA   . GLU B 2 21 ? 8.459   -3.592  -2.145  1.00 0.00 ? 21 GLU B HA   15 
ATOM 11630 H HB2  . GLU B 2 21 ? 6.878   -4.970  -3.318  1.00 0.00 ? 21 GLU B HB2  15 
ATOM 11631 H HB3  . GLU B 2 21 ? 7.425   -4.369  -4.883  1.00 0.00 ? 21 GLU B HB3  15 
ATOM 11632 H HG2  . GLU B 2 21 ? 9.413   -5.688  -3.068  1.00 0.00 ? 21 GLU B HG2  15 
ATOM 11633 H HG3  . GLU B 2 21 ? 8.289   -6.698  -3.978  1.00 0.00 ? 21 GLU B HG3  15 
ATOM 11634 N N    . ARG B 2 22 ? 9.711   -2.238  -4.825  1.00 0.00 ? 22 ARG B N    15 
ATOM 11635 C CA   . ARG B 2 22 ? 10.997  -1.887  -5.480  1.00 0.00 ? 22 ARG B CA   15 
ATOM 11636 C C    . ARG B 2 22 ? 11.695  -0.789  -4.679  1.00 0.00 ? 22 ARG B C    15 
ATOM 11637 O O    . ARG B 2 22 ? 12.846  -0.912  -4.307  1.00 0.00 ? 22 ARG B O    15 
ATOM 11638 C CB   . ARG B 2 22 ? 10.728  -1.390  -6.902  1.00 0.00 ? 22 ARG B CB   15 
ATOM 11639 C CG   . ARG B 2 22 ? 11.781  -1.964  -7.852  1.00 0.00 ? 22 ARG B CG   15 
ATOM 11640 C CD   . ARG B 2 22 ? 13.164  -1.444  -7.457  1.00 0.00 ? 22 ARG B CD   15 
ATOM 11641 N NE   . ARG B 2 22 ? 13.871  -0.942  -8.669  1.00 0.00 ? 22 ARG B NE   15 
ATOM 11642 C CZ   . ARG B 2 22 ? 14.717  -1.712  -9.297  1.00 0.00 ? 22 ARG B CZ   15 
ATOM 11643 N NH1  . ARG B 2 22 ? 14.282  -2.720  -10.002 1.00 0.00 ? 22 ARG B NH1  15 
ATOM 11644 N NH2  . ARG B 2 22 ? 15.998  -1.473  -9.221  1.00 0.00 ? 22 ARG B NH2  15 
ATOM 11645 H H    . ARG B 2 22 ? 8.879   -1.841  -5.144  1.00 0.00 ? 22 ARG B H    15 
ATOM 11646 H HA   . ARG B 2 22 ? 11.622  -2.757  -5.517  1.00 0.00 ? 22 ARG B HA   15 
ATOM 11647 H HB2  . ARG B 2 22 ? 9.745   -1.712  -7.215  1.00 0.00 ? 22 ARG B HB2  15 
ATOM 11648 H HB3  . ARG B 2 22 ? 10.777  -0.312  -6.923  1.00 0.00 ? 22 ARG B HB3  15 
ATOM 11649 H HG2  . ARG B 2 22 ? 11.770  -3.043  -7.792  1.00 0.00 ? 22 ARG B HG2  15 
ATOM 11650 H HG3  . ARG B 2 22 ? 11.558  -1.658  -8.863  1.00 0.00 ? 22 ARG B HG3  15 
ATOM 11651 H HD2  . ARG B 2 22 ? 13.056  -0.640  -6.744  1.00 0.00 ? 22 ARG B HD2  15 
ATOM 11652 H HD3  . ARG B 2 22 ? 13.736  -2.245  -7.013  1.00 0.00 ? 22 ARG B HD3  15 
ATOM 11653 H HE   . ARG B 2 22 ? 13.700  -0.033  -8.995  1.00 0.00 ? 22 ARG B HE   15 
ATOM 11654 H HH11 . ARG B 2 22 ? 13.301  -2.904  -10.061 1.00 0.00 ? 22 ARG B HH11 15 
ATOM 11655 H HH12 . ARG B 2 22 ? 14.931  -3.310  -10.483 1.00 0.00 ? 22 ARG B HH12 15 
ATOM 11656 H HH21 . ARG B 2 22 ? 16.331  -0.700  -8.681  1.00 0.00 ? 22 ARG B HH21 15 
ATOM 11657 H HH22 . ARG B 2 22 ? 16.646  -2.062  -9.703  1.00 0.00 ? 22 ARG B HH22 15 
ATOM 11658 N N    . GLY B 2 23 ? 11.007  0.283   -4.411  1.00 0.00 ? 23 GLY B N    15 
ATOM 11659 C CA   . GLY B 2 23 ? 11.626  1.394   -3.633  1.00 0.00 ? 23 GLY B CA   15 
ATOM 11660 C C    . GLY B 2 23 ? 11.402  1.161   -2.138  1.00 0.00 ? 23 GLY B C    15 
ATOM 11661 O O    . GLY B 2 23 ? 11.488  2.071   -1.338  1.00 0.00 ? 23 GLY B O    15 
ATOM 11662 H H    . GLY B 2 23 ? 10.081  0.357   -4.722  1.00 0.00 ? 23 GLY B H    15 
ATOM 11663 H HA2  . GLY B 2 23 ? 12.687  1.429   -3.839  1.00 0.00 ? 23 GLY B HA2  15 
ATOM 11664 H HA3  . GLY B 2 23 ? 11.172  2.331   -3.919  1.00 0.00 ? 23 GLY B HA3  15 
ATOM 11665 N N    . PHE B 2 24 ? 11.115  -0.053  -1.754  1.00 0.00 ? 24 PHE B N    15 
ATOM 11666 C CA   . PHE B 2 24 ? 10.886  -0.345  -0.311  1.00 0.00 ? 24 PHE B CA   15 
ATOM 11667 C C    . PHE B 2 24 ? 12.041  -1.193  0.227   1.00 0.00 ? 24 PHE B C    15 
ATOM 11668 O O    . PHE B 2 24 ? 12.504  -0.998  1.333   1.00 0.00 ? 24 PHE B O    15 
ATOM 11669 C CB   . PHE B 2 24 ? 9.570   -1.111  -0.150  1.00 0.00 ? 24 PHE B CB   15 
ATOM 11670 C CG   . PHE B 2 24 ? 8.515   -0.201  0.437   1.00 0.00 ? 24 PHE B CG   15 
ATOM 11671 C CD1  . PHE B 2 24 ? 8.582   1.182   0.225   1.00 0.00 ? 24 PHE B CD1  15 
ATOM 11672 C CD2  . PHE B 2 24 ? 7.469   -0.742  1.193   1.00 0.00 ? 24 PHE B CD2  15 
ATOM 11673 C CE1  . PHE B 2 24 ? 7.604   2.022   0.770   1.00 0.00 ? 24 PHE B CE1  15 
ATOM 11674 C CE2  . PHE B 2 24 ? 6.490   0.098   1.737   1.00 0.00 ? 24 PHE B CE2  15 
ATOM 11675 C CZ   . PHE B 2 24 ? 6.558   1.480   1.526   1.00 0.00 ? 24 PHE B CZ   15 
ATOM 11676 H H    . PHE B 2 24 ? 11.051  -0.773  -2.415  1.00 0.00 ? 24 PHE B H    15 
ATOM 11677 H HA   . PHE B 2 24 ? 10.834  0.582   0.241   1.00 0.00 ? 24 PHE B HA   15 
ATOM 11678 H HB2  . PHE B 2 24 ? 9.241   -1.466  -1.115  1.00 0.00 ? 24 PHE B HB2  15 
ATOM 11679 H HB3  . PHE B 2 24 ? 9.723   -1.953  0.509   1.00 0.00 ? 24 PHE B HB3  15 
ATOM 11680 H HD1  . PHE B 2 24 ? 9.389   1.601   -0.358  1.00 0.00 ? 24 PHE B HD1  15 
ATOM 11681 H HD2  . PHE B 2 24 ? 7.416   -1.809  1.356   1.00 0.00 ? 24 PHE B HD2  15 
ATOM 11682 H HE1  . PHE B 2 24 ? 7.656   3.088   0.607   1.00 0.00 ? 24 PHE B HE1  15 
ATOM 11683 H HE2  . PHE B 2 24 ? 5.683   -0.320  2.320   1.00 0.00 ? 24 PHE B HE2  15 
ATOM 11684 H HZ   . PHE B 2 24 ? 5.803   2.128   1.946   1.00 0.00 ? 24 PHE B HZ   15 
ATOM 11685 N N    . PHE B 2 25 ? 12.512  -2.131  -0.548  1.00 0.00 ? 25 PHE B N    15 
ATOM 11686 C CA   . PHE B 2 25 ? 13.637  -2.989  -0.081  1.00 0.00 ? 25 PHE B CA   15 
ATOM 11687 C C    . PHE B 2 25 ? 14.949  -2.481  -0.684  1.00 0.00 ? 25 PHE B C    15 
ATOM 11688 O O    . PHE B 2 25 ? 14.988  -2.018  -1.807  1.00 0.00 ? 25 PHE B O    15 
ATOM 11689 C CB   . PHE B 2 25 ? 13.397  -4.433  -0.524  1.00 0.00 ? 25 PHE B CB   15 
ATOM 11690 C CG   . PHE B 2 25 ? 14.443  -5.331  0.091   1.00 0.00 ? 25 PHE B CG   15 
ATOM 11691 C CD1  . PHE B 2 25 ? 14.529  -5.455  1.483   1.00 0.00 ? 25 PHE B CD1  15 
ATOM 11692 C CD2  . PHE B 2 25 ? 15.328  -6.040  -0.730  1.00 0.00 ? 25 PHE B CD2  15 
ATOM 11693 C CE1  . PHE B 2 25 ? 15.499  -6.287  2.053   1.00 0.00 ? 25 PHE B CE1  15 
ATOM 11694 C CE2  . PHE B 2 25 ? 16.298  -6.872  -0.160  1.00 0.00 ? 25 PHE B CE2  15 
ATOM 11695 C CZ   . PHE B 2 25 ? 16.383  -6.996  1.232   1.00 0.00 ? 25 PHE B CZ   15 
ATOM 11696 H H    . PHE B 2 25 ? 12.125  -2.272  -1.438  1.00 0.00 ? 25 PHE B H    15 
ATOM 11697 H HA   . PHE B 2 25 ? 13.697  -2.948  0.997   1.00 0.00 ? 25 PHE B HA   15 
ATOM 11698 H HB2  . PHE B 2 25 ? 12.415  -4.750  -0.202  1.00 0.00 ? 25 PHE B HB2  15 
ATOM 11699 H HB3  . PHE B 2 25 ? 13.459  -4.494  -1.601  1.00 0.00 ? 25 PHE B HB3  15 
ATOM 11700 H HD1  . PHE B 2 25 ? 13.846  -4.908  2.117   1.00 0.00 ? 25 PHE B HD1  15 
ATOM 11701 H HD2  . PHE B 2 25 ? 15.262  -5.944  -1.804  1.00 0.00 ? 25 PHE B HD2  15 
ATOM 11702 H HE1  . PHE B 2 25 ? 15.565  -6.383  3.127   1.00 0.00 ? 25 PHE B HE1  15 
ATOM 11703 H HE2  . PHE B 2 25 ? 16.980  -7.419  -0.794  1.00 0.00 ? 25 PHE B HE2  15 
ATOM 11704 H HZ   . PHE B 2 25 ? 17.132  -7.638  1.672   1.00 0.00 ? 25 PHE B HZ   15 
ATOM 11705 N N    . TYR B 2 26 ? 16.023  -2.563  0.052   1.00 0.00 ? 26 TYR B N    15 
ATOM 11706 C CA   . TYR B 2 26 ? 17.329  -2.083  -0.481  1.00 0.00 ? 26 TYR B CA   15 
ATOM 11707 C C    . TYR B 2 26 ? 18.294  -3.270  -0.612  1.00 0.00 ? 26 TYR B C    15 
ATOM 11708 O O    . TYR B 2 26 ? 18.552  -3.959  0.355   1.00 0.00 ? 26 TYR B O    15 
ATOM 11709 C CB   . TYR B 2 26 ? 17.922  -1.053  0.483   1.00 0.00 ? 26 TYR B CB   15 
ATOM 11710 C CG   . TYR B 2 26 ? 17.267  0.288   0.254   1.00 0.00 ? 26 TYR B CG   15 
ATOM 11711 C CD1  . TYR B 2 26 ? 17.555  1.018   -0.905  1.00 0.00 ? 26 TYR B CD1  15 
ATOM 11712 C CD2  . TYR B 2 26 ? 16.372  0.800   1.200   1.00 0.00 ? 26 TYR B CD2  15 
ATOM 11713 C CE1  . TYR B 2 26 ? 16.948  2.262   -1.117  1.00 0.00 ? 26 TYR B CE1  15 
ATOM 11714 C CE2  . TYR B 2 26 ? 15.765  2.044   0.988   1.00 0.00 ? 26 TYR B CE2  15 
ATOM 11715 C CZ   . TYR B 2 26 ? 16.053  2.774   -0.171  1.00 0.00 ? 26 TYR B CZ   15 
ATOM 11716 O OH   . TYR B 2 26 ? 15.455  4.000   -0.380  1.00 0.00 ? 26 TYR B OH   15 
ATOM 11717 H H    . TYR B 2 26 ? 15.971  -2.939  0.956   1.00 0.00 ? 26 TYR B H    15 
ATOM 11718 H HA   . TYR B 2 26 ? 17.174  -1.624  -1.444  1.00 0.00 ? 26 TYR B HA   15 
ATOM 11719 H HB2  . TYR B 2 26 ? 17.747  -1.371  1.501   1.00 0.00 ? 26 TYR B HB2  15 
ATOM 11720 H HB3  . TYR B 2 26 ? 18.985  -0.968  0.310   1.00 0.00 ? 26 TYR B HB3  15 
ATOM 11721 H HD1  . TYR B 2 26 ? 18.246  0.623   -1.635  1.00 0.00 ? 26 TYR B HD1  15 
ATOM 11722 H HD2  . TYR B 2 26 ? 16.150  0.236   2.094   1.00 0.00 ? 26 TYR B HD2  15 
ATOM 11723 H HE1  . TYR B 2 26 ? 17.170  2.826   -2.011  1.00 0.00 ? 26 TYR B HE1  15 
ATOM 11724 H HE2  . TYR B 2 26 ? 15.074  2.439   1.718   1.00 0.00 ? 26 TYR B HE2  15 
ATOM 11725 H HH   . TYR B 2 26 ? 15.644  4.556   0.379   1.00 0.00 ? 26 TYR B HH   15 
ATOM 11726 N N    . PRO B 2 27 ? 18.800  -3.478  -1.804  1.00 0.00 ? 27 PRO B N    15 
ATOM 11727 C CA   . PRO B 2 27 ? 19.740  -4.578  -2.082  1.00 0.00 ? 27 PRO B CA   15 
ATOM 11728 C C    . PRO B 2 27 ? 21.146  -4.213  -1.596  1.00 0.00 ? 27 PRO B C    15 
ATOM 11729 O O    . PRO B 2 27 ? 21.517  -3.056  -1.552  1.00 0.00 ? 27 PRO B O    15 
ATOM 11730 C CB   . PRO B 2 27 ? 19.706  -4.703  -3.607  1.00 0.00 ? 27 PRO B CB   15 
ATOM 11731 C CG   . PRO B 2 27 ? 19.213  -3.339  -4.146  1.00 0.00 ? 27 PRO B CG   15 
ATOM 11732 C CD   . PRO B 2 27 ? 18.485  -2.643  -2.981  1.00 0.00 ? 27 PRO B CD   15 
ATOM 11733 H HA   . PRO B 2 27 ? 19.403  -5.495  -1.627  1.00 0.00 ? 27 PRO B HA   15 
ATOM 11734 H HB2  . PRO B 2 27 ? 20.697  -4.919  -3.983  1.00 0.00 ? 27 PRO B HB2  15 
ATOM 11735 H HB3  . PRO B 2 27 ? 19.018  -5.480  -3.901  1.00 0.00 ? 27 PRO B HB3  15 
ATOM 11736 H HG2  . PRO B 2 27 ? 20.056  -2.744  -4.469  1.00 0.00 ? 27 PRO B HG2  15 
ATOM 11737 H HG3  . PRO B 2 27 ? 18.528  -3.490  -4.966  1.00 0.00 ? 27 PRO B HG3  15 
ATOM 11738 H HD2  . PRO B 2 27 ? 18.863  -1.638  -2.848  1.00 0.00 ? 27 PRO B HD2  15 
ATOM 11739 H HD3  . PRO B 2 27 ? 17.421  -2.629  -3.154  1.00 0.00 ? 27 PRO B HD3  15 
ATOM 11740 N N    . THR B 2 28 ? 21.931  -5.190  -1.232  1.00 0.00 ? 28 THR B N    15 
ATOM 11741 C CA   . THR B 2 28 ? 23.311  -4.898  -0.750  1.00 0.00 ? 28 THR B CA   15 
ATOM 11742 C C    . THR B 2 28 ? 23.274  -3.708  0.212   1.00 0.00 ? 28 THR B C    15 
ATOM 11743 O O    . THR B 2 28 ? 23.789  -2.647  -0.079  1.00 0.00 ? 28 THR B O    15 
ATOM 11744 C CB   . THR B 2 28 ? 24.208  -4.560  -1.944  1.00 0.00 ? 28 THR B CB   15 
ATOM 11745 O OG1  . THR B 2 28 ? 23.399  -4.170  -3.045  1.00 0.00 ? 28 THR B OG1  15 
ATOM 11746 C CG2  . THR B 2 28 ? 25.037  -5.787  -2.326  1.00 0.00 ? 28 THR B CG2  15 
ATOM 11747 H H    . THR B 2 28 ? 21.614  -6.116  -1.275  1.00 0.00 ? 28 THR B H    15 
ATOM 11748 H HA   . THR B 2 28 ? 23.705  -5.763  -0.237  1.00 0.00 ? 28 THR B HA   15 
ATOM 11749 H HB   . THR B 2 28 ? 24.871  -3.751  -1.679  1.00 0.00 ? 28 THR B HB   15 
ATOM 11750 H HG1  . THR B 2 28 ? 22.833  -4.910  -3.274  1.00 0.00 ? 28 THR B HG1  15 
ATOM 11751 H HG21 . THR B 2 28 ? 24.410  -6.498  -2.843  1.00 0.00 ? 28 THR B HG21 15 
ATOM 11752 H HG22 . THR B 2 28 ? 25.438  -6.243  -1.432  1.00 0.00 ? 28 THR B HG22 15 
ATOM 11753 H HG23 . THR B 2 28 ? 25.848  -5.486  -2.971  1.00 0.00 ? 28 THR B HG23 15 
ATOM 11754 N N    . LYS B 2 29 ? 22.670  -3.875  1.356   1.00 0.00 ? 29 LYS B N    15 
ATOM 11755 C CA   . LYS B 2 29 ? 22.601  -2.753  2.333   1.00 0.00 ? 29 LYS B CA   15 
ATOM 11756 C C    . LYS B 2 29 ? 23.891  -2.713  3.155   1.00 0.00 ? 29 LYS B C    15 
ATOM 11757 O O    . LYS B 2 29 ? 24.202  -3.633  3.885   1.00 0.00 ? 29 LYS B O    15 
ATOM 11758 C CB   . LYS B 2 29 ? 21.407  -2.960  3.267   1.00 0.00 ? 29 LYS B CB   15 
ATOM 11759 C CG   . LYS B 2 29 ? 20.645  -1.642  3.421   1.00 0.00 ? 29 LYS B CG   15 
ATOM 11760 C CD   . LYS B 2 29 ? 19.247  -1.922  3.977   1.00 0.00 ? 29 LYS B CD   15 
ATOM 11761 C CE   . LYS B 2 29 ? 18.635  -0.621  4.498   1.00 0.00 ? 29 LYS B CE   15 
ATOM 11762 N NZ   . LYS B 2 29 ? 18.161  -0.821  5.897   1.00 0.00 ? 29 LYS B NZ   15 
ATOM 11763 H H    . LYS B 2 29 ? 22.260  -4.739  1.572   1.00 0.00 ? 29 LYS B H    15 
ATOM 11764 H HA   . LYS B 2 29 ? 22.485  -1.820  1.802   1.00 0.00 ? 29 LYS B HA   15 
ATOM 11765 H HB2  . LYS B 2 29 ? 20.751  -3.711  2.851   1.00 0.00 ? 29 LYS B HB2  15 
ATOM 11766 H HB3  . LYS B 2 29 ? 21.758  -3.285  4.235   1.00 0.00 ? 29 LYS B HB3  15 
ATOM 11767 H HG2  . LYS B 2 29 ? 21.180  -0.995  4.100   1.00 0.00 ? 29 LYS B HG2  15 
ATOM 11768 H HG3  . LYS B 2 29 ? 20.558  -1.162  2.458   1.00 0.00 ? 29 LYS B HG3  15 
ATOM 11769 H HD2  . LYS B 2 29 ? 18.623  -2.327  3.193   1.00 0.00 ? 29 LYS B HD2  15 
ATOM 11770 H HD3  . LYS B 2 29 ? 19.317  -2.634  4.785   1.00 0.00 ? 29 LYS B HD3  15 
ATOM 11771 H HE2  . LYS B 2 29 ? 19.379  0.160   4.479   1.00 0.00 ? 29 LYS B HE2  15 
ATOM 11772 H HE3  . LYS B 2 29 ? 17.801  -0.340  3.872   1.00 0.00 ? 29 LYS B HE3  15 
ATOM 11773 H HZ1  . LYS B 2 29 ? 18.498  -0.039  6.493   1.00 0.00 ? 29 LYS B HZ1  15 
ATOM 11774 H HZ2  . LYS B 2 29 ? 18.532  -1.722  6.263   1.00 0.00 ? 29 LYS B HZ2  15 
ATOM 11775 H HZ3  . LYS B 2 29 ? 17.122  -0.843  5.912   1.00 0.00 ? 29 LYS B HZ3  15 
ATOM 11776 N N    . THR B 2 30 ? 24.644  -1.653  3.043   1.00 0.00 ? 30 THR B N    15 
ATOM 11777 C CA   . THR B 2 30 ? 25.912  -1.554  3.819   1.00 0.00 ? 30 THR B CA   15 
ATOM 11778 C C    . THR B 2 30 ? 25.628  -0.927  5.185   1.00 0.00 ? 30 THR B C    15 
ATOM 11779 O O    . THR B 2 30 ? 25.422  0.274   5.232   1.00 0.00 ? 30 THR B O    15 
ATOM 11780 C CB   . THR B 2 30 ? 26.910  -0.681  3.054   1.00 0.00 ? 30 THR B CB   15 
ATOM 11781 O OG1  . THR B 2 30 ? 26.234  0.445   2.513   1.00 0.00 ? 30 THR B OG1  15 
ATOM 11782 C CG2  . THR B 2 30 ? 27.540  -1.493  1.922   1.00 0.00 ? 30 THR B CG2  15 
ATOM 11783 O OXT  . THR B 2 30 ? 25.620  -1.660  6.161   1.00 0.00 ? 30 THR B OXT  15 
ATOM 11784 H H    . THR B 2 30 ? 24.375  -0.921  2.449   1.00 0.00 ? 30 THR B H    15 
ATOM 11785 H HA   . THR B 2 30 ? 26.328  -2.541  3.955   1.00 0.00 ? 30 THR B HA   15 
ATOM 11786 H HB   . THR B 2 30 ? 27.686  -0.347  3.726   1.00 0.00 ? 30 THR B HB   15 
ATOM 11787 H HG1  . THR B 2 30 ? 26.208  1.128   3.187   1.00 0.00 ? 30 THR B HG1  15 
ATOM 11788 H HG21 . THR B 2 30 ? 26.763  -1.984  1.355   1.00 0.00 ? 30 THR B HG21 15 
ATOM 11789 H HG22 . THR B 2 30 ? 28.205  -2.236  2.338   1.00 0.00 ? 30 THR B HG22 15 
ATOM 11790 H HG23 . THR B 2 30 ? 28.098  -0.834  1.273   1.00 0.00 ? 30 THR B HG23 15 
ATOM 11791 N N    . GLY A 1 1  ? -0.098  6.264   8.725   1.00 0.00 ? 1  GLY A N    16 
ATOM 11792 C CA   . GLY A 1 1  ? 0.056   6.470   7.257   1.00 0.00 ? 1  GLY A CA   16 
ATOM 11793 C C    . GLY A 1 1  ? -1.324  6.512   6.599   1.00 0.00 ? 1  GLY A C    16 
ATOM 11794 O O    . GLY A 1 1  ? -2.338  6.371   7.252   1.00 0.00 ? 1  GLY A O    16 
ATOM 11795 H H1   . GLY A 1 1  ? -0.630  7.058   9.133   1.00 0.00 ? 1  GLY A H1   16 
ATOM 11796 H H2   . GLY A 1 1  ? 0.843   6.211   9.168   1.00 0.00 ? 1  GLY A H2   16 
ATOM 11797 H H3   . GLY A 1 1  ? -0.613  5.378   8.899   1.00 0.00 ? 1  GLY A H3   16 
ATOM 11798 H HA2  . GLY A 1 1  ? 0.571   7.403   7.078   1.00 0.00 ? 1  GLY A HA2  16 
ATOM 11799 H HA3  . GLY A 1 1  ? 0.627   5.657   6.837   1.00 0.00 ? 1  GLY A HA3  16 
ATOM 11800 N N    . ILE A 1 2  ? -1.371  6.707   5.309   1.00 0.00 ? 2  ILE A N    16 
ATOM 11801 C CA   . ILE A 1 2  ? -2.687  6.759   4.612   1.00 0.00 ? 2  ILE A CA   16 
ATOM 11802 C C    . ILE A 1 2  ? -3.379  5.399   4.723   1.00 0.00 ? 2  ILE A C    16 
ATOM 11803 O O    . ILE A 1 2  ? -4.590  5.309   4.747   1.00 0.00 ? 2  ILE A O    16 
ATOM 11804 C CB   . ILE A 1 2  ? -2.477  7.110   3.136   1.00 0.00 ? 2  ILE A CB   16 
ATOM 11805 C CG1  . ILE A 1 2  ? -1.233  6.390   2.604   1.00 0.00 ? 2  ILE A CG1  16 
ATOM 11806 C CG2  . ILE A 1 2  ? -2.286  8.621   2.994   1.00 0.00 ? 2  ILE A CG2  16 
ATOM 11807 C CD1  . ILE A 1 2  ? -1.308  6.303   1.079   1.00 0.00 ? 2  ILE A CD1  16 
ATOM 11808 H H    . ILE A 1 2  ? -0.542  6.820   4.800   1.00 0.00 ? 2  ILE A H    16 
ATOM 11809 H HA   . ILE A 1 2  ? -3.307  7.512   5.074   1.00 0.00 ? 2  ILE A HA   16 
ATOM 11810 H HB   . ILE A 1 2  ? -3.343  6.803   2.568   1.00 0.00 ? 2  ILE A HB   16 
ATOM 11811 H HG12 . ILE A 1 2  ? -0.348  6.940   2.890   1.00 0.00 ? 2  ILE A HG12 16 
ATOM 11812 H HG13 . ILE A 1 2  ? -1.187  5.394   3.017   1.00 0.00 ? 2  ILE A HG13 16 
ATOM 11813 H HG21 . ILE A 1 2  ? -2.542  8.923   1.989   1.00 0.00 ? 2  ILE A HG21 16 
ATOM 11814 H HG22 . ILE A 1 2  ? -1.256  8.875   3.194   1.00 0.00 ? 2  ILE A HG22 16 
ATOM 11815 H HG23 . ILE A 1 2  ? -2.926  9.132   3.697   1.00 0.00 ? 2  ILE A HG23 16 
ATOM 11816 H HD11 . ILE A 1 2  ? -0.922  7.215   0.647   1.00 0.00 ? 2  ILE A HD11 16 
ATOM 11817 H HD12 . ILE A 1 2  ? -2.335  6.168   0.776   1.00 0.00 ? 2  ILE A HD12 16 
ATOM 11818 H HD13 . ILE A 1 2  ? -0.718  5.466   0.737   1.00 0.00 ? 2  ILE A HD13 16 
ATOM 11819 N N    . VAL A 1 3  ? -2.622  4.341   4.788   1.00 0.00 ? 3  VAL A N    16 
ATOM 11820 C CA   . VAL A 1 3  ? -3.228  2.993   4.894   1.00 0.00 ? 3  VAL A CA   16 
ATOM 11821 C C    . VAL A 1 3  ? -3.869  2.828   6.276   1.00 0.00 ? 3  VAL A C    16 
ATOM 11822 O O    . VAL A 1 3  ? -4.960  2.308   6.407   1.00 0.00 ? 3  VAL A O    16 
ATOM 11823 C CB   . VAL A 1 3  ? -2.121  1.955   4.687   1.00 0.00 ? 3  VAL A CB   16 
ATOM 11824 C CG1  . VAL A 1 3  ? -2.528  0.624   5.307   1.00 0.00 ? 3  VAL A CG1  16 
ATOM 11825 C CG2  . VAL A 1 3  ? -1.877  1.764   3.189   1.00 0.00 ? 3  VAL A CG2  16 
ATOM 11826 H H    . VAL A 1 3  ? -1.649  4.429   4.767   1.00 0.00 ? 3  VAL A H    16 
ATOM 11827 H HA   . VAL A 1 3  ? -3.981  2.876   4.133   1.00 0.00 ? 3  VAL A HA   16 
ATOM 11828 H HB   . VAL A 1 3  ? -1.212  2.304   5.157   1.00 0.00 ? 3  VAL A HB   16 
ATOM 11829 H HG11 . VAL A 1 3  ? -2.020  0.500   6.251   1.00 0.00 ? 3  VAL A HG11 16 
ATOM 11830 H HG12 . VAL A 1 3  ? -2.256  -0.179  4.641   1.00 0.00 ? 3  VAL A HG12 16 
ATOM 11831 H HG13 . VAL A 1 3  ? -3.595  0.617   5.468   1.00 0.00 ? 3  VAL A HG13 16 
ATOM 11832 H HG21 . VAL A 1 3  ? -1.557  0.750   3.002   1.00 0.00 ? 3  VAL A HG21 16 
ATOM 11833 H HG22 . VAL A 1 3  ? -1.110  2.450   2.859   1.00 0.00 ? 3  VAL A HG22 16 
ATOM 11834 H HG23 . VAL A 1 3  ? -2.790  1.959   2.648   1.00 0.00 ? 3  VAL A HG23 16 
ATOM 11835 N N    . GLU A 1 4  ? -3.199  3.261   7.304   1.00 0.00 ? 4  GLU A N    16 
ATOM 11836 C CA   . GLU A 1 4  ? -3.766  3.125   8.675   1.00 0.00 ? 4  GLU A CA   16 
ATOM 11837 C C    . GLU A 1 4  ? -4.971  4.054   8.830   1.00 0.00 ? 4  GLU A C    16 
ATOM 11838 O O    . GLU A 1 4  ? -5.949  3.717   9.468   1.00 0.00 ? 4  GLU A O    16 
ATOM 11839 C CB   . GLU A 1 4  ? -2.700  3.498   9.708   1.00 0.00 ? 4  GLU A CB   16 
ATOM 11840 C CG   . GLU A 1 4  ? -2.079  2.223   10.284  1.00 0.00 ? 4  GLU A CG   16 
ATOM 11841 C CD   . GLU A 1 4  ? -2.120  2.280   11.812  1.00 0.00 ? 4