data_1JEQ
# 
_entry.id   1JEQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JEQ         
RCSB  RCSB013687   
WWPDB D_1000013687 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JEQ 
_pdbx_database_status.recvd_initial_deposition_date   2001-06-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Walker, J.R.'  1 
'Corpina, R.A.' 2 
'Goldberg, J.'  3 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the Ku heterodimer bound to DNA and its implications for double-strand break repair.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            412 
_citation.page_first                607 
_citation.page_last                 614 
_citation.year                      2001 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11493912 
_citation.pdbx_database_id_DOI      10.1038/35088000 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Walker, J.R.'  1 
primary 'Corpina, R.A.' 2 
primary 'Goldberg, J.'  3 
# 
_cell.entry_id           1JEQ 
_cell.length_a           80.209 
_cell.length_b           86.186 
_cell.length_c           203.277 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JEQ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man KU70  69945.039 1  ? ? ? ? 
2 polymer man KU80  64190.543 1  ? ? ? ? 
3 water   nat water 18.015    42 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'HOMO SAPIENS THYROID AUTOANTIGEN 70KD' 
2 'DNA REPAIR PROTEIN XRCC5'              
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDR
DLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFK
MSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLE
DLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQ
IYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRY
TPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFEN
PVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYS
EEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD
;
;MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDR
DLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFK
MSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLE
DLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQ
IYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRY
TPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFEN
PVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYS
EEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD
;
A ? 
2 'polypeptide(L)' no no 
;MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVH
RHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDIS
LQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKI
ERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDI
VPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKR
ANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTT
KIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHED
GPTAK
;
;MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVH
RHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDIS
LQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKI
ERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDI
VPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKR
ANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTT
KIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHED
GPTAK
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLY n 
1 4   TRP n 
1 5   GLU n 
1 6   SER n 
1 7   TYR n 
1 8   TYR n 
1 9   LYS n 
1 10  THR n 
1 11  GLU n 
1 12  GLY n 
1 13  ASP n 
1 14  GLU n 
1 15  GLU n 
1 16  ALA n 
1 17  GLU n 
1 18  GLU n 
1 19  GLU n 
1 20  GLN n 
1 21  GLU n 
1 22  GLU n 
1 23  ASN n 
1 24  LEU n 
1 25  GLU n 
1 26  ALA n 
1 27  SER n 
1 28  GLY n 
1 29  ASP n 
1 30  TYR n 
1 31  LYS n 
1 32  TYR n 
1 33  SER n 
1 34  GLY n 
1 35  ARG n 
1 36  ASP n 
1 37  SER n 
1 38  LEU n 
1 39  ILE n 
1 40  PHE n 
1 41  LEU n 
1 42  VAL n 
1 43  ASP n 
1 44  ALA n 
1 45  SER n 
1 46  LYS n 
1 47  ALA n 
1 48  MET n 
1 49  PHE n 
1 50  GLU n 
1 51  SER n 
1 52  GLN n 
1 53  SER n 
1 54  GLU n 
1 55  ASP n 
1 56  GLU n 
1 57  LEU n 
1 58  THR n 
1 59  PRO n 
1 60  PHE n 
1 61  ASP n 
1 62  MET n 
1 63  SER n 
1 64  ILE n 
1 65  GLN n 
1 66  CYS n 
1 67  ILE n 
1 68  GLN n 
1 69  SER n 
1 70  VAL n 
1 71  TYR n 
1 72  ILE n 
1 73  SER n 
1 74  LYS n 
1 75  ILE n 
1 76  ILE n 
1 77  SER n 
1 78  SER n 
1 79  ASP n 
1 80  ARG n 
1 81  ASP n 
1 82  LEU n 
1 83  LEU n 
1 84  ALA n 
1 85  VAL n 
1 86  VAL n 
1 87  PHE n 
1 88  TYR n 
1 89  GLY n 
1 90  THR n 
1 91  GLU n 
1 92  LYS n 
1 93  ASP n 
1 94  LYS n 
1 95  ASN n 
1 96  SER n 
1 97  VAL n 
1 98  ASN n 
1 99  PHE n 
1 100 LYS n 
1 101 ASN n 
1 102 ILE n 
1 103 TYR n 
1 104 VAL n 
1 105 LEU n 
1 106 GLN n 
1 107 GLU n 
1 108 LEU n 
1 109 ASP n 
1 110 ASN n 
1 111 PRO n 
1 112 GLY n 
1 113 ALA n 
1 114 LYS n 
1 115 ARG n 
1 116 ILE n 
1 117 LEU n 
1 118 GLU n 
1 119 LEU n 
1 120 ASP n 
1 121 GLN n 
1 122 PHE n 
1 123 LYS n 
1 124 GLY n 
1 125 GLN n 
1 126 GLN n 
1 127 GLY n 
1 128 GLN n 
1 129 LYS n 
1 130 ARG n 
1 131 PHE n 
1 132 GLN n 
1 133 ASP n 
1 134 MET n 
1 135 MET n 
1 136 GLY n 
1 137 HIS n 
1 138 GLY n 
1 139 SER n 
1 140 ASP n 
1 141 TYR n 
1 142 SER n 
1 143 LEU n 
1 144 SER n 
1 145 GLU n 
1 146 VAL n 
1 147 LEU n 
1 148 TRP n 
1 149 VAL n 
1 150 CYS n 
1 151 ALA n 
1 152 ASN n 
1 153 LEU n 
1 154 PHE n 
1 155 SER n 
1 156 ASP n 
1 157 VAL n 
1 158 GLN n 
1 159 PHE n 
1 160 LYS n 
1 161 MET n 
1 162 SER n 
1 163 HIS n 
1 164 LYS n 
1 165 ARG n 
1 166 ILE n 
1 167 MET n 
1 168 LEU n 
1 169 PHE n 
1 170 THR n 
1 171 ASN n 
1 172 GLU n 
1 173 ASP n 
1 174 ASN n 
1 175 PRO n 
1 176 HIS n 
1 177 GLY n 
1 178 ASN n 
1 179 ASP n 
1 180 SER n 
1 181 ALA n 
1 182 LYS n 
1 183 ALA n 
1 184 SER n 
1 185 ARG n 
1 186 ALA n 
1 187 ARG n 
1 188 THR n 
1 189 LYS n 
1 190 ALA n 
1 191 GLY n 
1 192 ASP n 
1 193 LEU n 
1 194 ARG n 
1 195 ASP n 
1 196 THR n 
1 197 GLY n 
1 198 ILE n 
1 199 PHE n 
1 200 LEU n 
1 201 ASP n 
1 202 LEU n 
1 203 MET n 
1 204 HIS n 
1 205 LEU n 
1 206 LYS n 
1 207 LYS n 
1 208 PRO n 
1 209 GLY n 
1 210 GLY n 
1 211 PHE n 
1 212 ASP n 
1 213 ILE n 
1 214 SER n 
1 215 LEU n 
1 216 PHE n 
1 217 TYR n 
1 218 ARG n 
1 219 ASP n 
1 220 ILE n 
1 221 ILE n 
1 222 SER n 
1 223 ILE n 
1 224 ALA n 
1 225 GLU n 
1 226 ASP n 
1 227 GLU n 
1 228 ASP n 
1 229 LEU n 
1 230 ARG n 
1 231 VAL n 
1 232 HIS n 
1 233 PHE n 
1 234 GLU n 
1 235 GLU n 
1 236 SER n 
1 237 SER n 
1 238 LYS n 
1 239 LEU n 
1 240 GLU n 
1 241 ASP n 
1 242 LEU n 
1 243 LEU n 
1 244 ARG n 
1 245 LYS n 
1 246 VAL n 
1 247 ARG n 
1 248 ALA n 
1 249 LYS n 
1 250 GLU n 
1 251 THR n 
1 252 ARG n 
1 253 LYS n 
1 254 ARG n 
1 255 ALA n 
1 256 LEU n 
1 257 SER n 
1 258 ARG n 
1 259 LEU n 
1 260 LYS n 
1 261 LEU n 
1 262 LYS n 
1 263 LEU n 
1 264 ASN n 
1 265 LYS n 
1 266 ASP n 
1 267 ILE n 
1 268 VAL n 
1 269 ILE n 
1 270 SER n 
1 271 VAL n 
1 272 GLY n 
1 273 ILE n 
1 274 TYR n 
1 275 ASN n 
1 276 LEU n 
1 277 VAL n 
1 278 GLN n 
1 279 LYS n 
1 280 ALA n 
1 281 LEU n 
1 282 LYS n 
1 283 PRO n 
1 284 PRO n 
1 285 PRO n 
1 286 ILE n 
1 287 LYS n 
1 288 LEU n 
1 289 TYR n 
1 290 ARG n 
1 291 GLU n 
1 292 THR n 
1 293 ASN n 
1 294 GLU n 
1 295 PRO n 
1 296 VAL n 
1 297 LYS n 
1 298 THR n 
1 299 LYS n 
1 300 THR n 
1 301 ARG n 
1 302 THR n 
1 303 PHE n 
1 304 ASN n 
1 305 THR n 
1 306 SER n 
1 307 THR n 
1 308 GLY n 
1 309 GLY n 
1 310 LEU n 
1 311 LEU n 
1 312 LEU n 
1 313 PRO n 
1 314 SER n 
1 315 ASP n 
1 316 THR n 
1 317 LYS n 
1 318 ARG n 
1 319 SER n 
1 320 GLN n 
1 321 ILE n 
1 322 TYR n 
1 323 GLY n 
1 324 SER n 
1 325 ARG n 
1 326 GLN n 
1 327 ILE n 
1 328 ILE n 
1 329 LEU n 
1 330 GLU n 
1 331 LYS n 
1 332 GLU n 
1 333 GLU n 
1 334 THR n 
1 335 GLU n 
1 336 GLU n 
1 337 LEU n 
1 338 LYS n 
1 339 ARG n 
1 340 PHE n 
1 341 ASP n 
1 342 ASP n 
1 343 PRO n 
1 344 GLY n 
1 345 LEU n 
1 346 MET n 
1 347 LEU n 
1 348 MET n 
1 349 GLY n 
1 350 PHE n 
1 351 LYS n 
1 352 PRO n 
1 353 LEU n 
1 354 VAL n 
1 355 LEU n 
1 356 LEU n 
1 357 LYS n 
1 358 LYS n 
1 359 HIS n 
1 360 HIS n 
1 361 TYR n 
1 362 LEU n 
1 363 ARG n 
1 364 PRO n 
1 365 SER n 
1 366 LEU n 
1 367 PHE n 
1 368 VAL n 
1 369 TYR n 
1 370 PRO n 
1 371 GLU n 
1 372 GLU n 
1 373 SER n 
1 374 LEU n 
1 375 VAL n 
1 376 ILE n 
1 377 GLY n 
1 378 SER n 
1 379 SER n 
1 380 THR n 
1 381 LEU n 
1 382 PHE n 
1 383 SER n 
1 384 ALA n 
1 385 LEU n 
1 386 LEU n 
1 387 ILE n 
1 388 LYS n 
1 389 CYS n 
1 390 LEU n 
1 391 GLU n 
1 392 LYS n 
1 393 GLU n 
1 394 VAL n 
1 395 ALA n 
1 396 ALA n 
1 397 LEU n 
1 398 CYS n 
1 399 ARG n 
1 400 TYR n 
1 401 THR n 
1 402 PRO n 
1 403 ARG n 
1 404 ARG n 
1 405 ASN n 
1 406 ILE n 
1 407 PRO n 
1 408 PRO n 
1 409 TYR n 
1 410 PHE n 
1 411 VAL n 
1 412 ALA n 
1 413 LEU n 
1 414 VAL n 
1 415 PRO n 
1 416 GLN n 
1 417 GLU n 
1 418 GLU n 
1 419 GLU n 
1 420 LEU n 
1 421 ASP n 
1 422 ASP n 
1 423 GLN n 
1 424 LYS n 
1 425 ILE n 
1 426 GLN n 
1 427 VAL n 
1 428 THR n 
1 429 PRO n 
1 430 PRO n 
1 431 GLY n 
1 432 PHE n 
1 433 GLN n 
1 434 LEU n 
1 435 VAL n 
1 436 PHE n 
1 437 LEU n 
1 438 PRO n 
1 439 PHE n 
1 440 ALA n 
1 441 ASP n 
1 442 ASP n 
1 443 LYS n 
1 444 ARG n 
1 445 LYS n 
1 446 MET n 
1 447 PRO n 
1 448 PHE n 
1 449 THR n 
1 450 GLU n 
1 451 LYS n 
1 452 ILE n 
1 453 MET n 
1 454 ALA n 
1 455 THR n 
1 456 PRO n 
1 457 GLU n 
1 458 GLN n 
1 459 VAL n 
1 460 GLY n 
1 461 LYS n 
1 462 MET n 
1 463 LYS n 
1 464 ALA n 
1 465 ILE n 
1 466 VAL n 
1 467 GLU n 
1 468 LYS n 
1 469 LEU n 
1 470 ARG n 
1 471 PHE n 
1 472 THR n 
1 473 TYR n 
1 474 ARG n 
1 475 SER n 
1 476 ASP n 
1 477 SER n 
1 478 PHE n 
1 479 GLU n 
1 480 ASN n 
1 481 PRO n 
1 482 VAL n 
1 483 LEU n 
1 484 GLN n 
1 485 GLN n 
1 486 HIS n 
1 487 PHE n 
1 488 ARG n 
1 489 ASN n 
1 490 LEU n 
1 491 GLU n 
1 492 ALA n 
1 493 LEU n 
1 494 ALA n 
1 495 LEU n 
1 496 ASP n 
1 497 LEU n 
1 498 MET n 
1 499 GLU n 
1 500 PRO n 
1 501 GLU n 
1 502 GLN n 
1 503 ALA n 
1 504 VAL n 
1 505 ASP n 
1 506 LEU n 
1 507 THR n 
1 508 LEU n 
1 509 PRO n 
1 510 LYS n 
1 511 VAL n 
1 512 GLU n 
1 513 ALA n 
1 514 MET n 
1 515 ASN n 
1 516 LYS n 
1 517 ARG n 
1 518 LEU n 
1 519 GLY n 
1 520 SER n 
1 521 LEU n 
1 522 VAL n 
1 523 ASP n 
1 524 GLU n 
1 525 PHE n 
1 526 LYS n 
1 527 GLU n 
1 528 LEU n 
1 529 VAL n 
1 530 TYR n 
1 531 PRO n 
1 532 PRO n 
1 533 ASP n 
1 534 TYR n 
1 535 ASN n 
1 536 PRO n 
1 537 GLU n 
1 538 GLY n 
1 539 LYS n 
1 540 VAL n 
1 541 THR n 
1 542 LYS n 
1 543 ARG n 
1 544 LYS n 
1 545 HIS n 
1 546 ASP n 
1 547 ASN n 
1 548 GLU n 
1 549 GLY n 
1 550 SER n 
1 551 GLY n 
1 552 SER n 
1 553 LYS n 
1 554 ARG n 
1 555 PRO n 
1 556 LYS n 
1 557 VAL n 
1 558 GLU n 
1 559 TYR n 
1 560 SER n 
1 561 GLU n 
1 562 GLU n 
1 563 GLU n 
1 564 LEU n 
1 565 LYS n 
1 566 THR n 
1 567 HIS n 
1 568 ILE n 
1 569 SER n 
1 570 LYS n 
1 571 GLY n 
1 572 THR n 
1 573 LEU n 
1 574 GLY n 
1 575 LYS n 
1 576 PHE n 
1 577 THR n 
1 578 VAL n 
1 579 PRO n 
1 580 MET n 
1 581 LEU n 
1 582 LYS n 
1 583 GLU n 
1 584 ALA n 
1 585 CYS n 
1 586 ARG n 
1 587 ALA n 
1 588 TYR n 
1 589 GLY n 
1 590 LEU n 
1 591 LYS n 
1 592 SER n 
1 593 GLY n 
1 594 LEU n 
1 595 LYS n 
1 596 LYS n 
1 597 GLN n 
1 598 GLU n 
1 599 LEU n 
1 600 LEU n 
1 601 GLU n 
1 602 ALA n 
1 603 LEU n 
1 604 THR n 
1 605 LYS n 
1 606 HIS n 
1 607 PHE n 
1 608 GLN n 
1 609 ASP n 
2 1   MET n 
2 2   VAL n 
2 3   ARG n 
2 4   SER n 
2 5   GLY n 
2 6   ASN n 
2 7   LYS n 
2 8   ALA n 
2 9   ALA n 
2 10  VAL n 
2 11  VAL n 
2 12  LEU n 
2 13  CYS n 
2 14  MET n 
2 15  ASP n 
2 16  VAL n 
2 17  GLY n 
2 18  PHE n 
2 19  THR n 
2 20  MET n 
2 21  SER n 
2 22  ASN n 
2 23  SER n 
2 24  ILE n 
2 25  PRO n 
2 26  GLY n 
2 27  ILE n 
2 28  GLU n 
2 29  SER n 
2 30  PRO n 
2 31  PHE n 
2 32  GLU n 
2 33  GLN n 
2 34  ALA n 
2 35  LYS n 
2 36  LYS n 
2 37  VAL n 
2 38  ILE n 
2 39  THR n 
2 40  MET n 
2 41  PHE n 
2 42  VAL n 
2 43  GLN n 
2 44  ARG n 
2 45  GLN n 
2 46  VAL n 
2 47  PHE n 
2 48  ALA n 
2 49  GLU n 
2 50  ASN n 
2 51  LYS n 
2 52  ASP n 
2 53  GLU n 
2 54  ILE n 
2 55  ALA n 
2 56  LEU n 
2 57  VAL n 
2 58  LEU n 
2 59  PHE n 
2 60  GLY n 
2 61  THR n 
2 62  ASP n 
2 63  GLY n 
2 64  THR n 
2 65  ASP n 
2 66  ASN n 
2 67  PRO n 
2 68  LEU n 
2 69  SER n 
2 70  GLY n 
2 71  GLY n 
2 72  ASP n 
2 73  GLN n 
2 74  TYR n 
2 75  GLN n 
2 76  ASN n 
2 77  ILE n 
2 78  THR n 
2 79  VAL n 
2 80  HIS n 
2 81  ARG n 
2 82  HIS n 
2 83  LEU n 
2 84  MET n 
2 85  LEU n 
2 86  PRO n 
2 87  ASP n 
2 88  PHE n 
2 89  ASP n 
2 90  LEU n 
2 91  LEU n 
2 92  GLU n 
2 93  ASP n 
2 94  ILE n 
2 95  GLU n 
2 96  SER n 
2 97  LYS n 
2 98  ILE n 
2 99  GLN n 
2 100 PRO n 
2 101 GLY n 
2 102 SER n 
2 103 GLN n 
2 104 GLN n 
2 105 ALA n 
2 106 ASP n 
2 107 PHE n 
2 108 LEU n 
2 109 ASP n 
2 110 ALA n 
2 111 LEU n 
2 112 ILE n 
2 113 VAL n 
2 114 SER n 
2 115 MET n 
2 116 ASP n 
2 117 VAL n 
2 118 ILE n 
2 119 GLN n 
2 120 HIS n 
2 121 GLU n 
2 122 THR n 
2 123 ILE n 
2 124 GLY n 
2 125 LYS n 
2 126 LYS n 
2 127 PHE n 
2 128 GLU n 
2 129 LYS n 
2 130 ARG n 
2 131 HIS n 
2 132 ILE n 
2 133 GLU n 
2 134 ILE n 
2 135 PHE n 
2 136 THR n 
2 137 ASP n 
2 138 LEU n 
2 139 SER n 
2 140 SER n 
2 141 ARG n 
2 142 PHE n 
2 143 SER n 
2 144 LYS n 
2 145 SER n 
2 146 GLN n 
2 147 LEU n 
2 148 ASP n 
2 149 ILE n 
2 150 ILE n 
2 151 ILE n 
2 152 HIS n 
2 153 SER n 
2 154 LEU n 
2 155 LYS n 
2 156 LYS n 
2 157 CYS n 
2 158 ASP n 
2 159 ILE n 
2 160 SER n 
2 161 LEU n 
2 162 GLN n 
2 163 PHE n 
2 164 PHE n 
2 165 LEU n 
2 166 PRO n 
2 167 PHE n 
2 168 SER n 
2 169 LEU n 
2 170 GLY n 
2 171 LYS n 
2 172 GLU n 
2 173 ASP n 
2 174 GLY n 
2 175 SER n 
2 176 GLY n 
2 177 ASP n 
2 178 ARG n 
2 179 GLY n 
2 180 ASP n 
2 181 GLY n 
2 182 PRO n 
2 183 PHE n 
2 184 ARG n 
2 185 LEU n 
2 186 GLY n 
2 187 GLY n 
2 188 HIS n 
2 189 GLY n 
2 190 PRO n 
2 191 SER n 
2 192 PHE n 
2 193 PRO n 
2 194 LEU n 
2 195 LYS n 
2 196 GLY n 
2 197 ILE n 
2 198 THR n 
2 199 GLU n 
2 200 GLN n 
2 201 GLN n 
2 202 LYS n 
2 203 GLU n 
2 204 GLY n 
2 205 LEU n 
2 206 GLU n 
2 207 ILE n 
2 208 VAL n 
2 209 LYS n 
2 210 MET n 
2 211 VAL n 
2 212 MET n 
2 213 ILE n 
2 214 SER n 
2 215 LEU n 
2 216 GLU n 
2 217 GLY n 
2 218 GLU n 
2 219 ASP n 
2 220 GLY n 
2 221 LEU n 
2 222 ASP n 
2 223 GLU n 
2 224 ILE n 
2 225 TYR n 
2 226 SER n 
2 227 PHE n 
2 228 SER n 
2 229 GLU n 
2 230 SER n 
2 231 LEU n 
2 232 ARG n 
2 233 LYS n 
2 234 LEU n 
2 235 CYS n 
2 236 VAL n 
2 237 PHE n 
2 238 LYS n 
2 239 LYS n 
2 240 ILE n 
2 241 GLU n 
2 242 ARG n 
2 243 HIS n 
2 244 SER n 
2 245 ILE n 
2 246 HIS n 
2 247 TRP n 
2 248 PRO n 
2 249 CYS n 
2 250 ARG n 
2 251 LEU n 
2 252 THR n 
2 253 ILE n 
2 254 GLY n 
2 255 SER n 
2 256 ASN n 
2 257 LEU n 
2 258 SER n 
2 259 ILE n 
2 260 ARG n 
2 261 ILE n 
2 262 ALA n 
2 263 ALA n 
2 264 TYR n 
2 265 LYS n 
2 266 SER n 
2 267 ILE n 
2 268 LEU n 
2 269 GLN n 
2 270 GLU n 
2 271 ARG n 
2 272 VAL n 
2 273 LYS n 
2 274 LYS n 
2 275 THR n 
2 276 TRP n 
2 277 THR n 
2 278 VAL n 
2 279 VAL n 
2 280 ASP n 
2 281 ALA n 
2 282 LYS n 
2 283 THR n 
2 284 LEU n 
2 285 LYS n 
2 286 LYS n 
2 287 GLU n 
2 288 ASP n 
2 289 ILE n 
2 290 GLN n 
2 291 LYS n 
2 292 GLU n 
2 293 THR n 
2 294 VAL n 
2 295 TYR n 
2 296 CYS n 
2 297 LEU n 
2 298 ASN n 
2 299 ASP n 
2 300 ASP n 
2 301 ASP n 
2 302 GLU n 
2 303 THR n 
2 304 GLU n 
2 305 VAL n 
2 306 LEU n 
2 307 LYS n 
2 308 GLU n 
2 309 ASP n 
2 310 ILE n 
2 311 ILE n 
2 312 GLN n 
2 313 GLY n 
2 314 PHE n 
2 315 ARG n 
2 316 TYR n 
2 317 GLY n 
2 318 SER n 
2 319 ASP n 
2 320 ILE n 
2 321 VAL n 
2 322 PRO n 
2 323 PHE n 
2 324 SER n 
2 325 LYS n 
2 326 VAL n 
2 327 ASP n 
2 328 GLU n 
2 329 GLU n 
2 330 GLN n 
2 331 MET n 
2 332 LYS n 
2 333 TYR n 
2 334 LYS n 
2 335 SER n 
2 336 GLU n 
2 337 GLY n 
2 338 LYS n 
2 339 CYS n 
2 340 PHE n 
2 341 SER n 
2 342 VAL n 
2 343 LEU n 
2 344 GLY n 
2 345 PHE n 
2 346 CYS n 
2 347 LYS n 
2 348 SER n 
2 349 SER n 
2 350 GLN n 
2 351 VAL n 
2 352 GLN n 
2 353 ARG n 
2 354 ARG n 
2 355 PHE n 
2 356 PHE n 
2 357 MET n 
2 358 GLY n 
2 359 ASN n 
2 360 GLN n 
2 361 VAL n 
2 362 LEU n 
2 363 LYS n 
2 364 VAL n 
2 365 PHE n 
2 366 ALA n 
2 367 ALA n 
2 368 ARG n 
2 369 ASP n 
2 370 ASP n 
2 371 GLU n 
2 372 ALA n 
2 373 ALA n 
2 374 ALA n 
2 375 VAL n 
2 376 ALA n 
2 377 LEU n 
2 378 SER n 
2 379 SER n 
2 380 LEU n 
2 381 ILE n 
2 382 HIS n 
2 383 ALA n 
2 384 LEU n 
2 385 ASP n 
2 386 ASP n 
2 387 LEU n 
2 388 ASP n 
2 389 MET n 
2 390 VAL n 
2 391 ALA n 
2 392 ILE n 
2 393 VAL n 
2 394 ARG n 
2 395 TYR n 
2 396 ALA n 
2 397 TYR n 
2 398 ASP n 
2 399 LYS n 
2 400 ARG n 
2 401 ALA n 
2 402 ASN n 
2 403 PRO n 
2 404 GLN n 
2 405 VAL n 
2 406 GLY n 
2 407 VAL n 
2 408 ALA n 
2 409 PHE n 
2 410 PRO n 
2 411 HIS n 
2 412 ILE n 
2 413 LYS n 
2 414 HIS n 
2 415 ASN n 
2 416 TYR n 
2 417 GLU n 
2 418 CYS n 
2 419 LEU n 
2 420 VAL n 
2 421 TYR n 
2 422 VAL n 
2 423 GLN n 
2 424 LEU n 
2 425 PRO n 
2 426 PHE n 
2 427 MET n 
2 428 GLU n 
2 429 ASP n 
2 430 LEU n 
2 431 ARG n 
2 432 GLN n 
2 433 TYR n 
2 434 MET n 
2 435 PHE n 
2 436 SER n 
2 437 SER n 
2 438 LEU n 
2 439 LYS n 
2 440 ASN n 
2 441 SER n 
2 442 LYS n 
2 443 LYS n 
2 444 TYR n 
2 445 ALA n 
2 446 PRO n 
2 447 THR n 
2 448 GLU n 
2 449 ALA n 
2 450 GLN n 
2 451 LEU n 
2 452 ASN n 
2 453 ALA n 
2 454 VAL n 
2 455 ASP n 
2 456 ALA n 
2 457 LEU n 
2 458 ILE n 
2 459 ASP n 
2 460 SER n 
2 461 MET n 
2 462 SER n 
2 463 LEU n 
2 464 ALA n 
2 465 LYS n 
2 466 LYS n 
2 467 ASP n 
2 468 GLU n 
2 469 LYS n 
2 470 THR n 
2 471 ASP n 
2 472 THR n 
2 473 LEU n 
2 474 GLU n 
2 475 ASP n 
2 476 LEU n 
2 477 PHE n 
2 478 PRO n 
2 479 THR n 
2 480 THR n 
2 481 LYS n 
2 482 ILE n 
2 483 PRO n 
2 484 ASN n 
2 485 PRO n 
2 486 ARG n 
2 487 PHE n 
2 488 GLN n 
2 489 ARG n 
2 490 LEU n 
2 491 PHE n 
2 492 GLN n 
2 493 CYS n 
2 494 LEU n 
2 495 LEU n 
2 496 HIS n 
2 497 ARG n 
2 498 ALA n 
2 499 LEU n 
2 500 HIS n 
2 501 PRO n 
2 502 ARG n 
2 503 GLU n 
2 504 PRO n 
2 505 LEU n 
2 506 PRO n 
2 507 PRO n 
2 508 ILE n 
2 509 GLN n 
2 510 GLN n 
2 511 HIS n 
2 512 ILE n 
2 513 TRP n 
2 514 ASN n 
2 515 MET n 
2 516 LEU n 
2 517 ASN n 
2 518 PRO n 
2 519 PRO n 
2 520 ALA n 
2 521 GLU n 
2 522 VAL n 
2 523 THR n 
2 524 THR n 
2 525 LYS n 
2 526 SER n 
2 527 GLN n 
2 528 ILE n 
2 529 PRO n 
2 530 LEU n 
2 531 SER n 
2 532 LYS n 
2 533 ILE n 
2 534 LYS n 
2 535 THR n 
2 536 LEU n 
2 537 PHE n 
2 538 PRO n 
2 539 LEU n 
2 540 ILE n 
2 541 GLU n 
2 542 ALA n 
2 543 LYS n 
2 544 LYS n 
2 545 LYS n 
2 546 ASP n 
2 547 GLN n 
2 548 VAL n 
2 549 THR n 
2 550 ALA n 
2 551 GLN n 
2 552 GLU n 
2 553 ILE n 
2 554 PHE n 
2 555 GLN n 
2 556 ASP n 
2 557 ASN n 
2 558 HIS n 
2 559 GLU n 
2 560 ASP n 
2 561 GLY n 
2 562 PRO n 
2 563 THR n 
2 564 ALA n 
2 565 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo G22P1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 
Spodoptera ? ? ? ? ? SF9 ? ? ? ? ? ? ? 'BAC-TO-BAC Baculovirus expression system' ? ? ? 'pFASTBAC HT' ? ? 
2 1 sample ? ? ? human Homo XRCC5 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 
Spodoptera ? ? ? ? ? SF9 ? ? ? ? ? ? ? 'BAC-TO-BAC Baculovirus expression system' ? ? ? 'pFASTBAC HT' ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP KU70_HUMAN 1 
;MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDR
DLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFK
MSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLE
DLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQ
IYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRY
TPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFEN
PVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYS
EEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD
;
1 P12956 ? 
2 UNP KU86_HUMAN 2 
;MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVH
RHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDIS
LQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKI
ERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDI
VPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKR
ANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTT
KIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHED
GPTAK
;
1 P13010 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JEQ A 1 ? 609 ? P12956 0 ? 608 ? 1 609 
2 2 1JEQ B 1 ? 565 ? P13010 0 ? 564 ? 1 565 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1JEQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.62 
_exptl_crystal.density_percent_sol   53.02 
_exptl_crystal.description           ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
;14% PEG 4000, 900 mM sarcosine, 140 mM magnesium chloride, 100 mM Tris-HCl (pH 8.5), VAPOR DIFFUSION, HANGING DROP, temperature 295K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'BRANDEIS - B4' 
_diffrn_detector.pdbx_collection_date   2000-10-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9633 1.0 
2 0.9786 1.0 
3 0.9791 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.9633, 0.9786, 0.9791' 
# 
_reflns.entry_id                     1JEQ 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   -3.0 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   36700 
_reflns.number_all                   36700 
_reflns.percent_possible_obs         92.9 
_reflns.pdbx_Rmerge_I_obs            0.0900000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.2 
_reflns.B_iso_Wilson_estimate        27.4 
_reflns.pdbx_redundancy              5.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.7 
_reflns_shell.d_res_low              2.8 
_reflns_shell.percent_possible_all   69.8 
_reflns_shell.Rmerge_I_obs           0.4100000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        2.82 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1JEQ 
_refine.ls_number_reflns_obs                     31853 
_refine.ls_number_reflns_all                     39422 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1952449.00 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             19.89 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    80.8 
_refine.ls_R_factor_obs                          0.2250000 
_refine.ls_R_factor_all                          0.2250000 
_refine.ls_R_factor_R_work                       0.2220000 
_refine.ls_R_factor_R_free                       0.2830000 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1588 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               46.9 
_refine.aniso_B[1][1]                            0.95 
_refine.aniso_B[2][2]                            -5.54 
_refine.aniso_B[3][3]                            4.58 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.316 
_refine.solvent_model_param_bsol                 21.84 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1JEQ 
_refine_analyze.Luzzati_coordinate_error_obs    0.38 
_refine_analyze.Luzzati_sigma_a_obs             0.49 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.49 
_refine_analyze.Luzzati_sigma_a_free            0.58 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8591 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             42 
_refine_hist.number_atoms_total               8633 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        19.89 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.89  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.56  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.78  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.15  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.39  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.70 
_refine_ls_shell.d_res_low                        2.87 
_refine_ls_shell.number_reflns_R_work             2555 
_refine_ls_shell.R_factor_R_work                  0.3560000 
_refine_ls_shell.percent_reflns_obs               41.7 
_refine_ls_shell.R_factor_R_free                  0.4460000 
_refine_ls_shell.R_factor_R_free_error            0.037 
_refine_ls_shell.percent_reflns_R_free            5.4 
_refine_ls_shell.number_reflns_R_free             145 
_refine_ls_shell.number_reflns_obs                2700 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1JEQ 
_struct.title                     'Crystal Structure of the Ku Heterodimer' 
_struct.pdbx_descriptor           'ATP-DEPENDENT DNA HELICASE II, 70 KDA SUBUNIT, ATP-DEPENDENT DNA HELICASE II, 80 KDA SUBUNIT' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JEQ 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            
;double-strand DNA break repair, non-homologous end-joining, alpha/beta domain, beta barrel, helical C-terminal arm, sap domain, DNA BINDING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 46  ? GLU A 50  ? LYS A 46  GLU A 50  5 ? 5  
HELX_P HELX_P2  2  THR A 58  ? SER A 77  ? THR A 58  SER A 77  1 ? 20 
HELX_P HELX_P3  3  GLY A 112 ? GLN A 121 ? GLY A 112 GLN A 121 1 ? 10 
HELX_P HELX_P4  4  LYS A 123 ? MET A 135 ? LYS A 123 MET A 135 1 ? 13 
HELX_P HELX_P5  5  SER A 142 ? ASP A 156 ? SER A 142 ASP A 156 1 ? 15 
HELX_P HELX_P6  6  ALA A 181 ? GLY A 197 ? ALA A 181 GLY A 197 1 ? 17 
HELX_P HELX_P7  7  ASP A 212 ? PHE A 216 ? ASP A 212 PHE A 216 5 ? 5  
HELX_P HELX_P8  8  PHE A 216 ? ILE A 220 ? PHE A 216 ILE A 220 5 ? 5  
HELX_P HELX_P9  9  LYS A 238 ? THR A 251 ? LYS A 238 THR A 251 1 ? 14 
HELX_P HELX_P10 10 LEU A 312 ? SER A 314 ? LEU A 312 SER A 314 5 ? 3  
HELX_P HELX_P11 11 GLU A 330 ? LEU A 337 ? GLU A 330 LEU A 337 1 ? 8  
HELX_P HELX_P12 12 VAL A 354 ? LEU A 356 ? VAL A 354 LEU A 356 5 ? 3  
HELX_P HELX_P13 13 GLY A 377 ? GLU A 393 ? GLY A 377 GLU A 393 1 ? 17 
HELX_P HELX_P14 14 PHE A 439 ? ASP A 442 ? PHE A 439 ASP A 442 5 ? 4  
HELX_P HELX_P15 15 THR A 455 ? LEU A 469 ? THR A 455 LEU A 469 1 ? 15 
HELX_P HELX_P16 16 ASN A 480 ? LEU A 495 ? ASN A 480 LEU A 495 1 ? 16 
HELX_P HELX_P17 17 LYS A 510 ? GLY A 519 ? LYS A 510 GLY A 519 1 ? 10 
HELX_P HELX_P18 18 SER A 520 ? TYR A 530 ? SER A 520 TYR A 530 1 ? 11 
HELX_P HELX_P19 19 SER A 560 ? LYS A 570 ? SER A 560 LYS A 570 1 ? 11 
HELX_P HELX_P20 20 THR A 572 ? PHE A 576 ? THR A 572 PHE A 576 5 ? 5  
HELX_P HELX_P21 21 THR A 577 ? TYR A 588 ? THR A 577 TYR A 588 1 ? 12 
HELX_P HELX_P22 22 LYS A 595 ? GLN A 608 ? LYS A 595 GLN A 608 1 ? 14 
HELX_P HELX_P23 23 GLY B 17  ? ASN B 22  ? GLY B 17  ASN B 22  5 ? 6  
HELX_P HELX_P24 24 SER B 29  ? ALA B 48  ? SER B 29  ALA B 48  1 ? 20 
HELX_P HELX_P25 25 ASP B 87  ? SER B 96  ? ASP B 87  SER B 96  1 ? 10 
HELX_P HELX_P26 26 ASP B 106 ? ILE B 123 ? ASP B 106 ILE B 123 1 ? 18 
HELX_P HELX_P27 27 SER B 143 ? SER B 145 ? SER B 143 SER B 145 5 ? 3  
HELX_P HELX_P28 28 GLN B 146 ? ASP B 158 ? GLN B 146 ASP B 158 1 ? 13 
HELX_P HELX_P29 29 THR B 198 ? GLY B 217 ? THR B 198 GLY B 217 1 ? 20 
HELX_P HELX_P30 30 GLU B 218 ? ASP B 222 ? GLU B 218 ASP B 222 5 ? 5  
HELX_P HELX_P31 31 PHE B 227 ? ARG B 232 ? PHE B 227 ARG B 232 1 ? 6  
HELX_P HELX_P32 32 PHE B 237 ? GLU B 241 ? PHE B 237 GLU B 241 5 ? 5  
HELX_P HELX_P33 33 LEU B 306 ? GLU B 308 ? LEU B 306 GLU B 308 5 ? 3  
HELX_P HELX_P34 34 GLU B 328 ? LYS B 332 ? GLU B 328 LYS B 332 5 ? 5  
HELX_P HELX_P35 35 SER B 349 ? VAL B 351 ? SER B 349 VAL B 351 5 ? 3  
HELX_P HELX_P36 36 GLN B 352 ? PHE B 356 ? GLN B 352 PHE B 356 5 ? 5  
HELX_P HELX_P37 37 ASP B 370 ? ASP B 388 ? ASP B 370 ASP B 388 1 ? 19 
HELX_P HELX_P38 38 PHE B 426 ? ASP B 429 ? PHE B 426 ASP B 429 5 ? 4  
HELX_P HELX_P39 39 THR B 447 ? MET B 461 ? THR B 447 MET B 461 1 ? 15 
HELX_P HELX_P40 40 PRO B 478 ? ILE B 482 ? PRO B 478 ILE B 482 5 ? 5  
HELX_P HELX_P41 41 ASN B 484 ? HIS B 500 ? ASN B 484 HIS B 500 1 ? 17 
HELX_P HELX_P42 42 GLN B 509 ? ASN B 517 ? GLN B 509 ASN B 517 1 ? 9  
HELX_P HELX_P43 43 PRO B 519 ? PHE B 537 ? PRO B 519 PHE B 537 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 7 ? 
C ? 2 ? 
D ? 2 ? 
E ? 3 ? 
F ? 2 ? 
G ? 2 ? 
H ? 6 ? 
I ? 8 ? 
J ? 2 ? 
K ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
I 5 6 ? anti-parallel 
I 6 7 ? anti-parallel 
I 7 8 ? parallel      
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 102 ? ASP A 109 ? ILE A 102 ASP A 109 
A 2 LEU A 82  ? TYR A 88  ? LEU A 82  TYR A 88  
A 3 ASP A 36  ? ASP A 43  ? ASP A 36  ASP A 43  
A 4 HIS A 163 ? THR A 170 ? HIS A 163 THR A 170 
A 5 ILE A 198 ? HIS A 204 ? ILE A 198 HIS A 204 
B 1 SER A 257 ? LYS A 262 ? SER A 257 LYS A 262 
B 2 VAL A 268 ? TYR A 274 ? VAL A 268 TYR A 274 
B 3 LEU A 366 ? PRO A 370 ? LEU A 366 PRO A 370 
B 4 GLY A 431 ? PHE A 436 ? GLY A 431 PHE A 436 
B 5 TYR A 409 ? GLN A 416 ? TYR A 409 GLN A 416 
B 6 VAL A 394 ? THR A 401 ? VAL A 394 THR A 401 
B 7 GLY A 344 ? PRO A 352 ? GLY A 344 PRO A 352 
C 1 LEU A 288 ? TYR A 289 ? LEU A 288 TYR A 289 
C 2 ILE B 310 ? ILE B 311 ? ILE B 310 ILE B 311 
D 1 VAL A 296 ? ASN A 304 ? VAL A 296 ASN A 304 
D 2 ILE B 289 ? LEU B 297 ? ILE B 289 LEU B 297 
E 1 GLN A 326 ? LEU A 329 ? GLN A 326 LEU A 329 
E 2 THR A 316 ? ILE A 321 ? THR A 316 ILE A 321 
E 3 THR B 277 ? ASP B 280 ? THR B 277 ASP B 280 
F 1 VAL A 375 ? ILE A 376 ? VAL A 375 ILE A 376 
F 2 ILE B 540 ? GLU B 541 ? ILE B 540 GLU B 541 
G 1 GLU A 419 ? LEU A 420 ? GLU A 419 LEU A 420 
G 2 GLN A 426 ? THR A 428 ? GLN A 426 THR A 428 
H 1 ILE B 77  ? ARG B 81  ? ILE B 77  ARG B 81  
H 2 GLU B 53  ? PHE B 59  ? GLU B 53  PHE B 59  
H 3 ALA B 8   ? ASP B 15  ? ALA B 8   ASP B 15  
H 4 LYS B 129 ? PHE B 135 ? LYS B 129 PHE B 135 
H 5 ILE B 159 ? LEU B 165 ? ILE B 159 LEU B 165 
H 6 ILE B 224 ? SER B 226 ? ILE B 224 SER B 226 
I 1 TRP B 247 ? ILE B 253 ? TRP B 247 ILE B 253 
I 2 LEU B 257 ? LEU B 268 ? LEU B 257 LEU B 268 
I 3 MET B 357 ? ALA B 366 ? MET B 357 ALA B 366 
I 4 GLU B 417 ? GLN B 423 ? GLU B 417 GLN B 423 
I 5 GLN B 404 ? ILE B 412 ? GLN B 404 ILE B 412 
I 6 MET B 389 ? ALA B 396 ? MET B 389 ALA B 396 
I 7 CYS B 339 ? LYS B 347 ? CYS B 339 LYS B 347 
I 8 TRP B 247 ? ILE B 253 ? TRP B 247 ILE B 253 
J 1 PHE B 314 ? TYR B 316 ? PHE B 314 TYR B 316 
J 2 ASP B 319 ? VAL B 321 ? ASP B 319 VAL B 321 
K 1 ALA B 464 ? ASP B 467 ? ALA B 464 ASP B 467 
K 2 THR B 472 ? ASP B 475 ? THR B 472 ASP B 475 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ASP A 109 ? O ASP A 109 N LEU A 83  ? N LEU A 83  
A 2 3 N LEU A 82  ? N LEU A 82  O ASP A 36  ? O ASP A 36  
A 3 4 N SER A 37  ? N SER A 37  O HIS A 163 ? O HIS A 163 
A 4 5 N ILE A 166 ? N ILE A 166 O PHE A 199 ? O PHE A 199 
B 1 2 N LEU A 261 ? N LEU A 261 O ILE A 269 ? O ILE A 269 
B 2 3 O TYR A 274 ? O TYR A 274 N PHE A 367 ? N PHE A 367 
B 3 4 N VAL A 368 ? N VAL A 368 O PHE A 432 ? O PHE A 432 
B 4 5 O VAL A 435 ? O VAL A 435 N ALA A 412 ? N ALA A 412 
B 5 6 N LEU A 413 ? N LEU A 413 O ALA A 396 ? O ALA A 396 
B 6 7 O THR A 401 ? O THR A 401 N GLY A 344 ? N GLY A 344 
C 1 2 N LEU A 288 ? N LEU A 288 O ILE B 311 ? O ILE B 311 
D 1 2 O PHE A 303 ? O PHE A 303 N GLN B 290 ? N GLN B 290 
E 1 2 O LEU A 329 ? O LEU A 329 N ARG A 318 ? N ARG A 318 
E 2 3 O SER A 319 ? O SER A 319 N THR B 277 ? N THR B 277 
F 1 2 N ILE A 376 ? N ILE A 376 O ILE B 540 ? O ILE B 540 
G 1 2 O GLU A 419 ? O GLU A 419 N VAL A 427 ? N VAL A 427 
H 1 2 O ARG B 81  ? O ARG B 81  N LEU B 56  ? N LEU B 56  
H 2 3 N GLU B 53  ? N GLU B 53  O ALA B 8   ? O ALA B 8   
H 3 4 N ALA B 9   ? N ALA B 9   O LYS B 129 ? O LYS B 129 
H 4 5 O ARG B 130 ? O ARG B 130 N SER B 160 ? N SER B 160 
H 5 6 O PHE B 163 ? O PHE B 163 N TYR B 225 ? N TYR B 225 
I 1 2 N ILE B 253 ? N ILE B 253 O LEU B 257 ? O LEU B 257 
I 2 3 N SER B 266 ? N SER B 266 O VAL B 361 ? O VAL B 361 
I 3 4 N VAL B 364 ? N VAL B 364 O LEU B 419 ? O LEU B 419 
I 4 5 O VAL B 422 ? O VAL B 422 N VAL B 407 ? N VAL B 407 
I 5 6 O ALA B 408 ? O ALA B 408 N ALA B 391 ? N ALA B 391 
I 6 7 O ALA B 396 ? O ALA B 396 N CYS B 339 ? N CYS B 339 
I 7 8 N VAL B 342 ? N VAL B 342 O THR B 252 ? O THR B 252 
J 1 2 N TYR B 316 ? N TYR B 316 O ASP B 319 ? O ASP B 319 
K 1 2 O ASP B 467 ? O ASP B 467 N THR B 472 ? N THR B 472 
# 
_database_PDB_matrix.entry_id          1JEQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JEQ 
_atom_sites.fract_transf_matrix[1][1]   0.012467 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011603 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004919 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 35  ? 24.234  25.615  121.094 1.00 56.62  ? 35  ARG A N   1 
ATOM   2    C CA  . ARG A 1 35  ? 25.579  25.320  121.668 1.00 56.88  ? 35  ARG A CA  1 
ATOM   3    C C   . ARG A 1 35  ? 25.715  25.721  123.127 1.00 54.99  ? 35  ARG A C   1 
ATOM   4    O O   . ARG A 1 35  ? 25.402  26.845  123.502 1.00 55.37  ? 35  ARG A O   1 
ATOM   5    C CB  . ARG A 1 35  ? 26.665  26.033  120.866 1.00 58.79  ? 35  ARG A CB  1 
ATOM   6    C CG  . ARG A 1 35  ? 27.186  25.224  119.711 1.00 63.92  ? 35  ARG A CG  1 
ATOM   7    C CD  . ARG A 1 35  ? 28.389  25.879  119.058 1.00 66.86  ? 35  ARG A CD  1 
ATOM   8    N NE  . ARG A 1 35  ? 29.092  24.920  118.214 1.00 70.81  ? 35  ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 35  ? 30.060  25.234  117.360 1.00 72.89  ? 35  ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 35  ? 30.450  26.497  117.225 1.00 73.14  ? 35  ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 35  ? 30.640  24.281  116.638 1.00 74.06  ? 35  ARG A NH2 1 
ATOM   12   N N   . ASP A 1 36  ? 26.202  24.795  123.942 1.00 52.70  ? 36  ASP A N   1 
ATOM   13   C CA  . ASP A 1 36  ? 26.404  25.045  125.363 1.00 49.57  ? 36  ASP A CA  1 
ATOM   14   C C   . ASP A 1 36  ? 27.863  25.425  125.611 1.00 46.55  ? 36  ASP A C   1 
ATOM   15   O O   . ASP A 1 36  ? 28.779  24.871  124.990 1.00 44.91  ? 36  ASP A O   1 
ATOM   16   C CB  . ASP A 1 36  ? 26.060  23.788  126.165 1.00 52.83  ? 36  ASP A CB  1 
ATOM   17   C CG  . ASP A 1 36  ? 24.595  23.397  126.041 1.00 56.04  ? 36  ASP A CG  1 
ATOM   18   O OD1 . ASP A 1 36  ? 23.964  23.735  125.010 1.00 58.38  ? 36  ASP A OD1 1 
ATOM   19   O OD2 . ASP A 1 36  ? 24.080  22.738  126.973 1.00 56.95  ? 36  ASP A OD2 1 
ATOM   20   N N   . SER A 1 37  ? 28.078  26.380  126.510 1.00 43.06  ? 37  SER A N   1 
ATOM   21   C CA  . SER A 1 37  ? 29.432  26.811  126.847 1.00 39.32  ? 37  SER A CA  1 
ATOM   22   C C   . SER A 1 37  ? 29.759  26.426  128.273 1.00 36.21  ? 37  SER A C   1 
ATOM   23   O O   . SER A 1 37  ? 28.897  26.470  129.144 1.00 35.51  ? 37  SER A O   1 
ATOM   24   C CB  . SER A 1 37  ? 29.581  28.316  126.683 1.00 39.51  ? 37  SER A CB  1 
ATOM   25   O OG  . SER A 1 37  ? 29.709  28.638  125.317 1.00 42.62  ? 37  SER A OG  1 
ATOM   26   N N   . LEU A 1 38  ? 31.011  26.054  128.506 1.00 33.23  ? 38  LEU A N   1 
ATOM   27   C CA  . LEU A 1 38  ? 31.448  25.641  129.828 1.00 32.00  ? 38  LEU A CA  1 
ATOM   28   C C   . LEU A 1 38  ? 32.872  26.092  130.132 1.00 31.58  ? 38  LEU A C   1 
ATOM   29   O O   . LEU A 1 38  ? 33.823  25.670  129.468 1.00 30.54  ? 38  LEU A O   1 
ATOM   30   C CB  . LEU A 1 38  ? 31.359  24.114  129.942 1.00 32.64  ? 38  LEU A CB  1 
ATOM   31   C CG  . LEU A 1 38  ? 31.707  23.445  131.274 1.00 31.98  ? 38  LEU A CG  1 
ATOM   32   C CD1 . LEU A 1 38  ? 30.764  23.955  132.353 1.00 32.74  ? 38  LEU A CD1 1 
ATOM   33   C CD2 . LEU A 1 38  ? 31.588  21.930  131.142 1.00 31.38  ? 38  LEU A CD2 1 
ATOM   34   N N   . ILE A 1 39  ? 33.020  26.954  131.135 1.00 30.26  ? 39  ILE A N   1 
ATOM   35   C CA  . ILE A 1 39  ? 34.346  27.425  131.522 1.00 28.89  ? 39  ILE A CA  1 
ATOM   36   C C   . ILE A 1 39  ? 34.835  26.589  132.707 1.00 28.59  ? 39  ILE A C   1 
ATOM   37   O O   . ILE A 1 39  ? 34.089  26.356  133.661 1.00 27.30  ? 39  ILE A O   1 
ATOM   38   C CB  . ILE A 1 39  ? 34.320  28.936  131.913 1.00 28.50  ? 39  ILE A CB  1 
ATOM   39   C CG1 . ILE A 1 39  ? 34.015  29.789  130.678 1.00 28.06  ? 39  ILE A CG1 1 
ATOM   40   C CG2 . ILE A 1 39  ? 35.658  29.361  132.478 1.00 24.78  ? 39  ILE A CG2 1 
ATOM   41   C CD1 . ILE A 1 39  ? 33.710  31.242  130.988 1.00 27.20  ? 39  ILE A CD1 1 
ATOM   42   N N   . PHE A 1 40  ? 36.070  26.105  132.634 1.00 27.49  ? 40  PHE A N   1 
ATOM   43   C CA  . PHE A 1 40  ? 36.620  25.328  133.741 1.00 27.43  ? 40  PHE A CA  1 
ATOM   44   C C   . PHE A 1 40  ? 37.566  26.226  134.503 1.00 26.51  ? 40  PHE A C   1 
ATOM   45   O O   . PHE A 1 40  ? 38.620  26.600  134.002 1.00 25.16  ? 40  PHE A O   1 
ATOM   46   C CB  . PHE A 1 40  ? 37.355  24.091  133.237 1.00 28.19  ? 40  PHE A CB  1 
ATOM   47   C CG  . PHE A 1 40  ? 36.446  23.046  132.696 1.00 28.70  ? 40  PHE A CG  1 
ATOM   48   C CD1 . PHE A 1 40  ? 36.407  22.773  131.337 1.00 30.47  ? 40  PHE A CD1 1 
ATOM   49   C CD2 . PHE A 1 40  ? 35.621  22.329  133.548 1.00 30.25  ? 40  PHE A CD2 1 
ATOM   50   C CE1 . PHE A 1 40  ? 35.555  21.790  130.835 1.00 32.44  ? 40  PHE A CE1 1 
ATOM   51   C CE2 . PHE A 1 40  ? 34.767  21.346  133.058 1.00 31.99  ? 40  PHE A CE2 1 
ATOM   52   C CZ  . PHE A 1 40  ? 34.733  21.075  131.702 1.00 31.02  ? 40  PHE A CZ  1 
ATOM   53   N N   . LEU A 1 41  ? 37.165  26.580  135.716 1.00 26.56  ? 41  LEU A N   1 
ATOM   54   C CA  . LEU A 1 41  ? 37.945  27.465  136.560 1.00 27.03  ? 41  LEU A CA  1 
ATOM   55   C C   . LEU A 1 41  ? 38.733  26.668  137.591 1.00 28.46  ? 41  LEU A C   1 
ATOM   56   O O   . LEU A 1 41  ? 38.146  25.988  138.425 1.00 28.52  ? 41  LEU A O   1 
ATOM   57   C CB  . LEU A 1 41  ? 36.994  28.433  137.250 1.00 26.26  ? 41  LEU A CB  1 
ATOM   58   C CG  . LEU A 1 41  ? 37.646  29.602  137.961 1.00 25.35  ? 41  LEU A CG  1 
ATOM   59   C CD1 . LEU A 1 41  ? 38.568  30.351  137.000 1.00 24.79  ? 41  LEU A CD1 1 
ATOM   60   C CD2 . LEU A 1 41  ? 36.560  30.493  138.487 1.00 21.55  ? 41  LEU A CD2 1 
ATOM   61   N N   . VAL A 1 42  ? 40.061  26.767  137.538 1.00 30.42  ? 42  VAL A N   1 
ATOM   62   C CA  . VAL A 1 42  ? 40.934  26.025  138.455 1.00 33.01  ? 42  VAL A CA  1 
ATOM   63   C C   . VAL A 1 42  ? 41.772  26.862  139.435 1.00 33.83  ? 42  VAL A C   1 
ATOM   64   O O   . VAL A 1 42  ? 42.590  27.700  139.021 1.00 31.47  ? 42  VAL A O   1 
ATOM   65   C CB  . VAL A 1 42  ? 41.905  25.102  137.663 1.00 33.79  ? 42  VAL A CB  1 
ATOM   66   C CG1 . VAL A 1 42  ? 42.875  24.423  138.611 1.00 32.29  ? 42  VAL A CG1 1 
ATOM   67   C CG2 . VAL A 1 42  ? 41.118  24.061  136.899 1.00 34.81  ? 42  VAL A CG2 1 
ATOM   68   N N   . ASP A 1 43  ? 41.573  26.594  140.729 1.00 34.67  ? 43  ASP A N   1 
ATOM   69   C CA  . ASP A 1 43  ? 42.282  27.283  141.805 1.00 36.63  ? 43  ASP A CA  1 
ATOM   70   C C   . ASP A 1 43  ? 43.747  26.849  141.826 1.00 37.39  ? 43  ASP A C   1 
ATOM   71   O O   . ASP A 1 43  ? 44.051  25.680  142.051 1.00 38.56  ? 43  ASP A O   1 
ATOM   72   C CB  . ASP A 1 43  ? 41.641  26.962  143.161 1.00 39.45  ? 43  ASP A CB  1 
ATOM   73   C CG  . ASP A 1 43  ? 42.205  27.820  144.302 1.00 43.20  ? 43  ASP A CG  1 
ATOM   74   O OD1 . ASP A 1 43  ? 43.384  28.229  144.208 1.00 43.75  ? 43  ASP A OD1 1 
ATOM   75   O OD2 . ASP A 1 43  ? 41.481  28.082  145.293 1.00 43.86  ? 43  ASP A OD2 1 
ATOM   76   N N   . ALA A 1 44  ? 44.654  27.792  141.597 1.00 37.25  ? 44  ALA A N   1 
ATOM   77   C CA  . ALA A 1 44  ? 46.072  27.484  141.584 1.00 37.10  ? 44  ALA A CA  1 
ATOM   78   C C   . ALA A 1 44  ? 46.772  27.940  142.874 1.00 38.92  ? 44  ALA A C   1 
ATOM   79   O O   . ALA A 1 44  ? 47.933  28.356  142.866 1.00 39.21  ? 44  ALA A O   1 
ATOM   80   C CB  . ALA A 1 44  ? 46.721  28.112  140.364 1.00 36.29  ? 44  ALA A CB  1 
ATOM   81   N N   . SER A 1 45  ? 46.057  27.864  143.989 1.00 40.68  ? 45  SER A N   1 
ATOM   82   C CA  . SER A 1 45  ? 46.632  28.224  145.279 1.00 41.46  ? 45  SER A CA  1 
ATOM   83   C C   . SER A 1 45  ? 47.625  27.124  145.653 1.00 43.12  ? 45  SER A C   1 
ATOM   84   O O   . SER A 1 45  ? 47.600  26.028  145.087 1.00 42.92  ? 45  SER A O   1 
ATOM   85   C CB  . SER A 1 45  ? 45.541  28.324  146.352 1.00 40.38  ? 45  SER A CB  1 
ATOM   86   O OG  . SER A 1 45  ? 44.730  29.470  146.158 1.00 36.61  ? 45  SER A OG  1 
ATOM   87   N N   . LYS A 1 46  ? 48.500  27.412  146.608 1.00 44.49  ? 46  LYS A N   1 
ATOM   88   C CA  . LYS A 1 46  ? 49.490  26.432  147.020 1.00 44.11  ? 46  LYS A CA  1 
ATOM   89   C C   . LYS A 1 46  ? 48.889  25.171  147.656 1.00 41.62  ? 46  LYS A C   1 
ATOM   90   O O   . LYS A 1 46  ? 49.496  24.107  147.594 1.00 40.58  ? 46  LYS A O   1 
ATOM   91   C CB  . LYS A 1 46  ? 50.494  27.076  147.974 1.00 47.33  ? 46  LYS A CB  1 
ATOM   92   C CG  . LYS A 1 46  ? 51.775  26.288  148.094 1.00 53.08  ? 46  LYS A CG  1 
ATOM   93   C CD  . LYS A 1 46  ? 52.773  26.986  148.998 1.00 58.25  ? 46  LYS A CD  1 
ATOM   94   C CE  . LYS A 1 46  ? 54.045  26.146  149.175 1.00 60.73  ? 46  LYS A CE  1 
ATOM   95   N NZ  . LYS A 1 46  ? 54.942  26.689  150.244 1.00 61.48  ? 46  LYS A NZ  1 
ATOM   96   N N   . ALA A 1 47  ? 47.706  25.274  148.258 1.00 38.89  ? 47  ALA A N   1 
ATOM   97   C CA  . ALA A 1 47  ? 47.082  24.101  148.874 1.00 36.91  ? 47  ALA A CA  1 
ATOM   98   C C   . ALA A 1 47  ? 46.750  23.066  147.801 1.00 37.60  ? 47  ALA A C   1 
ATOM   99   O O   . ALA A 1 47  ? 46.901  21.857  147.996 1.00 38.13  ? 47  ALA A O   1 
ATOM   100  C CB  . ALA A 1 47  ? 45.812  24.504  149.615 1.00 32.45  ? 47  ALA A CB  1 
ATOM   101  N N   . MET A 1 48  ? 46.302  23.564  146.655 1.00 38.35  ? 48  MET A N   1 
ATOM   102  C CA  . MET A 1 48  ? 45.914  22.726  145.529 1.00 37.27  ? 48  MET A CA  1 
ATOM   103  C C   . MET A 1 48  ? 47.049  21.845  145.012 1.00 38.17  ? 48  MET A C   1 
ATOM   104  O O   . MET A 1 48  ? 46.817  20.951  144.201 1.00 39.52  ? 48  MET A O   1 
ATOM   105  C CB  . MET A 1 48  ? 45.381  23.599  144.376 1.00 34.27  ? 48  MET A CB  1 
ATOM   106  C CG  . MET A 1 48  ? 44.116  24.379  144.678 1.00 29.05  ? 48  MET A CG  1 
ATOM   107  S SD  . MET A 1 48  ? 42.625  23.378  144.644 1.00 23.36  ? 48  MET A SD  1 
ATOM   108  C CE  . MET A 1 48  ? 42.429  23.173  142.921 1.00 23.93  ? 48  MET A CE  1 
ATOM   109  N N   . PHE A 1 49  ? 48.277  22.086  145.450 1.00 37.66  ? 49  PHE A N   1 
ATOM   110  C CA  . PHE A 1 49  ? 49.358  21.237  144.975 1.00 39.39  ? 49  PHE A CA  1 
ATOM   111  C C   . PHE A 1 49  ? 49.900  20.295  146.043 1.00 41.62  ? 49  PHE A C   1 
ATOM   112  O O   . PHE A 1 49  ? 50.907  19.619  145.836 1.00 40.68  ? 49  PHE A O   1 
ATOM   113  C CB  . PHE A 1 49  ? 50.488  22.080  144.405 1.00 38.08  ? 49  PHE A CB  1 
ATOM   114  C CG  . PHE A 1 49  ? 50.092  22.868  143.207 1.00 38.64  ? 49  PHE A CG  1 
ATOM   115  C CD1 . PHE A 1 49  ? 49.614  24.166  143.337 1.00 38.42  ? 49  PHE A CD1 1 
ATOM   116  C CD2 . PHE A 1 49  ? 50.174  22.306  141.942 1.00 39.61  ? 49  PHE A CD2 1 
ATOM   117  C CE1 . PHE A 1 49  ? 49.225  24.893  142.224 1.00 38.09  ? 49  PHE A CE1 1 
ATOM   118  C CE2 . PHE A 1 49  ? 49.789  23.016  140.818 1.00 39.68  ? 49  PHE A CE2 1 
ATOM   119  C CZ  . PHE A 1 49  ? 49.310  24.319  140.957 1.00 39.44  ? 49  PHE A CZ  1 
ATOM   120  N N   . GLU A 1 50  ? 49.218  20.248  147.181 1.00 44.94  ? 50  GLU A N   1 
ATOM   121  C CA  . GLU A 1 50  ? 49.629  19.392  148.279 1.00 49.47  ? 50  GLU A CA  1 
ATOM   122  C C   . GLU A 1 50  ? 48.680  18.216  148.355 1.00 52.71  ? 50  GLU A C   1 
ATOM   123  O O   . GLU A 1 50  ? 47.475  18.399  148.547 1.00 53.54  ? 50  GLU A O   1 
ATOM   124  C CB  . GLU A 1 50  ? 49.579  20.160  149.601 1.00 49.79  ? 50  GLU A CB  1 
ATOM   125  C CG  . GLU A 1 50  ? 50.294  21.487  149.562 1.00 51.67  ? 50  GLU A CG  1 
ATOM   126  C CD  . GLU A 1 50  ? 50.151  22.278  150.849 1.00 54.25  ? 50  GLU A CD  1 
ATOM   127  O OE1 . GLU A 1 50  ? 49.072  22.225  151.489 1.00 55.45  ? 50  GLU A OE1 1 
ATOM   128  O OE2 . GLU A 1 50  ? 51.118  22.977  151.209 1.00 55.31  ? 50  GLU A OE2 1 
ATOM   129  N N   . SER A 1 51  ? 49.222  17.015  148.195 1.00 56.30  ? 51  SER A N   1 
ATOM   130  C CA  . SER A 1 51  ? 48.416  15.804  148.265 1.00 61.45  ? 51  SER A CA  1 
ATOM   131  C C   . SER A 1 51  ? 48.038  15.549  149.724 1.00 64.90  ? 51  SER A C   1 
ATOM   132  O O   . SER A 1 51  ? 48.843  15.778  150.629 1.00 65.14  ? 51  SER A O   1 
ATOM   133  C CB  . SER A 1 51  ? 49.211  14.606  147.716 1.00 61.16  ? 51  SER A CB  1 
ATOM   134  O OG  . SER A 1 51  ? 48.424  13.422  147.652 1.00 61.19  ? 51  SER A OG  1 
ATOM   135  N N   . GLN A 1 52  ? 46.808  15.108  149.967 1.00 69.12  ? 52  GLN A N   1 
ATOM   136  C CA  . GLN A 1 52  ? 46.417  14.808  151.333 1.00 74.37  ? 52  GLN A CA  1 
ATOM   137  C C   . GLN A 1 52  ? 46.951  13.427  151.691 1.00 77.41  ? 52  GLN A C   1 
ATOM   138  O O   . GLN A 1 52  ? 46.268  12.418  151.511 1.00 77.73  ? 52  GLN A O   1 
ATOM   139  C CB  . GLN A 1 52  ? 44.899  14.857  151.509 1.00 74.50  ? 52  GLN A CB  1 
ATOM   140  C CG  . GLN A 1 52  ? 44.378  16.261  151.755 1.00 77.38  ? 52  GLN A CG  1 
ATOM   141  C CD  . GLN A 1 52  ? 44.306  17.082  150.483 1.00 78.85  ? 52  GLN A CD  1 
ATOM   142  O OE1 . GLN A 1 52  ? 43.535  16.761  149.579 1.00 80.42  ? 52  GLN A OE1 1 
ATOM   143  N NE2 . GLN A 1 52  ? 45.102  18.146  150.405 1.00 77.61  ? 52  GLN A NE2 1 
ATOM   144  N N   . SER A 1 53  ? 48.196  13.418  152.168 1.00 80.14  ? 53  SER A N   1 
ATOM   145  C CA  . SER A 1 53  ? 48.942  12.228  152.592 1.00 83.22  ? 53  SER A CA  1 
ATOM   146  C C   . SER A 1 53  ? 48.440  10.804  152.246 1.00 85.24  ? 53  SER A C   1 
ATOM   147  O O   . SER A 1 53  ? 48.496  9.897   153.087 1.00 87.05  ? 53  SER A O   1 
ATOM   148  C CB  . SER A 1 53  ? 49.202  12.334  154.104 1.00 83.12  ? 53  SER A CB  1 
ATOM   149  O OG  . SER A 1 53  ? 48.058  12.816  154.795 1.00 82.07  ? 53  SER A OG  1 
ATOM   150  N N   . GLU A 1 54  ? 47.978  10.594  151.016 1.00 85.35  ? 54  GLU A N   1 
ATOM   151  C CA  . GLU A 1 54  ? 47.510  9.272   150.599 1.00 85.46  ? 54  GLU A CA  1 
ATOM   152  C C   . GLU A 1 54  ? 48.150  8.997   149.255 1.00 84.83  ? 54  GLU A C   1 
ATOM   153  O O   . GLU A 1 54  ? 48.781  9.884   148.678 1.00 85.06  ? 54  GLU A O   1 
ATOM   154  C CB  . GLU A 1 54  ? 45.995  9.259   150.414 1.00 87.06  ? 54  GLU A CB  1 
ATOM   155  C CG  . GLU A 1 54  ? 45.213  9.892   151.540 1.00 89.83  ? 54  GLU A CG  1 
ATOM   156  C CD  . GLU A 1 54  ? 43.948  10.572  151.038 1.00 91.14  ? 54  GLU A CD  1 
ATOM   157  O OE1 . GLU A 1 54  ? 43.072  9.863   150.491 1.00 92.88  ? 54  GLU A OE1 1 
ATOM   158  O OE2 . GLU A 1 54  ? 43.833  11.812  151.180 1.00 89.59  ? 54  GLU A OE2 1 
ATOM   159  N N   . ASP A 1 55  ? 47.995  7.777   148.751 1.00 83.65  ? 55  ASP A N   1 
ATOM   160  C CA  . ASP A 1 55  ? 48.551  7.452   147.444 1.00 82.38  ? 55  ASP A CA  1 
ATOM   161  C C   . ASP A 1 55  ? 47.590  8.004   146.386 1.00 79.88  ? 55  ASP A C   1 
ATOM   162  O O   . ASP A 1 55  ? 47.454  7.465   145.279 1.00 79.13  ? 55  ASP A O   1 
ATOM   163  C CB  . ASP A 1 55  ? 48.757  5.937   147.294 1.00 84.28  ? 55  ASP A CB  1 
ATOM   164  C CG  . ASP A 1 55  ? 50.069  5.458   147.929 1.00 85.75  ? 55  ASP A CG  1 
ATOM   165  O OD1 . ASP A 1 55  ? 51.146  5.944   147.518 1.00 84.71  ? 55  ASP A OD1 1 
ATOM   166  O OD2 . ASP A 1 55  ? 50.026  4.598   148.838 1.00 87.05  ? 55  ASP A OD2 1 
ATOM   167  N N   . GLU A 1 56  ? 46.933  9.102   146.768 1.00 76.01  ? 56  GLU A N   1 
ATOM   168  C CA  . GLU A 1 56  ? 45.985  9.816   145.923 1.00 71.20  ? 56  GLU A CA  1 
ATOM   169  C C   . GLU A 1 56  ? 46.702  11.029  145.307 1.00 66.38  ? 56  GLU A C   1 
ATOM   170  O O   . GLU A 1 56  ? 47.775  11.435  145.772 1.00 65.52  ? 56  GLU A O   1 
ATOM   171  C CB  . GLU A 1 56  ? 44.774  10.269  146.758 1.00 72.97  ? 56  GLU A CB  1 
ATOM   172  C CG  . GLU A 1 56  ? 43.645  10.915  145.945 1.00 76.83  ? 56  GLU A CG  1 
ATOM   173  C CD  . GLU A 1 56  ? 43.066  9.991   144.863 1.00 79.06  ? 56  GLU A CD  1 
ATOM   174  O OE1 . GLU A 1 56  ? 42.565  8.899   145.220 1.00 79.43  ? 56  GLU A OE1 1 
ATOM   175  O OE2 . GLU A 1 56  ? 43.110  10.360  143.660 1.00 79.16  ? 56  GLU A OE2 1 
ATOM   176  N N   . LEU A 1 57  ? 46.106  11.595  144.259 1.00 60.03  ? 57  LEU A N   1 
ATOM   177  C CA  . LEU A 1 57  ? 46.678  12.742  143.559 1.00 53.41  ? 57  LEU A CA  1 
ATOM   178  C C   . LEU A 1 57  ? 46.370  14.065  144.247 1.00 50.43  ? 57  LEU A C   1 
ATOM   179  O O   . LEU A 1 57  ? 45.494  14.147  145.106 1.00 49.47  ? 57  LEU A O   1 
ATOM   180  C CB  . LEU A 1 57  ? 46.136  12.796  142.131 1.00 50.12  ? 57  LEU A CB  1 
ATOM   181  C CG  . LEU A 1 57  ? 46.330  11.574  141.242 1.00 46.62  ? 57  LEU A CG  1 
ATOM   182  C CD1 . LEU A 1 57  ? 45.580  11.778  139.942 1.00 44.22  ? 57  LEU A CD1 1 
ATOM   183  C CD2 . LEU A 1 57  ? 47.817  11.348  140.998 1.00 45.67  ? 57  LEU A CD2 1 
ATOM   184  N N   . THR A 1 58  ? 47.105  15.103  143.865 1.00 48.12  ? 58  THR A N   1 
ATOM   185  C CA  . THR A 1 58  ? 46.878  16.433  144.414 1.00 45.74  ? 58  THR A CA  1 
ATOM   186  C C   . THR A 1 58  ? 45.592  16.958  143.785 1.00 43.62  ? 58  THR A C   1 
ATOM   187  O O   . THR A 1 58  ? 45.262  16.609  142.650 1.00 43.39  ? 58  THR A O   1 
ATOM   188  C CB  . THR A 1 58  ? 48.040  17.397  144.070 1.00 46.20  ? 58  THR A CB  1 
ATOM   189  O OG1 . THR A 1 58  ? 48.342  17.315  142.670 1.00 47.10  ? 58  THR A OG1 1 
ATOM   190  C CG2 . THR A 1 58  ? 49.278  17.046  144.873 1.00 45.54  ? 58  THR A CG2 1 
ATOM   191  N N   . PRO A 1 59  ? 44.835  17.785  144.518 1.00 41.62  ? 59  PRO A N   1 
ATOM   192  C CA  . PRO A 1 59  ? 43.591  18.317  143.953 1.00 40.65  ? 59  PRO A CA  1 
ATOM   193  C C   . PRO A 1 59  ? 43.768  18.978  142.577 1.00 38.99  ? 59  PRO A C   1 
ATOM   194  O O   . PRO A 1 59  ? 42.878  18.918  141.731 1.00 37.96  ? 59  PRO A O   1 
ATOM   195  C CB  . PRO A 1 59  ? 43.097  19.281  145.039 1.00 40.24  ? 59  PRO A CB  1 
ATOM   196  C CG  . PRO A 1 59  ? 44.323  19.583  145.833 1.00 41.16  ? 59  PRO A CG  1 
ATOM   197  C CD  . PRO A 1 59  ? 45.033  18.270  145.887 1.00 40.14  ? 59  PRO A CD  1 
ATOM   198  N N   . PHE A 1 60  ? 44.918  19.600  142.353 1.00 37.51  ? 60  PHE A N   1 
ATOM   199  C CA  . PHE A 1 60  ? 45.196  20.221  141.066 1.00 37.56  ? 60  PHE A CA  1 
ATOM   200  C C   . PHE A 1 60  ? 45.206  19.120  140.007 1.00 38.61  ? 60  PHE A C   1 
ATOM   201  O O   . PHE A 1 60  ? 44.525  19.210  138.982 1.00 39.89  ? 60  PHE A O   1 
ATOM   202  C CB  . PHE A 1 60  ? 46.563  20.892  141.096 1.00 37.42  ? 60  PHE A CB  1 
ATOM   203  C CG  . PHE A 1 60  ? 46.961  21.517  139.794 1.00 35.90  ? 60  PHE A CG  1 
ATOM   204  C CD1 . PHE A 1 60  ? 46.530  22.804  139.462 1.00 36.41  ? 60  PHE A CD1 1 
ATOM   205  C CD2 . PHE A 1 60  ? 47.758  20.823  138.889 1.00 35.70  ? 60  PHE A CD2 1 
ATOM   206  C CE1 . PHE A 1 60  ? 46.885  23.394  138.240 1.00 33.06  ? 60  PHE A CE1 1 
ATOM   207  C CE2 . PHE A 1 60  ? 48.120  21.401  137.662 1.00 36.39  ? 60  PHE A CE2 1 
ATOM   208  C CZ  . PHE A 1 60  ? 47.679  22.695  137.339 1.00 34.54  ? 60  PHE A CZ  1 
ATOM   209  N N   . ASP A 1 61  ? 45.991  18.078  140.258 1.00 38.13  ? 61  ASP A N   1 
ATOM   210  C CA  . ASP A 1 61  ? 46.087  16.962  139.329 1.00 38.17  ? 61  ASP A CA  1 
ATOM   211  C C   . ASP A 1 61  ? 44.694  16.377  139.026 1.00 37.52  ? 61  ASP A C   1 
ATOM   212  O O   . ASP A 1 61  ? 44.348  16.153  137.862 1.00 35.91  ? 61  ASP A O   1 
ATOM   213  C CB  . ASP A 1 61  ? 47.000  15.880  139.914 1.00 39.74  ? 61  ASP A CB  1 
ATOM   214  C CG  . ASP A 1 61  ? 47.728  15.060  138.834 1.00 42.13  ? 61  ASP A CG  1 
ATOM   215  O OD1 . ASP A 1 61  ? 47.610  15.365  137.621 1.00 40.28  ? 61  ASP A OD1 1 
ATOM   216  O OD2 . ASP A 1 61  ? 48.440  14.102  139.215 1.00 44.30  ? 61  ASP A OD2 1 
ATOM   217  N N   . MET A 1 62  ? 43.900  16.125  140.069 1.00 36.19  ? 62  MET A N   1 
ATOM   218  C CA  . MET A 1 62  ? 42.554  15.587  139.878 1.00 34.26  ? 62  MET A CA  1 
ATOM   219  C C   . MET A 1 62  ? 41.838  16.490  138.902 1.00 33.89  ? 62  MET A C   1 
ATOM   220  O O   . MET A 1 62  ? 41.354  16.051  137.858 1.00 34.40  ? 62  MET A O   1 
ATOM   221  C CB  . MET A 1 62  ? 41.747  15.600  141.174 1.00 34.63  ? 62  MET A CB  1 
ATOM   222  C CG  . MET A 1 62  ? 42.161  14.631  142.235 1.00 37.44  ? 62  MET A CG  1 
ATOM   223  S SD  . MET A 1 62  ? 40.825  14.551  143.440 1.00 40.79  ? 62  MET A SD  1 
ATOM   224  C CE  . MET A 1 62  ? 40.947  16.212  144.148 1.00 39.43  ? 62  MET A CE  1 
ATOM   225  N N   . SER A 1 63  ? 41.773  17.764  139.273 1.00 32.42  ? 63  SER A N   1 
ATOM   226  C CA  . SER A 1 63  ? 41.114  18.768  138.474 1.00 30.46  ? 63  SER A CA  1 
ATOM   227  C C   . SER A 1 63  ? 41.542  18.695  137.022 1.00 30.83  ? 63  SER A C   1 
ATOM   228  O O   . SER A 1 63  ? 40.715  18.452  136.148 1.00 31.86  ? 63  SER A O   1 
ATOM   229  C CB  . SER A 1 63  ? 41.388  20.150  139.061 1.00 29.38  ? 63  SER A CB  1 
ATOM   230  O OG  . SER A 1 63  ? 40.748  20.274  140.325 1.00 29.17  ? 63  SER A OG  1 
ATOM   231  N N   . ILE A 1 64  ? 42.826  18.872  136.751 1.00 30.52  ? 64  ILE A N   1 
ATOM   232  C CA  . ILE A 1 64  ? 43.281  18.822  135.367 1.00 32.42  ? 64  ILE A CA  1 
ATOM   233  C C   . ILE A 1 64  ? 42.755  17.590  134.635 1.00 33.84  ? 64  ILE A C   1 
ATOM   234  O O   . ILE A 1 64  ? 42.144  17.701  133.570 1.00 32.67  ? 64  ILE A O   1 
ATOM   235  C CB  . ILE A 1 64  ? 44.838  18.831  135.269 1.00 32.74  ? 64  ILE A CB  1 
ATOM   236  C CG1 . ILE A 1 64  ? 45.378  20.190  135.716 1.00 31.87  ? 64  ILE A CG1 1 
ATOM   237  C CG2 . ILE A 1 64  ? 45.292  18.513  133.830 1.00 29.18  ? 64  ILE A CG2 1 
ATOM   238  C CD1 . ILE A 1 64  ? 45.059  21.334  134.773 1.00 29.93  ? 64  ILE A CD1 1 
ATOM   239  N N   . GLN A 1 65  ? 42.984  16.420  135.221 1.00 35.74  ? 65  GLN A N   1 
ATOM   240  C CA  . GLN A 1 65  ? 42.574  15.168  134.607 1.00 36.36  ? 65  GLN A CA  1 
ATOM   241  C C   . GLN A 1 65  ? 41.095  15.015  134.352 1.00 35.15  ? 65  GLN A C   1 
ATOM   242  O O   . GLN A 1 65  ? 40.720  14.348  133.395 1.00 34.66  ? 65  GLN A O   1 
ATOM   243  C CB  . GLN A 1 65  ? 43.093  13.985  135.420 1.00 39.45  ? 65  GLN A CB  1 
ATOM   244  C CG  . GLN A 1 65  ? 44.569  13.693  135.160 1.00 43.21  ? 65  GLN A CG  1 
ATOM   245  C CD  . GLN A 1 65  ? 45.151  12.658  136.116 1.00 45.39  ? 65  GLN A CD  1 
ATOM   246  O OE1 . GLN A 1 65  ? 44.598  11.567  136.283 1.00 45.76  ? 65  GLN A OE1 1 
ATOM   247  N NE2 . GLN A 1 65  ? 46.278  12.995  136.741 1.00 44.99  ? 65  GLN A NE2 1 
ATOM   248  N N   . CYS A 1 66  ? 40.254  15.612  135.189 1.00 34.60  ? 66  CYS A N   1 
ATOM   249  C CA  . CYS A 1 66  ? 38.819  15.516  134.965 1.00 36.75  ? 66  CYS A CA  1 
ATOM   250  C C   . CYS A 1 66  ? 38.431  16.420  133.812 1.00 36.90  ? 66  CYS A C   1 
ATOM   251  O O   . CYS A 1 66  ? 37.401  16.231  133.165 1.00 38.44  ? 66  CYS A O   1 
ATOM   252  C CB  . CYS A 1 66  ? 38.047  15.907  136.216 1.00 38.45  ? 66  CYS A CB  1 
ATOM   253  S SG  . CYS A 1 66  ? 38.017  14.556  137.403 1.00 48.35  ? 66  CYS A SG  1 
ATOM   254  N N   . ILE A 1 67  ? 39.277  17.402  133.548 1.00 35.30  ? 67  ILE A N   1 
ATOM   255  C CA  . ILE A 1 67  ? 39.031  18.326  132.465 1.00 33.95  ? 67  ILE A CA  1 
ATOM   256  C C   . ILE A 1 67  ? 39.409  17.659  131.133 1.00 32.77  ? 67  ILE A C   1 
ATOM   257  O O   . ILE A 1 67  ? 38.657  17.738  130.156 1.00 31.71  ? 67  ILE A O   1 
ATOM   258  C CB  . ILE A 1 67  ? 39.810  19.649  132.717 1.00 33.81  ? 67  ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 67  ? 39.179  20.381  133.912 1.00 31.32  ? 67  ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 67  ? 39.792  20.540  131.475 1.00 33.40  ? 67  ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 67  ? 40.014  21.519  134.453 1.00 28.70  ? 67  ILE A CD1 1 
ATOM   262  N N   . GLN A 1 68  ? 40.556  16.985  131.093 1.00 32.16  ? 68  GLN A N   1 
ATOM   263  C CA  . GLN A 1 68  ? 40.966  16.301  129.869 1.00 31.92  ? 68  GLN A CA  1 
ATOM   264  C C   . GLN A 1 68  ? 39.876  15.303  129.541 1.00 30.20  ? 68  GLN A C   1 
ATOM   265  O O   . GLN A 1 68  ? 39.627  14.977  128.381 1.00 30.37  ? 68  GLN A O   1 
ATOM   266  C CB  . GLN A 1 68  ? 42.262  15.519  130.057 1.00 33.50  ? 68  GLN A CB  1 
ATOM   267  C CG  . GLN A 1 68  ? 43.449  16.309  130.503 1.00 36.54  ? 68  GLN A CG  1 
ATOM   268  C CD  . GLN A 1 68  ? 44.726  15.548  130.250 1.00 38.98  ? 68  GLN A CD  1 
ATOM   269  O OE1 . GLN A 1 68  ? 45.132  15.373  129.103 1.00 41.46  ? 68  GLN A OE1 1 
ATOM   270  N NE2 . GLN A 1 68  ? 45.362  15.073  131.318 1.00 41.74  ? 68  GLN A NE2 1 
ATOM   271  N N   . SER A 1 69  ? 39.242  14.806  130.590 1.00 28.90  ? 69  SER A N   1 
ATOM   272  C CA  . SER A 1 69  ? 38.180  13.840  130.436 1.00 29.06  ? 69  SER A CA  1 
ATOM   273  C C   . SER A 1 69  ? 36.963  14.441  129.768 1.00 28.58  ? 69  SER A C   1 
ATOM   274  O O   . SER A 1 69  ? 36.477  13.909  128.764 1.00 27.53  ? 69  SER A O   1 
ATOM   275  C CB  . SER A 1 69  ? 37.798  13.273  131.791 1.00 27.85  ? 69  SER A CB  1 
ATOM   276  O OG  . SER A 1 69  ? 38.822  12.405  132.222 1.00 30.61  ? 69  SER A OG  1 
ATOM   277  N N   . VAL A 1 70  ? 36.470  15.549  130.315 1.00 27.42  ? 70  VAL A N   1 
ATOM   278  C CA  . VAL A 1 70  ? 35.301  16.167  129.726 1.00 26.52  ? 70  VAL A CA  1 
ATOM   279  C C   . VAL A 1 70  ? 35.609  16.552  128.289 1.00 27.89  ? 70  VAL A C   1 
ATOM   280  O O   . VAL A 1 70  ? 34.740  16.452  127.420 1.00 27.02  ? 70  VAL A O   1 
ATOM   281  C CB  . VAL A 1 70  ? 34.844  17.382  130.515 1.00 23.12  ? 70  VAL A CB  1 
ATOM   282  C CG1 . VAL A 1 70  ? 33.512  17.871  129.976 1.00 21.66  ? 70  VAL A CG1 1 
ATOM   283  C CG2 . VAL A 1 70  ? 34.703  17.012  131.960 1.00 21.41  ? 70  VAL A CG2 1 
ATOM   284  N N   . TYR A 1 71  ? 36.845  16.971  128.029 1.00 27.89  ? 71  TYR A N   1 
ATOM   285  C CA  . TYR A 1 71  ? 37.214  17.326  126.664 1.00 29.37  ? 71  TYR A CA  1 
ATOM   286  C C   . TYR A 1 71  ? 37.063  16.082  125.798 1.00 29.40  ? 71  TYR A C   1 
ATOM   287  O O   . TYR A 1 71  ? 36.353  16.086  124.799 1.00 29.46  ? 71  TYR A O   1 
ATOM   288  C CB  . TYR A 1 71  ? 38.658  17.838  126.595 1.00 30.57  ? 71  TYR A CB  1 
ATOM   289  C CG  . TYR A 1 71  ? 38.812  19.329  126.842 1.00 34.22  ? 71  TYR A CG  1 
ATOM   290  C CD1 . TYR A 1 71  ? 38.315  19.931  128.004 1.00 34.97  ? 71  TYR A CD1 1 
ATOM   291  C CD2 . TYR A 1 71  ? 39.455  20.142  125.907 1.00 36.08  ? 71  TYR A CD2 1 
ATOM   292  C CE1 . TYR A 1 71  ? 38.452  21.316  128.226 1.00 35.56  ? 71  TYR A CE1 1 
ATOM   293  C CE2 . TYR A 1 71  ? 39.603  21.528  126.116 1.00 36.27  ? 71  TYR A CE2 1 
ATOM   294  C CZ  . TYR A 1 71  ? 39.096  22.106  127.273 1.00 36.84  ? 71  TYR A CZ  1 
ATOM   295  O OH  . TYR A 1 71  ? 39.208  23.469  127.460 1.00 34.45  ? 71  TYR A OH  1 
ATOM   296  N N   . ILE A 1 72  ? 37.717  15.002  126.195 1.00 28.81  ? 72  ILE A N   1 
ATOM   297  C CA  . ILE A 1 72  ? 37.637  13.780  125.430 1.00 28.12  ? 72  ILE A CA  1 
ATOM   298  C C   . ILE A 1 72  ? 36.215  13.227  125.376 1.00 28.13  ? 72  ILE A C   1 
ATOM   299  O O   . ILE A 1 72  ? 35.836  12.594  124.410 1.00 26.88  ? 72  ILE A O   1 
ATOM   300  C CB  . ILE A 1 72  ? 38.592  12.738  126.007 1.00 29.53  ? 72  ILE A CB  1 
ATOM   301  C CG1 . ILE A 1 72  ? 40.013  13.313  125.983 1.00 30.75  ? 72  ILE A CG1 1 
ATOM   302  C CG2 . ILE A 1 72  ? 38.487  11.430  125.231 1.00 26.53  ? 72  ILE A CG2 1 
ATOM   303  C CD1 . ILE A 1 72  ? 41.126  12.292  126.266 1.00 32.08  ? 72  ILE A CD1 1 
ATOM   304  N N   . SER A 1 73  ? 35.417  13.465  126.404 1.00 29.10  ? 73  SER A N   1 
ATOM   305  C CA  . SER A 1 73  ? 34.054  12.964  126.376 1.00 31.91  ? 73  SER A CA  1 
ATOM   306  C C   . SER A 1 73  ? 33.308  13.626  125.241 1.00 33.53  ? 73  SER A C   1 
ATOM   307  O O   . SER A 1 73  ? 32.674  12.956  124.424 1.00 34.71  ? 73  SER A O   1 
ATOM   308  C CB  . SER A 1 73  ? 33.328  13.276  127.680 1.00 34.43  ? 73  SER A CB  1 
ATOM   309  O OG  . SER A 1 73  ? 33.209  12.117  128.485 1.00 41.21  ? 73  SER A OG  1 
ATOM   310  N N   . LYS A 1 74  ? 33.386  14.951  125.204 1.00 33.61  ? 74  LYS A N   1 
ATOM   311  C CA  . LYS A 1 74  ? 32.716  15.745  124.192 1.00 32.70  ? 74  LYS A CA  1 
ATOM   312  C C   . LYS A 1 74  ? 33.141  15.369  122.783 1.00 33.56  ? 74  LYS A C   1 
ATOM   313  O O   . LYS A 1 74  ? 32.325  15.379  121.856 1.00 34.18  ? 74  LYS A O   1 
ATOM   314  C CB  . LYS A 1 74  ? 33.000  17.225  124.421 1.00 34.09  ? 74  LYS A CB  1 
ATOM   315  C CG  . LYS A 1 74  ? 32.531  17.769  125.756 1.00 35.17  ? 74  LYS A CG  1 
ATOM   316  C CD  . LYS A 1 74  ? 31.029  17.823  125.848 1.00 36.94  ? 74  LYS A CD  1 
ATOM   317  C CE  . LYS A 1 74  ? 30.605  18.462  127.158 1.00 40.13  ? 74  LYS A CE  1 
ATOM   318  N NZ  . LYS A 1 74  ? 29.123  18.436  127.342 1.00 42.81  ? 74  LYS A NZ  1 
ATOM   319  N N   . ILE A 1 75  ? 34.417  15.051  122.607 1.00 33.61  ? 75  ILE A N   1 
ATOM   320  C CA  . ILE A 1 75  ? 34.898  14.685  121.287 1.00 33.29  ? 75  ILE A CA  1 
ATOM   321  C C   . ILE A 1 75  ? 34.310  13.344  120.894 1.00 34.89  ? 75  ILE A C   1 
ATOM   322  O O   . ILE A 1 75  ? 33.933  13.148  119.750 1.00 35.84  ? 75  ILE A O   1 
ATOM   323  C CB  . ILE A 1 75  ? 36.440  14.600  121.236 1.00 32.50  ? 75  ILE A CB  1 
ATOM   324  C CG1 . ILE A 1 75  ? 37.040  15.988  121.484 1.00 31.95  ? 75  ILE A CG1 1 
ATOM   325  C CG2 . ILE A 1 75  ? 36.894  14.054  119.886 1.00 30.45  ? 75  ILE A CG2 1 
ATOM   326  C CD1 . ILE A 1 75  ? 38.561  16.040  121.392 1.00 31.51  ? 75  ILE A CD1 1 
ATOM   327  N N   . ILE A 1 76  ? 34.204  12.424  121.843 1.00 36.92  ? 76  ILE A N   1 
ATOM   328  C CA  . ILE A 1 76  ? 33.659  11.115  121.518 1.00 40.00  ? 76  ILE A CA  1 
ATOM   329  C C   . ILE A 1 76  ? 32.216  11.194  121.054 1.00 42.31  ? 76  ILE A C   1 
ATOM   330  O O   . ILE A 1 76  ? 31.858  10.576  120.052 1.00 43.84  ? 76  ILE A O   1 
ATOM   331  C CB  . ILE A 1 76  ? 33.726  10.133  122.713 1.00 39.87  ? 76  ILE A CB  1 
ATOM   332  C CG1 . ILE A 1 76  ? 35.179  9.940   123.166 1.00 39.81  ? 76  ILE A CG1 1 
ATOM   333  C CG2 . ILE A 1 76  ? 33.096  8.811   122.328 1.00 39.69  ? 76  ILE A CG2 1 
ATOM   334  C CD1 . ILE A 1 76  ? 36.151  9.674   122.059 1.00 38.13  ? 76  ILE A CD1 1 
ATOM   335  N N   . SER A 1 77  ? 31.385  11.945  121.774 1.00 43.88  ? 77  SER A N   1 
ATOM   336  C CA  . SER A 1 77  ? 29.977  12.061  121.404 1.00 46.53  ? 77  SER A CA  1 
ATOM   337  C C   . SER A 1 77  ? 29.801  13.104  120.306 1.00 48.87  ? 77  SER A C   1 
ATOM   338  O O   . SER A 1 77  ? 28.677  13.506  119.983 1.00 48.78  ? 77  SER A O   1 
ATOM   339  C CB  . SER A 1 77  ? 29.137  12.451  122.613 1.00 45.20  ? 77  SER A CB  1 
ATOM   340  O OG  . SER A 1 77  ? 29.299  13.827  122.884 1.00 48.64  ? 77  SER A OG  1 
ATOM   341  N N   . SER A 1 78  ? 30.926  13.530  119.735 1.00 50.88  ? 78  SER A N   1 
ATOM   342  C CA  . SER A 1 78  ? 30.940  14.533  118.679 1.00 51.78  ? 78  SER A CA  1 
ATOM   343  C C   . SER A 1 78  ? 30.094  15.757  119.032 1.00 53.26  ? 78  SER A C   1 
ATOM   344  O O   . SER A 1 78  ? 29.544  16.430  118.158 1.00 52.22  ? 78  SER A O   1 
ATOM   345  C CB  . SER A 1 78  ? 30.474  13.907  117.361 1.00 50.82  ? 78  SER A CB  1 
ATOM   346  O OG  . SER A 1 78  ? 29.839  12.659  117.577 1.00 51.46  ? 78  SER A OG  1 
ATOM   347  N N   . ASP A 1 79  ? 30.007  16.054  120.324 1.00 55.79  ? 79  ASP A N   1 
ATOM   348  C CA  . ASP A 1 79  ? 29.233  17.199  120.771 1.00 58.67  ? 79  ASP A CA  1 
ATOM   349  C C   . ASP A 1 79  ? 29.865  18.514  120.302 1.00 59.04  ? 79  ASP A C   1 
ATOM   350  O O   . ASP A 1 79  ? 31.091  18.646  120.221 1.00 57.51  ? 79  ASP A O   1 
ATOM   351  C CB  . ASP A 1 79  ? 29.102  17.186  122.290 1.00 61.40  ? 79  ASP A CB  1 
ATOM   352  C CG  . ASP A 1 79  ? 27.751  17.695  122.753 1.00 65.55  ? 79  ASP A CG  1 
ATOM   353  O OD1 . ASP A 1 79  ? 27.350  18.798  122.313 1.00 66.10  ? 79  ASP A OD1 1 
ATOM   354  O OD2 . ASP A 1 79  ? 27.089  16.991  123.552 1.00 67.36  ? 79  ASP A OD2 1 
ATOM   355  N N   . ARG A 1 80  ? 29.010  19.485  119.999 1.00 60.29  ? 80  ARG A N   1 
ATOM   356  C CA  . ARG A 1 80  ? 29.446  20.790  119.501 1.00 61.82  ? 80  ARG A CA  1 
ATOM   357  C C   . ARG A 1 80  ? 29.588  21.875  120.567 1.00 59.47  ? 80  ARG A C   1 
ATOM   358  O O   . ARG A 1 80  ? 29.608  23.063  120.243 1.00 59.46  ? 80  ARG A O   1 
ATOM   359  C CB  . ARG A 1 80  ? 28.462  21.278  118.429 1.00 66.16  ? 80  ARG A CB  1 
ATOM   360  C CG  . ARG A 1 80  ? 28.079  20.205  117.419 1.00 72.92  ? 80  ARG A CG  1 
ATOM   361  C CD  . ARG A 1 80  ? 27.369  20.786  116.187 1.00 79.34  ? 80  ARG A CD  1 
ATOM   362  N NE  . ARG A 1 80  ? 27.397  19.847  115.057 1.00 83.37  ? 80  ARG A NE  1 
ATOM   363  C CZ  . ARG A 1 80  ? 27.094  20.154  113.794 1.00 84.75  ? 80  ARG A CZ  1 
ATOM   364  N NH1 . ARG A 1 80  ? 26.728  21.389  113.465 1.00 84.47  ? 80  ARG A NH1 1 
ATOM   365  N NH2 . ARG A 1 80  ? 27.167  19.220  112.850 1.00 85.42  ? 80  ARG A NH2 1 
ATOM   366  N N   . ASP A 1 81  ? 29.693  21.470  121.829 1.00 56.78  ? 81  ASP A N   1 
ATOM   367  C CA  . ASP A 1 81  ? 29.808  22.423  122.930 1.00 53.70  ? 81  ASP A CA  1 
ATOM   368  C C   . ASP A 1 81  ? 31.137  23.148  122.979 1.00 50.29  ? 81  ASP A C   1 
ATOM   369  O O   . ASP A 1 81  ? 32.146  22.669  122.452 1.00 49.64  ? 81  ASP A O   1 
ATOM   370  C CB  . ASP A 1 81  ? 29.565  21.728  124.270 1.00 56.06  ? 81  ASP A CB  1 
ATOM   371  C CG  . ASP A 1 81  ? 28.219  21.022  124.322 1.00 58.27  ? 81  ASP A CG  1 
ATOM   372  O OD1 . ASP A 1 81  ? 27.223  21.587  123.806 1.00 58.34  ? 81  ASP A OD1 1 
ATOM   373  O OD2 . ASP A 1 81  ? 28.162  19.906  124.884 1.00 58.88  ? 81  ASP A OD2 1 
ATOM   374  N N   . LEU A 1 82  ? 31.121  24.311  123.619 1.00 45.96  ? 82  LEU A N   1 
ATOM   375  C CA  . LEU A 1 82  ? 32.314  25.127  123.742 1.00 42.72  ? 82  LEU A CA  1 
ATOM   376  C C   . LEU A 1 82  ? 32.892  25.015  125.137 1.00 40.53  ? 82  LEU A C   1 
ATOM   377  O O   . LEU A 1 82  ? 32.157  25.069  126.122 1.00 39.68  ? 82  LEU A O   1 
ATOM   378  C CB  . LEU A 1 82  ? 31.974  26.577  123.421 1.00 43.04  ? 82  LEU A CB  1 
ATOM   379  C CG  . LEU A 1 82  ? 31.515  26.730  121.976 1.00 41.67  ? 82  LEU A CG  1 
ATOM   380  C CD1 . LEU A 1 82  ? 31.280  28.193  121.660 1.00 40.61  ? 82  LEU A CD1 1 
ATOM   381  C CD2 . LEU A 1 82  ? 32.582  26.135  121.060 1.00 41.39  ? 82  LEU A CD2 1 
ATOM   382  N N   . LEU A 1 83  ? 34.212  24.862  125.209 1.00 37.97  ? 83  LEU A N   1 
ATOM   383  C CA  . LEU A 1 83  ? 34.913  24.707  126.477 1.00 35.01  ? 83  LEU A CA  1 
ATOM   384  C C   . LEU A 1 83  ? 36.045  25.706  126.625 1.00 35.44  ? 83  LEU A C   1 
ATOM   385  O O   . LEU A 1 83  ? 36.676  26.105  125.645 1.00 33.90  ? 83  LEU A O   1 
ATOM   386  C CB  . LEU A 1 83  ? 35.488  23.293  126.580 1.00 33.88  ? 83  LEU A CB  1 
ATOM   387  C CG  . LEU A 1 83  ? 34.519  22.129  126.344 1.00 33.67  ? 83  LEU A CG  1 
ATOM   388  C CD1 . LEU A 1 83  ? 35.300  20.824  126.183 1.00 32.67  ? 83  LEU A CD1 1 
ATOM   389  C CD2 . LEU A 1 83  ? 33.524  22.053  127.503 1.00 31.95  ? 83  LEU A CD2 1 
ATOM   390  N N   . ALA A 1 84  ? 36.309  26.092  127.868 1.00 36.37  ? 84  ALA A N   1 
ATOM   391  C CA  . ALA A 1 84  ? 37.379  27.029  128.179 1.00 36.43  ? 84  ALA A CA  1 
ATOM   392  C C   . ALA A 1 84  ? 38.119  26.544  129.415 1.00 36.71  ? 84  ALA A C   1 
ATOM   393  O O   . ALA A 1 84  ? 37.595  25.753  130.200 1.00 36.17  ? 84  ALA A O   1 
ATOM   394  C CB  . ALA A 1 84  ? 36.811  28.432  128.422 1.00 37.18  ? 84  ALA A CB  1 
ATOM   395  N N   . VAL A 1 85  ? 39.339  27.043  129.579 1.00 37.32  ? 85  VAL A N   1 
ATOM   396  C CA  . VAL A 1 85  ? 40.196  26.691  130.704 1.00 35.74  ? 85  VAL A CA  1 
ATOM   397  C C   . VAL A 1 85  ? 40.783  27.932  131.343 1.00 32.92  ? 85  VAL A C   1 
ATOM   398  O O   . VAL A 1 85  ? 41.551  28.655  130.710 1.00 32.58  ? 85  VAL A O   1 
ATOM   399  C CB  . VAL A 1 85  ? 41.348  25.832  130.237 1.00 38.92  ? 85  VAL A CB  1 
ATOM   400  C CG1 . VAL A 1 85  ? 42.314  25.606  131.384 1.00 42.28  ? 85  VAL A CG1 1 
ATOM   401  C CG2 . VAL A 1 85  ? 40.812  24.521  129.685 1.00 41.64  ? 85  VAL A CG2 1 
ATOM   402  N N   . VAL A 1 86  ? 40.448  28.164  132.604 1.00 30.30  ? 86  VAL A N   1 
ATOM   403  C CA  . VAL A 1 86  ? 40.931  29.346  133.296 1.00 28.17  ? 86  VAL A CA  1 
ATOM   404  C C   . VAL A 1 86  ? 41.457  29.095  134.706 1.00 29.57  ? 86  VAL A C   1 
ATOM   405  O O   . VAL A 1 86  ? 40.757  28.535  135.551 1.00 29.69  ? 86  VAL A O   1 
ATOM   406  C CB  . VAL A 1 86  ? 39.819  30.397  133.394 1.00 25.33  ? 86  VAL A CB  1 
ATOM   407  C CG1 . VAL A 1 86  ? 40.360  31.670  133.989 1.00 24.96  ? 86  VAL A CG1 1 
ATOM   408  C CG2 . VAL A 1 86  ? 39.238  30.653  132.035 1.00 22.21  ? 86  VAL A CG2 1 
ATOM   409  N N   . PHE A 1 87  ? 42.687  29.530  134.959 1.00 29.43  ? 87  PHE A N   1 
ATOM   410  C CA  . PHE A 1 87  ? 43.290  29.385  136.273 1.00 31.31  ? 87  PHE A CA  1 
ATOM   411  C C   . PHE A 1 87  ? 43.393  30.737  136.947 1.00 31.90  ? 87  PHE A C   1 
ATOM   412  O O   . PHE A 1 87  ? 43.586  31.742  136.281 1.00 33.00  ? 87  PHE A O   1 
ATOM   413  C CB  . PHE A 1 87  ? 44.690  28.807  136.162 1.00 32.65  ? 87  PHE A CB  1 
ATOM   414  C CG  . PHE A 1 87  ? 44.747  27.541  135.399 1.00 34.74  ? 87  PHE A CG  1 
ATOM   415  C CD1 . PHE A 1 87  ? 44.969  27.552  134.033 1.00 34.39  ? 87  PHE A CD1 1 
ATOM   416  C CD2 . PHE A 1 87  ? 44.520  26.327  136.035 1.00 34.26  ? 87  PHE A CD2 1 
ATOM   417  C CE1 . PHE A 1 87  ? 44.961  26.363  133.312 1.00 35.15  ? 87  PHE A CE1 1 
ATOM   418  C CE2 . PHE A 1 87  ? 44.511  25.141  135.319 1.00 32.83  ? 87  PHE A CE2 1 
ATOM   419  C CZ  . PHE A 1 87  ? 44.730  25.158  133.959 1.00 31.98  ? 87  PHE A CZ  1 
ATOM   420  N N   . TYR A 1 88  ? 43.263  30.761  138.266 1.00 33.01  ? 88  TYR A N   1 
ATOM   421  C CA  . TYR A 1 88  ? 43.382  32.004  139.009 1.00 33.84  ? 88  TYR A CA  1 
ATOM   422  C C   . TYR A 1 88  ? 44.319  31.759  140.194 1.00 35.24  ? 88  TYR A C   1 
ATOM   423  O O   . TYR A 1 88  ? 44.635  30.614  140.519 1.00 35.03  ? 88  TYR A O   1 
ATOM   424  C CB  . TYR A 1 88  ? 42.000  32.495  139.463 1.00 33.99  ? 88  TYR A CB  1 
ATOM   425  C CG  . TYR A 1 88  ? 41.323  31.663  140.531 1.00 34.71  ? 88  TYR A CG  1 
ATOM   426  C CD1 . TYR A 1 88  ? 41.457  31.992  141.876 1.00 34.04  ? 88  TYR A CD1 1 
ATOM   427  C CD2 . TYR A 1 88  ? 40.540  30.555  140.200 1.00 34.50  ? 88  TYR A CD2 1 
ATOM   428  C CE1 . TYR A 1 88  ? 40.833  31.243  142.872 1.00 34.03  ? 88  TYR A CE1 1 
ATOM   429  C CE2 . TYR A 1 88  ? 39.909  29.800  141.189 1.00 35.15  ? 88  TYR A CE2 1 
ATOM   430  C CZ  . TYR A 1 88  ? 40.061  30.151  142.527 1.00 34.94  ? 88  TYR A CZ  1 
ATOM   431  O OH  . TYR A 1 88  ? 39.451  29.417  143.527 1.00 34.42  ? 88  TYR A OH  1 
ATOM   432  N N   . GLY A 1 89  ? 44.783  32.829  140.823 1.00 35.66  ? 89  GLY A N   1 
ATOM   433  C CA  . GLY A 1 89  ? 45.700  32.667  141.931 1.00 36.42  ? 89  GLY A CA  1 
ATOM   434  C C   . GLY A 1 89  ? 47.087  32.345  141.404 1.00 37.99  ? 89  GLY A C   1 
ATOM   435  O O   . GLY A 1 89  ? 47.951  31.893  142.154 1.00 37.84  ? 89  GLY A O   1 
ATOM   436  N N   . THR A 1 90  ? 47.300  32.574  140.111 1.00 39.33  ? 90  THR A N   1 
ATOM   437  C CA  . THR A 1 90  ? 48.599  32.319  139.483 1.00 42.03  ? 90  THR A CA  1 
ATOM   438  C C   . THR A 1 90  ? 49.480  33.561  139.600 1.00 42.20  ? 90  THR A C   1 
ATOM   439  O O   . THR A 1 90  ? 49.016  34.620  140.017 1.00 42.83  ? 90  THR A O   1 
ATOM   440  C CB  . THR A 1 90  ? 48.452  31.971  137.986 1.00 43.46  ? 90  THR A CB  1 
ATOM   441  O OG1 . THR A 1 90  ? 47.890  33.092  137.286 1.00 45.84  ? 90  THR A OG1 1 
ATOM   442  C CG2 . THR A 1 90  ? 47.550  30.754  137.806 1.00 44.51  ? 90  THR A CG2 1 
ATOM   443  N N   . GLU A 1 91  ? 50.745  33.444  139.220 1.00 41.83  ? 91  GLU A N   1 
ATOM   444  C CA  . GLU A 1 91  ? 51.640  34.582  139.326 1.00 43.04  ? 91  GLU A CA  1 
ATOM   445  C C   . GLU A 1 91  ? 51.554  35.445  138.079 1.00 42.65  ? 91  GLU A C   1 
ATOM   446  O O   . GLU A 1 91  ? 51.454  36.661  138.176 1.00 42.32  ? 91  GLU A O   1 
ATOM   447  C CB  . GLU A 1 91  ? 53.070  34.104  139.542 1.00 46.57  ? 91  GLU A CB  1 
ATOM   448  C CG  . GLU A 1 91  ? 54.010  35.174  140.058 1.00 49.87  ? 91  GLU A CG  1 
ATOM   449  C CD  . GLU A 1 91  ? 55.394  35.068  139.434 1.00 52.83  ? 91  GLU A CD  1 
ATOM   450  O OE1 . GLU A 1 91  ? 55.512  35.303  138.207 1.00 52.72  ? 91  GLU A OE1 1 
ATOM   451  O OE2 . GLU A 1 91  ? 56.358  34.748  140.168 1.00 53.43  ? 91  GLU A OE2 1 
ATOM   452  N N   . LYS A 1 92  ? 51.607  34.819  136.907 1.00 43.19  ? 92  LYS A N   1 
ATOM   453  C CA  . LYS A 1 92  ? 51.492  35.562  135.655 1.00 43.02  ? 92  LYS A CA  1 
ATOM   454  C C   . LYS A 1 92  ? 50.007  35.739  135.365 1.00 42.92  ? 92  LYS A C   1 
ATOM   455  O O   . LYS A 1 92  ? 49.161  35.211  136.095 1.00 42.26  ? 92  LYS A O   1 
ATOM   456  C CB  . LYS A 1 92  ? 52.126  34.793  134.501 1.00 43.71  ? 92  LYS A CB  1 
ATOM   457  C CG  . LYS A 1 92  ? 53.638  34.722  134.523 1.00 48.18  ? 92  LYS A CG  1 
ATOM   458  C CD  . LYS A 1 92  ? 54.142  34.156  133.191 1.00 50.83  ? 92  LYS A CD  1 
ATOM   459  C CE  . LYS A 1 92  ? 55.648  33.900  133.179 1.00 51.64  ? 92  LYS A CE  1 
ATOM   460  N NZ  . LYS A 1 92  ? 56.058  33.242  131.900 1.00 50.88  ? 92  LYS A NZ  1 
ATOM   461  N N   . ASP A 1 93  ? 49.681  36.477  134.307 1.00 42.10  ? 93  ASP A N   1 
ATOM   462  C CA  . ASP A 1 93  ? 48.279  36.669  133.953 1.00 41.53  ? 93  ASP A CA  1 
ATOM   463  C C   . ASP A 1 93  ? 48.068  36.751  132.451 1.00 40.58  ? 93  ASP A C   1 
ATOM   464  O O   . ASP A 1 93  ? 49.005  36.970  131.688 1.00 40.38  ? 93  ASP A O   1 
ATOM   465  C CB  . ASP A 1 93  ? 47.704  37.920  134.628 1.00 42.98  ? 93  ASP A CB  1 
ATOM   466  C CG  . ASP A 1 93  ? 48.422  39.185  134.221 1.00 44.68  ? 93  ASP A CG  1 
ATOM   467  O OD1 . ASP A 1 93  ? 49.532  39.424  134.734 1.00 45.77  ? 93  ASP A OD1 1 
ATOM   468  O OD2 . ASP A 1 93  ? 47.881  39.936  133.380 1.00 46.19  ? 93  ASP A OD2 1 
ATOM   469  N N   . LYS A 1 94  ? 46.820  36.559  132.037 1.00 40.41  ? 94  LYS A N   1 
ATOM   470  C CA  . LYS A 1 94  ? 46.445  36.602  130.631 1.00 39.68  ? 94  LYS A CA  1 
ATOM   471  C C   . LYS A 1 94  ? 44.925  36.611  130.494 1.00 39.48  ? 94  LYS A C   1 
ATOM   472  O O   . LYS A 1 94  ? 44.289  35.563  130.481 1.00 40.08  ? 94  LYS A O   1 
ATOM   473  C CB  . LYS A 1 94  ? 47.014  35.396  129.888 1.00 39.87  ? 94  LYS A CB  1 
ATOM   474  C CG  . LYS A 1 94  ? 46.632  35.365  128.430 1.00 40.77  ? 94  LYS A CG  1 
ATOM   475  C CD  . LYS A 1 94  ? 47.034  34.076  127.752 1.00 43.95  ? 94  LYS A CD  1 
ATOM   476  C CE  . LYS A 1 94  ? 46.570  34.100  126.295 1.00 48.55  ? 94  LYS A CE  1 
ATOM   477  N NZ  . LYS A 1 94  ? 46.524  32.749  125.643 1.00 50.48  ? 94  LYS A NZ  1 
ATOM   478  N N   . ASN A 1 95  ? 44.354  37.806  130.403 1.00 39.40  ? 95  ASN A N   1 
ATOM   479  C CA  . ASN A 1 95  ? 42.912  37.985  130.259 1.00 39.17  ? 95  ASN A CA  1 
ATOM   480  C C   . ASN A 1 95  ? 42.709  39.328  129.570 1.00 40.03  ? 95  ASN A C   1 
ATOM   481  O O   . ASN A 1 95  ? 43.502  40.248  129.754 1.00 40.45  ? 95  ASN A O   1 
ATOM   482  C CB  . ASN A 1 95  ? 42.243  37.979  131.630 1.00 38.77  ? 95  ASN A CB  1 
ATOM   483  C CG  . ASN A 1 95  ? 42.892  38.950  132.586 1.00 38.90  ? 95  ASN A CG  1 
ATOM   484  O OD1 . ASN A 1 95  ? 42.705  40.152  132.477 1.00 40.09  ? 95  ASN A OD1 1 
ATOM   485  N ND2 . ASN A 1 95  ? 43.676  38.433  133.517 1.00 38.76  ? 95  ASN A ND2 1 
ATOM   486  N N   . SER A 1 96  ? 41.648  39.431  128.776 1.00 40.57  ? 96  SER A N   1 
ATOM   487  C CA  . SER A 1 96  ? 41.337  40.631  128.004 1.00 38.93  ? 96  SER A CA  1 
ATOM   488  C C   . SER A 1 96  ? 41.727  41.985  128.602 1.00 38.33  ? 96  SER A C   1 
ATOM   489  O O   . SER A 1 96  ? 42.292  42.828  127.908 1.00 39.04  ? 96  SER A O   1 
ATOM   490  C CB  . SER A 1 96  ? 39.849  40.644  127.658 1.00 39.03  ? 96  SER A CB  1 
ATOM   491  O OG  . SER A 1 96  ? 39.055  40.647  128.830 1.00 40.20  ? 96  SER A OG  1 
ATOM   492  N N   . VAL A 1 97  ? 41.441  42.196  129.879 1.00 36.10  ? 97  VAL A N   1 
ATOM   493  C CA  . VAL A 1 97  ? 41.739  43.473  130.520 1.00 34.40  ? 97  VAL A CA  1 
ATOM   494  C C   . VAL A 1 97  ? 42.906  43.440  131.501 1.00 35.75  ? 97  VAL A C   1 
ATOM   495  O O   . VAL A 1 97  ? 42.869  44.088  132.545 1.00 35.13  ? 97  VAL A O   1 
ATOM   496  C CB  . VAL A 1 97  ? 40.506  43.985  131.266 1.00 33.03  ? 97  VAL A CB  1 
ATOM   497  C CG1 . VAL A 1 97  ? 39.309  43.972  130.338 1.00 31.54  ? 97  VAL A CG1 1 
ATOM   498  C CG2 . VAL A 1 97  ? 40.247  43.122  132.495 1.00 32.46  ? 97  VAL A CG2 1 
ATOM   499  N N   . ASN A 1 98  ? 43.948  42.697  131.159 1.00 37.63  ? 98  ASN A N   1 
ATOM   500  C CA  . ASN A 1 98  ? 45.117  42.575  132.019 1.00 38.93  ? 98  ASN A CA  1 
ATOM   501  C C   . ASN A 1 98  ? 44.867  42.546  133.524 1.00 38.82  ? 98  ASN A C   1 
ATOM   502  O O   . ASN A 1 98  ? 45.655  43.097  134.287 1.00 38.03  ? 98  ASN A O   1 
ATOM   503  C CB  . ASN A 1 98  ? 46.115  43.676  131.696 1.00 41.36  ? 98  ASN A CB  1 
ATOM   504  C CG  . ASN A 1 98  ? 47.065  43.278  130.599 1.00 45.06  ? 98  ASN A CG  1 
ATOM   505  O OD1 . ASN A 1 98  ? 46.641  42.786  129.551 1.00 47.33  ? 98  ASN A OD1 1 
ATOM   506  N ND2 . ASN A 1 98  ? 48.362  43.483  130.826 1.00 47.44  ? 98  ASN A ND2 1 
ATOM   507  N N   . PHE A 1 99  ? 43.777  41.913  133.955 1.00 39.91  ? 99  PHE A N   1 
ATOM   508  C CA  . PHE A 1 99  ? 43.493  41.800  135.386 1.00 40.85  ? 99  PHE A CA  1 
ATOM   509  C C   . PHE A 1 99  ? 44.626  40.978  135.949 1.00 42.42  ? 99  PHE A C   1 
ATOM   510  O O   . PHE A 1 99  ? 45.276  40.234  135.210 1.00 44.16  ? 99  PHE A O   1 
ATOM   511  C CB  . PHE A 1 99  ? 42.162  41.101  135.632 1.00 39.44  ? 99  PHE A CB  1 
ATOM   512  C CG  . PHE A 1 99  ? 41.042  42.046  135.934 1.00 39.72  ? 99  PHE A CG  1 
ATOM   513  C CD1 . PHE A 1 99  ? 39.721  41.674  135.720 1.00 39.67  ? 99  PHE A CD1 1 
ATOM   514  C CD2 . PHE A 1 99  ? 41.306  43.308  136.450 1.00 38.30  ? 99  PHE A CD2 1 
ATOM   515  C CE1 . PHE A 1 99  ? 38.684  42.541  136.013 1.00 38.00  ? 99  PHE A CE1 1 
ATOM   516  C CE2 . PHE A 1 99  ? 40.277  44.178  136.745 1.00 37.20  ? 99  PHE A CE2 1 
ATOM   517  C CZ  . PHE A 1 99  ? 38.962  43.793  136.527 1.00 36.89  ? 99  PHE A CZ  1 
ATOM   518  N N   . LYS A 1 100 ? 44.868  41.084  137.247 1.00 42.59  ? 100 LYS A N   1 
ATOM   519  C CA  . LYS A 1 100 ? 45.997  40.361  137.814 1.00 42.83  ? 100 LYS A CA  1 
ATOM   520  C C   . LYS A 1 100 ? 45.747  38.987  138.421 1.00 41.05  ? 100 LYS A C   1 
ATOM   521  O O   . LYS A 1 100 ? 44.688  38.718  138.989 1.00 40.36  ? 100 LYS A O   1 
ATOM   522  C CB  . LYS A 1 100 ? 46.698  41.262  138.827 1.00 44.57  ? 100 LYS A CB  1 
ATOM   523  C CG  . LYS A 1 100 ? 47.231  42.532  138.201 1.00 47.18  ? 100 LYS A CG  1 
ATOM   524  C CD  . LYS A 1 100 ? 47.758  43.494  139.252 1.00 51.27  ? 100 LYS A CD  1 
ATOM   525  C CE  . LYS A 1 100 ? 48.403  44.720  138.601 1.00 53.25  ? 100 LYS A CE  1 
ATOM   526  N NZ  . LYS A 1 100 ? 49.058  45.608  139.609 1.00 53.62  ? 100 LYS A NZ  1 
ATOM   527  N N   . ASN A 1 101 ? 46.753  38.127  138.277 1.00 39.52  ? 101 ASN A N   1 
ATOM   528  C CA  . ASN A 1 101 ? 46.728  36.770  138.809 1.00 39.12  ? 101 ASN A CA  1 
ATOM   529  C C   . ASN A 1 101 ? 45.784  35.810  138.103 1.00 37.61  ? 101 ASN A C   1 
ATOM   530  O O   . ASN A 1 101 ? 45.603  34.683  138.554 1.00 37.66  ? 101 ASN A O   1 
ATOM   531  C CB  . ASN A 1 101 ? 46.387  36.800  140.299 1.00 40.42  ? 101 ASN A CB  1 
ATOM   532  C CG  . ASN A 1 101 ? 47.328  37.677  141.085 1.00 42.16  ? 101 ASN A CG  1 
ATOM   533  O OD1 . ASN A 1 101 ? 46.985  38.802  141.471 1.00 44.10  ? 101 ASN A OD1 1 
ATOM   534  N ND2 . ASN A 1 101 ? 48.534  37.176  141.316 1.00 42.03  ? 101 ASN A ND2 1 
ATOM   535  N N   . ILE A 1 102 ? 45.190  36.249  137.001 1.00 35.02  ? 102 ILE A N   1 
ATOM   536  C CA  . ILE A 1 102 ? 44.261  35.414  136.255 1.00 32.86  ? 102 ILE A CA  1 
ATOM   537  C C   . ILE A 1 102 ? 44.827  35.039  134.880 1.00 33.90  ? 102 ILE A C   1 
ATOM   538  O O   . ILE A 1 102 ? 45.149  35.904  134.059 1.00 33.27  ? 102 ILE A O   1 
ATOM   539  C CB  . ILE A 1 102 ? 42.905  36.139  136.111 1.00 31.73  ? 102 ILE A CB  1 
ATOM   540  C CG1 . ILE A 1 102 ? 42.351  36.432  137.507 1.00 31.81  ? 102 ILE A CG1 1 
ATOM   541  C CG2 . ILE A 1 102 ? 41.919  35.293  135.316 1.00 29.18  ? 102 ILE A CG2 1 
ATOM   542  C CD1 . ILE A 1 102 ? 41.228  37.448  137.533 1.00 33.04  ? 102 ILE A CD1 1 
ATOM   543  N N   . TYR A 1 103 ? 44.949  33.737  134.636 1.00 33.73  ? 103 TYR A N   1 
ATOM   544  C CA  . TYR A 1 103 ? 45.490  33.255  133.379 1.00 33.97  ? 103 TYR A CA  1 
ATOM   545  C C   . TYR A 1 103 ? 44.473  32.465  132.571 1.00 33.38  ? 103 TYR A C   1 
ATOM   546  O O   . TYR A 1 103 ? 43.987  31.430  133.012 1.00 34.21  ? 103 TYR A O   1 
ATOM   547  C CB  . TYR A 1 103 ? 46.702  32.379  133.643 1.00 34.74  ? 103 TYR A CB  1 
ATOM   548  C CG  . TYR A 1 103 ? 47.588  32.202  132.438 1.00 37.59  ? 103 TYR A CG  1 
ATOM   549  C CD1 . TYR A 1 103 ? 48.723  32.994  132.258 1.00 36.60  ? 103 TYR A CD1 1 
ATOM   550  C CD2 . TYR A 1 103 ? 47.315  31.222  131.493 1.00 39.42  ? 103 TYR A CD2 1 
ATOM   551  C CE1 . TYR A 1 103 ? 49.570  32.808  131.173 1.00 37.59  ? 103 TYR A CE1 1 
ATOM   552  C CE2 . TYR A 1 103 ? 48.161  31.027  130.395 1.00 41.66  ? 103 TYR A CE2 1 
ATOM   553  C CZ  . TYR A 1 103 ? 49.286  31.823  130.246 1.00 39.74  ? 103 TYR A CZ  1 
ATOM   554  O OH  . TYR A 1 103 ? 50.125  31.610  129.176 1.00 41.39  ? 103 TYR A OH  1 
ATOM   555  N N   . VAL A 1 104 ? 44.153  32.960  131.383 1.00 32.23  ? 104 VAL A N   1 
ATOM   556  C CA  . VAL A 1 104 ? 43.189  32.286  130.526 1.00 30.18  ? 104 VAL A CA  1 
ATOM   557  C C   . VAL A 1 104 ? 43.978  31.418  129.559 1.00 30.20  ? 104 VAL A C   1 
ATOM   558  O O   . VAL A 1 104 ? 44.504  31.907  128.568 1.00 29.43  ? 104 VAL A O   1 
ATOM   559  C CB  . VAL A 1 104 ? 42.310  33.315  129.749 1.00 28.27  ? 104 VAL A CB  1 
ATOM   560  C CG1 . VAL A 1 104 ? 41.457  32.611  128.706 1.00 26.75  ? 104 VAL A CG1 1 
ATOM   561  C CG2 . VAL A 1 104 ? 41.408  34.050  130.719 1.00 23.99  ? 104 VAL A CG2 1 
ATOM   562  N N   . LEU A 1 105 ? 44.071  30.130  129.872 1.00 30.44  ? 105 LEU A N   1 
ATOM   563  C CA  . LEU A 1 105 ? 44.809  29.186  129.050 1.00 30.59  ? 105 LEU A CA  1 
ATOM   564  C C   . LEU A 1 105 ? 44.119  28.950  127.719 1.00 30.52  ? 105 LEU A C   1 
ATOM   565  O O   . LEU A 1 105 ? 44.756  29.019  126.669 1.00 29.22  ? 105 LEU A O   1 
ATOM   566  C CB  . LEU A 1 105 ? 44.963  27.853  129.777 1.00 31.92  ? 105 LEU A CB  1 
ATOM   567  C CG  . LEU A 1 105 ? 45.842  26.857  129.014 1.00 34.42  ? 105 LEU A CG  1 
ATOM   568  C CD1 . LEU A 1 105 ? 47.318  27.292  129.046 1.00 32.38  ? 105 LEU A CD1 1 
ATOM   569  C CD2 . LEU A 1 105 ? 45.684  25.493  129.636 1.00 36.51  ? 105 LEU A CD2 1 
ATOM   570  N N   . GLN A 1 106 ? 42.819  28.659  127.777 1.00 31.55  ? 106 GLN A N   1 
ATOM   571  C CA  . GLN A 1 106 ? 42.006  28.416  126.579 1.00 31.80  ? 106 GLN A CA  1 
ATOM   572  C C   . GLN A 1 106 ? 40.652  29.135  126.666 1.00 32.54  ? 106 GLN A C   1 
ATOM   573  O O   . GLN A 1 106 ? 39.939  29.018  127.668 1.00 32.22  ? 106 GLN A O   1 
ATOM   574  C CB  . GLN A 1 106 ? 41.768  26.909  126.380 1.00 29.89  ? 106 GLN A CB  1 
ATOM   575  C CG  . GLN A 1 106 ? 43.028  26.052  126.469 1.00 30.19  ? 106 GLN A CG  1 
ATOM   576  C CD  . GLN A 1 106 ? 42.771  24.593  126.126 1.00 30.08  ? 106 GLN A CD  1 
ATOM   577  O OE1 . GLN A 1 106 ? 41.711  24.051  126.431 1.00 31.48  ? 106 GLN A OE1 1 
ATOM   578  N NE2 . GLN A 1 106 ? 43.748  23.949  125.507 1.00 28.58  ? 106 GLN A NE2 1 
ATOM   579  N N   . GLU A 1 107 ? 40.313  29.886  125.619 1.00 33.04  ? 107 GLU A N   1 
ATOM   580  C CA  . GLU A 1 107 ? 39.045  30.606  125.564 1.00 34.83  ? 107 GLU A CA  1 
ATOM   581  C C   . GLU A 1 107 ? 37.976  29.657  125.070 1.00 33.71  ? 107 GLU A C   1 
ATOM   582  O O   . GLU A 1 107 ? 38.285  28.595  124.551 1.00 32.83  ? 107 GLU A O   1 
ATOM   583  C CB  . GLU A 1 107 ? 39.136  31.773  124.590 1.00 38.56  ? 107 GLU A CB  1 
ATOM   584  C CG  . GLU A 1 107 ? 40.112  32.840  124.991 1.00 48.08  ? 107 GLU A CG  1 
ATOM   585  C CD  . GLU A 1 107 ? 40.562  33.674  123.805 1.00 54.23  ? 107 GLU A CD  1 
ATOM   586  O OE1 . GLU A 1 107 ? 39.702  34.339  123.177 1.00 58.19  ? 107 GLU A OE1 1 
ATOM   587  O OE2 . GLU A 1 107 ? 41.776  33.655  123.497 1.00 55.38  ? 107 GLU A OE2 1 
ATOM   588  N N   . LEU A 1 108 ? 36.717  30.043  125.221 1.00 34.08  ? 108 LEU A N   1 
ATOM   589  C CA  . LEU A 1 108 ? 35.623  29.205  124.763 1.00 36.53  ? 108 LEU A CA  1 
ATOM   590  C C   . LEU A 1 108 ? 35.808  28.831  123.295 1.00 38.27  ? 108 LEU A C   1 
ATOM   591  O O   . LEU A 1 108 ? 35.913  29.698  122.428 1.00 38.09  ? 108 LEU A O   1 
ATOM   592  C CB  . LEU A 1 108 ? 34.296  29.923  124.958 1.00 38.23  ? 108 LEU A CB  1 
ATOM   593  C CG  . LEU A 1 108 ? 33.753  29.867  126.383 1.00 39.50  ? 108 LEU A CG  1 
ATOM   594  C CD1 . LEU A 1 108 ? 32.619  30.866  126.537 1.00 39.58  ? 108 LEU A CD1 1 
ATOM   595  C CD2 . LEU A 1 108 ? 33.280  28.451  126.687 1.00 37.42  ? 108 LEU A CD2 1 
ATOM   596  N N   . ASP A 1 109 ? 35.834  27.526  123.031 1.00 40.06  ? 109 ASP A N   1 
ATOM   597  C CA  . ASP A 1 109 ? 36.047  26.994  121.693 1.00 40.59  ? 109 ASP A CA  1 
ATOM   598  C C   . ASP A 1 109 ? 35.808  25.474  121.730 1.00 40.76  ? 109 ASP A C   1 
ATOM   599  O O   . ASP A 1 109 ? 35.582  24.897  122.792 1.00 41.57  ? 109 ASP A O   1 
ATOM   600  C CB  . ASP A 1 109 ? 37.486  27.326  121.274 1.00 42.43  ? 109 ASP A CB  1 
ATOM   601  C CG  . ASP A 1 109 ? 37.748  27.080  119.801 1.00 46.64  ? 109 ASP A CG  1 
ATOM   602  O OD1 . ASP A 1 109 ? 36.775  27.092  119.008 1.00 48.56  ? 109 ASP A OD1 1 
ATOM   603  O OD2 . ASP A 1 109 ? 38.937  26.889  119.435 1.00 47.81  ? 109 ASP A OD2 1 
ATOM   604  N N   . ASN A 1 110 ? 35.844  24.826  120.574 1.00 40.44  ? 110 ASN A N   1 
ATOM   605  C CA  . ASN A 1 110 ? 35.639  23.384  120.503 1.00 39.75  ? 110 ASN A CA  1 
ATOM   606  C C   . ASN A 1 110 ? 36.868  22.593  120.939 1.00 39.92  ? 110 ASN A C   1 
ATOM   607  O O   . ASN A 1 110 ? 38.006  23.055  120.799 1.00 40.92  ? 110 ASN A O   1 
ATOM   608  C CB  . ASN A 1 110 ? 35.265  22.980  119.082 1.00 39.15  ? 110 ASN A CB  1 
ATOM   609  C CG  . ASN A 1 110 ? 33.931  23.526  118.669 1.00 40.31  ? 110 ASN A CG  1 
ATOM   610  O OD1 . ASN A 1 110 ? 32.913  23.258  119.316 1.00 42.03  ? 110 ASN A OD1 1 
ATOM   611  N ND2 . ASN A 1 110 ? 33.915  24.296  117.587 1.00 39.66  ? 110 ASN A ND2 1 
ATOM   612  N N   . PRO A 1 111 ? 36.656  21.371  121.459 1.00 38.89  ? 111 PRO A N   1 
ATOM   613  C CA  . PRO A 1 111 ? 37.770  20.531  121.910 1.00 37.78  ? 111 PRO A CA  1 
ATOM   614  C C   . PRO A 1 111 ? 38.610  20.011  120.741 1.00 37.32  ? 111 PRO A C   1 
ATOM   615  O O   . PRO A 1 111 ? 38.081  19.615  119.702 1.00 35.33  ? 111 PRO A O   1 
ATOM   616  C CB  . PRO A 1 111 ? 37.063  19.424  122.669 1.00 38.18  ? 111 PRO A CB  1 
ATOM   617  C CG  . PRO A 1 111 ? 35.796  19.257  121.865 1.00 38.20  ? 111 PRO A CG  1 
ATOM   618  C CD  . PRO A 1 111 ? 35.367  20.679  121.642 1.00 38.12  ? 111 PRO A CD  1 
ATOM   619  N N   . GLY A 1 112 ? 39.925  20.022  120.915 1.00 36.40  ? 112 GLY A N   1 
ATOM   620  C CA  . GLY A 1 112 ? 40.790  19.557  119.856 1.00 35.73  ? 112 GLY A CA  1 
ATOM   621  C C   . GLY A 1 112 ? 41.976  18.812  120.412 1.00 34.88  ? 112 GLY A C   1 
ATOM   622  O O   . GLY A 1 112 ? 42.287  18.913  121.594 1.00 34.26  ? 112 GLY A O   1 
ATOM   623  N N   . ALA A 1 113 ? 42.644  18.068  119.547 1.00 34.55  ? 113 ALA A N   1 
ATOM   624  C CA  . ALA A 1 113 ? 43.799  17.293  119.944 1.00 35.85  ? 113 ALA A CA  1 
ATOM   625  C C   . ALA A 1 113 ? 44.816  18.122  120.708 1.00 36.08  ? 113 ALA A C   1 
ATOM   626  O O   . ALA A 1 113 ? 45.251  17.741  121.791 1.00 35.54  ? 113 ALA A O   1 
ATOM   627  C CB  . ALA A 1 113 ? 44.446  16.694  118.720 1.00 38.31  ? 113 ALA A CB  1 
ATOM   628  N N   . LYS A 1 114 ? 45.195  19.255  120.132 1.00 37.27  ? 114 LYS A N   1 
ATOM   629  C CA  . LYS A 1 114 ? 46.178  20.139  120.745 1.00 37.45  ? 114 LYS A CA  1 
ATOM   630  C C   . LYS A 1 114 ? 45.736  20.694  122.094 1.00 36.81  ? 114 LYS A C   1 
ATOM   631  O O   . LYS A 1 114 ? 46.548  20.884  122.997 1.00 36.18  ? 114 LYS A O   1 
ATOM   632  C CB  . LYS A 1 114 ? 46.504  21.279  119.788 1.00 38.01  ? 114 LYS A CB  1 
ATOM   633  C CG  . LYS A 1 114 ? 47.147  20.805  118.501 1.00 42.12  ? 114 LYS A CG  1 
ATOM   634  C CD  . LYS A 1 114 ? 47.347  21.954  117.525 1.00 47.54  ? 114 LYS A CD  1 
ATOM   635  C CE  . LYS A 1 114 ? 47.792  21.463  116.147 1.00 49.29  ? 114 LYS A CE  1 
ATOM   636  N NZ  . LYS A 1 114 ? 47.797  22.583  115.167 1.00 50.04  ? 114 LYS A NZ  1 
ATOM   637  N N   . ARG A 1 115 ? 44.451  20.964  122.247 1.00 36.47  ? 115 ARG A N   1 
ATOM   638  C CA  . ARG A 1 115 ? 44.003  21.478  123.522 1.00 36.74  ? 115 ARG A CA  1 
ATOM   639  C C   . ARG A 1 115 ? 44.210  20.423  124.601 1.00 37.30  ? 115 ARG A C   1 
ATOM   640  O O   . ARG A 1 115 ? 44.720  20.712  125.682 1.00 37.02  ? 115 ARG A O   1 
ATOM   641  C CB  . ARG A 1 115 ? 42.540  21.914  123.441 1.00 35.72  ? 115 ARG A CB  1 
ATOM   642  C CG  . ARG A 1 115 ? 42.376  23.229  122.701 1.00 35.56  ? 115 ARG A CG  1 
ATOM   643  C CD  . ARG A 1 115 ? 41.069  23.901  123.051 1.00 36.97  ? 115 ARG A CD  1 
ATOM   644  N NE  . ARG A 1 115 ? 41.106  25.336  122.781 1.00 38.73  ? 115 ARG A NE  1 
ATOM   645  C CZ  . ARG A 1 115 ? 40.215  26.212  123.241 1.00 40.42  ? 115 ARG A CZ  1 
ATOM   646  N NH1 . ARG A 1 115 ? 39.203  25.801  123.998 1.00 40.85  ? 115 ARG A NH1 1 
ATOM   647  N NH2 . ARG A 1 115 ? 40.341  27.506  122.962 1.00 39.13  ? 115 ARG A NH2 1 
ATOM   648  N N   . ILE A 1 116 ? 43.836  19.190  124.299 1.00 37.81  ? 116 ILE A N   1 
ATOM   649  C CA  . ILE A 1 116 ? 43.998  18.121  125.262 1.00 39.25  ? 116 ILE A CA  1 
ATOM   650  C C   . ILE A 1 116 ? 45.484  17.926  125.579 1.00 41.32  ? 116 ILE A C   1 
ATOM   651  O O   . ILE A 1 116 ? 45.875  17.827  126.750 1.00 41.54  ? 116 ILE A O   1 
ATOM   652  C CB  . ILE A 1 116 ? 43.360  16.835  124.726 1.00 39.58  ? 116 ILE A CB  1 
ATOM   653  C CG1 . ILE A 1 116 ? 41.853  17.069  124.569 1.00 39.13  ? 116 ILE A CG1 1 
ATOM   654  C CG2 . ILE A 1 116 ? 43.631  15.670  125.673 1.00 40.85  ? 116 ILE A CG2 1 
ATOM   655  C CD1 . ILE A 1 116 ? 41.105  15.930  123.947 1.00 39.87  ? 116 ILE A CD1 1 
ATOM   656  N N   . LEU A 1 117 ? 46.313  17.889  124.538 1.00 41.99  ? 117 LEU A N   1 
ATOM   657  C CA  . LEU A 1 117 ? 47.754  17.741  124.714 1.00 41.60  ? 117 LEU A CA  1 
ATOM   658  C C   . LEU A 1 117 ? 48.251  18.813  125.673 1.00 43.31  ? 117 LEU A C   1 
ATOM   659  O O   . LEU A 1 117 ? 48.999  18.532  126.598 1.00 44.52  ? 117 LEU A O   1 
ATOM   660  C CB  . LEU A 1 117 ? 48.470  17.917  123.384 1.00 40.72  ? 117 LEU A CB  1 
ATOM   661  C CG  . LEU A 1 117 ? 49.993  17.968  123.480 1.00 40.89  ? 117 LEU A CG  1 
ATOM   662  C CD1 . LEU A 1 117 ? 50.524  16.582  123.768 1.00 40.59  ? 117 LEU A CD1 1 
ATOM   663  C CD2 . LEU A 1 117 ? 50.571  18.485  122.183 1.00 41.52  ? 117 LEU A CD2 1 
ATOM   664  N N   . GLU A 1 118 ? 47.830  20.049  125.435 1.00 45.29  ? 118 GLU A N   1 
ATOM   665  C CA  . GLU A 1 118 ? 48.229  21.166  126.276 1.00 46.22  ? 118 GLU A CA  1 
ATOM   666  C C   . GLU A 1 118 ? 47.868  20.902  127.727 1.00 45.49  ? 118 GLU A C   1 
ATOM   667  O O   . GLU A 1 118 ? 48.738  20.910  128.591 1.00 47.00  ? 118 GLU A O   1 
ATOM   668  C CB  . GLU A 1 118 ? 47.567  22.462  125.796 1.00 47.75  ? 118 GLU A CB  1 
ATOM   669  C CG  . GLU A 1 118 ? 47.892  23.674  126.657 1.00 52.86  ? 118 GLU A CG  1 
ATOM   670  C CD  . GLU A 1 118 ? 47.511  25.002  125.995 1.00 56.61  ? 118 GLU A CD  1 
ATOM   671  O OE1 . GLU A 1 118 ? 46.349  25.141  125.541 1.00 56.87  ? 118 GLU A OE1 1 
ATOM   672  O OE2 . GLU A 1 118 ? 48.376  25.910  125.940 1.00 57.07  ? 118 GLU A OE2 1 
ATOM   673  N N   . LEU A 1 119 ? 46.592  20.657  127.999 1.00 44.37  ? 119 LEU A N   1 
ATOM   674  C CA  . LEU A 1 119 ? 46.171  20.395  129.371 1.00 44.98  ? 119 LEU A CA  1 
ATOM   675  C C   . LEU A 1 119 ? 46.986  19.263  129.980 1.00 45.72  ? 119 LEU A C   1 
ATOM   676  O O   . LEU A 1 119 ? 47.401  19.333  131.139 1.00 45.27  ? 119 LEU A O   1 
ATOM   677  C CB  . LEU A 1 119 ? 44.679  20.050  129.421 1.00 43.46  ? 119 LEU A CB  1 
ATOM   678  C CG  . LEU A 1 119 ? 43.733  21.250  129.342 1.00 43.00  ? 119 LEU A CG  1 
ATOM   679  C CD1 . LEU A 1 119 ? 42.303  20.765  129.223 1.00 42.25  ? 119 LEU A CD1 1 
ATOM   680  C CD2 . LEU A 1 119 ? 43.916  22.132  130.578 1.00 40.68  ? 119 LEU A CD2 1 
ATOM   681  N N   . ASP A 1 120 ? 47.217  18.230  129.176 1.00 46.44  ? 120 ASP A N   1 
ATOM   682  C CA  . ASP A 1 120 ? 47.971  17.056  129.588 1.00 47.49  ? 120 ASP A CA  1 
ATOM   683  C C   . ASP A 1 120 ? 49.375  17.413  130.104 1.00 47.29  ? 120 ASP A C   1 
ATOM   684  O O   . ASP A 1 120 ? 49.936  16.712  130.941 1.00 46.39  ? 120 ASP A O   1 
ATOM   685  C CB  . ASP A 1 120 ? 48.044  16.088  128.398 1.00 50.78  ? 120 ASP A CB  1 
ATOM   686  C CG  . ASP A 1 120 ? 48.574  14.702  128.776 1.00 54.21  ? 120 ASP A CG  1 
ATOM   687  O OD1 . ASP A 1 120 ? 48.136  14.127  129.803 1.00 55.94  ? 120 ASP A OD1 1 
ATOM   688  O OD2 . ASP A 1 120 ? 49.421  14.175  128.017 1.00 55.80  ? 120 ASP A OD2 1 
ATOM   689  N N   . GLN A 1 121 ? 49.936  18.514  129.623 1.00 47.25  ? 121 GLN A N   1 
ATOM   690  C CA  . GLN A 1 121 ? 51.265  18.922  130.061 1.00 48.19  ? 121 GLN A CA  1 
ATOM   691  C C   . GLN A 1 121 ? 51.335  19.344  131.527 1.00 48.22  ? 121 GLN A C   1 
ATOM   692  O O   . GLN A 1 121 ? 52.416  19.606  132.046 1.00 47.82  ? 121 GLN A O   1 
ATOM   693  C CB  . GLN A 1 121 ? 51.776  20.058  129.175 1.00 49.58  ? 121 GLN A CB  1 
ATOM   694  C CG  . GLN A 1 121 ? 51.996  19.623  127.732 1.00 53.38  ? 121 GLN A CG  1 
ATOM   695  C CD  . GLN A 1 121 ? 52.902  18.394  127.614 1.00 55.02  ? 121 GLN A CD  1 
ATOM   696  O OE1 . GLN A 1 121 ? 54.113  18.470  127.842 1.00 55.44  ? 121 GLN A OE1 1 
ATOM   697  N NE2 . GLN A 1 121 ? 52.310  17.253  127.266 1.00 55.45  ? 121 GLN A NE2 1 
ATOM   698  N N   . PHE A 1 122 ? 50.184  19.393  132.192 1.00 48.16  ? 122 PHE A N   1 
ATOM   699  C CA  . PHE A 1 122 ? 50.110  19.796  133.592 1.00 47.51  ? 122 PHE A CA  1 
ATOM   700  C C   . PHE A 1 122 ? 49.696  18.646  134.489 1.00 49.23  ? 122 PHE A C   1 
ATOM   701  O O   . PHE A 1 122 ? 49.456  18.824  135.685 1.00 49.27  ? 122 PHE A O   1 
ATOM   702  C CB  . PHE A 1 122 ? 49.103  20.929  133.735 1.00 46.30  ? 122 PHE A CB  1 
ATOM   703  C CG  . PHE A 1 122 ? 49.469  22.156  132.961 1.00 44.66  ? 122 PHE A CG  1 
ATOM   704  C CD1 . PHE A 1 122 ? 48.483  22.944  132.381 1.00 43.70  ? 122 PHE A CD1 1 
ATOM   705  C CD2 . PHE A 1 122 ? 50.800  22.526  132.812 1.00 42.86  ? 122 PHE A CD2 1 
ATOM   706  C CE1 . PHE A 1 122 ? 48.815  24.079  131.661 1.00 42.21  ? 122 PHE A CE1 1 
ATOM   707  C CE2 . PHE A 1 122 ? 51.144  23.657  132.098 1.00 41.75  ? 122 PHE A CE2 1 
ATOM   708  C CZ  . PHE A 1 122 ? 50.151  24.437  131.520 1.00 42.61  ? 122 PHE A CZ  1 
ATOM   709  N N   . LYS A 1 123 ? 49.605  17.463  133.900 1.00 51.45  ? 123 LYS A N   1 
ATOM   710  C CA  . LYS A 1 123 ? 49.208  16.264  134.622 1.00 53.49  ? 123 LYS A CA  1 
ATOM   711  C C   . LYS A 1 123 ? 50.435  15.619  135.262 1.00 54.37  ? 123 LYS A C   1 
ATOM   712  O O   . LYS A 1 123 ? 51.560  15.812  134.796 1.00 54.29  ? 123 LYS A O   1 
ATOM   713  C CB  . LYS A 1 123 ? 48.543  15.292  133.643 1.00 54.87  ? 123 LYS A CB  1 
ATOM   714  C CG  . LYS A 1 123 ? 48.185  13.938  134.212 1.00 58.09  ? 123 LYS A CG  1 
ATOM   715  C CD  . LYS A 1 123 ? 47.697  13.004  133.108 1.00 60.94  ? 123 LYS A CD  1 
ATOM   716  C CE  . LYS A 1 123 ? 47.442  11.594  133.643 1.00 63.40  ? 123 LYS A CE  1 
ATOM   717  N NZ  . LYS A 1 123 ? 47.038  10.642  132.559 1.00 62.92  ? 123 LYS A NZ  1 
ATOM   718  N N   . GLY A 1 124 ? 50.222  14.865  136.335 1.00 54.83  ? 124 GLY A N   1 
ATOM   719  C CA  . GLY A 1 124 ? 51.333  14.205  136.995 1.00 57.06  ? 124 GLY A CA  1 
ATOM   720  C C   . GLY A 1 124 ? 52.234  15.174  137.729 1.00 59.04  ? 124 GLY A C   1 
ATOM   721  O O   . GLY A 1 124 ? 52.066  16.387  137.621 1.00 59.69  ? 124 GLY A O   1 
ATOM   722  N N   . GLN A 1 125 ? 53.199  14.651  138.475 1.00 60.63  ? 125 GLN A N   1 
ATOM   723  C CA  . GLN A 1 125 ? 54.094  15.518  139.220 1.00 62.10  ? 125 GLN A CA  1 
ATOM   724  C C   . GLN A 1 125 ? 54.950  16.367  138.289 1.00 61.94  ? 125 GLN A C   1 
ATOM   725  O O   . GLN A 1 125 ? 55.113  17.562  138.514 1.00 61.79  ? 125 GLN A O   1 
ATOM   726  C CB  . GLN A 1 125 ? 54.998  14.703  140.138 1.00 64.13  ? 125 GLN A CB  1 
ATOM   727  C CG  . GLN A 1 125 ? 55.587  15.540  141.267 1.00 68.36  ? 125 GLN A CG  1 
ATOM   728  C CD  . GLN A 1 125 ? 56.887  14.978  141.816 1.00 70.54  ? 125 GLN A CD  1 
ATOM   729  O OE1 . GLN A 1 125 ? 56.945  13.825  142.260 1.00 73.24  ? 125 GLN A OE1 1 
ATOM   730  N NE2 . GLN A 1 125 ? 57.940  15.794  141.792 1.00 70.28  ? 125 GLN A NE2 1 
ATOM   731  N N   . GLN A 1 126 ? 55.501  15.751  137.250 1.00 62.55  ? 126 GLN A N   1 
ATOM   732  C CA  . GLN A 1 126 ? 56.336  16.480  136.302 1.00 63.68  ? 126 GLN A CA  1 
ATOM   733  C C   . GLN A 1 126 ? 55.555  17.617  135.641 1.00 63.77  ? 126 GLN A C   1 
ATOM   734  O O   . GLN A 1 126 ? 56.105  18.691  135.368 1.00 63.34  ? 126 GLN A O   1 
ATOM   735  C CB  . GLN A 1 126 ? 56.853  15.551  135.208 1.00 65.18  ? 126 GLN A CB  1 
ATOM   736  C CG  . GLN A 1 126 ? 57.597  14.323  135.690 1.00 68.03  ? 126 GLN A CG  1 
ATOM   737  C CD  . GLN A 1 126 ? 58.282  13.591  134.541 1.00 69.42  ? 126 GLN A CD  1 
ATOM   738  O OE1 . GLN A 1 126 ? 57.724  13.469  133.441 1.00 69.35  ? 126 GLN A OE1 1 
ATOM   739  N NE2 . GLN A 1 126 ? 59.495  13.095  134.791 1.00 68.58  ? 126 GLN A NE2 1 
ATOM   740  N N   . GLY A 1 127 ? 54.278  17.367  135.366 1.00 63.42  ? 127 GLY A N   1 
ATOM   741  C CA  . GLY A 1 127 ? 53.446  18.377  134.742 1.00 62.45  ? 127 GLY A CA  1 
ATOM   742  C C   . GLY A 1 127 ? 53.121  19.486  135.721 1.00 62.50  ? 127 GLY A C   1 
ATOM   743  O O   . GLY A 1 127 ? 52.811  20.610  135.319 1.00 61.71  ? 127 GLY A O   1 
ATOM   744  N N   . GLN A 1 128 ? 53.190  19.168  137.013 1.00 62.18  ? 128 GLN A N   1 
ATOM   745  C CA  . GLN A 1 128 ? 52.903  20.143  138.051 1.00 61.39  ? 128 GLN A CA  1 
ATOM   746  C C   . GLN A 1 128 ? 53.992  21.194  138.001 1.00 60.90  ? 128 GLN A C   1 
ATOM   747  O O   . GLN A 1 128 ? 53.725  22.386  138.092 1.00 61.33  ? 128 GLN A O   1 
ATOM   748  C CB  . GLN A 1 128 ? 52.893  19.490  139.430 1.00 61.74  ? 128 GLN A CB  1 
ATOM   749  C CG  . GLN A 1 128 ? 52.088  20.279  140.440 1.00 64.16  ? 128 GLN A CG  1 
ATOM   750  C CD  . GLN A 1 128 ? 52.435  19.948  141.877 1.00 65.56  ? 128 GLN A CD  1 
ATOM   751  O OE1 . GLN A 1 128 ? 53.484  20.354  142.385 1.00 66.10  ? 128 GLN A OE1 1 
ATOM   752  N NE2 . GLN A 1 128 ? 51.555  19.206  142.542 1.00 66.00  ? 128 GLN A NE2 1 
ATOM   753  N N   . LYS A 1 129 ? 55.227  20.737  137.850 1.00 60.61  ? 129 LYS A N   1 
ATOM   754  C CA  . LYS A 1 129 ? 56.367  21.635  137.768 1.00 60.33  ? 129 LYS A CA  1 
ATOM   755  C C   . LYS A 1 129 ? 56.158  22.522  136.553 1.00 58.42  ? 129 LYS A C   1 
ATOM   756  O O   . LYS A 1 129 ? 56.258  23.744  136.648 1.00 58.69  ? 129 LYS A O   1 
ATOM   757  C CB  . LYS A 1 129 ? 57.659  20.828  137.629 1.00 63.32  ? 129 LYS A CB  1 
ATOM   758  C CG  . LYS A 1 129 ? 57.850  19.820  138.761 1.00 67.50  ? 129 LYS A CG  1 
ATOM   759  C CD  . LYS A 1 129 ? 58.728  18.651  138.334 1.00 69.35  ? 129 LYS A CD  1 
ATOM   760  C CE  . LYS A 1 129 ? 58.732  17.552  139.391 1.00 70.25  ? 129 LYS A CE  1 
ATOM   761  N NZ  . LYS A 1 129 ? 59.432  16.325  138.905 1.00 70.70  ? 129 LYS A NZ  1 
ATOM   762  N N   . ARG A 1 130 ? 55.845  21.911  135.415 1.00 55.44  ? 130 ARG A N   1 
ATOM   763  C CA  . ARG A 1 130 ? 55.616  22.679  134.203 1.00 54.02  ? 130 ARG A CA  1 
ATOM   764  C C   . ARG A 1 130 ? 54.603  23.802  134.430 1.00 53.85  ? 130 ARG A C   1 
ATOM   765  O O   . ARG A 1 130 ? 54.801  24.926  133.971 1.00 52.47  ? 130 ARG A O   1 
ATOM   766  C CB  . ARG A 1 130 ? 55.159  21.760  133.073 1.00 52.80  ? 130 ARG A CB  1 
ATOM   767  C CG  . ARG A 1 130 ? 56.291  21.391  132.132 1.00 54.35  ? 130 ARG A CG  1 
ATOM   768  C CD  . ARG A 1 130 ? 55.918  20.263  131.191 1.00 57.10  ? 130 ARG A CD  1 
ATOM   769  N NE  . ARG A 1 130 ? 55.767  18.992  131.901 1.00 59.79  ? 130 ARG A NE  1 
ATOM   770  C CZ  . ARG A 1 130 ? 55.390  17.854  131.324 1.00 60.75  ? 130 ARG A CZ  1 
ATOM   771  N NH1 . ARG A 1 130 ? 55.127  17.833  130.025 1.00 62.19  ? 130 ARG A NH1 1 
ATOM   772  N NH2 . ARG A 1 130 ? 55.275  16.740  132.042 1.00 60.38  ? 130 ARG A NH2 1 
ATOM   773  N N   . PHE A 1 131 ? 53.526  23.507  135.149 1.00 54.15  ? 131 PHE A N   1 
ATOM   774  C CA  . PHE A 1 131 ? 52.520  24.524  135.421 1.00 54.60  ? 131 PHE A CA  1 
ATOM   775  C C   . PHE A 1 131 ? 53.105  25.585  136.336 1.00 56.00  ? 131 PHE A C   1 
ATOM   776  O O   . PHE A 1 131 ? 52.996  26.783  136.063 1.00 56.23  ? 131 PHE A O   1 
ATOM   777  C CB  . PHE A 1 131 ? 51.290  23.924  136.101 1.00 52.85  ? 131 PHE A CB  1 
ATOM   778  C CG  . PHE A 1 131 ? 50.225  24.937  136.412 1.00 50.94  ? 131 PHE A CG  1 
ATOM   779  C CD1 . PHE A 1 131 ? 49.293  25.301  135.446 1.00 49.68  ? 131 PHE A CD1 1 
ATOM   780  C CD2 . PHE A 1 131 ? 50.178  25.559  137.653 1.00 50.43  ? 131 PHE A CD2 1 
ATOM   781  C CE1 . PHE A 1 131 ? 48.330  26.270  135.707 1.00 48.36  ? 131 PHE A CE1 1 
ATOM   782  C CE2 . PHE A 1 131 ? 49.218  26.532  137.925 1.00 50.36  ? 131 PHE A CE2 1 
ATOM   783  C CZ  . PHE A 1 131 ? 48.292  26.887  136.948 1.00 49.24  ? 131 PHE A CZ  1 
ATOM   784  N N   . GLN A 1 132 ? 53.713  25.130  137.430 1.00 57.09  ? 132 GLN A N   1 
ATOM   785  C CA  . GLN A 1 132 ? 54.327  26.019  138.409 1.00 57.99  ? 132 GLN A CA  1 
ATOM   786  C C   . GLN A 1 132 ? 55.236  27.018  137.702 1.00 57.81  ? 132 GLN A C   1 
ATOM   787  O O   . GLN A 1 132 ? 55.063  28.228  137.828 1.00 56.82  ? 132 GLN A O   1 
ATOM   788  C CB  . GLN A 1 132 ? 55.154  25.212  139.414 1.00 59.41  ? 132 GLN A CB  1 
ATOM   789  C CG  . GLN A 1 132 ? 54.394  24.123  140.166 1.00 61.68  ? 132 GLN A CG  1 
ATOM   790  C CD  . GLN A 1 132 ? 53.866  24.585  141.505 1.00 62.17  ? 132 GLN A CD  1 
ATOM   791  O OE1 . GLN A 1 132 ? 54.570  25.247  142.252 1.00 64.75  ? 132 GLN A OE1 1 
ATOM   792  N NE2 . GLN A 1 132 ? 52.632  24.219  141.824 1.00 62.13  ? 132 GLN A NE2 1 
ATOM   793  N N   . ASP A 1 133 ? 56.199  26.502  136.949 1.00 58.78  ? 133 ASP A N   1 
ATOM   794  C CA  . ASP A 1 133 ? 57.139  27.355  136.232 1.00 61.49  ? 133 ASP A CA  1 
ATOM   795  C C   . ASP A 1 133 ? 56.460  28.427  135.382 1.00 62.15  ? 133 ASP A C   1 
ATOM   796  O O   . ASP A 1 133 ? 56.759  29.616  135.512 1.00 63.47  ? 133 ASP A O   1 
ATOM   797  C CB  . ASP A 1 133 ? 58.049  26.508  135.336 1.00 62.50  ? 133 ASP A CB  1 
ATOM   798  C CG  . ASP A 1 133 ? 58.876  25.503  136.122 1.00 64.26  ? 133 ASP A CG  1 
ATOM   799  O OD1 . ASP A 1 133 ? 59.565  25.915  137.087 1.00 64.01  ? 133 ASP A OD1 1 
ATOM   800  O OD2 . ASP A 1 133 ? 58.842  24.301  135.765 1.00 65.54  ? 133 ASP A OD2 1 
ATOM   801  N N   . MET A 1 134 ? 55.540  27.996  134.524 1.00 61.69  ? 134 MET A N   1 
ATOM   802  C CA  . MET A 1 134 ? 54.826  28.890  133.622 1.00 60.96  ? 134 MET A CA  1 
ATOM   803  C C   . MET A 1 134 ? 53.963  29.948  134.306 1.00 60.40  ? 134 MET A C   1 
ATOM   804  O O   . MET A 1 134 ? 54.037  31.122  133.959 1.00 60.46  ? 134 MET A O   1 
ATOM   805  C CB  . MET A 1 134 ? 53.971  28.062  132.667 1.00 61.62  ? 134 MET A CB  1 
ATOM   806  C CG  . MET A 1 134 ? 53.302  28.859  131.575 1.00 63.85  ? 134 MET A CG  1 
ATOM   807  S SD  . MET A 1 134 ? 52.376  27.778  130.473 1.00 65.78  ? 134 MET A SD  1 
ATOM   808  C CE  . MET A 1 134 ? 53.720  26.639  129.971 1.00 67.25  ? 134 MET A CE  1 
ATOM   809  N N   . MET A 1 135 ? 53.145  29.542  135.270 1.00 59.84  ? 135 MET A N   1 
ATOM   810  C CA  . MET A 1 135 ? 52.276  30.489  135.964 1.00 59.86  ? 135 MET A CA  1 
ATOM   811  C C   . MET A 1 135 ? 52.352  30.283  137.470 1.00 60.92  ? 135 MET A C   1 
ATOM   812  O O   . MET A 1 135 ? 51.338  30.002  138.103 1.00 63.07  ? 135 MET A O   1 
ATOM   813  C CB  . MET A 1 135 ? 50.830  30.286  135.519 1.00 59.23  ? 135 MET A CB  1 
ATOM   814  C CG  . MET A 1 135 ? 50.643  30.167  134.022 1.00 59.60  ? 135 MET A CG  1 
ATOM   815  S SD  . MET A 1 135 ? 49.055  29.419  133.608 1.00 60.25  ? 135 MET A SD  1 
ATOM   816  C CE  . MET A 1 135 ? 49.541  28.207  132.427 1.00 59.53  ? 135 MET A CE  1 
ATOM   817  N N   . GLY A 1 136 ? 53.544  30.411  138.042 1.00 60.96  ? 136 GLY A N   1 
ATOM   818  C CA  . GLY A 1 136 ? 53.714  30.231  139.478 1.00 60.79  ? 136 GLY A CA  1 
ATOM   819  C C   . GLY A 1 136 ? 52.460  30.393  140.323 1.00 60.48  ? 136 GLY A C   1 
ATOM   820  O O   . GLY A 1 136 ? 51.765  31.402  140.255 1.00 61.82  ? 136 GLY A O   1 
ATOM   821  N N   . HIS A 1 137 ? 52.176  29.393  141.140 1.00 59.52  ? 137 HIS A N   1 
ATOM   822  C CA  . HIS A 1 137 ? 50.998  29.406  141.997 1.00 58.66  ? 137 HIS A CA  1 
ATOM   823  C C   . HIS A 1 137 ? 51.098  30.387  143.163 1.00 57.49  ? 137 HIS A C   1 
ATOM   824  O O   . HIS A 1 137 ? 51.841  31.367  143.109 1.00 56.64  ? 137 HIS A O   1 
ATOM   825  C CB  . HIS A 1 137 ? 50.785  28.007  142.552 1.00 59.63  ? 137 HIS A CB  1 
ATOM   826  C CG  . HIS A 1 137 ? 51.904  27.543  143.427 1.00 60.51  ? 137 HIS A CG  1 
ATOM   827  N ND1 . HIS A 1 137 ? 53.229  27.644  143.055 1.00 58.26  ? 137 HIS A ND1 1 
ATOM   828  C CD2 . HIS A 1 137 ? 51.902  26.996  144.665 1.00 61.31  ? 137 HIS A CD2 1 
ATOM   829  C CE1 . HIS A 1 137 ? 53.991  27.180  144.027 1.00 59.63  ? 137 HIS A CE1 1 
ATOM   830  N NE2 . HIS A 1 137 ? 53.211  26.780  145.016 1.00 61.45  ? 137 HIS A NE2 1 
ATOM   831  N N   . GLY A 1 138 ? 50.330  30.089  144.212 1.00 56.77  ? 138 GLY A N   1 
ATOM   832  C CA  . GLY A 1 138 ? 50.295  30.898  145.418 1.00 56.26  ? 138 GLY A CA  1 
ATOM   833  C C   . GLY A 1 138 ? 50.413  32.390  145.194 1.00 56.53  ? 138 GLY A C   1 
ATOM   834  O O   . GLY A 1 138 ? 51.489  32.960  145.380 1.00 58.24  ? 138 GLY A O   1 
ATOM   835  N N   . SER A 1 139 ? 49.314  33.029  144.803 1.00 55.51  ? 139 SER A N   1 
ATOM   836  C CA  . SER A 1 139 ? 49.321  34.468  144.564 1.00 53.72  ? 139 SER A CA  1 
ATOM   837  C C   . SER A 1 139 ? 48.034  35.127  145.027 1.00 53.07  ? 139 SER A C   1 
ATOM   838  O O   . SER A 1 139 ? 47.010  34.473  145.161 1.00 52.90  ? 139 SER A O   1 
ATOM   839  C CB  . SER A 1 139 ? 49.529  34.753  143.080 1.00 53.31  ? 139 SER A CB  1 
ATOM   840  O OG  . SER A 1 139 ? 50.795  34.285  142.655 1.00 53.79  ? 139 SER A OG  1 
ATOM   841  N N   . ASP A 1 140 ? 48.098  36.427  145.280 1.00 53.47  ? 140 ASP A N   1 
ATOM   842  C CA  . ASP A 1 140 ? 46.927  37.173  145.719 1.00 53.05  ? 140 ASP A CA  1 
ATOM   843  C C   . ASP A 1 140 ? 45.927  37.171  144.563 1.00 51.23  ? 140 ASP A C   1 
ATOM   844  O O   . ASP A 1 140 ? 46.315  36.919  143.420 1.00 51.72  ? 140 ASP A O   1 
ATOM   845  C CB  . ASP A 1 140 ? 47.328  38.607  146.053 1.00 56.47  ? 140 ASP A CB  1 
ATOM   846  C CG  . ASP A 1 140 ? 46.235  39.365  146.789 1.00 59.47  ? 140 ASP A CG  1 
ATOM   847  O OD1 . ASP A 1 140 ? 45.905  38.964  147.927 1.00 60.94  ? 140 ASP A OD1 1 
ATOM   848  O OD2 . ASP A 1 140 ? 45.707  40.361  146.234 1.00 61.01  ? 140 ASP A OD2 1 
ATOM   849  N N   . TYR A 1 141 ? 44.653  37.444  144.851 1.00 47.68  ? 141 TYR A N   1 
ATOM   850  C CA  . TYR A 1 141 ? 43.607  37.464  143.813 1.00 44.36  ? 141 TYR A CA  1 
ATOM   851  C C   . TYR A 1 141 ? 42.266  37.829  144.443 1.00 43.78  ? 141 TYR A C   1 
ATOM   852  O O   . TYR A 1 141 ? 42.136  37.851  145.668 1.00 42.45  ? 141 TYR A O   1 
ATOM   853  C CB  . TYR A 1 141 ? 43.480  36.074  143.135 1.00 39.66  ? 141 TYR A CB  1 
ATOM   854  C CG  . TYR A 1 141 ? 42.909  34.979  144.043 1.00 35.94  ? 141 TYR A CG  1 
ATOM   855  C CD1 . TYR A 1 141 ? 41.557  34.982  144.420 1.00 34.61  ? 141 TYR A CD1 1 
ATOM   856  C CD2 . TYR A 1 141 ? 43.729  33.988  144.584 1.00 32.94  ? 141 TYR A CD2 1 
ATOM   857  C CE1 . TYR A 1 141 ? 41.040  34.035  145.318 1.00 31.62  ? 141 TYR A CE1 1 
ATOM   858  C CE2 . TYR A 1 141 ? 43.218  33.034  145.489 1.00 31.02  ? 141 TYR A CE2 1 
ATOM   859  C CZ  . TYR A 1 141 ? 41.876  33.068  145.850 1.00 30.73  ? 141 TYR A CZ  1 
ATOM   860  O OH  . TYR A 1 141 ? 41.372  32.159  146.752 1.00 28.72  ? 141 TYR A OH  1 
ATOM   861  N N   . SER A 1 142 ? 41.274  38.121  143.603 1.00 43.48  ? 142 SER A N   1 
ATOM   862  C CA  . SER A 1 142 ? 39.930  38.417  144.093 1.00 43.87  ? 142 SER A CA  1 
ATOM   863  C C   . SER A 1 142 ? 38.944  37.810  143.096 1.00 43.02  ? 142 SER A C   1 
ATOM   864  O O   . SER A 1 142 ? 39.036  38.054  141.892 1.00 42.42  ? 142 SER A O   1 
ATOM   865  C CB  . SER A 1 142 ? 39.700  39.928  144.246 1.00 45.05  ? 142 SER A CB  1 
ATOM   866  O OG  . SER A 1 142 ? 39.403  40.541  143.009 1.00 47.60  ? 142 SER A OG  1 
ATOM   867  N N   . LEU A 1 143 ? 38.016  37.003  143.608 1.00 42.71  ? 143 LEU A N   1 
ATOM   868  C CA  . LEU A 1 143 ? 37.025  36.319  142.782 1.00 41.82  ? 143 LEU A CA  1 
ATOM   869  C C   . LEU A 1 143 ? 36.226  37.191  141.832 1.00 41.26  ? 143 LEU A C   1 
ATOM   870  O O   . LEU A 1 143 ? 35.917  36.763  140.716 1.00 41.66  ? 143 LEU A O   1 
ATOM   871  C CB  . LEU A 1 143 ? 36.060  35.511  143.656 1.00 41.46  ? 143 LEU A CB  1 
ATOM   872  C CG  . LEU A 1 143 ? 36.643  34.259  144.332 1.00 41.59  ? 143 LEU A CG  1 
ATOM   873  C CD1 . LEU A 1 143 ? 35.503  33.453  144.984 1.00 40.60  ? 143 LEU A CD1 1 
ATOM   874  C CD2 . LEU A 1 143 ? 37.394  33.407  143.308 1.00 38.77  ? 143 LEU A CD2 1 
ATOM   875  N N   . SER A 1 144 ? 35.870  38.398  142.259 1.00 39.97  ? 144 SER A N   1 
ATOM   876  C CA  . SER A 1 144 ? 35.117  39.278  141.375 1.00 38.96  ? 144 SER A CA  1 
ATOM   877  C C   . SER A 1 144 ? 35.878  39.422  140.057 1.00 37.73  ? 144 SER A C   1 
ATOM   878  O O   . SER A 1 144 ? 35.336  39.151  138.988 1.00 37.40  ? 144 SER A O   1 
ATOM   879  C CB  . SER A 1 144 ? 34.915  40.649  142.018 1.00 38.91  ? 144 SER A CB  1 
ATOM   880  O OG  . SER A 1 144 ? 35.706  40.779  143.181 1.00 41.97  ? 144 SER A OG  1 
ATOM   881  N N   . GLU A 1 145 ? 37.140  39.822  140.135 1.00 35.99  ? 145 GLU A N   1 
ATOM   882  C CA  . GLU A 1 145 ? 37.926  39.992  138.929 1.00 36.28  ? 145 GLU A CA  1 
ATOM   883  C C   . GLU A 1 145 ? 37.917  38.711  138.117 1.00 35.32  ? 145 GLU A C   1 
ATOM   884  O O   . GLU A 1 145 ? 37.818  38.743  136.890 1.00 34.12  ? 145 GLU A O   1 
ATOM   885  C CB  . GLU A 1 145 ? 39.360  40.367  139.280 1.00 39.13  ? 145 GLU A CB  1 
ATOM   886  C CG  . GLU A 1 145 ? 39.471  41.488  140.303 1.00 42.33  ? 145 GLU A CG  1 
ATOM   887  C CD  . GLU A 1 145 ? 40.538  42.519  139.953 1.00 44.53  ? 145 GLU A CD  1 
ATOM   888  O OE1 . GLU A 1 145 ? 41.609  42.136  139.412 1.00 45.25  ? 145 GLU A OE1 1 
ATOM   889  O OE2 . GLU A 1 145 ? 40.303  43.717  140.240 1.00 45.49  ? 145 GLU A OE2 1 
ATOM   890  N N   . VAL A 1 146 ? 38.015  37.583  138.813 1.00 34.73  ? 146 VAL A N   1 
ATOM   891  C CA  . VAL A 1 146 ? 38.017  36.272  138.169 1.00 33.38  ? 146 VAL A CA  1 
ATOM   892  C C   . VAL A 1 146 ? 36.640  35.965  137.597 1.00 32.04  ? 146 VAL A C   1 
ATOM   893  O O   . VAL A 1 146 ? 36.512  35.501  136.461 1.00 31.28  ? 146 VAL A O   1 
ATOM   894  C CB  . VAL A 1 146 ? 38.409  35.149  139.164 1.00 35.11  ? 146 VAL A CB  1 
ATOM   895  C CG1 . VAL A 1 146 ? 38.162  33.788  138.528 1.00 36.23  ? 146 VAL A CG1 1 
ATOM   896  C CG2 . VAL A 1 146 ? 39.877  35.276  139.562 1.00 33.46  ? 146 VAL A CG2 1 
ATOM   897  N N   . LEU A 1 147 ? 35.604  36.222  138.381 1.00 29.67  ? 147 LEU A N   1 
ATOM   898  C CA  . LEU A 1 147 ? 34.265  35.970  137.897 1.00 30.26  ? 147 LEU A CA  1 
ATOM   899  C C   . LEU A 1 147 ? 33.968  36.770  136.634 1.00 31.22  ? 147 LEU A C   1 
ATOM   900  O O   . LEU A 1 147 ? 33.259  36.296  135.739 1.00 30.44  ? 147 LEU A O   1 
ATOM   901  C CB  . LEU A 1 147 ? 33.237  36.309  138.967 1.00 28.82  ? 147 LEU A CB  1 
ATOM   902  C CG  . LEU A 1 147 ? 32.984  35.222  140.006 1.00 28.31  ? 147 LEU A CG  1 
ATOM   903  C CD1 . LEU A 1 147 ? 31.641  35.514  140.675 1.00 26.96  ? 147 LEU A CD1 1 
ATOM   904  C CD2 . LEU A 1 147 ? 32.957  33.834  139.346 1.00 24.43  ? 147 LEU A CD2 1 
ATOM   905  N N   . TRP A 1 148 ? 34.515  37.983  136.575 1.00 32.69  ? 148 TRP A N   1 
ATOM   906  C CA  . TRP A 1 148 ? 34.327  38.883  135.440 1.00 33.64  ? 148 TRP A CA  1 
ATOM   907  C C   . TRP A 1 148 ? 34.971  38.313  134.169 1.00 32.80  ? 148 TRP A C   1 
ATOM   908  O O   . TRP A 1 148 ? 34.335  38.253  133.115 1.00 31.40  ? 148 TRP A O   1 
ATOM   909  C CB  . TRP A 1 148 ? 34.927  40.264  135.760 1.00 35.75  ? 148 TRP A CB  1 
ATOM   910  C CG  . TRP A 1 148 ? 34.613  41.333  134.731 1.00 37.74  ? 148 TRP A CG  1 
ATOM   911  C CD1 . TRP A 1 148 ? 33.570  42.218  134.751 1.00 39.25  ? 148 TRP A CD1 1 
ATOM   912  C CD2 . TRP A 1 148 ? 35.314  41.573  133.503 1.00 37.56  ? 148 TRP A CD2 1 
ATOM   913  N NE1 . TRP A 1 148 ? 33.582  42.994  133.613 1.00 38.31  ? 148 TRP A NE1 1 
ATOM   914  C CE2 . TRP A 1 148 ? 34.646  42.624  132.839 1.00 36.99  ? 148 TRP A CE2 1 
ATOM   915  C CE3 . TRP A 1 148 ? 36.453  41.016  132.913 1.00 38.93  ? 148 TRP A CE3 1 
ATOM   916  C CZ2 . TRP A 1 148 ? 35.061  43.099  131.602 1.00 36.82  ? 148 TRP A CZ2 1 
ATOM   917  C CZ3 . TRP A 1 148 ? 36.867  41.495  131.680 1.00 37.82  ? 148 TRP A CZ3 1 
ATOM   918  C CH2 . TRP A 1 148 ? 36.180  42.533  131.046 1.00 38.16  ? 148 TRP A CH2 1 
ATOM   919  N N   . VAL A 1 149 ? 36.228  37.894  134.282 1.00 32.03  ? 149 VAL A N   1 
ATOM   920  C CA  . VAL A 1 149 ? 36.960  37.333  133.150 1.00 32.89  ? 149 VAL A CA  1 
ATOM   921  C C   . VAL A 1 149 ? 36.205  36.169  132.499 1.00 33.81  ? 149 VAL A C   1 
ATOM   922  O O   . VAL A 1 149 ? 36.128  36.073  131.273 1.00 32.85  ? 149 VAL A O   1 
ATOM   923  C CB  . VAL A 1 149 ? 38.354  36.838  133.589 1.00 32.02  ? 149 VAL A CB  1 
ATOM   924  C CG1 . VAL A 1 149 ? 39.132  36.327  132.389 1.00 30.52  ? 149 VAL A CG1 1 
ATOM   925  C CG2 . VAL A 1 149 ? 39.104  37.960  134.270 1.00 30.17  ? 149 VAL A CG2 1 
ATOM   926  N N   . CYS A 1 150 ? 35.652  35.287  133.326 1.00 34.98  ? 150 CYS A N   1 
ATOM   927  C CA  . CYS A 1 150 ? 34.901  34.140  132.825 1.00 35.36  ? 150 CYS A CA  1 
ATOM   928  C C   . CYS A 1 150 ? 33.602  34.624  132.203 1.00 36.47  ? 150 CYS A C   1 
ATOM   929  O O   . CYS A 1 150 ? 33.208  34.186  131.116 1.00 38.27  ? 150 CYS A O   1 
ATOM   930  C CB  . CYS A 1 150 ? 34.606  33.161  133.964 1.00 34.50  ? 150 CYS A CB  1 
ATOM   931  S SG  . CYS A 1 150 ? 36.102  32.497  134.715 1.00 31.84  ? 150 CYS A SG  1 
ATOM   932  N N   . ALA A 1 151 ? 32.930  35.531  132.897 1.00 36.03  ? 151 ALA A N   1 
ATOM   933  C CA  . ALA A 1 151 ? 31.694  36.081  132.377 1.00 35.81  ? 151 ALA A CA  1 
ATOM   934  C C   . ALA A 1 151 ? 32.052  36.748  131.054 1.00 35.34  ? 151 ALA A C   1 
ATOM   935  O O   . ALA A 1 151 ? 31.252  36.805  130.117 1.00 35.10  ? 151 ALA A O   1 
ATOM   936  C CB  . ALA A 1 151 ? 31.140  37.104  133.346 1.00 34.52  ? 151 ALA A CB  1 
ATOM   937  N N   . ASN A 1 152 ? 33.285  37.227  130.982 1.00 33.85  ? 152 ASN A N   1 
ATOM   938  C CA  . ASN A 1 152 ? 33.737  37.902  129.797 1.00 34.44  ? 152 ASN A CA  1 
ATOM   939  C C   . ASN A 1 152 ? 34.037  36.952  128.661 1.00 35.98  ? 152 ASN A C   1 
ATOM   940  O O   . ASN A 1 152 ? 33.747  37.269  127.511 1.00 37.87  ? 152 ASN A O   1 
ATOM   941  C CB  . ASN A 1 152 ? 34.963  38.747  130.106 1.00 34.16  ? 152 ASN A CB  1 
ATOM   942  C CG  . ASN A 1 152 ? 35.295  39.697  128.987 1.00 35.61  ? 152 ASN A CG  1 
ATOM   943  O OD1 . ASN A 1 152 ? 36.279  39.515  128.266 1.00 37.39  ? 152 ASN A OD1 1 
ATOM   944  N ND2 . ASN A 1 152 ? 34.461  40.718  128.821 1.00 36.31  ? 152 ASN A ND2 1 
ATOM   945  N N   . LEU A 1 153 ? 34.613  35.790  128.961 1.00 36.81  ? 153 LEU A N   1 
ATOM   946  C CA  . LEU A 1 153 ? 34.932  34.811  127.912 1.00 36.18  ? 153 LEU A CA  1 
ATOM   947  C C   . LEU A 1 153 ? 33.691  34.380  127.126 1.00 37.03  ? 153 LEU A C   1 
ATOM   948  O O   . LEU A 1 153 ? 33.787  33.968  125.965 1.00 33.81  ? 153 LEU A O   1 
ATOM   949  C CB  . LEU A 1 153 ? 35.609  33.584  128.518 1.00 34.41  ? 153 LEU A CB  1 
ATOM   950  C CG  . LEU A 1 153 ? 36.952  33.883  129.169 1.00 32.64  ? 153 LEU A CG  1 
ATOM   951  C CD1 . LEU A 1 153 ? 37.478  32.638  129.803 1.00 32.60  ? 153 LEU A CD1 1 
ATOM   952  C CD2 . LEU A 1 153 ? 37.923  34.403  128.146 1.00 31.81  ? 153 LEU A CD2 1 
ATOM   953  N N   . PHE A 1 154 ? 32.535  34.475  127.779 1.00 39.40  ? 154 PHE A N   1 
ATOM   954  C CA  . PHE A 1 154 ? 31.261  34.136  127.163 1.00 42.85  ? 154 PHE A CA  1 
ATOM   955  C C   . PHE A 1 154 ? 30.911  35.184  126.122 1.00 47.28  ? 154 PHE A C   1 
ATOM   956  O O   . PHE A 1 154 ? 30.720  34.860  124.956 1.00 49.04  ? 154 PHE A O   1 
ATOM   957  C CB  . PHE A 1 154 ? 30.151  34.096  128.209 1.00 39.99  ? 154 PHE A CB  1 
ATOM   958  C CG  . PHE A 1 154 ? 30.190  32.890  129.084 1.00 38.13  ? 154 PHE A CG  1 
ATOM   959  C CD1 . PHE A 1 154 ? 30.268  33.023  130.466 1.00 39.11  ? 154 PHE A CD1 1 
ATOM   960  C CD2 . PHE A 1 154 ? 30.126  31.617  128.531 1.00 35.64  ? 154 PHE A CD2 1 
ATOM   961  C CE1 . PHE A 1 154 ? 30.281  31.891  131.290 1.00 38.86  ? 154 PHE A CE1 1 
ATOM   962  C CE2 . PHE A 1 154 ? 30.138  30.488  129.335 1.00 34.99  ? 154 PHE A CE2 1 
ATOM   963  C CZ  . PHE A 1 154 ? 30.215  30.623  130.719 1.00 37.32  ? 154 PHE A CZ  1 
ATOM   964  N N   . SER A 1 155 ? 30.824  36.442  126.555 1.00 52.16  ? 155 SER A N   1 
ATOM   965  C CA  . SER A 1 155 ? 30.491  37.562  125.668 1.00 55.82  ? 155 SER A CA  1 
ATOM   966  C C   . SER A 1 155 ? 31.217  37.422  124.350 1.00 58.78  ? 155 SER A C   1 
ATOM   967  O O   . SER A 1 155 ? 30.610  37.379  123.286 1.00 59.33  ? 155 SER A O   1 
ATOM   968  C CB  . SER A 1 155 ? 30.906  38.888  126.301 1.00 54.85  ? 155 SER A CB  1 
ATOM   969  O OG  . SER A 1 155 ? 30.354  39.036  127.593 1.00 56.10  ? 155 SER A OG  1 
ATOM   970  N N   . ASP A 1 156 ? 32.535  37.350  124.453 1.00 63.47  ? 156 ASP A N   1 
ATOM   971  C CA  . ASP A 1 156 ? 33.435  37.227  123.320 1.00 68.20  ? 156 ASP A CA  1 
ATOM   972  C C   . ASP A 1 156 ? 32.926  36.213  122.282 1.00 69.56  ? 156 ASP A C   1 
ATOM   973  O O   . ASP A 1 156 ? 33.223  36.326  121.093 1.00 69.27  ? 156 ASP A O   1 
ATOM   974  C CB  . ASP A 1 156 ? 34.824  36.845  123.865 1.00 71.50  ? 156 ASP A CB  1 
ATOM   975  C CG  . ASP A 1 156 ? 35.970  37.252  122.940 1.00 75.85  ? 156 ASP A CG  1 
ATOM   976  O OD1 . ASP A 1 156 ? 35.854  38.282  122.231 1.00 78.09  ? 156 ASP A OD1 1 
ATOM   977  O OD2 . ASP A 1 156 ? 37.006  36.542  122.948 1.00 77.48  ? 156 ASP A OD2 1 
ATOM   978  N N   . VAL A 1 157 ? 32.140  35.240  122.732 1.00 71.90  ? 157 VAL A N   1 
ATOM   979  C CA  . VAL A 1 157 ? 31.600  34.214  121.844 1.00 75.34  ? 157 VAL A CA  1 
ATOM   980  C C   . VAL A 1 157 ? 30.835  34.858  120.689 1.00 77.91  ? 157 VAL A C   1 
ATOM   981  O O   . VAL A 1 157 ? 30.107  35.830  120.884 1.00 78.88  ? 157 VAL A O   1 
ATOM   982  C CB  . VAL A 1 157 ? 30.639  33.250  122.607 1.00 75.26  ? 157 VAL A CB  1 
ATOM   983  C CG1 . VAL A 1 157 ? 29.239  33.847  122.679 1.00 75.16  ? 157 VAL A CG1 1 
ATOM   984  C CG2 . VAL A 1 157 ? 30.610  31.891  121.932 1.00 74.21  ? 157 VAL A CG2 1 
ATOM   985  N N   . GLN A 1 158 ? 31.003  34.320  119.486 1.00 80.77  ? 158 GLN A N   1 
ATOM   986  C CA  . GLN A 1 158 ? 30.306  34.854  118.326 1.00 83.81  ? 158 GLN A CA  1 
ATOM   987  C C   . GLN A 1 158 ? 29.117  33.981  117.921 1.00 85.13  ? 158 GLN A C   1 
ATOM   988  O O   . GLN A 1 158 ? 28.473  34.241  116.907 1.00 86.37  ? 158 GLN A O   1 
ATOM   989  C CB  . GLN A 1 158 ? 31.266  35.020  117.139 1.00 85.06  ? 158 GLN A CB  1 
ATOM   990  C CG  . GLN A 1 158 ? 32.069  33.784  116.767 1.00 88.59  ? 158 GLN A CG  1 
ATOM   991  C CD  . GLN A 1 158 ? 33.323  33.622  117.612 1.00 90.93  ? 158 GLN A CD  1 
ATOM   992  O OE1 . GLN A 1 158 ? 33.248  33.401  118.822 1.00 92.22  ? 158 GLN A OE1 1 
ATOM   993  N NE2 . GLN A 1 158 ? 34.487  33.736  116.975 1.00 91.43  ? 158 GLN A NE2 1 
ATOM   994  N N   . PHE A 1 159 ? 28.819  32.953  118.716 1.00 85.93  ? 159 PHE A N   1 
ATOM   995  C CA  . PHE A 1 159 ? 27.692  32.063  118.421 1.00 85.96  ? 159 PHE A CA  1 
ATOM   996  C C   . PHE A 1 159 ? 26.566  32.272  119.439 1.00 85.09  ? 159 PHE A C   1 
ATOM   997  O O   . PHE A 1 159 ? 26.643  33.165  120.290 1.00 84.34  ? 159 PHE A O   1 
ATOM   998  C CB  . PHE A 1 159 ? 28.122  30.586  118.469 1.00 88.05  ? 159 PHE A CB  1 
ATOM   999  C CG  . PHE A 1 159 ? 29.400  30.277  117.718 1.00 90.18  ? 159 PHE A CG  1 
ATOM   1000 C CD1 . PHE A 1 159 ? 30.634  30.706  118.205 1.00 90.58  ? 159 PHE A CD1 1 
ATOM   1001 C CD2 . PHE A 1 159 ? 29.372  29.516  116.547 1.00 90.49  ? 159 PHE A CD2 1 
ATOM   1002 C CE1 . PHE A 1 159 ? 31.820  30.379  117.542 1.00 91.38  ? 159 PHE A CE1 1 
ATOM   1003 C CE2 . PHE A 1 159 ? 30.555  29.185  115.877 1.00 90.51  ? 159 PHE A CE2 1 
ATOM   1004 C CZ  . PHE A 1 159 ? 31.779  29.616  116.376 1.00 90.85  ? 159 PHE A CZ  1 
ATOM   1005 N N   . LYS A 1 160 ? 25.526  31.442  119.340 1.00 83.93  ? 160 LYS A N   1 
ATOM   1006 C CA  . LYS A 1 160 ? 24.381  31.496  120.256 1.00 83.41  ? 160 LYS A CA  1 
ATOM   1007 C C   . LYS A 1 160 ? 24.552  30.364  121.265 1.00 81.51  ? 160 LYS A C   1 
ATOM   1008 O O   . LYS A 1 160 ? 24.879  29.238  120.882 1.00 81.78  ? 160 LYS A O   1 
ATOM   1009 C CB  . LYS A 1 160 ? 23.065  31.339  119.479 1.00 84.70  ? 160 LYS A CB  1 
ATOM   1010 C CG  . LYS A 1 160 ? 22.828  32.479  118.501 1.00 87.02  ? 160 LYS A CG  1 
ATOM   1011 C CD  . LYS A 1 160 ? 21.547  32.337  117.702 1.00 88.08  ? 160 LYS A CD  1 
ATOM   1012 C CE  . LYS A 1 160 ? 21.481  33.431  116.635 1.00 88.89  ? 160 LYS A CE  1 
ATOM   1013 N NZ  . LYS A 1 160 ? 20.265  33.341  115.779 1.00 89.68  ? 160 LYS A NZ  1 
ATOM   1014 N N   . MET A 1 161 ? 24.320  30.650  122.544 1.00 78.80  ? 161 MET A N   1 
ATOM   1015 C CA  . MET A 1 161 ? 24.529  29.642  123.579 1.00 76.24  ? 161 MET A CA  1 
ATOM   1016 C C   . MET A 1 161 ? 23.325  29.224  124.433 1.00 73.97  ? 161 MET A C   1 
ATOM   1017 O O   . MET A 1 161 ? 22.711  30.043  125.118 1.00 73.05  ? 161 MET A O   1 
ATOM   1018 C CB  . MET A 1 161 ? 25.682  30.112  124.468 1.00 76.84  ? 161 MET A CB  1 
ATOM   1019 C CG  . MET A 1 161 ? 26.883  30.574  123.642 1.00 77.84  ? 161 MET A CG  1 
ATOM   1020 S SD  . MET A 1 161 ? 28.186  31.429  124.549 1.00 79.38  ? 161 MET A SD  1 
ATOM   1021 C CE  . MET A 1 161 ? 27.344  32.909  125.031 1.00 80.00  ? 161 MET A CE  1 
ATOM   1022 N N   . SER A 1 162 ? 23.015  27.928  124.380 1.00 71.56  ? 162 SER A N   1 
ATOM   1023 C CA  . SER A 1 162 ? 21.906  27.329  125.120 1.00 68.80  ? 162 SER A CA  1 
ATOM   1024 C C   . SER A 1 162 ? 22.179  27.296  126.625 1.00 67.31  ? 162 SER A C   1 
ATOM   1025 O O   . SER A 1 162 ? 21.250  27.314  127.434 1.00 67.33  ? 162 SER A O   1 
ATOM   1026 C CB  . SER A 1 162 ? 21.643  25.915  124.600 1.00 67.62  ? 162 SER A CB  1 
ATOM   1027 N N   . HIS A 1 163 ? 23.454  27.232  126.997 1.00 65.10  ? 163 HIS A N   1 
ATOM   1028 C CA  . HIS A 1 163 ? 23.843  27.219  128.401 1.00 62.83  ? 163 HIS A CA  1 
ATOM   1029 C C   . HIS A 1 163 ? 25.186  27.875  128.658 1.00 60.55  ? 163 HIS A C   1 
ATOM   1030 O O   . HIS A 1 163 ? 26.121  27.756  127.865 1.00 60.33  ? 163 HIS A O   1 
ATOM   1031 C CB  . HIS A 1 163 ? 23.879  25.801  128.954 1.00 65.34  ? 163 HIS A CB  1 
ATOM   1032 C CG  . HIS A 1 163 ? 22.528  25.246  129.265 1.00 68.12  ? 163 HIS A CG  1 
ATOM   1033 N ND1 . HIS A 1 163 ? 21.811  24.485  128.367 1.00 69.42  ? 163 HIS A ND1 1 
ATOM   1034 C CD2 . HIS A 1 163 ? 21.756  25.355  130.372 1.00 68.56  ? 163 HIS A CD2 1 
ATOM   1035 C CE1 . HIS A 1 163 ? 20.654  24.147  128.909 1.00 70.24  ? 163 HIS A CE1 1 
ATOM   1036 N NE2 . HIS A 1 163 ? 20.596  24.662  130.125 1.00 69.85  ? 163 HIS A NE2 1 
ATOM   1037 N N   . LYS A 1 164 ? 25.262  28.565  129.789 1.00 57.35  ? 164 LYS A N   1 
ATOM   1038 C CA  . LYS A 1 164 ? 26.463  29.266  130.200 1.00 54.32  ? 164 LYS A CA  1 
ATOM   1039 C C   . LYS A 1 164 ? 26.779  28.839  131.619 1.00 51.52  ? 164 LYS A C   1 
ATOM   1040 O O   . LYS A 1 164 ? 26.111  29.278  132.552 1.00 50.68  ? 164 LYS A O   1 
ATOM   1041 C CB  . LYS A 1 164 ? 26.225  30.774  130.191 1.00 55.94  ? 164 LYS A CB  1 
ATOM   1042 C CG  . LYS A 1 164 ? 26.061  31.429  128.829 1.00 56.05  ? 164 LYS A CG  1 
ATOM   1043 C CD  . LYS A 1 164 ? 25.685  32.897  129.040 1.00 58.01  ? 164 LYS A CD  1 
ATOM   1044 C CE  . LYS A 1 164 ? 25.970  33.753  127.818 1.00 59.72  ? 164 LYS A CE  1 
ATOM   1045 N NZ  . LYS A 1 164 ? 25.833  35.218  128.094 1.00 60.86  ? 164 LYS A NZ  1 
ATOM   1046 N N   . ARG A 1 165 ? 27.786  27.987  131.786 1.00 48.48  ? 165 ARG A N   1 
ATOM   1047 C CA  . ARG A 1 165 ? 28.166  27.527  133.120 1.00 45.63  ? 165 ARG A CA  1 
ATOM   1048 C C   . ARG A 1 165 ? 29.659  27.672  133.397 1.00 42.11  ? 165 ARG A C   1 
ATOM   1049 O O   . ARG A 1 165 ? 30.487  27.680  132.479 1.00 40.97  ? 165 ARG A O   1 
ATOM   1050 C CB  . ARG A 1 165 ? 27.791  26.053  133.331 1.00 48.28  ? 165 ARG A CB  1 
ATOM   1051 C CG  . ARG A 1 165 ? 26.440  25.623  132.793 1.00 52.52  ? 165 ARG A CG  1 
ATOM   1052 C CD  . ARG A 1 165 ? 25.869  24.472  133.614 1.00 56.45  ? 165 ARG A CD  1 
ATOM   1053 N NE  . ARG A 1 165 ? 25.082  24.970  134.741 1.00 60.36  ? 165 ARG A NE  1 
ATOM   1054 C CZ  . ARG A 1 165 ? 24.542  24.200  135.681 1.00 63.19  ? 165 ARG A CZ  1 
ATOM   1055 N NH1 . ARG A 1 165 ? 24.707  22.880  135.632 1.00 63.82  ? 165 ARG A NH1 1 
ATOM   1056 N NH2 . ARG A 1 165 ? 23.835  24.752  136.668 1.00 63.27  ? 165 ARG A NH2 1 
ATOM   1057 N N   . ILE A 1 166 ? 29.986  27.786  134.680 1.00 37.54  ? 166 ILE A N   1 
ATOM   1058 C CA  . ILE A 1 166 ? 31.365  27.884  135.136 1.00 32.97  ? 166 ILE A CA  1 
ATOM   1059 C C   . ILE A 1 166 ? 31.503  26.779  136.165 1.00 31.07  ? 166 ILE A C   1 
ATOM   1060 O O   . ILE A 1 166 ? 30.686  26.676  137.071 1.00 30.09  ? 166 ILE A O   1 
ATOM   1061 C CB  . ILE A 1 166 ? 31.644  29.210  135.841 1.00 32.25  ? 166 ILE A CB  1 
ATOM   1062 C CG1 . ILE A 1 166 ? 31.363  30.376  134.904 1.00 33.07  ? 166 ILE A CG1 1 
ATOM   1063 C CG2 . ILE A 1 166 ? 33.072  29.253  136.290 1.00 31.78  ? 166 ILE A CG2 1 
ATOM   1064 C CD1 . ILE A 1 166 ? 31.415  31.727  135.593 1.00 33.01  ? 166 ILE A CD1 1 
ATOM   1065 N N   . MET A 1 167 ? 32.519  25.942  136.018 1.00 30.74  ? 167 MET A N   1 
ATOM   1066 C CA  . MET A 1 167 ? 32.750  24.846  136.956 1.00 30.20  ? 167 MET A CA  1 
ATOM   1067 C C   . MET A 1 167 ? 34.047  25.189  137.707 1.00 29.75  ? 167 MET A C   1 
ATOM   1068 O O   . MET A 1 167 ? 35.139  25.203  137.128 1.00 28.05  ? 167 MET A O   1 
ATOM   1069 C CB  . MET A 1 167 ? 32.879  23.529  136.182 1.00 31.59  ? 167 MET A CB  1 
ATOM   1070 C CG  . MET A 1 167 ? 32.617  22.243  136.971 1.00 33.00  ? 167 MET A CG  1 
ATOM   1071 S SD  . MET A 1 167 ? 32.664  20.772  135.885 1.00 31.77  ? 167 MET A SD  1 
ATOM   1072 C CE  . MET A 1 167 ? 30.941  20.809  135.251 1.00 32.63  ? 167 MET A CE  1 
ATOM   1073 N N   . LEU A 1 168 ? 33.896  25.488  138.997 1.00 28.30  ? 168 LEU A N   1 
ATOM   1074 C CA  . LEU A 1 168 ? 35.005  25.874  139.856 1.00 27.17  ? 168 LEU A CA  1 
ATOM   1075 C C   . LEU A 1 168 ? 35.654  24.738  140.658 1.00 28.08  ? 168 LEU A C   1 
ATOM   1076 O O   . LEU A 1 168 ? 35.034  24.131  141.530 1.00 26.87  ? 168 LEU A O   1 
ATOM   1077 C CB  . LEU A 1 168 ? 34.540  26.977  140.818 1.00 24.11  ? 168 LEU A CB  1 
ATOM   1078 C CG  . LEU A 1 168 ? 35.511  27.371  141.944 1.00 23.44  ? 168 LEU A CG  1 
ATOM   1079 C CD1 . LEU A 1 168 ? 36.905  27.631  141.371 1.00 22.06  ? 168 LEU A CD1 1 
ATOM   1080 C CD2 . LEU A 1 168 ? 34.999  28.606  142.674 1.00 21.37  ? 168 LEU A CD2 1 
ATOM   1081 N N   . PHE A 1 169 ? 36.914  24.467  140.352 1.00 28.63  ? 169 PHE A N   1 
ATOM   1082 C CA  . PHE A 1 169 ? 37.677  23.453  141.043 1.00 30.53  ? 169 PHE A CA  1 
ATOM   1083 C C   . PHE A 1 169 ? 38.567  24.120  142.081 1.00 32.90  ? 169 PHE A C   1 
ATOM   1084 O O   . PHE A 1 169 ? 39.565  24.747  141.730 1.00 34.00  ? 169 PHE A O   1 
ATOM   1085 C CB  . PHE A 1 169 ? 38.579  22.707  140.070 1.00 33.43  ? 169 PHE A CB  1 
ATOM   1086 C CG  . PHE A 1 169 ? 37.850  21.780  139.158 1.00 35.57  ? 169 PHE A CG  1 
ATOM   1087 C CD1 . PHE A 1 169 ? 37.187  22.265  138.040 1.00 33.80  ? 169 PHE A CD1 1 
ATOM   1088 C CD2 . PHE A 1 169 ? 37.807  20.413  139.436 1.00 34.38  ? 169 PHE A CD2 1 
ATOM   1089 C CE1 . PHE A 1 169 ? 36.487  21.403  137.210 1.00 34.90  ? 169 PHE A CE1 1 
ATOM   1090 C CE2 . PHE A 1 169 ? 37.114  19.548  138.614 1.00 34.61  ? 169 PHE A CE2 1 
ATOM   1091 C CZ  . PHE A 1 169 ? 36.450  20.044  137.495 1.00 35.37  ? 169 PHE A CZ  1 
ATOM   1092 N N   . THR A 1 170 ? 38.218  23.993  143.356 1.00 34.14  ? 170 THR A N   1 
ATOM   1093 C CA  . THR A 1 170 ? 39.033  24.583  144.408 1.00 35.05  ? 170 THR A CA  1 
ATOM   1094 C C   . THR A 1 170 ? 38.901  23.829  145.718 1.00 34.96  ? 170 THR A C   1 
ATOM   1095 O O   . THR A 1 170 ? 37.802  23.411  146.093 1.00 34.02  ? 170 THR A O   1 
ATOM   1096 C CB  . THR A 1 170 ? 38.639  26.064  144.698 1.00 36.62  ? 170 THR A CB  1 
ATOM   1097 O OG1 . THR A 1 170 ? 39.527  26.614  145.687 1.00 36.66  ? 170 THR A OG1 1 
ATOM   1098 C CG2 . THR A 1 170 ? 37.213  26.144  145.233 1.00 35.41  ? 170 THR A CG2 1 
ATOM   1099 N N   . ASN A 1 171 ? 40.021  23.666  146.417 1.00 33.84  ? 171 ASN A N   1 
ATOM   1100 C CA  . ASN A 1 171 ? 39.989  23.018  147.719 1.00 34.41  ? 171 ASN A CA  1 
ATOM   1101 C C   . ASN A 1 171 ? 40.102  24.080  148.824 1.00 35.12  ? 171 ASN A C   1 
ATOM   1102 O O   . ASN A 1 171 ? 40.491  23.776  149.944 1.00 34.71  ? 171 ASN A O   1 
ATOM   1103 C CB  . ASN A 1 171 ? 41.112  21.980  147.844 1.00 32.80  ? 171 ASN A CB  1 
ATOM   1104 C CG  . ASN A 1 171 ? 42.469  22.600  148.060 1.00 31.15  ? 171 ASN A CG  1 
ATOM   1105 O OD1 . ASN A 1 171 ? 42.744  23.714  147.614 1.00 33.17  ? 171 ASN A OD1 1 
ATOM   1106 N ND2 . ASN A 1 171 ? 43.338  21.866  148.728 1.00 27.92  ? 171 ASN A ND2 1 
ATOM   1107 N N   . GLU A 1 172 ? 39.752  25.324  148.488 1.00 36.34  ? 172 GLU A N   1 
ATOM   1108 C CA  . GLU A 1 172 ? 39.773  26.451  149.428 1.00 37.31  ? 172 GLU A CA  1 
ATOM   1109 C C   . GLU A 1 172 ? 38.330  26.906  149.706 1.00 37.78  ? 172 GLU A C   1 
ATOM   1110 O O   . GLU A 1 172 ? 37.678  27.486  148.837 1.00 37.51  ? 172 GLU A O   1 
ATOM   1111 C CB  . GLU A 1 172 ? 40.581  27.611  148.837 1.00 37.88  ? 172 GLU A CB  1 
ATOM   1112 C CG  . GLU A 1 172 ? 40.550  28.879  149.677 1.00 40.13  ? 172 GLU A CG  1 
ATOM   1113 C CD  . GLU A 1 172 ? 41.109  28.666  151.075 1.00 43.28  ? 172 GLU A CD  1 
ATOM   1114 O OE1 . GLU A 1 172 ? 42.315  28.317  151.185 1.00 43.20  ? 172 GLU A OE1 1 
ATOM   1115 O OE2 . GLU A 1 172 ? 40.340  28.844  152.057 1.00 42.23  ? 172 GLU A OE2 1 
ATOM   1116 N N   . ASP A 1 173 ? 37.846  26.664  150.921 1.00 38.44  ? 173 ASP A N   1 
ATOM   1117 C CA  . ASP A 1 173 ? 36.469  27.003  151.286 1.00 41.02  ? 173 ASP A CA  1 
ATOM   1118 C C   . ASP A 1 173 ? 36.107  28.430  151.697 1.00 41.54  ? 173 ASP A C   1 
ATOM   1119 O O   . ASP A 1 173 ? 34.922  28.783  151.705 1.00 41.72  ? 173 ASP A O   1 
ATOM   1120 C CB  . ASP A 1 173 ? 35.981  26.059  152.389 1.00 45.14  ? 173 ASP A CB  1 
ATOM   1121 C CG  . ASP A 1 173 ? 36.758  26.216  153.685 1.00 48.30  ? 173 ASP A CG  1 
ATOM   1122 O OD1 . ASP A 1 173 ? 36.323  25.641  154.705 1.00 49.35  ? 173 ASP A OD1 1 
ATOM   1123 O OD2 . ASP A 1 173 ? 37.802  26.903  153.684 1.00 52.06  ? 173 ASP A OD2 1 
ATOM   1124 N N   . ASN A 1 174 ? 37.097  29.244  152.052 1.00 41.86  ? 174 ASN A N   1 
ATOM   1125 C CA  . ASN A 1 174 ? 36.838  30.628  152.463 1.00 42.70  ? 174 ASN A CA  1 
ATOM   1126 C C   . ASN A 1 174 ? 37.967  31.533  151.976 1.00 42.20  ? 174 ASN A C   1 
ATOM   1127 O O   . ASN A 1 174 ? 38.763  32.025  152.765 1.00 39.87  ? 174 ASN A O   1 
ATOM   1128 C CB  . ASN A 1 174 ? 36.708  30.688  153.988 1.00 44.40  ? 174 ASN A CB  1 
ATOM   1129 C CG  . ASN A 1 174 ? 36.452  32.092  154.507 1.00 45.66  ? 174 ASN A CG  1 
ATOM   1130 O OD1 . ASN A 1 174 ? 35.680  32.866  153.923 1.00 45.68  ? 174 ASN A OD1 1 
ATOM   1131 N ND2 . ASN A 1 174 ? 37.087  32.422  155.629 1.00 44.98  ? 174 ASN A ND2 1 
ATOM   1132 N N   . PRO A 1 175 ? 38.026  31.769  150.653 1.00 43.03  ? 175 PRO A N   1 
ATOM   1133 C CA  . PRO A 1 175 ? 38.996  32.578  149.903 1.00 42.92  ? 175 PRO A CA  1 
ATOM   1134 C C   . PRO A 1 175 ? 39.282  33.990  150.403 1.00 42.71  ? 175 PRO A C   1 
ATOM   1135 O O   . PRO A 1 175 ? 40.438  34.415  150.450 1.00 41.49  ? 175 PRO A O   1 
ATOM   1136 C CB  . PRO A 1 175 ? 38.409  32.596  148.487 1.00 43.29  ? 175 PRO A CB  1 
ATOM   1137 C CG  . PRO A 1 175 ? 37.632  31.327  148.418 1.00 42.95  ? 175 PRO A CG  1 
ATOM   1138 C CD  . PRO A 1 175 ? 36.945  31.323  149.757 1.00 43.00  ? 175 PRO A CD  1 
ATOM   1139 N N   . HIS A 1 176 ? 38.233  34.716  150.767 1.00 42.83  ? 176 HIS A N   1 
ATOM   1140 C CA  . HIS A 1 176 ? 38.402  36.086  151.221 1.00 44.75  ? 176 HIS A CA  1 
ATOM   1141 C C   . HIS A 1 176 ? 37.903  36.349  152.639 1.00 47.06  ? 176 HIS A C   1 
ATOM   1142 O O   . HIS A 1 176 ? 37.276  37.375  152.909 1.00 47.28  ? 176 HIS A O   1 
ATOM   1143 C CB  . HIS A 1 176 ? 37.704  37.020  150.234 1.00 42.70  ? 176 HIS A CB  1 
ATOM   1144 C CG  . HIS A 1 176 ? 38.343  37.052  148.880 1.00 40.75  ? 176 HIS A CG  1 
ATOM   1145 N ND1 . HIS A 1 176 ? 37.613  37.167  147.717 1.00 38.22  ? 176 HIS A ND1 1 
ATOM   1146 C CD2 . HIS A 1 176 ? 39.644  37.007  148.505 1.00 39.62  ? 176 HIS A CD2 1 
ATOM   1147 C CE1 . HIS A 1 176 ? 38.435  37.188  146.684 1.00 37.10  ? 176 HIS A CE1 1 
ATOM   1148 N NE2 . HIS A 1 176 ? 39.673  37.092  147.133 1.00 38.48  ? 176 HIS A NE2 1 
ATOM   1149 N N   . GLY A 1 177 ? 38.195  35.426  153.546 1.00 49.77  ? 177 GLY A N   1 
ATOM   1150 C CA  . GLY A 1 177 ? 37.768  35.590  154.923 1.00 54.59  ? 177 GLY A CA  1 
ATOM   1151 C C   . GLY A 1 177 ? 38.571  36.641  155.669 1.00 57.14  ? 177 GLY A C   1 
ATOM   1152 O O   . GLY A 1 177 ? 38.191  37.083  156.756 1.00 56.70  ? 177 GLY A O   1 
ATOM   1153 N N   . ASN A 1 178 ? 39.687  37.043  155.076 1.00 60.01  ? 178 ASN A N   1 
ATOM   1154 C CA  . ASN A 1 178 ? 40.551  38.044  155.676 1.00 62.77  ? 178 ASN A CA  1 
ATOM   1155 C C   . ASN A 1 178 ? 40.387  39.416  155.018 1.00 63.37  ? 178 ASN A C   1 
ATOM   1156 O O   . ASN A 1 178 ? 40.857  40.421  155.546 1.00 65.00  ? 178 ASN A O   1 
ATOM   1157 C CB  . ASN A 1 178 ? 42.010  37.593  155.582 1.00 65.05  ? 178 ASN A CB  1 
ATOM   1158 C CG  . ASN A 1 178 ? 42.444  37.308  154.154 1.00 67.69  ? 178 ASN A CG  1 
ATOM   1159 O OD1 . ASN A 1 178 ? 43.640  37.273  153.857 1.00 69.46  ? 178 ASN A OD1 1 
ATOM   1160 N ND2 . ASN A 1 178 ? 41.476  37.095  153.264 1.00 69.26  ? 178 ASN A ND2 1 
ATOM   1161 N N   . ASP A 1 179 ? 39.722  39.461  153.868 1.00 63.94  ? 179 ASP A N   1 
ATOM   1162 C CA  . ASP A 1 179 ? 39.513  40.722  153.164 1.00 64.48  ? 179 ASP A CA  1 
ATOM   1163 C C   . ASP A 1 179 ? 38.012  40.931  152.938 1.00 64.35  ? 179 ASP A C   1 
ATOM   1164 O O   . ASP A 1 179 ? 37.484  40.747  151.844 1.00 63.58  ? 179 ASP A O   1 
ATOM   1165 C CB  . ASP A 1 179 ? 40.283  40.716  151.835 1.00 65.67  ? 179 ASP A CB  1 
ATOM   1166 C CG  . ASP A 1 179 ? 40.494  42.114  151.268 1.00 67.07  ? 179 ASP A CG  1 
ATOM   1167 O OD1 . ASP A 1 179 ? 39.492  42.786  150.934 1.00 67.94  ? 179 ASP A OD1 1 
ATOM   1168 O OD2 . ASP A 1 179 ? 41.669  42.537  151.155 1.00 67.92  ? 179 ASP A OD2 1 
ATOM   1169 N N   . SER A 1 180 ? 37.341  41.315  154.014 1.00 65.40  ? 180 SER A N   1 
ATOM   1170 C CA  . SER A 1 180 ? 35.904  41.563  154.032 1.00 66.57  ? 180 SER A CA  1 
ATOM   1171 C C   . SER A 1 180 ? 35.365  42.502  152.948 1.00 66.35  ? 180 SER A C   1 
ATOM   1172 O O   . SER A 1 180 ? 34.199  42.899  152.989 1.00 67.51  ? 180 SER A O   1 
ATOM   1173 C CB  . SER A 1 180 ? 35.519  42.109  155.408 1.00 68.14  ? 180 SER A CB  1 
ATOM   1174 O OG  . SER A 1 180 ? 36.439  43.111  155.818 1.00 69.24  ? 180 SER A OG  1 
ATOM   1175 N N   . ALA A 1 181 ? 36.206  42.869  151.992 1.00 64.53  ? 181 ALA A N   1 
ATOM   1176 C CA  . ALA A 1 181 ? 35.769  43.745  150.914 1.00 61.88  ? 181 ALA A CA  1 
ATOM   1177 C C   . ALA A 1 181 ? 35.703  42.919  149.636 1.00 59.51  ? 181 ALA A C   1 
ATOM   1178 O O   . ALA A 1 181 ? 34.710  42.943  148.911 1.00 57.85  ? 181 ALA A O   1 
ATOM   1179 C CB  . ALA A 1 181 ? 36.747  44.902  150.754 1.00 63.20  ? 181 ALA A CB  1 
ATOM   1180 N N   . LYS A 1 182 ? 36.774  42.187  149.363 1.00 57.60  ? 182 LYS A N   1 
ATOM   1181 C CA  . LYS A 1 182 ? 36.805  41.344  148.182 1.00 56.49  ? 182 LYS A CA  1 
ATOM   1182 C C   . LYS A 1 182 ? 35.663  40.342  148.318 1.00 55.61  ? 182 LYS A C   1 
ATOM   1183 O O   . LYS A 1 182 ? 34.907  40.109  147.379 1.00 55.88  ? 182 LYS A O   1 
ATOM   1184 C CB  . LYS A 1 182 ? 38.141  40.596  148.077 1.00 54.79  ? 182 LYS A CB  1 
ATOM   1185 C CG  . LYS A 1 182 ? 39.369  41.470  147.883 1.00 51.69  ? 182 LYS A CG  1 
ATOM   1186 C CD  . LYS A 1 182 ? 40.557  40.594  147.561 1.00 50.31  ? 182 LYS A CD  1 
ATOM   1187 C CE  . LYS A 1 182 ? 41.866  41.322  147.749 1.00 50.80  ? 182 LYS A CE  1 
ATOM   1188 N NZ  . LYS A 1 182 ? 43.012  40.369  147.707 1.00 49.90  ? 182 LYS A NZ  1 
ATOM   1189 N N   . ALA A 1 183 ? 35.540  39.765  149.505 1.00 54.57  ? 183 ALA A N   1 
ATOM   1190 C CA  . ALA A 1 183 ? 34.500  38.791  149.773 1.00 54.77  ? 183 ALA A CA  1 
ATOM   1191 C C   . ALA A 1 183 ? 33.123  39.330  149.393 1.00 55.32  ? 183 ALA A C   1 
ATOM   1192 O O   . ALA A 1 183 ? 32.227  38.569  149.017 1.00 54.34  ? 183 ALA A O   1 
ATOM   1193 C CB  . ALA A 1 183 ? 34.526  38.414  151.238 1.00 54.59  ? 183 ALA A CB  1 
ATOM   1194 N N   . SER A 1 184 ? 32.964  40.648  149.487 1.00 56.20  ? 184 SER A N   1 
ATOM   1195 C CA  . SER A 1 184 ? 31.696  41.304  149.168 1.00 55.48  ? 184 SER A CA  1 
ATOM   1196 C C   . SER A 1 184 ? 31.549  41.529  147.673 1.00 54.40  ? 184 SER A C   1 
ATOM   1197 O O   . SER A 1 184 ? 30.479  41.329  147.112 1.00 54.34  ? 184 SER A O   1 
ATOM   1198 C CB  . SER A 1 184 ? 31.598  42.644  149.902 1.00 56.79  ? 184 SER A CB  1 
ATOM   1199 O OG  . SER A 1 184 ? 32.719  42.839  150.757 1.00 58.70  ? 184 SER A OG  1 
ATOM   1200 N N   . ARG A 1 185 ? 32.622  41.957  147.026 1.00 53.82  ? 185 ARG A N   1 
ATOM   1201 C CA  . ARG A 1 185 ? 32.555  42.176  145.597 1.00 53.94  ? 185 ARG A CA  1 
ATOM   1202 C C   . ARG A 1 185 ? 32.250  40.847  144.918 1.00 52.07  ? 185 ARG A C   1 
ATOM   1203 O O   . ARG A 1 185 ? 31.463  40.791  143.976 1.00 51.63  ? 185 ARG A O   1 
ATOM   1204 C CB  . ARG A 1 185 ? 33.874  42.768  145.082 1.00 56.61  ? 185 ARG A CB  1 
ATOM   1205 C CG  . ARG A 1 185 ? 33.963  44.293  145.245 1.00 62.44  ? 185 ARG A CG  1 
ATOM   1206 C CD  . ARG A 1 185 ? 35.282  44.864  144.730 1.00 66.69  ? 185 ARG A CD  1 
ATOM   1207 N NE  . ARG A 1 185 ? 36.386  44.599  145.652 1.00 71.53  ? 185 ARG A NE  1 
ATOM   1208 C CZ  . ARG A 1 185 ? 37.588  44.164  145.280 1.00 73.36  ? 185 ARG A CZ  1 
ATOM   1209 N NH1 . ARG A 1 185 ? 37.846  43.938  143.998 1.00 75.09  ? 185 ARG A NH1 1 
ATOM   1210 N NH2 . ARG A 1 185 ? 38.535  43.957  146.188 1.00 74.49  ? 185 ARG A NH2 1 
ATOM   1211 N N   . ALA A 1 186 ? 32.851  39.776  145.428 1.00 50.59  ? 186 ALA A N   1 
ATOM   1212 C CA  . ALA A 1 186 ? 32.661  38.445  144.869 1.00 48.78  ? 186 ALA A CA  1 
ATOM   1213 C C   . ALA A 1 186 ? 31.222  37.951  144.966 1.00 48.31  ? 186 ALA A C   1 
ATOM   1214 O O   . ALA A 1 186 ? 30.702  37.382  144.008 1.00 48.02  ? 186 ALA A O   1 
ATOM   1215 C CB  . ALA A 1 186 ? 33.600  37.455  145.546 1.00 47.59  ? 186 ALA A CB  1 
ATOM   1216 N N   . ARG A 1 187 ? 30.573  38.154  146.109 1.00 47.57  ? 187 ARG A N   1 
ATOM   1217 C CA  . ARG A 1 187 ? 29.199  37.699  146.252 1.00 47.95  ? 187 ARG A CA  1 
ATOM   1218 C C   . ARG A 1 187 ? 28.332  38.487  145.285 1.00 48.51  ? 187 ARG A C   1 
ATOM   1219 O O   . ARG A 1 187 ? 27.463  37.930  144.605 1.00 49.31  ? 187 ARG A O   1 
ATOM   1220 C CB  . ARG A 1 187 ? 28.717  37.878  147.691 1.00 49.56  ? 187 ARG A CB  1 
ATOM   1221 C CG  . ARG A 1 187 ? 29.431  36.945  148.662 1.00 55.47  ? 187 ARG A CG  1 
ATOM   1222 C CD  . ARG A 1 187 ? 29.045  37.158  150.118 1.00 57.67  ? 187 ARG A CD  1 
ATOM   1223 N NE  . ARG A 1 187 ? 29.179  38.559  150.495 1.00 62.04  ? 187 ARG A NE  1 
ATOM   1224 C CZ  . ARG A 1 187 ? 29.244  38.995  151.746 1.00 63.52  ? 187 ARG A CZ  1 
ATOM   1225 N NH1 . ARG A 1 187 ? 29.193  38.131  152.751 1.00 65.38  ? 187 ARG A NH1 1 
ATOM   1226 N NH2 . ARG A 1 187 ? 29.346  40.295  151.991 1.00 64.05  ? 187 ARG A NH2 1 
ATOM   1227 N N   . THR A 1 188 ? 28.579  39.788  145.207 1.00 47.17  ? 188 THR A N   1 
ATOM   1228 C CA  . THR A 1 188 ? 27.815  40.621  144.297 1.00 46.41  ? 188 THR A CA  1 
ATOM   1229 C C   . THR A 1 188 ? 28.028  40.095  142.889 1.00 44.75  ? 188 THR A C   1 
ATOM   1230 O O   . THR A 1 188 ? 27.101  39.610  142.243 1.00 44.61  ? 188 THR A O   1 
ATOM   1231 C CB  . THR A 1 188 ? 28.282  42.099  144.331 1.00 48.26  ? 188 THR A CB  1 
ATOM   1232 O OG1 . THR A 1 188 ? 28.067  42.655  145.637 1.00 49.22  ? 188 THR A OG1 1 
ATOM   1233 C CG2 . THR A 1 188 ? 27.511  42.921  143.306 1.00 48.43  ? 188 THR A CG2 1 
ATOM   1234 N N   . LYS A 1 189 ? 29.274  40.179  142.435 1.00 43.53  ? 189 LYS A N   1 
ATOM   1235 C CA  . LYS A 1 189 ? 29.640  39.751  141.098 1.00 43.69  ? 189 LYS A CA  1 
ATOM   1236 C C   . LYS A 1 189 ? 29.004  38.437  140.711 1.00 43.78  ? 189 LYS A C   1 
ATOM   1237 O O   . LYS A 1 189 ? 28.581  38.273  139.574 1.00 44.56  ? 189 LYS A O   1 
ATOM   1238 C CB  . LYS A 1 189 ? 31.157  39.648  140.960 1.00 44.49  ? 189 LYS A CB  1 
ATOM   1239 C CG  . LYS A 1 189 ? 31.606  39.443  139.531 1.00 47.91  ? 189 LYS A CG  1 
ATOM   1240 C CD  . LYS A 1 189 ? 31.032  40.536  138.637 1.00 50.80  ? 189 LYS A CD  1 
ATOM   1241 C CE  . LYS A 1 189 ? 31.318  40.270  137.171 1.00 53.17  ? 189 LYS A CE  1 
ATOM   1242 N NZ  . LYS A 1 189 ? 30.619  41.249  136.276 1.00 55.74  ? 189 LYS A NZ  1 
ATOM   1243 N N   . ALA A 1 190 ? 28.940  37.500  141.649 1.00 43.48  ? 190 ALA A N   1 
ATOM   1244 C CA  . ALA A 1 190 ? 28.329  36.211  141.364 1.00 44.35  ? 190 ALA A CA  1 
ATOM   1245 C C   . ALA A 1 190 ? 26.849  36.447  141.127 1.00 45.95  ? 190 ALA A C   1 
ATOM   1246 O O   . ALA A 1 190 ? 26.305  36.051  140.097 1.00 45.35  ? 190 ALA A O   1 
ATOM   1247 C CB  . ALA A 1 190 ? 28.520  35.265  142.527 1.00 43.69  ? 190 ALA A CB  1 
ATOM   1248 N N   . GLY A 1 191 ? 26.208  37.103  142.094 1.00 47.88  ? 191 GLY A N   1 
ATOM   1249 C CA  . GLY A 1 191 ? 24.793  37.397  141.987 1.00 49.24  ? 191 GLY A CA  1 
ATOM   1250 C C   . GLY A 1 191 ? 24.448  37.996  140.636 1.00 51.12  ? 191 GLY A C   1 
ATOM   1251 O O   . GLY A 1 191 ? 23.358  37.775  140.110 1.00 50.71  ? 191 GLY A O   1 
ATOM   1252 N N   . ASP A 1 192 ? 25.379  38.749  140.062 1.00 51.77  ? 192 ASP A N   1 
ATOM   1253 C CA  . ASP A 1 192 ? 25.132  39.365  138.770 1.00 53.19  ? 192 ASP A CA  1 
ATOM   1254 C C   . ASP A 1 192 ? 25.153  38.337  137.656 1.00 52.71  ? 192 ASP A C   1 
ATOM   1255 O O   . ASP A 1 192 ? 24.304  38.369  136.764 1.00 52.68  ? 192 ASP A O   1 
ATOM   1256 C CB  . ASP A 1 192 ? 26.159  40.466  138.492 1.00 56.18  ? 192 ASP A CB  1 
ATOM   1257 C CG  . ASP A 1 192 ? 26.008  41.653  139.432 1.00 59.29  ? 192 ASP A CG  1 
ATOM   1258 O OD1 . ASP A 1 192 ? 24.890  42.210  139.514 1.00 61.22  ? 192 ASP A OD1 1 
ATOM   1259 O OD2 . ASP A 1 192 ? 27.004  42.034  140.088 1.00 61.23  ? 192 ASP A OD2 1 
ATOM   1260 N N   . LEU A 1 193 ? 26.112  37.419  137.702 1.00 52.42  ? 193 LEU A N   1 
ATOM   1261 C CA  . LEU A 1 193 ? 26.191  36.396  136.668 1.00 52.50  ? 193 LEU A CA  1 
ATOM   1262 C C   . LEU A 1 193 ? 24.879  35.634  136.554 1.00 52.13  ? 193 LEU A C   1 
ATOM   1263 O O   . LEU A 1 193 ? 24.378  35.432  135.452 1.00 52.18  ? 193 LEU A O   1 
ATOM   1264 C CB  . LEU A 1 193 ? 27.346  35.422  136.933 1.00 51.57  ? 193 LEU A CB  1 
ATOM   1265 C CG  . LEU A 1 193 ? 28.757  35.996  136.750 1.00 51.31  ? 193 LEU A CG  1 
ATOM   1266 C CD1 . LEU A 1 193 ? 29.766  34.864  136.670 1.00 50.35  ? 193 LEU A CD1 1 
ATOM   1267 C CD2 . LEU A 1 193 ? 28.813  36.827  135.481 1.00 50.76  ? 193 LEU A CD2 1 
ATOM   1268 N N   . ARG A 1 194 ? 24.312  35.226  137.685 1.00 51.88  ? 194 ARG A N   1 
ATOM   1269 C CA  . ARG A 1 194 ? 23.053  34.496  137.654 1.00 53.12  ? 194 ARG A CA  1 
ATOM   1270 C C   . ARG A 1 194 ? 22.041  35.286  136.847 1.00 53.85  ? 194 ARG A C   1 
ATOM   1271 O O   . ARG A 1 194 ? 21.304  34.727  136.034 1.00 54.59  ? 194 ARG A O   1 
ATOM   1272 C CB  . ARG A 1 194 ? 22.505  34.301  139.060 1.00 53.95  ? 194 ARG A CB  1 
ATOM   1273 C CG  . ARG A 1 194 ? 23.478  33.682  140.023 1.00 55.59  ? 194 ARG A CG  1 
ATOM   1274 C CD  . ARG A 1 194 ? 22.974  33.884  141.423 1.00 56.73  ? 194 ARG A CD  1 
ATOM   1275 N NE  . ARG A 1 194 ? 24.005  33.628  142.413 1.00 57.40  ? 194 ARG A NE  1 
ATOM   1276 C CZ  . ARG A 1 194 ? 23.914  34.016  143.677 1.00 59.59  ? 194 ARG A CZ  1 
ATOM   1277 N NH1 . ARG A 1 194 ? 22.836  34.676  144.091 1.00 59.05  ? 194 ARG A NH1 1 
ATOM   1278 N NH2 . ARG A 1 194 ? 24.902  33.754  144.523 1.00 61.86  ? 194 ARG A NH2 1 
ATOM   1279 N N   . ASP A 1 195 ? 22.011  36.592  137.077 1.00 55.03  ? 195 ASP A N   1 
ATOM   1280 C CA  . ASP A 1 195 ? 21.080  37.461  136.374 1.00 55.96  ? 195 ASP A CA  1 
ATOM   1281 C C   . ASP A 1 195 ? 21.362  37.446  134.887 1.00 55.72  ? 195 ASP A C   1 
ATOM   1282 O O   . ASP A 1 195 ? 20.453  37.624  134.079 1.00 56.60  ? 195 ASP A O   1 
ATOM   1283 C CB  . ASP A 1 195 ? 21.173  38.892  136.902 1.00 58.45  ? 195 ASP A CB  1 
ATOM   1284 C CG  . ASP A 1 195 ? 20.913  38.977  138.394 1.00 61.28  ? 195 ASP A CG  1 
ATOM   1285 O OD1 . ASP A 1 195 ? 19.980  38.294  138.876 1.00 63.13  ? 195 ASP A OD1 1 
ATOM   1286 O OD2 . ASP A 1 195 ? 21.636  39.733  139.083 1.00 62.92  ? 195 ASP A OD2 1 
ATOM   1287 N N   . THR A 1 196 ? 22.623  37.240  134.526 1.00 54.40  ? 196 THR A N   1 
ATOM   1288 C CA  . THR A 1 196 ? 23.006  37.183  133.123 1.00 53.94  ? 196 THR A CA  1 
ATOM   1289 C C   . THR A 1 196 ? 22.763  35.785  132.554 1.00 52.66  ? 196 THR A C   1 
ATOM   1290 O O   . THR A 1 196 ? 22.893  35.557  131.354 1.00 51.71  ? 196 THR A O   1 
ATOM   1291 C CB  . THR A 1 196 ? 24.482  37.578  132.959 1.00 55.11  ? 196 THR A CB  1 
ATOM   1292 O OG1 . THR A 1 196 ? 24.590  38.999  133.076 1.00 56.22  ? 196 THR A OG1 1 
ATOM   1293 C CG2 . THR A 1 196 ? 25.024  37.147  131.608 1.00 56.54  ? 196 THR A CG2 1 
ATOM   1294 N N   . GLY A 1 197 ? 22.395  34.854  133.428 1.00 52.21  ? 197 GLY A N   1 
ATOM   1295 C CA  . GLY A 1 197 ? 22.130  33.494  133.000 1.00 51.91  ? 197 GLY A CA  1 
ATOM   1296 C C   . GLY A 1 197 ? 23.346  32.592  133.037 1.00 51.86  ? 197 GLY A C   1 
ATOM   1297 O O   . GLY A 1 197 ? 23.352  31.513  132.438 1.00 52.75  ? 197 GLY A O   1 
ATOM   1298 N N   . ILE A 1 198 ? 24.388  33.033  133.730 1.00 51.22  ? 198 ILE A N   1 
ATOM   1299 C CA  . ILE A 1 198 ? 25.601  32.240  133.842 1.00 50.92  ? 198 ILE A CA  1 
ATOM   1300 C C   . ILE A 1 198 ? 25.533  31.491  135.158 1.00 50.87  ? 198 ILE A C   1 
ATOM   1301 O O   . ILE A 1 198 ? 25.273  32.076  136.197 1.00 50.95  ? 198 ILE A O   1 
ATOM   1302 C CB  . ILE A 1 198 ? 26.852  33.127  133.791 1.00 50.09  ? 198 ILE A CB  1 
ATOM   1303 C CG1 . ILE A 1 198 ? 26.931  33.802  132.423 1.00 50.69  ? 198 ILE A CG1 1 
ATOM   1304 C CG2 . ILE A 1 198 ? 28.093  32.295  134.017 1.00 50.20  ? 198 ILE A CG2 1 
ATOM   1305 C CD1 . ILE A 1 198 ? 28.145  34.666  132.226 1.00 52.58  ? 198 ILE A CD1 1 
ATOM   1306 N N   . PHE A 1 199 ? 25.750  30.183  135.102 1.00 51.95  ? 199 PHE A N   1 
ATOM   1307 C CA  . PHE A 1 199 ? 25.667  29.343  136.285 1.00 51.89  ? 199 PHE A CA  1 
ATOM   1308 C C   . PHE A 1 199 ? 26.997  28.751  136.706 1.00 50.86  ? 199 PHE A C   1 
ATOM   1309 O O   . PHE A 1 199 ? 27.778  28.282  135.871 1.00 48.66  ? 199 PHE A O   1 
ATOM   1310 C CB  . PHE A 1 199 ? 24.651  28.238  136.022 1.00 55.36  ? 199 PHE A CB  1 
ATOM   1311 C CG  . PHE A 1 199 ? 23.250  28.748  135.875 1.00 60.91  ? 199 PHE A CG  1 
ATOM   1312 C CD1 . PHE A 1 199 ? 22.993  29.922  135.155 1.00 62.69  ? 199 PHE A CD1 1 
ATOM   1313 C CD2 . PHE A 1 199 ? 22.191  28.103  136.505 1.00 63.80  ? 199 PHE A CD2 1 
ATOM   1314 C CE1 . PHE A 1 199 ? 21.707  30.456  135.065 1.00 63.26  ? 199 PHE A CE1 1 
ATOM   1315 C CE2 . PHE A 1 199 ? 20.894  28.621  136.425 1.00 65.56  ? 199 PHE A CE2 1 
ATOM   1316 C CZ  . PHE A 1 199 ? 20.654  29.810  135.703 1.00 65.28  ? 199 PHE A CZ  1 
ATOM   1317 N N   . LEU A 1 200 ? 27.254  28.790  138.011 1.00 49.33  ? 200 LEU A N   1 
ATOM   1318 C CA  . LEU A 1 200 ? 28.489  28.243  138.554 1.00 48.25  ? 200 LEU A CA  1 
ATOM   1319 C C   . LEU A 1 200 ? 28.242  27.047  139.469 1.00 46.73  ? 200 LEU A C   1 
ATOM   1320 O O   . LEU A 1 200 ? 27.384  27.087  140.346 1.00 46.16  ? 200 LEU A O   1 
ATOM   1321 C CB  . LEU A 1 200 ? 29.261  29.315  139.325 1.00 47.91  ? 200 LEU A CB  1 
ATOM   1322 C CG  . LEU A 1 200 ? 30.525  28.750  139.984 1.00 49.97  ? 200 LEU A CG  1 
ATOM   1323 C CD1 . LEU A 1 200 ? 31.626  29.798  140.023 1.00 49.14  ? 200 LEU A CD1 1 
ATOM   1324 C CD2 . LEU A 1 200 ? 30.188  28.239  141.380 1.00 49.59  ? 200 LEU A CD2 1 
ATOM   1325 N N   . ASP A 1 201 ? 29.000  25.981  139.252 1.00 45.21  ? 201 ASP A N   1 
ATOM   1326 C CA  . ASP A 1 201 ? 28.888  24.791  140.074 1.00 44.53  ? 201 ASP A CA  1 
ATOM   1327 C C   . ASP A 1 201 ? 30.211  24.632  140.805 1.00 43.14  ? 201 ASP A C   1 
ATOM   1328 O O   . ASP A 1 201 ? 31.280  24.889  140.243 1.00 43.15  ? 201 ASP A O   1 
ATOM   1329 C CB  . ASP A 1 201 ? 28.604  23.569  139.202 1.00 47.74  ? 201 ASP A CB  1 
ATOM   1330 C CG  . ASP A 1 201 ? 27.271  23.665  138.482 1.00 49.63  ? 201 ASP A CG  1 
ATOM   1331 O OD1 . ASP A 1 201 ? 26.225  23.747  139.168 1.00 50.86  ? 201 ASP A OD1 1 
ATOM   1332 O OD2 . ASP A 1 201 ? 27.273  23.661  137.233 1.00 49.53  ? 201 ASP A OD2 1 
ATOM   1333 N N   . LEU A 1 202 ? 30.147  24.220  142.063 1.00 40.48  ? 202 LEU A N   1 
ATOM   1334 C CA  . LEU A 1 202 ? 31.363  24.052  142.845 1.00 37.58  ? 202 LEU A CA  1 
ATOM   1335 C C   . LEU A 1 202 ? 31.892  22.616  142.954 1.00 36.41  ? 202 LEU A C   1 
ATOM   1336 O O   . LEU A 1 202 ? 31.264  21.733  143.545 1.00 35.13  ? 202 LEU A O   1 
ATOM   1337 C CB  . LEU A 1 202 ? 31.151  24.623  144.249 1.00 36.94  ? 202 LEU A CB  1 
ATOM   1338 C CG  . LEU A 1 202 ? 32.181  24.266  145.324 1.00 35.25  ? 202 LEU A CG  1 
ATOM   1339 C CD1 . LEU A 1 202 ? 33.549  24.768  144.924 1.00 33.78  ? 202 LEU A CD1 1 
ATOM   1340 C CD2 . LEU A 1 202 ? 31.752  24.867  146.634 1.00 34.73  ? 202 LEU A CD2 1 
ATOM   1341 N N   . MET A 1 203 ? 33.054  22.386  142.366 1.00 34.22  ? 203 MET A N   1 
ATOM   1342 C CA  . MET A 1 203 ? 33.672  21.082  142.460 1.00 33.70  ? 203 MET A CA  1 
ATOM   1343 C C   . MET A 1 203 ? 34.698  21.252  143.565 1.00 31.96  ? 203 MET A C   1 
ATOM   1344 O O   . MET A 1 203 ? 35.892  21.309  143.311 1.00 30.38  ? 203 MET A O   1 
ATOM   1345 C CB  . MET A 1 203 ? 34.359  20.698  141.146 1.00 35.71  ? 203 MET A CB  1 
ATOM   1346 C CG  . MET A 1 203 ? 33.401  20.498  139.992 1.00 37.68  ? 203 MET A CG  1 
ATOM   1347 S SD  . MET A 1 203 ? 32.119  19.300  140.406 1.00 42.09  ? 203 MET A SD  1 
ATOM   1348 C CE  . MET A 1 203 ? 30.696  20.431  140.754 1.00 39.46  ? 203 MET A CE  1 
ATOM   1349 N N   . HIS A 1 204 ? 34.224  21.365  144.797 1.00 32.00  ? 204 HIS A N   1 
ATOM   1350 C CA  . HIS A 1 204 ? 35.133  21.537  145.916 1.00 33.61  ? 204 HIS A CA  1 
ATOM   1351 C C   . HIS A 1 204 ? 35.972  20.291  146.144 1.00 34.07  ? 204 HIS A C   1 
ATOM   1352 O O   . HIS A 1 204 ? 35.467  19.176  146.096 1.00 34.06  ? 204 HIS A O   1 
ATOM   1353 C CB  . HIS A 1 204 ? 34.359  21.910  147.179 1.00 33.26  ? 204 HIS A CB  1 
ATOM   1354 C CG  . HIS A 1 204 ? 33.221  20.995  147.483 1.00 33.59  ? 204 HIS A CG  1 
ATOM   1355 N ND1 . HIS A 1 204 ? 32.366  20.529  146.509 1.00 34.31  ? 204 HIS A ND1 1 
ATOM   1356 C CD2 . HIS A 1 204 ? 32.761  20.506  148.658 1.00 34.08  ? 204 HIS A CD2 1 
ATOM   1357 C CE1 . HIS A 1 204 ? 31.426  19.792  147.073 1.00 35.91  ? 204 HIS A CE1 1 
ATOM   1358 N NE2 . HIS A 1 204 ? 31.642  19.763  148.377 1.00 34.46  ? 204 HIS A NE2 1 
ATOM   1359 N N   . LEU A 1 205 ? 37.262  20.501  146.376 1.00 34.59  ? 205 LEU A N   1 
ATOM   1360 C CA  . LEU A 1 205 ? 38.200  19.416  146.595 1.00 35.02  ? 205 LEU A CA  1 
ATOM   1361 C C   . LEU A 1 205 ? 38.621  19.365  148.055 1.00 38.01  ? 205 LEU A C   1 
ATOM   1362 O O   . LEU A 1 205 ? 38.428  20.334  148.800 1.00 37.77  ? 205 LEU A O   1 
ATOM   1363 C CB  . LEU A 1 205 ? 39.406  19.609  145.684 1.00 33.67  ? 205 LEU A CB  1 
ATOM   1364 C CG  . LEU A 1 205 ? 38.970  19.834  144.232 1.00 32.12  ? 205 LEU A CG  1 
ATOM   1365 C CD1 . LEU A 1 205 ? 40.181  19.932  143.323 1.00 34.42  ? 205 LEU A CD1 1 
ATOM   1366 C CD2 . LEU A 1 205 ? 38.082  18.686  143.790 1.00 32.33  ? 205 LEU A CD2 1 
ATOM   1367 N N   . LYS A 1 206 ? 39.202  18.238  148.462 1.00 39.93  ? 206 LYS A N   1 
ATOM   1368 C CA  . LYS A 1 206 ? 39.608  18.057  149.856 1.00 41.56  ? 206 LYS A CA  1 
ATOM   1369 C C   . LYS A 1 206 ? 40.662  19.000  150.410 1.00 41.82  ? 206 LYS A C   1 
ATOM   1370 O O   . LYS A 1 206 ? 41.565  19.453  149.705 1.00 41.31  ? 206 LYS A O   1 
ATOM   1371 C CB  . LYS A 1 206 ? 40.076  16.624  150.105 1.00 41.73  ? 206 LYS A CB  1 
ATOM   1372 C CG  . LYS A 1 206 ? 40.366  16.365  151.564 1.00 43.86  ? 206 LYS A CG  1 
ATOM   1373 C CD  . LYS A 1 206 ? 40.706  14.929  151.841 1.00 45.79  ? 206 LYS A CD  1 
ATOM   1374 C CE  . LYS A 1 206 ? 40.694  14.678  153.331 1.00 46.29  ? 206 LYS A CE  1 
ATOM   1375 N NZ  . LYS A 1 206 ? 40.726  13.217  153.597 1.00 50.85  ? 206 LYS A NZ  1 
ATOM   1376 N N   . LYS A 1 207 ? 40.533  19.267  151.702 1.00 43.43  ? 207 LYS A N   1 
ATOM   1377 C CA  . LYS A 1 207 ? 41.449  20.133  152.421 1.00 45.38  ? 207 LYS A CA  1 
ATOM   1378 C C   . LYS A 1 207 ? 41.503  19.638  153.865 1.00 45.35  ? 207 LYS A C   1 
ATOM   1379 O O   . LYS A 1 207 ? 40.497  19.165  154.402 1.00 43.43  ? 207 LYS A O   1 
ATOM   1380 C CB  . LYS A 1 207 ? 40.938  21.575  152.390 1.00 47.23  ? 207 LYS A CB  1 
ATOM   1381 C CG  . LYS A 1 207 ? 42.012  22.620  152.611 1.00 52.65  ? 207 LYS A CG  1 
ATOM   1382 C CD  . LYS A 1 207 ? 41.412  24.013  152.769 1.00 57.15  ? 207 LYS A CD  1 
ATOM   1383 C CE  . LYS A 1 207 ? 42.495  25.080  152.828 1.00 57.13  ? 207 LYS A CE  1 
ATOM   1384 N NZ  . LYS A 1 207 ? 41.891  26.389  153.199 1.00 60.90  ? 207 LYS A NZ  1 
ATOM   1385 N N   . PRO A 1 208 ? 42.684  19.717  154.506 1.00 45.88  ? 208 PRO A N   1 
ATOM   1386 C CA  . PRO A 1 208 ? 42.814  19.271  155.893 1.00 45.77  ? 208 PRO A CA  1 
ATOM   1387 C C   . PRO A 1 208 ? 41.754  19.894  156.791 1.00 46.16  ? 208 PRO A C   1 
ATOM   1388 O O   . PRO A 1 208 ? 41.671  21.118  156.939 1.00 45.87  ? 208 PRO A O   1 
ATOM   1389 C CB  . PRO A 1 208 ? 44.237  19.697  156.270 1.00 45.72  ? 208 PRO A CB  1 
ATOM   1390 C CG  . PRO A 1 208 ? 44.613  20.723  155.238 1.00 44.93  ? 208 PRO A CG  1 
ATOM   1391 C CD  . PRO A 1 208 ? 43.982  20.183  153.995 1.00 46.32  ? 208 PRO A CD  1 
ATOM   1392 N N   . GLY A 1 209 ? 40.932  19.028  157.374 1.00 46.47  ? 209 GLY A N   1 
ATOM   1393 C CA  . GLY A 1 209 ? 39.875  19.475  158.255 1.00 46.47  ? 209 GLY A CA  1 
ATOM   1394 C C   . GLY A 1 209 ? 38.507  19.370  157.619 1.00 46.93  ? 209 GLY A C   1 
ATOM   1395 O O   . GLY A 1 209 ? 37.497  19.358  158.327 1.00 47.89  ? 209 GLY A O   1 
ATOM   1396 N N   . GLY A 1 210 ? 38.478  19.287  156.289 1.00 46.24  ? 210 GLY A N   1 
ATOM   1397 C CA  . GLY A 1 210 ? 37.223  19.199  155.557 1.00 47.19  ? 210 GLY A CA  1 
ATOM   1398 C C   . GLY A 1 210 ? 37.066  20.378  154.603 1.00 48.05  ? 210 GLY A C   1 
ATOM   1399 O O   . GLY A 1 210 ? 38.062  20.943  154.155 1.00 51.19  ? 210 GLY A O   1 
ATOM   1400 N N   . PHE A 1 211 ? 35.832  20.746  154.273 1.00 45.84  ? 211 PHE A N   1 
ATOM   1401 C CA  . PHE A 1 211 ? 35.583  21.880  153.387 1.00 44.50  ? 211 PHE A CA  1 
ATOM   1402 C C   . PHE A 1 211 ? 34.185  22.367  153.689 1.00 45.55  ? 211 PHE A C   1 
ATOM   1403 O O   . PHE A 1 211 ? 33.201  21.770  153.244 1.00 45.95  ? 211 PHE A O   1 
ATOM   1404 C CB  . PHE A 1 211 ? 35.675  21.475  151.909 1.00 42.58  ? 211 PHE A CB  1 
ATOM   1405 C CG  . PHE A 1 211 ? 35.486  22.634  150.935 1.00 40.02  ? 211 PHE A CG  1 
ATOM   1406 C CD1 . PHE A 1 211 ? 36.549  23.089  150.144 1.00 38.65  ? 211 PHE A CD1 1 
ATOM   1407 C CD2 . PHE A 1 211 ? 34.243  23.253  150.786 1.00 37.52  ? 211 PHE A CD2 1 
ATOM   1408 C CE1 . PHE A 1 211 ? 36.373  24.138  149.223 1.00 34.47  ? 211 PHE A CE1 1 
ATOM   1409 C CE2 . PHE A 1 211 ? 34.063  24.300  149.867 1.00 34.74  ? 211 PHE A CE2 1 
ATOM   1410 C CZ  . PHE A 1 211 ? 35.129  24.739  149.088 1.00 32.93  ? 211 PHE A CZ  1 
ATOM   1411 N N   . ASP A 1 212 ? 34.095  23.450  154.451 1.00 45.40  ? 212 ASP A N   1 
ATOM   1412 C CA  . ASP A 1 212 ? 32.801  24.005  154.816 1.00 46.61  ? 212 ASP A CA  1 
ATOM   1413 C C   . ASP A 1 212 ? 32.209  24.865  153.694 1.00 46.79  ? 212 ASP A C   1 
ATOM   1414 O O   . ASP A 1 212 ? 32.697  25.962  153.410 1.00 46.93  ? 212 ASP A O   1 
ATOM   1415 C CB  . ASP A 1 212 ? 32.928  24.837  156.095 1.00 47.63  ? 212 ASP A CB  1 
ATOM   1416 C CG  . ASP A 1 212 ? 31.575  25.220  156.683 1.00 49.42  ? 212 ASP A CG  1 
ATOM   1417 O OD1 . ASP A 1 212 ? 30.699  25.688  155.922 1.00 48.76  ? 212 ASP A OD1 1 
ATOM   1418 O OD2 . ASP A 1 212 ? 31.391  25.063  157.910 1.00 51.25  ? 212 ASP A OD2 1 
ATOM   1419 N N   . ILE A 1 213 ? 31.151  24.372  153.062 1.00 45.59  ? 213 ILE A N   1 
ATOM   1420 C CA  . ILE A 1 213 ? 30.520  25.119  151.992 1.00 45.73  ? 213 ILE A CA  1 
ATOM   1421 C C   . ILE A 1 213 ? 29.782  26.336  152.540 1.00 45.84  ? 213 ILE A C   1 
ATOM   1422 O O   . ILE A 1 213 ? 29.737  27.383  151.891 1.00 47.35  ? 213 ILE A O   1 
ATOM   1423 C CB  . ILE A 1 213 ? 29.542  24.216  151.186 1.00 46.30  ? 213 ILE A CB  1 
ATOM   1424 C CG1 . ILE A 1 213 ? 30.342  23.134  150.455 1.00 48.23  ? 213 ILE A CG1 1 
ATOM   1425 C CG2 . ILE A 1 213 ? 28.759  25.032  150.166 1.00 43.26  ? 213 ILE A CG2 1 
ATOM   1426 C CD1 . ILE A 1 213 ? 29.528  22.261  149.525 1.00 48.71  ? 213 ILE A CD1 1 
ATOM   1427 N N   . SER A 1 214 ? 29.238  26.215  153.746 1.00 44.69  ? 214 SER A N   1 
ATOM   1428 C CA  . SER A 1 214 ? 28.477  27.305  154.357 1.00 44.31  ? 214 SER A CA  1 
ATOM   1429 C C   . SER A 1 214 ? 29.243  28.592  154.713 1.00 43.31  ? 214 SER A C   1 
ATOM   1430 O O   . SER A 1 214 ? 28.630  29.601  155.067 1.00 42.55  ? 214 SER A O   1 
ATOM   1431 C CB  . SER A 1 214 ? 27.749  26.791  155.607 1.00 45.41  ? 214 SER A CB  1 
ATOM   1432 O OG  . SER A 1 214 ? 28.659  26.549  156.669 1.00 45.75  ? 214 SER A OG  1 
ATOM   1433 N N   . LEU A 1 215 ? 30.569  28.567  154.618 1.00 42.58  ? 215 LEU A N   1 
ATOM   1434 C CA  . LEU A 1 215 ? 31.376  29.749  154.945 1.00 41.84  ? 215 LEU A CA  1 
ATOM   1435 C C   . LEU A 1 215 ? 31.449  30.767  153.816 1.00 41.17  ? 215 LEU A C   1 
ATOM   1436 O O   . LEU A 1 215 ? 31.785  31.925  154.040 1.00 40.98  ? 215 LEU A O   1 
ATOM   1437 C CB  . LEU A 1 215 ? 32.813  29.353  155.292 1.00 41.84  ? 215 LEU A CB  1 
ATOM   1438 C CG  . LEU A 1 215 ? 33.039  28.211  156.275 1.00 41.39  ? 215 LEU A CG  1 
ATOM   1439 C CD1 . LEU A 1 215 ? 34.524  28.071  156.514 1.00 41.99  ? 215 LEU A CD1 1 
ATOM   1440 C CD2 . LEU A 1 215 ? 32.300  28.476  157.574 1.00 41.70  ? 215 LEU A CD2 1 
ATOM   1441 N N   . PHE A 1 216 ? 31.158  30.343  152.596 1.00 40.11  ? 216 PHE A N   1 
ATOM   1442 C CA  . PHE A 1 216 ? 31.245  31.276  151.505 1.00 39.89  ? 216 PHE A CA  1 
ATOM   1443 C C   . PHE A 1 216 ? 30.490  30.900  150.246 1.00 42.36  ? 216 PHE A C   1 
ATOM   1444 O O   . PHE A 1 216 ? 29.503  31.548  149.890 1.00 41.59  ? 216 PHE A O   1 
ATOM   1445 C CB  . PHE A 1 216 ? 32.707  31.501  151.160 1.00 37.68  ? 216 PHE A CB  1 
ATOM   1446 C CG  . PHE A 1 216 ? 32.912  32.496  150.071 1.00 35.58  ? 216 PHE A CG  1 
ATOM   1447 C CD1 . PHE A 1 216 ? 32.329  33.756  150.156 1.00 33.67  ? 216 PHE A CD1 1 
ATOM   1448 C CD2 . PHE A 1 216 ? 33.700  32.188  148.974 1.00 34.09  ? 216 PHE A CD2 1 
ATOM   1449 C CE1 . PHE A 1 216 ? 32.527  34.694  149.173 1.00 32.39  ? 216 PHE A CE1 1 
ATOM   1450 C CE2 . PHE A 1 216 ? 33.907  33.125  147.977 1.00 35.00  ? 216 PHE A CE2 1 
ATOM   1451 C CZ  . PHE A 1 216 ? 33.318  34.384  148.079 1.00 34.55  ? 216 PHE A CZ  1 
ATOM   1452 N N   . TYR A 1 217 ? 30.962  29.856  149.566 1.00 44.99  ? 217 TYR A N   1 
ATOM   1453 C CA  . TYR A 1 217 ? 30.346  29.418  148.320 1.00 45.37  ? 217 TYR A CA  1 
ATOM   1454 C C   . TYR A 1 217 ? 28.850  29.196  148.414 1.00 48.24  ? 217 TYR A C   1 
ATOM   1455 O O   . TYR A 1 217 ? 28.162  29.104  147.402 1.00 47.33  ? 217 TYR A O   1 
ATOM   1456 C CB  . TYR A 1 217 ? 31.063  28.183  147.800 1.00 41.45  ? 217 TYR A CB  1 
ATOM   1457 C CG  . TYR A 1 217 ? 32.435  28.548  147.312 1.00 37.80  ? 217 TYR A CG  1 
ATOM   1458 C CD1 . TYR A 1 217 ? 33.540  28.383  148.120 1.00 36.45  ? 217 TYR A CD1 1 
ATOM   1459 C CD2 . TYR A 1 217 ? 32.612  29.158  146.075 1.00 35.90  ? 217 TYR A CD2 1 
ATOM   1460 C CE1 . TYR A 1 217 ? 34.778  28.817  147.718 1.00 35.50  ? 217 TYR A CE1 1 
ATOM   1461 C CE2 . TYR A 1 217 ? 33.852  29.597  145.665 1.00 33.53  ? 217 TYR A CE2 1 
ATOM   1462 C CZ  . TYR A 1 217 ? 34.925  29.422  146.492 1.00 34.05  ? 217 TYR A CZ  1 
ATOM   1463 O OH  . TYR A 1 217 ? 36.168  29.840  146.108 1.00 36.07  ? 217 TYR A OH  1 
ATOM   1464 N N   . ARG A 1 218 ? 28.360  29.130  149.644 1.00 51.83  ? 218 ARG A N   1 
ATOM   1465 C CA  . ARG A 1 218 ? 26.944  28.977  149.915 1.00 55.76  ? 218 ARG A CA  1 
ATOM   1466 C C   . ARG A 1 218 ? 26.173  30.051  149.133 1.00 56.26  ? 218 ARG A C   1 
ATOM   1467 O O   . ARG A 1 218 ? 25.211  29.747  148.430 1.00 56.46  ? 218 ARG A O   1 
ATOM   1468 C CB  . ARG A 1 218 ? 26.712  29.152  151.414 1.00 60.49  ? 218 ARG A CB  1 
ATOM   1469 C CG  . ARG A 1 218 ? 25.262  29.273  151.827 1.00 67.79  ? 218 ARG A CG  1 
ATOM   1470 C CD  . ARG A 1 218 ? 25.151  29.497  153.335 1.00 73.02  ? 218 ARG A CD  1 
ATOM   1471 N NE  . ARG A 1 218 ? 23.793  29.251  153.815 1.00 78.28  ? 218 ARG A NE  1 
ATOM   1472 C CZ  . ARG A 1 218 ? 23.505  28.722  155.001 1.00 81.57  ? 218 ARG A CZ  1 
ATOM   1473 N NH1 . ARG A 1 218 ? 24.484  28.382  155.837 1.00 81.75  ? 218 ARG A NH1 1 
ATOM   1474 N NH2 . ARG A 1 218 ? 22.237  28.515  155.346 1.00 83.84  ? 218 ARG A NH2 1 
ATOM   1475 N N   . ASP A 1 219 ? 26.609  31.304  149.256 1.00 56.82  ? 219 ASP A N   1 
ATOM   1476 C CA  . ASP A 1 219 ? 25.962  32.424  148.567 1.00 57.48  ? 219 ASP A CA  1 
ATOM   1477 C C   . ASP A 1 219 ? 26.572  32.665  147.189 1.00 57.08  ? 219 ASP A C   1 
ATOM   1478 O O   . ASP A 1 219 ? 26.488  33.766  146.651 1.00 57.20  ? 219 ASP A O   1 
ATOM   1479 C CB  . ASP A 1 219 ? 26.113  33.699  149.391 1.00 59.28  ? 219 ASP A CB  1 
ATOM   1480 C CG  . ASP A 1 219 ? 25.751  33.499  150.840 1.00 61.73  ? 219 ASP A CG  1 
ATOM   1481 O OD1 . ASP A 1 219 ? 24.556  33.262  151.131 1.00 62.65  ? 219 ASP A OD1 1 
ATOM   1482 O OD2 . ASP A 1 219 ? 26.667  33.574  151.688 1.00 63.50  ? 219 ASP A OD2 1 
ATOM   1483 N N   . ILE A 1 220 ? 27.177  31.635  146.616 1.00 56.66  ? 220 ILE A N   1 
ATOM   1484 C CA  . ILE A 1 220 ? 27.818  31.777  145.322 1.00 56.00  ? 220 ILE A CA  1 
ATOM   1485 C C   . ILE A 1 220 ? 27.392  30.759  144.268 1.00 56.40  ? 220 ILE A C   1 
ATOM   1486 O O   . ILE A 1 220 ? 27.235  31.111  143.099 1.00 54.99  ? 220 ILE A O   1 
ATOM   1487 C CB  . ILE A 1 220 ? 29.344  31.745  145.506 1.00 55.67  ? 220 ILE A CB  1 
ATOM   1488 C CG1 . ILE A 1 220 ? 29.781  33.091  146.082 1.00 54.83  ? 220 ILE A CG1 1 
ATOM   1489 C CG2 . ILE A 1 220 ? 30.044  31.379  144.198 1.00 53.30  ? 220 ILE A CG2 1 
ATOM   1490 C CD1 . ILE A 1 220 ? 31.247  33.265  146.184 1.00 55.44  ? 220 ILE A CD1 1 
ATOM   1491 N N   . ILE A 1 221 ? 27.212  29.507  144.683 1.00 56.60  ? 221 ILE A N   1 
ATOM   1492 C CA  . ILE A 1 221 ? 26.793  28.441  143.779 1.00 57.26  ? 221 ILE A CA  1 
ATOM   1493 C C   . ILE A 1 221 ? 25.345  28.663  143.334 1.00 59.01  ? 221 ILE A C   1 
ATOM   1494 O O   . ILE A 1 221 ? 24.574  29.314  144.028 1.00 59.20  ? 221 ILE A O   1 
ATOM   1495 C CB  . ILE A 1 221 ? 26.895  27.075  144.464 1.00 55.70  ? 221 ILE A CB  1 
ATOM   1496 C CG1 . ILE A 1 221 ? 25.961  27.039  145.670 1.00 55.21  ? 221 ILE A CG1 1 
ATOM   1497 C CG2 . ILE A 1 221 ? 28.326  26.809  144.885 1.00 54.56  ? 221 ILE A CG2 1 
ATOM   1498 C CD1 . ILE A 1 221 ? 26.065  25.775  146.473 1.00 54.47  ? 221 ILE A CD1 1 
ATOM   1499 N N   . SER A 1 222 ? 24.974  28.103  142.187 1.00 61.88  ? 222 SER A N   1 
ATOM   1500 C CA  . SER A 1 222 ? 23.625  28.273  141.648 1.00 65.30  ? 222 SER A CA  1 
ATOM   1501 C C   . SER A 1 222 ? 22.632  27.152  141.973 1.00 68.27  ? 222 SER A C   1 
ATOM   1502 O O   . SER A 1 222 ? 22.949  25.967  141.840 1.00 68.66  ? 222 SER A O   1 
ATOM   1503 C CB  . SER A 1 222 ? 23.704  28.455  140.125 1.00 63.83  ? 222 SER A CB  1 
ATOM   1504 O OG  . SER A 1 222 ? 24.497  29.580  139.770 1.00 62.92  ? 222 SER A OG  1 
ATOM   1505 N N   . ILE A 1 223 ? 21.428  27.548  142.394 1.00 70.80  ? 223 ILE A N   1 
ATOM   1506 C CA  . ILE A 1 223 ? 20.348  26.604  142.726 1.00 72.42  ? 223 ILE A CA  1 
ATOM   1507 C C   . ILE A 1 223 ? 18.988  27.233  142.401 1.00 72.02  ? 223 ILE A C   1 
ATOM   1508 O O   . ILE A 1 223 ? 18.844  28.465  142.494 1.00 72.50  ? 223 ILE A O   1 
ATOM   1509 C CB  . ILE A 1 223 ? 20.370  26.247  144.224 1.00 73.96  ? 223 ILE A CB  1 
ATOM   1510 C CG1 . ILE A 1 223 ? 20.498  27.519  145.069 1.00 74.52  ? 223 ILE A CG1 1 
ATOM   1511 C CG2 . ILE A 1 223 ? 21.504  25.274  144.516 1.00 74.56  ? 223 ILE A CG2 1 
ATOM   1512 C CD1 . ILE A 1 223 ? 20.579  27.276  146.569 1.00 74.29  ? 223 ILE A CD1 1 
ATOM   1513 N N   . VAL A 1 231 ? 20.284  17.789  148.422 1.00 51.09  ? 231 VAL A N   1 
ATOM   1514 C CA  . VAL A 1 231 ? 21.454  18.408  149.042 1.00 51.96  ? 231 VAL A CA  1 
ATOM   1515 C C   . VAL A 1 231 ? 22.605  18.485  148.055 1.00 52.38  ? 231 VAL A C   1 
ATOM   1516 O O   . VAL A 1 231 ? 22.504  17.971  146.938 1.00 51.74  ? 231 VAL A O   1 
ATOM   1517 C CB  . VAL A 1 231 ? 21.928  17.634  150.287 1.00 51.83  ? 231 VAL A CB  1 
ATOM   1518 C CG1 . VAL A 1 231 ? 20.942  17.903  151.422 1.00 51.44  ? 231 VAL A CG1 1 
ATOM   1519 C CG2 . VAL A 1 231 ? 22.002  16.131  149.947 1.00 51.46  ? 231 VAL A CG2 1 
ATOM   1520 N N   . HIS A 1 232 ? 23.688  19.131  148.479 1.00 53.23  ? 232 HIS A N   1 
ATOM   1521 C CA  . HIS A 1 232 ? 24.871  19.328  147.648 1.00 53.86  ? 232 HIS A CA  1 
ATOM   1522 C C   . HIS A 1 232 ? 25.830  18.137  147.653 1.00 53.21  ? 232 HIS A C   1 
ATOM   1523 O O   . HIS A 1 232 ? 25.721  17.229  148.471 1.00 53.07  ? 232 HIS A O   1 
ATOM   1524 C CB  . HIS A 1 232 ? 25.611  20.599  148.111 1.00 55.66  ? 232 HIS A CB  1 
ATOM   1525 C CG  . HIS A 1 232 ? 26.613  21.128  147.121 1.00 56.52  ? 232 HIS A CG  1 
ATOM   1526 N ND1 . HIS A 1 232 ? 27.803  20.492  146.843 1.00 57.14  ? 232 HIS A ND1 1 
ATOM   1527 C CD2 . HIS A 1 232 ? 26.600  22.250  146.360 1.00 55.78  ? 232 HIS A CD2 1 
ATOM   1528 C CE1 . HIS A 1 232 ? 28.483  21.200  145.955 1.00 57.21  ? 232 HIS A CE1 1 
ATOM   1529 N NE2 . HIS A 1 232 ? 27.775  22.270  145.647 1.00 55.74  ? 232 HIS A NE2 1 
ATOM   1530 N N   . PHE A 1 233 ? 26.773  18.154  146.720 1.00 53.03  ? 233 PHE A N   1 
ATOM   1531 C CA  . PHE A 1 233 ? 27.770  17.097  146.597 1.00 53.38  ? 233 PHE A CA  1 
ATOM   1532 C C   . PHE A 1 233 ? 28.775  17.107  147.743 1.00 52.97  ? 233 PHE A C   1 
ATOM   1533 O O   . PHE A 1 233 ? 29.021  18.139  148.359 1.00 52.49  ? 233 PHE A O   1 
ATOM   1534 C CB  . PHE A 1 233 ? 28.542  17.258  145.284 1.00 54.27  ? 233 PHE A CB  1 
ATOM   1535 C CG  . PHE A 1 233 ? 27.822  16.737  144.079 1.00 53.94  ? 233 PHE A CG  1 
ATOM   1536 C CD1 . PHE A 1 233 ? 26.445  16.530  144.099 1.00 54.67  ? 233 PHE A CD1 1 
ATOM   1537 C CD2 . PHE A 1 233 ? 28.524  16.471  142.913 1.00 52.97  ? 233 PHE A CD2 1 
ATOM   1538 C CE1 . PHE A 1 233 ? 25.781  16.065  142.973 1.00 53.63  ? 233 PHE A CE1 1 
ATOM   1539 C CE2 . PHE A 1 233 ? 27.872  16.010  141.786 1.00 53.90  ? 233 PHE A CE2 1 
ATOM   1540 C CZ  . PHE A 1 233 ? 26.496  15.805  141.813 1.00 54.03  ? 233 PHE A CZ  1 
ATOM   1541 N N   . GLU A 1 234 ? 29.356  15.946  148.015 1.00 52.54  ? 234 GLU A N   1 
ATOM   1542 C CA  . GLU A 1 234 ? 30.369  15.812  149.053 1.00 51.78  ? 234 GLU A CA  1 
ATOM   1543 C C   . GLU A 1 234 ? 31.679  16.316  148.453 1.00 50.21  ? 234 GLU A C   1 
ATOM   1544 O O   . GLU A 1 234 ? 31.786  16.465  147.236 1.00 48.78  ? 234 GLU A O   1 
ATOM   1545 C CB  . GLU A 1 234 ? 30.528  14.340  149.449 1.00 53.60  ? 234 GLU A CB  1 
ATOM   1546 C CG  . GLU A 1 234 ? 29.369  13.763  150.239 1.00 55.39  ? 234 GLU A CG  1 
ATOM   1547 C CD  . GLU A 1 234 ? 29.142  14.530  151.522 1.00 57.33  ? 234 GLU A CD  1 
ATOM   1548 O OE1 . GLU A 1 234 ? 30.155  14.967  152.119 1.00 57.47  ? 234 GLU A OE1 1 
ATOM   1549 O OE2 . GLU A 1 234 ? 27.965  14.690  151.931 1.00 57.08  ? 234 GLU A OE2 1 
ATOM   1550 N N   . GLU A 1 235 ? 32.673  16.575  149.297 1.00 48.85  ? 235 GLU A N   1 
ATOM   1551 C CA  . GLU A 1 235 ? 33.954  17.047  148.794 1.00 47.56  ? 235 GLU A CA  1 
ATOM   1552 C C   . GLU A 1 235 ? 34.665  15.888  148.129 1.00 46.72  ? 235 GLU A C   1 
ATOM   1553 O O   . GLU A 1 235 ? 34.587  14.761  148.593 1.00 46.65  ? 235 GLU A O   1 
ATOM   1554 C CB  . GLU A 1 235 ? 34.817  17.616  149.922 1.00 47.80  ? 235 GLU A CB  1 
ATOM   1555 C CG  . GLU A 1 235 ? 35.190  16.628  151.001 1.00 49.07  ? 235 GLU A CG  1 
ATOM   1556 C CD  . GLU A 1 235 ? 36.059  17.254  152.072 1.00 50.34  ? 235 GLU A CD  1 
ATOM   1557 O OE1 . GLU A 1 235 ? 37.248  17.543  151.806 1.00 51.99  ? 235 GLU A OE1 1 
ATOM   1558 O OE2 . GLU A 1 235 ? 35.545  17.470  153.184 1.00 51.11  ? 235 GLU A OE2 1 
ATOM   1559 N N   . SER A 1 236 ? 35.355  16.174  147.034 1.00 46.97  ? 236 SER A N   1 
ATOM   1560 C CA  . SER A 1 236 ? 36.073  15.154  146.286 1.00 47.54  ? 236 SER A CA  1 
ATOM   1561 C C   . SER A 1 236 ? 37.514  14.997  146.749 1.00 47.91  ? 236 SER A C   1 
ATOM   1562 O O   . SER A 1 236 ? 38.280  15.962  146.765 1.00 47.43  ? 236 SER A O   1 
ATOM   1563 C CB  . SER A 1 236 ? 36.059  15.493  144.791 1.00 46.78  ? 236 SER A CB  1 
ATOM   1564 O OG  . SER A 1 236 ? 34.732  15.535  144.300 1.00 47.33  ? 236 SER A OG  1 
ATOM   1565 N N   . SER A 1 237 ? 37.877  13.772  147.119 1.00 48.73  ? 237 SER A N   1 
ATOM   1566 C CA  . SER A 1 237 ? 39.236  13.484  147.559 1.00 49.79  ? 237 SER A CA  1 
ATOM   1567 C C   . SER A 1 237 ? 39.882  12.482  146.604 1.00 49.38  ? 237 SER A C   1 
ATOM   1568 O O   . SER A 1 237 ? 41.098  12.323  146.585 1.00 49.68  ? 237 SER A O   1 
ATOM   1569 C CB  . SER A 1 237 ? 39.233  12.917  148.981 1.00 50.13  ? 237 SER A CB  1 
ATOM   1570 O OG  . SER A 1 237 ? 38.713  11.604  148.989 1.00 51.91  ? 237 SER A OG  1 
ATOM   1571 N N   . LYS A 1 238 ? 39.060  11.810  145.809 1.00 49.67  ? 238 LYS A N   1 
ATOM   1572 C CA  . LYS A 1 238 ? 39.559  10.828  144.852 1.00 49.64  ? 238 LYS A CA  1 
ATOM   1573 C C   . LYS A 1 238 ? 39.170  11.215  143.439 1.00 48.64  ? 238 LYS A C   1 
ATOM   1574 O O   . LYS A 1 238 ? 38.094  11.757  143.213 1.00 48.91  ? 238 LYS A O   1 
ATOM   1575 C CB  . LYS A 1 238 ? 38.976  9.445   145.134 1.00 50.63  ? 238 LYS A CB  1 
ATOM   1576 C CG  . LYS A 1 238 ? 39.295  8.843   146.482 1.00 52.05  ? 238 LYS A CG  1 
ATOM   1577 C CD  . LYS A 1 238 ? 38.530  7.548   146.592 1.00 54.79  ? 238 LYS A CD  1 
ATOM   1578 C CE  . LYS A 1 238 ? 38.850  6.788   147.846 1.00 58.32  ? 238 LYS A CE  1 
ATOM   1579 N NZ  . LYS A 1 238 ? 38.053  5.522   147.875 1.00 61.89  ? 238 LYS A NZ  1 
ATOM   1580 N N   . LEU A 1 239 ? 40.040  10.916  142.484 1.00 48.02  ? 239 LEU A N   1 
ATOM   1581 C CA  . LEU A 1 239 ? 39.748  11.222  141.101 1.00 47.86  ? 239 LEU A CA  1 
ATOM   1582 C C   . LEU A 1 239 ? 38.471  10.497  140.657 1.00 48.73  ? 239 LEU A C   1 
ATOM   1583 O O   . LEU A 1 239 ? 37.721  10.995  139.818 1.00 48.16  ? 239 LEU A O   1 
ATOM   1584 C CB  . LEU A 1 239 ? 40.933  10.821  140.228 1.00 46.42  ? 239 LEU A CB  1 
ATOM   1585 C CG  . LEU A 1 239 ? 40.780  11.081  138.728 1.00 47.66  ? 239 LEU A CG  1 
ATOM   1586 C CD1 . LEU A 1 239 ? 40.114  12.421  138.463 1.00 47.24  ? 239 LEU A CD1 1 
ATOM   1587 C CD2 . LEU A 1 239 ? 42.150  11.043  138.084 1.00 48.87  ? 239 LEU A CD2 1 
ATOM   1588 N N   . GLU A 1 240 ? 38.210  9.333   141.244 1.00 50.87  ? 240 GLU A N   1 
ATOM   1589 C CA  . GLU A 1 240 ? 37.022  8.543   140.901 1.00 52.30  ? 240 GLU A CA  1 
ATOM   1590 C C   . GLU A 1 240 ? 35.708  9.276   141.187 1.00 50.29  ? 240 GLU A C   1 
ATOM   1591 O O   . GLU A 1 240 ? 34.795  9.255   140.369 1.00 49.53  ? 240 GLU A O   1 
ATOM   1592 C CB  . GLU A 1 240 ? 37.007  7.216   141.666 1.00 55.93  ? 240 GLU A CB  1 
ATOM   1593 C CG  . GLU A 1 240 ? 38.366  6.737   142.156 1.00 62.17  ? 240 GLU A CG  1 
ATOM   1594 C CD  . GLU A 1 240 ? 38.301  5.346   142.787 1.00 66.00  ? 240 GLU A CD  1 
ATOM   1595 O OE1 . GLU A 1 240 ? 37.407  5.109   143.638 1.00 66.41  ? 240 GLU A OE1 1 
ATOM   1596 O OE2 . GLU A 1 240 ? 39.153  4.495   142.433 1.00 67.52  ? 240 GLU A OE2 1 
ATOM   1597 N N   . ASP A 1 241 ? 35.606  9.913   142.349 1.00 47.80  ? 241 ASP A N   1 
ATOM   1598 C CA  . ASP A 1 241 ? 34.384  10.625  142.693 1.00 45.12  ? 241 ASP A CA  1 
ATOM   1599 C C   . ASP A 1 241 ? 34.311  11.977  142.025 1.00 43.38  ? 241 ASP A C   1 
ATOM   1600 O O   . ASP A 1 241 ? 33.221  12.475  141.761 1.00 42.24  ? 241 ASP A O   1 
ATOM   1601 C CB  . ASP A 1 241 ? 34.270  10.801  144.199 1.00 45.91  ? 241 ASP A CB  1 
ATOM   1602 C CG  . ASP A 1 241 ? 34.377  9.490   144.940 1.00 45.84  ? 241 ASP A CG  1 
ATOM   1603 O OD1 . ASP A 1 241 ? 33.684  8.521   144.553 1.00 45.73  ? 241 ASP A OD1 1 
ATOM   1604 O OD2 . ASP A 1 241 ? 35.153  9.431   145.912 1.00 46.15  ? 241 ASP A OD2 1 
ATOM   1605 N N   . LEU A 1 242 ? 35.465  12.572  141.739 1.00 41.39  ? 242 LEU A N   1 
ATOM   1606 C CA  . LEU A 1 242 ? 35.459  13.873  141.096 1.00 40.38  ? 242 LEU A CA  1 
ATOM   1607 C C   . LEU A 1 242 ? 34.924  13.767  139.684 1.00 41.70  ? 242 LEU A C   1 
ATOM   1608 O O   . LEU A 1 242 ? 34.129  14.602  139.256 1.00 41.42  ? 242 LEU A O   1 
ATOM   1609 C CB  . LEU A 1 242 ? 36.855  14.484  141.065 1.00 37.76  ? 242 LEU A CB  1 
ATOM   1610 C CG  . LEU A 1 242 ? 36.889  15.900  140.478 1.00 33.09  ? 242 LEU A CG  1 
ATOM   1611 C CD1 . LEU A 1 242 ? 35.829  16.771  141.105 1.00 29.95  ? 242 LEU A CD1 1 
ATOM   1612 C CD2 . LEU A 1 242 ? 38.253  16.485  140.699 1.00 32.03  ? 242 LEU A CD2 1 
ATOM   1613 N N   . LEU A 1 243 ? 35.357  12.738  138.962 1.00 43.27  ? 243 LEU A N   1 
ATOM   1614 C CA  . LEU A 1 243 ? 34.897  12.530  137.593 1.00 45.84  ? 243 LEU A CA  1 
ATOM   1615 C C   . LEU A 1 243 ? 33.391  12.268  137.581 1.00 46.88  ? 243 LEU A C   1 
ATOM   1616 O O   . LEU A 1 243 ? 32.659  12.807  136.745 1.00 45.88  ? 243 LEU A O   1 
ATOM   1617 C CB  . LEU A 1 243 ? 35.630  11.343  136.955 1.00 47.01  ? 243 LEU A CB  1 
ATOM   1618 C CG  . LEU A 1 243 ? 36.440  11.626  135.685 1.00 47.36  ? 243 LEU A CG  1 
ATOM   1619 C CD1 . LEU A 1 243 ? 36.982  10.323  135.109 1.00 47.47  ? 243 LEU A CD1 1 
ATOM   1620 C CD2 . LEU A 1 243 ? 35.553  12.325  134.668 1.00 47.96  ? 243 LEU A CD2 1 
ATOM   1621 N N   . ARG A 1 244 ? 32.939  11.439  138.517 1.00 47.67  ? 244 ARG A N   1 
ATOM   1622 C CA  . ARG A 1 244 ? 31.530  11.101  138.630 1.00 49.63  ? 244 ARG A CA  1 
ATOM   1623 C C   . ARG A 1 244 ? 30.724  12.367  138.854 1.00 50.68  ? 244 ARG A C   1 
ATOM   1624 O O   . ARG A 1 244 ? 29.630  12.538  138.317 1.00 51.18  ? 244 ARG A O   1 
ATOM   1625 C CB  . ARG A 1 244 ? 31.328  10.120  139.788 1.00 50.41  ? 244 ARG A CB  1 
ATOM   1626 C CG  . ARG A 1 244 ? 32.005  8.774   139.533 1.00 51.79  ? 244 ARG A CG  1 
ATOM   1627 C CD  . ARG A 1 244 ? 31.867  7.779   140.683 1.00 52.08  ? 244 ARG A CD  1 
ATOM   1628 N NE  . ARG A 1 244 ? 32.490  6.490   140.356 1.00 50.04  ? 244 ARG A NE  1 
ATOM   1629 C CZ  . ARG A 1 244 ? 32.761  5.539   141.246 1.00 49.81  ? 244 ARG A CZ  1 
ATOM   1630 N NH1 . ARG A 1 244 ? 32.470  5.721   142.527 1.00 52.01  ? 244 ARG A NH1 1 
ATOM   1631 N NH2 . ARG A 1 244 ? 33.317  4.401   140.858 1.00 50.24  ? 244 ARG A NH2 1 
ATOM   1632 N N   . LYS A 1 245 ? 31.288  13.268  139.644 1.00 51.76  ? 245 LYS A N   1 
ATOM   1633 C CA  . LYS A 1 245 ? 30.626  14.521  139.939 1.00 51.99  ? 245 LYS A CA  1 
ATOM   1634 C C   . LYS A 1 245 ? 30.677  15.415  138.719 1.00 52.45  ? 245 LYS A C   1 
ATOM   1635 O O   . LYS A 1 245 ? 29.711  16.117  138.418 1.00 53.79  ? 245 LYS A O   1 
ATOM   1636 C CB  . LYS A 1 245 ? 31.297  15.191  141.140 1.00 51.73  ? 245 LYS A CB  1 
ATOM   1637 C CG  . LYS A 1 245 ? 31.074  14.424  142.437 1.00 50.43  ? 245 LYS A CG  1 
ATOM   1638 C CD  . LYS A 1 245 ? 31.957  14.909  143.563 1.00 50.31  ? 245 LYS A CD  1 
ATOM   1639 C CE  . LYS A 1 245 ? 31.772  14.040  144.793 1.00 50.82  ? 245 LYS A CE  1 
ATOM   1640 N NZ  . LYS A 1 245 ? 32.776  14.349  145.839 1.00 51.70  ? 245 LYS A NZ  1 
ATOM   1641 N N   . VAL A 1 246 ? 31.797  15.386  138.005 1.00 52.36  ? 246 VAL A N   1 
ATOM   1642 C CA  . VAL A 1 246 ? 31.924  16.213  136.814 1.00 51.97  ? 246 VAL A CA  1 
ATOM   1643 C C   . VAL A 1 246 ? 30.992  15.684  135.725 1.00 51.31  ? 246 VAL A C   1 
ATOM   1644 O O   . VAL A 1 246 ? 30.213  16.443  135.153 1.00 50.72  ? 246 VAL A O   1 
ATOM   1645 C CB  . VAL A 1 246 ? 33.385  16.249  136.283 1.00 51.85  ? 246 VAL A CB  1 
ATOM   1646 C CG1 . VAL A 1 246 ? 33.459  17.140  135.051 1.00 52.08  ? 246 VAL A CG1 1 
ATOM   1647 C CG2 . VAL A 1 246 ? 34.327  16.786  137.352 1.00 50.59  ? 246 VAL A CG2 1 
ATOM   1648 N N   . ARG A 1 247 ? 31.059  14.382  135.454 1.00 51.33  ? 247 ARG A N   1 
ATOM   1649 C CA  . ARG A 1 247 ? 30.206  13.773  134.438 1.00 52.09  ? 247 ARG A CA  1 
ATOM   1650 C C   . ARG A 1 247 ? 28.753  14.122  134.685 1.00 53.12  ? 247 ARG A C   1 
ATOM   1651 O O   . ARG A 1 247 ? 28.013  14.426  133.752 1.00 54.50  ? 247 ARG A O   1 
ATOM   1652 C CB  . ARG A 1 247 ? 30.353  12.253  134.443 1.00 52.40  ? 247 ARG A CB  1 
ATOM   1653 C CG  . ARG A 1 247 ? 31.633  11.743  133.826 1.00 54.25  ? 247 ARG A CG  1 
ATOM   1654 C CD  . ARG A 1 247 ? 31.812  10.259  134.085 1.00 54.32  ? 247 ARG A CD  1 
ATOM   1655 N NE  . ARG A 1 247 ? 33.057  9.766   133.502 1.00 57.57  ? 247 ARG A NE  1 
ATOM   1656 C CZ  . ARG A 1 247 ? 33.629  8.610   133.824 1.00 58.46  ? 247 ARG A CZ  1 
ATOM   1657 N NH1 . ARG A 1 247 ? 33.065  7.822   134.732 1.00 59.30  ? 247 ARG A NH1 1 
ATOM   1658 N NH2 . ARG A 1 247 ? 34.767  8.248   133.243 1.00 57.93  ? 247 ARG A NH2 1 
ATOM   1659 N N   . ALA A 1 248 ? 28.348  14.075  135.950 1.00 53.40  ? 248 ALA A N   1 
ATOM   1660 C CA  . ALA A 1 248 ? 26.978  14.382  136.339 1.00 52.89  ? 248 ALA A CA  1 
ATOM   1661 C C   . ALA A 1 248 ? 26.575  15.842  136.096 1.00 53.66  ? 248 ALA A C   1 
ATOM   1662 O O   . ALA A 1 248 ? 25.431  16.217  136.343 1.00 53.97  ? 248 ALA A O   1 
ATOM   1663 C CB  . ALA A 1 248 ? 26.776  14.025  137.803 1.00 51.95  ? 248 ALA A CB  1 
ATOM   1664 N N   . LYS A 1 249 ? 27.499  16.669  135.613 1.00 54.40  ? 249 LYS A N   1 
ATOM   1665 C CA  . LYS A 1 249 ? 27.182  18.073  135.355 1.00 55.47  ? 249 LYS A CA  1 
ATOM   1666 C C   . LYS A 1 249 ? 27.792  18.647  134.073 1.00 55.74  ? 249 LYS A C   1 
ATOM   1667 O O   . LYS A 1 249 ? 27.526  19.794  133.705 1.00 54.43  ? 249 LYS A O   1 
ATOM   1668 C CB  . LYS A 1 249 ? 27.603  18.930  136.548 1.00 55.75  ? 249 LYS A CB  1 
ATOM   1669 C CG  . LYS A 1 249 ? 26.761  18.722  137.784 1.00 54.65  ? 249 LYS A CG  1 
ATOM   1670 C CD  . LYS A 1 249 ? 26.857  19.934  138.683 1.00 56.52  ? 249 LYS A CD  1 
ATOM   1671 C CE  . LYS A 1 249 ? 25.759  19.933  139.727 1.00 57.07  ? 249 LYS A CE  1 
ATOM   1672 N NZ  . LYS A 1 249 ? 25.827  21.141  140.592 1.00 59.24  ? 249 LYS A NZ  1 
ATOM   1673 N N   . GLU A 1 250 ? 28.601  17.840  133.394 1.00 57.14  ? 250 GLU A N   1 
ATOM   1674 C CA  . GLU A 1 250 ? 29.250  18.264  132.156 1.00 58.85  ? 250 GLU A CA  1 
ATOM   1675 C C   . GLU A 1 250 ? 28.220  18.505  131.067 1.00 58.59  ? 250 GLU A C   1 
ATOM   1676 O O   . GLU A 1 250 ? 28.502  19.167  130.075 1.00 58.92  ? 250 GLU A O   1 
ATOM   1677 C CB  . GLU A 1 250 ? 30.237  17.199  131.659 1.00 59.66  ? 250 GLU A CB  1 
ATOM   1678 C CG  . GLU A 1 250 ? 29.559  15.984  131.032 1.00 62.01  ? 250 GLU A CG  1 
ATOM   1679 C CD  . GLU A 1 250 ? 30.514  15.087  130.259 1.00 63.25  ? 250 GLU A CD  1 
ATOM   1680 O OE1 . GLU A 1 250 ? 31.455  14.540  130.880 1.00 64.24  ? 250 GLU A OE1 1 
ATOM   1681 O OE2 . GLU A 1 250 ? 30.317  14.929  129.030 1.00 62.32  ? 250 GLU A OE2 1 
ATOM   1682 N N   . THR A 1 251 ? 27.028  17.949  131.249 1.00 59.80  ? 251 THR A N   1 
ATOM   1683 C CA  . THR A 1 251 ? 25.957  18.095  130.270 1.00 60.16  ? 251 THR A CA  1 
ATOM   1684 C C   . THR A 1 251 ? 24.694  18.589  130.946 1.00 59.91  ? 251 THR A C   1 
ATOM   1685 O O   . THR A 1 251 ? 24.591  18.590  132.171 1.00 59.90  ? 251 THR A O   1 
ATOM   1686 C CB  . THR A 1 251 ? 25.649  16.750  129.558 1.00 60.95  ? 251 THR A CB  1 
ATOM   1687 O OG1 . THR A 1 251 ? 26.803  16.314  128.824 1.00 61.97  ? 251 THR A OG1 1 
ATOM   1688 C CG2 . THR A 1 251 ? 24.488  16.905  128.590 1.00 61.78  ? 251 THR A CG2 1 
ATOM   1689 N N   . ARG A 1 252 ? 23.736  19.017  130.137 1.00 60.78  ? 252 ARG A N   1 
ATOM   1690 C CA  . ARG A 1 252 ? 22.476  19.519  130.652 1.00 61.64  ? 252 ARG A CA  1 
ATOM   1691 C C   . ARG A 1 252 ? 21.332  18.694  130.072 1.00 58.88  ? 252 ARG A C   1 
ATOM   1692 O O   . ARG A 1 252 ? 21.390  18.263  128.920 1.00 58.44  ? 252 ARG A O   1 
ATOM   1693 C CB  . ARG A 1 252 ? 22.308  20.998  130.276 1.00 66.31  ? 252 ARG A CB  1 
ATOM   1694 C CG  . ARG A 1 252 ? 23.463  21.905  130.715 1.00 71.60  ? 252 ARG A CG  1 
ATOM   1695 C CD  . ARG A 1 252 ? 24.717  21.701  129.848 1.00 76.74  ? 252 ARG A CD  1 
ATOM   1696 N NE  . ARG A 1 252 ? 25.849  22.520  130.293 1.00 81.56  ? 252 ARG A NE  1 
ATOM   1697 C CZ  . ARG A 1 252 ? 27.050  22.538  129.712 1.00 83.10  ? 252 ARG A CZ  1 
ATOM   1698 N NH1 . ARG A 1 252 ? 27.302  21.780  128.646 1.00 82.62  ? 252 ARG A NH1 1 
ATOM   1699 N NH2 . ARG A 1 252 ? 28.004  23.324  130.203 1.00 83.53  ? 252 ARG A NH2 1 
ATOM   1700 N N   . LYS A 1 253 ? 20.305  18.467  130.883 1.00 55.75  ? 253 LYS A N   1 
ATOM   1701 C CA  . LYS A 1 253 ? 19.144  17.705  130.457 1.00 53.03  ? 253 LYS A CA  1 
ATOM   1702 C C   . LYS A 1 253 ? 18.791  17.976  129.002 1.00 52.68  ? 253 LYS A C   1 
ATOM   1703 O O   . LYS A 1 253 ? 18.705  19.130  128.581 1.00 53.62  ? 253 LYS A O   1 
ATOM   1704 C CB  . LYS A 1 253 ? 17.921  18.068  131.294 1.00 51.79  ? 253 LYS A CB  1 
ATOM   1705 C CG  . LYS A 1 253 ? 17.798  17.419  132.637 1.00 49.23  ? 253 LYS A CG  1 
ATOM   1706 C CD  . LYS A 1 253 ? 16.325  17.393  132.995 1.00 50.52  ? 253 LYS A CD  1 
ATOM   1707 C CE  . LYS A 1 253 ? 16.027  18.088  134.310 1.00 52.88  ? 253 LYS A CE  1 
ATOM   1708 N NZ  . LYS A 1 253 ? 14.545  18.161  134.540 1.00 53.99  ? 253 LYS A NZ  1 
ATOM   1709 N N   . ARG A 1 254 ? 18.586  16.903  128.244 1.00 51.83  ? 254 ARG A N   1 
ATOM   1710 C CA  . ARG A 1 254 ? 18.186  16.983  126.842 1.00 50.43  ? 254 ARG A CA  1 
ATOM   1711 C C   . ARG A 1 254 ? 17.105  15.917  126.634 1.00 47.64  ? 254 ARG A C   1 
ATOM   1712 O O   . ARG A 1 254 ? 17.394  14.721  126.598 1.00 45.71  ? 254 ARG A O   1 
ATOM   1713 C CB  . ARG A 1 254 ? 19.375  16.717  125.901 1.00 53.55  ? 254 ARG A CB  1 
ATOM   1714 C CG  . ARG A 1 254 ? 20.547  17.687  126.047 1.00 56.61  ? 254 ARG A CG  1 
ATOM   1715 C CD  . ARG A 1 254 ? 21.609  17.521  124.941 1.00 57.06  ? 254 ARG A CD  1 
ATOM   1716 N NE  . ARG A 1 254 ? 22.848  18.232  125.274 1.00 58.78  ? 254 ARG A NE  1 
ATOM   1717 C CZ  . ARG A 1 254 ? 23.897  18.359  124.462 1.00 59.31  ? 254 ARG A CZ  1 
ATOM   1718 N NH1 . ARG A 1 254 ? 23.880  17.827  123.249 1.00 59.73  ? 254 ARG A NH1 1 
ATOM   1719 N NH2 . ARG A 1 254 ? 24.971  19.017  124.868 1.00 59.00  ? 254 ARG A NH2 1 
ATOM   1720 N N   . ALA A 1 255 ? 15.856  16.353  126.517 1.00 46.10  ? 255 ALA A N   1 
ATOM   1721 C CA  . ALA A 1 255 ? 14.750  15.424  126.322 1.00 45.44  ? 255 ALA A CA  1 
ATOM   1722 C C   . ALA A 1 255 ? 14.735  14.868  124.914 1.00 44.56  ? 255 ALA A C   1 
ATOM   1723 O O   . ALA A 1 255 ? 15.148  15.528  123.970 1.00 45.39  ? 255 ALA A O   1 
ATOM   1724 C CB  . ALA A 1 255 ? 13.422  16.105  126.614 1.00 43.54  ? 255 ALA A CB  1 
ATOM   1725 N N   . LEU A 1 256 ? 14.263  13.640  124.777 1.00 43.60  ? 256 LEU A N   1 
ATOM   1726 C CA  . LEU A 1 256 ? 14.187  13.026  123.474 1.00 42.92  ? 256 LEU A CA  1 
ATOM   1727 C C   . LEU A 1 256 ? 12.990  13.669  122.807 1.00 42.44  ? 256 LEU A C   1 
ATOM   1728 O O   . LEU A 1 256 ? 12.928  13.825  121.588 1.00 41.85  ? 256 LEU A O   1 
ATOM   1729 C CB  . LEU A 1 256 ? 13.964  11.526  123.617 1.00 44.13  ? 256 LEU A CB  1 
ATOM   1730 C CG  . LEU A 1 256 ? 14.092  10.794  122.289 1.00 45.12  ? 256 LEU A CG  1 
ATOM   1731 C CD1 . LEU A 1 256 ? 15.449  11.120  121.673 1.00 45.66  ? 256 LEU A CD1 1 
ATOM   1732 C CD2 . LEU A 1 256 ? 13.924  9.302   122.503 1.00 46.00  ? 256 LEU A CD2 1 
ATOM   1733 N N   . SER A 1 257 ? 12.039  14.055  123.643 1.00 42.10  ? 257 SER A N   1 
ATOM   1734 C CA  . SER A 1 257 ? 10.822  14.684  123.179 1.00 42.23  ? 257 SER A CA  1 
ATOM   1735 C C   . SER A 1 257 ? 9.962   15.056  124.374 1.00 42.85  ? 257 SER A C   1 
ATOM   1736 O O   . SER A 1 257 ? 10.382  14.954  125.527 1.00 43.30  ? 257 SER A O   1 
ATOM   1737 C CB  . SER A 1 257 ? 10.046  13.732  122.266 1.00 41.96  ? 257 SER A CB  1 
ATOM   1738 O OG  . SER A 1 257 ? 9.489   12.648  122.995 1.00 40.47  ? 257 SER A OG  1 
ATOM   1739 N N   . ARG A 1 258 ? 8.747   15.485  124.081 1.00 43.86  ? 258 ARG A N   1 
ATOM   1740 C CA  . ARG A 1 258 ? 7.797   15.878  125.103 1.00 46.17  ? 258 ARG A CA  1 
ATOM   1741 C C   . ARG A 1 258 ? 6.472   15.381  124.580 1.00 44.90  ? 258 ARG A C   1 
ATOM   1742 O O   . ARG A 1 258 ? 6.137   15.608  123.418 1.00 45.36  ? 258 ARG A O   1 
ATOM   1743 C CB  . ARG A 1 258 ? 7.817   17.402  125.258 1.00 49.62  ? 258 ARG A CB  1 
ATOM   1744 C CG  . ARG A 1 258 ? 9.193   17.880  125.673 1.00 54.50  ? 258 ARG A CG  1 
ATOM   1745 C CD  . ARG A 1 258 ? 9.387   19.376  125.706 1.00 57.89  ? 258 ARG A CD  1 
ATOM   1746 N NE  . ARG A 1 258 ? 10.739  19.659  126.184 1.00 61.32  ? 258 ARG A NE  1 
ATOM   1747 C CZ  . ARG A 1 258 ? 11.231  20.871  126.408 1.00 65.51  ? 258 ARG A CZ  1 
ATOM   1748 N NH1 . ARG A 1 258 ? 10.487  21.955  126.197 1.00 67.43  ? 258 ARG A NH1 1 
ATOM   1749 N NH2 . ARG A 1 258 ? 12.471  20.998  126.864 1.00 66.89  ? 258 ARG A NH2 1 
ATOM   1750 N N   . LEU A 1 259 ? 5.724   14.685  125.422 1.00 42.86  ? 259 LEU A N   1 
ATOM   1751 C CA  . LEU A 1 259 ? 4.460   14.134  124.974 1.00 41.31  ? 259 LEU A CA  1 
ATOM   1752 C C   . LEU A 1 259 ? 3.321   14.306  125.951 1.00 41.27  ? 259 LEU A C   1 
ATOM   1753 O O   . LEU A 1 259 ? 3.509   14.668  127.111 1.00 40.55  ? 259 LEU A O   1 
ATOM   1754 C CB  . LEU A 1 259 ? 4.611   12.643  124.695 1.00 39.75  ? 259 LEU A CB  1 
ATOM   1755 C CG  . LEU A 1 259 ? 5.697   12.146  123.754 1.00 37.78  ? 259 LEU A CG  1 
ATOM   1756 C CD1 . LEU A 1 259 ? 5.742   10.644  123.896 1.00 36.73  ? 259 LEU A CD1 1 
ATOM   1757 C CD2 . LEU A 1 259 ? 5.429   12.565  122.305 1.00 36.64  ? 259 LEU A CD2 1 
ATOM   1758 N N   . LYS A 1 260 ? 2.129   14.019  125.456 1.00 40.95  ? 260 LYS A N   1 
ATOM   1759 C CA  . LYS A 1 260 ? 0.947   14.102  126.270 1.00 41.57  ? 260 LYS A CA  1 
ATOM   1760 C C   . LYS A 1 260 ? 0.737   12.719  126.853 1.00 41.21  ? 260 LYS A C   1 
ATOM   1761 O O   . LYS A 1 260 ? 0.571   11.745  126.124 1.00 42.10  ? 260 LYS A O   1 
ATOM   1762 C CB  . LYS A 1 260 ? -0.275  14.486  125.422 1.00 43.10  ? 260 LYS A CB  1 
ATOM   1763 C CG  . LYS A 1 260 ? -0.157  15.818  124.675 1.00 46.32  ? 260 LYS A CG  1 
ATOM   1764 C CD  . LYS A 1 260 ? -1.377  16.090  123.769 1.00 46.58  ? 260 LYS A CD  1 
ATOM   1765 C CE  . LYS A 1 260 ? -1.180  17.342  122.902 1.00 45.86  ? 260 LYS A CE  1 
ATOM   1766 N NZ  . LYS A 1 260 ? -2.316  17.589  121.963 1.00 43.76  ? 260 LYS A NZ  1 
ATOM   1767 N N   . LEU A 1 261 ? 0.784   12.623  128.169 1.00 40.26  ? 261 LEU A N   1 
ATOM   1768 C CA  . LEU A 1 261 ? 0.524   11.353  128.816 1.00 39.90  ? 261 LEU A CA  1 
ATOM   1769 C C   . LEU A 1 261 ? -0.939  11.506  129.206 1.00 40.37  ? 261 LEU A C   1 
ATOM   1770 O O   . LEU A 1 261 ? -1.263  12.055  130.260 1.00 40.48  ? 261 LEU A O   1 
ATOM   1771 C CB  . LEU A 1 261 ? 1.402   11.191  130.050 1.00 38.93  ? 261 LEU A CB  1 
ATOM   1772 C CG  . LEU A 1 261 ? 1.286   9.884   130.828 1.00 37.58  ? 261 LEU A CG  1 
ATOM   1773 C CD1 . LEU A 1 261 ? 2.358   9.849   131.902 1.00 36.99  ? 261 LEU A CD1 1 
ATOM   1774 C CD2 . LEU A 1 261 ? -0.080  9.771   131.455 1.00 37.15  ? 261 LEU A CD2 1 
ATOM   1775 N N   . LYS A 1 262 ? -1.825  11.053  128.331 1.00 40.13  ? 262 LYS A N   1 
ATOM   1776 C CA  . LYS A 1 262 ? -3.250  11.176  128.578 1.00 39.69  ? 262 LYS A CA  1 
ATOM   1777 C C   . LYS A 1 262 ? -3.752  10.105  129.521 1.00 39.13  ? 262 LYS A C   1 
ATOM   1778 O O   . LYS A 1 262 ? -3.565  8.926   129.256 1.00 39.30  ? 262 LYS A O   1 
ATOM   1779 C CB  . LYS A 1 262 ? -3.996  11.082  127.253 1.00 39.72  ? 262 LYS A CB  1 
ATOM   1780 C CG  . LYS A 1 262 ? -3.434  12.004  126.191 1.00 40.62  ? 262 LYS A CG  1 
ATOM   1781 C CD  . LYS A 1 262 ? -4.012  11.707  124.825 1.00 42.32  ? 262 LYS A CD  1 
ATOM   1782 C CE  . LYS A 1 262 ? -3.237  12.451  123.742 1.00 43.78  ? 262 LYS A CE  1 
ATOM   1783 N NZ  . LYS A 1 262 ? -3.361  11.794  122.400 1.00 44.31  ? 262 LYS A NZ  1 
ATOM   1784 N N   . LEU A 1 263 ? -4.374  10.510  130.628 1.00 39.76  ? 263 LEU A N   1 
ATOM   1785 C CA  . LEU A 1 263 ? -4.929  9.533   131.564 1.00 40.40  ? 263 LEU A CA  1 
ATOM   1786 C C   . LEU A 1 263 ? -6.269  9.104   130.992 1.00 42.32  ? 263 LEU A C   1 
ATOM   1787 O O   . LEU A 1 263 ? -6.806  8.060   131.357 1.00 42.04  ? 263 LEU A O   1 
ATOM   1788 C CB  . LEU A 1 263 ? -5.102  10.115  132.972 1.00 38.46  ? 263 LEU A CB  1 
ATOM   1789 C CG  . LEU A 1 263 ? -3.808  10.350  133.766 1.00 37.56  ? 263 LEU A CG  1 
ATOM   1790 C CD1 . LEU A 1 263 ? -4.095  10.413  135.254 1.00 38.15  ? 263 LEU A CD1 1 
ATOM   1791 C CD2 . LEU A 1 263 ? -2.857  9.219   133.521 1.00 37.74  ? 263 LEU A CD2 1 
ATOM   1792 N N   . ASN A 1 264 ? -6.785  9.934   130.084 1.00 43.99  ? 264 ASN A N   1 
ATOM   1793 C CA  . ASN A 1 264 ? -8.029  9.704   129.350 1.00 46.17  ? 264 ASN A CA  1 
ATOM   1794 C C   . ASN A 1 264 ? -8.085  10.830  128.340 1.00 48.15  ? 264 ASN A C   1 
ATOM   1795 O O   . ASN A 1 264 ? -7.192  11.674  128.315 1.00 48.04  ? 264 ASN A O   1 
ATOM   1796 C CB  . ASN A 1 264 ? -9.284  9.732   130.247 1.00 48.13  ? 264 ASN A CB  1 
ATOM   1797 C CG  . ASN A 1 264 ? -9.682  11.142  130.703 1.00 49.14  ? 264 ASN A CG  1 
ATOM   1798 O OD1 . ASN A 1 264 ? -9.346  12.149  130.076 1.00 51.33  ? 264 ASN A OD1 1 
ATOM   1799 N ND2 . ASN A 1 264 ? -10.431 11.205  131.795 1.00 48.18  ? 264 ASN A ND2 1 
ATOM   1800 N N   . LYS A 1 265 ? -9.124  10.852  127.516 1.00 50.16  ? 265 LYS A N   1 
ATOM   1801 C CA  . LYS A 1 265 ? -9.258  11.892  126.509 1.00 52.89  ? 265 LYS A CA  1 
ATOM   1802 C C   . LYS A 1 265 ? -8.825  13.258  127.009 1.00 54.42  ? 265 LYS A C   1 
ATOM   1803 O O   . LYS A 1 265 ? -7.974  13.905  126.398 1.00 55.11  ? 265 LYS A O   1 
ATOM   1804 C CB  . LYS A 1 265 ? -10.705 11.986  126.030 1.00 54.67  ? 265 LYS A CB  1 
ATOM   1805 C CG  . LYS A 1 265 ? -11.153 10.813  125.203 1.00 57.81  ? 265 LYS A CG  1 
ATOM   1806 C CD  . LYS A 1 265 ? -11.517 11.260  123.799 1.00 60.46  ? 265 LYS A CD  1 
ATOM   1807 C CE  . LYS A 1 265 ? -11.798 10.065  122.894 1.00 62.05  ? 265 LYS A CE  1 
ATOM   1808 N NZ  . LYS A 1 265 ? -12.123 10.479  121.495 1.00 63.93  ? 265 LYS A NZ  1 
ATOM   1809 N N   . ASP A 1 266 ? -9.406  13.690  128.125 1.00 55.74  ? 266 ASP A N   1 
ATOM   1810 C CA  . ASP A 1 266 ? -9.116  15.008  128.677 1.00 57.40  ? 266 ASP A CA  1 
ATOM   1811 C C   . ASP A 1 266 ? -8.009  15.131  129.708 1.00 57.24  ? 266 ASP A C   1 
ATOM   1812 O O   . ASP A 1 266 ? -7.057  15.883  129.493 1.00 59.80  ? 266 ASP A O   1 
ATOM   1813 C CB  . ASP A 1 266 ? -10.390 15.625  129.241 1.00 60.39  ? 266 ASP A CB  1 
ATOM   1814 C CG  . ASP A 1 266 ? -10.733 16.939  128.570 1.00 63.54  ? 266 ASP A CG  1 
ATOM   1815 O OD1 . ASP A 1 266 ? -10.028 17.946  128.817 1.00 63.88  ? 266 ASP A OD1 1 
ATOM   1816 O OD2 . ASP A 1 266 ? -11.701 16.958  127.778 1.00 66.53  ? 266 ASP A OD2 1 
ATOM   1817 N N   . ILE A 1 267 ? -8.136  14.435  130.835 1.00 55.09  ? 267 ILE A N   1 
ATOM   1818 C CA  . ILE A 1 267 ? -7.102  14.494  131.870 1.00 52.31  ? 267 ILE A CA  1 
ATOM   1819 C C   . ILE A 1 267 ? -5.733  14.192  131.246 1.00 50.34  ? 267 ILE A C   1 
ATOM   1820 O O   . ILE A 1 267 ? -5.380  13.030  131.044 1.00 50.30  ? 267 ILE A O   1 
ATOM   1821 C CB  . ILE A 1 267 ? -7.378  13.465  132.965 1.00 52.21  ? 267 ILE A CB  1 
ATOM   1822 C CG1 . ILE A 1 267 ? -8.850  13.548  133.385 1.00 51.60  ? 267 ILE A CG1 1 
ATOM   1823 C CG2 . ILE A 1 267 ? -6.437  13.701  134.140 1.00 52.06  ? 267 ILE A CG2 1 
ATOM   1824 C CD1 . ILE A 1 267 ? -9.236  12.557  134.485 1.00 52.17  ? 267 ILE A CD1 1 
ATOM   1825 N N   . VAL A 1 268 ? -4.968  15.237  130.947 1.00 47.42  ? 268 VAL A N   1 
ATOM   1826 C CA  . VAL A 1 268 ? -3.667  15.065  130.314 1.00 45.30  ? 268 VAL A CA  1 
ATOM   1827 C C   . VAL A 1 268 ? -2.540  15.799  131.009 1.00 46.01  ? 268 VAL A C   1 
ATOM   1828 O O   . VAL A 1 268 ? -2.725  16.918  131.476 1.00 46.87  ? 268 VAL A O   1 
ATOM   1829 C CB  . VAL A 1 268 ? -3.691  15.575  128.874 1.00 43.81  ? 268 VAL A CB  1 
ATOM   1830 C CG1 . VAL A 1 268 ? -2.287  15.532  128.292 1.00 42.76  ? 268 VAL A CG1 1 
ATOM   1831 C CG2 . VAL A 1 268 ? -4.659  14.754  128.044 1.00 43.14  ? 268 VAL A CG2 1 
ATOM   1832 N N   . ILE A 1 269 ? -1.366  15.176  131.061 1.00 45.95  ? 269 ILE A N   1 
ATOM   1833 C CA  . ILE A 1 269 ? -0.198  15.813  131.668 1.00 46.02  ? 269 ILE A CA  1 
ATOM   1834 C C   . ILE A 1 269 ? 0.964   15.714  130.687 1.00 45.75  ? 269 ILE A C   1 
ATOM   1835 O O   . ILE A 1 269 ? 1.072   14.740  129.948 1.00 46.15  ? 269 ILE A O   1 
ATOM   1836 C CB  . ILE A 1 269 ? 0.197   15.147  133.005 1.00 45.77  ? 269 ILE A CB  1 
ATOM   1837 C CG1 . ILE A 1 269 ? 1.070   13.926  132.759 1.00 45.14  ? 269 ILE A CG1 1 
ATOM   1838 C CG2 . ILE A 1 269 ? -1.056  14.716  133.755 1.00 46.05  ? 269 ILE A CG2 1 
ATOM   1839 C CD1 . ILE A 1 269 ? 1.422   13.179  134.033 1.00 47.44  ? 269 ILE A CD1 1 
ATOM   1840 N N   . SER A 1 270 ? 1.820   16.729  130.665 1.00 44.96  ? 270 SER A N   1 
ATOM   1841 C CA  . SER A 1 270 ? 2.959   16.733  129.755 1.00 43.86  ? 270 SER A CA  1 
ATOM   1842 C C   . SER A 1 270 ? 4.182   16.151  130.432 1.00 42.21  ? 270 SER A C   1 
ATOM   1843 O O   . SER A 1 270 ? 4.469   16.462  131.586 1.00 42.44  ? 270 SER A O   1 
ATOM   1844 C CB  . SER A 1 270 ? 3.288   18.156  129.302 1.00 45.71  ? 270 SER A CB  1 
ATOM   1845 O OG  . SER A 1 270 ? 3.830   18.905  130.378 1.00 49.52  ? 270 SER A OG  1 
ATOM   1846 N N   . VAL A 1 271 ? 4.904   15.305  129.709 1.00 39.77  ? 271 VAL A N   1 
ATOM   1847 C CA  . VAL A 1 271 ? 6.110   14.699  130.245 1.00 37.40  ? 271 VAL A CA  1 
ATOM   1848 C C   . VAL A 1 271 ? 7.231   14.802  129.222 1.00 36.53  ? 271 VAL A C   1 
ATOM   1849 O O   . VAL A 1 271 ? 6.990   14.971  128.024 1.00 36.25  ? 271 VAL A O   1 
ATOM   1850 C CB  . VAL A 1 271 ? 5.906   13.195  130.605 1.00 37.11  ? 271 VAL A CB  1 
ATOM   1851 C CG1 . VAL A 1 271 ? 4.786   13.038  131.594 1.00 35.19  ? 271 VAL A CG1 1 
ATOM   1852 C CG2 . VAL A 1 271 ? 5.603   12.395  129.362 1.00 37.84  ? 271 VAL A CG2 1 
ATOM   1853 N N   . GLY A 1 272 ? 8.461   14.719  129.714 1.00 36.10  ? 272 GLY A N   1 
ATOM   1854 C CA  . GLY A 1 272 ? 9.620   14.767  128.847 1.00 34.88  ? 272 GLY A CA  1 
ATOM   1855 C C   . GLY A 1 272 ? 10.159  13.353  128.759 1.00 34.89  ? 272 GLY A C   1 
ATOM   1856 O O   . GLY A 1 272 ? 10.301  12.663  129.776 1.00 35.77  ? 272 GLY A O   1 
ATOM   1857 N N   . ILE A 1 273 ? 10.435  12.894  127.548 1.00 32.72  ? 273 ILE A N   1 
ATOM   1858 C CA  . ILE A 1 273 ? 10.965  11.554  127.388 1.00 30.92  ? 273 ILE A CA  1 
ATOM   1859 C C   . ILE A 1 273 ? 12.472  11.653  127.212 1.00 31.21  ? 273 ILE A C   1 
ATOM   1860 O O   . ILE A 1 273 ? 12.948  12.306  126.288 1.00 29.39  ? 273 ILE A O   1 
ATOM   1861 C CB  . ILE A 1 273 ? 10.348  10.865  126.171 1.00 29.85  ? 273 ILE A CB  1 
ATOM   1862 C CG1 . ILE A 1 273 ? 8.830   10.796  126.331 1.00 26.47  ? 273 ILE A CG1 1 
ATOM   1863 C CG2 . ILE A 1 273 ? 10.928  9.481   126.018 1.00 28.32  ? 273 ILE A CG2 1 
ATOM   1864 C CD1 . ILE A 1 273 ? 8.380   9.885   127.420 1.00 26.82  ? 273 ILE A CD1 1 
ATOM   1865 N N   . TYR A 1 274 ? 13.219  11.021  128.111 1.00 30.94  ? 274 TYR A N   1 
ATOM   1866 C CA  . TYR A 1 274 ? 14.669  11.063  128.031 1.00 31.59  ? 274 TYR A CA  1 
ATOM   1867 C C   . TYR A 1 274 ? 15.260  9.680   127.802 1.00 32.53  ? 274 TYR A C   1 
ATOM   1868 O O   . TYR A 1 274 ? 14.732  8.668   128.280 1.00 29.45  ? 274 TYR A O   1 
ATOM   1869 C CB  . TYR A 1 274 ? 15.280  11.649  129.314 1.00 32.01  ? 274 TYR A CB  1 
ATOM   1870 C CG  . TYR A 1 274 ? 14.696  12.970  129.760 1.00 30.23  ? 274 TYR A CG  1 
ATOM   1871 C CD1 . TYR A 1 274 ? 13.471  13.016  130.421 1.00 28.52  ? 274 TYR A CD1 1 
ATOM   1872 C CD2 . TYR A 1 274 ? 15.349  14.174  129.493 1.00 28.15  ? 274 TYR A CD2 1 
ATOM   1873 C CE1 . TYR A 1 274 ? 12.907  14.224  130.801 1.00 29.59  ? 274 TYR A CE1 1 
ATOM   1874 C CE2 . TYR A 1 274 ? 14.788  15.397  129.870 1.00 28.70  ? 274 TYR A CE2 1 
ATOM   1875 C CZ  . TYR A 1 274 ? 13.564  15.414  130.524 1.00 29.37  ? 274 TYR A CZ  1 
ATOM   1876 O OH  . TYR A 1 274 ? 12.978  16.612  130.900 1.00 30.84  ? 274 TYR A OH  1 
ATOM   1877 N N   . ASN A 1 275 ? 16.367  9.655   127.066 1.00 32.82  ? 275 ASN A N   1 
ATOM   1878 C CA  . ASN A 1 275 ? 17.069  8.413   126.781 1.00 33.35  ? 275 ASN A CA  1 
ATOM   1879 C C   . ASN A 1 275 ? 18.402  8.425   127.509 1.00 31.01  ? 275 ASN A C   1 
ATOM   1880 O O   . ASN A 1 275 ? 19.403  8.905   126.999 1.00 28.11  ? 275 ASN A O   1 
ATOM   1881 C CB  . ASN A 1 275 ? 17.258  8.234   125.262 1.00 38.25  ? 275 ASN A CB  1 
ATOM   1882 C CG  . ASN A 1 275 ? 17.931  9.430   124.595 1.00 42.09  ? 275 ASN A CG  1 
ATOM   1883 O OD1 . ASN A 1 275 ? 17.625  10.601  124.893 1.00 44.80  ? 275 ASN A OD1 1 
ATOM   1884 N ND2 . ASN A 1 275 ? 18.842  9.139   123.673 1.00 40.37  ? 275 ASN A ND2 1 
ATOM   1885 N N   . LEU A 1 276 ? 18.383  7.900   128.729 1.00 31.85  ? 276 LEU A N   1 
ATOM   1886 C CA  . LEU A 1 276 ? 19.564  7.847   129.568 1.00 31.01  ? 276 LEU A CA  1 
ATOM   1887 C C   . LEU A 1 276 ? 20.622  6.875   129.059 1.00 31.83  ? 276 LEU A C   1 
ATOM   1888 O O   . LEU A 1 276 ? 21.791  7.040   129.381 1.00 34.93  ? 276 LEU A O   1 
ATOM   1889 C CB  . LEU A 1 276 ? 19.160  7.535   131.011 1.00 28.72  ? 276 LEU A CB  1 
ATOM   1890 C CG  . LEU A 1 276 ? 18.122  8.559   131.500 1.00 29.56  ? 276 LEU A CG  1 
ATOM   1891 C CD1 . LEU A 1 276 ? 17.772  8.337   132.963 1.00 26.53  ? 276 LEU A CD1 1 
ATOM   1892 C CD2 . LEU A 1 276 ? 18.673  9.965   131.291 1.00 29.18  ? 276 LEU A CD2 1 
ATOM   1893 N N   . VAL A 1 277 ? 20.239  5.866   128.277 1.00 30.05  ? 277 VAL A N   1 
ATOM   1894 C CA  . VAL A 1 277 ? 21.242  4.954   127.710 1.00 29.37  ? 277 VAL A CA  1 
ATOM   1895 C C   . VAL A 1 277 ? 21.172  5.095   126.196 1.00 29.71  ? 277 VAL A C   1 
ATOM   1896 O O   . VAL A 1 277 ? 20.087  5.177   125.630 1.00 30.44  ? 277 VAL A O   1 
ATOM   1897 C CB  . VAL A 1 277 ? 21.018  3.462   128.116 1.00 28.22  ? 277 VAL A CB  1 
ATOM   1898 C CG1 . VAL A 1 277 ? 21.056  3.326   129.622 1.00 28.84  ? 277 VAL A CG1 1 
ATOM   1899 C CG2 . VAL A 1 277 ? 19.721  2.950   127.583 1.00 27.89  ? 277 VAL A CG2 1 
ATOM   1900 N N   . GLN A 1 278 ? 22.316  5.148   125.531 1.00 29.92  ? 278 GLN A N   1 
ATOM   1901 C CA  . GLN A 1 278 ? 22.292  5.311   124.086 1.00 32.57  ? 278 GLN A CA  1 
ATOM   1902 C C   . GLN A 1 278 ? 23.588  4.843   123.457 1.00 33.14  ? 278 GLN A C   1 
ATOM   1903 O O   . GLN A 1 278 ? 24.601  5.536   123.511 1.00 36.33  ? 278 GLN A O   1 
ATOM   1904 C CB  . GLN A 1 278 ? 22.048  6.785   123.743 1.00 34.69  ? 278 GLN A CB  1 
ATOM   1905 C CG  . GLN A 1 278 ? 21.888  7.075   122.265 1.00 38.53  ? 278 GLN A CG  1 
ATOM   1906 C CD  . GLN A 1 278 ? 20.742  6.290   121.661 1.00 43.07  ? 278 GLN A CD  1 
ATOM   1907 O OE1 . GLN A 1 278 ? 19.637  6.253   122.218 1.00 44.38  ? 278 GLN A OE1 1 
ATOM   1908 N NE2 . GLN A 1 278 ? 20.994  5.656   120.516 1.00 44.36  ? 278 GLN A NE2 1 
ATOM   1909 N N   . LYS A 1 279 ? 23.556  3.669   122.850 1.00 32.26  ? 279 LYS A N   1 
ATOM   1910 C CA  . LYS A 1 279 ? 24.742  3.115   122.218 1.00 32.09  ? 279 LYS A CA  1 
ATOM   1911 C C   . LYS A 1 279 ? 25.558  4.184   121.502 1.00 30.58  ? 279 LYS A C   1 
ATOM   1912 O O   . LYS A 1 279 ? 25.076  4.848   120.596 1.00 29.20  ? 279 LYS A O   1 
ATOM   1913 C CB  . LYS A 1 279 ? 24.321  2.030   121.235 1.00 34.99  ? 279 LYS A CB  1 
ATOM   1914 C CG  . LYS A 1 279 ? 25.426  1.212   120.638 1.00 36.41  ? 279 LYS A CG  1 
ATOM   1915 C CD  . LYS A 1 279 ? 24.790  0.167   119.737 1.00 40.84  ? 279 LYS A CD  1 
ATOM   1916 C CE  . LYS A 1 279 ? 25.802  -0.468  118.815 1.00 45.92  ? 279 LYS A CE  1 
ATOM   1917 N NZ  . LYS A 1 279 ? 25.147  -1.261  117.740 1.00 48.34  ? 279 LYS A NZ  1 
ATOM   1918 N N   . ALA A 1 280 ? 26.797  4.348   121.944 1.00 30.77  ? 280 ALA A N   1 
ATOM   1919 C CA  . ALA A 1 280 ? 27.720  5.307   121.358 1.00 30.06  ? 280 ALA A CA  1 
ATOM   1920 C C   . ALA A 1 280 ? 28.260  4.697   120.090 1.00 30.78  ? 280 ALA A C   1 
ATOM   1921 O O   . ALA A 1 280 ? 28.865  3.634   120.123 1.00 29.15  ? 280 ALA A O   1 
ATOM   1922 C CB  . ALA A 1 280 ? 28.865  5.584   122.313 1.00 29.73  ? 280 ALA A CB  1 
ATOM   1923 N N   . LEU A 1 281 ? 28.044  5.364   118.968 1.00 33.77  ? 281 LEU A N   1 
ATOM   1924 C CA  . LEU A 1 281 ? 28.527  4.837   117.704 1.00 36.14  ? 281 LEU A CA  1 
ATOM   1925 C C   . LEU A 1 281 ? 29.861  5.399   117.266 1.00 38.65  ? 281 LEU A C   1 
ATOM   1926 O O   . LEU A 1 281 ? 30.270  6.477   117.686 1.00 39.86  ? 281 LEU A O   1 
ATOM   1927 C CB  . LEU A 1 281 ? 27.498  5.081   116.616 1.00 35.56  ? 281 LEU A CB  1 
ATOM   1928 C CG  . LEU A 1 281 ? 26.216  4.279   116.812 1.00 34.99  ? 281 LEU A CG  1 
ATOM   1929 C CD1 . LEU A 1 281 ? 25.225  4.654   115.734 1.00 35.48  ? 281 LEU A CD1 1 
ATOM   1930 C CD2 . LEU A 1 281 ? 26.526  2.789   116.779 1.00 34.28  ? 281 LEU A CD2 1 
ATOM   1931 N N   . LYS A 1 282 ? 30.549  4.634   116.433 1.00 41.49  ? 282 LYS A N   1 
ATOM   1932 C CA  . LYS A 1 282 ? 31.828  5.047   115.891 1.00 45.32  ? 282 LYS A CA  1 
ATOM   1933 C C   . LYS A 1 282 ? 31.411  6.019   114.794 1.00 48.46  ? 282 LYS A C   1 
ATOM   1934 O O   . LYS A 1 282 ? 30.854  5.614   113.770 1.00 48.60  ? 282 LYS A O   1 
ATOM   1935 C CB  . LYS A 1 282 ? 32.541  3.823   115.312 1.00 46.32  ? 282 LYS A CB  1 
ATOM   1936 C CG  . LYS A 1 282 ? 33.910  4.049   114.683 1.00 48.51  ? 282 LYS A CG  1 
ATOM   1937 C CD  . LYS A 1 282 ? 34.518  2.685   114.273 1.00 48.56  ? 282 LYS A CD  1 
ATOM   1938 C CE  . LYS A 1 282 ? 35.879  2.817   113.564 1.00 50.08  ? 282 LYS A CE  1 
ATOM   1939 N NZ  . LYS A 1 282 ? 36.507  1.505   113.191 1.00 47.19  ? 282 LYS A NZ  1 
ATOM   1940 N N   . PRO A 1 283 ? 31.643  7.325   115.003 1.00 51.87  ? 283 PRO A N   1 
ATOM   1941 C CA  . PRO A 1 283 ? 31.246  8.283   113.966 1.00 53.12  ? 283 PRO A CA  1 
ATOM   1942 C C   . PRO A 1 283 ? 31.810  7.853   112.618 1.00 54.80  ? 283 PRO A C   1 
ATOM   1943 O O   . PRO A 1 283 ? 32.910  7.304   112.541 1.00 54.61  ? 283 PRO A O   1 
ATOM   1944 C CB  . PRO A 1 283 ? 31.828  9.598   114.473 1.00 52.27  ? 283 PRO A CB  1 
ATOM   1945 C CG  . PRO A 1 283 ? 33.060  9.154   115.206 1.00 52.36  ? 283 PRO A CG  1 
ATOM   1946 C CD  . PRO A 1 283 ? 32.561  7.951   115.972 1.00 51.90  ? 283 PRO A CD  1 
ATOM   1947 N N   . PRO A 1 284 ? 31.052  8.073   111.539 1.00 57.04  ? 284 PRO A N   1 
ATOM   1948 C CA  . PRO A 1 284 ? 31.491  7.697   110.190 1.00 58.12  ? 284 PRO A CA  1 
ATOM   1949 C C   . PRO A 1 284 ? 32.456  8.740   109.636 1.00 59.81  ? 284 PRO A C   1 
ATOM   1950 O O   . PRO A 1 284 ? 32.471  9.886   110.100 1.00 59.88  ? 284 PRO A O   1 
ATOM   1951 C CB  . PRO A 1 284 ? 30.189  7.670   109.415 1.00 56.81  ? 284 PRO A CB  1 
ATOM   1952 C CG  . PRO A 1 284 ? 29.474  8.869   109.995 1.00 57.49  ? 284 PRO A CG  1 
ATOM   1953 C CD  . PRO A 1 284 ? 29.735  8.737   111.499 1.00 57.06  ? 284 PRO A CD  1 
ATOM   1954 N N   . PRO A 1 285 ? 33.278  8.359   108.639 1.00 60.60  ? 285 PRO A N   1 
ATOM   1955 C CA  . PRO A 1 285 ? 34.226  9.309   108.056 1.00 61.14  ? 285 PRO A CA  1 
ATOM   1956 C C   . PRO A 1 285 ? 33.465  10.339  107.232 1.00 62.27  ? 285 PRO A C   1 
ATOM   1957 O O   . PRO A 1 285 ? 32.293  10.133  106.915 1.00 62.66  ? 285 PRO A O   1 
ATOM   1958 C CB  . PRO A 1 285 ? 35.112  8.417   107.190 1.00 60.46  ? 285 PRO A CB  1 
ATOM   1959 C CG  . PRO A 1 285 ? 34.158  7.387   106.706 1.00 60.34  ? 285 PRO A CG  1 
ATOM   1960 C CD  . PRO A 1 285 ? 33.367  7.053   107.961 1.00 60.68  ? 285 PRO A CD  1 
ATOM   1961 N N   . ILE A 1 286 ? 34.116  11.453  106.910 1.00 63.37  ? 286 ILE A N   1 
ATOM   1962 C CA  . ILE A 1 286 ? 33.486  12.483  106.093 1.00 65.16  ? 286 ILE A CA  1 
ATOM   1963 C C   . ILE A 1 286 ? 34.321  12.613  104.822 1.00 65.97  ? 286 ILE A C   1 
ATOM   1964 O O   . ILE A 1 286 ? 35.501  12.244  104.809 1.00 65.03  ? 286 ILE A O   1 
ATOM   1965 C CB  . ILE A 1 286 ? 33.442  13.862  106.809 1.00 65.95  ? 286 ILE A CB  1 
ATOM   1966 C CG1 . ILE A 1 286 ? 32.759  13.741  108.171 1.00 67.13  ? 286 ILE A CG1 1 
ATOM   1967 C CG2 . ILE A 1 286 ? 32.650  14.858  105.970 1.00 65.89  ? 286 ILE A CG2 1 
ATOM   1968 C CD1 . ILE A 1 286 ? 32.603  15.078  108.903 1.00 68.22  ? 286 ILE A CD1 1 
ATOM   1969 N N   . LYS A 1 287 ? 33.707  13.121  103.755 1.00 67.68  ? 287 LYS A N   1 
ATOM   1970 C CA  . LYS A 1 287 ? 34.402  13.305  102.483 1.00 69.37  ? 287 LYS A CA  1 
ATOM   1971 C C   . LYS A 1 287 ? 34.999  14.702  102.380 1.00 70.63  ? 287 LYS A C   1 
ATOM   1972 O O   . LYS A 1 287 ? 34.384  15.690  102.785 1.00 68.76  ? 287 LYS A O   1 
ATOM   1973 C CB  . LYS A 1 287 ? 33.450  13.018  101.325 1.00 68.56  ? 287 LYS A CB  1 
ATOM   1974 C CG  . LYS A 1 287 ? 33.204  11.538  101.159 1.00 68.36  ? 287 LYS A CG  1 
ATOM   1975 C CD  . LYS A 1 287 ? 31.922  11.259  100.432 1.00 69.44  ? 287 LYS A CD  1 
ATOM   1976 C CE  . LYS A 1 287 ? 31.641  9.772   100.438 1.00 71.46  ? 287 LYS A CE  1 
ATOM   1977 N NZ  . LYS A 1 287 ? 30.289  9.465   99.898  1.00 73.37  ? 287 LYS A NZ  1 
ATOM   1978 N N   . LEU A 1 288 ? 36.210  14.769  101.836 1.00 73.84  ? 288 LEU A N   1 
ATOM   1979 C CA  . LEU A 1 288 ? 36.937  16.028  101.724 1.00 77.96  ? 288 LEU A CA  1 
ATOM   1980 C C   . LEU A 1 288 ? 37.530  16.324  100.347 1.00 80.78  ? 288 LEU A C   1 
ATOM   1981 O O   . LEU A 1 288 ? 37.912  15.412  99.612  1.00 80.77  ? 288 LEU A O   1 
ATOM   1982 C CB  . LEU A 1 288 ? 38.068  16.030  102.754 1.00 77.10  ? 288 LEU A CB  1 
ATOM   1983 C CG  . LEU A 1 288 ? 37.673  15.639  104.181 1.00 76.67  ? 288 LEU A CG  1 
ATOM   1984 C CD1 . LEU A 1 288 ? 38.921  15.281  104.973 1.00 75.22  ? 288 LEU A CD1 1 
ATOM   1985 C CD2 . LEU A 1 288 ? 36.892  16.783  104.836 1.00 76.56  ? 288 LEU A CD2 1 
ATOM   1986 N N   . TYR A 1 289 ? 37.614  17.611  100.016 1.00 84.34  ? 289 TYR A N   1 
ATOM   1987 C CA  . TYR A 1 289 ? 38.182  18.052  98.746  1.00 88.42  ? 289 TYR A CA  1 
ATOM   1988 C C   . TYR A 1 289 ? 39.691  17.840  98.851  1.00 89.76  ? 289 TYR A C   1 
ATOM   1989 O O   . TYR A 1 289 ? 40.409  18.694  99.362  1.00 90.70  ? 289 TYR A O   1 
ATOM   1990 C CB  . TYR A 1 289 ? 37.878  19.540  98.522  1.00 90.73  ? 289 TYR A CB  1 
ATOM   1991 C CG  . TYR A 1 289 ? 38.250  20.078  97.149  1.00 93.82  ? 289 TYR A CG  1 
ATOM   1992 C CD1 . TYR A 1 289 ? 37.559  19.671  96.003  1.00 94.75  ? 289 TYR A CD1 1 
ATOM   1993 C CD2 . TYR A 1 289 ? 39.271  21.024  96.997  1.00 94.92  ? 289 TYR A CD2 1 
ATOM   1994 C CE1 . TYR A 1 289 ? 37.868  20.195  94.736  1.00 95.25  ? 289 TYR A CE1 1 
ATOM   1995 C CE2 . TYR A 1 289 ? 39.590  21.554  95.734  1.00 95.66  ? 289 TYR A CE2 1 
ATOM   1996 C CZ  . TYR A 1 289 ? 38.882  21.136  94.609  1.00 95.29  ? 289 TYR A CZ  1 
ATOM   1997 O OH  . TYR A 1 289 ? 39.172  21.671  93.371  1.00 93.03  ? 289 TYR A OH  1 
ATOM   1998 N N   . ARG A 1 290 ? 40.154  16.689  98.376  1.00 91.48  ? 290 ARG A N   1 
ATOM   1999 C CA  . ARG A 1 290 ? 41.568  16.309  98.411  1.00 93.29  ? 290 ARG A CA  1 
ATOM   2000 C C   . ARG A 1 290 ? 42.619  17.416  98.462  1.00 93.41  ? 290 ARG A C   1 
ATOM   2001 O O   . ARG A 1 290 ? 43.664  17.254  99.093  1.00 93.57  ? 290 ARG A O   1 
ATOM   2002 C CB  . ARG A 1 290 ? 41.880  15.390  97.228  1.00 94.65  ? 290 ARG A CB  1 
ATOM   2003 C CG  . ARG A 1 290 ? 43.332  15.413  96.798  1.00 96.21  ? 290 ARG A CG  1 
ATOM   2004 C CD  . ARG A 1 290 ? 43.648  14.253  95.884  1.00 98.28  ? 290 ARG A CD  1 
ATOM   2005 N NE  . ARG A 1 290 ? 43.518  12.982  96.589  1.00 99.81  ? 290 ARG A NE  1 
ATOM   2006 C CZ  . ARG A 1 290 ? 43.927  11.815  96.103  1.00 100.78 ? 290 ARG A CZ  1 
ATOM   2007 N NH1 . ARG A 1 290 ? 44.493  11.759  94.903  1.00 100.78 ? 290 ARG A NH1 1 
ATOM   2008 N NH2 . ARG A 1 290 ? 43.778  10.706  96.819  1.00 100.74 ? 290 ARG A NH2 1 
ATOM   2009 N N   . GLU A 1 291 ? 42.359  18.528  97.789  1.00 93.80  ? 291 GLU A N   1 
ATOM   2010 C CA  . GLU A 1 291 ? 43.315  19.623  97.770  1.00 93.58  ? 291 GLU A CA  1 
ATOM   2011 C C   . GLU A 1 291 ? 43.249  20.513  99.005  1.00 92.81  ? 291 GLU A C   1 
ATOM   2012 O O   . GLU A 1 291 ? 44.282  20.880  99.558  1.00 92.84  ? 291 GLU A O   1 
ATOM   2013 C CB  . GLU A 1 291 ? 43.118  20.454  96.501  1.00 94.58  ? 291 GLU A CB  1 
ATOM   2014 C CG  . GLU A 1 291 ? 43.642  19.768  95.245  1.00 95.60  ? 291 GLU A CG  1 
ATOM   2015 C CD  . GLU A 1 291 ? 43.228  20.477  93.973  1.00 96.30  ? 291 GLU A CD  1 
ATOM   2016 O OE1 . GLU A 1 291 ? 43.394  21.714  93.894  1.00 96.61  ? 291 GLU A OE1 1 
ATOM   2017 O OE2 . GLU A 1 291 ? 42.742  19.792  93.048  1.00 96.86  ? 291 GLU A OE2 1 
ATOM   2018 N N   . THR A 1 292 ? 42.039  20.845  99.446  1.00 92.44  ? 292 THR A N   1 
ATOM   2019 C CA  . THR A 1 292 ? 41.863  21.710  100.610 1.00 92.05  ? 292 THR A CA  1 
ATOM   2020 C C   . THR A 1 292 ? 41.353  20.980  101.855 1.00 92.31  ? 292 THR A C   1 
ATOM   2021 O O   . THR A 1 292 ? 41.073  21.614  102.873 1.00 92.56  ? 292 THR A O   1 
ATOM   2022 C CB  . THR A 1 292 ? 40.879  22.875  100.294 1.00 91.88  ? 292 THR A CB  1 
ATOM   2023 O OG1 . THR A 1 292 ? 39.570  22.353  100.022 1.00 90.95  ? 292 THR A OG1 1 
ATOM   2024 C CG2 . THR A 1 292 ? 41.355  23.660  99.085  1.00 91.32  ? 292 THR A CG2 1 
ATOM   2025 N N   . ASN A 1 293 ? 41.240  19.656  101.779 1.00 92.44  ? 293 ASN A N   1 
ATOM   2026 C CA  . ASN A 1 293 ? 40.739  18.861  102.901 1.00 92.43  ? 293 ASN A CA  1 
ATOM   2027 C C   . ASN A 1 293 ? 39.540  19.542  103.541 1.00 93.04  ? 293 ASN A C   1 
ATOM   2028 O O   . ASN A 1 293 ? 39.464  19.688  104.761 1.00 93.15  ? 293 ASN A O   1 
ATOM   2029 C CB  . ASN A 1 293 ? 41.833  18.658  103.942 1.00 91.22  ? 293 ASN A CB  1 
ATOM   2030 C CG  . ASN A 1 293 ? 42.968  17.823  103.417 1.00 90.92  ? 293 ASN A CG  1 
ATOM   2031 O OD1 . ASN A 1 293 ? 42.767  16.696  102.978 1.00 90.56  ? 293 ASN A OD1 1 
ATOM   2032 N ND2 . ASN A 1 293 ? 44.172  18.371  103.452 1.00 91.65  ? 293 ASN A ND2 1 
ATOM   2033 N N   . GLU A 1 294 ? 38.599  19.941  102.695 1.00 93.79  ? 294 GLU A N   1 
ATOM   2034 C CA  . GLU A 1 294 ? 37.402  20.633  103.131 1.00 95.08  ? 294 GLU A CA  1 
ATOM   2035 C C   . GLU A 1 294 ? 36.143  19.774  103.044 1.00 95.22  ? 294 GLU A C   1 
ATOM   2036 O O   . GLU A 1 294 ? 35.986  18.971  102.125 1.00 94.68  ? 294 GLU A O   1 
ATOM   2037 C CB  . GLU A 1 294 ? 37.233  21.898  102.285 1.00 96.59  ? 294 GLU A CB  1 
ATOM   2038 C CG  . GLU A 1 294 ? 35.858  22.543  102.350 1.00 99.09  ? 294 GLU A CG  1 
ATOM   2039 C CD  . GLU A 1 294 ? 35.718  23.710  101.386 1.00 100.01 ? 294 GLU A CD  1 
ATOM   2040 O OE1 . GLU A 1 294 ? 36.000  23.527  100.181 1.00 100.52 ? 294 GLU A OE1 1 
ATOM   2041 O OE2 . GLU A 1 294 ? 35.322  24.808  101.833 1.00 100.78 ? 294 GLU A OE2 1 
ATOM   2042 N N   . PRO A 1 295 ? 35.233  19.930  104.018 1.00 95.52  ? 295 PRO A N   1 
ATOM   2043 C CA  . PRO A 1 295 ? 33.975  19.180  104.058 1.00 95.63  ? 295 PRO A CA  1 
ATOM   2044 C C   . PRO A 1 295 ? 33.236  19.322  102.728 1.00 95.29  ? 295 PRO A C   1 
ATOM   2045 O O   . PRO A 1 295 ? 33.353  20.347  102.061 1.00 95.54  ? 295 PRO A O   1 
ATOM   2046 C CB  . PRO A 1 295 ? 33.226  19.844  105.208 1.00 95.85  ? 295 PRO A CB  1 
ATOM   2047 C CG  . PRO A 1 295 ? 34.335  20.186  106.154 1.00 95.63  ? 295 PRO A CG  1 
ATOM   2048 C CD  . PRO A 1 295 ? 35.386  20.759  105.228 1.00 95.62  ? 295 PRO A CD  1 
ATOM   2049 N N   . VAL A 1 296 ? 32.477  18.302  102.345 1.00 94.93  ? 296 VAL A N   1 
ATOM   2050 C CA  . VAL A 1 296 ? 31.736  18.342  101.088 1.00 94.52  ? 296 VAL A CA  1 
ATOM   2051 C C   . VAL A 1 296 ? 30.287  17.904  101.271 1.00 94.71  ? 296 VAL A C   1 
ATOM   2052 O O   . VAL A 1 296 ? 30.018  16.750  101.610 1.00 94.44  ? 296 VAL A O   1 
ATOM   2053 C CB  . VAL A 1 296 ? 32.386  17.426  100.033 1.00 94.05  ? 296 VAL A CB  1 
ATOM   2054 C CG1 . VAL A 1 296 ? 31.587  17.468  98.749  1.00 94.44  ? 296 VAL A CG1 1 
ATOM   2055 C CG2 . VAL A 1 296 ? 33.814  17.856  99.779  1.00 93.97  ? 296 VAL A CG2 1 
ATOM   2056 N N   . LYS A 1 297 ? 29.355  18.827  101.047 1.00 95.04  ? 297 LYS A N   1 
ATOM   2057 C CA  . LYS A 1 297 ? 27.938  18.509  101.185 1.00 95.64  ? 297 LYS A CA  1 
ATOM   2058 C C   . LYS A 1 297 ? 27.572  17.516  100.100 1.00 95.46  ? 297 LYS A C   1 
ATOM   2059 O O   . LYS A 1 297 ? 28.246  17.427  99.071  1.00 94.70  ? 297 LYS A O   1 
ATOM   2060 C CB  . LYS A 1 297 ? 27.079  19.770  101.046 1.00 96.57  ? 297 LYS A CB  1 
ATOM   2061 C CG  . LYS A 1 297 ? 25.566  19.520  100.978 1.00 98.27  ? 297 LYS A CG  1 
ATOM   2062 C CD  . LYS A 1 297 ? 24.984  18.910  102.258 1.00 98.45  ? 297 LYS A CD  1 
ATOM   2063 C CE  . LYS A 1 297 ? 23.466  18.749  102.125 1.00 98.73  ? 297 LYS A CE  1 
ATOM   2064 N NZ  . LYS A 1 297 ? 22.795  18.254  103.359 1.00 98.68  ? 297 LYS A NZ  1 
ATOM   2065 N N   . THR A 1 298 ? 26.502  16.768  100.332 1.00 95.52  ? 298 THR A N   1 
ATOM   2066 C CA  . THR A 1 298 ? 26.076  15.778  99.365  1.00 95.49  ? 298 THR A CA  1 
ATOM   2067 C C   . THR A 1 298 ? 24.637  15.956  98.939  1.00 95.59  ? 298 THR A C   1 
ATOM   2068 O O   . THR A 1 298 ? 23.714  15.680  99.704  1.00 95.29  ? 298 THR A O   1 
ATOM   2069 C CB  . THR A 1 298 ? 26.232  14.366  99.922  1.00 95.42  ? 298 THR A CB  1 
ATOM   2070 O OG1 . THR A 1 298 ? 27.592  14.163  100.321 1.00 94.86  ? 298 THR A OG1 1 
ATOM   2071 C CG2 . THR A 1 298 ? 25.861  13.343  98.864  1.00 95.74  ? 298 THR A CG2 1 
ATOM   2072 N N   . LYS A 1 299 ? 24.450  16.423  97.710  1.00 95.94  ? 299 LYS A N   1 
ATOM   2073 C CA  . LYS A 1 299 ? 23.110  16.600  97.182  1.00 96.12  ? 299 LYS A CA  1 
ATOM   2074 C C   . LYS A 1 299 ? 22.708  15.290  96.514  1.00 95.37  ? 299 LYS A C   1 
ATOM   2075 O O   . LYS A 1 299 ? 23.564  14.517  96.072  1.00 95.04  ? 299 LYS A O   1 
ATOM   2076 C CB  . LYS A 1 299 ? 23.067  17.752  96.172  1.00 97.26  ? 299 LYS A CB  1 
ATOM   2077 C CG  . LYS A 1 299 ? 23.207  19.134  96.799  1.00 98.13  ? 299 LYS A CG  1 
ATOM   2078 C CD  . LYS A 1 299 ? 22.823  20.226  95.813  1.00 99.28  ? 299 LYS A CD  1 
ATOM   2079 C CE  . LYS A 1 299 ? 22.872  21.600  96.467  1.00 99.88  ? 299 LYS A CE  1 
ATOM   2080 N NZ  . LYS A 1 299 ? 22.312  22.660  95.581  1.00 100.78 ? 299 LYS A NZ  1 
ATOM   2081 N N   . THR A 1 300 ? 21.406  15.040  96.457  1.00 94.30  ? 300 THR A N   1 
ATOM   2082 C CA  . THR A 1 300 ? 20.882  13.827  95.851  1.00 92.89  ? 300 THR A CA  1 
ATOM   2083 C C   . THR A 1 300 ? 19.755  14.171  94.898  1.00 91.55  ? 300 THR A C   1 
ATOM   2084 O O   . THR A 1 300 ? 18.704  14.647  95.321  1.00 91.87  ? 300 THR A O   1 
ATOM   2085 C CB  . THR A 1 300 ? 20.344  12.867  96.925  1.00 93.47  ? 300 THR A CB  1 
ATOM   2086 O OG1 . THR A 1 300 ? 21.441  12.335  97.675  1.00 92.85  ? 300 THR A OG1 1 
ATOM   2087 C CG2 . THR A 1 300 ? 19.552  11.731  96.288  1.00 93.95  ? 300 THR A CG2 1 
ATOM   2088 N N   . ARG A 1 301 ? 19.977  13.932  93.612  1.00 89.92  ? 301 ARG A N   1 
ATOM   2089 C CA  . ARG A 1 301 ? 18.955  14.216  92.616  1.00 88.39  ? 301 ARG A CA  1 
ATOM   2090 C C   . ARG A 1 301 ? 18.531  12.977  91.855  1.00 85.51  ? 301 ARG A C   1 
ATOM   2091 O O   . ARG A 1 301 ? 19.349  12.315  91.213  1.00 85.04  ? 301 ARG A O   1 
ATOM   2092 C CB  . ARG A 1 301 ? 19.440  15.260  91.610  1.00 90.88  ? 301 ARG A CB  1 
ATOM   2093 C CG  . ARG A 1 301 ? 19.543  16.665  92.154  1.00 93.72  ? 301 ARG A CG  1 
ATOM   2094 C CD  . ARG A 1 301 ? 19.791  17.638  91.016  1.00 96.62  ? 301 ARG A CD  1 
ATOM   2095 N NE  . ARG A 1 301 ? 20.284  18.928  91.486  1.00 98.99  ? 301 ARG A NE  1 
ATOM   2096 C CZ  . ARG A 1 301 ? 20.668  19.914  90.682  1.00 100.68 ? 301 ARG A CZ  1 
ATOM   2097 N NH1 . ARG A 1 301 ? 20.611  19.756  89.364  1.00 100.78 ? 301 ARG A NH1 1 
ATOM   2098 N NH2 . ARG A 1 301 ? 21.127  21.051  91.192  1.00 100.78 ? 301 ARG A NH2 1 
ATOM   2099 N N   . THR A 1 302 ? 17.244  12.665  91.942  1.00 81.96  ? 302 THR A N   1 
ATOM   2100 C CA  . THR A 1 302 ? 16.693  11.527  91.234  1.00 79.12  ? 302 THR A CA  1 
ATOM   2101 C C   . THR A 1 302 ? 16.146  12.135  89.967  1.00 77.10  ? 302 THR A C   1 
ATOM   2102 O O   . THR A 1 302 ? 15.770  13.302  89.960  1.00 76.83  ? 302 THR A O   1 
ATOM   2103 C CB  . THR A 1 302 ? 15.524  10.878  92.001  1.00 79.05  ? 302 THR A CB  1 
ATOM   2104 O OG1 . THR A 1 302 ? 16.002  10.329  93.235  1.00 79.01  ? 302 THR A OG1 1 
ATOM   2105 C CG2 . THR A 1 302 ? 14.884  9.773   91.168  1.00 77.87  ? 302 THR A CG2 1 
ATOM   2106 N N   . PHE A 1 303 ? 16.107  11.357  88.896  1.00 75.09  ? 303 PHE A N   1 
ATOM   2107 C CA  . PHE A 1 303 ? 15.577  11.859  87.643  1.00 73.34  ? 303 PHE A CA  1 
ATOM   2108 C C   . PHE A 1 303 ? 15.196  10.724  86.719  1.00 71.20  ? 303 PHE A C   1 
ATOM   2109 O O   . PHE A 1 303 ? 15.636  9.591   86.900  1.00 70.43  ? 303 PHE A O   1 
ATOM   2110 C CB  . PHE A 1 303 ? 16.597  12.779  86.967  1.00 75.23  ? 303 PHE A CB  1 
ATOM   2111 C CG  . PHE A 1 303 ? 17.991  12.214  86.904  1.00 77.21  ? 303 PHE A CG  1 
ATOM   2112 C CD1 . PHE A 1 303 ? 18.242  10.986  86.288  1.00 78.50  ? 303 PHE A CD1 1 
ATOM   2113 C CD2 . PHE A 1 303 ? 19.062  12.923  87.435  1.00 77.12  ? 303 PHE A CD2 1 
ATOM   2114 C CE1 . PHE A 1 303 ? 19.543  10.472  86.201  1.00 77.98  ? 303 PHE A CE1 1 
ATOM   2115 C CE2 . PHE A 1 303 ? 20.361  12.421  87.352  1.00 77.70  ? 303 PHE A CE2 1 
ATOM   2116 C CZ  . PHE A 1 303 ? 20.601  11.191  86.732  1.00 77.43  ? 303 PHE A CZ  1 
ATOM   2117 N N   . ASN A 1 304 ? 14.354  11.025  85.740  1.00 69.13  ? 304 ASN A N   1 
ATOM   2118 C CA  . ASN A 1 304 ? 13.940  10.015  84.784  1.00 67.90  ? 304 ASN A CA  1 
ATOM   2119 C C   . ASN A 1 304 ? 15.083  9.884   83.780  1.00 66.98  ? 304 ASN A C   1 
ATOM   2120 O O   . ASN A 1 304 ? 15.560  10.872  83.234  1.00 66.60  ? 304 ASN A O   1 
ATOM   2121 C CB  . ASN A 1 304 ? 12.639  10.440  84.096  1.00 67.27  ? 304 ASN A CB  1 
ATOM   2122 C CG  . ASN A 1 304 ? 12.125  9.402   83.128  1.00 65.48  ? 304 ASN A CG  1 
ATOM   2123 O OD1 . ASN A 1 304 ? 12.750  9.129   82.107  1.00 65.00  ? 304 ASN A OD1 1 
ATOM   2124 N ND2 . ASN A 1 304 ? 10.981  8.813   83.447  1.00 65.26  ? 304 ASN A ND2 1 
ATOM   2125 N N   . THR A 1 305 ? 15.532  8.656   83.564  1.00 66.68  ? 305 THR A N   1 
ATOM   2126 C CA  . THR A 1 305 ? 16.631  8.377   82.651  1.00 66.46  ? 305 THR A CA  1 
ATOM   2127 C C   . THR A 1 305 ? 16.343  8.728   81.196  1.00 66.19  ? 305 THR A C   1 
ATOM   2128 O O   . THR A 1 305 ? 17.208  9.252   80.500  1.00 65.18  ? 305 THR A O   1 
ATOM   2129 C CB  . THR A 1 305 ? 17.023  6.888   82.711  1.00 66.82  ? 305 THR A CB  1 
ATOM   2130 O OG1 . THR A 1 305 ? 17.585  6.583   83.993  1.00 68.22  ? 305 THR A OG1 1 
ATOM   2131 C CG2 . THR A 1 305 ? 18.030  6.569   81.642  1.00 67.93  ? 305 THR A CG2 1 
ATOM   2132 N N   . SER A 1 306 ? 15.129  8.433   80.742  1.00 67.19  ? 306 SER A N   1 
ATOM   2133 C CA  . SER A 1 306 ? 14.738  8.688   79.357  1.00 67.95  ? 306 SER A CA  1 
ATOM   2134 C C   . SER A 1 306 ? 14.507  10.154  78.985  1.00 68.80  ? 306 SER A C   1 
ATOM   2135 O O   . SER A 1 306 ? 14.855  10.571  77.881  1.00 69.21  ? 306 SER A O   1 
ATOM   2136 C CB  . SER A 1 306 ? 13.495  7.861   78.999  1.00 67.30  ? 306 SER A CB  1 
ATOM   2137 O OG  . SER A 1 306 ? 12.426  8.105   79.895  1.00 66.55  ? 306 SER A OG  1 
ATOM   2138 N N   . THR A 1 307 ? 13.926  10.935  79.891  1.00 69.26  ? 307 THR A N   1 
ATOM   2139 C CA  . THR A 1 307 ? 13.680  12.343  79.605  1.00 69.47  ? 307 THR A CA  1 
ATOM   2140 C C   . THR A 1 307 ? 14.697  13.235  80.299  1.00 69.57  ? 307 THR A C   1 
ATOM   2141 O O   . THR A 1 307 ? 14.582  14.457  80.263  1.00 69.80  ? 307 THR A O   1 
ATOM   2142 C CB  . THR A 1 307 ? 12.275  12.777  80.056  1.00 70.31  ? 307 THR A CB  1 
ATOM   2143 O OG1 . THR A 1 307 ? 12.188  12.704  81.485  1.00 70.42  ? 307 THR A OG1 1 
ATOM   2144 C CG2 . THR A 1 307 ? 11.212  11.878  79.427  1.00 71.23  ? 307 THR A CG2 1 
ATOM   2145 N N   . GLY A 1 308 ? 15.693  12.620  80.930  1.00 69.98  ? 308 GLY A N   1 
ATOM   2146 C CA  . GLY A 1 308 ? 16.715  13.384  81.629  1.00 70.72  ? 308 GLY A CA  1 
ATOM   2147 C C   . GLY A 1 308 ? 16.146  14.420  82.586  1.00 70.74  ? 308 GLY A C   1 
ATOM   2148 O O   . GLY A 1 308 ? 16.872  15.255  83.118  1.00 69.17  ? 308 GLY A O   1 
ATOM   2149 N N   . GLY A 1 309 ? 14.840  14.358  82.812  1.00 72.20  ? 309 GLY A N   1 
ATOM   2150 C CA  . GLY A 1 309 ? 14.199  15.307  83.700  1.00 74.91  ? 309 GLY A CA  1 
ATOM   2151 C C   . GLY A 1 309 ? 14.321  15.003  85.182  1.00 76.66  ? 309 GLY A C   1 
ATOM   2152 O O   . GLY A 1 309 ? 14.219  13.851  85.615  1.00 76.58  ? 309 GLY A O   1 
ATOM   2153 N N   . LEU A 1 310 ? 14.540  16.056  85.963  1.00 77.74  ? 310 LEU A N   1 
ATOM   2154 C CA  . LEU A 1 310 ? 14.667  15.935  87.405  1.00 78.65  ? 310 LEU A CA  1 
ATOM   2155 C C   . LEU A 1 310 ? 13.282  15.614  87.959  1.00 78.74  ? 310 LEU A C   1 
ATOM   2156 O O   . LEU A 1 310 ? 12.303  16.294  87.652  1.00 77.97  ? 310 LEU A O   1 
ATOM   2157 C CB  . LEU A 1 310 ? 15.203  17.247  87.986  1.00 80.32  ? 310 LEU A CB  1 
ATOM   2158 C CG  . LEU A 1 310 ? 15.624  17.294  89.458  1.00 81.72  ? 310 LEU A CG  1 
ATOM   2159 C CD1 . LEU A 1 310 ? 16.559  16.137  89.757  1.00 82.92  ? 310 LEU A CD1 1 
ATOM   2160 C CD2 . LEU A 1 310 ? 16.312  18.624  89.758  1.00 81.82  ? 310 LEU A CD2 1 
ATOM   2161 N N   . LEU A 1 311 ? 13.206  14.570  88.773  1.00 79.56  ? 311 LEU A N   1 
ATOM   2162 C CA  . LEU A 1 311 ? 11.939  14.137  89.329  1.00 80.55  ? 311 LEU A CA  1 
ATOM   2163 C C   . LEU A 1 311 ? 11.506  14.838  90.596  1.00 82.16  ? 311 LEU A C   1 
ATOM   2164 O O   . LEU A 1 311 ? 12.304  15.068  91.501  1.00 81.88  ? 311 LEU A O   1 
ATOM   2165 C CB  . LEU A 1 311 ? 11.975  12.632  89.587  1.00 79.74  ? 311 LEU A CB  1 
ATOM   2166 C CG  . LEU A 1 311 ? 12.061  11.743  88.347  1.00 79.86  ? 311 LEU A CG  1 
ATOM   2167 C CD1 . LEU A 1 311 ? 12.211  10.295  88.765  1.00 80.45  ? 311 LEU A CD1 1 
ATOM   2168 C CD2 . LEU A 1 311 ? 10.813  11.923  87.501  1.00 80.39  ? 311 LEU A CD2 1 
ATOM   2169 N N   . LEU A 1 312 ? 10.220  15.172  90.637  1.00 84.22  ? 312 LEU A N   1 
ATOM   2170 C CA  . LEU A 1 312 ? 9.609   15.811  91.796  1.00 85.69  ? 312 LEU A CA  1 
ATOM   2171 C C   . LEU A 1 312 ? 8.813   14.716  92.510  1.00 85.97  ? 312 LEU A C   1 
ATOM   2172 O O   . LEU A 1 312 ? 8.380   13.743  91.886  1.00 85.69  ? 312 LEU A O   1 
ATOM   2173 C CB  . LEU A 1 312 ? 8.658   16.938  91.367  1.00 86.80  ? 312 LEU A CB  1 
ATOM   2174 C CG  . LEU A 1 312 ? 9.200   18.198  90.677  1.00 87.20  ? 312 LEU A CG  1 
ATOM   2175 C CD1 . LEU A 1 312 ? 8.050   19.176  90.477  1.00 85.87  ? 312 LEU A CD1 1 
ATOM   2176 C CD2 . LEU A 1 312 ? 10.297  18.844  91.518  1.00 87.35  ? 312 LEU A CD2 1 
ATOM   2177 N N   . PRO A 1 313 ? 8.606   14.862  93.825  1.00 86.07  ? 313 PRO A N   1 
ATOM   2178 C CA  . PRO A 1 313 ? 7.861   13.879  94.620  1.00 85.57  ? 313 PRO A CA  1 
ATOM   2179 C C   . PRO A 1 313 ? 6.539   13.374  94.026  1.00 84.20  ? 313 PRO A C   1 
ATOM   2180 O O   . PRO A 1 313 ? 6.083   12.282  94.370  1.00 83.79  ? 313 PRO A O   1 
ATOM   2181 C CB  . PRO A 1 313 ? 7.663   14.597  95.960  1.00 86.72  ? 313 PRO A CB  1 
ATOM   2182 C CG  . PRO A 1 313 ? 7.759   16.064  95.599  1.00 86.58  ? 313 PRO A CG  1 
ATOM   2183 C CD  . PRO A 1 313 ? 8.904   16.060  94.627  1.00 86.26  ? 313 PRO A CD  1 
ATOM   2184 N N   . SER A 1 314 ? 5.925   14.154  93.142  1.00 82.92  ? 314 SER A N   1 
ATOM   2185 C CA  . SER A 1 314 ? 4.657   13.742  92.537  1.00 81.83  ? 314 SER A CA  1 
ATOM   2186 C C   . SER A 1 314 ? 4.835   13.063  91.172  1.00 80.34  ? 314 SER A C   1 
ATOM   2187 O O   . SER A 1 314 ? 3.852   12.736  90.495  1.00 79.99  ? 314 SER A O   1 
ATOM   2188 C CB  . SER A 1 314 ? 3.705   14.944  92.401  1.00 82.57  ? 314 SER A CB  1 
ATOM   2189 O OG  . SER A 1 314 ? 4.162   15.882  91.439  1.00 83.04  ? 314 SER A OG  1 
ATOM   2190 N N   . ASP A 1 315 ? 6.088   12.856  90.771  1.00 77.72  ? 315 ASP A N   1 
ATOM   2191 C CA  . ASP A 1 315 ? 6.384   12.208  89.499  1.00 74.66  ? 315 ASP A CA  1 
ATOM   2192 C C   . ASP A 1 315 ? 6.792   10.761  89.733  1.00 71.58  ? 315 ASP A C   1 
ATOM   2193 O O   . ASP A 1 315 ? 7.271   10.070  88.824  1.00 71.41  ? 315 ASP A O   1 
ATOM   2194 C CB  . ASP A 1 315 ? 7.494   12.956  88.760  1.00 77.43  ? 315 ASP A CB  1 
ATOM   2195 C CG  . ASP A 1 315 ? 7.013   14.260  88.156  1.00 79.68  ? 315 ASP A CG  1 
ATOM   2196 O OD1 . ASP A 1 315 ? 6.034   14.224  87.370  1.00 80.73  ? 315 ASP A OD1 1 
ATOM   2197 O OD2 . ASP A 1 315 ? 7.614   15.315  88.467  1.00 80.66  ? 315 ASP A OD2 1 
ATOM   2198 N N   . THR A 1 316 ? 6.593   10.309  90.966  1.00 66.67  ? 316 THR A N   1 
ATOM   2199 C CA  . THR A 1 316 ? 6.919   8.946   91.339  1.00 61.50  ? 316 THR A CA  1 
ATOM   2200 C C   . THR A 1 316 ? 5.939   8.421   92.364  1.00 58.50  ? 316 THR A C   1 
ATOM   2201 O O   . THR A 1 316 ? 5.512   9.146   93.259  1.00 57.27  ? 316 THR A O   1 
ATOM   2202 C CB  . THR A 1 316 ? 8.330   8.845   91.924  1.00 61.07  ? 316 THR A CB  1 
ATOM   2203 O OG1 . THR A 1 316 ? 8.469   9.779   93.004  1.00 61.45  ? 316 THR A OG1 1 
ATOM   2204 C CG2 . THR A 1 316 ? 9.372   9.104   90.838  1.00 60.62  ? 316 THR A CG2 1 
ATOM   2205 N N   . LYS A 1 317 ? 5.581   7.153   92.204  1.00 55.96  ? 317 LYS A N   1 
ATOM   2206 C CA  . LYS A 1 317 ? 4.668   6.461   93.103  1.00 52.90  ? 317 LYS A CA  1 
ATOM   2207 C C   . LYS A 1 317 ? 5.459   5.327   93.754  1.00 49.33  ? 317 LYS A C   1 
ATOM   2208 O O   . LYS A 1 317 ? 6.592   5.060   93.359  1.00 47.18  ? 317 LYS A O   1 
ATOM   2209 C CB  . LYS A 1 317 ? 3.486   5.893   92.315  1.00 55.34  ? 317 LYS A CB  1 
ATOM   2210 C CG  . LYS A 1 317 ? 2.615   6.946   91.641  1.00 57.81  ? 317 LYS A CG  1 
ATOM   2211 C CD  . LYS A 1 317 ? 1.520   6.304   90.795  1.00 60.02  ? 317 LYS A CD  1 
ATOM   2212 C CE  . LYS A 1 317 ? 0.633   7.345   90.121  1.00 61.25  ? 317 LYS A CE  1 
ATOM   2213 N NZ  . LYS A 1 317 ? -0.442  6.696   89.314  1.00 62.90  ? 317 LYS A NZ  1 
ATOM   2214 N N   . ARG A 1 318 ? 4.858   4.660   94.739  1.00 46.67  ? 318 ARG A N   1 
ATOM   2215 C CA  . ARG A 1 318 ? 5.516   3.563   95.454  1.00 43.81  ? 318 ARG A CA  1 
ATOM   2216 C C   . ARG A 1 318 ? 5.104   2.188   94.980  1.00 41.80  ? 318 ARG A C   1 
ATOM   2217 O O   . ARG A 1 318 ? 3.944   1.953   94.671  1.00 43.03  ? 318 ARG A O   1 
ATOM   2218 C CB  . ARG A 1 318 ? 5.242   3.673   96.949  1.00 42.10  ? 318 ARG A CB  1 
ATOM   2219 C CG  . ARG A 1 318 ? 5.784   4.938   97.536  1.00 43.41  ? 318 ARG A CG  1 
ATOM   2220 C CD  . ARG A 1 318 ? 7.287   4.977   97.406  1.00 44.40  ? 318 ARG A CD  1 
ATOM   2221 N NE  . ARG A 1 318 ? 7.798   6.313   97.675  1.00 48.28  ? 318 ARG A NE  1 
ATOM   2222 C CZ  . ARG A 1 318 ? 8.070   7.211   96.735  1.00 48.57  ? 318 ARG A CZ  1 
ATOM   2223 N NH1 . ARG A 1 318 ? 7.886   6.913   95.453  1.00 47.56  ? 318 ARG A NH1 1 
ATOM   2224 N NH2 . ARG A 1 318 ? 8.513   8.413   97.084  1.00 49.31  ? 318 ARG A NH2 1 
ATOM   2225 N N   . SER A 1 319 ? 6.061   1.271   94.942  1.00 39.33  ? 319 SER A N   1 
ATOM   2226 C CA  . SER A 1 319 ? 5.776   -0.079  94.497  1.00 37.35  ? 319 SER A CA  1 
ATOM   2227 C C   . SER A 1 319 ? 6.380   -1.177  95.356  1.00 36.88  ? 319 SER A C   1 
ATOM   2228 O O   . SER A 1 319 ? 7.386   -0.981  96.038  1.00 35.40  ? 319 SER A O   1 
ATOM   2229 C CB  . SER A 1 319 ? 6.265   -0.267  93.066  1.00 37.20  ? 319 SER A CB  1 
ATOM   2230 O OG  . SER A 1 319 ? 6.276   -1.640  92.715  1.00 38.07  ? 319 SER A OG  1 
ATOM   2231 N N   . GLN A 1 320 ? 5.718   -2.329  95.307  1.00 36.88  ? 320 GLN A N   1 
ATOM   2232 C CA  . GLN A 1 320 ? 6.107   -3.565  95.981  1.00 35.73  ? 320 GLN A CA  1 
ATOM   2233 C C   . GLN A 1 320 ? 5.466   -4.645  95.124  1.00 37.07  ? 320 GLN A C   1 
ATOM   2234 O O   . GLN A 1 320 ? 4.363   -4.446  94.594  1.00 37.82  ? 320 GLN A O   1 
ATOM   2235 C CB  . GLN A 1 320 ? 5.539   -3.669  97.384  1.00 32.98  ? 320 GLN A CB  1 
ATOM   2236 C CG  . GLN A 1 320 ? 6.129   -2.725  98.386  1.00 34.50  ? 320 GLN A CG  1 
ATOM   2237 C CD  . GLN A 1 320 ? 5.775   -3.136  99.800  1.00 35.09  ? 320 GLN A CD  1 
ATOM   2238 O OE1 . GLN A 1 320 ? 4.804   -3.866  100.013 1.00 33.82  ? 320 GLN A OE1 1 
ATOM   2239 N NE2 . GLN A 1 320 ? 6.555   -2.672  100.776 1.00 34.38  ? 320 GLN A NE2 1 
ATOM   2240 N N   . ILE A 1 321 ? 6.145   -5.778  94.979  1.00 36.47  ? 321 ILE A N   1 
ATOM   2241 C CA  . ILE A 1 321 ? 5.621   -6.861  94.161  1.00 34.82  ? 321 ILE A CA  1 
ATOM   2242 C C   . ILE A 1 321 ? 5.568   -8.151  94.946  1.00 35.87  ? 321 ILE A C   1 
ATOM   2243 O O   . ILE A 1 321 ? 6.432   -8.409  95.775  1.00 37.55  ? 321 ILE A O   1 
ATOM   2244 C CB  . ILE A 1 321 ? 6.506   -7.099  92.920  1.00 32.88  ? 321 ILE A CB  1 
ATOM   2245 C CG1 . ILE A 1 321 ? 6.599   -5.823  92.090  1.00 30.59  ? 321 ILE A CG1 1 
ATOM   2246 C CG2 . ILE A 1 321 ? 5.940   -8.245  92.081  1.00 33.67  ? 321 ILE A CG2 1 
ATOM   2247 C CD1 . ILE A 1 321 ? 7.456   -5.966  90.875  1.00 26.24  ? 321 ILE A CD1 1 
ATOM   2248 N N   . TYR A 1 322 ? 4.550   -8.960  94.692  1.00 35.55  ? 322 TYR A N   1 
ATOM   2249 C CA  . TYR A 1 322 ? 4.430   -10.242 95.362  1.00 36.76  ? 322 TYR A CA  1 
ATOM   2250 C C   . TYR A 1 322 ? 4.055   -11.237 94.289  1.00 39.74  ? 322 TYR A C   1 
ATOM   2251 O O   . TYR A 1 322 ? 2.889   -11.350 93.925  1.00 41.86  ? 322 TYR A O   1 
ATOM   2252 C CB  . TYR A 1 322 ? 3.356   -10.198 96.445  1.00 33.47  ? 322 TYR A CB  1 
ATOM   2253 C CG  . TYR A 1 322 ? 3.637   -9.180  97.514  1.00 30.18  ? 322 TYR A CG  1 
ATOM   2254 C CD1 . TYR A 1 322 ? 3.420   -7.834  97.282  1.00 28.91  ? 322 TYR A CD1 1 
ATOM   2255 C CD2 . TYR A 1 322 ? 4.161   -9.557  98.743  1.00 30.63  ? 322 TYR A CD2 1 
ATOM   2256 C CE1 . TYR A 1 322 ? 3.715   -6.879  98.246  1.00 29.12  ? 322 TYR A CE1 1 
ATOM   2257 C CE2 . TYR A 1 322 ? 4.470   -8.604  99.723  1.00 28.86  ? 322 TYR A CE2 1 
ATOM   2258 C CZ  . TYR A 1 322 ? 4.244   -7.267  99.466  1.00 28.19  ? 322 TYR A CZ  1 
ATOM   2259 O OH  . TYR A 1 322 ? 4.551   -6.312  100.411 1.00 23.97  ? 322 TYR A OH  1 
ATOM   2260 N N   . GLY A 1 323 ? 5.051   -11.954 93.775  1.00 42.69  ? 323 GLY A N   1 
ATOM   2261 C CA  . GLY A 1 323 ? 4.796   -12.914 92.716  1.00 44.37  ? 323 GLY A CA  1 
ATOM   2262 C C   . GLY A 1 323 ? 4.583   -12.137 91.433  1.00 46.11  ? 323 GLY A C   1 
ATOM   2263 O O   . GLY A 1 323 ? 5.451   -11.375 91.006  1.00 45.93  ? 323 GLY A O   1 
ATOM   2264 N N   . SER A 1 324 ? 3.418   -12.319 90.821  1.00 47.45  ? 324 SER A N   1 
ATOM   2265 C CA  . SER A 1 324 ? 3.089   -11.611 89.591  1.00 47.50  ? 324 SER A CA  1 
ATOM   2266 C C   . SER A 1 324 ? 2.034   -10.577 89.947  1.00 47.04  ? 324 SER A C   1 
ATOM   2267 O O   . SER A 1 324 ? 0.997   -10.468 89.276  1.00 48.12  ? 324 SER A O   1 
ATOM   2268 C CB  . SER A 1 324 ? 2.537   -12.581 88.533  1.00 48.41  ? 324 SER A CB  1 
ATOM   2269 O OG  . SER A 1 324 ? 1.311   -13.173 88.943  1.00 47.48  ? 324 SER A OG  1 
ATOM   2270 N N   . ARG A 1 325 ? 2.293   -9.829  91.015  1.00 44.50  ? 325 ARG A N   1 
ATOM   2271 C CA  . ARG A 1 325 ? 1.353   -8.810  91.455  1.00 42.84  ? 325 ARG A CA  1 
ATOM   2272 C C   . ARG A 1 325 ? 2.062   -7.548  91.954  1.00 40.97  ? 325 ARG A C   1 
ATOM   2273 O O   . ARG A 1 325 ? 2.802   -7.583  92.940  1.00 40.02  ? 325 ARG A O   1 
ATOM   2274 C CB  . ARG A 1 325 ? 0.453   -9.390  92.549  1.00 43.86  ? 325 ARG A CB  1 
ATOM   2275 C CG  . ARG A 1 325 ? -0.810  -8.586  92.833  1.00 45.91  ? 325 ARG A CG  1 
ATOM   2276 C CD  . ARG A 1 325 ? -1.663  -8.463  91.581  1.00 45.35  ? 325 ARG A CD  1 
ATOM   2277 N NE  . ARG A 1 325 ? -3.006  -7.961  91.850  1.00 41.41  ? 325 ARG A NE  1 
ATOM   2278 C CZ  . ARG A 1 325 ? -4.098  -8.709  91.756  1.00 40.60  ? 325 ARG A CZ  1 
ATOM   2279 N NH1 . ARG A 1 325 ? -4.002  -9.987  91.404  1.00 36.25  ? 325 ARG A NH1 1 
ATOM   2280 N NH2 . ARG A 1 325 ? -5.285  -8.172  91.991  1.00 41.30  ? 325 ARG A NH2 1 
ATOM   2281 N N   . GLN A 1 326 ? 1.837   -6.432  91.265  1.00 39.20  ? 326 GLN A N   1 
ATOM   2282 C CA  . GLN A 1 326 ? 2.460   -5.174  91.656  1.00 37.68  ? 326 GLN A CA  1 
ATOM   2283 C C   . GLN A 1 326 ? 1.472   -4.280  92.395  1.00 35.64  ? 326 GLN A C   1 
ATOM   2284 O O   . GLN A 1 326 ? 0.323   -4.145  91.987  1.00 35.77  ? 326 GLN A O   1 
ATOM   2285 C CB  . GLN A 1 326 ? 2.994   -4.431  90.434  1.00 36.92  ? 326 GLN A CB  1 
ATOM   2286 C CG  . GLN A 1 326 ? 3.876   -3.256  90.821  1.00 39.53  ? 326 GLN A CG  1 
ATOM   2287 C CD  . GLN A 1 326 ? 4.270   -2.369  89.650  1.00 40.13  ? 326 GLN A CD  1 
ATOM   2288 O OE1 . GLN A 1 326 ? 4.202   -2.777  88.487  1.00 40.76  ? 326 GLN A OE1 1 
ATOM   2289 N NE2 . GLN A 1 326 ? 4.709   -1.155  89.958  1.00 38.03  ? 326 GLN A NE2 1 
ATOM   2290 N N   . ILE A 1 327 ? 1.914   -3.665  93.481  1.00 32.63  ? 327 ILE A N   1 
ATOM   2291 C CA  . ILE A 1 327 ? 1.019   -2.815  94.228  1.00 32.02  ? 327 ILE A CA  1 
ATOM   2292 C C   . ILE A 1 327 ? 1.594   -1.415  94.282  1.00 32.28  ? 327 ILE A C   1 
ATOM   2293 O O   . ILE A 1 327 ? 2.745   -1.222  94.671  1.00 32.94  ? 327 ILE A O   1 
ATOM   2294 C CB  . ILE A 1 327 ? 0.774   -3.407  95.628  1.00 31.80  ? 327 ILE A CB  1 
ATOM   2295 C CG1 . ILE A 1 327 ? 0.208   -4.824  95.452  1.00 33.16  ? 327 ILE A CG1 1 
ATOM   2296 C CG2 . ILE A 1 327 ? -0.224  -2.554  96.417  1.00 29.06  ? 327 ILE A CG2 1 
ATOM   2297 C CD1 . ILE A 1 327 ? 0.010   -5.613  96.737  1.00 33.33  ? 327 ILE A CD1 1 
ATOM   2298 N N   . ILE A 1 328 ? 0.783   -0.446  93.863  1.00 30.80  ? 328 ILE A N   1 
ATOM   2299 C CA  . ILE A 1 328 ? 1.193   0.948   93.811  1.00 31.22  ? 328 ILE A CA  1 
ATOM   2300 C C   . ILE A 1 328 ? 0.467   1.848   94.811  1.00 32.94  ? 328 ILE A C   1 
ATOM   2301 O O   . ILE A 1 328 ? -0.760  1.859   94.861  1.00 33.00  ? 328 ILE A O   1 
ATOM   2302 C CB  . ILE A 1 328 ? 0.940   1.530   92.398  1.00 29.34  ? 328 ILE A CB  1 
ATOM   2303 C CG1 . ILE A 1 328 ? 1.530   0.608   91.340  1.00 27.47  ? 328 ILE A CG1 1 
ATOM   2304 C CG2 . ILE A 1 328 ? 1.544   2.924   92.283  1.00 27.13  ? 328 ILE A CG2 1 
ATOM   2305 C CD1 . ILE A 1 328 ? 3.009   0.522   91.400  1.00 27.55  ? 328 ILE A CD1 1 
ATOM   2306 N N   . LEU A 1 329 ? 1.223   2.616   95.591  1.00 33.96  ? 329 LEU A N   1 
ATOM   2307 C CA  . LEU A 1 329 ? 0.617   3.536   96.552  1.00 38.12  ? 329 LEU A CA  1 
ATOM   2308 C C   . LEU A 1 329 ? 1.327   4.880   96.488  1.00 40.18  ? 329 LEU A C   1 
ATOM   2309 O O   . LEU A 1 329 ? 2.513   4.938   96.166  1.00 42.03  ? 329 LEU A O   1 
ATOM   2310 C CB  . LEU A 1 329 ? 0.726   3.009   97.986  1.00 37.18  ? 329 LEU A CB  1 
ATOM   2311 C CG  . LEU A 1 329 ? 0.123   1.683   98.434  1.00 37.42  ? 329 LEU A CG  1 
ATOM   2312 C CD1 . LEU A 1 329 ? -0.309  1.873   99.878  1.00 37.49  ? 329 LEU A CD1 1 
ATOM   2313 C CD2 . LEU A 1 329 ? -1.065  1.273   97.588  1.00 38.39  ? 329 LEU A CD2 1 
ATOM   2314 N N   . GLU A 1 330 ? 0.611   5.962   96.774  1.00 40.81  ? 330 GLU A N   1 
ATOM   2315 C CA  . GLU A 1 330 ? 1.249   7.267   96.776  1.00 44.05  ? 330 GLU A CA  1 
ATOM   2316 C C   . GLU A 1 330 ? 2.149   7.207   97.997  1.00 45.39  ? 330 GLU A C   1 
ATOM   2317 O O   . GLU A 1 330 ? 1.942   6.367   98.871  1.00 44.33  ? 330 GLU A O   1 
ATOM   2318 C CB  . GLU A 1 330 ? 0.223   8.385   96.958  1.00 44.87  ? 330 GLU A CB  1 
ATOM   2319 C CG  . GLU A 1 330 ? -0.887  8.398   95.923  1.00 47.01  ? 330 GLU A CG  1 
ATOM   2320 C CD  . GLU A 1 330 ? -0.371  8.497   94.503  1.00 46.51  ? 330 GLU A CD  1 
ATOM   2321 O OE1 . GLU A 1 330 ? 0.530   9.331   94.268  1.00 48.31  ? 330 GLU A OE1 1 
ATOM   2322 O OE2 . GLU A 1 330 ? -0.874  7.754   93.627  1.00 43.87  ? 330 GLU A OE2 1 
ATOM   2323 N N   . LYS A 1 331 ? 3.149   8.076   98.070  1.00 47.77  ? 331 LYS A N   1 
ATOM   2324 C CA  . LYS A 1 331 ? 4.027   8.051   99.228  1.00 50.41  ? 331 LYS A CA  1 
ATOM   2325 C C   . LYS A 1 331 ? 3.188   8.358   100.466 1.00 51.03  ? 331 LYS A C   1 
ATOM   2326 O O   . LYS A 1 331 ? 3.350   7.743   101.519 1.00 50.01  ? 331 LYS A O   1 
ATOM   2327 C CB  . LYS A 1 331 ? 5.136   9.087   99.086  1.00 51.96  ? 331 LYS A CB  1 
ATOM   2328 C CG  . LYS A 1 331 ? 6.093   9.077   100.257 1.00 55.87  ? 331 LYS A CG  1 
ATOM   2329 C CD  . LYS A 1 331 ? 7.043   10.259  100.241 1.00 58.44  ? 331 LYS A CD  1 
ATOM   2330 C CE  . LYS A 1 331 ? 7.880   10.295  101.522 1.00 60.58  ? 331 LYS A CE  1 
ATOM   2331 N NZ  . LYS A 1 331 ? 8.744   11.511  101.582 1.00 59.80  ? 331 LYS A NZ  1 
ATOM   2332 N N   . GLU A 1 332 ? 2.278   9.311   100.319 1.00 52.46  ? 332 GLU A N   1 
ATOM   2333 C CA  . GLU A 1 332 ? 1.412   9.710   101.412 1.00 53.13  ? 332 GLU A CA  1 
ATOM   2334 C C   . GLU A 1 332 ? 0.695   8.514   102.021 1.00 51.46  ? 332 GLU A C   1 
ATOM   2335 O O   . GLU A 1 332 ? 0.378   8.511   103.212 1.00 51.47  ? 332 GLU A O   1 
ATOM   2336 C CB  . GLU A 1 332 ? 0.368   10.702  100.915 1.00 57.28  ? 332 GLU A CB  1 
ATOM   2337 C CG  . GLU A 1 332 ? 0.927   11.849  100.098 1.00 65.70  ? 332 GLU A CG  1 
ATOM   2338 C CD  . GLU A 1 332 ? -0.076  12.996  99.954  1.00 71.25  ? 332 GLU A CD  1 
ATOM   2339 O OE1 . GLU A 1 332 ? -1.175  12.761  99.398  1.00 73.16  ? 332 GLU A OE1 1 
ATOM   2340 O OE2 . GLU A 1 332 ? 0.236   14.131  100.401 1.00 73.10  ? 332 GLU A OE2 1 
ATOM   2341 N N   . GLU A 1 333 ? 0.432   7.503   101.200 1.00 49.06  ? 333 GLU A N   1 
ATOM   2342 C CA  . GLU A 1 333 ? -0.274  6.320   101.669 1.00 47.70  ? 333 GLU A CA  1 
ATOM   2343 C C   . GLU A 1 333 ? 0.637   5.346   102.399 1.00 47.09  ? 333 GLU A C   1 
ATOM   2344 O O   . GLU A 1 333 ? 0.209   4.677   103.342 1.00 46.76  ? 333 GLU A O   1 
ATOM   2345 C CB  . GLU A 1 333 ? -0.978  5.635   100.499 1.00 47.33  ? 333 GLU A CB  1 
ATOM   2346 C CG  . GLU A 1 333 ? -2.076  6.499   99.901  1.00 49.30  ? 333 GLU A CG  1 
ATOM   2347 C CD  . GLU A 1 333 ? -2.677  5.922   98.634  1.00 52.35  ? 333 GLU A CD  1 
ATOM   2348 O OE1 . GLU A 1 333 ? -1.902  5.582   97.713  1.00 51.87  ? 333 GLU A OE1 1 
ATOM   2349 O OE2 . GLU A 1 333 ? -3.927  5.818   98.553  1.00 54.72  ? 333 GLU A OE2 1 
ATOM   2350 N N   . THR A 1 334 ? 1.894   5.264   101.980 1.00 45.57  ? 334 THR A N   1 
ATOM   2351 C CA  . THR A 1 334 ? 2.809   4.375   102.664 1.00 44.18  ? 334 THR A CA  1 
ATOM   2352 C C   . THR A 1 334 ? 2.836   4.800   104.120 1.00 44.40  ? 334 THR A C   1 
ATOM   2353 O O   . THR A 1 334 ? 2.905   3.959   105.007 1.00 45.62  ? 334 THR A O   1 
ATOM   2354 C CB  . THR A 1 334 ? 4.241   4.442   102.099 1.00 43.46  ? 334 THR A CB  1 
ATOM   2355 O OG1 . THR A 1 334 ? 4.793   5.749   102.302 1.00 42.83  ? 334 THR A OG1 1 
ATOM   2356 C CG2 . THR A 1 334 ? 4.229   4.113   100.631 1.00 42.18  ? 334 THR A CG2 1 
ATOM   2357 N N   . GLU A 1 335 ? 2.767   6.103   104.372 1.00 44.29  ? 335 GLU A N   1 
ATOM   2358 C CA  . GLU A 1 335 ? 2.785   6.578   105.748 1.00 46.28  ? 335 GLU A CA  1 
ATOM   2359 C C   . GLU A 1 335 ? 1.404   6.448   106.371 1.00 45.74  ? 335 GLU A C   1 
ATOM   2360 O O   . GLU A 1 335 ? 1.269   6.127   107.553 1.00 44.73  ? 335 GLU A O   1 
ATOM   2361 C CB  . GLU A 1 335 ? 3.243   8.044   105.834 1.00 49.18  ? 335 GLU A CB  1 
ATOM   2362 C CG  . GLU A 1 335 ? 4.643   8.352   105.270 1.00 53.16  ? 335 GLU A CG  1 
ATOM   2363 C CD  . GLU A 1 335 ? 5.668   7.239   105.507 1.00 54.69  ? 335 GLU A CD  1 
ATOM   2364 O OE1 . GLU A 1 335 ? 5.894   6.847   106.676 1.00 53.53  ? 335 GLU A OE1 1 
ATOM   2365 O OE2 . GLU A 1 335 ? 6.252   6.762   104.505 1.00 55.52  ? 335 GLU A OE2 1 
ATOM   2366 N N   . GLU A 1 336 ? 0.381   6.699   105.568 1.00 46.13  ? 336 GLU A N   1 
ATOM   2367 C CA  . GLU A 1 336 ? -1.001  6.622   106.026 1.00 47.12  ? 336 GLU A CA  1 
ATOM   2368 C C   . GLU A 1 336 ? -1.323  5.297   106.709 1.00 46.11  ? 336 GLU A C   1 
ATOM   2369 O O   . GLU A 1 336 ? -2.080  5.263   107.678 1.00 46.55  ? 336 GLU A O   1 
ATOM   2370 C CB  . GLU A 1 336 ? -1.945  6.808   104.840 1.00 50.78  ? 336 GLU A CB  1 
ATOM   2371 C CG  . GLU A 1 336 ? -3.430  6.816   105.192 1.00 55.60  ? 336 GLU A CG  1 
ATOM   2372 C CD  . GLU A 1 336 ? -4.321  6.383   104.018 1.00 59.01  ? 336 GLU A CD  1 
ATOM   2373 O OE1 . GLU A 1 336 ? -4.044  6.794   102.865 1.00 60.23  ? 336 GLU A OE1 1 
ATOM   2374 O OE2 . GLU A 1 336 ? -5.305  5.637   104.254 1.00 60.22  ? 336 GLU A OE2 1 
ATOM   2375 N N   . LEU A 1 337 ? -0.758  4.205   106.199 1.00 44.33  ? 337 LEU A N   1 
ATOM   2376 C CA  . LEU A 1 337 ? -1.024  2.887   106.763 1.00 42.50  ? 337 LEU A CA  1 
ATOM   2377 C C   . LEU A 1 337 ? -0.277  2.524   108.046 1.00 42.16  ? 337 LEU A C   1 
ATOM   2378 O O   . LEU A 1 337 ? -0.302  1.366   108.458 1.00 42.84  ? 337 LEU A O   1 
ATOM   2379 C CB  . LEU A 1 337 ? -0.780  1.802   105.705 1.00 40.41  ? 337 LEU A CB  1 
ATOM   2380 C CG  . LEU A 1 337 ? 0.550   1.728   104.950 1.00 38.44  ? 337 LEU A CG  1 
ATOM   2381 C CD1 . LEU A 1 337 ? 1.707   1.445   105.884 1.00 36.27  ? 337 LEU A CD1 1 
ATOM   2382 C CD2 . LEU A 1 337 ? 0.440   0.628   103.910 1.00 37.27  ? 337 LEU A CD2 1 
ATOM   2383 N N   . LYS A 1 338 ? 0.384   3.490   108.679 1.00 41.11  ? 338 LYS A N   1 
ATOM   2384 C CA  . LYS A 1 338 ? 1.112   3.225   109.918 1.00 40.53  ? 338 LYS A CA  1 
ATOM   2385 C C   . LYS A 1 338 ? 0.420   3.954   111.045 1.00 41.56  ? 338 LYS A C   1 
ATOM   2386 O O   . LYS A 1 338 ? 0.581   3.639   112.219 1.00 42.33  ? 338 LYS A O   1 
ATOM   2387 C CB  . LYS A 1 338 ? 2.542   3.755   109.844 1.00 40.26  ? 338 LYS A CB  1 
ATOM   2388 C CG  . LYS A 1 338 ? 3.405   3.182   108.757 1.00 39.06  ? 338 LYS A CG  1 
ATOM   2389 C CD  . LYS A 1 338 ? 4.791   3.772   108.865 1.00 40.96  ? 338 LYS A CD  1 
ATOM   2390 C CE  . LYS A 1 338 ? 5.662   3.347   107.700 1.00 43.88  ? 338 LYS A CE  1 
ATOM   2391 N NZ  . LYS A 1 338 ? 7.016   3.955   107.777 1.00 45.76  ? 338 LYS A NZ  1 
ATOM   2392 N N   . ARG A 1 339 ? -0.361  4.948   110.665 1.00 43.18  ? 339 ARG A N   1 
ATOM   2393 C CA  . ARG A 1 339 ? -1.050  5.784   111.623 1.00 43.90  ? 339 ARG A CA  1 
ATOM   2394 C C   . ARG A 1 339 ? -2.072  5.089   112.503 1.00 41.69  ? 339 ARG A C   1 
ATOM   2395 O O   . ARG A 1 339 ? -2.992  4.450   112.005 1.00 43.14  ? 339 ARG A O   1 
ATOM   2396 C CB  . ARG A 1 339 ? -1.721  6.941   110.881 1.00 46.46  ? 339 ARG A CB  1 
ATOM   2397 C CG  . ARG A 1 339 ? -2.341  7.975   111.791 1.00 52.13  ? 339 ARG A CG  1 
ATOM   2398 C CD  . ARG A 1 339 ? -3.045  9.048   110.998 1.00 56.96  ? 339 ARG A CD  1 
ATOM   2399 N NE  . ARG A 1 339 ? -3.910  9.859   111.850 1.00 62.98  ? 339 ARG A NE  1 
ATOM   2400 C CZ  . ARG A 1 339 ? -4.900  10.617  111.386 1.00 65.96  ? 339 ARG A CZ  1 
ATOM   2401 N NH1 . ARG A 1 339 ? -5.137  10.657  110.076 1.00 67.38  ? 339 ARG A NH1 1 
ATOM   2402 N NH2 . ARG A 1 339 ? -5.658  11.325  112.222 1.00 67.14  ? 339 ARG A NH2 1 
ATOM   2403 N N   . PHE A 1 340 ? -1.901  5.211   113.815 1.00 39.40  ? 340 PHE A N   1 
ATOM   2404 C CA  . PHE A 1 340 ? -2.861  4.649   114.756 1.00 38.01  ? 340 PHE A CA  1 
ATOM   2405 C C   . PHE A 1 340 ? -3.225  5.734   115.748 1.00 37.43  ? 340 PHE A C   1 
ATOM   2406 O O   . PHE A 1 340 ? -4.168  6.475   115.521 1.00 36.79  ? 340 PHE A O   1 
ATOM   2407 C CB  . PHE A 1 340 ? -2.302  3.418   115.475 1.00 35.85  ? 340 PHE A CB  1 
ATOM   2408 C CG  . PHE A 1 340 ? -2.297  2.177   114.626 1.00 32.07  ? 340 PHE A CG  1 
ATOM   2409 C CD1 . PHE A 1 340 ? -1.419  2.058   113.550 1.00 30.30  ? 340 PHE A CD1 1 
ATOM   2410 C CD2 . PHE A 1 340 ? -3.165  1.130   114.898 1.00 30.57  ? 340 PHE A CD2 1 
ATOM   2411 C CE1 . PHE A 1 340 ? -1.402  0.914   112.760 1.00 27.72  ? 340 PHE A CE1 1 
ATOM   2412 C CE2 . PHE A 1 340 ? -3.156  -0.026  114.107 1.00 30.08  ? 340 PHE A CE2 1 
ATOM   2413 C CZ  . PHE A 1 340 ? -2.270  -0.130  113.036 1.00 28.76  ? 340 PHE A CZ  1 
ATOM   2414 N N   . ASP A 1 341 ? -2.485  5.830   116.842 1.00 38.79  ? 341 ASP A N   1 
ATOM   2415 C CA  . ASP A 1 341 ? -2.737  6.864   117.834 1.00 39.86  ? 341 ASP A CA  1 
ATOM   2416 C C   . ASP A 1 341 ? -1.990  8.098   117.371 1.00 40.89  ? 341 ASP A C   1 
ATOM   2417 O O   . ASP A 1 341 ? -1.111  7.999   116.508 1.00 41.95  ? 341 ASP A O   1 
ATOM   2418 C CB  . ASP A 1 341 ? -2.154  6.477   119.192 1.00 40.97  ? 341 ASP A CB  1 
ATOM   2419 C CG  . ASP A 1 341 ? -2.819  5.270   119.799 1.00 43.56  ? 341 ASP A CG  1 
ATOM   2420 O OD1 . ASP A 1 341 ? -3.812  4.794   119.221 1.00 45.94  ? 341 ASP A OD1 1 
ATOM   2421 O OD2 . ASP A 1 341 ? -2.346  4.806   120.863 1.00 43.96  ? 341 ASP A OD2 1 
ATOM   2422 N N   . ASP A 1 342 ? -2.348  9.256   117.921 1.00 40.73  ? 342 ASP A N   1 
ATOM   2423 C CA  . ASP A 1 342 ? -1.611  10.476  117.621 1.00 40.94  ? 342 ASP A CA  1 
ATOM   2424 C C   . ASP A 1 342 ? -0.484  10.361  118.635 1.00 40.09  ? 342 ASP A C   1 
ATOM   2425 O O   . ASP A 1 342 ? -0.591  9.603   119.604 1.00 39.55  ? 342 ASP A O   1 
ATOM   2426 C CB  . ASP A 1 342 ? -2.415  11.736  117.936 1.00 45.08  ? 342 ASP A CB  1 
ATOM   2427 C CG  . ASP A 1 342 ? -3.534  11.978  116.957 1.00 49.37  ? 342 ASP A CG  1 
ATOM   2428 O OD1 . ASP A 1 342 ? -3.346  11.671  115.755 1.00 52.60  ? 342 ASP A OD1 1 
ATOM   2429 O OD2 . ASP A 1 342 ? -4.591  12.494  117.388 1.00 49.65  ? 342 ASP A OD2 1 
ATOM   2430 N N   . PRO A 1 343 ? 0.606   11.106  118.445 1.00 38.73  ? 343 PRO A N   1 
ATOM   2431 C CA  . PRO A 1 343 ? 1.702   11.004  119.410 1.00 38.46  ? 343 PRO A CA  1 
ATOM   2432 C C   . PRO A 1 343 ? 1.260   11.076  120.881 1.00 37.80  ? 343 PRO A C   1 
ATOM   2433 O O   . PRO A 1 343 ? 0.262   11.718  121.204 1.00 37.42  ? 343 PRO A O   1 
ATOM   2434 C CB  . PRO A 1 343 ? 2.614   12.150  118.996 1.00 38.68  ? 343 PRO A CB  1 
ATOM   2435 C CG  . PRO A 1 343 ? 2.444   12.147  117.507 1.00 37.49  ? 343 PRO A CG  1 
ATOM   2436 C CD  . PRO A 1 343 ? 0.949   12.037  117.360 1.00 37.90  ? 343 PRO A CD  1 
ATOM   2437 N N   . GLY A 1 344 ? 1.999   10.390  121.753 1.00 36.83  ? 344 GLY A N   1 
ATOM   2438 C CA  . GLY A 1 344 ? 1.682   10.391  123.166 1.00 35.09  ? 344 GLY A CA  1 
ATOM   2439 C C   . GLY A 1 344 ? 1.747   9.032   123.842 1.00 35.66  ? 344 GLY A C   1 
ATOM   2440 O O   . GLY A 1 344 ? 2.169   8.034   123.247 1.00 32.15  ? 344 GLY A O   1 
ATOM   2441 N N   . LEU A 1 345 ? 1.306   9.024   125.100 1.00 35.36  ? 345 LEU A N   1 
ATOM   2442 C CA  . LEU A 1 345 ? 1.277   7.849   125.956 1.00 36.42  ? 345 LEU A CA  1 
ATOM   2443 C C   . LEU A 1 345 ? -0.126  7.617   126.505 1.00 37.51  ? 345 LEU A C   1 
ATOM   2444 O O   . LEU A 1 345 ? -0.484  8.178   127.536 1.00 39.10  ? 345 LEU A O   1 
ATOM   2445 C CB  . LEU A 1 345 ? 2.215   8.062   127.137 1.00 37.65  ? 345 LEU A CB  1 
ATOM   2446 C CG  . LEU A 1 345 ? 3.723   7.978   126.946 1.00 39.44  ? 345 LEU A CG  1 
ATOM   2447 C CD1 . LEU A 1 345 ? 4.423   8.767   128.046 1.00 37.18  ? 345 LEU A CD1 1 
ATOM   2448 C CD2 . LEU A 1 345 ? 4.139   6.505   126.975 1.00 39.90  ? 345 LEU A CD2 1 
ATOM   2449 N N   . MET A 1 346 ? -0.924  6.790   125.845 1.00 37.39  ? 346 MET A N   1 
ATOM   2450 C CA  . MET A 1 346 ? -2.278  6.534   126.332 1.00 36.48  ? 346 MET A CA  1 
ATOM   2451 C C   . MET A 1 346 ? -2.272  5.557   127.497 1.00 36.75  ? 346 MET A C   1 
ATOM   2452 O O   . MET A 1 346 ? -1.716  4.460   127.385 1.00 37.70  ? 346 MET A O   1 
ATOM   2453 C CB  . MET A 1 346 ? -3.137  5.959   125.221 1.00 34.55  ? 346 MET A CB  1 
ATOM   2454 C CG  . MET A 1 346 ? -3.202  6.827   124.016 1.00 36.33  ? 346 MET A CG  1 
ATOM   2455 S SD  . MET A 1 346 ? -4.184  6.008   122.792 1.00 38.40  ? 346 MET A SD  1 
ATOM   2456 C CE  . MET A 1 346 ? -5.782  6.072   123.592 1.00 34.87  ? 346 MET A CE  1 
ATOM   2457 N N   . LEU A 1 347 ? -2.900  5.938   128.607 1.00 34.99  ? 347 LEU A N   1 
ATOM   2458 C CA  . LEU A 1 347 ? -2.943  5.051   129.760 1.00 34.29  ? 347 LEU A CA  1 
ATOM   2459 C C   . LEU A 1 347 ? -3.898  3.897   129.518 1.00 34.63  ? 347 LEU A C   1 
ATOM   2460 O O   . LEU A 1 347 ? -5.023  4.097   129.056 1.00 36.59  ? 347 LEU A O   1 
ATOM   2461 C CB  . LEU A 1 347 ? -3.363  5.806   131.017 1.00 34.16  ? 347 LEU A CB  1 
ATOM   2462 C CG  . LEU A 1 347 ? -3.326  4.908   132.262 1.00 36.33  ? 347 LEU A CG  1 
ATOM   2463 C CD1 . LEU A 1 347 ? -1.978  4.170   132.363 1.00 36.89  ? 347 LEU A CD1 1 
ATOM   2464 C CD2 . LEU A 1 347 ? -3.559  5.749   133.492 1.00 34.02  ? 347 LEU A CD2 1 
ATOM   2465 N N   . MET A 1 348 ? -3.449  2.687   129.832 1.00 33.80  ? 348 MET A N   1 
ATOM   2466 C CA  . MET A 1 348 ? -4.268  1.498   129.632 1.00 33.48  ? 348 MET A CA  1 
ATOM   2467 C C   . MET A 1 348 ? -4.680  0.882   130.954 1.00 33.75  ? 348 MET A C   1 
ATOM   2468 O O   . MET A 1 348 ? -5.629  0.111   131.007 1.00 35.04  ? 348 MET A O   1 
ATOM   2469 C CB  . MET A 1 348 ? -3.500  0.449   128.817 1.00 33.06  ? 348 MET A CB  1 
ATOM   2470 C CG  . MET A 1 348 ? -3.021  0.916   127.446 1.00 32.85  ? 348 MET A CG  1 
ATOM   2471 S SD  . MET A 1 348 ? -4.357  1.336   126.290 1.00 28.36  ? 348 MET A SD  1 
ATOM   2472 C CE  . MET A 1 348 ? -4.960  -0.244  126.009 1.00 30.62  ? 348 MET A CE  1 
ATOM   2473 N N   . GLY A 1 349 ? -3.955  1.220   132.016 1.00 34.42  ? 349 GLY A N   1 
ATOM   2474 C CA  . GLY A 1 349 ? -4.245  0.678   133.333 1.00 33.49  ? 349 GLY A CA  1 
ATOM   2475 C C   . GLY A 1 349 ? -2.960  0.406   134.102 1.00 33.03  ? 349 GLY A C   1 
ATOM   2476 O O   . GLY A 1 349 ? -1.876  0.776   133.649 1.00 32.46  ? 349 GLY A O   1 
ATOM   2477 N N   . PHE A 1 350 ? -3.076  -0.243  135.258 1.00 31.52  ? 350 PHE A N   1 
ATOM   2478 C CA  . PHE A 1 350 ? -1.914  -0.545  136.084 1.00 31.68  ? 350 PHE A CA  1 
ATOM   2479 C C   . PHE A 1 350 ? -1.814  -2.031  136.303 1.00 33.00  ? 350 PHE A C   1 
ATOM   2480 O O   . PHE A 1 350 ? -2.800  -2.700  136.592 1.00 33.16  ? 350 PHE A O   1 
ATOM   2481 C CB  . PHE A 1 350 ? -2.005  0.169   137.431 1.00 30.58  ? 350 PHE A CB  1 
ATOM   2482 C CG  . PHE A 1 350 ? -2.231  1.638   137.309 1.00 29.71  ? 350 PHE A CG  1 
ATOM   2483 C CD1 . PHE A 1 350 ? -3.476  2.129   136.919 1.00 29.22  ? 350 PHE A CD1 1 
ATOM   2484 C CD2 . PHE A 1 350 ? -1.189  2.530   137.510 1.00 29.50  ? 350 PHE A CD2 1 
ATOM   2485 C CE1 . PHE A 1 350 ? -3.682  3.486   136.722 1.00 28.20  ? 350 PHE A CE1 1 
ATOM   2486 C CE2 . PHE A 1 350 ? -1.383  3.892   137.318 1.00 30.48  ? 350 PHE A CE2 1 
ATOM   2487 C CZ  . PHE A 1 350 ? -2.633  4.370   136.921 1.00 29.65  ? 350 PHE A CZ  1 
ATOM   2488 N N   . LYS A 1 351 ? -0.599  -2.542  136.182 1.00 34.48  ? 351 LYS A N   1 
ATOM   2489 C CA  . LYS A 1 351 ? -0.359  -3.963  136.317 1.00 34.77  ? 351 LYS A CA  1 
ATOM   2490 C C   . LYS A 1 351 ? 0.741   -4.191  137.335 1.00 34.49  ? 351 LYS A C   1 
ATOM   2491 O O   . LYS A 1 351 ? 1.747   -3.484  137.334 1.00 33.54  ? 351 LYS A O   1 
ATOM   2492 C CB  . LYS A 1 351 ? 0.039   -4.509  134.942 1.00 36.77  ? 351 LYS A CB  1 
ATOM   2493 C CG  . LYS A 1 351 ? 0.257   -5.999  134.860 1.00 40.07  ? 351 LYS A CG  1 
ATOM   2494 C CD  . LYS A 1 351 ? 0.572   -6.436  133.428 1.00 40.48  ? 351 LYS A CD  1 
ATOM   2495 C CE  . LYS A 1 351 ? -0.609  -6.192  132.500 1.00 40.84  ? 351 LYS A CE  1 
ATOM   2496 N NZ  . LYS A 1 351 ? -0.390  -6.786  131.149 1.00 41.06  ? 351 LYS A NZ  1 
ATOM   2497 N N   . PRO A 1 352 ? 0.543   -5.159  138.248 1.00 34.74  ? 352 PRO A N   1 
ATOM   2498 C CA  . PRO A 1 352 ? 1.532   -5.480  139.283 1.00 35.57  ? 352 PRO A CA  1 
ATOM   2499 C C   . PRO A 1 352 ? 2.892   -5.798  138.677 1.00 36.42  ? 352 PRO A C   1 
ATOM   2500 O O   . PRO A 1 352 ? 3.001   -6.658  137.807 1.00 37.77  ? 352 PRO A O   1 
ATOM   2501 C CB  . PRO A 1 352 ? 0.910   -6.683  140.005 1.00 35.16  ? 352 PRO A CB  1 
ATOM   2502 C CG  . PRO A 1 352 ? -0.109  -7.220  139.038 1.00 33.60  ? 352 PRO A CG  1 
ATOM   2503 C CD  . PRO A 1 352 ? -0.670  -5.971  138.424 1.00 34.44  ? 352 PRO A CD  1 
ATOM   2504 N N   . LEU A 1 353 ? 3.923   -5.096  139.136 1.00 36.01  ? 353 LEU A N   1 
ATOM   2505 C CA  . LEU A 1 353 ? 5.274   -5.283  138.625 1.00 35.31  ? 353 LEU A CA  1 
ATOM   2506 C C   . LEU A 1 353 ? 5.678   -6.740  138.426 1.00 35.42  ? 353 LEU A C   1 
ATOM   2507 O O   . LEU A 1 353 ? 6.473   -7.045  137.551 1.00 38.35  ? 353 LEU A O   1 
ATOM   2508 C CB  . LEU A 1 353 ? 6.284   -4.586  139.546 1.00 35.30  ? 353 LEU A CB  1 
ATOM   2509 C CG  . LEU A 1 353 ? 6.137   -3.066  139.718 1.00 34.44  ? 353 LEU A CG  1 
ATOM   2510 C CD1 . LEU A 1 353 ? 7.219   -2.570  140.652 1.00 33.07  ? 353 LEU A CD1 1 
ATOM   2511 C CD2 . LEU A 1 353 ? 6.242   -2.360  138.376 1.00 32.04  ? 353 LEU A CD2 1 
ATOM   2512 N N   . VAL A 1 354 ? 5.132   -7.645  139.225 1.00 35.57  ? 354 VAL A N   1 
ATOM   2513 C CA  . VAL A 1 354 ? 5.469   -9.067  139.101 1.00 35.51  ? 354 VAL A CA  1 
ATOM   2514 C C   . VAL A 1 354 ? 5.301   -9.623  137.682 1.00 35.37  ? 354 VAL A C   1 
ATOM   2515 O O   . VAL A 1 354 ? 6.118   -10.421 137.218 1.00 35.80  ? 354 VAL A O   1 
ATOM   2516 C CB  . VAL A 1 354 ? 4.586   -9.953  140.029 1.00 35.63  ? 354 VAL A CB  1 
ATOM   2517 C CG1 . VAL A 1 354 ? 5.105   -11.382 140.037 1.00 35.13  ? 354 VAL A CG1 1 
ATOM   2518 C CG2 . VAL A 1 354 ? 4.557   -9.390  141.427 1.00 35.72  ? 354 VAL A CG2 1 
ATOM   2519 N N   . LEU A 1 355 ? 4.231   -9.213  137.008 1.00 34.07  ? 355 LEU A N   1 
ATOM   2520 C CA  . LEU A 1 355 ? 3.943   -9.703  135.666 1.00 34.65  ? 355 LEU A CA  1 
ATOM   2521 C C   . LEU A 1 355 ? 4.931   -9.254  134.601 1.00 35.24  ? 355 LEU A C   1 
ATOM   2522 O O   . LEU A 1 355 ? 4.973   -9.816  133.504 1.00 35.27  ? 355 LEU A O   1 
ATOM   2523 C CB  . LEU A 1 355 ? 2.526   -9.299  135.264 1.00 33.92  ? 355 LEU A CB  1 
ATOM   2524 C CG  . LEU A 1 355 ? 1.467   -9.878  136.203 1.00 33.06  ? 355 LEU A CG  1 
ATOM   2525 C CD1 . LEU A 1 355 ? 0.111   -9.298  135.860 1.00 31.37  ? 355 LEU A CD1 1 
ATOM   2526 C CD2 . LEU A 1 355 ? 1.464   -11.412 136.102 1.00 33.11  ? 355 LEU A CD2 1 
ATOM   2527 N N   . LEU A 1 356 ? 5.715   -8.232  134.913 1.00 35.35  ? 356 LEU A N   1 
ATOM   2528 C CA  . LEU A 1 356 ? 6.706   -7.748  133.971 1.00 35.65  ? 356 LEU A CA  1 
ATOM   2529 C C   . LEU A 1 356 ? 7.910   -8.638  134.183 1.00 35.98  ? 356 LEU A C   1 
ATOM   2530 O O   . LEU A 1 356 ? 8.346   -8.827  135.315 1.00 36.83  ? 356 LEU A O   1 
ATOM   2531 C CB  . LEU A 1 356 ? 7.057   -6.297  134.267 1.00 35.80  ? 356 LEU A CB  1 
ATOM   2532 C CG  . LEU A 1 356 ? 5.866   -5.337  134.282 1.00 36.87  ? 356 LEU A CG  1 
ATOM   2533 C CD1 . LEU A 1 356 ? 6.390   -3.941  134.533 1.00 36.35  ? 356 LEU A CD1 1 
ATOM   2534 C CD2 . LEU A 1 356 ? 5.095   -5.398  132.962 1.00 35.94  ? 356 LEU A CD2 1 
ATOM   2535 N N   . LYS A 1 357 ? 8.442   -9.193  133.101 1.00 35.94  ? 357 LYS A N   1 
ATOM   2536 C CA  . LYS A 1 357 ? 9.573   -10.093 133.221 1.00 35.65  ? 357 LYS A CA  1 
ATOM   2537 C C   . LYS A 1 357 ? 10.862  -9.547  132.685 1.00 32.77  ? 357 LYS A C   1 
ATOM   2538 O O   . LYS A 1 357 ? 10.908  -8.957  131.619 1.00 32.92  ? 357 LYS A O   1 
ATOM   2539 C CB  . LYS A 1 357 ? 9.256   -11.426 132.552 1.00 39.09  ? 357 LYS A CB  1 
ATOM   2540 C CG  . LYS A 1 357 ? 8.157   -12.181 133.271 1.00 43.59  ? 357 LYS A CG  1 
ATOM   2541 C CD  . LYS A 1 357 ? 7.840   -13.479 132.571 1.00 49.17  ? 357 LYS A CD  1 
ATOM   2542 C CE  . LYS A 1 357 ? 6.847   -14.319 133.370 1.00 52.12  ? 357 LYS A CE  1 
ATOM   2543 N NZ  . LYS A 1 357 ? 6.702   -15.694 132.786 1.00 54.30  ? 357 LYS A NZ  1 
ATOM   2544 N N   . LYS A 1 358 ? 11.909  -9.772  133.462 1.00 31.61  ? 358 LYS A N   1 
ATOM   2545 C CA  . LYS A 1 358 ? 13.272  -9.340  133.176 1.00 30.30  ? 358 LYS A CA  1 
ATOM   2546 C C   . LYS A 1 358 ? 13.771  -9.796  131.800 1.00 29.75  ? 358 LYS A C   1 
ATOM   2547 O O   . LYS A 1 358 ? 14.405  -9.039  131.075 1.00 29.17  ? 358 LYS A O   1 
ATOM   2548 C CB  . LYS A 1 358 ? 14.171  -9.900  134.275 1.00 30.89  ? 358 LYS A CB  1 
ATOM   2549 C CG  . LYS A 1 358 ? 15.520  -9.256  134.480 1.00 31.52  ? 358 LYS A CG  1 
ATOM   2550 C CD  . LYS A 1 358 ? 16.170  -9.930  135.687 1.00 34.18  ? 358 LYS A CD  1 
ATOM   2551 C CE  . LYS A 1 358 ? 17.535  -9.382  136.012 1.00 37.09  ? 358 LYS A CE  1 
ATOM   2552 N NZ  . LYS A 1 358 ? 18.235  -10.252 137.004 1.00 38.96  ? 358 LYS A NZ  1 
ATOM   2553 N N   . HIS A 1 359 ? 13.481  -11.035 131.440 1.00 28.65  ? 359 HIS A N   1 
ATOM   2554 C CA  . HIS A 1 359 ? 13.923  -11.559 130.164 1.00 30.11  ? 359 HIS A CA  1 
ATOM   2555 C C   . HIS A 1 359 ? 13.014  -11.123 129.024 1.00 29.92  ? 359 HIS A C   1 
ATOM   2556 O O   . HIS A 1 359 ? 13.135  -11.618 127.904 1.00 29.46  ? 359 HIS A O   1 
ATOM   2557 C CB  . HIS A 1 359 ? 13.978  -13.090 130.219 1.00 32.34  ? 359 HIS A CB  1 
ATOM   2558 C CG  . HIS A 1 359 ? 12.718  -13.710 130.726 1.00 33.57  ? 359 HIS A CG  1 
ATOM   2559 N ND1 . HIS A 1 359 ? 12.507  -13.975 132.061 1.00 35.26  ? 359 HIS A ND1 1 
ATOM   2560 C CD2 . HIS A 1 359 ? 11.562  -14.018 130.094 1.00 35.09  ? 359 HIS A CD2 1 
ATOM   2561 C CE1 . HIS A 1 359 ? 11.272  -14.412 132.231 1.00 36.31  ? 359 HIS A CE1 1 
ATOM   2562 N NE2 . HIS A 1 359 ? 10.676  -14.446 131.052 1.00 35.21  ? 359 HIS A NE2 1 
ATOM   2563 N N   . HIS A 1 360 ? 12.100  -10.201 129.309 1.00 30.10  ? 360 HIS A N   1 
ATOM   2564 C CA  . HIS A 1 360 ? 11.172  -9.720  128.294 1.00 28.68  ? 360 HIS A CA  1 
ATOM   2565 C C   . HIS A 1 360 ? 11.650  -8.391  127.759 1.00 27.39  ? 360 HIS A C   1 
ATOM   2566 O O   . HIS A 1 360 ? 10.857  -7.517  127.442 1.00 29.24  ? 360 HIS A O   1 
ATOM   2567 C CB  . HIS A 1 360 ? 9.765   -9.580  128.877 1.00 33.03  ? 360 HIS A CB  1 
ATOM   2568 C CG  . HIS A 1 360 ? 8.853   -10.729 128.566 1.00 35.71  ? 360 HIS A CG  1 
ATOM   2569 N ND1 . HIS A 1 360 ? 9.316   -11.989 128.237 1.00 36.91  ? 360 HIS A ND1 1 
ATOM   2570 C CD2 . HIS A 1 360 ? 7.501   -10.817 128.557 1.00 35.71  ? 360 HIS A CD2 1 
ATOM   2571 C CE1 . HIS A 1 360 ? 8.292   -12.798 128.038 1.00 35.64  ? 360 HIS A CE1 1 
ATOM   2572 N NE2 . HIS A 1 360 ? 7.177   -12.111 128.226 1.00 37.52  ? 360 HIS A NE2 1 
ATOM   2573 N N   . TYR A 1 361 ? 12.966  -8.250  127.669 1.00 24.63  ? 361 TYR A N   1 
ATOM   2574 C CA  . TYR A 1 361 ? 13.598  -7.055  127.137 1.00 21.17  ? 361 TYR A CA  1 
ATOM   2575 C C   . TYR A 1 361 ? 13.406  -6.980  125.610 1.00 20.50  ? 361 TYR A C   1 
ATOM   2576 O O   . TYR A 1 361 ? 13.475  -7.995  124.931 1.00 20.87  ? 361 TYR A O   1 
ATOM   2577 C CB  . TYR A 1 361 ? 15.095  -7.095  127.471 1.00 20.88  ? 361 TYR A CB  1 
ATOM   2578 C CG  . TYR A 1 361 ? 15.914  -6.022  126.776 1.00 22.18  ? 361 TYR A CG  1 
ATOM   2579 C CD1 . TYR A 1 361 ? 15.862  -4.689  127.199 1.00 19.69  ? 361 TYR A CD1 1 
ATOM   2580 C CD2 . TYR A 1 361 ? 16.689  -6.324  125.659 1.00 20.50  ? 361 TYR A CD2 1 
ATOM   2581 C CE1 . TYR A 1 361 ? 16.558  -3.689  126.522 1.00 19.16  ? 361 TYR A CE1 1 
ATOM   2582 C CE2 . TYR A 1 361 ? 17.384  -5.328  124.975 1.00 22.48  ? 361 TYR A CE2 1 
ATOM   2583 C CZ  . TYR A 1 361 ? 17.312  -4.007  125.415 1.00 21.80  ? 361 TYR A CZ  1 
ATOM   2584 O OH  . TYR A 1 361 ? 17.993  -3.010  124.741 1.00 21.43  ? 361 TYR A OH  1 
ATOM   2585 N N   . LEU A 1 362 ? 13.173  -5.785  125.071 1.00 19.87  ? 362 LEU A N   1 
ATOM   2586 C CA  . LEU A 1 362 ? 13.004  -5.633  123.632 1.00 19.56  ? 362 LEU A CA  1 
ATOM   2587 C C   . LEU A 1 362 ? 13.923  -4.572  123.036 1.00 21.49  ? 362 LEU A C   1 
ATOM   2588 O O   . LEU A 1 362 ? 14.454  -4.733  121.944 1.00 21.83  ? 362 LEU A O   1 
ATOM   2589 C CB  . LEU A 1 362 ? 11.566  -5.253  123.282 1.00 19.07  ? 362 LEU A CB  1 
ATOM   2590 C CG  . LEU A 1 362 ? 11.512  -4.969  121.777 1.00 17.91  ? 362 LEU A CG  1 
ATOM   2591 C CD1 . LEU A 1 362 ? 11.198  -6.264  121.068 1.00 17.95  ? 362 LEU A CD1 1 
ATOM   2592 C CD2 . LEU A 1 362 ? 10.493  -3.906  121.435 1.00 15.56  ? 362 LEU A CD2 1 
ATOM   2593 N N   . ARG A 1 363 ? 14.070  -3.459  123.738 1.00 23.40  ? 363 ARG A N   1 
ATOM   2594 C CA  . ARG A 1 363 ? 14.921  -2.367  123.274 1.00 24.47  ? 363 ARG A CA  1 
ATOM   2595 C C   . ARG A 1 363 ? 15.184  -1.491  124.484 1.00 23.12  ? 363 ARG A C   1 
ATOM   2596 O O   . ARG A 1 363 ? 14.380  -1.449  125.420 1.00 21.45  ? 363 ARG A O   1 
ATOM   2597 C CB  . ARG A 1 363 ? 14.228  -1.535  122.181 1.00 26.90  ? 363 ARG A CB  1 
ATOM   2598 C CG  . ARG A 1 363 ? 13.095  -0.665  122.700 1.00 33.30  ? 363 ARG A CG  1 
ATOM   2599 C CD  . ARG A 1 363 ? 12.591  0.329   121.662 1.00 41.23  ? 363 ARG A CD  1 
ATOM   2600 N NE  . ARG A 1 363 ? 13.574  1.363   121.323 1.00 49.68  ? 363 ARG A NE  1 
ATOM   2601 C CZ  . ARG A 1 363 ? 14.118  2.225   122.189 1.00 51.98  ? 363 ARG A CZ  1 
ATOM   2602 N NH1 . ARG A 1 363 ? 13.784  2.199   123.468 1.00 53.96  ? 363 ARG A NH1 1 
ATOM   2603 N NH2 . ARG A 1 363 ? 15.012  3.117   121.776 1.00 53.47  ? 363 ARG A NH2 1 
ATOM   2604 N N   . PRO A 1 364 ? 16.303  -0.758  124.471 1.00 22.22  ? 364 PRO A N   1 
ATOM   2605 C CA  . PRO A 1 364 ? 16.673  0.123   125.584 1.00 22.12  ? 364 PRO A CA  1 
ATOM   2606 C C   . PRO A 1 364 ? 15.487  0.860   126.162 1.00 21.07  ? 364 PRO A C   1 
ATOM   2607 O O   . PRO A 1 364 ? 14.547  1.145   125.452 1.00 22.14  ? 364 PRO A O   1 
ATOM   2608 C CB  . PRO A 1 364 ? 17.703  1.053   124.953 1.00 21.79  ? 364 PRO A CB  1 
ATOM   2609 C CG  . PRO A 1 364 ? 17.346  1.012   123.495 1.00 23.48  ? 364 PRO A CG  1 
ATOM   2610 C CD  . PRO A 1 364 ? 17.093  -0.436  123.276 1.00 19.59  ? 364 PRO A CD  1 
ATOM   2611 N N   . SER A 1 365 ? 15.519  1.141   127.458 1.00 21.07  ? 365 SER A N   1 
ATOM   2612 C CA  . SER A 1 365 ? 14.422  1.856   128.090 1.00 21.82  ? 365 SER A CA  1 
ATOM   2613 C C   . SER A 1 365 ? 14.604  3.376   128.078 1.00 23.15  ? 365 SER A C   1 
ATOM   2614 O O   . SER A 1 365 ? 15.712  3.896   127.911 1.00 23.23  ? 365 SER A O   1 
ATOM   2615 C CB  . SER A 1 365 ? 14.237  1.372   129.529 1.00 23.00  ? 365 SER A CB  1 
ATOM   2616 O OG  . SER A 1 365 ? 13.753  0.038   129.547 1.00 25.42  ? 365 SER A OG  1 
ATOM   2617 N N   . LEU A 1 366 ? 13.499  4.088   128.242 1.00 22.41  ? 366 LEU A N   1 
ATOM   2618 C CA  . LEU A 1 366 ? 13.537  5.535   128.268 1.00 21.94  ? 366 LEU A CA  1 
ATOM   2619 C C   . LEU A 1 366 ? 13.219  6.009   129.691 1.00 25.05  ? 366 LEU A C   1 
ATOM   2620 O O   . LEU A 1 366 ? 12.908  5.196   130.558 1.00 23.41  ? 366 LEU A O   1 
ATOM   2621 C CB  . LEU A 1 366 ? 12.530  6.074   127.259 1.00 19.23  ? 366 LEU A CB  1 
ATOM   2622 C CG  . LEU A 1 366 ? 12.874  5.750   125.801 1.00 16.87  ? 366 LEU A CG  1 
ATOM   2623 C CD1 . LEU A 1 366 ? 11.725  6.106   124.877 1.00 14.08  ? 366 LEU A CD1 1 
ATOM   2624 C CD2 . LEU A 1 366 ? 14.127  6.515   125.405 1.00 17.16  ? 366 LEU A CD2 1 
ATOM   2625 N N   . PHE A 1 367 ? 13.334  7.314   129.946 1.00 28.90  ? 367 PHE A N   1 
ATOM   2626 C CA  . PHE A 1 367 ? 13.044  7.868   131.277 1.00 29.91  ? 367 PHE A CA  1 
ATOM   2627 C C   . PHE A 1 367 ? 11.941  8.897   131.143 1.00 31.04  ? 367 PHE A C   1 
ATOM   2628 O O   . PHE A 1 367 ? 11.999  9.761   130.262 1.00 32.17  ? 367 PHE A O   1 
ATOM   2629 C CB  . PHE A 1 367 ? 14.277  8.541   131.883 1.00 31.20  ? 367 PHE A CB  1 
ATOM   2630 C CG  . PHE A 1 367 ? 14.074  9.006   133.297 1.00 33.38  ? 367 PHE A CG  1 
ATOM   2631 C CD1 . PHE A 1 367 ? 13.871  8.091   134.324 1.00 34.55  ? 367 PHE A CD1 1 
ATOM   2632 C CD2 . PHE A 1 367 ? 14.062  10.362  133.601 1.00 33.87  ? 367 PHE A CD2 1 
ATOM   2633 C CE1 . PHE A 1 367 ? 13.659  8.523   135.630 1.00 34.24  ? 367 PHE A CE1 1 
ATOM   2634 C CE2 . PHE A 1 367 ? 13.850  10.805  134.896 1.00 32.06  ? 367 PHE A CE2 1 
ATOM   2635 C CZ  . PHE A 1 367 ? 13.648  9.887   135.913 1.00 34.82  ? 367 PHE A CZ  1 
ATOM   2636 N N   . VAL A 1 368 ? 10.935  8.806   132.007 1.00 30.85  ? 368 VAL A N   1 
ATOM   2637 C CA  . VAL A 1 368 ? 9.828   9.740   131.936 1.00 32.74  ? 368 VAL A CA  1 
ATOM   2638 C C   . VAL A 1 368 ? 9.820   10.647  133.152 1.00 34.15  ? 368 VAL A C   1 
ATOM   2639 O O   . VAL A 1 368 ? 9.766   10.183  134.289 1.00 33.63  ? 368 VAL A O   1 
ATOM   2640 C CB  . VAL A 1 368 ? 8.465   9.004   131.812 1.00 33.55  ? 368 VAL A CB  1 
ATOM   2641 C CG1 . VAL A 1 368 ? 7.344   10.009  131.622 1.00 34.73  ? 368 VAL A CG1 1 
ATOM   2642 C CG2 . VAL A 1 368 ? 8.482   8.059   130.626 1.00 32.47  ? 368 VAL A CG2 1 
ATOM   2643 N N   . TYR A 1 369 ? 9.891   11.948  132.888 1.00 36.18  ? 369 TYR A N   1 
ATOM   2644 C CA  . TYR A 1 369 ? 9.896   12.975  133.925 1.00 38.21  ? 369 TYR A CA  1 
ATOM   2645 C C   . TYR A 1 369 ? 8.827   13.980  133.521 1.00 39.28  ? 369 TYR A C   1 
ATOM   2646 O O   . TYR A 1 369 ? 8.532   14.121  132.341 1.00 38.68  ? 369 TYR A O   1 
ATOM   2647 C CB  . TYR A 1 369 ? 11.265  13.669  133.972 1.00 39.14  ? 369 TYR A CB  1 
ATOM   2648 C CG  . TYR A 1 369 ? 11.550  14.428  135.254 1.00 40.12  ? 369 TYR A CG  1 
ATOM   2649 C CD1 . TYR A 1 369 ? 11.880  13.752  136.437 1.00 40.02  ? 369 TYR A CD1 1 
ATOM   2650 C CD2 . TYR A 1 369 ? 11.452  15.821  135.296 1.00 41.66  ? 369 TYR A CD2 1 
ATOM   2651 C CE1 . TYR A 1 369 ? 12.104  14.447  137.634 1.00 38.99  ? 369 TYR A CE1 1 
ATOM   2652 C CE2 . TYR A 1 369 ? 11.669  16.530  136.488 1.00 40.53  ? 369 TYR A CE2 1 
ATOM   2653 C CZ  . TYR A 1 369 ? 11.993  15.841  137.650 1.00 40.42  ? 369 TYR A CZ  1 
ATOM   2654 O OH  . TYR A 1 369 ? 12.196  16.554  138.813 1.00 37.21  ? 369 TYR A OH  1 
ATOM   2655 N N   . PRO A 1 370 ? 8.217   14.674  134.494 1.00 41.05  ? 370 PRO A N   1 
ATOM   2656 C CA  . PRO A 1 370 ? 7.182   15.657  134.172 1.00 43.04  ? 370 PRO A CA  1 
ATOM   2657 C C   . PRO A 1 370 ? 7.764   16.876  133.479 1.00 45.46  ? 370 PRO A C   1 
ATOM   2658 O O   . PRO A 1 370 ? 8.915   17.235  133.715 1.00 44.88  ? 370 PRO A O   1 
ATOM   2659 C CB  . PRO A 1 370 ? 6.594   15.994  135.536 1.00 42.17  ? 370 PRO A CB  1 
ATOM   2660 C CG  . PRO A 1 370 ? 7.761   15.817  136.449 1.00 41.27  ? 370 PRO A CG  1 
ATOM   2661 C CD  . PRO A 1 370 ? 8.351   14.528  135.953 1.00 41.54  ? 370 PRO A CD  1 
ATOM   2662 N N   . GLU A 1 371 ? 6.967   17.499  132.616 1.00 48.49  ? 371 GLU A N   1 
ATOM   2663 C CA  . GLU A 1 371 ? 7.401   18.690  131.896 1.00 52.46  ? 371 GLU A CA  1 
ATOM   2664 C C   . GLU A 1 371 ? 6.486   19.866  132.216 1.00 53.89  ? 371 GLU A C   1 
ATOM   2665 O O   . GLU A 1 371 ? 5.709   20.324  131.371 1.00 53.51  ? 371 GLU A O   1 
ATOM   2666 C CB  . GLU A 1 371 ? 7.411   18.445  130.387 1.00 54.08  ? 371 GLU A CB  1 
ATOM   2667 C CG  . GLU A 1 371 ? 8.015   19.612  129.609 1.00 58.02  ? 371 GLU A CG  1 
ATOM   2668 C CD  . GLU A 1 371 ? 9.505   19.829  129.899 1.00 59.83  ? 371 GLU A CD  1 
ATOM   2669 O OE1 . GLU A 1 371 ? 9.920   19.804  131.082 1.00 61.92  ? 371 GLU A OE1 1 
ATOM   2670 O OE2 . GLU A 1 371 ? 10.267  20.041  128.933 1.00 60.17  ? 371 GLU A OE2 1 
ATOM   2671 N N   . GLU A 1 372 ? 6.608   20.354  133.447 1.00 55.51  ? 372 GLU A N   1 
ATOM   2672 C CA  . GLU A 1 372 ? 5.811   21.463  133.966 1.00 56.47  ? 372 GLU A CA  1 
ATOM   2673 C C   . GLU A 1 372 ? 5.632   22.678  133.037 1.00 56.54  ? 372 GLU A C   1 
ATOM   2674 O O   . GLU A 1 372 ? 4.639   23.400  133.157 1.00 57.84  ? 372 GLU A O   1 
ATOM   2675 C CB  . GLU A 1 372 ? 6.415   21.911  135.297 1.00 56.62  ? 372 GLU A CB  1 
ATOM   2676 C CG  . GLU A 1 372 ? 5.519   22.774  136.171 1.00 58.52  ? 372 GLU A CG  1 
ATOM   2677 C CD  . GLU A 1 372 ? 4.269   22.055  136.648 1.00 59.87  ? 372 GLU A CD  1 
ATOM   2678 O OE1 . GLU A 1 372 ? 4.359   20.873  137.041 1.00 59.04  ? 372 GLU A OE1 1 
ATOM   2679 O OE2 . GLU A 1 372 ? 3.193   22.683  136.644 1.00 61.03  ? 372 GLU A OE2 1 
ATOM   2680 N N   . SER A 1 373 ? 6.570   22.892  132.112 1.00 55.27  ? 373 SER A N   1 
ATOM   2681 C CA  . SER A 1 373 ? 6.520   24.034  131.186 1.00 53.74  ? 373 SER A CA  1 
ATOM   2682 C C   . SER A 1 373 ? 5.323   24.087  130.229 1.00 53.07  ? 373 SER A C   1 
ATOM   2683 O O   . SER A 1 373 ? 4.791   25.162  129.948 1.00 52.52  ? 373 SER A O   1 
ATOM   2684 C CB  . SER A 1 373 ? 7.804   24.087  130.352 1.00 53.66  ? 373 SER A CB  1 
ATOM   2685 O OG  . SER A 1 373 ? 7.868   23.008  129.425 1.00 56.34  ? 373 SER A OG  1 
ATOM   2686 N N   . LEU A 1 374 ? 4.911   22.933  129.715 1.00 52.33  ? 374 LEU A N   1 
ATOM   2687 C CA  . LEU A 1 374 ? 3.798   22.886  128.778 1.00 50.66  ? 374 LEU A CA  1 
ATOM   2688 C C   . LEU A 1 374 ? 2.463   22.883  129.506 1.00 49.03  ? 374 LEU A C   1 
ATOM   2689 O O   . LEU A 1 374 ? 1.661   23.798  129.351 1.00 49.14  ? 374 LEU A O   1 
ATOM   2690 C CB  . LEU A 1 374 ? 3.929   21.655  127.878 1.00 50.71  ? 374 LEU A CB  1 
ATOM   2691 C CG  . LEU A 1 374 ? 5.312   21.491  127.233 1.00 51.22  ? 374 LEU A CG  1 
ATOM   2692 C CD1 . LEU A 1 374 ? 5.243   20.404  126.168 1.00 52.08  ? 374 LEU A CD1 1 
ATOM   2693 C CD2 . LEU A 1 374 ? 5.776   22.807  126.618 1.00 50.93  ? 374 LEU A CD2 1 
ATOM   2694 N N   . VAL A 1 375 ? 2.223   21.853  130.299 1.00 47.77  ? 375 VAL A N   1 
ATOM   2695 C CA  . VAL A 1 375 ? 0.986   21.771  131.054 1.00 47.03  ? 375 VAL A CA  1 
ATOM   2696 C C   . VAL A 1 375 ? 1.331   21.924  132.526 1.00 47.55  ? 375 VAL A C   1 
ATOM   2697 O O   . VAL A 1 375 ? 1.997   21.071  133.121 1.00 47.83  ? 375 VAL A O   1 
ATOM   2698 C CB  . VAL A 1 375 ? 0.267   20.420  130.826 1.00 46.07  ? 375 VAL A CB  1 
ATOM   2699 C CG1 . VAL A 1 375 ? -0.902  20.278  131.790 1.00 43.66  ? 375 VAL A CG1 1 
ATOM   2700 C CG2 . VAL A 1 375 ? -0.217  20.332  129.389 1.00 44.63  ? 375 VAL A CG2 1 
ATOM   2701 N N   . ILE A 1 376 ? 0.887   23.027  133.107 1.00 46.57  ? 376 ILE A N   1 
ATOM   2702 C CA  . ILE A 1 376 ? 1.162   23.282  134.501 1.00 46.01  ? 376 ILE A CA  1 
ATOM   2703 C C   . ILE A 1 376 ? 0.248   22.456  135.394 1.00 45.43  ? 376 ILE A C   1 
ATOM   2704 O O   . ILE A 1 376 ? -0.965  22.388  135.170 1.00 44.45  ? 376 ILE A O   1 
ATOM   2705 C CB  . ILE A 1 376 ? 0.992   24.774  134.811 1.00 47.70  ? 376 ILE A CB  1 
ATOM   2706 C CG1 . ILE A 1 376 ? 2.020   25.574  133.997 1.00 48.62  ? 376 ILE A CG1 1 
ATOM   2707 C CG2 . ILE A 1 376 ? 1.132   25.015  136.309 1.00 47.31  ? 376 ILE A CG2 1 
ATOM   2708 C CD1 . ILE A 1 376 ? 1.873   27.084  134.086 1.00 49.39  ? 376 ILE A CD1 1 
ATOM   2709 N N   . GLY A 1 377 ? 0.854   21.829  136.400 1.00 44.97  ? 377 GLY A N   1 
ATOM   2710 C CA  . GLY A 1 377 ? 0.124   21.002  137.344 1.00 44.70  ? 377 GLY A CA  1 
ATOM   2711 C C   . GLY A 1 377 ? 0.560   19.554  137.222 1.00 44.85  ? 377 GLY A C   1 
ATOM   2712 O O   . GLY A 1 377 ? 0.301   18.730  138.105 1.00 45.19  ? 377 GLY A O   1 
ATOM   2713 N N   . SER A 1 378 ? 1.237   19.256  136.115 1.00 43.05  ? 378 SER A N   1 
ATOM   2714 C CA  . SER A 1 378 ? 1.719   17.915  135.820 1.00 41.18  ? 378 SER A CA  1 
ATOM   2715 C C   . SER A 1 378 ? 2.664   17.378  136.892 1.00 40.13  ? 378 SER A C   1 
ATOM   2716 O O   . SER A 1 378 ? 2.471   16.275  137.407 1.00 39.72  ? 378 SER A O   1 
ATOM   2717 C CB  . SER A 1 378 ? 2.427   17.910  134.466 1.00 42.34  ? 378 SER A CB  1 
ATOM   2718 O OG  . SER A 1 378 ? 1.616   18.474  133.452 1.00 43.33  ? 378 SER A OG  1 
ATOM   2719 N N   . SER A 1 379 ? 3.689   18.153  137.225 1.00 39.10  ? 379 SER A N   1 
ATOM   2720 C CA  . SER A 1 379 ? 4.646   17.725  138.236 1.00 38.68  ? 379 SER A CA  1 
ATOM   2721 C C   . SER A 1 379 ? 3.883   17.227  139.466 1.00 38.22  ? 379 SER A C   1 
ATOM   2722 O O   . SER A 1 379 ? 4.363   16.376  140.225 1.00 36.22  ? 379 SER A O   1 
ATOM   2723 C CB  . SER A 1 379 ? 5.581   18.880  138.616 1.00 39.30  ? 379 SER A CB  1 
ATOM   2724 O OG  . SER A 1 379 ? 6.327   19.341  137.501 1.00 38.05  ? 379 SER A OG  1 
ATOM   2725 N N   . THR A 1 380 ? 2.682   17.749  139.665 1.00 37.59  ? 380 THR A N   1 
ATOM   2726 C CA  . THR A 1 380 ? 1.907   17.292  140.800 1.00 38.54  ? 380 THR A CA  1 
ATOM   2727 C C   . THR A 1 380 ? 1.267   15.936  140.483 1.00 37.59  ? 380 THR A C   1 
ATOM   2728 O O   . THR A 1 380 ? 1.606   14.940  141.123 1.00 38.03  ? 380 THR A O   1 
ATOM   2729 C CB  . THR A 1 380 ? 0.847   18.346  141.229 1.00 39.04  ? 380 THR A CB  1 
ATOM   2730 O OG1 . THR A 1 380 ? 1.525   19.497  141.761 1.00 37.67  ? 380 THR A OG1 1 
ATOM   2731 C CG2 . THR A 1 380 ? -0.082  17.782  142.315 1.00 38.11  ? 380 THR A CG2 1 
ATOM   2732 N N   . LEU A 1 381 ? 0.378   15.876  139.493 1.00 35.82  ? 381 LEU A N   1 
ATOM   2733 C CA  . LEU A 1 381 ? -0.264  14.605  139.157 1.00 35.04  ? 381 LEU A CA  1 
ATOM   2734 C C   . LEU A 1 381 ? 0.782   13.483  139.029 1.00 35.66  ? 381 LEU A C   1 
ATOM   2735 O O   . LEU A 1 381 ? 0.649   12.404  139.614 1.00 33.82  ? 381 LEU A O   1 
ATOM   2736 C CB  . LEU A 1 381 ? -1.060  14.733  137.848 1.00 32.44  ? 381 LEU A CB  1 
ATOM   2737 C CG  . LEU A 1 381 ? -2.388  13.954  137.855 1.00 30.72  ? 381 LEU A CG  1 
ATOM   2738 C CD1 . LEU A 1 381 ? -3.039  13.934  136.478 1.00 29.30  ? 381 LEU A CD1 1 
ATOM   2739 C CD2 . LEU A 1 381 ? -2.128  12.555  138.325 1.00 27.98  ? 381 LEU A CD2 1 
ATOM   2740 N N   . PHE A 1 382 ? 1.827   13.762  138.263 1.00 36.12  ? 382 PHE A N   1 
ATOM   2741 C CA  . PHE A 1 382 ? 2.903   12.815  138.034 1.00 37.08  ? 382 PHE A CA  1 
ATOM   2742 C C   . PHE A 1 382 ? 3.446   12.309  139.366 1.00 37.87  ? 382 PHE A C   1 
ATOM   2743 O O   . PHE A 1 382 ? 3.548   11.108  139.602 1.00 38.58  ? 382 PHE A O   1 
ATOM   2744 C CB  . PHE A 1 382 ? 4.013   13.517  137.244 1.00 37.18  ? 382 PHE A CB  1 
ATOM   2745 C CG  . PHE A 1 382 ? 5.175   12.632  136.888 1.00 35.51  ? 382 PHE A CG  1 
ATOM   2746 C CD1 . PHE A 1 382 ? 5.447   12.336  135.563 1.00 35.25  ? 382 PHE A CD1 1 
ATOM   2747 C CD2 . PHE A 1 382 ? 6.013   12.124  137.869 1.00 34.00  ? 382 PHE A CD2 1 
ATOM   2748 C CE1 . PHE A 1 382 ? 6.535   11.549  135.224 1.00 35.87  ? 382 PHE A CE1 1 
ATOM   2749 C CE2 . PHE A 1 382 ? 7.102   11.338  137.539 1.00 34.00  ? 382 PHE A CE2 1 
ATOM   2750 C CZ  . PHE A 1 382 ? 7.365   11.049  136.218 1.00 35.68  ? 382 PHE A CZ  1 
ATOM   2751 N N   . SER A 1 383 ? 3.798   13.249  140.231 1.00 39.32  ? 383 SER A N   1 
ATOM   2752 C CA  . SER A 1 383 ? 4.351   12.932  141.540 1.00 39.72  ? 383 SER A CA  1 
ATOM   2753 C C   . SER A 1 383 ? 3.448   12.016  142.354 1.00 39.41  ? 383 SER A C   1 
ATOM   2754 O O   . SER A 1 383 ? 3.925   11.109  143.033 1.00 38.41  ? 383 SER A O   1 
ATOM   2755 C CB  . SER A 1 383 ? 4.598   14.226  142.316 1.00 41.21  ? 383 SER A CB  1 
ATOM   2756 O OG  . SER A 1 383 ? 5.244   13.967  143.551 1.00 43.17  ? 383 SER A OG  1 
ATOM   2757 N N   . ALA A 1 384 ? 2.143   12.260  142.293 1.00 40.01  ? 384 ALA A N   1 
ATOM   2758 C CA  . ALA A 1 384 ? 1.188   11.449  143.043 1.00 41.19  ? 384 ALA A CA  1 
ATOM   2759 C C   . ALA A 1 384 ? 1.240   10.015  142.529 1.00 41.73  ? 384 ALA A C   1 
ATOM   2760 O O   . ALA A 1 384 ? 1.303   9.052   143.307 1.00 42.79  ? 384 ALA A O   1 
ATOM   2761 C CB  . ALA A 1 384 ? -0.219  12.023  142.890 1.00 40.93  ? 384 ALA A CB  1 
ATOM   2762 N N   . LEU A 1 385 ? 1.215   9.890   141.208 1.00 40.52  ? 385 LEU A N   1 
ATOM   2763 C CA  . LEU A 1 385 ? 1.280   8.593   140.568 1.00 39.56  ? 385 LEU A CA  1 
ATOM   2764 C C   . LEU A 1 385 ? 2.549   7.859   140.978 1.00 38.77  ? 385 LEU A C   1 
ATOM   2765 O O   . LEU A 1 385 ? 2.491   6.719   141.442 1.00 38.84  ? 385 LEU A O   1 
ATOM   2766 C CB  . LEU A 1 385 ? 1.222   8.769   139.050 1.00 38.28  ? 385 LEU A CB  1 
ATOM   2767 C CG  . LEU A 1 385 ? -0.218  8.948   138.566 1.00 36.98  ? 385 LEU A CG  1 
ATOM   2768 C CD1 . LEU A 1 385 ? -0.271  9.665   137.247 1.00 35.56  ? 385 LEU A CD1 1 
ATOM   2769 C CD2 . LEU A 1 385 ? -0.861  7.576   138.467 1.00 37.05  ? 385 LEU A CD2 1 
ATOM   2770 N N   . LEU A 1 386 ? 3.692   8.516   140.830 1.00 36.54  ? 386 LEU A N   1 
ATOM   2771 C CA  . LEU A 1 386 ? 4.941   7.880   141.191 1.00 37.15  ? 386 LEU A CA  1 
ATOM   2772 C C   . LEU A 1 386 ? 4.911   7.420   142.639 1.00 38.89  ? 386 LEU A C   1 
ATOM   2773 O O   . LEU A 1 386 ? 5.477   6.386   142.992 1.00 39.12  ? 386 LEU A O   1 
ATOM   2774 C CB  . LEU A 1 386 ? 6.109   8.833   140.984 1.00 35.77  ? 386 LEU A CB  1 
ATOM   2775 C CG  . LEU A 1 386 ? 7.474   8.214   141.305 1.00 36.98  ? 386 LEU A CG  1 
ATOM   2776 C CD1 . LEU A 1 386 ? 7.731   6.966   140.463 1.00 36.41  ? 386 LEU A CD1 1 
ATOM   2777 C CD2 . LEU A 1 386 ? 8.545   9.246   141.030 1.00 40.13  ? 386 LEU A CD2 1 
ATOM   2778 N N   . ILE A 1 387 ? 4.234   8.180   143.483 1.00 40.77  ? 387 ILE A N   1 
ATOM   2779 C CA  . ILE A 1 387 ? 4.173   7.824   144.887 1.00 42.22  ? 387 ILE A CA  1 
ATOM   2780 C C   . ILE A 1 387 ? 3.279   6.621   145.109 1.00 43.04  ? 387 ILE A C   1 
ATOM   2781 O O   . ILE A 1 387 ? 3.604   5.738   145.906 1.00 42.82  ? 387 ILE A O   1 
ATOM   2782 C CB  . ILE A 1 387 ? 3.676   9.008   145.743 1.00 42.34  ? 387 ILE A CB  1 
ATOM   2783 C CG1 . ILE A 1 387 ? 4.718   10.133  145.714 1.00 42.60  ? 387 ILE A CG1 1 
ATOM   2784 C CG2 . ILE A 1 387 ? 3.444   8.556   147.172 1.00 42.33  ? 387 ILE A CG2 1 
ATOM   2785 C CD1 . ILE A 1 387 ? 4.299   11.408  146.422 1.00 41.63  ? 387 ILE A CD1 1 
ATOM   2786 N N   . LYS A 1 388 ? 2.163   6.575   144.392 1.00 44.06  ? 388 LYS A N   1 
ATOM   2787 C CA  . LYS A 1 388 ? 1.228   5.471   144.546 1.00 45.66  ? 388 LYS A CA  1 
ATOM   2788 C C   . LYS A 1 388 ? 1.660   4.178   143.849 1.00 46.30  ? 388 LYS A C   1 
ATOM   2789 O O   . LYS A 1 388 ? 1.385   3.079   144.344 1.00 45.87  ? 388 LYS A O   1 
ATOM   2790 C CB  . LYS A 1 388 ? -0.170  5.901   144.080 1.00 46.55  ? 388 LYS A CB  1 
ATOM   2791 C CG  . LYS A 1 388 ? -0.901  6.790   145.084 1.00 46.82  ? 388 LYS A CG  1 
ATOM   2792 C CD  . LYS A 1 388 ? -1.005  6.100   146.449 1.00 48.06  ? 388 LYS A CD  1 
ATOM   2793 C CE  . LYS A 1 388 ? -1.711  6.974   147.471 1.00 49.71  ? 388 LYS A CE  1 
ATOM   2794 N NZ  . LYS A 1 388 ? -1.719  6.360   148.824 1.00 49.72  ? 388 LYS A NZ  1 
ATOM   2795 N N   . CYS A 1 389 ? 2.339   4.296   142.712 1.00 46.16  ? 389 CYS A N   1 
ATOM   2796 C CA  . CYS A 1 389 ? 2.786   3.105   142.006 1.00 45.66  ? 389 CYS A CA  1 
ATOM   2797 C C   . CYS A 1 389 ? 3.851   2.409   142.815 1.00 46.17  ? 389 CYS A C   1 
ATOM   2798 O O   . CYS A 1 389 ? 3.938   1.187   142.799 1.00 47.07  ? 389 CYS A O   1 
ATOM   2799 C CB  . CYS A 1 389 ? 3.333   3.461   140.633 1.00 45.30  ? 389 CYS A CB  1 
ATOM   2800 S SG  . CYS A 1 389 ? 2.046   3.916   139.466 1.00 45.25  ? 389 CYS A SG  1 
ATOM   2801 N N   . LEU A 1 390 ? 4.661   3.191   143.523 1.00 46.50  ? 390 LEU A N   1 
ATOM   2802 C CA  . LEU A 1 390 ? 5.714   2.635   144.360 1.00 47.17  ? 390 LEU A CA  1 
ATOM   2803 C C   . LEU A 1 390 ? 5.087   1.931   145.550 1.00 48.55  ? 390 LEU A C   1 
ATOM   2804 O O   . LEU A 1 390 ? 5.529   0.844   145.937 1.00 48.71  ? 390 LEU A O   1 
ATOM   2805 C CB  . LEU A 1 390 ? 6.651   3.738   144.844 1.00 47.53  ? 390 LEU A CB  1 
ATOM   2806 C CG  . LEU A 1 390 ? 7.643   4.225   143.787 1.00 49.04  ? 390 LEU A CG  1 
ATOM   2807 C CD1 . LEU A 1 390 ? 8.230   5.577   144.161 1.00 48.58  ? 390 LEU A CD1 1 
ATOM   2808 C CD2 . LEU A 1 390 ? 8.728   3.180   143.631 1.00 49.41  ? 390 LEU A CD2 1 
ATOM   2809 N N   . GLU A 1 391 ? 4.054   2.550   146.122 1.00 49.25  ? 391 GLU A N   1 
ATOM   2810 C CA  . GLU A 1 391 ? 3.352   1.972   147.265 1.00 50.29  ? 391 GLU A CA  1 
ATOM   2811 C C   . GLU A 1 391 ? 2.675   0.671   146.879 1.00 49.70  ? 391 GLU A C   1 
ATOM   2812 O O   . GLU A 1 391 ? 2.744   -0.311  147.608 1.00 49.38  ? 391 GLU A O   1 
ATOM   2813 C CB  . GLU A 1 391 ? 2.282   2.924   147.803 1.00 52.96  ? 391 GLU A CB  1 
ATOM   2814 C CG  . GLU A 1 391 ? 2.789   4.017   148.732 1.00 58.33  ? 391 GLU A CG  1 
ATOM   2815 C CD  . GLU A 1 391 ? 1.657   4.836   149.365 1.00 60.81  ? 391 GLU A CD  1 
ATOM   2816 O OE1 . GLU A 1 391 ? 1.965   5.798   150.107 1.00 62.69  ? 391 GLU A OE1 1 
ATOM   2817 O OE2 . GLU A 1 391 ? 0.465   4.521   149.127 1.00 61.25  ? 391 GLU A OE2 1 
ATOM   2818 N N   . LYS A 1 392 ? 2.024   0.666   145.723 1.00 50.03  ? 392 LYS A N   1 
ATOM   2819 C CA  . LYS A 1 392 ? 1.322   -0.522  145.267 1.00 50.00  ? 392 LYS A CA  1 
ATOM   2820 C C   . LYS A 1 392 ? 2.136   -1.509  144.440 1.00 49.52  ? 392 LYS A C   1 
ATOM   2821 O O   . LYS A 1 392 ? 1.624   -2.566  144.077 1.00 49.95  ? 392 LYS A O   1 
ATOM   2822 C CB  . LYS A 1 392 ? 0.080   -0.108  144.492 1.00 49.73  ? 392 LYS A CB  1 
ATOM   2823 C CG  . LYS A 1 392 ? -0.886  0.677   145.336 1.00 51.31  ? 392 LYS A CG  1 
ATOM   2824 C CD  . LYS A 1 392 ? -2.125  1.010   144.559 1.00 53.85  ? 392 LYS A CD  1 
ATOM   2825 C CE  . LYS A 1 392 ? -3.250  1.378   145.493 1.00 56.07  ? 392 LYS A CE  1 
ATOM   2826 N NZ  . LYS A 1 392 ? -4.491  1.580   144.710 1.00 60.06  ? 392 LYS A NZ  1 
ATOM   2827 N N   . GLU A 1 393 ? 3.400   -1.182  144.165 1.00 48.31  ? 393 GLU A N   1 
ATOM   2828 C CA  . GLU A 1 393 ? 4.271   -2.050  143.371 1.00 46.08  ? 393 GLU A CA  1 
ATOM   2829 C C   . GLU A 1 393 ? 3.564   -2.388  142.074 1.00 42.48  ? 393 GLU A C   1 
ATOM   2830 O O   . GLU A 1 393 ? 3.310   -3.546  141.754 1.00 42.79  ? 393 GLU A O   1 
ATOM   2831 C CB  . GLU A 1 393 ? 4.590   -3.337  144.125 1.00 48.72  ? 393 GLU A CB  1 
ATOM   2832 C CG  . GLU A 1 393 ? 5.453   -3.138  145.342 1.00 52.89  ? 393 GLU A CG  1 
ATOM   2833 C CD  . GLU A 1 393 ? 5.956   -4.450  145.892 1.00 56.11  ? 393 GLU A CD  1 
ATOM   2834 O OE1 . GLU A 1 393 ? 5.143   -5.228  146.449 1.00 56.92  ? 393 GLU A OE1 1 
ATOM   2835 O OE2 . GLU A 1 393 ? 7.172   -4.707  145.755 1.00 59.40  ? 393 GLU A OE2 1 
ATOM   2836 N N   . VAL A 1 394 ? 3.263   -1.355  141.318 1.00 38.26  ? 394 VAL A N   1 
ATOM   2837 C CA  . VAL A 1 394 ? 2.546   -1.546  140.095 1.00 35.62  ? 394 VAL A CA  1 
ATOM   2838 C C   . VAL A 1 394 ? 3.075   -0.555  139.072 1.00 35.29  ? 394 VAL A C   1 
ATOM   2839 O O   . VAL A 1 394 ? 3.465   0.564   139.422 1.00 35.52  ? 394 VAL A O   1 
ATOM   2840 C CB  . VAL A 1 394 ? 1.045   -1.322  140.373 1.00 34.57  ? 394 VAL A CB  1 
ATOM   2841 C CG1 . VAL A 1 394 ? 0.589   0.031   139.847 1.00 34.30  ? 394 VAL A CG1 1 
ATOM   2842 C CG2 . VAL A 1 394 ? 0.255   -2.447  139.815 1.00 35.01  ? 394 VAL A CG2 1 
ATOM   2843 N N   . ALA A 1 395 ? 3.113   -0.976  137.813 1.00 32.98  ? 395 ALA A N   1 
ATOM   2844 C CA  . ALA A 1 395 ? 3.573   -0.108  136.748 1.00 30.64  ? 395 ALA A CA  1 
ATOM   2845 C C   . ALA A 1 395 ? 2.355   0.303   135.926 1.00 30.99  ? 395 ALA A C   1 
ATOM   2846 O O   . ALA A 1 395 ? 1.343   -0.387  135.909 1.00 30.91  ? 395 ALA A O   1 
ATOM   2847 C CB  . ALA A 1 395 ? 4.573   -0.840  135.887 1.00 29.18  ? 395 ALA A CB  1 
ATOM   2848 N N   . ALA A 1 396 ? 2.437   1.441   135.260 1.00 31.60  ? 396 ALA A N   1 
ATOM   2849 C CA  . ALA A 1 396 ? 1.315   1.887   134.455 1.00 32.81  ? 396 ALA A CA  1 
ATOM   2850 C C   . ALA A 1 396 ? 1.553   1.496   133.011 1.00 33.65  ? 396 ALA A C   1 
ATOM   2851 O O   . ALA A 1 396 ? 2.550   1.890   132.399 1.00 33.76  ? 396 ALA A O   1 
ATOM   2852 C CB  . ALA A 1 396 ? 1.140   3.386   134.575 1.00 32.88  ? 396 ALA A CB  1 
ATOM   2853 N N   . LEU A 1 397 ? 0.617   0.713   132.483 1.00 35.04  ? 397 LEU A N   1 
ATOM   2854 C CA  . LEU A 1 397 ? 0.659   0.204   131.114 1.00 34.31  ? 397 LEU A CA  1 
ATOM   2855 C C   . LEU A 1 397 ? 0.096   1.213   130.116 1.00 33.86  ? 397 LEU A C   1 
ATOM   2856 O O   . LEU A 1 397 ? -1.052  1.635   130.228 1.00 34.33  ? 397 LEU A O   1 
ATOM   2857 C CB  . LEU A 1 397 ? -0.128  -1.104  131.051 1.00 34.62  ? 397 LEU A CB  1 
ATOM   2858 C CG  . LEU A 1 397 ? -0.100  -1.865  129.734 1.00 36.00  ? 397 LEU A CG  1 
ATOM   2859 C CD1 . LEU A 1 397 ? 1.315   -1.943  129.225 1.00 36.82  ? 397 LEU A CD1 1 
ATOM   2860 C CD2 . LEU A 1 397 ? -0.667  -3.253  129.945 1.00 37.21  ? 397 LEU A CD2 1 
ATOM   2861 N N   . CYS A 1 398 ? 0.902   1.587   129.131 1.00 33.42  ? 398 CYS A N   1 
ATOM   2862 C CA  . CYS A 1 398 ? 0.473   2.578   128.155 1.00 33.82  ? 398 CYS A CA  1 
ATOM   2863 C C   . CYS A 1 398 ? 0.718   2.196   126.697 1.00 34.43  ? 398 CYS A C   1 
ATOM   2864 O O   . CYS A 1 398 ? 1.608   1.403   126.378 1.00 34.33  ? 398 CYS A O   1 
ATOM   2865 C CB  . CYS A 1 398 ? 1.185   3.910   128.421 1.00 34.46  ? 398 CYS A CB  1 
ATOM   2866 S SG  . CYS A 1 398 ? 1.264   4.437   130.157 1.00 36.66  ? 398 CYS A SG  1 
ATOM   2867 N N   . ARG A 1 399 ? -0.085  2.781   125.815 1.00 33.09  ? 399 ARG A N   1 
ATOM   2868 C CA  . ARG A 1 399 ? 0.070   2.556   124.394 1.00 31.07  ? 399 ARG A CA  1 
ATOM   2869 C C   . ARG A 1 399 ? 0.883   3.761   123.936 1.00 30.01  ? 399 ARG A C   1 
ATOM   2870 O O   . ARG A 1 399 ? 0.370   4.868   123.802 1.00 30.03  ? 399 ARG A O   1 
ATOM   2871 C CB  . ARG A 1 399 ? -1.287  2.512   123.710 1.00 31.69  ? 399 ARG A CB  1 
ATOM   2872 C CG  . ARG A 1 399 ? -1.343  1.519   122.563 1.00 32.89  ? 399 ARG A CG  1 
ATOM   2873 C CD  . ARG A 1 399 ? -2.774  1.192   122.213 1.00 34.66  ? 399 ARG A CD  1 
ATOM   2874 N NE  . ARG A 1 399 ? -3.465  2.352   121.660 1.00 38.45  ? 399 ARG A NE  1 
ATOM   2875 C CZ  . ARG A 1 399 ? -4.781  2.534   121.702 1.00 37.79  ? 399 ARG A CZ  1 
ATOM   2876 N NH1 . ARG A 1 399 ? -5.559  1.624   122.284 1.00 36.90  ? 399 ARG A NH1 1 
ATOM   2877 N NH2 . ARG A 1 399 ? -5.315  3.623   121.156 1.00 36.21  ? 399 ARG A NH2 1 
ATOM   2878 N N   . TYR A 1 400 ? 2.166   3.522   123.722 1.00 28.14  ? 400 TYR A N   1 
ATOM   2879 C CA  . TYR A 1 400 ? 3.124   4.536   123.329 1.00 28.50  ? 400 TYR A CA  1 
ATOM   2880 C C   . TYR A 1 400 ? 3.220   4.772   121.816 1.00 29.49  ? 400 TYR A C   1 
ATOM   2881 O O   . TYR A 1 400 ? 3.250   3.821   121.036 1.00 30.23  ? 400 TYR A O   1 
ATOM   2882 C CB  . TYR A 1 400 ? 4.469   4.109   123.911 1.00 27.94  ? 400 TYR A CB  1 
ATOM   2883 C CG  . TYR A 1 400 ? 5.664   4.946   123.558 1.00 29.42  ? 400 TYR A CG  1 
ATOM   2884 C CD1 . TYR A 1 400 ? 5.874   6.189   124.148 1.00 30.71  ? 400 TYR A CD1 1 
ATOM   2885 C CD2 . TYR A 1 400 ? 6.628   4.460   122.680 1.00 30.50  ? 400 TYR A CD2 1 
ATOM   2886 C CE1 . TYR A 1 400 ? 7.026   6.923   123.877 1.00 31.99  ? 400 TYR A CE1 1 
ATOM   2887 C CE2 . TYR A 1 400 ? 7.781   5.184   122.398 1.00 33.15  ? 400 TYR A CE2 1 
ATOM   2888 C CZ  . TYR A 1 400 ? 7.975   6.409   123.002 1.00 33.08  ? 400 TYR A CZ  1 
ATOM   2889 O OH  . TYR A 1 400 ? 9.132   7.096   122.750 1.00 35.18  ? 400 TYR A OH  1 
ATOM   2890 N N   . THR A 1 401 ? 3.256   6.046   121.417 1.00 30.62  ? 401 THR A N   1 
ATOM   2891 C CA  . THR A 1 401 ? 3.373   6.470   120.008 1.00 30.63  ? 401 THR A CA  1 
ATOM   2892 C C   . THR A 1 401 ? 4.306   7.686   120.000 1.00 32.94  ? 401 THR A C   1 
ATOM   2893 O O   . THR A 1 401 ? 3.904   8.772   120.385 1.00 32.37  ? 401 THR A O   1 
ATOM   2894 C CB  . THR A 1 401 ? 1.996   6.912   119.407 1.00 30.17  ? 401 THR A CB  1 
ATOM   2895 O OG1 . THR A 1 401 ? 1.041   5.857   119.561 1.00 31.19  ? 401 THR A OG1 1 
ATOM   2896 C CG2 . THR A 1 401 ? 2.116   7.248   117.930 1.00 24.06  ? 401 THR A CG2 1 
ATOM   2897 N N   . PRO A 1 402 ? 5.565   7.514   119.564 1.00 35.83  ? 402 PRO A N   1 
ATOM   2898 C CA  . PRO A 1 402 ? 6.559   8.594   119.511 1.00 38.72  ? 402 PRO A CA  1 
ATOM   2899 C C   . PRO A 1 402 ? 6.132   9.791   118.667 1.00 42.44  ? 402 PRO A C   1 
ATOM   2900 O O   . PRO A 1 402 ? 5.620   10.779  119.189 1.00 44.89  ? 402 PRO A O   1 
ATOM   2901 C CB  . PRO A 1 402 ? 7.781   7.902   118.930 1.00 36.66  ? 402 PRO A CB  1 
ATOM   2902 C CG  . PRO A 1 402 ? 7.625   6.510   119.405 1.00 37.44  ? 402 PRO A CG  1 
ATOM   2903 C CD  . PRO A 1 402 ? 6.173   6.248   119.130 1.00 36.46  ? 402 PRO A CD  1 
ATOM   2904 N N   . ARG A 1 403 ? 6.355   9.699   117.359 1.00 45.03  ? 403 ARG A N   1 
ATOM   2905 C CA  . ARG A 1 403 ? 5.983   10.767  116.440 1.00 46.41  ? 403 ARG A CA  1 
ATOM   2906 C C   . ARG A 1 403 ? 4.720   10.387  115.675 1.00 46.07  ? 403 ARG A C   1 
ATOM   2907 O O   . ARG A 1 403 ? 4.084   9.380   115.971 1.00 44.70  ? 403 ARG A O   1 
ATOM   2908 C CB  . ARG A 1 403 ? 7.139   11.055  115.470 1.00 49.32  ? 403 ARG A CB  1 
ATOM   2909 C CG  . ARG A 1 403 ? 7.741   9.812   114.861 1.00 54.23  ? 403 ARG A CG  1 
ATOM   2910 C CD  . ARG A 1 403 ? 9.003   10.061  114.031 1.00 58.71  ? 403 ARG A CD  1 
ATOM   2911 N NE  . ARG A 1 403 ? 9.438   8.813   113.399 1.00 64.22  ? 403 ARG A NE  1 
ATOM   2912 C CZ  . ARG A 1 403 ? 10.415  8.705   112.500 1.00 67.64  ? 403 ARG A CZ  1 
ATOM   2913 N NH1 . ARG A 1 403 ? 11.089  9.781   112.109 1.00 69.51  ? 403 ARG A NH1 1 
ATOM   2914 N NH2 . ARG A 1 403 ? 10.710  7.515   111.978 1.00 69.07  ? 403 ARG A NH2 1 
ATOM   2915 N N   . ARG A 1 404 ? 4.357   11.207  114.699 1.00 46.17  ? 404 ARG A N   1 
ATOM   2916 C CA  . ARG A 1 404 ? 3.168   10.970  113.892 1.00 45.92  ? 404 ARG A CA  1 
ATOM   2917 C C   . ARG A 1 404 ? 3.381   9.744   113.004 1.00 44.57  ? 404 ARG A C   1 
ATOM   2918 O O   . ARG A 1 404 ? 4.514   9.387   112.701 1.00 45.29  ? 404 ARG A O   1 
ATOM   2919 C CB  . ARG A 1 404 ? 2.906   12.197  113.008 1.00 47.67  ? 404 ARG A CB  1 
ATOM   2920 C CG  . ARG A 1 404 ? 3.149   13.529  113.713 1.00 51.17  ? 404 ARG A CG  1 
ATOM   2921 C CD  . ARG A 1 404 ? 1.846   14.238  114.106 1.00 54.64  ? 404 ARG A CD  1 
ATOM   2922 N NE  . ARG A 1 404 ? 2.045   15.197  115.201 1.00 57.91  ? 404 ARG A NE  1 
ATOM   2923 C CZ  . ARG A 1 404 ? 1.067   15.877  115.800 1.00 58.90  ? 404 ARG A CZ  1 
ATOM   2924 N NH1 . ARG A 1 404 ? -0.189  15.716  115.406 1.00 60.40  ? 404 ARG A NH1 1 
ATOM   2925 N NH2 . ARG A 1 404 ? 1.340   16.697  116.814 1.00 58.95  ? 404 ARG A NH2 1 
ATOM   2926 N N   . ASN A 1 405 ? 2.289   9.104   112.595 1.00 42.49  ? 405 ASN A N   1 
ATOM   2927 C CA  . ASN A 1 405 ? 2.337   7.943   111.702 1.00 40.64  ? 405 ASN A CA  1 
ATOM   2928 C C   . ASN A 1 405 ? 3.240   6.795   112.136 1.00 38.88  ? 405 ASN A C   1 
ATOM   2929 O O   . ASN A 1 405 ? 4.138   6.397   111.402 1.00 39.11  ? 405 ASN A O   1 
ATOM   2930 C CB  . ASN A 1 405 ? 2.771   8.372   110.292 1.00 42.19  ? 405 ASN A CB  1 
ATOM   2931 C CG  . ASN A 1 405 ? 2.035   9.604   109.793 1.00 43.00  ? 405 ASN A CG  1 
ATOM   2932 O OD1 . ASN A 1 405 ? 0.807   9.659   109.806 1.00 41.67  ? 405 ASN A OD1 1 
ATOM   2933 N ND2 . ASN A 1 405 ? 2.794   10.600  109.342 1.00 44.35  ? 405 ASN A ND2 1 
ATOM   2934 N N   . ILE A 1 406 ? 3.003   6.239   113.312 1.00 36.36  ? 406 ILE A N   1 
ATOM   2935 C CA  . ILE A 1 406 ? 3.834   5.140   113.762 1.00 33.45  ? 406 ILE A CA  1 
ATOM   2936 C C   . ILE A 1 406 ? 3.027   4.190   114.609 1.00 31.87  ? 406 ILE A C   1 
ATOM   2937 O O   . ILE A 1 406 ? 2.359   4.601   115.561 1.00 33.03  ? 406 ILE A O   1 
ATOM   2938 C CB  . ILE A 1 406 ? 5.028   5.654   114.556 1.00 34.16  ? 406 ILE A CB  1 
ATOM   2939 C CG1 . ILE A 1 406 ? 6.003   6.325   113.599 1.00 34.14  ? 406 ILE A CG1 1 
ATOM   2940 C CG2 . ILE A 1 406 ? 5.718   4.518   115.294 1.00 34.26  ? 406 ILE A CG2 1 
ATOM   2941 C CD1 . ILE A 1 406 ? 7.221   6.837   114.288 1.00 37.98  ? 406 ILE A CD1 1 
ATOM   2942 N N   . PRO A 1 407 ? 3.077   2.896   114.272 1.00 28.76  ? 407 PRO A N   1 
ATOM   2943 C CA  . PRO A 1 407 ? 2.331   1.889   115.017 1.00 27.84  ? 407 PRO A CA  1 
ATOM   2944 C C   . PRO A 1 407 ? 2.603   2.032   116.501 1.00 28.19  ? 407 PRO A C   1 
ATOM   2945 O O   . PRO A 1 407 ? 3.704   2.392   116.918 1.00 30.11  ? 407 PRO A O   1 
ATOM   2946 C CB  . PRO A 1 407 ? 2.852   0.585   114.433 1.00 29.19  ? 407 PRO A CB  1 
ATOM   2947 C CG  . PRO A 1 407 ? 3.171   0.977   113.022 1.00 27.05  ? 407 PRO A CG  1 
ATOM   2948 C CD  . PRO A 1 407 ? 3.904   2.265   113.236 1.00 25.31  ? 407 PRO A CD  1 
ATOM   2949 N N   . PRO A 1 408 ? 1.596   1.774   117.326 1.00 27.05  ? 408 PRO A N   1 
ATOM   2950 C CA  . PRO A 1 408 ? 1.827   1.908   118.758 1.00 26.23  ? 408 PRO A CA  1 
ATOM   2951 C C   . PRO A 1 408 ? 2.574   0.724   119.311 1.00 26.43  ? 408 PRO A C   1 
ATOM   2952 O O   . PRO A 1 408 ? 2.695   -0.310  118.664 1.00 25.14  ? 408 PRO A O   1 
ATOM   2953 C CB  . PRO A 1 408 ? 0.420   1.985   119.316 1.00 26.83  ? 408 PRO A CB  1 
ATOM   2954 C CG  . PRO A 1 408 ? -0.319  1.040   118.414 1.00 26.90  ? 408 PRO A CG  1 
ATOM   2955 C CD  . PRO A 1 408 ? 0.197   1.422   117.042 1.00 27.44  ? 408 PRO A CD  1 
ATOM   2956 N N   . TYR A 1 409 ? 3.082   0.892   120.520 1.00 27.77  ? 409 TYR A N   1 
ATOM   2957 C CA  . TYR A 1 409 ? 3.787   -0.173  121.209 1.00 28.39  ? 409 TYR A CA  1 
ATOM   2958 C C   . TYR A 1 409 ? 3.327   -0.085  122.652 1.00 29.00  ? 409 TYR A C   1 
ATOM   2959 O O   . TYR A 1 409 ? 3.227   1.012   123.206 1.00 29.31  ? 409 TYR A O   1 
ATOM   2960 C CB  . TYR A 1 409 ? 5.311   0.027   121.153 1.00 27.74  ? 409 TYR A CB  1 
ATOM   2961 C CG  . TYR A 1 409 ? 6.043   -1.112  120.477 1.00 26.92  ? 409 TYR A CG  1 
ATOM   2962 C CD1 . TYR A 1 409 ? 6.357   -1.057  119.113 1.00 25.45  ? 409 TYR A CD1 1 
ATOM   2963 C CD2 . TYR A 1 409 ? 6.346   -2.279  121.176 1.00 24.77  ? 409 TYR A CD2 1 
ATOM   2964 C CE1 . TYR A 1 409 ? 6.943   -2.137  118.464 1.00 23.79  ? 409 TYR A CE1 1 
ATOM   2965 C CE2 . TYR A 1 409 ? 6.929   -3.367  120.533 1.00 24.64  ? 409 TYR A CE2 1 
ATOM   2966 C CZ  . TYR A 1 409 ? 7.217   -3.288  119.177 1.00 23.95  ? 409 TYR A CZ  1 
ATOM   2967 O OH  . TYR A 1 409 ? 7.722   -4.381  118.520 1.00 24.81  ? 409 TYR A OH  1 
ATOM   2968 N N   . PHE A 1 410 ? 3.017   -1.224  123.257 1.00 27.95  ? 410 PHE A N   1 
ATOM   2969 C CA  . PHE A 1 410 ? 2.619   -1.193  124.645 1.00 26.53  ? 410 PHE A CA  1 
ATOM   2970 C C   . PHE A 1 410 ? 3.887   -1.119  125.460 1.00 25.97  ? 410 PHE A C   1 
ATOM   2971 O O   . PHE A 1 410 ? 4.814   -1.891  125.233 1.00 24.13  ? 410 PHE A O   1 
ATOM   2972 C CB  . PHE A 1 410 ? 1.850   -2.445  125.019 1.00 26.37  ? 410 PHE A CB  1 
ATOM   2973 C CG  . PHE A 1 410 ? 0.493   -2.506  124.418 1.00 30.08  ? 410 PHE A CG  1 
ATOM   2974 C CD1 . PHE A 1 410 ? 0.218   -3.382  123.376 1.00 31.69  ? 410 PHE A CD1 1 
ATOM   2975 C CD2 . PHE A 1 410 ? -0.520  -1.681  124.886 1.00 30.77  ? 410 PHE A CD2 1 
ATOM   2976 C CE1 . PHE A 1 410 ? -1.046  -3.440  122.810 1.00 30.45  ? 410 PHE A CE1 1 
ATOM   2977 C CE2 . PHE A 1 410 ? -1.786  -1.730  124.329 1.00 30.64  ? 410 PHE A CE2 1 
ATOM   2978 C CZ  . PHE A 1 410 ? -2.048  -2.613  123.289 1.00 33.18  ? 410 PHE A CZ  1 
ATOM   2979 N N   . VAL A 1 411 ? 3.942   -0.171  126.386 1.00 26.08  ? 411 VAL A N   1 
ATOM   2980 C CA  . VAL A 1 411 ? 5.108   -0.046  127.250 1.00 27.10  ? 411 VAL A CA  1 
ATOM   2981 C C   . VAL A 1 411 ? 4.681   -0.088  128.705 1.00 27.57  ? 411 VAL A C   1 
ATOM   2982 O O   . VAL A 1 411 ? 3.503   0.026   129.023 1.00 27.49  ? 411 VAL A O   1 
ATOM   2983 C CB  . VAL A 1 411 ? 5.864   1.269   127.019 1.00 27.04  ? 411 VAL A CB  1 
ATOM   2984 C CG1 . VAL A 1 411 ? 6.172   1.426   125.532 1.00 22.92  ? 411 VAL A CG1 1 
ATOM   2985 C CG2 . VAL A 1 411 ? 5.063   2.447   127.601 1.00 23.84  ? 411 VAL A CG2 1 
ATOM   2986 N N   . ALA A 1 412 ? 5.647   -0.262  129.590 1.00 28.49  ? 412 ALA A N   1 
ATOM   2987 C CA  . ALA A 1 412 ? 5.354   -0.295  131.011 1.00 28.79  ? 412 ALA A CA  1 
ATOM   2988 C C   . ALA A 1 412 ? 6.092   0.853   131.660 1.00 30.21  ? 412 ALA A C   1 
ATOM   2989 O O   . ALA A 1 412 ? 7.310   0.990   131.503 1.00 31.07  ? 412 ALA A O   1 
ATOM   2990 C CB  . ALA A 1 412 ? 5.808   -1.591  131.607 1.00 27.08  ? 412 ALA A CB  1 
ATOM   2991 N N   . LEU A 1 413 ? 5.359   1.707   132.361 1.00 29.95  ? 413 LEU A N   1 
ATOM   2992 C CA  . LEU A 1 413 ? 6.013   2.807   133.028 1.00 29.04  ? 413 LEU A CA  1 
ATOM   2993 C C   . LEU A 1 413 ? 6.253   2.288   134.409 1.00 27.32  ? 413 LEU A C   1 
ATOM   2994 O O   . LEU A 1 413 ? 5.342   2.233   135.223 1.00 24.17  ? 413 LEU A O   1 
ATOM   2995 C CB  . LEU A 1 413 ? 5.126   4.047   133.045 1.00 30.17  ? 413 LEU A CB  1 
ATOM   2996 C CG  . LEU A 1 413 ? 4.825   4.577   131.641 1.00 31.99  ? 413 LEU A CG  1 
ATOM   2997 C CD1 . LEU A 1 413 ? 4.611   6.079   131.711 1.00 33.86  ? 413 LEU A CD1 1 
ATOM   2998 C CD2 . LEU A 1 413 ? 5.992   4.279   130.702 1.00 32.77  ? 413 LEU A CD2 1 
ATOM   2999 N N   . VAL A 1 414 ? 7.486   1.868   134.646 1.00 27.43  ? 414 VAL A N   1 
ATOM   3000 C CA  . VAL A 1 414 ? 7.862   1.319   135.935 1.00 30.19  ? 414 VAL A CA  1 
ATOM   3001 C C   . VAL A 1 414 ? 8.310   2.416   136.882 1.00 31.46  ? 414 VAL A C   1 
ATOM   3002 O O   . VAL A 1 414 ? 9.226   3.184   136.570 1.00 31.61  ? 414 VAL A O   1 
ATOM   3003 C CB  . VAL A 1 414 ? 8.987   0.306   135.776 1.00 29.20  ? 414 VAL A CB  1 
ATOM   3004 C CG1 . VAL A 1 414 ? 9.403   -0.218  137.121 1.00 29.99  ? 414 VAL A CG1 1 
ATOM   3005 C CG2 . VAL A 1 414 ? 8.521   -0.811  134.900 1.00 27.65  ? 414 VAL A CG2 1 
ATOM   3006 N N   . PRO A 1 415 ? 7.662   2.504   138.052 1.00 31.31  ? 415 PRO A N   1 
ATOM   3007 C CA  . PRO A 1 415 ? 7.970   3.508   139.072 1.00 32.30  ? 415 PRO A CA  1 
ATOM   3008 C C   . PRO A 1 415 ? 9.409   3.386   139.519 1.00 33.23  ? 415 PRO A C   1 
ATOM   3009 O O   . PRO A 1 415 ? 9.881   2.287   139.788 1.00 32.19  ? 415 PRO A O   1 
ATOM   3010 C CB  . PRO A 1 415 ? 6.974   3.193   140.183 1.00 31.73  ? 415 PRO A CB  1 
ATOM   3011 C CG  . PRO A 1 415 ? 6.731   1.736   140.019 1.00 33.09  ? 415 PRO A CG  1 
ATOM   3012 C CD  . PRO A 1 415 ? 6.637   1.567   138.530 1.00 31.81  ? 415 PRO A CD  1 
ATOM   3013 N N   . GLN A 1 416 ? 10.096  4.522   139.598 1.00 35.58  ? 416 GLN A N   1 
ATOM   3014 C CA  . GLN A 1 416 ? 11.501  4.555   139.981 1.00 38.83  ? 416 GLN A CA  1 
ATOM   3015 C C   . GLN A 1 416 ? 11.853  5.578   141.062 1.00 40.52  ? 416 GLN A C   1 
ATOM   3016 O O   . GLN A 1 416 ? 11.817  6.792   140.827 1.00 40.34  ? 416 GLN A O   1 
ATOM   3017 C CB  . GLN A 1 416 ? 12.339  4.820   138.736 1.00 40.66  ? 416 GLN A CB  1 
ATOM   3018 C CG  . GLN A 1 416 ? 13.826  4.979   138.976 1.00 42.92  ? 416 GLN A CG  1 
ATOM   3019 C CD  . GLN A 1 416 ? 14.567  5.180   137.676 1.00 44.60  ? 416 GLN A CD  1 
ATOM   3020 O OE1 . GLN A 1 416 ? 14.515  4.326   136.790 1.00 47.13  ? 416 GLN A OE1 1 
ATOM   3021 N NE2 . GLN A 1 416 ? 15.253  6.314   137.545 1.00 45.51  ? 416 GLN A NE2 1 
ATOM   3022 N N   . GLU A 1 417 ? 12.223  5.070   142.235 1.00 42.08  ? 417 GLU A N   1 
ATOM   3023 C CA  . GLU A 1 417 ? 12.578  5.908   143.379 1.00 43.71  ? 417 GLU A CA  1 
ATOM   3024 C C   . GLU A 1 417 ? 13.976  6.515   143.273 1.00 43.08  ? 417 GLU A C   1 
ATOM   3025 O O   . GLU A 1 417 ? 14.899  5.891   142.750 1.00 42.56  ? 417 GLU A O   1 
ATOM   3026 C CB  . GLU A 1 417 ? 12.486  5.088   144.657 1.00 44.89  ? 417 GLU A CB  1 
ATOM   3027 C CG  . GLU A 1 417 ? 12.373  5.929   145.897 1.00 51.31  ? 417 GLU A CG  1 
ATOM   3028 C CD  . GLU A 1 417 ? 12.094  5.098   147.131 1.00 54.73  ? 417 GLU A CD  1 
ATOM   3029 O OE1 . GLU A 1 417 ? 11.165  4.252   147.093 1.00 56.03  ? 417 GLU A OE1 1 
ATOM   3030 O OE2 . GLU A 1 417 ? 12.801  5.299   148.142 1.00 57.84  ? 417 GLU A OE2 1 
ATOM   3031 N N   . GLU A 1 418 ? 14.132  7.738   143.771 1.00 41.96  ? 418 GLU A N   1 
ATOM   3032 C CA  . GLU A 1 418 ? 15.432  8.382   143.717 1.00 40.86  ? 418 GLU A CA  1 
ATOM   3033 C C   . GLU A 1 418 ? 16.405  7.729   144.664 1.00 40.30  ? 418 GLU A C   1 
ATOM   3034 O O   . GLU A 1 418 ? 16.018  7.251   145.720 1.00 40.35  ? 418 GLU A O   1 
ATOM   3035 C CB  . GLU A 1 418 ? 15.357  9.852   144.078 1.00 40.16  ? 418 GLU A CB  1 
ATOM   3036 C CG  . GLU A 1 418 ? 16.741  10.409  144.345 1.00 41.58  ? 418 GLU A CG  1 
ATOM   3037 C CD  . GLU A 1 418 ? 16.755  11.903  144.479 1.00 44.23  ? 418 GLU A CD  1 
ATOM   3038 O OE1 . GLU A 1 418 ? 16.430  12.582  143.489 1.00 46.94  ? 418 GLU A OE1 1 
ATOM   3039 O OE2 . GLU A 1 418 ? 17.089  12.407  145.571 1.00 46.36  ? 418 GLU A OE2 1 
ATOM   3040 N N   . GLU A 1 419 ? 17.675  7.748   144.280 1.00 40.54  ? 419 GLU A N   1 
ATOM   3041 C CA  . GLU A 1 419 ? 18.743  7.158   145.063 1.00 41.12  ? 419 GLU A CA  1 
ATOM   3042 C C   . GLU A 1 419 ? 20.041  7.957   144.925 1.00 41.86  ? 419 GLU A C   1 
ATOM   3043 O O   . GLU A 1 419 ? 20.457  8.285   143.813 1.00 42.07  ? 419 GLU A O   1 
ATOM   3044 C CB  . GLU A 1 419 ? 18.959  5.712   144.609 1.00 40.81  ? 419 GLU A CB  1 
ATOM   3045 C CG  . GLU A 1 419 ? 20.226  5.050   145.148 1.00 44.70  ? 419 GLU A CG  1 
ATOM   3046 C CD  . GLU A 1 419 ? 20.184  3.521   145.049 1.00 48.69  ? 419 GLU A CD  1 
ATOM   3047 O OE1 . GLU A 1 419 ? 19.674  2.983   144.033 1.00 50.19  ? 419 GLU A OE1 1 
ATOM   3048 O OE2 . GLU A 1 419 ? 20.673  2.852   145.989 1.00 50.30  ? 419 GLU A OE2 1 
ATOM   3049 N N   . LEU A 1 420 ? 20.668  8.281   146.059 1.00 41.39  ? 420 LEU A N   1 
ATOM   3050 C CA  . LEU A 1 420 ? 21.934  9.019   146.070 1.00 39.53  ? 420 LEU A CA  1 
ATOM   3051 C C   . LEU A 1 420 ? 22.959  8.123   146.745 1.00 40.16  ? 420 LEU A C   1 
ATOM   3052 O O   . LEU A 1 420 ? 22.591  7.315   147.592 1.00 40.66  ? 420 LEU A O   1 
ATOM   3053 C CB  . LEU A 1 420 ? 21.799  10.315  146.869 1.00 38.46  ? 420 LEU A CB  1 
ATOM   3054 C CG  . LEU A 1 420 ? 20.768  11.360  146.435 1.00 37.19  ? 420 LEU A CG  1 
ATOM   3055 C CD1 . LEU A 1 420 ? 20.890  12.593  147.316 1.00 35.22  ? 420 LEU A CD1 1 
ATOM   3056 C CD2 . LEU A 1 420 ? 20.983  11.722  144.976 1.00 36.38  ? 420 LEU A CD2 1 
ATOM   3057 N N   . ASP A 1 421 ? 24.231  8.243   146.379 1.00 39.90  ? 421 ASP A N   1 
ATOM   3058 C CA  . ASP A 1 421 ? 25.242  7.401   147.005 1.00 40.64  ? 421 ASP A CA  1 
ATOM   3059 C C   . ASP A 1 421 ? 25.940  8.158   148.139 1.00 42.48  ? 421 ASP A C   1 
ATOM   3060 O O   . ASP A 1 421 ? 25.440  9.194   148.590 1.00 41.28  ? 421 ASP A O   1 
ATOM   3061 C CB  . ASP A 1 421 ? 26.252  6.890   145.966 1.00 40.25  ? 421 ASP A CB  1 
ATOM   3062 C CG  . ASP A 1 421 ? 27.124  7.987   145.393 1.00 39.79  ? 421 ASP A CG  1 
ATOM   3063 O OD1 . ASP A 1 421 ? 26.981  9.147   145.819 1.00 39.23  ? 421 ASP A OD1 1 
ATOM   3064 O OD2 . ASP A 1 421 ? 27.963  7.687   144.516 1.00 40.64  ? 421 ASP A OD2 1 
ATOM   3065 N N   . ASP A 1 422 ? 27.082  7.649   148.607 1.00 44.21  ? 422 ASP A N   1 
ATOM   3066 C CA  . ASP A 1 422 ? 27.797  8.286   149.710 1.00 44.45  ? 422 ASP A CA  1 
ATOM   3067 C C   . ASP A 1 422 ? 28.308  9.690   149.392 1.00 44.78  ? 422 ASP A C   1 
ATOM   3068 O O   . ASP A 1 422 ? 28.355  10.547  150.276 1.00 45.99  ? 422 ASP A O   1 
ATOM   3069 C CB  . ASP A 1 422 ? 28.935  7.367   150.223 1.00 46.41  ? 422 ASP A CB  1 
ATOM   3070 C CG  . ASP A 1 422 ? 30.121  7.245   149.248 1.00 49.78  ? 422 ASP A CG  1 
ATOM   3071 O OD1 . ASP A 1 422 ? 29.979  7.570   148.048 1.00 51.38  ? 422 ASP A OD1 1 
ATOM   3072 O OD2 . ASP A 1 422 ? 31.209  6.796   149.691 1.00 48.85  ? 422 ASP A OD2 1 
ATOM   3073 N N   . GLN A 1 423 ? 28.659  9.943   148.134 1.00 44.41  ? 423 GLN A N   1 
ATOM   3074 C CA  . GLN A 1 423 ? 29.153  11.263  147.739 1.00 44.69  ? 423 GLN A CA  1 
ATOM   3075 C C   . GLN A 1 423 ? 27.991  12.203  147.384 1.00 45.49  ? 423 GLN A C   1 
ATOM   3076 O O   . GLN A 1 423 ? 28.209  13.301  146.863 1.00 46.76  ? 423 GLN A O   1 
ATOM   3077 C CB  . GLN A 1 423 ? 30.076  11.156  146.522 1.00 43.57  ? 423 GLN A CB  1 
ATOM   3078 C CG  . GLN A 1 423 ? 31.181  10.113  146.599 1.00 43.53  ? 423 GLN A CG  1 
ATOM   3079 C CD  . GLN A 1 423 ? 32.351  10.518  147.477 1.00 44.30  ? 423 GLN A CD  1 
ATOM   3080 O OE1 . GLN A 1 423 ? 32.802  11.662  147.450 1.00 45.11  ? 423 GLN A OE1 1 
ATOM   3081 N NE2 . GLN A 1 423 ? 32.868  9.565   148.241 1.00 46.03  ? 423 GLN A NE2 1 
ATOM   3082 N N   . LYS A 1 424 ? 26.765  11.766  147.669 1.00 45.57  ? 424 LYS A N   1 
ATOM   3083 C CA  . LYS A 1 424 ? 25.537  12.522  147.376 1.00 45.16  ? 424 LYS A CA  1 
ATOM   3084 C C   . LYS A 1 424 ? 25.307  12.661  145.870 1.00 42.50  ? 424 LYS A C   1 
ATOM   3085 O O   . LYS A 1 424 ? 24.510  13.485  145.431 1.00 42.67  ? 424 LYS A O   1 
ATOM   3086 C CB  . LYS A 1 424 ? 25.558  13.918  148.013 1.00 48.81  ? 424 LYS A CB  1 
ATOM   3087 C CG  . LYS A 1 424 ? 25.756  13.953  149.520 1.00 53.72  ? 424 LYS A CG  1 
ATOM   3088 C CD  . LYS A 1 424 ? 24.641  13.247  150.288 1.00 57.35  ? 424 LYS A CD  1 
ATOM   3089 C CE  . LYS A 1 424 ? 24.909  13.289  151.806 1.00 59.29  ? 424 LYS A CE  1 
ATOM   3090 N NZ  . LYS A 1 424 ? 23.935  12.492  152.622 1.00 59.26  ? 424 LYS A NZ  1 
ATOM   3091 N N   . ILE A 1 425 ? 26.023  11.867  145.083 1.00 39.67  ? 425 ILE A N   1 
ATOM   3092 C CA  . ILE A 1 425 ? 25.863  11.865  143.634 1.00 38.07  ? 425 ILE A CA  1 
ATOM   3093 C C   . ILE A 1 425 ? 24.558  11.122  143.338 1.00 37.21  ? 425 ILE A C   1 
ATOM   3094 O O   . ILE A 1 425 ? 24.325  10.049  143.887 1.00 37.47  ? 425 ILE A O   1 
ATOM   3095 C CB  . ILE A 1 425 ? 26.987  11.092  142.956 1.00 37.31  ? 425 ILE A CB  1 
ATOM   3096 C CG1 . ILE A 1 425 ? 28.324  11.754  143.244 1.00 37.90  ? 425 ILE A CG1 1 
ATOM   3097 C CG2 . ILE A 1 425 ? 26.731  11.017  141.477 1.00 37.98  ? 425 ILE A CG2 1 
ATOM   3098 C CD1 . ILE A 1 425 ? 29.480  11.072  142.552 1.00 39.94  ? 425 ILE A CD1 1 
ATOM   3099 N N   . GLN A 1 426 ? 23.713  11.675  142.473 1.00 36.43  ? 426 GLN A N   1 
ATOM   3100 C CA  . GLN A 1 426 ? 22.443  11.027  142.159 1.00 35.75  ? 426 GLN A CA  1 
ATOM   3101 C C   . GLN A 1 426 ? 22.612  9.837   141.222 1.00 35.90  ? 426 GLN A C   1 
ATOM   3102 O O   . GLN A 1 426 ? 22.768  9.998   140.022 1.00 36.55  ? 426 GLN A O   1 
ATOM   3103 C CB  . GLN A 1 426 ? 21.472  12.027  141.540 1.00 34.54  ? 426 GLN A CB  1 
ATOM   3104 C CG  . GLN A 1 426 ? 20.114  11.432  141.227 1.00 32.53  ? 426 GLN A CG  1 
ATOM   3105 C CD  . GLN A 1 426 ? 19.126  12.468  140.716 1.00 32.74  ? 426 GLN A CD  1 
ATOM   3106 O OE1 . GLN A 1 426 ? 19.325  13.073  139.659 1.00 31.87  ? 426 GLN A OE1 1 
ATOM   3107 N NE2 . GLN A 1 426 ? 18.055  12.679  141.468 1.00 31.27  ? 426 GLN A NE2 1 
ATOM   3108 N N   . VAL A 1 427 ? 22.562  8.638   141.790 1.00 36.90  ? 427 VAL A N   1 
ATOM   3109 C CA  . VAL A 1 427 ? 22.708  7.392   141.044 1.00 35.61  ? 427 VAL A CA  1 
ATOM   3110 C C   . VAL A 1 427 ? 21.486  7.020   140.199 1.00 33.32  ? 427 VAL A C   1 
ATOM   3111 O O   . VAL A 1 427 ? 21.627  6.595   139.056 1.00 33.53  ? 427 VAL A O   1 
ATOM   3112 C CB  . VAL A 1 427 ? 23.009  6.229   142.011 1.00 37.65  ? 427 VAL A CB  1 
ATOM   3113 C CG1 . VAL A 1 427 ? 22.908  4.904   141.285 1.00 41.84  ? 427 VAL A CG1 1 
ATOM   3114 C CG2 . VAL A 1 427 ? 24.400  6.397   142.598 1.00 38.29  ? 427 VAL A CG2 1 
ATOM   3115 N N   . THR A 1 428 ? 20.295  7.178   140.761 1.00 30.55  ? 428 THR A N   1 
ATOM   3116 C CA  . THR A 1 428 ? 19.067  6.845   140.053 1.00 28.11  ? 428 THR A CA  1 
ATOM   3117 C C   . THR A 1 428 ? 18.042  7.955   140.236 1.00 28.34  ? 428 THR A C   1 
ATOM   3118 O O   . THR A 1 428 ? 17.568  8.206   141.338 1.00 28.30  ? 428 THR A O   1 
ATOM   3119 C CB  . THR A 1 428 ? 18.460  5.549   140.596 1.00 27.77  ? 428 THR A CB  1 
ATOM   3120 O OG1 . THR A 1 428 ? 19.504  4.601   140.848 1.00 24.74  ? 428 THR A OG1 1 
ATOM   3121 C CG2 . THR A 1 428 ? 17.475  4.972   139.591 1.00 25.28  ? 428 THR A CG2 1 
ATOM   3122 N N   . PRO A 1 429 ? 17.670  8.626   139.150 1.00 28.04  ? 429 PRO A N   1 
ATOM   3123 C CA  . PRO A 1 429 ? 16.689  9.707   139.272 1.00 28.10  ? 429 PRO A CA  1 
ATOM   3124 C C   . PRO A 1 429 ? 15.272  9.278   139.660 1.00 29.05  ? 429 PRO A C   1 
ATOM   3125 O O   . PRO A 1 429 ? 14.953  8.092   139.689 1.00 29.28  ? 429 PRO A O   1 
ATOM   3126 C CB  . PRO A 1 429 ? 16.730  10.352  137.887 1.00 27.94  ? 429 PRO A CB  1 
ATOM   3127 C CG  . PRO A 1 429 ? 17.048  9.192   136.979 1.00 26.00  ? 429 PRO A CG  1 
ATOM   3128 C CD  . PRO A 1 429 ? 18.122  8.465   137.756 1.00 27.22  ? 429 PRO A CD  1 
ATOM   3129 N N   . PRO A 1 430 ? 14.422  10.246  140.036 1.00 29.78  ? 430 PRO A N   1 
ATOM   3130 C CA  . PRO A 1 430 ? 13.039  9.906   140.395 1.00 30.10  ? 430 PRO A CA  1 
ATOM   3131 C C   . PRO A 1 430 ? 12.197  10.028  139.115 1.00 30.18  ? 430 PRO A C   1 
ATOM   3132 O O   . PRO A 1 430 ? 12.511  10.833  138.228 1.00 28.05  ? 430 PRO A O   1 
ATOM   3133 C CB  . PRO A 1 430 ? 12.677  10.961  141.435 1.00 29.54  ? 430 PRO A CB  1 
ATOM   3134 C CG  . PRO A 1 430 ? 13.447  12.159  140.974 1.00 29.60  ? 430 PRO A CG  1 
ATOM   3135 C CD  . PRO A 1 430 ? 14.791  11.573  140.567 1.00 29.13  ? 430 PRO A CD  1 
ATOM   3136 N N   . GLY A 1 431 ? 11.147  9.221   139.012 1.00 30.38  ? 431 GLY A N   1 
ATOM   3137 C CA  . GLY A 1 431 ? 10.304  9.265   137.831 1.00 29.76  ? 431 GLY A CA  1 
ATOM   3138 C C   . GLY A 1 431 ? 9.960   7.869   137.373 1.00 29.45  ? 431 GLY A C   1 
ATOM   3139 O O   . GLY A 1 431 ? 9.985   6.937   138.181 1.00 28.76  ? 431 GLY A O   1 
ATOM   3140 N N   . PHE A 1 432 ? 9.646   7.721   136.087 1.00 29.48  ? 432 PHE A N   1 
ATOM   3141 C CA  . PHE A 1 432 ? 9.281   6.414   135.526 1.00 30.01  ? 432 PHE A CA  1 
ATOM   3142 C C   . PHE A 1 432 ? 10.190  5.868   134.443 1.00 29.32  ? 432 PHE A C   1 
ATOM   3143 O O   . PHE A 1 432 ? 10.595  6.591   133.531 1.00 28.66  ? 432 PHE A O   1 
ATOM   3144 C CB  . PHE A 1 432 ? 7.866   6.432   134.938 1.00 30.12  ? 432 PHE A CB  1 
ATOM   3145 C CG  . PHE A 1 432 ? 6.792   6.512   135.957 1.00 29.60  ? 432 PHE A CG  1 
ATOM   3146 C CD1 . PHE A 1 432 ? 6.308   7.744   136.371 1.00 29.22  ? 432 PHE A CD1 1 
ATOM   3147 C CD2 . PHE A 1 432 ? 6.284   5.353   136.533 1.00 29.10  ? 432 PHE A CD2 1 
ATOM   3148 C CE1 . PHE A 1 432 ? 5.333   7.819   137.342 1.00 29.78  ? 432 PHE A CE1 1 
ATOM   3149 C CE2 . PHE A 1 432 ? 5.304   5.412   137.508 1.00 27.42  ? 432 PHE A CE2 1 
ATOM   3150 C CZ  . PHE A 1 432 ? 4.826   6.644   137.917 1.00 29.58  ? 432 PHE A CZ  1 
ATOM   3151 N N   . GLN A 1 433 ? 10.484  4.576   134.546 1.00 28.25  ? 433 GLN A N   1 
ATOM   3152 C CA  . GLN A 1 433 ? 11.293  3.898   133.547 1.00 27.21  ? 433 GLN A CA  1 
ATOM   3153 C C   . GLN A 1 433 ? 10.276  3.453   132.490 1.00 26.10  ? 433 GLN A C   1 
ATOM   3154 O O   . GLN A 1 433 ? 9.347   2.695   132.792 1.00 26.37  ? 433 GLN A O   1 
ATOM   3155 C CB  . GLN A 1 433 ? 11.988  2.666   134.145 1.00 27.48  ? 433 GLN A CB  1 
ATOM   3156 C CG  . GLN A 1 433 ? 13.116  2.106   133.285 1.00 28.40  ? 433 GLN A CG  1 
ATOM   3157 C CD  . GLN A 1 433 ? 13.453  0.629   133.554 1.00 29.80  ? 433 GLN A CD  1 
ATOM   3158 O OE1 . GLN A 1 433 ? 13.467  0.164   134.699 1.00 27.54  ? 433 GLN A OE1 1 
ATOM   3159 N NE2 . GLN A 1 433 ? 13.753  -0.104  132.484 1.00 29.23  ? 433 GLN A NE2 1 
ATOM   3160 N N   . LEU A 1 434 ? 10.415  3.970   131.271 1.00 24.55  ? 434 LEU A N   1 
ATOM   3161 C CA  . LEU A 1 434 ? 9.528   3.600   130.176 1.00 21.80  ? 434 LEU A CA  1 
ATOM   3162 C C   . LEU A 1 434 ? 10.102  2.311   129.601 1.00 20.29  ? 434 LEU A C   1 
ATOM   3163 O O   . LEU A 1 434 ? 11.190  2.313   129.018 1.00 17.32  ? 434 LEU A O   1 
ATOM   3164 C CB  . LEU A 1 434 ? 9.505   4.701   129.111 1.00 22.77  ? 434 LEU A CB  1 
ATOM   3165 C CG  . LEU A 1 434 ? 8.505   4.506   127.954 1.00 23.75  ? 434 LEU A CG  1 
ATOM   3166 C CD1 . LEU A 1 434 ? 8.279   5.818   127.209 1.00 22.56  ? 434 LEU A CD1 1 
ATOM   3167 C CD2 . LEU A 1 434 ? 9.023   3.430   127.006 1.00 24.43  ? 434 LEU A CD2 1 
ATOM   3168 N N   . VAL A 1 435 ? 9.373   1.214   129.765 1.00 18.18  ? 435 VAL A N   1 
ATOM   3169 C CA  . VAL A 1 435 ? 9.850   -0.078  129.293 1.00 18.36  ? 435 VAL A CA  1 
ATOM   3170 C C   . VAL A 1 435 ? 9.020   -0.658  128.162 1.00 19.47  ? 435 VAL A C   1 
ATOM   3171 O O   . VAL A 1 435 ? 7.807   -0.847  128.307 1.00 20.50  ? 435 VAL A O   1 
ATOM   3172 C CB  . VAL A 1 435 ? 9.860   -1.118  130.448 1.00 19.33  ? 435 VAL A CB  1 
ATOM   3173 C CG1 . VAL A 1 435 ? 10.288  -2.477  129.929 1.00 20.14  ? 435 VAL A CG1 1 
ATOM   3174 C CG2 . VAL A 1 435 ? 10.798  -0.663  131.576 1.00 18.44  ? 435 VAL A CG2 1 
ATOM   3175 N N   . PHE A 1 436 ? 9.669   -0.946  127.036 1.00 16.77  ? 436 PHE A N   1 
ATOM   3176 C CA  . PHE A 1 436 ? 8.965   -1.548  125.916 1.00 16.00  ? 436 PHE A CA  1 
ATOM   3177 C C   . PHE A 1 436 ? 8.671   -3.012  126.210 1.00 16.50  ? 436 PHE A C   1 
ATOM   3178 O O   . PHE A 1 436 ? 9.505   -3.717  126.771 1.00 16.04  ? 436 PHE A O   1 
ATOM   3179 C CB  . PHE A 1 436 ? 9.798   -1.480  124.646 1.00 15.42  ? 436 PHE A CB  1 
ATOM   3180 C CG  . PHE A 1 436 ? 10.040  -0.101  124.167 1.00 15.37  ? 436 PHE A CG  1 
ATOM   3181 C CD1 . PHE A 1 436 ? 10.992  0.703   124.790 1.00 15.36  ? 436 PHE A CD1 1 
ATOM   3182 C CD2 . PHE A 1 436 ? 9.284   0.419   123.113 1.00 14.62  ? 436 PHE A CD2 1 
ATOM   3183 C CE1 . PHE A 1 436 ? 11.194  2.017   124.371 1.00 14.65  ? 436 PHE A CE1 1 
ATOM   3184 C CE2 . PHE A 1 436 ? 9.468   1.730   122.679 1.00 14.98  ? 436 PHE A CE2 1 
ATOM   3185 C CZ  . PHE A 1 436 ? 10.431  2.536   123.312 1.00 15.90  ? 436 PHE A CZ  1 
ATOM   3186 N N   . LEU A 1 437 ? 7.475   -3.450  125.837 1.00 16.94  ? 437 LEU A N   1 
ATOM   3187 C CA  . LEU A 1 437 ? 7.048   -4.830  126.008 1.00 16.90  ? 437 LEU A CA  1 
ATOM   3188 C C   . LEU A 1 437 ? 6.963   -5.357  124.596 1.00 18.64  ? 437 LEU A C   1 
ATOM   3189 O O   . LEU A 1 437 ? 6.543   -4.643  123.698 1.00 19.10  ? 437 LEU A O   1 
ATOM   3190 C CB  . LEU A 1 437 ? 5.671   -4.894  126.639 1.00 16.70  ? 437 LEU A CB  1 
ATOM   3191 C CG  . LEU A 1 437 ? 5.567   -4.197  127.982 1.00 16.37  ? 437 LEU A CG  1 
ATOM   3192 C CD1 . LEU A 1 437 ? 4.108   -4.130  128.426 1.00 14.18  ? 437 LEU A CD1 1 
ATOM   3193 C CD2 . LEU A 1 437 ? 6.424   -4.959  128.977 1.00 16.53  ? 437 LEU A CD2 1 
ATOM   3194 N N   . PRO A 1 438 ? 7.349   -6.619  124.377 1.00 19.86  ? 438 PRO A N   1 
ATOM   3195 C CA  . PRO A 1 438 ? 7.308   -7.206  123.034 1.00 19.39  ? 438 PRO A CA  1 
ATOM   3196 C C   . PRO A 1 438 ? 5.927   -7.651  122.592 1.00 19.72  ? 438 PRO A C   1 
ATOM   3197 O O   . PRO A 1 438 ? 5.078   -7.980  123.419 1.00 20.76  ? 438 PRO A O   1 
ATOM   3198 C CB  . PRO A 1 438 ? 8.245   -8.391  123.171 1.00 20.34  ? 438 PRO A CB  1 
ATOM   3199 C CG  . PRO A 1 438 ? 7.890   -8.887  124.547 1.00 19.05  ? 438 PRO A CG  1 
ATOM   3200 C CD  . PRO A 1 438 ? 7.858   -7.596  125.357 1.00 18.98  ? 438 PRO A CD  1 
ATOM   3201 N N   . PHE A 1 439 ? 5.694   -7.649  121.286 1.00 19.46  ? 439 PHE A N   1 
ATOM   3202 C CA  . PHE A 1 439 ? 4.421   -8.131  120.765 1.00 18.84  ? 439 PHE A CA  1 
ATOM   3203 C C   . PHE A 1 439 ? 4.655   -9.619  120.581 1.00 20.33  ? 439 PHE A C   1 
ATOM   3204 O O   . PHE A 1 439 ? 5.784   -10.088 120.713 1.00 19.64  ? 439 PHE A O   1 
ATOM   3205 C CB  . PHE A 1 439 ? 4.084   -7.491  119.422 1.00 17.16  ? 439 PHE A CB  1 
ATOM   3206 C CG  . PHE A 1 439 ? 3.449   -6.148  119.546 1.00 17.26  ? 439 PHE A CG  1 
ATOM   3207 C CD1 . PHE A 1 439 ? 4.110   -5.009  119.123 1.00 15.81  ? 439 PHE A CD1 1 
ATOM   3208 C CD2 . PHE A 1 439 ? 2.182   -6.021  120.109 1.00 17.36  ? 439 PHE A CD2 1 
ATOM   3209 C CE1 . PHE A 1 439 ? 3.521   -3.763  119.257 1.00 15.42  ? 439 PHE A CE1 1 
ATOM   3210 C CE2 . PHE A 1 439 ? 1.587   -4.782  120.246 1.00 14.06  ? 439 PHE A CE2 1 
ATOM   3211 C CZ  . PHE A 1 439 ? 2.257   -3.649  119.819 1.00 14.28  ? 439 PHE A CZ  1 
ATOM   3212 N N   . ALA A 1 440 ? 3.598   -10.367 120.301 1.00 21.29  ? 440 ALA A N   1 
ATOM   3213 C CA  . ALA A 1 440 ? 3.737   -11.799 120.106 1.00 21.29  ? 440 ALA A CA  1 
ATOM   3214 C C   . ALA A 1 440 ? 4.843   -12.099 119.075 1.00 23.14  ? 440 ALA A C   1 
ATOM   3215 O O   . ALA A 1 440 ? 5.634   -13.029 119.253 1.00 22.31  ? 440 ALA A O   1 
ATOM   3216 C CB  . ALA A 1 440 ? 2.418   -12.372 119.645 1.00 18.39  ? 440 ALA A CB  1 
ATOM   3217 N N   . ASP A 1 441 ? 4.896   -11.299 118.011 1.00 24.03  ? 441 ASP A N   1 
ATOM   3218 C CA  . ASP A 1 441 ? 5.884   -11.476 116.949 1.00 26.95  ? 441 ASP A CA  1 
ATOM   3219 C C   . ASP A 1 441 ? 7.325   -11.313 117.417 1.00 27.28  ? 441 ASP A C   1 
ATOM   3220 O O   . ASP A 1 441 ? 8.245   -11.765 116.741 1.00 26.59  ? 441 ASP A O   1 
ATOM   3221 C CB  . ASP A 1 441 ? 5.688   -10.457 115.818 1.00 29.37  ? 441 ASP A CB  1 
ATOM   3222 C CG  . ASP A 1 441 ? 4.257   -10.295 115.411 1.00 31.04  ? 441 ASP A CG  1 
ATOM   3223 O OD1 . ASP A 1 441 ? 3.441   -9.945  116.285 1.00 32.95  ? 441 ASP A OD1 1 
ATOM   3224 O OD2 . ASP A 1 441 ? 3.955   -10.498 114.211 1.00 34.83  ? 441 ASP A OD2 1 
ATOM   3225 N N   . ASP A 1 442 ? 7.535   -10.636 118.538 1.00 27.32  ? 442 ASP A N   1 
ATOM   3226 C CA  . ASP A 1 442 ? 8.893   -10.424 119.018 1.00 27.92  ? 442 ASP A CA  1 
ATOM   3227 C C   . ASP A 1 442 ? 9.402   -11.583 119.868 1.00 29.18  ? 442 ASP A C   1 
ATOM   3228 O O   . ASP A 1 442 ? 10.597  -11.690 120.127 1.00 30.37  ? 442 ASP A O   1 
ATOM   3229 C CB  . ASP A 1 442 ? 8.973   -9.105  119.774 1.00 26.66  ? 442 ASP A CB  1 
ATOM   3230 C CG  . ASP A 1 442 ? 8.456   -7.943  118.953 1.00 27.02  ? 442 ASP A CG  1 
ATOM   3231 O OD1 . ASP A 1 442 ? 8.822   -7.866  117.761 1.00 25.22  ? 442 ASP A OD1 1 
ATOM   3232 O OD2 . ASP A 1 442 ? 7.691   -7.112  119.497 1.00 26.85  ? 442 ASP A OD2 1 
ATOM   3233 N N   . LYS A 1 443 ? 8.491   -12.454 120.287 1.00 29.52  ? 443 LYS A N   1 
ATOM   3234 C CA  . LYS A 1 443 ? 8.850   -13.627 121.060 1.00 30.36  ? 443 LYS A CA  1 
ATOM   3235 C C   . LYS A 1 443 ? 9.161   -14.727 120.060 1.00 32.09  ? 443 LYS A C   1 
ATOM   3236 O O   . LYS A 1 443 ? 8.502   -14.830 119.041 1.00 34.08  ? 443 LYS A O   1 
ATOM   3237 C CB  . LYS A 1 443 ? 7.678   -14.075 121.922 1.00 30.38  ? 443 LYS A CB  1 
ATOM   3238 C CG  . LYS A 1 443 ? 7.444   -13.280 123.186 1.00 30.89  ? 443 LYS A CG  1 
ATOM   3239 C CD  . LYS A 1 443 ? 6.290   -13.914 123.960 1.00 32.54  ? 443 LYS A CD  1 
ATOM   3240 C CE  . LYS A 1 443 ? 5.997   -13.195 125.270 1.00 36.20  ? 443 LYS A CE  1 
ATOM   3241 N NZ  . LYS A 1 443 ? 4.754   -13.673 125.978 1.00 40.00  ? 443 LYS A NZ  1 
ATOM   3242 N N   . ARG A 1 444 ? 10.176  -15.534 120.330 1.00 35.73  ? 444 ARG A N   1 
ATOM   3243 C CA  . ARG A 1 444 ? 10.532  -16.647 119.455 1.00 39.31  ? 444 ARG A CA  1 
ATOM   3244 C C   . ARG A 1 444 ? 10.522  -17.844 120.376 1.00 43.66  ? 444 ARG A C   1 
ATOM   3245 O O   . ARG A 1 444 ? 11.445  -18.005 121.160 1.00 43.71  ? 444 ARG A O   1 
ATOM   3246 C CB  . ARG A 1 444 ? 11.943  -16.485 118.892 1.00 38.69  ? 444 ARG A CB  1 
ATOM   3247 C CG  . ARG A 1 444 ? 12.038  -15.913 117.491 1.00 39.50  ? 444 ARG A CG  1 
ATOM   3248 C CD  . ARG A 1 444 ? 11.498  -14.514 117.464 1.00 41.59  ? 444 ARG A CD  1 
ATOM   3249 N NE  . ARG A 1 444 ? 11.773  -13.811 116.214 1.00 43.47  ? 444 ARG A NE  1 
ATOM   3250 C CZ  . ARG A 1 444 ? 11.389  -12.557 115.989 1.00 44.22  ? 444 ARG A CZ  1 
ATOM   3251 N NH1 . ARG A 1 444 ? 10.724  -11.913 116.937 1.00 43.63  ? 444 ARG A NH1 1 
ATOM   3252 N NH2 . ARG A 1 444 ? 11.661  -11.943 114.837 1.00 42.21  ? 444 ARG A NH2 1 
ATOM   3253 N N   . LYS A 1 445 ? 9.488   -18.679 120.314 1.00 50.19  ? 445 LYS A N   1 
ATOM   3254 C CA  . LYS A 1 445 ? 9.459   -19.836 121.213 1.00 55.63  ? 445 LYS A CA  1 
ATOM   3255 C C   . LYS A 1 445 ? 10.557  -20.852 120.916 1.00 56.97  ? 445 LYS A C   1 
ATOM   3256 O O   . LYS A 1 445 ? 11.149  -20.869 119.828 1.00 57.06  ? 445 LYS A O   1 
ATOM   3257 C CB  . LYS A 1 445 ? 8.102   -20.555 121.200 1.00 57.70  ? 445 LYS A CB  1 
ATOM   3258 C CG  . LYS A 1 445 ? 8.052   -21.637 122.281 1.00 60.33  ? 445 LYS A CG  1 
ATOM   3259 C CD  . LYS A 1 445 ? 6.696   -22.286 122.480 1.00 63.79  ? 445 LYS A CD  1 
ATOM   3260 C CE  . LYS A 1 445 ? 6.765   -23.252 123.677 1.00 65.64  ? 445 LYS A CE  1 
ATOM   3261 N NZ  . LYS A 1 445 ? 5.494   -23.988 123.977 1.00 66.79  ? 445 LYS A NZ  1 
ATOM   3262 N N   . MET A 1 446 ? 10.831  -21.703 121.896 1.00 58.90  ? 446 MET A N   1 
ATOM   3263 C CA  . MET A 1 446 ? 11.868  -22.696 121.718 1.00 62.29  ? 446 MET A CA  1 
ATOM   3264 C C   . MET A 1 446 ? 11.522  -24.096 122.167 1.00 66.58  ? 446 MET A C   1 
ATOM   3265 O O   . MET A 1 446 ? 10.945  -24.294 123.243 1.00 66.30  ? 446 MET A O   1 
ATOM   3266 C CB  . MET A 1 446 ? 13.137  -22.257 122.427 1.00 57.97  ? 446 MET A CB  1 
ATOM   3267 C CG  . MET A 1 446 ? 13.842  -21.126 121.744 1.00 52.32  ? 446 MET A CG  1 
ATOM   3268 S SD  . MET A 1 446 ? 15.167  -20.694 122.775 1.00 44.82  ? 446 MET A SD  1 
ATOM   3269 C CE  . MET A 1 446 ? 14.263  -20.267 124.167 1.00 47.26  ? 446 MET A CE  1 
ATOM   3270 N N   . PRO A 1 447 ? 11.881  -25.093 121.332 1.00 71.16  ? 447 PRO A N   1 
ATOM   3271 C CA  . PRO A 1 447 ? 11.645  -26.512 121.588 1.00 74.63  ? 447 PRO A CA  1 
ATOM   3272 C C   . PRO A 1 447 ? 12.687  -26.825 122.645 1.00 77.68  ? 447 PRO A C   1 
ATOM   3273 O O   . PRO A 1 447 ? 13.651  -26.083 122.807 1.00 78.76  ? 447 PRO A O   1 
ATOM   3274 C CB  . PRO A 1 447 ? 11.977  -27.154 120.250 1.00 74.37  ? 447 PRO A CB  1 
ATOM   3275 C CG  . PRO A 1 447 ? 13.197  -26.363 119.842 1.00 73.69  ? 447 PRO A CG  1 
ATOM   3276 C CD  . PRO A 1 447 ? 12.741  -24.924 120.144 1.00 72.44  ? 447 PRO A CD  1 
ATOM   3277 N N   . PHE A 1 448 ? 12.519  -27.924 123.346 1.00 81.15  ? 448 PHE A N   1 
ATOM   3278 C CA  . PHE A 1 448 ? 13.447  -28.269 124.410 1.00 84.45  ? 448 PHE A CA  1 
ATOM   3279 C C   . PHE A 1 448 ? 13.755  -29.749 124.287 1.00 84.47  ? 448 PHE A C   1 
ATOM   3280 O O   . PHE A 1 448 ? 13.016  -30.498 123.643 1.00 85.18  ? 448 PHE A O   1 
ATOM   3281 C CB  . PHE A 1 448 ? 12.737  -28.015 125.730 1.00 87.94  ? 448 PHE A CB  1 
ATOM   3282 C CG  . PHE A 1 448 ? 11.365  -28.606 125.750 1.00 92.53  ? 448 PHE A CG  1 
ATOM   3283 C CD1 . PHE A 1 448 ? 11.167  -29.912 126.191 1.00 94.42  ? 448 PHE A CD1 1 
ATOM   3284 C CD2 . PHE A 1 448 ? 10.300  -27.929 125.146 1.00 94.30  ? 448 PHE A CD2 1 
ATOM   3285 C CE1 . PHE A 1 448 ? 9.932   -30.547 126.022 1.00 96.38  ? 448 PHE A CE1 1 
ATOM   3286 C CE2 . PHE A 1 448 ? 9.059   -28.552 124.970 1.00 96.38  ? 448 PHE A CE2 1 
ATOM   3287 C CZ  . PHE A 1 448 ? 8.875   -29.866 125.406 1.00 96.93  ? 448 PHE A CZ  1 
ATOM   3288 N N   . THR A 1 449 ? 14.856  -30.168 124.885 1.00 83.78  ? 449 THR A N   1 
ATOM   3289 C CA  . THR A 1 449 ? 15.187  -31.578 124.889 1.00 83.13  ? 449 THR A CA  1 
ATOM   3290 C C   . THR A 1 449 ? 14.676  -31.964 126.281 1.00 82.35  ? 449 THR A C   1 
ATOM   3291 O O   . THR A 1 449 ? 13.702  -31.372 126.769 1.00 82.00  ? 449 THR A O   1 
ATOM   3292 C CB  . THR A 1 449 ? 16.718  -31.795 124.745 1.00 83.17  ? 449 THR A CB  1 
ATOM   3293 O OG1 . THR A 1 449 ? 17.410  -30.635 125.220 1.00 83.65  ? 449 THR A OG1 1 
ATOM   3294 C CG2 . THR A 1 449 ? 17.100  -32.035 123.283 1.00 81.18  ? 449 THR A CG2 1 
ATOM   3295 N N   . GLU A 1 450 ? 15.295  -32.938 126.929 1.00 81.50  ? 450 GLU A N   1 
ATOM   3296 C CA  . GLU A 1 450 ? 14.843  -33.290 128.268 1.00 80.87  ? 450 GLU A CA  1 
ATOM   3297 C C   . GLU A 1 450 ? 15.667  -32.529 129.295 1.00 78.20  ? 450 GLU A C   1 
ATOM   3298 O O   . GLU A 1 450 ? 16.847  -32.251 129.073 1.00 78.96  ? 450 GLU A O   1 
ATOM   3299 C CB  . GLU A 1 450 ? 14.967  -34.793 128.512 1.00 83.40  ? 450 GLU A CB  1 
ATOM   3300 C CG  . GLU A 1 450 ? 13.803  -35.602 127.966 1.00 86.26  ? 450 GLU A CG  1 
ATOM   3301 C CD  . GLU A 1 450 ? 13.866  -37.061 128.380 1.00 87.99  ? 450 GLU A CD  1 
ATOM   3302 O OE1 . GLU A 1 450 ? 13.857  -37.336 129.602 1.00 88.40  ? 450 GLU A OE1 1 
ATOM   3303 O OE2 . GLU A 1 450 ? 13.923  -37.933 127.485 1.00 88.36  ? 450 GLU A OE2 1 
ATOM   3304 N N   . LYS A 1 451 ? 15.045  -32.181 130.414 1.00 73.88  ? 451 LYS A N   1 
ATOM   3305 C CA  . LYS A 1 451 ? 15.749  -31.454 131.456 1.00 69.24  ? 451 LYS A CA  1 
ATOM   3306 C C   . LYS A 1 451 ? 16.667  -32.389 132.235 1.00 66.19  ? 451 LYS A C   1 
ATOM   3307 O O   . LYS A 1 451 ? 16.217  -33.396 132.771 1.00 65.34  ? 451 LYS A O   1 
ATOM   3308 C CB  . LYS A 1 451 ? 14.739  -30.798 132.396 1.00 69.51  ? 451 LYS A CB  1 
ATOM   3309 C CG  . LYS A 1 451 ? 15.366  -30.059 133.559 1.00 69.66  ? 451 LYS A CG  1 
ATOM   3310 C CD  . LYS A 1 451 ? 14.345  -29.197 134.279 1.00 69.95  ? 451 LYS A CD  1 
ATOM   3311 C CE  . LYS A 1 451 ? 14.969  -28.514 135.482 1.00 71.16  ? 451 LYS A CE  1 
ATOM   3312 N NZ  . LYS A 1 451 ? 14.107  -27.443 136.052 1.00 70.27  ? 451 LYS A NZ  1 
ATOM   3313 N N   . ILE A 1 452 ? 17.956  -32.059 132.277 1.00 63.01  ? 452 ILE A N   1 
ATOM   3314 C CA  . ILE A 1 452 ? 18.951  -32.853 133.001 1.00 60.12  ? 452 ILE A CA  1 
ATOM   3315 C C   . ILE A 1 452 ? 19.580  -31.966 134.074 1.00 57.82  ? 452 ILE A C   1 
ATOM   3316 O O   . ILE A 1 452 ? 20.558  -31.270 133.829 1.00 57.60  ? 452 ILE A O   1 
ATOM   3317 C CB  . ILE A 1 452 ? 20.058  -33.382 132.054 1.00 61.45  ? 452 ILE A CB  1 
ATOM   3318 C CG1 . ILE A 1 452 ? 19.445  -34.308 130.996 1.00 62.21  ? 452 ILE A CG1 1 
ATOM   3319 C CG2 . ILE A 1 452 ? 21.110  -34.136 132.847 1.00 60.38  ? 452 ILE A CG2 1 
ATOM   3320 C CD1 . ILE A 1 452 ? 20.448  -34.859 129.994 1.00 62.17  ? 452 ILE A CD1 1 
ATOM   3321 N N   . MET A 1 453 ? 18.998  -32.020 135.266 1.00 55.87  ? 453 MET A N   1 
ATOM   3322 C CA  . MET A 1 453 ? 19.399  -31.228 136.426 1.00 53.69  ? 453 MET A CA  1 
ATOM   3323 C C   . MET A 1 453 ? 20.670  -31.668 137.159 1.00 51.33  ? 453 MET A C   1 
ATOM   3324 O O   . MET A 1 453 ? 20.969  -32.851 137.258 1.00 51.66  ? 453 MET A O   1 
ATOM   3325 C CB  . MET A 1 453 ? 18.238  -31.212 137.408 1.00 55.83  ? 453 MET A CB  1 
ATOM   3326 C CG  . MET A 1 453 ? 18.003  -29.896 138.094 1.00 59.32  ? 453 MET A CG  1 
ATOM   3327 S SD  . MET A 1 453 ? 16.231  -29.645 138.210 1.00 61.72  ? 453 MET A SD  1 
ATOM   3328 C CE  . MET A 1 453 ? 15.852  -30.721 139.621 1.00 62.24  ? 453 MET A CE  1 
ATOM   3329 N N   . ALA A 1 454 ? 21.404  -30.701 137.695 1.00 48.60  ? 454 ALA A N   1 
ATOM   3330 C CA  . ALA A 1 454 ? 22.638  -30.989 138.411 1.00 45.56  ? 454 ALA A CA  1 
ATOM   3331 C C   . ALA A 1 454 ? 22.324  -31.401 139.837 1.00 44.90  ? 454 ALA A C   1 
ATOM   3332 O O   . ALA A 1 454 ? 21.234  -31.144 140.342 1.00 45.57  ? 454 ALA A O   1 
ATOM   3333 C CB  . ALA A 1 454 ? 23.538  -29.765 138.407 1.00 45.01  ? 454 ALA A CB  1 
ATOM   3334 N N   . THR A 1 455 ? 23.289  -32.036 140.491 1.00 44.10  ? 455 THR A N   1 
ATOM   3335 C CA  . THR A 1 455 ? 23.109  -32.487 141.862 1.00 42.98  ? 455 THR A CA  1 
ATOM   3336 C C   . THR A 1 455 ? 23.603  -31.457 142.848 1.00 44.16  ? 455 THR A C   1 
ATOM   3337 O O   . THR A 1 455 ? 24.511  -30.676 142.555 1.00 44.10  ? 455 THR A O   1 
ATOM   3338 C CB  . THR A 1 455 ? 23.884  -33.787 142.158 1.00 42.32  ? 455 THR A CB  1 
ATOM   3339 O OG1 . THR A 1 455 ? 25.296  -33.520 142.181 1.00 40.41  ? 455 THR A OG1 1 
ATOM   3340 C CG2 . THR A 1 455 ? 23.572  -34.842 141.106 1.00 42.07  ? 455 THR A CG2 1 
ATOM   3341 N N   . PRO A 1 456 ? 23.013  -31.448 144.045 1.00 44.87  ? 456 PRO A N   1 
ATOM   3342 C CA  . PRO A 1 456 ? 23.409  -30.502 145.089 1.00 45.15  ? 456 PRO A CA  1 
ATOM   3343 C C   . PRO A 1 456 ? 24.911  -30.441 145.367 1.00 44.96  ? 456 PRO A C   1 
ATOM   3344 O O   . PRO A 1 456 ? 25.410  -29.407 145.799 1.00 46.88  ? 456 PRO A O   1 
ATOM   3345 C CB  . PRO A 1 456 ? 22.589  -30.947 146.307 1.00 44.45  ? 456 PRO A CB  1 
ATOM   3346 C CG  . PRO A 1 456 ? 22.010  -32.305 145.913 1.00 44.87  ? 456 PRO A CG  1 
ATOM   3347 C CD  . PRO A 1 456 ? 21.814  -32.200 144.443 1.00 44.28  ? 456 PRO A CD  1 
ATOM   3348 N N   . GLU A 1 457 ? 25.637  -31.523 145.117 1.00 45.12  ? 457 GLU A N   1 
ATOM   3349 C CA  . GLU A 1 457 ? 27.082  -31.502 145.350 1.00 45.12  ? 457 GLU A CA  1 
ATOM   3350 C C   . GLU A 1 457 ? 27.767  -30.654 144.279 1.00 42.54  ? 457 GLU A C   1 
ATOM   3351 O O   . GLU A 1 457 ? 28.758  -29.966 144.547 1.00 42.12  ? 457 GLU A O   1 
ATOM   3352 C CB  . GLU A 1 457 ? 27.678  -32.923 145.321 1.00 49.07  ? 457 GLU A CB  1 
ATOM   3353 C CG  . GLU A 1 457 ? 29.106  -32.998 145.908 1.00 56.17  ? 457 GLU A CG  1 
ATOM   3354 C CD  . GLU A 1 457 ? 29.796  -34.372 145.757 1.00 60.69  ? 457 GLU A CD  1 
ATOM   3355 O OE1 . GLU A 1 457 ? 29.101  -35.419 145.793 1.00 62.94  ? 457 GLU A OE1 1 
ATOM   3356 O OE2 . GLU A 1 457 ? 31.045  -34.404 145.627 1.00 61.59  ? 457 GLU A OE2 1 
ATOM   3357 N N   . GLN A 1 458 ? 27.235  -30.706 143.061 1.00 38.67  ? 458 GLN A N   1 
ATOM   3358 C CA  . GLN A 1 458 ? 27.810  -29.956 141.955 1.00 35.45  ? 458 GLN A CA  1 
ATOM   3359 C C   . GLN A 1 458 ? 27.503  -28.471 142.105 1.00 35.33  ? 458 GLN A C   1 
ATOM   3360 O O   . GLN A 1 458 ? 28.415  -27.632 142.090 1.00 34.59  ? 458 GLN A O   1 
ATOM   3361 C CB  . GLN A 1 458 ? 27.283  -30.523 140.639 1.00 32.23  ? 458 GLN A CB  1 
ATOM   3362 C CG  . GLN A 1 458 ? 27.635  -31.995 140.499 1.00 28.20  ? 458 GLN A CG  1 
ATOM   3363 C CD  . GLN A 1 458 ? 26.895  -32.682 139.386 1.00 24.42  ? 458 GLN A CD  1 
ATOM   3364 O OE1 . GLN A 1 458 ? 25.754  -32.339 139.091 1.00 24.27  ? 458 GLN A OE1 1 
ATOM   3365 N NE2 . GLN A 1 458 ? 27.527  -33.675 138.775 1.00 19.31  ? 458 GLN A NE2 1 
ATOM   3366 N N   . VAL A 1 459 ? 26.222  -28.153 142.257 1.00 34.89  ? 459 VAL A N   1 
ATOM   3367 C CA  . VAL A 1 459 ? 25.800  -26.776 142.471 1.00 34.63  ? 459 VAL A CA  1 
ATOM   3368 C C   . VAL A 1 459 ? 26.748  -26.211 143.534 1.00 35.68  ? 459 VAL A C   1 
ATOM   3369 O O   . VAL A 1 459 ? 27.226  -25.079 143.431 1.00 36.61  ? 459 VAL A O   1 
ATOM   3370 C CB  . VAL A 1 459 ? 24.336  -26.727 142.991 1.00 34.06  ? 459 VAL A CB  1 
ATOM   3371 C CG1 . VAL A 1 459 ? 23.960  -25.317 143.426 1.00 33.15  ? 459 VAL A CG1 1 
ATOM   3372 C CG2 . VAL A 1 459 ? 23.392  -27.204 141.905 1.00 33.80  ? 459 VAL A CG2 1 
ATOM   3373 N N   . GLY A 1 460 ? 27.024  -27.032 144.547 1.00 36.05  ? 460 GLY A N   1 
ATOM   3374 C CA  . GLY A 1 460 ? 27.918  -26.646 145.621 1.00 34.70  ? 460 GLY A CA  1 
ATOM   3375 C C   . GLY A 1 460 ? 29.245  -26.136 145.100 1.00 34.96  ? 460 GLY A C   1 
ATOM   3376 O O   . GLY A 1 460 ? 29.605  -24.989 145.360 1.00 36.77  ? 460 GLY A O   1 
ATOM   3377 N N   . LYS A 1 461 ? 29.974  -26.960 144.355 1.00 34.37  ? 461 LYS A N   1 
ATOM   3378 C CA  . LYS A 1 461 ? 31.265  -26.522 143.829 1.00 35.38  ? 461 LYS A CA  1 
ATOM   3379 C C   . LYS A 1 461 ? 31.177  -25.284 142.944 1.00 35.57  ? 461 LYS A C   1 
ATOM   3380 O O   . LYS A 1 461 ? 32.103  -24.466 142.918 1.00 35.27  ? 461 LYS A O   1 
ATOM   3381 C CB  . LYS A 1 461 ? 31.933  -27.634 143.033 1.00 36.55  ? 461 LYS A CB  1 
ATOM   3382 C CG  . LYS A 1 461 ? 32.703  -28.617 143.869 1.00 39.95  ? 461 LYS A CG  1 
ATOM   3383 C CD  . LYS A 1 461 ? 34.008  -28.059 144.394 1.00 40.29  ? 461 LYS A CD  1 
ATOM   3384 C CE  . LYS A 1 461 ? 34.640  -29.076 145.338 1.00 40.59  ? 461 LYS A CE  1 
ATOM   3385 N NZ  . LYS A 1 461 ? 35.975  -28.652 145.827 1.00 42.55  ? 461 LYS A NZ  1 
ATOM   3386 N N   . MET A 1 462 ? 30.079  -25.147 142.204 1.00 33.96  ? 462 MET A N   1 
ATOM   3387 C CA  . MET A 1 462 ? 29.933  -23.993 141.336 1.00 32.59  ? 462 MET A CA  1 
ATOM   3388 C C   . MET A 1 462 ? 29.709  -22.753 142.202 1.00 32.62  ? 462 MET A C   1 
ATOM   3389 O O   . MET A 1 462 ? 30.285  -21.691 141.935 1.00 31.37  ? 462 MET A O   1 
ATOM   3390 C CB  . MET A 1 462 ? 28.783  -24.211 140.345 1.00 29.79  ? 462 MET A CB  1 
ATOM   3391 C CG  . MET A 1 462 ? 28.747  -23.197 139.210 1.00 28.20  ? 462 MET A CG  1 
ATOM   3392 S SD  . MET A 1 462 ? 30.367  -22.719 138.516 1.00 24.07  ? 462 MET A SD  1 
ATOM   3393 C CE  . MET A 1 462 ? 30.695  -24.050 137.397 1.00 26.46  ? 462 MET A CE  1 
ATOM   3394 N N   . LYS A 1 463 ? 28.901  -22.894 143.253 1.00 32.01  ? 463 LYS A N   1 
ATOM   3395 C CA  . LYS A 1 463 ? 28.647  -21.772 144.144 1.00 33.39  ? 463 LYS A CA  1 
ATOM   3396 C C   . LYS A 1 463 ? 29.966  -21.220 144.626 1.00 34.29  ? 463 LYS A C   1 
ATOM   3397 O O   . LYS A 1 463 ? 30.197  -20.008 144.580 1.00 35.40  ? 463 LYS A O   1 
ATOM   3398 C CB  . LYS A 1 463 ? 27.832  -22.192 145.354 1.00 33.36  ? 463 LYS A CB  1 
ATOM   3399 C CG  . LYS A 1 463 ? 26.364  -22.356 145.095 1.00 34.66  ? 463 LYS A CG  1 
ATOM   3400 C CD  . LYS A 1 463 ? 25.620  -22.453 146.406 1.00 38.44  ? 463 LYS A CD  1 
ATOM   3401 C CE  . LYS A 1 463 ? 24.201  -22.949 146.197 1.00 42.25  ? 463 LYS A CE  1 
ATOM   3402 N NZ  . LYS A 1 463 ? 23.502  -23.167 147.491 1.00 43.25  ? 463 LYS A NZ  1 
ATOM   3403 N N   . ALA A 1 464 ? 30.824  -22.121 145.095 1.00 34.45  ? 464 ALA A N   1 
ATOM   3404 C CA  . ALA A 1 464 ? 32.146  -21.746 145.585 1.00 34.75  ? 464 ALA A CA  1 
ATOM   3405 C C   . ALA A 1 464 ? 32.890  -20.933 144.532 1.00 34.09  ? 464 ALA A C   1 
ATOM   3406 O O   . ALA A 1 464 ? 33.447  -19.886 144.840 1.00 34.52  ? 464 ALA A O   1 
ATOM   3407 C CB  . ALA A 1 464 ? 32.951  -22.995 145.948 1.00 34.37  ? 464 ALA A CB  1 
ATOM   3408 N N   . ILE A 1 465 ? 32.894  -21.422 143.294 1.00 33.88  ? 465 ILE A N   1 
ATOM   3409 C CA  . ILE A 1 465 ? 33.563  -20.739 142.193 1.00 32.83  ? 465 ILE A CA  1 
ATOM   3410 C C   . ILE A 1 465 ? 32.956  -19.356 141.957 1.00 32.62  ? 465 ILE A C   1 
ATOM   3411 O O   . ILE A 1 465 ? 33.673  -18.373 141.741 1.00 29.59  ? 465 ILE A O   1 
ATOM   3412 C CB  . ILE A 1 465 ? 33.456  -21.556 140.885 1.00 33.03  ? 465 ILE A CB  1 
ATOM   3413 C CG1 . ILE A 1 465 ? 34.154  -22.905 141.058 1.00 33.02  ? 465 ILE A CG1 1 
ATOM   3414 C CG2 . ILE A 1 465 ? 34.092  -20.792 139.738 1.00 32.70  ? 465 ILE A CG2 1 
ATOM   3415 C CD1 . ILE A 1 465 ? 34.349  -23.668 139.771 1.00 33.48  ? 465 ILE A CD1 1 
ATOM   3416 N N   . VAL A 1 466 ? 31.631  -19.280 142.001 1.00 32.72  ? 466 VAL A N   1 
ATOM   3417 C CA  . VAL A 1 466 ? 30.977  -18.003 141.792 1.00 35.48  ? 466 VAL A CA  1 
ATOM   3418 C C   . VAL A 1 466 ? 31.449  -16.978 142.821 1.00 37.69  ? 466 VAL A C   1 
ATOM   3419 O O   . VAL A 1 466 ? 31.746  -15.835 142.476 1.00 39.18  ? 466 VAL A O   1 
ATOM   3420 C CB  . VAL A 1 466 ? 29.441  -18.121 141.864 1.00 34.65  ? 466 VAL A CB  1 
ATOM   3421 C CG1 . VAL A 1 466 ? 28.819  -16.744 141.964 1.00 34.81  ? 466 VAL A CG1 1 
ATOM   3422 C CG2 . VAL A 1 466 ? 28.921  -18.804 140.621 1.00 32.60  ? 466 VAL A CG2 1 
ATOM   3423 N N   . GLU A 1 467 ? 31.549  -17.376 144.081 1.00 39.17  ? 467 GLU A N   1 
ATOM   3424 C CA  . GLU A 1 467 ? 31.975  -16.427 145.094 1.00 40.09  ? 467 GLU A CA  1 
ATOM   3425 C C   . GLU A 1 467 ? 33.429  -15.987 144.991 1.00 39.24  ? 467 GLU A C   1 
ATOM   3426 O O   . GLU A 1 467 ? 33.754  -14.843 145.303 1.00 40.05  ? 467 GLU A O   1 
ATOM   3427 C CB  . GLU A 1 467 ? 31.672  -16.986 146.468 1.00 41.57  ? 467 GLU A CB  1 
ATOM   3428 C CG  . GLU A 1 467 ? 30.254  -17.461 146.541 1.00 48.17  ? 467 GLU A CG  1 
ATOM   3429 C CD  . GLU A 1 467 ? 29.720  -17.471 147.944 1.00 53.37  ? 467 GLU A CD  1 
ATOM   3430 O OE1 . GLU A 1 467 ? 29.751  -16.397 148.585 1.00 56.49  ? 467 GLU A OE1 1 
ATOM   3431 O OE2 . GLU A 1 467 ? 29.266  -18.545 148.404 1.00 57.05  ? 467 GLU A OE2 1 
ATOM   3432 N N   . LYS A 1 468 ? 34.317  -16.861 144.548 1.00 37.14  ? 468 LYS A N   1 
ATOM   3433 C CA  . LYS A 1 468 ? 35.696  -16.421 144.441 1.00 37.96  ? 468 LYS A CA  1 
ATOM   3434 C C   . LYS A 1 468 ? 35.792  -15.347 143.365 1.00 36.87  ? 468 LYS A C   1 
ATOM   3435 O O   . LYS A 1 468 ? 36.680  -14.504 143.398 1.00 38.01  ? 468 LYS A O   1 
ATOM   3436 C CB  . LYS A 1 468 ? 36.631  -17.587 144.095 1.00 39.88  ? 468 LYS A CB  1 
ATOM   3437 C CG  . LYS A 1 468 ? 36.589  -18.733 145.078 1.00 44.06  ? 468 LYS A CG  1 
ATOM   3438 C CD  . LYS A 1 468 ? 36.973  -18.292 146.479 1.00 48.94  ? 468 LYS A CD  1 
ATOM   3439 C CE  . LYS A 1 468 ? 36.643  -19.373 147.504 1.00 51.67  ? 468 LYS A CE  1 
ATOM   3440 N NZ  . LYS A 1 468 ? 37.232  -19.088 148.851 1.00 53.42  ? 468 LYS A NZ  1 
ATOM   3441 N N   . LEU A 1 469 ? 34.860  -15.360 142.420 1.00 35.43  ? 469 LEU A N   1 
ATOM   3442 C CA  . LEU A 1 469 ? 34.894  -14.393 141.325 1.00 33.35  ? 469 LEU A CA  1 
ATOM   3443 C C   . LEU A 1 469 ? 33.867  -13.264 141.474 1.00 33.08  ? 469 LEU A C   1 
ATOM   3444 O O   . LEU A 1 469 ? 33.438  -12.646 140.496 1.00 33.18  ? 469 LEU A O   1 
ATOM   3445 C CB  . LEU A 1 469 ? 34.704  -15.136 139.999 1.00 31.61  ? 469 LEU A CB  1 
ATOM   3446 C CG  . LEU A 1 469 ? 35.644  -16.338 139.817 1.00 29.29  ? 469 LEU A CG  1 
ATOM   3447 C CD1 . LEU A 1 469 ? 35.164  -17.214 138.682 1.00 30.21  ? 469 LEU A CD1 1 
ATOM   3448 C CD2 . LEU A 1 469 ? 37.036  -15.857 139.546 1.00 28.29  ? 469 LEU A CD2 1 
ATOM   3449 N N   . ARG A 1 470 ? 33.489  -12.996 142.714 1.00 32.05  ? 470 ARG A N   1 
ATOM   3450 C CA  . ARG A 1 470 ? 32.534  -11.948 143.020 1.00 32.11  ? 470 ARG A CA  1 
ATOM   3451 C C   . ARG A 1 470 ? 33.183  -10.605 142.697 1.00 31.98  ? 470 ARG A C   1 
ATOM   3452 O O   . ARG A 1 470 ? 34.398  -10.512 142.569 1.00 32.92  ? 470 ARG A O   1 
ATOM   3453 C CB  . ARG A 1 470 ? 32.195  -12.005 144.504 1.00 33.35  ? 470 ARG A CB  1 
ATOM   3454 C CG  . ARG A 1 470 ? 30.880  -11.398 144.910 1.00 34.70  ? 470 ARG A CG  1 
ATOM   3455 C CD  . ARG A 1 470 ? 30.782  -11.408 146.421 1.00 35.44  ? 470 ARG A CD  1 
ATOM   3456 N NE  . ARG A 1 470 ? 29.405  -11.404 146.887 1.00 37.66  ? 470 ARG A NE  1 
ATOM   3457 C CZ  . ARG A 1 470 ? 28.682  -12.500 147.104 1.00 41.47  ? 470 ARG A CZ  1 
ATOM   3458 N NH1 . ARG A 1 470 ? 29.210  -13.705 146.896 1.00 40.63  ? 470 ARG A NH1 1 
ATOM   3459 N NH2 . ARG A 1 470 ? 27.432  -12.392 147.544 1.00 43.48  ? 470 ARG A NH2 1 
ATOM   3460 N N   . PHE A 1 471 ? 32.363  -9.575  142.547 1.00 30.58  ? 471 PHE A N   1 
ATOM   3461 C CA  . PHE A 1 471 ? 32.847  -8.233  142.277 1.00 30.88  ? 471 PHE A CA  1 
ATOM   3462 C C   . PHE A 1 471 ? 31.651  -7.304  142.164 1.00 31.56  ? 471 PHE A C   1 
ATOM   3463 O O   . PHE A 1 471 ? 30.523  -7.746  141.966 1.00 32.36  ? 471 PHE A O   1 
ATOM   3464 C CB  . PHE A 1 471 ? 33.758  -8.189  141.030 1.00 31.73  ? 471 PHE A CB  1 
ATOM   3465 C CG  . PHE A 1 471 ? 33.043  -7.997  139.716 1.00 33.24  ? 471 PHE A CG  1 
ATOM   3466 C CD1 . PHE A 1 471 ? 32.474  -6.776  139.374 1.00 34.83  ? 471 PHE A CD1 1 
ATOM   3467 C CD2 . PHE A 1 471 ? 32.993  -9.030  138.792 1.00 34.61  ? 471 PHE A CD2 1 
ATOM   3468 C CE1 . PHE A 1 471 ? 31.868  -6.592  138.122 1.00 35.50  ? 471 PHE A CE1 1 
ATOM   3469 C CE2 . PHE A 1 471 ? 32.392  -8.858  137.544 1.00 33.81  ? 471 PHE A CE2 1 
ATOM   3470 C CZ  . PHE A 1 471 ? 31.831  -7.640  137.208 1.00 35.87  ? 471 PHE A CZ  1 
ATOM   3471 N N   . THR A 1 472 ? 31.894  -6.015  142.329 1.00 31.43  ? 472 THR A N   1 
ATOM   3472 C CA  . THR A 1 472 ? 30.818  -5.041  142.287 1.00 32.59  ? 472 THR A CA  1 
ATOM   3473 C C   . THR A 1 472 ? 30.606  -4.452  140.902 1.00 32.86  ? 472 THR A C   1 
ATOM   3474 O O   . THR A 1 472 ? 31.468  -3.762  140.374 1.00 34.97  ? 472 THR A O   1 
ATOM   3475 C CB  . THR A 1 472 ? 31.095  -3.900  143.266 1.00 32.15  ? 472 THR A CB  1 
ATOM   3476 O OG1 . THR A 1 472 ? 31.370  -4.450  144.558 1.00 32.90  ? 472 THR A OG1 1 
ATOM   3477 C CG2 . THR A 1 472 ? 29.894  -2.990  143.368 1.00 33.59  ? 472 THR A CG2 1 
ATOM   3478 N N   . TYR A 1 473 ? 29.451  -4.714  140.309 1.00 33.14  ? 473 TYR A N   1 
ATOM   3479 C CA  . TYR A 1 473 ? 29.187  -4.181  138.990 1.00 33.44  ? 473 TYR A CA  1 
ATOM   3480 C C   . TYR A 1 473 ? 28.573  -2.794  139.090 1.00 35.43  ? 473 TYR A C   1 
ATOM   3481 O O   . TYR A 1 473 ? 27.696  -2.544  139.906 1.00 36.33  ? 473 TYR A O   1 
ATOM   3482 C CB  . TYR A 1 473 ? 28.240  -5.089  138.213 1.00 29.53  ? 473 TYR A CB  1 
ATOM   3483 C CG  . TYR A 1 473 ? 27.763  -4.480  136.916 1.00 27.78  ? 473 TYR A CG  1 
ATOM   3484 C CD1 . TYR A 1 473 ? 28.567  -4.495  135.776 1.00 27.73  ? 473 TYR A CD1 1 
ATOM   3485 C CD2 . TYR A 1 473 ? 26.516  -3.877  136.832 1.00 26.80  ? 473 TYR A CD2 1 
ATOM   3486 C CE1 . TYR A 1 473 ? 28.146  -3.925  134.578 1.00 27.56  ? 473 TYR A CE1 1 
ATOM   3487 C CE2 . TYR A 1 473 ? 26.080  -3.297  135.643 1.00 29.02  ? 473 TYR A CE2 1 
ATOM   3488 C CZ  . TYR A 1 473 ? 26.897  -3.326  134.517 1.00 29.20  ? 473 TYR A CZ  1 
ATOM   3489 O OH  . TYR A 1 473 ? 26.471  -2.744  133.337 1.00 29.89  ? 473 TYR A OH  1 
ATOM   3490 N N   . ARG A 1 474 ? 29.051  -1.895  138.244 1.00 36.71  ? 474 ARG A N   1 
ATOM   3491 C CA  . ARG A 1 474 ? 28.560  -0.525  138.187 1.00 38.06  ? 474 ARG A CA  1 
ATOM   3492 C C   . ARG A 1 474 ? 28.514  -0.217  136.672 1.00 36.71  ? 474 ARG A C   1 
ATOM   3493 O O   . ARG A 1 474 ? 29.397  -0.615  135.921 1.00 36.14  ? 474 ARG A O   1 
ATOM   3494 C CB  . ARG A 1 474 ? 29.514  0.370   139.004 1.00 39.41  ? 474 ARG A CB  1 
ATOM   3495 C CG  . ARG A 1 474 ? 30.036  1.609   138.372 1.00 43.73  ? 474 ARG A CG  1 
ATOM   3496 C CD  . ARG A 1 474 ? 31.089  2.262   139.284 1.00 45.14  ? 474 ARG A CD  1 
ATOM   3497 N NE  . ARG A 1 474 ? 30.767  3.665   139.507 1.00 48.96  ? 474 ARG A NE  1 
ATOM   3498 C CZ  . ARG A 1 474 ? 29.900  4.098   140.424 1.00 51.87  ? 474 ARG A CZ  1 
ATOM   3499 N NH1 . ARG A 1 474 ? 29.271  3.238   141.229 1.00 52.37  ? 474 ARG A NH1 1 
ATOM   3500 N NH2 . ARG A 1 474 ? 29.624  5.397   140.512 1.00 54.75  ? 474 ARG A NH2 1 
ATOM   3501 N N   . SER A 1 475 ? 27.452  0.422   136.205 1.00 35.13  ? 475 SER A N   1 
ATOM   3502 C CA  . SER A 1 475 ? 27.321  0.683   134.773 1.00 34.12  ? 475 SER A CA  1 
ATOM   3503 C C   . SER A 1 475 ? 28.475  1.409   134.082 1.00 34.51  ? 475 SER A C   1 
ATOM   3504 O O   . SER A 1 475 ? 28.639  1.289   132.874 1.00 32.98  ? 475 SER A O   1 
ATOM   3505 C CB  . SER A 1 475 ? 26.045  1.455   134.502 1.00 32.43  ? 475 SER A CB  1 
ATOM   3506 O OG  . SER A 1 475 ? 26.091  2.698   135.164 1.00 31.10  ? 475 SER A OG  1 
ATOM   3507 N N   . ASP A 1 476 ? 29.273  2.166   134.823 1.00 35.15  ? 476 ASP A N   1 
ATOM   3508 C CA  . ASP A 1 476 ? 30.367  2.887   134.191 1.00 35.47  ? 476 ASP A CA  1 
ATOM   3509 C C   . ASP A 1 476 ? 31.668  2.093   134.257 1.00 35.25  ? 476 ASP A C   1 
ATOM   3510 O O   . ASP A 1 476 ? 32.753  2.652   134.085 1.00 36.13  ? 476 ASP A O   1 
ATOM   3511 C CB  . ASP A 1 476 ? 30.531  4.265   134.854 1.00 38.09  ? 476 ASP A CB  1 
ATOM   3512 C CG  . ASP A 1 476 ? 31.317  4.214   136.168 1.00 40.40  ? 476 ASP A CG  1 
ATOM   3513 O OD1 . ASP A 1 476 ? 31.565  3.101   136.670 1.00 41.62  ? 476 ASP A OD1 1 
ATOM   3514 O OD2 . ASP A 1 476 ? 31.691  5.290   136.702 1.00 40.24  ? 476 ASP A OD2 1 
ATOM   3515 N N   . SER A 1 477 ? 31.540  0.787   134.489 1.00 33.48  ? 477 SER A N   1 
ATOM   3516 C CA  . SER A 1 477 ? 32.679  -0.117  134.631 1.00 32.40  ? 477 SER A CA  1 
ATOM   3517 C C   . SER A 1 477 ? 33.577  -0.318  133.423 1.00 31.45  ? 477 SER A C   1 
ATOM   3518 O O   . SER A 1 477 ? 34.793  -0.317  133.556 1.00 32.07  ? 477 SER A O   1 
ATOM   3519 C CB  . SER A 1 477 ? 32.211  -1.504  135.076 1.00 34.28  ? 477 SER A CB  1 
ATOM   3520 O OG  . SER A 1 477 ? 31.594  -1.493  136.353 1.00 40.36  ? 477 SER A OG  1 
ATOM   3521 N N   . PHE A 1 478 ? 32.998  -0.507  132.245 1.00 30.33  ? 478 PHE A N   1 
ATOM   3522 C CA  . PHE A 1 478 ? 33.824  -0.763  131.081 1.00 29.66  ? 478 PHE A CA  1 
ATOM   3523 C C   . PHE A 1 478 ? 33.726  0.247   129.966 1.00 30.13  ? 478 PHE A C   1 
ATOM   3524 O O   . PHE A 1 478 ? 32.657  0.777   129.689 1.00 31.10  ? 478 PHE A O   1 
ATOM   3525 C CB  . PHE A 1 478 ? 33.494  -2.137  130.501 1.00 30.02  ? 478 PHE A CB  1 
ATOM   3526 C CG  . PHE A 1 478 ? 33.299  -3.212  131.537 1.00 29.75  ? 478 PHE A CG  1 
ATOM   3527 C CD1 . PHE A 1 478 ? 32.100  -3.326  132.226 1.00 28.45  ? 478 PHE A CD1 1 
ATOM   3528 C CD2 . PHE A 1 478 ? 34.324  -4.110  131.826 1.00 29.59  ? 478 PHE A CD2 1 
ATOM   3529 C CE1 . PHE A 1 478 ? 31.920  -4.321  133.192 1.00 29.24  ? 478 PHE A CE1 1 
ATOM   3530 C CE2 . PHE A 1 478 ? 34.155  -5.104  132.786 1.00 29.20  ? 478 PHE A CE2 1 
ATOM   3531 C CZ  . PHE A 1 478 ? 32.950  -5.211  133.472 1.00 28.50  ? 478 PHE A CZ  1 
ATOM   3532 N N   . GLU A 1 479 ? 34.857  0.495   129.318 1.00 31.19  ? 479 GLU A N   1 
ATOM   3533 C CA  . GLU A 1 479 ? 34.903  1.405   128.186 1.00 33.19  ? 479 GLU A CA  1 
ATOM   3534 C C   . GLU A 1 479 ? 34.762  0.532   126.956 1.00 33.20  ? 479 GLU A C   1 
ATOM   3535 O O   . GLU A 1 479 ? 35.111  -0.647  126.983 1.00 33.72  ? 479 GLU A O   1 
ATOM   3536 C CB  . GLU A 1 479 ? 36.231  2.158   128.125 1.00 35.21  ? 479 GLU A CB  1 
ATOM   3537 C CG  . GLU A 1 479 ? 36.443  3.133   129.273 1.00 40.55  ? 479 GLU A CG  1 
ATOM   3538 C CD  . GLU A 1 479 ? 37.695  3.968   129.107 1.00 42.03  ? 479 GLU A CD  1 
ATOM   3539 O OE1 . GLU A 1 479 ? 38.702  3.418   128.599 1.00 43.30  ? 479 GLU A OE1 1 
ATOM   3540 O OE2 . GLU A 1 479 ? 37.675  5.163   129.494 1.00 41.88  ? 479 GLU A OE2 1 
ATOM   3541 N N   . ASN A 1 480 ? 34.241  1.111   125.884 1.00 33.05  ? 480 ASN A N   1 
ATOM   3542 C CA  . ASN A 1 480 ? 34.046  0.393   124.636 1.00 32.73  ? 480 ASN A CA  1 
ATOM   3543 C C   . ASN A 1 480 ? 35.395  0.235   123.932 1.00 34.03  ? 480 ASN A C   1 
ATOM   3544 O O   . ASN A 1 480 ? 35.965  1.208   123.455 1.00 34.72  ? 480 ASN A O   1 
ATOM   3545 C CB  . ASN A 1 480 ? 33.071  1.168   123.753 1.00 31.36  ? 480 ASN A CB  1 
ATOM   3546 C CG  . ASN A 1 480 ? 32.834  0.498   122.435 1.00 29.84  ? 480 ASN A CG  1 
ATOM   3547 O OD1 . ASN A 1 480 ? 33.758  -0.059  121.846 1.00 28.95  ? 480 ASN A OD1 1 
ATOM   3548 N ND2 . ASN A 1 480 ? 31.596  0.559   121.946 1.00 27.98  ? 480 ASN A ND2 1 
ATOM   3549 N N   . PRO A 1 481 ? 35.913  -1.007  123.860 1.00 35.21  ? 481 PRO A N   1 
ATOM   3550 C CA  . PRO A 1 481 ? 37.185  -1.418  123.246 1.00 35.18  ? 481 PRO A CA  1 
ATOM   3551 C C   . PRO A 1 481 ? 37.469  -0.755  121.914 1.00 35.96  ? 481 PRO A C   1 
ATOM   3552 O O   . PRO A 1 481 ? 38.554  -0.209  121.692 1.00 36.42  ? 481 PRO A O   1 
ATOM   3553 C CB  . PRO A 1 481 ? 37.015  -2.919  123.060 1.00 34.99  ? 481 PRO A CB  1 
ATOM   3554 C CG  . PRO A 1 481 ? 36.143  -3.287  124.178 1.00 37.43  ? 481 PRO A CG  1 
ATOM   3555 C CD  . PRO A 1 481 ? 35.117  -2.190  124.224 1.00 35.12  ? 481 PRO A CD  1 
ATOM   3556 N N   . VAL A 1 482 ? 36.484  -0.837  121.025 1.00 34.98  ? 482 VAL A N   1 
ATOM   3557 C CA  . VAL A 1 482 ? 36.591  -0.287  119.690 1.00 35.14  ? 482 VAL A CA  1 
ATOM   3558 C C   . VAL A 1 482 ? 36.628  1.229   119.654 1.00 35.24  ? 482 VAL A C   1 
ATOM   3559 O O   . VAL A 1 482 ? 37.516  1.809   119.038 1.00 36.31  ? 482 VAL A O   1 
ATOM   3560 C CB  . VAL A 1 482 ? 35.427  -0.764  118.805 1.00 35.74  ? 482 VAL A CB  1 
ATOM   3561 C CG1 . VAL A 1 482 ? 35.546  -0.147  117.419 1.00 34.33  ? 482 VAL A CG1 1 
ATOM   3562 C CG2 . VAL A 1 482 ? 35.432  -2.289  118.719 1.00 37.05  ? 482 VAL A CG2 1 
ATOM   3563 N N   . LEU A 1 483 ? 35.662  1.877   120.292 1.00 34.48  ? 483 LEU A N   1 
ATOM   3564 C CA  . LEU A 1 483 ? 35.642  3.330   120.284 1.00 35.86  ? 483 LEU A CA  1 
ATOM   3565 C C   . LEU A 1 483 ? 36.970  3.855   120.786 1.00 36.79  ? 483 LEU A C   1 
ATOM   3566 O O   . LEU A 1 483 ? 37.556  4.746   120.177 1.00 37.15  ? 483 LEU A O   1 
ATOM   3567 C CB  . LEU A 1 483 ? 34.509  3.866   121.154 1.00 35.26  ? 483 LEU A CB  1 
ATOM   3568 C CG  . LEU A 1 483 ? 33.106  3.703   120.576 1.00 34.55  ? 483 LEU A CG  1 
ATOM   3569 C CD1 . LEU A 1 483 ? 32.092  4.222   121.592 1.00 36.59  ? 483 LEU A CD1 1 
ATOM   3570 C CD2 . LEU A 1 483 ? 32.995  4.451   119.250 1.00 33.51  ? 483 LEU A CD2 1 
ATOM   3571 N N   . GLN A 1 484 ? 37.441  3.301   121.897 1.00 37.39  ? 484 GLN A N   1 
ATOM   3572 C CA  . GLN A 1 484 ? 38.713  3.709   122.462 1.00 38.84  ? 484 GLN A CA  1 
ATOM   3573 C C   . GLN A 1 484 ? 39.794  3.625   121.391 1.00 40.59  ? 484 GLN A C   1 
ATOM   3574 O O   . GLN A 1 484 ? 40.439  4.622   121.054 1.00 41.60  ? 484 GLN A O   1 
ATOM   3575 C CB  . GLN A 1 484 ? 39.089  2.803   123.633 1.00 39.80  ? 484 GLN A CB  1 
ATOM   3576 C CG  . GLN A 1 484 ? 38.236  2.999   124.853 1.00 41.74  ? 484 GLN A CG  1 
ATOM   3577 C CD  . GLN A 1 484 ? 38.052  4.457   125.166 1.00 43.14  ? 484 GLN A CD  1 
ATOM   3578 O OE1 . GLN A 1 484 ? 39.006  5.237   125.130 1.00 46.00  ? 484 GLN A OE1 1 
ATOM   3579 N NE2 . GLN A 1 484 ? 36.824  4.843   125.475 1.00 43.02  ? 484 GLN A NE2 1 
ATOM   3580 N N   . GLN A 1 485 ? 39.984  2.427   120.857 1.00 40.68  ? 485 GLN A N   1 
ATOM   3581 C CA  . GLN A 1 485 ? 40.980  2.199   119.823 1.00 41.88  ? 485 GLN A CA  1 
ATOM   3582 C C   . GLN A 1 485 ? 40.907  3.268   118.731 1.00 39.76  ? 485 GLN A C   1 
ATOM   3583 O O   . GLN A 1 485 ? 41.889  3.934   118.424 1.00 39.60  ? 485 GLN A O   1 
ATOM   3584 C CB  . GLN A 1 485 ? 40.758  0.811   119.216 1.00 47.15  ? 485 GLN A CB  1 
ATOM   3585 C CG  . GLN A 1 485 ? 41.859  0.323   118.285 1.00 53.97  ? 485 GLN A CG  1 
ATOM   3586 C CD  . GLN A 1 485 ? 43.238  0.441   118.912 1.00 59.36  ? 485 GLN A CD  1 
ATOM   3587 O OE1 . GLN A 1 485 ? 43.426  0.169   120.109 1.00 62.06  ? 485 GLN A OE1 1 
ATOM   3588 N NE2 . GLN A 1 485 ? 44.218  0.839   118.103 1.00 61.91  ? 485 GLN A NE2 1 
ATOM   3589 N N   . HIS A 1 486 ? 39.723  3.422   118.155 1.00 38.26  ? 486 HIS A N   1 
ATOM   3590 C CA  . HIS A 1 486 ? 39.486  4.381   117.091 1.00 36.58  ? 486 HIS A CA  1 
ATOM   3591 C C   . HIS A 1 486 ? 39.977  5.759   117.474 1.00 36.89  ? 486 HIS A C   1 
ATOM   3592 O O   . HIS A 1 486 ? 40.941  6.253   116.911 1.00 37.41  ? 486 HIS A O   1 
ATOM   3593 C CB  . HIS A 1 486 ? 37.996  4.437   116.779 1.00 35.88  ? 486 HIS A CB  1 
ATOM   3594 C CG  . HIS A 1 486 ? 37.630  5.379   115.672 1.00 34.55  ? 486 HIS A CG  1 
ATOM   3595 N ND1 . HIS A 1 486 ? 37.975  5.156   114.358 1.00 34.14  ? 486 HIS A ND1 1 
ATOM   3596 C CD2 . HIS A 1 486 ? 36.866  6.497   115.676 1.00 34.57  ? 486 HIS A CD2 1 
ATOM   3597 C CE1 . HIS A 1 486 ? 37.433  6.091   113.598 1.00 34.06  ? 486 HIS A CE1 1 
ATOM   3598 N NE2 . HIS A 1 486 ? 36.755  6.916   114.373 1.00 34.26  ? 486 HIS A NE2 1 
ATOM   3599 N N   . PHE A 1 487 ? 39.320  6.378   118.443 1.00 37.19  ? 487 PHE A N   1 
ATOM   3600 C CA  . PHE A 1 487 ? 39.697  7.720   118.853 1.00 38.18  ? 487 PHE A CA  1 
ATOM   3601 C C   . PHE A 1 487 ? 41.100  7.868   119.403 1.00 39.10  ? 487 PHE A C   1 
ATOM   3602 O O   . PHE A 1 487 ? 41.684  8.944   119.327 1.00 38.75  ? 487 PHE A O   1 
ATOM   3603 C CB  . PHE A 1 487 ? 38.695  8.269   119.859 1.00 36.82  ? 487 PHE A CB  1 
ATOM   3604 C CG  . PHE A 1 487 ? 37.363  8.571   119.264 1.00 36.26  ? 487 PHE A CG  1 
ATOM   3605 C CD1 . PHE A 1 487 ? 36.286  7.700   119.448 1.00 36.70  ? 487 PHE A CD1 1 
ATOM   3606 C CD2 . PHE A 1 487 ? 37.174  9.731   118.530 1.00 34.14  ? 487 PHE A CD2 1 
ATOM   3607 C CE1 . PHE A 1 487 ? 35.041  7.984   118.914 1.00 35.79  ? 487 PHE A CE1 1 
ATOM   3608 C CE2 . PHE A 1 487 ? 35.934  10.026  117.990 1.00 34.27  ? 487 PHE A CE2 1 
ATOM   3609 C CZ  . PHE A 1 487 ? 34.861  9.153   118.182 1.00 35.39  ? 487 PHE A CZ  1 
ATOM   3610 N N   . ARG A 1 488 ? 41.646  6.805   119.970 1.00 40.96  ? 488 ARG A N   1 
ATOM   3611 C CA  . ARG A 1 488 ? 42.995  6.901   120.496 1.00 43.85  ? 488 ARG A CA  1 
ATOM   3612 C C   . ARG A 1 488 ? 43.921  7.081   119.285 1.00 42.31  ? 488 ARG A C   1 
ATOM   3613 O O   . ARG A 1 488 ? 44.810  7.925   119.289 1.00 41.43  ? 488 ARG A O   1 
ATOM   3614 C CB  . ARG A 1 488 ? 43.355  5.637   121.286 1.00 48.39  ? 488 ARG A CB  1 
ATOM   3615 C CG  . ARG A 1 488 ? 44.541  5.798   122.227 1.00 54.54  ? 488 ARG A CG  1 
ATOM   3616 C CD  . ARG A 1 488 ? 44.165  6.534   123.521 1.00 61.97  ? 488 ARG A CD  1 
ATOM   3617 N NE  . ARG A 1 488 ? 43.534  7.839   123.291 1.00 68.01  ? 488 ARG A NE  1 
ATOM   3618 C CZ  . ARG A 1 488 ? 42.238  8.093   123.483 1.00 70.36  ? 488 ARG A CZ  1 
ATOM   3619 N NH1 . ARG A 1 488 ? 41.432  7.127   123.915 1.00 71.45  ? 488 ARG A NH1 1 
ATOM   3620 N NH2 . ARG A 1 488 ? 41.745  9.308   123.237 1.00 69.86  ? 488 ARG A NH2 1 
ATOM   3621 N N   . ASN A 1 489 ? 43.690  6.293   118.243 1.00 40.97  ? 489 ASN A N   1 
ATOM   3622 C CA  . ASN A 1 489 ? 44.485  6.389   117.033 1.00 41.68  ? 489 ASN A CA  1 
ATOM   3623 C C   . ASN A 1 489 ? 44.248  7.740   116.385 1.00 41.26  ? 489 ASN A C   1 
ATOM   3624 O O   . ASN A 1 489 ? 45.187  8.440   116.002 1.00 41.35  ? 489 ASN A O   1 
ATOM   3625 C CB  . ASN A 1 489 ? 44.084  5.300   116.038 1.00 43.22  ? 489 ASN A CB  1 
ATOM   3626 C CG  . ASN A 1 489 ? 44.666  3.950   116.381 1.00 45.01  ? 489 ASN A CG  1 
ATOM   3627 O OD1 . ASN A 1 489 ? 45.886  3.777   116.427 1.00 43.43  ? 489 ASN A OD1 1 
ATOM   3628 N ND2 . ASN A 1 489 ? 43.793  2.975   116.617 1.00 45.89  ? 489 ASN A ND2 1 
ATOM   3629 N N   . LEU A 1 490 ? 42.974  8.088   116.258 1.00 41.02  ? 490 LEU A N   1 
ATOM   3630 C CA  . LEU A 1 490 ? 42.574  9.333   115.643 1.00 40.70  ? 490 LEU A CA  1 
ATOM   3631 C C   . LEU A 1 490 ? 43.285  10.495  116.295 1.00 43.50  ? 490 LEU A C   1 
ATOM   3632 O O   . LEU A 1 490 ? 43.654  11.453  115.628 1.00 45.02  ? 490 LEU A O   1 
ATOM   3633 C CB  . LEU A 1 490 ? 41.063  9.505   115.759 1.00 38.18  ? 490 LEU A CB  1 
ATOM   3634 C CG  . LEU A 1 490 ? 40.403  10.051  114.491 1.00 36.96  ? 490 LEU A CG  1 
ATOM   3635 C CD1 . LEU A 1 490 ? 40.966  9.338   113.273 1.00 36.26  ? 490 LEU A CD1 1 
ATOM   3636 C CD2 . LEU A 1 490 ? 38.902  9.876   114.568 1.00 34.22  ? 490 LEU A CD2 1 
ATOM   3637 N N   . GLU A 1 491 ? 43.492  10.411  117.601 1.00 46.45  ? 491 GLU A N   1 
ATOM   3638 C CA  . GLU A 1 491 ? 44.171  11.481  118.319 1.00 49.10  ? 491 GLU A CA  1 
ATOM   3639 C C   . GLU A 1 491 ? 45.632  11.488  117.889 1.00 49.59  ? 491 GLU A C   1 
ATOM   3640 O O   . GLU A 1 491 ? 46.146  12.493  117.402 1.00 50.85  ? 491 GLU A O   1 
ATOM   3641 C CB  . GLU A 1 491 ? 44.081  11.250  119.828 1.00 50.90  ? 491 GLU A CB  1 
ATOM   3642 C CG  . GLU A 1 491 ? 44.299  12.490  120.667 1.00 55.37  ? 491 GLU A CG  1 
ATOM   3643 C CD  . GLU A 1 491 ? 44.534  12.173  122.136 1.00 58.29  ? 491 GLU A CD  1 
ATOM   3644 O OE1 . GLU A 1 491 ? 43.851  11.271  122.669 1.00 59.68  ? 491 GLU A OE1 1 
ATOM   3645 O OE2 . GLU A 1 491 ? 45.396  12.837  122.758 1.00 60.72  ? 491 GLU A OE2 1 
ATOM   3646 N N   . ALA A 1 492 ? 46.290  10.349  118.062 1.00 50.05  ? 492 ALA A N   1 
ATOM   3647 C CA  . ALA A 1 492 ? 47.689  10.212  117.701 1.00 50.53  ? 492 ALA A CA  1 
ATOM   3648 C C   . ALA A 1 492 ? 47.934  10.824  116.330 1.00 51.92  ? 492 ALA A C   1 
ATOM   3649 O O   . ALA A 1 492 ? 48.925  11.531  116.134 1.00 52.10  ? 492 ALA A O   1 
ATOM   3650 C CB  . ALA A 1 492 ? 48.087  8.741   117.704 1.00 50.88  ? 492 ALA A CB  1 
ATOM   3651 N N   . LEU A 1 493 ? 47.025  10.573  115.389 1.00 52.86  ? 493 LEU A N   1 
ATOM   3652 C CA  . LEU A 1 493 ? 47.179  11.107  114.037 1.00 54.84  ? 493 LEU A CA  1 
ATOM   3653 C C   . LEU A 1 493 ? 46.980  12.611  113.941 1.00 55.83  ? 493 LEU A C   1 
ATOM   3654 O O   . LEU A 1 493 ? 47.755  13.305  113.284 1.00 55.64  ? 493 LEU A O   1 
ATOM   3655 C CB  . LEU A 1 493 ? 46.220  10.423  113.063 1.00 55.33  ? 493 LEU A CB  1 
ATOM   3656 C CG  . LEU A 1 493 ? 46.503  8.976   112.664 1.00 55.72  ? 493 LEU A CG  1 
ATOM   3657 C CD1 . LEU A 1 493 ? 45.697  8.663   111.411 1.00 56.56  ? 493 LEU A CD1 1 
ATOM   3658 C CD2 . LEU A 1 493 ? 47.979  8.775   112.386 1.00 56.51  ? 493 LEU A CD2 1 
ATOM   3659 N N   . ALA A 1 494 ? 45.934  13.111  114.585 1.00 56.66  ? 494 ALA A N   1 
ATOM   3660 C CA  . ALA A 1 494 ? 45.657  14.536  114.560 1.00 58.29  ? 494 ALA A CA  1 
ATOM   3661 C C   . ALA A 1 494 ? 46.815  15.278  115.203 1.00 59.62  ? 494 ALA A C   1 
ATOM   3662 O O   . ALA A 1 494 ? 46.993  16.473  114.984 1.00 60.51  ? 494 ALA A O   1 
ATOM   3663 C CB  . ALA A 1 494 ? 44.373  14.828  115.306 1.00 58.49  ? 494 ALA A CB  1 
ATOM   3664 N N   . LEU A 1 495 ? 47.600  14.558  115.998 1.00 61.11  ? 495 LEU A N   1 
ATOM   3665 C CA  . LEU A 1 495 ? 48.748  15.137  116.684 1.00 63.52  ? 495 LEU A CA  1 
ATOM   3666 C C   . LEU A 1 495 ? 50.072  14.739  116.041 1.00 65.88  ? 495 LEU A C   1 
ATOM   3667 O O   . LEU A 1 495 ? 51.129  14.853  116.660 1.00 65.68  ? 495 LEU A O   1 
ATOM   3668 C CB  . LEU A 1 495 ? 48.744  14.727  118.162 1.00 61.84  ? 495 LEU A CB  1 
ATOM   3669 C CG  . LEU A 1 495 ? 47.637  15.360  119.013 1.00 61.29  ? 495 LEU A CG  1 
ATOM   3670 C CD1 . LEU A 1 495 ? 47.682  14.806  120.432 1.00 59.54  ? 495 LEU A CD1 1 
ATOM   3671 C CD2 . LEU A 1 495 ? 47.802  16.877  119.017 1.00 59.94  ? 495 LEU A CD2 1 
ATOM   3672 N N   . ASP A 1 496 ? 50.009  14.277  114.797 1.00 69.10  ? 496 ASP A N   1 
ATOM   3673 C CA  . ASP A 1 496 ? 51.205  13.869  114.069 1.00 73.02  ? 496 ASP A CA  1 
ATOM   3674 C C   . ASP A 1 496 ? 52.120  13.104  115.018 1.00 75.84  ? 496 ASP A C   1 
ATOM   3675 O O   . ASP A 1 496 ? 53.338  13.189  114.917 1.00 76.20  ? 496 ASP A O   1 
ATOM   3676 C CB  . ASP A 1 496 ? 51.936  15.106  113.525 1.00 73.25  ? 496 ASP A CB  1 
ATOM   3677 C CG  . ASP A 1 496 ? 52.520  14.887  112.128 1.00 74.10  ? 496 ASP A CG  1 
ATOM   3678 O OD1 . ASP A 1 496 ? 51.741  14.607  111.191 1.00 75.01  ? 496 ASP A OD1 1 
ATOM   3679 O OD2 . ASP A 1 496 ? 53.755  15.003  111.959 1.00 74.26  ? 496 ASP A OD2 1 
ATOM   3680 N N   . LEU A 1 497 ? 51.522  12.372  115.953 1.00 79.47  ? 497 LEU A N   1 
ATOM   3681 C CA  . LEU A 1 497 ? 52.291  11.602  116.918 1.00 82.85  ? 497 LEU A CA  1 
ATOM   3682 C C   . LEU A 1 497 ? 52.968  10.430  116.256 1.00 85.75  ? 497 LEU A C   1 
ATOM   3683 O O   . LEU A 1 497 ? 52.476  9.896   115.264 1.00 85.65  ? 497 LEU A O   1 
ATOM   3684 C CB  . LEU A 1 497 ? 51.398  11.081  118.038 1.00 83.85  ? 497 LEU A CB  1 
ATOM   3685 C CG  . LEU A 1 497 ? 51.434  11.850  119.357 1.00 85.66  ? 497 LEU A CG  1 
ATOM   3686 C CD1 . LEU A 1 497 ? 50.626  11.083  120.405 1.00 86.40  ? 497 LEU A CD1 1 
ATOM   3687 C CD2 . LEU A 1 497 ? 52.881  12.018  119.818 1.00 85.98  ? 497 LEU A CD2 1 
ATOM   3688 N N   . MET A 1 498 ? 54.098  10.029  116.825 1.00 89.86  ? 498 MET A N   1 
ATOM   3689 C CA  . MET A 1 498 ? 54.881  8.909   116.312 1.00 94.00  ? 498 MET A CA  1 
ATOM   3690 C C   . MET A 1 498 ? 54.002  7.681   116.042 1.00 95.15  ? 498 MET A C   1 
ATOM   3691 O O   . MET A 1 498 ? 54.035  7.100   114.953 1.00 95.83  ? 498 MET A O   1 
ATOM   3692 C CB  . MET A 1 498 ? 55.987  8.564   117.316 1.00 96.45  ? 498 MET A CB  1 
ATOM   3693 C CG  . MET A 1 498 ? 56.941  9.725   117.616 1.00 98.27  ? 498 MET A CG  1 
ATOM   3694 S SD  . MET A 1 498 ? 58.003  9.423   119.058 1.00 100.78 ? 498 MET A SD  1 
ATOM   3695 C CE  . MET A 1 498 ? 56.970  10.144  120.385 1.00 100.78 ? 498 MET A CE  1 
ATOM   3696 N N   . GLU A 1 499 ? 53.220  7.287   117.041 1.00 95.83  ? 499 GLU A N   1 
ATOM   3697 C CA  . GLU A 1 499 ? 52.325  6.148   116.902 1.00 96.23  ? 499 GLU A CA  1 
ATOM   3698 C C   . GLU A 1 499 ? 51.175  6.347   117.877 1.00 96.01  ? 499 GLU A C   1 
ATOM   3699 O O   . GLU A 1 499 ? 51.186  7.272   118.686 1.00 96.49  ? 499 GLU A O   1 
ATOM   3700 C CB  . GLU A 1 499 ? 53.043  4.837   117.231 1.00 97.17  ? 499 GLU A CB  1 
ATOM   3701 C CG  . GLU A 1 499 ? 53.212  4.595   118.724 1.00 98.34  ? 499 GLU A CG  1 
ATOM   3702 C CD  . GLU A 1 499 ? 53.431  3.133   119.062 1.00 98.45  ? 499 GLU A CD  1 
ATOM   3703 O OE1 . GLU A 1 499 ? 54.506  2.592   118.720 1.00 98.67  ? 499 GLU A OE1 1 
ATOM   3704 O OE2 . GLU A 1 499 ? 52.518  2.525   119.665 1.00 98.17  ? 499 GLU A OE2 1 
ATOM   3705 N N   . PRO A 1 500 ? 50.166  5.476   117.813 1.00 95.73  ? 500 PRO A N   1 
ATOM   3706 C CA  . PRO A 1 500 ? 49.013  5.585   118.709 1.00 95.23  ? 500 PRO A CA  1 
ATOM   3707 C C   . PRO A 1 500 ? 49.191  4.849   120.030 1.00 94.77  ? 500 PRO A C   1 
ATOM   3708 O O   . PRO A 1 500 ? 50.141  4.094   120.209 1.00 94.46  ? 500 PRO A O   1 
ATOM   3709 C CB  . PRO A 1 500 ? 47.897  4.992   117.876 1.00 95.73  ? 500 PRO A CB  1 
ATOM   3710 C CG  . PRO A 1 500 ? 48.612  3.874   117.166 1.00 96.23  ? 500 PRO A CG  1 
ATOM   3711 C CD  . PRO A 1 500 ? 49.892  4.533   116.714 1.00 95.71  ? 500 PRO A CD  1 
ATOM   3712 N N   . GLU A 1 501 ? 48.253  5.075   120.945 1.00 95.22  ? 501 GLU A N   1 
ATOM   3713 C CA  . GLU A 1 501 ? 48.265  4.440   122.261 1.00 96.38  ? 501 GLU A CA  1 
ATOM   3714 C C   . GLU A 1 501 ? 47.314  3.240   122.302 1.00 96.15  ? 501 GLU A C   1 
ATOM   3715 O O   . GLU A 1 501 ? 46.113  3.399   122.546 1.00 95.84  ? 501 GLU A O   1 
ATOM   3716 C CB  . GLU A 1 501 ? 47.842  5.443   123.343 1.00 97.81  ? 501 GLU A CB  1 
ATOM   3717 C CG  . GLU A 1 501 ? 47.741  4.840   124.751 1.00 99.30  ? 501 GLU A CG  1 
ATOM   3718 C CD  . GLU A 1 501 ? 47.102  5.779   125.771 1.00 99.94  ? 501 GLU A CD  1 
ATOM   3719 O OE1 . GLU A 1 501 ? 47.092  5.431   126.973 1.00 99.73  ? 501 GLU A OE1 1 
ATOM   3720 O OE2 . GLU A 1 501 ? 46.606  6.858   125.377 1.00 100.11 ? 501 GLU A OE2 1 
ATOM   3721 N N   . GLN A 1 502 ? 47.855  2.044   122.075 1.00 95.83  ? 502 GLN A N   1 
ATOM   3722 C CA  . GLN A 1 502 ? 47.044  0.824   122.089 1.00 94.81  ? 502 GLN A CA  1 
ATOM   3723 C C   . GLN A 1 502 ? 46.373  0.673   123.453 1.00 92.36  ? 502 GLN A C   1 
ATOM   3724 O O   . GLN A 1 502 ? 47.016  0.285   124.430 1.00 92.48  ? 502 GLN A O   1 
ATOM   3725 C CB  . GLN A 1 502 ? 47.912  -0.411  121.806 1.00 96.29  ? 502 GLN A CB  1 
ATOM   3726 C CG  . GLN A 1 502 ? 48.864  -0.262  120.620 1.00 98.44  ? 502 GLN A CG  1 
ATOM   3727 C CD  . GLN A 1 502 ? 48.183  0.298   119.379 1.00 99.67  ? 502 GLN A CD  1 
ATOM   3728 O OE1 . GLN A 1 502 ? 47.146  -0.206  118.946 1.00 100.29 ? 502 GLN A OE1 1 
ATOM   3729 N NE2 . GLN A 1 502 ? 48.773  1.342   118.798 1.00 99.27  ? 502 GLN A NE2 1 
ATOM   3730 N N   . ALA A 1 503 ? 45.082  0.983   123.515 1.00 88.63  ? 503 ALA A N   1 
ATOM   3731 C CA  . ALA A 1 503 ? 44.334  0.886   124.761 1.00 84.30  ? 503 ALA A CA  1 
ATOM   3732 C C   . ALA A 1 503 ? 44.468  -0.498  125.397 1.00 81.29  ? 503 ALA A C   1 
ATOM   3733 O O   . ALA A 1 503 ? 45.056  -1.421  124.819 1.00 80.41  ? 503 ALA A O   1 
ATOM   3734 C CB  . ALA A 1 503 ? 42.861  1.207   124.507 1.00 84.13  ? 503 ALA A CB  1 
ATOM   3735 N N   . VAL A 1 504 ? 43.929  -0.631  126.602 1.00 77.47  ? 504 VAL A N   1 
ATOM   3736 C CA  . VAL A 1 504 ? 43.961  -1.900  127.316 1.00 73.56  ? 504 VAL A CA  1 
ATOM   3737 C C   . VAL A 1 504 ? 42.521  -2.378  127.444 1.00 70.91  ? 504 VAL A C   1 
ATOM   3738 O O   . VAL A 1 504 ? 41.706  -1.763  128.136 1.00 71.27  ? 504 VAL A O   1 
ATOM   3739 C CB  . VAL A 1 504 ? 44.571  -1.741  128.720 1.00 73.22  ? 504 VAL A CB  1 
ATOM   3740 C CG1 . VAL A 1 504 ? 44.694  -3.099  129.390 1.00 70.87  ? 504 VAL A CG1 1 
ATOM   3741 C CG2 . VAL A 1 504 ? 45.927  -1.065  128.617 1.00 72.36  ? 504 VAL A CG2 1 
ATOM   3742 N N   . ASP A 1 505 ? 42.209  -3.474  126.767 1.00 66.53  ? 505 ASP A N   1 
ATOM   3743 C CA  . ASP A 1 505 ? 40.861  -4.011  126.789 1.00 62.15  ? 505 ASP A CA  1 
ATOM   3744 C C   . ASP A 1 505 ? 40.458  -4.508  128.173 1.00 60.79  ? 505 ASP A C   1 
ATOM   3745 O O   . ASP A 1 505 ? 40.876  -5.581  128.607 1.00 61.68  ? 505 ASP A O   1 
ATOM   3746 C CB  . ASP A 1 505 ? 40.744  -5.147  125.783 1.00 60.20  ? 505 ASP A CB  1 
ATOM   3747 C CG  . ASP A 1 505 ? 39.355  -5.270  125.220 1.00 59.54  ? 505 ASP A CG  1 
ATOM   3748 O OD1 . ASP A 1 505 ? 38.390  -4.993  125.967 1.00 58.45  ? 505 ASP A OD1 1 
ATOM   3749 O OD2 . ASP A 1 505 ? 39.229  -5.646  124.035 1.00 58.31  ? 505 ASP A OD2 1 
ATOM   3750 N N   . LEU A 1 506 ? 39.638  -3.730  128.865 1.00 58.65  ? 506 LEU A N   1 
ATOM   3751 C CA  . LEU A 1 506 ? 39.187  -4.107  130.199 1.00 56.75  ? 506 LEU A CA  1 
ATOM   3752 C C   . LEU A 1 506 ? 38.093  -5.156  130.075 1.00 53.88  ? 506 LEU A C   1 
ATOM   3753 O O   . LEU A 1 506 ? 37.843  -5.921  131.001 1.00 53.35  ? 506 LEU A O   1 
ATOM   3754 C CB  . LEU A 1 506 ? 38.611  -2.894  130.927 1.00 59.72  ? 506 LEU A CB  1 
ATOM   3755 C CG  . LEU A 1 506 ? 39.236  -1.540  130.582 1.00 63.36  ? 506 LEU A CG  1 
ATOM   3756 C CD1 . LEU A 1 506 ? 38.382  -0.393  131.166 1.00 62.87  ? 506 LEU A CD1 1 
ATOM   3757 C CD2 . LEU A 1 506 ? 40.678  -1.512  131.102 1.00 63.28  ? 506 LEU A CD2 1 
ATOM   3758 N N   . THR A 1 507 ? 37.427  -5.175  128.928 1.00 50.56  ? 507 THR A N   1 
ATOM   3759 C CA  . THR A 1 507 ? 36.349  -6.122  128.713 1.00 47.30  ? 507 THR A CA  1 
ATOM   3760 C C   . THR A 1 507 ? 36.872  -7.546  128.689 1.00 45.12  ? 507 THR A C   1 
ATOM   3761 O O   . THR A 1 507 ? 36.106  -8.492  128.832 1.00 45.83  ? 507 THR A O   1 
ATOM   3762 C CB  . THR A 1 507 ? 35.604  -5.831  127.401 1.00 47.15  ? 507 THR A CB  1 
ATOM   3763 O OG1 . THR A 1 507 ? 36.394  -6.250  126.282 1.00 46.17  ? 507 THR A OG1 1 
ATOM   3764 C CG2 . THR A 1 507 ? 35.330  -4.351  127.289 1.00 46.87  ? 507 THR A CG2 1 
ATOM   3765 N N   . LEU A 1 508 ? 38.178  -7.704  128.510 1.00 42.23  ? 508 LEU A N   1 
ATOM   3766 C CA  . LEU A 1 508 ? 38.760  -9.035  128.490 1.00 40.26  ? 508 LEU A CA  1 
ATOM   3767 C C   . LEU A 1 508 ? 38.839  -9.587  129.908 1.00 38.79  ? 508 LEU A C   1 
ATOM   3768 O O   . LEU A 1 508 ? 39.021  -8.842  130.860 1.00 37.61  ? 508 LEU A O   1 
ATOM   3769 C CB  . LEU A 1 508 ? 40.142  -9.009  127.826 1.00 39.89  ? 508 LEU A CB  1 
ATOM   3770 C CG  . LEU A 1 508 ? 40.058  -8.932  126.293 1.00 40.07  ? 508 LEU A CG  1 
ATOM   3771 C CD1 . LEU A 1 508 ? 41.416  -9.138  125.667 1.00 40.58  ? 508 LEU A CD1 1 
ATOM   3772 C CD2 . LEU A 1 508 ? 39.132  -10.012 125.791 1.00 40.48  ? 508 LEU A CD2 1 
ATOM   3773 N N   . PRO A 1 509 ? 38.681  -10.907 130.063 1.00 38.56  ? 509 PRO A N   1 
ATOM   3774 C CA  . PRO A 1 509 ? 38.731  -11.539 131.379 1.00 39.25  ? 509 PRO A CA  1 
ATOM   3775 C C   . PRO A 1 509 ? 40.156  -11.671 131.878 1.00 40.89  ? 509 PRO A C   1 
ATOM   3776 O O   . PRO A 1 509 ? 41.033  -12.141 131.158 1.00 40.59  ? 509 PRO A O   1 
ATOM   3777 C CB  . PRO A 1 509 ? 38.103  -12.906 131.139 1.00 39.34  ? 509 PRO A CB  1 
ATOM   3778 C CG  . PRO A 1 509 ? 37.535  -12.836 129.733 1.00 39.80  ? 509 PRO A CG  1 
ATOM   3779 C CD  . PRO A 1 509 ? 38.454  -11.916 129.024 1.00 38.79  ? 509 PRO A CD  1 
ATOM   3780 N N   . LYS A 1 510 ? 40.378  -11.255 133.116 1.00 42.97  ? 510 LYS A N   1 
ATOM   3781 C CA  . LYS A 1 510 ? 41.691  -11.335 133.736 1.00 45.88  ? 510 LYS A CA  1 
ATOM   3782 C C   . LYS A 1 510 ? 41.912  -12.809 134.077 1.00 46.55  ? 510 LYS A C   1 
ATOM   3783 O O   . LYS A 1 510 ? 41.691  -13.250 135.203 1.00 45.77  ? 510 LYS A O   1 
ATOM   3784 C CB  . LYS A 1 510 ? 41.697  -10.463 134.992 1.00 46.76  ? 510 LYS A CB  1 
ATOM   3785 C CG  . LYS A 1 510 ? 41.330  -9.008  134.701 1.00 47.09  ? 510 LYS A CG  1 
ATOM   3786 C CD  . LYS A 1 510 ? 40.899  -8.273  135.958 1.00 47.92  ? 510 LYS A CD  1 
ATOM   3787 C CE  . LYS A 1 510 ? 40.606  -6.809  135.677 1.00 48.38  ? 510 LYS A CE  1 
ATOM   3788 N NZ  . LYS A 1 510 ? 40.109  -6.095  136.894 1.00 49.91  ? 510 LYS A NZ  1 
ATOM   3789 N N   . VAL A 1 511 ? 42.345  -13.564 133.078 1.00 48.12  ? 511 VAL A N   1 
ATOM   3790 C CA  . VAL A 1 511 ? 42.561  -14.994 133.212 1.00 49.62  ? 511 VAL A CA  1 
ATOM   3791 C C   . VAL A 1 511 ? 43.525  -15.452 134.299 1.00 50.80  ? 511 VAL A C   1 
ATOM   3792 O O   . VAL A 1 511 ? 43.117  -16.145 135.236 1.00 50.08  ? 511 VAL A O   1 
ATOM   3793 C CB  . VAL A 1 511 ? 43.005  -15.576 131.874 1.00 49.60  ? 511 VAL A CB  1 
ATOM   3794 C CG1 . VAL A 1 511 ? 43.429  -17.018 132.050 1.00 51.80  ? 511 VAL A CG1 1 
ATOM   3795 C CG2 . VAL A 1 511 ? 41.865  -15.480 130.886 1.00 49.42  ? 511 VAL A CG2 1 
ATOM   3796 N N   . GLU A 1 512 ? 44.800  -15.093 134.167 1.00 51.73  ? 512 GLU A N   1 
ATOM   3797 C CA  . GLU A 1 512 ? 45.787  -15.491 135.157 1.00 52.75  ? 512 GLU A CA  1 
ATOM   3798 C C   . GLU A 1 512 ? 45.229  -15.250 136.559 1.00 51.98  ? 512 GLU A C   1 
ATOM   3799 O O   . GLU A 1 512 ? 45.345  -16.101 137.440 1.00 53.42  ? 512 GLU A O   1 
ATOM   3800 C CB  . GLU A 1 512 ? 47.088  -14.704 134.976 1.00 55.89  ? 512 GLU A CB  1 
ATOM   3801 C CG  . GLU A 1 512 ? 47.709  -14.783 133.577 1.00 61.11  ? 512 GLU A CG  1 
ATOM   3802 C CD  . GLU A 1 512 ? 47.766  -16.201 133.020 1.00 63.84  ? 512 GLU A CD  1 
ATOM   3803 O OE1 . GLU A 1 512 ? 47.823  -17.161 133.825 1.00 65.89  ? 512 GLU A OE1 1 
ATOM   3804 O OE2 . GLU A 1 512 ? 47.767  -16.353 131.775 1.00 63.15  ? 512 GLU A OE2 1 
ATOM   3805 N N   . ALA A 1 513 ? 44.605  -14.094 136.758 1.00 49.96  ? 513 ALA A N   1 
ATOM   3806 C CA  . ALA A 1 513 ? 44.036  -13.756 138.054 1.00 48.94  ? 513 ALA A CA  1 
ATOM   3807 C C   . ALA A 1 513 ? 42.950  -14.748 138.454 1.00 49.19  ? 513 ALA A C   1 
ATOM   3808 O O   . ALA A 1 513 ? 43.089  -15.457 139.449 1.00 50.57  ? 513 ALA A O   1 
ATOM   3809 C CB  . ALA A 1 513 ? 43.475  -12.342 138.024 1.00 48.62  ? 513 ALA A CB  1 
ATOM   3810 N N   . MET A 1 514 ? 41.870  -14.791 137.676 1.00 49.07  ? 514 MET A N   1 
ATOM   3811 C CA  . MET A 1 514 ? 40.755  -15.700 137.939 1.00 48.12  ? 514 MET A CA  1 
ATOM   3812 C C   . MET A 1 514 ? 41.298  -17.078 138.284 1.00 48.52  ? 514 MET A C   1 
ATOM   3813 O O   . MET A 1 514 ? 40.884  -17.696 139.264 1.00 48.07  ? 514 MET A O   1 
ATOM   3814 C CB  . MET A 1 514 ? 39.849  -15.803 136.704 1.00 47.71  ? 514 MET A CB  1 
ATOM   3815 C CG  . MET A 1 514 ? 39.121  -14.512 136.342 1.00 46.44  ? 514 MET A CG  1 
ATOM   3816 S SD  . MET A 1 514 ? 38.291  -14.567 134.740 1.00 42.38  ? 514 MET A SD  1 
ATOM   3817 C CE  . MET A 1 514 ? 36.917  -15.615 135.142 1.00 43.77  ? 514 MET A CE  1 
ATOM   3818 N N   . ASN A 1 515 ? 42.233  -17.551 137.465 1.00 48.85  ? 515 ASN A N   1 
ATOM   3819 C CA  . ASN A 1 515 ? 42.855  -18.851 137.671 1.00 48.33  ? 515 ASN A CA  1 
ATOM   3820 C C   . ASN A 1 515 ? 43.397  -18.954 139.085 1.00 47.68  ? 515 ASN A C   1 
ATOM   3821 O O   . ASN A 1 515 ? 42.953  -19.793 139.880 1.00 47.69  ? 515 ASN A O   1 
ATOM   3822 C CB  . ASN A 1 515 ? 43.998  -19.048 136.678 1.00 49.64  ? 515 ASN A CB  1 
ATOM   3823 C CG  . ASN A 1 515 ? 43.503  -19.255 135.256 1.00 52.08  ? 515 ASN A CG  1 
ATOM   3824 O OD1 . ASN A 1 515 ? 42.302  -19.158 134.985 1.00 51.19  ? 515 ASN A OD1 1 
ATOM   3825 N ND2 . ASN A 1 515 ? 44.428  -19.541 134.338 1.00 51.72  ? 515 ASN A ND2 1 
ATOM   3826 N N   . LYS A 1 516 ? 44.357  -18.093 139.394 1.00 45.24  ? 516 LYS A N   1 
ATOM   3827 C CA  . LYS A 1 516 ? 44.958  -18.099 140.708 1.00 43.66  ? 516 LYS A CA  1 
ATOM   3828 C C   . LYS A 1 516 ? 43.897  -18.038 141.806 1.00 42.39  ? 516 LYS A C   1 
ATOM   3829 O O   . LYS A 1 516 ? 43.910  -18.842 142.733 1.00 42.72  ? 516 LYS A O   1 
ATOM   3830 C CB  . LYS A 1 516 ? 45.943  -16.933 140.846 1.00 44.45  ? 516 LYS A CB  1 
ATOM   3831 C CG  . LYS A 1 516 ? 46.554  -16.837 142.238 1.00 48.14  ? 516 LYS A CG  1 
ATOM   3832 C CD  . LYS A 1 516 ? 47.849  -16.031 142.300 1.00 49.68  ? 516 LYS A CD  1 
ATOM   3833 C CE  . LYS A 1 516 ? 48.413  -16.071 143.722 1.00 51.04  ? 516 LYS A CE  1 
ATOM   3834 N NZ  . LYS A 1 516 ? 49.824  -15.610 143.814 1.00 53.11  ? 516 LYS A NZ  1 
ATOM   3835 N N   . ARG A 1 517 ? 42.960  -17.110 141.688 1.00 41.24  ? 517 ARG A N   1 
ATOM   3836 C CA  . ARG A 1 517 ? 41.933  -16.964 142.709 1.00 41.42  ? 517 ARG A CA  1 
ATOM   3837 C C   . ARG A 1 517 ? 41.012  -18.188 142.866 1.00 39.93  ? 517 ARG A C   1 
ATOM   3838 O O   . ARG A 1 517 ? 40.419  -18.407 143.930 1.00 38.97  ? 517 ARG A O   1 
ATOM   3839 C CB  . ARG A 1 517 ? 41.111  -15.699 142.432 1.00 43.78  ? 517 ARG A CB  1 
ATOM   3840 C CG  . ARG A 1 517 ? 40.159  -15.321 143.563 1.00 48.14  ? 517 ARG A CG  1 
ATOM   3841 C CD  . ARG A 1 517 ? 40.054  -13.807 143.728 1.00 52.29  ? 517 ARG A CD  1 
ATOM   3842 N NE  . ARG A 1 517 ? 40.077  -13.442 145.143 1.00 57.09  ? 517 ARG A NE  1 
ATOM   3843 C CZ  . ARG A 1 517 ? 39.096  -13.699 146.005 1.00 58.75  ? 517 ARG A CZ  1 
ATOM   3844 N NH1 . ARG A 1 517 ? 37.994  -14.318 145.604 1.00 59.91  ? 517 ARG A NH1 1 
ATOM   3845 N NH2 . ARG A 1 517 ? 39.230  -13.362 147.281 1.00 60.68  ? 517 ARG A NH2 1 
ATOM   3846 N N   . LEU A 1 518 ? 40.908  -18.993 141.816 1.00 38.05  ? 518 LEU A N   1 
ATOM   3847 C CA  . LEU A 1 518 ? 40.058  -20.180 141.848 1.00 35.25  ? 518 LEU A CA  1 
ATOM   3848 C C   . LEU A 1 518 ? 40.708  -21.392 142.514 1.00 35.03  ? 518 LEU A C   1 
ATOM   3849 O O   . LEU A 1 518 ? 40.023  -22.282 143.027 1.00 32.76  ? 518 LEU A O   1 
ATOM   3850 C CB  . LEU A 1 518 ? 39.638  -20.547 140.428 1.00 31.71  ? 518 LEU A CB  1 
ATOM   3851 C CG  . LEU A 1 518 ? 38.499  -19.704 139.874 1.00 28.50  ? 518 LEU A CG  1 
ATOM   3852 C CD1 . LEU A 1 518 ? 38.238  -20.104 138.439 1.00 28.66  ? 518 LEU A CD1 1 
ATOM   3853 C CD2 . LEU A 1 518 ? 37.253  -19.892 140.722 1.00 25.79  ? 518 LEU A CD2 1 
ATOM   3854 N N   . GLY A 1 519 ? 42.033  -21.427 142.498 1.00 34.92  ? 519 GLY A N   1 
ATOM   3855 C CA  . GLY A 1 519 ? 42.729  -22.549 143.097 1.00 36.99  ? 519 GLY A CA  1 
ATOM   3856 C C   . GLY A 1 519 ? 42.337  -23.911 142.535 1.00 36.66  ? 519 GLY A C   1 
ATOM   3857 O O   . GLY A 1 519 ? 42.211  -24.096 141.324 1.00 36.25  ? 519 GLY A O   1 
ATOM   3858 N N   . SER A 1 520 ? 42.134  -24.870 143.430 1.00 36.72  ? 520 SER A N   1 
ATOM   3859 C CA  . SER A 1 520 ? 41.779  -26.225 143.031 1.00 35.28  ? 520 SER A CA  1 
ATOM   3860 C C   . SER A 1 520 ? 40.309  -26.393 142.655 1.00 35.20  ? 520 SER A C   1 
ATOM   3861 O O   . SER A 1 520 ? 39.937  -27.403 142.072 1.00 36.20  ? 520 SER A O   1 
ATOM   3862 C CB  . SER A 1 520 ? 42.130  -27.205 144.153 1.00 33.59  ? 520 SER A CB  1 
ATOM   3863 O OG  . SER A 1 520 ? 41.307  -26.988 145.287 1.00 30.85  ? 520 SER A OG  1 
ATOM   3864 N N   . LEU A 1 521 ? 39.475  -25.415 142.990 1.00 34.79  ? 521 LEU A N   1 
ATOM   3865 C CA  . LEU A 1 521 ? 38.050  -25.486 142.673 1.00 35.02  ? 521 LEU A CA  1 
ATOM   3866 C C   . LEU A 1 521 ? 37.757  -25.958 141.232 1.00 35.53  ? 521 LEU A C   1 
ATOM   3867 O O   . LEU A 1 521 ? 36.833  -26.739 140.999 1.00 35.13  ? 521 LEU A O   1 
ATOM   3868 C CB  . LEU A 1 521 ? 37.403  -24.115 142.902 1.00 35.12  ? 521 LEU A CB  1 
ATOM   3869 C CG  . LEU A 1 521 ? 37.214  -23.641 144.342 1.00 33.81  ? 521 LEU A CG  1 
ATOM   3870 C CD1 . LEU A 1 521 ? 36.651  -22.235 144.332 1.00 34.57  ? 521 LEU A CD1 1 
ATOM   3871 C CD2 . LEU A 1 521 ? 36.271  -24.578 145.079 1.00 32.50  ? 521 LEU A CD2 1 
ATOM   3872 N N   . VAL A 1 522 ? 38.529  -25.473 140.264 1.00 35.13  ? 522 VAL A N   1 
ATOM   3873 C CA  . VAL A 1 522 ? 38.320  -25.882 138.887 1.00 35.04  ? 522 VAL A CA  1 
ATOM   3874 C C   . VAL A 1 522 ? 38.398  -27.400 138.849 1.00 36.78  ? 522 VAL A C   1 
ATOM   3875 O O   . VAL A 1 522 ? 37.371  -28.076 138.764 1.00 37.20  ? 522 VAL A O   1 
ATOM   3876 C CB  . VAL A 1 522 ? 39.387  -25.271 137.940 1.00 35.06  ? 522 VAL A CB  1 
ATOM   3877 C CG1 . VAL A 1 522 ? 39.573  -26.156 136.710 1.00 35.61  ? 522 VAL A CG1 1 
ATOM   3878 C CG2 . VAL A 1 522 ? 38.955  -23.870 137.506 1.00 32.68  ? 522 VAL A CG2 1 
ATOM   3879 N N   . ASP A 1 523 ? 39.615  -27.929 138.931 1.00 37.23  ? 523 ASP A N   1 
ATOM   3880 C CA  . ASP A 1 523 ? 39.835  -29.364 138.919 1.00 38.20  ? 523 ASP A CA  1 
ATOM   3881 C C   . ASP A 1 523 ? 38.872  -30.142 139.814 1.00 39.62  ? 523 ASP A C   1 
ATOM   3882 O O   . ASP A 1 523 ? 38.559  -31.299 139.545 1.00 40.85  ? 523 ASP A O   1 
ATOM   3883 C CB  . ASP A 1 523 ? 41.275  -29.667 139.327 1.00 39.30  ? 523 ASP A CB  1 
ATOM   3884 C CG  . ASP A 1 523 ? 42.248  -29.518 138.169 1.00 41.77  ? 523 ASP A CG  1 
ATOM   3885 O OD1 . ASP A 1 523 ? 41.773  -29.339 137.023 1.00 45.23  ? 523 ASP A OD1 1 
ATOM   3886 O OD2 . ASP A 1 523 ? 43.477  -29.590 138.390 1.00 39.72  ? 523 ASP A OD2 1 
ATOM   3887 N N   . GLU A 1 524 ? 38.387  -29.520 140.876 1.00 39.60  ? 524 GLU A N   1 
ATOM   3888 C CA  . GLU A 1 524 ? 37.470  -30.220 141.758 1.00 40.89  ? 524 GLU A CA  1 
ATOM   3889 C C   . GLU A 1 524 ? 36.064  -30.203 141.164 1.00 40.37  ? 524 GLU A C   1 
ATOM   3890 O O   . GLU A 1 524 ? 35.266  -31.108 141.413 1.00 41.37  ? 524 GLU A O   1 
ATOM   3891 C CB  . GLU A 1 524 ? 37.508  -29.587 143.162 1.00 42.74  ? 524 GLU A CB  1 
ATOM   3892 C CG  . GLU A 1 524 ? 38.943  -29.456 143.692 1.00 45.74  ? 524 GLU A CG  1 
ATOM   3893 C CD  . GLU A 1 524 ? 39.058  -28.923 145.115 1.00 48.09  ? 524 GLU A CD  1 
ATOM   3894 O OE1 . GLU A 1 524 ? 38.404  -27.906 145.436 1.00 48.97  ? 524 GLU A OE1 1 
ATOM   3895 O OE2 . GLU A 1 524 ? 39.831  -29.516 145.903 1.00 48.92  ? 524 GLU A OE2 1 
ATOM   3896 N N   . PHE A 1 525 ? 35.768  -29.185 140.357 1.00 38.75  ? 525 PHE A N   1 
ATOM   3897 C CA  . PHE A 1 525 ? 34.451  -29.069 139.726 1.00 36.17  ? 525 PHE A CA  1 
ATOM   3898 C C   . PHE A 1 525 ? 34.326  -30.038 138.559 1.00 36.29  ? 525 PHE A C   1 
ATOM   3899 O O   . PHE A 1 525 ? 33.295  -30.694 138.391 1.00 36.61  ? 525 PHE A O   1 
ATOM   3900 C CB  . PHE A 1 525 ? 34.200  -27.640 139.218 1.00 31.82  ? 525 PHE A CB  1 
ATOM   3901 C CG  . PHE A 1 525 ? 32.925  -27.496 138.427 1.00 26.85  ? 525 PHE A CG  1 
ATOM   3902 C CD1 . PHE A 1 525 ? 31.689  -27.517 139.058 1.00 27.23  ? 525 PHE A CD1 1 
ATOM   3903 C CD2 . PHE A 1 525 ? 32.961  -27.392 137.043 1.00 25.67  ? 525 PHE A CD2 1 
ATOM   3904 C CE1 . PHE A 1 525 ? 30.501  -27.438 138.321 1.00 27.83  ? 525 PHE A CE1 1 
ATOM   3905 C CE2 . PHE A 1 525 ? 31.788  -27.314 136.296 1.00 26.10  ? 525 PHE A CE2 1 
ATOM   3906 C CZ  . PHE A 1 525 ? 30.554  -27.337 136.936 1.00 27.87  ? 525 PHE A CZ  1 
ATOM   3907 N N   . LYS A 1 526 ? 35.372  -30.115 137.742 1.00 36.07  ? 526 LYS A N   1 
ATOM   3908 C CA  . LYS A 1 526 ? 35.353  -31.011 136.595 1.00 36.75  ? 526 LYS A CA  1 
ATOM   3909 C C   . LYS A 1 526 ? 35.040  -32.427 137.062 1.00 38.61  ? 526 LYS A C   1 
ATOM   3910 O O   . LYS A 1 526 ? 34.175  -33.100 136.488 1.00 36.87  ? 526 LYS A O   1 
ATOM   3911 C CB  . LYS A 1 526 ? 36.701  -30.999 135.879 1.00 34.78  ? 526 LYS A CB  1 
ATOM   3912 C CG  . LYS A 1 526 ? 37.004  -29.732 135.102 1.00 32.31  ? 526 LYS A CG  1 
ATOM   3913 C CD  . LYS A 1 526 ? 38.338  -29.882 134.397 1.00 31.54  ? 526 LYS A CD  1 
ATOM   3914 C CE  . LYS A 1 526 ? 38.751  -28.609 133.722 1.00 29.30  ? 526 LYS A CE  1 
ATOM   3915 N NZ  . LYS A 1 526 ? 40.103  -28.738 133.159 1.00 27.48  ? 526 LYS A NZ  1 
ATOM   3916 N N   . GLU A 1 527 ? 35.742  -32.854 138.114 1.00 39.31  ? 527 GLU A N   1 
ATOM   3917 C CA  . GLU A 1 527 ? 35.571  -34.180 138.700 1.00 40.27  ? 527 GLU A CA  1 
ATOM   3918 C C   . GLU A 1 527 ? 34.127  -34.523 138.988 1.00 38.50  ? 527 GLU A C   1 
ATOM   3919 O O   . GLU A 1 527 ? 33.722  -35.685 138.882 1.00 38.05  ? 527 GLU A O   1 
ATOM   3920 C CB  . GLU A 1 527 ? 36.349  -34.295 140.013 1.00 45.43  ? 527 GLU A CB  1 
ATOM   3921 C CG  . GLU A 1 527 ? 37.830  -34.503 139.833 1.00 52.65  ? 527 GLU A CG  1 
ATOM   3922 C CD  . GLU A 1 527 ? 38.111  -35.703 138.968 1.00 56.11  ? 527 GLU A CD  1 
ATOM   3923 O OE1 . GLU A 1 527 ? 37.671  -36.810 139.358 1.00 58.69  ? 527 GLU A OE1 1 
ATOM   3924 O OE2 . GLU A 1 527 ? 38.753  -35.535 137.904 1.00 57.11  ? 527 GLU A OE2 1 
ATOM   3925 N N   . LEU A 1 528 ? 33.357  -33.509 139.362 1.00 35.53  ? 528 LEU A N   1 
ATOM   3926 C CA  . LEU A 1 528 ? 31.960  -33.706 139.698 1.00 34.12  ? 528 LEU A CA  1 
ATOM   3927 C C   . LEU A 1 528 ? 31.034  -33.720 138.502 1.00 34.64  ? 528 LEU A C   1 
ATOM   3928 O O   . LEU A 1 528 ? 29.897  -34.176 138.609 1.00 34.92  ? 528 LEU A O   1 
ATOM   3929 C CB  . LEU A 1 528 ? 31.501  -32.613 140.650 1.00 34.15  ? 528 LEU A CB  1 
ATOM   3930 C CG  . LEU A 1 528 ? 32.123  -32.575 142.042 1.00 34.95  ? 528 LEU A CG  1 
ATOM   3931 C CD1 . LEU A 1 528 ? 31.671  -31.323 142.755 1.00 34.74  ? 528 LEU A CD1 1 
ATOM   3932 C CD2 . LEU A 1 528 ? 31.694  -33.802 142.833 1.00 34.72  ? 528 LEU A CD2 1 
ATOM   3933 N N   . VAL A 1 529 ? 31.509  -33.230 137.361 1.00 34.17  ? 529 VAL A N   1 
ATOM   3934 C CA  . VAL A 1 529 ? 30.648  -33.170 136.190 1.00 32.78  ? 529 VAL A CA  1 
ATOM   3935 C C   . VAL A 1 529 ? 31.189  -33.731 134.879 1.00 31.58  ? 529 VAL A C   1 
ATOM   3936 O O   . VAL A 1 529 ? 30.412  -34.132 134.031 1.00 32.94  ? 529 VAL A O   1 
ATOM   3937 C CB  . VAL A 1 529 ? 30.195  -31.708 135.932 1.00 33.08  ? 529 VAL A CB  1 
ATOM   3938 C CG1 . VAL A 1 529 ? 29.492  -31.144 137.157 1.00 30.71  ? 529 VAL A CG1 1 
ATOM   3939 C CG2 . VAL A 1 529 ? 31.404  -30.848 135.599 1.00 35.01  ? 529 VAL A CG2 1 
ATOM   3940 N N   . TYR A 1 530 ? 32.496  -33.785 134.697 1.00 30.58  ? 530 TYR A N   1 
ATOM   3941 C CA  . TYR A 1 530 ? 33.012  -34.269 133.424 1.00 32.85  ? 530 TYR A CA  1 
ATOM   3942 C C   . TYR A 1 530 ? 33.670  -35.644 133.445 1.00 34.93  ? 530 TYR A C   1 
ATOM   3943 O O   . TYR A 1 530 ? 34.792  -35.786 133.922 1.00 36.99  ? 530 TYR A O   1 
ATOM   3944 C CB  . TYR A 1 530 ? 34.003  -33.246 132.856 1.00 33.86  ? 530 TYR A CB  1 
ATOM   3945 C CG  . TYR A 1 530 ? 33.378  -31.944 132.365 1.00 36.27  ? 530 TYR A CG  1 
ATOM   3946 C CD1 . TYR A 1 530 ? 34.163  -30.814 132.165 1.00 35.04  ? 530 TYR A CD1 1 
ATOM   3947 C CD2 . TYR A 1 530 ? 32.012  -31.855 132.064 1.00 36.42  ? 530 TYR A CD2 1 
ATOM   3948 C CE1 . TYR A 1 530 ? 33.618  -29.639 131.681 1.00 35.17  ? 530 TYR A CE1 1 
ATOM   3949 C CE2 . TYR A 1 530 ? 31.459  -30.678 131.578 1.00 34.95  ? 530 TYR A CE2 1 
ATOM   3950 C CZ  . TYR A 1 530 ? 32.273  -29.574 131.388 1.00 36.35  ? 530 TYR A CZ  1 
ATOM   3951 O OH  . TYR A 1 530 ? 31.753  -28.397 130.892 1.00 39.28  ? 530 TYR A OH  1 
ATOM   3952 N N   . PRO A 1 531 ? 32.999  -36.669 132.892 1.00 35.17  ? 531 PRO A N   1 
ATOM   3953 C CA  . PRO A 1 531 ? 33.575  -38.012 132.875 1.00 36.18  ? 531 PRO A CA  1 
ATOM   3954 C C   . PRO A 1 531 ? 35.038  -37.910 132.466 1.00 39.17  ? 531 PRO A C   1 
ATOM   3955 O O   . PRO A 1 531 ? 35.421  -37.003 131.725 1.00 40.99  ? 531 PRO A O   1 
ATOM   3956 C CB  . PRO A 1 531 ? 32.725  -38.721 131.841 1.00 35.79  ? 531 PRO A CB  1 
ATOM   3957 C CG  . PRO A 1 531 ? 31.405  -38.069 132.020 1.00 34.76  ? 531 PRO A CG  1 
ATOM   3958 C CD  . PRO A 1 531 ? 31.778  -36.627 132.074 1.00 34.95  ? 531 PRO A CD  1 
ATOM   3959 N N   . PRO A 1 532 ? 35.877  -38.841 132.931 1.00 40.85  ? 532 PRO A N   1 
ATOM   3960 C CA  . PRO A 1 532 ? 37.305  -38.802 132.591 1.00 42.09  ? 532 PRO A CA  1 
ATOM   3961 C C   . PRO A 1 532 ? 37.649  -38.843 131.107 1.00 44.32  ? 532 PRO A C   1 
ATOM   3962 O O   . PRO A 1 532 ? 38.759  -38.500 130.718 1.00 44.36  ? 532 PRO A O   1 
ATOM   3963 C CB  . PRO A 1 532 ? 37.871  -39.991 133.360 1.00 40.79  ? 532 PRO A CB  1 
ATOM   3964 C CG  . PRO A 1 532 ? 36.718  -40.948 133.389 1.00 40.37  ? 532 PRO A CG  1 
ATOM   3965 C CD  . PRO A 1 532 ? 35.541  -40.058 133.689 1.00 39.54  ? 532 PRO A CD  1 
ATOM   3966 N N   . ASP A 1 533 ? 36.702  -39.256 130.278 1.00 47.61  ? 533 ASP A N   1 
ATOM   3967 C CA  . ASP A 1 533 ? 36.953  -39.331 128.847 1.00 52.32  ? 533 ASP A CA  1 
ATOM   3968 C C   . ASP A 1 533 ? 36.006  -38.390 128.114 1.00 56.54  ? 533 ASP A C   1 
ATOM   3969 O O   . ASP A 1 533 ? 35.287  -38.791 127.204 1.00 58.88  ? 533 ASP A O   1 
ATOM   3970 C CB  . ASP A 1 533 ? 36.761  -40.773 128.366 1.00 51.20  ? 533 ASP A CB  1 
ATOM   3971 C CG  . ASP A 1 533 ? 35.318  -41.245 128.482 1.00 51.36  ? 533 ASP A CG  1 
ATOM   3972 O OD1 . ASP A 1 533 ? 34.621  -40.790 129.418 1.00 51.04  ? 533 ASP A OD1 1 
ATOM   3973 O OD2 . ASP A 1 533 ? 34.890  -42.076 127.645 1.00 50.21  ? 533 ASP A OD2 1 
ATOM   3974 N N   . TYR A 1 534 ? 36.010  -37.124 128.506 1.00 60.42  ? 534 TYR A N   1 
ATOM   3975 C CA  . TYR A 1 534 ? 35.125  -36.160 127.881 1.00 63.56  ? 534 TYR A CA  1 
ATOM   3976 C C   . TYR A 1 534 ? 35.790  -35.355 126.761 1.00 67.33  ? 534 TYR A C   1 
ATOM   3977 O O   . TYR A 1 534 ? 36.974  -35.029 126.849 1.00 66.72  ? 534 TYR A O   1 
ATOM   3978 C CB  . TYR A 1 534 ? 34.583  -35.219 128.946 1.00 60.61  ? 534 TYR A CB  1 
ATOM   3979 C CG  . TYR A 1 534 ? 33.579  -34.235 128.415 1.00 60.37  ? 534 TYR A CG  1 
ATOM   3980 C CD1 . TYR A 1 534 ? 32.381  -34.663 127.856 1.00 59.73  ? 534 TYR A CD1 1 
ATOM   3981 C CD2 . TYR A 1 534 ? 33.826  -32.866 128.467 1.00 60.53  ? 534 TYR A CD2 1 
ATOM   3982 C CE1 . TYR A 1 534 ? 31.452  -33.749 127.363 1.00 59.38  ? 534 TYR A CE1 1 
ATOM   3983 C CE2 . TYR A 1 534 ? 32.906  -31.946 127.980 1.00 59.02  ? 534 TYR A CE2 1 
ATOM   3984 C CZ  . TYR A 1 534 ? 31.724  -32.390 127.430 1.00 58.07  ? 534 TYR A CZ  1 
ATOM   3985 O OH  . TYR A 1 534 ? 30.823  -31.469 126.957 1.00 57.25  ? 534 TYR A OH  1 
ATOM   3986 N N   . ASN A 1 535 ? 35.011  -35.057 125.712 1.00 72.50  ? 535 ASN A N   1 
ATOM   3987 C CA  . ASN A 1 535 ? 35.445  -34.270 124.538 1.00 76.72  ? 535 ASN A CA  1 
ATOM   3988 C C   . ASN A 1 535 ? 34.978  -32.809 124.715 1.00 78.93  ? 535 ASN A C   1 
ATOM   3989 O O   . ASN A 1 535 ? 34.105  -32.338 123.973 1.00 79.35  ? 535 ASN A O   1 
ATOM   3990 C CB  . ASN A 1 535 ? 34.804  -34.826 123.254 1.00 77.33  ? 535 ASN A CB  1 
ATOM   3991 C CG  . ASN A 1 535 ? 35.253  -36.236 122.931 1.00 79.02  ? 535 ASN A CG  1 
ATOM   3992 O OD1 . ASN A 1 535 ? 35.799  -36.936 123.783 1.00 81.08  ? 535 ASN A OD1 1 
ATOM   3993 N ND2 . ASN A 1 535 ? 35.012  -36.667 121.693 1.00 79.61  ? 535 ASN A ND2 1 
ATOM   3994 N N   . PRO A 1 536 ? 35.578  -32.071 125.677 1.00 80.35  ? 536 PRO A N   1 
ATOM   3995 C CA  . PRO A 1 536 ? 35.271  -30.674 126.017 1.00 81.39  ? 536 PRO A CA  1 
ATOM   3996 C C   . PRO A 1 536 ? 35.513  -29.654 124.914 1.00 82.78  ? 536 PRO A C   1 
ATOM   3997 O O   . PRO A 1 536 ? 34.864  -28.606 124.875 1.00 82.00  ? 536 PRO A O   1 
ATOM   3998 C CB  . PRO A 1 536 ? 36.170  -30.397 127.229 1.00 81.04  ? 536 PRO A CB  1 
ATOM   3999 C CG  . PRO A 1 536 ? 36.692  -31.762 127.646 1.00 81.49  ? 536 PRO A CG  1 
ATOM   4000 C CD  . PRO A 1 536 ? 36.824  -32.470 126.344 1.00 80.80  ? 536 PRO A CD  1 
ATOM   4001 N N   . GLU A 1 537 ? 36.457  -29.955 124.029 1.00 84.73  ? 537 GLU A N   1 
ATOM   4002 C CA  . GLU A 1 537 ? 36.795  -29.047 122.939 1.00 85.62  ? 537 GLU A CA  1 
ATOM   4003 C C   . GLU A 1 537 ? 37.079  -29.797 121.636 1.00 86.01  ? 537 GLU A C   1 
ATOM   4004 O O   . GLU A 1 537 ? 37.647  -29.237 120.698 1.00 85.87  ? 537 GLU A O   1 
ATOM   4005 C CB  . GLU A 1 537 ? 38.013  -28.218 123.353 1.00 85.89  ? 537 GLU A CB  1 
ATOM   4006 C CG  . GLU A 1 537 ? 37.878  -27.667 124.770 1.00 87.69  ? 537 GLU A CG  1 
ATOM   4007 C CD  . GLU A 1 537 ? 39.085  -26.883 125.226 1.00 89.09  ? 537 GLU A CD  1 
ATOM   4008 O OE1 . GLU A 1 537 ? 40.183  -27.476 125.298 1.00 90.51  ? 537 GLU A OE1 1 
ATOM   4009 O OE2 . GLU A 1 537 ? 38.935  -25.675 125.513 1.00 89.95  ? 537 GLU A OE2 1 
ATOM   4010 N N   . GLY A 1 538 ? 36.670  -31.062 121.578 1.00 86.09  ? 538 GLY A N   1 
ATOM   4011 C CA  . GLY A 1 538 ? 36.896  -31.866 120.387 1.00 85.91  ? 538 GLY A CA  1 
ATOM   4012 C C   . GLY A 1 538 ? 35.594  -32.483 119.881 1.00 85.50  ? 538 GLY A C   1 
ATOM   4013 O O   . GLY A 1 538 ? 35.412  -33.719 119.916 1.00 85.06  ? 538 GLY A O   1 
ATOM   4014 N N   . TYR A 1 559 ? -2.807  -46.408 122.314 1.00 68.85  ? 559 TYR A N   1 
ATOM   4015 C CA  . TYR A 1 559 ? -3.469  -45.777 123.450 1.00 69.46  ? 559 TYR A CA  1 
ATOM   4016 C C   . TYR A 1 559 ? -2.630  -45.970 124.713 1.00 69.38  ? 559 TYR A C   1 
ATOM   4017 O O   . TYR A 1 559 ? -2.894  -46.870 125.506 1.00 68.32  ? 559 TYR A O   1 
ATOM   4018 C CB  . TYR A 1 559 ? -4.858  -46.397 123.689 1.00 70.21  ? 559 TYR A CB  1 
ATOM   4019 C CG  . TYR A 1 559 ? -5.740  -46.475 122.449 1.00 70.28  ? 559 TYR A CG  1 
ATOM   4020 C CD1 . TYR A 1 559 ? -5.553  -47.472 121.490 1.00 70.74  ? 559 TYR A CD1 1 
ATOM   4021 C CD2 . TYR A 1 559 ? -6.784  -45.573 122.257 1.00 70.29  ? 559 TYR A CD2 1 
ATOM   4022 C CE1 . TYR A 1 559 ? -6.387  -47.571 120.382 1.00 70.22  ? 559 TYR A CE1 1 
ATOM   4023 C CE2 . TYR A 1 559 ? -7.622  -45.661 121.151 1.00 70.50  ? 559 TYR A CE2 1 
ATOM   4024 C CZ  . TYR A 1 559 ? -7.419  -46.664 120.220 1.00 70.62  ? 559 TYR A CZ  1 
ATOM   4025 O OH  . TYR A 1 559 ? -8.253  -46.763 119.133 1.00 71.32  ? 559 TYR A OH  1 
ATOM   4026 N N   . SER A 1 560 ? -1.605  -45.143 124.876 1.00 70.83  ? 560 SER A N   1 
ATOM   4027 C CA  . SER A 1 560 ? -0.720  -45.249 126.032 1.00 72.14  ? 560 SER A CA  1 
ATOM   4028 C C   . SER A 1 560 ? -1.407  -44.855 127.327 1.00 72.79  ? 560 SER A C   1 
ATOM   4029 O O   . SER A 1 560 ? -2.298  -44.007 127.346 1.00 73.20  ? 560 SER A O   1 
ATOM   4030 C CB  . SER A 1 560 ? 0.529   -44.389 125.845 1.00 72.25  ? 560 SER A CB  1 
ATOM   4031 O OG  . SER A 1 560 ? 1.383   -44.960 124.870 1.00 73.17  ? 560 SER A OG  1 
ATOM   4032 N N   . GLU A 1 561 ? -0.968  -45.475 128.414 1.00 74.17  ? 561 GLU A N   1 
ATOM   4033 C CA  . GLU A 1 561 ? -1.526  -45.231 129.741 1.00 75.23  ? 561 GLU A CA  1 
ATOM   4034 C C   . GLU A 1 561 ? -1.848  -43.757 129.986 1.00 74.58  ? 561 GLU A C   1 
ATOM   4035 O O   . GLU A 1 561 ? -2.919  -43.423 130.486 1.00 74.34  ? 561 GLU A O   1 
ATOM   4036 C CB  . GLU A 1 561 ? -0.556  -45.734 130.826 1.00 76.80  ? 561 GLU A CB  1 
ATOM   4037 C CG  . GLU A 1 561 ? 0.068   -47.112 130.558 1.00 78.03  ? 561 GLU A CG  1 
ATOM   4038 C CD  . GLU A 1 561 ? 0.717   -47.712 131.801 1.00 79.42  ? 561 GLU A CD  1 
ATOM   4039 O OE1 . GLU A 1 561 ? 1.399   -46.965 132.543 1.00 78.85  ? 561 GLU A OE1 1 
ATOM   4040 O OE2 . GLU A 1 561 ? 0.551   -48.933 132.031 1.00 79.80  ? 561 GLU A OE2 1 
ATOM   4041 N N   . GLU A 1 562 ? -0.917  -42.880 129.627 1.00 74.35  ? 562 GLU A N   1 
ATOM   4042 C CA  . GLU A 1 562 ? -1.108  -41.450 129.820 1.00 74.43  ? 562 GLU A CA  1 
ATOM   4043 C C   . GLU A 1 562 ? -2.414  -41.001 129.174 1.00 72.32  ? 562 GLU A C   1 
ATOM   4044 O O   . GLU A 1 562 ? -3.343  -40.563 129.852 1.00 72.49  ? 562 GLU A O   1 
ATOM   4045 C CB  . GLU A 1 562 ? 0.049   -40.673 129.189 1.00 78.05  ? 562 GLU A CB  1 
ATOM   4046 C CG  . GLU A 1 562 ? 1.443   -41.152 129.580 1.00 83.71  ? 562 GLU A CG  1 
ATOM   4047 C CD  . GLU A 1 562 ? 2.556   -40.296 128.965 1.00 86.87  ? 562 GLU A CD  1 
ATOM   4048 O OE1 . GLU A 1 562 ? 2.559   -40.123 127.720 1.00 87.95  ? 562 GLU A OE1 1 
ATOM   4049 O OE2 . GLU A 1 562 ? 3.427   -39.802 129.726 1.00 87.45  ? 562 GLU A OE2 1 
ATOM   4050 N N   . GLU A 1 563 ? -2.463  -41.116 127.852 1.00 69.55  ? 563 GLU A N   1 
ATOM   4051 C CA  . GLU A 1 563 ? -3.625  -40.728 127.063 1.00 67.09  ? 563 GLU A CA  1 
ATOM   4052 C C   . GLU A 1 563 ? -4.934  -41.179 127.714 1.00 65.52  ? 563 GLU A C   1 
ATOM   4053 O O   . GLU A 1 563 ? -5.778  -40.361 128.088 1.00 64.34  ? 563 GLU A O   1 
ATOM   4054 C CB  . GLU A 1 563 ? -3.509  -41.345 125.666 1.00 67.10  ? 563 GLU A CB  1 
ATOM   4055 C CG  . GLU A 1 563 ? -4.415  -40.742 124.608 1.00 65.91  ? 563 GLU A CG  1 
ATOM   4056 C CD  . GLU A 1 563 ? -4.529  -41.631 123.384 1.00 66.34  ? 563 GLU A CD  1 
ATOM   4057 O OE1 . GLU A 1 563 ? -3.520  -42.262 123.004 1.00 66.50  ? 563 GLU A OE1 1 
ATOM   4058 O OE2 . GLU A 1 563 ? -5.627  -41.696 122.794 1.00 67.10  ? 563 GLU A OE2 1 
ATOM   4059 N N   . LEU A 1 564 ? -5.084  -42.492 127.845 1.00 63.86  ? 564 LEU A N   1 
ATOM   4060 C CA  . LEU A 1 564 ? -6.274  -43.089 128.431 1.00 62.58  ? 564 LEU A CA  1 
ATOM   4061 C C   . LEU A 1 564 ? -6.588  -42.570 129.829 1.00 62.69  ? 564 LEU A C   1 
ATOM   4062 O O   . LEU A 1 564 ? -7.752  -42.419 130.192 1.00 62.15  ? 564 LEU A O   1 
ATOM   4063 C CB  . LEU A 1 564 ? -6.122  -44.610 128.451 1.00 61.40  ? 564 LEU A CB  1 
ATOM   4064 C CG  . LEU A 1 564 ? -6.080  -45.269 127.069 1.00 61.36  ? 564 LEU A CG  1 
ATOM   4065 C CD1 . LEU A 1 564 ? -5.535  -46.687 127.152 1.00 60.99  ? 564 LEU A CD1 1 
ATOM   4066 C CD2 . LEU A 1 564 ? -7.479  -45.266 126.483 1.00 61.67  ? 564 LEU A CD2 1 
ATOM   4067 N N   . LYS A 1 565 ? -5.558  -42.296 130.620 1.00 63.55  ? 565 LYS A N   1 
ATOM   4068 C CA  . LYS A 1 565 ? -5.778  -41.790 131.967 1.00 64.03  ? 565 LYS A CA  1 
ATOM   4069 C C   . LYS A 1 565 ? -6.368  -40.387 131.876 1.00 63.08  ? 565 LYS A C   1 
ATOM   4070 O O   . LYS A 1 565 ? -7.141  -39.965 132.743 1.00 62.65  ? 565 LYS A O   1 
ATOM   4071 C CB  . LYS A 1 565 ? -4.462  -41.760 132.754 1.00 66.71  ? 565 LYS A CB  1 
ATOM   4072 C CG  . LYS A 1 565 ? -4.641  -41.328 134.210 1.00 70.98  ? 565 LYS A CG  1 
ATOM   4073 C CD  . LYS A 1 565 ? -3.320  -41.254 134.978 1.00 73.25  ? 565 LYS A CD  1 
ATOM   4074 C CE  . LYS A 1 565 ? -3.548  -40.803 136.428 1.00 74.31  ? 565 LYS A CE  1 
ATOM   4075 N NZ  . LYS A 1 565 ? -2.285  -40.687 137.221 1.00 75.06  ? 565 LYS A NZ  1 
ATOM   4076 N N   . THR A 1 566 ? -6.006  -39.679 130.808 1.00 62.05  ? 566 THR A N   1 
ATOM   4077 C CA  . THR A 1 566 ? -6.483  -38.318 130.576 1.00 61.21  ? 566 THR A CA  1 
ATOM   4078 C C   . THR A 1 566 ? -7.930  -38.307 130.067 1.00 60.44  ? 566 THR A C   1 
ATOM   4079 O O   . THR A 1 566 ? -8.738  -37.455 130.461 1.00 59.61  ? 566 THR A O   1 
ATOM   4080 C CB  . THR A 1 566 ? -5.599  -37.593 129.543 1.00 61.89  ? 566 THR A CB  1 
ATOM   4081 O OG1 . THR A 1 566 ? -4.220  -37.876 129.808 1.00 61.65  ? 566 THR A OG1 1 
ATOM   4082 C CG2 . THR A 1 566 ? -5.821  -36.083 129.619 1.00 62.04  ? 566 THR A CG2 1 
ATOM   4083 N N   . HIS A 1 567 ? -8.247  -39.249 129.179 1.00 59.34  ? 567 HIS A N   1 
ATOM   4084 C CA  . HIS A 1 567 ? -9.596  -39.350 128.627 1.00 58.72  ? 567 HIS A CA  1 
ATOM   4085 C C   . HIS A 1 567 ? -10.578 -39.569 129.770 1.00 57.41  ? 567 HIS A C   1 
ATOM   4086 O O   . HIS A 1 567 ? -11.682 -39.024 129.769 1.00 57.43  ? 567 HIS A O   1 
ATOM   4087 C CB  . HIS A 1 567 ? -9.694  -40.519 127.634 1.00 59.31  ? 567 HIS A CB  1 
ATOM   4088 C CG  . HIS A 1 567 ? -9.105  -40.228 126.285 1.00 59.98  ? 567 HIS A CG  1 
ATOM   4089 N ND1 . HIS A 1 567 ? -9.705  -39.384 125.378 1.00 59.19  ? 567 HIS A ND1 1 
ATOM   4090 C CD2 . HIS A 1 567 ? -7.975  -40.681 125.689 1.00 60.38  ? 567 HIS A CD2 1 
ATOM   4091 C CE1 . HIS A 1 567 ? -8.972  -39.332 124.278 1.00 60.11  ? 567 HIS A CE1 1 
ATOM   4092 N NE2 . HIS A 1 567 ? -7.919  -40.109 124.441 1.00 59.31  ? 567 HIS A NE2 1 
ATOM   4093 N N   . ILE A 1 568 ? -10.158 -40.365 130.749 1.00 55.66  ? 568 ILE A N   1 
ATOM   4094 C CA  . ILE A 1 568 ? -10.986 -40.672 131.904 1.00 53.28  ? 568 ILE A CA  1 
ATOM   4095 C C   . ILE A 1 568 ? -11.193 -39.434 132.754 1.00 53.04  ? 568 ILE A C   1 
ATOM   4096 O O   . ILE A 1 568 ? -12.309 -39.152 133.181 1.00 51.63  ? 568 ILE A O   1 
ATOM   4097 C CB  . ILE A 1 568 ? -10.349 -41.787 132.749 1.00 52.49  ? 568 ILE A CB  1 
ATOM   4098 C CG1 . ILE A 1 568 ? -10.252 -43.066 131.910 1.00 51.65  ? 568 ILE A CG1 1 
ATOM   4099 C CG2 . ILE A 1 568 ? -11.176 -42.036 133.996 1.00 51.45  ? 568 ILE A CG2 1 
ATOM   4100 C CD1 . ILE A 1 568 ? -9.621  -44.236 132.624 1.00 50.79  ? 568 ILE A CD1 1 
ATOM   4101 N N   . SER A 1 569 ? -10.118 -38.690 132.989 1.00 53.46  ? 569 SER A N   1 
ATOM   4102 C CA  . SER A 1 569 ? -10.202 -37.472 133.788 1.00 54.13  ? 569 SER A CA  1 
ATOM   4103 C C   . SER A 1 569 ? -11.083 -36.435 133.103 1.00 54.41  ? 569 SER A C   1 
ATOM   4104 O O   . SER A 1 569 ? -11.812 -35.701 133.761 1.00 53.38  ? 569 SER A O   1 
ATOM   4105 C CB  . SER A 1 569 ? -8.800  -36.881 134.018 1.00 54.31  ? 569 SER A CB  1 
ATOM   4106 O OG  . SER A 1 569 ? -8.852  -35.603 134.645 1.00 53.20  ? 569 SER A OG  1 
ATOM   4107 N N   . LYS A 1 570 ? -11.024 -36.387 131.778 1.00 55.35  ? 570 LYS A N   1 
ATOM   4108 C CA  . LYS A 1 570 ? -11.803 -35.410 131.024 1.00 56.17  ? 570 LYS A CA  1 
ATOM   4109 C C   . LYS A 1 570 ? -13.178 -35.911 130.561 1.00 55.78  ? 570 LYS A C   1 
ATOM   4110 O O   . LYS A 1 570 ? -13.939 -35.176 129.926 1.00 56.11  ? 570 LYS A O   1 
ATOM   4111 C CB  . LYS A 1 570 ? -10.970 -34.931 129.835 1.00 56.36  ? 570 LYS A CB  1 
ATOM   4112 C CG  . LYS A 1 570 ? -9.671  -34.265 130.254 1.00 56.07  ? 570 LYS A CG  1 
ATOM   4113 C CD  . LYS A 1 570 ? -9.958  -33.005 131.070 1.00 57.56  ? 570 LYS A CD  1 
ATOM   4114 C CE  . LYS A 1 570 ? -8.686  -32.209 131.377 1.00 57.44  ? 570 LYS A CE  1 
ATOM   4115 N NZ  . LYS A 1 570 ? -8.979  -30.901 132.035 1.00 55.56  ? 570 LYS A NZ  1 
ATOM   4116 N N   . GLY A 1 571 ? -13.490 -37.159 130.893 1.00 54.70  ? 571 GLY A N   1 
ATOM   4117 C CA  . GLY A 1 571 ? -14.771 -37.735 130.523 1.00 53.99  ? 571 GLY A CA  1 
ATOM   4118 C C   . GLY A 1 571 ? -15.003 -37.874 129.034 1.00 53.53  ? 571 GLY A C   1 
ATOM   4119 O O   . GLY A 1 571 ? -16.127 -37.718 128.550 1.00 54.11  ? 571 GLY A O   1 
ATOM   4120 N N   . THR A 1 572 ? -13.939 -38.171 128.300 1.00 53.04  ? 572 THR A N   1 
ATOM   4121 C CA  . THR A 1 572 ? -14.050 -38.330 126.860 1.00 51.87  ? 572 THR A CA  1 
ATOM   4122 C C   . THR A 1 572 ? -13.851 -39.795 126.478 1.00 52.28  ? 572 THR A C   1 
ATOM   4123 O O   . THR A 1 572 ? -13.994 -40.162 125.310 1.00 52.86  ? 572 THR A O   1 
ATOM   4124 C CB  . THR A 1 572 ? -13.017 -37.440 126.115 1.00 50.47  ? 572 THR A CB  1 
ATOM   4125 O OG1 . THR A 1 572 ? -11.687 -37.870 126.428 1.00 48.69  ? 572 THR A OG1 1 
ATOM   4126 C CG2 . THR A 1 572 ? -13.174 -35.986 126.535 1.00 49.70  ? 572 THR A CG2 1 
ATOM   4127 N N   . LEU A 1 573 ? -13.529 -40.636 127.460 1.00 51.75  ? 573 LEU A N   1 
ATOM   4128 C CA  . LEU A 1 573 ? -13.327 -42.057 127.181 1.00 51.68  ? 573 LEU A CA  1 
ATOM   4129 C C   . LEU A 1 573 ? -14.650 -42.650 126.719 1.00 51.51  ? 573 LEU A C   1 
ATOM   4130 O O   . LEU A 1 573 ? -14.692 -43.435 125.769 1.00 51.27  ? 573 LEU A O   1 
ATOM   4131 C CB  . LEU A 1 573 ? -12.841 -42.807 128.428 1.00 52.28  ? 573 LEU A CB  1 
ATOM   4132 C CG  . LEU A 1 573 ? -12.503 -44.299 128.245 1.00 52.64  ? 573 LEU A CG  1 
ATOM   4133 C CD1 . LEU A 1 573 ? -11.181 -44.462 127.509 1.00 52.15  ? 573 LEU A CD1 1 
ATOM   4134 C CD2 . LEU A 1 573 ? -12.405 -44.972 129.598 1.00 53.95  ? 573 LEU A CD2 1 
ATOM   4135 N N   . GLY A 1 574 ? -15.726 -42.262 127.399 1.00 50.60  ? 574 GLY A N   1 
ATOM   4136 C CA  . GLY A 1 574 ? -17.046 -42.751 127.052 1.00 49.77  ? 574 GLY A CA  1 
ATOM   4137 C C   . GLY A 1 574 ? -17.475 -42.378 125.644 1.00 49.46  ? 574 GLY A C   1 
ATOM   4138 O O   . GLY A 1 574 ? -18.457 -42.909 125.131 1.00 49.73  ? 574 GLY A O   1 
ATOM   4139 N N   . LYS A 1 575 ? -16.745 -41.462 125.017 1.00 48.74  ? 575 LYS A N   1 
ATOM   4140 C CA  . LYS A 1 575 ? -17.068 -41.039 123.664 1.00 47.70  ? 575 LYS A CA  1 
ATOM   4141 C C   . LYS A 1 575 ? -16.362 -41.910 122.640 1.00 47.42  ? 575 LYS A C   1 
ATOM   4142 O O   . LYS A 1 575 ? -16.535 -41.734 121.445 1.00 48.21  ? 575 LYS A O   1 
ATOM   4143 C CB  . LYS A 1 575 ? -16.678 -39.581 123.470 1.00 48.26  ? 575 LYS A CB  1 
ATOM   4144 C CG  . LYS A 1 575 ? -17.320 -38.654 124.485 1.00 49.77  ? 575 LYS A CG  1 
ATOM   4145 C CD  . LYS A 1 575 ? -18.830 -38.772 124.434 1.00 50.98  ? 575 LYS A CD  1 
ATOM   4146 C CE  . LYS A 1 575 ? -19.503 -37.882 125.459 1.00 51.76  ? 575 LYS A CE  1 
ATOM   4147 N NZ  . LYS A 1 575 ? -20.988 -37.930 125.295 1.00 51.56  ? 575 LYS A NZ  1 
ATOM   4148 N N   . PHE A 1 576 ? -15.570 -42.855 123.126 1.00 48.39  ? 576 PHE A N   1 
ATOM   4149 C CA  . PHE A 1 576 ? -14.827 -43.801 122.286 1.00 50.00  ? 576 PHE A CA  1 
ATOM   4150 C C   . PHE A 1 576 ? -15.763 -44.712 121.469 1.00 49.38  ? 576 PHE A C   1 
ATOM   4151 O O   . PHE A 1 576 ? -16.812 -45.129 121.962 1.00 49.14  ? 576 PHE A O   1 
ATOM   4152 C CB  . PHE A 1 576 ? -13.952 -44.698 123.182 1.00 50.30  ? 576 PHE A CB  1 
ATOM   4153 C CG  . PHE A 1 576 ? -12.523 -44.248 123.319 1.00 49.61  ? 576 PHE A CG  1 
ATOM   4154 C CD1 . PHE A 1 576 ? -12.211 -42.922 123.585 1.00 50.40  ? 576 PHE A CD1 1 
ATOM   4155 C CD2 . PHE A 1 576 ? -11.487 -45.175 123.226 1.00 50.21  ? 576 PHE A CD2 1 
ATOM   4156 C CE1 . PHE A 1 576 ? -10.883 -42.526 123.762 1.00 51.91  ? 576 PHE A CE1 1 
ATOM   4157 C CE2 . PHE A 1 576 ? -10.158 -44.793 123.402 1.00 50.65  ? 576 PHE A CE2 1 
ATOM   4158 C CZ  . PHE A 1 576 ? -9.854  -43.467 123.671 1.00 51.27  ? 576 PHE A CZ  1 
ATOM   4159 N N   . THR A 1 577 ? -15.393 -45.023 120.230 1.00 48.39  ? 577 THR A N   1 
ATOM   4160 C CA  . THR A 1 577 ? -16.213 -45.933 119.442 1.00 48.59  ? 577 THR A CA  1 
ATOM   4161 C C   . THR A 1 577 ? -15.808 -47.308 119.977 1.00 49.70  ? 577 THR A C   1 
ATOM   4162 O O   . THR A 1 577 ? -14.732 -47.444 120.571 1.00 49.06  ? 577 THR A O   1 
ATOM   4163 C CB  . THR A 1 577 ? -15.910 -45.831 117.920 1.00 48.35  ? 577 THR A CB  1 
ATOM   4164 O OG1 . THR A 1 577 ? -14.536 -46.151 117.662 1.00 48.15  ? 577 THR A OG1 1 
ATOM   4165 C CG2 . THR A 1 577 ? -16.198 -44.429 117.422 1.00 47.23  ? 577 THR A CG2 1 
ATOM   4166 N N   . VAL A 1 578 ? -16.648 -48.323 119.791 1.00 50.33  ? 578 VAL A N   1 
ATOM   4167 C CA  . VAL A 1 578 ? -16.312 -49.644 120.315 1.00 51.76  ? 578 VAL A CA  1 
ATOM   4168 C C   . VAL A 1 578 ? -15.012 -50.230 119.755 1.00 52.86  ? 578 VAL A C   1 
ATOM   4169 O O   . VAL A 1 578 ? -14.328 -51.002 120.433 1.00 53.27  ? 578 VAL A O   1 
ATOM   4170 C CB  . VAL A 1 578 ? -17.467 -50.659 120.107 1.00 51.74  ? 578 VAL A CB  1 
ATOM   4171 C CG1 . VAL A 1 578 ? -18.740 -50.117 120.714 1.00 50.87  ? 578 VAL A CG1 1 
ATOM   4172 C CG2 . VAL A 1 578 ? -17.663 -50.964 118.636 1.00 53.22  ? 578 VAL A CG2 1 
ATOM   4173 N N   . PRO A 1 579 ? -14.653 -49.886 118.507 1.00 53.25  ? 579 PRO A N   1 
ATOM   4174 C CA  . PRO A 1 579 ? -13.405 -50.447 117.984 1.00 53.70  ? 579 PRO A CA  1 
ATOM   4175 C C   . PRO A 1 579 ? -12.236 -49.903 118.795 1.00 53.69  ? 579 PRO A C   1 
ATOM   4176 O O   . PRO A 1 579 ? -11.296 -50.622 119.138 1.00 54.16  ? 579 PRO A O   1 
ATOM   4177 C CB  . PRO A 1 579 ? -13.382 -49.949 116.539 1.00 53.10  ? 579 PRO A CB  1 
ATOM   4178 C CG  . PRO A 1 579 ? -14.821 -49.862 116.197 1.00 53.42  ? 579 PRO A CG  1 
ATOM   4179 C CD  . PRO A 1 579 ? -15.392 -49.204 117.435 1.00 53.91  ? 579 PRO A CD  1 
ATOM   4180 N N   . MET A 1 580 ? -12.309 -48.615 119.097 1.00 52.98  ? 580 MET A N   1 
ATOM   4181 C CA  . MET A 1 580 ? -11.267 -47.975 119.869 1.00 52.23  ? 580 MET A CA  1 
ATOM   4182 C C   . MET A 1 580 ? -11.185 -48.652 121.230 1.00 52.95  ? 580 MET A C   1 
ATOM   4183 O O   . MET A 1 580 ? -10.096 -48.831 121.776 1.00 52.95  ? 580 MET A O   1 
ATOM   4184 C CB  . MET A 1 580 ? -11.593 -46.495 120.056 1.00 51.18  ? 580 MET A CB  1 
ATOM   4185 C CG  . MET A 1 580 ? -11.722 -45.677 118.775 1.00 46.22  ? 580 MET A CG  1 
ATOM   4186 S SD  . MET A 1 580 ? -12.124 -43.974 119.215 1.00 40.36  ? 580 MET A SD  1 
ATOM   4187 C CE  . MET A 1 580 ? -10.639 -43.584 120.164 1.00 38.09  ? 580 MET A CE  1 
ATOM   4188 N N   . LEU A 1 581 ? -12.347 -49.029 121.767 1.00 54.16  ? 581 LEU A N   1 
ATOM   4189 C CA  . LEU A 1 581 ? -12.429 -49.677 123.076 1.00 54.67  ? 581 LEU A CA  1 
ATOM   4190 C C   . LEU A 1 581 ? -11.803 -51.062 123.089 1.00 56.53  ? 581 LEU A C   1 
ATOM   4191 O O   . LEU A 1 581 ? -11.151 -51.446 124.061 1.00 56.55  ? 581 LEU A O   1 
ATOM   4192 C CB  . LEU A 1 581 ? -13.884 -49.757 123.534 1.00 51.18  ? 581 LEU A CB  1 
ATOM   4193 C CG  . LEU A 1 581 ? -14.459 -48.404 123.953 1.00 49.55  ? 581 LEU A CG  1 
ATOM   4194 C CD1 . LEU A 1 581 ? -15.947 -48.510 124.202 1.00 49.83  ? 581 LEU A CD1 1 
ATOM   4195 C CD2 . LEU A 1 581 ? -13.742 -47.926 125.195 1.00 47.79  ? 581 LEU A CD2 1 
ATOM   4196 N N   . LYS A 1 582 ? -11.999 -51.811 122.010 1.00 59.42  ? 582 LYS A N   1 
ATOM   4197 C CA  . LYS A 1 582 ? -11.422 -53.144 121.901 1.00 62.00  ? 582 LYS A CA  1 
ATOM   4198 C C   . LYS A 1 582 ? -9.907  -53.030 121.885 1.00 63.35  ? 582 LYS A C   1 
ATOM   4199 O O   . LYS A 1 582 ? -9.232  -53.511 122.791 1.00 64.32  ? 582 LYS A O   1 
ATOM   4200 C CB  . LYS A 1 582 ? -11.873 -53.831 120.614 1.00 62.03  ? 582 LYS A CB  1 
ATOM   4201 C CG  . LYS A 1 582 ? -13.306 -54.306 120.612 1.00 62.86  ? 582 LYS A CG  1 
ATOM   4202 C CD  . LYS A 1 582 ? -13.540 -55.139 119.369 1.00 64.04  ? 582 LYS A CD  1 
ATOM   4203 C CE  . LYS A 1 582 ? -14.792 -55.988 119.459 1.00 63.67  ? 582 LYS A CE  1 
ATOM   4204 N NZ  . LYS A 1 582 ? -14.856 -56.909 118.281 1.00 64.88  ? 582 LYS A NZ  1 
ATOM   4205 N N   . GLU A 1 583 ? -9.382  -52.390 120.843 1.00 64.88  ? 583 GLU A N   1 
ATOM   4206 C CA  . GLU A 1 583 ? -7.944  -52.200 120.690 1.00 66.68  ? 583 GLU A CA  1 
ATOM   4207 C C   . GLU A 1 583 ? -7.318  -51.816 122.021 1.00 66.43  ? 583 GLU A C   1 
ATOM   4208 O O   . GLU A 1 583 ? -6.233  -52.280 122.359 1.00 65.61  ? 583 GLU A O   1 
ATOM   4209 C CB  . GLU A 1 583 ? -7.658  -51.101 119.662 1.00 69.14  ? 583 GLU A CB  1 
ATOM   4210 C CG  . GLU A 1 583 ? -8.251  -51.354 118.277 1.00 72.95  ? 583 GLU A CG  1 
ATOM   4211 C CD  . GLU A 1 583 ? -7.539  -52.465 117.506 1.00 75.01  ? 583 GLU A CD  1 
ATOM   4212 O OE1 . GLU A 1 583 ? -6.674  -53.150 118.105 1.00 75.99  ? 583 GLU A OE1 1 
ATOM   4213 O OE2 . GLU A 1 583 ? -7.852  -52.652 116.302 1.00 73.83  ? 583 GLU A OE2 1 
ATOM   4214 N N   . ALA A 1 584 ? -8.010  -50.962 122.771 1.00 66.19  ? 584 ALA A N   1 
ATOM   4215 C CA  . ALA A 1 584 ? -7.518  -50.520 124.067 1.00 66.54  ? 584 ALA A CA  1 
ATOM   4216 C C   . ALA A 1 584 ? -7.436  -51.716 125.013 1.00 66.80  ? 584 ALA A C   1 
ATOM   4217 O O   . ALA A 1 584 ? -6.408  -51.947 125.649 1.00 67.14  ? 584 ALA A O   1 
ATOM   4218 C CB  . ALA A 1 584 ? -8.438  -49.439 124.638 1.00 66.17  ? 584 ALA A CB  1 
ATOM   4219 N N   . CYS A 1 585 ? -8.516  -52.484 125.099 1.00 66.80  ? 585 CYS A N   1 
ATOM   4220 C CA  . CYS A 1 585 ? -8.524  -53.653 125.960 1.00 67.32  ? 585 CYS A CA  1 
ATOM   4221 C C   . CYS A 1 585 ? -7.600  -54.733 125.426 1.00 68.15  ? 585 CYS A C   1 
ATOM   4222 O O   . CYS A 1 585 ? -7.077  -55.537 126.191 1.00 68.17  ? 585 CYS A O   1 
ATOM   4223 C CB  . CYS A 1 585 ? -9.940  -54.200 126.106 1.00 67.14  ? 585 CYS A CB  1 
ATOM   4224 S SG  . CYS A 1 585 ? -10.989 -53.174 127.152 1.00 67.31  ? 585 CYS A SG  1 
ATOM   4225 N N   . ARG A 1 586 ? -7.400  -54.758 124.112 1.00 69.94  ? 586 ARG A N   1 
ATOM   4226 C CA  . ARG A 1 586 ? -6.511  -55.748 123.514 1.00 72.29  ? 586 ARG A CA  1 
ATOM   4227 C C   . ARG A 1 586 ? -5.086  -55.440 123.957 1.00 72.74  ? 586 ARG A C   1 
ATOM   4228 O O   . ARG A 1 586 ? -4.315  -56.346 124.279 1.00 73.52  ? 586 ARG A O   1 
ATOM   4229 C CB  . ARG A 1 586 ? -6.562  -55.701 121.981 1.00 74.22  ? 586 ARG A CB  1 
ATOM   4230 C CG  . ARG A 1 586 ? -7.926  -55.946 121.343 1.00 77.44  ? 586 ARG A CG  1 
ATOM   4231 C CD  . ARG A 1 586 ? -7.793  -56.019 119.817 1.00 79.92  ? 586 ARG A CD  1 
ATOM   4232 N NE  . ARG A 1 586 ? -9.071  -55.841 119.122 1.00 82.47  ? 586 ARG A NE  1 
ATOM   4233 C CZ  . ARG A 1 586 ? -9.218  -55.876 117.799 1.00 82.74  ? 586 ARG A CZ  1 
ATOM   4234 N NH1 . ARG A 1 586 ? -8.169  -56.088 117.014 1.00 82.61  ? 586 ARG A NH1 1 
ATOM   4235 N NH2 . ARG A 1 586 ? -10.414 -55.687 117.255 1.00 83.08  ? 586 ARG A NH2 1 
ATOM   4236 N N   . ALA A 1 587 ? -4.755  -54.150 123.976 1.00 72.55  ? 587 ALA A N   1 
ATOM   4237 C CA  . ALA A 1 587 ? -3.425  -53.669 124.355 1.00 72.09  ? 587 ALA A CA  1 
ATOM   4238 C C   . ALA A 1 587 ? -3.029  -53.988 125.784 1.00 71.85  ? 587 ALA A C   1 
ATOM   4239 O O   . ALA A 1 587 ? -1.846  -54.175 126.080 1.00 71.75  ? 587 ALA A O   1 
ATOM   4240 C CB  . ALA A 1 587 ? -3.334  -52.177 124.123 1.00 72.64  ? 587 ALA A CB  1 
ATOM   4241 N N   . TYR A 1 588 ? -4.017  -54.018 126.671 1.00 71.65  ? 588 TYR A N   1 
ATOM   4242 C CA  . TYR A 1 588 ? -3.768  -54.345 128.068 1.00 71.91  ? 588 TYR A CA  1 
ATOM   4243 C C   . TYR A 1 588 ? -4.288  -55.747 128.307 1.00 72.70  ? 588 TYR A C   1 
ATOM   4244 O O   . TYR A 1 588 ? -4.466  -56.166 129.452 1.00 72.61  ? 588 TYR A O   1 
ATOM   4245 C CB  . TYR A 1 588 ? -4.467  -53.354 128.997 1.00 70.82  ? 588 TYR A CB  1 
ATOM   4246 C CG  . TYR A 1 588 ? -3.941  -51.960 128.828 1.00 70.33  ? 588 TYR A CG  1 
ATOM   4247 C CD1 . TYR A 1 588 ? -4.111  -51.279 127.627 1.00 70.09  ? 588 TYR A CD1 1 
ATOM   4248 C CD2 . TYR A 1 588 ? -3.213  -51.345 129.834 1.00 70.17  ? 588 TYR A CD2 1 
ATOM   4249 C CE1 . TYR A 1 588 ? -3.563  -50.024 127.431 1.00 70.48  ? 588 TYR A CE1 1 
ATOM   4250 C CE2 . TYR A 1 588 ? -2.659  -50.091 129.651 1.00 70.61  ? 588 TYR A CE2 1 
ATOM   4251 C CZ  . TYR A 1 588 ? -2.831  -49.439 128.445 1.00 70.67  ? 588 TYR A CZ  1 
ATOM   4252 O OH  . TYR A 1 588 ? -2.229  -48.217 128.237 1.00 71.16  ? 588 TYR A OH  1 
ATOM   4253 N N   . GLY A 1 589 ? -4.535  -56.449 127.200 1.00 73.20  ? 589 GLY A N   1 
ATOM   4254 C CA  . GLY A 1 589 ? -5.029  -57.810 127.238 1.00 74.29  ? 589 GLY A CA  1 
ATOM   4255 C C   . GLY A 1 589 ? -5.910  -58.107 128.427 1.00 75.70  ? 589 GLY A C   1 
ATOM   4256 O O   . GLY A 1 589 ? -5.787  -59.164 129.050 1.00 74.90  ? 589 GLY A O   1 
ATOM   4257 N N   . LEU A 1 590 ? -6.804  -57.173 128.742 1.00 77.29  ? 590 LEU A N   1 
ATOM   4258 C CA  . LEU A 1 590 ? -7.699  -57.348 129.875 1.00 78.72  ? 590 LEU A CA  1 
ATOM   4259 C C   . LEU A 1 590 ? -9.054  -57.881 129.436 1.00 80.17  ? 590 LEU A C   1 
ATOM   4260 O O   . LEU A 1 590 ? -9.508  -57.624 128.313 1.00 79.16  ? 590 LEU A O   1 
ATOM   4261 C CB  . LEU A 1 590 ? -7.874  -56.041 130.659 1.00 78.27  ? 590 LEU A CB  1 
ATOM   4262 C CG  . LEU A 1 590 ? -8.514  -54.787 130.048 1.00 78.25  ? 590 LEU A CG  1 
ATOM   4263 C CD1 . LEU A 1 590 ? -8.721  -53.750 131.145 1.00 78.11  ? 590 LEU A CD1 1 
ATOM   4264 C CD2 . LEU A 1 590 ? -7.633  -54.219 128.957 1.00 78.12  ? 590 LEU A CD2 1 
ATOM   4265 N N   . LYS A 1 591 ? -9.685  -58.622 130.347 1.00 82.06  ? 591 LYS A N   1 
ATOM   4266 C CA  . LYS A 1 591 ? -10.974 -59.264 130.112 1.00 83.90  ? 591 LYS A CA  1 
ATOM   4267 C C   . LYS A 1 591 ? -12.056 -58.263 129.707 1.00 85.02  ? 591 LYS A C   1 
ATOM   4268 O O   . LYS A 1 591 ? -12.506 -57.427 130.501 1.00 85.27  ? 591 LYS A O   1 
ATOM   4269 C CB  . LYS A 1 591 ? -11.364 -60.054 131.359 1.00 83.86  ? 591 LYS A CB  1 
ATOM   4270 C CG  . LYS A 1 591 ? -10.184 -60.903 131.845 1.00 84.67  ? 591 LYS A CG  1 
ATOM   4271 C CD  . LYS A 1 591 ? -10.502 -61.837 133.001 1.00 84.69  ? 591 LYS A CD  1 
ATOM   4272 C CE  . LYS A 1 591 ? -9.248  -62.645 133.328 1.00 83.70  ? 591 LYS A CE  1 
ATOM   4273 N NZ  . LYS A 1 591 ? -9.449  -63.828 134.206 1.00 84.08  ? 591 LYS A NZ  1 
ATOM   4274 N N   . SER A 1 592 ? -12.470 -58.364 128.447 1.00 85.84  ? 592 SER A N   1 
ATOM   4275 C CA  . SER A 1 592 ? -13.452 -57.451 127.872 1.00 86.55  ? 592 SER A CA  1 
ATOM   4276 C C   . SER A 1 592 ? -14.929 -57.858 127.800 1.00 87.69  ? 592 SER A C   1 
ATOM   4277 O O   . SER A 1 592 ? -15.505 -58.332 128.778 1.00 86.69  ? 592 SER A O   1 
ATOM   4278 C CB  . SER A 1 592 ? -12.972 -57.041 126.473 1.00 85.88  ? 592 SER A CB  1 
ATOM   4279 O OG  . SER A 1 592 ? -12.787 -58.169 125.626 1.00 84.09  ? 592 SER A OG  1 
ATOM   4280 N N   . GLY A 1 593 ? -15.523 -57.610 126.631 1.00 88.84  ? 593 GLY A N   1 
ATOM   4281 C CA  . GLY A 1 593 ? -16.917 -57.918 126.382 1.00 89.06  ? 593 GLY A CA  1 
ATOM   4282 C C   . GLY A 1 593 ? -17.303 -57.703 124.920 1.00 89.47  ? 593 GLY A C   1 
ATOM   4283 O O   . GLY A 1 593 ? -16.435 -57.564 124.043 1.00 89.04  ? 593 GLY A O   1 
ATOM   4284 N N   . LEU A 1 594 ? -18.611 -57.692 124.659 1.00 89.32  ? 594 LEU A N   1 
ATOM   4285 C CA  . LEU A 1 594 ? -19.156 -57.496 123.311 1.00 88.35  ? 594 LEU A CA  1 
ATOM   4286 C C   . LEU A 1 594 ? -19.862 -56.138 123.306 1.00 87.00  ? 594 LEU A C   1 
ATOM   4287 O O   . LEU A 1 594 ? -20.066 -55.538 122.248 1.00 86.81  ? 594 LEU A O   1 
ATOM   4288 C CB  . LEU A 1 594 ? -20.207 -58.574 122.973 1.00 88.66  ? 594 LEU A CB  1 
ATOM   4289 C CG  . LEU A 1 594 ? -20.082 -60.046 123.412 1.00 87.95  ? 594 LEU A CG  1 
ATOM   4290 C CD1 . LEU A 1 594 ? -21.448 -60.703 123.269 1.00 87.45  ? 594 LEU A CD1 1 
ATOM   4291 C CD2 . LEU A 1 594 ? -19.025 -60.806 122.605 1.00 87.34  ? 594 LEU A CD2 1 
ATOM   4292 N N   . LYS A 1 595 ? -20.235 -55.679 124.504 1.00 84.34  ? 595 LYS A N   1 
ATOM   4293 C CA  . LYS A 1 595 ? -20.948 -54.419 124.704 1.00 80.90  ? 595 LYS A CA  1 
ATOM   4294 C C   . LYS A 1 595 ? -19.988 -53.271 124.972 1.00 79.05  ? 595 LYS A C   1 
ATOM   4295 O O   . LYS A 1 595 ? -18.838 -53.496 125.335 1.00 78.75  ? 595 LYS A O   1 
ATOM   4296 C CB  . LYS A 1 595 ? -21.897 -54.557 125.890 1.00 80.25  ? 595 LYS A CB  1 
ATOM   4297 C CG  . LYS A 1 595 ? -22.740 -55.827 125.876 1.00 79.08  ? 595 LYS A CG  1 
ATOM   4298 C CD  . LYS A 1 595 ? -23.534 -55.957 127.166 1.00 79.03  ? 595 LYS A CD  1 
ATOM   4299 C CE  . LYS A 1 595 ? -24.454 -57.165 127.129 1.00 78.78  ? 595 LYS A CE  1 
ATOM   4300 N NZ  . LYS A 1 595 ? -25.157 -57.342 128.428 1.00 77.74  ? 595 LYS A NZ  1 
ATOM   4301 N N   . LYS A 1 596 ? -20.461 -52.040 124.798 1.00 77.12  ? 596 LYS A N   1 
ATOM   4302 C CA  . LYS A 1 596 ? -19.626 -50.864 125.023 1.00 75.68  ? 596 LYS A CA  1 
ATOM   4303 C C   . LYS A 1 596 ? -19.448 -50.577 126.509 1.00 74.92  ? 596 LYS A C   1 
ATOM   4304 O O   . LYS A 1 596 ? -18.326 -50.404 126.997 1.00 73.42  ? 596 LYS A O   1 
ATOM   4305 C CB  . LYS A 1 596 ? -20.243 -49.646 124.334 1.00 74.91  ? 596 LYS A CB  1 
ATOM   4306 C CG  . LYS A 1 596 ? -19.474 -48.344 124.524 1.00 74.65  ? 596 LYS A CG  1 
ATOM   4307 C CD  . LYS A 1 596 ? -20.234 -47.173 123.916 1.00 75.05  ? 596 LYS A CD  1 
ATOM   4308 C CE  . LYS A 1 596 ? -19.542 -45.838 124.166 1.00 75.41  ? 596 LYS A CE  1 
ATOM   4309 N NZ  . LYS A 1 596 ? -20.318 -44.676 123.621 1.00 73.90  ? 596 LYS A NZ  1 
ATOM   4310 N N   . GLN A 1 597 ? -20.560 -50.529 127.230 1.00 74.28  ? 597 GLN A N   1 
ATOM   4311 C CA  . GLN A 1 597 ? -20.495 -50.265 128.657 1.00 74.10  ? 597 GLN A CA  1 
ATOM   4312 C C   . GLN A 1 597 ? -19.480 -51.211 129.294 1.00 73.23  ? 597 GLN A C   1 
ATOM   4313 O O   . GLN A 1 597 ? -18.758 -50.836 130.211 1.00 72.32  ? 597 GLN A O   1 
ATOM   4314 C CB  . GLN A 1 597 ? -21.878 -50.447 129.292 1.00 74.64  ? 597 GLN A CB  1 
ATOM   4315 C CG  . GLN A 1 597 ? -21.972 -50.018 130.761 1.00 74.87  ? 597 GLN A CG  1 
ATOM   4316 C CD  . GLN A 1 597 ? -21.341 -48.652 131.031 1.00 75.62  ? 597 GLN A CD  1 
ATOM   4317 O OE1 . GLN A 1 597 ? -21.464 -47.721 130.229 1.00 74.60  ? 597 GLN A OE1 1 
ATOM   4318 N NE2 . GLN A 1 597 ? -20.672 -48.528 132.182 1.00 75.80  ? 597 GLN A NE2 1 
ATOM   4319 N N   . GLU A 1 598 ? -19.417 -52.437 128.794 1.00 72.84  ? 598 GLU A N   1 
ATOM   4320 C CA  . GLU A 1 598 ? -18.467 -53.392 129.326 1.00 72.89  ? 598 GLU A CA  1 
ATOM   4321 C C   . GLU A 1 598 ? -17.074 -52.825 129.160 1.00 71.42  ? 598 GLU A C   1 
ATOM   4322 O O   . GLU A 1 598 ? -16.416 -52.472 130.135 1.00 71.66  ? 598 GLU A O   1 
ATOM   4323 C CB  . GLU A 1 598 ? -18.549 -54.721 128.579 1.00 74.93  ? 598 GLU A CB  1 
ATOM   4324 C CG  . GLU A 1 598 ? -19.794 -55.515 128.854 1.00 78.16  ? 598 GLU A CG  1 
ATOM   4325 C CD  . GLU A 1 598 ? -19.686 -56.930 128.327 1.00 81.03  ? 598 GLU A CD  1 
ATOM   4326 O OE1 . GLU A 1 598 ? -19.407 -57.097 127.124 1.00 81.18  ? 598 GLU A OE1 1 
ATOM   4327 O OE2 . GLU A 1 598 ? -19.872 -57.879 129.119 1.00 83.14  ? 598 GLU A OE2 1 
ATOM   4328 N N   . LEU A 1 599 ? -16.630 -52.743 127.912 1.00 69.49  ? 599 LEU A N   1 
ATOM   4329 C CA  . LEU A 1 599 ? -15.304 -52.228 127.616 1.00 67.98  ? 599 LEU A CA  1 
ATOM   4330 C C   . LEU A 1 599 ? -15.047 -50.929 128.368 1.00 67.05  ? 599 LEU A C   1 
ATOM   4331 O O   . LEU A 1 599 ? -13.930 -50.663 128.806 1.00 65.76  ? 599 LEU A O   1 
ATOM   4332 C CB  . LEU A 1 599 ? -15.150 -52.019 126.107 1.00 67.75  ? 599 LEU A CB  1 
ATOM   4333 C CG  . LEU A 1 599 ? -15.240 -53.300 125.264 1.00 66.70  ? 599 LEU A CG  1 
ATOM   4334 C CD1 . LEU A 1 599 ? -15.065 -52.980 123.798 1.00 67.56  ? 599 LEU A CD1 1 
ATOM   4335 C CD2 . LEU A 1 599 ? -14.168 -54.263 125.695 1.00 67.03  ? 599 LEU A CD2 1 
ATOM   4336 N N   . LEU A 1 600 ? -16.090 -50.128 128.531 1.00 66.66  ? 600 LEU A N   1 
ATOM   4337 C CA  . LEU A 1 600 ? -15.963 -48.871 129.245 1.00 66.10  ? 600 LEU A CA  1 
ATOM   4338 C C   . LEU A 1 600 ? -15.656 -49.113 130.727 1.00 66.65  ? 600 LEU A C   1 
ATOM   4339 O O   . LEU A 1 600 ? -14.720 -48.526 131.280 1.00 66.28  ? 600 LEU A O   1 
ATOM   4340 C CB  . LEU A 1 600 ? -17.255 -48.074 129.096 1.00 65.56  ? 600 LEU A CB  1 
ATOM   4341 C CG  . LEU A 1 600 ? -17.225 -46.871 128.164 1.00 64.52  ? 600 LEU A CG  1 
ATOM   4342 C CD1 . LEU A 1 600 ? -18.644 -46.419 127.864 1.00 64.84  ? 600 LEU A CD1 1 
ATOM   4343 C CD2 . LEU A 1 600 ? -16.418 -45.765 128.812 1.00 63.56  ? 600 LEU A CD2 1 
ATOM   4344 N N   . GLU A 1 601 ? -16.448 -49.975 131.364 1.00 67.30  ? 601 GLU A N   1 
ATOM   4345 C CA  . GLU A 1 601 ? -16.263 -50.284 132.776 1.00 68.02  ? 601 GLU A CA  1 
ATOM   4346 C C   . GLU A 1 601 ? -14.868 -50.849 132.992 1.00 67.76  ? 601 GLU A C   1 
ATOM   4347 O O   . GLU A 1 601 ? -14.152 -50.417 133.897 1.00 67.89  ? 601 GLU A O   1 
ATOM   4348 C CB  . GLU A 1 601 ? -17.295 -51.310 133.251 1.00 68.89  ? 601 GLU A CB  1 
ATOM   4349 C CG  . GLU A 1 601 ? -18.740 -50.889 133.087 1.00 72.09  ? 601 GLU A CG  1 
ATOM   4350 C CD  . GLU A 1 601 ? -19.726 -52.041 133.299 1.00 73.63  ? 601 GLU A CD  1 
ATOM   4351 O OE1 . GLU A 1 601 ? -19.358 -53.210 133.039 1.00 73.60  ? 601 GLU A OE1 1 
ATOM   4352 O OE2 . GLU A 1 601 ? -20.879 -51.771 133.705 1.00 73.96  ? 601 GLU A OE2 1 
ATOM   4353 N N   . ALA A 1 602 ? -14.497 -51.822 132.162 1.00 66.69  ? 602 ALA A N   1 
ATOM   4354 C CA  . ALA A 1 602 ? -13.194 -52.469 132.249 1.00 65.48  ? 602 ALA A CA  1 
ATOM   4355 C C   . ALA A 1 602 ? -12.053 -51.459 132.255 1.00 64.90  ? 602 ALA A C   1 
ATOM   4356 O O   . ALA A 1 602 ? -11.443 -51.218 133.295 1.00 65.43  ? 602 ALA A O   1 
ATOM   4357 C CB  . ALA A 1 602 ? -13.014 -53.452 131.084 1.00 65.35  ? 602 ALA A CB  1 
ATOM   4358 N N   . LEU A 1 603 ? -11.778 -50.863 131.096 1.00 63.90  ? 603 LEU A N   1 
ATOM   4359 C CA  . LEU A 1 603 ? -10.698 -49.889 130.968 1.00 63.20  ? 603 LEU A CA  1 
ATOM   4360 C C   . LEU A 1 603 ? -10.594 -48.877 132.102 1.00 63.63  ? 603 LEU A C   1 
ATOM   4361 O O   . LEU A 1 603 ? -9.489  -48.554 132.536 1.00 63.48  ? 603 LEU A O   1 
ATOM   4362 C CB  . LEU A 1 603 ? -10.799 -49.143 129.636 1.00 62.12  ? 603 LEU A CB  1 
ATOM   4363 C CG  . LEU A 1 603 ? -10.336 -49.924 128.406 1.00 61.52  ? 603 LEU A CG  1 
ATOM   4364 C CD1 . LEU A 1 603 ? -10.474 -49.047 127.184 1.00 61.31  ? 603 LEU A CD1 1 
ATOM   4365 C CD2 . LEU A 1 603 ? -8.888  -50.383 128.577 1.00 60.60  ? 603 LEU A CD2 1 
ATOM   4366 N N   . THR A 1 604 ? -11.728 -48.380 132.589 1.00 64.10  ? 604 THR A N   1 
ATOM   4367 C CA  . THR A 1 604 ? -11.709 -47.408 133.675 1.00 65.14  ? 604 THR A CA  1 
ATOM   4368 C C   . THR A 1 604 ? -11.215 -48.072 134.942 1.00 66.77  ? 604 THR A C   1 
ATOM   4369 O O   . THR A 1 604 ? -10.408 -47.500 135.684 1.00 66.66  ? 604 THR A O   1 
ATOM   4370 C CB  . THR A 1 604 ? -13.098 -46.838 133.963 1.00 64.65  ? 604 THR A CB  1 
ATOM   4371 O OG1 . THR A 1 604 ? -13.613 -46.222 132.777 1.00 65.24  ? 604 THR A OG1 1 
ATOM   4372 C CG2 . THR A 1 604 ? -13.010 -45.808 135.084 1.00 63.42  ? 604 THR A CG2 1 
ATOM   4373 N N   . LYS A 1 605 ? -11.729 -49.272 135.193 1.00 68.40  ? 605 LYS A N   1 
ATOM   4374 C CA  . LYS A 1 605 ? -11.348 -50.028 136.363 1.00 70.24  ? 605 LYS A CA  1 
ATOM   4375 C C   . LYS A 1 605 ? -9.880  -50.414 136.281 1.00 71.06  ? 605 LYS A C   1 
ATOM   4376 O O   . LYS A 1 605 ? -9.154  -50.298 137.252 1.00 71.89  ? 605 LYS A O   1 
ATOM   4377 C CB  . LYS A 1 605 ? -12.219 -51.282 136.488 1.00 71.79  ? 605 LYS A CB  1 
ATOM   4378 C CG  . LYS A 1 605 ? -11.884 -52.140 137.696 1.00 74.09  ? 605 LYS A CG  1 
ATOM   4379 C CD  . LYS A 1 605 ? -12.544 -53.508 137.627 1.00 75.88  ? 605 LYS A CD  1 
ATOM   4380 C CE  . LYS A 1 605 ? -12.143 -54.343 138.827 1.00 77.28  ? 605 LYS A CE  1 
ATOM   4381 N NZ  . LYS A 1 605 ? -12.825 -55.663 138.805 1.00 79.55  ? 605 LYS A NZ  1 
ATOM   4382 N N   . HIS A 1 606 ? -9.431  -50.859 135.117 1.00 72.12  ? 606 HIS A N   1 
ATOM   4383 C CA  . HIS A 1 606 ? -8.033  -51.263 134.979 1.00 73.87  ? 606 HIS A CA  1 
ATOM   4384 C C   . HIS A 1 606 ? -7.059  -50.186 135.436 1.00 74.82  ? 606 HIS A C   1 
ATOM   4385 O O   . HIS A 1 606 ? -5.983  -50.497 135.944 1.00 75.31  ? 606 HIS A O   1 
ATOM   4386 C CB  . HIS A 1 606 ? -7.722  -51.672 133.542 1.00 74.11  ? 606 HIS A CB  1 
ATOM   4387 C CG  . HIS A 1 606 ? -6.361  -52.280 133.370 1.00 75.15  ? 606 HIS A CG  1 
ATOM   4388 N ND1 . HIS A 1 606 ? -5.218  -51.522 133.301 1.00 76.17  ? 606 HIS A ND1 1 
ATOM   4389 C CD2 . HIS A 1 606 ? -5.970  -53.573 133.280 1.00 76.33  ? 606 HIS A CD2 1 
ATOM   4390 C CE1 . HIS A 1 606 ? -4.169  -52.322 133.172 1.00 77.24  ? 606 HIS A CE1 1 
ATOM   4391 N NE2 . HIS A 1 606 ? -4.597  -53.567 133.157 1.00 77.36  ? 606 HIS A NE2 1 
ATOM   4392 N N   . PHE A 1 607 ? -7.444  -48.922 135.301 1.00 76.13  ? 607 PHE A N   1 
ATOM   4393 C CA  . PHE A 1 607 ? -6.570  -47.828 135.723 1.00 78.00  ? 607 PHE A CA  1 
ATOM   4394 C C   . PHE A 1 607 ? -6.847  -47.284 137.137 1.00 80.53  ? 607 PHE A C   1 
ATOM   4395 O O   . PHE A 1 607 ? -6.016  -47.384 138.034 1.00 79.76  ? 607 PHE A O   1 
ATOM   4396 C CB  . PHE A 1 607 ? -6.645  -46.687 134.693 1.00 76.54  ? 607 PHE A CB  1 
ATOM   4397 C CG  . PHE A 1 607 ? -6.042  -47.028 133.363 1.00 75.20  ? 607 PHE A CG  1 
ATOM   4398 C CD1 . PHE A 1 607 ? -6.514  -48.102 132.613 1.00 75.33  ? 607 PHE A CD1 1 
ATOM   4399 C CD2 . PHE A 1 607 ? -5.010  -46.261 132.848 1.00 74.95  ? 607 PHE A CD2 1 
ATOM   4400 C CE1 . PHE A 1 607 ? -5.968  -48.407 131.365 1.00 74.93  ? 607 PHE A CE1 1 
ATOM   4401 C CE2 . PHE A 1 607 ? -4.453  -46.562 131.590 1.00 75.22  ? 607 PHE A CE2 1 
ATOM   4402 C CZ  . PHE A 1 607 ? -4.940  -47.641 130.853 1.00 74.70  ? 607 PHE A CZ  1 
ATOM   4403 N N   . GLN A 1 608 ? -8.012  -46.680 137.308 1.00 84.59  ? 608 GLN A N   1 
ATOM   4404 C CA  . GLN A 1 608 ? -8.412  -46.115 138.578 1.00 88.81  ? 608 GLN A CA  1 
ATOM   4405 C C   . GLN A 1 608 ? -8.656  -47.140 139.677 1.00 91.57  ? 608 GLN A C   1 
ATOM   4406 O O   . GLN A 1 608 ? -8.155  -46.955 140.813 1.00 91.18  ? 608 GLN A O   1 
ATOM   4407 C CB  . GLN A 1 608 ? -9.647  -45.208 138.346 1.00 89.98  ? 608 GLN A CB  1 
ATOM   4408 C CG  . GLN A 1 608 ? -10.640 -45.020 139.505 1.00 91.28  ? 608 GLN A CG  1 
ATOM   4409 C CD  . GLN A 1 608 ? -10.184 -44.039 140.591 1.00 92.78  ? 608 GLN A CD  1 
ATOM   4410 O OE1 . GLN A 1 608 ? -9.433  -43.086 140.338 1.00 93.36  ? 608 GLN A OE1 1 
ATOM   4411 N NE2 . GLN A 1 608 ? -10.685 -44.257 141.813 1.00 93.31  ? 608 GLN A NE2 1 
ATOM   4412 N N   . ASP A 1 609 ? -9.386  -48.214 139.350 1.00 94.63  ? 609 ASP A N   1 
ATOM   4413 C CA  . ASP A 1 609 ? -9.745  -49.249 140.341 1.00 97.76  ? 609 ASP A CA  1 
ATOM   4414 C C   . ASP A 1 609 ? -8.787  -50.461 140.418 1.00 99.37  ? 609 ASP A C   1 
ATOM   4415 O O   . ASP A 1 609 ? -8.336  -50.788 141.557 1.00 100.04 ? 609 ASP A O   1 
ATOM   4416 C CB  . ASP A 1 609 ? -11.097 -49.803 140.027 1.00 98.07  ? 609 ASP A CB  1 
ATOM   4417 C CG  . ASP A 1 609 ? -12.047 -49.717 141.217 1.00 100.22 ? 609 ASP A CG  1 
ATOM   4418 O OD1 . ASP A 1 609 ? -11.598 -49.265 142.303 1.00 100.78 ? 609 ASP A OD1 1 
ATOM   4419 O OD2 . ASP A 1 609 ? -13.241 -50.103 141.107 1.00 100.78 ? 609 ASP A OD2 1 
ATOM   4420 N N   . ASN B 2 6   ? 11.229  -26.612 106.915 1.00 53.92  ? 6   ASN B N   1 
ATOM   4421 C CA  . ASN B 2 6   ? 11.462  -25.902 105.631 1.00 54.53  ? 6   ASN B CA  1 
ATOM   4422 C C   . ASN B 2 6   ? 10.156  -25.678 104.827 1.00 54.57  ? 6   ASN B C   1 
ATOM   4423 O O   . ASN B 2 6   ? 9.979   -24.623 104.205 1.00 56.26  ? 6   ASN B O   1 
ATOM   4424 C CB  . ASN B 2 6   ? 12.491  -26.686 104.805 1.00 54.45  ? 6   ASN B CB  1 
ATOM   4425 C CG  . ASN B 2 6   ? 13.016  -25.896 103.616 1.00 55.99  ? 6   ASN B CG  1 
ATOM   4426 O OD1 . ASN B 2 6   ? 12.330  -25.740 102.595 1.00 56.43  ? 6   ASN B OD1 1 
ATOM   4427 N ND2 . ASN B 2 6   ? 14.239  -25.385 103.746 1.00 55.62  ? 6   ASN B ND2 1 
ATOM   4428 N N   . LYS B 2 7   ? 9.245   -26.651 104.844 1.00 51.48  ? 7   LYS B N   1 
ATOM   4429 C CA  . LYS B 2 7   ? 7.981   -26.521 104.118 1.00 47.17  ? 7   LYS B CA  1 
ATOM   4430 C C   . LYS B 2 7   ? 6.848   -27.157 104.909 1.00 43.57  ? 7   LYS B C   1 
ATOM   4431 O O   . LYS B 2 7   ? 7.032   -28.195 105.539 1.00 42.44  ? 7   LYS B O   1 
ATOM   4432 C CB  . LYS B 2 7   ? 8.070   -27.211 102.753 1.00 49.37  ? 7   LYS B CB  1 
ATOM   4433 C CG  . LYS B 2 7   ? 7.747   -26.312 101.569 1.00 53.28  ? 7   LYS B CG  1 
ATOM   4434 C CD  . LYS B 2 7   ? 7.176   -27.111 100.377 1.00 56.84  ? 7   LYS B CD  1 
ATOM   4435 C CE  . LYS B 2 7   ? 8.155   -28.152 99.802  1.00 58.74  ? 7   LYS B CE  1 
ATOM   4436 N NZ  . LYS B 2 7   ? 7.556   -29.008 98.713  1.00 58.22  ? 7   LYS B NZ  1 
ATOM   4437 N N   . ALA B 2 8   ? 5.675   -26.533 104.874 1.00 39.47  ? 8   ALA B N   1 
ATOM   4438 C CA  . ALA B 2 8   ? 4.503   -27.058 105.570 1.00 35.06  ? 8   ALA B CA  1 
ATOM   4439 C C   . ALA B 2 8   ? 3.316   -27.120 104.616 1.00 32.90  ? 8   ALA B C   1 
ATOM   4440 O O   . ALA B 2 8   ? 3.171   -26.271 103.738 1.00 30.41  ? 8   ALA B O   1 
ATOM   4441 C CB  . ALA B 2 8   ? 4.159   -26.182 106.753 1.00 34.90  ? 8   ALA B CB  1 
ATOM   4442 N N   . ALA B 2 9   ? 2.483   -28.142 104.770 1.00 30.06  ? 9   ALA B N   1 
ATOM   4443 C CA  . ALA B 2 9   ? 1.297   -28.275 103.932 1.00 28.66  ? 9   ALA B CA  1 
ATOM   4444 C C   . ALA B 2 9   ? 0.111   -28.059 104.857 1.00 27.30  ? 9   ALA B C   1 
ATOM   4445 O O   . ALA B 2 9   ? -0.151  -28.851 105.758 1.00 26.85  ? 9   ALA B O   1 
ATOM   4446 C CB  . ALA B 2 9   ? 1.231   -29.661 103.290 1.00 26.84  ? 9   ALA B CB  1 
ATOM   4447 N N   . VAL B 2 10  ? -0.615  -26.982 104.640 1.00 26.70  ? 10  VAL B N   1 
ATOM   4448 C CA  . VAL B 2 10  ? -1.736  -26.696 105.511 1.00 27.41  ? 10  VAL B CA  1 
ATOM   4449 C C   . VAL B 2 10  ? -3.086  -26.718 104.799 1.00 27.93  ? 10  VAL B C   1 
ATOM   4450 O O   . VAL B 2 10  ? -3.252  -26.111 103.737 1.00 28.00  ? 10  VAL B O   1 
ATOM   4451 C CB  . VAL B 2 10  ? -1.548  -25.314 106.180 1.00 26.06  ? 10  VAL B CB  1 
ATOM   4452 C CG1 . VAL B 2 10  ? -2.443  -25.191 107.375 1.00 27.36  ? 10  VAL B CG1 1 
ATOM   4453 C CG2 . VAL B 2 10  ? -0.105  -25.126 106.578 1.00 25.42  ? 10  VAL B CG2 1 
ATOM   4454 N N   . VAL B 2 11  ? -4.046  -27.427 105.384 1.00 27.40  ? 11  VAL B N   1 
ATOM   4455 C CA  . VAL B 2 11  ? -5.390  -27.483 104.821 1.00 26.48  ? 11  VAL B CA  1 
ATOM   4456 C C   . VAL B 2 11  ? -6.350  -26.726 105.706 1.00 26.77  ? 11  VAL B C   1 
ATOM   4457 O O   . VAL B 2 11  ? -6.533  -27.069 106.873 1.00 27.74  ? 11  VAL B O   1 
ATOM   4458 C CB  . VAL B 2 11  ? -5.929  -28.898 104.730 1.00 26.30  ? 11  VAL B CB  1 
ATOM   4459 C CG1 . VAL B 2 11  ? -7.393  -28.860 104.315 1.00 25.20  ? 11  VAL B CG1 1 
ATOM   4460 C CG2 . VAL B 2 11  ? -5.117  -29.684 103.744 1.00 27.96  ? 11  VAL B CG2 1 
ATOM   4461 N N   . LEU B 2 12  ? -6.962  -25.696 105.148 1.00 25.92  ? 12  LEU B N   1 
ATOM   4462 C CA  . LEU B 2 12  ? -7.931  -24.905 105.886 1.00 25.44  ? 12  LEU B CA  1 
ATOM   4463 C C   . LEU B 2 12  ? -9.294  -25.479 105.589 1.00 25.88  ? 12  LEU B C   1 
ATOM   4464 O O   . LEU B 2 12  ? -9.874  -25.184 104.552 1.00 26.47  ? 12  LEU B O   1 
ATOM   4465 C CB  . LEU B 2 12  ? -7.903  -23.449 105.434 1.00 24.15  ? 12  LEU B CB  1 
ATOM   4466 C CG  . LEU B 2 12  ? -6.558  -22.733 105.507 1.00 21.61  ? 12  LEU B CG  1 
ATOM   4467 C CD1 . LEU B 2 12  ? -6.702  -21.340 104.948 1.00 20.42  ? 12  LEU B CD1 1 
ATOM   4468 C CD2 . LEU B 2 12  ? -6.083  -22.683 106.936 1.00 20.98  ? 12  LEU B CD2 1 
ATOM   4469 N N   . CYS B 2 13  ? -9.795  -26.309 106.492 1.00 26.32  ? 13  CYS B N   1 
ATOM   4470 C CA  . CYS B 2 13  ? -11.108 -26.915 106.330 1.00 28.05  ? 13  CYS B CA  1 
ATOM   4471 C C   . CYS B 2 13  ? -12.138 -25.923 106.913 1.00 29.06  ? 13  CYS B C   1 
ATOM   4472 O O   . CYS B 2 13  ? -12.288 -25.808 108.131 1.00 29.14  ? 13  CYS B O   1 
ATOM   4473 C CB  . CYS B 2 13  ? -11.118 -28.253 107.073 1.00 28.80  ? 13  CYS B CB  1 
ATOM   4474 S SG  . CYS B 2 13  ? -12.612 -29.244 106.916 1.00 34.99  ? 13  CYS B SG  1 
ATOM   4475 N N   . MET B 2 14  ? -12.832 -25.193 106.043 1.00 29.22  ? 14  MET B N   1 
ATOM   4476 C CA  . MET B 2 14  ? -13.794 -24.200 106.506 1.00 30.75  ? 14  MET B CA  1 
ATOM   4477 C C   . MET B 2 14  ? -15.252 -24.562 106.418 1.00 32.23  ? 14  MET B C   1 
ATOM   4478 O O   . MET B 2 14  ? -15.761 -24.876 105.347 1.00 33.65  ? 14  MET B O   1 
ATOM   4479 C CB  . MET B 2 14  ? -13.615 -22.876 105.760 1.00 30.24  ? 14  MET B CB  1 
ATOM   4480 C CG  . MET B 2 14  ? -14.707 -21.860 106.090 1.00 29.93  ? 14  MET B CG  1 
ATOM   4481 S SD  . MET B 2 14  ? -14.619 -20.358 105.113 1.00 32.57  ? 14  MET B SD  1 
ATOM   4482 C CE  . MET B 2 14  ? -15.465 -19.169 106.209 1.00 31.04  ? 14  MET B CE  1 
ATOM   4483 N N   . ASP B 2 15  ? -15.935 -24.483 107.550 1.00 34.28  ? 15  ASP B N   1 
ATOM   4484 C CA  . ASP B 2 15  ? -17.361 -24.750 107.595 1.00 36.61  ? 15  ASP B CA  1 
ATOM   4485 C C   . ASP B 2 15  ? -18.090 -23.588 106.915 1.00 36.60  ? 15  ASP B C   1 
ATOM   4486 O O   . ASP B 2 15  ? -17.853 -22.424 107.234 1.00 36.16  ? 15  ASP B O   1 
ATOM   4487 C CB  . ASP B 2 15  ? -17.833 -24.852 109.043 1.00 40.56  ? 15  ASP B CB  1 
ATOM   4488 C CG  . ASP B 2 15  ? -19.271 -25.307 109.149 1.00 44.11  ? 15  ASP B CG  1 
ATOM   4489 O OD1 . ASP B 2 15  ? -20.123 -24.744 108.423 1.00 46.41  ? 15  ASP B OD1 1 
ATOM   4490 O OD2 . ASP B 2 15  ? -19.549 -26.228 109.954 1.00 45.56  ? 15  ASP B OD2 1 
ATOM   4491 N N   . VAL B 2 16  ? -18.971 -23.903 105.975 1.00 36.96  ? 16  VAL B N   1 
ATOM   4492 C CA  . VAL B 2 16  ? -19.728 -22.871 105.271 1.00 37.26  ? 16  VAL B CA  1 
ATOM   4493 C C   . VAL B 2 16  ? -21.208 -23.176 105.347 1.00 37.76  ? 16  VAL B C   1 
ATOM   4494 O O   . VAL B 2 16  ? -22.014 -22.554 104.662 1.00 37.41  ? 16  VAL B O   1 
ATOM   4495 C CB  . VAL B 2 16  ? -19.337 -22.788 103.798 1.00 36.47  ? 16  VAL B CB  1 
ATOM   4496 C CG1 . VAL B 2 16  ? -17.923 -22.246 103.676 1.00 36.53  ? 16  VAL B CG1 1 
ATOM   4497 C CG2 . VAL B 2 16  ? -19.464 -24.165 103.156 1.00 34.52  ? 16  VAL B CG2 1 
ATOM   4498 N N   . GLY B 2 17  ? -21.539 -24.142 106.200 1.00 38.64  ? 17  GLY B N   1 
ATOM   4499 C CA  . GLY B 2 17  ? -22.914 -24.560 106.398 1.00 37.71  ? 17  GLY B CA  1 
ATOM   4500 C C   . GLY B 2 17  ? -23.869 -23.428 106.705 1.00 36.07  ? 17  GLY B C   1 
ATOM   4501 O O   . GLY B 2 17  ? -23.460 -22.314 107.037 1.00 35.30  ? 17  GLY B O   1 
ATOM   4502 N N   . PHE B 2 18  ? -25.156 -23.732 106.609 1.00 34.75  ? 18  PHE B N   1 
ATOM   4503 C CA  . PHE B 2 18  ? -26.180 -22.742 106.850 1.00 34.45  ? 18  PHE B CA  1 
ATOM   4504 C C   . PHE B 2 18  ? -26.107 -22.054 108.200 1.00 34.41  ? 18  PHE B C   1 
ATOM   4505 O O   . PHE B 2 18  ? -26.123 -20.825 108.260 1.00 36.17  ? 18  PHE B O   1 
ATOM   4506 C CB  . PHE B 2 18  ? -27.570 -23.352 106.694 1.00 32.49  ? 18  PHE B CB  1 
ATOM   4507 C CG  . PHE B 2 18  ? -28.675 -22.343 106.807 1.00 31.71  ? 18  PHE B CG  1 
ATOM   4508 C CD1 . PHE B 2 18  ? -28.837 -21.358 105.830 1.00 31.13  ? 18  PHE B CD1 1 
ATOM   4509 C CD2 . PHE B 2 18  ? -29.546 -22.358 107.893 1.00 29.99  ? 18  PHE B CD2 1 
ATOM   4510 C CE1 . PHE B 2 18  ? -29.850 -20.404 105.932 1.00 28.57  ? 18  PHE B CE1 1 
ATOM   4511 C CE2 . PHE B 2 18  ? -30.560 -21.408 108.003 1.00 28.54  ? 18  PHE B CE2 1 
ATOM   4512 C CZ  . PHE B 2 18  ? -30.712 -20.430 107.017 1.00 28.40  ? 18  PHE B CZ  1 
ATOM   4513 N N   . THR B 2 19  ? -26.041 -22.826 109.281 1.00 33.79  ? 19  THR B N   1 
ATOM   4514 C CA  . THR B 2 19  ? -26.004 -22.207 110.602 1.00 34.29  ? 19  THR B CA  1 
ATOM   4515 C C   . THR B 2 19  ? -24.819 -21.273 110.800 1.00 34.60  ? 19  THR B C   1 
ATOM   4516 O O   . THR B 2 19  ? -24.812 -20.479 111.733 1.00 33.48  ? 19  THR B O   1 
ATOM   4517 C CB  . THR B 2 19  ? -26.025 -23.249 111.748 1.00 32.50  ? 19  THR B CB  1 
ATOM   4518 O OG1 . THR B 2 19  ? -24.995 -24.215 111.548 1.00 33.75  ? 19  THR B OG1 1 
ATOM   4519 C CG2 . THR B 2 19  ? -27.352 -23.946 111.804 1.00 32.36  ? 19  THR B CG2 1 
ATOM   4520 N N   . MET B 2 20  ? -23.821 -21.362 109.927 1.00 36.44  ? 20  MET B N   1 
ATOM   4521 C CA  . MET B 2 20  ? -22.666 -20.481 110.040 1.00 38.36  ? 20  MET B CA  1 
ATOM   4522 C C   . MET B 2 20  ? -23.118 -19.055 109.766 1.00 41.33  ? 20  MET B C   1 
ATOM   4523 O O   . MET B 2 20  ? -22.483 -18.098 110.206 1.00 42.47  ? 20  MET B O   1 
ATOM   4524 C CB  . MET B 2 20  ? -21.578 -20.864 109.034 1.00 35.68  ? 20  MET B CB  1 
ATOM   4525 C CG  . MET B 2 20  ? -20.746 -22.072 109.438 1.00 33.35  ? 20  MET B CG  1 
ATOM   4526 S SD  . MET B 2 20  ? -19.783 -21.854 110.951 1.00 29.64  ? 20  MET B SD  1 
ATOM   4527 C CE  . MET B 2 20  ? -18.513 -20.700 110.403 1.00 25.56  ? 20  MET B CE  1 
ATOM   4528 N N   . SER B 2 21  ? -24.230 -18.916 109.053 1.00 43.81  ? 21  SER B N   1 
ATOM   4529 C CA  . SER B 2 21  ? -24.744 -17.596 108.707 1.00 47.10  ? 21  SER B CA  1 
ATOM   4530 C C   . SER B 2 21  ? -25.636 -16.965 109.778 1.00 49.48  ? 21  SER B C   1 
ATOM   4531 O O   . SER B 2 21  ? -25.813 -15.744 109.800 1.00 49.27  ? 21  SER B O   1 
ATOM   4532 C CB  . SER B 2 21  ? -25.493 -17.687 107.387 1.00 46.64  ? 21  SER B CB  1 
ATOM   4533 O OG  . SER B 2 21  ? -24.695 -18.380 106.446 1.00 50.47  ? 21  SER B OG  1 
ATOM   4534 N N   . ASN B 2 22  ? -26.198 -17.797 110.656 1.00 51.78  ? 22  ASN B N   1 
ATOM   4535 C CA  . ASN B 2 22  ? -27.054 -17.320 111.736 1.00 52.82  ? 22  ASN B CA  1 
ATOM   4536 C C   . ASN B 2 22  ? -26.409 -16.092 112.324 1.00 54.63  ? 22  ASN B C   1 
ATOM   4537 O O   . ASN B 2 22  ? -25.271 -16.139 112.765 1.00 53.79  ? 22  ASN B O   1 
ATOM   4538 C CB  . ASN B 2 22  ? -27.185 -18.385 112.819 1.00 52.73  ? 22  ASN B CB  1 
ATOM   4539 C CG  . ASN B 2 22  ? -28.190 -19.463 112.463 1.00 53.62  ? 22  ASN B CG  1 
ATOM   4540 O OD1 . ASN B 2 22  ? -28.531 -19.665 111.289 1.00 52.08  ? 22  ASN B OD1 1 
ATOM   4541 N ND2 . ASN B 2 22  ? -28.663 -20.176 113.480 1.00 53.86  ? 22  ASN B ND2 1 
ATOM   4542 N N   . SER B 2 23  ? -27.141 -14.991 112.339 1.00 59.21  ? 23  SER B N   1 
ATOM   4543 C CA  . SER B 2 23  ? -26.592 -13.754 112.861 1.00 63.57  ? 23  SER B CA  1 
ATOM   4544 C C   . SER B 2 23  ? -27.355 -13.139 114.027 1.00 65.76  ? 23  SER B C   1 
ATOM   4545 O O   . SER B 2 23  ? -28.506 -12.715 113.887 1.00 66.79  ? 23  SER B O   1 
ATOM   4546 C CB  . SER B 2 23  ? -26.474 -12.729 111.727 1.00 64.86  ? 23  SER B CB  1 
ATOM   4547 O OG  . SER B 2 23  ? -27.709 -12.568 111.044 1.00 67.24  ? 23  SER B OG  1 
ATOM   4548 N N   . ILE B 2 24  ? -26.695 -13.101 115.179 1.00 67.86  ? 24  ILE B N   1 
ATOM   4549 C CA  . ILE B 2 24  ? -27.252 -12.495 116.385 1.00 69.87  ? 24  ILE B CA  1 
ATOM   4550 C C   . ILE B 2 24  ? -27.021 -10.980 116.266 1.00 71.69  ? 24  ILE B C   1 
ATOM   4551 O O   . ILE B 2 24  ? -25.939 -10.540 115.860 1.00 72.27  ? 24  ILE B O   1 
ATOM   4552 C CB  . ILE B 2 24  ? -26.535 -13.024 117.644 1.00 69.16  ? 24  ILE B CB  1 
ATOM   4553 C CG1 . ILE B 2 24  ? -26.975 -14.464 117.917 1.00 69.19  ? 24  ILE B CG1 1 
ATOM   4554 C CG2 . ILE B 2 24  ? -26.810 -12.113 118.832 1.00 68.58  ? 24  ILE B CG2 1 
ATOM   4555 C CD1 . ILE B 2 24  ? -26.190 -15.152 119.024 1.00 68.96  ? 24  ILE B CD1 1 
ATOM   4556 N N   . PRO B 2 25  ? -28.025 -10.161 116.629 1.00 72.41  ? 25  PRO B N   1 
ATOM   4557 C CA  . PRO B 2 25  ? -27.864 -8.704  116.529 1.00 71.67  ? 25  PRO B CA  1 
ATOM   4558 C C   . PRO B 2 25  ? -26.529 -8.176  117.055 1.00 70.46  ? 25  PRO B C   1 
ATOM   4559 O O   . PRO B 2 25  ? -26.120 -8.495  118.176 1.00 69.76  ? 25  PRO B O   1 
ATOM   4560 C CB  . PRO B 2 25  ? -29.054 -8.169  117.327 1.00 72.24  ? 25  PRO B CB  1 
ATOM   4561 C CG  . PRO B 2 25  ? -29.301 -9.268  118.340 1.00 73.50  ? 25  PRO B CG  1 
ATOM   4562 C CD  . PRO B 2 25  ? -29.187 -10.498 117.471 1.00 72.58  ? 25  PRO B CD  1 
ATOM   4563 N N   . GLY B 2 26  ? -25.849 -7.387  116.225 1.00 69.10  ? 26  GLY B N   1 
ATOM   4564 C CA  . GLY B 2 26  ? -24.578 -6.796  116.617 1.00 66.85  ? 26  GLY B CA  1 
ATOM   4565 C C   . GLY B 2 26  ? -23.319 -7.647  116.517 1.00 64.79  ? 26  GLY B C   1 
ATOM   4566 O O   . GLY B 2 26  ? -22.237 -7.119  116.260 1.00 65.41  ? 26  GLY B O   1 
ATOM   4567 N N   . ILE B 2 27  ? -23.455 -8.954  116.718 1.00 61.82  ? 27  ILE B N   1 
ATOM   4568 C CA  . ILE B 2 27  ? -22.320 -9.879  116.663 1.00 58.32  ? 27  ILE B CA  1 
ATOM   4569 C C   . ILE B 2 27  ? -22.110 -10.489 115.280 1.00 55.96  ? 27  ILE B C   1 
ATOM   4570 O O   . ILE B 2 27  ? -23.036 -11.073 114.718 1.00 56.36  ? 27  ILE B O   1 
ATOM   4571 C CB  . ILE B 2 27  ? -22.529 -11.052 117.627 1.00 58.67  ? 27  ILE B CB  1 
ATOM   4572 C CG1 . ILE B 2 27  ? -22.910 -10.524 119.006 1.00 59.09  ? 27  ILE B CG1 1 
ATOM   4573 C CG2 . ILE B 2 27  ? -21.274 -11.925 117.677 1.00 56.40  ? 27  ILE B CG2 1 
ATOM   4574 C CD1 . ILE B 2 27  ? -23.507 -11.595 119.897 1.00 57.80  ? 27  ILE B CD1 1 
ATOM   4575 N N   . GLU B 2 28  ? -20.896 -10.378 114.744 1.00 52.69  ? 28  GLU B N   1 
ATOM   4576 C CA  . GLU B 2 28  ? -20.596 -10.955 113.441 1.00 49.32  ? 28  GLU B CA  1 
ATOM   4577 C C   . GLU B 2 28  ? -20.901 -12.458 113.486 1.00 46.05  ? 28  GLU B C   1 
ATOM   4578 O O   . GLU B 2 28  ? -20.683 -13.121 114.498 1.00 44.72  ? 28  GLU B O   1 
ATOM   4579 C CB  . GLU B 2 28  ? -19.134 -10.699 113.088 1.00 51.12  ? 28  GLU B CB  1 
ATOM   4580 C CG  . GLU B 2 28  ? -18.967 -9.772  111.907 1.00 56.82  ? 28  GLU B CG  1 
ATOM   4581 C CD  . GLU B 2 28  ? -17.569 -9.179  111.808 1.00 61.21  ? 28  GLU B CD  1 
ATOM   4582 O OE1 . GLU B 2 28  ? -17.205 -8.362  112.687 1.00 63.35  ? 28  GLU B OE1 1 
ATOM   4583 O OE2 . GLU B 2 28  ? -16.835 -9.526  110.851 1.00 62.54  ? 28  GLU B OE2 1 
ATOM   4584 N N   . SER B 2 29  ? -21.432 -12.989 112.395 1.00 42.11  ? 29  SER B N   1 
ATOM   4585 C CA  . SER B 2 29  ? -21.788 -14.397 112.348 1.00 38.18  ? 29  SER B CA  1 
ATOM   4586 C C   . SER B 2 29  ? -20.571 -15.295 112.253 1.00 37.26  ? 29  SER B C   1 
ATOM   4587 O O   . SER B 2 29  ? -19.512 -14.870 111.799 1.00 38.25  ? 29  SER B O   1 
ATOM   4588 C CB  . SER B 2 29  ? -22.679 -14.658 111.144 1.00 36.33  ? 29  SER B CB  1 
ATOM   4589 O OG  . SER B 2 29  ? -21.961 -14.414 109.953 1.00 32.41  ? 29  SER B OG  1 
ATOM   4590 N N   . PRO B 2 30  ? -20.701 -16.557 112.688 1.00 34.78  ? 30  PRO B N   1 
ATOM   4591 C CA  . PRO B 2 30  ? -19.568 -17.470 112.612 1.00 32.79  ? 30  PRO B CA  1 
ATOM   4592 C C   . PRO B 2 30  ? -18.878 -17.418 111.252 1.00 32.70  ? 30  PRO B C   1 
ATOM   4593 O O   . PRO B 2 30  ? -17.654 -17.402 111.179 1.00 34.04  ? 30  PRO B O   1 
ATOM   4594 C CB  . PRO B 2 30  ? -20.214 -18.814 112.899 1.00 32.25  ? 30  PRO B CB  1 
ATOM   4595 C CG  . PRO B 2 30  ? -21.172 -18.454 113.968 1.00 32.31  ? 30  PRO B CG  1 
ATOM   4596 C CD  . PRO B 2 30  ? -21.803 -17.173 113.448 1.00 34.37  ? 30  PRO B CD  1 
ATOM   4597 N N   . PHE B 2 31  ? -19.664 -17.369 110.183 1.00 32.21  ? 31  PHE B N   1 
ATOM   4598 C CA  . PHE B 2 31  ? -19.111 -17.327 108.837 1.00 32.30  ? 31  PHE B CA  1 
ATOM   4599 C C   . PHE B 2 31  ? -18.213 -16.122 108.620 1.00 33.48  ? 31  PHE B C   1 
ATOM   4600 O O   . PHE B 2 31  ? -17.140 -16.237 108.029 1.00 34.97  ? 31  PHE B O   1 
ATOM   4601 C CB  . PHE B 2 31  ? -20.220 -17.301 107.786 1.00 31.20  ? 31  PHE B CB  1 
ATOM   4602 C CG  . PHE B 2 31  ? -19.706 -17.193 106.372 1.00 30.33  ? 31  PHE B CG  1 
ATOM   4603 C CD1 . PHE B 2 31  ? -19.178 -18.304 105.720 1.00 30.18  ? 31  PHE B CD1 1 
ATOM   4604 C CD2 . PHE B 2 31  ? -19.723 -15.972 105.699 1.00 30.03  ? 31  PHE B CD2 1 
ATOM   4605 C CE1 . PHE B 2 31  ? -18.680 -18.204 104.423 1.00 29.26  ? 31  PHE B CE1 1 
ATOM   4606 C CE2 . PHE B 2 31  ? -19.224 -15.861 104.398 1.00 28.30  ? 31  PHE B CE2 1 
ATOM   4607 C CZ  . PHE B 2 31  ? -18.705 -16.976 103.763 1.00 28.57  ? 31  PHE B CZ  1 
ATOM   4608 N N   . GLU B 2 32  ? -18.651 -14.961 109.086 1.00 33.72  ? 32  GLU B N   1 
ATOM   4609 C CA  . GLU B 2 32  ? -17.859 -13.747 108.918 1.00 35.46  ? 32  GLU B CA  1 
ATOM   4610 C C   . GLU B 2 32  ? -16.590 -13.730 109.760 1.00 35.01  ? 32  GLU B C   1 
ATOM   4611 O O   . GLU B 2 32  ? -15.569 -13.165 109.354 1.00 35.73  ? 32  GLU B O   1 
ATOM   4612 C CB  . GLU B 2 32  ? -18.703 -12.525 109.242 1.00 36.62  ? 32  GLU B CB  1 
ATOM   4613 C CG  . GLU B 2 32  ? -19.714 -12.207 108.179 1.00 40.22  ? 32  GLU B CG  1 
ATOM   4614 C CD  . GLU B 2 32  ? -19.055 -11.825 106.875 1.00 44.21  ? 32  GLU B CD  1 
ATOM   4615 O OE1 . GLU B 2 32  ? -18.640 -12.724 106.104 1.00 46.24  ? 32  GLU B OE1 1 
ATOM   4616 O OE2 . GLU B 2 32  ? -18.939 -10.608 106.630 1.00 47.05  ? 32  GLU B OE2 1 
ATOM   4617 N N   . GLN B 2 33  ? -16.663 -14.335 110.940 1.00 33.13  ? 33  GLN B N   1 
ATOM   4618 C CA  . GLN B 2 33  ? -15.511 -14.399 111.813 1.00 31.81  ? 33  GLN B CA  1 
ATOM   4619 C C   . GLN B 2 33  ? -14.507 -15.349 111.192 1.00 30.76  ? 33  GLN B C   1 
ATOM   4620 O O   . GLN B 2 33  ? -13.329 -15.025 111.070 1.00 31.31  ? 33  GLN B O   1 
ATOM   4621 C CB  . GLN B 2 33  ? -15.912 -14.899 113.204 1.00 32.65  ? 33  GLN B CB  1 
ATOM   4622 C CG  . GLN B 2 33  ? -16.643 -13.865 114.047 1.00 33.74  ? 33  GLN B CG  1 
ATOM   4623 C CD  . GLN B 2 33  ? -16.978 -14.361 115.448 1.00 34.46  ? 33  GLN B CD  1 
ATOM   4624 O OE1 . GLN B 2 33  ? -16.160 -14.999 116.105 1.00 35.94  ? 33  GLN B OE1 1 
ATOM   4625 N NE2 . GLN B 2 33  ? -18.177 -14.045 115.918 1.00 36.46  ? 33  GLN B NE2 1 
ATOM   4626 N N   . ALA B 2 34  ? -14.975 -16.523 110.792 1.00 29.01  ? 34  ALA B N   1 
ATOM   4627 C CA  . ALA B 2 34  ? -14.092 -17.503 110.190 1.00 29.61  ? 34  ALA B CA  1 
ATOM   4628 C C   . ALA B 2 34  ? -13.427 -16.881 108.967 1.00 30.87  ? 34  ALA B C   1 
ATOM   4629 O O   . ALA B 2 34  ? -12.224 -17.033 108.735 1.00 30.01  ? 34  ALA B O   1 
ATOM   4630 C CB  . ALA B 2 34  ? -14.876 -18.727 109.798 1.00 28.03  ? 34  ALA B CB  1 
ATOM   4631 N N   . LYS B 2 35  ? -14.215 -16.163 108.188 1.00 30.50  ? 35  LYS B N   1 
ATOM   4632 C CA  . LYS B 2 35  ? -13.678 -15.527 107.010 1.00 32.54  ? 35  LYS B CA  1 
ATOM   4633 C C   . LYS B 2 35  ? -12.548 -14.583 107.453 1.00 32.30  ? 35  LYS B C   1 
ATOM   4634 O O   . LYS B 2 35  ? -11.509 -14.496 106.803 1.00 33.45  ? 35  LYS B O   1 
ATOM   4635 C CB  . LYS B 2 35  ? -14.797 -14.772 106.298 1.00 34.99  ? 35  LYS B CB  1 
ATOM   4636 C CG  . LYS B 2 35  ? -14.577 -14.455 104.833 1.00 37.92  ? 35  LYS B CG  1 
ATOM   4637 C CD  . LYS B 2 35  ? -15.852 -13.802 104.319 1.00 45.53  ? 35  LYS B CD  1 
ATOM   4638 C CE  . LYS B 2 35  ? -15.685 -13.012 103.034 1.00 48.65  ? 35  LYS B CE  1 
ATOM   4639 N NZ  . LYS B 2 35  ? -16.925 -12.210 102.763 1.00 50.87  ? 35  LYS B NZ  1 
ATOM   4640 N N   . LYS B 2 36  ? -12.731 -13.888 108.569 1.00 30.80  ? 36  LYS B N   1 
ATOM   4641 C CA  . LYS B 2 36  ? -11.680 -12.985 109.039 1.00 29.98  ? 36  LYS B CA  1 
ATOM   4642 C C   . LYS B 2 36  ? -10.413 -13.738 109.462 1.00 27.76  ? 36  LYS B C   1 
ATOM   4643 O O   . LYS B 2 36  ? -9.306  -13.384 109.074 1.00 28.34  ? 36  LYS B O   1 
ATOM   4644 C CB  . LYS B 2 36  ? -12.178 -12.122 110.205 1.00 30.57  ? 36  LYS B CB  1 
ATOM   4645 C CG  . LYS B 2 36  ? -13.120 -11.017 109.791 1.00 33.20  ? 36  LYS B CG  1 
ATOM   4646 C CD  . LYS B 2 36  ? -13.308 -10.013 110.906 1.00 33.73  ? 36  LYS B CD  1 
ATOM   4647 C CE  . LYS B 2 36  ? -14.131 -8.831  110.433 1.00 35.50  ? 36  LYS B CE  1 
ATOM   4648 N NZ  . LYS B 2 36  ? -14.087 -7.698  111.414 1.00 40.14  ? 36  LYS B NZ  1 
ATOM   4649 N N   . VAL B 2 37  ? -10.573 -14.772 110.268 1.00 23.93  ? 37  VAL B N   1 
ATOM   4650 C CA  . VAL B 2 37  ? -9.428  -15.535 110.699 1.00 20.70  ? 37  VAL B CA  1 
ATOM   4651 C C   . VAL B 2 37  ? -8.703  -16.129 109.501 1.00 20.32  ? 37  VAL B C   1 
ATOM   4652 O O   . VAL B 2 37  ? -7.488  -16.015 109.390 1.00 20.76  ? 37  VAL B O   1 
ATOM   4653 C CB  . VAL B 2 37  ? -9.844  -16.675 111.635 1.00 20.72  ? 37  VAL B CB  1 
ATOM   4654 C CG1 . VAL B 2 37  ? -8.686  -17.635 111.825 1.00 17.70  ? 37  VAL B CG1 1 
ATOM   4655 C CG2 . VAL B 2 37  ? -10.291 -16.104 112.973 1.00 20.72  ? 37  VAL B CG2 1 
ATOM   4656 N N   . ILE B 2 38  ? -9.451  -16.768 108.606 1.00 19.05  ? 38  ILE B N   1 
ATOM   4657 C CA  . ILE B 2 38  ? -8.860  -17.395 107.428 1.00 17.30  ? 38  ILE B CA  1 
ATOM   4658 C C   . ILE B 2 38  ? -8.035  -16.434 106.594 1.00 17.68  ? 38  ILE B C   1 
ATOM   4659 O O   . ILE B 2 38  ? -6.951  -16.780 106.119 1.00 15.67  ? 38  ILE B O   1 
ATOM   4660 C CB  . ILE B 2 38  ? -9.940  -18.027 106.546 1.00 16.86  ? 38  ILE B CB  1 
ATOM   4661 C CG1 . ILE B 2 38  ? -10.397 -19.340 107.183 1.00 18.77  ? 38  ILE B CG1 1 
ATOM   4662 C CG2 . ILE B 2 38  ? -9.399  -18.280 105.158 1.00 16.44  ? 38  ILE B CG2 1 
ATOM   4663 C CD1 . ILE B 2 38  ? -11.630 -19.945 106.558 1.00 19.62  ? 38  ILE B CD1 1 
ATOM   4664 N N   . THR B 2 39  ? -8.557  -15.227 106.417 1.00 17.85  ? 39  THR B N   1 
ATOM   4665 C CA  . THR B 2 39  ? -7.866  -14.214 105.647 1.00 19.07  ? 39  THR B CA  1 
ATOM   4666 C C   . THR B 2 39  ? -6.627  -13.728 106.367 1.00 19.48  ? 39  THR B C   1 
ATOM   4667 O O   . THR B 2 39  ? -5.654  -13.324 105.740 1.00 21.39  ? 39  THR B O   1 
ATOM   4668 C CB  . THR B 2 39  ? -8.759  -13.013 105.402 1.00 18.87  ? 39  THR B CB  1 
ATOM   4669 O OG1 . THR B 2 39  ? -9.928  -13.444 104.705 1.00 22.35  ? 39  THR B OG1 1 
ATOM   4670 C CG2 . THR B 2 39  ? -8.027  -11.962 104.578 1.00 16.79  ? 39  THR B CG2 1 
ATOM   4671 N N   . MET B 2 40  ? -6.670  -13.742 107.688 1.00 19.30  ? 40  MET B N   1 
ATOM   4672 C CA  . MET B 2 40  ? -5.525  -13.302 108.460 1.00 21.23  ? 40  MET B CA  1 
ATOM   4673 C C   . MET B 2 40  ? -4.370  -14.264 108.195 1.00 22.92  ? 40  MET B C   1 
ATOM   4674 O O   . MET B 2 40  ? -3.210  -13.848 108.118 1.00 23.66  ? 40  MET B O   1 
ATOM   4675 C CB  . MET B 2 40  ? -5.870  -13.311 109.941 1.00 19.63  ? 40  MET B CB  1 
ATOM   4676 C CG  . MET B 2 40  ? -4.775  -12.872 110.867 1.00 16.80  ? 40  MET B CG  1 
ATOM   4677 S SD  . MET B 2 40  ? -5.227  -13.376 112.521 1.00 22.96  ? 40  MET B SD  1 
ATOM   4678 C CE  . MET B 2 40  ? -3.734  -12.856 113.449 1.00 23.61  ? 40  MET B CE  1 
ATOM   4679 N N   . PHE B 2 41  ? -4.705  -15.547 108.049 1.00 22.07  ? 41  PHE B N   1 
ATOM   4680 C CA  . PHE B 2 41  ? -3.714  -16.589 107.803 1.00 22.22  ? 41  PHE B CA  1 
ATOM   4681 C C   . PHE B 2 41  ? -3.127  -16.444 106.414 1.00 22.78  ? 41  PHE B C   1 
ATOM   4682 O O   . PHE B 2 41  ? -1.915  -16.305 106.254 1.00 21.84  ? 41  PHE B O   1 
ATOM   4683 C CB  . PHE B 2 41  ? -4.354  -17.969 107.936 1.00 23.53  ? 41  PHE B CB  1 
ATOM   4684 C CG  . PHE B 2 41  ? -3.391  -19.109 107.767 1.00 24.59  ? 41  PHE B CG  1 
ATOM   4685 C CD1 . PHE B 2 41  ? -2.535  -19.476 108.803 1.00 25.81  ? 41  PHE B CD1 1 
ATOM   4686 C CD2 . PHE B 2 41  ? -3.344  -19.823 106.574 1.00 26.16  ? 41  PHE B CD2 1 
ATOM   4687 C CE1 . PHE B 2 41  ? -1.641  -20.541 108.653 1.00 26.04  ? 41  PHE B CE1 1 
ATOM   4688 C CE2 . PHE B 2 41  ? -2.457  -20.893 106.403 1.00 25.65  ? 41  PHE B CE2 1 
ATOM   4689 C CZ  . PHE B 2 41  ? -1.604  -21.255 107.443 1.00 27.40  ? 41  PHE B CZ  1 
ATOM   4690 N N   . VAL B 2 42  ? -3.997  -16.458 105.409 1.00 23.52  ? 42  VAL B N   1 
ATOM   4691 C CA  . VAL B 2 42  ? -3.551  -16.347 104.031 1.00 24.57  ? 42  VAL B CA  1 
ATOM   4692 C C   . VAL B 2 42  ? -2.793  -15.043 103.765 1.00 25.74  ? 42  VAL B C   1 
ATOM   4693 O O   . VAL B 2 42  ? -1.766  -15.066 103.103 1.00 26.00  ? 42  VAL B O   1 
ATOM   4694 C CB  . VAL B 2 42  ? -4.742  -16.541 103.046 1.00 23.79  ? 42  VAL B CB  1 
ATOM   4695 C CG1 . VAL B 2 42  ? -4.255  -16.511 101.613 1.00 21.58  ? 42  VAL B CG1 1 
ATOM   4696 C CG2 . VAL B 2 42  ? -5.402  -17.892 103.312 1.00 23.52  ? 42  VAL B CG2 1 
ATOM   4697 N N   . GLN B 2 43  ? -3.268  -13.915 104.284 1.00 27.67  ? 43  GLN B N   1 
ATOM   4698 C CA  . GLN B 2 43  ? -2.553  -12.658 104.081 1.00 30.10  ? 43  GLN B CA  1 
ATOM   4699 C C   . GLN B 2 43  ? -1.090  -12.841 104.492 1.00 31.10  ? 43  GLN B C   1 
ATOM   4700 O O   . GLN B 2 43  ? -0.166  -12.598 103.714 1.00 31.10  ? 43  GLN B O   1 
ATOM   4701 C CB  . GLN B 2 43  ? -3.128  -11.541 104.946 1.00 32.02  ? 43  GLN B CB  1 
ATOM   4702 C CG  . GLN B 2 43  ? -4.471  -10.969 104.547 1.00 33.85  ? 43  GLN B CG  1 
ATOM   4703 C CD  . GLN B 2 43  ? -4.792  -9.725  105.360 1.00 35.25  ? 43  GLN B CD  1 
ATOM   4704 O OE1 . GLN B 2 43  ? -4.421  -9.632  106.540 1.00 36.70  ? 43  GLN B OE1 1 
ATOM   4705 N NE2 . GLN B 2 43  ? -5.484  -8.765  104.743 1.00 34.00  ? 43  GLN B NE2 1 
ATOM   4706 N N   . ARG B 2 44  ? -0.895  -13.256 105.738 1.00 31.48  ? 44  ARG B N   1 
ATOM   4707 C CA  . ARG B 2 44  ? 0.438   -13.465 106.286 1.00 31.66  ? 44  ARG B CA  1 
ATOM   4708 C C   . ARG B 2 44  ? 1.290   -14.334 105.363 1.00 29.79  ? 44  ARG B C   1 
ATOM   4709 O O   . ARG B 2 44  ? 2.405   -13.965 105.017 1.00 29.79  ? 44  ARG B O   1 
ATOM   4710 C CB  . ARG B 2 44  ? 0.327   -14.101 107.687 1.00 34.15  ? 44  ARG B CB  1 
ATOM   4711 C CG  . ARG B 2 44  ? 1.614   -14.701 108.279 1.00 37.86  ? 44  ARG B CG  1 
ATOM   4712 C CD  . ARG B 2 44  ? 2.660   -13.655 108.687 1.00 43.73  ? 44  ARG B CD  1 
ATOM   4713 N NE  . ARG B 2 44  ? 2.291   -12.856 109.859 1.00 45.21  ? 44  ARG B NE  1 
ATOM   4714 C CZ  . ARG B 2 44  ? 3.024   -11.848 110.336 1.00 46.30  ? 44  ARG B CZ  1 
ATOM   4715 N NH1 . ARG B 2 44  ? 4.169   -11.511 109.748 1.00 46.53  ? 44  ARG B NH1 1 
ATOM   4716 N NH2 . ARG B 2 44  ? 2.606   -11.161 111.394 1.00 47.12  ? 44  ARG B NH2 1 
ATOM   4717 N N   . GLN B 2 45  ? 0.761   -15.475 104.947 1.00 27.55  ? 45  GLN B N   1 
ATOM   4718 C CA  . GLN B 2 45  ? 1.506   -16.384 104.093 1.00 25.77  ? 45  GLN B CA  1 
ATOM   4719 C C   . GLN B 2 45  ? 1.923   -15.771 102.764 1.00 26.52  ? 45  GLN B C   1 
ATOM   4720 O O   . GLN B 2 45  ? 2.983   -16.090 102.214 1.00 26.13  ? 45  GLN B O   1 
ATOM   4721 C CB  . GLN B 2 45  ? 0.676   -17.637 103.829 1.00 26.51  ? 45  GLN B CB  1 
ATOM   4722 C CG  . GLN B 2 45  ? 0.366   -18.464 105.066 1.00 25.48  ? 45  GLN B CG  1 
ATOM   4723 C CD  . GLN B 2 45  ? 1.618   -18.949 105.768 1.00 27.42  ? 45  GLN B CD  1 
ATOM   4724 O OE1 . GLN B 2 45  ? 1.834   -18.647 106.950 1.00 29.12  ? 45  GLN B OE1 1 
ATOM   4725 N NE2 . GLN B 2 45  ? 2.455   -19.706 105.049 1.00 25.20  ? 45  GLN B NE2 1 
ATOM   4726 N N   . VAL B 2 46  ? 1.092   -14.874 102.256 1.00 26.27  ? 46  VAL B N   1 
ATOM   4727 C CA  . VAL B 2 46  ? 1.345   -14.250 100.974 1.00 26.32  ? 46  VAL B CA  1 
ATOM   4728 C C   . VAL B 2 46  ? 2.339   -13.099 100.975 1.00 27.87  ? 46  VAL B C   1 
ATOM   4729 O O   . VAL B 2 46  ? 3.340   -13.153 100.263 1.00 29.40  ? 46  VAL B O   1 
ATOM   4730 C CB  . VAL B 2 46  ? 0.008   -13.813 100.342 1.00 24.85  ? 46  VAL B CB  1 
ATOM   4731 C CG1 . VAL B 2 46  ? 0.245   -12.894 99.147  1.00 22.27  ? 46  VAL B CG1 1 
ATOM   4732 C CG2 . VAL B 2 46  ? -0.763  -15.065 99.918  1.00 22.24  ? 46  VAL B CG2 1 
ATOM   4733 N N   . PHE B 2 47  ? 2.067   -12.061 101.758 1.00 29.62  ? 47  PHE B N   1 
ATOM   4734 C CA  . PHE B 2 47  ? 2.962   -10.904 101.829 1.00 30.40  ? 47  PHE B CA  1 
ATOM   4735 C C   . PHE B 2 47  ? 4.272   -11.229 102.547 1.00 31.86  ? 47  PHE B C   1 
ATOM   4736 O O   . PHE B 2 47  ? 5.240   -10.474 102.467 1.00 33.11  ? 47  PHE B O   1 
ATOM   4737 C CB  . PHE B 2 47  ? 2.258   -9.731  102.513 1.00 28.94  ? 47  PHE B CB  1 
ATOM   4738 C CG  . PHE B 2 47  ? 0.950   -9.366  101.872 1.00 28.91  ? 47  PHE B CG  1 
ATOM   4739 C CD1 . PHE B 2 47  ? -0.247  -9.482  102.581 1.00 29.47  ? 47  PHE B CD1 1 
ATOM   4740 C CD2 . PHE B 2 47  ? 0.904   -8.939  100.552 1.00 28.00  ? 47  PHE B CD2 1 
ATOM   4741 C CE1 . PHE B 2 47  ? -1.464  -9.179  101.980 1.00 27.53  ? 47  PHE B CE1 1 
ATOM   4742 C CE2 . PHE B 2 47  ? -0.312  -8.634  99.947  1.00 27.18  ? 47  PHE B CE2 1 
ATOM   4743 C CZ  . PHE B 2 47  ? -1.494  -8.755  100.663 1.00 25.94  ? 47  PHE B CZ  1 
ATOM   4744 N N   . ALA B 2 48  ? 4.306   -12.356 103.250 1.00 32.78  ? 48  ALA B N   1 
ATOM   4745 C CA  . ALA B 2 48  ? 5.522   -12.770 103.934 1.00 33.82  ? 48  ALA B CA  1 
ATOM   4746 C C   . ALA B 2 48  ? 6.358   -13.588 102.939 1.00 35.18  ? 48  ALA B C   1 
ATOM   4747 O O   . ALA B 2 48  ? 7.571   -13.728 103.088 1.00 36.37  ? 48  ALA B O   1 
ATOM   4748 C CB  . ALA B 2 48  ? 5.175   -13.594 105.146 1.00 33.74  ? 48  ALA B CB  1 
ATOM   4749 N N   . GLU B 2 49  ? 5.685   -14.119 101.922 1.00 35.71  ? 49  GLU B N   1 
ATOM   4750 C CA  . GLU B 2 49  ? 6.308   -14.896 100.855 1.00 36.61  ? 49  GLU B CA  1 
ATOM   4751 C C   . GLU B 2 49  ? 6.727   -16.297 101.253 1.00 37.08  ? 49  GLU B C   1 
ATOM   4752 O O   . GLU B 2 49  ? 7.607   -16.900 100.631 1.00 36.92  ? 49  GLU B O   1 
ATOM   4753 C CB  . GLU B 2 49  ? 7.510   -14.144 100.284 1.00 37.12  ? 49  GLU B CB  1 
ATOM   4754 C CG  . GLU B 2 49  ? 7.207   -12.691 99.948  1.00 38.81  ? 49  GLU B CG  1 
ATOM   4755 C CD  . GLU B 2 49  ? 7.901   -12.213 98.693  1.00 39.04  ? 49  GLU B CD  1 
ATOM   4756 O OE1 . GLU B 2 49  ? 7.497   -12.640 97.591  1.00 39.99  ? 49  GLU B OE1 1 
ATOM   4757 O OE2 . GLU B 2 49  ? 8.849   -11.410 98.810  1.00 39.69  ? 49  GLU B OE2 1 
ATOM   4758 N N   . ASN B 2 50  ? 6.084   -16.827 102.280 1.00 36.34  ? 50  ASN B N   1 
ATOM   4759 C CA  . ASN B 2 50  ? 6.417   -18.166 102.720 1.00 37.88  ? 50  ASN B CA  1 
ATOM   4760 C C   . ASN B 2 50  ? 6.010   -19.166 101.639 1.00 37.30  ? 50  ASN B C   1 
ATOM   4761 O O   . ASN B 2 50  ? 5.006   -18.962 100.961 1.00 37.85  ? 50  ASN B O   1 
ATOM   4762 C CB  . ASN B 2 50  ? 5.702   -18.458 104.036 1.00 39.38  ? 50  ASN B CB  1 
ATOM   4763 C CG  . ASN B 2 50  ? 5.998   -17.407 105.090 1.00 40.84  ? 50  ASN B CG  1 
ATOM   4764 O OD1 . ASN B 2 50  ? 7.159   -17.049 105.317 1.00 42.81  ? 50  ASN B OD1 1 
ATOM   4765 N ND2 . ASN B 2 50  ? 4.957   -16.906 105.739 1.00 40.48  ? 50  ASN B ND2 1 
ATOM   4766 N N   . LYS B 2 51  ? 6.800   -20.226 101.472 1.00 35.55  ? 51  LYS B N   1 
ATOM   4767 C CA  . LYS B 2 51  ? 6.513   -21.254 100.474 1.00 35.02  ? 51  LYS B CA  1 
ATOM   4768 C C   . LYS B 2 51  ? 5.738   -22.432 101.048 1.00 36.22  ? 51  LYS B C   1 
ATOM   4769 O O   . LYS B 2 51  ? 5.801   -23.549 100.529 1.00 36.40  ? 51  LYS B O   1 
ATOM   4770 C CB  . LYS B 2 51  ? 7.800   -21.766 99.847  1.00 32.45  ? 51  LYS B CB  1 
ATOM   4771 C CG  . LYS B 2 51  ? 8.680   -20.666 99.369  1.00 30.12  ? 51  LYS B CG  1 
ATOM   4772 C CD  . LYS B 2 51  ? 7.986   -19.811 98.360  1.00 28.72  ? 51  LYS B CD  1 
ATOM   4773 C CE  . LYS B 2 51  ? 8.699   -18.501 98.308  1.00 31.84  ? 51  LYS B CE  1 
ATOM   4774 N NZ  . LYS B 2 51  ? 8.171   -17.631 97.257  1.00 35.20  ? 51  LYS B NZ  1 
ATOM   4775 N N   . ASP B 2 52  ? 5.029   -22.181 102.143 1.00 36.48  ? 52  ASP B N   1 
ATOM   4776 C CA  . ASP B 2 52  ? 4.201   -23.202 102.756 1.00 35.35  ? 52  ASP B CA  1 
ATOM   4777 C C   . ASP B 2 52  ? 3.005   -23.330 101.804 1.00 33.35  ? 52  ASP B C   1 
ATOM   4778 O O   . ASP B 2 52  ? 2.464   -22.321 101.358 1.00 31.86  ? 52  ASP B O   1 
ATOM   4779 C CB  . ASP B 2 52  ? 3.731   -22.731 104.139 1.00 37.87  ? 52  ASP B CB  1 
ATOM   4780 C CG  . ASP B 2 52  ? 4.890   -22.462 105.103 1.00 40.38  ? 52  ASP B CG  1 
ATOM   4781 O OD1 . ASP B 2 52  ? 5.642   -23.417 105.427 1.00 40.58  ? 52  ASP B OD1 1 
ATOM   4782 O OD2 . ASP B 2 52  ? 5.040   -21.294 105.544 1.00 41.13  ? 52  ASP B OD2 1 
ATOM   4783 N N   . GLU B 2 53  ? 2.602   -24.551 101.472 1.00 32.86  ? 53  GLU B N   1 
ATOM   4784 C CA  . GLU B 2 53  ? 1.470   -24.723 100.562 1.00 34.62  ? 53  GLU B CA  1 
ATOM   4785 C C   . GLU B 2 53  ? 0.139   -24.817 101.290 1.00 33.93  ? 53  GLU B C   1 
ATOM   4786 O O   . GLU B 2 53  ? 0.041   -25.406 102.363 1.00 34.03  ? 53  GLU B O   1 
ATOM   4787 C CB  . GLU B 2 53  ? 1.685   -25.942 99.681  1.00 36.89  ? 53  GLU B CB  1 
ATOM   4788 C CG  . GLU B 2 53  ? 2.984   -25.861 98.912  1.00 39.96  ? 53  GLU B CG  1 
ATOM   4789 C CD  . GLU B 2 53  ? 3.071   -26.900 97.833  1.00 43.63  ? 53  GLU B CD  1 
ATOM   4790 O OE1 . GLU B 2 53  ? 4.190   -27.123 97.318  1.00 44.15  ? 53  GLU B OE1 1 
ATOM   4791 O OE2 . GLU B 2 53  ? 2.012   -27.483 97.497  1.00 46.08  ? 53  GLU B OE2 1 
ATOM   4792 N N   . ILE B 2 54  ? -0.893  -24.245 100.689 1.00 33.69  ? 54  ILE B N   1 
ATOM   4793 C CA  . ILE B 2 54  ? -2.202  -24.206 101.325 1.00 33.29  ? 54  ILE B CA  1 
ATOM   4794 C C   . ILE B 2 54  ? -3.350  -24.687 100.473 1.00 33.31  ? 54  ILE B C   1 
ATOM   4795 O O   . ILE B 2 54  ? -3.519  -24.246 99.333  1.00 33.70  ? 54  ILE B O   1 
ATOM   4796 C CB  . ILE B 2 54  ? -2.545  -22.772 101.741 1.00 33.50  ? 54  ILE B CB  1 
ATOM   4797 C CG1 . ILE B 2 54  ? -1.396  -22.171 102.541 1.00 33.87  ? 54  ILE B CG1 1 
ATOM   4798 C CG2 . ILE B 2 54  ? -3.819  -22.757 102.544 1.00 32.66  ? 54  ILE B CG2 1 
ATOM   4799 C CD1 . ILE B 2 54  ? -1.470  -20.663 102.651 1.00 35.49  ? 54  ILE B CD1 1 
ATOM   4800 N N   . ALA B 2 55  ? -4.149  -25.578 101.049 1.00 32.95  ? 55  ALA B N   1 
ATOM   4801 C CA  . ALA B 2 55  ? -5.332  -26.115 100.385 1.00 33.32  ? 55  ALA B CA  1 
ATOM   4802 C C   . ALA B 2 55  ? -6.521  -25.617 101.189 1.00 33.35  ? 55  ALA B C   1 
ATOM   4803 O O   . ALA B 2 55  ? -6.411  -25.417 102.394 1.00 33.98  ? 55  ALA B O   1 
ATOM   4804 C CB  . ALA B 2 55  ? -5.302  -27.627 100.391 1.00 31.91  ? 55  ALA B CB  1 
ATOM   4805 N N   . LEU B 2 56  ? -7.652  -25.404 100.528 1.00 32.68  ? 56  LEU B N   1 
ATOM   4806 C CA  . LEU B 2 56  ? -8.850  -24.933 101.219 1.00 30.71  ? 56  LEU B CA  1 
ATOM   4807 C C   . LEU B 2 56  ? -10.032 -25.858 100.950 1.00 31.62  ? 56  LEU B C   1 
ATOM   4808 O O   . LEU B 2 56  ? -10.469 -25.997 99.811  1.00 32.63  ? 56  LEU B O   1 
ATOM   4809 C CB  . LEU B 2 56  ? -9.200  -23.516 100.774 1.00 25.84  ? 56  LEU B CB  1 
ATOM   4810 C CG  . LEU B 2 56  ? -10.597 -23.061 101.175 1.00 23.60  ? 56  LEU B CG  1 
ATOM   4811 C CD1 . LEU B 2 56  ? -10.754 -23.139 102.678 1.00 21.99  ? 56  LEU B CD1 1 
ATOM   4812 C CD2 . LEU B 2 56  ? -10.838 -21.653 100.667 1.00 23.32  ? 56  LEU B CD2 1 
ATOM   4813 N N   . VAL B 2 57  ? -10.541 -26.503 101.994 1.00 31.99  ? 57  VAL B N   1 
ATOM   4814 C CA  . VAL B 2 57  ? -11.684 -27.392 101.839 1.00 32.07  ? 57  VAL B CA  1 
ATOM   4815 C C   . VAL B 2 57  ? -12.901 -26.667 102.382 1.00 32.40  ? 57  VAL B C   1 
ATOM   4816 O O   . VAL B 2 57  ? -12.788 -25.823 103.268 1.00 33.29  ? 57  VAL B O   1 
ATOM   4817 C CB  . VAL B 2 57  ? -11.513 -28.700 102.629 1.00 32.48  ? 57  VAL B CB  1 
ATOM   4818 C CG1 . VAL B 2 57  ? -12.715 -29.584 102.421 1.00 33.53  ? 57  VAL B CG1 1 
ATOM   4819 C CG2 . VAL B 2 57  ? -10.264 -29.426 102.189 1.00 33.42  ? 57  VAL B CG2 1 
ATOM   4820 N N   . LEU B 2 58  ? -14.065 -26.987 101.843 1.00 31.94  ? 58  LEU B N   1 
ATOM   4821 C CA  . LEU B 2 58  ? -15.293 -26.354 102.293 1.00 31.42  ? 58  LEU B CA  1 
ATOM   4822 C C   . LEU B 2 58  ? -16.328 -27.439 102.488 1.00 32.18  ? 58  LEU B C   1 
ATOM   4823 O O   . LEU B 2 58  ? -16.446 -28.351 101.673 1.00 31.35  ? 58  LEU B O   1 
ATOM   4824 C CB  . LEU B 2 58  ? -15.810 -25.353 101.255 1.00 29.11  ? 58  LEU B CB  1 
ATOM   4825 C CG  . LEU B 2 58  ? -14.853 -24.273 100.750 1.00 28.31  ? 58  LEU B CG  1 
ATOM   4826 C CD1 . LEU B 2 58  ? -15.572 -23.401 99.725  1.00 27.66  ? 58  LEU B CD1 1 
ATOM   4827 C CD2 . LEU B 2 58  ? -14.356 -23.429 101.903 1.00 27.03  ? 58  LEU B CD2 1 
ATOM   4828 N N   . PHE B 2 59  ? -17.062 -27.361 103.586 1.00 32.27  ? 59  PHE B N   1 
ATOM   4829 C CA  . PHE B 2 59  ? -18.089 -28.341 103.813 1.00 33.73  ? 59  PHE B CA  1 
ATOM   4830 C C   . PHE B 2 59  ? -19.331 -27.578 104.173 1.00 35.08  ? 59  PHE B C   1 
ATOM   4831 O O   . PHE B 2 59  ? -19.302 -26.688 105.026 1.00 34.97  ? 59  PHE B O   1 
ATOM   4832 C CB  . PHE B 2 59  ? -17.679 -29.353 104.890 1.00 34.17  ? 59  PHE B CB  1 
ATOM   4833 C CG  . PHE B 2 59  ? -17.249 -28.749 106.195 1.00 35.68  ? 59  PHE B CG  1 
ATOM   4834 C CD1 . PHE B 2 59  ? -18.051 -28.863 107.322 1.00 35.88  ? 59  PHE B CD1 1 
ATOM   4835 C CD2 . PHE B 2 59  ? -16.005 -28.140 106.324 1.00 37.76  ? 59  PHE B CD2 1 
ATOM   4836 C CE1 . PHE B 2 59  ? -17.617 -28.386 108.558 1.00 36.57  ? 59  PHE B CE1 1 
ATOM   4837 C CE2 . PHE B 2 59  ? -15.561 -27.658 107.557 1.00 36.46  ? 59  PHE B CE2 1 
ATOM   4838 C CZ  . PHE B 2 59  ? -16.368 -27.784 108.671 1.00 37.12  ? 59  PHE B CZ  1 
ATOM   4839 N N   . GLY B 2 60  ? -20.414 -27.912 103.481 1.00 35.34  ? 60  GLY B N   1 
ATOM   4840 C CA  . GLY B 2 60  ? -21.670 -27.224 103.695 1.00 36.53  ? 60  GLY B CA  1 
ATOM   4841 C C   . GLY B 2 60  ? -22.028 -26.502 102.409 1.00 36.34  ? 60  GLY B C   1 
ATOM   4842 O O   . GLY B 2 60  ? -22.977 -25.730 102.339 1.00 36.87  ? 60  GLY B O   1 
ATOM   4843 N N   . THR B 2 61  ? -21.239 -26.744 101.379 1.00 36.12  ? 61  THR B N   1 
ATOM   4844 C CA  . THR B 2 61  ? -21.498 -26.137 100.090 1.00 38.12  ? 61  THR B CA  1 
ATOM   4845 C C   . THR B 2 61  ? -22.761 -26.780 99.521  1.00 40.07  ? 61  THR B C   1 
ATOM   4846 O O   . THR B 2 61  ? -23.099 -27.913 99.875  1.00 40.17  ? 61  THR B O   1 
ATOM   4847 C CB  . THR B 2 61  ? -20.346 -26.407 99.128  1.00 37.25  ? 61  THR B CB  1 
ATOM   4848 O OG1 . THR B 2 61  ? -20.144 -27.825 99.016  1.00 35.43  ? 61  THR B OG1 1 
ATOM   4849 C CG2 . THR B 2 61  ? -19.076 -25.735 99.627  1.00 36.31  ? 61  THR B CG2 1 
ATOM   4850 N N   . ASP B 2 62  ? -23.463 -26.071 98.642  1.00 41.48  ? 62  ASP B N   1 
ATOM   4851 C CA  . ASP B 2 62  ? -24.662 -26.646 98.055  1.00 42.02  ? 62  ASP B CA  1 
ATOM   4852 C C   . ASP B 2 62  ? -24.324 -27.840 97.163  1.00 41.46  ? 62  ASP B C   1 
ATOM   4853 O O   . ASP B 2 62  ? -25.083 -28.805 97.098  1.00 41.28  ? 62  ASP B O   1 
ATOM   4854 C CB  . ASP B 2 62  ? -25.449 -25.590 97.276  1.00 44.27  ? 62  ASP B CB  1 
ATOM   4855 C CG  . ASP B 2 62  ? -26.263 -24.678 98.197  1.00 48.64  ? 62  ASP B CG  1 
ATOM   4856 O OD1 . ASP B 2 62  ? -26.668 -25.147 99.288  1.00 51.21  ? 62  ASP B OD1 1 
ATOM   4857 O OD2 . ASP B 2 62  ? -26.515 -23.504 97.833  1.00 49.23  ? 62  ASP B OD2 1 
ATOM   4858 N N   . GLY B 2 63  ? -23.177 -27.788 96.492  1.00 40.97  ? 63  GLY B N   1 
ATOM   4859 C CA  . GLY B 2 63  ? -22.784 -28.895 95.637  1.00 39.74  ? 63  GLY B CA  1 
ATOM   4860 C C   . GLY B 2 63  ? -21.716 -29.782 96.252  1.00 40.09  ? 63  GLY B C   1 
ATOM   4861 O O   . GLY B 2 63  ? -21.316 -29.572 97.403  1.00 42.32  ? 63  GLY B O   1 
ATOM   4862 N N   . THR B 2 64  ? -21.261 -30.780 95.497  1.00 38.16  ? 64  THR B N   1 
ATOM   4863 C CA  . THR B 2 64  ? -20.222 -31.695 95.966  1.00 37.06  ? 64  THR B CA  1 
ATOM   4864 C C   . THR B 2 64  ? -19.082 -31.747 94.980  1.00 37.34  ? 64  THR B C   1 
ATOM   4865 O O   . THR B 2 64  ? -19.270 -32.123 93.832  1.00 37.73  ? 64  THR B O   1 
ATOM   4866 C CB  . THR B 2 64  ? -20.730 -33.127 96.116  1.00 36.24  ? 64  THR B CB  1 
ATOM   4867 O OG1 . THR B 2 64  ? -21.847 -33.145 97.008  1.00 38.02  ? 64  THR B OG1 1 
ATOM   4868 C CG2 . THR B 2 64  ? -19.632 -34.018 96.669  1.00 34.05  ? 64  THR B CG2 1 
ATOM   4869 N N   . ASP B 2 65  ? -17.891 -31.388 95.435  1.00 38.57  ? 65  ASP B N   1 
ATOM   4870 C CA  . ASP B 2 65  ? -16.716 -31.402 94.571  1.00 38.71  ? 65  ASP B CA  1 
ATOM   4871 C C   . ASP B 2 65  ? -15.499 -31.890 95.338  1.00 38.36  ? 65  ASP B C   1 
ATOM   4872 O O   . ASP B 2 65  ? -14.692 -31.091 95.815  1.00 38.29  ? 65  ASP B O   1 
ATOM   4873 C CB  . ASP B 2 65  ? -16.434 -30.001 94.038  1.00 39.57  ? 65  ASP B CB  1 
ATOM   4874 C CG  . ASP B 2 65  ? -15.415 -30.000 92.911  1.00 41.72  ? 65  ASP B CG  1 
ATOM   4875 O OD1 . ASP B 2 65  ? -14.717 -31.031 92.722  1.00 39.32  ? 65  ASP B OD1 1 
ATOM   4876 O OD2 . ASP B 2 65  ? -15.311 -28.957 92.218  1.00 42.69  ? 65  ASP B OD2 1 
ATOM   4877 N N   . ASN B 2 66  ? -15.360 -33.201 95.461  1.00 37.49  ? 66  ASN B N   1 
ATOM   4878 C CA  . ASN B 2 66  ? -14.225 -33.734 96.183  1.00 37.99  ? 66  ASN B CA  1 
ATOM   4879 C C   . ASN B 2 66  ? -13.910 -35.162 95.772  1.00 38.98  ? 66  ASN B C   1 
ATOM   4880 O O   . ASN B 2 66  ? -14.798 -35.952 95.474  1.00 37.25  ? 66  ASN B O   1 
ATOM   4881 C CB  . ASN B 2 66  ? -14.476 -33.653 97.693  1.00 38.52  ? 66  ASN B CB  1 
ATOM   4882 C CG  . ASN B 2 66  ? -15.221 -34.857 98.234  1.00 37.49  ? 66  ASN B CG  1 
ATOM   4883 O OD1 . ASN B 2 66  ? -14.693 -35.970 98.264  1.00 37.02  ? 66  ASN B OD1 1 
ATOM   4884 N ND2 . ASN B 2 66  ? -16.453 -34.637 98.679  1.00 37.27  ? 66  ASN B ND2 1 
ATOM   4885 N N   . PRO B 2 67  ? -12.622 -35.507 95.768  1.00 40.75  ? 67  PRO B N   1 
ATOM   4886 C CA  . PRO B 2 67  ? -12.077 -36.814 95.403  1.00 41.59  ? 67  PRO B CA  1 
ATOM   4887 C C   . PRO B 2 67  ? -12.816 -38.033 95.930  1.00 42.43  ? 67  PRO B C   1 
ATOM   4888 O O   . PRO B 2 67  ? -12.884 -39.049 95.251  1.00 43.85  ? 67  PRO B O   1 
ATOM   4889 C CB  . PRO B 2 67  ? -10.650 -36.742 95.933  1.00 42.35  ? 67  PRO B CB  1 
ATOM   4890 C CG  . PRO B 2 67  ? -10.307 -35.291 95.740  1.00 43.74  ? 67  PRO B CG  1 
ATOM   4891 C CD  . PRO B 2 67  ? -11.552 -34.617 96.257  1.00 42.39  ? 67  PRO B CD  1 
ATOM   4892 N N   . LEU B 2 68  ? -13.379 -37.936 97.127  1.00 43.01  ? 68  LEU B N   1 
ATOM   4893 C CA  . LEU B 2 68  ? -14.060 -39.074 97.730  1.00 43.17  ? 68  LEU B CA  1 
ATOM   4894 C C   . LEU B 2 68  ? -15.568 -39.146 97.532  1.00 45.20  ? 68  LEU B C   1 
ATOM   4895 O O   . LEU B 2 68  ? -16.207 -40.061 98.043  1.00 44.09  ? 68  LEU B O   1 
ATOM   4896 C CB  . LEU B 2 68  ? -13.761 -39.097 99.224  1.00 42.42  ? 68  LEU B CB  1 
ATOM   4897 C CG  . LEU B 2 68  ? -12.308 -38.827 99.612  1.00 40.47  ? 68  LEU B CG  1 
ATOM   4898 C CD1 . LEU B 2 68  ? -12.141 -38.956 101.111 1.00 40.11  ? 68  LEU B CD1 1 
ATOM   4899 C CD2 . LEU B 2 68  ? -11.413 -39.802 98.905  1.00 40.40  ? 68  LEU B CD2 1 
ATOM   4900 N N   . SER B 2 69  ? -16.128 -38.203 96.778  1.00 49.01  ? 69  SER B N   1 
ATOM   4901 C CA  . SER B 2 69  ? -17.573 -38.141 96.545  1.00 52.36  ? 69  SER B CA  1 
ATOM   4902 C C   . SER B 2 69  ? -18.193 -39.297 95.769  1.00 55.39  ? 69  SER B C   1 
ATOM   4903 O O   . SER B 2 69  ? -19.411 -39.339 95.592  1.00 57.16  ? 69  SER B O   1 
ATOM   4904 C CB  . SER B 2 69  ? -17.945 -36.824 95.853  1.00 51.31  ? 69  SER B CB  1 
ATOM   4905 O OG  . SER B 2 69  ? -17.312 -36.702 94.594  1.00 51.80  ? 69  SER B OG  1 
ATOM   4906 N N   . GLY B 2 70  ? -17.376 -40.232 95.305  1.00 57.08  ? 70  GLY B N   1 
ATOM   4907 C CA  . GLY B 2 70  ? -17.929 -41.353 94.571  1.00 60.97  ? 70  GLY B CA  1 
ATOM   4908 C C   . GLY B 2 70  ? -18.980 -42.157 95.338  1.00 63.35  ? 70  GLY B C   1 
ATOM   4909 O O   . GLY B 2 70  ? -18.648 -42.919 96.253  1.00 63.56  ? 70  GLY B O   1 
ATOM   4910 N N   . GLY B 2 71  ? -20.252 -41.981 94.980  1.00 64.72  ? 71  GLY B N   1 
ATOM   4911 C CA  . GLY B 2 71  ? -21.312 -42.736 95.634  1.00 65.53  ? 71  GLY B CA  1 
ATOM   4912 C C   . GLY B 2 71  ? -22.172 -42.046 96.676  1.00 66.23  ? 71  GLY B C   1 
ATOM   4913 O O   . GLY B 2 71  ? -22.481 -42.638 97.714  1.00 66.11  ? 71  GLY B O   1 
ATOM   4914 N N   . ASP B 2 72  ? -22.563 -40.804 96.415  1.00 66.77  ? 72  ASP B N   1 
ATOM   4915 C CA  . ASP B 2 72  ? -23.409 -40.080 97.354  1.00 67.53  ? 72  ASP B CA  1 
ATOM   4916 C C   . ASP B 2 72  ? -22.857 -40.130 98.787  1.00 66.14  ? 72  ASP B C   1 
ATOM   4917 O O   . ASP B 2 72  ? -23.593 -40.374 99.745  1.00 66.36  ? 72  ASP B O   1 
ATOM   4918 C CB  . ASP B 2 72  ? -24.821 -40.674 97.302  1.00 69.96  ? 72  ASP B CB  1 
ATOM   4919 C CG  . ASP B 2 72  ? -25.415 -40.647 95.894  1.00 71.87  ? 72  ASP B CG  1 
ATOM   4920 O OD1 . ASP B 2 72  ? -24.642 -40.765 94.915  1.00 70.92  ? 72  ASP B OD1 1 
ATOM   4921 O OD2 . ASP B 2 72  ? -26.654 -40.519 95.764  1.00 73.84  ? 72  ASP B OD2 1 
ATOM   4922 N N   . GLN B 2 73  ? -21.553 -39.907 98.919  1.00 64.47  ? 73  GLN B N   1 
ATOM   4923 C CA  . GLN B 2 73  ? -20.888 -39.902 100.218 1.00 62.15  ? 73  GLN B CA  1 
ATOM   4924 C C   . GLN B 2 73  ? -20.054 -38.640 100.270 1.00 59.34  ? 73  GLN B C   1 
ATOM   4925 O O   . GLN B 2 73  ? -19.836 -38.005 99.238  1.00 58.71  ? 73  GLN B O   1 
ATOM   4926 C CB  . GLN B 2 73  ? -19.980 -41.112 100.359 1.00 63.96  ? 73  GLN B CB  1 
ATOM   4927 C CG  . GLN B 2 73  ? -20.606 -42.389 99.866  1.00 67.57  ? 73  GLN B CG  1 
ATOM   4928 C CD  . GLN B 2 73  ? -19.851 -43.607 100.337 1.00 70.61  ? 73  GLN B CD  1 
ATOM   4929 O OE1 . GLN B 2 73  ? -19.906 -43.960 101.520 1.00 72.61  ? 73  GLN B OE1 1 
ATOM   4930 N NE2 . GLN B 2 73  ? -19.129 -44.255 99.422  1.00 70.22  ? 73  GLN B NE2 1 
ATOM   4931 N N   . TYR B 2 74  ? -19.577 -38.281 101.456 1.00 55.99  ? 74  TYR B N   1 
ATOM   4932 C CA  . TYR B 2 74  ? -18.793 -37.063 101.595 1.00 52.82  ? 74  TYR B CA  1 
ATOM   4933 C C   . TYR B 2 74  ? -19.461 -35.982 100.749 1.00 50.77  ? 74  TYR B C   1 
ATOM   4934 O O   . TYR B 2 74  ? -18.797 -35.246 100.024 1.00 48.89  ? 74  TYR B O   1 
ATOM   4935 C CB  . TYR B 2 74  ? -17.356 -37.284 101.119 1.00 52.71  ? 74  TYR B CB  1 
ATOM   4936 C CG  . TYR B 2 74  ? -16.625 -38.377 101.875 1.00 52.88  ? 74  TYR B CG  1 
ATOM   4937 C CD1 . TYR B 2 74  ? -16.517 -39.665 101.351 1.00 52.85  ? 74  TYR B CD1 1 
ATOM   4938 C CD2 . TYR B 2 74  ? -16.078 -38.136 103.135 1.00 52.78  ? 74  TYR B CD2 1 
ATOM   4939 C CE1 . TYR B 2 74  ? -15.885 -40.683 102.063 1.00 51.92  ? 74  TYR B CE1 1 
ATOM   4940 C CE2 . TYR B 2 74  ? -15.448 -39.149 103.857 1.00 51.60  ? 74  TYR B CE2 1 
ATOM   4941 C CZ  . TYR B 2 74  ? -15.358 -40.419 103.316 1.00 51.27  ? 74  TYR B CZ  1 
ATOM   4942 O OH  . TYR B 2 74  ? -14.775 -41.437 104.036 1.00 50.90  ? 74  TYR B OH  1 
ATOM   4943 N N   . GLN B 2 75  ? -20.786 -35.914 100.840 1.00 49.11  ? 75  GLN B N   1 
ATOM   4944 C CA  . GLN B 2 75  ? -21.577 -34.943 100.095 1.00 48.25  ? 75  GLN B CA  1 
ATOM   4945 C C   . GLN B 2 75  ? -21.481 -33.550 100.703 1.00 45.89  ? 75  GLN B C   1 
ATOM   4946 O O   . GLN B 2 75  ? -21.269 -33.401 101.904 1.00 45.28  ? 75  GLN B O   1 
ATOM   4947 C CB  . GLN B 2 75  ? -23.049 -35.371 100.068 1.00 49.89  ? 75  GLN B CB  1 
ATOM   4948 C CG  . GLN B 2 75  ? -23.321 -36.671 99.332  1.00 54.21  ? 75  GLN B CG  1 
ATOM   4949 C CD  . GLN B 2 75  ? -23.242 -36.507 97.829  1.00 56.04  ? 75  GLN B CD  1 
ATOM   4950 O OE1 . GLN B 2 75  ? -24.017 -35.754 97.237  1.00 57.60  ? 75  GLN B OE1 1 
ATOM   4951 N NE2 . GLN B 2 75  ? -22.303 -37.207 97.201  1.00 56.81  ? 75  GLN B NE2 1 
ATOM   4952 N N   . ASN B 2 76  ? -21.628 -32.534 99.859  1.00 44.26  ? 76  ASN B N   1 
ATOM   4953 C CA  . ASN B 2 76  ? -21.591 -31.146 100.297 1.00 42.08  ? 76  ASN B CA  1 
ATOM   4954 C C   . ASN B 2 76  ? -20.234 -30.696 100.828 1.00 40.56  ? 76  ASN B C   1 
ATOM   4955 O O   . ASN B 2 76  ? -20.128 -29.724 101.580 1.00 39.09  ? 76  ASN B O   1 
ATOM   4956 C CB  . ASN B 2 76  ? -22.674 -30.937 101.348 1.00 43.29  ? 76  ASN B CB  1 
ATOM   4957 C CG  . ASN B 2 76  ? -24.044 -31.330 100.845 1.00 42.13  ? 76  ASN B CG  1 
ATOM   4958 O OD1 . ASN B 2 76  ? -24.628 -30.634 100.018 1.00 42.58  ? 76  ASN B OD1 1 
ATOM   4959 N ND2 . ASN B 2 76  ? -24.558 -32.459 101.327 1.00 41.63  ? 76  ASN B ND2 1 
ATOM   4960 N N   . ILE B 2 77  ? -19.194 -31.422 100.441 1.00 39.64  ? 77  ILE B N   1 
ATOM   4961 C CA  . ILE B 2 77  ? -17.832 -31.092 100.837 1.00 38.52  ? 77  ILE B CA  1 
ATOM   4962 C C   . ILE B 2 77  ? -17.119 -30.729 99.547  1.00 39.23  ? 77  ILE B C   1 
ATOM   4963 O O   . ILE B 2 77  ? -17.115 -31.507 98.589  1.00 38.79  ? 77  ILE B O   1 
ATOM   4964 C CB  . ILE B 2 77  ? -17.104 -32.291 101.487 1.00 37.06  ? 77  ILE B CB  1 
ATOM   4965 C CG1 . ILE B 2 77  ? -17.742 -32.625 102.832 1.00 34.22  ? 77  ILE B CG1 1 
ATOM   4966 C CG2 . ILE B 2 77  ? -15.627 -31.972 101.662 1.00 35.23  ? 77  ILE B CG2 1 
ATOM   4967 C CD1 . ILE B 2 77  ? -17.240 -33.916 103.418 1.00 35.36  ? 77  ILE B CD1 1 
ATOM   4968 N N   . THR B 2 78  ? -16.522 -29.547 99.523  1.00 39.34  ? 78  THR B N   1 
ATOM   4969 C CA  . THR B 2 78  ? -15.825 -29.082 98.339  1.00 39.64  ? 78  THR B CA  1 
ATOM   4970 C C   . THR B 2 78  ? -14.371 -28.724 98.581  1.00 38.07  ? 78  THR B C   1 
ATOM   4971 O O   . THR B 2 78  ? -14.039 -28.000 99.520  1.00 37.58  ? 78  THR B O   1 
ATOM   4972 C CB  . THR B 2 78  ? -16.531 -27.850 97.761  1.00 42.25  ? 78  THR B CB  1 
ATOM   4973 O OG1 . THR B 2 78  ? -17.857 -28.219 97.370  1.00 46.20  ? 78  THR B OG1 1 
ATOM   4974 C CG2 . THR B 2 78  ? -15.780 -27.306 96.550  1.00 43.62  ? 78  THR B CG2 1 
ATOM   4975 N N   . VAL B 2 79  ? -13.499 -29.246 97.726  1.00 36.47  ? 79  VAL B N   1 
ATOM   4976 C CA  . VAL B 2 79  ? -12.085 -28.923 97.826  1.00 33.80  ? 79  VAL B CA  1 
ATOM   4977 C C   . VAL B 2 79  ? -11.916 -27.711 96.910  1.00 33.30  ? 79  VAL B C   1 
ATOM   4978 O O   . VAL B 2 79  ? -11.515 -27.844 95.765  1.00 35.01  ? 79  VAL B O   1 
ATOM   4979 C CB  . VAL B 2 79  ? -11.188 -30.092 97.349  1.00 31.07  ? 79  VAL B CB  1 
ATOM   4980 C CG1 . VAL B 2 79  ? -9.724  -29.683 97.396  1.00 31.86  ? 79  VAL B CG1 1 
ATOM   4981 C CG2 . VAL B 2 79  ? -11.404 -31.296 98.231  1.00 28.94  ? 79  VAL B CG2 1 
ATOM   4982 N N   . HIS B 2 80  ? -12.275 -26.538 97.420  1.00 31.66  ? 80  HIS B N   1 
ATOM   4983 C CA  . HIS B 2 80  ? -12.181 -25.283 96.685  1.00 30.61  ? 80  HIS B CA  1 
ATOM   4984 C C   . HIS B 2 80  ? -10.782 -25.002 96.142  1.00 31.03  ? 80  HIS B C   1 
ATOM   4985 O O   . HIS B 2 80  ? -10.623 -24.427 95.067  1.00 31.57  ? 80  HIS B O   1 
ATOM   4986 C CB  . HIS B 2 80  ? -12.569 -24.128 97.602  1.00 31.05  ? 80  HIS B CB  1 
ATOM   4987 C CG  . HIS B 2 80  ? -12.479 -22.784 96.950  1.00 33.23  ? 80  HIS B CG  1 
ATOM   4988 N ND1 . HIS B 2 80  ? -13.493 -22.263 96.174  1.00 33.98  ? 80  HIS B ND1 1 
ATOM   4989 C CD2 . HIS B 2 80  ? -11.493 -21.856 96.956  1.00 33.74  ? 80  HIS B CD2 1 
ATOM   4990 C CE1 . HIS B 2 80  ? -13.135 -21.068 95.733  1.00 34.17  ? 80  HIS B CE1 1 
ATOM   4991 N NE2 . HIS B 2 80  ? -11.927 -20.798 96.193  1.00 33.56  ? 80  HIS B NE2 1 
ATOM   4992 N N   . ARG B 2 81  ? -9.767  -25.385 96.903  1.00 30.58  ? 81  ARG B N   1 
ATOM   4993 C CA  . ARG B 2 81  ? -8.396  -25.135 96.500  1.00 31.02  ? 81  ARG B CA  1 
ATOM   4994 C C   . ARG B 2 81  ? -7.481  -26.271 96.898  1.00 31.64  ? 81  ARG B C   1 
ATOM   4995 O O   . ARG B 2 81  ? -7.392  -26.614 98.080  1.00 31.92  ? 81  ARG B O   1 
ATOM   4996 C CB  . ARG B 2 81  ? -7.888  -23.855 97.152  1.00 31.10  ? 81  ARG B CB  1 
ATOM   4997 C CG  . ARG B 2 81  ? -6.434  -23.564 96.881  1.00 31.94  ? 81  ARG B CG  1 
ATOM   4998 C CD  . ARG B 2 81  ? -6.219  -22.995 95.499  1.00 32.36  ? 81  ARG B CD  1 
ATOM   4999 N NE  . ARG B 2 81  ? -5.115  -22.038 95.529  1.00 36.45  ? 81  ARG B NE  1 
ATOM   5000 C CZ  . ARG B 2 81  ? -5.168  -20.797 95.054  1.00 36.11  ? 81  ARG B CZ  1 
ATOM   5001 N NH1 . ARG B 2 81  ? -6.275  -20.335 94.491  1.00 38.71  ? 81  ARG B NH1 1 
ATOM   5002 N NH2 . ARG B 2 81  ? -4.115  -20.006 95.170  1.00 36.23  ? 81  ARG B NH2 1 
ATOM   5003 N N   . HIS B 2 82  ? -6.797  -26.845 95.911  1.00 30.22  ? 82  HIS B N   1 
ATOM   5004 C CA  . HIS B 2 82  ? -5.863  -27.929 96.166  1.00 29.61  ? 82  HIS B CA  1 
ATOM   5005 C C   . HIS B 2 82  ? -4.545  -27.349 96.647  1.00 29.04  ? 82  HIS B C   1 
ATOM   5006 O O   . HIS B 2 82  ? -4.324  -26.141 96.556  1.00 28.08  ? 82  HIS B O   1 
ATOM   5007 C CB  . HIS B 2 82  ? -5.644  -28.750 94.904  1.00 30.62  ? 82  HIS B CB  1 
ATOM   5008 C CG  . HIS B 2 82  ? -6.851  -29.526 94.478  1.00 31.63  ? 82  HIS B CG  1 
ATOM   5009 N ND1 . HIS B 2 82  ? -7.095  -30.811 94.903  1.00 31.66  ? 82  HIS B ND1 1 
ATOM   5010 C CD2 . HIS B 2 82  ? -7.888  -29.185 93.677  1.00 30.74  ? 82  HIS B CD2 1 
ATOM   5011 C CE1 . HIS B 2 82  ? -8.234  -31.235 94.378  1.00 33.09  ? 82  HIS B CE1 1 
ATOM   5012 N NE2 . HIS B 2 82  ? -8.733  -30.268 93.633  1.00 32.31  ? 82  HIS B NE2 1 
ATOM   5013 N N   . LEU B 2 83  ? -3.684  -28.217 97.166  1.00 28.62  ? 83  LEU B N   1 
ATOM   5014 C CA  . LEU B 2 83  ? -2.383  -27.822 97.693  1.00 30.21  ? 83  LEU B CA  1 
ATOM   5015 C C   . LEU B 2 83  ? -1.498  -27.026 96.746  1.00 31.64  ? 83  LEU B C   1 
ATOM   5016 O O   . LEU B 2 83  ? -1.173  -27.496 95.663  1.00 34.58  ? 83  LEU B O   1 
ATOM   5017 C CB  . LEU B 2 83  ? -1.609  -29.054 98.108  1.00 29.62  ? 83  LEU B CB  1 
ATOM   5018 C CG  . LEU B 2 83  ? -1.553  -29.395 99.577  1.00 27.54  ? 83  LEU B CG  1 
ATOM   5019 C CD1 . LEU B 2 83  ? -0.334  -30.287 99.759  1.00 26.59  ? 83  LEU B CD1 1 
ATOM   5020 C CD2 . LEU B 2 83  ? -1.447  -28.129 100.426 1.00 26.78  ? 83  LEU B CD2 1 
ATOM   5021 N N   . MET B 2 84  ? -1.074  -25.843 97.165  1.00 30.10  ? 84  MET B N   1 
ATOM   5022 C CA  . MET B 2 84  ? -0.226  -25.018 96.326  1.00 28.48  ? 84  MET B CA  1 
ATOM   5023 C C   . MET B 2 84  ? -0.024  -23.682 96.997  1.00 29.53  ? 84  MET B C   1 
ATOM   5024 O O   . MET B 2 84  ? -0.821  -23.285 97.848  1.00 30.83  ? 84  MET B O   1 
ATOM   5025 C CB  . MET B 2 84  ? -0.856  -24.816 94.950  1.00 27.58  ? 84  MET B CB  1 
ATOM   5026 C CG  . MET B 2 84  ? -2.231  -24.175 94.964  1.00 29.60  ? 84  MET B CG  1 
ATOM   5027 S SD  . MET B 2 84  ? -2.883  -23.799 93.304  1.00 27.81  ? 84  MET B SD  1 
ATOM   5028 C CE  . MET B 2 84  ? -3.636  -25.328 92.895  1.00 24.10  ? 84  MET B CE  1 
ATOM   5029 N N   . LEU B 2 85  ? 1.042   -22.991 96.619  1.00 28.31  ? 85  LEU B N   1 
ATOM   5030 C CA  . LEU B 2 85  ? 1.332   -21.708 97.212  1.00 28.94  ? 85  LEU B CA  1 
ATOM   5031 C C   . LEU B 2 85  ? 0.068   -20.871 97.217  1.00 30.54  ? 85  LEU B C   1 
ATOM   5032 O O   . LEU B 2 85  ? -0.807  -21.052 96.380  1.00 31.78  ? 85  LEU B O   1 
ATOM   5033 C CB  . LEU B 2 85  ? 2.419   -21.006 96.416  1.00 29.08  ? 85  LEU B CB  1 
ATOM   5034 C CG  . LEU B 2 85  ? 3.779   -21.690 96.351  1.00 29.54  ? 85  LEU B CG  1 
ATOM   5035 C CD1 . LEU B 2 85  ? 4.677   -20.860 95.481  1.00 32.45  ? 85  LEU B CD1 1 
ATOM   5036 C CD2 . LEU B 2 85  ? 4.390   -21.829 97.737  1.00 30.54  ? 85  LEU B CD2 1 
ATOM   5037 N N   . PRO B 2 86  ? -0.060  -19.957 98.174  1.00 31.79  ? 86  PRO B N   1 
ATOM   5038 C CA  . PRO B 2 86  ? -1.273  -19.151 98.181  1.00 32.52  ? 86  PRO B CA  1 
ATOM   5039 C C   . PRO B 2 86  ? -0.968  -17.911 97.387  1.00 33.76  ? 86  PRO B C   1 
ATOM   5040 O O   . PRO B 2 86  ? 0.149   -17.404 97.451  1.00 34.86  ? 86  PRO B O   1 
ATOM   5041 C CB  . PRO B 2 86  ? -1.463  -18.854 99.652  1.00 33.53  ? 86  PRO B CB  1 
ATOM   5042 C CG  . PRO B 2 86  ? -0.040  -18.605 100.088 1.00 35.22  ? 86  PRO B CG  1 
ATOM   5043 C CD  . PRO B 2 86  ? 0.738   -19.722 99.390  1.00 34.27  ? 86  PRO B CD  1 
ATOM   5044 N N   . ASP B 2 87  ? -1.955  -17.434 96.638  1.00 35.15  ? 87  ASP B N   1 
ATOM   5045 C CA  . ASP B 2 87  ? -1.807  -16.241 95.812  1.00 35.69  ? 87  ASP B CA  1 
ATOM   5046 C C   . ASP B 2 87  ? -3.003  -15.335 96.050  1.00 35.89  ? 87  ASP B C   1 
ATOM   5047 O O   . ASP B 2 87  ? -3.896  -15.680 96.822  1.00 34.45  ? 87  ASP B O   1 
ATOM   5048 C CB  . ASP B 2 87  ? -1.728  -16.627 94.327  1.00 37.01  ? 87  ASP B CB  1 
ATOM   5049 C CG  . ASP B 2 87  ? -2.740  -17.710 93.942  1.00 39.62  ? 87  ASP B CG  1 
ATOM   5050 O OD1 . ASP B 2 87  ? -3.951  -17.521 94.215  1.00 43.19  ? 87  ASP B OD1 1 
ATOM   5051 O OD2 . ASP B 2 87  ? -2.329  -18.751 93.368  1.00 35.91  ? 87  ASP B OD2 1 
ATOM   5052 N N   . PHE B 2 88  ? -3.020  -14.180 95.388  1.00 37.00  ? 88  PHE B N   1 
ATOM   5053 C CA  . PHE B 2 88  ? -4.118  -13.232 95.543  1.00 37.26  ? 88  PHE B CA  1 
ATOM   5054 C C   . PHE B 2 88  ? -5.434  -13.803 95.055  1.00 37.11  ? 88  PHE B C   1 
ATOM   5055 O O   . PHE B 2 88  ? -6.499  -13.409 95.524  1.00 37.86  ? 88  PHE B O   1 
ATOM   5056 C CB  . PHE B 2 88  ? -3.824  -11.935 94.803  1.00 35.48  ? 88  PHE B CB  1 
ATOM   5057 C CG  . PHE B 2 88  ? -2.603  -11.234 95.296  1.00 35.91  ? 88  PHE B CG  1 
ATOM   5058 C CD1 . PHE B 2 88  ? -1.350  -11.552 94.789  1.00 35.72  ? 88  PHE B CD1 1 
ATOM   5059 C CD2 . PHE B 2 88  ? -2.698  -10.266 96.291  1.00 35.92  ? 88  PHE B CD2 1 
ATOM   5060 C CE1 . PHE B 2 88  ? -0.205  -10.911 95.268  1.00 35.92  ? 88  PHE B CE1 1 
ATOM   5061 C CE2 . PHE B 2 88  ? -1.560  -9.620  96.778  1.00 34.88  ? 88  PHE B CE2 1 
ATOM   5062 C CZ  . PHE B 2 88  ? -0.312  -9.942  96.265  1.00 35.83  ? 88  PHE B CZ  1 
ATOM   5063 N N   . ASP B 2 89  ? -5.361  -14.730 94.110  1.00 36.84  ? 89  ASP B N   1 
ATOM   5064 C CA  . ASP B 2 89  ? -6.568  -15.339 93.584  1.00 36.00  ? 89  ASP B CA  1 
ATOM   5065 C C   . ASP B 2 89  ? -7.253  -16.140 94.683  1.00 35.50  ? 89  ASP B C   1 
ATOM   5066 O O   . ASP B 2 89  ? -8.460  -16.373 94.626  1.00 35.56  ? 89  ASP B O   1 
ATOM   5067 C CB  . ASP B 2 89  ? -6.235  -16.214 92.373  1.00 37.35  ? 89  ASP B CB  1 
ATOM   5068 C CG  . ASP B 2 89  ? -6.136  -15.409 91.076  1.00 38.88  ? 89  ASP B CG  1 
ATOM   5069 O OD1 . ASP B 2 89  ? -6.017  -14.161 91.127  1.00 41.02  ? 89  ASP B OD1 1 
ATOM   5070 O OD2 . ASP B 2 89  ? -6.169  -16.028 89.994  1.00 39.14  ? 89  ASP B OD2 1 
ATOM   5071 N N   . LEU B 2 90  ? -6.490  -16.561 95.692  1.00 33.87  ? 90  LEU B N   1 
ATOM   5072 C CA  . LEU B 2 90  ? -7.093  -17.290 96.805  1.00 31.10  ? 90  LEU B CA  1 
ATOM   5073 C C   . LEU B 2 90  ? -7.708  -16.263 97.733  1.00 30.04  ? 90  LEU B C   1 
ATOM   5074 O O   . LEU B 2 90  ? -8.782  -16.466 98.270  1.00 28.83  ? 90  LEU B O   1 
ATOM   5075 C CB  . LEU B 2 90  ? -6.067  -18.089 97.601  1.00 29.77  ? 90  LEU B CB  1 
ATOM   5076 C CG  . LEU B 2 90  ? -6.712  -18.815 98.787  1.00 29.12  ? 90  LEU B CG  1 
ATOM   5077 C CD1 . LEU B 2 90  ? -7.551  -19.984 98.271  1.00 29.85  ? 90  LEU B CD1 1 
ATOM   5078 C CD2 . LEU B 2 90  ? -5.640  -19.306 99.748  1.00 26.96  ? 90  LEU B CD2 1 
ATOM   5079 N N   . LEU B 2 91  ? -7.011  -15.154 97.923  1.00 29.35  ? 91  LEU B N   1 
ATOM   5080 C CA  . LEU B 2 91  ? -7.514  -14.118 98.793  1.00 32.68  ? 91  LEU B CA  1 
ATOM   5081 C C   . LEU B 2 91  ? -8.808  -13.522 98.251  1.00 36.90  ? 91  LEU B C   1 
ATOM   5082 O O   . LEU B 2 91  ? -9.776  -13.347 99.000  1.00 38.89  ? 91  LEU B O   1 
ATOM   5083 C CB  . LEU B 2 91  ? -6.464  -13.031 98.959  1.00 30.54  ? 91  LEU B CB  1 
ATOM   5084 C CG  . LEU B 2 91  ? -5.210  -13.488 99.696  1.00 27.14  ? 91  LEU B CG  1 
ATOM   5085 C CD1 . LEU B 2 91  ? -4.090  -12.497 99.428  1.00 26.01  ? 91  LEU B CD1 1 
ATOM   5086 C CD2 . LEU B 2 91  ? -5.505  -13.607 101.182 1.00 23.52  ? 91  LEU B CD2 1 
ATOM   5087 N N   . GLU B 2 92  ? -8.838  -13.212 96.957  1.00 39.90  ? 92  GLU B N   1 
ATOM   5088 C CA  . GLU B 2 92  ? -10.044 -12.641 96.373  1.00 42.10  ? 92  GLU B CA  1 
ATOM   5089 C C   . GLU B 2 92  ? -11.201 -13.636 96.485  1.00 42.75  ? 92  GLU B C   1 
ATOM   5090 O O   . GLU B 2 92  ? -12.354 -13.238 96.637  1.00 43.00  ? 92  GLU B O   1 
ATOM   5091 C CB  . GLU B 2 92  ? -9.823  -12.260 94.909  1.00 43.48  ? 92  GLU B CB  1 
ATOM   5092 C CG  . GLU B 2 92  ? -10.896 -11.289 94.399  1.00 47.88  ? 92  GLU B CG  1 
ATOM   5093 C CD  . GLU B 2 92  ? -10.822 -11.028 92.902  1.00 48.38  ? 92  GLU B CD  1 
ATOM   5094 O OE1 . GLU B 2 92  ? -10.745 -12.015 92.140  1.00 50.89  ? 92  GLU B OE1 1 
ATOM   5095 O OE2 . GLU B 2 92  ? -10.853 -9.846  92.486  1.00 46.70  ? 92  GLU B OE2 1 
ATOM   5096 N N   . ASP B 2 93  ? -10.894 -14.928 96.412  1.00 43.51  ? 93  ASP B N   1 
ATOM   5097 C CA  . ASP B 2 93  ? -11.922 -15.963 96.533  1.00 44.77  ? 93  ASP B CA  1 
ATOM   5098 C C   . ASP B 2 93  ? -12.545 -15.930 97.940  1.00 46.38  ? 93  ASP B C   1 
ATOM   5099 O O   . ASP B 2 93  ? -13.746 -16.137 98.096  1.00 46.75  ? 93  ASP B O   1 
ATOM   5100 C CB  . ASP B 2 93  ? -11.324 -17.359 96.288  1.00 45.08  ? 93  ASP B CB  1 
ATOM   5101 C CG  . ASP B 2 93  ? -11.112 -17.679 94.809  1.00 46.84  ? 93  ASP B CG  1 
ATOM   5102 O OD1 . ASP B 2 93  ? -11.121 -16.746 93.976  1.00 47.92  ? 93  ASP B OD1 1 
ATOM   5103 O OD2 . ASP B 2 93  ? -10.921 -18.878 94.483  1.00 46.20  ? 93  ASP B OD2 1 
ATOM   5104 N N   . ILE B 2 94  ? -11.725 -15.672 98.959  1.00 47.38  ? 94  ILE B N   1 
ATOM   5105 C CA  . ILE B 2 94  ? -12.203 -15.634 100.341 1.00 47.50  ? 94  ILE B CA  1 
ATOM   5106 C C   . ILE B 2 94  ? -13.118 -14.441 100.619 1.00 49.04  ? 94  ILE B C   1 
ATOM   5107 O O   . ILE B 2 94  ? -14.136 -14.591 101.293 1.00 49.72  ? 94  ILE B O   1 
ATOM   5108 C CB  . ILE B 2 94  ? -11.032 -15.605 101.362 1.00 47.06  ? 94  ILE B CB  1 
ATOM   5109 C CG1 . ILE B 2 94  ? -10.073 -16.766 101.115 1.00 46.42  ? 94  ILE B CG1 1 
ATOM   5110 C CG2 . ILE B 2 94  ? -11.577 -15.738 102.778 1.00 46.60  ? 94  ILE B CG2 1 
ATOM   5111 C CD1 . ILE B 2 94  ? -10.718 -18.119 101.252 1.00 47.21  ? 94  ILE B CD1 1 
ATOM   5112 N N   . GLU B 2 95  ? -12.763 -13.259 100.126 1.00 50.14  ? 95  GLU B N   1 
ATOM   5113 C CA  . GLU B 2 95  ? -13.617 -12.094 100.344 1.00 52.90  ? 95  GLU B CA  1 
ATOM   5114 C C   . GLU B 2 95  ? -14.902 -12.276 99.540  1.00 54.14  ? 95  GLU B C   1 
ATOM   5115 O O   . GLU B 2 95  ? -15.954 -12.656 100.059 1.00 54.76  ? 95  GLU B O   1 
ATOM   5116 C CB  . GLU B 2 95  ? -12.958 -10.815 99.843  1.00 54.55  ? 95  GLU B CB  1 
ATOM   5117 C CG  . GLU B 2 95  ? -11.616 -10.480 100.413 1.00 58.91  ? 95  GLU B CG  1 
ATOM   5118 C CD  . GLU B 2 95  ? -11.322 -8.997  100.276 1.00 61.93  ? 95  GLU B CD  1 
ATOM   5119 O OE1 . GLU B 2 95  ? -11.619 -8.423  99.202  1.00 62.57  ? 95  GLU B OE1 1 
ATOM   5120 O OE2 . GLU B 2 95  ? -10.799 -8.402  101.241 1.00 65.10  ? 95  GLU B OE2 1 
ATOM   5121 N N   . SER B 2 96  ? -14.778 -11.977 98.252  1.00 54.51  ? 96  SER B N   1 
ATOM   5122 C CA  . SER B 2 96  ? -15.860 -12.067 97.292  1.00 54.64  ? 96  SER B CA  1 
ATOM   5123 C C   . SER B 2 96  ? -16.239 -13.544 97.087  1.00 53.95  ? 96  SER B C   1 
ATOM   5124 O O   . SER B 2 96  ? -16.593 -14.234 98.034  1.00 53.98  ? 96  SER B O   1 
ATOM   5125 C CB  . SER B 2 96  ? -15.395 -11.422 95.974  1.00 56.02  ? 96  SER B CB  1 
ATOM   5126 O OG  . SER B 2 96  ? -16.473 -10.914 95.206  1.00 57.72  ? 96  SER B OG  1 
ATOM   5127 N N   . LYS B 2 97  ? -16.126 -14.018 95.852  1.00 53.34  ? 97  LYS B N   1 
ATOM   5128 C CA  . LYS B 2 97  ? -16.469 -15.384 95.470  1.00 53.42  ? 97  LYS B CA  1 
ATOM   5129 C C   . LYS B 2 97  ? -17.159 -16.288 96.502  1.00 52.27  ? 97  LYS B C   1 
ATOM   5130 O O   . LYS B 2 97  ? -18.382 -16.367 96.501  1.00 53.50  ? 97  LYS B O   1 
ATOM   5131 C CB  . LYS B 2 97  ? -15.241 -16.091 94.887  1.00 56.49  ? 97  LYS B CB  1 
ATOM   5132 C CG  . LYS B 2 97  ? -15.587 -17.329 94.035  1.00 61.02  ? 97  LYS B CG  1 
ATOM   5133 C CD  . LYS B 2 97  ? -14.386 -17.849 93.223  1.00 64.45  ? 97  LYS B CD  1 
ATOM   5134 C CE  . LYS B 2 97  ? -14.744 -19.104 92.411  1.00 66.69  ? 97  LYS B CE  1 
ATOM   5135 N NZ  . LYS B 2 97  ? -13.569 -19.712 91.701  1.00 68.01  ? 97  LYS B NZ  1 
ATOM   5136 N N   . ILE B 2 98  ? -16.408 -16.965 97.372  1.00 51.08  ? 98  ILE B N   1 
ATOM   5137 C CA  . ILE B 2 98  ? -17.002 -17.881 98.372  1.00 49.82  ? 98  ILE B CA  1 
ATOM   5138 C C   . ILE B 2 98  ? -18.055 -17.257 99.304  1.00 50.06  ? 98  ILE B C   1 
ATOM   5139 O O   . ILE B 2 98  ? -17.805 -16.247 99.965  1.00 49.03  ? 98  ILE B O   1 
ATOM   5140 C CB  . ILE B 2 98  ? -15.909 -18.556 99.271  1.00 48.56  ? 98  ILE B CB  1 
ATOM   5141 C CG1 . ILE B 2 98  ? -14.859 -19.252 98.402  1.00 47.03  ? 98  ILE B CG1 1 
ATOM   5142 C CG2 . ILE B 2 98  ? -16.546 -19.601 100.183 1.00 45.65  ? 98  ILE B CG2 1 
ATOM   5143 C CD1 . ILE B 2 98  ? -13.738 -19.890 99.184  1.00 46.67  ? 98  ILE B CD1 1 
ATOM   5144 N N   . GLN B 2 99  ? -19.230 -17.883 99.353  1.00 50.13  ? 99  GLN B N   1 
ATOM   5145 C CA  . GLN B 2 99  ? -20.342 -17.415 100.185 1.00 50.28  ? 99  GLN B CA  1 
ATOM   5146 C C   . GLN B 2 99  ? -20.926 -18.550 101.036 1.00 47.58  ? 99  GLN B C   1 
ATOM   5147 O O   . GLN B 2 99  ? -20.579 -19.712 100.851 1.00 47.23  ? 99  GLN B O   1 
ATOM   5148 C CB  . GLN B 2 99  ? -21.442 -16.826 99.301  1.00 54.03  ? 99  GLN B CB  1 
ATOM   5149 C CG  . GLN B 2 99  ? -21.087 -15.504 98.632  1.00 59.65  ? 99  GLN B CG  1 
ATOM   5150 C CD  . GLN B 2 99  ? -22.097 -15.119 97.555  1.00 64.05  ? 99  GLN B CD  1 
ATOM   5151 O OE1 . GLN B 2 99  ? -23.286 -14.915 97.837  1.00 65.72  ? 99  GLN B OE1 1 
ATOM   5152 N NE2 . GLN B 2 99  ? -21.628 -15.032 96.308  1.00 65.47  ? 99  GLN B NE2 1 
ATOM   5153 N N   . PRO B 2 100 ? -21.824 -18.220 101.978 1.00 45.17  ? 100 PRO B N   1 
ATOM   5154 C CA  . PRO B 2 100 ? -22.471 -19.189 102.876 1.00 44.60  ? 100 PRO B CA  1 
ATOM   5155 C C   . PRO B 2 100 ? -23.388 -20.184 102.173 1.00 44.75  ? 100 PRO B C   1 
ATOM   5156 O O   . PRO B 2 100 ? -24.064 -19.835 101.207 1.00 46.32  ? 100 PRO B O   1 
ATOM   5157 C CB  . PRO B 2 100 ? -23.243 -18.302 103.841 1.00 45.06  ? 100 PRO B CB  1 
ATOM   5158 C CG  . PRO B 2 100 ? -22.465 -17.020 103.828 1.00 45.63  ? 100 PRO B CG  1 
ATOM   5159 C CD  . PRO B 2 100 ? -22.149 -16.843 102.378 1.00 43.84  ? 100 PRO B CD  1 
ATOM   5160 N N   . GLY B 2 101 ? -23.425 -21.415 102.677 1.00 43.55  ? 101 GLY B N   1 
ATOM   5161 C CA  . GLY B 2 101 ? -24.246 -22.444 102.066 1.00 43.11  ? 101 GLY B CA  1 
ATOM   5162 C C   . GLY B 2 101 ? -25.632 -22.643 102.653 1.00 44.02  ? 101 GLY B C   1 
ATOM   5163 O O   . GLY B 2 101 ? -26.044 -21.926 103.563 1.00 43.65  ? 101 GLY B O   1 
ATOM   5164 N N   . SER B 2 102 ? -26.351 -23.627 102.114 1.00 44.37  ? 102 SER B N   1 
ATOM   5165 C CA  . SER B 2 102 ? -27.704 -23.964 102.555 1.00 44.75  ? 102 SER B CA  1 
ATOM   5166 C C   . SER B 2 102 ? -27.710 -25.344 103.201 1.00 45.35  ? 102 SER B C   1 
ATOM   5167 O O   . SER B 2 102 ? -28.636 -25.711 103.927 1.00 46.15  ? 102 SER B O   1 
ATOM   5168 C CB  . SER B 2 102 ? -28.662 -23.998 101.364 1.00 44.84  ? 102 SER B CB  1 
ATOM   5169 O OG  . SER B 2 102 ? -28.640 -22.779 100.650 1.00 48.65  ? 102 SER B OG  1 
ATOM   5170 N N   . GLN B 2 103 ? -26.670 -26.115 102.924 1.00 44.50  ? 103 GLN B N   1 
ATOM   5171 C CA  . GLN B 2 103 ? -26.581 -27.457 103.458 1.00 42.82  ? 103 GLN B CA  1 
ATOM   5172 C C   . GLN B 2 103 ? -25.711 -27.534 104.698 1.00 41.54  ? 103 GLN B C   1 
ATOM   5173 O O   . GLN B 2 103 ? -25.123 -26.538 105.117 1.00 41.73  ? 103 GLN B O   1 
ATOM   5174 C CB  . GLN B 2 103 ? -26.062 -28.377 102.368 1.00 45.51  ? 103 GLN B CB  1 
ATOM   5175 C CG  . GLN B 2 103 ? -26.934 -28.312 101.138 1.00 47.30  ? 103 GLN B CG  1 
ATOM   5176 C CD  . GLN B 2 103 ? -28.350 -28.710 101.460 1.00 49.01  ? 103 GLN B CD  1 
ATOM   5177 O OE1 . GLN B 2 103 ? -28.623 -29.883 101.724 1.00 49.36  ? 103 GLN B OE1 1 
ATOM   5178 N NE2 . GLN B 2 103 ? -29.262 -27.735 101.464 1.00 47.48  ? 103 GLN B NE2 1 
ATOM   5179 N N   . GLN B 2 104 ? -25.647 -28.722 105.289 1.00 38.54  ? 104 GLN B N   1 
ATOM   5180 C CA  . GLN B 2 104 ? -24.870 -28.938 106.496 1.00 36.32  ? 104 GLN B CA  1 
ATOM   5181 C C   . GLN B 2 104 ? -24.085 -30.231 106.346 1.00 36.10  ? 104 GLN B C   1 
ATOM   5182 O O   . GLN B 2 104 ? -24.609 -31.314 106.578 1.00 36.76  ? 104 GLN B O   1 
ATOM   5183 C CB  . GLN B 2 104 ? -25.810 -29.020 107.704 1.00 35.27  ? 104 GLN B CB  1 
ATOM   5184 C CG  . GLN B 2 104 ? -26.624 -27.749 107.942 1.00 35.11  ? 104 GLN B CG  1 
ATOM   5185 C CD  . GLN B 2 104 ? -25.858 -26.661 108.699 1.00 35.75  ? 104 GLN B CD  1 
ATOM   5186 O OE1 . GLN B 2 104 ? -24.634 -26.545 108.590 1.00 35.87  ? 104 GLN B OE1 1 
ATOM   5187 N NE2 . GLN B 2 104 ? -26.587 -25.851 109.460 1.00 35.57  ? 104 GLN B NE2 1 
ATOM   5188 N N   . ALA B 2 105 ? -22.822 -30.116 105.958 1.00 35.62  ? 105 ALA B N   1 
ATOM   5189 C CA  . ALA B 2 105 ? -21.984 -31.290 105.760 1.00 34.03  ? 105 ALA B CA  1 
ATOM   5190 C C   . ALA B 2 105 ? -21.577 -31.942 107.066 1.00 33.49  ? 105 ALA B C   1 
ATOM   5191 O O   . ALA B 2 105 ? -21.547 -31.304 108.109 1.00 34.67  ? 105 ALA B O   1 
ATOM   5192 C CB  . ALA B 2 105 ? -20.750 -30.911 104.961 1.00 32.57  ? 105 ALA B CB  1 
ATOM   5193 N N   . ASP B 2 106 ? -21.272 -33.229 106.997 1.00 33.96  ? 106 ASP B N   1 
ATOM   5194 C CA  . ASP B 2 106 ? -20.837 -33.997 108.156 1.00 33.27  ? 106 ASP B CA  1 
ATOM   5195 C C   . ASP B 2 106 ? -19.428 -33.481 108.487 1.00 32.77  ? 106 ASP B C   1 
ATOM   5196 O O   . ASP B 2 106 ? -18.487 -33.685 107.715 1.00 32.79  ? 106 ASP B O   1 
ATOM   5197 C CB  . ASP B 2 106 ? -20.820 -35.483 107.775 1.00 34.09  ? 106 ASP B CB  1 
ATOM   5198 C CG  . ASP B 2 106 ? -20.261 -36.366 108.864 1.00 36.49  ? 106 ASP B CG  1 
ATOM   5199 O OD1 . ASP B 2 106 ? -19.178 -36.044 109.393 1.00 36.51  ? 106 ASP B OD1 1 
ATOM   5200 O OD2 . ASP B 2 106 ? -20.898 -37.399 109.175 1.00 38.86  ? 106 ASP B OD2 1 
ATOM   5201 N N   . PHE B 2 107 ? -19.279 -32.819 109.628 1.00 30.66  ? 107 PHE B N   1 
ATOM   5202 C CA  . PHE B 2 107 ? -17.986 -32.243 109.996 1.00 31.04  ? 107 PHE B CA  1 
ATOM   5203 C C   . PHE B 2 107 ? -16.766 -33.190 109.989 1.00 31.03  ? 107 PHE B C   1 
ATOM   5204 O O   . PHE B 2 107 ? -15.677 -32.785 109.585 1.00 31.27  ? 107 PHE B O   1 
ATOM   5205 C CB  . PHE B 2 107 ? -18.147 -31.465 111.325 1.00 30.94  ? 107 PHE B CB  1 
ATOM   5206 C CG  . PHE B 2 107 ? -17.377 -32.020 112.484 1.00 30.10  ? 107 PHE B CG  1 
ATOM   5207 C CD1 . PHE B 2 107 ? -15.998 -31.866 112.555 1.00 29.90  ? 107 PHE B CD1 1 
ATOM   5208 C CD2 . PHE B 2 107 ? -18.036 -32.667 113.525 1.00 28.63  ? 107 PHE B CD2 1 
ATOM   5209 C CE1 . PHE B 2 107 ? -15.276 -32.346 113.645 1.00 28.49  ? 107 PHE B CE1 1 
ATOM   5210 C CE2 . PHE B 2 107 ? -17.323 -33.148 114.617 1.00 29.64  ? 107 PHE B CE2 1 
ATOM   5211 C CZ  . PHE B 2 107 ? -15.933 -32.985 114.674 1.00 27.55  ? 107 PHE B CZ  1 
ATOM   5212 N N   . LEU B 2 108 ? -16.926 -34.443 110.408 1.00 30.26  ? 108 LEU B N   1 
ATOM   5213 C CA  . LEU B 2 108 ? -15.797 -35.375 110.378 1.00 29.09  ? 108 LEU B CA  1 
ATOM   5214 C C   . LEU B 2 108 ? -15.517 -35.806 108.941 1.00 29.75  ? 108 LEU B C   1 
ATOM   5215 O O   . LEU B 2 108 ? -14.380 -36.118 108.586 1.00 29.99  ? 108 LEU B O   1 
ATOM   5216 C CB  . LEU B 2 108 ? -16.075 -36.613 111.230 1.00 26.52  ? 108 LEU B CB  1 
ATOM   5217 C CG  . LEU B 2 108 ? -15.947 -36.457 112.745 1.00 25.08  ? 108 LEU B CG  1 
ATOM   5218 C CD1 . LEU B 2 108 ? -16.112 -37.812 113.414 1.00 23.70  ? 108 LEU B CD1 1 
ATOM   5219 C CD2 . LEU B 2 108 ? -14.585 -35.869 113.077 1.00 24.81  ? 108 LEU B CD2 1 
ATOM   5220 N N   . ASP B 2 109 ? -16.564 -35.843 108.123 1.00 30.04  ? 109 ASP B N   1 
ATOM   5221 C CA  . ASP B 2 109 ? -16.413 -36.201 106.721 1.00 29.80  ? 109 ASP B CA  1 
ATOM   5222 C C   . ASP B 2 109 ? -15.484 -35.153 106.090 1.00 28.74  ? 109 ASP B C   1 
ATOM   5223 O O   . ASP B 2 109 ? -14.576 -35.498 105.338 1.00 28.61  ? 109 ASP B O   1 
ATOM   5224 C CB  . ASP B 2 109 ? -17.778 -36.206 106.002 1.00 32.34  ? 109 ASP B CB  1 
ATOM   5225 C CG  . ASP B 2 109 ? -18.429 -37.599 105.951 1.00 33.50  ? 109 ASP B CG  1 
ATOM   5226 O OD1 . ASP B 2 109 ? -17.776 -38.563 106.397 1.00 32.88  ? 109 ASP B OD1 1 
ATOM   5227 O OD2 . ASP B 2 109 ? -19.585 -37.724 105.456 1.00 32.07  ? 109 ASP B OD2 1 
ATOM   5228 N N   . ALA B 2 110 ? -15.711 -33.879 106.407 1.00 27.10  ? 110 ALA B N   1 
ATOM   5229 C CA  . ALA B 2 110 ? -14.877 -32.795 105.882 1.00 26.97  ? 110 ALA B CA  1 
ATOM   5230 C C   . ALA B 2 110 ? -13.437 -33.071 106.281 1.00 28.12  ? 110 ALA B C   1 
ATOM   5231 O O   . ALA B 2 110 ? -12.521 -33.051 105.454 1.00 28.51  ? 110 ALA B O   1 
ATOM   5232 C CB  . ALA B 2 110 ? -15.318 -31.468 106.456 1.00 24.88  ? 110 ALA B CB  1 
ATOM   5233 N N   . LEU B 2 111 ? -13.252 -33.336 107.566 1.00 28.11  ? 111 LEU B N   1 
ATOM   5234 C CA  . LEU B 2 111 ? -11.940 -33.642 108.090 1.00 29.75  ? 111 LEU B CA  1 
ATOM   5235 C C   . LEU B 2 111 ? -11.282 -34.731 107.243 1.00 30.68  ? 111 LEU B C   1 
ATOM   5236 O O   . LEU B 2 111 ? -10.150 -34.577 106.777 1.00 32.29  ? 111 LEU B O   1 
ATOM   5237 C CB  . LEU B 2 111 ? -12.055 -34.115 109.539 1.00 29.45  ? 111 LEU B CB  1 
ATOM   5238 C CG  . LEU B 2 111 ? -10.719 -34.255 110.274 1.00 28.61  ? 111 LEU B CG  1 
ATOM   5239 C CD1 . LEU B 2 111 ? -9.859  -33.000 110.047 1.00 27.04  ? 111 LEU B CD1 1 
ATOM   5240 C CD2 . LEU B 2 111 ? -10.992 -34.488 111.755 1.00 26.85  ? 111 LEU B CD2 1 
ATOM   5241 N N   . ILE B 2 112 ? -11.987 -35.836 107.048 1.00 28.33  ? 112 ILE B N   1 
ATOM   5242 C CA  . ILE B 2 112 ? -11.430 -36.907 106.248 1.00 28.23  ? 112 ILE B CA  1 
ATOM   5243 C C   . ILE B 2 112 ? -11.023 -36.386 104.865 1.00 27.62  ? 112 ILE B C   1 
ATOM   5244 O O   . ILE B 2 112 ? -9.916  -36.646 104.406 1.00 27.08  ? 112 ILE B O   1 
ATOM   5245 C CB  . ILE B 2 112 ? -12.435 -38.089 106.133 1.00 28.99  ? 112 ILE B CB  1 
ATOM   5246 C CG1 . ILE B 2 112 ? -12.450 -38.887 107.443 1.00 30.39  ? 112 ILE B CG1 1 
ATOM   5247 C CG2 . ILE B 2 112 ? -12.042 -39.014 105.011 1.00 29.40  ? 112 ILE B CG2 1 
ATOM   5248 C CD1 . ILE B 2 112 ? -13.391 -40.103 107.446 1.00 28.41  ? 112 ILE B CD1 1 
ATOM   5249 N N   . VAL B 2 113 ? -11.900 -35.638 104.206 1.00 27.03  ? 113 VAL B N   1 
ATOM   5250 C CA  . VAL B 2 113 ? -11.567 -35.110 102.888 1.00 26.87  ? 113 VAL B CA  1 
ATOM   5251 C C   . VAL B 2 113 ? -10.329 -34.243 103.014 1.00 27.88  ? 113 VAL B C   1 
ATOM   5252 O O   . VAL B 2 113 ? -9.467  -34.235 102.145 1.00 25.71  ? 113 VAL B O   1 
ATOM   5253 C CB  . VAL B 2 113 ? -12.686 -34.220 102.308 1.00 27.79  ? 113 VAL B CB  1 
ATOM   5254 C CG1 . VAL B 2 113 ? -12.317 -33.795 100.897 1.00 26.90  ? 113 VAL B CG1 1 
ATOM   5255 C CG2 . VAL B 2 113 ? -14.013 -34.952 102.316 1.00 28.46  ? 113 VAL B CG2 1 
ATOM   5256 N N   . SER B 2 114 ? -10.257 -33.489 104.103 1.00 30.32  ? 114 SER B N   1 
ATOM   5257 C CA  . SER B 2 114 ? -9.116  -32.618 104.334 1.00 32.29  ? 114 SER B CA  1 
ATOM   5258 C C   . SER B 2 114 ? -7.839  -33.444 104.504 1.00 33.24  ? 114 SER B C   1 
ATOM   5259 O O   . SER B 2 114 ? -6.777  -33.080 104.000 1.00 32.86  ? 114 SER B O   1 
ATOM   5260 C CB  . SER B 2 114 ? -9.364  -31.747 105.569 1.00 32.48  ? 114 SER B CB  1 
ATOM   5261 O OG  . SER B 2 114 ? -10.340 -30.750 105.298 1.00 32.98  ? 114 SER B OG  1 
ATOM   5262 N N   . MET B 2 115 ? -7.952  -34.563 105.212 1.00 33.65  ? 115 MET B N   1 
ATOM   5263 C CA  . MET B 2 115 ? -6.812  -35.440 105.432 1.00 34.00  ? 115 MET B CA  1 
ATOM   5264 C C   . MET B 2 115 ? -6.372  -36.044 104.126 1.00 34.40  ? 115 MET B C   1 
ATOM   5265 O O   . MET B 2 115 ? -5.192  -36.264 103.902 1.00 35.12  ? 115 MET B O   1 
ATOM   5266 C CB  . MET B 2 115 ? -7.175  -36.568 106.381 1.00 34.30  ? 115 MET B CB  1 
ATOM   5267 C CG  . MET B 2 115 ? -7.355  -36.150 107.810 1.00 34.66  ? 115 MET B CG  1 
ATOM   5268 S SD  . MET B 2 115 ? -7.471  -37.630 108.781 1.00 34.02  ? 115 MET B SD  1 
ATOM   5269 C CE  . MET B 2 115 ? -9.247  -37.757 108.858 1.00 37.29  ? 115 MET B CE  1 
ATOM   5270 N N   . ASP B 2 116 ? -7.337  -36.316 103.262 1.00 36.75  ? 116 ASP B N   1 
ATOM   5271 C CA  . ASP B 2 116 ? -7.048  -36.910 101.966 1.00 38.15  ? 116 ASP B CA  1 
ATOM   5272 C C   . ASP B 2 116 ? -6.304  -35.934 101.068 1.00 38.31  ? 116 ASP B C   1 
ATOM   5273 O O   . ASP B 2 116 ? -5.483  -36.343 100.263 1.00 39.43  ? 116 ASP B O   1 
ATOM   5274 C CB  . ASP B 2 116 ? -8.344  -37.359 101.286 1.00 39.87  ? 116 ASP B CB  1 
ATOM   5275 C CG  . ASP B 2 116 ? -8.092  -38.196 100.046 1.00 42.26  ? 116 ASP B CG  1 
ATOM   5276 O OD1 . ASP B 2 116 ? -7.808  -39.415 100.183 1.00 41.51  ? 116 ASP B OD1 1 
ATOM   5277 O OD2 . ASP B 2 116 ? -8.172  -37.623 98.936  1.00 43.44  ? 116 ASP B OD2 1 
ATOM   5278 N N   . VAL B 2 117 ? -6.587  -34.644 101.191 1.00 37.32  ? 117 VAL B N   1 
ATOM   5279 C CA  . VAL B 2 117 ? -5.875  -33.697 100.365 1.00 36.73  ? 117 VAL B CA  1 
ATOM   5280 C C   . VAL B 2 117 ? -4.417  -33.808 100.740 1.00 38.68  ? 117 VAL B C   1 
ATOM   5281 O O   . VAL B 2 117 ? -3.562  -33.946 99.879  1.00 40.79  ? 117 VAL B O   1 
ATOM   5282 C CB  . VAL B 2 117 ? -6.336  -32.257 100.583 1.00 35.70  ? 117 VAL B CB  1 
ATOM   5283 C CG1 . VAL B 2 117 ? -5.193  -31.309 100.308 1.00 34.09  ? 117 VAL B CG1 1 
ATOM   5284 C CG2 . VAL B 2 117 ? -7.481  -31.937 99.643  1.00 34.03  ? 117 VAL B CG2 1 
ATOM   5285 N N   . ILE B 2 118 ? -4.122  -33.771 102.028 1.00 39.83  ? 118 ILE B N   1 
ATOM   5286 C CA  . ILE B 2 118 ? -2.734  -33.880 102.441 1.00 40.72  ? 118 ILE B CA  1 
ATOM   5287 C C   . ILE B 2 118 ? -2.105  -35.170 101.938 1.00 42.43  ? 118 ILE B C   1 
ATOM   5288 O O   . ILE B 2 118 ? -1.226  -35.152 101.082 1.00 43.03  ? 118 ILE B O   1 
ATOM   5289 C CB  . ILE B 2 118 ? -2.603  -33.835 103.954 1.00 38.87  ? 118 ILE B CB  1 
ATOM   5290 C CG1 . ILE B 2 118 ? -2.809  -32.405 104.438 1.00 39.79  ? 118 ILE B CG1 1 
ATOM   5291 C CG2 . ILE B 2 118 ? -1.252  -34.365 104.370 1.00 40.01  ? 118 ILE B CG2 1 
ATOM   5292 C CD1 . ILE B 2 118 ? -2.699  -32.242 105.939 1.00 41.52  ? 118 ILE B CD1 1 
ATOM   5293 N N   . GLN B 2 119 ? -2.579  -36.288 102.462 1.00 44.55  ? 119 GLN B N   1 
ATOM   5294 C CA  . GLN B 2 119 ? -2.046  -37.585 102.100 1.00 47.76  ? 119 GLN B CA  1 
ATOM   5295 C C   . GLN B 2 119 ? -1.648  -37.760 100.640 1.00 49.90  ? 119 GLN B C   1 
ATOM   5296 O O   . GLN B 2 119 ? -0.481  -37.986 100.334 1.00 50.52  ? 119 GLN B O   1 
ATOM   5297 C CB  . GLN B 2 119 ? -3.033  -38.683 102.511 1.00 47.87  ? 119 GLN B CB  1 
ATOM   5298 C CG  . GLN B 2 119 ? -3.187  -38.824 104.022 1.00 49.75  ? 119 GLN B CG  1 
ATOM   5299 C CD  . GLN B 2 119 ? -4.234  -39.849 104.426 1.00 51.86  ? 119 GLN B CD  1 
ATOM   5300 O OE1 . GLN B 2 119 ? -5.387  -39.782 103.995 1.00 53.00  ? 119 GLN B OE1 1 
ATOM   5301 N NE2 . GLN B 2 119 ? -3.838  -40.800 105.268 1.00 53.23  ? 119 GLN B NE2 1 
ATOM   5302 N N   . HIS B 2 120 ? -2.613  -37.638 99.739  1.00 52.50  ? 120 HIS B N   1 
ATOM   5303 C CA  . HIS B 2 120 ? -2.361  -37.831 98.312  1.00 54.36  ? 120 HIS B CA  1 
ATOM   5304 C C   . HIS B 2 120 ? -1.541  -36.730 97.648  1.00 53.93  ? 120 HIS B C   1 
ATOM   5305 O O   . HIS B 2 120 ? -0.633  -37.024 96.869  1.00 54.19  ? 120 HIS B O   1 
ATOM   5306 C CB  . HIS B 2 120 ? -3.695  -38.022 97.553  1.00 57.56  ? 120 HIS B CB  1 
ATOM   5307 C CG  . HIS B 2 120 ? -3.531  -38.223 96.072  1.00 63.25  ? 120 HIS B CG  1 
ATOM   5308 N ND1 . HIS B 2 120 ? -3.241  -37.193 95.210  1.00 65.76  ? 120 HIS B ND1 1 
ATOM   5309 C CD2 . HIS B 2 120 ? -3.591  -39.351 95.321  1.00 64.61  ? 120 HIS B CD2 1 
ATOM   5310 C CE1 . HIS B 2 120 ? -3.127  -37.675 93.977  1.00 65.36  ? 120 HIS B CE1 1 
ATOM   5311 N NE2 . HIS B 2 120 ? -3.334  -38.974 94.022  1.00 64.90  ? 120 HIS B NE2 1 
ATOM   5312 N N   . GLU B 2 121 ? -1.853  -35.473 97.947  1.00 53.42  ? 121 GLU B N   1 
ATOM   5313 C CA  . GLU B 2 121 ? -1.149  -34.354 97.337  1.00 52.00  ? 121 GLU B CA  1 
ATOM   5314 C C   . GLU B 2 121 ? 0.235   -34.055 97.914  1.00 50.91  ? 121 GLU B C   1 
ATOM   5315 O O   . GLU B 2 121 ? 0.880   -33.091 97.500  1.00 51.92  ? 121 GLU B O   1 
ATOM   5316 C CB  . GLU B 2 121 ? -2.026  -33.099 97.394  1.00 52.51  ? 121 GLU B CB  1 
ATOM   5317 C CG  . GLU B 2 121 ? -3.278  -33.182 96.530  1.00 55.93  ? 121 GLU B CG  1 
ATOM   5318 C CD  . GLU B 2 121 ? -4.227  -32.004 96.724  1.00 58.91  ? 121 GLU B CD  1 
ATOM   5319 O OE1 . GLU B 2 121 ? -3.742  -30.846 96.751  1.00 60.00  ? 121 GLU B OE1 1 
ATOM   5320 O OE2 . GLU B 2 121 ? -5.459  -32.241 96.830  1.00 58.38  ? 121 GLU B OE2 1 
ATOM   5321 N N   . THR B 2 122 ? 0.708   -34.861 98.858  1.00 48.76  ? 122 THR B N   1 
ATOM   5322 C CA  . THR B 2 122 ? 2.034   -34.610 99.407  1.00 47.82  ? 122 THR B CA  1 
ATOM   5323 C C   . THR B 2 122 ? 3.064   -35.632 98.956  1.00 47.56  ? 122 THR B C   1 
ATOM   5324 O O   . THR B 2 122 ? 4.258   -35.403 99.116  1.00 47.96  ? 122 THR B O   1 
ATOM   5325 C CB  . THR B 2 122 ? 2.037   -34.561 100.963 1.00 46.38  ? 122 THR B CB  1 
ATOM   5326 O OG1 . THR B 2 122 ? 1.477   -35.770 101.492 1.00 46.60  ? 122 THR B OG1 1 
ATOM   5327 C CG2 . THR B 2 122 ? 1.260   -33.351 101.463 1.00 44.63  ? 122 THR B CG2 1 
ATOM   5328 N N   . ILE B 2 123 ? 2.605   -36.744 98.387  1.00 47.94  ? 123 ILE B N   1 
ATOM   5329 C CA  . ILE B 2 123 ? 3.488   -37.822 97.922  1.00 48.99  ? 123 ILE B CA  1 
ATOM   5330 C C   . ILE B 2 123 ? 4.740   -37.346 97.173  1.00 49.46  ? 123 ILE B C   1 
ATOM   5331 O O   . ILE B 2 123 ? 5.877   -37.612 97.585  1.00 49.63  ? 123 ILE B O   1 
ATOM   5332 C CB  . ILE B 2 123 ? 2.754   -38.796 96.973  1.00 48.75  ? 123 ILE B CB  1 
ATOM   5333 C CG1 . ILE B 2 123 ? 1.505   -39.372 97.641  1.00 49.82  ? 123 ILE B CG1 1 
ATOM   5334 C CG2 . ILE B 2 123 ? 3.675   -39.931 96.600  1.00 48.46  ? 123 ILE B CG2 1 
ATOM   5335 C CD1 . ILE B 2 123 ? 0.594   -40.151 96.677  1.00 50.03  ? 123 ILE B CD1 1 
ATOM   5336 N N   . GLY B 2 124 ? 4.527   -36.649 96.066  1.00 48.65  ? 124 GLY B N   1 
ATOM   5337 C CA  . GLY B 2 124 ? 5.658   -36.186 95.288  1.00 49.32  ? 124 GLY B CA  1 
ATOM   5338 C C   . GLY B 2 124 ? 6.464   -35.042 95.881  1.00 49.28  ? 124 GLY B C   1 
ATOM   5339 O O   . GLY B 2 124 ? 7.504   -34.680 95.333  1.00 50.13  ? 124 GLY B O   1 
ATOM   5340 N N   . LYS B 2 125 ? 6.015   -34.477 96.996  1.00 47.98  ? 125 LYS B N   1 
ATOM   5341 C CA  . LYS B 2 125 ? 6.717   -33.343 97.588  1.00 47.50  ? 125 LYS B CA  1 
ATOM   5342 C C   . LYS B 2 125 ? 7.435   -33.629 98.912  1.00 47.94  ? 125 LYS B C   1 
ATOM   5343 O O   . LYS B 2 125 ? 7.400   -34.747 99.430  1.00 47.20  ? 125 LYS B O   1 
ATOM   5344 C CB  . LYS B 2 125 ? 5.733   -32.191 97.781  1.00 46.91  ? 125 LYS B CB  1 
ATOM   5345 C CG  . LYS B 2 125 ? 4.860   -31.923 96.571  1.00 46.06  ? 125 LYS B CG  1 
ATOM   5346 C CD  . LYS B 2 125 ? 3.980   -30.680 96.754  1.00 48.01  ? 125 LYS B CD  1 
ATOM   5347 C CE  . LYS B 2 125 ? 3.124   -30.423 95.502  1.00 49.20  ? 125 LYS B CE  1 
ATOM   5348 N NZ  . LYS B 2 125 ? 2.202   -29.238 95.604  1.00 48.52  ? 125 LYS B NZ  1 
ATOM   5349 N N   . LYS B 2 126 ? 8.103   -32.611 99.446  1.00 47.35  ? 126 LYS B N   1 
ATOM   5350 C CA  . LYS B 2 126 ? 8.810   -32.772 100.707 1.00 47.60  ? 126 LYS B CA  1 
ATOM   5351 C C   . LYS B 2 126 ? 8.339   -31.715 101.687 1.00 46.43  ? 126 LYS B C   1 
ATOM   5352 O O   . LYS B 2 126 ? 8.773   -30.564 101.619 1.00 46.72  ? 126 LYS B O   1 
ATOM   5353 C CB  . LYS B 2 126 ? 10.322  -32.617 100.534 1.00 50.32  ? 126 LYS B CB  1 
ATOM   5354 C CG  . LYS B 2 126 ? 11.116  -32.834 101.834 1.00 54.08  ? 126 LYS B CG  1 
ATOM   5355 C CD  . LYS B 2 126 ? 12.128  -31.736 102.096 1.00 55.73  ? 126 LYS B CD  1 
ATOM   5356 C CE  . LYS B 2 126 ? 12.714  -31.917 103.475 1.00 55.05  ? 126 LYS B CE  1 
ATOM   5357 N NZ  . LYS B 2 126 ? 13.710  -30.874 103.805 1.00 56.64  ? 126 LYS B NZ  1 
ATOM   5358 N N   . PHE B 2 127 ? 7.460   -32.111 102.603 1.00 43.73  ? 127 PHE B N   1 
ATOM   5359 C CA  . PHE B 2 127 ? 6.948   -31.200 103.615 1.00 40.73  ? 127 PHE B CA  1 
ATOM   5360 C C   . PHE B 2 127 ? 7.502   -31.624 104.962 1.00 42.62  ? 127 PHE B C   1 
ATOM   5361 O O   . PHE B 2 127 ? 7.736   -32.806 105.211 1.00 43.58  ? 127 PHE B O   1 
ATOM   5362 C CB  . PHE B 2 127 ? 5.419   -31.213 103.650 1.00 34.89  ? 127 PHE B CB  1 
ATOM   5363 C CG  . PHE B 2 127 ? 4.782   -30.620 102.433 1.00 29.42  ? 127 PHE B CG  1 
ATOM   5364 C CD1 . PHE B 2 127 ? 4.134   -31.427 101.504 1.00 28.15  ? 127 PHE B CD1 1 
ATOM   5365 C CD2 . PHE B 2 127 ? 4.844   -29.250 102.204 1.00 27.43  ? 127 PHE B CD2 1 
ATOM   5366 C CE1 . PHE B 2 127 ? 3.572   -30.876 100.363 1.00 27.69  ? 127 PHE B CE1 1 
ATOM   5367 C CE2 . PHE B 2 127 ? 4.284   -28.687 101.068 1.00 25.84  ? 127 PHE B CE2 1 
ATOM   5368 C CZ  . PHE B 2 127 ? 3.644   -29.499 100.147 1.00 29.19  ? 127 PHE B CZ  1 
ATOM   5369 N N   . GLU B 2 128 ? 7.718   -30.647 105.830 1.00 44.25  ? 128 GLU B N   1 
ATOM   5370 C CA  . GLU B 2 128 ? 8.262   -30.924 107.142 1.00 45.20  ? 128 GLU B CA  1 
ATOM   5371 C C   . GLU B 2 128 ? 7.122   -31.083 108.142 1.00 43.57  ? 128 GLU B C   1 
ATOM   5372 O O   . GLU B 2 128 ? 7.280   -31.770 109.157 1.00 43.45  ? 128 GLU B O   1 
ATOM   5373 C CB  . GLU B 2 128 ? 9.182   -29.790 107.563 1.00 49.47  ? 128 GLU B CB  1 
ATOM   5374 C CG  . GLU B 2 128 ? 9.980   -30.080 108.809 1.00 56.05  ? 128 GLU B CG  1 
ATOM   5375 C CD  . GLU B 2 128 ? 10.766  -28.860 109.243 1.00 60.23  ? 128 GLU B CD  1 
ATOM   5376 O OE1 . GLU B 2 128 ? 11.726  -28.473 108.528 1.00 61.64  ? 128 GLU B OE1 1 
ATOM   5377 O OE2 . GLU B 2 128 ? 10.408  -28.275 110.292 1.00 62.18  ? 128 GLU B OE2 1 
ATOM   5378 N N   . LYS B 2 129 ? 5.991   -30.432 107.860 1.00 41.37  ? 129 LYS B N   1 
ATOM   5379 C CA  . LYS B 2 129 ? 4.814   -30.513 108.711 1.00 39.47  ? 129 LYS B CA  1 
ATOM   5380 C C   . LYS B 2 129 ? 3.531   -30.476 107.911 1.00 39.35  ? 129 LYS B C   1 
ATOM   5381 O O   . LYS B 2 129 ? 3.402   -29.679 106.985 1.00 40.55  ? 129 LYS B O   1 
ATOM   5382 C CB  . LYS B 2 129 ? 4.839   -29.368 109.690 1.00 38.45  ? 129 LYS B CB  1 
ATOM   5383 C CG  . LYS B 2 129 ? 6.104   -29.445 110.531 1.00 43.39  ? 129 LYS B CG  1 
ATOM   5384 C CD  . LYS B 2 129 ? 6.287   -28.232 111.472 1.00 47.01  ? 129 LYS B CD  1 
ATOM   5385 C CE  . LYS B 2 129 ? 7.393   -28.333 112.558 1.00 47.44  ? 129 LYS B CE  1 
ATOM   5386 N NZ  . LYS B 2 129 ? 7.039   -29.466 113.430 1.00 44.03  ? 129 LYS B NZ  1 
ATOM   5387 N N   . ARG B 2 130 ? 2.605   -31.376 108.234 1.00 38.07  ? 130 ARG B N   1 
ATOM   5388 C CA  . ARG B 2 130 ? 1.298   -31.392 107.580 1.00 36.35  ? 130 ARG B CA  1 
ATOM   5389 C C   . ARG B 2 130 ? 0.359   -30.967 108.711 1.00 35.21  ? 130 ARG B C   1 
ATOM   5390 O O   . ARG B 2 130 ? 0.364   -31.548 109.796 1.00 35.70  ? 130 ARG B O   1 
ATOM   5391 C CB  . ARG B 2 130 ? 0.903   -32.785 107.075 1.00 38.55  ? 130 ARG B CB  1 
ATOM   5392 C CG  . ARG B 2 130 ? 1.946   -33.511 106.224 1.00 41.11  ? 130 ARG B CG  1 
ATOM   5393 C CD  . ARG B 2 130 ? 2.696   -34.516 107.081 1.00 45.89  ? 130 ARG B CD  1 
ATOM   5394 N NE  . ARG B 2 130 ? 4.121   -34.562 106.776 1.00 50.75  ? 130 ARG B NE  1 
ATOM   5395 C CZ  . ARG B 2 130 ? 5.047   -34.996 107.626 1.00 53.20  ? 130 ARG B CZ  1 
ATOM   5396 N NH1 . ARG B 2 130 ? 4.695   -35.418 108.837 1.00 52.66  ? 130 ARG B NH1 1 
ATOM   5397 N NH2 . ARG B 2 130 ? 6.326   -35.015 107.266 1.00 55.64  ? 130 ARG B NH2 1 
ATOM   5398 N N   . HIS B 2 131 ? -0.441  -29.945 108.464 1.00 32.80  ? 131 HIS B N   1 
ATOM   5399 C CA  . HIS B 2 131 ? -1.333  -29.435 109.483 1.00 28.89  ? 131 HIS B CA  1 
ATOM   5400 C C   . HIS B 2 131 ? -2.704  -29.122 108.906 1.00 28.94  ? 131 HIS B C   1 
ATOM   5401 O O   . HIS B 2 131 ? -2.834  -28.742 107.731 1.00 28.06  ? 131 HIS B O   1 
ATOM   5402 C CB  . HIS B 2 131 ? -0.714  -28.172 110.078 1.00 26.69  ? 131 HIS B CB  1 
ATOM   5403 C CG  . HIS B 2 131 ? -1.477  -27.592 111.217 1.00 23.72  ? 131 HIS B CG  1 
ATOM   5404 N ND1 . HIS B 2 131 ? -1.817  -28.325 112.340 1.00 23.96  ? 131 HIS B ND1 1 
ATOM   5405 C CD2 . HIS B 2 131 ? -1.907  -26.333 111.458 1.00 24.33  ? 131 HIS B CD2 1 
ATOM   5406 C CE1 . HIS B 2 131 ? -2.410  -27.540 113.212 1.00 25.88  ? 131 HIS B CE1 1 
ATOM   5407 N NE2 . HIS B 2 131 ? -2.478  -26.318 112.703 1.00 24.99  ? 131 HIS B NE2 1 
ATOM   5408 N N   . ILE B 2 132 ? -3.724  -29.286 109.742 1.00 27.78  ? 132 ILE B N   1 
ATOM   5409 C CA  . ILE B 2 132 ? -5.094  -28.995 109.341 1.00 25.68  ? 132 ILE B CA  1 
ATOM   5410 C C   . ILE B 2 132 ? -5.773  -28.060 110.333 1.00 24.31  ? 132 ILE B C   1 
ATOM   5411 O O   . ILE B 2 132 ? -5.654  -28.215 111.545 1.00 22.09  ? 132 ILE B O   1 
ATOM   5412 C CB  . ILE B 2 132 ? -5.928  -30.277 109.230 1.00 25.26  ? 132 ILE B CB  1 
ATOM   5413 C CG1 . ILE B 2 132 ? -5.475  -31.099 108.025 1.00 24.50  ? 132 ILE B CG1 1 
ATOM   5414 C CG2 . ILE B 2 132 ? -7.400  -29.929 109.109 1.00 26.08  ? 132 ILE B CG2 1 
ATOM   5415 C CD1 . ILE B 2 132 ? -5.993  -32.536 108.075 1.00 26.53  ? 132 ILE B CD1 1 
ATOM   5416 N N   . GLU B 2 133 ? -6.480  -27.077 109.800 1.00 23.07  ? 133 GLU B N   1 
ATOM   5417 C CA  . GLU B 2 133 ? -7.196  -26.132 110.626 1.00 22.21  ? 133 GLU B CA  1 
ATOM   5418 C C   . GLU B 2 133 ? -8.662  -26.156 110.238 1.00 23.02  ? 133 GLU B C   1 
ATOM   5419 O O   . GLU B 2 133 ? -9.005  -25.921 109.088 1.00 23.39  ? 133 GLU B O   1 
ATOM   5420 C CB  . GLU B 2 133 ? -6.586  -24.751 110.454 1.00 19.82  ? 133 GLU B CB  1 
ATOM   5421 C CG  . GLU B 2 133 ? -5.291  -24.654 111.208 1.00 22.41  ? 133 GLU B CG  1 
ATOM   5422 C CD  . GLU B 2 133 ? -4.484  -23.415 110.892 1.00 25.27  ? 133 GLU B CD  1 
ATOM   5423 O OE1 . GLU B 2 133 ? -5.079  -22.343 110.663 1.00 25.00  ? 133 GLU B OE1 1 
ATOM   5424 O OE2 . GLU B 2 133 ? -3.239  -23.509 110.897 1.00 26.85  ? 133 GLU B OE2 1 
ATOM   5425 N N   . ILE B 2 134 ? -9.521  -26.483 111.198 1.00 24.48  ? 134 ILE B N   1 
ATOM   5426 C CA  . ILE B 2 134 ? -10.956 -26.549 110.944 1.00 26.66  ? 134 ILE B CA  1 
ATOM   5427 C C   . ILE B 2 134 ? -11.658 -25.404 111.635 1.00 28.04  ? 134 ILE B C   1 
ATOM   5428 O O   . ILE B 2 134 ? -11.391 -25.130 112.795 1.00 30.03  ? 134 ILE B O   1 
ATOM   5429 C CB  . ILE B 2 134 ? -11.589 -27.848 111.492 1.00 26.49  ? 134 ILE B CB  1 
ATOM   5430 C CG1 . ILE B 2 134 ? -10.837 -29.071 110.976 1.00 27.81  ? 134 ILE B CG1 1 
ATOM   5431 C CG2 . ILE B 2 134 ? -13.041 -27.924 111.078 1.00 26.04  ? 134 ILE B CG2 1 
ATOM   5432 C CD1 . ILE B 2 134 ? -9.627  -29.429 111.815 1.00 31.46  ? 134 ILE B CD1 1 
ATOM   5433 N N   . PHE B 2 135 ? -12.559 -24.736 110.930 1.00 28.52  ? 135 PHE B N   1 
ATOM   5434 C CA  . PHE B 2 135 ? -13.309 -23.631 111.526 1.00 29.20  ? 135 PHE B CA  1 
ATOM   5435 C C   . PHE B 2 135 ? -14.761 -24.038 111.371 1.00 29.29  ? 135 PHE B C   1 
ATOM   5436 O O   . PHE B 2 135 ? -15.235 -24.232 110.262 1.00 30.69  ? 135 PHE B O   1 
ATOM   5437 C CB  . PHE B 2 135 ? -13.039 -22.319 110.781 1.00 27.22  ? 135 PHE B CB  1 
ATOM   5438 C CG  . PHE B 2 135 ? -11.583 -22.048 110.544 1.00 27.26  ? 135 PHE B CG  1 
ATOM   5439 C CD1 . PHE B 2 135 ? -10.855 -22.817 109.638 1.00 27.10  ? 135 PHE B CD1 1 
ATOM   5440 C CD2 . PHE B 2 135 ? -10.933 -21.028 111.222 1.00 27.76  ? 135 PHE B CD2 1 
ATOM   5441 C CE1 . PHE B 2 135 ? -9.498  -22.571 109.413 1.00 25.48  ? 135 PHE B CE1 1 
ATOM   5442 C CE2 . PHE B 2 135 ? -9.570  -20.776 111.001 1.00 27.15  ? 135 PHE B CE2 1 
ATOM   5443 C CZ  . PHE B 2 135 ? -8.857  -21.551 110.094 1.00 24.46  ? 135 PHE B CZ  1 
ATOM   5444 N N   . THR B 2 136 ? -15.474 -24.178 112.477 1.00 29.41  ? 136 THR B N   1 
ATOM   5445 C CA  . THR B 2 136 ? -16.861 -24.616 112.406 1.00 28.23  ? 136 THR B CA  1 
ATOM   5446 C C   . THR B 2 136 ? -17.584 -24.288 113.700 1.00 29.06  ? 136 THR B C   1 
ATOM   5447 O O   . THR B 2 136 ? -16.954 -23.948 114.706 1.00 28.55  ? 136 THR B O   1 
ATOM   5448 C CB  . THR B 2 136 ? -16.908 -26.160 112.148 1.00 28.50  ? 136 THR B CB  1 
ATOM   5449 O OG1 . THR B 2 136 ? -18.252 -26.643 112.231 1.00 28.48  ? 136 THR B OG1 1 
ATOM   5450 C CG2 . THR B 2 136 ? -16.047 -26.898 113.160 1.00 25.94  ? 136 THR B CG2 1 
ATOM   5451 N N   . ASP B 2 137 ? -18.910 -24.375 113.668 1.00 29.51  ? 137 ASP B N   1 
ATOM   5452 C CA  . ASP B 2 137 ? -19.709 -24.119 114.859 1.00 29.42  ? 137 ASP B CA  1 
ATOM   5453 C C   . ASP B 2 137 ? -20.227 -25.437 115.428 1.00 30.00  ? 137 ASP B C   1 
ATOM   5454 O O   . ASP B 2 137 ? -21.050 -25.443 116.339 1.00 31.38  ? 137 ASP B O   1 
ATOM   5455 C CB  . ASP B 2 137 ? -20.882 -23.196 114.536 1.00 28.04  ? 137 ASP B CB  1 
ATOM   5456 C CG  . ASP B 2 137 ? -21.797 -23.767 113.479 1.00 29.16  ? 137 ASP B CG  1 
ATOM   5457 O OD1 . ASP B 2 137 ? -21.499 -24.871 112.966 1.00 27.60  ? 137 ASP B OD1 1 
ATOM   5458 O OD2 . ASP B 2 137 ? -22.810 -23.105 113.155 1.00 28.36  ? 137 ASP B OD2 1 
ATOM   5459 N N   . LEU B 2 138 ? -19.753 -26.553 114.883 1.00 29.26  ? 138 LEU B N   1 
ATOM   5460 C CA  . LEU B 2 138 ? -20.174 -27.861 115.362 1.00 31.35  ? 138 LEU B CA  1 
ATOM   5461 C C   . LEU B 2 138 ? -21.687 -27.934 115.547 1.00 32.56  ? 138 LEU B C   1 
ATOM   5462 O O   . LEU B 2 138 ? -22.180 -28.617 116.439 1.00 34.19  ? 138 LEU B O   1 
ATOM   5463 C CB  . LEU B 2 138 ? -19.496 -28.136 116.696 1.00 31.53  ? 138 LEU B CB  1 
ATOM   5464 C CG  . LEU B 2 138 ? -17.975 -28.057 116.622 1.00 34.03  ? 138 LEU B CG  1 
ATOM   5465 C CD1 . LEU B 2 138 ? -17.396 -27.956 118.025 1.00 33.71  ? 138 LEU B CD1 1 
ATOM   5466 C CD2 . LEU B 2 138 ? -17.441 -29.285 115.876 1.00 33.00  ? 138 LEU B CD2 1 
ATOM   5467 N N   . SER B 2 139 ? -22.428 -27.255 114.685 1.00 33.10  ? 139 SER B N   1 
ATOM   5468 C CA  . SER B 2 139 ? -23.872 -27.213 114.823 1.00 33.46  ? 139 SER B CA  1 
ATOM   5469 C C   . SER B 2 139 ? -24.678 -28.427 114.376 1.00 33.04  ? 139 SER B C   1 
ATOM   5470 O O   . SER B 2 139 ? -25.782 -28.631 114.865 1.00 32.65  ? 139 SER B O   1 
ATOM   5471 C CB  . SER B 2 139 ? -24.416 -25.973 114.109 1.00 34.65  ? 139 SER B CB  1 
ATOM   5472 O OG  . SER B 2 139 ? -24.863 -26.302 112.807 1.00 35.72  ? 139 SER B OG  1 
ATOM   5473 N N   . SER B 2 140 ? -24.139 -29.239 113.475 1.00 33.25  ? 140 SER B N   1 
ATOM   5474 C CA  . SER B 2 140 ? -24.891 -30.384 112.969 1.00 33.23  ? 140 SER B CA  1 
ATOM   5475 C C   . SER B 2 140 ? -24.454 -31.796 113.331 1.00 33.81  ? 140 SER B C   1 
ATOM   5476 O O   . SER B 2 140 ? -23.486 -32.018 114.061 1.00 33.45  ? 140 SER B O   1 
ATOM   5477 C CB  . SER B 2 140 ? -24.971 -30.285 111.458 1.00 34.07  ? 140 SER B CB  1 
ATOM   5478 O OG  . SER B 2 140 ? -25.360 -28.980 111.092 1.00 37.79  ? 140 SER B OG  1 
ATOM   5479 N N   . ARG B 2 141 ? -25.205 -32.750 112.789 1.00 35.41  ? 141 ARG B N   1 
ATOM   5480 C CA  . ARG B 2 141 ? -24.974 -34.176 112.997 1.00 36.62  ? 141 ARG B CA  1 
ATOM   5481 C C   . ARG B 2 141 ? -23.735 -34.684 112.251 1.00 36.89  ? 141 ARG B C   1 
ATOM   5482 O O   . ARG B 2 141 ? -23.228 -34.032 111.329 1.00 36.62  ? 141 ARG B O   1 
ATOM   5483 C CB  . ARG B 2 141 ? -26.210 -34.966 112.549 1.00 36.08  ? 141 ARG B CB  1 
ATOM   5484 C CG  . ARG B 2 141 ? -27.451 -34.617 113.340 1.00 39.51  ? 141 ARG B CG  1 
ATOM   5485 C CD  . ARG B 2 141 ? -28.679 -35.413 112.916 1.00 42.32  ? 141 ARG B CD  1 
ATOM   5486 N NE  . ARG B 2 141 ? -29.663 -34.586 112.210 1.00 45.68  ? 141 ARG B NE  1 
ATOM   5487 C CZ  . ARG B 2 141 ? -29.710 -34.425 110.886 1.00 47.55  ? 141 ARG B CZ  1 
ATOM   5488 N NH1 . ARG B 2 141 ? -28.826 -35.043 110.108 1.00 47.51  ? 141 ARG B NH1 1 
ATOM   5489 N NH2 . ARG B 2 141 ? -30.637 -33.640 110.339 1.00 47.30  ? 141 ARG B NH2 1 
ATOM   5490 N N   . PHE B 2 142 ? -23.257 -35.853 112.665 1.00 36.68  ? 142 PHE B N   1 
ATOM   5491 C CA  . PHE B 2 142 ? -22.089 -36.475 112.059 1.00 37.49  ? 142 PHE B CA  1 
ATOM   5492 C C   . PHE B 2 142 ? -22.012 -37.928 112.499 1.00 37.83  ? 142 PHE B C   1 
ATOM   5493 O O   . PHE B 2 142 ? -22.583 -38.302 113.516 1.00 37.67  ? 142 PHE B O   1 
ATOM   5494 C CB  . PHE B 2 142 ? -20.822 -35.734 112.489 1.00 38.72  ? 142 PHE B CB  1 
ATOM   5495 C CG  . PHE B 2 142 ? -20.621 -35.683 113.986 1.00 40.46  ? 142 PHE B CG  1 
ATOM   5496 C CD1 . PHE B 2 142 ? -19.949 -36.703 114.650 1.00 41.16  ? 142 PHE B CD1 1 
ATOM   5497 C CD2 . PHE B 2 142 ? -21.105 -34.611 114.728 1.00 41.14  ? 142 PHE B CD2 1 
ATOM   5498 C CE1 . PHE B 2 142 ? -19.760 -36.653 116.028 1.00 40.28  ? 142 PHE B CE1 1 
ATOM   5499 C CE2 . PHE B 2 142 ? -20.923 -34.552 116.104 1.00 41.09  ? 142 PHE B CE2 1 
ATOM   5500 C CZ  . PHE B 2 142 ? -20.247 -35.574 116.755 1.00 41.05  ? 142 PHE B CZ  1 
ATOM   5501 N N   . SER B 2 143 ? -21.310 -38.746 111.731 1.00 37.67  ? 143 SER B N   1 
ATOM   5502 C CA  . SER B 2 143 ? -21.159 -40.147 112.079 1.00 38.27  ? 143 SER B CA  1 
ATOM   5503 C C   . SER B 2 143 ? -19.854 -40.408 112.823 1.00 39.49  ? 143 SER B C   1 
ATOM   5504 O O   . SER B 2 143 ? -18.772 -40.140 112.298 1.00 39.47  ? 143 SER B O   1 
ATOM   5505 C CB  . SER B 2 143 ? -21.191 -41.004 110.821 1.00 38.22  ? 143 SER B CB  1 
ATOM   5506 O OG  . SER B 2 143 ? -20.801 -42.337 111.115 1.00 38.73  ? 143 SER B OG  1 
ATOM   5507 N N   . LYS B 2 144 ? -19.953 -40.950 114.034 1.00 41.15  ? 144 LYS B N   1 
ATOM   5508 C CA  . LYS B 2 144 ? -18.762 -41.259 114.828 1.00 42.33  ? 144 LYS B CA  1 
ATOM   5509 C C   . LYS B 2 144 ? -17.999 -42.458 114.259 1.00 43.07  ? 144 LYS B C   1 
ATOM   5510 O O   . LYS B 2 144 ? -16.869 -42.731 114.660 1.00 42.79  ? 144 LYS B O   1 
ATOM   5511 C CB  . LYS B 2 144 ? -19.143 -41.573 116.273 1.00 41.73  ? 144 LYS B CB  1 
ATOM   5512 C CG  . LYS B 2 144 ? -19.701 -40.417 117.080 1.00 44.31  ? 144 LYS B CG  1 
ATOM   5513 C CD  . LYS B 2 144 ? -19.823 -40.820 118.556 1.00 47.52  ? 144 LYS B CD  1 
ATOM   5514 C CE  . LYS B 2 144 ? -20.514 -39.749 119.419 1.00 50.59  ? 144 LYS B CE  1 
ATOM   5515 N NZ  . LYS B 2 144 ? -20.474 -40.080 120.889 1.00 49.30  ? 144 LYS B NZ  1 
ATOM   5516 N N   . SER B 2 145 ? -18.619 -43.153 113.313 1.00 44.80  ? 145 SER B N   1 
ATOM   5517 C CA  . SER B 2 145 ? -18.051 -44.357 112.699 1.00 46.67  ? 145 SER B CA  1 
ATOM   5518 C C   . SER B 2 145 ? -16.648 -44.247 112.116 1.00 47.98  ? 145 SER B C   1 
ATOM   5519 O O   . SER B 2 145 ? -15.915 -45.236 112.061 1.00 46.42  ? 145 SER B O   1 
ATOM   5520 C CB  . SER B 2 145 ? -18.990 -44.862 111.598 1.00 47.20  ? 145 SER B CB  1 
ATOM   5521 O OG  . SER B 2 145 ? -19.034 -43.955 110.505 1.00 48.27  ? 145 SER B OG  1 
ATOM   5522 N N   . GLN B 2 146 ? -16.278 -43.050 111.674 1.00 50.59  ? 146 GLN B N   1 
ATOM   5523 C CA  . GLN B 2 146 ? -14.972 -42.851 111.060 1.00 52.88  ? 146 GLN B CA  1 
ATOM   5524 C C   . GLN B 2 146 ? -13.849 -42.593 112.051 1.00 52.48  ? 146 GLN B C   1 
ATOM   5525 O O   . GLN B 2 146 ? -12.691 -42.894 111.766 1.00 50.72  ? 146 GLN B O   1 
ATOM   5526 C CB  . GLN B 2 146 ? -15.048 -41.703 110.046 1.00 56.90  ? 146 GLN B CB  1 
ATOM   5527 C CG  . GLN B 2 146 ? -16.074 -41.926 108.920 1.00 60.11  ? 146 GLN B CG  1 
ATOM   5528 C CD  . GLN B 2 146 ? -15.983 -43.321 108.306 1.00 61.13  ? 146 GLN B CD  1 
ATOM   5529 O OE1 . GLN B 2 146 ? -14.945 -43.715 107.768 1.00 60.52  ? 146 GLN B OE1 1 
ATOM   5530 N NE2 . GLN B 2 146 ? -17.075 -44.075 108.394 1.00 62.48  ? 146 GLN B NE2 1 
ATOM   5531 N N   . LEU B 2 147 ? -14.208 -42.047 113.212 1.00 53.28  ? 147 LEU B N   1 
ATOM   5532 C CA  . LEU B 2 147 ? -13.257 -41.729 114.279 1.00 53.54  ? 147 LEU B CA  1 
ATOM   5533 C C   . LEU B 2 147 ? -12.113 -42.719 114.369 1.00 53.91  ? 147 LEU B C   1 
ATOM   5534 O O   . LEU B 2 147 ? -10.944 -42.344 114.485 1.00 55.34  ? 147 LEU B O   1 
ATOM   5535 C CB  . LEU B 2 147 ? -13.979 -41.664 115.623 1.00 51.31  ? 147 LEU B CB  1 
ATOM   5536 C CG  . LEU B 2 147 ? -14.812 -40.394 115.800 1.00 51.68  ? 147 LEU B CG  1 
ATOM   5537 C CD1 . LEU B 2 147 ? -15.477 -40.405 117.165 1.00 52.05  ? 147 LEU B CD1 1 
ATOM   5538 C CD2 . LEU B 2 147 ? -13.913 -39.167 115.650 1.00 50.43  ? 147 LEU B CD2 1 
ATOM   5539 N N   . ASP B 2 148 ? -12.463 -43.991 114.320 1.00 53.51  ? 148 ASP B N   1 
ATOM   5540 C CA  . ASP B 2 148 ? -11.486 -45.056 114.378 1.00 52.73  ? 148 ASP B CA  1 
ATOM   5541 C C   . ASP B 2 148 ? -10.346 -44.789 113.370 1.00 51.77  ? 148 ASP B C   1 
ATOM   5542 O O   . ASP B 2 148 ? -9.188  -44.587 113.751 1.00 50.37  ? 148 ASP B O   1 
ATOM   5543 C CB  . ASP B 2 148 ? -12.211 -46.362 114.068 1.00 54.19  ? 148 ASP B CB  1 
ATOM   5544 C CG  . ASP B 2 148 ? -11.389 -47.571 114.389 1.00 56.42  ? 148 ASP B CG  1 
ATOM   5545 O OD1 . ASP B 2 148 ? -10.691 -47.544 115.432 1.00 58.04  ? 148 ASP B OD1 1 
ATOM   5546 O OD2 . ASP B 2 148 ? -11.456 -48.546 113.604 1.00 56.06  ? 148 ASP B OD2 1 
ATOM   5547 N N   . ILE B 2 149 ? -10.689 -44.769 112.085 1.00 50.60  ? 149 ILE B N   1 
ATOM   5548 C CA  . ILE B 2 149 ? -9.715  -44.538 111.025 1.00 48.24  ? 149 ILE B CA  1 
ATOM   5549 C C   . ILE B 2 149 ? -9.073  -43.163 111.110 1.00 46.13  ? 149 ILE B C   1 
ATOM   5550 O O   . ILE B 2 149 ? -7.867  -43.017 110.945 1.00 46.40  ? 149 ILE B O   1 
ATOM   5551 C CB  . ILE B 2 149 ? -10.367 -44.647 109.634 1.00 49.30  ? 149 ILE B CB  1 
ATOM   5552 C CG1 . ILE B 2 149 ? -10.997 -46.030 109.451 1.00 50.73  ? 149 ILE B CG1 1 
ATOM   5553 C CG2 . ILE B 2 149 ? -9.321  -44.390 108.556 1.00 50.35  ? 149 ILE B CG2 1 
ATOM   5554 C CD1 . ILE B 2 149 ? -11.630 -46.258 108.071 1.00 50.99  ? 149 ILE B CD1 1 
ATOM   5555 N N   . ILE B 2 150 ? -9.899  -42.155 111.348 1.00 43.55  ? 150 ILE B N   1 
ATOM   5556 C CA  . ILE B 2 150 ? -9.440  -40.776 111.431 1.00 41.07  ? 150 ILE B CA  1 
ATOM   5557 C C   . ILE B 2 150 ? -8.234  -40.594 112.346 1.00 39.61  ? 150 ILE B C   1 
ATOM   5558 O O   . ILE B 2 150 ? -7.173  -40.153 111.911 1.00 38.88  ? 150 ILE B O   1 
ATOM   5559 C CB  . ILE B 2 150 ? -10.583 -39.870 111.908 1.00 40.39  ? 150 ILE B CB  1 
ATOM   5560 C CG1 . ILE B 2 150 ? -11.784 -40.037 110.977 1.00 39.13  ? 150 ILE B CG1 1 
ATOM   5561 C CG2 . ILE B 2 150 ? -10.128 -38.431 111.934 1.00 38.91  ? 150 ILE B CG2 1 
ATOM   5562 C CD1 . ILE B 2 150 ? -13.049 -39.446 111.522 1.00 41.26  ? 150 ILE B CD1 1 
ATOM   5563 N N   . ILE B 2 151 ? -8.398  -40.945 113.612 1.00 38.22  ? 151 ILE B N   1 
ATOM   5564 C CA  . ILE B 2 151 ? -7.318  -40.802 114.571 1.00 37.21  ? 151 ILE B CA  1 
ATOM   5565 C C   . ILE B 2 151 ? -6.060  -41.531 114.141 1.00 37.72  ? 151 ILE B C   1 
ATOM   5566 O O   . ILE B 2 151 ? -5.000  -40.928 113.978 1.00 37.02  ? 151 ILE B O   1 
ATOM   5567 C CB  . ILE B 2 151 ? -7.738  -41.330 115.943 1.00 35.57  ? 151 ILE B CB  1 
ATOM   5568 C CG1 . ILE B 2 151 ? -8.906  -40.507 116.460 1.00 35.12  ? 151 ILE B CG1 1 
ATOM   5569 C CG2 . ILE B 2 151 ? -6.581  -41.238 116.920 1.00 33.55  ? 151 ILE B CG2 1 
ATOM   5570 C CD1 . ILE B 2 151 ? -9.404  -40.959 117.799 1.00 37.40  ? 151 ILE B CD1 1 
ATOM   5571 N N   . HIS B 2 152 ? -6.194  -42.837 113.956 1.00 38.80  ? 152 HIS B N   1 
ATOM   5572 C CA  . HIS B 2 152 ? -5.074  -43.680 113.573 1.00 39.76  ? 152 HIS B CA  1 
ATOM   5573 C C   . HIS B 2 152 ? -4.316  -43.156 112.352 1.00 37.98  ? 152 HIS B C   1 
ATOM   5574 O O   . HIS B 2 152 ? -3.093  -43.230 112.311 1.00 35.89  ? 152 HIS B O   1 
ATOM   5575 C CB  . HIS B 2 152 ? -5.579  -45.104 113.341 1.00 43.50  ? 152 HIS B CB  1 
ATOM   5576 C CG  . HIS B 2 152 ? -4.491  -46.134 113.268 1.00 48.81  ? 152 HIS B CG  1 
ATOM   5577 N ND1 . HIS B 2 152 ? -3.631  -46.234 112.198 1.00 49.47  ? 152 HIS B ND1 1 
ATOM   5578 C CD2 . HIS B 2 152 ? -4.156  -47.135 114.121 1.00 50.72  ? 152 HIS B CD2 1 
ATOM   5579 C CE1 . HIS B 2 152 ? -2.811  -47.257 112.390 1.00 49.71  ? 152 HIS B CE1 1 
ATOM   5580 N NE2 . HIS B 2 152 ? -3.110  -47.819 113.546 1.00 51.45  ? 152 HIS B NE2 1 
ATOM   5581 N N   . SER B 2 153 ? -5.033  -42.621 111.366 1.00 37.65  ? 153 SER B N   1 
ATOM   5582 C CA  . SER B 2 153 ? -4.384  -42.073 110.169 1.00 38.83  ? 153 SER B CA  1 
ATOM   5583 C C   . SER B 2 153 ? -3.624  -40.800 110.512 1.00 38.90  ? 153 SER B C   1 
ATOM   5584 O O   . SER B 2 153 ? -2.476  -40.626 110.101 1.00 38.46  ? 153 SER B O   1 
ATOM   5585 C CB  . SER B 2 153 ? -5.401  -41.758 109.071 1.00 39.23  ? 153 SER B CB  1 
ATOM   5586 O OG  . SER B 2 153 ? -5.729  -42.915 108.324 1.00 41.83  ? 153 SER B OG  1 
ATOM   5587 N N   . LEU B 2 154 ? -4.266  -39.909 111.260 1.00 38.30  ? 154 LEU B N   1 
ATOM   5588 C CA  . LEU B 2 154 ? -3.612  -38.670 111.655 1.00 39.21  ? 154 LEU B CA  1 
ATOM   5589 C C   . LEU B 2 154 ? -2.296  -38.999 112.344 1.00 40.60  ? 154 LEU B C   1 
ATOM   5590 O O   . LEU B 2 154 ? -1.274  -38.362 112.093 1.00 41.71  ? 154 LEU B O   1 
ATOM   5591 C CB  . LEU B 2 154 ? -4.496  -37.861 112.612 1.00 36.37  ? 154 LEU B CB  1 
ATOM   5592 C CG  . LEU B 2 154 ? -5.689  -37.119 112.015 1.00 33.54  ? 154 LEU B CG  1 
ATOM   5593 C CD1 . LEU B 2 154 ? -6.517  -36.528 113.128 1.00 33.12  ? 154 LEU B CD1 1 
ATOM   5594 C CD2 . LEU B 2 154 ? -5.211  -36.045 111.076 1.00 32.13  ? 154 LEU B CD2 1 
ATOM   5595 N N   . LYS B 2 155 ? -2.317  -39.998 113.213 1.00 40.74  ? 155 LYS B N   1 
ATOM   5596 C CA  . LYS B 2 155 ? -1.106  -40.365 113.911 1.00 42.50  ? 155 LYS B CA  1 
ATOM   5597 C C   . LYS B 2 155 ? -0.077  -40.967 112.973 1.00 44.40  ? 155 LYS B C   1 
ATOM   5598 O O   . LYS B 2 155 ? 1.083   -40.565 112.980 1.00 43.92  ? 155 LYS B O   1 
ATOM   5599 C CB  . LYS B 2 155 ? -1.424  -41.329 115.054 1.00 41.31  ? 155 LYS B CB  1 
ATOM   5600 C CG  . LYS B 2 155 ? -2.297  -40.681 116.101 1.00 38.89  ? 155 LYS B CG  1 
ATOM   5601 C CD  . LYS B 2 155 ? -2.317  -41.409 117.420 1.00 36.17  ? 155 LYS B CD  1 
ATOM   5602 C CE  . LYS B 2 155 ? -3.163  -40.617 118.415 1.00 34.67  ? 155 LYS B CE  1 
ATOM   5603 N NZ  . LYS B 2 155 ? -3.420  -41.325 119.700 1.00 34.56  ? 155 LYS B NZ  1 
ATOM   5604 N N   . LYS B 2 156 ? -0.494  -41.922 112.156 1.00 47.41  ? 156 LYS B N   1 
ATOM   5605 C CA  . LYS B 2 156 ? 0.442   -42.549 111.237 1.00 51.10  ? 156 LYS B CA  1 
ATOM   5606 C C   . LYS B 2 156 ? 1.020   -41.565 110.236 1.00 50.74  ? 156 LYS B C   1 
ATOM   5607 O O   . LYS B 2 156 ? 2.224   -41.568 109.985 1.00 51.54  ? 156 LYS B O   1 
ATOM   5608 C CB  . LYS B 2 156 ? -0.227  -43.711 110.492 1.00 54.94  ? 156 LYS B CB  1 
ATOM   5609 C CG  . LYS B 2 156 ? -0.614  -44.869 111.403 1.00 61.57  ? 156 LYS B CG  1 
ATOM   5610 C CD  . LYS B 2 156 ? 0.614   -45.500 112.088 1.00 66.74  ? 156 LYS B CD  1 
ATOM   5611 C CE  . LYS B 2 156 ? 0.207   -46.488 113.187 1.00 68.99  ? 156 LYS B CE  1 
ATOM   5612 N NZ  . LYS B 2 156 ? 1.306   -47.419 113.581 1.00 70.93  ? 156 LYS B NZ  1 
ATOM   5613 N N   . CYS B 2 157 ? 0.171   -40.714 109.674 1.00 50.13  ? 157 CYS B N   1 
ATOM   5614 C CA  . CYS B 2 157 ? 0.638   -39.752 108.686 1.00 49.58  ? 157 CYS B CA  1 
ATOM   5615 C C   . CYS B 2 157 ? 1.334   -38.543 109.295 1.00 47.77  ? 157 CYS B C   1 
ATOM   5616 O O   . CYS B 2 157 ? 2.009   -37.786 108.597 1.00 47.67  ? 157 CYS B O   1 
ATOM   5617 C CB  . CYS B 2 157 ? -0.527  -39.295 107.805 1.00 51.86  ? 157 CYS B CB  1 
ATOM   5618 S SG  . CYS B 2 157 ? -1.242  -40.594 106.748 1.00 54.01  ? 157 CYS B SG  1 
ATOM   5619 N N   . ASP B 2 158 ? 1.168   -38.366 110.598 1.00 46.21  ? 158 ASP B N   1 
ATOM   5620 C CA  . ASP B 2 158 ? 1.788   -37.256 111.318 1.00 44.87  ? 158 ASP B CA  1 
ATOM   5621 C C   . ASP B 2 158 ? 1.248   -35.887 110.896 1.00 43.36  ? 158 ASP B C   1 
ATOM   5622 O O   . ASP B 2 158 ? 2.005   -34.957 110.593 1.00 42.24  ? 158 ASP B O   1 
ATOM   5623 C CB  . ASP B 2 158 ? 3.306   -37.302 111.147 1.00 45.61  ? 158 ASP B CB  1 
ATOM   5624 C CG  . ASP B 2 158 ? 4.026   -36.446 112.159 1.00 47.83  ? 158 ASP B CG  1 
ATOM   5625 O OD1 . ASP B 2 158 ? 3.664   -36.525 113.351 1.00 48.81  ? 158 ASP B OD1 1 
ATOM   5626 O OD2 . ASP B 2 158 ? 4.956   -35.706 111.769 1.00 49.34  ? 158 ASP B OD2 1 
ATOM   5627 N N   . ILE B 2 159 ? -0.077  -35.786 110.880 1.00 40.47  ? 159 ILE B N   1 
ATOM   5628 C CA  . ILE B 2 159 ? -0.767  -34.565 110.530 1.00 37.55  ? 159 ILE B CA  1 
ATOM   5629 C C   . ILE B 2 159 ? -1.221  -33.988 111.856 1.00 36.76  ? 159 ILE B C   1 
ATOM   5630 O O   . ILE B 2 159 ? -1.855  -34.695 112.642 1.00 36.74  ? 159 ILE B O   1 
ATOM   5631 C CB  . ILE B 2 159 ? -2.007  -34.876 109.694 1.00 38.98  ? 159 ILE B CB  1 
ATOM   5632 C CG1 . ILE B 2 159 ? -1.624  -35.797 108.539 1.00 40.56  ? 159 ILE B CG1 1 
ATOM   5633 C CG2 . ILE B 2 159 ? -2.635  -33.598 109.174 1.00 36.66  ? 159 ILE B CG2 1 
ATOM   5634 C CD1 . ILE B 2 159 ? -2.784  -36.171 107.658 1.00 42.65  ? 159 ILE B CD1 1 
ATOM   5635 N N   . SER B 2 160 ? -0.891  -32.726 112.122 1.00 35.41  ? 160 SER B N   1 
ATOM   5636 C CA  . SER B 2 160 ? -1.308  -32.091 113.372 1.00 34.23  ? 160 SER B CA  1 
ATOM   5637 C C   . SER B 2 160 ? -2.658  -31.401 113.166 1.00 34.90  ? 160 SER B C   1 
ATOM   5638 O O   . SER B 2 160 ? -3.098  -31.200 112.027 1.00 34.03  ? 160 SER B O   1 
ATOM   5639 C CB  . SER B 2 160 ? -0.262  -31.084 113.851 1.00 34.00  ? 160 SER B CB  1 
ATOM   5640 O OG  . SER B 2 160 ? -0.279  -29.912 113.073 1.00 33.96  ? 160 SER B OG  1 
ATOM   5641 N N   . LEU B 2 161 ? -3.306  -31.021 114.264 1.00 35.01  ? 161 LEU B N   1 
ATOM   5642 C CA  . LEU B 2 161 ? -4.628  -30.422 114.174 1.00 33.54  ? 161 LEU B CA  1 
ATOM   5643 C C   . LEU B 2 161 ? -4.916  -29.196 115.064 1.00 33.06  ? 161 LEU B C   1 
ATOM   5644 O O   . LEU B 2 161 ? -4.271  -28.984 116.094 1.00 32.57  ? 161 LEU B O   1 
ATOM   5645 C CB  . LEU B 2 161 ? -5.631  -31.522 114.473 1.00 35.19  ? 161 LEU B CB  1 
ATOM   5646 C CG  . LEU B 2 161 ? -6.980  -31.480 113.794 1.00 37.39  ? 161 LEU B CG  1 
ATOM   5647 C CD1 . LEU B 2 161 ? -6.781  -31.281 112.296 1.00 38.09  ? 161 LEU B CD1 1 
ATOM   5648 C CD2 . LEU B 2 161 ? -7.715  -32.790 114.101 1.00 37.00  ? 161 LEU B CD2 1 
ATOM   5649 N N   . GLN B 2 162 ? -5.902  -28.405 114.641 1.00 32.12  ? 162 GLN B N   1 
ATOM   5650 C CA  . GLN B 2 162 ? -6.347  -27.198 115.342 1.00 29.97  ? 162 GLN B CA  1 
ATOM   5651 C C   . GLN B 2 162 ? -7.808  -26.896 115.009 1.00 29.26  ? 162 GLN B C   1 
ATOM   5652 O O   . GLN B 2 162 ? -8.225  -27.023 113.851 1.00 28.06  ? 162 GLN B O   1 
ATOM   5653 C CB  . GLN B 2 162 ? -5.507  -25.984 114.938 1.00 29.36  ? 162 GLN B CB  1 
ATOM   5654 C CG  . GLN B 2 162 ? -4.131  -25.938 115.564 1.00 31.19  ? 162 GLN B CG  1 
ATOM   5655 C CD  . GLN B 2 162 ? -3.467  -24.576 115.435 1.00 31.59  ? 162 GLN B CD  1 
ATOM   5656 O OE1 . GLN B 2 162 ? -3.284  -24.052 114.328 1.00 32.21  ? 162 GLN B OE1 1 
ATOM   5657 N NE2 . GLN B 2 162 ? -3.097  -23.995 116.573 1.00 29.24  ? 162 GLN B NE2 1 
ATOM   5658 N N   . PHE B 2 163 ? -8.577  -26.489 116.020 1.00 27.09  ? 163 PHE B N   1 
ATOM   5659 C CA  . PHE B 2 163 ? -9.985  -26.146 115.827 1.00 26.78  ? 163 PHE B CA  1 
ATOM   5660 C C   . PHE B 2 163 ? -10.289 -24.690 116.201 1.00 27.68  ? 163 PHE B C   1 
ATOM   5661 O O   . PHE B 2 163 ? -9.835  -24.201 117.228 1.00 30.73  ? 163 PHE B O   1 
ATOM   5662 C CB  . PHE B 2 163 ? -10.892 -27.036 116.678 1.00 25.71  ? 163 PHE B CB  1 
ATOM   5663 C CG  . PHE B 2 163 ? -10.991 -28.453 116.207 1.00 25.69  ? 163 PHE B CG  1 
ATOM   5664 C CD1 . PHE B 2 163 ? -9.985  -29.372 116.501 1.00 24.35  ? 163 PHE B CD1 1 
ATOM   5665 C CD2 . PHE B 2 163 ? -12.116 -28.883 115.495 1.00 25.11  ? 163 PHE B CD2 1 
ATOM   5666 C CE1 . PHE B 2 163 ? -10.096 -30.713 116.094 1.00 25.37  ? 163 PHE B CE1 1 
ATOM   5667 C CE2 . PHE B 2 163 ? -12.239 -30.209 115.082 1.00 24.76  ? 163 PHE B CE2 1 
ATOM   5668 C CZ  . PHE B 2 163 ? -11.225 -31.133 115.384 1.00 25.49  ? 163 PHE B CZ  1 
ATOM   5669 N N   . PHE B 2 164 ? -11.072 -24.004 115.377 1.00 26.66  ? 164 PHE B N   1 
ATOM   5670 C CA  . PHE B 2 164 ? -11.454 -22.627 115.657 1.00 25.18  ? 164 PHE B CA  1 
ATOM   5671 C C   . PHE B 2 164 ? -12.983 -22.563 115.632 1.00 25.61  ? 164 PHE B C   1 
ATOM   5672 O O   . PHE B 2 164 ? -13.610 -22.800 114.601 1.00 23.19  ? 164 PHE B O   1 
ATOM   5673 C CB  . PHE B 2 164 ? -10.827 -21.699 114.625 1.00 25.92  ? 164 PHE B CB  1 
ATOM   5674 C CG  . PHE B 2 164 ? -9.334  -21.773 114.592 1.00 25.42  ? 164 PHE B CG  1 
ATOM   5675 C CD1 . PHE B 2 164 ? -8.693  -22.858 114.023 1.00 26.17  ? 164 PHE B CD1 1 
ATOM   5676 C CD2 . PHE B 2 164 ? -8.566  -20.781 115.181 1.00 27.05  ? 164 PHE B CD2 1 
ATOM   5677 C CE1 . PHE B 2 164 ? -7.306  -22.954 114.045 1.00 28.48  ? 164 PHE B CE1 1 
ATOM   5678 C CE2 . PHE B 2 164 ? -7.173  -20.865 115.211 1.00 27.36  ? 164 PHE B CE2 1 
ATOM   5679 C CZ  . PHE B 2 164 ? -6.543  -21.949 114.644 1.00 28.73  ? 164 PHE B CZ  1 
ATOM   5680 N N   . LEU B 2 165 ? -13.563 -22.251 116.789 1.00 25.74  ? 165 LEU B N   1 
ATOM   5681 C CA  . LEU B 2 165 ? -15.008 -22.204 116.983 1.00 26.05  ? 165 LEU B CA  1 
ATOM   5682 C C   . LEU B 2 165 ? -15.528 -20.807 117.288 1.00 27.58  ? 165 LEU B C   1 
ATOM   5683 O O   . LEU B 2 165 ? -14.749 -19.886 117.466 1.00 28.34  ? 165 LEU B O   1 
ATOM   5684 C CB  . LEU B 2 165 ? -15.370 -23.125 118.143 1.00 26.06  ? 165 LEU B CB  1 
ATOM   5685 C CG  . LEU B 2 165 ? -14.675 -24.484 118.121 1.00 23.95  ? 165 LEU B CG  1 
ATOM   5686 C CD1 . LEU B 2 165 ? -14.814 -25.138 119.464 1.00 22.40  ? 165 LEU B CD1 1 
ATOM   5687 C CD2 . LEU B 2 165 ? -15.272 -25.355 117.032 1.00 25.27  ? 165 LEU B CD2 1 
ATOM   5688 N N   . PRO B 2 166 ? -16.863 -20.640 117.357 1.00 29.48  ? 166 PRO B N   1 
ATOM   5689 C CA  . PRO B 2 166 ? -17.524 -19.357 117.644 1.00 30.50  ? 166 PRO B CA  1 
ATOM   5690 C C   . PRO B 2 166 ? -17.591 -19.024 119.140 1.00 31.81  ? 166 PRO B C   1 
ATOM   5691 O O   . PRO B 2 166 ? -18.167 -18.009 119.540 1.00 31.92  ? 166 PRO B O   1 
ATOM   5692 C CB  . PRO B 2 166 ? -18.929 -19.542 117.062 1.00 29.81  ? 166 PRO B CB  1 
ATOM   5693 C CG  . PRO B 2 166 ? -18.786 -20.686 116.106 1.00 31.38  ? 166 PRO B CG  1 
ATOM   5694 C CD  . PRO B 2 166 ? -17.843 -21.600 116.826 1.00 29.99  ? 166 PRO B CD  1 
ATOM   5695 N N   . PHE B 2 167 ? -17.003 -19.886 119.956 1.00 32.46  ? 167 PHE B N   1 
ATOM   5696 C CA  . PHE B 2 167 ? -17.002 -19.700 121.396 1.00 33.98  ? 167 PHE B CA  1 
ATOM   5697 C C   . PHE B 2 167 ? -15.755 -20.338 121.996 1.00 37.42  ? 167 PHE B C   1 
ATOM   5698 O O   . PHE B 2 167 ? -14.944 -20.918 121.271 1.00 38.83  ? 167 PHE B O   1 
ATOM   5699 C CB  . PHE B 2 167 ? -18.258 -20.338 121.975 1.00 31.22  ? 167 PHE B CB  1 
ATOM   5700 C CG  . PHE B 2 167 ? -18.542 -21.702 121.429 1.00 27.19  ? 167 PHE B CG  1 
ATOM   5701 C CD1 . PHE B 2 167 ? -17.900 -22.814 121.945 1.00 24.52  ? 167 PHE B CD1 1 
ATOM   5702 C CD2 . PHE B 2 167 ? -19.425 -21.869 120.367 1.00 25.53  ? 167 PHE B CD2 1 
ATOM   5703 C CE1 . PHE B 2 167 ? -18.134 -24.078 121.408 1.00 25.05  ? 167 PHE B CE1 1 
ATOM   5704 C CE2 . PHE B 2 167 ? -19.663 -23.128 119.825 1.00 24.27  ? 167 PHE B CE2 1 
ATOM   5705 C CZ  . PHE B 2 167 ? -19.017 -24.235 120.344 1.00 23.28  ? 167 PHE B CZ  1 
ATOM   5706 N N   . SER B 2 168 ? -15.593 -20.230 123.312 1.00 40.11  ? 168 SER B N   1 
ATOM   5707 C CA  . SER B 2 168 ? -14.426 -20.807 123.969 1.00 43.26  ? 168 SER B CA  1 
ATOM   5708 C C   . SER B 2 168 ? -14.850 -21.978 124.827 1.00 44.70  ? 168 SER B C   1 
ATOM   5709 O O   . SER B 2 168 ? -16.042 -22.266 124.926 1.00 47.72  ? 168 SER B O   1 
ATOM   5710 C CB  . SER B 2 168 ? -13.720 -19.754 124.826 1.00 44.36  ? 168 SER B CB  1 
ATOM   5711 O OG  . SER B 2 168 ? -13.132 -18.729 124.030 1.00 46.01  ? 168 SER B OG  1 
ATOM   5712 N N   . LEU B 2 169 ? -13.887 -22.658 125.438 1.00 44.54  ? 169 LEU B N   1 
ATOM   5713 C CA  . LEU B 2 169 ? -14.209 -23.793 126.278 1.00 44.52  ? 169 LEU B CA  1 
ATOM   5714 C C   . LEU B 2 169 ? -14.703 -23.362 127.672 1.00 44.30  ? 169 LEU B C   1 
ATOM   5715 O O   . LEU B 2 169 ? -14.057 -23.627 128.694 1.00 45.78  ? 169 LEU B O   1 
ATOM   5716 C CB  . LEU B 2 169 ? -12.970 -24.704 126.389 1.00 44.98  ? 169 LEU B CB  1 
ATOM   5717 C CG  . LEU B 2 169 ? -12.719 -25.555 125.144 1.00 45.06  ? 169 LEU B CG  1 
ATOM   5718 C CD1 . LEU B 2 169 ? -11.563 -26.513 125.406 1.00 44.66  ? 169 LEU B CD1 1 
ATOM   5719 C CD2 . LEU B 2 169 ? -13.975 -26.335 124.818 1.00 44.40  ? 169 LEU B CD2 1 
ATOM   5720 N N   . PRO B 2 182 ? -20.766 -6.132  126.313 1.00 59.12  ? 182 PRO B N   1 
ATOM   5721 C CA  . PRO B 2 182 ? -20.946 -6.233  124.854 1.00 59.68  ? 182 PRO B CA  1 
ATOM   5722 C C   . PRO B 2 182 ? -19.791 -6.953  124.167 1.00 59.75  ? 182 PRO B C   1 
ATOM   5723 O O   . PRO B 2 182 ? -18.624 -6.726  124.488 1.00 60.21  ? 182 PRO B O   1 
ATOM   5724 C CB  . PRO B 2 182 ? -21.033 -4.748  124.420 1.00 59.19  ? 182 PRO B CB  1 
ATOM   5725 C CG  . PRO B 2 182 ? -21.720 -4.152  125.605 1.00 59.60  ? 182 PRO B CG  1 
ATOM   5726 C CD  . PRO B 2 182 ? -20.952 -4.745  126.770 1.00 58.53  ? 182 PRO B CD  1 
ATOM   5727 N N   . PHE B 2 183 ? -20.124 -7.843  123.239 1.00 59.17  ? 183 PHE B N   1 
ATOM   5728 C CA  . PHE B 2 183 ? -19.142 -8.637  122.479 1.00 57.52  ? 183 PHE B CA  1 
ATOM   5729 C C   . PHE B 2 183 ? -18.307 -7.735  121.568 1.00 55.44  ? 183 PHE B C   1 
ATOM   5730 O O   . PHE B 2 183 ? -18.851 -6.966  120.772 1.00 54.90  ? 183 PHE B O   1 
ATOM   5731 C CB  . PHE B 2 183 ? -19.895 -9.674  121.640 1.00 59.48  ? 183 PHE B CB  1 
ATOM   5732 C CG  . PHE B 2 183 ? -19.016 -10.580 120.839 1.00 62.21  ? 183 PHE B CG  1 
ATOM   5733 C CD1 . PHE B 2 183 ? -18.268 -11.582 121.459 1.00 63.57  ? 183 PHE B CD1 1 
ATOM   5734 C CD2 . PHE B 2 183 ? -18.959 -10.454 119.452 1.00 62.94  ? 183 PHE B CD2 1 
ATOM   5735 C CE1 . PHE B 2 183 ? -17.473 -12.447 120.702 1.00 63.54  ? 183 PHE B CE1 1 
ATOM   5736 C CE2 . PHE B 2 183 ? -18.170 -11.309 118.684 1.00 62.36  ? 183 PHE B CE2 1 
ATOM   5737 C CZ  . PHE B 2 183 ? -17.428 -12.307 119.306 1.00 63.34  ? 183 PHE B CZ  1 
ATOM   5738 N N   . ARG B 2 184 ? -16.989 -7.822  121.712 1.00 53.42  ? 184 ARG B N   1 
ATOM   5739 C CA  . ARG B 2 184 ? -16.046 -7.040  120.910 1.00 51.61  ? 184 ARG B CA  1 
ATOM   5740 C C   . ARG B 2 184 ? -15.169 -8.026  120.157 1.00 48.57  ? 184 ARG B C   1 
ATOM   5741 O O   . ARG B 2 184 ? -14.379 -8.743  120.764 1.00 46.77  ? 184 ARG B O   1 
ATOM   5742 C CB  . ARG B 2 184 ? -15.143 -6.195  121.806 1.00 54.16  ? 184 ARG B CB  1 
ATOM   5743 C CG  . ARG B 2 184 ? -15.868 -5.256  122.706 1.00 58.01  ? 184 ARG B CG  1 
ATOM   5744 C CD  . ARG B 2 184 ? -16.129 -3.970  121.997 1.00 62.82  ? 184 ARG B CD  1 
ATOM   5745 N NE  . ARG B 2 184 ? -17.379 -3.382  122.451 1.00 68.78  ? 184 ARG B NE  1 
ATOM   5746 C CZ  . ARG B 2 184 ? -17.655 -2.084  122.397 1.00 71.76  ? 184 ARG B CZ  1 
ATOM   5747 N NH1 . ARG B 2 184 ? -16.754 -1.235  121.908 1.00 72.83  ? 184 ARG B NH1 1 
ATOM   5748 N NH2 . ARG B 2 184 ? -18.834 -1.639  122.826 1.00 71.70  ? 184 ARG B NH2 1 
ATOM   5749 N N   . LEU B 2 185 ? -15.291 -8.075  118.841 1.00 46.27  ? 185 LEU B N   1 
ATOM   5750 C CA  . LEU B 2 185 ? -14.462 -9.009  118.097 1.00 43.97  ? 185 LEU B CA  1 
ATOM   5751 C C   . LEU B 2 185 ? -12.982 -8.692  118.327 1.00 42.83  ? 185 LEU B C   1 
ATOM   5752 O O   . LEU B 2 185 ? -12.522 -7.568  118.082 1.00 41.41  ? 185 LEU B O   1 
ATOM   5753 C CB  . LEU B 2 185 ? -14.793 -8.955  116.606 1.00 42.93  ? 185 LEU B CB  1 
ATOM   5754 C CG  . LEU B 2 185 ? -14.229 -10.117 115.789 1.00 42.21  ? 185 LEU B CG  1 
ATOM   5755 C CD1 . LEU B 2 185 ? -14.740 -11.442 116.351 1.00 39.68  ? 185 LEU B CD1 1 
ATOM   5756 C CD2 . LEU B 2 185 ? -14.624 -9.950  114.335 1.00 41.83  ? 185 LEU B CD2 1 
ATOM   5757 N N   . GLY B 2 186 ? -12.251 -9.692  118.813 1.00 41.30  ? 186 GLY B N   1 
ATOM   5758 C CA  . GLY B 2 186 ? -10.835 -9.529  119.082 1.00 40.78  ? 186 GLY B CA  1 
ATOM   5759 C C   . GLY B 2 186 ? -10.551 -8.894  120.432 1.00 40.84  ? 186 GLY B C   1 
ATOM   5760 O O   . GLY B 2 186 ? -9.405  -8.589  120.756 1.00 39.75  ? 186 GLY B O   1 
ATOM   5761 N N   . GLY B 2 187 ? -11.596 -8.698  121.226 1.00 40.92  ? 187 GLY B N   1 
ATOM   5762 C CA  . GLY B 2 187 ? -11.421 -8.085  122.525 1.00 41.33  ? 187 GLY B CA  1 
ATOM   5763 C C   . GLY B 2 187 ? -10.917 -9.038  123.588 1.00 42.61  ? 187 GLY B C   1 
ATOM   5764 O O   . GLY B 2 187 ? -10.664 -10.214 123.326 1.00 41.26  ? 187 GLY B O   1 
ATOM   5765 N N   . HIS B 2 188 ? -10.788 -8.514  124.801 1.00 44.26  ? 188 HIS B N   1 
ATOM   5766 C CA  . HIS B 2 188 ? -10.307 -9.270  125.946 1.00 47.04  ? 188 HIS B CA  1 
ATOM   5767 C C   . HIS B 2 188 ? -11.407 -9.374  127.004 1.00 50.53  ? 188 HIS B C   1 
ATOM   5768 O O   . HIS B 2 188 ? -11.149 -9.142  128.186 1.00 52.29  ? 188 HIS B O   1 
ATOM   5769 C CB  . HIS B 2 188 ? -9.111  -8.539  126.555 1.00 45.81  ? 188 HIS B CB  1 
ATOM   5770 C CG  . HIS B 2 188 ? -7.998  -8.280  125.587 1.00 45.62  ? 188 HIS B CG  1 
ATOM   5771 N ND1 . HIS B 2 188 ? -7.039  -9.220  125.292 1.00 44.76  ? 188 HIS B ND1 1 
ATOM   5772 C CD2 . HIS B 2 188 ? -7.720  -7.199  124.819 1.00 46.01  ? 188 HIS B CD2 1 
ATOM   5773 C CE1 . HIS B 2 188 ? -6.215  -8.733  124.377 1.00 44.78  ? 188 HIS B CE1 1 
ATOM   5774 N NE2 . HIS B 2 188 ? -6.607  -7.511  124.075 1.00 44.68  ? 188 HIS B NE2 1 
ATOM   5775 N N   . GLY B 2 189 ? -12.624 -9.725  126.596 1.00 53.16  ? 189 GLY B N   1 
ATOM   5776 C CA  . GLY B 2 189 ? -13.721 -9.815  127.551 1.00 55.62  ? 189 GLY B CA  1 
ATOM   5777 C C   . GLY B 2 189 ? -14.349 -11.207 127.668 1.00 56.85  ? 189 GLY B C   1 
ATOM   5778 O O   . GLY B 2 189 ? -14.428 -11.776 128.788 1.00 58.92  ? 189 GLY B O   1 
ATOM   5779 N N   . PHE B 2 192 ? -19.792 -16.963 125.447 1.00 99.60  ? 192 PHE B N   1 
ATOM   5780 C CA  . PHE B 2 192 ? -21.040 -17.715 125.316 1.00 100.12 ? 192 PHE B CA  1 
ATOM   5781 C C   . PHE B 2 192 ? -20.990 -18.916 126.252 1.00 100.78 ? 192 PHE B C   1 
ATOM   5782 O O   . PHE B 2 192 ? -20.238 -19.870 126.035 1.00 100.78 ? 192 PHE B O   1 
ATOM   5783 C CB  . PHE B 2 192 ? -21.233 -18.209 123.888 1.00 99.68  ? 192 PHE B CB  1 
ATOM   5784 C CG  . PHE B 2 192 ? -21.013 -17.135 122.845 1.00 100.73 ? 192 PHE B CG  1 
ATOM   5785 C CD1 . PHE B 2 192 ? -19.755 -16.541 122.670 1.00 100.78 ? 192 PHE B CD1 1 
ATOM   5786 C CD2 . PHE B 2 192 ? -22.059 -16.713 122.033 1.00 100.78 ? 192 PHE B CD2 1 
ATOM   5787 C CE1 . PHE B 2 192 ? -19.554 -15.553 121.700 1.00 100.78 ? 192 PHE B CE1 1 
ATOM   5788 C CE2 . PHE B 2 192 ? -21.869 -15.726 121.058 1.00 100.78 ? 192 PHE B CE2 1 
ATOM   5789 C CZ  . PHE B 2 192 ? -20.612 -15.146 120.893 1.00 100.78 ? 192 PHE B CZ  1 
ATOM   5790 N N   . PRO B 2 193 ? -21.770 -18.870 127.337 1.00 100.78 ? 193 PRO B N   1 
ATOM   5791 C CA  . PRO B 2 193 ? -21.800 -19.974 128.309 1.00 100.38 ? 193 PRO B CA  1 
ATOM   5792 C C   . PRO B 2 193 ? -21.883 -21.294 127.542 1.00 99.57  ? 193 PRO B C   1 
ATOM   5793 O O   . PRO B 2 193 ? -22.592 -21.331 126.523 1.00 100.78 ? 193 PRO B O   1 
ATOM   5794 C CB  . PRO B 2 193 ? -23.101 -19.725 129.048 1.00 100.78 ? 193 PRO B CB  1 
ATOM   5795 C CG  . PRO B 2 193 ? -23.209 -18.254 129.025 1.00 100.78 ? 193 PRO B CG  1 
ATOM   5796 C CD  . PRO B 2 193 ? -22.879 -17.935 127.591 1.00 100.78 ? 193 PRO B CD  1 
ATOM   5797 N N   . LEU B 2 194 ? -21.185 -22.355 127.979 1.00 97.70  ? 194 LEU B N   1 
ATOM   5798 C CA  . LEU B 2 194 ? -21.282 -23.647 127.282 1.00 95.26  ? 194 LEU B CA  1 
ATOM   5799 C C   . LEU B 2 194 ? -22.707 -24.179 127.457 1.00 94.29  ? 194 LEU B C   1 
ATOM   5800 O O   . LEU B 2 194 ? -23.035 -25.273 126.990 1.00 94.55  ? 194 LEU B O   1 
ATOM   5801 C CB  . LEU B 2 194 ? -20.250 -24.659 127.802 1.00 94.06  ? 194 LEU B CB  1 
ATOM   5802 C CG  . LEU B 2 194 ? -18.805 -24.272 127.456 1.00 92.52  ? 194 LEU B CG  1 
ATOM   5803 C CD1 . LEU B 2 194 ? -17.942 -25.498 127.505 1.00 91.47  ? 194 LEU B CD1 1 
ATOM   5804 C CD2 . LEU B 2 194 ? -18.719 -23.650 126.058 1.00 91.45  ? 194 LEU B CD2 1 
ATOM   5805 N N   . LYS B 2 195 ? -23.535 -23.369 128.126 1.00 92.48  ? 195 LYS B N   1 
ATOM   5806 C CA  . LYS B 2 195 ? -24.946 -23.646 128.394 1.00 89.31  ? 195 LYS B CA  1 
ATOM   5807 C C   . LYS B 2 195 ? -25.771 -22.983 127.269 1.00 85.96  ? 195 LYS B C   1 
ATOM   5808 O O   . LYS B 2 195 ? -26.842 -23.479 126.890 1.00 86.79  ? 195 LYS B O   1 
ATOM   5809 C CB  . LYS B 2 195 ? -25.334 -23.068 129.775 1.00 90.25  ? 195 LYS B CB  1 
ATOM   5810 C CG  . LYS B 2 195 ? -26.807 -23.235 130.180 1.00 91.53  ? 195 LYS B CG  1 
ATOM   5811 C CD  . LYS B 2 195 ? -27.134 -22.518 131.490 1.00 91.46  ? 195 LYS B CD  1 
ATOM   5812 C CE  . LYS B 2 195 ? -28.626 -22.591 131.764 1.00 91.60  ? 195 LYS B CE  1 
ATOM   5813 N NZ  . LYS B 2 195 ? -28.957 -21.880 133.018 1.00 90.13  ? 195 LYS B NZ  1 
ATOM   5814 N N   . GLY B 2 196 ? -25.256 -21.870 126.740 1.00 80.19  ? 196 GLY B N   1 
ATOM   5815 C CA  . GLY B 2 196 ? -25.930 -21.169 125.664 1.00 72.61  ? 196 GLY B CA  1 
ATOM   5816 C C   . GLY B 2 196 ? -25.725 -21.771 124.281 1.00 67.32  ? 196 GLY B C   1 
ATOM   5817 O O   . GLY B 2 196 ? -26.231 -21.230 123.295 1.00 67.07  ? 196 GLY B O   1 
ATOM   5818 N N   . ILE B 2 197 ? -24.984 -22.872 124.192 1.00 61.02  ? 197 ILE B N   1 
ATOM   5819 C CA  . ILE B 2 197 ? -24.760 -23.510 122.900 1.00 54.88  ? 197 ILE B CA  1 
ATOM   5820 C C   . ILE B 2 197 ? -25.770 -24.657 122.765 1.00 51.01  ? 197 ILE B C   1 
ATOM   5821 O O   . ILE B 2 197 ? -26.244 -25.170 123.769 1.00 51.12  ? 197 ILE B O   1 
ATOM   5822 C CB  . ILE B 2 197 ? -23.292 -24.043 122.779 1.00 54.10  ? 197 ILE B CB  1 
ATOM   5823 C CG1 . ILE B 2 197 ? -23.089 -25.223 123.722 1.00 52.39  ? 197 ILE B CG1 1 
ATOM   5824 C CG2 . ILE B 2 197 ? -22.309 -22.920 123.139 1.00 52.26  ? 197 ILE B CG2 1 
ATOM   5825 C CD1 . ILE B 2 197 ? -21.679 -25.759 123.719 1.00 51.74  ? 197 ILE B CD1 1 
ATOM   5826 N N   . THR B 2 198 ? -26.105 -25.051 121.539 1.00 46.78  ? 198 THR B N   1 
ATOM   5827 C CA  . THR B 2 198 ? -27.074 -26.123 121.328 1.00 43.29  ? 198 THR B CA  1 
ATOM   5828 C C   . THR B 2 198 ? -26.565 -27.450 121.893 1.00 41.75  ? 198 THR B C   1 
ATOM   5829 O O   . THR B 2 198 ? -25.390 -27.567 122.239 1.00 40.68  ? 198 THR B O   1 
ATOM   5830 C CB  . THR B 2 198 ? -27.401 -26.298 119.816 1.00 42.38  ? 198 THR B CB  1 
ATOM   5831 O OG1 . THR B 2 198 ? -26.422 -27.136 119.195 1.00 42.08  ? 198 THR B OG1 1 
ATOM   5832 C CG2 . THR B 2 198 ? -27.372 -24.969 119.122 1.00 39.60  ? 198 THR B CG2 1 
ATOM   5833 N N   . GLU B 2 199 ? -27.438 -28.448 122.001 1.00 39.98  ? 199 GLU B N   1 
ATOM   5834 C CA  . GLU B 2 199 ? -26.988 -29.727 122.522 1.00 40.56  ? 199 GLU B CA  1 
ATOM   5835 C C   . GLU B 2 199 ? -26.157 -30.454 121.473 1.00 39.36  ? 199 GLU B C   1 
ATOM   5836 O O   . GLU B 2 199 ? -25.263 -31.226 121.823 1.00 39.00  ? 199 GLU B O   1 
ATOM   5837 C CB  . GLU B 2 199 ? -28.162 -30.609 122.967 1.00 43.71  ? 199 GLU B CB  1 
ATOM   5838 C CG  . GLU B 2 199 ? -28.723 -30.294 124.373 1.00 50.00  ? 199 GLU B CG  1 
ATOM   5839 C CD  . GLU B 2 199 ? -27.704 -30.477 125.524 1.00 52.17  ? 199 GLU B CD  1 
ATOM   5840 O OE1 . GLU B 2 199 ? -27.165 -31.596 125.689 1.00 54.48  ? 199 GLU B OE1 1 
ATOM   5841 O OE2 . GLU B 2 199 ? -27.451 -29.500 126.271 1.00 51.39  ? 199 GLU B OE2 1 
ATOM   5842 N N   . GLN B 2 200 ? -26.446 -30.206 120.192 1.00 37.06  ? 200 GLN B N   1 
ATOM   5843 C CA  . GLN B 2 200 ? -25.697 -30.828 119.107 1.00 34.06  ? 200 GLN B CA  1 
ATOM   5844 C C   . GLN B 2 200 ? -24.286 -30.292 119.164 1.00 34.52  ? 200 GLN B C   1 
ATOM   5845 O O   . GLN B 2 200 ? -23.319 -31.041 119.044 1.00 34.01  ? 200 GLN B O   1 
ATOM   5846 C CB  . GLN B 2 200 ? -26.282 -30.464 117.757 1.00 34.29  ? 200 GLN B CB  1 
ATOM   5847 C CG  . GLN B 2 200 ? -25.529 -31.091 116.604 1.00 34.57  ? 200 GLN B CG  1 
ATOM   5848 C CD  . GLN B 2 200 ? -25.699 -32.600 116.556 1.00 35.17  ? 200 GLN B CD  1 
ATOM   5849 O OE1 . GLN B 2 200 ? -26.812 -33.096 116.405 1.00 35.69  ? 200 GLN B OE1 1 
ATOM   5850 N NE2 . GLN B 2 200 ? -24.595 -33.336 116.682 1.00 34.50  ? 200 GLN B NE2 1 
ATOM   5851 N N   . GLN B 2 201 ? -24.176 -28.979 119.335 1.00 34.02  ? 201 GLN B N   1 
ATOM   5852 C CA  . GLN B 2 201 ? -22.877 -28.351 119.434 1.00 34.22  ? 201 GLN B CA  1 
ATOM   5853 C C   . GLN B 2 201 ? -22.129 -29.002 120.572 1.00 36.15  ? 201 GLN B C   1 
ATOM   5854 O O   . GLN B 2 201 ? -20.955 -29.324 120.431 1.00 38.35  ? 201 GLN B O   1 
ATOM   5855 C CB  . GLN B 2 201 ? -23.008 -26.857 119.702 1.00 32.92  ? 201 GLN B CB  1 
ATOM   5856 C CG  . GLN B 2 201 ? -23.543 -26.085 118.527 1.00 33.15  ? 201 GLN B CG  1 
ATOM   5857 C CD  . GLN B 2 201 ? -23.515 -24.595 118.765 1.00 33.29  ? 201 GLN B CD  1 
ATOM   5858 O OE1 . GLN B 2 201 ? -24.080 -24.101 119.733 1.00 30.55  ? 201 GLN B OE1 1 
ATOM   5859 N NE2 . GLN B 2 201 ? -22.852 -23.868 117.874 1.00 35.20  ? 201 GLN B NE2 1 
ATOM   5860 N N   . LYS B 2 202 ? -22.802 -29.208 121.699 1.00 37.62  ? 202 LYS B N   1 
ATOM   5861 C CA  . LYS B 2 202 ? -22.161 -29.831 122.855 1.00 38.10  ? 202 LYS B CA  1 
ATOM   5862 C C   . LYS B 2 202 ? -21.622 -31.221 122.543 1.00 39.23  ? 202 LYS B C   1 
ATOM   5863 O O   . LYS B 2 202 ? -20.552 -31.606 123.018 1.00 37.55  ? 202 LYS B O   1 
ATOM   5864 C CB  . LYS B 2 202 ? -23.142 -29.935 124.013 1.00 38.62  ? 202 LYS B CB  1 
ATOM   5865 C CG  . LYS B 2 202 ? -23.477 -28.622 124.696 1.00 40.06  ? 202 LYS B CG  1 
ATOM   5866 C CD  . LYS B 2 202 ? -24.264 -28.899 125.982 1.00 40.78  ? 202 LYS B CD  1 
ATOM   5867 C CE  . LYS B 2 202 ? -24.735 -27.626 126.666 1.00 40.92  ? 202 LYS B CE  1 
ATOM   5868 N NZ  . LYS B 2 202 ? -25.557 -27.898 127.890 1.00 40.43  ? 202 LYS B NZ  1 
ATOM   5869 N N   . GLU B 2 203 ? -22.369 -31.977 121.748 1.00 41.41  ? 203 GLU B N   1 
ATOM   5870 C CA  . GLU B 2 203 ? -21.953 -33.325 121.390 1.00 44.70  ? 203 GLU B CA  1 
ATOM   5871 C C   . GLU B 2 203 ? -20.755 -33.309 120.446 1.00 44.00  ? 203 GLU B C   1 
ATOM   5872 O O   . GLU B 2 203 ? -19.866 -34.158 120.539 1.00 44.65  ? 203 GLU B O   1 
ATOM   5873 C CB  . GLU B 2 203 ? -23.095 -34.081 120.726 1.00 47.62  ? 203 GLU B CB  1 
ATOM   5874 C CG  . GLU B 2 203 ? -22.805 -35.563 120.600 1.00 56.41  ? 203 GLU B CG  1 
ATOM   5875 C CD  . GLU B 2 203 ? -23.603 -36.216 119.487 1.00 62.68  ? 203 GLU B CD  1 
ATOM   5876 O OE1 . GLU B 2 203 ? -24.837 -35.987 119.431 1.00 67.07  ? 203 GLU B OE1 1 
ATOM   5877 O OE2 . GLU B 2 203 ? -22.999 -36.960 118.675 1.00 64.32  ? 203 GLU B OE2 1 
ATOM   5878 N N   . GLY B 2 204 ? -20.748 -32.354 119.522 1.00 42.08  ? 204 GLY B N   1 
ATOM   5879 C CA  . GLY B 2 204 ? -19.645 -32.253 118.591 1.00 38.67  ? 204 GLY B CA  1 
ATOM   5880 C C   . GLY B 2 204 ? -18.398 -31.878 119.357 1.00 36.76  ? 204 GLY B C   1 
ATOM   5881 O O   . GLY B 2 204 ? -17.313 -32.412 119.128 1.00 37.50  ? 204 GLY B O   1 
ATOM   5882 N N   . LEU B 2 205 ? -18.560 -30.960 120.292 1.00 34.39  ? 205 LEU B N   1 
ATOM   5883 C CA  . LEU B 2 205 ? -17.441 -30.508 121.085 1.00 34.68  ? 205 LEU B CA  1 
ATOM   5884 C C   . LEU B 2 205 ? -16.777 -31.645 121.861 1.00 35.77  ? 205 LEU B C   1 
ATOM   5885 O O   . LEU B 2 205 ? -15.559 -31.640 122.053 1.00 36.09  ? 205 LEU B O   1 
ATOM   5886 C CB  . LEU B 2 205 ? -17.900 -29.411 122.044 1.00 32.99  ? 205 LEU B CB  1 
ATOM   5887 C CG  . LEU B 2 205 ? -16.793 -28.722 122.841 1.00 32.19  ? 205 LEU B CG  1 
ATOM   5888 C CD1 . LEU B 2 205 ? -15.684 -28.223 121.920 1.00 31.94  ? 205 LEU B CD1 1 
ATOM   5889 C CD2 . LEU B 2 205 ? -17.399 -27.569 123.594 1.00 32.69  ? 205 LEU B CD2 1 
ATOM   5890 N N   . GLU B 2 206 ? -17.573 -32.616 122.307 1.00 35.63  ? 206 GLU B N   1 
ATOM   5891 C CA  . GLU B 2 206 ? -17.037 -33.746 123.062 1.00 35.31  ? 206 GLU B CA  1 
ATOM   5892 C C   . GLU B 2 206 ? -16.157 -34.599 122.170 1.00 35.45  ? 206 GLU B C   1 
ATOM   5893 O O   . GLU B 2 206 ? -15.130 -35.121 122.607 1.00 36.94  ? 206 GLU B O   1 
ATOM   5894 C CB  . GLU B 2 206 ? -18.170 -34.581 123.658 1.00 36.07  ? 206 GLU B CB  1 
ATOM   5895 C CG  . GLU B 2 206 ? -18.891 -33.881 124.801 1.00 37.78  ? 206 GLU B CG  1 
ATOM   5896 C CD  . GLU B 2 206 ? -17.960 -33.553 125.959 1.00 39.79  ? 206 GLU B CD  1 
ATOM   5897 O OE1 . GLU B 2 206 ? -17.418 -34.505 126.569 1.00 42.07  ? 206 GLU B OE1 1 
ATOM   5898 O OE2 . GLU B 2 206 ? -17.766 -32.348 126.256 1.00 39.51  ? 206 GLU B OE2 1 
ATOM   5899 N N   . ILE B 2 207 ? -16.554 -34.734 120.911 1.00 35.32  ? 207 ILE B N   1 
ATOM   5900 C CA  . ILE B 2 207 ? -15.764 -35.505 119.964 1.00 34.65  ? 207 ILE B CA  1 
ATOM   5901 C C   . ILE B 2 207 ? -14.520 -34.698 119.571 1.00 34.41  ? 207 ILE B C   1 
ATOM   5902 O O   . ILE B 2 207 ? -13.457 -35.267 119.345 1.00 34.76  ? 207 ILE B O   1 
ATOM   5903 C CB  . ILE B 2 207 ? -16.586 -35.855 118.705 1.00 33.75  ? 207 ILE B CB  1 
ATOM   5904 C CG1 . ILE B 2 207 ? -17.745 -36.765 119.103 1.00 30.24  ? 207 ILE B CG1 1 
ATOM   5905 C CG2 . ILE B 2 207 ? -15.696 -36.551 117.657 1.00 32.88  ? 207 ILE B CG2 1 
ATOM   5906 C CD1 . ILE B 2 207 ? -17.300 -38.063 119.699 1.00 25.80  ? 207 ILE B CD1 1 
ATOM   5907 N N   . VAL B 2 208 ? -14.646 -33.376 119.495 1.00 32.96  ? 208 VAL B N   1 
ATOM   5908 C CA  . VAL B 2 208 ? -13.490 -32.558 119.161 1.00 32.26  ? 208 VAL B CA  1 
ATOM   5909 C C   . VAL B 2 208 ? -12.525 -32.687 120.330 1.00 32.92  ? 208 VAL B C   1 
ATOM   5910 O O   . VAL B 2 208 ? -11.349 -33.018 120.146 1.00 31.96  ? 208 VAL B O   1 
ATOM   5911 C CB  . VAL B 2 208 ? -13.862 -31.065 118.990 1.00 32.31  ? 208 VAL B CB  1 
ATOM   5912 C CG1 . VAL B 2 208 ? -12.605 -30.246 118.706 1.00 28.79  ? 208 VAL B CG1 1 
ATOM   5913 C CG2 . VAL B 2 208 ? -14.869 -30.908 117.859 1.00 30.20  ? 208 VAL B CG2 1 
ATOM   5914 N N   . LYS B 2 209 ? -13.040 -32.438 121.535 1.00 32.75  ? 209 LYS B N   1 
ATOM   5915 C CA  . LYS B 2 209 ? -12.229 -32.528 122.738 1.00 32.60  ? 209 LYS B CA  1 
ATOM   5916 C C   . LYS B 2 209 ? -11.525 -33.870 122.803 1.00 33.58  ? 209 LYS B C   1 
ATOM   5917 O O   . LYS B 2 209 ? -10.345 -33.933 123.139 1.00 34.08  ? 209 LYS B O   1 
ATOM   5918 C CB  . LYS B 2 209 ? -13.077 -32.321 124.000 1.00 33.27  ? 209 LYS B CB  1 
ATOM   5919 C CG  . LYS B 2 209 ? -13.481 -30.868 124.276 1.00 33.20  ? 209 LYS B CG  1 
ATOM   5920 C CD  . LYS B 2 209 ? -13.819 -30.639 125.749 1.00 33.51  ? 209 LYS B CD  1 
ATOM   5921 C CE  . LYS B 2 209 ? -14.955 -31.540 126.221 1.00 37.01  ? 209 LYS B CE  1 
ATOM   5922 N NZ  . LYS B 2 209 ? -15.254 -31.430 127.682 1.00 37.93  ? 209 LYS B NZ  1 
ATOM   5923 N N   . MET B 2 210 ? -12.228 -34.949 122.478 1.00 33.30  ? 210 MET B N   1 
ATOM   5924 C CA  . MET B 2 210 ? -11.590 -36.259 122.518 1.00 34.16  ? 210 MET B CA  1 
ATOM   5925 C C   . MET B 2 210 ? -10.440 -36.320 121.550 1.00 33.48  ? 210 MET B C   1 
ATOM   5926 O O   . MET B 2 210 ? -9.297  -36.523 121.944 1.00 35.60  ? 210 MET B O   1 
ATOM   5927 C CB  . MET B 2 210 ? -12.561 -37.371 122.151 1.00 36.48  ? 210 MET B CB  1 
ATOM   5928 C CG  . MET B 2 210 ? -11.859 -38.707 121.902 1.00 38.70  ? 210 MET B CG  1 
ATOM   5929 S SD  . MET B 2 210 ? -12.928 -39.961 121.149 1.00 42.45  ? 210 MET B SD  1 
ATOM   5930 C CE  . MET B 2 210 ? -12.262 -39.996 119.484 1.00 41.28  ? 210 MET B CE  1 
ATOM   5931 N N   . VAL B 2 211 ? -10.765 -36.153 120.274 1.00 33.23  ? 211 VAL B N   1 
ATOM   5932 C CA  . VAL B 2 211 ? -9.786  -36.202 119.196 1.00 32.48  ? 211 VAL B CA  1 
ATOM   5933 C C   . VAL B 2 211 ? -8.506  -35.459 119.555 1.00 32.41  ? 211 VAL B C   1 
ATOM   5934 O O   . VAL B 2 211 ? -7.412  -35.993 119.385 1.00 32.18  ? 211 VAL B O   1 
ATOM   5935 C CB  . VAL B 2 211 ? -10.371 -35.630 117.873 1.00 31.54  ? 211 VAL B CB  1 
ATOM   5936 C CG1 . VAL B 2 211 ? -9.334  -35.732 116.761 1.00 31.06  ? 211 VAL B CG1 1 
ATOM   5937 C CG2 . VAL B 2 211 ? -11.617 -36.409 117.473 1.00 29.46  ? 211 VAL B CG2 1 
ATOM   5938 N N   . MET B 2 212 ? -8.627  -34.236 120.052 1.00 31.08  ? 212 MET B N   1 
ATOM   5939 C CA  . MET B 2 212 ? -7.433  -33.506 120.435 1.00 30.51  ? 212 MET B CA  1 
ATOM   5940 C C   . MET B 2 212 ? -6.688  -34.169 121.611 1.00 30.30  ? 212 MET B C   1 
ATOM   5941 O O   . MET B 2 212 ? -5.466  -34.110 121.678 1.00 31.06  ? 212 MET B O   1 
ATOM   5942 C CB  . MET B 2 212 ? -7.779  -32.059 120.790 1.00 29.92  ? 212 MET B CB  1 
ATOM   5943 C CG  . MET B 2 212 ? -8.210  -31.196 119.603 1.00 28.95  ? 212 MET B CG  1 
ATOM   5944 S SD  . MET B 2 212 ? -7.086  -31.199 118.169 1.00 26.56  ? 212 MET B SD  1 
ATOM   5945 C CE  . MET B 2 212 ? -5.499  -30.697 118.942 1.00 26.75  ? 212 MET B CE  1 
ATOM   5946 N N   . ILE B 2 213 ? -7.405  -34.797 122.537 1.00 28.83  ? 213 ILE B N   1 
ATOM   5947 C CA  . ILE B 2 213 ? -6.741  -35.444 123.663 1.00 28.76  ? 213 ILE B CA  1 
ATOM   5948 C C   . ILE B 2 213 ? -5.955  -36.663 123.177 1.00 31.45  ? 213 ILE B C   1 
ATOM   5949 O O   . ILE B 2 213 ? -4.844  -36.927 123.639 1.00 32.05  ? 213 ILE B O   1 
ATOM   5950 C CB  . ILE B 2 213 ? -7.760  -35.845 124.751 1.00 26.97  ? 213 ILE B CB  1 
ATOM   5951 C CG1 . ILE B 2 213 ? -8.126  -34.619 125.581 1.00 24.36  ? 213 ILE B CG1 1 
ATOM   5952 C CG2 . ILE B 2 213 ? -7.183  -36.902 125.668 1.00 26.43  ? 213 ILE B CG2 1 
ATOM   5953 C CD1 . ILE B 2 213 ? -9.398  -34.779 126.385 1.00 24.19  ? 213 ILE B CD1 1 
ATOM   5954 N N   . SER B 2 214 ? -6.515  -37.398 122.229 1.00 34.03  ? 214 SER B N   1 
ATOM   5955 C CA  . SER B 2 214 ? -5.827  -38.568 121.683 1.00 36.98  ? 214 SER B CA  1 
ATOM   5956 C C   . SER B 2 214 ? -4.600  -38.181 120.852 1.00 36.71  ? 214 SER B C   1 
ATOM   5957 O O   . SER B 2 214 ? -3.659  -38.962 120.728 1.00 36.33  ? 214 SER B O   1 
ATOM   5958 C CB  . SER B 2 214 ? -6.777  -39.373 120.801 1.00 39.22  ? 214 SER B CB  1 
ATOM   5959 O OG  . SER B 2 214 ? -8.003  -39.598 121.468 1.00 45.46  ? 214 SER B OG  1 
ATOM   5960 N N   . LEU B 2 215 ? -4.620  -36.981 120.278 1.00 36.86  ? 215 LEU B N   1 
ATOM   5961 C CA  . LEU B 2 215 ? -3.515  -36.515 119.455 1.00 37.42  ? 215 LEU B CA  1 
ATOM   5962 C C   . LEU B 2 215 ? -2.394  -35.863 120.235 1.00 38.71  ? 215 LEU B C   1 
ATOM   5963 O O   . LEU B 2 215 ? -1.227  -36.098 119.938 1.00 40.49  ? 215 LEU B O   1 
ATOM   5964 C CB  . LEU B 2 215 ? -4.005  -35.523 118.400 1.00 37.25  ? 215 LEU B CB  1 
ATOM   5965 C CG  . LEU B 2 215 ? -4.877  -36.057 117.261 1.00 36.99  ? 215 LEU B CG  1 
ATOM   5966 C CD1 . LEU B 2 215 ? -5.136  -34.924 116.296 1.00 36.78  ? 215 LEU B CD1 1 
ATOM   5967 C CD2 . LEU B 2 215 ? -4.201  -37.222 116.551 1.00 34.72  ? 215 LEU B CD2 1 
ATOM   5968 N N   . GLU B 2 216 ? -2.734  -35.046 121.229 1.00 40.10  ? 216 GLU B N   1 
ATOM   5969 C CA  . GLU B 2 216 ? -1.711  -34.343 122.012 1.00 40.74  ? 216 GLU B CA  1 
ATOM   5970 C C   . GLU B 2 216 ? -1.873  -34.454 123.521 1.00 39.76  ? 216 GLU B C   1 
ATOM   5971 O O   . GLU B 2 216 ? -1.057  -33.929 124.277 1.00 38.70  ? 216 GLU B O   1 
ATOM   5972 C CB  . GLU B 2 216 ? -1.678  -32.861 121.607 1.00 42.55  ? 216 GLU B CB  1 
ATOM   5973 C CG  . GLU B 2 216 ? -1.119  -32.609 120.212 1.00 46.48  ? 216 GLU B CG  1 
ATOM   5974 C CD  . GLU B 2 216 ? -1.145  -31.144 119.818 1.00 51.27  ? 216 GLU B CD  1 
ATOM   5975 O OE1 . GLU B 2 216 ? -0.881  -30.289 120.700 1.00 53.83  ? 216 GLU B OE1 1 
ATOM   5976 O OE2 . GLU B 2 216 ? -1.414  -30.846 118.625 1.00 52.27  ? 216 GLU B OE2 1 
ATOM   5977 N N   . GLY B 2 217 ? -2.922  -35.138 123.958 1.00 39.98  ? 217 GLY B N   1 
ATOM   5978 C CA  . GLY B 2 217 ? -3.149  -35.286 125.380 1.00 40.83  ? 217 GLY B CA  1 
ATOM   5979 C C   . GLY B 2 217 ? -3.778  -34.034 125.954 1.00 42.15  ? 217 GLY B C   1 
ATOM   5980 O O   . GLY B 2 217 ? -4.488  -33.325 125.255 1.00 41.95  ? 217 GLY B O   1 
ATOM   5981 N N   . GLU B 2 218 ? -3.502  -33.758 127.223 1.00 44.77  ? 218 GLU B N   1 
ATOM   5982 C CA  . GLU B 2 218 ? -4.047  -32.599 127.919 1.00 47.32  ? 218 GLU B CA  1 
ATOM   5983 C C   . GLU B 2 218 ? -3.890  -31.301 127.139 1.00 48.16  ? 218 GLU B C   1 
ATOM   5984 O O   . GLU B 2 218 ? -4.870  -30.623 126.843 1.00 49.75  ? 218 GLU B O   1 
ATOM   5985 C CB  . GLU B 2 218 ? -3.369  -32.457 129.275 1.00 50.47  ? 218 GLU B CB  1 
ATOM   5986 C CG  . GLU B 2 218 ? -4.141  -31.597 130.261 1.00 56.47  ? 218 GLU B CG  1 
ATOM   5987 C CD  . GLU B 2 218 ? -3.421  -31.459 131.597 1.00 59.57  ? 218 GLU B CD  1 
ATOM   5988 O OE1 . GLU B 2 218 ? -2.984  -32.501 132.147 1.00 60.35  ? 218 GLU B OE1 1 
ATOM   5989 O OE2 . GLU B 2 218 ? -3.296  -30.311 132.094 1.00 60.96  ? 218 GLU B OE2 1 
ATOM   5990 N N   . ASP B 2 219 ? -2.647  -30.966 126.812 1.00 48.89  ? 219 ASP B N   1 
ATOM   5991 C CA  . ASP B 2 219 ? -2.307  -29.750 126.070 1.00 47.38  ? 219 ASP B CA  1 
ATOM   5992 C C   . ASP B 2 219 ? -3.126  -29.597 124.804 1.00 44.77  ? 219 ASP B C   1 
ATOM   5993 O O   . ASP B 2 219 ? -3.346  -28.486 124.325 1.00 43.07  ? 219 ASP B O   1 
ATOM   5994 C CB  . ASP B 2 219 ? -0.828  -29.790 125.709 1.00 51.28  ? 219 ASP B CB  1 
ATOM   5995 C CG  . ASP B 2 219 ? 0.022   -30.289 126.853 1.00 55.96  ? 219 ASP B CG  1 
ATOM   5996 O OD1 . ASP B 2 219 ? 0.201   -29.523 127.832 1.00 57.60  ? 219 ASP B OD1 1 
ATOM   5997 O OD2 . ASP B 2 219 ? 0.488   -31.454 126.781 1.00 58.99  ? 219 ASP B OD2 1 
ATOM   5998 N N   . GLY B 2 220 ? -3.562  -30.725 124.258 1.00 42.72  ? 220 GLY B N   1 
ATOM   5999 C CA  . GLY B 2 220 ? -4.352  -30.694 123.048 1.00 42.44  ? 220 GLY B CA  1 
ATOM   6000 C C   . GLY B 2 220 ? -5.575  -29.811 123.187 1.00 42.01  ? 220 GLY B C   1 
ATOM   6001 O O   . GLY B 2 220 ? -6.040  -29.226 122.211 1.00 42.53  ? 220 GLY B O   1 
ATOM   6002 N N   . LEU B 2 221 ? -6.104  -29.707 124.400 1.00 40.94  ? 221 LEU B N   1 
ATOM   6003 C CA  . LEU B 2 221 ? -7.282  -28.882 124.621 1.00 38.83  ? 221 LEU B CA  1 
ATOM   6004 C C   . LEU B 2 221 ? -6.984  -27.407 124.378 1.00 38.74  ? 221 LEU B C   1 
ATOM   6005 O O   . LEU B 2 221 ? -7.903  -26.612 124.195 1.00 38.84  ? 221 LEU B O   1 
ATOM   6006 C CB  . LEU B 2 221 ? -7.816  -29.087 126.039 1.00 35.78  ? 221 LEU B CB  1 
ATOM   6007 C CG  . LEU B 2 221 ? -8.416  -30.460 126.361 1.00 34.51  ? 221 LEU B CG  1 
ATOM   6008 C CD1 . LEU B 2 221 ? -8.882  -30.434 127.797 1.00 36.34  ? 221 LEU B CD1 1 
ATOM   6009 C CD2 . LEU B 2 221 ? -9.593  -30.793 125.450 1.00 31.98  ? 221 LEU B CD2 1 
ATOM   6010 N N   . ASP B 2 222 ? -5.698  -27.049 124.373 1.00 39.50  ? 222 ASP B N   1 
ATOM   6011 C CA  . ASP B 2 222 ? -5.273  -25.661 124.153 1.00 39.24  ? 222 ASP B CA  1 
ATOM   6012 C C   . ASP B 2 222 ? -5.155  -25.396 122.649 1.00 37.32  ? 222 ASP B C   1 
ATOM   6013 O O   . ASP B 2 222 ? -4.672  -24.342 122.214 1.00 34.84  ? 222 ASP B O   1 
ATOM   6014 C CB  . ASP B 2 222 ? -3.926  -25.387 124.837 1.00 42.46  ? 222 ASP B CB  1 
ATOM   6015 C CG  . ASP B 2 222 ? -3.956  -25.664 126.335 1.00 45.94  ? 222 ASP B CG  1 
ATOM   6016 O OD1 . ASP B 2 222 ? -4.247  -26.816 126.721 1.00 50.52  ? 222 ASP B OD1 1 
ATOM   6017 O OD2 . ASP B 2 222 ? -3.681  -24.743 127.134 1.00 47.35  ? 222 ASP B OD2 1 
ATOM   6018 N N   . GLU B 2 223 ? -5.603  -26.372 121.865 1.00 34.36  ? 223 GLU B N   1 
ATOM   6019 C CA  . GLU B 2 223 ? -5.591  -26.265 120.422 1.00 33.14  ? 223 GLU B CA  1 
ATOM   6020 C C   . GLU B 2 223 ? -7.005  -26.059 119.884 1.00 32.53  ? 223 GLU B C   1 
ATOM   6021 O O   . GLU B 2 223 ? -7.277  -26.281 118.702 1.00 32.82  ? 223 GLU B O   1 
ATOM   6022 C CB  . GLU B 2 223 ? -4.964  -27.510 119.808 1.00 33.58  ? 223 GLU B CB  1 
ATOM   6023 C CG  . GLU B 2 223 ? -3.499  -27.634 120.115 1.00 35.23  ? 223 GLU B CG  1 
ATOM   6024 C CD  . GLU B 2 223 ? -2.803  -26.287 120.074 1.00 37.46  ? 223 GLU B CD  1 
ATOM   6025 O OE1 . GLU B 2 223 ? -3.203  -25.445 119.237 1.00 35.81  ? 223 GLU B OE1 1 
ATOM   6026 O OE2 . GLU B 2 223 ? -1.854  -26.074 120.870 1.00 39.94  ? 223 GLU B OE2 1 
ATOM   6027 N N   . ILE B 2 224 ? -7.897  -25.629 120.770 1.00 30.56  ? 224 ILE B N   1 
ATOM   6028 C CA  . ILE B 2 224 ? -9.284  -25.353 120.431 1.00 28.48  ? 224 ILE B CA  1 
ATOM   6029 C C   . ILE B 2 224 ? -9.468  -23.891 120.782 1.00 27.66  ? 224 ILE B C   1 
ATOM   6030 O O   . ILE B 2 224 ? -9.541  -23.530 121.955 1.00 26.44  ? 224 ILE B O   1 
ATOM   6031 C CB  . ILE B 2 224 ? -10.247 -26.196 121.285 1.00 29.35  ? 224 ILE B CB  1 
ATOM   6032 C CG1 . ILE B 2 224 ? -9.870  -27.677 121.191 1.00 29.18  ? 224 ILE B CG1 1 
ATOM   6033 C CG2 . ILE B 2 224 ? -11.664 -25.986 120.812 1.00 30.42  ? 224 ILE B CG2 1 
ATOM   6034 C CD1 . ILE B 2 224 ? -10.624 -28.578 122.145 1.00 28.85  ? 224 ILE B CD1 1 
ATOM   6035 N N   . TYR B 2 225 ? -9.534  -23.042 119.765 1.00 27.41  ? 225 TYR B N   1 
ATOM   6036 C CA  . TYR B 2 225 ? -9.679  -21.611 120.001 1.00 26.95  ? 225 TYR B CA  1 
ATOM   6037 C C   . TYR B 2 225 ? -11.015 -21.050 119.544 1.00 26.19  ? 225 TYR B C   1 
ATOM   6038 O O   . TYR B 2 225 ? -11.818 -21.749 118.935 1.00 27.27  ? 225 TYR B O   1 
ATOM   6039 C CB  . TYR B 2 225 ? -8.567  -20.848 119.276 1.00 26.45  ? 225 TYR B CB  1 
ATOM   6040 C CG  . TYR B 2 225 ? -7.168  -21.372 119.508 1.00 26.09  ? 225 TYR B CG  1 
ATOM   6041 C CD1 . TYR B 2 225 ? -6.704  -22.496 118.835 1.00 26.85  ? 225 TYR B CD1 1 
ATOM   6042 C CD2 . TYR B 2 225 ? -6.299  -20.726 120.382 1.00 25.43  ? 225 TYR B CD2 1 
ATOM   6043 C CE1 . TYR B 2 225 ? -5.405  -22.965 119.023 1.00 27.51  ? 225 TYR B CE1 1 
ATOM   6044 C CE2 . TYR B 2 225 ? -5.004  -21.183 120.577 1.00 27.75  ? 225 TYR B CE2 1 
ATOM   6045 C CZ  . TYR B 2 225 ? -4.559  -22.304 119.895 1.00 28.39  ? 225 TYR B CZ  1 
ATOM   6046 O OH  . TYR B 2 225 ? -3.267  -22.751 120.073 1.00 31.86  ? 225 TYR B OH  1 
ATOM   6047 N N   . SER B 2 226 ? -11.237 -19.777 119.842 1.00 24.01  ? 226 SER B N   1 
ATOM   6048 C CA  . SER B 2 226 ? -12.446 -19.092 119.416 1.00 23.33  ? 226 SER B CA  1 
ATOM   6049 C C   . SER B 2 226 ? -11.967 -18.143 118.319 1.00 23.84  ? 226 SER B C   1 
ATOM   6050 O O   . SER B 2 226 ? -10.837 -17.661 118.365 1.00 24.14  ? 226 SER B O   1 
ATOM   6051 C CB  . SER B 2 226 ? -13.053 -18.281 120.562 1.00 22.81  ? 226 SER B CB  1 
ATOM   6052 O OG  . SER B 2 226 ? -12.408 -17.020 120.699 1.00 22.65  ? 226 SER B OG  1 
ATOM   6053 N N   . PHE B 2 227 ? -12.814 -17.865 117.339 1.00 23.27  ? 227 PHE B N   1 
ATOM   6054 C CA  . PHE B 2 227 ? -12.432 -16.983 116.247 1.00 23.73  ? 227 PHE B CA  1 
ATOM   6055 C C   . PHE B 2 227 ? -11.902 -15.667 116.766 1.00 25.89  ? 227 PHE B C   1 
ATOM   6056 O O   . PHE B 2 227 ? -10.865 -15.182 116.314 1.00 27.38  ? 227 PHE B O   1 
ATOM   6057 C CB  . PHE B 2 227 ? -13.634 -16.731 115.336 1.00 22.49  ? 227 PHE B CB  1 
ATOM   6058 C CG  . PHE B 2 227 ? -14.173 -17.978 114.686 1.00 21.86  ? 227 PHE B CG  1 
ATOM   6059 C CD1 . PHE B 2 227 ? -15.542 -18.203 114.612 1.00 21.41  ? 227 PHE B CD1 1 
ATOM   6060 C CD2 . PHE B 2 227 ? -13.310 -18.927 114.142 1.00 22.02  ? 227 PHE B CD2 1 
ATOM   6061 C CE1 . PHE B 2 227 ? -16.050 -19.351 114.011 1.00 24.19  ? 227 PHE B CE1 1 
ATOM   6062 C CE2 . PHE B 2 227 ? -13.810 -20.080 113.536 1.00 25.47  ? 227 PHE B CE2 1 
ATOM   6063 C CZ  . PHE B 2 227 ? -15.186 -20.294 113.470 1.00 24.26  ? 227 PHE B CZ  1 
ATOM   6064 N N   . SER B 2 228 ? -12.615 -15.096 117.730 1.00 28.43  ? 228 SER B N   1 
ATOM   6065 C CA  . SER B 2 228 ? -12.239 -13.810 118.312 1.00 29.30  ? 228 SER B CA  1 
ATOM   6066 C C   . SER B 2 228 ? -10.848 -13.782 118.943 1.00 29.24  ? 228 SER B C   1 
ATOM   6067 O O   . SER B 2 228 ? -10.074 -12.851 118.694 1.00 27.73  ? 228 SER B O   1 
ATOM   6068 C CB  . SER B 2 228 ? -13.273 -13.382 119.356 1.00 30.43  ? 228 SER B CB  1 
ATOM   6069 O OG  . SER B 2 228 ? -12.976 -12.093 119.867 1.00 29.12  ? 228 SER B OG  1 
ATOM   6070 N N   . GLU B 2 229 ? -10.532 -14.778 119.770 1.00 27.60  ? 229 GLU B N   1 
ATOM   6071 C CA  . GLU B 2 229 ? -9.217  -14.794 120.397 1.00 27.90  ? 229 GLU B CA  1 
ATOM   6072 C C   . GLU B 2 229 ? -8.141  -15.105 119.376 1.00 26.47  ? 229 GLU B C   1 
ATOM   6073 O O   . GLU B 2 229 ? -6.975  -14.815 119.601 1.00 27.46  ? 229 GLU B O   1 
ATOM   6074 C CB  . GLU B 2 229 ? -9.147  -15.808 121.542 1.00 30.74  ? 229 GLU B CB  1 
ATOM   6075 C CG  . GLU B 2 229 ? -9.618  -17.192 121.192 1.00 34.80  ? 229 GLU B CG  1 
ATOM   6076 C CD  . GLU B 2 229 ? -9.437  -18.174 122.328 1.00 36.46  ? 229 GLU B CD  1 
ATOM   6077 O OE1 . GLU B 2 229 ? -10.127 -19.216 122.317 1.00 39.62  ? 229 GLU B OE1 1 
ATOM   6078 O OE2 . GLU B 2 229 ? -8.602  -17.913 123.220 1.00 37.72  ? 229 GLU B OE2 1 
ATOM   6079 N N   . SER B 2 230 ? -8.537  -15.688 118.253 1.00 24.49  ? 230 SER B N   1 
ATOM   6080 C CA  . SER B 2 230 ? -7.589  -16.013 117.206 1.00 24.00  ? 230 SER B CA  1 
ATOM   6081 C C   . SER B 2 230 ? -7.161  -14.771 116.465 1.00 24.31  ? 230 SER B C   1 
ATOM   6082 O O   . SER B 2 230 ? -6.112  -14.755 115.824 1.00 25.23  ? 230 SER B O   1 
ATOM   6083 C CB  . SER B 2 230 ? -8.188  -17.010 116.220 1.00 25.15  ? 230 SER B CB  1 
ATOM   6084 O OG  . SER B 2 230 ? -8.176  -18.314 116.768 1.00 27.17  ? 230 SER B OG  1 
ATOM   6085 N N   . LEU B 2 231 ? -7.965  -13.723 116.538 1.00 23.86  ? 231 LEU B N   1 
ATOM   6086 C CA  . LEU B 2 231 ? -7.595  -12.501 115.850 1.00 25.91  ? 231 LEU B CA  1 
ATOM   6087 C C   . LEU B 2 231 ? -6.493  -11.776 116.595 1.00 27.32  ? 231 LEU B C   1 
ATOM   6088 O O   . LEU B 2 231 ? -5.684  -11.075 115.976 1.00 28.10  ? 231 LEU B O   1 
ATOM   6089 C CB  . LEU B 2 231 ? -8.803  -11.583 115.691 1.00 24.93  ? 231 LEU B CB  1 
ATOM   6090 C CG  . LEU B 2 231 ? -9.832  -12.122 114.703 1.00 24.65  ? 231 LEU B CG  1 
ATOM   6091 C CD1 . LEU B 2 231 ? -11.080 -11.274 114.740 1.00 23.82  ? 231 LEU B CD1 1 
ATOM   6092 C CD2 . LEU B 2 231 ? -9.215  -12.139 113.312 1.00 24.53  ? 231 LEU B CD2 1 
ATOM   6093 N N   . ARG B 2 232 ? -6.450  -11.964 117.915 1.00 27.74  ? 232 ARG B N   1 
ATOM   6094 C CA  . ARG B 2 232 ? -5.453  -11.308 118.759 1.00 29.47  ? 232 ARG B CA  1 
ATOM   6095 C C   . ARG B 2 232 ? -4.340  -12.243 119.212 1.00 30.04  ? 232 ARG B C   1 
ATOM   6096 O O   . ARG B 2 232 ? -3.714  -12.029 120.252 1.00 31.74  ? 232 ARG B O   1 
ATOM   6097 C CB  . ARG B 2 232 ? -6.132  -10.684 119.983 1.00 30.82  ? 232 ARG B CB  1 
ATOM   6098 C CG  . ARG B 2 232 ? -6.880  -11.668 120.873 1.00 33.00  ? 232 ARG B CG  1 
ATOM   6099 C CD  . ARG B 2 232 ? -7.794  -10.935 121.866 1.00 34.32  ? 232 ARG B CD  1 
ATOM   6100 N NE  . ARG B 2 232 ? -8.481  -11.854 122.769 1.00 33.14  ? 232 ARG B NE  1 
ATOM   6101 C CZ  . ARG B 2 232 ? -7.843  -12.674 123.586 1.00 34.24  ? 232 ARG B CZ  1 
ATOM   6102 N NH1 . ARG B 2 232 ? -6.519  -12.662 123.595 1.00 36.90  ? 232 ARG B NH1 1 
ATOM   6103 N NH2 . ARG B 2 232 ? -8.512  -13.513 124.367 1.00 35.01  ? 232 ARG B NH2 1 
ATOM   6104 N N   . LYS B 2 233 ? -4.098  -13.276 118.419 1.00 28.78  ? 233 LYS B N   1 
ATOM   6105 C CA  . LYS B 2 233 ? -3.065  -14.253 118.709 1.00 29.13  ? 233 LYS B CA  1 
ATOM   6106 C C   . LYS B 2 233 ? -2.415  -14.721 117.404 1.00 29.31  ? 233 LYS B C   1 
ATOM   6107 O O   . LYS B 2 233 ? -2.891  -14.409 116.310 1.00 29.65  ? 233 LYS B O   1 
ATOM   6108 C CB  . LYS B 2 233 ? -3.687  -15.432 119.472 1.00 27.92  ? 233 LYS B CB  1 
ATOM   6109 C CG  . LYS B 2 233 ? -4.133  -15.022 120.863 1.00 32.61  ? 233 LYS B CG  1 
ATOM   6110 C CD  . LYS B 2 233 ? -4.917  -16.073 121.647 1.00 34.34  ? 233 LYS B CD  1 
ATOM   6111 C CE  . LYS B 2 233 ? -5.001  -15.614 123.120 1.00 36.76  ? 233 LYS B CE  1 
ATOM   6112 N NZ  . LYS B 2 233 ? -6.230  -16.031 123.872 1.00 38.90  ? 233 LYS B NZ  1 
ATOM   6113 N N   . LEU B 2 234 ? -1.313  -15.450 117.508 1.00 27.86  ? 234 LEU B N   1 
ATOM   6114 C CA  . LEU B 2 234 ? -0.665  -15.952 116.313 1.00 26.87  ? 234 LEU B CA  1 
ATOM   6115 C C   . LEU B 2 234 ? -0.845  -17.457 116.262 1.00 27.61  ? 234 LEU B C   1 
ATOM   6116 O O   . LEU B 2 234 ? -0.212  -18.134 115.461 1.00 26.82  ? 234 LEU B O   1 
ATOM   6117 C CB  . LEU B 2 234 ? 0.817   -15.611 116.328 1.00 26.15  ? 234 LEU B CB  1 
ATOM   6118 C CG  . LEU B 2 234 ? 1.152   -14.129 116.242 1.00 27.23  ? 234 LEU B CG  1 
ATOM   6119 C CD1 . LEU B 2 234 ? 2.629   -13.931 116.468 1.00 28.78  ? 234 LEU B CD1 1 
ATOM   6120 C CD2 . LEU B 2 234 ? 0.759   -13.595 114.890 1.00 29.55  ? 234 LEU B CD2 1 
ATOM   6121 N N   . CYS B 2 235 ? -1.730  -17.966 117.113 1.00 28.22  ? 235 CYS B N   1 
ATOM   6122 C CA  . CYS B 2 235 ? -1.987  -19.399 117.207 1.00 29.08  ? 235 CYS B CA  1 
ATOM   6123 C C   . CYS B 2 235 ? -2.224  -20.129 115.887 1.00 28.27  ? 235 CYS B C   1 
ATOM   6124 O O   . CYS B 2 235 ? -1.962  -21.318 115.791 1.00 28.18  ? 235 CYS B O   1 
ATOM   6125 C CB  . CYS B 2 235 ? -3.163  -19.668 118.153 1.00 30.03  ? 235 CYS B CB  1 
ATOM   6126 S SG  . CYS B 2 235 ? -4.750  -19.048 117.561 1.00 33.97  ? 235 CYS B SG  1 
ATOM   6127 N N   . VAL B 2 236 ? -2.716  -19.445 114.865 1.00 28.17  ? 236 VAL B N   1 
ATOM   6128 C CA  . VAL B 2 236 ? -2.943  -20.138 113.604 1.00 27.64  ? 236 VAL B CA  1 
ATOM   6129 C C   . VAL B 2 236 ? -1.636  -20.495 112.928 1.00 27.09  ? 236 VAL B C   1 
ATOM   6130 O O   . VAL B 2 236 ? -1.592  -21.404 112.095 1.00 27.08  ? 236 VAL B O   1 
ATOM   6131 C CB  . VAL B 2 236 ? -3.765  -19.299 112.620 1.00 27.75  ? 236 VAL B CB  1 
ATOM   6132 C CG1 . VAL B 2 236 ? -5.176  -19.101 113.158 1.00 28.60  ? 236 VAL B CG1 1 
ATOM   6133 C CG2 . VAL B 2 236 ? -3.079  -17.977 112.380 1.00 27.99  ? 236 VAL B CG2 1 
ATOM   6134 N N   . PHE B 2 237 ? -0.573  -19.779 113.296 1.00 26.93  ? 237 PHE B N   1 
ATOM   6135 C CA  . PHE B 2 237 ? 0.752   -20.002 112.714 1.00 27.09  ? 237 PHE B CA  1 
ATOM   6136 C C   . PHE B 2 237 ? 1.616   -20.900 113.587 1.00 29.37  ? 237 PHE B C   1 
ATOM   6137 O O   . PHE B 2 237 ? 2.705   -21.315 113.181 1.00 30.25  ? 237 PHE B O   1 
ATOM   6138 C CB  . PHE B 2 237 ? 1.481   -18.673 112.514 1.00 24.45  ? 237 PHE B CB  1 
ATOM   6139 C CG  . PHE B 2 237 ? 0.664   -17.622 111.820 1.00 22.32  ? 237 PHE B CG  1 
ATOM   6140 C CD1 . PHE B 2 237 ? 0.190   -16.524 112.525 1.00 21.80  ? 237 PHE B CD1 1 
ATOM   6141 C CD2 . PHE B 2 237 ? 0.378   -17.722 110.459 1.00 19.21  ? 237 PHE B CD2 1 
ATOM   6142 C CE1 . PHE B 2 237 ? -0.553  -15.544 111.891 1.00 21.67  ? 237 PHE B CE1 1 
ATOM   6143 C CE2 . PHE B 2 237 ? -0.360  -16.755 109.817 1.00 19.83  ? 237 PHE B CE2 1 
ATOM   6144 C CZ  . PHE B 2 237 ? -0.832  -15.657 110.528 1.00 21.67  ? 237 PHE B CZ  1 
ATOM   6145 N N   . LYS B 2 238 ? 1.123   -21.188 114.786 1.00 30.66  ? 238 LYS B N   1 
ATOM   6146 C CA  . LYS B 2 238 ? 1.825   -22.022 115.752 1.00 31.95  ? 238 LYS B CA  1 
ATOM   6147 C C   . LYS B 2 238 ? 2.525   -23.230 115.131 1.00 34.45  ? 238 LYS B C   1 
ATOM   6148 O O   . LYS B 2 238 ? 3.752   -23.318 115.151 1.00 34.08  ? 238 LYS B O   1 
ATOM   6149 C CB  . LYS B 2 238 ? 0.832   -22.482 116.815 1.00 32.07  ? 238 LYS B CB  1 
ATOM   6150 C CG  . LYS B 2 238 ? 1.417   -23.139 118.035 1.00 31.73  ? 238 LYS B CG  1 
ATOM   6151 C CD  . LYS B 2 238 ? 0.346   -23.247 119.118 1.00 34.59  ? 238 LYS B CD  1 
ATOM   6152 C CE  . LYS B 2 238 ? 0.915   -23.695 120.456 1.00 36.82  ? 238 LYS B CE  1 
ATOM   6153 N NZ  . LYS B 2 238 ? -0.143  -23.760 121.517 1.00 38.63  ? 238 LYS B NZ  1 
ATOM   6154 N N   . LYS B 2 239 ? 1.756   -24.149 114.555 1.00 36.63  ? 239 LYS B N   1 
ATOM   6155 C CA  . LYS B 2 239 ? 2.341   -25.359 113.986 1.00 38.41  ? 239 LYS B CA  1 
ATOM   6156 C C   . LYS B 2 239 ? 3.209   -25.226 112.756 1.00 39.57  ? 239 LYS B C   1 
ATOM   6157 O O   . LYS B 2 239 ? 3.601   -26.239 112.188 1.00 39.84  ? 239 LYS B O   1 
ATOM   6158 C CB  . LYS B 2 239 ? 1.259   -26.392 113.690 1.00 38.49  ? 239 LYS B CB  1 
ATOM   6159 C CG  . LYS B 2 239 ? 0.599   -26.948 114.925 1.00 42.18  ? 239 LYS B CG  1 
ATOM   6160 C CD  . LYS B 2 239 ? 1.569   -27.734 115.793 1.00 43.84  ? 239 LYS B CD  1 
ATOM   6161 C CE  . LYS B 2 239 ? 0.858   -28.212 117.056 1.00 46.74  ? 239 LYS B CE  1 
ATOM   6162 N NZ  . LYS B 2 239 ? 1.653   -29.196 117.842 1.00 48.45  ? 239 LYS B NZ  1 
ATOM   6163 N N   . ILE B 2 240 ? 3.523   -24.009 112.329 1.00 40.39  ? 240 ILE B N   1 
ATOM   6164 C CA  . ILE B 2 240 ? 4.362   -23.878 111.145 1.00 42.29  ? 240 ILE B CA  1 
ATOM   6165 C C   . ILE B 2 240 ? 5.449   -22.831 111.231 1.00 45.14  ? 240 ILE B C   1 
ATOM   6166 O O   . ILE B 2 240 ? 5.983   -22.395 110.218 1.00 46.13  ? 240 ILE B O   1 
ATOM   6167 C CB  . ILE B 2 240 ? 3.533   -23.595 109.888 1.00 40.15  ? 240 ILE B CB  1 
ATOM   6168 C CG1 . ILE B 2 240 ? 2.807   -22.259 110.031 1.00 38.97  ? 240 ILE B CG1 1 
ATOM   6169 C CG2 . ILE B 2 240 ? 2.577   -24.732 109.647 1.00 39.07  ? 240 ILE B CG2 1 
ATOM   6170 C CD1 . ILE B 2 240 ? 2.196   -21.757 108.744 1.00 35.52  ? 240 ILE B CD1 1 
ATOM   6171 N N   . GLU B 2 241 ? 5.787   -22.420 112.438 1.00 48.73  ? 241 GLU B N   1 
ATOM   6172 C CA  . GLU B 2 241 ? 6.835   -21.436 112.585 1.00 52.78  ? 241 GLU B CA  1 
ATOM   6173 C C   . GLU B 2 241 ? 8.160   -22.141 112.323 1.00 55.31  ? 241 GLU B C   1 
ATOM   6174 O O   . GLU B 2 241 ? 8.338   -23.308 112.683 1.00 54.90  ? 241 GLU B O   1 
ATOM   6175 C CB  . GLU B 2 241 ? 6.803   -20.840 113.995 1.00 53.46  ? 241 GLU B CB  1 
ATOM   6176 C CG  . GLU B 2 241 ? 5.492   -20.130 114.327 1.00 55.07  ? 241 GLU B CG  1 
ATOM   6177 C CD  . GLU B 2 241 ? 5.539   -18.623 114.096 1.00 56.41  ? 241 GLU B CD  1 
ATOM   6178 O OE1 . GLU B 2 241 ? 6.200   -18.187 113.125 1.00 57.39  ? 241 GLU B OE1 1 
ATOM   6179 O OE2 . GLU B 2 241 ? 4.902   -17.877 114.879 1.00 55.27  ? 241 GLU B OE2 1 
ATOM   6180 N N   . ARG B 2 242 ? 9.075   -21.429 111.675 1.00 58.94  ? 242 ARG B N   1 
ATOM   6181 C CA  . ARG B 2 242 ? 10.392  -21.957 111.363 1.00 63.04  ? 242 ARG B CA  1 
ATOM   6182 C C   . ARG B 2 242 ? 11.300  -21.783 112.576 1.00 64.73  ? 242 ARG B C   1 
ATOM   6183 O O   . ARG B 2 242 ? 11.625  -20.657 112.957 1.00 64.67  ? 242 ARG B O   1 
ATOM   6184 C CB  . ARG B 2 242 ? 10.996  -21.193 110.193 1.00 65.98  ? 242 ARG B CB  1 
ATOM   6185 C CG  . ARG B 2 242 ? 10.129  -21.112 108.953 1.00 70.96  ? 242 ARG B CG  1 
ATOM   6186 C CD  . ARG B 2 242 ? 10.512  -19.863 108.172 1.00 76.47  ? 242 ARG B CD  1 
ATOM   6187 N NE  . ARG B 2 242 ? 10.041  -19.876 106.790 1.00 80.45  ? 242 ARG B NE  1 
ATOM   6188 C CZ  . ARG B 2 242 ? 10.168  -18.852 105.947 1.00 82.28  ? 242 ARG B CZ  1 
ATOM   6189 N NH1 . ARG B 2 242 ? 10.750  -17.721 106.343 1.00 81.35  ? 242 ARG B NH1 1 
ATOM   6190 N NH2 . ARG B 2 242 ? 9.715   -18.965 104.700 1.00 83.31  ? 242 ARG B NH2 1 
ATOM   6191 N N   . HIS B 2 243 ? 11.704  -22.895 113.182 1.00 66.61  ? 243 HIS B N   1 
ATOM   6192 C CA  . HIS B 2 243 ? 12.592  -22.863 114.340 1.00 68.24  ? 243 HIS B CA  1 
ATOM   6193 C C   . HIS B 2 243 ? 13.827  -22.014 114.006 1.00 67.72  ? 243 HIS B C   1 
ATOM   6194 O O   . HIS B 2 243 ? 14.277  -21.986 112.854 1.00 67.98  ? 243 HIS B O   1 
ATOM   6195 C CB  . HIS B 2 243 ? 13.004  -24.296 114.705 1.00 72.05  ? 243 HIS B CB  1 
ATOM   6196 C CG  . HIS B 2 243 ? 13.849  -24.393 115.939 1.00 77.24  ? 243 HIS B CG  1 
ATOM   6197 N ND1 . HIS B 2 243 ? 15.196  -24.103 115.950 1.00 79.20  ? 243 HIS B ND1 1 
ATOM   6198 C CD2 . HIS B 2 243 ? 13.524  -24.723 117.211 1.00 79.30  ? 243 HIS B CD2 1 
ATOM   6199 C CE1 . HIS B 2 243 ? 15.667  -24.250 117.179 1.00 80.10  ? 243 HIS B CE1 1 
ATOM   6200 N NE2 . HIS B 2 243 ? 14.674  -24.624 117.963 1.00 79.84  ? 243 HIS B NE2 1 
ATOM   6201 N N   . SER B 2 244 ? 14.359  -21.316 115.011 1.00 65.98  ? 244 SER B N   1 
ATOM   6202 C CA  . SER B 2 244 ? 15.537  -20.455 114.844 1.00 63.57  ? 244 SER B CA  1 
ATOM   6203 C C   . SER B 2 244 ? 16.820  -21.256 115.079 1.00 61.58  ? 244 SER B C   1 
ATOM   6204 O O   . SER B 2 244 ? 16.887  -22.061 116.007 1.00 61.11  ? 244 SER B O   1 
ATOM   6205 C CB  . SER B 2 244 ? 15.468  -19.286 115.831 1.00 63.91  ? 244 SER B CB  1 
ATOM   6206 O OG  . SER B 2 244 ? 16.483  -18.332 115.577 1.00 65.02  ? 244 SER B OG  1 
ATOM   6207 N N   . ILE B 2 245 ? 17.838  -21.038 114.249 1.00 59.04  ? 245 ILE B N   1 
ATOM   6208 C CA  . ILE B 2 245 ? 19.089  -21.784 114.402 1.00 57.31  ? 245 ILE B CA  1 
ATOM   6209 C C   . ILE B 2 245 ? 19.917  -21.353 115.617 1.00 54.84  ? 245 ILE B C   1 
ATOM   6210 O O   . ILE B 2 245 ? 19.900  -20.189 116.033 1.00 54.43  ? 245 ILE B O   1 
ATOM   6211 C CB  . ILE B 2 245 ? 19.975  -21.697 113.135 1.00 58.92  ? 245 ILE B CB  1 
ATOM   6212 C CG1 . ILE B 2 245 ? 19.188  -22.176 111.909 1.00 59.46  ? 245 ILE B CG1 1 
ATOM   6213 C CG2 . ILE B 2 245 ? 21.209  -22.588 113.303 1.00 58.29  ? 245 ILE B CG2 1 
ATOM   6214 C CD1 . ILE B 2 245 ? 18.806  -23.647 111.948 1.00 59.26  ? 245 ILE B CD1 1 
ATOM   6215 N N   . HIS B 2 246 ? 20.649  -22.312 116.173 1.00 50.50  ? 246 HIS B N   1 
ATOM   6216 C CA  . HIS B 2 246 ? 21.463  -22.084 117.350 1.00 45.66  ? 246 HIS B CA  1 
ATOM   6217 C C   . HIS B 2 246 ? 22.844  -21.507 117.054 1.00 41.50  ? 246 HIS B C   1 
ATOM   6218 O O   . HIS B 2 246 ? 23.358  -21.595 115.944 1.00 37.99  ? 246 HIS B O   1 
ATOM   6219 C CB  . HIS B 2 246 ? 21.628  -23.392 118.121 1.00 47.81  ? 246 HIS B CB  1 
ATOM   6220 C CG  . HIS B 2 246 ? 22.556  -24.365 117.454 1.00 49.50  ? 246 HIS B CG  1 
ATOM   6221 N ND1 . HIS B 2 246 ? 22.277  -24.950 116.242 1.00 49.49  ? 246 HIS B ND1 1 
ATOM   6222 C CD2 . HIS B 2 246 ? 23.783  -24.808 117.818 1.00 50.09  ? 246 HIS B CD2 1 
ATOM   6223 C CE1 . HIS B 2 246 ? 23.297  -25.715 115.880 1.00 49.72  ? 246 HIS B CE1 1 
ATOM   6224 N NE2 . HIS B 2 246 ? 24.220  -25.644 116.817 1.00 49.69  ? 246 HIS B NE2 1 
ATOM   6225 N N   . TRP B 2 247 ? 23.426  -20.916 118.091 1.00 38.31  ? 247 TRP B N   1 
ATOM   6226 C CA  . TRP B 2 247 ? 24.744  -20.315 118.054 1.00 34.47  ? 247 TRP B CA  1 
ATOM   6227 C C   . TRP B 2 247 ? 25.573  -21.183 118.991 1.00 34.28  ? 247 TRP B C   1 
ATOM   6228 O O   . TRP B 2 247 ? 25.259  -21.311 120.173 1.00 33.71  ? 247 TRP B O   1 
ATOM   6229 C CB  . TRP B 2 247 ? 24.665  -18.904 118.597 1.00 31.74  ? 247 TRP B CB  1 
ATOM   6230 C CG  . TRP B 2 247 ? 25.955  -18.175 118.576 1.00 31.87  ? 247 TRP B CG  1 
ATOM   6231 C CD1 . TRP B 2 247 ? 26.602  -17.694 117.479 1.00 31.21  ? 247 TRP B CD1 1 
ATOM   6232 C CD2 . TRP B 2 247 ? 26.728  -17.764 119.708 1.00 31.09  ? 247 TRP B CD2 1 
ATOM   6233 N NE1 . TRP B 2 247 ? 27.722  -16.999 117.854 1.00 29.61  ? 247 TRP B NE1 1 
ATOM   6234 C CE2 . TRP B 2 247 ? 27.824  -17.027 119.220 1.00 29.85  ? 247 TRP B CE2 1 
ATOM   6235 C CE3 . TRP B 2 247 ? 26.598  -17.941 121.091 1.00 30.33  ? 247 TRP B CE3 1 
ATOM   6236 C CZ2 . TRP B 2 247 ? 28.785  -16.464 120.064 1.00 30.19  ? 247 TRP B CZ2 1 
ATOM   6237 C CZ3 . TRP B 2 247 ? 27.556  -17.377 121.932 1.00 29.90  ? 247 TRP B CZ3 1 
ATOM   6238 C CH2 . TRP B 2 247 ? 28.632  -16.648 121.415 1.00 28.21  ? 247 TRP B CH2 1 
ATOM   6239 N N   . PRO B 2 248 ? 26.616  -21.827 118.466 1.00 33.60  ? 248 PRO B N   1 
ATOM   6240 C CA  . PRO B 2 248 ? 27.489  -22.697 119.264 1.00 32.47  ? 248 PRO B CA  1 
ATOM   6241 C C   . PRO B 2 248 ? 28.712  -21.972 119.818 1.00 33.17  ? 248 PRO B C   1 
ATOM   6242 O O   . PRO B 2 248 ? 29.389  -21.243 119.097 1.00 33.54  ? 248 PRO B O   1 
ATOM   6243 C CB  . PRO B 2 248 ? 27.893  -23.775 118.274 1.00 31.42  ? 248 PRO B CB  1 
ATOM   6244 C CG  . PRO B 2 248 ? 26.879  -23.643 117.154 1.00 33.37  ? 248 PRO B CG  1 
ATOM   6245 C CD  . PRO B 2 248 ? 26.708  -22.182 117.047 1.00 32.26  ? 248 PRO B CD  1 
ATOM   6246 N N   . CYS B 2 249 ? 29.002  -22.177 121.094 1.00 31.74  ? 249 CYS B N   1 
ATOM   6247 C CA  . CYS B 2 249 ? 30.152  -21.526 121.691 1.00 30.65  ? 249 CYS B CA  1 
ATOM   6248 C C   . CYS B 2 249 ? 30.485  -22.156 123.032 1.00 31.65  ? 249 CYS B C   1 
ATOM   6249 O O   . CYS B 2 249 ? 29.746  -23.000 123.539 1.00 31.55  ? 249 CYS B O   1 
ATOM   6250 C CB  . CYS B 2 249 ? 29.876  -20.030 121.876 1.00 29.04  ? 249 CYS B CB  1 
ATOM   6251 S SG  . CYS B 2 249 ? 31.368  -19.032 122.207 1.00 30.05  ? 249 CYS B SG  1 
ATOM   6252 N N   . ARG B 2 250 ? 31.618  -21.746 123.591 1.00 31.86  ? 250 ARG B N   1 
ATOM   6253 C CA  . ARG B 2 250 ? 32.067  -22.250 124.878 1.00 32.22  ? 250 ARG B CA  1 
ATOM   6254 C C   . ARG B 2 250 ? 31.974  -21.167 125.939 1.00 31.43  ? 250 ARG B C   1 
ATOM   6255 O O   . ARG B 2 250 ? 32.593  -20.104 125.811 1.00 32.06  ? 250 ARG B O   1 
ATOM   6256 C CB  . ARG B 2 250 ? 33.520  -22.719 124.793 1.00 35.03  ? 250 ARG B CB  1 
ATOM   6257 C CG  . ARG B 2 250 ? 33.718  -24.059 124.143 1.00 40.68  ? 250 ARG B CG  1 
ATOM   6258 C CD  . ARG B 2 250 ? 35.193  -24.361 123.989 1.00 47.65  ? 250 ARG B CD  1 
ATOM   6259 N NE  . ARG B 2 250 ? 35.423  -25.282 122.882 1.00 56.80  ? 250 ARG B NE  1 
ATOM   6260 C CZ  . ARG B 2 250 ? 36.596  -25.452 122.274 1.00 61.38  ? 250 ARG B CZ  1 
ATOM   6261 N NH1 . ARG B 2 250 ? 37.662  -24.760 122.671 1.00 62.32  ? 250 ARG B NH1 1 
ATOM   6262 N NH2 . ARG B 2 250 ? 36.700  -26.303 121.252 1.00 63.62  ? 250 ARG B NH2 1 
ATOM   6263 N N   . LEU B 2 251 ? 31.192  -21.415 126.980 1.00 28.04  ? 251 LEU B N   1 
ATOM   6264 C CA  . LEU B 2 251 ? 31.109  -20.442 128.052 1.00 26.84  ? 251 LEU B CA  1 
ATOM   6265 C C   . LEU B 2 251 ? 32.361  -20.725 128.894 1.00 26.92  ? 251 LEU B C   1 
ATOM   6266 O O   . LEU B 2 251 ? 32.511  -21.817 129.432 1.00 25.16  ? 251 LEU B O   1 
ATOM   6267 C CB  . LEU B 2 251 ? 29.829  -20.661 128.858 1.00 26.29  ? 251 LEU B CB  1 
ATOM   6268 C CG  . LEU B 2 251 ? 29.523  -19.709 130.007 1.00 24.74  ? 251 LEU B CG  1 
ATOM   6269 C CD1 . LEU B 2 251 ? 28.092  -19.929 130.487 1.00 23.55  ? 251 LEU B CD1 1 
ATOM   6270 C CD2 . LEU B 2 251 ? 30.524  -19.937 131.123 1.00 25.67  ? 251 LEU B CD2 1 
ATOM   6271 N N   . THR B 2 252 ? 33.266  -19.755 128.994 1.00 25.41  ? 252 THR B N   1 
ATOM   6272 C CA  . THR B 2 252 ? 34.493  -19.979 129.740 1.00 25.50  ? 252 THR B CA  1 
ATOM   6273 C C   . THR B 2 252 ? 34.655  -19.193 131.037 1.00 27.62  ? 252 THR B C   1 
ATOM   6274 O O   . THR B 2 252 ? 34.271  -18.024 131.130 1.00 30.71  ? 252 THR B O   1 
ATOM   6275 C CB  . THR B 2 252 ? 35.728  -19.741 128.840 1.00 24.77  ? 252 THR B CB  1 
ATOM   6276 O OG1 . THR B 2 252 ? 35.849  -18.350 128.508 1.00 25.01  ? 252 THR B OG1 1 
ATOM   6277 C CG2 . THR B 2 252 ? 35.588  -20.548 127.561 1.00 23.98  ? 252 THR B CG2 1 
ATOM   6278 N N   . ILE B 2 253 ? 35.206  -19.861 132.051 1.00 26.87  ? 253 ILE B N   1 
ATOM   6279 C CA  . ILE B 2 253 ? 35.448  -19.256 133.357 1.00 25.11  ? 253 ILE B CA  1 
ATOM   6280 C C   . ILE B 2 253 ? 36.919  -19.475 133.622 1.00 24.55  ? 253 ILE B C   1 
ATOM   6281 O O   . ILE B 2 253 ? 37.337  -20.577 133.950 1.00 24.39  ? 253 ILE B O   1 
ATOM   6282 C CB  . ILE B 2 253 ? 34.622  -19.930 134.461 1.00 23.12  ? 253 ILE B CB  1 
ATOM   6283 C CG1 . ILE B 2 253 ? 33.136  -19.814 134.122 1.00 22.24  ? 253 ILE B CG1 1 
ATOM   6284 C CG2 . ILE B 2 253 ? 34.909  -19.262 135.798 1.00 21.57  ? 253 ILE B CG2 1 
ATOM   6285 C CD1 . ILE B 2 253 ? 32.209  -20.465 135.133 1.00 24.94  ? 253 ILE B CD1 1 
ATOM   6286 N N   . GLY B 2 254 ? 37.698  -18.413 133.481 1.00 25.00  ? 254 GLY B N   1 
ATOM   6287 C CA  . GLY B 2 254 ? 39.126  -18.530 133.653 1.00 25.59  ? 254 GLY B CA  1 
ATOM   6288 C C   . GLY B 2 254 ? 39.567  -19.167 132.353 1.00 26.64  ? 254 GLY B C   1 
ATOM   6289 O O   . GLY B 2 254 ? 38.833  -19.102 131.366 1.00 26.89  ? 254 GLY B O   1 
ATOM   6290 N N   . SER B 2 255 ? 40.739  -19.788 132.327 1.00 26.79  ? 255 SER B N   1 
ATOM   6291 C CA  . SER B 2 255 ? 41.189  -20.422 131.100 1.00 27.48  ? 255 SER B CA  1 
ATOM   6292 C C   . SER B 2 255 ? 41.214  -21.930 131.264 1.00 28.32  ? 255 SER B C   1 
ATOM   6293 O O   . SER B 2 255 ? 41.695  -22.645 130.381 1.00 28.55  ? 255 SER B O   1 
ATOM   6294 C CB  . SER B 2 255 ? 42.581  -19.939 130.725 1.00 28.14  ? 255 SER B CB  1 
ATOM   6295 O OG  . SER B 2 255 ? 43.534  -20.423 131.646 1.00 32.44  ? 255 SER B OG  1 
ATOM   6296 N N   . ASN B 2 256 ? 40.689  -22.419 132.388 1.00 28.27  ? 256 ASN B N   1 
ATOM   6297 C CA  . ASN B 2 256 ? 40.674  -23.858 132.641 1.00 26.73  ? 256 ASN B CA  1 
ATOM   6298 C C   . ASN B 2 256 ? 39.312  -24.516 132.787 1.00 25.54  ? 256 ASN B C   1 
ATOM   6299 O O   . ASN B 2 256 ? 39.229  -25.717 132.941 1.00 24.77  ? 256 ASN B O   1 
ATOM   6300 C CB  . ASN B 2 256 ? 41.531  -24.177 133.865 1.00 26.61  ? 256 ASN B CB  1 
ATOM   6301 C CG  . ASN B 2 256 ? 43.007  -24.030 133.578 1.00 27.11  ? 256 ASN B CG  1 
ATOM   6302 O OD1 . ASN B 2 256 ? 43.534  -24.661 132.655 1.00 26.47  ? 256 ASN B OD1 1 
ATOM   6303 N ND2 . ASN B 2 256 ? 43.685  -23.194 134.356 1.00 25.38  ? 256 ASN B ND2 1 
ATOM   6304 N N   . LEU B 2 257 ? 38.243  -23.738 132.759 1.00 26.66  ? 257 LEU B N   1 
ATOM   6305 C CA  . LEU B 2 257 ? 36.913  -24.322 132.876 1.00 27.35  ? 257 LEU B CA  1 
ATOM   6306 C C   . LEU B 2 257 ? 36.178  -23.977 131.602 1.00 27.59  ? 257 LEU B C   1 
ATOM   6307 O O   . LEU B 2 257 ? 36.162  -22.821 131.180 1.00 25.65  ? 257 LEU B O   1 
ATOM   6308 C CB  . LEU B 2 257 ? 36.155  -23.767 134.086 1.00 29.85  ? 257 LEU B CB  1 
ATOM   6309 C CG  . LEU B 2 257 ? 34.748  -24.357 134.280 1.00 31.98  ? 257 LEU B CG  1 
ATOM   6310 C CD1 . LEU B 2 257 ? 34.788  -25.863 134.008 1.00 32.09  ? 257 LEU B CD1 1 
ATOM   6311 C CD2 . LEU B 2 257 ? 34.237  -24.054 135.695 1.00 30.00  ? 257 LEU B CD2 1 
ATOM   6312 N N   . SER B 2 258 ? 35.583  -24.982 130.972 1.00 27.54  ? 258 SER B N   1 
ATOM   6313 C CA  . SER B 2 258 ? 34.885  -24.732 129.725 1.00 25.29  ? 258 SER B CA  1 
ATOM   6314 C C   . SER B 2 258 ? 33.595  -25.514 129.607 1.00 23.73  ? 258 SER B C   1 
ATOM   6315 O O   . SER B 2 258 ? 33.548  -26.700 129.915 1.00 25.78  ? 258 SER B O   1 
ATOM   6316 C CB  . SER B 2 258 ? 35.797  -25.069 128.567 1.00 25.83  ? 258 SER B CB  1 
ATOM   6317 O OG  . SER B 2 258 ? 35.254  -24.566 127.377 1.00 31.53  ? 258 SER B OG  1 
ATOM   6318 N N   . ILE B 2 259 ? 32.546  -24.836 129.157 1.00 21.01  ? 259 ILE B N   1 
ATOM   6319 C CA  . ILE B 2 259 ? 31.239  -25.452 129.007 1.00 17.55  ? 259 ILE B CA  1 
ATOM   6320 C C   . ILE B 2 259 ? 30.643  -25.161 127.642 1.00 18.67  ? 259 ILE B C   1 
ATOM   6321 O O   . ILE B 2 259 ? 30.394  -24.005 127.291 1.00 19.57  ? 259 ILE B O   1 
ATOM   6322 C CB  . ILE B 2 259 ? 30.269  -24.926 130.053 1.00 15.82  ? 259 ILE B CB  1 
ATOM   6323 C CG1 . ILE B 2 259 ? 30.894  -25.029 131.431 1.00 11.42  ? 259 ILE B CG1 1 
ATOM   6324 C CG2 . ILE B 2 259 ? 28.970  -25.705 129.999 1.00 16.39  ? 259 ILE B CG2 1 
ATOM   6325 C CD1 . ILE B 2 259 ? 30.017  -24.445 132.500 1.00 9.54   ? 259 ILE B CD1 1 
ATOM   6326 N N   . ARG B 2 260 ? 30.411  -26.219 126.876 1.00 19.27  ? 260 ARG B N   1 
ATOM   6327 C CA  . ARG B 2 260 ? 29.831  -26.096 125.551 1.00 18.62  ? 260 ARG B CA  1 
ATOM   6328 C C   . ARG B 2 260 ? 28.360  -25.674 125.628 1.00 19.72  ? 260 ARG B C   1 
ATOM   6329 O O   . ARG B 2 260 ? 27.521  -26.361 126.215 1.00 19.62  ? 260 ARG B O   1 
ATOM   6330 C CB  . ARG B 2 260 ? 29.966  -27.423 124.808 1.00 18.95  ? 260 ARG B CB  1 
ATOM   6331 C CG  . ARG B 2 260 ? 31.423  -27.876 124.602 1.00 22.32  ? 260 ARG B CG  1 
ATOM   6332 C CD  . ARG B 2 260 ? 31.567  -28.627 123.290 1.00 26.58  ? 260 ARG B CD  1 
ATOM   6333 N NE  . ARG B 2 260 ? 30.385  -29.451 123.053 1.00 33.44  ? 260 ARG B NE  1 
ATOM   6334 C CZ  . ARG B 2 260 ? 29.934  -29.796 121.849 1.00 35.48  ? 260 ARG B CZ  1 
ATOM   6335 N NH1 . ARG B 2 260 ? 30.583  -29.389 120.759 1.00 38.91  ? 260 ARG B NH1 1 
ATOM   6336 N NH2 . ARG B 2 260 ? 28.816  -30.513 121.734 1.00 34.99  ? 260 ARG B NH2 1 
ATOM   6337 N N   . ILE B 2 261 ? 28.049  -24.535 125.019 1.00 19.62  ? 261 ILE B N   1 
ATOM   6338 C CA  . ILE B 2 261 ? 26.690  -23.997 125.031 1.00 18.29  ? 261 ILE B CA  1 
ATOM   6339 C C   . ILE B 2 261 ? 26.126  -23.760 123.630 1.00 17.52  ? 261 ILE B C   1 
ATOM   6340 O O   . ILE B 2 261 ? 26.841  -23.819 122.637 1.00 16.45  ? 261 ILE B O   1 
ATOM   6341 C CB  . ILE B 2 261 ? 26.657  -22.646 125.760 1.00 18.92  ? 261 ILE B CB  1 
ATOM   6342 C CG1 . ILE B 2 261 ? 27.678  -21.706 125.109 1.00 17.93  ? 261 ILE B CG1 1 
ATOM   6343 C CG2 . ILE B 2 261 ? 26.955  -22.836 127.245 1.00 17.83  ? 261 ILE B CG2 1 
ATOM   6344 C CD1 . ILE B 2 261 ? 27.542  -20.271 125.506 1.00 20.83  ? 261 ILE B CD1 1 
ATOM   6345 N N   . ALA B 2 262 ? 24.833  -23.474 123.576 1.00 17.09  ? 262 ALA B N   1 
ATOM   6346 C CA  . ALA B 2 262 ? 24.129  -23.177 122.329 1.00 16.44  ? 262 ALA B CA  1 
ATOM   6347 C C   . ALA B 2 262 ? 23.192  -22.019 122.664 1.00 16.64  ? 262 ALA B C   1 
ATOM   6348 O O   . ALA B 2 262 ? 22.449  -22.094 123.645 1.00 14.74  ? 262 ALA B O   1 
ATOM   6349 C CB  . ALA B 2 262 ? 23.329  -24.379 121.876 1.00 17.59  ? 262 ALA B CB  1 
ATOM   6350 N N   . ALA B 2 263 ? 23.224  -20.950 121.870 1.00 16.29  ? 263 ALA B N   1 
ATOM   6351 C CA  . ALA B 2 263 ? 22.369  -19.791 122.147 1.00 17.46  ? 263 ALA B CA  1 
ATOM   6352 C C   . ALA B 2 263 ? 21.269  -19.593 121.119 1.00 18.38  ? 263 ALA B C   1 
ATOM   6353 O O   . ALA B 2 263 ? 21.459  -19.818 119.930 1.00 16.02  ? 263 ALA B O   1 
ATOM   6354 C CB  . ALA B 2 263 ? 23.212  -18.526 122.251 1.00 15.90  ? 263 ALA B CB  1 
ATOM   6355 N N   . TYR B 2 264 ? 20.114  -19.158 121.599 1.00 21.26  ? 264 TYR B N   1 
ATOM   6356 C CA  . TYR B 2 264 ? 18.968  -18.937 120.745 1.00 24.98  ? 264 TYR B CA  1 
ATOM   6357 C C   . TYR B 2 264 ? 18.386  -17.558 120.992 1.00 26.62  ? 264 TYR B C   1 
ATOM   6358 O O   . TYR B 2 264 ? 18.242  -17.150 122.144 1.00 27.18  ? 264 TYR B O   1 
ATOM   6359 C CB  . TYR B 2 264 ? 17.890  -19.985 121.030 1.00 27.50  ? 264 TYR B CB  1 
ATOM   6360 C CG  . TYR B 2 264 ? 18.368  -21.413 120.881 1.00 31.82  ? 264 TYR B CG  1 
ATOM   6361 C CD1 . TYR B 2 264 ? 19.125  -22.027 121.881 1.00 32.50  ? 264 TYR B CD1 1 
ATOM   6362 C CD2 . TYR B 2 264 ? 18.105  -22.139 119.715 1.00 34.07  ? 264 TYR B CD2 1 
ATOM   6363 C CE1 . TYR B 2 264 ? 19.608  -23.329 121.720 1.00 33.36  ? 264 TYR B CE1 1 
ATOM   6364 C CE2 . TYR B 2 264 ? 18.588  -23.439 119.547 1.00 34.44  ? 264 TYR B CE2 1 
ATOM   6365 C CZ  . TYR B 2 264 ? 19.337  -24.025 120.553 1.00 33.99  ? 264 TYR B CZ  1 
ATOM   6366 O OH  . TYR B 2 264 ? 19.812  -25.308 120.394 1.00 36.47  ? 264 TYR B OH  1 
ATOM   6367 N N   . LYS B 2 265 ? 18.051  -16.850 119.910 1.00 27.22  ? 265 LYS B N   1 
ATOM   6368 C CA  . LYS B 2 265 ? 17.443  -15.528 120.009 1.00 25.15  ? 265 LYS B CA  1 
ATOM   6369 C C   . LYS B 2 265 ? 16.057  -15.696 120.586 1.00 23.89  ? 265 LYS B C   1 
ATOM   6370 O O   . LYS B 2 265 ? 15.128  -16.053 119.884 1.00 24.48  ? 265 LYS B O   1 
ATOM   6371 C CB  . LYS B 2 265 ? 17.341  -14.871 118.638 1.00 26.21  ? 265 LYS B CB  1 
ATOM   6372 C CG  . LYS B 2 265 ? 18.694  -14.429 118.082 1.00 31.41  ? 265 LYS B CG  1 
ATOM   6373 C CD  . LYS B 2 265 ? 18.578  -13.593 116.820 1.00 31.09  ? 265 LYS B CD  1 
ATOM   6374 C CE  . LYS B 2 265 ? 19.952  -13.289 116.279 1.00 32.82  ? 265 LYS B CE  1 
ATOM   6375 N NZ  . LYS B 2 265 ? 19.840  -12.634 114.950 1.00 39.41  ? 265 LYS B NZ  1 
ATOM   6376 N N   . SER B 2 266 ? 15.942  -15.456 121.882 1.00 23.20  ? 266 SER B N   1 
ATOM   6377 C CA  . SER B 2 266 ? 14.688  -15.576 122.602 1.00 21.84  ? 266 SER B CA  1 
ATOM   6378 C C   . SER B 2 266 ? 13.760  -14.422 122.233 1.00 21.87  ? 266 SER B C   1 
ATOM   6379 O O   . SER B 2 266 ? 12.567  -14.614 121.982 1.00 18.50  ? 266 SER B O   1 
ATOM   6380 C CB  . SER B 2 266 ? 14.987  -15.563 124.098 1.00 22.81  ? 266 SER B CB  1 
ATOM   6381 O OG  . SER B 2 266 ? 13.810  -15.399 124.857 1.00 24.57  ? 266 SER B OG  1 
ATOM   6382 N N   . ILE B 2 267 ? 14.320  -13.215 122.206 1.00 22.65  ? 267 ILE B N   1 
ATOM   6383 C CA  . ILE B 2 267 ? 13.560  -12.009 121.864 1.00 22.46  ? 267 ILE B CA  1 
ATOM   6384 C C   . ILE B 2 267 ? 14.310  -11.238 120.783 1.00 23.23  ? 267 ILE B C   1 
ATOM   6385 O O   . ILE B 2 267 ? 15.518  -11.017 120.885 1.00 23.50  ? 267 ILE B O   1 
ATOM   6386 C CB  . ILE B 2 267 ? 13.375  -11.076 123.083 1.00 22.40  ? 267 ILE B CB  1 
ATOM   6387 C CG1 . ILE B 2 267 ? 12.797  -11.849 124.280 1.00 21.02  ? 267 ILE B CG1 1 
ATOM   6388 C CG2 . ILE B 2 267 ? 12.473  -9.921  122.702 1.00 22.47  ? 267 ILE B CG2 1 
ATOM   6389 C CD1 . ILE B 2 267 ? 11.397  -12.359 124.088 1.00 18.16  ? 267 ILE B CD1 1 
ATOM   6390 N N   . LEU B 2 268 ? 13.579  -10.827 119.753 1.00 23.71  ? 268 LEU B N   1 
ATOM   6391 C CA  . LEU B 2 268 ? 14.142  -10.097 118.622 1.00 24.73  ? 268 LEU B CA  1 
ATOM   6392 C C   . LEU B 2 268 ? 12.963  -9.426  117.954 1.00 25.85  ? 268 LEU B C   1 
ATOM   6393 O O   . LEU B 2 268 ? 12.048  -10.108 117.545 1.00 27.98  ? 268 LEU B O   1 
ATOM   6394 C CB  . LEU B 2 268 ? 14.793  -11.080 117.638 1.00 23.09  ? 268 LEU B CB  1 
ATOM   6395 C CG  . LEU B 2 268 ? 15.247  -10.532 116.279 1.00 21.61  ? 268 LEU B CG  1 
ATOM   6396 C CD1 . LEU B 2 268 ? 16.513  -9.710  116.440 1.00 19.70  ? 268 LEU B CD1 1 
ATOM   6397 C CD2 . LEU B 2 268 ? 15.494  -11.680 115.330 1.00 20.63  ? 268 LEU B CD2 1 
ATOM   6398 N N   . GLN B 2 269 ? 12.974  -8.107  117.826 1.00 28.51  ? 269 GLN B N   1 
ATOM   6399 C CA  . GLN B 2 269 ? 11.836  -7.428  117.216 1.00 31.67  ? 269 GLN B CA  1 
ATOM   6400 C C   . GLN B 2 269 ? 11.622  -7.734  115.746 1.00 31.69  ? 269 GLN B C   1 
ATOM   6401 O O   . GLN B 2 269 ? 12.533  -7.590  114.936 1.00 32.79  ? 269 GLN B O   1 
ATOM   6402 C CB  . GLN B 2 269 ? 11.950  -5.918  117.393 1.00 34.60  ? 269 GLN B CB  1 
ATOM   6403 C CG  . GLN B 2 269 ? 10.852  -5.170  116.677 1.00 38.56  ? 269 GLN B CG  1 
ATOM   6404 C CD  . GLN B 2 269 ? 10.925  -3.684  116.903 1.00 42.80  ? 269 GLN B CD  1 
ATOM   6405 O OE1 . GLN B 2 269 ? 10.679  -3.191  118.011 1.00 43.33  ? 269 GLN B OE1 1 
ATOM   6406 N NE2 . GLN B 2 269 ? 11.276  -2.950  115.850 1.00 46.65  ? 269 GLN B NE2 1 
ATOM   6407 N N   . GLU B 2 270 ? 10.404  -8.146  115.410 1.00 32.13  ? 270 GLU B N   1 
ATOM   6408 C CA  . GLU B 2 270 ? 10.058  -8.461  114.036 1.00 33.42  ? 270 GLU B CA  1 
ATOM   6409 C C   . GLU B 2 270 ? 9.831   -7.149  113.321 1.00 34.88  ? 270 GLU B C   1 
ATOM   6410 O O   . GLU B 2 270 ? 9.249   -6.220  113.880 1.00 34.17  ? 270 GLU B O   1 
ATOM   6411 C CB  . GLU B 2 270 ? 8.791   -9.307  113.983 1.00 34.55  ? 270 GLU B CB  1 
ATOM   6412 C CG  . GLU B 2 270 ? 8.399   -9.752  112.582 1.00 38.07  ? 270 GLU B CG  1 
ATOM   6413 C CD  . GLU B 2 270 ? 9.334   -10.808 112.010 1.00 39.38  ? 270 GLU B CD  1 
ATOM   6414 O OE1 . GLU B 2 270 ? 10.559  -10.554 111.943 1.00 42.94  ? 270 GLU B OE1 1 
ATOM   6415 O OE2 . GLU B 2 270 ? 8.842   -11.889 111.625 1.00 38.08  ? 270 GLU B OE2 1 
ATOM   6416 N N   . ARG B 2 271 ? 10.291  -7.066  112.081 1.00 37.57  ? 271 ARG B N   1 
ATOM   6417 C CA  . ARG B 2 271 ? 10.135  -5.840  111.326 1.00 40.47  ? 271 ARG B CA  1 
ATOM   6418 C C   . ARG B 2 271 ? 9.571   -6.056  109.938 1.00 40.80  ? 271 ARG B C   1 
ATOM   6419 O O   . ARG B 2 271 ? 9.612   -7.160  109.399 1.00 41.50  ? 271 ARG B O   1 
ATOM   6420 C CB  . ARG B 2 271 ? 11.482  -5.134  111.219 1.00 43.85  ? 271 ARG B CB  1 
ATOM   6421 C CG  . ARG B 2 271 ? 12.063  -4.804  112.564 1.00 50.69  ? 271 ARG B CG  1 
ATOM   6422 C CD  . ARG B 2 271 ? 13.398  -4.079  112.489 1.00 55.73  ? 271 ARG B CD  1 
ATOM   6423 N NE  . ARG B 2 271 ? 13.870  -3.775  113.842 1.00 61.52  ? 271 ARG B NE  1 
ATOM   6424 C CZ  . ARG B 2 271 ? 15.062  -3.261  114.133 1.00 64.18  ? 271 ARG B CZ  1 
ATOM   6425 N NH1 . ARG B 2 271 ? 15.923  -2.983  113.158 1.00 65.55  ? 271 ARG B NH1 1 
ATOM   6426 N NH2 . ARG B 2 271 ? 15.398  -3.030  115.401 1.00 64.98  ? 271 ARG B NH2 1 
ATOM   6427 N N   . VAL B 2 272 ? 9.030   -4.986  109.370 1.00 40.13  ? 272 VAL B N   1 
ATOM   6428 C CA  . VAL B 2 272 ? 8.481   -5.023  108.027 1.00 38.63  ? 272 VAL B CA  1 
ATOM   6429 C C   . VAL B 2 272 ? 9.661   -5.401  107.145 1.00 38.12  ? 272 VAL B C   1 
ATOM   6430 O O   . VAL B 2 272 ? 10.645  -4.675  107.076 1.00 37.08  ? 272 VAL B O   1 
ATOM   6431 C CB  . VAL B 2 272 ? 7.953   -3.637  107.638 1.00 37.57  ? 272 VAL B CB  1 
ATOM   6432 C CG1 . VAL B 2 272 ? 7.551   -3.616  106.178 1.00 37.36  ? 272 VAL B CG1 1 
ATOM   6433 C CG2 . VAL B 2 272 ? 6.774   -3.281  108.538 1.00 35.93  ? 272 VAL B CG2 1 
ATOM   6434 N N   . LYS B 2 273 ? 9.569   -6.535  106.471 1.00 38.06  ? 273 LYS B N   1 
ATOM   6435 C CA  . LYS B 2 273 ? 10.680  -6.966  105.655 1.00 41.07  ? 273 LYS B CA  1 
ATOM   6436 C C   . LYS B 2 273 ? 10.825  -6.269  104.306 1.00 41.78  ? 273 LYS B C   1 
ATOM   6437 O O   . LYS B 2 273 ? 11.865  -5.679  104.025 1.00 42.70  ? 273 LYS B O   1 
ATOM   6438 C CB  . LYS B 2 273 ? 10.617  -8.473  105.455 1.00 43.66  ? 273 LYS B CB  1 
ATOM   6439 C CG  . LYS B 2 273 ? 9.471   -8.933  104.600 1.00 47.13  ? 273 LYS B CG  1 
ATOM   6440 C CD  . LYS B 2 273 ? 9.833   -10.261 103.975 1.00 51.22  ? 273 LYS B CD  1 
ATOM   6441 C CE  . LYS B 2 273 ? 8.858   -10.643 102.891 1.00 54.94  ? 273 LYS B CE  1 
ATOM   6442 N NZ  . LYS B 2 273 ? 9.338   -11.859 102.192 1.00 56.43  ? 273 LYS B NZ  1 
ATOM   6443 N N   . LYS B 2 274 ? 9.788   -6.336  103.480 1.00 42.13  ? 274 LYS B N   1 
ATOM   6444 C CA  . LYS B 2 274 ? 9.799   -5.738  102.145 1.00 42.76  ? 274 LYS B CA  1 
ATOM   6445 C C   . LYS B 2 274 ? 9.816   -4.217  102.177 1.00 44.80  ? 274 LYS B C   1 
ATOM   6446 O O   . LYS B 2 274 ? 9.245   -3.607  103.077 1.00 46.01  ? 274 LYS B O   1 
ATOM   6447 C CB  . LYS B 2 274 ? 8.558   -6.180  101.387 1.00 42.01  ? 274 LYS B CB  1 
ATOM   6448 C CG  . LYS B 2 274 ? 8.722   -6.311  99.902  1.00 39.64  ? 274 LYS B CG  1 
ATOM   6449 C CD  . LYS B 2 274 ? 8.268   -7.704  99.513  1.00 40.23  ? 274 LYS B CD  1 
ATOM   6450 C CE  . LYS B 2 274 ? 8.339   -7.929  98.028  1.00 40.31  ? 274 LYS B CE  1 
ATOM   6451 N NZ  . LYS B 2 274 ? 8.021   -9.353  97.721  1.00 41.06  ? 274 LYS B NZ  1 
ATOM   6452 N N   . THR B 2 275 ? 10.453  -3.601  101.183 1.00 46.52  ? 275 THR B N   1 
ATOM   6453 C CA  . THR B 2 275 ? 10.514  -2.138  101.120 1.00 47.08  ? 275 THR B CA  1 
ATOM   6454 C C   . THR B 2 275 ? 9.780   -1.564  99.903  1.00 46.06  ? 275 THR B C   1 
ATOM   6455 O O   . THR B 2 275 ? 9.536   -2.262  98.909  1.00 46.03  ? 275 THR B O   1 
ATOM   6456 C CB  . THR B 2 275 ? 11.972  -1.620  101.095 1.00 47.09  ? 275 THR B CB  1 
ATOM   6457 O OG1 . THR B 2 275 ? 11.970  -0.209  101.332 1.00 47.94  ? 275 THR B OG1 1 
ATOM   6458 C CG2 . THR B 2 275 ? 12.618  -1.883  99.741  1.00 47.08  ? 275 THR B CG2 1 
ATOM   6459 N N   . TRP B 2 276 ? 9.427   -0.286  99.995  1.00 44.16  ? 276 TRP B N   1 
ATOM   6460 C CA  . TRP B 2 276 ? 8.720   0.393   98.916  1.00 42.73  ? 276 TRP B CA  1 
ATOM   6461 C C   . TRP B 2 276 ? 9.691   0.842   97.849  1.00 41.90  ? 276 TRP B C   1 
ATOM   6462 O O   . TRP B 2 276 ? 10.599  1.618   98.120  1.00 42.28  ? 276 TRP B O   1 
ATOM   6463 C CB  . TRP B 2 276 ? 7.946   1.601   99.459  1.00 40.89  ? 276 TRP B CB  1 
ATOM   6464 C CG  . TRP B 2 276 ? 6.769   1.199   100.272 1.00 39.13  ? 276 TRP B CG  1 
ATOM   6465 C CD1 . TRP B 2 276 ? 6.661   1.221   101.633 1.00 38.17  ? 276 TRP B CD1 1 
ATOM   6466 C CD2 . TRP B 2 276 ? 5.558   0.639   99.785  1.00 38.60  ? 276 TRP B CD2 1 
ATOM   6467 N NE1 . TRP B 2 276 ? 5.455   0.703   102.023 1.00 37.94  ? 276 TRP B NE1 1 
ATOM   6468 C CE2 . TRP B 2 276 ? 4.746   0.331   100.894 1.00 39.68  ? 276 TRP B CE2 1 
ATOM   6469 C CE3 . TRP B 2 276 ? 5.059   0.358   98.498  1.00 39.26  ? 276 TRP B CE3 1 
ATOM   6470 C CZ2 . TRP B 2 276 ? 3.475   -0.241  100.780 1.00 41.02  ? 276 TRP B CZ2 1 
ATOM   6471 C CZ3 . TRP B 2 276 ? 3.793   -0.212  98.372  1.00 37.75  ? 276 TRP B CZ3 1 
ATOM   6472 C CH2 . TRP B 2 276 ? 3.017   -0.504  99.506  1.00 39.64  ? 276 TRP B CH2 1 
ATOM   6473 N N   . THR B 2 277 ? 9.502   0.349   96.634  1.00 41.07  ? 277 THR B N   1 
ATOM   6474 C CA  . THR B 2 277 ? 10.378  0.719   95.531  1.00 41.56  ? 277 THR B CA  1 
ATOM   6475 C C   . THR B 2 277 ? 9.859   1.967   94.820  1.00 40.86  ? 277 THR B C   1 
ATOM   6476 O O   . THR B 2 277 ? 8.678   2.044   94.477  1.00 40.82  ? 277 THR B O   1 
ATOM   6477 C CB  . THR B 2 277 ? 10.473  -0.424  94.504  1.00 42.47  ? 277 THR B CB  1 
ATOM   6478 O OG1 . THR B 2 277 ? 10.925  -1.612  95.160  1.00 42.87  ? 277 THR B OG1 1 
ATOM   6479 C CG2 . THR B 2 277 ? 11.440  -0.064  93.390  1.00 42.27  ? 277 THR B CG2 1 
ATOM   6480 N N   . VAL B 2 278 ? 10.732  2.948   94.606  1.00 39.07  ? 278 VAL B N   1 
ATOM   6481 C CA  . VAL B 2 278 ? 10.309  4.157   93.901  1.00 37.74  ? 278 VAL B CA  1 
ATOM   6482 C C   . VAL B 2 278 ? 10.233  3.882   92.402  1.00 37.40  ? 278 VAL B C   1 
ATOM   6483 O O   . VAL B 2 278 ? 11.192  3.401   91.788  1.00 36.57  ? 278 VAL B O   1 
ATOM   6484 C CB  . VAL B 2 278 ? 11.274  5.340   94.109  1.00 36.16  ? 278 VAL B CB  1 
ATOM   6485 C CG1 . VAL B 2 278 ? 10.783  6.527   93.321  1.00 35.67  ? 278 VAL B CG1 1 
ATOM   6486 C CG2 . VAL B 2 278 ? 11.367  5.702   95.577  1.00 36.14  ? 278 VAL B CG2 1 
ATOM   6487 N N   . VAL B 2 279 ? 9.084   4.193   91.819  1.00 37.28  ? 279 VAL B N   1 
ATOM   6488 C CA  . VAL B 2 279 ? 8.881   3.986   90.401  1.00 38.50  ? 279 VAL B CA  1 
ATOM   6489 C C   . VAL B 2 279 ? 8.312   5.235   89.766  1.00 41.36  ? 279 VAL B C   1 
ATOM   6490 O O   . VAL B 2 279 ? 7.946   6.182   90.455  1.00 41.32  ? 279 VAL B O   1 
ATOM   6491 C CB  . VAL B 2 279 ? 7.913   2.847   90.161  1.00 37.49  ? 279 VAL B CB  1 
ATOM   6492 C CG1 . VAL B 2 279 ? 8.543   1.553   90.598  1.00 39.29  ? 279 VAL B CG1 1 
ATOM   6493 C CG2 . VAL B 2 279 ? 6.635   3.095   90.942  1.00 36.38  ? 279 VAL B CG2 1 
ATOM   6494 N N   . ASP B 2 280 ? 8.240   5.232   88.443  1.00 45.17  ? 280 ASP B N   1 
ATOM   6495 C CA  . ASP B 2 280 ? 7.696   6.360   87.711  1.00 48.25  ? 280 ASP B CA  1 
ATOM   6496 C C   . ASP B 2 280 ? 6.184   6.339   87.786  1.00 49.39  ? 280 ASP B C   1 
ATOM   6497 O O   . ASP B 2 280 ? 5.562   5.295   87.601  1.00 49.15  ? 280 ASP B O   1 
ATOM   6498 C CB  . ASP B 2 280 ? 8.118   6.291   86.254  1.00 51.06  ? 280 ASP B CB  1 
ATOM   6499 C CG  . ASP B 2 280 ? 7.493   7.383   85.434  1.00 54.15  ? 280 ASP B CG  1 
ATOM   6500 O OD1 . ASP B 2 280 ? 6.322   7.229   84.998  1.00 53.14  ? 280 ASP B OD1 1 
ATOM   6501 O OD2 . ASP B 2 280 ? 8.182   8.408   85.251  1.00 56.52  ? 280 ASP B OD2 1 
ATOM   6502 N N   . ALA B 2 281 ? 5.593   7.501   88.035  1.00 51.92  ? 281 ALA B N   1 
ATOM   6503 C CA  . ALA B 2 281 ? 4.143   7.612   88.152  1.00 54.36  ? 281 ALA B CA  1 
ATOM   6504 C C   . ALA B 2 281 ? 3.355   6.977   87.009  1.00 55.86  ? 281 ALA B C   1 
ATOM   6505 O O   . ALA B 2 281 ? 2.173   6.688   87.171  1.00 57.24  ? 281 ALA B O   1 
ATOM   6506 C CB  . ALA B 2 281 ? 3.744   9.072   88.309  1.00 51.99  ? 281 ALA B CB  1 
ATOM   6507 N N   . LYS B 2 282 ? 3.992   6.736   85.868  1.00 57.47  ? 282 LYS B N   1 
ATOM   6508 C CA  . LYS B 2 282 ? 3.272   6.146   84.748  1.00 60.02  ? 282 LYS B CA  1 
ATOM   6509 C C   . LYS B 2 282 ? 3.781   4.777   84.312  1.00 60.79  ? 282 LYS B C   1 
ATOM   6510 O O   . LYS B 2 282 ? 3.015   3.813   84.295  1.00 60.95  ? 282 LYS B O   1 
ATOM   6511 C CB  . LYS B 2 282 ? 3.297   7.115   83.582  1.00 62.18  ? 282 LYS B CB  1 
ATOM   6512 C CG  . LYS B 2 282 ? 3.048   8.536   84.034  1.00 64.92  ? 282 LYS B CG  1 
ATOM   6513 C CD  . LYS B 2 282 ? 3.078   9.507   82.875  1.00 66.99  ? 282 LYS B CD  1 
ATOM   6514 C CE  . LYS B 2 282 ? 2.969   10.941  83.371  1.00 68.35  ? 282 LYS B CE  1 
ATOM   6515 N NZ  . LYS B 2 282 ? 2.821   11.905  82.240  1.00 70.69  ? 282 LYS B NZ  1 
ATOM   6516 N N   . THR B 2 283 ? 5.056   4.681   83.941  1.00 61.28  ? 283 THR B N   1 
ATOM   6517 C CA  . THR B 2 283 ? 5.587   3.381   83.542  1.00 62.81  ? 283 THR B CA  1 
ATOM   6518 C C   . THR B 2 283 ? 5.510   2.438   84.734  1.00 62.50  ? 283 THR B C   1 
ATOM   6519 O O   . THR B 2 283 ? 5.380   1.221   84.570  1.00 63.29  ? 283 THR B O   1 
ATOM   6520 C CB  . THR B 2 283 ? 7.072   3.443   83.077  1.00 63.32  ? 283 THR B CB  1 
ATOM   6521 O OG1 . THR B 2 283 ? 7.784   4.429   83.838  1.00 65.70  ? 283 THR B OG1 1 
ATOM   6522 C CG2 . THR B 2 283 ? 7.159   3.747   81.593  1.00 64.23  ? 283 THR B CG2 1 
ATOM   6523 N N   . LEU B 2 284 ? 5.579   3.007   85.934  1.00 61.28  ? 284 LEU B N   1 
ATOM   6524 C CA  . LEU B 2 284 ? 5.542   2.209   87.148  1.00 59.80  ? 284 LEU B CA  1 
ATOM   6525 C C   . LEU B 2 284 ? 6.770   1.304   87.158  1.00 60.22  ? 284 LEU B C   1 
ATOM   6526 O O   . LEU B 2 284 ? 6.766   0.250   87.790  1.00 60.13  ? 284 LEU B O   1 
ATOM   6527 C CB  . LEU B 2 284 ? 4.284   1.348   87.171  1.00 57.76  ? 284 LEU B CB  1 
ATOM   6528 C CG  . LEU B 2 284 ? 2.939   2.062   87.168  1.00 56.68  ? 284 LEU B CG  1 
ATOM   6529 C CD1 . LEU B 2 284 ? 1.853   1.038   86.967  1.00 55.72  ? 284 LEU B CD1 1 
ATOM   6530 C CD2 . LEU B 2 284 ? 2.733   2.807   88.476  1.00 55.54  ? 284 LEU B CD2 1 
ATOM   6531 N N   . LYS B 2 285 ? 7.812   1.717   86.441  1.00 61.04  ? 285 LYS B N   1 
ATOM   6532 C CA  . LYS B 2 285 ? 9.047   0.947   86.338  1.00 62.20  ? 285 LYS B CA  1 
ATOM   6533 C C   . LYS B 2 285 ? 10.148  1.552   87.191  1.00 63.31  ? 285 LYS B C   1 
ATOM   6534 O O   . LYS B 2 285 ? 10.085  2.723   87.562  1.00 63.33  ? 285 LYS B O   1 
ATOM   6535 C CB  . LYS B 2 285 ? 9.511   0.890   84.881  1.00 62.94  ? 285 LYS B CB  1 
ATOM   6536 C CG  . LYS B 2 285 ? 8.527   0.230   83.924  1.00 64.53  ? 285 LYS B CG  1 
ATOM   6537 C CD  . LYS B 2 285 ? 8.293   -1.219  84.310  1.00 67.96  ? 285 LYS B CD  1 
ATOM   6538 C CE  . LYS B 2 285 ? 7.364   -1.924  83.339  1.00 68.98  ? 285 LYS B CE  1 
ATOM   6539 N NZ  . LYS B 2 285 ? 7.091   -3.316  83.798  1.00 70.41  ? 285 LYS B NZ  1 
ATOM   6540 N N   . LYS B 2 286 ? 11.157  0.753   87.512  1.00 64.40  ? 286 LYS B N   1 
ATOM   6541 C CA  . LYS B 2 286 ? 12.251  1.256   88.317  1.00 66.23  ? 286 LYS B CA  1 
ATOM   6542 C C   . LYS B 2 286 ? 13.353  1.739   87.393  1.00 68.00  ? 286 LYS B C   1 
ATOM   6543 O O   . LYS B 2 286 ? 13.855  2.847   87.549  1.00 67.59  ? 286 LYS B O   1 
ATOM   6544 C CB  . LYS B 2 286 ? 12.796  0.169   89.243  1.00 65.67  ? 286 LYS B CB  1 
ATOM   6545 C CG  . LYS B 2 286 ? 13.865  0.679   90.195  1.00 65.97  ? 286 LYS B CG  1 
ATOM   6546 C CD  . LYS B 2 286 ? 14.313  -0.393  91.174  1.00 67.01  ? 286 LYS B CD  1 
ATOM   6547 C CE  . LYS B 2 286 ? 15.321  0.165   92.183  1.00 67.50  ? 286 LYS B CE  1 
ATOM   6548 N NZ  . LYS B 2 286 ? 15.641  -0.808  93.272  1.00 66.59  ? 286 LYS B NZ  1 
ATOM   6549 N N   . GLU B 2 287 ? 13.710  0.900   86.423  1.00 70.81  ? 287 GLU B N   1 
ATOM   6550 C CA  . GLU B 2 287 ? 14.764  1.191   85.450  1.00 73.86  ? 287 GLU B CA  1 
ATOM   6551 C C   . GLU B 2 287 ? 14.859  2.658   85.028  1.00 74.85  ? 287 GLU B C   1 
ATOM   6552 O O   . GLU B 2 287 ? 15.932  3.259   85.047  1.00 75.29  ? 287 GLU B O   1 
ATOM   6553 C CB  . GLU B 2 287 ? 14.578  0.311   84.205  1.00 75.77  ? 287 GLU B CB  1 
ATOM   6554 C CG  . GLU B 2 287 ? 15.141  -1.115  84.317  1.00 79.79  ? 287 GLU B CG  1 
ATOM   6555 C CD  . GLU B 2 287 ? 14.601  -1.888  85.517  1.00 82.29  ? 287 GLU B CD  1 
ATOM   6556 O OE1 . GLU B 2 287 ? 13.361  -1.923  85.698  1.00 84.78  ? 287 GLU B OE1 1 
ATOM   6557 O OE2 . GLU B 2 287 ? 15.418  -2.467  86.272  1.00 82.09  ? 287 GLU B OE2 1 
ATOM   6558 N N   . ASP B 2 288 ? 13.726  3.228   84.648  1.00 76.32  ? 288 ASP B N   1 
ATOM   6559 C CA  . ASP B 2 288 ? 13.655  4.617   84.205  1.00 76.58  ? 288 ASP B CA  1 
ATOM   6560 C C   . ASP B 2 288 ? 14.134  5.615   85.273  1.00 74.95  ? 288 ASP B C   1 
ATOM   6561 O O   . ASP B 2 288 ? 14.595  6.704   84.948  1.00 74.21  ? 288 ASP B O   1 
ATOM   6562 C CB  . ASP B 2 288 ? 12.204  4.939   83.825  1.00 80.24  ? 288 ASP B CB  1 
ATOM   6563 C CG  . ASP B 2 288 ? 11.599  3.911   82.872  1.00 82.60  ? 288 ASP B CG  1 
ATOM   6564 O OD1 . ASP B 2 288 ? 12.029  2.733   82.897  1.00 83.50  ? 288 ASP B OD1 1 
ATOM   6565 O OD2 . ASP B 2 288 ? 10.676  4.281   82.110  1.00 84.00  ? 288 ASP B OD2 1 
ATOM   6566 N N   . ILE B 2 289 ? 14.029  5.225   86.541  1.00 73.78  ? 289 ILE B N   1 
ATOM   6567 C CA  . ILE B 2 289 ? 14.391  6.075   87.679  1.00 71.99  ? 289 ILE B CA  1 
ATOM   6568 C C   . ILE B 2 289 ? 15.826  5.929   88.190  1.00 71.99  ? 289 ILE B C   1 
ATOM   6569 O O   . ILE B 2 289 ? 16.282  4.821   88.453  1.00 72.39  ? 289 ILE B O   1 
ATOM   6570 C CB  . ILE B 2 289 ? 13.454  5.778   88.878  1.00 70.46  ? 289 ILE B CB  1 
ATOM   6571 C CG1 . ILE B 2 289 ? 12.011  5.604   88.396  1.00 68.97  ? 289 ILE B CG1 1 
ATOM   6572 C CG2 . ILE B 2 289 ? 13.545  6.888   89.904  1.00 70.08  ? 289 ILE B CG2 1 
ATOM   6573 C CD1 . ILE B 2 289 ? 11.447  6.793   87.651  1.00 69.72  ? 289 ILE B CD1 1 
ATOM   6574 N N   . GLN B 2 290 ? 16.541  7.039   88.348  1.00 72.20  ? 290 GLN B N   1 
ATOM   6575 C CA  . GLN B 2 290 ? 17.893  6.941   88.876  1.00 73.19  ? 290 GLN B CA  1 
ATOM   6576 C C   . GLN B 2 290 ? 18.349  8.116   89.726  1.00 73.88  ? 290 GLN B C   1 
ATOM   6577 O O   . GLN B 2 290 ? 18.282  9.269   89.313  1.00 72.52  ? 290 GLN B O   1 
ATOM   6578 C CB  . GLN B 2 290 ? 18.913  6.710   87.764  1.00 74.28  ? 290 GLN B CB  1 
ATOM   6579 C CG  . GLN B 2 290 ? 20.208  6.138   88.327  1.00 76.48  ? 290 GLN B CG  1 
ATOM   6580 C CD  . GLN B 2 290 ? 21.267  5.867   87.286  1.00 77.11  ? 290 GLN B CD  1 
ATOM   6581 O OE1 . GLN B 2 290 ? 21.045  5.141   86.312  1.00 76.95  ? 290 GLN B OE1 1 
ATOM   6582 N NE2 . GLN B 2 290 ? 22.441  6.446   87.495  1.00 78.23  ? 290 GLN B NE2 1 
ATOM   6583 N N   . LYS B 2 291 ? 18.819  7.796   90.928  1.00 76.30  ? 291 LYS B N   1 
ATOM   6584 C CA  . LYS B 2 291 ? 19.308  8.795   91.868  1.00 78.68  ? 291 LYS B CA  1 
ATOM   6585 C C   . LYS B 2 291 ? 20.786  9.026   91.608  1.00 80.70  ? 291 LYS B C   1 
ATOM   6586 O O   . LYS B 2 291 ? 21.560  8.076   91.522  1.00 79.88  ? 291 LYS B O   1 
ATOM   6587 C CB  . LYS B 2 291 ? 19.130  8.317   93.317  1.00 78.40  ? 291 LYS B CB  1 
ATOM   6588 C CG  . LYS B 2 291 ? 17.700  7.971   93.706  1.00 78.56  ? 291 LYS B CG  1 
ATOM   6589 C CD  . LYS B 2 291 ? 17.506  7.894   95.222  1.00 77.30  ? 291 LYS B CD  1 
ATOM   6590 C CE  . LYS B 2 291 ? 18.255  6.728   95.848  1.00 77.15  ? 291 LYS B CE  1 
ATOM   6591 N NZ  . LYS B 2 291 ? 17.887  6.522   97.281  1.00 76.20  ? 291 LYS B NZ  1 
ATOM   6592 N N   . GLU B 2 292 ? 21.178  10.287  91.474  1.00 83.93  ? 292 GLU B N   1 
ATOM   6593 C CA  . GLU B 2 292 ? 22.576  10.599  91.243  1.00 87.09  ? 292 GLU B CA  1 
ATOM   6594 C C   . GLU B 2 292 ? 23.100  11.477  92.363  1.00 88.65  ? 292 GLU B C   1 
ATOM   6595 O O   . GLU B 2 292 ? 22.761  12.657  92.453  1.00 89.34  ? 292 GLU B O   1 
ATOM   6596 C CB  . GLU B 2 292 ? 22.771  11.304  89.901  1.00 88.12  ? 292 GLU B CB  1 
ATOM   6597 C CG  . GLU B 2 292 ? 24.220  11.252  89.419  1.00 90.45  ? 292 GLU B CG  1 
ATOM   6598 C CD  . GLU B 2 292 ? 24.432  11.904  88.064  1.00 91.30  ? 292 GLU B CD  1 
ATOM   6599 O OE1 . GLU B 2 292 ? 24.282  13.144  87.969  1.00 90.63  ? 292 GLU B OE1 1 
ATOM   6600 O OE2 . GLU B 2 292 ? 24.751  11.170  87.098  1.00 91.50  ? 292 GLU B OE2 1 
ATOM   6601 N N   . THR B 2 293 ? 23.926  10.882  93.216  1.00 90.33  ? 293 THR B N   1 
ATOM   6602 C CA  . THR B 2 293 ? 24.522  11.579  94.347  1.00 91.42  ? 293 THR B CA  1 
ATOM   6603 C C   . THR B 2 293 ? 25.885  12.177  93.960  1.00 91.87  ? 293 THR B C   1 
ATOM   6604 O O   . THR B 2 293 ? 26.822  11.445  93.636  1.00 91.44  ? 293 THR B O   1 
ATOM   6605 C CB  . THR B 2 293 ? 24.663  10.602  95.551  1.00 91.10  ? 293 THR B CB  1 
ATOM   6606 O OG1 . THR B 2 293 ? 25.482  11.194  96.558  1.00 92.19  ? 293 THR B OG1 1 
ATOM   6607 C CG2 . THR B 2 293 ? 25.273  9.278   95.117  1.00 90.58  ? 293 THR B CG2 1 
ATOM   6608 N N   . VAL B 2 294 ? 25.982  13.509  93.980  1.00 92.91  ? 294 VAL B N   1 
ATOM   6609 C CA  . VAL B 2 294 ? 27.223  14.211  93.623  1.00 94.13  ? 294 VAL B CA  1 
ATOM   6610 C C   . VAL B 2 294 ? 27.797  15.032  94.790  1.00 94.55  ? 294 VAL B C   1 
ATOM   6611 O O   . VAL B 2 294 ? 27.097  15.307  95.769  1.00 94.37  ? 294 VAL B O   1 
ATOM   6612 C CB  . VAL B 2 294 ? 26.994  15.150  92.414  1.00 94.32  ? 294 VAL B CB  1 
ATOM   6613 C CG1 . VAL B 2 294 ? 28.323  15.697  91.898  1.00 93.57  ? 294 VAL B CG1 1 
ATOM   6614 C CG2 . VAL B 2 294 ? 26.271  14.397  91.310  1.00 95.44  ? 294 VAL B CG2 1 
ATOM   6615 N N   . TYR B 2 295 ? 29.068  15.423  94.675  1.00 95.25  ? 295 TYR B N   1 
ATOM   6616 C CA  . TYR B 2 295 ? 29.753  16.183  95.725  1.00 96.08  ? 295 TYR B CA  1 
ATOM   6617 C C   . TYR B 2 295 ? 30.335  17.519  95.240  1.00 97.22  ? 295 TYR B C   1 
ATOM   6618 O O   . TYR B 2 295 ? 30.851  17.618  94.123  1.00 96.94  ? 295 TYR B O   1 
ATOM   6619 C CB  . TYR B 2 295 ? 30.875  15.333  96.325  1.00 94.85  ? 295 TYR B CB  1 
ATOM   6620 C CG  . TYR B 2 295 ? 30.496  13.885  96.501  1.00 94.44  ? 295 TYR B CG  1 
ATOM   6621 C CD1 . TYR B 2 295 ? 30.380  13.042  95.399  1.00 95.11  ? 295 TYR B CD1 1 
ATOM   6622 C CD2 . TYR B 2 295 ? 30.214  13.363  97.759  1.00 94.42  ? 295 TYR B CD2 1 
ATOM   6623 C CE1 . TYR B 2 295 ? 29.987  11.713  95.540  1.00 95.83  ? 295 TYR B CE1 1 
ATOM   6624 C CE2 . TYR B 2 295 ? 29.821  12.030  97.917  1.00 95.18  ? 295 TYR B CE2 1 
ATOM   6625 C CZ  . TYR B 2 295 ? 29.708  11.209  96.801  1.00 95.64  ? 295 TYR B CZ  1 
ATOM   6626 O OH  . TYR B 2 295 ? 29.312  9.892   96.933  1.00 95.59  ? 295 TYR B OH  1 
ATOM   6627 N N   . CYS B 2 296 ? 30.256  18.534  96.103  1.00 98.69  ? 296 CYS B N   1 
ATOM   6628 C CA  . CYS B 2 296 ? 30.749  19.888  95.806  1.00 99.78  ? 296 CYS B CA  1 
ATOM   6629 C C   . CYS B 2 296 ? 31.157  20.647  97.082  1.00 100.41 ? 296 CYS B C   1 
ATOM   6630 O O   . CYS B 2 296 ? 30.716  20.298  98.181  1.00 100.78 ? 296 CYS B O   1 
ATOM   6631 C CB  . CYS B 2 296 ? 29.660  20.684  95.085  1.00 99.89  ? 296 CYS B CB  1 
ATOM   6632 S SG  . CYS B 2 296 ? 28.124  20.854  96.047  1.00 99.54  ? 296 CYS B SG  1 
ATOM   6633 N N   . LEU B 2 297 ? 31.979  21.690  96.925  1.00 100.57 ? 297 LEU B N   1 
ATOM   6634 C CA  . LEU B 2 297 ? 32.453  22.507  98.055  1.00 100.58 ? 297 LEU B CA  1 
ATOM   6635 C C   . LEU B 2 297 ? 31.296  23.049  98.895  1.00 100.60 ? 297 LEU B C   1 
ATOM   6636 O O   . LEU B 2 297 ? 30.435  23.770  98.390  1.00 100.78 ? 297 LEU B O   1 
ATOM   6637 C CB  . LEU B 2 297 ? 33.316  23.664  97.544  1.00 100.24 ? 297 LEU B CB  1 
ATOM   6638 C CG  . LEU B 2 297 ? 34.520  23.255  96.679  1.00 100.78 ? 297 LEU B CG  1 
ATOM   6639 C CD1 . LEU B 2 297 ? 35.273  24.497  96.216  1.00 100.78 ? 297 LEU B CD1 1 
ATOM   6640 C CD2 . LEU B 2 297 ? 35.447  22.336  97.463  1.00 100.32 ? 297 LEU B CD2 1 
ATOM   6641 N N   . ASN B 2 298 ? 31.305  22.705  100.183 1.00 100.64 ? 298 ASN B N   1 
ATOM   6642 C CA  . ASN B 2 298 ? 30.259  23.078  101.146 1.00 100.78 ? 298 ASN B CA  1 
ATOM   6643 C C   . ASN B 2 298 ? 29.968  24.574  101.343 1.00 100.78 ? 298 ASN B C   1 
ATOM   6644 O O   . ASN B 2 298 ? 28.803  24.971  101.472 1.00 100.60 ? 298 ASN B O   1 
ATOM   6645 C CB  . ASN B 2 298 ? 30.567  22.423  102.508 1.00 100.78 ? 298 ASN B CB  1 
ATOM   6646 C CG  . ASN B 2 298 ? 29.416  22.549  103.499 1.00 100.78 ? 298 ASN B CG  1 
ATOM   6647 O OD1 . ASN B 2 298 ? 28.250  22.378  103.140 1.00 100.78 ? 298 ASN B OD1 1 
ATOM   6648 N ND2 . ASN B 2 298 ? 29.742  22.835  104.756 1.00 100.13 ? 298 ASN B ND2 1 
ATOM   6649 N N   . ASP B 2 299 ? 31.014  25.399  101.378 1.00 100.78 ? 299 ASP B N   1 
ATOM   6650 C CA  . ASP B 2 299 ? 30.838  26.841  101.558 1.00 100.78 ? 299 ASP B CA  1 
ATOM   6651 C C   . ASP B 2 299 ? 30.608  27.450  100.168 1.00 100.78 ? 299 ASP B C   1 
ATOM   6652 O O   . ASP B 2 299 ? 30.723  26.744  99.160  1.00 100.78 ? 299 ASP B O   1 
ATOM   6653 C CB  . ASP B 2 299 ? 32.091  27.440  102.217 1.00 100.65 ? 299 ASP B CB  1 
ATOM   6654 C CG  . ASP B 2 299 ? 31.798  28.710  103.005 1.00 100.78 ? 299 ASP B CG  1 
ATOM   6655 O OD1 . ASP B 2 299 ? 31.332  29.701  102.401 1.00 100.22 ? 299 ASP B OD1 1 
ATOM   6656 O OD2 . ASP B 2 299 ? 32.038  28.715  104.234 1.00 100.78 ? 299 ASP B OD2 1 
ATOM   6657 N N   . ASP B 2 300 ? 30.273  28.743  100.116 1.00 100.78 ? 300 ASP B N   1 
ATOM   6658 C CA  . ASP B 2 300 ? 30.033  29.446  98.844  1.00 100.78 ? 300 ASP B CA  1 
ATOM   6659 C C   . ASP B 2 300 ? 31.068  29.068  97.770  1.00 100.78 ? 300 ASP B C   1 
ATOM   6660 O O   . ASP B 2 300 ? 32.011  28.312  98.042  1.00 100.78 ? 300 ASP B O   1 
ATOM   6661 C CB  . ASP B 2 300 ? 30.043  30.969  99.065  1.00 100.78 ? 300 ASP B CB  1 
ATOM   6662 C CG  . ASP B 2 300 ? 28.646  31.555  99.189  1.00 100.78 ? 300 ASP B CG  1 
ATOM   6663 O OD1 . ASP B 2 300 ? 27.857  31.066  100.028 1.00 100.78 ? 300 ASP B OD1 1 
ATOM   6664 O OD2 . ASP B 2 300 ? 28.341  32.512  98.444  1.00 100.37 ? 300 ASP B OD2 1 
ATOM   6665 N N   . ASP B 2 301 ? 30.908  29.602  96.558  1.00 100.78 ? 301 ASP B N   1 
ATOM   6666 C CA  . ASP B 2 301 ? 31.822  29.261  95.468  1.00 100.78 ? 301 ASP B CA  1 
ATOM   6667 C C   . ASP B 2 301 ? 31.798  27.736  95.478  1.00 100.78 ? 301 ASP B C   1 
ATOM   6668 O O   . ASP B 2 301 ? 32.830  27.058  95.548  1.00 100.55 ? 301 ASP B O   1 
ATOM   6669 C CB  . ASP B 2 301 ? 33.233  29.788  95.752  1.00 100.78 ? 301 ASP B CB  1 
ATOM   6670 C CG  . ASP B 2 301 ? 33.230  31.229  96.237  1.00 100.78 ? 301 ASP B CG  1 
ATOM   6671 O OD1 . ASP B 2 301 ? 32.373  32.012  95.770  1.00 100.78 ? 301 ASP B OD1 1 
ATOM   6672 O OD2 . ASP B 2 301 ? 34.083  31.578  97.083  1.00 100.78 ? 301 ASP B OD2 1 
ATOM   6673 N N   . GLU B 2 302 ? 30.568  27.235  95.446  1.00 100.78 ? 302 GLU B N   1 
ATOM   6674 C CA  . GLU B 2 302 ? 30.229  25.823  95.472  1.00 100.52 ? 302 GLU B CA  1 
ATOM   6675 C C   . GLU B 2 302 ? 30.660  25.084  94.206  1.00 100.44 ? 302 GLU B C   1 
ATOM   6676 O O   . GLU B 2 302 ? 29.831  24.709  93.369  1.00 99.70  ? 302 GLU B O   1 
ATOM   6677 C CB  . GLU B 2 302 ? 28.722  25.713  95.665  1.00 100.46 ? 302 GLU B CB  1 
ATOM   6678 C CG  . GLU B 2 302 ? 28.164  24.327  95.717  1.00 100.78 ? 302 GLU B CG  1 
ATOM   6679 C CD  . GLU B 2 302 ? 26.658  24.356  95.785  1.00 100.78 ? 302 GLU B CD  1 
ATOM   6680 O OE1 . GLU B 2 302 ? 26.121  25.044  96.682  1.00 100.45 ? 302 GLU B OE1 1 
ATOM   6681 O OE2 . GLU B 2 302 ? 26.013  23.697  94.944  1.00 100.78 ? 302 GLU B OE2 1 
ATOM   6682 N N   . THR B 2 303 ? 31.965  24.872  94.081  1.00 100.78 ? 303 THR B N   1 
ATOM   6683 C CA  . THR B 2 303 ? 32.528  24.181  92.931  1.00 100.73 ? 303 THR B CA  1 
ATOM   6684 C C   . THR B 2 303 ? 32.257  22.690  93.070  1.00 100.47 ? 303 THR B C   1 
ATOM   6685 O O   . THR B 2 303 ? 32.057  22.185  94.175  1.00 100.78 ? 303 THR B O   1 
ATOM   6686 C CB  . THR B 2 303 ? 34.064  24.379  92.839  1.00 100.78 ? 303 THR B CB  1 
ATOM   6687 O OG1 . THR B 2 303 ? 34.410  25.720  93.213  1.00 100.78 ? 303 THR B OG1 1 
ATOM   6688 C CG2 . THR B 2 303 ? 34.548  24.126  91.414  1.00 100.31 ? 303 THR B CG2 1 
ATOM   6689 N N   . GLU B 2 304 ? 32.247  21.990  91.944  1.00 100.13 ? 304 GLU B N   1 
ATOM   6690 C CA  . GLU B 2 304 ? 32.017  20.556  91.946  1.00 99.48  ? 304 GLU B CA  1 
ATOM   6691 C C   . GLU B 2 304 ? 33.350  19.842  92.169  1.00 99.18  ? 304 GLU B C   1 
ATOM   6692 O O   . GLU B 2 304 ? 34.415  20.390  91.870  1.00 98.78  ? 304 GLU B O   1 
ATOM   6693 C CB  . GLU B 2 304 ? 31.407  20.129  90.613  1.00 99.47  ? 304 GLU B CB  1 
ATOM   6694 C CG  . GLU B 2 304 ? 31.265  18.629  90.435  1.00 100.35 ? 304 GLU B CG  1 
ATOM   6695 C CD  . GLU B 2 304 ? 30.613  18.264  89.115  1.00 100.78 ? 304 GLU B CD  1 
ATOM   6696 O OE1 . GLU B 2 304 ? 31.060  18.785  88.070  1.00 100.78 ? 304 GLU B OE1 1 
ATOM   6697 O OE2 . GLU B 2 304 ? 29.660  17.452  89.122  1.00 100.78 ? 304 GLU B OE2 1 
ATOM   6698 N N   . VAL B 2 305 ? 33.292  18.625  92.704  1.00 98.96  ? 305 VAL B N   1 
ATOM   6699 C CA  . VAL B 2 305 ? 34.504  17.854  92.955  1.00 98.17  ? 305 VAL B CA  1 
ATOM   6700 C C   . VAL B 2 305 ? 34.450  16.487  92.279  1.00 97.79  ? 305 VAL B C   1 
ATOM   6701 O O   . VAL B 2 305 ? 33.375  15.922  92.067  1.00 97.08  ? 305 VAL B O   1 
ATOM   6702 C CB  . VAL B 2 305 ? 34.722  17.649  94.459  1.00 98.23  ? 305 VAL B CB  1 
ATOM   6703 C CG1 . VAL B 2 305 ? 36.101  17.053  94.711  1.00 97.82  ? 305 VAL B CG1 1 
ATOM   6704 C CG2 . VAL B 2 305 ? 34.553  18.970  95.192  1.00 98.37  ? 305 VAL B CG2 1 
ATOM   6705 N N   . LEU B 2 306 ? 35.623  15.962  91.940  1.00 97.69  ? 306 LEU B N   1 
ATOM   6706 C CA  . LEU B 2 306 ? 35.720  14.673  91.271  1.00 97.69  ? 306 LEU B CA  1 
ATOM   6707 C C   . LEU B 2 306 ? 36.077  13.545  92.218  1.00 97.33  ? 306 LEU B C   1 
ATOM   6708 O O   . LEU B 2 306 ? 36.891  13.715  93.124  1.00 97.04  ? 306 LEU B O   1 
ATOM   6709 C CB  . LEU B 2 306 ? 36.768  14.733  90.160  1.00 98.33  ? 306 LEU B CB  1 
ATOM   6710 C CG  . LEU B 2 306 ? 36.453  15.666  88.992  1.00 98.62  ? 306 LEU B CG  1 
ATOM   6711 C CD1 . LEU B 2 306 ? 37.560  15.583  87.954  1.00 98.51  ? 306 LEU B CD1 1 
ATOM   6712 C CD2 . LEU B 2 306 ? 35.119  15.273  88.379  1.00 98.89  ? 306 LEU B CD2 1 
ATOM   6713 N N   . LYS B 2 307 ? 35.464  12.389  91.993  1.00 97.05  ? 307 LYS B N   1 
ATOM   6714 C CA  . LYS B 2 307 ? 35.716  11.214  92.807  1.00 97.54  ? 307 LYS B CA  1 
ATOM   6715 C C   . LYS B 2 307 ? 37.210  10.948  92.948  1.00 97.71  ? 307 LYS B C   1 
ATOM   6716 O O   . LYS B 2 307 ? 37.702  10.756  94.056  1.00 98.13  ? 307 LYS B O   1 
ATOM   6717 C CB  . LYS B 2 307 ? 35.051  9.990   92.189  1.00 98.25  ? 307 LYS B CB  1 
ATOM   6718 C CG  . LYS B 2 307 ? 35.519  8.696   92.822  1.00 99.49  ? 307 LYS B CG  1 
ATOM   6719 C CD  . LYS B 2 307 ? 34.978  7.483   92.102  1.00 100.72 ? 307 LYS B CD  1 
ATOM   6720 C CE  . LYS B 2 307 ? 35.455  6.213   92.788  1.00 100.78 ? 307 LYS B CE  1 
ATOM   6721 N NZ  . LYS B 2 307 ? 34.852  4.999   92.182  1.00 100.78 ? 307 LYS B NZ  1 
ATOM   6722 N N   . GLU B 2 308 ? 37.927  10.917  91.826  1.00 97.91  ? 308 GLU B N   1 
ATOM   6723 C CA  . GLU B 2 308 ? 39.370  10.682  91.853  1.00 97.45  ? 308 GLU B CA  1 
ATOM   6724 C C   . GLU B 2 308 ? 40.025  11.629  92.852  1.00 96.23  ? 308 GLU B C   1 
ATOM   6725 O O   . GLU B 2 308 ? 41.054  11.306  93.449  1.00 95.57  ? 308 GLU B O   1 
ATOM   6726 C CB  . GLU B 2 308 ? 39.993  10.927  90.474  1.00 98.71  ? 308 GLU B CB  1 
ATOM   6727 C CG  . GLU B 2 308 ? 40.142  9.693   89.592  1.00 100.23 ? 308 GLU B CG  1 
ATOM   6728 C CD  . GLU B 2 308 ? 41.314  9.815   88.610  1.00 100.78 ? 308 GLU B CD  1 
ATOM   6729 O OE1 . GLU B 2 308 ? 42.474  9.934   89.080  1.00 100.78 ? 308 GLU B OE1 1 
ATOM   6730 O OE2 . GLU B 2 308 ? 41.078  9.789   87.375  1.00 100.78 ? 308 GLU B OE2 1 
ATOM   6731 N N   . ASP B 2 309 ? 39.413  12.800  93.021  1.00 95.36  ? 309 ASP B N   1 
ATOM   6732 C CA  . ASP B 2 309 ? 39.918  13.834  93.922  1.00 94.03  ? 309 ASP B CA  1 
ATOM   6733 C C   . ASP B 2 309 ? 39.130  13.982  95.227  1.00 92.07  ? 309 ASP B C   1 
ATOM   6734 O O   . ASP B 2 309 ? 38.847  15.103  95.664  1.00 92.34  ? 309 ASP B O   1 
ATOM   6735 C CB  . ASP B 2 309 ? 39.933  15.178  93.196  1.00 95.18  ? 309 ASP B CB  1 
ATOM   6736 C CG  . ASP B 2 309 ? 40.813  15.160  91.970  1.00 96.40  ? 309 ASP B CG  1 
ATOM   6737 O OD1 . ASP B 2 309 ? 42.035  14.942  92.128  1.00 97.23  ? 309 ASP B OD1 1 
ATOM   6738 O OD2 . ASP B 2 309 ? 40.285  15.360  90.853  1.00 96.96  ? 309 ASP B OD2 1 
ATOM   6739 N N   . ILE B 2 310 ? 38.774  12.858  95.844  1.00 88.49  ? 310 ILE B N   1 
ATOM   6740 C CA  . ILE B 2 310 ? 38.036  12.876  97.100  1.00 83.52  ? 310 ILE B CA  1 
ATOM   6741 C C   . ILE B 2 310 ? 38.533  11.794  98.031  1.00 81.83  ? 310 ILE B C   1 
ATOM   6742 O O   . ILE B 2 310 ? 38.566  10.623  97.667  1.00 82.04  ? 310 ILE B O   1 
ATOM   6743 C CB  . ILE B 2 310 ? 36.531  12.670  96.881  1.00 81.58  ? 310 ILE B CB  1 
ATOM   6744 C CG1 . ILE B 2 310 ? 35.874  14.010  96.557  1.00 80.29  ? 310 ILE B CG1 1 
ATOM   6745 C CG2 . ILE B 2 310 ? 35.903  12.044  98.115  1.00 81.51  ? 310 ILE B CG2 1 
ATOM   6746 C CD1 . ILE B 2 310 ? 34.369  13.955  96.490  1.00 79.57  ? 310 ILE B CD1 1 
ATOM   6747 N N   . ILE B 2 311 ? 38.923  12.196  99.234  1.00 79.81  ? 311 ILE B N   1 
ATOM   6748 C CA  . ILE B 2 311 ? 39.406  11.252  100.228 1.00 78.02  ? 311 ILE B CA  1 
ATOM   6749 C C   . ILE B 2 311 ? 38.473  11.258  101.426 1.00 77.23  ? 311 ILE B C   1 
ATOM   6750 O O   . ILE B 2 311 ? 37.554  12.077  101.517 1.00 76.63  ? 311 ILE B O   1 
ATOM   6751 C CB  . ILE B 2 311 ? 40.824  11.602  100.715 1.00 77.54  ? 311 ILE B CB  1 
ATOM   6752 C CG1 . ILE B 2 311 ? 40.871  13.063  101.158 1.00 77.66  ? 311 ILE B CG1 1 
ATOM   6753 C CG2 . ILE B 2 311 ? 41.836  11.339  99.613  1.00 77.89  ? 311 ILE B CG2 1 
ATOM   6754 C CD1 . ILE B 2 311 ? 42.209  13.485  101.718 1.00 77.85  ? 311 ILE B CD1 1 
ATOM   6755 N N   . GLN B 2 312 ? 38.706  10.329  102.341 1.00 76.44  ? 312 GLN B N   1 
ATOM   6756 C CA  . GLN B 2 312 ? 37.891  10.240  103.534 1.00 75.83  ? 312 GLN B CA  1 
ATOM   6757 C C   . GLN B 2 312 ? 38.743  10.693  104.698 1.00 73.60  ? 312 GLN B C   1 
ATOM   6758 O O   . GLN B 2 312 ? 39.905  11.059  104.527 1.00 73.13  ? 312 GLN B O   1 
ATOM   6759 C CB  . GLN B 2 312 ? 37.438  8.804   103.777 1.00 79.55  ? 312 GLN B CB  1 
ATOM   6760 C CG  . GLN B 2 312 ? 36.900  8.090   102.550 1.00 84.13  ? 312 GLN B CG  1 
ATOM   6761 C CD  . GLN B 2 312 ? 36.362  6.713   102.891 1.00 87.73  ? 312 GLN B CD  1 
ATOM   6762 O OE1 . GLN B 2 312 ? 36.981  5.962   103.657 1.00 89.80  ? 312 GLN B OE1 1 
ATOM   6763 N NE2 . GLN B 2 312 ? 35.208  6.371   102.323 1.00 88.79  ? 312 GLN B NE2 1 
ATOM   6764 N N   . GLY B 2 313 ? 38.158  10.651  105.885 1.00 71.13  ? 313 GLY B N   1 
ATOM   6765 C CA  . GLY B 2 313 ? 38.872  11.060  107.074 1.00 67.68  ? 313 GLY B CA  1 
ATOM   6766 C C   . GLY B 2 313 ? 37.855  11.382  108.138 1.00 65.15  ? 313 GLY B C   1 
ATOM   6767 O O   . GLY B 2 313 ? 36.739  11.794  107.818 1.00 64.82  ? 313 GLY B O   1 
ATOM   6768 N N   . PHE B 2 314 ? 38.226  11.209  109.401 1.00 62.61  ? 314 PHE B N   1 
ATOM   6769 C CA  . PHE B 2 314 ? 37.285  11.481  110.475 1.00 60.68  ? 314 PHE B CA  1 
ATOM   6770 C C   . PHE B 2 314 ? 37.577  12.756  111.212 1.00 58.33  ? 314 PHE B C   1 
ATOM   6771 O O   . PHE B 2 314 ? 38.650  13.340  111.084 1.00 58.02  ? 314 PHE B O   1 
ATOM   6772 C CB  . PHE B 2 314 ? 37.266  10.341  111.486 1.00 61.31  ? 314 PHE B CB  1 
ATOM   6773 C CG  . PHE B 2 314 ? 37.130  8.998   110.862 1.00 61.28  ? 314 PHE B CG  1 
ATOM   6774 C CD1 . PHE B 2 314 ? 38.232  8.368   110.303 1.00 59.98  ? 314 PHE B CD1 1 
ATOM   6775 C CD2 . PHE B 2 314 ? 35.900  8.360   110.829 1.00 61.72  ? 314 PHE B CD2 1 
ATOM   6776 C CE1 . PHE B 2 314 ? 38.110  7.127   109.714 1.00 59.65  ? 314 PHE B CE1 1 
ATOM   6777 C CE2 . PHE B 2 314 ? 35.770  7.115   110.240 1.00 61.65  ? 314 PHE B CE2 1 
ATOM   6778 C CZ  . PHE B 2 314 ? 36.881  6.494   109.685 1.00 60.54  ? 314 PHE B CZ  1 
ATOM   6779 N N   . ARG B 2 315 ? 36.596  13.176  111.995 1.00 56.56  ? 315 ARG B N   1 
ATOM   6780 C CA  . ARG B 2 315 ? 36.726  14.377  112.785 1.00 55.04  ? 315 ARG B CA  1 
ATOM   6781 C C   . ARG B 2 315 ? 37.237  13.964  114.151 1.00 53.36  ? 315 ARG B C   1 
ATOM   6782 O O   . ARG B 2 315 ? 37.093  12.813  114.560 1.00 53.28  ? 315 ARG B O   1 
ATOM   6783 C CB  . ARG B 2 315 ? 35.371  15.057  112.963 1.00 55.62  ? 315 ARG B CB  1 
ATOM   6784 C CG  . ARG B 2 315 ? 34.652  15.433  111.681 1.00 58.76  ? 315 ARG B CG  1 
ATOM   6785 C CD  . ARG B 2 315 ? 33.454  16.304  112.014 1.00 61.48  ? 315 ARG B CD  1 
ATOM   6786 N NE  . ARG B 2 315 ? 33.894  17.488  112.745 1.00 63.82  ? 315 ARG B NE  1 
ATOM   6787 C CZ  . ARG B 2 315 ? 34.307  18.609  112.162 1.00 64.50  ? 315 ARG B CZ  1 
ATOM   6788 N NH1 . ARG B 2 315 ? 34.320  18.703  110.835 1.00 62.97  ? 315 ARG B NH1 1 
ATOM   6789 N NH2 . ARG B 2 315 ? 34.729  19.626  112.906 1.00 65.20  ? 315 ARG B NH2 1 
ATOM   6790 N N   . TYR B 2 316 ? 37.859  14.908  114.838 1.00 50.90  ? 316 TYR B N   1 
ATOM   6791 C CA  . TYR B 2 316 ? 38.350  14.699  116.188 1.00 47.60  ? 316 TYR B CA  1 
ATOM   6792 C C   . TYR B 2 316 ? 38.232  16.094  116.773 1.00 45.39  ? 316 TYR B C   1 
ATOM   6793 O O   . TYR B 2 316 ? 39.211  16.834  116.869 1.00 45.10  ? 316 TYR B O   1 
ATOM   6794 C CB  . TYR B 2 316 ? 39.807  14.234  116.207 1.00 46.40  ? 316 TYR B CB  1 
ATOM   6795 C CG  . TYR B 2 316 ? 40.248  13.806  117.589 1.00 45.10  ? 316 TYR B CG  1 
ATOM   6796 C CD1 . TYR B 2 316 ? 39.780  12.625  118.149 1.00 43.94  ? 316 TYR B CD1 1 
ATOM   6797 C CD2 . TYR B 2 316 ? 41.092  14.606  118.355 1.00 45.17  ? 316 TYR B CD2 1 
ATOM   6798 C CE1 . TYR B 2 316 ? 40.131  12.247  119.428 1.00 43.97  ? 316 TYR B CE1 1 
ATOM   6799 C CE2 . TYR B 2 316 ? 41.451  14.235  119.642 1.00 45.45  ? 316 TYR B CE2 1 
ATOM   6800 C CZ  . TYR B 2 316 ? 40.966  13.051  120.173 1.00 44.68  ? 316 TYR B CZ  1 
ATOM   6801 O OH  . TYR B 2 316 ? 41.312  12.663  121.447 1.00 44.64  ? 316 TYR B OH  1 
ATOM   6802 N N   . GLY B 2 317 ? 37.010  16.450  117.141 1.00 43.05  ? 317 GLY B N   1 
ATOM   6803 C CA  . GLY B 2 317 ? 36.773  17.771  117.668 1.00 42.54  ? 317 GLY B CA  1 
ATOM   6804 C C   . GLY B 2 317 ? 36.868  18.727  116.503 1.00 41.54  ? 317 GLY B C   1 
ATOM   6805 O O   . GLY B 2 317 ? 36.250  18.511  115.463 1.00 42.77  ? 317 GLY B O   1 
ATOM   6806 N N   . SER B 2 318 ? 37.657  19.777  116.664 1.00 40.40  ? 318 SER B N   1 
ATOM   6807 C CA  . SER B 2 318 ? 37.816  20.760  115.610 1.00 39.91  ? 318 SER B CA  1 
ATOM   6808 C C   . SER B 2 318 ? 38.773  20.211  114.568 1.00 41.62  ? 318 SER B C   1 
ATOM   6809 O O   . SER B 2 318 ? 38.843  20.712  113.450 1.00 41.86  ? 318 SER B O   1 
ATOM   6810 C CB  . SER B 2 318 ? 38.379  22.062  116.178 1.00 37.04  ? 318 SER B CB  1 
ATOM   6811 O OG  . SER B 2 318 ? 39.705  21.888  116.643 1.00 35.13  ? 318 SER B OG  1 
ATOM   6812 N N   . ASP B 2 319 ? 39.513  19.178  114.947 1.00 43.18  ? 319 ASP B N   1 
ATOM   6813 C CA  . ASP B 2 319 ? 40.480  18.577  114.047 1.00 44.74  ? 319 ASP B CA  1 
ATOM   6814 C C   . ASP B 2 319 ? 39.801  17.753  112.979 1.00 45.83  ? 319 ASP B C   1 
ATOM   6815 O O   . ASP B 2 319 ? 38.696  17.247  113.169 1.00 46.58  ? 319 ASP B O   1 
ATOM   6816 C CB  . ASP B 2 319 ? 41.453  17.695  114.830 1.00 45.48  ? 319 ASP B CB  1 
ATOM   6817 C CG  . ASP B 2 319 ? 42.281  18.485  115.814 1.00 46.58  ? 319 ASP B CG  1 
ATOM   6818 O OD1 . ASP B 2 319 ? 42.799  17.895  116.783 1.00 48.74  ? 319 ASP B OD1 1 
ATOM   6819 O OD2 . ASP B 2 319 ? 42.418  19.705  115.614 1.00 48.40  ? 319 ASP B OD2 1 
ATOM   6820 N N   . ILE B 2 320 ? 40.475  17.644  111.842 1.00 47.16  ? 320 ILE B N   1 
ATOM   6821 C CA  . ILE B 2 320 ? 39.993  16.868  110.708 1.00 48.22  ? 320 ILE B CA  1 
ATOM   6822 C C   . ILE B 2 320 ? 41.164  16.019  110.287 1.00 50.14  ? 320 ILE B C   1 
ATOM   6823 O O   . ILE B 2 320 ? 42.192  16.538  109.853 1.00 50.45  ? 320 ILE B O   1 
ATOM   6824 C CB  . ILE B 2 320 ? 39.576  17.767  109.544 1.00 46.48  ? 320 ILE B CB  1 
ATOM   6825 C CG1 . ILE B 2 320 ? 38.130  18.229  109.728 1.00 46.02  ? 320 ILE B CG1 1 
ATOM   6826 C CG2 . ILE B 2 320 ? 39.744  17.028  108.246 1.00 46.58  ? 320 ILE B CG2 1 
ATOM   6827 C CD1 . ILE B 2 320 ? 37.722  19.320  108.753 1.00 48.38  ? 320 ILE B CD1 1 
ATOM   6828 N N   . VAL B 2 321 ? 41.008  14.711  110.411 1.00 53.38  ? 321 VAL B N   1 
ATOM   6829 C CA  . VAL B 2 321 ? 42.090  13.809  110.090 1.00 57.33  ? 321 VAL B CA  1 
ATOM   6830 C C   . VAL B 2 321 ? 41.766  12.986  108.860 1.00 60.58  ? 321 VAL B C   1 
ATOM   6831 O O   . VAL B 2 321 ? 40.776  12.272  108.831 1.00 60.30  ? 321 VAL B O   1 
ATOM   6832 C CB  . VAL B 2 321 ? 42.340  12.848  111.263 1.00 56.67  ? 321 VAL B CB  1 
ATOM   6833 C CG1 . VAL B 2 321 ? 43.789  12.414  111.284 1.00 57.49  ? 321 VAL B CG1 1 
ATOM   6834 C CG2 . VAL B 2 321 ? 41.936  13.515  112.576 1.00 56.28  ? 321 VAL B CG2 1 
ATOM   6835 N N   . PRO B 2 322 ? 42.596  13.083  107.818 1.00 64.28  ? 322 PRO B N   1 
ATOM   6836 C CA  . PRO B 2 322 ? 42.331  12.299  106.608 1.00 68.11  ? 322 PRO B CA  1 
ATOM   6837 C C   . PRO B 2 322 ? 42.722  10.828  106.850 1.00 70.94  ? 322 PRO B C   1 
ATOM   6838 O O   . PRO B 2 322 ? 43.910  10.466  106.837 1.00 70.99  ? 322 PRO B O   1 
ATOM   6839 C CB  . PRO B 2 322 ? 43.178  13.010  105.556 1.00 66.81  ? 322 PRO B CB  1 
ATOM   6840 C CG  . PRO B 2 322 ? 44.342  13.552  106.361 1.00 65.46  ? 322 PRO B CG  1 
ATOM   6841 C CD  . PRO B 2 322 ? 43.708  14.035  107.629 1.00 65.08  ? 322 PRO B CD  1 
ATOM   6842 N N   . PHE B 2 323 ? 41.707  10.001  107.101 1.00 74.03  ? 323 PHE B N   1 
ATOM   6843 C CA  . PHE B 2 323 ? 41.887  8.578   107.386 1.00 76.07  ? 323 PHE B CA  1 
ATOM   6844 C C   . PHE B 2 323 ? 41.291  7.796   106.187 1.00 75.60  ? 323 PHE B C   1 
ATOM   6845 O O   . PHE B 2 323 ? 40.125  7.344   106.231 1.00 75.01  ? 323 PHE B O   1 
ATOM   6846 C CB  . PHE B 2 323 ? 41.114  8.238   108.698 1.00 79.10  ? 323 PHE B CB  1 
ATOM   6847 C CG  . PHE B 2 323 ? 41.739  7.148   109.552 1.00 81.87  ? 323 PHE B CG  1 
ATOM   6848 C CD1 . PHE B 2 323 ? 41.094  6.721   110.703 1.00 83.46  ? 323 PHE B CD1 1 
ATOM   6849 C CD2 . PHE B 2 323 ? 42.961  6.556   109.224 1.00 83.63  ? 323 PHE B CD2 1 
ATOM   6850 C CE1 . PHE B 2 323 ? 41.642  5.746   111.521 1.00 83.20  ? 323 PHE B CE1 1 
ATOM   6851 C CE2 . PHE B 2 323 ? 43.506  5.567   110.064 1.00 83.68  ? 323 PHE B CE2 1 
ATOM   6852 C CZ  . PHE B 2 323 ? 42.831  5.172   111.203 1.00 83.06  ? 323 PHE B CZ  1 
ATOM   6853 N N   . ASP B 2 327 ? 48.891  1.871   106.659 1.00 96.25  ? 327 ASP B N   1 
ATOM   6854 C CA  . ASP B 2 327 ? 49.111  2.242   108.047 1.00 95.74  ? 327 ASP B CA  1 
ATOM   6855 C C   . ASP B 2 327 ? 47.828  2.763   108.653 1.00 94.98  ? 327 ASP B C   1 
ATOM   6856 O O   . ASP B 2 327 ? 47.813  3.125   109.825 1.00 94.46  ? 327 ASP B O   1 
ATOM   6857 C CB  . ASP B 2 327 ? 50.123  3.362   108.139 1.00 97.26  ? 327 ASP B CB  1 
ATOM   6858 C CG  . ASP B 2 327 ? 51.475  2.941   107.627 1.00 99.17  ? 327 ASP B CG  1 
ATOM   6859 O OD1 . ASP B 2 327 ? 52.066  2.021   108.244 1.00 100.76 ? 327 ASP B OD1 1 
ATOM   6860 O OD2 . ASP B 2 327 ? 51.956  3.480   106.610 1.00 99.98  ? 327 ASP B OD2 1 
ATOM   6861 N N   . GLU B 2 328 ? 46.737  2.768   107.890 1.00 94.44  ? 328 GLU B N   1 
ATOM   6862 C CA  . GLU B 2 328 ? 45.502  3.330   108.428 1.00 93.13  ? 328 GLU B CA  1 
ATOM   6863 C C   . GLU B 2 328 ? 44.355  2.403   108.854 1.00 93.21  ? 328 GLU B C   1 
ATOM   6864 O O   . GLU B 2 328 ? 44.222  2.119   110.042 1.00 93.42  ? 328 GLU B O   1 
ATOM   6865 C CB  . GLU B 2 328 ? 45.055  4.446   107.482 1.00 92.00  ? 328 GLU B CB  1 
ATOM   6866 C CG  . GLU B 2 328 ? 46.206  5.431   107.244 1.00 90.11  ? 328 GLU B CG  1 
ATOM   6867 C CD  . GLU B 2 328 ? 45.777  6.837   106.887 1.00 89.52  ? 328 GLU B CD  1 
ATOM   6868 O OE1 . GLU B 2 328 ? 44.900  7.052   106.010 1.00 88.39  ? 328 GLU B OE1 1 
ATOM   6869 O OE2 . GLU B 2 328 ? 46.361  7.740   107.506 1.00 88.44  ? 328 GLU B OE2 1 
ATOM   6870 N N   . GLU B 2 329 ? 43.537  1.917   107.922 1.00 93.07  ? 329 GLU B N   1 
ATOM   6871 C CA  . GLU B 2 329 ? 42.448  1.008   108.315 1.00 91.79  ? 329 GLU B CA  1 
ATOM   6872 C C   . GLU B 2 329 ? 43.109  -0.103  109.173 1.00 89.93  ? 329 GLU B C   1 
ATOM   6873 O O   . GLU B 2 329 ? 42.460  -0.759  109.999 1.00 89.66  ? 329 GLU B O   1 
ATOM   6874 C CB  . GLU B 2 329 ? 41.724  0.385   107.078 1.00 93.76  ? 329 GLU B CB  1 
ATOM   6875 C CG  . GLU B 2 329 ? 40.774  1.288   106.229 1.00 95.18  ? 329 GLU B CG  1 
ATOM   6876 C CD  . GLU B 2 329 ? 40.374  2.606   106.886 1.00 97.36  ? 329 GLU B CD  1 
ATOM   6877 O OE1 . GLU B 2 329 ? 39.917  2.527   108.039 1.00 98.26  ? 329 GLU B OE1 1 
ATOM   6878 O OE2 . GLU B 2 329 ? 40.515  3.700   106.271 1.00 97.61  ? 329 GLU B OE2 1 
ATOM   6879 N N   . GLN B 2 330 ? 44.397  -0.327  108.922 1.00 88.05  ? 330 GLN B N   1 
ATOM   6880 C CA  . GLN B 2 330 ? 45.208  -1.333  109.579 1.00 86.78  ? 330 GLN B CA  1 
ATOM   6881 C C   . GLN B 2 330 ? 45.408  -1.019  111.037 1.00 85.03  ? 330 GLN B C   1 
ATOM   6882 O O   . GLN B 2 330 ? 46.224  -1.633  111.698 1.00 84.70  ? 330 GLN B O   1 
ATOM   6883 C CB  . GLN B 2 330 ? 46.543  -1.396  108.847 1.00 88.64  ? 330 GLN B CB  1 
ATOM   6884 C CG  . GLN B 2 330 ? 46.545  -0.536  107.611 1.00 91.56  ? 330 GLN B CG  1 
ATOM   6885 C CD  . GLN B 2 330 ? 47.756  -0.683  106.739 1.00 93.00  ? 330 GLN B CD  1 
ATOM   6886 O OE1 . GLN B 2 330 ? 48.890  -0.637  107.218 1.00 93.82  ? 330 GLN B OE1 1 
ATOM   6887 N NE2 . GLN B 2 330 ? 47.525  -0.820  105.429 1.00 93.32  ? 330 GLN B NE2 1 
ATOM   6888 N N   . MET B 2 331 ? 44.661  -0.034  111.522 1.00 84.10  ? 331 MET B N   1 
ATOM   6889 C CA  . MET B 2 331 ? 44.704  0.390   112.922 1.00 82.48  ? 331 MET B CA  1 
ATOM   6890 C C   . MET B 2 331 ? 43.340  0.152   113.579 1.00 81.53  ? 331 MET B C   1 
ATOM   6891 O O   . MET B 2 331 ? 43.026  0.743   114.610 1.00 82.07  ? 331 MET B O   1 
ATOM   6892 C CB  . MET B 2 331 ? 45.073  1.890   113.042 1.00 83.30  ? 331 MET B CB  1 
ATOM   6893 C CG  . MET B 2 331 ? 46.438  2.294   112.479 1.00 84.20  ? 331 MET B CG  1 
ATOM   6894 S SD  . MET B 2 331 ? 47.056  3.864   113.167 1.00 85.55  ? 331 MET B SD  1 
ATOM   6895 C CE  . MET B 2 331 ? 46.418  4.986   112.038 1.00 84.49  ? 331 MET B CE  1 
ATOM   6896 N N   . LYS B 2 332 ? 42.523  -0.696  112.960 1.00 80.28  ? 332 LYS B N   1 
ATOM   6897 C CA  . LYS B 2 332 ? 41.201  -1.011  113.497 1.00 78.32  ? 332 LYS B CA  1 
ATOM   6898 C C   . LYS B 2 332 ? 41.354  -2.009  114.636 1.00 76.81  ? 332 LYS B C   1 
ATOM   6899 O O   . LYS B 2 332 ? 42.330  -2.760  114.681 1.00 76.19  ? 332 LYS B O   1 
ATOM   6900 C CB  . LYS B 2 332 ? 40.289  -1.619  112.419 1.00 80.17  ? 332 LYS B CB  1 
ATOM   6901 C CG  . LYS B 2 332 ? 38.975  -2.160  112.980 1.00 82.43  ? 332 LYS B CG  1 
ATOM   6902 C CD  . LYS B 2 332 ? 38.145  -2.898  111.942 1.00 84.48  ? 332 LYS B CD  1 
ATOM   6903 C CE  . LYS B 2 332 ? 36.960  -3.583  112.623 1.00 86.45  ? 332 LYS B CE  1 
ATOM   6904 N NZ  . LYS B 2 332 ? 35.991  -4.231  111.686 1.00 87.38  ? 332 LYS B NZ  1 
ATOM   6905 N N   . TYR B 2 333 ? 40.390  -2.008  115.552 1.00 74.69  ? 333 TYR B N   1 
ATOM   6906 C CA  . TYR B 2 333 ? 40.397  -2.912  116.693 1.00 72.50  ? 333 TYR B CA  1 
ATOM   6907 C C   . TYR B 2 333 ? 40.592  -4.364  116.260 1.00 72.20  ? 333 TYR B C   1 
ATOM   6908 O O   . TYR B 2 333 ? 40.021  -4.810  115.262 1.00 72.10  ? 333 TYR B O   1 
ATOM   6909 C CB  . TYR B 2 333 ? 39.073  -2.782  117.445 1.00 70.90  ? 333 TYR B CB  1 
ATOM   6910 C CG  . TYR B 2 333 ? 38.920  -3.746  118.595 1.00 68.68  ? 333 TYR B CG  1 
ATOM   6911 C CD1 . TYR B 2 333 ? 39.659  -3.585  119.762 1.00 67.40  ? 333 TYR B CD1 1 
ATOM   6912 C CD2 . TYR B 2 333 ? 38.035  -4.822  118.516 1.00 67.93  ? 333 TYR B CD2 1 
ATOM   6913 C CE1 . TYR B 2 333 ? 39.522  -4.461  120.819 1.00 66.55  ? 333 TYR B CE1 1 
ATOM   6914 C CE2 . TYR B 2 333 ? 37.893  -5.706  119.570 1.00 67.22  ? 333 TYR B CE2 1 
ATOM   6915 C CZ  . TYR B 2 333 ? 38.639  -5.518  120.719 1.00 67.07  ? 333 TYR B CZ  1 
ATOM   6916 O OH  . TYR B 2 333 ? 38.497  -6.390  121.770 1.00 67.72  ? 333 TYR B OH  1 
ATOM   6917 N N   . LYS B 2 334 ? 41.399  -5.096  117.021 1.00 70.87  ? 334 LYS B N   1 
ATOM   6918 C CA  . LYS B 2 334 ? 41.649  -6.494  116.729 1.00 69.54  ? 334 LYS B CA  1 
ATOM   6919 C C   . LYS B 2 334 ? 41.087  -7.373  117.820 1.00 67.45  ? 334 LYS B C   1 
ATOM   6920 O O   . LYS B 2 334 ? 41.576  -7.374  118.946 1.00 66.42  ? 334 LYS B O   1 
ATOM   6921 C CB  . LYS B 2 334 ? 43.146  -6.750  116.570 1.00 71.84  ? 334 LYS B CB  1 
ATOM   6922 C CG  . LYS B 2 334 ? 43.666  -6.270  115.227 1.00 75.62  ? 334 LYS B CG  1 
ATOM   6923 C CD  . LYS B 2 334 ? 45.087  -6.729  114.925 1.00 77.59  ? 334 LYS B CD  1 
ATOM   6924 C CE  . LYS B 2 334 ? 45.410  -6.469  113.450 1.00 78.25  ? 334 LYS B CE  1 
ATOM   6925 N NZ  . LYS B 2 334 ? 46.786  -6.883  113.064 1.00 79.44  ? 334 LYS B NZ  1 
ATOM   6926 N N   . SER B 2 335 ? 40.051  -8.124  117.475 1.00 66.22  ? 335 SER B N   1 
ATOM   6927 C CA  . SER B 2 335 ? 39.411  -9.016  118.432 1.00 66.33  ? 335 SER B CA  1 
ATOM   6928 C C   . SER B 2 335 ? 39.850  -10.465 118.250 1.00 65.09  ? 335 SER B C   1 
ATOM   6929 O O   . SER B 2 335 ? 40.033  -10.940 117.127 1.00 64.04  ? 335 SER B O   1 
ATOM   6930 C CB  . SER B 2 335 ? 37.886  -8.950  118.286 1.00 67.73  ? 335 SER B CB  1 
ATOM   6931 O OG  . SER B 2 335 ? 37.454  -9.671  117.139 1.00 67.74  ? 335 SER B OG  1 
ATOM   6932 N N   . GLU B 2 336 ? 40.004  -11.172 119.362 1.00 63.94  ? 336 GLU B N   1 
ATOM   6933 C CA  . GLU B 2 336 ? 40.389  -12.571 119.298 1.00 63.23  ? 336 GLU B CA  1 
ATOM   6934 C C   . GLU B 2 336 ? 39.263  -13.395 118.664 1.00 59.88  ? 336 GLU B C   1 
ATOM   6935 O O   . GLU B 2 336 ? 39.362  -14.616 118.571 1.00 59.92  ? 336 GLU B O   1 
ATOM   6936 C CB  . GLU B 2 336 ? 40.707  -13.104 120.702 1.00 66.93  ? 336 GLU B CB  1 
ATOM   6937 C CG  . GLU B 2 336 ? 42.011  -12.581 121.303 1.00 71.70  ? 336 GLU B CG  1 
ATOM   6938 C CD  . GLU B 2 336 ? 41.795  -11.490 122.346 1.00 74.87  ? 336 GLU B CD  1 
ATOM   6939 O OE1 . GLU B 2 336 ? 41.187  -10.443 122.011 1.00 76.13  ? 336 GLU B OE1 1 
ATOM   6940 O OE2 . GLU B 2 336 ? 42.238  -11.686 123.502 1.00 75.97  ? 336 GLU B OE2 1 
ATOM   6941 N N   . GLY B 2 337 ? 38.198  -12.716 118.235 1.00 56.01  ? 337 GLY B N   1 
ATOM   6942 C CA  . GLY B 2 337 ? 37.067  -13.383 117.608 1.00 50.64  ? 337 GLY B CA  1 
ATOM   6943 C C   . GLY B 2 337 ? 35.948  -13.838 118.538 1.00 48.11  ? 337 GLY B C   1 
ATOM   6944 O O   . GLY B 2 337 ? 35.829  -13.391 119.682 1.00 48.19  ? 337 GLY B O   1 
ATOM   6945 N N   . LYS B 2 338 ? 35.127  -14.748 118.026 1.00 44.57  ? 338 LYS B N   1 
ATOM   6946 C CA  . LYS B 2 338 ? 33.984  -15.325 118.739 1.00 40.41  ? 338 LYS B CA  1 
ATOM   6947 C C   . LYS B 2 338 ? 34.268  -15.704 120.194 1.00 37.43  ? 338 LYS B C   1 
ATOM   6948 O O   . LYS B 2 338 ? 35.331  -16.238 120.504 1.00 34.72  ? 338 LYS B O   1 
ATOM   6949 C CB  . LYS B 2 338 ? 33.521  -16.558 117.967 1.00 42.33  ? 338 LYS B CB  1 
ATOM   6950 C CG  . LYS B 2 338 ? 32.282  -17.254 118.472 1.00 42.84  ? 338 LYS B CG  1 
ATOM   6951 C CD  . LYS B 2 338 ? 32.064  -18.495 117.620 1.00 44.03  ? 338 LYS B CD  1 
ATOM   6952 C CE  . LYS B 2 338 ? 30.704  -19.121 117.855 1.00 46.80  ? 338 LYS B CE  1 
ATOM   6953 N NZ  . LYS B 2 338 ? 30.492  -20.306 116.973 1.00 48.32  ? 338 LYS B NZ  1 
ATOM   6954 N N   . CYS B 2 339 ? 33.308  -15.435 121.081 1.00 35.55  ? 339 CYS B N   1 
ATOM   6955 C CA  . CYS B 2 339 ? 33.472  -15.760 122.496 1.00 32.99  ? 339 CYS B CA  1 
ATOM   6956 C C   . CYS B 2 339 ? 32.241  -15.548 123.374 1.00 30.86  ? 339 CYS B C   1 
ATOM   6957 O O   . CYS B 2 339 ? 31.235  -14.983 122.958 1.00 30.42  ? 339 CYS B O   1 
ATOM   6958 C CB  . CYS B 2 339 ? 34.641  -14.972 123.097 1.00 34.53  ? 339 CYS B CB  1 
ATOM   6959 S SG  . CYS B 2 339 ? 34.260  -13.293 123.679 1.00 38.72  ? 339 CYS B SG  1 
ATOM   6960 N N   . PHE B 2 340 ? 32.353  -16.026 124.606 1.00 28.66  ? 340 PHE B N   1 
ATOM   6961 C CA  . PHE B 2 340 ? 31.316  -15.921 125.616 1.00 24.57  ? 340 PHE B CA  1 
ATOM   6962 C C   . PHE B 2 340 ? 32.053  -16.232 126.914 1.00 23.99  ? 340 PHE B C   1 
ATOM   6963 O O   . PHE B 2 340 ? 31.781  -17.230 127.572 1.00 22.00  ? 340 PHE B O   1 
ATOM   6964 C CB  . PHE B 2 340 ? 30.235  -16.965 125.376 1.00 24.39  ? 340 PHE B CB  1 
ATOM   6965 C CG  . PHE B 2 340 ? 28.979  -16.724 126.160 1.00 24.55  ? 340 PHE B CG  1 
ATOM   6966 C CD1 . PHE B 2 340 ? 27.940  -15.986 125.617 1.00 24.16  ? 340 PHE B CD1 1 
ATOM   6967 C CD2 . PHE B 2 340 ? 28.850  -17.210 127.454 1.00 23.85  ? 340 PHE B CD2 1 
ATOM   6968 C CE1 . PHE B 2 340 ? 26.793  -15.740 126.343 1.00 23.86  ? 340 PHE B CE1 1 
ATOM   6969 C CE2 . PHE B 2 340 ? 27.711  -16.971 128.188 1.00 22.31  ? 340 PHE B CE2 1 
ATOM   6970 C CZ  . PHE B 2 340 ? 26.678  -16.232 127.632 1.00 25.44  ? 340 PHE B CZ  1 
ATOM   6971 N N   . SER B 2 341 ? 33.007  -15.377 127.260 1.00 24.03  ? 341 SER B N   1 
ATOM   6972 C CA  . SER B 2 341 ? 33.823  -15.561 128.451 1.00 23.85  ? 341 SER B CA  1 
ATOM   6973 C C   . SER B 2 341 ? 33.340  -14.788 129.686 1.00 25.99  ? 341 SER B C   1 
ATOM   6974 O O   . SER B 2 341 ? 32.911  -13.646 129.589 1.00 28.74  ? 341 SER B O   1 
ATOM   6975 C CB  . SER B 2 341 ? 35.261  -15.188 128.111 1.00 23.57  ? 341 SER B CB  1 
ATOM   6976 O OG  . SER B 2 341 ? 35.304  -14.251 127.046 1.00 22.39  ? 341 SER B OG  1 
ATOM   6977 N N   . VAL B 2 342 ? 33.407  -15.423 130.852 1.00 26.49  ? 342 VAL B N   1 
ATOM   6978 C CA  . VAL B 2 342 ? 32.964  -14.793 132.098 1.00 26.29  ? 342 VAL B CA  1 
ATOM   6979 C C   . VAL B 2 342 ? 33.977  -13.802 132.676 1.00 27.41  ? 342 VAL B C   1 
ATOM   6980 O O   . VAL B 2 342 ? 35.176  -14.088 132.760 1.00 27.99  ? 342 VAL B O   1 
ATOM   6981 C CB  . VAL B 2 342 ? 32.661  -15.853 133.192 1.00 25.53  ? 342 VAL B CB  1 
ATOM   6982 C CG1 . VAL B 2 342 ? 32.170  -15.168 134.448 1.00 23.41  ? 342 VAL B CG1 1 
ATOM   6983 C CG2 . VAL B 2 342 ? 31.620  -16.848 132.690 1.00 25.30  ? 342 VAL B CG2 1 
ATOM   6984 N N   . LEU B 2 343 ? 33.484  -12.635 133.071 1.00 26.28  ? 343 LEU B N   1 
ATOM   6985 C CA  . LEU B 2 343 ? 34.332  -11.627 133.663 1.00 25.07  ? 343 LEU B CA  1 
ATOM   6986 C C   . LEU B 2 343 ? 34.291  -11.792 135.164 1.00 24.57  ? 343 LEU B C   1 
ATOM   6987 O O   . LEU B 2 343 ? 35.307  -11.684 135.833 1.00 25.59  ? 343 LEU B O   1 
ATOM   6988 C CB  . LEU B 2 343 ? 33.841  -10.237 133.292 1.00 26.69  ? 343 LEU B CB  1 
ATOM   6989 C CG  . LEU B 2 343 ? 34.057  -9.846  131.834 1.00 29.47  ? 343 LEU B CG  1 
ATOM   6990 C CD1 . LEU B 2 343 ? 33.700  -8.370  131.650 1.00 31.14  ? 343 LEU B CD1 1 
ATOM   6991 C CD2 . LEU B 2 343 ? 35.509  -10.093 131.457 1.00 30.27  ? 343 LEU B CD2 1 
ATOM   6992 N N   . GLY B 2 344 ? 33.099  -12.060 135.680 1.00 23.68  ? 344 GLY B N   1 
ATOM   6993 C CA  . GLY B 2 344 ? 32.911  -12.229 137.107 1.00 23.15  ? 344 GLY B CA  1 
ATOM   6994 C C   . GLY B 2 344 ? 31.435  -12.387 137.416 1.00 24.65  ? 344 GLY B C   1 
ATOM   6995 O O   . GLY B 2 344 ? 30.613  -12.453 136.501 1.00 25.97  ? 344 GLY B O   1 
ATOM   6996 N N   . PHE B 2 345 ? 31.085  -12.450 138.698 1.00 24.34  ? 345 PHE B N   1 
ATOM   6997 C CA  . PHE B 2 345 ? 29.691  -12.615 139.099 1.00 24.29  ? 345 PHE B CA  1 
ATOM   6998 C C   . PHE B 2 345 ? 29.341  -11.495 140.047 1.00 24.48  ? 345 PHE B C   1 
ATOM   6999 O O   . PHE B 2 345 ? 30.228  -10.810 140.523 1.00 24.95  ? 345 PHE B O   1 
ATOM   7000 C CB  . PHE B 2 345 ? 29.496  -13.973 139.784 1.00 24.62  ? 345 PHE B CB  1 
ATOM   7001 C CG  . PHE B 2 345 ? 29.953  -15.138 138.952 1.00 25.79  ? 345 PHE B CG  1 
ATOM   7002 C CD1 . PHE B 2 345 ? 31.302  -15.424 138.823 1.00 25.55  ? 345 PHE B CD1 1 
ATOM   7003 C CD2 . PHE B 2 345 ? 29.036  -15.909 138.245 1.00 25.69  ? 345 PHE B CD2 1 
ATOM   7004 C CE1 . PHE B 2 345 ? 31.727  -16.455 138.015 1.00 27.05  ? 345 PHE B CE1 1 
ATOM   7005 C CE2 . PHE B 2 345 ? 29.453  -16.948 137.428 1.00 24.28  ? 345 PHE B CE2 1 
ATOM   7006 C CZ  . PHE B 2 345 ? 30.794  -17.218 137.308 1.00 26.51  ? 345 PHE B CZ  1 
ATOM   7007 N N   . CYS B 2 346 ? 28.061  -11.289 140.318 1.00 24.96  ? 346 CYS B N   1 
ATOM   7008 C CA  . CYS B 2 346 ? 27.689  -10.220 141.230 1.00 26.91  ? 346 CYS B CA  1 
ATOM   7009 C C   . CYS B 2 346 ? 26.220  -10.254 141.567 1.00 27.50  ? 346 CYS B C   1 
ATOM   7010 O O   . CYS B 2 346 ? 25.442  -10.914 140.883 1.00 26.00  ? 346 CYS B O   1 
ATOM   7011 C CB  . CYS B 2 346 ? 28.048  -8.854  140.634 1.00 28.71  ? 346 CYS B CB  1 
ATOM   7012 S SG  . CYS B 2 346 ? 27.180  -8.469  139.115 1.00 30.29  ? 346 CYS B SG  1 
ATOM   7013 N N   . LYS B 2 347 ? 25.859  -9.539  142.632 1.00 29.12  ? 347 LYS B N   1 
ATOM   7014 C CA  . LYS B 2 347 ? 24.480  -9.482  143.091 1.00 31.35  ? 347 LYS B CA  1 
ATOM   7015 C C   . LYS B 2 347 ? 23.594  -9.056  141.947 1.00 31.22  ? 347 LYS B C   1 
ATOM   7016 O O   . LYS B 2 347 ? 23.911  -8.103  141.232 1.00 30.78  ? 347 LYS B O   1 
ATOM   7017 C CB  . LYS B 2 347 ? 24.331  -8.485  144.231 1.00 35.63  ? 347 LYS B CB  1 
ATOM   7018 C CG  . LYS B 2 347 ? 25.186  -8.782  145.425 1.00 40.21  ? 347 LYS B CG  1 
ATOM   7019 C CD  . LYS B 2 347 ? 24.731  -7.958  146.619 1.00 43.72  ? 347 LYS B CD  1 
ATOM   7020 C CE  . LYS B 2 347 ? 25.550  -8.340  147.843 1.00 47.17  ? 347 LYS B CE  1 
ATOM   7021 N NZ  . LYS B 2 347 ? 25.024  -7.749  149.102 1.00 49.98  ? 347 LYS B NZ  1 
ATOM   7022 N N   . SER B 2 348 ? 22.478  -9.755  141.777 1.00 29.89  ? 348 SER B N   1 
ATOM   7023 C CA  . SER B 2 348 ? 21.581  -9.431  140.688 1.00 28.16  ? 348 SER B CA  1 
ATOM   7024 C C   . SER B 2 348 ? 21.105  -8.007  140.770 1.00 26.36  ? 348 SER B C   1 
ATOM   7025 O O   . SER B 2 348 ? 20.999  -7.321  139.755 1.00 24.31  ? 348 SER B O   1 
ATOM   7026 C CB  . SER B 2 348 ? 20.370  -10.344 140.691 1.00 28.73  ? 348 SER B CB  1 
ATOM   7027 O OG  . SER B 2 348 ? 19.427  -9.860  139.750 1.00 31.80  ? 348 SER B OG  1 
ATOM   7028 N N   . SER B 2 349 ? 20.813  -7.579  141.988 1.00 26.31  ? 349 SER B N   1 
ATOM   7029 C CA  . SER B 2 349 ? 20.316  -6.233  142.247 1.00 29.05  ? 349 SER B CA  1 
ATOM   7030 C C   . SER B 2 349 ? 21.167  -5.099  141.646 1.00 29.97  ? 349 SER B C   1 
ATOM   7031 O O   . SER B 2 349 ? 20.652  -4.019  141.354 1.00 29.77  ? 349 SER B O   1 
ATOM   7032 C CB  . SER B 2 349 ? 20.178  -6.043  143.756 1.00 30.96  ? 349 SER B CB  1 
ATOM   7033 O OG  . SER B 2 349 ? 21.346  -6.509  144.423 1.00 31.26  ? 349 SER B OG  1 
ATOM   7034 N N   . GLN B 2 350 ? 22.460  -5.342  141.456 1.00 29.86  ? 350 GLN B N   1 
ATOM   7035 C CA  . GLN B 2 350 ? 23.343  -4.327  140.900 1.00 30.07  ? 350 GLN B CA  1 
ATOM   7036 C C   . GLN B 2 350 ? 23.216  -4.177  139.390 1.00 31.31  ? 350 GLN B C   1 
ATOM   7037 O O   . GLN B 2 350 ? 23.570  -3.136  138.838 1.00 33.82  ? 350 GLN B O   1 
ATOM   7038 C CB  . GLN B 2 350 ? 24.785  -4.642  141.263 1.00 29.14  ? 350 GLN B CB  1 
ATOM   7039 C CG  . GLN B 2 350 ? 24.944  -5.021  142.698 1.00 31.30  ? 350 GLN B CG  1 
ATOM   7040 C CD  . GLN B 2 350 ? 26.386  -5.056  143.108 1.00 33.44  ? 350 GLN B CD  1 
ATOM   7041 O OE1 . GLN B 2 350 ? 27.235  -5.543  142.368 1.00 33.91  ? 350 GLN B OE1 1 
ATOM   7042 N NE2 . GLN B 2 350 ? 26.680  -4.544  144.299 1.00 36.15  ? 350 GLN B NE2 1 
ATOM   7043 N N   . VAL B 2 351 ? 22.744  -5.217  138.713 1.00 30.91  ? 351 VAL B N   1 
ATOM   7044 C CA  . VAL B 2 351 ? 22.558  -5.142  137.270 1.00 30.61  ? 351 VAL B CA  1 
ATOM   7045 C C   . VAL B 2 351 ? 21.086  -4.848  137.059 1.00 32.62  ? 351 VAL B C   1 
ATOM   7046 O O   . VAL B 2 351 ? 20.270  -5.752  136.978 1.00 34.03  ? 351 VAL B O   1 
ATOM   7047 C CB  . VAL B 2 351 ? 22.926  -6.461  136.567 1.00 28.95  ? 351 VAL B CB  1 
ATOM   7048 C CG1 . VAL B 2 351 ? 22.486  -6.418  135.121 1.00 25.37  ? 351 VAL B CG1 1 
ATOM   7049 C CG2 . VAL B 2 351 ? 24.428  -6.688  136.647 1.00 28.12  ? 351 VAL B CG2 1 
ATOM   7050 N N   . GLN B 2 352 ? 20.760  -3.563  136.986 1.00 34.55  ? 352 GLN B N   1 
ATOM   7051 C CA  . GLN B 2 352 ? 19.390  -3.108  136.812 1.00 35.33  ? 352 GLN B CA  1 
ATOM   7052 C C   . GLN B 2 352 ? 18.902  -3.122  135.371 1.00 34.63  ? 352 GLN B C   1 
ATOM   7053 O O   . GLN B 2 352 ? 19.630  -2.756  134.452 1.00 35.73  ? 352 GLN B O   1 
ATOM   7054 C CB  . GLN B 2 352 ? 19.246  -1.706  137.400 1.00 37.36  ? 352 GLN B CB  1 
ATOM   7055 C CG  . GLN B 2 352 ? 19.320  -1.674  138.911 1.00 39.24  ? 352 GLN B CG  1 
ATOM   7056 C CD  . GLN B 2 352 ? 19.502  -0.270  139.439 1.00 43.10  ? 352 GLN B CD  1 
ATOM   7057 O OE1 . GLN B 2 352 ? 18.671  0.610   139.205 1.00 43.25  ? 352 GLN B OE1 1 
ATOM   7058 N NE2 . GLN B 2 352 ? 20.598  -0.048  140.156 1.00 46.23  ? 352 GLN B NE2 1 
ATOM   7059 N N   . ARG B 2 353 ? 17.653  -3.539  135.195 1.00 33.09  ? 353 ARG B N   1 
ATOM   7060 C CA  . ARG B 2 353 ? 17.032  -3.640  133.883 1.00 31.76  ? 353 ARG B CA  1 
ATOM   7061 C C   . ARG B 2 353 ? 17.090  -2.366  133.044 1.00 30.58  ? 353 ARG B C   1 
ATOM   7062 O O   . ARG B 2 353 ? 17.196  -2.419  131.820 1.00 27.26  ? 353 ARG B O   1 
ATOM   7063 C CB  . ARG B 2 353 ? 15.581  -4.086  134.050 1.00 32.86  ? 353 ARG B CB  1 
ATOM   7064 C CG  . ARG B 2 353 ? 14.721  -3.756  132.872 1.00 36.32  ? 353 ARG B CG  1 
ATOM   7065 C CD  . ARG B 2 353 ? 13.446  -4.542  132.873 1.00 37.87  ? 353 ARG B CD  1 
ATOM   7066 N NE  . ARG B 2 353 ? 13.031  -4.793  131.498 1.00 39.61  ? 353 ARG B NE  1 
ATOM   7067 C CZ  . ARG B 2 353 ? 12.042  -5.606  131.162 1.00 41.76  ? 353 ARG B CZ  1 
ATOM   7068 N NH1 . ARG B 2 353 ? 11.363  -6.250  132.107 1.00 43.53  ? 353 ARG B NH1 1 
ATOM   7069 N NH2 . ARG B 2 353 ? 11.734  -5.776  129.883 1.00 42.96  ? 353 ARG B NH2 1 
ATOM   7070 N N   . ARG B 2 354 ? 17.021  -1.217  133.701 1.00 31.64  ? 354 ARG B N   1 
ATOM   7071 C CA  . ARG B 2 354 ? 17.059  0.044   132.981 1.00 32.95  ? 354 ARG B CA  1 
ATOM   7072 C C   . ARG B 2 354 ? 18.382  0.256   132.235 1.00 32.23  ? 354 ARG B C   1 
ATOM   7073 O O   . ARG B 2 354 ? 18.555  1.233   131.514 1.00 33.26  ? 354 ARG B O   1 
ATOM   7074 C CB  . ARG B 2 354 ? 16.803  1.199   133.945 1.00 34.60  ? 354 ARG B CB  1 
ATOM   7075 C CG  . ARG B 2 354 ? 17.765  1.269   135.115 1.00 37.10  ? 354 ARG B CG  1 
ATOM   7076 C CD  . ARG B 2 354 ? 17.681  2.641   135.771 1.00 39.96  ? 354 ARG B CD  1 
ATOM   7077 N NE  . ARG B 2 354 ? 18.673  2.825   136.830 1.00 42.89  ? 354 ARG B NE  1 
ATOM   7078 C CZ  . ARG B 2 354 ? 19.394  3.932   137.000 1.00 43.13  ? 354 ARG B CZ  1 
ATOM   7079 N NH1 . ARG B 2 354 ? 19.245  4.966   136.174 1.00 41.36  ? 354 ARG B NH1 1 
ATOM   7080 N NH2 . ARG B 2 354 ? 20.258  4.008   138.005 1.00 41.99  ? 354 ARG B NH2 1 
ATOM   7081 N N   . PHE B 2 355 ? 19.311  -0.672  132.400 1.00 31.35  ? 355 PHE B N   1 
ATOM   7082 C CA  . PHE B 2 355 ? 20.602  -0.573  131.737 1.00 30.29  ? 355 PHE B CA  1 
ATOM   7083 C C   . PHE B 2 355 ? 20.657  -1.506  130.532 1.00 28.93  ? 355 PHE B C   1 
ATOM   7084 O O   . PHE B 2 355 ? 21.491  -1.331  129.642 1.00 25.88  ? 355 PHE B O   1 
ATOM   7085 C CB  . PHE B 2 355 ? 21.722  -0.937  132.716 1.00 32.35  ? 355 PHE B CB  1 
ATOM   7086 C CG  . PHE B 2 355 ? 21.889  0.040   133.844 1.00 34.58  ? 355 PHE B CG  1 
ATOM   7087 C CD1 . PHE B 2 355 ? 22.378  -0.384  135.083 1.00 36.13  ? 355 PHE B CD1 1 
ATOM   7088 C CD2 . PHE B 2 355 ? 21.563  1.383   133.676 1.00 34.62  ? 355 PHE B CD2 1 
ATOM   7089 C CE1 . PHE B 2 355 ? 22.547  0.526   136.133 1.00 35.60  ? 355 PHE B CE1 1 
ATOM   7090 C CE2 . PHE B 2 355 ? 21.730  2.295   134.719 1.00 34.53  ? 355 PHE B CE2 1 
ATOM   7091 C CZ  . PHE B 2 355 ? 22.216  1.866   135.948 1.00 34.01  ? 355 PHE B CZ  1 
ATOM   7092 N N   . PHE B 2 356 ? 19.769  -2.497  130.507 1.00 27.79  ? 356 PHE B N   1 
ATOM   7093 C CA  . PHE B 2 356 ? 19.741  -3.453  129.409 1.00 27.04  ? 356 PHE B CA  1 
ATOM   7094 C C   . PHE B 2 356 ? 19.791  -2.713  128.102 1.00 28.15  ? 356 PHE B C   1 
ATOM   7095 O O   . PHE B 2 356 ? 19.136  -1.682  127.927 1.00 30.30  ? 356 PHE B O   1 
ATOM   7096 C CB  . PHE B 2 356 ? 18.473  -4.300  129.431 1.00 27.08  ? 356 PHE B CB  1 
ATOM   7097 C CG  . PHE B 2 356 ? 18.426  -5.323  130.537 1.00 26.61  ? 356 PHE B CG  1 
ATOM   7098 C CD1 . PHE B 2 356 ? 17.310  -6.133  130.688 1.00 24.44  ? 356 PHE B CD1 1 
ATOM   7099 C CD2 . PHE B 2 356 ? 19.488  -5.480  131.421 1.00 26.47  ? 356 PHE B CD2 1 
ATOM   7100 C CE1 . PHE B 2 356 ? 17.250  -7.080  131.693 1.00 26.82  ? 356 PHE B CE1 1 
ATOM   7101 C CE2 . PHE B 2 356 ? 19.436  -6.428  132.435 1.00 26.55  ? 356 PHE B CE2 1 
ATOM   7102 C CZ  . PHE B 2 356 ? 18.315  -7.231  132.570 1.00 26.66  ? 356 PHE B CZ  1 
ATOM   7103 N N   . MET B 2 357 ? 20.571  -3.248  127.180 1.00 28.63  ? 357 MET B N   1 
ATOM   7104 C CA  . MET B 2 357 ? 20.720  -2.647  125.876 1.00 27.50  ? 357 MET B CA  1 
ATOM   7105 C C   . MET B 2 357 ? 20.804  -3.684  124.779 1.00 27.30  ? 357 MET B C   1 
ATOM   7106 O O   . MET B 2 357 ? 20.799  -4.887  125.033 1.00 27.44  ? 357 MET B O   1 
ATOM   7107 C CB  . MET B 2 357 ? 21.952  -1.761  125.871 1.00 28.81  ? 357 MET B CB  1 
ATOM   7108 C CG  . MET B 2 357 ? 21.700  -0.443  126.580 1.00 32.99  ? 357 MET B CG  1 
ATOM   7109 S SD  . MET B 2 357 ? 23.077  0.669   126.416 1.00 37.46  ? 357 MET B SD  1 
ATOM   7110 C CE  . MET B 2 357 ? 23.139  0.958   124.605 1.00 34.19  ? 357 MET B CE  1 
ATOM   7111 N N   . GLY B 2 358 ? 20.882  -3.210  123.549 1.00 27.77  ? 358 GLY B N   1 
ATOM   7112 C CA  . GLY B 2 358 ? 20.952  -4.119  122.430 1.00 28.23  ? 358 GLY B CA  1 
ATOM   7113 C C   . GLY B 2 358 ? 19.538  -4.316  121.942 1.00 29.54  ? 358 GLY B C   1 
ATOM   7114 O O   . GLY B 2 358 ? 18.597  -3.756  122.512 1.00 26.67  ? 358 GLY B O   1 
ATOM   7115 N N   . ASN B 2 359 ? 19.376  -5.129  120.906 1.00 30.86  ? 359 ASN B N   1 
ATOM   7116 C CA  . ASN B 2 359 ? 18.057  -5.352  120.369 1.00 32.43  ? 359 ASN B CA  1 
ATOM   7117 C C   . ASN B 2 359 ? 17.713  -6.822  120.277 1.00 31.17  ? 359 ASN B C   1 
ATOM   7118 O O   . ASN B 2 359 ? 17.018  -7.260  119.352 1.00 32.59  ? 359 ASN B O   1 
ATOM   7119 C CB  . ASN B 2 359 ? 17.957  -4.654  119.015 1.00 38.04  ? 359 ASN B CB  1 
ATOM   7120 C CG  . ASN B 2 359 ? 18.063  -3.126  119.146 1.00 41.84  ? 359 ASN B CG  1 
ATOM   7121 O OD1 . ASN B 2 359 ? 17.113  -2.462  119.568 1.00 43.43  ? 359 ASN B OD1 1 
ATOM   7122 N ND2 . ASN B 2 359 ? 19.232  -2.573  118.809 1.00 44.00  ? 359 ASN B ND2 1 
ATOM   7123 N N   . GLN B 2 360 ? 18.174  -7.578  121.267 1.00 27.70  ? 360 GLN B N   1 
ATOM   7124 C CA  . GLN B 2 360 ? 17.905  -9.004  121.300 1.00 24.24  ? 360 GLN B CA  1 
ATOM   7125 C C   . GLN B 2 360 ? 18.094  -9.598  122.684 1.00 23.28  ? 360 GLN B C   1 
ATOM   7126 O O   . GLN B 2 360 ? 18.730  -9.007  123.559 1.00 23.49  ? 360 GLN B O   1 
ATOM   7127 C CB  . GLN B 2 360 ? 18.834  -9.729  120.333 1.00 23.15  ? 360 GLN B CB  1 
ATOM   7128 C CG  . GLN B 2 360 ? 20.251  -9.942  120.845 1.00 22.43  ? 360 GLN B CG  1 
ATOM   7129 C CD  . GLN B 2 360 ? 21.132  -10.626 119.816 1.00 24.47  ? 360 GLN B CD  1 
ATOM   7130 O OE1 . GLN B 2 360 ? 20.632  -11.211 118.854 1.00 24.19  ? 360 GLN B OE1 1 
ATOM   7131 N NE2 . GLN B 2 360 ? 22.451  -10.570 120.019 1.00 25.60  ? 360 GLN B NE2 1 
ATOM   7132 N N   . VAL B 2 361 ? 17.536  -10.781 122.874 1.00 20.14  ? 361 VAL B N   1 
ATOM   7133 C CA  . VAL B 2 361 ? 17.692  -11.498 124.124 1.00 18.38  ? 361 VAL B CA  1 
ATOM   7134 C C   . VAL B 2 361 ? 18.070  -12.910 123.737 1.00 19.25  ? 361 VAL B C   1 
ATOM   7135 O O   . VAL B 2 361 ? 17.341  -13.566 122.997 1.00 19.94  ? 361 VAL B O   1 
ATOM   7136 C CB  . VAL B 2 361 ? 16.395  -11.547 124.915 1.00 17.91  ? 361 VAL B CB  1 
ATOM   7137 C CG1 . VAL B 2 361 ? 16.572  -12.421 126.133 1.00 15.53  ? 361 VAL B CG1 1 
ATOM   7138 C CG2 . VAL B 2 361 ? 15.991  -10.151 125.315 1.00 17.73  ? 361 VAL B CG2 1 
ATOM   7139 N N   . LEU B 2 362 ? 19.215  -13.378 124.208 1.00 19.05  ? 362 LEU B N   1 
ATOM   7140 C CA  . LEU B 2 362 ? 19.640  -14.731 123.895 1.00 18.66  ? 362 LEU B CA  1 
ATOM   7141 C C   . LEU B 2 362 ? 19.410  -15.676 125.063 1.00 22.05  ? 362 LEU B C   1 
ATOM   7142 O O   . LEU B 2 362 ? 19.592  -15.297 126.224 1.00 23.69  ? 362 LEU B O   1 
ATOM   7143 C CB  . LEU B 2 362 ? 21.121  -14.760 123.568 1.00 15.99  ? 362 LEU B CB  1 
ATOM   7144 C CG  . LEU B 2 362 ? 21.572  -13.897 122.415 1.00 14.95  ? 362 LEU B CG  1 
ATOM   7145 C CD1 . LEU B 2 362 ? 23.056  -14.096 122.221 1.00 12.84  ? 362 LEU B CD1 1 
ATOM   7146 C CD2 . LEU B 2 362 ? 20.782  -14.277 121.171 1.00 17.28  ? 362 LEU B CD2 1 
ATOM   7147 N N   . LYS B 2 363 ? 18.987  -16.900 124.759 1.00 23.19  ? 363 LYS B N   1 
ATOM   7148 C CA  . LYS B 2 363 ? 18.828  -17.912 125.792 1.00 24.14  ? 363 LYS B CA  1 
ATOM   7149 C C   . LYS B 2 363 ? 19.934  -18.919 125.510 1.00 27.01  ? 363 LYS B C   1 
ATOM   7150 O O   . LYS B 2 363 ? 20.040  -19.476 124.405 1.00 25.72  ? 363 LYS B O   1 
ATOM   7151 C CB  . LYS B 2 363 ? 17.461  -18.589 125.744 1.00 22.42  ? 363 LYS B CB  1 
ATOM   7152 C CG  . LYS B 2 363 ? 16.384  -17.805 126.457 1.00 23.95  ? 363 LYS B CG  1 
ATOM   7153 C CD  . LYS B 2 363 ? 15.113  -18.602 126.623 1.00 20.96  ? 363 LYS B CD  1 
ATOM   7154 C CE  . LYS B 2 363 ? 14.018  -17.755 127.237 1.00 23.22  ? 363 LYS B CE  1 
ATOM   7155 N NZ  . LYS B 2 363 ? 12.766  -18.538 127.438 1.00 25.80  ? 363 LYS B NZ  1 
ATOM   7156 N N   . VAL B 2 364 ? 20.780  -19.116 126.514 1.00 29.10  ? 364 VAL B N   1 
ATOM   7157 C CA  . VAL B 2 364 ? 21.903  -20.028 126.403 1.00 30.27  ? 364 VAL B CA  1 
ATOM   7158 C C   . VAL B 2 364 ? 21.622  -21.360 127.086 1.00 31.17  ? 364 VAL B C   1 
ATOM   7159 O O   . VAL B 2 364 ? 21.230  -21.401 128.252 1.00 31.23  ? 364 VAL B O   1 
ATOM   7160 C CB  . VAL B 2 364 ? 23.166  -19.398 127.016 1.00 29.80  ? 364 VAL B CB  1 
ATOM   7161 C CG1 . VAL B 2 364 ? 24.357  -20.295 126.790 1.00 28.92  ? 364 VAL B CG1 1 
ATOM   7162 C CG2 . VAL B 2 364 ? 23.407  -18.028 126.401 1.00 30.19  ? 364 VAL B CG2 1 
ATOM   7163 N N   . PHE B 2 365 ? 21.808  -22.445 126.336 1.00 31.80  ? 365 PHE B N   1 
ATOM   7164 C CA  . PHE B 2 365 ? 21.615  -23.796 126.842 1.00 30.45  ? 365 PHE B CA  1 
ATOM   7165 C C   . PHE B 2 365 ? 22.909  -24.530 126.584 1.00 30.85  ? 365 PHE B C   1 
ATOM   7166 O O   . PHE B 2 365 ? 23.794  -24.033 125.876 1.00 28.54  ? 365 PHE B O   1 
ATOM   7167 C CB  . PHE B 2 365 ? 20.523  -24.545 126.082 1.00 31.48  ? 365 PHE B CB  1 
ATOM   7168 C CG  . PHE B 2 365 ? 19.189  -23.885 126.108 1.00 33.57  ? 365 PHE B CG  1 
ATOM   7169 C CD1 . PHE B 2 365 ? 18.907  -22.820 125.256 1.00 35.09  ? 365 PHE B CD1 1 
ATOM   7170 C CD2 . PHE B 2 365 ? 18.202  -24.333 126.977 1.00 32.92  ? 365 PHE B CD2 1 
ATOM   7171 C CE1 . PHE B 2 365 ? 17.646  -22.207 125.273 1.00 36.52  ? 365 PHE B CE1 1 
ATOM   7172 C CE2 . PHE B 2 365 ? 16.947  -23.731 127.000 1.00 34.90  ? 365 PHE B CE2 1 
ATOM   7173 C CZ  . PHE B 2 365 ? 16.665  -22.666 126.147 1.00 34.18  ? 365 PHE B CZ  1 
ATOM   7174 N N   . ALA B 2 366 ? 23.003  -25.727 127.147 1.00 31.45  ? 366 ALA B N   1 
ATOM   7175 C CA  . ALA B 2 366 ? 24.171  -26.560 126.945 1.00 31.06  ? 366 ALA B CA  1 
ATOM   7176 C C   . ALA B 2 366 ? 24.039  -27.132 125.546 1.00 31.09  ? 366 ALA B C   1 
ATOM   7177 O O   . ALA B 2 366 ? 22.936  -27.392 125.063 1.00 28.69  ? 366 ALA B O   1 
ATOM   7178 C CB  . ALA B 2 366 ? 24.199  -27.679 127.965 1.00 28.96  ? 366 ALA B CB  1 
ATOM   7179 N N   . ALA B 2 367 ? 25.171  -27.298 124.886 1.00 33.49  ? 367 ALA B N   1 
ATOM   7180 C CA  . ALA B 2 367 ? 25.189  -27.865 123.553 1.00 37.15  ? 367 ALA B CA  1 
ATOM   7181 C C   . ALA B 2 367 ? 24.197  -29.031 123.488 1.00 39.22  ? 367 ALA B C   1 
ATOM   7182 O O   . ALA B 2 367 ? 24.021  -29.769 124.458 1.00 38.68  ? 367 ALA B O   1 
ATOM   7183 C CB  . ALA B 2 367 ? 26.601  -28.345 123.228 1.00 36.00  ? 367 ALA B CB  1 
ATOM   7184 N N   . ARG B 2 368 ? 23.552  -29.192 122.342 1.00 42.47  ? 368 ARG B N   1 
ATOM   7185 C CA  . ARG B 2 368 ? 22.584  -30.262 122.166 1.00 47.44  ? 368 ARG B CA  1 
ATOM   7186 C C   . ARG B 2 368 ? 23.225  -31.655 122.310 1.00 47.87  ? 368 ARG B C   1 
ATOM   7187 O O   . ARG B 2 368 ? 24.250  -31.961 121.688 1.00 45.75  ? 368 ARG B O   1 
ATOM   7188 C CB  . ARG B 2 368 ? 21.903  -30.119 120.795 1.00 52.42  ? 368 ARG B CB  1 
ATOM   7189 C CG  . ARG B 2 368 ? 20.702  -31.031 120.574 1.00 58.61  ? 368 ARG B CG  1 
ATOM   7190 C CD  . ARG B 2 368 ? 20.045  -30.750 119.229 1.00 64.76  ? 368 ARG B CD  1 
ATOM   7191 N NE  . ARG B 2 368 ? 19.041  -31.758 118.880 1.00 71.08  ? 368 ARG B NE  1 
ATOM   7192 C CZ  . ARG B 2 368 ? 18.314  -31.747 117.760 1.00 73.46  ? 368 ARG B CZ  1 
ATOM   7193 N NH1 . ARG B 2 368 ? 18.468  -30.775 116.866 1.00 73.65  ? 368 ARG B NH1 1 
ATOM   7194 N NH2 . ARG B 2 368 ? 17.433  -32.717 117.525 1.00 74.63  ? 368 ARG B NH2 1 
ATOM   7195 N N   . ASP B 2 369 ? 22.603  -32.483 123.150 1.00 49.16  ? 369 ASP B N   1 
ATOM   7196 C CA  . ASP B 2 369 ? 23.048  -33.853 123.414 1.00 50.07  ? 369 ASP B CA  1 
ATOM   7197 C C   . ASP B 2 369 ? 24.401  -33.964 124.107 1.00 48.75  ? 369 ASP B C   1 
ATOM   7198 O O   . ASP B 2 369 ? 25.182  -34.867 123.800 1.00 48.91  ? 369 ASP B O   1 
ATOM   7199 C CB  . ASP B 2 369 ? 23.108  -34.658 122.118 1.00 53.16  ? 369 ASP B CB  1 
ATOM   7200 C CG  . ASP B 2 369 ? 21.831  -34.555 121.312 1.00 58.21  ? 369 ASP B CG  1 
ATOM   7201 O OD1 . ASP B 2 369 ? 20.731  -34.712 121.908 1.00 59.17  ? 369 ASP B OD1 1 
ATOM   7202 O OD2 . ASP B 2 369 ? 21.931  -34.318 120.080 1.00 60.61  ? 369 ASP B OD2 1 
ATOM   7203 N N   . ASP B 2 370 ? 24.677  -33.059 125.041 1.00 45.92  ? 370 ASP B N   1 
ATOM   7204 C CA  . ASP B 2 370 ? 25.939  -33.082 125.781 1.00 42.13  ? 370 ASP B CA  1 
ATOM   7205 C C   . ASP B 2 370 ? 25.597  -33.098 127.263 1.00 41.77  ? 370 ASP B C   1 
ATOM   7206 O O   . ASP B 2 370 ? 25.653  -32.084 127.941 1.00 43.68  ? 370 ASP B O   1 
ATOM   7207 C CB  . ASP B 2 370 ? 26.775  -31.845 125.454 1.00 39.58  ? 370 ASP B CB  1 
ATOM   7208 C CG  . ASP B 2 370 ? 28.196  -31.943 125.986 1.00 37.34  ? 370 ASP B CG  1 
ATOM   7209 O OD1 . ASP B 2 370 ? 28.375  -32.470 127.102 1.00 37.95  ? 370 ASP B OD1 1 
ATOM   7210 O OD2 . ASP B 2 370 ? 29.135  -31.488 125.294 1.00 33.92  ? 370 ASP B OD2 1 
ATOM   7211 N N   . GLU B 2 371 ? 25.240  -34.268 127.760 1.00 40.95  ? 371 GLU B N   1 
ATOM   7212 C CA  . GLU B 2 371 ? 24.864  -34.425 129.147 1.00 39.47  ? 371 GLU B CA  1 
ATOM   7213 C C   . GLU B 2 371 ? 25.850  -33.788 130.116 1.00 35.75  ? 371 GLU B C   1 
ATOM   7214 O O   . GLU B 2 371 ? 25.435  -33.172 131.096 1.00 32.93  ? 371 GLU B O   1 
ATOM   7215 C CB  . GLU B 2 371 ? 24.692  -35.913 129.462 1.00 44.44  ? 371 GLU B CB  1 
ATOM   7216 C CG  . GLU B 2 371 ? 23.743  -36.190 130.621 1.00 51.86  ? 371 GLU B CG  1 
ATOM   7217 C CD  . GLU B 2 371 ? 23.161  -37.592 130.537 1.00 56.87  ? 371 GLU B CD  1 
ATOM   7218 O OE1 . GLU B 2 371 ? 23.440  -38.301 129.531 1.00 58.95  ? 371 GLU B OE1 1 
ATOM   7219 O OE2 . GLU B 2 371 ? 22.424  -37.984 131.471 1.00 58.53  ? 371 GLU B OE2 1 
ATOM   7220 N N   . ALA B 2 372 ? 27.146  -33.942 129.843 1.00 32.84  ? 372 ALA B N   1 
ATOM   7221 C CA  . ALA B 2 372 ? 28.186  -33.381 130.699 1.00 31.04  ? 372 ALA B CA  1 
ATOM   7222 C C   . ALA B 2 372 ? 27.946  -31.887 130.830 1.00 30.61  ? 372 ALA B C   1 
ATOM   7223 O O   . ALA B 2 372 ? 27.794  -31.356 131.940 1.00 30.39  ? 372 ALA B O   1 
ATOM   7224 C CB  . ALA B 2 372 ? 29.550  -33.639 130.104 1.00 30.43  ? 372 ALA B CB  1 
ATOM   7225 N N   . ALA B 2 373 ? 27.922  -31.212 129.685 1.00 28.97  ? 373 ALA B N   1 
ATOM   7226 C CA  . ALA B 2 373 ? 27.683  -29.777 129.647 1.00 26.73  ? 373 ALA B CA  1 
ATOM   7227 C C   . ALA B 2 373 ? 26.345  -29.467 130.305 1.00 24.54  ? 373 ALA B C   1 
ATOM   7228 O O   . ALA B 2 373 ? 26.221  -28.529 131.087 1.00 23.73  ? 373 ALA B O   1 
ATOM   7229 C CB  . ALA B 2 373 ? 27.684  -29.296 128.215 1.00 26.47  ? 373 ALA B CB  1 
ATOM   7230 N N   . ALA B 2 374 ? 25.338  -30.263 129.986 1.00 23.89  ? 374 ALA B N   1 
ATOM   7231 C CA  . ALA B 2 374 ? 24.021  -30.054 130.565 1.00 25.76  ? 374 ALA B CA  1 
ATOM   7232 C C   . ALA B 2 374 ? 24.167  -29.887 132.076 1.00 25.97  ? 374 ALA B C   1 
ATOM   7233 O O   . ALA B 2 374 ? 23.625  -28.952 132.670 1.00 28.30  ? 374 ALA B O   1 
ATOM   7234 C CB  . ALA B 2 374 ? 23.120  -31.242 130.254 1.00 25.53  ? 374 ALA B CB  1 
ATOM   7235 N N   . VAL B 2 375 ? 24.926  -30.793 132.683 1.00 22.78  ? 375 VAL B N   1 
ATOM   7236 C CA  . VAL B 2 375 ? 25.149  -30.777 134.120 1.00 18.82  ? 375 VAL B CA  1 
ATOM   7237 C C   . VAL B 2 375 ? 25.995  -29.592 134.538 1.00 17.80  ? 375 VAL B C   1 
ATOM   7238 O O   . VAL B 2 375 ? 25.686  -28.919 135.527 1.00 15.17  ? 375 VAL B O   1 
ATOM   7239 C CB  . VAL B 2 375 ? 25.819  -32.095 134.579 1.00 16.91  ? 375 VAL B CB  1 
ATOM   7240 C CG1 . VAL B 2 375 ? 26.201  -32.029 136.039 1.00 12.00  ? 375 VAL B CG1 1 
ATOM   7241 C CG2 . VAL B 2 375 ? 24.857  -33.240 134.345 1.00 17.18  ? 375 VAL B CG2 1 
ATOM   7242 N N   . ALA B 2 376 ? 27.051  -29.334 133.773 1.00 15.38  ? 376 ALA B N   1 
ATOM   7243 C CA  . ALA B 2 376 ? 27.943  -28.222 134.058 1.00 16.36  ? 376 ALA B CA  1 
ATOM   7244 C C   . ALA B 2 376 ? 27.140  -26.919 134.151 1.00 17.95  ? 376 ALA B C   1 
ATOM   7245 O O   . ALA B 2 376 ? 27.177  -26.206 135.165 1.00 15.80  ? 376 ALA B O   1 
ATOM   7246 C CB  . ALA B 2 376 ? 29.005  -28.111 132.963 1.00 14.24  ? 376 ALA B CB  1 
ATOM   7247 N N   . LEU B 2 377 ? 26.399  -26.624 133.093 1.00 18.25  ? 377 LEU B N   1 
ATOM   7248 C CA  . LEU B 2 377 ? 25.604  -25.419 133.069 1.00 22.54  ? 377 LEU B CA  1 
ATOM   7249 C C   . LEU B 2 377 ? 24.580  -25.393 134.212 1.00 25.19  ? 377 LEU B C   1 
ATOM   7250 O O   . LEU B 2 377 ? 24.392  -24.364 134.867 1.00 26.48  ? 377 LEU B O   1 
ATOM   7251 C CB  . LEU B 2 377 ? 24.885  -25.294 131.726 1.00 23.50  ? 377 LEU B CB  1 
ATOM   7252 C CG  . LEU B 2 377 ? 24.391  -23.888 131.367 1.00 22.64  ? 377 LEU B CG  1 
ATOM   7253 C CD1 . LEU B 2 377 ? 25.587  -23.013 131.031 1.00 22.12  ? 377 LEU B CD1 1 
ATOM   7254 C CD2 . LEU B 2 377 ? 23.437  -23.954 130.184 1.00 22.96  ? 377 LEU B CD2 1 
ATOM   7255 N N   . SER B 2 378 ? 23.925  -26.526 134.455 1.00 26.54  ? 378 SER B N   1 
ATOM   7256 C CA  . SER B 2 378 ? 22.916  -26.613 135.508 1.00 25.46  ? 378 SER B CA  1 
ATOM   7257 C C   . SER B 2 378 ? 23.492  -26.127 136.831 1.00 25.83  ? 378 SER B C   1 
ATOM   7258 O O   . SER B 2 378 ? 22.844  -25.374 137.559 1.00 23.75  ? 378 SER B O   1 
ATOM   7259 C CB  . SER B 2 378 ? 22.431  -28.053 135.650 1.00 24.35  ? 378 SER B CB  1 
ATOM   7260 O OG  . SER B 2 378 ? 21.211  -28.091 136.364 1.00 23.01  ? 378 SER B OG  1 
ATOM   7261 N N   . SER B 2 379 ? 24.714  -26.566 137.126 1.00 26.50  ? 379 SER B N   1 
ATOM   7262 C CA  . SER B 2 379 ? 25.409  -26.175 138.344 1.00 27.64  ? 379 SER B CA  1 
ATOM   7263 C C   . SER B 2 379 ? 25.393  -24.649 138.384 1.00 27.81  ? 379 SER B C   1 
ATOM   7264 O O   . SER B 2 379 ? 24.836  -24.040 139.300 1.00 29.20  ? 379 SER B O   1 
ATOM   7265 C CB  . SER B 2 379 ? 26.874  -26.641 138.312 1.00 28.70  ? 379 SER B CB  1 
ATOM   7266 O OG  . SER B 2 379 ? 27.017  -27.959 137.825 1.00 30.66  ? 379 SER B OG  1 
ATOM   7267 N N   . LEU B 2 380 ? 26.009  -24.044 137.370 1.00 25.89  ? 380 LEU B N   1 
ATOM   7268 C CA  . LEU B 2 380 ? 26.094  -22.597 137.257 1.00 24.61  ? 380 LEU B CA  1 
ATOM   7269 C C   . LEU B 2 380 ? 24.735  -21.934 137.467 1.00 24.43  ? 380 LEU B C   1 
ATOM   7270 O O   . LEU B 2 380 ? 24.574  -21.082 138.349 1.00 23.26  ? 380 LEU B O   1 
ATOM   7271 C CB  . LEU B 2 380 ? 26.636  -22.209 135.883 1.00 23.94  ? 380 LEU B CB  1 
ATOM   7272 C CG  . LEU B 2 380 ? 27.641  -21.052 135.838 1.00 25.22  ? 380 LEU B CG  1 
ATOM   7273 C CD1 . LEU B 2 380 ? 27.626  -20.438 134.444 1.00 25.83  ? 380 LEU B CD1 1 
ATOM   7274 C CD2 . LEU B 2 380 ? 27.307  -19.999 136.872 1.00 23.14  ? 380 LEU B CD2 1 
ATOM   7275 N N   . ILE B 2 381 ? 23.763  -22.332 136.653 1.00 22.41  ? 381 ILE B N   1 
ATOM   7276 C CA  . ILE B 2 381 ? 22.422  -21.781 136.740 1.00 22.46  ? 381 ILE B CA  1 
ATOM   7277 C C   . ILE B 2 381 ? 21.852  -21.796 138.148 1.00 24.01  ? 381 ILE B C   1 
ATOM   7278 O O   . ILE B 2 381 ? 21.428  -20.769 138.667 1.00 24.67  ? 381 ILE B O   1 
ATOM   7279 C CB  . ILE B 2 381 ? 21.473  -22.526 135.812 1.00 20.53  ? 381 ILE B CB  1 
ATOM   7280 C CG1 . ILE B 2 381 ? 21.778  -22.119 134.375 1.00 23.30  ? 381 ILE B CG1 1 
ATOM   7281 C CG2 . ILE B 2 381 ? 20.040  -22.220 136.167 1.00 18.01  ? 381 ILE B CG2 1 
ATOM   7282 C CD1 . ILE B 2 381 ? 20.992  -22.879 133.337 1.00 25.50  ? 381 ILE B CD1 1 
ATOM   7283 N N   . HIS B 2 382 ? 21.840  -22.963 138.768 1.00 24.72  ? 382 HIS B N   1 
ATOM   7284 C CA  . HIS B 2 382 ? 21.315  -23.069 140.114 1.00 24.31  ? 382 HIS B CA  1 
ATOM   7285 C C   . HIS B 2 382 ? 22.202  -22.335 141.089 1.00 23.38  ? 382 HIS B C   1 
ATOM   7286 O O   . HIS B 2 382 ? 21.726  -21.748 142.054 1.00 21.84  ? 382 HIS B O   1 
ATOM   7287 C CB  . HIS B 2 382 ? 21.180  -24.537 140.493 1.00 24.34  ? 382 HIS B CB  1 
ATOM   7288 C CG  . HIS B 2 382 ? 19.994  -25.196 139.866 1.00 23.09  ? 382 HIS B CG  1 
ATOM   7289 N ND1 . HIS B 2 382 ? 18.719  -25.061 140.369 1.00 23.28  ? 382 HIS B ND1 1 
ATOM   7290 C CD2 . HIS B 2 382 ? 19.884  -25.951 138.752 1.00 22.44  ? 382 HIS B CD2 1 
ATOM   7291 C CE1 . HIS B 2 382 ? 17.871  -25.709 139.591 1.00 22.40  ? 382 HIS B CE1 1 
ATOM   7292 N NE2 . HIS B 2 382 ? 18.553  -26.257 138.604 1.00 24.12  ? 382 HIS B NE2 1 
ATOM   7293 N N   . ALA B 2 383 ? 23.499  -22.371 140.825 1.00 23.99  ? 383 ALA B N   1 
ATOM   7294 C CA  . ALA B 2 383 ? 24.454  -21.683 141.671 1.00 26.61  ? 383 ALA B CA  1 
ATOM   7295 C C   . ALA B 2 383 ? 24.086  -20.192 141.724 1.00 28.84  ? 383 ALA B C   1 
ATOM   7296 O O   . ALA B 2 383 ? 24.153  -19.559 142.777 1.00 29.03  ? 383 ALA B O   1 
ATOM   7297 C CB  . ALA B 2 383 ? 25.851  -21.866 141.111 1.00 24.97  ? 383 ALA B CB  1 
ATOM   7298 N N   . LEU B 2 384 ? 23.681  -19.638 140.584 1.00 30.52  ? 384 LEU B N   1 
ATOM   7299 C CA  . LEU B 2 384 ? 23.316  -18.228 140.505 1.00 31.44  ? 384 LEU B CA  1 
ATOM   7300 C C   . LEU B 2 384 ? 21.963  -17.924 141.126 1.00 33.40  ? 384 LEU B C   1 
ATOM   7301 O O   . LEU B 2 384 ? 21.798  -16.925 141.820 1.00 32.71  ? 384 LEU B O   1 
ATOM   7302 C CB  . LEU B 2 384 ? 23.329  -17.772 139.048 1.00 29.24  ? 384 LEU B CB  1 
ATOM   7303 C CG  . LEU B 2 384 ? 24.702  -17.903 138.400 1.00 26.58  ? 384 LEU B CG  1 
ATOM   7304 C CD1 . LEU B 2 384 ? 24.603  -17.502 136.966 1.00 26.18  ? 384 LEU B CD1 1 
ATOM   7305 C CD2 . LEU B 2 384 ? 25.710  -17.037 139.119 1.00 25.78  ? 384 LEU B CD2 1 
ATOM   7306 N N   . ASP B 2 385 ? 20.994  -18.789 140.865 1.00 36.80  ? 385 ASP B N   1 
ATOM   7307 C CA  . ASP B 2 385 ? 19.657  -18.611 141.400 1.00 41.24  ? 385 ASP B CA  1 
ATOM   7308 C C   . ASP B 2 385 ? 19.701  -18.644 142.928 1.00 43.26  ? 385 ASP B C   1 
ATOM   7309 O O   . ASP B 2 385 ? 18.914  -17.967 143.599 1.00 44.18  ? 385 ASP B O   1 
ATOM   7310 C CB  . ASP B 2 385 ? 18.744  -19.710 140.870 1.00 43.83  ? 385 ASP B CB  1 
ATOM   7311 C CG  . ASP B 2 385 ? 17.403  -19.728 141.558 1.00 48.57  ? 385 ASP B CG  1 
ATOM   7312 O OD1 . ASP B 2 385 ? 16.639  -18.753 141.395 1.00 50.28  ? 385 ASP B OD1 1 
ATOM   7313 O OD2 . ASP B 2 385 ? 17.115  -20.717 142.270 1.00 51.39  ? 385 ASP B OD2 1 
ATOM   7314 N N   . ASP B 2 386 ? 20.635  -19.428 143.465 1.00 44.44  ? 386 ASP B N   1 
ATOM   7315 C CA  . ASP B 2 386 ? 20.831  -19.578 144.914 1.00 45.06  ? 386 ASP B CA  1 
ATOM   7316 C C   . ASP B 2 386 ? 21.420  -18.341 145.585 1.00 42.74  ? 386 ASP B C   1 
ATOM   7317 O O   . ASP B 2 386 ? 20.756  -17.654 146.355 1.00 42.32  ? 386 ASP B O   1 
ATOM   7318 C CB  . ASP B 2 386 ? 21.769  -20.753 145.200 1.00 49.64  ? 386 ASP B CB  1 
ATOM   7319 C CG  . ASP B 2 386 ? 21.038  -22.068 145.344 1.00 53.52  ? 386 ASP B CG  1 
ATOM   7320 O OD1 . ASP B 2 386 ? 20.325  -22.473 144.391 1.00 56.54  ? 386 ASP B OD1 1 
ATOM   7321 O OD2 . ASP B 2 386 ? 21.190  -22.694 146.421 1.00 55.28  ? 386 ASP B OD2 1 
ATOM   7322 N N   . LEU B 2 387 ? 22.693  -18.101 145.307 1.00 40.43  ? 387 LEU B N   1 
ATOM   7323 C CA  . LEU B 2 387 ? 23.412  -16.965 145.843 1.00 39.02  ? 387 LEU B CA  1 
ATOM   7324 C C   . LEU B 2 387 ? 22.718  -15.685 145.379 1.00 39.05  ? 387 LEU B C   1 
ATOM   7325 O O   . LEU B 2 387 ? 23.047  -14.595 145.833 1.00 40.32  ? 387 LEU B O   1 
ATOM   7326 C CB  . LEU B 2 387 ? 24.838  -16.975 145.300 1.00 38.78  ? 387 LEU B CB  1 
ATOM   7327 C CG  . LEU B 2 387 ? 25.680  -18.245 145.391 1.00 36.37  ? 387 LEU B CG  1 
ATOM   7328 C CD1 . LEU B 2 387 ? 26.559  -18.364 144.164 1.00 36.22  ? 387 LEU B CD1 1 
ATOM   7329 C CD2 . LEU B 2 387 ? 26.533  -18.197 146.631 1.00 37.30  ? 387 LEU B CD2 1 
ATOM   7330 N N   . ASP B 2 388 ? 21.766  -15.829 144.463 1.00 38.24  ? 388 ASP B N   1 
ATOM   7331 C CA  . ASP B 2 388 ? 21.031  -14.700 143.892 1.00 38.52  ? 388 ASP B CA  1 
ATOM   7332 C C   . ASP B 2 388 ? 21.961  -13.740 143.151 1.00 37.82  ? 388 ASP B C   1 
ATOM   7333 O O   . ASP B 2 388 ? 21.816  -12.527 143.221 1.00 37.79  ? 388 ASP B O   1 
ATOM   7334 C CB  . ASP B 2 388 ? 20.261  -13.931 144.965 1.00 40.60  ? 388 ASP B CB  1 
ATOM   7335 C CG  . ASP B 2 388 ? 19.427  -12.791 144.377 1.00 44.36  ? 388 ASP B CG  1 
ATOM   7336 O OD1 . ASP B 2 388 ? 18.561  -13.049 143.509 1.00 46.29  ? 388 ASP B OD1 1 
ATOM   7337 O OD2 . ASP B 2 388 ? 19.639  -11.627 144.777 1.00 47.73  ? 388 ASP B OD2 1 
ATOM   7338 N N   . MET B 2 389 ? 22.910  -14.299 142.420 1.00 36.26  ? 389 MET B N   1 
ATOM   7339 C CA  . MET B 2 389 ? 23.850  -13.490 141.678 1.00 33.67  ? 389 MET B CA  1 
ATOM   7340 C C   . MET B 2 389 ? 23.638  -13.658 140.173 1.00 31.01  ? 389 MET B C   1 
ATOM   7341 O O   . MET B 2 389 ? 22.637  -14.229 139.749 1.00 29.18  ? 389 MET B O   1 
ATOM   7342 C CB  . MET B 2 389 ? 25.265  -13.887 142.071 1.00 34.42  ? 389 MET B CB  1 
ATOM   7343 C CG  . MET B 2 389 ? 25.499  -13.817 143.564 1.00 35.21  ? 389 MET B CG  1 
ATOM   7344 S SD  . MET B 2 389 ? 27.251  -13.968 143.929 1.00 36.64  ? 389 MET B SD  1 
ATOM   7345 C CE  . MET B 2 389 ? 27.709  -12.260 143.894 1.00 37.33  ? 389 MET B CE  1 
ATOM   7346 N N   . VAL B 2 390 ? 24.573  -13.131 139.386 1.00 26.93  ? 390 VAL B N   1 
ATOM   7347 C CA  . VAL B 2 390 ? 24.523  -13.197 137.932 1.00 24.78  ? 390 VAL B CA  1 
ATOM   7348 C C   . VAL B 2 390 ? 25.937  -13.067 137.386 1.00 24.19  ? 390 VAL B C   1 
ATOM   7349 O O   . VAL B 2 390 ? 26.850  -12.639 138.094 1.00 23.88  ? 390 VAL B O   1 
ATOM   7350 C CB  . VAL B 2 390 ? 23.667  -12.044 137.291 1.00 24.65  ? 390 VAL B CB  1 
ATOM   7351 C CG1 . VAL B 2 390 ? 22.208  -12.293 137.501 1.00 22.13  ? 390 VAL B CG1 1 
ATOM   7352 C CG2 . VAL B 2 390 ? 24.059  -10.692 137.874 1.00 23.70  ? 390 VAL B CG2 1 
ATOM   7353 N N   . ALA B 2 391 ? 26.103  -13.417 136.116 1.00 21.08  ? 391 ALA B N   1 
ATOM   7354 C CA  . ALA B 2 391 ? 27.395  -13.343 135.474 1.00 19.53  ? 391 ALA B CA  1 
ATOM   7355 C C   . ALA B 2 391 ? 27.512  -12.160 134.512 1.00 21.36  ? 391 ALA B C   1 
ATOM   7356 O O   . ALA B 2 391 ? 26.613  -11.917 133.693 1.00 21.38  ? 391 ALA B O   1 
ATOM   7357 C CB  . ALA B 2 391 ? 27.644  -14.621 134.726 1.00 17.50  ? 391 ALA B CB  1 
ATOM   7358 N N   . ILE B 2 392 ? 28.610  -11.415 134.626 1.00 19.81  ? 392 ILE B N   1 
ATOM   7359 C CA  . ILE B 2 392 ? 28.875  -10.318 133.704 1.00 20.15  ? 392 ILE B CA  1 
ATOM   7360 C C   . ILE B 2 392 ? 29.784  -10.994 132.693 1.00 20.20  ? 392 ILE B C   1 
ATOM   7361 O O   . ILE B 2 392 ? 30.828  -11.521 133.064 1.00 19.35  ? 392 ILE B O   1 
ATOM   7362 C CB  . ILE B 2 392 ? 29.637  -9.159  134.364 1.00 22.28  ? 392 ILE B CB  1 
ATOM   7363 C CG1 . ILE B 2 392 ? 28.809  -8.574  135.508 1.00 24.56  ? 392 ILE B CG1 1 
ATOM   7364 C CG2 . ILE B 2 392 ? 29.918  -8.074  133.331 1.00 21.13  ? 392 ILE B CG2 1 
ATOM   7365 C CD1 . ILE B 2 392 ? 27.443  -8.034  135.080 1.00 22.92  ? 392 ILE B CD1 1 
ATOM   7366 N N   . VAL B 2 393 ? 29.396  -10.984 131.424 1.00 20.29  ? 393 VAL B N   1 
ATOM   7367 C CA  . VAL B 2 393 ? 30.175  -11.672 130.405 1.00 21.60  ? 393 VAL B CA  1 
ATOM   7368 C C   . VAL B 2 393 ? 30.540  -10.835 129.194 1.00 21.85  ? 393 VAL B C   1 
ATOM   7369 O O   . VAL B 2 393 ? 29.892  -9.832  128.904 1.00 24.39  ? 393 VAL B O   1 
ATOM   7370 C CB  . VAL B 2 393 ? 29.401  -12.931 129.885 1.00 23.66  ? 393 VAL B CB  1 
ATOM   7371 C CG1 . VAL B 2 393 ? 28.955  -13.790 131.042 1.00 21.77  ? 393 VAL B CG1 1 
ATOM   7372 C CG2 . VAL B 2 393 ? 28.178  -12.508 129.069 1.00 23.91  ? 393 VAL B CG2 1 
ATOM   7373 N N   . ARG B 2 394 ? 31.575  -11.277 128.485 1.00 21.44  ? 394 ARG B N   1 
ATOM   7374 C CA  . ARG B 2 394 ? 32.041  -10.632 127.263 1.00 22.94  ? 394 ARG B CA  1 
ATOM   7375 C C   . ARG B 2 394 ? 31.498  -11.467 126.106 1.00 25.16  ? 394 ARG B C   1 
ATOM   7376 O O   . ARG B 2 394 ? 31.783  -12.663 126.015 1.00 25.85  ? 394 ARG B O   1 
ATOM   7377 C CB  . ARG B 2 394 ? 33.560  -10.624 127.202 1.00 22.76  ? 394 ARG B CB  1 
ATOM   7378 C CG  . ARG B 2 394 ? 34.121  -10.206 125.846 1.00 24.35  ? 394 ARG B CG  1 
ATOM   7379 C CD  . ARG B 2 394 ? 35.633  -10.378 125.809 1.00 25.29  ? 394 ARG B CD  1 
ATOM   7380 N NE  . ARG B 2 394 ? 36.275  -9.306  125.062 1.00 27.10  ? 394 ARG B NE  1 
ATOM   7381 C CZ  . ARG B 2 394 ? 36.511  -9.336  123.757 1.00 30.97  ? 394 ARG B CZ  1 
ATOM   7382 N NH1 . ARG B 2 394 ? 36.170  -10.394 123.026 1.00 31.29  ? 394 ARG B NH1 1 
ATOM   7383 N NH2 . ARG B 2 394 ? 37.075  -8.288  123.178 1.00 34.45  ? 394 ARG B NH2 1 
ATOM   7384 N N   . TYR B 2 395 ? 30.734  -10.829 125.223 1.00 25.50  ? 395 TYR B N   1 
ATOM   7385 C CA  . TYR B 2 395 ? 30.114  -11.513 124.099 1.00 25.73  ? 395 TYR B CA  1 
ATOM   7386 C C   . TYR B 2 395 ? 30.612  -11.040 122.743 1.00 27.71  ? 395 TYR B C   1 
ATOM   7387 O O   . TYR B 2 395 ? 30.676  -9.845  122.475 1.00 28.60  ? 395 TYR B O   1 
ATOM   7388 C CB  . TYR B 2 395 ? 28.598  -11.306 124.167 1.00 24.61  ? 395 TYR B CB  1 
ATOM   7389 C CG  . TYR B 2 395 ? 27.819  -11.897 123.018 1.00 23.80  ? 395 TYR B CG  1 
ATOM   7390 C CD1 . TYR B 2 395 ? 27.582  -13.260 122.957 1.00 22.95  ? 395 TYR B CD1 1 
ATOM   7391 C CD2 . TYR B 2 395 ? 27.302  -11.088 121.999 1.00 23.54  ? 395 TYR B CD2 1 
ATOM   7392 C CE1 . TYR B 2 395 ? 26.854  -13.819 121.925 1.00 23.52  ? 395 TYR B CE1 1 
ATOM   7393 C CE2 . TYR B 2 395 ? 26.561  -11.641 120.949 1.00 23.24  ? 395 TYR B CE2 1 
ATOM   7394 C CZ  . TYR B 2 395 ? 26.341  -13.014 120.923 1.00 23.97  ? 395 TYR B CZ  1 
ATOM   7395 O OH  . TYR B 2 395 ? 25.609  -13.603 119.917 1.00 20.15  ? 395 TYR B OH  1 
ATOM   7396 N N   . ALA B 2 396 ? 30.949  -11.989 121.882 1.00 29.06  ? 396 ALA B N   1 
ATOM   7397 C CA  . ALA B 2 396 ? 31.398  -11.672 120.537 1.00 30.20  ? 396 ALA B CA  1 
ATOM   7398 C C   . ALA B 2 396 ? 30.825  -12.722 119.570 1.00 31.95  ? 396 ALA B C   1 
ATOM   7399 O O   . ALA B 2 396 ? 31.218  -13.895 119.603 1.00 30.49  ? 396 ALA B O   1 
ATOM   7400 C CB  . ALA B 2 396 ? 32.899  -11.667 120.487 1.00 29.57  ? 396 ALA B CB  1 
ATOM   7401 N N   . TYR B 2 397 ? 29.895  -12.293 118.715 1.00 33.10  ? 397 TYR B N   1 
ATOM   7402 C CA  . TYR B 2 397 ? 29.240  -13.185 117.756 1.00 34.29  ? 397 TYR B CA  1 
ATOM   7403 C C   . TYR B 2 397 ? 30.200  -13.918 116.802 1.00 36.39  ? 397 TYR B C   1 
ATOM   7404 O O   . TYR B 2 397 ? 30.235  -15.151 116.769 1.00 35.90  ? 397 TYR B O   1 
ATOM   7405 C CB  . TYR B 2 397 ? 28.190  -12.407 116.959 1.00 33.47  ? 397 TYR B CB  1 
ATOM   7406 C CG  . TYR B 2 397 ? 27.337  -13.291 116.071 1.00 36.30  ? 397 TYR B CG  1 
ATOM   7407 C CD1 . TYR B 2 397 ? 26.496  -14.259 116.619 1.00 35.33  ? 397 TYR B CD1 1 
ATOM   7408 C CD2 . TYR B 2 397 ? 27.381  -13.174 114.679 1.00 35.23  ? 397 TYR B CD2 1 
ATOM   7409 C CE1 . TYR B 2 397 ? 25.726  -15.083 115.813 1.00 33.16  ? 397 TYR B CE1 1 
ATOM   7410 C CE2 . TYR B 2 397 ? 26.609  -13.999 113.866 1.00 34.33  ? 397 TYR B CE2 1 
ATOM   7411 C CZ  . TYR B 2 397 ? 25.786  -14.946 114.439 1.00 33.96  ? 397 TYR B CZ  1 
ATOM   7412 O OH  . TYR B 2 397 ? 25.015  -15.745 113.631 1.00 35.37  ? 397 TYR B OH  1 
ATOM   7413 N N   . ASP B 2 398 ? 30.948  -13.168 116.000 1.00 38.05  ? 398 ASP B N   1 
ATOM   7414 C CA  . ASP B 2 398 ? 31.917  -13.769 115.094 1.00 38.99  ? 398 ASP B CA  1 
ATOM   7415 C C   . ASP B 2 398 ? 33.167  -12.922 115.136 1.00 41.54  ? 398 ASP B C   1 
ATOM   7416 O O   . ASP B 2 398 ? 33.239  -11.965 115.899 1.00 43.09  ? 398 ASP B O   1 
ATOM   7417 C CB  . ASP B 2 398 ? 31.385  -13.876 113.654 1.00 37.77  ? 398 ASP B CB  1 
ATOM   7418 C CG  . ASP B 2 398 ? 30.913  -12.557 113.088 1.00 37.66  ? 398 ASP B CG  1 
ATOM   7419 O OD1 . ASP B 2 398 ? 31.568  -11.524 113.343 1.00 39.79  ? 398 ASP B OD1 1 
ATOM   7420 O OD2 . ASP B 2 398 ? 29.892  -12.561 112.362 1.00 36.19  ? 398 ASP B OD2 1 
ATOM   7421 N N   . LYS B 2 399 ? 34.154  -13.282 114.329 1.00 43.94  ? 399 LYS B N   1 
ATOM   7422 C CA  . LYS B 2 399 ? 35.421  -12.565 114.270 1.00 45.01  ? 399 LYS B CA  1 
ATOM   7423 C C   . LYS B 2 399 ? 35.266  -11.086 113.962 1.00 44.30  ? 399 LYS B C   1 
ATOM   7424 O O   . LYS B 2 399 ? 35.908  -10.243 114.574 1.00 45.86  ? 399 LYS B O   1 
ATOM   7425 C CB  . LYS B 2 399 ? 36.333  -13.207 113.214 1.00 48.97  ? 399 LYS B CB  1 
ATOM   7426 C CG  . LYS B 2 399 ? 37.552  -12.361 112.846 1.00 54.22  ? 399 LYS B CG  1 
ATOM   7427 C CD  . LYS B 2 399 ? 38.660  -13.186 112.168 1.00 57.75  ? 399 LYS B CD  1 
ATOM   7428 C CE  . LYS B 2 399 ? 40.021  -12.450 112.228 1.00 58.00  ? 399 LYS B CE  1 
ATOM   7429 N NZ  . LYS B 2 399 ? 41.220  -13.361 112.181 1.00 56.78  ? 399 LYS B NZ  1 
ATOM   7430 N N   . ARG B 2 400 ? 34.411  -10.771 113.006 1.00 43.91  ? 400 ARG B N   1 
ATOM   7431 C CA  . ARG B 2 400 ? 34.205  -9.391  112.607 1.00 44.49  ? 400 ARG B CA  1 
ATOM   7432 C C   . ARG B 2 400 ? 33.309  -8.589  113.559 1.00 42.86  ? 400 ARG B C   1 
ATOM   7433 O O   . ARG B 2 400 ? 33.192  -7.370  113.446 1.00 43.16  ? 400 ARG B O   1 
ATOM   7434 C CB  . ARG B 2 400 ? 33.613  -9.369  111.197 1.00 46.87  ? 400 ARG B CB  1 
ATOM   7435 C CG  . ARG B 2 400 ? 33.644  -8.010  110.524 1.00 48.82  ? 400 ARG B CG  1 
ATOM   7436 C CD  . ARG B 2 400 ? 33.024  -8.106  109.168 1.00 50.26  ? 400 ARG B CD  1 
ATOM   7437 N NE  . ARG B 2 400 ? 33.289  -6.924  108.370 1.00 52.93  ? 400 ARG B NE  1 
ATOM   7438 C CZ  . ARG B 2 400 ? 33.020  -6.842  107.072 1.00 56.17  ? 400 ARG B CZ  1 
ATOM   7439 N NH1 . ARG B 2 400 ? 32.480  -7.879  106.440 1.00 57.61  ? 400 ARG B NH1 1 
ATOM   7440 N NH2 . ARG B 2 400 ? 33.291  -5.729  106.405 1.00 57.70  ? 400 ARG B NH2 1 
ATOM   7441 N N   . ALA B 2 401 ? 32.686  -9.270  114.506 1.00 41.25  ? 401 ALA B N   1 
ATOM   7442 C CA  . ALA B 2 401 ? 31.784  -8.610  115.443 1.00 39.91  ? 401 ALA B CA  1 
ATOM   7443 C C   . ALA B 2 401 ? 32.434  -7.695  116.492 1.00 38.19  ? 401 ALA B C   1 
ATOM   7444 O O   . ALA B 2 401 ? 33.580  -7.911  116.901 1.00 41.16  ? 401 ALA B O   1 
ATOM   7445 C CB  . ALA B 2 401 ? 30.938  -9.666  116.142 1.00 39.55  ? 401 ALA B CB  1 
ATOM   7446 N N   . ASN B 2 402 ? 31.695  -6.669  116.912 1.00 33.10  ? 402 ASN B N   1 
ATOM   7447 C CA  . ASN B 2 402 ? 32.162  -5.756  117.947 1.00 28.85  ? 402 ASN B CA  1 
ATOM   7448 C C   . ASN B 2 402 ? 31.890  -6.398  119.302 1.00 26.22  ? 402 ASN B C   1 
ATOM   7449 O O   . ASN B 2 402 ? 30.749  -6.705  119.624 1.00 26.71  ? 402 ASN B O   1 
ATOM   7450 C CB  . ASN B 2 402 ? 31.418  -4.430  117.871 1.00 29.52  ? 402 ASN B CB  1 
ATOM   7451 C CG  . ASN B 2 402 ? 31.989  -3.516  116.825 1.00 30.76  ? 402 ASN B CG  1 
ATOM   7452 O OD1 . ASN B 2 402 ? 33.201  -3.391  116.698 1.00 31.43  ? 402 ASN B OD1 1 
ATOM   7453 N ND2 . ASN B 2 402 ? 31.124  -2.858  116.074 1.00 34.46  ? 402 ASN B ND2 1 
ATOM   7454 N N   . PRO B 2 403 ? 32.929  -6.593  120.123 1.00 22.48  ? 403 PRO B N   1 
ATOM   7455 C CA  . PRO B 2 403 ? 32.709  -7.215  121.426 1.00 20.69  ? 403 PRO B CA  1 
ATOM   7456 C C   . PRO B 2 403 ? 31.658  -6.540  122.253 1.00 20.39  ? 403 PRO B C   1 
ATOM   7457 O O   . PRO B 2 403 ? 31.408  -5.358  122.121 1.00 20.47  ? 403 PRO B O   1 
ATOM   7458 C CB  . PRO B 2 403 ? 34.081  -7.159  122.076 1.00 19.94  ? 403 PRO B CB  1 
ATOM   7459 C CG  . PRO B 2 403 ? 34.663  -5.961  121.495 1.00 22.63  ? 403 PRO B CG  1 
ATOM   7460 C CD  . PRO B 2 403 ? 34.295  -6.071  120.034 1.00 22.15  ? 403 PRO B CD  1 
ATOM   7461 N N   . GLN B 2 404 ? 31.043  -7.319  123.119 1.00 21.47  ? 404 GLN B N   1 
ATOM   7462 C CA  . GLN B 2 404 ? 30.003  -6.822  123.993 1.00 20.03  ? 404 GLN B CA  1 
ATOM   7463 C C   . GLN B 2 404 ? 30.250  -7.281  125.407 1.00 19.55  ? 404 GLN B C   1 
ATOM   7464 O O   . GLN B 2 404 ? 30.927  -8.287  125.655 1.00 14.85  ? 404 GLN B O   1 
ATOM   7465 C CB  . GLN B 2 404 ? 28.653  -7.378  123.579 1.00 20.28  ? 404 GLN B CB  1 
ATOM   7466 C CG  . GLN B 2 404 ? 27.909  -6.585  122.583 1.00 20.30  ? 404 GLN B CG  1 
ATOM   7467 C CD  . GLN B 2 404 ? 26.748  -7.370  122.022 1.00 21.43  ? 404 GLN B CD  1 
ATOM   7468 O OE1 . GLN B 2 404 ? 25.946  -7.951  122.763 1.00 17.29  ? 404 GLN B OE1 1 
ATOM   7469 N NE2 . GLN B 2 404 ? 26.657  -7.402  120.700 1.00 22.66  ? 404 GLN B NE2 1 
ATOM   7470 N N   . VAL B 2 405 ? 29.659  -6.526  126.320 1.00 18.65  ? 405 VAL B N   1 
ATOM   7471 C CA  . VAL B 2 405 ? 29.694  -6.810  127.742 1.00 18.66  ? 405 VAL B CA  1 
ATOM   7472 C C   . VAL B 2 405 ? 28.218  -6.874  128.107 1.00 19.45  ? 405 VAL B C   1 
ATOM   7473 O O   . VAL B 2 405 ? 27.445  -5.977  127.767 1.00 17.99  ? 405 VAL B O   1 
ATOM   7474 C CB  . VAL B 2 405 ? 30.370  -5.681  128.508 1.00 19.25  ? 405 VAL B CB  1 
ATOM   7475 C CG1 . VAL B 2 405 ? 30.182  -5.864  129.983 1.00 18.49  ? 405 VAL B CG1 1 
ATOM   7476 C CG2 . VAL B 2 405 ? 31.841  -5.667  128.173 1.00 21.31  ? 405 VAL B CG2 1 
ATOM   7477 N N   . GLY B 2 406 ? 27.815  -7.952  128.761 1.00 19.13  ? 406 GLY B N   1 
ATOM   7478 C CA  . GLY B 2 406 ? 26.421  -8.084  129.130 1.00 19.00  ? 406 GLY B CA  1 
ATOM   7479 C C   . GLY B 2 406 ? 26.246  -8.988  130.328 1.00 19.11  ? 406 GLY B C   1 
ATOM   7480 O O   . GLY B 2 406 ? 27.225  -9.419  130.944 1.00 20.01  ? 406 GLY B O   1 
ATOM   7481 N N   . VAL B 2 407 ? 24.993  -9.284  130.644 1.00 16.68  ? 407 VAL B N   1 
ATOM   7482 C CA  . VAL B 2 407 ? 24.658  -10.125 131.776 1.00 15.71  ? 407 VAL B CA  1 
ATOM   7483 C C   . VAL B 2 407 ? 24.084  -11.478 131.343 1.00 17.61  ? 407 VAL B C   1 
ATOM   7484 O O   . VAL B 2 407 ? 23.442  -11.591 130.301 1.00 17.58  ? 407 VAL B O   1 
ATOM   7485 C CB  . VAL B 2 407 ? 23.605  -9.428  132.672 1.00 13.77  ? 407 VAL B CB  1 
ATOM   7486 C CG1 . VAL B 2 407 ? 22.413  -9.042  131.842 1.00 11.07  ? 407 VAL B CG1 1 
ATOM   7487 C CG2 . VAL B 2 407 ? 23.149  -10.357 133.785 1.00 14.01  ? 407 VAL B CG2 1 
ATOM   7488 N N   . ALA B 2 408 ? 24.344  -12.499 132.150 1.00 17.22  ? 408 ALA B N   1 
ATOM   7489 C CA  . ALA B 2 408 ? 23.802  -13.829 131.929 1.00 19.15  ? 408 ALA B CA  1 
ATOM   7490 C C   . ALA B 2 408 ? 23.203  -14.199 133.291 1.00 20.87  ? 408 ALA B C   1 
ATOM   7491 O O   . ALA B 2 408 ? 23.932  -14.443 134.254 1.00 18.73  ? 408 ALA B O   1 
ATOM   7492 C CB  . ALA B 2 408 ? 24.904  -14.809 131.531 1.00 20.15  ? 408 ALA B CB  1 
ATOM   7493 N N   . PHE B 2 409 ? 21.875  -14.191 133.383 1.00 23.12  ? 409 PHE B N   1 
ATOM   7494 C CA  . PHE B 2 409 ? 21.198  -14.512 134.638 1.00 25.38  ? 409 PHE B CA  1 
ATOM   7495 C C   . PHE B 2 409 ? 20.374  -15.788 134.543 1.00 28.73  ? 409 PHE B C   1 
ATOM   7496 O O   . PHE B 2 409 ? 19.812  -16.101 133.498 1.00 30.81  ? 409 PHE B O   1 
ATOM   7497 C CB  . PHE B 2 409 ? 20.316  -13.340 135.080 1.00 22.77  ? 409 PHE B CB  1 
ATOM   7498 C CG  . PHE B 2 409 ? 19.329  -12.870 134.040 1.00 22.34  ? 409 PHE B CG  1 
ATOM   7499 C CD1 . PHE B 2 409 ? 18.037  -13.373 134.004 1.00 23.25  ? 409 PHE B CD1 1 
ATOM   7500 C CD2 . PHE B 2 409 ? 19.677  -11.878 133.126 1.00 21.95  ? 409 PHE B CD2 1 
ATOM   7501 C CE1 . PHE B 2 409 ? 17.105  -12.883 133.078 1.00 22.55  ? 409 PHE B CE1 1 
ATOM   7502 C CE2 . PHE B 2 409 ? 18.755  -11.387 132.198 1.00 19.03  ? 409 PHE B CE2 1 
ATOM   7503 C CZ  . PHE B 2 409 ? 17.471  -11.887 132.174 1.00 19.33  ? 409 PHE B CZ  1 
ATOM   7504 N N   . PRO B 2 410 ? 20.299  -16.550 135.639 1.00 30.62  ? 410 PRO B N   1 
ATOM   7505 C CA  . PRO B 2 410 ? 19.539  -17.803 135.666 1.00 33.09  ? 410 PRO B CA  1 
ATOM   7506 C C   . PRO B 2 410 ? 18.060  -17.646 135.347 1.00 34.57  ? 410 PRO B C   1 
ATOM   7507 O O   . PRO B 2 410 ? 17.452  -16.616 135.643 1.00 35.31  ? 410 PRO B O   1 
ATOM   7508 C CB  . PRO B 2 410 ? 19.782  -18.327 137.080 1.00 32.94  ? 410 PRO B CB  1 
ATOM   7509 C CG  . PRO B 2 410 ? 19.952  -17.079 137.865 1.00 31.80  ? 410 PRO B CG  1 
ATOM   7510 C CD  . PRO B 2 410 ? 20.839  -16.240 136.969 1.00 30.75  ? 410 PRO B CD  1 
ATOM   7511 N N   . HIS B 2 411 ? 17.508  -18.693 134.741 1.00 35.53  ? 411 HIS B N   1 
ATOM   7512 C CA  . HIS B 2 411 ? 16.111  -18.768 134.322 1.00 36.10  ? 411 HIS B CA  1 
ATOM   7513 C C   . HIS B 2 411 ? 15.763  -20.252 134.438 1.00 38.19  ? 411 HIS B C   1 
ATOM   7514 O O   . HIS B 2 411 ? 16.179  -21.060 133.601 1.00 39.58  ? 411 HIS B O   1 
ATOM   7515 C CB  . HIS B 2 411 ? 16.005  -18.312 132.866 1.00 35.10  ? 411 HIS B CB  1 
ATOM   7516 C CG  . HIS B 2 411 ? 14.605  -18.261 132.336 1.00 36.48  ? 411 HIS B CG  1 
ATOM   7517 N ND1 . HIS B 2 411 ? 13.619  -17.483 132.903 1.00 39.08  ? 411 HIS B ND1 1 
ATOM   7518 C CD2 . HIS B 2 411 ? 14.045  -18.850 131.254 1.00 35.02  ? 411 HIS B CD2 1 
ATOM   7519 C CE1 . HIS B 2 411 ? 12.511  -17.592 132.188 1.00 35.80  ? 411 HIS B CE1 1 
ATOM   7520 N NE2 . HIS B 2 411 ? 12.744  -18.414 131.183 1.00 34.98  ? 411 HIS B NE2 1 
ATOM   7521 N N   . ILE B 2 412 ? 15.030  -20.619 135.484 1.00 39.42  ? 412 ILE B N   1 
ATOM   7522 C CA  . ILE B 2 412 ? 14.670  -22.017 135.700 1.00 39.21  ? 412 ILE B CA  1 
ATOM   7523 C C   . ILE B 2 412 ? 13.187  -22.234 135.504 1.00 40.92  ? 412 ILE B C   1 
ATOM   7524 O O   . ILE B 2 412 ? 12.370  -21.449 135.981 1.00 39.06  ? 412 ILE B O   1 
ATOM   7525 C CB  . ILE B 2 412 ? 15.025  -22.470 137.119 1.00 37.66  ? 412 ILE B CB  1 
ATOM   7526 C CG1 . ILE B 2 412 ? 16.475  -22.119 137.427 1.00 35.76  ? 412 ILE B CG1 1 
ATOM   7527 C CG2 . ILE B 2 412 ? 14.812  -23.970 137.257 1.00 36.57  ? 412 ILE B CG2 1 
ATOM   7528 C CD1 . ILE B 2 412 ? 16.776  -22.119 138.906 1.00 34.48  ? 412 ILE B CD1 1 
ATOM   7529 N N   . LYS B 2 413 ? 12.847  -23.311 134.806 1.00 44.74  ? 413 LYS B N   1 
ATOM   7530 C CA  . LYS B 2 413 ? 11.454  -23.635 134.537 1.00 49.40  ? 413 LYS B CA  1 
ATOM   7531 C C   . LYS B 2 413 ? 11.137  -25.118 134.650 1.00 51.87  ? 413 LYS B C   1 
ATOM   7532 O O   . LYS B 2 413 ? 11.985  -25.934 135.028 1.00 51.20  ? 413 LYS B O   1 
ATOM   7533 C CB  . LYS B 2 413 ? 11.048  -23.141 133.142 1.00 50.31  ? 413 LYS B CB  1 
ATOM   7534 C CG  . LYS B 2 413 ? 10.921  -21.634 133.040 1.00 52.67  ? 413 LYS B CG  1 
ATOM   7535 C CD  . LYS B 2 413 ? 9.994   -21.095 134.126 1.00 53.71  ? 413 LYS B CD  1 
ATOM   7536 C CE  . LYS B 2 413 ? 10.172  -19.596 134.318 1.00 55.64  ? 413 LYS B CE  1 
ATOM   7537 N NZ  . LYS B 2 413 ? 9.597   -19.125 135.616 1.00 55.66  ? 413 LYS B NZ  1 
ATOM   7538 N N   . HIS B 2 414 ? 9.895   -25.448 134.312 1.00 54.60  ? 414 HIS B N   1 
ATOM   7539 C CA  . HIS B 2 414 ? 9.412   -26.819 134.352 1.00 56.78  ? 414 HIS B CA  1 
ATOM   7540 C C   . HIS B 2 414 ? 10.153  -27.713 133.355 1.00 54.57  ? 414 HIS B C   1 
ATOM   7541 O O   . HIS B 2 414 ? 10.688  -28.756 133.729 1.00 53.29  ? 414 HIS B O   1 
ATOM   7542 C CB  . HIS B 2 414 ? 7.898   -26.850 134.055 1.00 62.01  ? 414 HIS B CB  1 
ATOM   7543 C CG  . HIS B 2 414 ? 7.305   -28.233 134.034 1.00 67.89  ? 414 HIS B CG  1 
ATOM   7544 N ND1 . HIS B 2 414 ? 7.664   -29.185 133.103 1.00 69.49  ? 414 HIS B ND1 1 
ATOM   7545 C CD2 . HIS B 2 414 ? 6.385   -28.823 134.839 1.00 69.60  ? 414 HIS B CD2 1 
ATOM   7546 C CE1 . HIS B 2 414 ? 6.993   -30.302 133.334 1.00 70.17  ? 414 HIS B CE1 1 
ATOM   7547 N NE2 . HIS B 2 414 ? 6.211   -30.109 134.381 1.00 70.92  ? 414 HIS B NE2 1 
ATOM   7548 N N   . ASN B 2 415 ? 10.195  -27.279 132.096 1.00 52.91  ? 415 ASN B N   1 
ATOM   7549 C CA  . ASN B 2 415 ? 10.814  -28.049 131.016 1.00 51.17  ? 415 ASN B CA  1 
ATOM   7550 C C   . ASN B 2 415 ? 12.301  -27.823 130.765 1.00 49.06  ? 415 ASN B C   1 
ATOM   7551 O O   . ASN B 2 415 ? 12.964  -28.663 130.148 1.00 48.84  ? 415 ASN B O   1 
ATOM   7552 C CB  . ASN B 2 415 ? 10.071  -27.775 129.704 1.00 53.77  ? 415 ASN B CB  1 
ATOM   7553 C CG  . ASN B 2 415 ? 8.572   -27.972 129.824 1.00 56.79  ? 415 ASN B CG  1 
ATOM   7554 O OD1 . ASN B 2 415 ? 8.049   -29.073 129.608 1.00 59.20  ? 415 ASN B OD1 1 
ATOM   7555 N ND2 . ASN B 2 415 ? 7.868   -26.900 130.179 1.00 57.90  ? 415 ASN B ND2 1 
ATOM   7556 N N   . TYR B 2 416 ? 12.841  -26.702 131.223 1.00 45.20  ? 416 TYR B N   1 
ATOM   7557 C CA  . TYR B 2 416 ? 14.239  -26.458 130.943 1.00 41.19  ? 416 TYR B CA  1 
ATOM   7558 C C   . TYR B 2 416 ? 14.892  -25.456 131.863 1.00 37.71  ? 416 TYR B C   1 
ATOM   7559 O O   . TYR B 2 416 ? 14.241  -24.858 132.714 1.00 36.39  ? 416 TYR B O   1 
ATOM   7560 C CB  . TYR B 2 416 ? 14.370  -26.000 129.492 1.00 44.73  ? 416 TYR B CB  1 
ATOM   7561 C CG  . TYR B 2 416 ? 13.662  -24.689 129.203 1.00 48.44  ? 416 TYR B CG  1 
ATOM   7562 C CD1 . TYR B 2 416 ? 14.306  -23.474 129.413 1.00 48.67  ? 416 TYR B CD1 1 
ATOM   7563 C CD2 . TYR B 2 416 ? 12.335  -24.661 128.760 1.00 50.07  ? 416 TYR B CD2 1 
ATOM   7564 C CE1 . TYR B 2 416 ? 13.658  -22.261 129.196 1.00 51.37  ? 416 TYR B CE1 1 
ATOM   7565 C CE2 . TYR B 2 416 ? 11.671  -23.444 128.543 1.00 52.54  ? 416 TYR B CE2 1 
ATOM   7566 C CZ  . TYR B 2 416 ? 12.344  -22.246 128.766 1.00 52.80  ? 416 TYR B CZ  1 
ATOM   7567 O OH  . TYR B 2 416 ? 11.716  -21.027 128.585 1.00 54.66  ? 416 TYR B OH  1 
ATOM   7568 N N   . GLU B 2 417 ? 16.196  -25.293 131.675 1.00 33.83  ? 417 GLU B N   1 
ATOM   7569 C CA  . GLU B 2 417 ? 16.999  -24.372 132.453 1.00 30.92  ? 417 GLU B CA  1 
ATOM   7570 C C   . GLU B 2 417 ? 17.995  -23.712 131.517 1.00 30.63  ? 417 GLU B C   1 
ATOM   7571 O O   . GLU B 2 417 ? 18.521  -24.351 130.604 1.00 28.70  ? 417 GLU B O   1 
ATOM   7572 C CB  . GLU B 2 417 ? 17.776  -25.115 133.520 1.00 31.45  ? 417 GLU B CB  1 
ATOM   7573 C CG  . GLU B 2 417 ? 16.973  -26.117 134.281 1.00 35.08  ? 417 GLU B CG  1 
ATOM   7574 C CD  . GLU B 2 417 ? 17.724  -26.667 135.476 1.00 34.64  ? 417 GLU B CD  1 
ATOM   7575 O OE1 . GLU B 2 417 ? 18.876  -27.131 135.311 1.00 34.75  ? 417 GLU B OE1 1 
ATOM   7576 O OE2 . GLU B 2 417 ? 17.149  -26.636 136.581 1.00 35.59  ? 417 GLU B OE2 1 
ATOM   7577 N N   . CYS B 2 418 ? 18.278  -22.436 131.753 1.00 29.70  ? 418 CYS B N   1 
ATOM   7578 C CA  . CYS B 2 418 ? 19.224  -21.731 130.900 1.00 27.55  ? 418 CYS B CA  1 
ATOM   7579 C C   . CYS B 2 418 ? 19.571  -20.366 131.466 1.00 26.06  ? 418 CYS B C   1 
ATOM   7580 O O   . CYS B 2 418 ? 19.035  -19.948 132.490 1.00 25.82  ? 418 CYS B O   1 
ATOM   7581 C CB  . CYS B 2 418 ? 18.620  -21.539 129.517 1.00 27.73  ? 418 CYS B CB  1 
ATOM   7582 S SG  . CYS B 2 418 ? 17.306  -20.313 129.530 1.00 28.27  ? 418 CYS B SG  1 
ATOM   7583 N N   . LEU B 2 419 ? 20.481  -19.680 130.783 1.00 24.06  ? 419 LEU B N   1 
ATOM   7584 C CA  . LEU B 2 419 ? 20.897  -18.332 131.165 1.00 21.61  ? 419 LEU B CA  1 
ATOM   7585 C C   . LEU B 2 419 ? 20.344  -17.385 130.108 1.00 20.06  ? 419 LEU B C   1 
ATOM   7586 O O   . LEU B 2 419 ? 20.338  -17.698 128.914 1.00 16.68  ? 419 LEU B O   1 
ATOM   7587 C CB  . LEU B 2 419 ? 22.424  -18.204 131.185 1.00 19.45  ? 419 LEU B CB  1 
ATOM   7588 C CG  . LEU B 2 419 ? 23.246  -19.045 132.159 1.00 19.04  ? 419 LEU B CG  1 
ATOM   7589 C CD1 . LEU B 2 419 ? 24.732  -18.943 131.827 1.00 16.58  ? 419 LEU B CD1 1 
ATOM   7590 C CD2 . LEU B 2 419 ? 22.985  -18.561 133.570 1.00 20.45  ? 419 LEU B CD2 1 
ATOM   7591 N N   . VAL B 2 420 ? 19.858  -16.234 130.548 1.00 19.68  ? 420 VAL B N   1 
ATOM   7592 C CA  . VAL B 2 420 ? 19.349  -15.257 129.605 1.00 18.85  ? 420 VAL B CA  1 
ATOM   7593 C C   . VAL B 2 420 ? 20.439  -14.246 129.433 1.00 18.52  ? 420 VAL B C   1 
ATOM   7594 O O   . VAL B 2 420 ? 20.843  -13.613 130.401 1.00 19.80  ? 420 VAL B O   1 
ATOM   7595 C CB  . VAL B 2 420 ? 18.132  -14.506 130.115 1.00 18.31  ? 420 VAL B CB  1 
ATOM   7596 C CG1 . VAL B 2 420 ? 17.696  -13.520 129.059 1.00 17.03  ? 420 VAL B CG1 1 
ATOM   7597 C CG2 . VAL B 2 420 ? 17.023  -15.463 130.433 1.00 16.48  ? 420 VAL B CG2 1 
ATOM   7598 N N   . TYR B 2 421 ? 20.937  -14.112 128.214 1.00 17.00  ? 421 TYR B N   1 
ATOM   7599 C CA  . TYR B 2 421 ? 21.975  -13.150 127.972 1.00 17.02  ? 421 TYR B CA  1 
ATOM   7600 C C   . TYR B 2 421 ? 21.328  -11.888 127.485 1.00 18.51  ? 421 TYR B C   1 
ATOM   7601 O O   . TYR B 2 421 ? 20.386  -11.942 126.695 1.00 20.36  ? 421 TYR B O   1 
ATOM   7602 C CB  . TYR B 2 421 ? 22.932  -13.619 126.895 1.00 20.31  ? 421 TYR B CB  1 
ATOM   7603 C CG  . TYR B 2 421 ? 23.862  -12.502 126.462 1.00 23.67  ? 421 TYR B CG  1 
ATOM   7604 C CD1 . TYR B 2 421 ? 24.957  -12.141 127.248 1.00 24.41  ? 421 TYR B CD1 1 
ATOM   7605 C CD2 . TYR B 2 421 ? 23.611  -11.764 125.303 1.00 23.03  ? 421 TYR B CD2 1 
ATOM   7606 C CE1 . TYR B 2 421 ? 25.781  -11.072 126.899 1.00 25.99  ? 421 TYR B CE1 1 
ATOM   7607 C CE2 . TYR B 2 421 ? 24.430  -10.693 124.943 1.00 25.71  ? 421 TYR B CE2 1 
ATOM   7608 C CZ  . TYR B 2 421 ? 25.517  -10.351 125.751 1.00 26.32  ? 421 TYR B CZ  1 
ATOM   7609 O OH  . TYR B 2 421 ? 26.341  -9.294  125.426 1.00 25.59  ? 421 TYR B OH  1 
ATOM   7610 N N   . VAL B 2 422 ? 21.827  -10.754 127.958 1.00 17.92  ? 422 VAL B N   1 
ATOM   7611 C CA  . VAL B 2 422 ? 21.324  -9.457  127.529 1.00 16.74  ? 422 VAL B CA  1 
ATOM   7612 C C   . VAL B 2 422 ? 22.481  -8.484  127.617 1.00 17.70  ? 422 VAL B C   1 
ATOM   7613 O O   . VAL B 2 422 ? 23.166  -8.409  128.634 1.00 17.64  ? 422 VAL B O   1 
ATOM   7614 C CB  . VAL B 2 422 ? 20.195  -8.923  128.422 1.00 16.34  ? 422 VAL B CB  1 
ATOM   7615 C CG1 . VAL B 2 422 ? 19.557  -7.725  127.750 1.00 18.47  ? 422 VAL B CG1 1 
ATOM   7616 C CG2 . VAL B 2 422 ? 19.162  -9.980  128.675 1.00 13.69  ? 422 VAL B CG2 1 
ATOM   7617 N N   . GLN B 2 423 ? 22.711  -7.738  126.552 1.00 19.53  ? 423 GLN B N   1 
ATOM   7618 C CA  . GLN B 2 423 ? 23.808  -6.783  126.557 1.00 21.52  ? 423 GLN B CA  1 
ATOM   7619 C C   . GLN B 2 423 ? 23.667  -5.652  127.582 1.00 22.35  ? 423 GLN B C   1 
ATOM   7620 O O   . GLN B 2 423 ? 22.577  -5.133  127.813 1.00 21.71  ? 423 GLN B O   1 
ATOM   7621 C CB  . GLN B 2 423 ? 23.980  -6.190  125.162 1.00 19.79  ? 423 GLN B CB  1 
ATOM   7622 C CG  . GLN B 2 423 ? 24.874  -4.984  125.130 1.00 19.25  ? 423 GLN B CG  1 
ATOM   7623 C CD  . GLN B 2 423 ? 25.307  -4.636  123.734 1.00 19.77  ? 423 GLN B CD  1 
ATOM   7624 O OE1 . GLN B 2 423 ? 24.525  -4.723  122.788 1.00 21.12  ? 423 GLN B OE1 1 
ATOM   7625 N NE2 . GLN B 2 423 ? 26.560  -4.233  123.591 1.00 19.42  ? 423 GLN B NE2 1 
ATOM   7626 N N   . LEU B 2 424 ? 24.785  -5.294  128.207 1.00 23.66  ? 424 LEU B N   1 
ATOM   7627 C CA  . LEU B 2 424 ? 24.813  -4.203  129.176 1.00 24.34  ? 424 LEU B CA  1 
ATOM   7628 C C   . LEU B 2 424 ? 25.489  -3.021  128.473 1.00 25.33  ? 424 LEU B C   1 
ATOM   7629 O O   . LEU B 2 424 ? 25.945  -3.153  127.337 1.00 27.96  ? 424 LEU B O   1 
ATOM   7630 C CB  . LEU B 2 424 ? 25.592  -4.621  130.419 1.00 22.89  ? 424 LEU B CB  1 
ATOM   7631 C CG  . LEU B 2 424 ? 24.915  -5.621  131.357 1.00 21.90  ? 424 LEU B CG  1 
ATOM   7632 C CD1 . LEU B 2 424 ? 25.891  -5.969  132.478 1.00 20.69  ? 424 LEU B CD1 1 
ATOM   7633 C CD2 . LEU B 2 424 ? 23.622  -5.032  131.919 1.00 16.05  ? 424 LEU B CD2 1 
ATOM   7634 N N   . PRO B 2 425 ? 25.584  -1.859  129.135 1.00 24.38  ? 425 PRO B N   1 
ATOM   7635 C CA  . PRO B 2 425 ? 26.210  -0.703  128.498 1.00 23.96  ? 425 PRO B CA  1 
ATOM   7636 C C   . PRO B 2 425 ? 27.691  -0.475  128.709 1.00 23.65  ? 425 PRO B C   1 
ATOM   7637 O O   . PRO B 2 425 ? 28.268  -0.918  129.694 1.00 26.01  ? 425 PRO B O   1 
ATOM   7638 C CB  . PRO B 2 425 ? 25.426  0.449   129.089 1.00 23.09  ? 425 PRO B CB  1 
ATOM   7639 C CG  . PRO B 2 425 ? 25.321  0.035   130.476 1.00 21.37  ? 425 PRO B CG  1 
ATOM   7640 C CD  . PRO B 2 425 ? 24.897  -1.433  130.364 1.00 24.68  ? 425 PRO B CD  1 
ATOM   7641 N N   . PHE B 2 426 ? 28.292  0.246   127.770 1.00 22.68  ? 426 PHE B N   1 
ATOM   7642 C CA  . PHE B 2 426 ? 29.684  0.661   127.871 1.00 21.17  ? 426 PHE B CA  1 
ATOM   7643 C C   . PHE B 2 426 ? 29.562  2.067   128.478 1.00 21.31  ? 426 PHE B C   1 
ATOM   7644 O O   . PHE B 2 426 ? 28.506  2.691   128.363 1.00 17.77  ? 426 PHE B O   1 
ATOM   7645 C CB  . PHE B 2 426 ? 30.311  0.752   126.487 1.00 20.35  ? 426 PHE B CB  1 
ATOM   7646 C CG  . PHE B 2 426 ? 30.817  -0.545  125.969 1.00 17.86  ? 426 PHE B CG  1 
ATOM   7647 C CD1 . PHE B 2 426 ? 30.524  -0.943  124.675 1.00 17.42  ? 426 PHE B CD1 1 
ATOM   7648 C CD2 . PHE B 2 426 ? 31.616  -1.363  126.759 1.00 17.33  ? 426 PHE B CD2 1 
ATOM   7649 C CE1 . PHE B 2 426 ? 31.020  -2.136  124.170 1.00 15.42  ? 426 PHE B CE1 1 
ATOM   7650 C CE2 . PHE B 2 426 ? 32.115  -2.561  126.255 1.00 15.81  ? 426 PHE B CE2 1 
ATOM   7651 C CZ  . PHE B 2 426 ? 31.815  -2.942  124.962 1.00 15.20  ? 426 PHE B CZ  1 
ATOM   7652 N N   . MET B 2 427 ? 30.614  2.564   129.123 1.00 23.10  ? 427 MET B N   1 
ATOM   7653 C CA  . MET B 2 427 ? 30.573  3.898   129.740 1.00 25.40  ? 427 MET B CA  1 
ATOM   7654 C C   . MET B 2 427 ? 30.108  5.026   128.802 1.00 25.01  ? 427 MET B C   1 
ATOM   7655 O O   . MET B 2 427 ? 29.269  5.843   129.181 1.00 24.15  ? 427 MET B O   1 
ATOM   7656 C CB  . MET B 2 427 ? 31.947  4.257   130.314 1.00 29.27  ? 427 MET B CB  1 
ATOM   7657 C CG  . MET B 2 427 ? 32.064  5.706   130.797 1.00 35.72  ? 427 MET B CG  1 
ATOM   7658 S SD  . MET B 2 427 ? 33.278  6.665   129.822 1.00 42.74  ? 427 MET B SD  1 
ATOM   7659 C CE  . MET B 2 427 ? 32.268  8.102   129.256 1.00 41.38  ? 427 MET B CE  1 
ATOM   7660 N N   . GLU B 2 428 ? 30.648  5.066   127.587 1.00 23.60  ? 428 GLU B N   1 
ATOM   7661 C CA  . GLU B 2 428 ? 30.286  6.092   126.618 1.00 25.13  ? 428 GLU B CA  1 
ATOM   7662 C C   . GLU B 2 428 ? 28.822  6.046   126.196 1.00 26.11  ? 428 GLU B C   1 
ATOM   7663 O O   . GLU B 2 428 ? 28.383  6.902   125.431 1.00 26.67  ? 428 GLU B O   1 
ATOM   7664 C CB  . GLU B 2 428 ? 31.128  5.975   125.351 1.00 27.17  ? 428 GLU B CB  1 
ATOM   7665 C CG  . GLU B 2 428 ? 32.625  5.913   125.557 1.00 32.61  ? 428 GLU B CG  1 
ATOM   7666 C CD  . GLU B 2 428 ? 33.115  4.517   125.901 1.00 36.32  ? 428 GLU B CD  1 
ATOM   7667 O OE1 . GLU B 2 428 ? 34.332  4.249   125.747 1.00 37.54  ? 428 GLU B OE1 1 
ATOM   7668 O OE2 . GLU B 2 428 ? 32.284  3.687   126.332 1.00 39.88  ? 428 GLU B OE2 1 
ATOM   7669 N N   . ASP B 2 429 ? 28.076  5.042   126.658 1.00 25.73  ? 429 ASP B N   1 
ATOM   7670 C CA  . ASP B 2 429 ? 26.662  4.931   126.303 1.00 25.62  ? 429 ASP B CA  1 
ATOM   7671 C C   . ASP B 2 429 ? 25.845  5.610   127.386 1.00 26.12  ? 429 ASP B C   1 
ATOM   7672 O O   . ASP B 2 429 ? 24.654  5.888   127.201 1.00 26.69  ? 429 ASP B O   1 
ATOM   7673 C CB  . ASP B 2 429 ? 26.186  3.466   126.218 1.00 25.57  ? 429 ASP B CB  1 
ATOM   7674 C CG  . ASP B 2 429 ? 26.954  2.635   125.199 1.00 28.73  ? 429 ASP B CG  1 
ATOM   7675 O OD1 . ASP B 2 429 ? 27.298  3.158   124.120 1.00 25.92  ? 429 ASP B OD1 1 
ATOM   7676 O OD2 . ASP B 2 429 ? 27.191  1.433   125.474 1.00 31.18  ? 429 ASP B OD2 1 
ATOM   7677 N N   . LEU B 2 430 ? 26.482  5.869   128.523 1.00 24.51  ? 430 LEU B N   1 
ATOM   7678 C CA  . LEU B 2 430 ? 25.778  6.471   129.641 1.00 25.04  ? 430 LEU B CA  1 
ATOM   7679 C C   . LEU B 2 430 ? 25.576  7.987   129.531 1.00 27.11  ? 430 LEU B C   1 
ATOM   7680 O O   . LEU B 2 430 ? 26.513  8.761   129.367 1.00 26.64  ? 430 LEU B O   1 
ATOM   7681 C CB  . LEU B 2 430 ? 26.496  6.114   130.958 1.00 23.10  ? 430 LEU B CB  1 
ATOM   7682 C CG  . LEU B 2 430 ? 26.636  4.635   131.370 1.00 20.96  ? 430 LEU B CG  1 
ATOM   7683 C CD1 . LEU B 2 430 ? 27.350  4.484   132.714 1.00 17.37  ? 430 LEU B CD1 1 
ATOM   7684 C CD2 . LEU B 2 430 ? 25.259  4.021   131.460 1.00 21.49  ? 430 LEU B CD2 1 
ATOM   7685 N N   . ARG B 2 431 ? 24.327  8.402   129.598 1.00 29.91  ? 431 ARG B N   1 
ATOM   7686 C CA  . ARG B 2 431 ? 24.009  9.810   129.539 1.00 34.49  ? 431 ARG B CA  1 
ATOM   7687 C C   . ARG B 2 431 ? 23.419  10.077  130.910 1.00 37.89  ? 431 ARG B C   1 
ATOM   7688 O O   . ARG B 2 431 ? 22.271  9.724   131.194 1.00 38.72  ? 431 ARG B O   1 
ATOM   7689 C CB  . ARG B 2 431 ? 22.997  10.101  128.431 1.00 34.33  ? 431 ARG B CB  1 
ATOM   7690 C CG  . ARG B 2 431 ? 23.547  9.960   127.016 1.00 37.26  ? 431 ARG B CG  1 
ATOM   7691 C CD  . ARG B 2 431 ? 22.534  10.521  126.040 1.00 44.55  ? 431 ARG B CD  1 
ATOM   7692 N NE  . ARG B 2 431 ? 22.825  10.223  124.637 1.00 50.28  ? 431 ARG B NE  1 
ATOM   7693 C CZ  . ARG B 2 431 ? 22.075  10.644  123.613 1.00 51.26  ? 431 ARG B CZ  1 
ATOM   7694 N NH1 . ARG B 2 431 ? 20.990  11.382  123.838 1.00 51.50  ? 431 ARG B NH1 1 
ATOM   7695 N NH2 . ARG B 2 431 ? 22.403  10.326  122.365 1.00 50.74  ? 431 ARG B NH2 1 
ATOM   7696 N N   . GLN B 2 432 ? 24.236  10.680  131.767 1.00 40.57  ? 432 GLN B N   1 
ATOM   7697 C CA  . GLN B 2 432 ? 23.850  10.970  133.139 1.00 42.67  ? 432 GLN B CA  1 
ATOM   7698 C C   . GLN B 2 432 ? 23.401  12.410  133.349 1.00 42.56  ? 432 GLN B C   1 
ATOM   7699 O O   . GLN B 2 432 ? 24.210  13.337  133.394 1.00 42.49  ? 432 GLN B O   1 
ATOM   7700 C CB  . GLN B 2 432 ? 25.020  10.651  134.076 1.00 45.46  ? 432 GLN B CB  1 
ATOM   7701 C CG  . GLN B 2 432 ? 25.868  9.476   133.593 1.00 47.95  ? 432 GLN B CG  1 
ATOM   7702 C CD  . GLN B 2 432 ? 26.730  8.877   134.683 1.00 49.17  ? 432 GLN B CD  1 
ATOM   7703 O OE1 . GLN B 2 432 ? 26.221  8.363   135.685 1.00 50.87  ? 432 GLN B OE1 1 
ATOM   7704 N NE2 . GLN B 2 432 ? 28.041  8.934   134.495 1.00 49.74  ? 432 GLN B NE2 1 
ATOM   7705 N N   . TYR B 2 433 ? 22.094  12.573  133.484 1.00 41.23  ? 433 TYR B N   1 
ATOM   7706 C CA  . TYR B 2 433 ? 21.471  13.857  133.709 1.00 39.15  ? 433 TYR B CA  1 
ATOM   7707 C C   . TYR B 2 433 ? 20.921  13.763  135.110 1.00 38.48  ? 433 TYR B C   1 
ATOM   7708 O O   . TYR B 2 433 ? 20.440  12.704  135.498 1.00 37.34  ? 433 TYR B O   1 
ATOM   7709 C CB  . TYR B 2 433 ? 20.293  14.041  132.758 1.00 39.92  ? 433 TYR B CB  1 
ATOM   7710 C CG  . TYR B 2 433 ? 20.646  13.995  131.299 1.00 40.51  ? 433 TYR B CG  1 
ATOM   7711 C CD1 . TYR B 2 433 ? 19.694  13.625  130.349 1.00 41.07  ? 433 TYR B CD1 1 
ATOM   7712 C CD2 . TYR B 2 433 ? 21.917  14.354  130.857 1.00 41.81  ? 433 TYR B CD2 1 
ATOM   7713 C CE1 . TYR B 2 433 ? 19.996  13.611  128.987 1.00 40.81  ? 433 TYR B CE1 1 
ATOM   7714 C CE2 . TYR B 2 433 ? 22.232  14.348  129.493 1.00 42.87  ? 433 TYR B CE2 1 
ATOM   7715 C CZ  . TYR B 2 433 ? 21.264  13.974  128.565 1.00 42.28  ? 433 TYR B CZ  1 
ATOM   7716 O OH  . TYR B 2 433 ? 21.573  13.963  127.223 1.00 43.44  ? 433 TYR B OH  1 
ATOM   7717 N N   . MET B 2 434 ? 20.980  14.850  135.871 1.00 38.03  ? 434 MET B N   1 
ATOM   7718 C CA  . MET B 2 434 ? 20.418  14.832  137.216 1.00 38.46  ? 434 MET B CA  1 
ATOM   7719 C C   . MET B 2 434 ? 18.986  15.364  137.101 1.00 38.34  ? 434 MET B C   1 
ATOM   7720 O O   . MET B 2 434 ? 18.689  16.145  136.199 1.00 38.05  ? 434 MET B O   1 
ATOM   7721 C CB  . MET B 2 434 ? 21.241  15.715  138.161 1.00 39.24  ? 434 MET B CB  1 
ATOM   7722 C CG  . MET B 2 434 ? 22.742  15.520  138.033 1.00 43.48  ? 434 MET B CG  1 
ATOM   7723 S SD  . MET B 2 434 ? 23.672  15.946  139.535 1.00 46.35  ? 434 MET B SD  1 
ATOM   7724 C CE  . MET B 2 434 ? 23.124  17.663  139.811 1.00 48.53  ? 434 MET B CE  1 
ATOM   7725 N N   . PHE B 2 435 ? 18.098  14.924  137.991 1.00 37.85  ? 435 PHE B N   1 
ATOM   7726 C CA  . PHE B 2 435 ? 16.708  15.378  137.981 1.00 38.04  ? 435 PHE B CA  1 
ATOM   7727 C C   . PHE B 2 435 ? 16.299  15.732  139.404 1.00 39.35  ? 435 PHE B C   1 
ATOM   7728 O O   . PHE B 2 435 ? 16.746  15.092  140.351 1.00 39.09  ? 435 PHE B O   1 
ATOM   7729 C CB  . PHE B 2 435 ? 15.770  14.290  137.432 1.00 36.99  ? 435 PHE B CB  1 
ATOM   7730 C CG  . PHE B 2 435 ? 15.879  14.074  135.939 1.00 36.43  ? 435 PHE B CG  1 
ATOM   7731 C CD1 . PHE B 2 435 ? 16.996  13.448  135.388 1.00 36.22  ? 435 PHE B CD1 1 
ATOM   7732 C CD2 . PHE B 2 435 ? 14.856  14.496  135.084 1.00 35.61  ? 435 PHE B CD2 1 
ATOM   7733 C CE1 . PHE B 2 435 ? 17.096  13.249  134.008 1.00 35.98  ? 435 PHE B CE1 1 
ATOM   7734 C CE2 . PHE B 2 435 ? 14.945  14.302  133.709 1.00 33.56  ? 435 PHE B CE2 1 
ATOM   7735 C CZ  . PHE B 2 435 ? 16.063  13.678  133.168 1.00 34.75  ? 435 PHE B CZ  1 
ATOM   7736 N N   . SER B 2 436 ? 15.438  16.735  139.549 1.00 41.71  ? 436 SER B N   1 
ATOM   7737 C CA  . SER B 2 436 ? 14.985  17.196  140.864 1.00 44.17  ? 436 SER B CA  1 
ATOM   7738 C C   . SER B 2 436 ? 14.025  16.293  141.616 1.00 45.64  ? 436 SER B C   1 
ATOM   7739 O O   . SER B 2 436 ? 12.954  15.958  141.117 1.00 45.81  ? 436 SER B O   1 
ATOM   7740 C CB  . SER B 2 436 ? 14.328  18.571  140.743 1.00 44.51  ? 436 SER B CB  1 
ATOM   7741 O OG  . SER B 2 436 ? 15.193  19.487  140.103 1.00 48.40  ? 436 SER B OG  1 
ATOM   7742 N N   . SER B 2 437 ? 14.399  15.926  142.836 1.00 47.96  ? 437 SER B N   1 
ATOM   7743 C CA  . SER B 2 437 ? 13.537  15.091  143.657 1.00 50.62  ? 437 SER B CA  1 
ATOM   7744 C C   . SER B 2 437 ? 12.167  15.728  143.666 1.00 52.85  ? 437 SER B C   1 
ATOM   7745 O O   . SER B 2 437 ? 12.033  16.932  143.866 1.00 53.44  ? 437 SER B O   1 
ATOM   7746 C CB  . SER B 2 437 ? 14.044  15.008  145.098 1.00 50.88  ? 437 SER B CB  1 
ATOM   7747 O OG  . SER B 2 437 ? 15.131  14.108  145.233 1.00 52.38  ? 437 SER B OG  1 
ATOM   7748 N N   . LEU B 2 438 ? 11.147  14.921  143.432 1.00 55.50  ? 438 LEU B N   1 
ATOM   7749 C CA  . LEU B 2 438 ? 9.790   15.427  143.438 1.00 58.12  ? 438 LEU B CA  1 
ATOM   7750 C C   . LEU B 2 438 ? 9.175   15.178  144.813 1.00 60.31  ? 438 LEU B C   1 
ATOM   7751 O O   . LEU B 2 438 ? 8.161   15.782  145.177 1.00 59.83  ? 438 LEU B O   1 
ATOM   7752 C CB  . LEU B 2 438 ? 8.982   14.726  142.352 1.00 57.83  ? 438 LEU B CB  1 
ATOM   7753 C CG  . LEU B 2 438 ? 9.418   15.070  140.930 1.00 57.94  ? 438 LEU B CG  1 
ATOM   7754 C CD1 . LEU B 2 438 ? 8.767   14.112  139.941 1.00 58.32  ? 438 LEU B CD1 1 
ATOM   7755 C CD2 . LEU B 2 438 ? 9.042   16.512  140.625 1.00 57.24  ? 438 LEU B CD2 1 
ATOM   7756 N N   . LYS B 2 439 ? 9.811   14.292  145.577 1.00 63.39  ? 439 LYS B N   1 
ATOM   7757 C CA  . LYS B 2 439 ? 9.341   13.949  146.917 1.00 66.70  ? 439 LYS B CA  1 
ATOM   7758 C C   . LYS B 2 439 ? 9.597   15.086  147.914 1.00 68.47  ? 439 LYS B C   1 
ATOM   7759 O O   . LYS B 2 439 ? 8.723   15.468  148.697 1.00 67.35  ? 439 LYS B O   1 
ATOM   7760 C CB  . LYS B 2 439 ? 10.033  12.665  147.408 1.00 66.83  ? 439 LYS B CB  1 
ATOM   7761 C CG  . LYS B 2 439 ? 9.501   12.171  148.755 1.00 69.64  ? 439 LYS B CG  1 
ATOM   7762 C CD  . LYS B 2 439 ? 10.215  10.934  149.287 1.00 70.43  ? 439 LYS B CD  1 
ATOM   7763 C CE  . LYS B 2 439 ? 9.587   10.488  150.609 1.00 70.88  ? 439 LYS B CE  1 
ATOM   7764 N NZ  . LYS B 2 439 ? 10.239  9.283   151.205 1.00 71.82  ? 439 LYS B NZ  1 
ATOM   7765 N N   . ASN B 2 440 ? 10.806  15.626  147.867 1.00 71.21  ? 440 ASN B N   1 
ATOM   7766 C CA  . ASN B 2 440 ? 11.207  16.697  148.762 1.00 73.23  ? 440 ASN B CA  1 
ATOM   7767 C C   . ASN B 2 440 ? 10.784  18.061  148.244 1.00 73.54  ? 440 ASN B C   1 
ATOM   7768 O O   . ASN B 2 440 ? 11.152  19.089  148.818 1.00 73.96  ? 440 ASN B O   1 
ATOM   7769 C CB  . ASN B 2 440 ? 12.720  16.653  148.941 1.00 75.46  ? 440 ASN B CB  1 
ATOM   7770 C CG  . ASN B 2 440 ? 13.230  15.237  149.132 1.00 77.65  ? 440 ASN B CG  1 
ATOM   7771 O OD1 . ASN B 2 440 ? 12.657  14.463  149.906 1.00 78.48  ? 440 ASN B OD1 1 
ATOM   7772 N ND2 . ASN B 2 440 ? 14.306  14.887  148.427 1.00 78.21  ? 440 ASN B ND2 1 
ATOM   7773 N N   . SER B 2 441 ? 10.014  18.069  147.158 1.00 73.18  ? 441 SER B N   1 
ATOM   7774 C CA  . SER B 2 441 ? 9.540   19.318  146.571 1.00 72.60  ? 441 SER B CA  1 
ATOM   7775 C C   . SER B 2 441 ? 8.340   19.834  147.329 1.00 72.33  ? 441 SER B C   1 
ATOM   7776 O O   . SER B 2 441 ? 7.280   19.214  147.301 1.00 72.92  ? 441 SER B O   1 
ATOM   7777 C CB  . SER B 2 441 ? 9.135   19.125  145.110 1.00 72.34  ? 441 SER B CB  1 
ATOM   7778 O OG  . SER B 2 441 ? 8.390   20.242  144.644 1.00 70.32  ? 441 SER B OG  1 
ATOM   7779 N N   . LYS B 2 442 ? 8.503   20.964  148.007 1.00 71.50  ? 442 LYS B N   1 
ATOM   7780 C CA  . LYS B 2 442 ? 7.399   21.552  148.750 1.00 71.18  ? 442 LYS B CA  1 
ATOM   7781 C C   . LYS B 2 442 ? 6.509   22.274  147.754 1.00 70.11  ? 442 LYS B C   1 
ATOM   7782 O O   . LYS B 2 442 ? 5.334   22.538  148.012 1.00 69.78  ? 442 LYS B O   1 
ATOM   7783 C CB  . LYS B 2 442 ? 7.924   22.533  149.802 1.00 72.64  ? 442 LYS B CB  1 
ATOM   7784 C CG  . LYS B 2 442 ? 8.912   21.898  150.773 1.00 74.12  ? 442 LYS B CG  1 
ATOM   7785 C CD  . LYS B 2 442 ? 8.365   20.581  151.342 1.00 74.55  ? 442 LYS B CD  1 
ATOM   7786 C CE  . LYS B 2 442 ? 9.462   19.751  152.006 1.00 74.32  ? 442 LYS B CE  1 
ATOM   7787 N NZ  . LYS B 2 442 ? 9.026   18.353  152.291 1.00 72.85  ? 442 LYS B NZ  1 
ATOM   7788 N N   . LYS B 2 443 ? 7.084   22.573  146.597 1.00 69.27  ? 443 LYS B N   1 
ATOM   7789 C CA  . LYS B 2 443 ? 6.367   23.266  145.543 1.00 68.76  ? 443 LYS B CA  1 
ATOM   7790 C C   . LYS B 2 443 ? 5.327   22.369  144.861 1.00 67.54  ? 443 LYS B C   1 
ATOM   7791 O O   . LYS B 2 443 ? 4.241   22.837  144.516 1.00 67.14  ? 443 LYS B O   1 
ATOM   7792 C CB  . LYS B 2 443 ? 7.375   23.810  144.522 1.00 69.88  ? 443 LYS B CB  1 
ATOM   7793 C CG  . LYS B 2 443 ? 8.458   24.685  145.169 1.00 72.01  ? 443 LYS B CG  1 
ATOM   7794 C CD  . LYS B 2 443 ? 9.479   25.226  144.157 1.00 72.97  ? 443 LYS B CD  1 
ATOM   7795 C CE  . LYS B 2 443 ? 10.467  26.201  144.821 1.00 71.91  ? 443 LYS B CE  1 
ATOM   7796 N NZ  . LYS B 2 443 ? 11.533  26.709  143.896 1.00 70.99  ? 443 LYS B NZ  1 
ATOM   7797 N N   . TYR B 2 444 ? 5.642   21.082  144.692 1.00 65.69  ? 444 TYR B N   1 
ATOM   7798 C CA  . TYR B 2 444 ? 4.726   20.148  144.023 1.00 63.60  ? 444 TYR B CA  1 
ATOM   7799 C C   . TYR B 2 444 ? 4.083   19.039  144.858 1.00 63.56  ? 444 TYR B C   1 
ATOM   7800 O O   . TYR B 2 444 ? 3.114   18.419  144.412 1.00 63.83  ? 444 TYR B O   1 
ATOM   7801 C CB  . TYR B 2 444 ? 5.426   19.485  142.831 1.00 59.95  ? 444 TYR B CB  1 
ATOM   7802 C CG  . TYR B 2 444 ? 5.892   20.451  141.781 1.00 55.87  ? 444 TYR B CG  1 
ATOM   7803 C CD1 . TYR B 2 444 ? 7.247   20.681  141.583 1.00 55.66  ? 444 TYR B CD1 1 
ATOM   7804 C CD2 . TYR B 2 444 ? 4.983   21.144  140.990 1.00 53.84  ? 444 TYR B CD2 1 
ATOM   7805 C CE1 . TYR B 2 444 ? 7.690   21.582  140.619 1.00 54.79  ? 444 TYR B CE1 1 
ATOM   7806 C CE2 . TYR B 2 444 ? 5.414   22.048  140.021 1.00 53.64  ? 444 TYR B CE2 1 
ATOM   7807 C CZ  . TYR B 2 444 ? 6.770   22.262  139.842 1.00 53.93  ? 444 TYR B CZ  1 
ATOM   7808 O OH  . TYR B 2 444 ? 7.214   23.149  138.888 1.00 54.04  ? 444 TYR B OH  1 
ATOM   7809 N N   . ALA B 2 445 ? 4.617   18.771  146.045 1.00 63.40  ? 445 ALA B N   1 
ATOM   7810 C CA  . ALA B 2 445 ? 4.076   17.708  146.892 1.00 63.75  ? 445 ALA B CA  1 
ATOM   7811 C C   . ALA B 2 445 ? 2.547   17.676  146.861 1.00 63.73  ? 445 ALA B C   1 
ATOM   7812 O O   . ALA B 2 445 ? 1.888   18.683  147.123 1.00 64.50  ? 445 ALA B O   1 
ATOM   7813 C CB  . ALA B 2 445 ? 4.574   17.869  148.328 1.00 63.51  ? 445 ALA B CB  1 
ATOM   7814 N N   . PRO B 2 446 ? 1.964   16.517  146.519 1.00 63.48  ? 446 PRO B N   1 
ATOM   7815 C CA  . PRO B 2 446 ? 0.507   16.370  146.457 1.00 63.17  ? 446 PRO B CA  1 
ATOM   7816 C C   . PRO B 2 446 ? -0.140  16.257  147.845 1.00 62.53  ? 446 PRO B C   1 
ATOM   7817 O O   . PRO B 2 446 ? 0.493   15.809  148.800 1.00 61.72  ? 446 PRO B O   1 
ATOM   7818 C CB  . PRO B 2 446 ? 0.334   15.106  145.617 1.00 62.98  ? 446 PRO B CB  1 
ATOM   7819 C CG  . PRO B 2 446 ? 1.506   14.280  146.035 1.00 62.51  ? 446 PRO B CG  1 
ATOM   7820 C CD  . PRO B 2 446 ? 2.631   15.297  146.027 1.00 63.59  ? 446 PRO B CD  1 
ATOM   7821 N N   . THR B 2 447 ? -1.402  16.665  147.941 1.00 62.22  ? 447 THR B N   1 
ATOM   7822 C CA  . THR B 2 447 ? -2.145  16.630  149.197 1.00 62.66  ? 447 THR B CA  1 
ATOM   7823 C C   . THR B 2 447 ? -2.634  15.230  149.515 1.00 63.97  ? 447 THR B C   1 
ATOM   7824 O O   . THR B 2 447 ? -2.475  14.313  148.715 1.00 65.61  ? 447 THR B O   1 
ATOM   7825 C CB  . THR B 2 447 ? -3.384  17.533  149.139 1.00 62.13  ? 447 THR B CB  1 
ATOM   7826 O OG1 . THR B 2 447 ? -4.317  17.001  148.192 1.00 61.88  ? 447 THR B OG1 1 
ATOM   7827 C CG2 . THR B 2 447 ? -3.001  18.938  148.718 1.00 62.08  ? 447 THR B CG2 1 
ATOM   7828 N N   . GLU B 2 448 ? -3.240  15.071  150.686 1.00 64.97  ? 448 GLU B N   1 
ATOM   7829 C CA  . GLU B 2 448 ? -3.768  13.779  151.088 1.00 65.84  ? 448 GLU B CA  1 
ATOM   7830 C C   . GLU B 2 448 ? -5.038  13.547  150.267 1.00 64.70  ? 448 GLU B C   1 
ATOM   7831 O O   . GLU B 2 448 ? -5.416  12.414  149.982 1.00 64.51  ? 448 GLU B O   1 
ATOM   7832 C CB  . GLU B 2 448 ? -4.066  13.788  152.593 1.00 69.18  ? 448 GLU B CB  1 
ATOM   7833 C CG  . GLU B 2 448 ? -4.508  12.447  153.204 1.00 75.23  ? 448 GLU B CG  1 
ATOM   7834 C CD  . GLU B 2 448 ? -3.496  11.312  153.002 1.00 78.57  ? 448 GLU B CD  1 
ATOM   7835 O OE1 . GLU B 2 448 ? -2.273  11.574  153.088 1.00 79.63  ? 448 GLU B OE1 1 
ATOM   7836 O OE2 . GLU B 2 448 ? -3.926  10.152  152.773 1.00 79.79  ? 448 GLU B OE2 1 
ATOM   7837 N N   . ALA B 2 449 ? -5.685  14.636  149.870 1.00 63.49  ? 449 ALA B N   1 
ATOM   7838 C CA  . ALA B 2 449 ? -6.898  14.547  149.069 1.00 62.61  ? 449 ALA B CA  1 
ATOM   7839 C C   . ALA B 2 449 ? -6.518  14.039  147.681 1.00 62.13  ? 449 ALA B C   1 
ATOM   7840 O O   . ALA B 2 449 ? -7.263  13.289  147.038 1.00 61.79  ? 449 ALA B O   1 
ATOM   7841 C CB  . ALA B 2 449 ? -7.551  15.920  148.962 1.00 62.57  ? 449 ALA B CB  1 
ATOM   7842 N N   . GLN B 2 450 ? -5.340  14.460  147.233 1.00 60.76  ? 450 GLN B N   1 
ATOM   7843 C CA  . GLN B 2 450 ? -4.828  14.081  145.927 1.00 58.55  ? 450 GLN B CA  1 
ATOM   7844 C C   . GLN B 2 450 ? -4.279  12.662  145.897 1.00 57.86  ? 450 GLN B C   1 
ATOM   7845 O O   . GLN B 2 450 ? -4.521  11.927  144.944 1.00 57.95  ? 450 GLN B O   1 
ATOM   7846 C CB  . GLN B 2 450 ? -3.748  15.067  145.487 1.00 56.77  ? 450 GLN B CB  1 
ATOM   7847 C CG  . GLN B 2 450 ? -4.285  16.455  145.187 1.00 55.63  ? 450 GLN B CG  1 
ATOM   7848 C CD  . GLN B 2 450 ? -3.213  17.412  144.707 1.00 54.83  ? 450 GLN B CD  1 
ATOM   7849 O OE1 . GLN B 2 450 ? -2.180  17.587  145.357 1.00 54.50  ? 450 GLN B OE1 1 
ATOM   7850 N NE2 . GLN B 2 450 ? -3.457  18.046  143.566 1.00 53.75  ? 450 GLN B NE2 1 
ATOM   7851 N N   . LEU B 2 451 ? -3.547  12.271  146.936 1.00 56.72  ? 451 LEU B N   1 
ATOM   7852 C CA  . LEU B 2 451 ? -2.977  10.929  146.983 1.00 56.49  ? 451 LEU B CA  1 
ATOM   7853 C C   . LEU B 2 451 ? -4.020  9.823   146.947 1.00 56.84  ? 451 LEU B C   1 
ATOM   7854 O O   . LEU B 2 451 ? -3.970  8.946   146.087 1.00 57.69  ? 451 LEU B O   1 
ATOM   7855 C CB  . LEU B 2 451 ? -2.113  10.750  148.225 1.00 55.70  ? 451 LEU B CB  1 
ATOM   7856 C CG  . LEU B 2 451 ? -0.774  11.477  148.187 1.00 55.37  ? 451 LEU B CG  1 
ATOM   7857 C CD1 . LEU B 2 451 ? -0.005  11.193  149.462 1.00 54.46  ? 451 LEU B CD1 1 
ATOM   7858 C CD2 . LEU B 2 451 ? 0.014   11.024  146.968 1.00 56.12  ? 451 LEU B CD2 1 
ATOM   7859 N N   . ASN B 2 452 ? -4.961  9.856   147.880 1.00 56.58  ? 452 ASN B N   1 
ATOM   7860 C CA  . ASN B 2 452 ? -5.986  8.829   147.926 1.00 56.36  ? 452 ASN B CA  1 
ATOM   7861 C C   . ASN B 2 452 ? -6.780  8.841   146.637 1.00 55.96  ? 452 ASN B C   1 
ATOM   7862 O O   . ASN B 2 452 ? -7.312  7.815   146.219 1.00 54.81  ? 452 ASN B O   1 
ATOM   7863 C CB  . ASN B 2 452 ? -6.907  9.054   149.120 1.00 57.02  ? 452 ASN B CB  1 
ATOM   7864 C CG  . ASN B 2 452 ? -6.140  9.175   150.423 1.00 58.49  ? 452 ASN B CG  1 
ATOM   7865 O OD1 . ASN B 2 452 ? -5.334  8.308   150.771 1.00 59.37  ? 452 ASN B OD1 1 
ATOM   7866 N ND2 . ASN B 2 452 ? -6.385  10.257  151.152 1.00 59.38  ? 452 ASN B ND2 1 
ATOM   7867 N N   . ALA B 2 453 ? -6.851  10.007  146.002 1.00 56.27  ? 453 ALA B N   1 
ATOM   7868 C CA  . ALA B 2 453 ? -7.583  10.139  144.745 1.00 56.71  ? 453 ALA B CA  1 
ATOM   7869 C C   . ALA B 2 453 ? -6.953  9.231   143.686 1.00 56.23  ? 453 ALA B C   1 
ATOM   7870 O O   . ALA B 2 453 ? -7.657  8.530   142.953 1.00 54.63  ? 453 ALA B O   1 
ATOM   7871 C CB  . ALA B 2 453 ? -7.568  11.599  144.276 1.00 58.18  ? 453 ALA B CB  1 
ATOM   7872 N N   . VAL B 2 454 ? -5.622  9.256   143.624 1.00 55.93  ? 454 VAL B N   1 
ATOM   7873 C CA  . VAL B 2 454 ? -4.850  8.441   142.692 1.00 54.98  ? 454 VAL B CA  1 
ATOM   7874 C C   . VAL B 2 454 ? -4.894  6.984   143.143 1.00 56.17  ? 454 VAL B C   1 
ATOM   7875 O O   . VAL B 2 454 ? -5.043  6.073   142.323 1.00 56.69  ? 454 VAL B O   1 
ATOM   7876 C CB  . VAL B 2 454 ? -3.390  8.926   142.634 1.00 53.71  ? 454 VAL B CB  1 
ATOM   7877 C CG1 . VAL B 2 454 ? -2.491  7.861   142.029 1.00 53.51  ? 454 VAL B CG1 1 
ATOM   7878 C CG2 . VAL B 2 454 ? -3.314  10.197  141.815 1.00 52.14  ? 454 VAL B CG2 1 
ATOM   7879 N N   . ASP B 2 455 ? -4.764  6.773   144.452 1.00 56.67  ? 455 ASP B N   1 
ATOM   7880 C CA  . ASP B 2 455 ? -4.808  5.431   145.031 1.00 56.95  ? 455 ASP B CA  1 
ATOM   7881 C C   . ASP B 2 455 ? -6.108  4.777   144.578 1.00 56.21  ? 455 ASP B C   1 
ATOM   7882 O O   . ASP B 2 455 ? -6.159  3.570   144.359 1.00 56.40  ? 455 ASP B O   1 
ATOM   7883 C CB  . ASP B 2 455 ? -4.758  5.507   146.572 1.00 58.75  ? 455 ASP B CB  1 
ATOM   7884 C CG  . ASP B 2 455 ? -4.734  4.127   147.244 1.00 60.00  ? 455 ASP B CG  1 
ATOM   7885 O OD1 . ASP B 2 455 ? -5.721  3.369   147.101 1.00 60.24  ? 455 ASP B OD1 1 
ATOM   7886 O OD2 . ASP B 2 455 ? -3.729  3.803   147.924 1.00 60.13  ? 455 ASP B OD2 1 
ATOM   7887 N N   . ALA B 2 456 ? -7.153  5.589   144.430 1.00 55.24  ? 456 ALA B N   1 
ATOM   7888 C CA  . ALA B 2 456 ? -8.458  5.100   143.998 1.00 53.45  ? 456 ALA B CA  1 
ATOM   7889 C C   . ALA B 2 456 ? -8.392  4.664   142.539 1.00 52.19  ? 456 ALA B C   1 
ATOM   7890 O O   . ALA B 2 456 ? -8.838  3.573   142.175 1.00 52.42  ? 456 ALA B O   1 
ATOM   7891 C CB  . ALA B 2 456 ? -9.501  6.197   144.160 1.00 53.43  ? 456 ALA B CB  1 
ATOM   7892 N N   . LEU B 2 457 ? -7.831  5.538   141.713 1.00 49.79  ? 457 LEU B N   1 
ATOM   7893 C CA  . LEU B 2 457 ? -7.689  5.289   140.283 1.00 47.30  ? 457 LEU B CA  1 
ATOM   7894 C C   . LEU B 2 457 ? -6.909  4.017   139.977 1.00 45.39  ? 457 LEU B C   1 
ATOM   7895 O O   . LEU B 2 457 ? -7.380  3.137   139.246 1.00 43.18  ? 457 LEU B O   1 
ATOM   7896 C CB  . LEU B 2 457 ? -6.979  6.463   139.628 1.00 47.33  ? 457 LEU B CB  1 
ATOM   7897 C CG  . LEU B 2 457 ? -6.810  6.267   138.133 1.00 47.73  ? 457 LEU B CG  1 
ATOM   7898 C CD1 . LEU B 2 457 ? -8.180  6.141   137.504 1.00 49.58  ? 457 LEU B CD1 1 
ATOM   7899 C CD2 . LEU B 2 457 ? -6.052  7.426   137.541 1.00 49.08  ? 457 LEU B CD2 1 
ATOM   7900 N N   . ILE B 2 458 ? -5.703  3.940   140.528 1.00 43.20  ? 458 ILE B N   1 
ATOM   7901 C CA  . ILE B 2 458 ? -4.860  2.783   140.321 1.00 42.06  ? 458 ILE B CA  1 
ATOM   7902 C C   . ILE B 2 458 ? -5.629  1.507   140.647 1.00 43.45  ? 458 ILE B C   1 
ATOM   7903 O O   . ILE B 2 458 ? -5.578  0.547   139.889 1.00 43.69  ? 458 ILE B O   1 
ATOM   7904 C CB  . ILE B 2 458 ? -3.579  2.909   141.150 1.00 39.01  ? 458 ILE B CB  1 
ATOM   7905 C CG1 . ILE B 2 458 ? -2.748  4.061   140.580 1.00 35.75  ? 458 ILE B CG1 1 
ATOM   7906 C CG2 . ILE B 2 458 ? -2.796  1.613   141.121 1.00 36.36  ? 458 ILE B CG2 1 
ATOM   7907 C CD1 . ILE B 2 458 ? -1.487  4.356   141.334 1.00 33.83  ? 458 ILE B CD1 1 
ATOM   7908 N N   . ASP B 2 459 ? -6.361  1.501   141.755 1.00 46.13  ? 459 ASP B N   1 
ATOM   7909 C CA  . ASP B 2 459 ? -7.160  0.327   142.120 1.00 48.94  ? 459 ASP B CA  1 
ATOM   7910 C C   . ASP B 2 459 ? -8.179  -0.047  141.034 1.00 49.69  ? 459 ASP B C   1 
ATOM   7911 O O   . ASP B 2 459 ? -8.277  -1.209  140.623 1.00 50.25  ? 459 ASP B O   1 
ATOM   7912 C CB  . ASP B 2 459 ? -7.919  0.574   143.423 1.00 50.74  ? 459 ASP B CB  1 
ATOM   7913 C CG  . ASP B 2 459 ? -7.088  0.278   144.644 1.00 53.36  ? 459 ASP B CG  1 
ATOM   7914 O OD1 . ASP B 2 459 ? -6.336  -0.718  144.605 1.00 54.96  ? 459 ASP B OD1 1 
ATOM   7915 O OD2 . ASP B 2 459 ? -7.196  1.024   145.645 1.00 55.20  ? 459 ASP B OD2 1 
ATOM   7916 N N   . SER B 2 460 ? -8.937  0.946   140.580 1.00 49.27  ? 460 SER B N   1 
ATOM   7917 C CA  . SER B 2 460 ? -9.960  0.733   139.568 1.00 48.46  ? 460 SER B CA  1 
ATOM   7918 C C   . SER B 2 460 ? -9.396  0.304   138.223 1.00 48.87  ? 460 SER B C   1 
ATOM   7919 O O   . SER B 2 460 ? -10.007 -0.501  137.516 1.00 48.63  ? 460 SER B O   1 
ATOM   7920 C CB  . SER B 2 460 ? -10.783 2.008   139.392 1.00 48.10  ? 460 SER B CB  1 
ATOM   7921 O OG  . SER B 2 460 ? -9.945  3.105   139.075 1.00 49.22  ? 460 SER B OG  1 
ATOM   7922 N N   . MET B 2 461 ? -8.231  0.835   137.864 1.00 48.45  ? 461 MET B N   1 
ATOM   7923 C CA  . MET B 2 461 ? -7.634  0.493   136.585 1.00 47.02  ? 461 MET B CA  1 
ATOM   7924 C C   . MET B 2 461 ? -6.664  -0.668  136.632 1.00 45.88  ? 461 MET B C   1 
ATOM   7925 O O   . MET B 2 461 ? -5.769  -0.768  135.797 1.00 44.00  ? 461 MET B O   1 
ATOM   7926 C CB  . MET B 2 461 ? -6.958  1.715   135.982 1.00 48.10  ? 461 MET B CB  1 
ATOM   7927 C CG  . MET B 2 461 ? -7.939  2.804   135.638 1.00 49.48  ? 461 MET B CG  1 
ATOM   7928 S SD  . MET B 2 461 ? -7.413  3.639   134.157 1.00 50.11  ? 461 MET B SD  1 
ATOM   7929 C CE  . MET B 2 461 ? -6.330  4.808   134.850 1.00 51.35  ? 461 MET B CE  1 
ATOM   7930 N N   . SER B 2 462 ? -6.848  -1.549  137.609 1.00 46.38  ? 462 SER B N   1 
ATOM   7931 C CA  . SER B 2 462 ? -6.000  -2.724  137.735 1.00 47.94  ? 462 SER B CA  1 
ATOM   7932 C C   . SER B 2 462 ? -6.233  -3.646  136.534 1.00 48.33  ? 462 SER B C   1 
ATOM   7933 O O   . SER B 2 462 ? -7.374  -3.967  136.194 1.00 49.80  ? 462 SER B O   1 
ATOM   7934 C CB  . SER B 2 462 ? -6.322  -3.475  139.027 1.00 47.34  ? 462 SER B CB  1 
ATOM   7935 O OG  . SER B 2 462 ? -5.599  -4.691  139.096 1.00 47.93  ? 462 SER B OG  1 
ATOM   7936 N N   . LEU B 2 463 ? -5.151  -4.063  135.892 1.00 47.68  ? 463 LEU B N   1 
ATOM   7937 C CA  . LEU B 2 463 ? -5.245  -4.939  134.737 1.00 47.87  ? 463 LEU B CA  1 
ATOM   7938 C C   . LEU B 2 463 ? -4.876  -6.345  135.177 1.00 49.51  ? 463 LEU B C   1 
ATOM   7939 O O   . LEU B 2 463 ? -4.242  -7.099  134.437 1.00 49.68  ? 463 LEU B O   1 
ATOM   7940 C CB  . LEU B 2 463 ? -4.301  -4.460  133.628 1.00 44.63  ? 463 LEU B CB  1 
ATOM   7941 C CG  . LEU B 2 463 ? -4.595  -3.070  133.051 1.00 42.22  ? 463 LEU B CG  1 
ATOM   7942 C CD1 . LEU B 2 463 ? -3.569  -2.737  131.999 1.00 40.50  ? 463 LEU B CD1 1 
ATOM   7943 C CD2 . LEU B 2 463 ? -5.997  -3.030  132.457 1.00 39.80  ? 463 LEU B CD2 1 
ATOM   7944 N N   . ALA B 2 464 ? -5.272  -6.689  136.396 1.00 51.08  ? 464 ALA B N   1 
ATOM   7945 C CA  . ALA B 2 464 ? -4.988  -8.008  136.934 1.00 54.51  ? 464 ALA B CA  1 
ATOM   7946 C C   . ALA B 2 464 ? -5.993  -8.372  138.008 1.00 57.08  ? 464 ALA B C   1 
ATOM   7947 O O   . ALA B 2 464 ? -6.739  -7.520  138.493 1.00 57.21  ? 464 ALA B O   1 
ATOM   7948 C CB  . ALA B 2 464 ? -3.585  -8.046  137.508 1.00 53.15  ? 464 ALA B CB  1 
ATOM   7949 N N   . LYS B 2 465 ? -6.016  -9.649  138.373 1.00 61.15  ? 465 LYS B N   1 
ATOM   7950 C CA  . LYS B 2 465 ? -6.922  -10.110 139.408 1.00 65.34  ? 465 LYS B CA  1 
ATOM   7951 C C   . LYS B 2 465 ? -6.530  -11.422 140.076 1.00 68.06  ? 465 LYS B C   1 
ATOM   7952 O O   . LYS B 2 465 ? -6.169  -12.391 139.410 1.00 66.92  ? 465 LYS B O   1 
ATOM   7953 C CB  . LYS B 2 465 ? -8.343  -10.267 138.871 1.00 65.36  ? 465 LYS B CB  1 
ATOM   7954 C CG  . LYS B 2 465 ? -9.275  -10.692 139.989 1.00 68.05  ? 465 LYS B CG  1 
ATOM   7955 C CD  . LYS B 2 465 ? -10.604 -11.253 139.533 1.00 69.90  ? 465 LYS B CD  1 
ATOM   7956 C CE  . LYS B 2 465 ? -11.378 -11.756 140.756 1.00 69.82  ? 465 LYS B CE  1 
ATOM   7957 N NZ  . LYS B 2 465 ? -12.706 -12.346 140.429 1.00 70.74  ? 465 LYS B NZ  1 
ATOM   7958 N N   . LYS B 2 466 ? -6.615  -11.438 141.404 1.00 72.79  ? 466 LYS B N   1 
ATOM   7959 C CA  . LYS B 2 466 ? -6.328  -12.637 142.182 1.00 77.85  ? 466 LYS B CA  1 
ATOM   7960 C C   . LYS B 2 466 ? -7.607  -13.459 142.057 1.00 81.86  ? 466 LYS B C   1 
ATOM   7961 O O   . LYS B 2 466 ? -8.502  -13.376 142.903 1.00 81.99  ? 466 LYS B O   1 
ATOM   7962 C CB  . LYS B 2 466 ? -6.079  -12.277 143.644 1.00 77.23  ? 466 LYS B CB  1 
ATOM   7963 C CG  . LYS B 2 466 ? -4.971  -11.265 143.862 1.00 76.27  ? 466 LYS B CG  1 
ATOM   7964 C CD  . LYS B 2 466 ? -4.767  -11.028 145.347 1.00 75.94  ? 466 LYS B CD  1 
ATOM   7965 C CE  . LYS B 2 466 ? -3.637  -10.055 145.612 1.00 75.52  ? 466 LYS B CE  1 
ATOM   7966 N NZ  . LYS B 2 466 ? -3.390  -9.900  147.072 1.00 74.71  ? 466 LYS B NZ  1 
ATOM   7967 N N   . ASP B 2 467 ? -7.686  -14.239 140.983 1.00 86.94  ? 467 ASP B N   1 
ATOM   7968 C CA  . ASP B 2 467 ? -8.865  -15.049 140.680 1.00 91.72  ? 467 ASP B CA  1 
ATOM   7969 C C   . ASP B 2 467 ? -8.647  -16.548 140.912 1.00 94.14  ? 467 ASP B C   1 
ATOM   7970 O O   . ASP B 2 467 ? -7.708  -16.954 141.605 1.00 95.29  ? 467 ASP B O   1 
ATOM   7971 C CB  . ASP B 2 467 ? -9.271  -14.800 139.212 1.00 92.98  ? 467 ASP B CB  1 
ATOM   7972 C CG  . ASP B 2 467 ? -10.633 -15.393 138.854 1.00 93.84  ? 467 ASP B CG  1 
ATOM   7973 O OD1 . ASP B 2 467 ? -11.660 -14.901 139.370 1.00 93.27  ? 467 ASP B OD1 1 
ATOM   7974 O OD2 . ASP B 2 467 ? -10.672 -16.352 138.050 1.00 94.33  ? 467 ASP B OD2 1 
ATOM   7975 N N   . GLU B 2 468 ? -9.542  -17.343 140.323 1.00 95.87  ? 468 GLU B N   1 
ATOM   7976 C CA  . GLU B 2 468 ? -9.548  -18.804 140.377 1.00 97.30  ? 468 GLU B CA  1 
ATOM   7977 C C   . GLU B 2 468 ? -8.763  -19.472 141.515 1.00 98.29  ? 468 GLU B C   1 
ATOM   7978 O O   . GLU B 2 468 ? -9.249  -19.547 142.654 1.00 98.06  ? 468 GLU B O   1 
ATOM   7979 C CB  . GLU B 2 468 ? -9.084  -19.354 139.025 1.00 97.73  ? 468 GLU B CB  1 
ATOM   7980 C CG  . GLU B 2 468 ? -9.212  -20.858 138.893 1.00 99.13  ? 468 GLU B CG  1 
ATOM   7981 C CD  . GLU B 2 468 ? -9.799  -21.271 137.559 1.00 100.26 ? 468 GLU B CD  1 
ATOM   7982 O OE1 . GLU B 2 468 ? -9.229  -20.885 136.513 1.00 100.78 ? 468 GLU B OE1 1 
ATOM   7983 O OE2 . GLU B 2 468 ? -10.831 -21.982 137.558 1.00 100.78 ? 468 GLU B OE2 1 
ATOM   7984 N N   . LYS B 2 469 ? -7.570  -19.980 141.196 1.00 98.65  ? 469 LYS B N   1 
ATOM   7985 C CA  . LYS B 2 469 ? -6.717  -20.643 142.183 1.00 98.09  ? 469 LYS B CA  1 
ATOM   7986 C C   . LYS B 2 469 ? -6.300  -19.603 143.213 1.00 97.62  ? 469 LYS B C   1 
ATOM   7987 O O   . LYS B 2 469 ? -5.115  -19.301 143.356 1.00 97.30  ? 469 LYS B O   1 
ATOM   7988 C CB  . LYS B 2 469 ? -5.488  -21.246 141.490 1.00 97.87  ? 469 LYS B CB  1 
ATOM   7989 C CG  . LYS B 2 469 ? -5.847  -22.295 140.441 1.00 98.28  ? 469 LYS B CG  1 
ATOM   7990 C CD  . LYS B 2 469 ? -4.650  -22.726 139.609 1.00 99.13  ? 469 LYS B CD  1 
ATOM   7991 C CE  . LYS B 2 469 ? -5.085  -23.680 138.498 1.00 99.70  ? 469 LYS B CE  1 
ATOM   7992 N NZ  . LYS B 2 469 ? -3.985  -23.975 137.531 1.00 100.51 ? 469 LYS B NZ  1 
ATOM   7993 N N   . THR B 2 470 ? -7.308  -19.071 143.909 1.00 97.11  ? 470 THR B N   1 
ATOM   7994 C CA  . THR B 2 470 ? -7.192  -18.033 144.938 1.00 96.27  ? 470 THR B CA  1 
ATOM   7995 C C   . THR B 2 470 ? -5.826  -17.372 145.142 1.00 95.37  ? 470 THR B C   1 
ATOM   7996 O O   . THR B 2 470 ? -5.727  -16.142 145.170 1.00 95.72  ? 470 THR B O   1 
ATOM   7997 C CB  . THR B 2 470 ? -7.701  -18.557 146.294 1.00 96.40  ? 470 THR B CB  1 
ATOM   7998 O OG1 . THR B 2 470 ? -7.026  -19.778 146.626 1.00 96.99  ? 470 THR B OG1 1 
ATOM   7999 C CG2 . THR B 2 470 ? -9.203  -18.806 146.225 1.00 96.26  ? 470 THR B CG2 1 
ATOM   8000 N N   . ASP B 2 471 ? -4.783  -18.184 145.285 1.00 93.38  ? 471 ASP B N   1 
ATOM   8001 C CA  . ASP B 2 471 ? -3.426  -17.687 145.488 1.00 90.24  ? 471 ASP B CA  1 
ATOM   8002 C C   . ASP B 2 471 ? -2.737  -17.448 144.148 1.00 87.34  ? 471 ASP B C   1 
ATOM   8003 O O   . ASP B 2 471 ? -1.511  -17.476 144.066 1.00 87.22  ? 471 ASP B O   1 
ATOM   8004 C CB  . ASP B 2 471 ? -2.628  -18.710 146.291 1.00 91.85  ? 471 ASP B CB  1 
ATOM   8005 C CG  . ASP B 2 471 ? -3.516  -19.566 147.188 1.00 94.13  ? 471 ASP B CG  1 
ATOM   8006 O OD1 . ASP B 2 471 ? -4.298  -18.992 147.982 1.00 95.17  ? 471 ASP B OD1 1 
ATOM   8007 O OD2 . ASP B 2 471 ? -3.437  -20.814 147.098 1.00 94.33  ? 471 ASP B OD2 1 
ATOM   8008 N N   . THR B 2 472 ? -3.530  -17.212 143.104 1.00 83.55  ? 472 THR B N   1 
ATOM   8009 C CA  . THR B 2 472 ? -3.004  -16.989 141.756 1.00 79.48  ? 472 THR B CA  1 
ATOM   8010 C C   . THR B 2 472 ? -3.367  -15.628 141.160 1.00 75.61  ? 472 THR B C   1 
ATOM   8011 O O   . THR B 2 472 ? -4.443  -15.089 141.422 1.00 75.39  ? 472 THR B O   1 
ATOM   8012 C CB  . THR B 2 472 ? -3.493  -18.098 140.794 1.00 80.68  ? 472 THR B CB  1 
ATOM   8013 O OG1 . THR B 2 472 ? -2.761  -19.303 141.048 1.00 81.74  ? 472 THR B OG1 1 
ATOM   8014 C CG2 . THR B 2 472 ? -3.302  -17.688 139.340 1.00 81.03  ? 472 THR B CG2 1 
ATOM   8015 N N   . LEU B 2 473 ? -2.463  -15.089 140.346 1.00 70.51  ? 473 LEU B N   1 
ATOM   8016 C CA  . LEU B 2 473 ? -2.681  -13.799 139.706 1.00 66.62  ? 473 LEU B CA  1 
ATOM   8017 C C   . LEU B 2 473 ? -2.952  -13.972 138.209 1.00 65.43  ? 473 LEU B C   1 
ATOM   8018 O O   . LEU B 2 473 ? -2.227  -14.691 137.528 1.00 65.74  ? 473 LEU B O   1 
ATOM   8019 C CB  . LEU B 2 473 ? -1.460  -12.910 139.914 1.00 63.01  ? 473 LEU B CB  1 
ATOM   8020 C CG  . LEU B 2 473 ? -1.639  -11.430 139.590 1.00 60.18  ? 473 LEU B CG  1 
ATOM   8021 C CD1 . LEU B 2 473 ? -2.718  -10.828 140.464 1.00 58.77  ? 473 LEU B CD1 1 
ATOM   8022 C CD2 . LEU B 2 473 ? -0.334  -10.719 139.822 1.00 60.49  ? 473 LEU B CD2 1 
ATOM   8023 N N   . GLU B 2 474 ? -3.995  -13.308 137.707 1.00 63.26  ? 474 GLU B N   1 
ATOM   8024 C CA  . GLU B 2 474 ? -4.387  -13.391 136.295 1.00 60.45  ? 474 GLU B CA  1 
ATOM   8025 C C   . GLU B 2 474 ? -4.285  -12.057 135.577 1.00 57.21  ? 474 GLU B C   1 
ATOM   8026 O O   . GLU B 2 474 ? -4.899  -11.074 135.988 1.00 55.87  ? 474 GLU B O   1 
ATOM   8027 C CB  . GLU B 2 474 ? -5.831  -13.879 136.169 1.00 63.92  ? 474 GLU B CB  1 
ATOM   8028 C CG  . GLU B 2 474 ? -6.059  -15.276 136.693 1.00 71.51  ? 474 GLU B CG  1 
ATOM   8029 C CD  . GLU B 2 474 ? -5.432  -16.344 135.808 1.00 75.42  ? 474 GLU B CD  1 
ATOM   8030 O OE1 . GLU B 2 474 ? -4.285  -16.142 135.343 1.00 77.96  ? 474 GLU B OE1 1 
ATOM   8031 O OE2 . GLU B 2 474 ? -6.086  -17.392 135.589 1.00 77.19  ? 474 GLU B OE2 1 
ATOM   8032 N N   . ASP B 2 475 ? -3.528  -12.028 134.486 1.00 53.47  ? 475 ASP B N   1 
ATOM   8033 C CA  . ASP B 2 475 ? -3.367  -10.805 133.709 1.00 49.43  ? 475 ASP B CA  1 
ATOM   8034 C C   . ASP B 2 475 ? -4.624  -10.652 132.858 1.00 47.02  ? 475 ASP B C   1 
ATOM   8035 O O   . ASP B 2 475 ? -5.079  -11.607 132.239 1.00 47.80  ? 475 ASP B O   1 
ATOM   8036 C CB  . ASP B 2 475 ? -2.123  -10.914 132.820 1.00 48.71  ? 475 ASP B CB  1 
ATOM   8037 C CG  . ASP B 2 475 ? -1.749  -9.597  132.166 1.00 47.83  ? 475 ASP B CG  1 
ATOM   8038 O OD1 . ASP B 2 475 ? -2.661  -8.892  131.699 1.00 47.50  ? 475 ASP B OD1 1 
ATOM   8039 O OD2 . ASP B 2 475 ? -0.541  -9.275  132.107 1.00 48.12  ? 475 ASP B OD2 1 
ATOM   8040 N N   . LEU B 2 476 ? -5.197  -9.460  132.831 1.00 43.92  ? 476 LEU B N   1 
ATOM   8041 C CA  . LEU B 2 476 ? -6.404  -9.249  132.046 1.00 42.07  ? 476 LEU B CA  1 
ATOM   8042 C C   . LEU B 2 476 ? -6.079  -8.597  130.714 1.00 41.46  ? 476 LEU B C   1 
ATOM   8043 O O   . LEU B 2 476 ? -6.945  -8.478  129.846 1.00 41.30  ? 476 LEU B O   1 
ATOM   8044 C CB  . LEU B 2 476 ? -7.375  -8.341  132.797 1.00 41.20  ? 476 LEU B CB  1 
ATOM   8045 C CG  . LEU B 2 476 ? -7.671  -8.728  134.242 1.00 42.60  ? 476 LEU B CG  1 
ATOM   8046 C CD1 . LEU B 2 476 ? -8.608  -7.691  134.849 1.00 40.62  ? 476 LEU B CD1 1 
ATOM   8047 C CD2 . LEU B 2 476 ? -8.263  -10.137 134.296 1.00 40.89  ? 476 LEU B CD2 1 
ATOM   8048 N N   . PHE B 2 477 ? -4.827  -8.182  130.557 1.00 39.60  ? 477 PHE B N   1 
ATOM   8049 C CA  . PHE B 2 477 ? -4.400  -7.482  129.357 1.00 36.91  ? 477 PHE B CA  1 
ATOM   8050 C C   . PHE B 2 477 ? -2.969  -7.887  128.987 1.00 35.58  ? 477 PHE B C   1 
ATOM   8051 O O   . PHE B 2 477 ? -2.056  -7.070  129.067 1.00 36.37  ? 477 PHE B O   1 
ATOM   8052 C CB  . PHE B 2 477 ? -4.480  -5.982  129.652 1.00 36.97  ? 477 PHE B CB  1 
ATOM   8053 C CG  . PHE B 2 477 ? -4.485  -5.117  128.436 1.00 38.10  ? 477 PHE B CG  1 
ATOM   8054 C CD1 . PHE B 2 477 ? -5.417  -5.315  127.427 1.00 38.27  ? 477 PHE B CD1 1 
ATOM   8055 C CD2 . PHE B 2 477 ? -3.569  -4.085  128.304 1.00 38.14  ? 477 PHE B CD2 1 
ATOM   8056 C CE1 . PHE B 2 477 ? -5.430  -4.498  126.303 1.00 37.70  ? 477 PHE B CE1 1 
ATOM   8057 C CE2 . PHE B 2 477 ? -3.580  -3.261  127.178 1.00 37.62  ? 477 PHE B CE2 1 
ATOM   8058 C CZ  . PHE B 2 477 ? -4.508  -3.471  126.183 1.00 36.21  ? 477 PHE B CZ  1 
ATOM   8059 N N   . PRO B 2 478 ? -2.762  -9.154  128.565 1.00 33.65  ? 478 PRO B N   1 
ATOM   8060 C CA  . PRO B 2 478 ? -1.460  -9.729  128.174 1.00 32.65  ? 478 PRO B CA  1 
ATOM   8061 C C   . PRO B 2 478 ? -0.843  -9.207  126.864 1.00 31.87  ? 478 PRO B C   1 
ATOM   8062 O O   . PRO B 2 478 ? -0.514  -9.981  125.970 1.00 31.10  ? 478 PRO B O   1 
ATOM   8063 C CB  . PRO B 2 478 ? -1.753  -11.232 128.094 1.00 30.30  ? 478 PRO B CB  1 
ATOM   8064 C CG  . PRO B 2 478 ? -3.001  -11.407 128.881 1.00 28.80  ? 478 PRO B CG  1 
ATOM   8065 C CD  . PRO B 2 478 ? -3.797  -10.198 128.542 1.00 31.44  ? 478 PRO B CD  1 
ATOM   8066 N N   . THR B 2 479 ? -0.666  -7.899  126.766 1.00 31.89  ? 479 THR B N   1 
ATOM   8067 C CA  . THR B 2 479 ? -0.107  -7.282  125.568 1.00 32.01  ? 479 THR B CA  1 
ATOM   8068 C C   . THR B 2 479 ? 0.958   -8.069  124.807 1.00 31.24  ? 479 THR B C   1 
ATOM   8069 O O   . THR B 2 479 ? 1.135   -7.846  123.605 1.00 31.69  ? 479 THR B O   1 
ATOM   8070 C CB  . THR B 2 479 ? 0.462   -5.890  125.888 1.00 31.70  ? 479 THR B CB  1 
ATOM   8071 O OG1 . THR B 2 479 ? 1.406   -5.991  126.959 1.00 31.34  ? 479 THR B OG1 1 
ATOM   8072 C CG2 . THR B 2 479 ? -0.657  -4.955  126.288 1.00 32.68  ? 479 THR B CG2 1 
ATOM   8073 N N   . THR B 2 480 ? 1.662   -8.977  125.478 1.00 29.21  ? 480 THR B N   1 
ATOM   8074 C CA  . THR B 2 480 ? 2.690   -9.747  124.790 1.00 29.43  ? 480 THR B CA  1 
ATOM   8075 C C   . THR B 2 480 ? 2.153   -11.030 124.159 1.00 28.47  ? 480 THR B C   1 
ATOM   8076 O O   . THR B 2 480 ? 2.921   -11.921 123.799 1.00 29.23  ? 480 THR B O   1 
ATOM   8077 C CB  . THR B 2 480 ? 3.858   -10.112 125.720 1.00 30.79  ? 480 THR B CB  1 
ATOM   8078 O OG1 . THR B 2 480 ? 3.409   -11.036 126.716 1.00 33.73  ? 480 THR B OG1 1 
ATOM   8079 C CG2 . THR B 2 480 ? 4.408   -8.865  126.385 1.00 31.64  ? 480 THR B CG2 1 
ATOM   8080 N N   . LYS B 2 481 ? 0.835   -11.128 124.033 1.00 25.88  ? 481 LYS B N   1 
ATOM   8081 C CA  . LYS B 2 481 ? 0.211   -12.291 123.409 1.00 24.57  ? 481 LYS B CA  1 
ATOM   8082 C C   . LYS B 2 481 ? -0.497  -11.789 122.172 1.00 24.78  ? 481 LYS B C   1 
ATOM   8083 O O   . LYS B 2 481 ? -1.047  -12.557 121.382 1.00 25.79  ? 481 LYS B O   1 
ATOM   8084 C CB  . LYS B 2 481 ? -0.790  -12.951 124.352 1.00 22.94  ? 481 LYS B CB  1 
ATOM   8085 C CG  . LYS B 2 481 ? -0.126  -13.587 125.539 1.00 25.49  ? 481 LYS B CG  1 
ATOM   8086 C CD  . LYS B 2 481 ? -0.961  -14.693 126.096 1.00 29.57  ? 481 LYS B CD  1 
ATOM   8087 C CE  . LYS B 2 481 ? -0.177  -15.507 127.122 1.00 32.60  ? 481 LYS B CE  1 
ATOM   8088 N NZ  . LYS B 2 481 ? -0.904  -16.768 127.522 1.00 34.37  ? 481 LYS B NZ  1 
ATOM   8089 N N   . ILE B 2 482 ? -0.467  -10.468 122.033 1.00 24.53  ? 482 ILE B N   1 
ATOM   8090 C CA  . ILE B 2 482 ? -1.080  -9.759  120.925 1.00 23.21  ? 482 ILE B CA  1 
ATOM   8091 C C   . ILE B 2 482 ? -0.037  -9.524  119.844 1.00 23.86  ? 482 ILE B C   1 
ATOM   8092 O O   . ILE B 2 482 ? 1.109   -9.162  120.124 1.00 23.57  ? 482 ILE B O   1 
ATOM   8093 C CB  . ILE B 2 482 ? -1.613  -8.383  121.379 1.00 22.34  ? 482 ILE B CB  1 
ATOM   8094 C CG1 . ILE B 2 482 ? -2.600  -8.567  122.536 1.00 21.49  ? 482 ILE B CG1 1 
ATOM   8095 C CG2 . ILE B 2 482 ? -2.240  -7.655  120.196 1.00 20.12  ? 482 ILE B CG2 1 
ATOM   8096 C CD1 . ILE B 2 482 ? -3.096  -7.271  123.140 1.00 20.63  ? 482 ILE B CD1 1 
ATOM   8097 N N   . PRO B 2 483 ? -0.414  -9.743  118.587 1.00 23.67  ? 483 PRO B N   1 
ATOM   8098 C CA  . PRO B 2 483 ? 0.568   -9.515  117.539 1.00 23.61  ? 483 PRO B CA  1 
ATOM   8099 C C   . PRO B 2 483 ? 0.668   -8.019  117.260 1.00 24.51  ? 483 PRO B C   1 
ATOM   8100 O O   . PRO B 2 483 ? -0.244  -7.260  117.567 1.00 24.46  ? 483 PRO B O   1 
ATOM   8101 C CB  . PRO B 2 483 ? -0.007  -10.304 116.373 1.00 23.22  ? 483 PRO B CB  1 
ATOM   8102 C CG  . PRO B 2 483 ? -1.475  -10.147 116.577 1.00 22.07  ? 483 PRO B CG  1 
ATOM   8103 C CD  . PRO B 2 483 ? -1.626  -10.387 118.051 1.00 24.42  ? 483 PRO B CD  1 
ATOM   8104 N N   . ASN B 2 484 ? 1.790   -7.597  116.699 1.00 26.26  ? 484 ASN B N   1 
ATOM   8105 C CA  . ASN B 2 484 ? 2.006   -6.198  116.364 1.00 28.53  ? 484 ASN B CA  1 
ATOM   8106 C C   . ASN B 2 484 ? 0.906   -5.792  115.367 1.00 30.43  ? 484 ASN B C   1 
ATOM   8107 O O   . ASN B 2 484 ? 0.880   -6.288  114.243 1.00 33.43  ? 484 ASN B O   1 
ATOM   8108 C CB  . ASN B 2 484 ? 3.375   -6.069  115.709 1.00 27.94  ? 484 ASN B CB  1 
ATOM   8109 C CG  . ASN B 2 484 ? 3.908   -4.674  115.758 1.00 27.42  ? 484 ASN B CG  1 
ATOM   8110 O OD1 . ASN B 2 484 ? 3.184   -3.716  115.517 1.00 28.12  ? 484 ASN B OD1 1 
ATOM   8111 N ND2 . ASN B 2 484 ? 5.190   -4.545  116.064 1.00 27.32  ? 484 ASN B ND2 1 
ATOM   8112 N N   . PRO B 2 485 ? -0.005  -4.877  115.750 1.00 30.51  ? 485 PRO B N   1 
ATOM   8113 C CA  . PRO B 2 485 ? -1.095  -4.439  114.864 1.00 30.92  ? 485 PRO B CA  1 
ATOM   8114 C C   . PRO B 2 485 ? -0.589  -3.803  113.578 1.00 31.72  ? 485 PRO B C   1 
ATOM   8115 O O   . PRO B 2 485 ? -1.362  -3.349  112.732 1.00 33.75  ? 485 PRO B O   1 
ATOM   8116 C CB  . PRO B 2 485 ? -1.832  -3.432  115.720 1.00 30.42  ? 485 PRO B CB  1 
ATOM   8117 C CG  . PRO B 2 485 ? -0.698  -2.762  116.436 1.00 29.75  ? 485 PRO B CG  1 
ATOM   8118 C CD  . PRO B 2 485 ? 0.112   -3.960  116.896 1.00 31.77  ? 485 PRO B CD  1 
ATOM   8119 N N   . ARG B 2 486 ? 0.726   -3.768  113.451 1.00 30.48  ? 486 ARG B N   1 
ATOM   8120 C CA  . ARG B 2 486 ? 1.391   -3.176  112.310 1.00 28.56  ? 486 ARG B CA  1 
ATOM   8121 C C   . ARG B 2 486 ? 1.195   -3.933  111.011 1.00 28.44  ? 486 ARG B C   1 
ATOM   8122 O O   . ARG B 2 486 ? 0.923   -3.354  109.964 1.00 27.64  ? 486 ARG B O   1 
ATOM   8123 C CB  . ARG B 2 486 ? 2.879   -3.090  112.626 1.00 28.61  ? 486 ARG B CB  1 
ATOM   8124 C CG  . ARG B 2 486 ? 3.747   -2.740  111.477 1.00 26.72  ? 486 ARG B CG  1 
ATOM   8125 C CD  . ARG B 2 486 ? 4.997   -2.101  111.988 1.00 25.71  ? 486 ARG B CD  1 
ATOM   8126 N NE  . ARG B 2 486 ? 5.526   -1.173  111.004 1.00 27.93  ? 486 ARG B NE  1 
ATOM   8127 C CZ  . ARG B 2 486 ? 6.366   -0.194  111.299 1.00 31.15  ? 486 ARG B CZ  1 
ATOM   8128 N NH1 . ARG B 2 486 ? 6.769   -0.031  112.555 1.00 32.25  ? 486 ARG B NH1 1 
ATOM   8129 N NH2 . ARG B 2 486 ? 6.781   0.634   110.346 1.00 33.43  ? 486 ARG B NH2 1 
ATOM   8130 N N   . PHE B 2 487 ? 1.338   -5.243  111.094 1.00 28.92  ? 487 PHE B N   1 
ATOM   8131 C CA  . PHE B 2 487 ? 1.248   -6.097  109.925 1.00 28.86  ? 487 PHE B CA  1 
ATOM   8132 C C   . PHE B 2 487 ? -0.142  -6.327  109.371 1.00 28.51  ? 487 PHE B C   1 
ATOM   8133 O O   . PHE B 2 487 ? -0.375  -6.093  108.187 1.00 27.63  ? 487 PHE B O   1 
ATOM   8134 C CB  . PHE B 2 487 ? 1.935   -7.416  110.251 1.00 27.52  ? 487 PHE B CB  1 
ATOM   8135 C CG  . PHE B 2 487 ? 3.277   -7.229  110.896 1.00 23.95  ? 487 PHE B CG  1 
ATOM   8136 C CD1 . PHE B 2 487 ? 3.426   -7.362  112.280 1.00 19.85  ? 487 PHE B CD1 1 
ATOM   8137 C CD2 . PHE B 2 487 ? 4.385   -6.861  110.127 1.00 21.74  ? 487 PHE B CD2 1 
ATOM   8138 C CE1 . PHE B 2 487 ? 4.660   -7.127  112.897 1.00 18.67  ? 487 PHE B CE1 1 
ATOM   8139 C CE2 . PHE B 2 487 ? 5.633   -6.622  110.735 1.00 22.07  ? 487 PHE B CE2 1 
ATOM   8140 C CZ  . PHE B 2 487 ? 5.770   -6.757  112.124 1.00 18.32  ? 487 PHE B CZ  1 
ATOM   8141 N N   . GLN B 2 488 ? -1.056  -6.790  110.219 1.00 30.04  ? 488 GLN B N   1 
ATOM   8142 C CA  . GLN B 2 488 ? -2.434  -7.035  109.802 1.00 29.37  ? 488 GLN B CA  1 
ATOM   8143 C C   . GLN B 2 488 ? -2.979  -5.776  109.134 1.00 28.12  ? 488 GLN B C   1 
ATOM   8144 O O   . GLN B 2 488 ? -3.769  -5.851  108.182 1.00 28.44  ? 488 GLN B O   1 
ATOM   8145 C CB  . GLN B 2 488 ? -3.285  -7.385  111.009 1.00 32.59  ? 488 GLN B CB  1 
ATOM   8146 C CG  . GLN B 2 488 ? -2.984  -8.750  111.596 1.00 38.80  ? 488 GLN B CG  1 
ATOM   8147 C CD  . GLN B 2 488 ? -3.676  -8.964  112.939 1.00 43.50  ? 488 GLN B CD  1 
ATOM   8148 O OE1 . GLN B 2 488 ? -3.306  -8.341  113.940 1.00 46.43  ? 488 GLN B OE1 1 
ATOM   8149 N NE2 . GLN B 2 488 ? -4.694  -9.833  112.964 1.00 45.20  ? 488 GLN B NE2 1 
ATOM   8150 N N   . ARG B 2 489 ? -2.540  -4.626  109.643 1.00 24.75  ? 489 ARG B N   1 
ATOM   8151 C CA  . ARG B 2 489 ? -2.925  -3.329  109.109 1.00 23.37  ? 489 ARG B CA  1 
ATOM   8152 C C   . ARG B 2 489 ? -2.394  -3.230  107.690 1.00 23.70  ? 489 ARG B C   1 
ATOM   8153 O O   . ARG B 2 489 ? -3.147  -3.089  106.733 1.00 23.89  ? 489 ARG B O   1 
ATOM   8154 C CB  . ARG B 2 489 ? -2.314  -2.221  109.968 1.00 22.80  ? 489 ARG B CB  1 
ATOM   8155 C CG  . ARG B 2 489 ? -2.473  -0.839  109.394 1.00 22.44  ? 489 ARG B CG  1 
ATOM   8156 C CD  . ARG B 2 489 ? -3.863  -0.678  108.800 1.00 24.38  ? 489 ARG B CD  1 
ATOM   8157 N NE  . ARG B 2 489 ? -4.204  0.705   108.481 1.00 24.05  ? 489 ARG B NE  1 
ATOM   8158 C CZ  . ARG B 2 489 ? -5.305  1.058   107.825 1.00 23.82  ? 489 ARG B CZ  1 
ATOM   8159 N NH1 . ARG B 2 489 ? -6.169  0.140   107.410 1.00 22.36  ? 489 ARG B NH1 1 
ATOM   8160 N NH2 . ARG B 2 489 ? -5.547  2.334   107.597 1.00 24.77  ? 489 ARG B NH2 1 
ATOM   8161 N N   . LEU B 2 490 ? -1.074  -3.314  107.583 1.00 25.99  ? 490 LEU B N   1 
ATOM   8162 C CA  . LEU B 2 490 ? -0.357  -3.264  106.317 1.00 26.34  ? 490 LEU B CA  1 
ATOM   8163 C C   . LEU B 2 490 ? -0.920  -4.254  105.320 1.00 28.35  ? 490 LEU B C   1 
ATOM   8164 O O   . LEU B 2 490 ? -1.247  -3.873  104.193 1.00 30.78  ? 490 LEU B O   1 
ATOM   8165 C CB  . LEU B 2 490 ? 1.120   -3.609  106.529 1.00 25.87  ? 490 LEU B CB  1 
ATOM   8166 C CG  . LEU B 2 490 ? 1.942   -3.772  105.246 1.00 23.26  ? 490 LEU B CG  1 
ATOM   8167 C CD1 . LEU B 2 490 ? 2.068   -2.419  104.601 1.00 22.36  ? 490 LEU B CD1 1 
ATOM   8168 C CD2 . LEU B 2 490 ? 3.319   -4.339  105.539 1.00 20.11  ? 490 LEU B CD2 1 
ATOM   8169 N N   . PHE B 2 491 ? -1.005  -5.526  105.724 1.00 26.64  ? 491 PHE B N   1 
ATOM   8170 C CA  . PHE B 2 491 ? -1.518  -6.574  104.845 1.00 26.67  ? 491 PHE B CA  1 
ATOM   8171 C C   . PHE B 2 491 ? -2.912  -6.217  104.379 1.00 27.24  ? 491 PHE B C   1 
ATOM   8172 O O   . PHE B 2 491 ? -3.211  -6.287  103.187 1.00 25.06  ? 491 PHE B O   1 
ATOM   8173 C CB  . PHE B 2 491 ? -1.513  -7.928  105.560 1.00 25.26  ? 491 PHE B CB  1 
ATOM   8174 C CG  . PHE B 2 491 ? -0.127  -8.443  105.860 1.00 25.00  ? 491 PHE B CG  1 
ATOM   8175 C CD1 . PHE B 2 491 ? 0.067   -9.469  106.776 1.00 25.19  ? 491 PHE B CD1 1 
ATOM   8176 C CD2 . PHE B 2 491 ? 0.997   -7.841  105.280 1.00 23.33  ? 491 PHE B CD2 1 
ATOM   8177 C CE1 . PHE B 2 491 ? 1.358   -9.899  107.092 1.00 25.86  ? 491 PHE B CE1 1 
ATOM   8178 C CE2 . PHE B 2 491 ? 2.280   -8.261  105.586 1.00 21.19  ? 491 PHE B CE2 1 
ATOM   8179 C CZ  . PHE B 2 491 ? 2.465   -9.278  106.504 1.00 23.81  ? 491 PHE B CZ  1 
ATOM   8180 N N   . GLN B 2 492 ? -3.763  -5.821  105.316 1.00 28.03  ? 492 GLN B N   1 
ATOM   8181 C CA  . GLN B 2 492 ? -5.106  -5.426  104.940 1.00 30.66  ? 492 GLN B CA  1 
ATOM   8182 C C   . GLN B 2 492 ? -5.008  -4.405  103.797 1.00 32.09  ? 492 GLN B C   1 
ATOM   8183 O O   . GLN B 2 492 ? -5.579  -4.607  102.713 1.00 31.68  ? 492 GLN B O   1 
ATOM   8184 C CB  . GLN B 2 492 ? -5.838  -4.795  106.118 1.00 31.09  ? 492 GLN B CB  1 
ATOM   8185 C CG  . GLN B 2 492 ? -7.233  -4.356  105.755 1.00 32.49  ? 492 GLN B CG  1 
ATOM   8186 C CD  . GLN B 2 492 ? -7.702  -3.164  106.554 1.00 36.08  ? 492 GLN B CD  1 
ATOM   8187 O OE1 . GLN B 2 492 ? -6.904  -2.310  106.950 1.00 38.91  ? 492 GLN B OE1 1 
ATOM   8188 N NE2 . GLN B 2 492 ? -9.008  -3.078  106.774 1.00 37.98  ? 492 GLN B NE2 1 
ATOM   8189 N N   . CYS B 2 493 ? -4.281  -3.314  104.030 1.00 31.04  ? 493 CYS B N   1 
ATOM   8190 C CA  . CYS B 2 493 ? -4.133  -2.304  102.994 1.00 33.29  ? 493 CYS B CA  1 
ATOM   8191 C C   . CYS B 2 493 ? -3.599  -2.892  101.691 1.00 35.72  ? 493 CYS B C   1 
ATOM   8192 O O   . CYS B 2 493 ? -4.235  -2.777  100.640 1.00 36.37  ? 493 CYS B O   1 
ATOM   8193 C CB  . CYS B 2 493 ? -3.205  -1.190  103.452 1.00 33.81  ? 493 CYS B CB  1 
ATOM   8194 S SG  . CYS B 2 493 ? -3.878  -0.199  104.778 1.00 36.96  ? 493 CYS B SG  1 
ATOM   8195 N N   . LEU B 2 494 ? -2.430  -3.521  101.755 1.00 36.44  ? 494 LEU B N   1 
ATOM   8196 C CA  . LEU B 2 494 ? -1.844  -4.107  100.559 1.00 37.52  ? 494 LEU B CA  1 
ATOM   8197 C C   . LEU B 2 494 ? -2.890  -4.865  99.766  1.00 38.01  ? 494 LEU B C   1 
ATOM   8198 O O   . LEU B 2 494 ? -3.013  -4.682  98.555  1.00 38.73  ? 494 LEU B O   1 
ATOM   8199 C CB  . LEU B 2 494 ? -0.692  -5.050  100.918 1.00 38.88  ? 494 LEU B CB  1 
ATOM   8200 C CG  . LEU B 2 494 ? 0.667   -4.401  101.199 1.00 40.24  ? 494 LEU B CG  1 
ATOM   8201 C CD1 . LEU B 2 494 ? 1.677   -5.479  101.556 1.00 39.07  ? 494 LEU B CD1 1 
ATOM   8202 C CD2 . LEU B 2 494 ? 1.126   -3.611  99.976  1.00 39.37  ? 494 LEU B CD2 1 
ATOM   8203 N N   . LEU B 2 495 ? -3.656  -5.706  100.455 1.00 37.84  ? 495 LEU B N   1 
ATOM   8204 C CA  . LEU B 2 495 ? -4.683  -6.506  99.804  1.00 36.01  ? 495 LEU B CA  1 
ATOM   8205 C C   . LEU B 2 495 ? -5.751  -5.620  99.194  1.00 35.60  ? 495 LEU B C   1 
ATOM   8206 O O   . LEU B 2 495 ? -6.085  -5.733  98.014  1.00 34.60  ? 495 LEU B O   1 
ATOM   8207 C CB  . LEU B 2 495 ? -5.323  -7.467  100.810 1.00 34.72  ? 495 LEU B CB  1 
ATOM   8208 C CG  . LEU B 2 495 ? -6.290  -8.502  100.221 1.00 34.94  ? 495 LEU B CG  1 
ATOM   8209 C CD1 . LEU B 2 495 ? -5.652  -9.149  98.996  1.00 34.82  ? 495 LEU B CD1 1 
ATOM   8210 C CD2 . LEU B 2 495 ? -6.639  -9.565  101.269 1.00 33.46  ? 495 LEU B CD2 1 
ATOM   8211 N N   . HIS B 2 496 ? -6.274  -4.711  99.998  1.00 35.86  ? 496 HIS B N   1 
ATOM   8212 C CA  . HIS B 2 496 ? -7.319  -3.836  99.505  1.00 36.91  ? 496 HIS B CA  1 
ATOM   8213 C C   . HIS B 2 496 ? -6.886  -3.068  98.259  1.00 36.57  ? 496 HIS B C   1 
ATOM   8214 O O   . HIS B 2 496 ? -7.719  -2.680  97.434  1.00 37.62  ? 496 HIS B O   1 
ATOM   8215 C CB  . HIS B 2 496 ? -7.757  -2.879  100.606 1.00 36.86  ? 496 HIS B CB  1 
ATOM   8216 C CG  . HIS B 2 496 ? -9.029  -2.156  100.299 1.00 38.84  ? 496 HIS B CG  1 
ATOM   8217 N ND1 . HIS B 2 496 ? -9.071  -1.011  99.535  1.00 38.87  ? 496 HIS B ND1 1 
ATOM   8218 C CD2 . HIS B 2 496 ? -10.309 -2.420  100.658 1.00 39.38  ? 496 HIS B CD2 1 
ATOM   8219 C CE1 . HIS B 2 496 ? -10.322 -0.595  99.440  1.00 39.85  ? 496 HIS B CE1 1 
ATOM   8220 N NE2 . HIS B 2 496 ? -11.091 -1.432  100.113 1.00 40.35  ? 496 HIS B NE2 1 
ATOM   8221 N N   . ARG B 2 497 ? -5.586  -2.856  98.106  1.00 34.36  ? 497 ARG B N   1 
ATOM   8222 C CA  . ARG B 2 497 ? -5.130  -2.148  96.936  1.00 31.99  ? 497 ARG B CA  1 
ATOM   8223 C C   . ARG B 2 497 ? -4.988  -3.092  95.773  1.00 32.05  ? 497 ARG B C   1 
ATOM   8224 O O   . ARG B 2 497 ? -5.157  -2.694  94.631  1.00 33.49  ? 497 ARG B O   1 
ATOM   8225 C CB  . ARG B 2 497 ? -3.801  -1.467  97.176  1.00 31.45  ? 497 ARG B CB  1 
ATOM   8226 C CG  . ARG B 2 497 ? -3.402  -0.644  95.978  1.00 30.08  ? 497 ARG B CG  1 
ATOM   8227 C CD  . ARG B 2 497 ? -4.371  0.498   95.793  1.00 27.93  ? 497 ARG B CD  1 
ATOM   8228 N NE  . ARG B 2 497 ? -3.785  1.725   96.307  1.00 28.12  ? 497 ARG B NE  1 
ATOM   8229 C CZ  . ARG B 2 497 ? -4.471  2.698   96.886  1.00 29.43  ? 497 ARG B CZ  1 
ATOM   8230 N NH1 . ARG B 2 497 ? -5.785  2.603   97.035  1.00 31.98  ? 497 ARG B NH1 1 
ATOM   8231 N NH2 . ARG B 2 497 ? -3.836  3.764   97.330  1.00 27.61  ? 497 ARG B NH2 1 
ATOM   8232 N N   . ALA B 2 498 ? -4.669  -4.345  96.058  1.00 31.62  ? 498 ALA B N   1 
ATOM   8233 C CA  . ALA B 2 498 ? -4.515  -5.331  95.001  1.00 31.00  ? 498 ALA B CA  1 
ATOM   8234 C C   . ALA B 2 498 ? -5.855  -5.657  94.374  1.00 31.37  ? 498 ALA B C   1 
ATOM   8235 O O   . ALA B 2 498 ? -5.956  -5.868  93.171  1.00 30.81  ? 498 ALA B O   1 
ATOM   8236 C CB  . ALA B 2 498 ? -3.905  -6.585  95.552  1.00 30.86  ? 498 ALA B CB  1 
ATOM   8237 N N   . LEU B 2 499 ? -6.889  -5.702  95.199  1.00 32.82  ? 499 LEU B N   1 
ATOM   8238 C CA  . LEU B 2 499 ? -8.211  -6.030  94.710  1.00 34.45  ? 499 LEU B CA  1 
ATOM   8239 C C   . LEU B 2 499 ? -9.015  -4.804  94.334  1.00 36.02  ? 499 LEU B C   1 
ATOM   8240 O O   . LEU B 2 499 ? -9.847  -4.858  93.443  1.00 36.44  ? 499 LEU B O   1 
ATOM   8241 C CB  . LEU B 2 499 ? -8.977  -6.828  95.762  1.00 34.02  ? 499 LEU B CB  1 
ATOM   8242 C CG  . LEU B 2 499 ? -8.314  -8.108  96.287  1.00 34.47  ? 499 LEU B CG  1 
ATOM   8243 C CD1 . LEU B 2 499 ? -9.335  -8.915  97.094  1.00 33.67  ? 499 LEU B CD1 1 
ATOM   8244 C CD2 . LEU B 2 499 ? -7.781  -8.940  95.126  1.00 33.30  ? 499 LEU B CD2 1 
ATOM   8245 N N   . HIS B 2 500 ? -8.772  -3.692  95.011  1.00 38.19  ? 500 HIS B N   1 
ATOM   8246 C CA  . HIS B 2 500 ? -9.534  -2.493  94.712  1.00 40.87  ? 500 HIS B CA  1 
ATOM   8247 C C   . HIS B 2 500 ? -8.615  -1.326  94.454  1.00 43.19  ? 500 HIS B C   1 
ATOM   8248 O O   . HIS B 2 500 ? -8.590  -0.351  95.211  1.00 44.51  ? 500 HIS B O   1 
ATOM   8249 C CB  . HIS B 2 500 ? -10.496 -2.210  95.861  1.00 39.60  ? 500 HIS B CB  1 
ATOM   8250 C CG  . HIS B 2 500 ? -11.261 -3.423  96.285  1.00 39.58  ? 500 HIS B CG  1 
ATOM   8251 N ND1 . HIS B 2 500 ? -10.978 -4.113  97.444  1.00 39.18  ? 500 HIS B ND1 1 
ATOM   8252 C CD2 . HIS B 2 500 ? -12.227 -4.129  95.652  1.00 39.92  ? 500 HIS B CD2 1 
ATOM   8253 C CE1 . HIS B 2 500 ? -11.738 -5.193  97.506  1.00 40.23  ? 500 HIS B CE1 1 
ATOM   8254 N NE2 . HIS B 2 500 ? -12.504 -5.227  96.431  1.00 39.71  ? 500 HIS B NE2 1 
ATOM   8255 N N   . PRO B 2 501 ? -7.857  -1.409  93.349  1.00 45.21  ? 501 PRO B N   1 
ATOM   8256 C CA  . PRO B 2 501 ? -6.890  -0.403  92.902  1.00 47.14  ? 501 PRO B CA  1 
ATOM   8257 C C   . PRO B 2 501 ? -7.384  1.031   92.913  1.00 48.90  ? 501 PRO B C   1 
ATOM   8258 O O   . PRO B 2 501 ? -6.636  1.938   93.259  1.00 49.33  ? 501 PRO B O   1 
ATOM   8259 C CB  . PRO B 2 501 ? -6.506  -0.882  91.498  1.00 46.32  ? 501 PRO B CB  1 
ATOM   8260 C CG  . PRO B 2 501 ? -7.678  -1.727  91.071  1.00 46.24  ? 501 PRO B CG  1 
ATOM   8261 C CD  . PRO B 2 501 ? -8.019  -2.462  92.330  1.00 44.60  ? 501 PRO B CD  1 
ATOM   8262 N N   . ARG B 2 502 ? -8.644  1.237   92.546  1.00 51.67  ? 502 ARG B N   1 
ATOM   8263 C CA  . ARG B 2 502 ? -9.206  2.585   92.505  1.00 53.38  ? 502 ARG B CA  1 
ATOM   8264 C C   . ARG B 2 502 ? -9.614  3.154   93.870  1.00 52.05  ? 502 ARG B C   1 
ATOM   8265 O O   . ARG B 2 502 ? -9.378  4.327   94.153  1.00 52.22  ? 502 ARG B O   1 
ATOM   8266 C CB  . ARG B 2 502 ? -10.403 2.620   91.550  1.00 56.31  ? 502 ARG B CB  1 
ATOM   8267 C CG  . ARG B 2 502 ? -10.052 2.469   90.061  1.00 60.97  ? 502 ARG B CG  1 
ATOM   8268 C CD  . ARG B 2 502 ? -11.336 2.488   89.224  1.00 65.62  ? 502 ARG B CD  1 
ATOM   8269 N NE  . ARG B 2 502 ? -11.121 2.542   87.779  1.00 68.64  ? 502 ARG B NE  1 
ATOM   8270 C CZ  . ARG B 2 502 ? -12.109 2.535   86.884  1.00 70.77  ? 502 ARG B CZ  1 
ATOM   8271 N NH1 . ARG B 2 502 ? -13.372 2.476   87.291  1.00 71.36  ? 502 ARG B NH1 1 
ATOM   8272 N NH2 . ARG B 2 502 ? -11.840 2.582   85.582  1.00 71.62  ? 502 ARG B NH2 1 
ATOM   8273 N N   . GLU B 2 503 ? -10.216 2.329   94.717  1.00 50.95  ? 503 GLU B N   1 
ATOM   8274 C CA  . GLU B 2 503 ? -10.654 2.787   96.030  1.00 49.70  ? 503 GLU B CA  1 
ATOM   8275 C C   . GLU B 2 503 ? -9.503  3.187   96.947  1.00 47.13  ? 503 GLU B C   1 
ATOM   8276 O O   . GLU B 2 503 ? -8.425  2.594   96.907  1.00 47.59  ? 503 GLU B O   1 
ATOM   8277 C CB  . GLU B 2 503 ? -11.474 1.698   96.711  1.00 51.89  ? 503 GLU B CB  1 
ATOM   8278 C CG  . GLU B 2 503 ? -12.751 1.327   95.990  1.00 56.25  ? 503 GLU B CG  1 
ATOM   8279 C CD  . GLU B 2 503 ? -13.465 0.150   96.653  1.00 59.98  ? 503 GLU B CD  1 
ATOM   8280 O OE1 . GLU B 2 503 ? -13.719 0.200   97.881  1.00 60.80  ? 503 GLU B OE1 1 
ATOM   8281 O OE2 . GLU B 2 503 ? -13.781 -0.829  95.944  1.00 62.46  ? 503 GLU B OE2 1 
ATOM   8282 N N   . PRO B 2 504 ? -9.718  4.205   97.790  1.00 44.25  ? 504 PRO B N   1 
ATOM   8283 C CA  . PRO B 2 504 ? -8.677  4.655   98.713  1.00 42.90  ? 504 PRO B CA  1 
ATOM   8284 C C   . PRO B 2 504 ? -8.513  3.637   99.848  1.00 41.44  ? 504 PRO B C   1 
ATOM   8285 O O   . PRO B 2 504 ? -9.440  2.882   100.153 1.00 40.46  ? 504 PRO B O   1 
ATOM   8286 C CB  . PRO B 2 504 ? -9.222  5.989   99.205  1.00 41.86  ? 504 PRO B CB  1 
ATOM   8287 C CG  . PRO B 2 504 ? -10.674 5.726   99.259  1.00 42.35  ? 504 PRO B CG  1 
ATOM   8288 C CD  . PRO B 2 504 ? -10.922 5.038   97.932  1.00 43.26  ? 504 PRO B CD  1 
ATOM   8289 N N   . LEU B 2 505 ? -7.336  3.617   100.468 1.00 39.42  ? 505 LEU B N   1 
ATOM   8290 C CA  . LEU B 2 505 ? -7.068  2.688   101.561 1.00 37.85  ? 505 LEU B CA  1 
ATOM   8291 C C   . LEU B 2 505 ? -8.157  2.736   102.624 1.00 37.30  ? 505 LEU B C   1 
ATOM   8292 O O   . LEU B 2 505 ? -8.546  3.809   103.072 1.00 37.61  ? 505 LEU B O   1 
ATOM   8293 C CB  . LEU B 2 505 ? -5.716  2.996   102.194 1.00 37.04  ? 505 LEU B CB  1 
ATOM   8294 C CG  . LEU B 2 505 ? -4.506  2.716   101.307 1.00 34.75  ? 505 LEU B CG  1 
ATOM   8295 C CD1 . LEU B 2 505 ? -3.247  3.073   102.065 1.00 32.47  ? 505 LEU B CD1 1 
ATOM   8296 C CD2 . LEU B 2 505 ? -4.500  1.260   100.888 1.00 32.48  ? 505 LEU B CD2 1 
ATOM   8297 N N   . PRO B 2 506 ? -8.645  1.558   103.057 1.00 36.63  ? 506 PRO B N   1 
ATOM   8298 C CA  . PRO B 2 506 ? -9.695  1.355   104.062 1.00 34.69  ? 506 PRO B CA  1 
ATOM   8299 C C   . PRO B 2 506 ? -9.346  1.739   105.485 1.00 32.58  ? 506 PRO B C   1 
ATOM   8300 O O   . PRO B 2 506 ? -8.187  1.890   105.847 1.00 32.89  ? 506 PRO B O   1 
ATOM   8301 C CB  . PRO B 2 506 ? -9.981  -0.133  103.956 1.00 35.82  ? 506 PRO B CB  1 
ATOM   8302 C CG  . PRO B 2 506 ? -8.631  -0.670  103.738 1.00 37.12  ? 506 PRO B CG  1 
ATOM   8303 C CD  . PRO B 2 506 ? -8.079  0.260   102.659 1.00 36.02  ? 506 PRO B CD  1 
ATOM   8304 N N   . PRO B 2 507 ? -10.365 1.880   106.323 1.00 31.15  ? 507 PRO B N   1 
ATOM   8305 C CA  . PRO B 2 507 ? -10.153 2.245   107.719 1.00 30.26  ? 507 PRO B CA  1 
ATOM   8306 C C   . PRO B 2 507 ? -9.648  1.031   108.485 1.00 29.20  ? 507 PRO B C   1 
ATOM   8307 O O   . PRO B 2 507 ? -9.878  -0.105  108.077 1.00 28.88  ? 507 PRO B O   1 
ATOM   8308 C CB  . PRO B 2 507 ? -11.542 2.672   108.161 1.00 30.14  ? 507 PRO B CB  1 
ATOM   8309 C CG  . PRO B 2 507 ? -12.409 1.689   107.438 1.00 30.96  ? 507 PRO B CG  1 
ATOM   8310 C CD  . PRO B 2 507 ? -11.795 1.661   106.045 1.00 31.26  ? 507 PRO B CD  1 
ATOM   8311 N N   . ILE B 2 508 ? -8.948  1.280   109.583 1.00 29.15  ? 508 ILE B N   1 
ATOM   8312 C CA  . ILE B 2 508 ? -8.420  0.203   110.413 1.00 28.64  ? 508 ILE B CA  1 
ATOM   8313 C C   . ILE B 2 508 ? -9.618  -0.675  110.764 1.00 28.70  ? 508 ILE B C   1 
ATOM   8314 O O   . ILE B 2 508 ? -10.730 -0.175  110.895 1.00 29.63  ? 508 ILE B O   1 
ATOM   8315 C CB  . ILE B 2 508 ? -7.747  0.783   111.702 1.00 26.98  ? 508 ILE B CB  1 
ATOM   8316 C CG1 . ILE B 2 508 ? -6.594  1.700   111.292 1.00 26.25  ? 508 ILE B CG1 1 
ATOM   8317 C CG2 . ILE B 2 508 ? -7.244  -0.341  112.619 1.00 24.30  ? 508 ILE B CG2 1 
ATOM   8318 C CD1 . ILE B 2 508 ? -5.916  2.410   112.447 1.00 28.44  ? 508 ILE B CD1 1 
ATOM   8319 N N   . GLN B 2 509 ? -9.398  -1.977  110.885 1.00 27.90  ? 509 GLN B N   1 
ATOM   8320 C CA  . GLN B 2 509 ? -10.475 -2.895  111.204 1.00 28.46  ? 509 GLN B CA  1 
ATOM   8321 C C   . GLN B 2 509 ? -10.776 -2.850  112.688 1.00 28.60  ? 509 GLN B C   1 
ATOM   8322 O O   . GLN B 2 509 ? -9.869  -2.898  113.510 1.00 30.65  ? 509 GLN B O   1 
ATOM   8323 C CB  . GLN B 2 509 ? -10.082 -4.314  110.795 1.00 29.93  ? 509 GLN B CB  1 
ATOM   8324 C CG  . GLN B 2 509 ? -9.747  -4.450  109.334 1.00 34.45  ? 509 GLN B CG  1 
ATOM   8325 C CD  . GLN B 2 509 ? -8.953  -5.706  109.038 1.00 39.46  ? 509 GLN B CD  1 
ATOM   8326 O OE1 . GLN B 2 509 ? -7.733  -5.763  109.252 1.00 40.45  ? 509 GLN B OE1 1 
ATOM   8327 N NE2 . GLN B 2 509 ? -9.642  -6.729  108.551 1.00 41.47  ? 509 GLN B NE2 1 
ATOM   8328 N N   . GLN B 2 510 ? -12.053 -2.774  113.039 1.00 28.86  ? 510 GLN B N   1 
ATOM   8329 C CA  . GLN B 2 510 ? -12.429 -2.720  114.441 1.00 28.90  ? 510 GLN B CA  1 
ATOM   8330 C C   . GLN B 2 510 ? -11.755 -3.747  115.328 1.00 28.38  ? 510 GLN B C   1 
ATOM   8331 O O   . GLN B 2 510 ? -11.215 -3.398  116.373 1.00 26.26  ? 510 GLN B O   1 
ATOM   8332 C CB  . GLN B 2 510 ? -13.939 -2.853  114.605 1.00 29.80  ? 510 GLN B CB  1 
ATOM   8333 C CG  . GLN B 2 510 ? -14.609 -1.522  114.843 1.00 34.92  ? 510 GLN B CG  1 
ATOM   8334 C CD  . GLN B 2 510 ? -14.014 -0.767  116.029 1.00 36.64  ? 510 GLN B CD  1 
ATOM   8335 O OE1 . GLN B 2 510 ? -13.667 0.412   115.919 1.00 38.07  ? 510 GLN B OE1 1 
ATOM   8336 N NE2 . GLN B 2 510 ? -13.902 -1.443  117.168 1.00 37.81  ? 510 GLN B NE2 1 
ATOM   8337 N N   . HIS B 2 511 ? -11.771 -5.013  114.921 1.00 28.97  ? 511 HIS B N   1 
ATOM   8338 C CA  . HIS B 2 511 ? -11.179 -6.037  115.765 1.00 28.39  ? 511 HIS B CA  1 
ATOM   8339 C C   . HIS B 2 511 ? -9.725  -5.743  116.079 1.00 27.79  ? 511 HIS B C   1 
ATOM   8340 O O   . HIS B 2 511 ? -9.193  -6.213  117.077 1.00 27.20  ? 511 HIS B O   1 
ATOM   8341 C CB  . HIS B 2 511 ? -11.371 -7.429  115.150 1.00 29.22  ? 511 HIS B CB  1 
ATOM   8342 C CG  . HIS B 2 511 ? -10.537 -7.700  113.943 1.00 30.94  ? 511 HIS B CG  1 
ATOM   8343 N ND1 . HIS B 2 511 ? -9.242  -8.169  114.025 1.00 31.77  ? 511 HIS B ND1 1 
ATOM   8344 C CD2 . HIS B 2 511 ? -10.826 -7.626  112.622 1.00 31.85  ? 511 HIS B CD2 1 
ATOM   8345 C CE1 . HIS B 2 511 ? -8.772  -8.377  112.809 1.00 32.14  ? 511 HIS B CE1 1 
ATOM   8346 N NE2 . HIS B 2 511 ? -9.714  -8.055  111.938 1.00 32.72  ? 511 HIS B NE2 1 
ATOM   8347 N N   . ILE B 2 512 ? -9.074  -4.936  115.254 1.00 28.21  ? 512 ILE B N   1 
ATOM   8348 C CA  . ILE B 2 512 ? -7.695  -4.600  115.572 1.00 29.07  ? 512 ILE B CA  1 
ATOM   8349 C C   . ILE B 2 512 ? -7.700  -3.538  116.684 1.00 29.90  ? 512 ILE B C   1 
ATOM   8350 O O   . ILE B 2 512 ? -6.918  -3.633  117.633 1.00 30.17  ? 512 ILE B O   1 
ATOM   8351 C CB  . ILE B 2 512 ? -6.900  -4.148  114.320 1.00 25.94  ? 512 ILE B CB  1 
ATOM   8352 C CG1 . ILE B 2 512 ? -6.658  -5.371  113.429 1.00 26.20  ? 512 ILE B CG1 1 
ATOM   8353 C CG2 . ILE B 2 512 ? -5.565  -3.551  114.725 1.00 24.23  ? 512 ILE B CG2 1 
ATOM   8354 C CD1 . ILE B 2 512 ? -5.599  -5.204  112.354 1.00 26.64  ? 512 ILE B CD1 1 
ATOM   8355 N N   . TRP B 2 513 ? -8.596  -2.555  116.593 1.00 29.74  ? 513 TRP B N   1 
ATOM   8356 C CA  . TRP B 2 513 ? -8.700  -1.535  117.640 1.00 30.51  ? 513 TRP B CA  1 
ATOM   8357 C C   . TRP B 2 513 ? -9.187  -2.183  118.939 1.00 31.82  ? 513 TRP B C   1 
ATOM   8358 O O   . TRP B 2 513 ? -8.737  -1.835  120.029 1.00 32.15  ? 513 TRP B O   1 
ATOM   8359 C CB  . TRP B 2 513 ? -9.686  -0.431  117.237 1.00 29.00  ? 513 TRP B CB  1 
ATOM   8360 C CG  . TRP B 2 513 ? -9.072  0.677   116.458 1.00 27.09  ? 513 TRP B CG  1 
ATOM   8361 C CD1 . TRP B 2 513 ? -9.487  1.152   115.264 1.00 26.47  ? 513 TRP B CD1 1 
ATOM   8362 C CD2 . TRP B 2 513 ? -7.919  1.454   116.826 1.00 28.55  ? 513 TRP B CD2 1 
ATOM   8363 N NE1 . TRP B 2 513 ? -8.669  2.179   114.850 1.00 28.40  ? 513 TRP B NE1 1 
ATOM   8364 C CE2 . TRP B 2 513 ? -7.712  2.385   115.785 1.00 28.23  ? 513 TRP B CE2 1 
ATOM   8365 C CE3 . TRP B 2 513 ? -7.062  1.454   117.926 1.00 28.62  ? 513 TRP B CE3 1 
ATOM   8366 C CZ2 . TRP B 2 513 ? -6.655  3.309   115.824 1.00 28.47  ? 513 TRP B CZ2 1 
ATOM   8367 C CZ3 . TRP B 2 513 ? -6.016  2.376   117.954 1.00 26.05  ? 513 TRP B CZ3 1 
ATOM   8368 C CH2 . TRP B 2 513 ? -5.827  3.289   116.913 1.00 27.25  ? 513 TRP B CH2 1 
ATOM   8369 N N   . ASN B 2 514 ? -10.104 -3.134  118.820 1.00 32.43  ? 514 ASN B N   1 
ATOM   8370 C CA  . ASN B 2 514 ? -10.634 -3.793  119.996 1.00 34.01  ? 514 ASN B CA  1 
ATOM   8371 C C   . ASN B 2 514 ? -9.586  -4.579  120.768 1.00 34.49  ? 514 ASN B C   1 
ATOM   8372 O O   . ASN B 2 514 ? -9.670  -4.686  121.992 1.00 33.78  ? 514 ASN B O   1 
ATOM   8373 C CB  . ASN B 2 514 ? -11.798 -4.721  119.623 1.00 36.42  ? 514 ASN B CB  1 
ATOM   8374 C CG  . ASN B 2 514 ? -13.040 -3.956  119.165 1.00 38.98  ? 514 ASN B CG  1 
ATOM   8375 O OD1 . ASN B 2 514 ? -13.294 -2.826  119.603 1.00 38.00  ? 514 ASN B OD1 1 
ATOM   8376 N ND2 . ASN B 2 514 ? -13.830 -4.583  118.297 1.00 39.86  ? 514 ASN B ND2 1 
ATOM   8377 N N   . MET B 2 515 ? -8.593  -5.126  120.068 1.00 35.09  ? 515 MET B N   1 
ATOM   8378 C CA  . MET B 2 515 ? -7.561  -5.909  120.751 1.00 33.25  ? 515 MET B CA  1 
ATOM   8379 C C   . MET B 2 515 ? -6.475  -5.053  121.365 1.00 33.07  ? 515 MET B C   1 
ATOM   8380 O O   . MET B 2 515 ? -5.774  -5.490  122.275 1.00 34.69  ? 515 MET B O   1 
ATOM   8381 C CB  . MET B 2 515 ? -6.917  -6.935  119.815 1.00 30.57  ? 515 MET B CB  1 
ATOM   8382 C CG  . MET B 2 515 ? -5.994  -6.376  118.750 1.00 27.26  ? 515 MET B CG  1 
ATOM   8383 S SD  . MET B 2 515 ? -5.267  -7.748  117.831 1.00 22.28  ? 515 MET B SD  1 
ATOM   8384 C CE  . MET B 2 515 ? -3.732  -7.034  117.179 1.00 23.79  ? 515 MET B CE  1 
ATOM   8385 N N   . LEU B 2 516 ? -6.324  -3.832  120.881 1.00 31.61  ? 516 LEU B N   1 
ATOM   8386 C CA  . LEU B 2 516 ? -5.299  -2.978  121.445 1.00 31.48  ? 516 LEU B CA  1 
ATOM   8387 C C   . LEU B 2 516 ? -5.833  -2.203  122.642 1.00 31.74  ? 516 LEU B C   1 
ATOM   8388 O O   . LEU B 2 516 ? -5.074  -1.537  123.328 1.00 30.79  ? 516 LEU B O   1 
ATOM   8389 C CB  . LEU B 2 516 ? -4.766  -2.027  120.379 1.00 31.35  ? 516 LEU B CB  1 
ATOM   8390 C CG  . LEU B 2 516 ? -4.133  -2.739  119.185 1.00 30.50  ? 516 LEU B CG  1 
ATOM   8391 C CD1 . LEU B 2 516 ? -3.895  -1.737  118.073 1.00 28.92  ? 516 LEU B CD1 1 
ATOM   8392 C CD2 . LEU B 2 516 ? -2.844  -3.418  119.607 1.00 28.67  ? 516 LEU B CD2 1 
ATOM   8393 N N   . ASN B 2 517 ? -7.140  -2.281  122.884 1.00 33.44  ? 517 ASN B N   1 
ATOM   8394 C CA  . ASN B 2 517 ? -7.743  -1.599  124.032 1.00 34.83  ? 517 ASN B CA  1 
ATOM   8395 C C   . ASN B 2 517 ? -7.922  -2.612  125.140 1.00 36.83  ? 517 ASN B C   1 
ATOM   8396 O O   . ASN B 2 517 ? -8.025  -3.813  124.891 1.00 35.70  ? 517 ASN B O   1 
ATOM   8397 C CB  . ASN B 2 517 ? -9.108  -1.008  123.690 1.00 34.85  ? 517 ASN B CB  1 
ATOM   8398 C CG  . ASN B 2 517 ? -9.030  0.056   122.626 1.00 35.27  ? 517 ASN B CG  1 
ATOM   8399 O OD1 . ASN B 2 517 ? -8.217  0.978   122.723 1.00 34.43  ? 517 ASN B OD1 1 
ATOM   8400 N ND2 . ASN B 2 517 ? -9.881  -0.056  121.601 1.00 35.16  ? 517 ASN B ND2 1 
ATOM   8401 N N   . PRO B 2 518 ? -7.981  -2.139  126.386 1.00 39.97  ? 518 PRO B N   1 
ATOM   8402 C CA  . PRO B 2 518 ? -8.145  -3.007  127.553 1.00 42.82  ? 518 PRO B CA  1 
ATOM   8403 C C   . PRO B 2 518 ? -9.570  -3.510  127.691 1.00 45.07  ? 518 PRO B C   1 
ATOM   8404 O O   . PRO B 2 518 ? -10.474 -3.046  126.992 1.00 45.02  ? 518 PRO B O   1 
ATOM   8405 C CB  . PRO B 2 518 ? -7.747  -2.092  128.702 1.00 43.16  ? 518 PRO B CB  1 
ATOM   8406 C CG  . PRO B 2 518 ? -8.346  -0.794  128.273 1.00 42.39  ? 518 PRO B CG  1 
ATOM   8407 C CD  . PRO B 2 518 ? -7.980  -0.722  126.790 1.00 41.40  ? 518 PRO B CD  1 
ATOM   8408 N N   . PRO B 2 519 ? -9.791  -4.463  128.609 1.00 47.27  ? 519 PRO B N   1 
ATOM   8409 C CA  . PRO B 2 519 ? -11.130 -5.015  128.829 1.00 48.86  ? 519 PRO B CA  1 
ATOM   8410 C C   . PRO B 2 519 ? -12.107 -3.864  129.029 1.00 50.84  ? 519 PRO B C   1 
ATOM   8411 O O   . PRO B 2 519 ? -11.702 -2.738  129.315 1.00 51.39  ? 519 PRO B O   1 
ATOM   8412 C CB  . PRO B 2 519 ? -10.962 -5.837  130.102 1.00 49.24  ? 519 PRO B CB  1 
ATOM   8413 C CG  . PRO B 2 519 ? -9.523  -6.267  130.045 1.00 49.20  ? 519 PRO B CG  1 
ATOM   8414 C CD  . PRO B 2 519 ? -8.824  -5.012  129.578 1.00 47.64  ? 519 PRO B CD  1 
ATOM   8415 N N   . ALA B 2 520 ? -13.393 -4.142  128.886 1.00 53.26  ? 520 ALA B N   1 
ATOM   8416 C CA  . ALA B 2 520 ? -14.396 -3.103  129.062 1.00 55.41  ? 520 ALA B CA  1 
ATOM   8417 C C   . ALA B 2 520 ? -14.516 -2.743  130.540 1.00 57.33  ? 520 ALA B C   1 
ATOM   8418 O O   . ALA B 2 520 ? -14.736 -1.584  130.887 1.00 58.38  ? 520 ALA B O   1 
ATOM   8419 C CB  . ALA B 2 520 ? -15.740 -3.573  128.515 1.00 54.19  ? 520 ALA B CB  1 
ATOM   8420 N N   . GLU B 2 521 ? -14.353 -3.741  131.406 1.00 59.88  ? 521 GLU B N   1 
ATOM   8421 C CA  . GLU B 2 521 ? -14.444 -3.529  132.850 1.00 61.97  ? 521 GLU B CA  1 
ATOM   8422 C C   . GLU B 2 521 ? -13.590 -2.341  133.273 1.00 61.02  ? 521 GLU B C   1 
ATOM   8423 O O   . GLU B 2 521 ? -14.101 -1.366  133.827 1.00 60.51  ? 521 GLU B O   1 
ATOM   8424 C CB  . GLU B 2 521 ? -13.969 -4.772  133.604 1.00 65.73  ? 521 GLU B CB  1 
ATOM   8425 C CG  . GLU B 2 521 ? -14.561 -6.076  133.091 1.00 71.58  ? 521 GLU B CG  1 
ATOM   8426 C CD  . GLU B 2 521 ? -14.051 -7.295  133.861 1.00 74.60  ? 521 GLU B CD  1 
ATOM   8427 O OE1 . GLU B 2 521 ? -13.082 -7.155  134.647 1.00 74.83  ? 521 GLU B OE1 1 
ATOM   8428 O OE2 . GLU B 2 521 ? -14.619 -8.397  133.671 1.00 76.09  ? 521 GLU B OE2 1 
ATOM   8429 N N   . VAL B 2 522 ? -12.288 -2.438  133.009 1.00 59.76  ? 522 VAL B N   1 
ATOM   8430 C CA  . VAL B 2 522 ? -11.342 -1.384  133.359 1.00 57.69  ? 522 VAL B CA  1 
ATOM   8431 C C   . VAL B 2 522 ? -11.873 0.007   133.021 1.00 55.80  ? 522 VAL B C   1 
ATOM   8432 O O   . VAL B 2 522 ? -11.854 0.907   133.862 1.00 56.24  ? 522 VAL B O   1 
ATOM   8433 C CB  . VAL B 2 522 ? -9.991  -1.595  132.642 1.00 57.84  ? 522 VAL B CB  1 
ATOM   8434 C CG1 . VAL B 2 522 ? -9.046  -0.426  132.934 1.00 55.85  ? 522 VAL B CG1 1 
ATOM   8435 C CG2 . VAL B 2 522 ? -9.376  -2.913  133.096 1.00 57.75  ? 522 VAL B CG2 1 
ATOM   8436 N N   . THR B 2 523 ? -12.346 0.182   131.795 1.00 52.64  ? 523 THR B N   1 
ATOM   8437 C CA  . THR B 2 523 ? -12.875 1.472   131.384 1.00 51.47  ? 523 THR B CA  1 
ATOM   8438 C C   . THR B 2 523 ? -14.029 1.873   132.297 1.00 51.14  ? 523 THR B C   1 
ATOM   8439 O O   . THR B 2 523 ? -14.126 3.024   132.736 1.00 50.97  ? 523 THR B O   1 
ATOM   8440 C CB  . THR B 2 523 ? -13.379 1.420   129.952 1.00 51.23  ? 523 THR B CB  1 
ATOM   8441 O OG1 . THR B 2 523 ? -12.432 0.707   129.151 1.00 53.13  ? 523 THR B OG1 1 
ATOM   8442 C CG2 . THR B 2 523 ? -13.551 2.828   129.400 1.00 48.82  ? 523 THR B CG2 1 
ATOM   8443 N N   . THR B 2 524 ? -14.905 0.917   132.578 1.00 49.90  ? 524 THR B N   1 
ATOM   8444 C CA  . THR B 2 524 ? -16.046 1.158   133.449 1.00 49.23  ? 524 THR B CA  1 
ATOM   8445 C C   . THR B 2 524 ? -15.567 1.580   134.840 1.00 48.83  ? 524 THR B C   1 
ATOM   8446 O O   . THR B 2 524 ? -15.734 2.731   135.237 1.00 48.13  ? 524 THR B O   1 
ATOM   8447 C CB  . THR B 2 524 ? -16.920 -0.110  133.550 1.00 49.44  ? 524 THR B CB  1 
ATOM   8448 O OG1 . THR B 2 524 ? -17.639 -0.278  132.320 1.00 49.75  ? 524 THR B OG1 1 
ATOM   8449 C CG2 . THR B 2 524 ? -17.898 -0.014  134.712 1.00 48.88  ? 524 THR B CG2 1 
ATOM   8450 N N   . LYS B 2 525 ? -14.961 0.650   135.571 1.00 48.15  ? 525 LYS B N   1 
ATOM   8451 C CA  . LYS B 2 525 ? -14.455 0.945   136.904 1.00 48.71  ? 525 LYS B CA  1 
ATOM   8452 C C   . LYS B 2 525 ? -13.644 2.244   137.001 1.00 50.04  ? 525 LYS B C   1 
ATOM   8453 O O   . LYS B 2 525 ? -13.550 2.845   138.069 1.00 50.00  ? 525 LYS B O   1 
ATOM   8454 C CB  . LYS B 2 525 ? -13.587 -0.209  137.404 1.00 46.94  ? 525 LYS B CB  1 
ATOM   8455 C CG  . LYS B 2 525 ? -14.326 -1.506  137.600 1.00 47.31  ? 525 LYS B CG  1 
ATOM   8456 C CD  . LYS B 2 525 ? -13.503 -2.490  138.412 1.00 46.58  ? 525 LYS B CD  1 
ATOM   8457 C CE  . LYS B 2 525 ? -14.316 -3.725  138.748 1.00 48.74  ? 525 LYS B CE  1 
ATOM   8458 N NZ  . LYS B 2 525 ? -13.541 -4.725  139.544 1.00 51.19  ? 525 LYS B NZ  1 
ATOM   8459 N N   . SER B 2 526 ? -13.062 2.679   135.892 1.00 51.54  ? 526 SER B N   1 
ATOM   8460 C CA  . SER B 2 526 ? -12.235 3.884   135.892 1.00 53.45  ? 526 SER B CA  1 
ATOM   8461 C C   . SER B 2 526 ? -12.989 5.227   135.942 1.00 53.62  ? 526 SER B C   1 
ATOM   8462 O O   . SER B 2 526 ? -12.547 6.168   136.604 1.00 53.22  ? 526 SER B O   1 
ATOM   8463 C CB  . SER B 2 526 ? -11.315 3.865   134.667 1.00 54.65  ? 526 SER B CB  1 
ATOM   8464 O OG  . SER B 2 526 ? -12.047 4.134   133.478 1.00 56.08  ? 526 SER B OG  1 
ATOM   8465 N N   . GLN B 2 527 ? -14.113 5.308   135.234 1.00 53.65  ? 527 GLN B N   1 
ATOM   8466 C CA  . GLN B 2 527 ? -14.935 6.522   135.164 1.00 54.10  ? 527 GLN B CA  1 
ATOM   8467 C C   . GLN B 2 527 ? -14.905 7.465   136.376 1.00 53.90  ? 527 GLN B C   1 
ATOM   8468 O O   . GLN B 2 527 ? -14.233 8.505   136.356 1.00 51.26  ? 527 GLN B O   1 
ATOM   8469 C CB  . GLN B 2 527 ? -16.384 6.134   134.871 1.00 56.44  ? 527 GLN B CB  1 
ATOM   8470 C CG  . GLN B 2 527 ? -16.574 5.514   133.511 1.00 58.07  ? 527 GLN B CG  1 
ATOM   8471 C CD  . GLN B 2 527 ? -15.975 6.378   132.439 1.00 59.72  ? 527 GLN B CD  1 
ATOM   8472 O OE1 . GLN B 2 527 ? -16.282 7.567   132.353 1.00 60.89  ? 527 GLN B OE1 1 
ATOM   8473 N NE2 . GLN B 2 527 ? -15.105 5.797   131.619 1.00 61.44  ? 527 GLN B NE2 1 
ATOM   8474 N N   . ILE B 2 528 ? -15.662 7.099   137.412 1.00 53.37  ? 528 ILE B N   1 
ATOM   8475 C CA  . ILE B 2 528 ? -15.759 7.875   138.646 1.00 53.01  ? 528 ILE B CA  1 
ATOM   8476 C C   . ILE B 2 528 ? -14.386 8.254   139.192 1.00 51.75  ? 528 ILE B C   1 
ATOM   8477 O O   . ILE B 2 528 ? -14.104 9.430   139.419 1.00 50.19  ? 528 ILE B O   1 
ATOM   8478 C CB  . ILE B 2 528 ? -16.537 7.087   139.728 1.00 54.66  ? 528 ILE B CB  1 
ATOM   8479 C CG1 . ILE B 2 528 ? -17.993 6.907   139.286 1.00 54.32  ? 528 ILE B CG1 1 
ATOM   8480 C CG2 . ILE B 2 528 ? -16.446 7.804   141.078 1.00 54.75  ? 528 ILE B CG2 1 
ATOM   8481 C CD1 . ILE B 2 528 ? -18.793 5.989   140.185 1.00 54.79  ? 528 ILE B CD1 1 
ATOM   8482 N N   . PRO B 2 529 ? -13.519 7.257   139.434 1.00 50.86  ? 529 PRO B N   1 
ATOM   8483 C CA  . PRO B 2 529 ? -12.201 7.620   139.948 1.00 51.08  ? 529 PRO B CA  1 
ATOM   8484 C C   . PRO B 2 529 ? -11.627 8.758   139.114 1.00 51.90  ? 529 PRO B C   1 
ATOM   8485 O O   . PRO B 2 529 ? -11.297 9.820   139.640 1.00 52.68  ? 529 PRO B O   1 
ATOM   8486 C CB  . PRO B 2 529 ? -11.413 6.327   139.796 1.00 49.58  ? 529 PRO B CB  1 
ATOM   8487 C CG  . PRO B 2 529 ? -12.447 5.293   140.104 1.00 49.86  ? 529 PRO B CG  1 
ATOM   8488 C CD  . PRO B 2 529 ? -13.660 5.792   139.340 1.00 50.35  ? 529 PRO B CD  1 
ATOM   8489 N N   . LEU B 2 530 ? -11.544 8.544   137.805 1.00 52.03  ? 530 LEU B N   1 
ATOM   8490 C CA  . LEU B 2 530 ? -10.997 9.555   136.909 1.00 52.94  ? 530 LEU B CA  1 
ATOM   8491 C C   . LEU B 2 530 ? -11.619 10.935  137.119 1.00 53.72  ? 530 LEU B C   1 
ATOM   8492 O O   . LEU B 2 530 ? -10.905 11.937  137.207 1.00 53.16  ? 530 LEU B O   1 
ATOM   8493 C CB  . LEU B 2 530 ? -11.167 9.122   135.445 1.00 52.32  ? 530 LEU B CB  1 
ATOM   8494 C CG  . LEU B 2 530 ? -10.365 7.903   134.967 1.00 51.85  ? 530 LEU B CG  1 
ATOM   8495 C CD1 . LEU B 2 530 ? -10.636 7.651   133.494 1.00 51.37  ? 530 LEU B CD1 1 
ATOM   8496 C CD2 . LEU B 2 530 ? -8.887  8.140   135.191 1.00 51.40  ? 530 LEU B CD2 1 
ATOM   8497 N N   . SER B 2 531 ? -12.946 10.982  137.204 1.00 55.09  ? 531 SER B N   1 
ATOM   8498 C CA  . SER B 2 531 ? -13.661 12.241  137.395 1.00 54.86  ? 531 SER B CA  1 
ATOM   8499 C C   . SER B 2 531 ? -13.088 12.996  138.577 1.00 54.79  ? 531 SER B C   1 
ATOM   8500 O O   . SER B 2 531 ? -12.722 14.160  138.461 1.00 54.98  ? 531 SER B O   1 
ATOM   8501 C CB  . SER B 2 531 ? -15.148 11.979  137.632 1.00 54.50  ? 531 SER B CB  1 
ATOM   8502 O OG  . SER B 2 531 ? -15.342 11.203  138.800 1.00 53.48  ? 531 SER B OG  1 
ATOM   8503 N N   . LYS B 2 532 ? -13.009 12.328  139.719 1.00 55.09  ? 532 LYS B N   1 
ATOM   8504 C CA  . LYS B 2 532 ? -12.465 12.964  140.907 1.00 56.76  ? 532 LYS B CA  1 
ATOM   8505 C C   . LYS B 2 532 ? -11.047 13.443  140.625 1.00 56.42  ? 532 LYS B C   1 
ATOM   8506 O O   . LYS B 2 532 ? -10.671 14.562  140.986 1.00 57.10  ? 532 LYS B O   1 
ATOM   8507 C CB  . LYS B 2 532 ? -12.471 11.989  142.091 1.00 58.08  ? 532 LYS B CB  1 
ATOM   8508 C CG  . LYS B 2 532 ? -13.869 11.638  142.563 1.00 60.00  ? 532 LYS B CG  1 
ATOM   8509 C CD  . LYS B 2 532 ? -13.848 10.651  143.711 1.00 63.26  ? 532 LYS B CD  1 
ATOM   8510 C CE  . LYS B 2 532 ? -15.269 10.309  144.164 1.00 64.60  ? 532 LYS B CE  1 
ATOM   8511 N NZ  . LYS B 2 532 ? -15.299 9.269   145.241 1.00 65.91  ? 532 LYS B NZ  1 
ATOM   8512 N N   . ILE B 2 533 ? -10.260 12.600  139.968 1.00 55.29  ? 533 ILE B N   1 
ATOM   8513 C CA  . ILE B 2 533 ? -8.895  12.973  139.660 1.00 53.14  ? 533 ILE B CA  1 
ATOM   8514 C C   . ILE B 2 533 ? -8.857  14.164  138.734 1.00 53.20  ? 533 ILE B C   1 
ATOM   8515 O O   . ILE B 2 533 ? -7.901  14.937  138.756 1.00 53.26  ? 533 ILE B O   1 
ATOM   8516 C CB  . ILE B 2 533 ? -8.117  11.817  139.044 1.00 50.93  ? 533 ILE B CB  1 
ATOM   8517 C CG1 . ILE B 2 533 ? -7.866  10.773  140.129 1.00 49.81  ? 533 ILE B CG1 1 
ATOM   8518 C CG2 . ILE B 2 533 ? -6.819  12.329  138.428 1.00 49.28  ? 533 ILE B CG2 1 
ATOM   8519 C CD1 . ILE B 2 533 ? -6.804  9.784   139.799 1.00 50.82  ? 533 ILE B CD1 1 
ATOM   8520 N N   . LYS B 2 534 ? -9.893  14.332  137.926 1.00 52.48  ? 534 LYS B N   1 
ATOM   8521 C CA  . LYS B 2 534 ? -9.889  15.480  137.049 1.00 54.03  ? 534 LYS B CA  1 
ATOM   8522 C C   . LYS B 2 534 ? -9.973  16.730  137.916 1.00 55.65  ? 534 LYS B C   1 
ATOM   8523 O O   . LYS B 2 534 ? -9.087  17.591  137.880 1.00 56.72  ? 534 LYS B O   1 
ATOM   8524 C CB  . LYS B 2 534 ? -11.062 15.449  136.070 1.00 53.07  ? 534 LYS B CB  1 
ATOM   8525 C CG  . LYS B 2 534 ? -10.997 16.594  135.072 1.00 52.17  ? 534 LYS B CG  1 
ATOM   8526 C CD  . LYS B 2 534 ? -11.897 16.380  133.882 1.00 52.72  ? 534 LYS B CD  1 
ATOM   8527 C CE  . LYS B 2 534 ? -11.655 17.447  132.826 1.00 52.11  ? 534 LYS B CE  1 
ATOM   8528 N NZ  . LYS B 2 534 ? -12.493 17.195  131.622 1.00 54.20  ? 534 LYS B NZ  1 
ATOM   8529 N N   . THR B 2 535 ? -11.033 16.816  138.713 1.00 55.54  ? 535 THR B N   1 
ATOM   8530 C CA  . THR B 2 535 ? -11.228 17.968  139.573 1.00 55.25  ? 535 THR B CA  1 
ATOM   8531 C C   . THR B 2 535 ? -10.036 18.197  140.500 1.00 54.96  ? 535 THR B C   1 
ATOM   8532 O O   . THR B 2 535 ? -9.376  19.233  140.412 1.00 55.00  ? 535 THR B O   1 
ATOM   8533 C CB  . THR B 2 535 ? -12.530 17.839  140.420 1.00 55.33  ? 535 THR B CB  1 
ATOM   8534 O OG1 . THR B 2 535 ? -12.458 16.678  141.254 1.00 56.05  ? 535 THR B OG1 1 
ATOM   8535 C CG2 . THR B 2 535 ? -13.747 17.721  139.514 1.00 54.60  ? 535 THR B CG2 1 
ATOM   8536 N N   . LEU B 2 536 ? -9.748  17.230  141.369 1.00 54.38  ? 536 LEU B N   1 
ATOM   8537 C CA  . LEU B 2 536 ? -8.644  17.359  142.326 1.00 54.09  ? 536 LEU B CA  1 
ATOM   8538 C C   . LEU B 2 536 ? -7.256  17.732  141.781 1.00 53.60  ? 536 LEU B C   1 
ATOM   8539 O O   . LEU B 2 536 ? -6.398  18.191  142.540 1.00 53.04  ? 536 LEU B O   1 
ATOM   8540 C CB  . LEU B 2 536 ? -8.532  16.084  143.163 1.00 54.46  ? 536 LEU B CB  1 
ATOM   8541 C CG  . LEU B 2 536 ? -9.657  15.878  144.172 1.00 54.90  ? 536 LEU B CG  1 
ATOM   8542 C CD1 . LEU B 2 536 ? -9.388  14.643  145.045 1.00 55.84  ? 536 LEU B CD1 1 
ATOM   8543 C CD2 . LEU B 2 536 ? -9.743  17.122  145.028 1.00 55.73  ? 536 LEU B CD2 1 
ATOM   8544 N N   . PHE B 2 537 ? -7.020  17.530  140.485 1.00 53.06  ? 537 PHE B N   1 
ATOM   8545 C CA  . PHE B 2 537 ? -5.726  17.887  139.904 1.00 51.99  ? 537 PHE B CA  1 
ATOM   8546 C C   . PHE B 2 537 ? -5.855  18.923  138.797 1.00 52.69  ? 537 PHE B C   1 
ATOM   8547 O O   . PHE B 2 537 ? -6.084  18.590  137.631 1.00 53.08  ? 537 PHE B O   1 
ATOM   8548 C CB  . PHE B 2 537 ? -5.003  16.657  139.362 1.00 48.82  ? 537 PHE B CB  1 
ATOM   8549 C CG  . PHE B 2 537 ? -4.558  15.698  140.427 1.00 48.08  ? 537 PHE B CG  1 
ATOM   8550 C CD1 . PHE B 2 537 ? -5.479  14.886  141.081 1.00 47.65  ? 537 PHE B CD1 1 
ATOM   8551 C CD2 . PHE B 2 537 ? -3.214  15.606  140.781 1.00 46.61  ? 537 PHE B CD2 1 
ATOM   8552 C CE1 . PHE B 2 537 ? -5.068  13.997  142.068 1.00 46.49  ? 537 PHE B CE1 1 
ATOM   8553 C CE2 . PHE B 2 537 ? -2.794  14.724  141.763 1.00 44.40  ? 537 PHE B CE2 1 
ATOM   8554 C CZ  . PHE B 2 537 ? -3.722  13.917  142.407 1.00 45.87  ? 537 PHE B CZ  1 
ATOM   8555 N N   . PRO B 2 538 ? -5.708  20.205  139.152 1.00 53.21  ? 538 PRO B N   1 
ATOM   8556 C CA  . PRO B 2 538 ? -5.812  21.279  138.161 1.00 54.00  ? 538 PRO B CA  1 
ATOM   8557 C C   . PRO B 2 538 ? -4.733  21.127  137.096 1.00 54.39  ? 538 PRO B C   1 
ATOM   8558 O O   . PRO B 2 538 ? -3.619  20.681  137.383 1.00 55.57  ? 538 PRO B O   1 
ATOM   8559 C CB  . PRO B 2 538 ? -5.630  22.539  138.999 1.00 52.87  ? 538 PRO B CB  1 
ATOM   8560 C CG  . PRO B 2 538 ? -4.695  22.075  140.087 1.00 53.48  ? 538 PRO B CG  1 
ATOM   8561 C CD  . PRO B 2 538 ? -5.290  20.734  140.463 1.00 53.14  ? 538 PRO B CD  1 
ATOM   8562 N N   . LEU B 2 539 ? -5.064  21.490  135.868 1.00 54.08  ? 539 LEU B N   1 
ATOM   8563 C CA  . LEU B 2 539 ? -4.105  21.375  134.788 1.00 55.67  ? 539 LEU B CA  1 
ATOM   8564 C C   . LEU B 2 539 ? -4.408  22.433  133.747 1.00 57.81  ? 539 LEU B C   1 
ATOM   8565 O O   . LEU B 2 539 ? -5.497  22.460  133.172 1.00 57.75  ? 539 LEU B O   1 
ATOM   8566 C CB  . LEU B 2 539 ? -4.191  19.981  134.158 1.00 53.61  ? 539 LEU B CB  1 
ATOM   8567 C CG  . LEU B 2 539 ? -3.798  18.798  135.041 1.00 50.70  ? 539 LEU B CG  1 
ATOM   8568 C CD1 . LEU B 2 539 ? -4.392  17.516  134.495 1.00 50.44  ? 539 LEU B CD1 1 
ATOM   8569 C CD2 . LEU B 2 539 ? -2.286  18.714  135.117 1.00 50.41  ? 539 LEU B CD2 1 
ATOM   8570 N N   . ILE B 2 540 ? -3.446  23.316  133.514 1.00 60.57  ? 540 ILE B N   1 
ATOM   8571 C CA  . ILE B 2 540 ? -3.640  24.367  132.527 1.00 63.76  ? 540 ILE B CA  1 
ATOM   8572 C C   . ILE B 2 540 ? -2.413  24.532  131.630 1.00 65.34  ? 540 ILE B C   1 
ATOM   8573 O O   . ILE B 2 540 ? -1.272  24.571  132.102 1.00 64.52  ? 540 ILE B O   1 
ATOM   8574 C CB  . ILE B 2 540 ? -3.996  25.718  133.215 1.00 63.71  ? 540 ILE B CB  1 
ATOM   8575 C CG1 . ILE B 2 540 ? -4.206  26.806  132.155 1.00 63.62  ? 540 ILE B CG1 1 
ATOM   8576 C CG2 . ILE B 2 540 ? -2.912  26.097  134.220 1.00 63.07  ? 540 ILE B CG2 1 
ATOM   8577 C CD1 . ILE B 2 540 ? -4.786  28.112  132.693 1.00 63.26  ? 540 ILE B CD1 1 
ATOM   8578 N N   . GLU B 2 541 ? -2.663  24.607  130.327 1.00 68.06  ? 541 GLU B N   1 
ATOM   8579 C CA  . GLU B 2 541 ? -1.590  24.762  129.354 1.00 71.89  ? 541 GLU B CA  1 
ATOM   8580 C C   . GLU B 2 541 ? -0.969  26.154  129.453 1.00 72.84  ? 541 GLU B C   1 
ATOM   8581 O O   . GLU B 2 541 ? -1.684  27.147  129.573 1.00 74.17  ? 541 GLU B O   1 
ATOM   8582 C CB  . GLU B 2 541 ? -2.124  24.532  127.935 1.00 73.35  ? 541 GLU B CB  1 
ATOM   8583 C CG  . GLU B 2 541 ? -2.745  23.160  127.711 1.00 75.95  ? 541 GLU B CG  1 
ATOM   8584 C CD  . GLU B 2 541 ? -2.778  22.770  126.239 1.00 77.88  ? 541 GLU B CD  1 
ATOM   8585 O OE1 . GLU B 2 541 ? -1.694  22.661  125.627 1.00 76.87  ? 541 GLU B OE1 1 
ATOM   8586 O OE2 . GLU B 2 541 ? -3.884  22.570  125.691 1.00 79.98  ? 541 GLU B OE2 1 
ATOM   8587 N N   . ALA B 2 542 ? 0.358   26.229  129.401 1.00 73.19  ? 542 ALA B N   1 
ATOM   8588 C CA  . ALA B 2 542 ? 1.026   27.517  129.486 1.00 74.33  ? 542 ALA B CA  1 
ATOM   8589 C C   . ALA B 2 542 ? 0.636   28.404  128.292 1.00 75.12  ? 542 ALA B C   1 
ATOM   8590 O O   . ALA B 2 542 ? 0.239   27.845  127.244 1.00 76.17  ? 542 ALA B O   1 
ATOM   8591 C CB  . ALA B 2 542 ? 2.536   27.313  129.527 1.00 74.67  ? 542 ALA B CB  1 
HETATM 8592 O O   . HOH C 3 .   ? -2.953  -4.428  92.392  1.00 37.40  ? 610 HOH A O   1 
HETATM 8593 O O   . HOH C 3 .   ? 6.513   -8.784  130.930 1.00 35.84  ? 611 HOH A O   1 
HETATM 8594 O O   . HOH C 3 .   ? 8.801   19.983  137.365 1.00 56.45  ? 612 HOH A O   1 
HETATM 8595 O O   . HOH C 3 .   ? 12.445  -1.316  127.686 1.00 26.11  ? 613 HOH A O   1 
HETATM 8596 O O   . HOH C 3 .   ? 14.736  4.279   131.974 1.00 24.30  ? 614 HOH A O   1 
HETATM 8597 O O   . HOH C 3 .   ? 39.257  29.534  146.423 1.00 57.13  ? 615 HOH A O   1 
HETATM 8598 O O   . HOH C 3 .   ? 3.872   -4.173  122.117 1.00 23.41  ? 616 HOH A O   1 
HETATM 8599 O O   . HOH C 3 .   ? 11.774  -10.805 135.753 1.00 22.66  ? 617 HOH A O   1 
HETATM 8600 O O   . HOH C 3 .   ? 11.905  8.976   144.730 1.00 17.09  ? 618 HOH A O   1 
HETATM 8601 O O   . HOH C 3 .   ? 16.299  5.728   134.586 1.00 17.00  ? 619 HOH A O   1 
HETATM 8602 O O   . HOH C 3 .   ? 30.524  -37.854 136.292 1.00 18.83  ? 620 HOH A O   1 
HETATM 8603 O O   . HOH C 3 .   ? 32.924  5.999   146.978 1.00 38.39  ? 621 HOH A O   1 
HETATM 8604 O O   . HOH C 3 .   ? 36.580  -7.463  137.077 1.00 19.86  ? 622 HOH A O   1 
HETATM 8605 O O   . HOH C 3 .   ? 36.650  39.734  145.123 1.00 32.04  ? 623 HOH A O   1 
HETATM 8606 O O   . HOH C 3 .   ? 37.656  -23.256 125.223 1.00 17.66  ? 624 HOH A O   1 
HETATM 8607 O O   . HOH C 3 .   ? 3.745   -5.989  124.541 1.00 22.48  ? 625 HOH A O   1 
HETATM 8608 O O   . HOH C 3 .   ? 7.931   10.287  95.399  1.00 46.62  ? 626 HOH A O   1 
HETATM 8609 O O   . HOH C 3 .   ? 14.270  -15.296 115.028 1.00 17.39  ? 627 HOH A O   1 
HETATM 8610 O O   . HOH C 3 .   ? 20.202  11.477  137.932 1.00 34.36  ? 628 HOH A O   1 
HETATM 8611 O O   . HOH C 3 .   ? 35.803  33.890  151.489 1.00 26.97  ? 629 HOH A O   1 
HETATM 8612 O O   . HOH C 3 .   ? 41.177  -25.985 140.027 1.00 26.22  ? 630 HOH A O   1 
HETATM 8613 O O   . HOH D 3 .   ? -21.561 -31.986 111.279 1.00 33.09  ? 566 HOH B O   1 
HETATM 8614 O O   . HOH D 3 .   ? -10.015 2.933   129.364 1.00 34.83  ? 567 HOH B O   1 
HETATM 8615 O O   . HOH D 3 .   ? -22.419 -20.627 117.784 1.00 18.55  ? 568 HOH B O   1 
HETATM 8616 O O   . HOH D 3 .   ? -2.490  -13.700 92.278  1.00 28.18  ? 569 HOH B O   1 
HETATM 8617 O O   . HOH D 3 .   ? 28.509  -3.908  125.504 1.00 15.22  ? 570 HOH B O   1 
HETATM 8618 O O   . HOH D 3 .   ? 28.768  2.016   122.563 1.00 11.93  ? 571 HOH B O   1 
HETATM 8619 O O   . HOH D 3 .   ? -11.368 -21.731 123.697 1.00 45.93  ? 572 HOH B O   1 
HETATM 8620 O O   . HOH D 3 .   ? -2.672  -10.895 109.513 1.00 29.98  ? 573 HOH B O   1 
HETATM 8621 O O   . HOH D 3 .   ? -1.425  -35.487 115.476 1.00 24.52  ? 574 HOH B O   1 
HETATM 8622 O O   . HOH D 3 .   ? 1.729   -6.816  129.490 1.00 26.72  ? 575 HOH B O   1 
HETATM 8623 O O   . HOH D 3 .   ? 1.806   -37.201 105.367 1.00 29.53  ? 576 HOH B O   1 
HETATM 8624 O O   . HOH D 3 .   ? 6.750   -8.111  106.702 1.00 30.90  ? 577 HOH B O   1 
HETATM 8625 O O   . HOH D 3 .   ? 9.445   0.101   119.058 1.00 26.94  ? 578 HOH B O   1 
HETATM 8626 O O   . HOH D 3 .   ? 9.362   -5.757  128.953 1.00 51.83  ? 579 HOH B O   1 
HETATM 8627 O O   . HOH D 3 .   ? 13.693  -17.753 136.764 1.00 23.39  ? 580 HOH B O   1 
HETATM 8628 O O   . HOH D 3 .   ? 13.377  -14.238 126.988 1.00 24.66  ? 581 HOH B O   1 
HETATM 8629 O O   . HOH D 3 .   ? 20.806  -6.960  147.489 1.00 19.16  ? 582 HOH B O   1 
HETATM 8630 O O   . HOH D 3 .   ? 21.327  -26.058 129.268 1.00 26.82  ? 583 HOH B O   1 
HETATM 8631 O O   . HOH D 3 .   ? 1.709   -10.647 128.523 1.00 29.39  ? 584 HOH B O   1 
HETATM 8632 O O   . HOH D 3 .   ? 21.034  -7.433  124.024 1.00 25.78  ? 585 HOH B O   1 
HETATM 8633 O O   . HOH D 3 .   ? 26.261  -36.473 126.727 1.00 29.88  ? 586 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   TRP 4   4   ?   ?   ?   A . n 
A 1 5   GLU 5   5   ?   ?   ?   A . n 
A 1 6   SER 6   6   ?   ?   ?   A . n 
A 1 7   TYR 7   7   ?   ?   ?   A . n 
A 1 8   TYR 8   8   ?   ?   ?   A . n 
A 1 9   LYS 9   9   ?   ?   ?   A . n 
A 1 10  THR 10  10  ?   ?   ?   A . n 
A 1 11  GLU 11  11  ?   ?   ?   A . n 
A 1 12  GLY 12  12  ?   ?   ?   A . n 
A 1 13  ASP 13  13  ?   ?   ?   A . n 
A 1 14  GLU 14  14  ?   ?   ?   A . n 
A 1 15  GLU 15  15  ?   ?   ?   A . n 
A 1 16  ALA 16  16  ?   ?   ?   A . n 
A 1 17  GLU 17  17  ?   ?   ?   A . n 
A 1 18  GLU 18  18  ?   ?   ?   A . n 
A 1 19  GLU 19  19  ?   ?   ?   A . n 
A 1 20  GLN 20  20  ?   ?   ?   A . n 
A 1 21  GLU 21  21  ?   ?   ?   A . n 
A 1 22  GLU 22  22  ?   ?   ?   A . n 
A 1 23  ASN 23  23  ?   ?   ?   A . n 
A 1 24  LEU 24  24  ?   ?   ?   A . n 
A 1 25  GLU 25  25  ?   ?   ?   A . n 
A 1 26  ALA 26  26  ?   ?   ?   A . n 
A 1 27  SER 27  27  ?   ?   ?   A . n 
A 1 28  GLY 28  28  ?   ?   ?   A . n 
A 1 29  ASP 29  29  ?   ?   ?   A . n 
A 1 30  TYR 30  30  ?   ?   ?   A . n 
A 1 31  LYS 31  31  ?   ?   ?   A . n 
A 1 32  TYR 32  32  ?   ?   ?   A . n 
A 1 33  SER 33  33  ?   ?   ?   A . n 
A 1 34  GLY 34  34  ?   ?   ?   A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  SER 37  37  37  SER SER A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  ILE 39  39  39  ILE ILE A . n 
A 1 40  PHE 40  40  40  PHE PHE A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  ASP 43  43  43  ASP ASP A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PHE 49  49  49  PHE PHE A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  GLN 52  52  52  GLN GLN A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  MET 62  62  62  MET MET A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  GLN 65  65  65  GLN GLN A . n 
A 1 66  CYS 66  66  66  CYS CYS A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  SER 69  69  69  SER SER A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  ILE 72  72  72  ILE ILE A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  ILE 76  76  76  ILE ILE A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  ASP 79  79  79  ASP ASP A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  VAL 86  86  86  VAL VAL A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  ASN 95  95  95  ASN ASN A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 ASN 101 101 101 ASN ASN A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 TYR 103 103 103 TYR TYR A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ASP 109 109 109 ASP ASP A . n 
A 1 110 ASN 110 110 110 ASN ASN A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 ASP 120 120 120 ASP ASP A . n 
A 1 121 GLN 121 121 121 GLN GLN A . n 
A 1 122 PHE 122 122 122 PHE PHE A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 GLN 125 125 125 GLN GLN A . n 
A 1 126 GLN 126 126 126 GLN GLN A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 GLN 128 128 128 GLN GLN A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 ARG 130 130 130 ARG ARG A . n 
A 1 131 PHE 131 131 131 PHE PHE A . n 
A 1 132 GLN 132 132 132 GLN GLN A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 MET 134 134 134 MET MET A . n 
A 1 135 MET 135 135 135 MET MET A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 HIS 137 137 137 HIS HIS A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 TYR 141 141 141 TYR TYR A . n 
A 1 142 SER 142 142 142 SER SER A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 SER 144 144 144 SER SER A . n 
A 1 145 GLU 145 145 145 GLU GLU A . n 
A 1 146 VAL 146 146 146 VAL VAL A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 TRP 148 148 148 TRP TRP A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 CYS 150 150 150 CYS CYS A . n 
A 1 151 ALA 151 151 151 ALA ALA A . n 
A 1 152 ASN 152 152 152 ASN ASN A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 PHE 154 154 154 PHE PHE A . n 
A 1 155 SER 155 155 155 SER SER A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 GLN 158 158 158 GLN GLN A . n 
A 1 159 PHE 159 159 159 PHE PHE A . n 
A 1 160 LYS 160 160 160 LYS LYS A . n 
A 1 161 MET 161 161 161 MET MET A . n 
A 1 162 SER 162 162 162 SER ALA A . n 
A 1 163 HIS 163 163 163 HIS HIS A . n 
A 1 164 LYS 164 164 164 LYS LYS A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 MET 167 167 167 MET MET A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 PHE 169 169 169 PHE PHE A . n 
A 1 170 THR 170 170 170 THR THR A . n 
A 1 171 ASN 171 171 171 ASN ASN A . n 
A 1 172 GLU 172 172 172 GLU GLU A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 ASN 174 174 174 ASN ASN A . n 
A 1 175 PRO 175 175 175 PRO PRO A . n 
A 1 176 HIS 176 176 176 HIS HIS A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 ASN 178 178 178 ASN ASN A . n 
A 1 179 ASP 179 179 179 ASP ASP A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 ALA 181 181 181 ALA ALA A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 ARG 185 185 185 ARG ARG A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 ARG 187 187 187 ARG ARG A . n 
A 1 188 THR 188 188 188 THR THR A . n 
A 1 189 LYS 189 189 189 LYS LYS A . n 
A 1 190 ALA 190 190 190 ALA ALA A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 ASP 195 195 195 ASP ASP A . n 
A 1 196 THR 196 196 196 THR THR A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 ILE 198 198 198 ILE ILE A . n 
A 1 199 PHE 199 199 199 PHE PHE A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 ASP 201 201 201 ASP ASP A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 MET 203 203 203 MET MET A . n 
A 1 204 HIS 204 204 204 HIS HIS A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 LYS 206 206 206 LYS LYS A . n 
A 1 207 LYS 207 207 207 LYS LYS A . n 
A 1 208 PRO 208 208 208 PRO PRO A . n 
A 1 209 GLY 209 209 209 GLY GLY A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 PHE 211 211 211 PHE PHE A . n 
A 1 212 ASP 212 212 212 ASP ASP A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 SER 214 214 214 SER SER A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 PHE 216 216 216 PHE PHE A . n 
A 1 217 TYR 217 217 217 TYR TYR A . n 
A 1 218 ARG 218 218 218 ARG ARG A . n 
A 1 219 ASP 219 219 219 ASP ASP A . n 
A 1 220 ILE 220 220 220 ILE ILE A . n 
A 1 221 ILE 221 221 221 ILE ILE A . n 
A 1 222 SER 222 222 222 SER SER A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 ALA 224 224 ?   ?   ?   A . n 
A 1 225 GLU 225 225 ?   ?   ?   A . n 
A 1 226 ASP 226 226 ?   ?   ?   A . n 
A 1 227 GLU 227 227 ?   ?   ?   A . n 
A 1 228 ASP 228 228 ?   ?   ?   A . n 
A 1 229 LEU 229 229 ?   ?   ?   A . n 
A 1 230 ARG 230 230 ?   ?   ?   A . n 
A 1 231 VAL 231 231 231 VAL VAL A . n 
A 1 232 HIS 232 232 232 HIS HIS A . n 
A 1 233 PHE 233 233 233 PHE PHE A . n 
A 1 234 GLU 234 234 234 GLU GLU A . n 
A 1 235 GLU 235 235 235 GLU GLU A . n 
A 1 236 SER 236 236 236 SER SER A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 LEU 239 239 239 LEU LEU A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 ASP 241 241 241 ASP ASP A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 LEU 243 243 243 LEU LEU A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 LYS 245 245 245 LYS LYS A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 LYS 249 249 249 LYS LYS A . n 
A 1 250 GLU 250 250 250 GLU GLU A . n 
A 1 251 THR 251 251 251 THR THR A . n 
A 1 252 ARG 252 252 252 ARG ARG A . n 
A 1 253 LYS 253 253 253 LYS LYS A . n 
A 1 254 ARG 254 254 254 ARG ARG A . n 
A 1 255 ALA 255 255 255 ALA ALA A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 SER 257 257 257 SER SER A . n 
A 1 258 ARG 258 258 258 ARG ARG A . n 
A 1 259 LEU 259 259 259 LEU LEU A . n 
A 1 260 LYS 260 260 260 LYS LYS A . n 
A 1 261 LEU 261 261 261 LEU LEU A . n 
A 1 262 LYS 262 262 262 LYS LYS A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 ASN 264 264 264 ASN ASN A . n 
A 1 265 LYS 265 265 265 LYS LYS A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 ILE 267 267 267 ILE ILE A . n 
A 1 268 VAL 268 268 268 VAL VAL A . n 
A 1 269 ILE 269 269 269 ILE ILE A . n 
A 1 270 SER 270 270 270 SER SER A . n 
A 1 271 VAL 271 271 271 VAL VAL A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 ILE 273 273 273 ILE ILE A . n 
A 1 274 TYR 274 274 274 TYR TYR A . n 
A 1 275 ASN 275 275 275 ASN ASN A . n 
A 1 276 LEU 276 276 276 LEU LEU A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLN 278 278 278 GLN GLN A . n 
A 1 279 LYS 279 279 279 LYS LYS A . n 
A 1 280 ALA 280 280 280 ALA ALA A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 LYS 282 282 282 LYS LYS A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PRO 284 284 284 PRO PRO A . n 
A 1 285 PRO 285 285 285 PRO PRO A . n 
A 1 286 ILE 286 286 286 ILE ILE A . n 
A 1 287 LYS 287 287 287 LYS LYS A . n 
A 1 288 LEU 288 288 288 LEU LEU A . n 
A 1 289 TYR 289 289 289 TYR TYR A . n 
A 1 290 ARG 290 290 290 ARG ARG A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 THR 292 292 292 THR THR A . n 
A 1 293 ASN 293 293 293 ASN ASN A . n 
A 1 294 GLU 294 294 294 GLU GLU A . n 
A 1 295 PRO 295 295 295 PRO PRO A . n 
A 1 296 VAL 296 296 296 VAL VAL A . n 
A 1 297 LYS 297 297 297 LYS LYS A . n 
A 1 298 THR 298 298 298 THR THR A . n 
A 1 299 LYS 299 299 299 LYS LYS A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 ARG 301 301 301 ARG ARG A . n 
A 1 302 THR 302 302 302 THR THR A . n 
A 1 303 PHE 303 303 303 PHE PHE A . n 
A 1 304 ASN 304 304 304 ASN ASN A . n 
A 1 305 THR 305 305 305 THR THR A . n 
A 1 306 SER 306 306 306 SER SER A . n 
A 1 307 THR 307 307 307 THR THR A . n 
A 1 308 GLY 308 308 308 GLY GLY A . n 
A 1 309 GLY 309 309 309 GLY GLY A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 LEU 312 312 312 LEU LEU A . n 
A 1 313 PRO 313 313 313 PRO PRO A . n 
A 1 314 SER 314 314 314 SER SER A . n 
A 1 315 ASP 315 315 315 ASP ASP A . n 
A 1 316 THR 316 316 316 THR THR A . n 
A 1 317 LYS 317 317 317 LYS LYS A . n 
A 1 318 ARG 318 318 318 ARG ARG A . n 
A 1 319 SER 319 319 319 SER SER A . n 
A 1 320 GLN 320 320 320 GLN GLN A . n 
A 1 321 ILE 321 321 321 ILE ILE A . n 
A 1 322 TYR 322 322 322 TYR TYR A . n 
A 1 323 GLY 323 323 323 GLY GLY A . n 
A 1 324 SER 324 324 324 SER SER A . n 
A 1 325 ARG 325 325 325 ARG ARG A . n 
A 1 326 GLN 326 326 326 GLN GLN A . n 
A 1 327 ILE 327 327 327 ILE ILE A . n 
A 1 328 ILE 328 328 328 ILE ILE A . n 
A 1 329 LEU 329 329 329 LEU LEU A . n 
A 1 330 GLU 330 330 330 GLU GLU A . n 
A 1 331 LYS 331 331 331 LYS LYS A . n 
A 1 332 GLU 332 332 332 GLU GLU A . n 
A 1 333 GLU 333 333 333 GLU GLU A . n 
A 1 334 THR 334 334 334 THR THR A . n 
A 1 335 GLU 335 335 335 GLU GLU A . n 
A 1 336 GLU 336 336 336 GLU GLU A . n 
A 1 337 LEU 337 337 337 LEU LEU A . n 
A 1 338 LYS 338 338 338 LYS LYS A . n 
A 1 339 ARG 339 339 339 ARG ARG A . n 
A 1 340 PHE 340 340 340 PHE PHE A . n 
A 1 341 ASP 341 341 341 ASP ASP A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 PRO 343 343 343 PRO PRO A . n 
A 1 344 GLY 344 344 344 GLY GLY A . n 
A 1 345 LEU 345 345 345 LEU LEU A . n 
A 1 346 MET 346 346 346 MET MET A . n 
A 1 347 LEU 347 347 347 LEU LEU A . n 
A 1 348 MET 348 348 348 MET MET A . n 
A 1 349 GLY 349 349 349 GLY GLY A . n 
A 1 350 PHE 350 350 350 PHE PHE A . n 
A 1 351 LYS 351 351 351 LYS LYS A . n 
A 1 352 PRO 352 352 352 PRO PRO A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 VAL 354 354 354 VAL VAL A . n 
A 1 355 LEU 355 355 355 LEU LEU A . n 
A 1 356 LEU 356 356 356 LEU LEU A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LYS 358 358 358 LYS LYS A . n 
A 1 359 HIS 359 359 359 HIS HIS A . n 
A 1 360 HIS 360 360 360 HIS HIS A . n 
A 1 361 TYR 361 361 361 TYR TYR A . n 
A 1 362 LEU 362 362 362 LEU LEU A . n 
A 1 363 ARG 363 363 363 ARG ARG A . n 
A 1 364 PRO 364 364 364 PRO PRO A . n 
A 1 365 SER 365 365 365 SER SER A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 PHE 367 367 367 PHE PHE A . n 
A 1 368 VAL 368 368 368 VAL VAL A . n 
A 1 369 TYR 369 369 369 TYR TYR A . n 
A 1 370 PRO 370 370 370 PRO PRO A . n 
A 1 371 GLU 371 371 371 GLU GLU A . n 
A 1 372 GLU 372 372 372 GLU GLU A . n 
A 1 373 SER 373 373 373 SER SER A . n 
A 1 374 LEU 374 374 374 LEU LEU A . n 
A 1 375 VAL 375 375 375 VAL VAL A . n 
A 1 376 ILE 376 376 376 ILE ILE A . n 
A 1 377 GLY 377 377 377 GLY GLY A . n 
A 1 378 SER 378 378 378 SER SER A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 THR 380 380 380 THR THR A . n 
A 1 381 LEU 381 381 381 LEU LEU A . n 
A 1 382 PHE 382 382 382 PHE PHE A . n 
A 1 383 SER 383 383 383 SER SER A . n 
A 1 384 ALA 384 384 384 ALA ALA A . n 
A 1 385 LEU 385 385 385 LEU LEU A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 ILE 387 387 387 ILE ILE A . n 
A 1 388 LYS 388 388 388 LYS LYS A . n 
A 1 389 CYS 389 389 389 CYS CYS A . n 
A 1 390 LEU 390 390 390 LEU LEU A . n 
A 1 391 GLU 391 391 391 GLU GLU A . n 
A 1 392 LYS 392 392 392 LYS LYS A . n 
A 1 393 GLU 393 393 393 GLU GLU A . n 
A 1 394 VAL 394 394 394 VAL VAL A . n 
A 1 395 ALA 395 395 395 ALA ALA A . n 
A 1 396 ALA 396 396 396 ALA ALA A . n 
A 1 397 LEU 397 397 397 LEU LEU A . n 
A 1 398 CYS 398 398 398 CYS CYS A . n 
A 1 399 ARG 399 399 399 ARG ARG A . n 
A 1 400 TYR 400 400 400 TYR TYR A . n 
A 1 401 THR 401 401 401 THR THR A . n 
A 1 402 PRO 402 402 402 PRO PRO A . n 
A 1 403 ARG 403 403 403 ARG ARG A . n 
A 1 404 ARG 404 404 404 ARG ARG A . n 
A 1 405 ASN 405 405 405 ASN ASN A . n 
A 1 406 ILE 406 406 406 ILE ILE A . n 
A 1 407 PRO 407 407 407 PRO PRO A . n 
A 1 408 PRO 408 408 408 PRO PRO A . n 
A 1 409 TYR 409 409 409 TYR TYR A . n 
A 1 410 PHE 410 410 410 PHE PHE A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 LEU 413 413 413 LEU LEU A . n 
A 1 414 VAL 414 414 414 VAL VAL A . n 
A 1 415 PRO 415 415 415 PRO PRO A . n 
A 1 416 GLN 416 416 416 GLN GLN A . n 
A 1 417 GLU 417 417 417 GLU GLU A . n 
A 1 418 GLU 418 418 418 GLU GLU A . n 
A 1 419 GLU 419 419 419 GLU GLU A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 ASP 421 421 421 ASP ASP A . n 
A 1 422 ASP 422 422 422 ASP ASP A . n 
A 1 423 GLN 423 423 423 GLN GLN A . n 
A 1 424 LYS 424 424 424 LYS LYS A . n 
A 1 425 ILE 425 425 425 ILE ILE A . n 
A 1 426 GLN 426 426 426 GLN GLN A . n 
A 1 427 VAL 427 427 427 VAL VAL A . n 
A 1 428 THR 428 428 428 THR THR A . n 
A 1 429 PRO 429 429 429 PRO PRO A . n 
A 1 430 PRO 430 430 430 PRO PRO A . n 
A 1 431 GLY 431 431 431 GLY GLY A . n 
A 1 432 PHE 432 432 432 PHE PHE A . n 
A 1 433 GLN 433 433 433 GLN GLN A . n 
A 1 434 LEU 434 434 434 LEU LEU A . n 
A 1 435 VAL 435 435 435 VAL VAL A . n 
A 1 436 PHE 436 436 436 PHE PHE A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 PRO 438 438 438 PRO PRO A . n 
A 1 439 PHE 439 439 439 PHE PHE A . n 
A 1 440 ALA 440 440 440 ALA ALA A . n 
A 1 441 ASP 441 441 441 ASP ASP A . n 
A 1 442 ASP 442 442 442 ASP ASP A . n 
A 1 443 LYS 443 443 443 LYS LYS A . n 
A 1 444 ARG 444 444 444 ARG ARG A . n 
A 1 445 LYS 445 445 445 LYS LYS A . n 
A 1 446 MET 446 446 446 MET MET A . n 
A 1 447 PRO 447 447 447 PRO PRO A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 THR 449 449 449 THR THR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 LYS 451 451 451 LYS LYS A . n 
A 1 452 ILE 452 452 452 ILE ILE A . n 
A 1 453 MET 453 453 453 MET MET A . n 
A 1 454 ALA 454 454 454 ALA ALA A . n 
A 1 455 THR 455 455 455 THR THR A . n 
A 1 456 PRO 456 456 456 PRO PRO A . n 
A 1 457 GLU 457 457 457 GLU GLU A . n 
A 1 458 GLN 458 458 458 GLN GLN A . n 
A 1 459 VAL 459 459 459 VAL VAL A . n 
A 1 460 GLY 460 460 460 GLY GLY A . n 
A 1 461 LYS 461 461 461 LYS LYS A . n 
A 1 462 MET 462 462 462 MET MET A . n 
A 1 463 LYS 463 463 463 LYS LYS A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 ILE 465 465 465 ILE ILE A . n 
A 1 466 VAL 466 466 466 VAL VAL A . n 
A 1 467 GLU 467 467 467 GLU GLU A . n 
A 1 468 LYS 468 468 468 LYS LYS A . n 
A 1 469 LEU 469 469 469 LEU LEU A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 PHE 471 471 471 PHE PHE A . n 
A 1 472 THR 472 472 472 THR THR A . n 
A 1 473 TYR 473 473 473 TYR TYR A . n 
A 1 474 ARG 474 474 474 ARG ARG A . n 
A 1 475 SER 475 475 475 SER SER A . n 
A 1 476 ASP 476 476 476 ASP ASP A . n 
A 1 477 SER 477 477 477 SER SER A . n 
A 1 478 PHE 478 478 478 PHE PHE A . n 
A 1 479 GLU 479 479 479 GLU GLU A . n 
A 1 480 ASN 480 480 480 ASN ASN A . n 
A 1 481 PRO 481 481 481 PRO PRO A . n 
A 1 482 VAL 482 482 482 VAL VAL A . n 
A 1 483 LEU 483 483 483 LEU LEU A . n 
A 1 484 GLN 484 484 484 GLN GLN A . n 
A 1 485 GLN 485 485 485 GLN GLN A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 PHE 487 487 487 PHE PHE A . n 
A 1 488 ARG 488 488 488 ARG ARG A . n 
A 1 489 ASN 489 489 489 ASN ASN A . n 
A 1 490 LEU 490 490 490 LEU LEU A . n 
A 1 491 GLU 491 491 491 GLU GLU A . n 
A 1 492 ALA 492 492 492 ALA ALA A . n 
A 1 493 LEU 493 493 493 LEU LEU A . n 
A 1 494 ALA 494 494 494 ALA ALA A . n 
A 1 495 LEU 495 495 495 LEU LEU A . n 
A 1 496 ASP 496 496 496 ASP ASP A . n 
A 1 497 LEU 497 497 497 LEU LEU A . n 
A 1 498 MET 498 498 498 MET MET A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 PRO 500 500 500 PRO PRO A . n 
A 1 501 GLU 501 501 501 GLU GLU A . n 
A 1 502 GLN 502 502 502 GLN GLN A . n 
A 1 503 ALA 503 503 503 ALA ALA A . n 
A 1 504 VAL 504 504 504 VAL VAL A . n 
A 1 505 ASP 505 505 505 ASP ASP A . n 
A 1 506 LEU 506 506 506 LEU LEU A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 LEU 508 508 508 LEU LEU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 LYS 510 510 510 LYS LYS A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 GLU 512 512 512 GLU GLU A . n 
A 1 513 ALA 513 513 513 ALA ALA A . n 
A 1 514 MET 514 514 514 MET MET A . n 
A 1 515 ASN 515 515 515 ASN ASN A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLY 519 519 519 GLY GLY A . n 
A 1 520 SER 520 520 520 SER SER A . n 
A 1 521 LEU 521 521 521 LEU LEU A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 ASP 523 523 523 ASP ASP A . n 
A 1 524 GLU 524 524 524 GLU GLU A . n 
A 1 525 PHE 525 525 525 PHE PHE A . n 
A 1 526 LYS 526 526 526 LYS LYS A . n 
A 1 527 GLU 527 527 527 GLU GLU A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 VAL 529 529 529 VAL VAL A . n 
A 1 530 TYR 530 530 530 TYR TYR A . n 
A 1 531 PRO 531 531 531 PRO PRO A . n 
A 1 532 PRO 532 532 532 PRO PRO A . n 
A 1 533 ASP 533 533 533 ASP ASP A . n 
A 1 534 TYR 534 534 534 TYR TYR A . n 
A 1 535 ASN 535 535 535 ASN ASN A . n 
A 1 536 PRO 536 536 536 PRO PRO A . n 
A 1 537 GLU 537 537 537 GLU GLU A . n 
A 1 538 GLY 538 538 538 GLY GLY A . n 
A 1 539 LYS 539 539 ?   ?   ?   A . n 
A 1 540 VAL 540 540 ?   ?   ?   A . n 
A 1 541 THR 541 541 ?   ?   ?   A . n 
A 1 542 LYS 542 542 ?   ?   ?   A . n 
A 1 543 ARG 543 543 ?   ?   ?   A . n 
A 1 544 LYS 544 544 ?   ?   ?   A . n 
A 1 545 HIS 545 545 ?   ?   ?   A . n 
A 1 546 ASP 546 546 ?   ?   ?   A . n 
A 1 547 ASN 547 547 ?   ?   ?   A . n 
A 1 548 GLU 548 548 ?   ?   ?   A . n 
A 1 549 GLY 549 549 ?   ?   ?   A . n 
A 1 550 SER 550 550 ?   ?   ?   A . n 
A 1 551 GLY 551 551 ?   ?   ?   A . n 
A 1 552 SER 552 552 ?   ?   ?   A . n 
A 1 553 LYS 553 553 ?   ?   ?   A . n 
A 1 554 ARG 554 554 ?   ?   ?   A . n 
A 1 555 PRO 555 555 ?   ?   ?   A . n 
A 1 556 LYS 556 556 ?   ?   ?   A . n 
A 1 557 VAL 557 557 ?   ?   ?   A . n 
A 1 558 GLU 558 558 ?   ?   ?   A . n 
A 1 559 TYR 559 559 559 TYR TYR A . n 
A 1 560 SER 560 560 560 SER SER A . n 
A 1 561 GLU 561 561 561 GLU GLU A . n 
A 1 562 GLU 562 562 562 GLU GLU A . n 
A 1 563 GLU 563 563 563 GLU GLU A . n 
A 1 564 LEU 564 564 564 LEU LEU A . n 
A 1 565 LYS 565 565 565 LYS LYS A . n 
A 1 566 THR 566 566 566 THR THR A . n 
A 1 567 HIS 567 567 567 HIS HIS A . n 
A 1 568 ILE 568 568 568 ILE ILE A . n 
A 1 569 SER 569 569 569 SER SER A . n 
A 1 570 LYS 570 570 570 LYS LYS A . n 
A 1 571 GLY 571 571 571 GLY GLY A . n 
A 1 572 THR 572 572 572 THR THR A . n 
A 1 573 LEU 573 573 573 LEU LEU A . n 
A 1 574 GLY 574 574 574 GLY GLY A . n 
A 1 575 LYS 575 575 575 LYS LYS A . n 
A 1 576 PHE 576 576 576 PHE PHE A . n 
A 1 577 THR 577 577 577 THR THR A . n 
A 1 578 VAL 578 578 578 VAL VAL A . n 
A 1 579 PRO 579 579 579 PRO PRO A . n 
A 1 580 MET 580 580 580 MET MET A . n 
A 1 581 LEU 581 581 581 LEU LEU A . n 
A 1 582 LYS 582 582 582 LYS LYS A . n 
A 1 583 GLU 583 583 583 GLU GLU A . n 
A 1 584 ALA 584 584 584 ALA ALA A . n 
A 1 585 CYS 585 585 585 CYS CYS A . n 
A 1 586 ARG 586 586 586 ARG ARG A . n 
A 1 587 ALA 587 587 587 ALA ALA A . n 
A 1 588 TYR 588 588 588 TYR TYR A . n 
A 1 589 GLY 589 589 589 GLY GLY A . n 
A 1 590 LEU 590 590 590 LEU LEU A . n 
A 1 591 LYS 591 591 591 LYS LYS A . n 
A 1 592 SER 592 592 592 SER SER A . n 
A 1 593 GLY 593 593 593 GLY GLY A . n 
A 1 594 LEU 594 594 594 LEU LEU A . n 
A 1 595 LYS 595 595 595 LYS LYS A . n 
A 1 596 LYS 596 596 596 LYS LYS A . n 
A 1 597 GLN 597 597 597 GLN GLN A . n 
A 1 598 GLU 598 598 598 GLU GLU A . n 
A 1 599 LEU 599 599 599 LEU LEU A . n 
A 1 600 LEU 600 600 600 LEU LEU A . n 
A 1 601 GLU 601 601 601 GLU GLU A . n 
A 1 602 ALA 602 602 602 ALA ALA A . n 
A 1 603 LEU 603 603 603 LEU LEU A . n 
A 1 604 THR 604 604 604 THR THR A . n 
A 1 605 LYS 605 605 605 LYS LYS A . n 
A 1 606 HIS 606 606 606 HIS HIS A . n 
A 1 607 PHE 607 607 607 PHE PHE A . n 
A 1 608 GLN 608 608 608 GLN GLN A . n 
A 1 609 ASP 609 609 609 ASP ASP A . n 
B 2 1   MET 1   1   ?   ?   ?   B . n 
B 2 2   VAL 2   2   ?   ?   ?   B . n 
B 2 3   ARG 3   3   ?   ?   ?   B . n 
B 2 4   SER 4   4   ?   ?   ?   B . n 
B 2 5   GLY 5   5   ?   ?   ?   B . n 
B 2 6   ASN 6   6   6   ASN ASN B . n 
B 2 7   LYS 7   7   7   LYS LYS B . n 
B 2 8   ALA 8   8   8   ALA ALA B . n 
B 2 9   ALA 9   9   9   ALA ALA B . n 
B 2 10  VAL 10  10  10  VAL VAL B . n 
B 2 11  VAL 11  11  11  VAL VAL B . n 
B 2 12  LEU 12  12  12  LEU LEU B . n 
B 2 13  CYS 13  13  13  CYS CYS B . n 
B 2 14  MET 14  14  14  MET MET B . n 
B 2 15  ASP 15  15  15  ASP ASP B . n 
B 2 16  VAL 16  16  16  VAL VAL B . n 
B 2 17  GLY 17  17  17  GLY GLY B . n 
B 2 18  PHE 18  18  18  PHE PHE B . n 
B 2 19  THR 19  19  19  THR THR B . n 
B 2 20  MET 20  20  20  MET MET B . n 
B 2 21  SER 21  21  21  SER SER B . n 
B 2 22  ASN 22  22  22  ASN ASN B . n 
B 2 23  SER 23  23  23  SER SER B . n 
B 2 24  ILE 24  24  24  ILE ILE B . n 
B 2 25  PRO 25  25  25  PRO PRO B . n 
B 2 26  GLY 26  26  26  GLY GLY B . n 
B 2 27  ILE 27  27  27  ILE ILE B . n 
B 2 28  GLU 28  28  28  GLU GLU B . n 
B 2 29  SER 29  29  29  SER SER B . n 
B 2 30  PRO 30  30  30  PRO PRO B . n 
B 2 31  PHE 31  31  31  PHE PHE B . n 
B 2 32  GLU 32  32  32  GLU GLU B . n 
B 2 33  GLN 33  33  33  GLN GLN B . n 
B 2 34  ALA 34  34  34  ALA ALA B . n 
B 2 35  LYS 35  35  35  LYS LYS B . n 
B 2 36  LYS 36  36  36  LYS LYS B . n 
B 2 37  VAL 37  37  37  VAL VAL B . n 
B 2 38  ILE 38  38  38  ILE ILE B . n 
B 2 39  THR 39  39  39  THR THR B . n 
B 2 40  MET 40  40  40  MET MET B . n 
B 2 41  PHE 41  41  41  PHE PHE B . n 
B 2 42  VAL 42  42  42  VAL VAL B . n 
B 2 43  GLN 43  43  43  GLN GLN B . n 
B 2 44  ARG 44  44  44  ARG ARG B . n 
B 2 45  GLN 45  45  45  GLN GLN B . n 
B 2 46  VAL 46  46  46  VAL VAL B . n 
B 2 47  PHE 47  47  47  PHE PHE B . n 
B 2 48  ALA 48  48  48  ALA ALA B . n 
B 2 49  GLU 49  49  49  GLU GLU B . n 
B 2 50  ASN 50  50  50  ASN ASN B . n 
B 2 51  LYS 51  51  51  LYS LYS B . n 
B 2 52  ASP 52  52  52  ASP ASP B . n 
B 2 53  GLU 53  53  53  GLU GLU B . n 
B 2 54  ILE 54  54  54  ILE ILE B . n 
B 2 55  ALA 55  55  55  ALA ALA B . n 
B 2 56  LEU 56  56  56  LEU LEU B . n 
B 2 57  VAL 57  57  57  VAL VAL B . n 
B 2 58  LEU 58  58  58  LEU LEU B . n 
B 2 59  PHE 59  59  59  PHE PHE B . n 
B 2 60  GLY 60  60  60  GLY GLY B . n 
B 2 61  THR 61  61  61  THR THR B . n 
B 2 62  ASP 62  62  62  ASP ASP B . n 
B 2 63  GLY 63  63  63  GLY GLY B . n 
B 2 64  THR 64  64  64  THR THR B . n 
B 2 65  ASP 65  65  65  ASP ASP B . n 
B 2 66  ASN 66  66  66  ASN ASN B . n 
B 2 67  PRO 67  67  67  PRO PRO B . n 
B 2 68  LEU 68  68  68  LEU LEU B . n 
B 2 69  SER 69  69  69  SER SER B . n 
B 2 70  GLY 70  70  70  GLY GLY B . n 
B 2 71  GLY 71  71  71  GLY GLY B . n 
B 2 72  ASP 72  72  72  ASP ASP B . n 
B 2 73  GLN 73  73  73  GLN GLN B . n 
B 2 74  TYR 74  74  74  TYR TYR B . n 
B 2 75  GLN 75  75  75  GLN GLN B . n 
B 2 76  ASN 76  76  76  ASN ASN B . n 
B 2 77  ILE 77  77  77  ILE ILE B . n 
B 2 78  THR 78  78  78  THR THR B . n 
B 2 79  VAL 79  79  79  VAL VAL B . n 
B 2 80  HIS 80  80  80  HIS HIS B . n 
B 2 81  ARG 81  81  81  ARG ARG B . n 
B 2 82  HIS 82  82  82  HIS HIS B . n 
B 2 83  LEU 83  83  83  LEU LEU B . n 
B 2 84  MET 84  84  84  MET MET B . n 
B 2 85  LEU 85  85  85  LEU LEU B . n 
B 2 86  PRO 86  86  86  PRO PRO B . n 
B 2 87  ASP 87  87  87  ASP ASP B . n 
B 2 88  PHE 88  88  88  PHE PHE B . n 
B 2 89  ASP 89  89  89  ASP ASP B . n 
B 2 90  LEU 90  90  90  LEU LEU B . n 
B 2 91  LEU 91  91  91  LEU LEU B . n 
B 2 92  GLU 92  92  92  GLU GLU B . n 
B 2 93  ASP 93  93  93  ASP ASP B . n 
B 2 94  ILE 94  94  94  ILE ILE B . n 
B 2 95  GLU 95  95  95  GLU GLU B . n 
B 2 96  SER 96  96  96  SER SER B . n 
B 2 97  LYS 97  97  97  LYS LYS B . n 
B 2 98  ILE 98  98  98  ILE ILE B . n 
B 2 99  GLN 99  99  99  GLN GLN B . n 
B 2 100 PRO 100 100 100 PRO PRO B . n 
B 2 101 GLY 101 101 101 GLY GLY B . n 
B 2 102 SER 102 102 102 SER SER B . n 
B 2 103 GLN 103 103 103 GLN GLN B . n 
B 2 104 GLN 104 104 104 GLN GLN B . n 
B 2 105 ALA 105 105 105 ALA ALA B . n 
B 2 106 ASP 106 106 106 ASP ASP B . n 
B 2 107 PHE 107 107 107 PHE PHE B . n 
B 2 108 LEU 108 108 108 LEU LEU B . n 
B 2 109 ASP 109 109 109 ASP ASP B . n 
B 2 110 ALA 110 110 110 ALA ALA B . n 
B 2 111 LEU 111 111 111 LEU LEU B . n 
B 2 112 ILE 112 112 112 ILE ILE B . n 
B 2 113 VAL 113 113 113 VAL VAL B . n 
B 2 114 SER 114 114 114 SER SER B . n 
B 2 115 MET 115 115 115 MET MET B . n 
B 2 116 ASP 116 116 116 ASP ASP B . n 
B 2 117 VAL 117 117 117 VAL VAL B . n 
B 2 118 ILE 118 118 118 ILE ILE B . n 
B 2 119 GLN 119 119 119 GLN GLN B . n 
B 2 120 HIS 120 120 120 HIS HIS B . n 
B 2 121 GLU 121 121 121 GLU GLU B . n 
B 2 122 THR 122 122 122 THR THR B . n 
B 2 123 ILE 123 123 123 ILE ILE B . n 
B 2 124 GLY 124 124 124 GLY GLY B . n 
B 2 125 LYS 125 125 125 LYS LYS B . n 
B 2 126 LYS 126 126 126 LYS LYS B . n 
B 2 127 PHE 127 127 127 PHE PHE B . n 
B 2 128 GLU 128 128 128 GLU GLU B . n 
B 2 129 LYS 129 129 129 LYS LYS B . n 
B 2 130 ARG 130 130 130 ARG ARG B . n 
B 2 131 HIS 131 131 131 HIS HIS B . n 
B 2 132 ILE 132 132 132 ILE ILE B . n 
B 2 133 GLU 133 133 133 GLU GLU B . n 
B 2 134 ILE 134 134 134 ILE ILE B . n 
B 2 135 PHE 135 135 135 PHE PHE B . n 
B 2 136 THR 136 136 136 THR THR B . n 
B 2 137 ASP 137 137 137 ASP ASP B . n 
B 2 138 LEU 138 138 138 LEU LEU B . n 
B 2 139 SER 139 139 139 SER SER B . n 
B 2 140 SER 140 140 140 SER SER B . n 
B 2 141 ARG 141 141 141 ARG ARG B . n 
B 2 142 PHE 142 142 142 PHE PHE B . n 
B 2 143 SER 143 143 143 SER SER B . n 
B 2 144 LYS 144 144 144 LYS LYS B . n 
B 2 145 SER 145 145 145 SER SER B . n 
B 2 146 GLN 146 146 146 GLN GLN B . n 
B 2 147 LEU 147 147 147 LEU LEU B . n 
B 2 148 ASP 148 148 148 ASP ASP B . n 
B 2 149 ILE 149 149 149 ILE ILE B . n 
B 2 150 ILE 150 150 150 ILE ILE B . n 
B 2 151 ILE 151 151 151 ILE ILE B . n 
B 2 152 HIS 152 152 152 HIS HIS B . n 
B 2 153 SER 153 153 153 SER SER B . n 
B 2 154 LEU 154 154 154 LEU LEU B . n 
B 2 155 LYS 155 155 155 LYS LYS B . n 
B 2 156 LYS 156 156 156 LYS LYS B . n 
B 2 157 CYS 157 157 157 CYS CYS B . n 
B 2 158 ASP 158 158 158 ASP ASP B . n 
B 2 159 ILE 159 159 159 ILE ILE B . n 
B 2 160 SER 160 160 160 SER SER B . n 
B 2 161 LEU 161 161 161 LEU LEU B . n 
B 2 162 GLN 162 162 162 GLN GLN B . n 
B 2 163 PHE 163 163 163 PHE PHE B . n 
B 2 164 PHE 164 164 164 PHE PHE B . n 
B 2 165 LEU 165 165 165 LEU LEU B . n 
B 2 166 PRO 166 166 166 PRO PRO B . n 
B 2 167 PHE 167 167 167 PHE PHE B . n 
B 2 168 SER 168 168 168 SER SER B . n 
B 2 169 LEU 169 169 169 LEU LEU B . n 
B 2 170 GLY 170 170 ?   ?   ?   B . n 
B 2 171 LYS 171 171 ?   ?   ?   B . n 
B 2 172 GLU 172 172 ?   ?   ?   B . n 
B 2 173 ASP 173 173 ?   ?   ?   B . n 
B 2 174 GLY 174 174 ?   ?   ?   B . n 
B 2 175 SER 175 175 ?   ?   ?   B . n 
B 2 176 GLY 176 176 ?   ?   ?   B . n 
B 2 177 ASP 177 177 ?   ?   ?   B . n 
B 2 178 ARG 178 178 ?   ?   ?   B . n 
B 2 179 GLY 179 179 ?   ?   ?   B . n 
B 2 180 ASP 180 180 ?   ?   ?   B . n 
B 2 181 GLY 181 181 ?   ?   ?   B . n 
B 2 182 PRO 182 182 182 PRO PRO B . n 
B 2 183 PHE 183 183 183 PHE PHE B . n 
B 2 184 ARG 184 184 184 ARG ARG B . n 
B 2 185 LEU 185 185 185 LEU LEU B . n 
B 2 186 GLY 186 186 186 GLY GLY B . n 
B 2 187 GLY 187 187 187 GLY GLY B . n 
B 2 188 HIS 188 188 188 HIS HIS B . n 
B 2 189 GLY 189 189 189 GLY GLY B . n 
B 2 190 PRO 190 190 ?   ?   ?   B . n 
B 2 191 SER 191 191 ?   ?   ?   B . n 
B 2 192 PHE 192 192 192 PHE PHE B . n 
B 2 193 PRO 193 193 193 PRO PRO B . n 
B 2 194 LEU 194 194 194 LEU LEU B . n 
B 2 195 LYS 195 195 195 LYS LYS B . n 
B 2 196 GLY 196 196 196 GLY GLY B . n 
B 2 197 ILE 197 197 197 ILE ILE B . n 
B 2 198 THR 198 198 198 THR THR B . n 
B 2 199 GLU 199 199 199 GLU GLU B . n 
B 2 200 GLN 200 200 200 GLN GLN B . n 
B 2 201 GLN 201 201 201 GLN GLN B . n 
B 2 202 LYS 202 202 202 LYS LYS B . n 
B 2 203 GLU 203 203 203 GLU GLU B . n 
B 2 204 GLY 204 204 204 GLY GLY B . n 
B 2 205 LEU 205 205 205 LEU LEU B . n 
B 2 206 GLU 206 206 206 GLU GLU B . n 
B 2 207 ILE 207 207 207 ILE ILE B . n 
B 2 208 VAL 208 208 208 VAL VAL B . n 
B 2 209 LYS 209 209 209 LYS LYS B . n 
B 2 210 MET 210 210 210 MET MET B . n 
B 2 211 VAL 211 211 211 VAL VAL B . n 
B 2 212 MET 212 212 212 MET MET B . n 
B 2 213 ILE 213 213 213 ILE ILE B . n 
B 2 214 SER 214 214 214 SER SER B . n 
B 2 215 LEU 215 215 215 LEU LEU B . n 
B 2 216 GLU 216 216 216 GLU GLU B . n 
B 2 217 GLY 217 217 217 GLY GLY B . n 
B 2 218 GLU 218 218 218 GLU GLU B . n 
B 2 219 ASP 219 219 219 ASP ASP B . n 
B 2 220 GLY 220 220 220 GLY GLY B . n 
B 2 221 LEU 221 221 221 LEU LEU B . n 
B 2 222 ASP 222 222 222 ASP ASP B . n 
B 2 223 GLU 223 223 223 GLU GLU B . n 
B 2 224 ILE 224 224 224 ILE ILE B . n 
B 2 225 TYR 225 225 225 TYR TYR B . n 
B 2 226 SER 226 226 226 SER SER B . n 
B 2 227 PHE 227 227 227 PHE PHE B . n 
B 2 228 SER 228 228 228 SER SER B . n 
B 2 229 GLU 229 229 229 GLU GLU B . n 
B 2 230 SER 230 230 230 SER SER B . n 
B 2 231 LEU 231 231 231 LEU LEU B . n 
B 2 232 ARG 232 232 232 ARG ARG B . n 
B 2 233 LYS 233 233 233 LYS LYS B . n 
B 2 234 LEU 234 234 234 LEU LEU B . n 
B 2 235 CYS 235 235 235 CYS CYS B . n 
B 2 236 VAL 236 236 236 VAL VAL B . n 
B 2 237 PHE 237 237 237 PHE PHE B . n 
B 2 238 LYS 238 238 238 LYS LYS B . n 
B 2 239 LYS 239 239 239 LYS LYS B . n 
B 2 240 ILE 240 240 240 ILE ILE B . n 
B 2 241 GLU 241 241 241 GLU GLU B . n 
B 2 242 ARG 242 242 242 ARG ARG B . n 
B 2 243 HIS 243 243 243 HIS HIS B . n 
B 2 244 SER 244 244 244 SER SER B . n 
B 2 245 ILE 245 245 245 ILE ILE B . n 
B 2 246 HIS 246 246 246 HIS HIS B . n 
B 2 247 TRP 247 247 247 TRP TRP B . n 
B 2 248 PRO 248 248 248 PRO PRO B . n 
B 2 249 CYS 249 249 249 CYS CYS B . n 
B 2 250 ARG 250 250 250 ARG ARG B . n 
B 2 251 LEU 251 251 251 LEU LEU B . n 
B 2 252 THR 252 252 252 THR THR B . n 
B 2 253 ILE 253 253 253 ILE ILE B . n 
B 2 254 GLY 254 254 254 GLY GLY B . n 
B 2 255 SER 255 255 255 SER SER B . n 
B 2 256 ASN 256 256 256 ASN ASN B . n 
B 2 257 LEU 257 257 257 LEU LEU B . n 
B 2 258 SER 258 258 258 SER SER B . n 
B 2 259 ILE 259 259 259 ILE ILE B . n 
B 2 260 ARG 260 260 260 ARG ARG B . n 
B 2 261 ILE 261 261 261 ILE ILE B . n 
B 2 262 ALA 262 262 262 ALA ALA B . n 
B 2 263 ALA 263 263 263 ALA ALA B . n 
B 2 264 TYR 264 264 264 TYR TYR B . n 
B 2 265 LYS 265 265 265 LYS LYS B . n 
B 2 266 SER 266 266 266 SER SER B . n 
B 2 267 ILE 267 267 267 ILE ILE B . n 
B 2 268 LEU 268 268 268 LEU LEU B . n 
B 2 269 GLN 269 269 269 GLN GLN B . n 
B 2 270 GLU 270 270 270 GLU GLU B . n 
B 2 271 ARG 271 271 271 ARG ARG B . n 
B 2 272 VAL 272 272 272 VAL VAL B . n 
B 2 273 LYS 273 273 273 LYS LYS B . n 
B 2 274 LYS 274 274 274 LYS LYS B . n 
B 2 275 THR 275 275 275 THR THR B . n 
B 2 276 TRP 276 276 276 TRP TRP B . n 
B 2 277 THR 277 277 277 THR THR B . n 
B 2 278 VAL 278 278 278 VAL VAL B . n 
B 2 279 VAL 279 279 279 VAL VAL B . n 
B 2 280 ASP 280 280 280 ASP ASP B . n 
B 2 281 ALA 281 281 281 ALA ALA B . n 
B 2 282 LYS 282 282 282 LYS LYS B . n 
B 2 283 THR 283 283 283 THR THR B . n 
B 2 284 LEU 284 284 284 LEU LEU B . n 
B 2 285 LYS 285 285 285 LYS LYS B . n 
B 2 286 LYS 286 286 286 LYS LYS B . n 
B 2 287 GLU 287 287 287 GLU GLU B . n 
B 2 288 ASP 288 288 288 ASP ASP B . n 
B 2 289 ILE 289 289 289 ILE ILE B . n 
B 2 290 GLN 290 290 290 GLN GLN B . n 
B 2 291 LYS 291 291 291 LYS LYS B . n 
B 2 292 GLU 292 292 292 GLU GLU B . n 
B 2 293 THR 293 293 293 THR THR B . n 
B 2 294 VAL 294 294 294 VAL VAL B . n 
B 2 295 TYR 295 295 295 TYR TYR B . n 
B 2 296 CYS 296 296 296 CYS CYS B . n 
B 2 297 LEU 297 297 297 LEU LEU B . n 
B 2 298 ASN 298 298 298 ASN ASN B . n 
B 2 299 ASP 299 299 299 ASP ASP B . n 
B 2 300 ASP 300 300 300 ASP ASP B . n 
B 2 301 ASP 301 301 301 ASP ASP B . n 
B 2 302 GLU 302 302 302 GLU GLU B . n 
B 2 303 THR 303 303 303 THR THR B . n 
B 2 304 GLU 304 304 304 GLU GLU B . n 
B 2 305 VAL 305 305 305 VAL VAL B . n 
B 2 306 LEU 306 306 306 LEU LEU B . n 
B 2 307 LYS 307 307 307 LYS LYS B . n 
B 2 308 GLU 308 308 308 GLU GLU B . n 
B 2 309 ASP 309 309 309 ASP ASP B . n 
B 2 310 ILE 310 310 310 ILE ILE B . n 
B 2 311 ILE 311 311 311 ILE ILE B . n 
B 2 312 GLN 312 312 312 GLN GLN B . n 
B 2 313 GLY 313 313 313 GLY GLY B . n 
B 2 314 PHE 314 314 314 PHE PHE B . n 
B 2 315 ARG 315 315 315 ARG ARG B . n 
B 2 316 TYR 316 316 316 TYR TYR B . n 
B 2 317 GLY 317 317 317 GLY GLY B . n 
B 2 318 SER 318 318 318 SER SER B . n 
B 2 319 ASP 319 319 319 ASP ASP B . n 
B 2 320 ILE 320 320 320 ILE ILE B . n 
B 2 321 VAL 321 321 321 VAL VAL B . n 
B 2 322 PRO 322 322 322 PRO PRO B . n 
B 2 323 PHE 323 323 323 PHE PHE B . n 
B 2 324 SER 324 324 ?   ?   ?   B . n 
B 2 325 LYS 325 325 ?   ?   ?   B . n 
B 2 326 VAL 326 326 ?   ?   ?   B . n 
B 2 327 ASP 327 327 327 ASP ASP B . n 
B 2 328 GLU 328 328 328 GLU GLU B . n 
B 2 329 GLU 329 329 329 GLU GLU B . n 
B 2 330 GLN 330 330 330 GLN GLN B . n 
B 2 331 MET 331 331 331 MET MET B . n 
B 2 332 LYS 332 332 332 LYS LYS B . n 
B 2 333 TYR 333 333 333 TYR TYR B . n 
B 2 334 LYS 334 334 334 LYS LYS B . n 
B 2 335 SER 335 335 335 SER SER B . n 
B 2 336 GLU 336 336 336 GLU GLU B . n 
B 2 337 GLY 337 337 337 GLY GLY B . n 
B 2 338 LYS 338 338 338 LYS LYS B . n 
B 2 339 CYS 339 339 339 CYS CYS B . n 
B 2 340 PHE 340 340 340 PHE PHE B . n 
B 2 341 SER 341 341 341 SER SER B . n 
B 2 342 VAL 342 342 342 VAL VAL B . n 
B 2 343 LEU 343 343 343 LEU LEU B . n 
B 2 344 GLY 344 344 344 GLY GLY B . n 
B 2 345 PHE 345 345 345 PHE PHE B . n 
B 2 346 CYS 346 346 346 CYS CYS B . n 
B 2 347 LYS 347 347 347 LYS LYS B . n 
B 2 348 SER 348 348 348 SER SER B . n 
B 2 349 SER 349 349 349 SER SER B . n 
B 2 350 GLN 350 350 350 GLN GLN B . n 
B 2 351 VAL 351 351 351 VAL VAL B . n 
B 2 352 GLN 352 352 352 GLN GLN B . n 
B 2 353 ARG 353 353 353 ARG ARG B . n 
B 2 354 ARG 354 354 354 ARG ARG B . n 
B 2 355 PHE 355 355 355 PHE PHE B . n 
B 2 356 PHE 356 356 356 PHE PHE B . n 
B 2 357 MET 357 357 357 MET MET B . n 
B 2 358 GLY 358 358 358 GLY GLY B . n 
B 2 359 ASN 359 359 359 ASN ASN B . n 
B 2 360 GLN 360 360 360 GLN GLN B . n 
B 2 361 VAL 361 361 361 VAL VAL B . n 
B 2 362 LEU 362 362 362 LEU LEU B . n 
B 2 363 LYS 363 363 363 LYS LYS B . n 
B 2 364 VAL 364 364 364 VAL VAL B . n 
B 2 365 PHE 365 365 365 PHE PHE B . n 
B 2 366 ALA 366 366 366 ALA ALA B . n 
B 2 367 ALA 367 367 367 ALA ALA B . n 
B 2 368 ARG 368 368 368 ARG ARG B . n 
B 2 369 ASP 369 369 369 ASP ASP B . n 
B 2 370 ASP 370 370 370 ASP ASP B . n 
B 2 371 GLU 371 371 371 GLU GLU B . n 
B 2 372 ALA 372 372 372 ALA ALA B . n 
B 2 373 ALA 373 373 373 ALA ALA B . n 
B 2 374 ALA 374 374 374 ALA ALA B . n 
B 2 375 VAL 375 375 375 VAL VAL B . n 
B 2 376 ALA 376 376 376 ALA ALA B . n 
B 2 377 LEU 377 377 377 LEU LEU B . n 
B 2 378 SER 378 378 378 SER SER B . n 
B 2 379 SER 379 379 379 SER SER B . n 
B 2 380 LEU 380 380 380 LEU LEU B . n 
B 2 381 ILE 381 381 381 ILE ILE B . n 
B 2 382 HIS 382 382 382 HIS HIS B . n 
B 2 383 ALA 383 383 383 ALA ALA B . n 
B 2 384 LEU 384 384 384 LEU LEU B . n 
B 2 385 ASP 385 385 385 ASP ASP B . n 
B 2 386 ASP 386 386 386 ASP ASP B . n 
B 2 387 LEU 387 387 387 LEU LEU B . n 
B 2 388 ASP 388 388 388 ASP ASP B . n 
B 2 389 MET 389 389 389 MET MET B . n 
B 2 390 VAL 390 390 390 VAL VAL B . n 
B 2 391 ALA 391 391 391 ALA ALA B . n 
B 2 392 ILE 392 392 392 ILE ILE B . n 
B 2 393 VAL 393 393 393 VAL VAL B . n 
B 2 394 ARG 394 394 394 ARG ARG B . n 
B 2 395 TYR 395 395 395 TYR TYR B . n 
B 2 396 ALA 396 396 396 ALA ALA B . n 
B 2 397 TYR 397 397 397 TYR TYR B . n 
B 2 398 ASP 398 398 398 ASP ASP B . n 
B 2 399 LYS 399 399 399 LYS LYS B . n 
B 2 400 ARG 400 400 400 ARG ARG B . n 
B 2 401 ALA 401 401 401 ALA ALA B . n 
B 2 402 ASN 402 402 402 ASN ASN B . n 
B 2 403 PRO 403 403 403 PRO PRO B . n 
B 2 404 GLN 404 404 404 GLN GLN B . n 
B 2 405 VAL 405 405 405 VAL VAL B . n 
B 2 406 GLY 406 406 406 GLY GLY B . n 
B 2 407 VAL 407 407 407 VAL VAL B . n 
B 2 408 ALA 408 408 408 ALA ALA B . n 
B 2 409 PHE 409 409 409 PHE PHE B . n 
B 2 410 PRO 410 410 410 PRO PRO B . n 
B 2 411 HIS 411 411 411 HIS HIS B . n 
B 2 412 ILE 412 412 412 ILE ILE B . n 
B 2 413 LYS 413 413 413 LYS LYS B . n 
B 2 414 HIS 414 414 414 HIS HIS B . n 
B 2 415 ASN 415 415 415 ASN ASN B . n 
B 2 416 TYR 416 416 416 TYR TYR B . n 
B 2 417 GLU 417 417 417 GLU GLU B . n 
B 2 418 CYS 418 418 418 CYS CYS B . n 
B 2 419 LEU 419 419 419 LEU LEU B . n 
B 2 420 VAL 420 420 420 VAL VAL B . n 
B 2 421 TYR 421 421 421 TYR TYR B . n 
B 2 422 VAL 422 422 422 VAL VAL B . n 
B 2 423 GLN 423 423 423 GLN GLN B . n 
B 2 424 LEU 424 424 424 LEU LEU B . n 
B 2 425 PRO 425 425 425 PRO PRO B . n 
B 2 426 PHE 426 426 426 PHE PHE B . n 
B 2 427 MET 427 427 427 MET MET B . n 
B 2 428 GLU 428 428 428 GLU GLU B . n 
B 2 429 ASP 429 429 429 ASP ASP B . n 
B 2 430 LEU 430 430 430 LEU LEU B . n 
B 2 431 ARG 431 431 431 ARG ARG B . n 
B 2 432 GLN 432 432 432 GLN GLN B . n 
B 2 433 TYR 433 433 433 TYR TYR B . n 
B 2 434 MET 434 434 434 MET MET B . n 
B 2 435 PHE 435 435 435 PHE PHE B . n 
B 2 436 SER 436 436 436 SER SER B . n 
B 2 437 SER 437 437 437 SER SER B . n 
B 2 438 LEU 438 438 438 LEU LEU B . n 
B 2 439 LYS 439 439 439 LYS LYS B . n 
B 2 440 ASN 440 440 440 ASN ASN B . n 
B 2 441 SER 441 441 441 SER SER B . n 
B 2 442 LYS 442 442 442 LYS LYS B . n 
B 2 443 LYS 443 443 443 LYS LYS B . n 
B 2 444 TYR 444 444 444 TYR TYR B . n 
B 2 445 ALA 445 445 445 ALA ALA B . n 
B 2 446 PRO 446 446 446 PRO PRO B . n 
B 2 447 THR 447 447 447 THR THR B . n 
B 2 448 GLU 448 448 448 GLU GLU B . n 
B 2 449 ALA 449 449 449 ALA ALA B . n 
B 2 450 GLN 450 450 450 GLN GLN B . n 
B 2 451 LEU 451 451 451 LEU LEU B . n 
B 2 452 ASN 452 452 452 ASN ASN B . n 
B 2 453 ALA 453 453 453 ALA ALA B . n 
B 2 454 VAL 454 454 454 VAL VAL B . n 
B 2 455 ASP 455 455 455 ASP ASP B . n 
B 2 456 ALA 456 456 456 ALA ALA B . n 
B 2 457 LEU 457 457 457 LEU LEU B . n 
B 2 458 ILE 458 458 458 ILE ILE B . n 
B 2 459 ASP 459 459 459 ASP ASP B . n 
B 2 460 SER 460 460 460 SER SER B . n 
B 2 461 MET 461 461 461 MET MET B . n 
B 2 462 SER 462 462 462 SER SER B . n 
B 2 463 LEU 463 463 463 LEU LEU B . n 
B 2 464 ALA 464 464 464 ALA ALA B . n 
B 2 465 LYS 465 465 465 LYS LYS B . n 
B 2 466 LYS 466 466 466 LYS LYS B . n 
B 2 467 ASP 467 467 467 ASP ASP B . n 
B 2 468 GLU 468 468 468 GLU GLU B . n 
B 2 469 LYS 469 469 469 LYS LYS B . n 
B 2 470 THR 470 470 470 THR THR B . n 
B 2 471 ASP 471 471 471 ASP ASP B . n 
B 2 472 THR 472 472 472 THR THR B . n 
B 2 473 LEU 473 473 473 LEU LEU B . n 
B 2 474 GLU 474 474 474 GLU GLU B . n 
B 2 475 ASP 475 475 475 ASP ASP B . n 
B 2 476 LEU 476 476 476 LEU LEU B . n 
B 2 477 PHE 477 477 477 PHE PHE B . n 
B 2 478 PRO 478 478 478 PRO PRO B . n 
B 2 479 THR 479 479 479 THR THR B . n 
B 2 480 THR 480 480 480 THR THR B . n 
B 2 481 LYS 481 481 481 LYS LYS B . n 
B 2 482 ILE 482 482 482 ILE ILE B . n 
B 2 483 PRO 483 483 483 PRO PRO B . n 
B 2 484 ASN 484 484 484 ASN ASN B . n 
B 2 485 PRO 485 485 485 PRO PRO B . n 
B 2 486 ARG 486 486 486 ARG ARG B . n 
B 2 487 PHE 487 487 487 PHE PHE B . n 
B 2 488 GLN 488 488 488 GLN GLN B . n 
B 2 489 ARG 489 489 489 ARG ARG B . n 
B 2 490 LEU 490 490 490 LEU LEU B . n 
B 2 491 PHE 491 491 491 PHE PHE B . n 
B 2 492 GLN 492 492 492 GLN GLN B . n 
B 2 493 CYS 493 493 493 CYS CYS B . n 
B 2 494 LEU 494 494 494 LEU LEU B . n 
B 2 495 LEU 495 495 495 LEU LEU B . n 
B 2 496 HIS 496 496 496 HIS HIS B . n 
B 2 497 ARG 497 497 497 ARG ARG B . n 
B 2 498 ALA 498 498 498 ALA ALA B . n 
B 2 499 LEU 499 499 499 LEU LEU B . n 
B 2 500 HIS 500 500 500 HIS HIS B . n 
B 2 501 PRO 501 501 501 PRO PRO B . n 
B 2 502 ARG 502 502 502 ARG ARG B . n 
B 2 503 GLU 503 503 503 GLU GLU B . n 
B 2 504 PRO 504 504 504 PRO PRO B . n 
B 2 505 LEU 505 505 505 LEU LEU B . n 
B 2 506 PRO 506 506 506 PRO PRO B . n 
B 2 507 PRO 507 507 507 PRO PRO B . n 
B 2 508 ILE 508 508 508 ILE ILE B . n 
B 2 509 GLN 509 509 509 GLN GLN B . n 
B 2 510 GLN 510 510 510 GLN GLN B . n 
B 2 511 HIS 511 511 511 HIS HIS B . n 
B 2 512 ILE 512 512 512 ILE ILE B . n 
B 2 513 TRP 513 513 513 TRP TRP B . n 
B 2 514 ASN 514 514 514 ASN ASN B . n 
B 2 515 MET 515 515 515 MET MET B . n 
B 2 516 LEU 516 516 516 LEU LEU B . n 
B 2 517 ASN 517 517 517 ASN ASN B . n 
B 2 518 PRO 518 518 518 PRO PRO B . n 
B 2 519 PRO 519 519 519 PRO PRO B . n 
B 2 520 ALA 520 520 520 ALA ALA B . n 
B 2 521 GLU 521 521 521 GLU GLU B . n 
B 2 522 VAL 522 522 522 VAL VAL B . n 
B 2 523 THR 523 523 523 THR THR B . n 
B 2 524 THR 524 524 524 THR THR B . n 
B 2 525 LYS 525 525 525 LYS LYS B . n 
B 2 526 SER 526 526 526 SER SER B . n 
B 2 527 GLN 527 527 527 GLN GLN B . n 
B 2 528 ILE 528 528 528 ILE ILE B . n 
B 2 529 PRO 529 529 529 PRO PRO B . n 
B 2 530 LEU 530 530 530 LEU LEU B . n 
B 2 531 SER 531 531 531 SER SER B . n 
B 2 532 LYS 532 532 532 LYS LYS B . n 
B 2 533 ILE 533 533 533 ILE ILE B . n 
B 2 534 LYS 534 534 534 LYS LYS B . n 
B 2 535 THR 535 535 535 THR THR B . n 
B 2 536 LEU 536 536 536 LEU LEU B . n 
B 2 537 PHE 537 537 537 PHE PHE B . n 
B 2 538 PRO 538 538 538 PRO PRO B . n 
B 2 539 LEU 539 539 539 LEU LEU B . n 
B 2 540 ILE 540 540 540 ILE ILE B . n 
B 2 541 GLU 541 541 541 GLU GLU B . n 
B 2 542 ALA 542 542 542 ALA ALA B . n 
B 2 543 LYS 543 543 ?   ?   ?   B . n 
B 2 544 LYS 544 544 ?   ?   ?   B . n 
B 2 545 LYS 545 545 ?   ?   ?   B . n 
B 2 546 ASP 546 546 ?   ?   ?   B . n 
B 2 547 GLN 547 547 ?   ?   ?   B . n 
B 2 548 VAL 548 548 ?   ?   ?   B . n 
B 2 549 THR 549 549 ?   ?   ?   B . n 
B 2 550 ALA 550 550 ?   ?   ?   B . n 
B 2 551 GLN 551 551 ?   ?   ?   B . n 
B 2 552 GLU 552 552 ?   ?   ?   B . n 
B 2 553 ILE 553 553 ?   ?   ?   B . n 
B 2 554 PHE 554 554 ?   ?   ?   B . n 
B 2 555 GLN 555 555 ?   ?   ?   B . n 
B 2 556 ASP 556 556 ?   ?   ?   B . n 
B 2 557 ASN 557 557 ?   ?   ?   B . n 
B 2 558 HIS 558 558 ?   ?   ?   B . n 
B 2 559 GLU 559 559 ?   ?   ?   B . n 
B 2 560 ASP 560 560 ?   ?   ?   B . n 
B 2 561 GLY 561 561 ?   ?   ?   B . n 
B 2 562 PRO 562 562 ?   ?   ?   B . n 
B 2 563 THR 563 563 ?   ?   ?   B . n 
B 2 564 ALA 564 564 ?   ?   ?   B . n 
B 2 565 LYS 565 565 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  610 4  HOH HOH A . 
C 3 HOH 2  611 6  HOH HOH A . 
C 3 HOH 3  612 7  HOH HOH A . 
C 3 HOH 4  613 8  HOH HOH A . 
C 3 HOH 5  614 9  HOH HOH A . 
C 3 HOH 6  615 12 HOH HOH A . 
C 3 HOH 7  616 17 HOH HOH A . 
C 3 HOH 8  617 22 HOH HOH A . 
C 3 HOH 9  618 23 HOH HOH A . 
C 3 HOH 10 619 26 HOH HOH A . 
C 3 HOH 11 620 29 HOH HOH A . 
C 3 HOH 12 621 30 HOH HOH A . 
C 3 HOH 13 622 31 HOH HOH A . 
C 3 HOH 14 623 32 HOH HOH A . 
C 3 HOH 15 624 33 HOH HOH A . 
C 3 HOH 16 625 35 HOH HOH A . 
C 3 HOH 17 626 36 HOH HOH A . 
C 3 HOH 18 627 37 HOH HOH A . 
C 3 HOH 19 628 38 HOH HOH A . 
C 3 HOH 20 629 41 HOH HOH A . 
C 3 HOH 21 630 42 HOH HOH A . 
D 3 HOH 1  566 1  HOH HOH B . 
D 3 HOH 2  567 2  HOH HOH B . 
D 3 HOH 3  568 3  HOH HOH B . 
D 3 HOH 4  569 5  HOH HOH B . 
D 3 HOH 5  570 10 HOH HOH B . 
D 3 HOH 6  571 11 HOH HOH B . 
D 3 HOH 7  572 13 HOH HOH B . 
D 3 HOH 8  573 14 HOH HOH B . 
D 3 HOH 9  574 15 HOH HOH B . 
D 3 HOH 10 575 16 HOH HOH B . 
D 3 HOH 11 576 18 HOH HOH B . 
D 3 HOH 12 577 19 HOH HOH B . 
D 3 HOH 13 578 20 HOH HOH B . 
D 3 HOH 14 579 21 HOH HOH B . 
D 3 HOH 15 580 24 HOH HOH B . 
D 3 HOH 16 581 25 HOH HOH B . 
D 3 HOH 17 582 27 HOH HOH B . 
D 3 HOH 18 583 28 HOH HOH B . 
D 3 HOH 19 584 34 HOH HOH B . 
D 3 HOH 20 585 39 HOH HOH B . 
D 3 HOH 21 586 40 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 19070 ? 
1 MORE         -131  ? 
1 'SSA (A^2)'  50560 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-08-15 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-02-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Experimental preparation'  
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            exptl_crystal_grow 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_exptl_crystal_grow.pdbx_details' 
2 4 'Structure model' '_exptl_crystal_grow.temp'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
SOLVE     phasing          .   ? 1 ? ? ? ? 
CNS       refinement       1.0 ? 2 ? ? ? ? 
DENZO     'data reduction' .   ? 3 ? ? ? ? 
SCALEPACK 'data scaling'   .   ? 4 ? ? ? ? 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASN 
_pdbx_validate_rmsd_angle.auth_seq_id_1              174 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              175 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              175 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                128.88 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            9.58 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 53  ? ? 12.95   42.94   
2  1 ASP A 55  ? ? -79.84  30.62   
3  1 LYS A 94  ? ? -169.28 93.57   
4  1 ASN A 98  ? ? 36.36   36.57   
5  1 HIS A 137 ? ? -71.89  -155.72 
6  1 SER A 180 ? ? -51.26  8.44    
7  1 PHE A 216 ? ? -160.66 -68.62  
8  1 LYS A 249 ? ? -140.10 -4.18   
9  1 LYS A 253 ? ? -36.67  131.30  
10 1 SER A 257 ? ? -177.79 -171.79 
11 1 ILE A 267 ? ? -52.15  98.78   
12 1 LYS A 279 ? ? -39.27  119.28  
13 1 ARG A 290 ? ? -24.99  -35.49  
14 1 SER A 324 ? ? -108.32 48.12   
15 1 PHE A 340 ? ? -129.99 -89.83  
16 1 PRO A 402 ? ? -57.60  -84.23  
17 1 THR A 449 ? ? -98.59  -148.98 
18 1 GLN A 502 ? ? -58.87  103.37  
19 1 ALA A 503 ? ? -53.48  173.47  
20 1 VAL A 522 ? ? -55.56  -75.80  
21 1 PRO A 531 ? ? -44.34  151.10  
22 1 ASP A 533 ? ? -118.17 54.59   
23 1 GLU A 537 ? ? -141.02 16.08   
24 1 SER A 592 ? ? -97.57  -134.51 
25 1 ALA A 602 ? ? -52.20  -73.59  
26 1 PHE A 607 ? ? -95.90  -65.95  
27 1 MET B 84  ? ? 174.12  158.30  
28 1 LEU B 85  ? ? -47.67  151.59  
29 1 GLU B 95  ? ? -69.05  -80.11  
30 1 SER B 96  ? ? -67.83  -120.37 
31 1 LYS B 97  ? ? 7.70    -85.46  
32 1 LEU B 194 ? ? -66.27  2.55    
33 1 LYS B 239 ? ? -68.09  7.21    
34 1 LYS B 265 ? ? -68.08  98.97   
35 1 ASP B 300 ? ? -42.08  177.04  
36 1 GLU B 302 ? ? -67.57  72.89   
37 1 ASP B 309 ? ? -105.50 43.19   
38 1 GLU B 328 ? ? -105.97 -80.70  
39 1 GLN B 330 ? ? -66.79  10.34   
40 1 GLU B 336 ? ? -66.84  3.17    
41 1 PHE B 340 ? ? -164.13 63.70   
42 1 ASP B 386 ? ? -70.84  -71.10  
43 1 MET B 389 ? ? -112.68 -169.80 
44 1 ASP B 467 ? ? -107.26 -162.83 
45 1 GLU B 468 ? ? 19.98   -101.82 
46 1 LYS B 469 ? ? -65.05  62.66   
47 1 THR B 470 ? ? 7.35    -50.02  
48 1 PRO B 478 ? ? -69.77  55.74   
49 1 THR B 479 ? ? -34.37  -24.32  
50 1 PRO B 485 ? ? -60.26  1.20    
51 1 GLN B 527 ? ? -28.78  -79.56  
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     SER 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      162 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     OG 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    A 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    SER 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     162 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    OG 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A SER 2   ? A SER 2   
3   1 Y 1 A GLY 3   ? A GLY 3   
4   1 Y 1 A TRP 4   ? A TRP 4   
5   1 Y 1 A GLU 5   ? A GLU 5   
6   1 Y 1 A SER 6   ? A SER 6   
7   1 Y 1 A TYR 7   ? A TYR 7   
8   1 Y 1 A TYR 8   ? A TYR 8   
9   1 Y 1 A LYS 9   ? A LYS 9   
10  1 Y 1 A THR 10  ? A THR 10  
11  1 Y 1 A GLU 11  ? A GLU 11  
12  1 Y 1 A GLY 12  ? A GLY 12  
13  1 Y 1 A ASP 13  ? A ASP 13  
14  1 Y 1 A GLU 14  ? A GLU 14  
15  1 Y 1 A GLU 15  ? A GLU 15  
16  1 Y 1 A ALA 16  ? A ALA 16  
17  1 Y 1 A GLU 17  ? A GLU 17  
18  1 Y 1 A GLU 18  ? A GLU 18  
19  1 Y 1 A GLU 19  ? A GLU 19  
20  1 Y 1 A GLN 20  ? A GLN 20  
21  1 Y 1 A GLU 21  ? A GLU 21  
22  1 Y 1 A GLU 22  ? A GLU 22  
23  1 Y 1 A ASN 23  ? A ASN 23  
24  1 Y 1 A LEU 24  ? A LEU 24  
25  1 Y 1 A GLU 25  ? A GLU 25  
26  1 Y 1 A ALA 26  ? A ALA 26  
27  1 Y 1 A SER 27  ? A SER 27  
28  1 Y 1 A GLY 28  ? A GLY 28  
29  1 Y 1 A ASP 29  ? A ASP 29  
30  1 Y 1 A TYR 30  ? A TYR 30  
31  1 Y 1 A LYS 31  ? A LYS 31  
32  1 Y 1 A TYR 32  ? A TYR 32  
33  1 Y 1 A SER 33  ? A SER 33  
34  1 Y 1 A GLY 34  ? A GLY 34  
35  1 Y 1 A ALA 224 ? A ALA 224 
36  1 Y 1 A GLU 225 ? A GLU 225 
37  1 Y 1 A ASP 226 ? A ASP 226 
38  1 Y 1 A GLU 227 ? A GLU 227 
39  1 Y 1 A ASP 228 ? A ASP 228 
40  1 Y 1 A LEU 229 ? A LEU 229 
41  1 Y 1 A ARG 230 ? A ARG 230 
42  1 Y 1 A LYS 539 ? A LYS 539 
43  1 Y 1 A VAL 540 ? A VAL 540 
44  1 Y 1 A THR 541 ? A THR 541 
45  1 Y 1 A LYS 542 ? A LYS 542 
46  1 Y 1 A ARG 543 ? A ARG 543 
47  1 Y 1 A LYS 544 ? A LYS 544 
48  1 Y 1 A HIS 545 ? A HIS 545 
49  1 Y 1 A ASP 546 ? A ASP 546 
50  1 Y 1 A ASN 547 ? A ASN 547 
51  1 Y 1 A GLU 548 ? A GLU 548 
52  1 Y 1 A GLY 549 ? A GLY 549 
53  1 Y 1 A SER 550 ? A SER 550 
54  1 Y 1 A GLY 551 ? A GLY 551 
55  1 Y 1 A SER 552 ? A SER 552 
56  1 Y 1 A LYS 553 ? A LYS 553 
57  1 Y 1 A ARG 554 ? A ARG 554 
58  1 Y 1 A PRO 555 ? A PRO 555 
59  1 Y 1 A LYS 556 ? A LYS 556 
60  1 Y 1 A VAL 557 ? A VAL 557 
61  1 Y 1 A GLU 558 ? A GLU 558 
62  1 Y 1 B MET 1   ? B MET 1   
63  1 Y 1 B VAL 2   ? B VAL 2   
64  1 Y 1 B ARG 3   ? B ARG 3   
65  1 Y 1 B SER 4   ? B SER 4   
66  1 Y 1 B GLY 5   ? B GLY 5   
67  1 Y 1 B GLY 170 ? B GLY 170 
68  1 Y 1 B LYS 171 ? B LYS 171 
69  1 Y 1 B GLU 172 ? B GLU 172 
70  1 Y 1 B ASP 173 ? B ASP 173 
71  1 Y 1 B GLY 174 ? B GLY 174 
72  1 Y 1 B SER 175 ? B SER 175 
73  1 Y 1 B GLY 176 ? B GLY 176 
74  1 Y 1 B ASP 177 ? B ASP 177 
75  1 Y 1 B ARG 178 ? B ARG 178 
76  1 Y 1 B GLY 179 ? B GLY 179 
77  1 Y 1 B ASP 180 ? B ASP 180 
78  1 Y 1 B GLY 181 ? B GLY 181 
79  1 Y 1 B PRO 190 ? B PRO 190 
80  1 Y 1 B SER 191 ? B SER 191 
81  1 Y 1 B SER 324 ? B SER 324 
82  1 Y 1 B LYS 325 ? B LYS 325 
83  1 Y 1 B VAL 326 ? B VAL 326 
84  1 Y 1 B LYS 543 ? B LYS 543 
85  1 Y 1 B LYS 544 ? B LYS 544 
86  1 Y 1 B LYS 545 ? B LYS 545 
87  1 Y 1 B ASP 546 ? B ASP 546 
88  1 Y 1 B GLN 547 ? B GLN 547 
89  1 Y 1 B VAL 548 ? B VAL 548 
90  1 Y 1 B THR 549 ? B THR 549 
91  1 Y 1 B ALA 550 ? B ALA 550 
92  1 Y 1 B GLN 551 ? B GLN 551 
93  1 Y 1 B GLU 552 ? B GLU 552 
94  1 Y 1 B ILE 553 ? B ILE 553 
95  1 Y 1 B PHE 554 ? B PHE 554 
96  1 Y 1 B GLN 555 ? B GLN 555 
97  1 Y 1 B ASP 556 ? B ASP 556 
98  1 Y 1 B ASN 557 ? B ASN 557 
99  1 Y 1 B HIS 558 ? B HIS 558 
100 1 Y 1 B GLU 559 ? B GLU 559 
101 1 Y 1 B ASP 560 ? B ASP 560 
102 1 Y 1 B GLY 561 ? B GLY 561 
103 1 Y 1 B PRO 562 ? B PRO 562 
104 1 Y 1 B THR 563 ? B THR 563 
105 1 Y 1 B ALA 564 ? B ALA 564 
106 1 Y 1 B LYS 565 ? B LYS 565 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#