data_1JEY
# 
_entry.id   1JEY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JEY         
NDB   PD0220       
RCSB  RCSB013691   
WWPDB D_1000013691 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1JEQ 
_pdbx_database_related.details        'Crystal Structure of the Ku Heterodimer' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JEY 
_pdbx_database_status.recvd_initial_deposition_date   2001-06-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Walker, J.R.'  1 
'Corpina, R.A.' 2 
'Goldberg, J.'  3 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the Ku heterodimer bound to DNA and its implications for double-strand break repair.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            412 
_citation.page_first                607 
_citation.page_last                 614 
_citation.year                      2001 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11493912 
_citation.pdbx_database_id_DOI      10.1038/35088000 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Walker, J.R.'  1 
primary 'Corpina, R.A.' 2 
primary 'Goldberg, J.'  3 
# 
_cell.entry_id           1JEY 
_cell.length_a           83.920 
_cell.length_b           126.305 
_cell.length_c           126.436 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JEY 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(*GP*TP*TP*TP*TP*TP*AP*GP*TP*TP*TP*AP*TP*TP*GP*GP*GP*CP*GP*CP*G)-3')
;
6506.188  1   ? ? ?                ? 
2 polymer syn 'DNA (34-MER)'                                                                  10325.685 1   ? ? ?                ? 
3 polymer man Ku70                                                                            69945.039 1   ? ? ?                ? 
4 polymer man Ku80                                                                            64190.543 1   ? ? 'residues 1-565' ? 
5 water   nat water                                                                           18.015    255 ? ? ?                ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'HOMO SAPIENS THYROID AUTOANTIGEN 70KD' 
4 'DNA REPAIR PROTEIN XRCC5'              
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DG)(DT)(DT)(DT)(DT)(DT)(DA)(DG)(DT)(DT)(DT)(DA)(DT)(DT)(DG)(DG)(DG)(DC)(DG)(DC)
(DG)
;
GTTTTTAGTTTATTGGGCGCG C ? 
2 polydeoxyribonucleotide no no 
;(DC)(DG)(DC)(DG)(DC)(DC)(DC)(DA)(DG)(DC)(DT)(DT)(DT)(DC)(DC)(DC)(DA)(DG)(DC)(DT)
(DA)(DA)(DT)(DA)(DA)(DA)(DC)(DT)(DA)(DA)(DA)(DA)(DA)(DC)
;
CGCGCCCAGCTTTCCCAGCTAATAAACTAAAAAC D ? 
3 'polypeptide(L)'        no no 
;MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDR
DLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFK
MSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLE
DLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQ
IYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRY
TPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFEN
PVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYS
EEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD
;
;MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDR
DLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFK
MSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLE
DLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQ
IYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRY
TPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFEN
PVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYS
EEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD
;
A ? 
4 'polypeptide(L)'        no no 
;MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVH
RHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDIS
LQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKI
ERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDI
VPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKR
ANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTT
KIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHED
GPTAK
;
;MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVH
RHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDIS
LQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKI
ERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDI
VPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKR
ANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTT
KIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHED
GPTAK
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DT  n 
1 3   DT  n 
1 4   DT  n 
1 5   DT  n 
1 6   DT  n 
1 7   DA  n 
1 8   DG  n 
1 9   DT  n 
1 10  DT  n 
1 11  DT  n 
1 12  DA  n 
1 13  DT  n 
1 14  DT  n 
1 15  DG  n 
1 16  DG  n 
1 17  DG  n 
1 18  DC  n 
1 19  DG  n 
1 20  DC  n 
1 21  DG  n 
2 1   DC  n 
2 2   DG  n 
2 3   DC  n 
2 4   DG  n 
2 5   DC  n 
2 6   DC  n 
2 7   DC  n 
2 8   DA  n 
2 9   DG  n 
2 10  DC  n 
2 11  DT  n 
2 12  DT  n 
2 13  DT  n 
2 14  DC  n 
2 15  DC  n 
2 16  DC  n 
2 17  DA  n 
2 18  DG  n 
2 19  DC  n 
2 20  DT  n 
2 21  DA  n 
2 22  DA  n 
2 23  DT  n 
2 24  DA  n 
2 25  DA  n 
2 26  DA  n 
2 27  DC  n 
2 28  DT  n 
2 29  DA  n 
2 30  DA  n 
2 31  DA  n 
2 32  DA  n 
2 33  DA  n 
2 34  DC  n 
3 1   MET n 
3 2   SER n 
3 3   GLY n 
3 4   TRP n 
3 5   GLU n 
3 6   SER n 
3 7   TYR n 
3 8   TYR n 
3 9   LYS n 
3 10  THR n 
3 11  GLU n 
3 12  GLY n 
3 13  ASP n 
3 14  GLU n 
3 15  GLU n 
3 16  ALA n 
3 17  GLU n 
3 18  GLU n 
3 19  GLU n 
3 20  GLN n 
3 21  GLU n 
3 22  GLU n 
3 23  ASN n 
3 24  LEU n 
3 25  GLU n 
3 26  ALA n 
3 27  SER n 
3 28  GLY n 
3 29  ASP n 
3 30  TYR n 
3 31  LYS n 
3 32  TYR n 
3 33  SER n 
3 34  GLY n 
3 35  ARG n 
3 36  ASP n 
3 37  SER n 
3 38  LEU n 
3 39  ILE n 
3 40  PHE n 
3 41  LEU n 
3 42  VAL n 
3 43  ASP n 
3 44  ALA n 
3 45  SER n 
3 46  LYS n 
3 47  ALA n 
3 48  MET n 
3 49  PHE n 
3 50  GLU n 
3 51  SER n 
3 52  GLN n 
3 53  SER n 
3 54  GLU n 
3 55  ASP n 
3 56  GLU n 
3 57  LEU n 
3 58  THR n 
3 59  PRO n 
3 60  PHE n 
3 61  ASP n 
3 62  MET n 
3 63  SER n 
3 64  ILE n 
3 65  GLN n 
3 66  CYS n 
3 67  ILE n 
3 68  GLN n 
3 69  SER n 
3 70  VAL n 
3 71  TYR n 
3 72  ILE n 
3 73  SER n 
3 74  LYS n 
3 75  ILE n 
3 76  ILE n 
3 77  SER n 
3 78  SER n 
3 79  ASP n 
3 80  ARG n 
3 81  ASP n 
3 82  LEU n 
3 83  LEU n 
3 84  ALA n 
3 85  VAL n 
3 86  VAL n 
3 87  PHE n 
3 88  TYR n 
3 89  GLY n 
3 90  THR n 
3 91  GLU n 
3 92  LYS n 
3 93  ASP n 
3 94  LYS n 
3 95  ASN n 
3 96  SER n 
3 97  VAL n 
3 98  ASN n 
3 99  PHE n 
3 100 LYS n 
3 101 ASN n 
3 102 ILE n 
3 103 TYR n 
3 104 VAL n 
3 105 LEU n 
3 106 GLN n 
3 107 GLU n 
3 108 LEU n 
3 109 ASP n 
3 110 ASN n 
3 111 PRO n 
3 112 GLY n 
3 113 ALA n 
3 114 LYS n 
3 115 ARG n 
3 116 ILE n 
3 117 LEU n 
3 118 GLU n 
3 119 LEU n 
3 120 ASP n 
3 121 GLN n 
3 122 PHE n 
3 123 LYS n 
3 124 GLY n 
3 125 GLN n 
3 126 GLN n 
3 127 GLY n 
3 128 GLN n 
3 129 LYS n 
3 130 ARG n 
3 131 PHE n 
3 132 GLN n 
3 133 ASP n 
3 134 MET n 
3 135 MET n 
3 136 GLY n 
3 137 HIS n 
3 138 GLY n 
3 139 SER n 
3 140 ASP n 
3 141 TYR n 
3 142 SER n 
3 143 LEU n 
3 144 SER n 
3 145 GLU n 
3 146 VAL n 
3 147 LEU n 
3 148 TRP n 
3 149 VAL n 
3 150 CYS n 
3 151 ALA n 
3 152 ASN n 
3 153 LEU n 
3 154 PHE n 
3 155 SER n 
3 156 ASP n 
3 157 VAL n 
3 158 GLN n 
3 159 PHE n 
3 160 LYS n 
3 161 MET n 
3 162 SER n 
3 163 HIS n 
3 164 LYS n 
3 165 ARG n 
3 166 ILE n 
3 167 MET n 
3 168 LEU n 
3 169 PHE n 
3 170 THR n 
3 171 ASN n 
3 172 GLU n 
3 173 ASP n 
3 174 ASN n 
3 175 PRO n 
3 176 HIS n 
3 177 GLY n 
3 178 ASN n 
3 179 ASP n 
3 180 SER n 
3 181 ALA n 
3 182 LYS n 
3 183 ALA n 
3 184 SER n 
3 185 ARG n 
3 186 ALA n 
3 187 ARG n 
3 188 THR n 
3 189 LYS n 
3 190 ALA n 
3 191 GLY n 
3 192 ASP n 
3 193 LEU n 
3 194 ARG n 
3 195 ASP n 
3 196 THR n 
3 197 GLY n 
3 198 ILE n 
3 199 PHE n 
3 200 LEU n 
3 201 ASP n 
3 202 LEU n 
3 203 MET n 
3 204 HIS n 
3 205 LEU n 
3 206 LYS n 
3 207 LYS n 
3 208 PRO n 
3 209 GLY n 
3 210 GLY n 
3 211 PHE n 
3 212 ASP n 
3 213 ILE n 
3 214 SER n 
3 215 LEU n 
3 216 PHE n 
3 217 TYR n 
3 218 ARG n 
3 219 ASP n 
3 220 ILE n 
3 221 ILE n 
3 222 SER n 
3 223 ILE n 
3 224 ALA n 
3 225 GLU n 
3 226 ASP n 
3 227 GLU n 
3 228 ASP n 
3 229 LEU n 
3 230 ARG n 
3 231 VAL n 
3 232 HIS n 
3 233 PHE n 
3 234 GLU n 
3 235 GLU n 
3 236 SER n 
3 237 SER n 
3 238 LYS n 
3 239 LEU n 
3 240 GLU n 
3 241 ASP n 
3 242 LEU n 
3 243 LEU n 
3 244 ARG n 
3 245 LYS n 
3 246 VAL n 
3 247 ARG n 
3 248 ALA n 
3 249 LYS n 
3 250 GLU n 
3 251 THR n 
3 252 ARG n 
3 253 LYS n 
3 254 ARG n 
3 255 ALA n 
3 256 LEU n 
3 257 SER n 
3 258 ARG n 
3 259 LEU n 
3 260 LYS n 
3 261 LEU n 
3 262 LYS n 
3 263 LEU n 
3 264 ASN n 
3 265 LYS n 
3 266 ASP n 
3 267 ILE n 
3 268 VAL n 
3 269 ILE n 
3 270 SER n 
3 271 VAL n 
3 272 GLY n 
3 273 ILE n 
3 274 TYR n 
3 275 ASN n 
3 276 LEU n 
3 277 VAL n 
3 278 GLN n 
3 279 LYS n 
3 280 ALA n 
3 281 LEU n 
3 282 LYS n 
3 283 PRO n 
3 284 PRO n 
3 285 PRO n 
3 286 ILE n 
3 287 LYS n 
3 288 LEU n 
3 289 TYR n 
3 290 ARG n 
3 291 GLU n 
3 292 THR n 
3 293 ASN n 
3 294 GLU n 
3 295 PRO n 
3 296 VAL n 
3 297 LYS n 
3 298 THR n 
3 299 LYS n 
3 300 THR n 
3 301 ARG n 
3 302 THR n 
3 303 PHE n 
3 304 ASN n 
3 305 THR n 
3 306 SER n 
3 307 THR n 
3 308 GLY n 
3 309 GLY n 
3 310 LEU n 
3 311 LEU n 
3 312 LEU n 
3 313 PRO n 
3 314 SER n 
3 315 ASP n 
3 316 THR n 
3 317 LYS n 
3 318 ARG n 
3 319 SER n 
3 320 GLN n 
3 321 ILE n 
3 322 TYR n 
3 323 GLY n 
3 324 SER n 
3 325 ARG n 
3 326 GLN n 
3 327 ILE n 
3 328 ILE n 
3 329 LEU n 
3 330 GLU n 
3 331 LYS n 
3 332 GLU n 
3 333 GLU n 
3 334 THR n 
3 335 GLU n 
3 336 GLU n 
3 337 LEU n 
3 338 LYS n 
3 339 ARG n 
3 340 PHE n 
3 341 ASP n 
3 342 ASP n 
3 343 PRO n 
3 344 GLY n 
3 345 LEU n 
3 346 MET n 
3 347 LEU n 
3 348 MET n 
3 349 GLY n 
3 350 PHE n 
3 351 LYS n 
3 352 PRO n 
3 353 LEU n 
3 354 VAL n 
3 355 LEU n 
3 356 LEU n 
3 357 LYS n 
3 358 LYS n 
3 359 HIS n 
3 360 HIS n 
3 361 TYR n 
3 362 LEU n 
3 363 ARG n 
3 364 PRO n 
3 365 SER n 
3 366 LEU n 
3 367 PHE n 
3 368 VAL n 
3 369 TYR n 
3 370 PRO n 
3 371 GLU n 
3 372 GLU n 
3 373 SER n 
3 374 LEU n 
3 375 VAL n 
3 376 ILE n 
3 377 GLY n 
3 378 SER n 
3 379 SER n 
3 380 THR n 
3 381 LEU n 
3 382 PHE n 
3 383 SER n 
3 384 ALA n 
3 385 LEU n 
3 386 LEU n 
3 387 ILE n 
3 388 LYS n 
3 389 CYS n 
3 390 LEU n 
3 391 GLU n 
3 392 LYS n 
3 393 GLU n 
3 394 VAL n 
3 395 ALA n 
3 396 ALA n 
3 397 LEU n 
3 398 CYS n 
3 399 ARG n 
3 400 TYR n 
3 401 THR n 
3 402 PRO n 
3 403 ARG n 
3 404 ARG n 
3 405 ASN n 
3 406 ILE n 
3 407 PRO n 
3 408 PRO n 
3 409 TYR n 
3 410 PHE n 
3 411 VAL n 
3 412 ALA n 
3 413 LEU n 
3 414 VAL n 
3 415 PRO n 
3 416 GLN n 
3 417 GLU n 
3 418 GLU n 
3 419 GLU n 
3 420 LEU n 
3 421 ASP n 
3 422 ASP n 
3 423 GLN n 
3 424 LYS n 
3 425 ILE n 
3 426 GLN n 
3 427 VAL n 
3 428 THR n 
3 429 PRO n 
3 430 PRO n 
3 431 GLY n 
3 432 PHE n 
3 433 GLN n 
3 434 LEU n 
3 435 VAL n 
3 436 PHE n 
3 437 LEU n 
3 438 PRO n 
3 439 PHE n 
3 440 ALA n 
3 441 ASP n 
3 442 ASP n 
3 443 LYS n 
3 444 ARG n 
3 445 LYS n 
3 446 MET n 
3 447 PRO n 
3 448 PHE n 
3 449 THR n 
3 450 GLU n 
3 451 LYS n 
3 452 ILE n 
3 453 MET n 
3 454 ALA n 
3 455 THR n 
3 456 PRO n 
3 457 GLU n 
3 458 GLN n 
3 459 VAL n 
3 460 GLY n 
3 461 LYS n 
3 462 MET n 
3 463 LYS n 
3 464 ALA n 
3 465 ILE n 
3 466 VAL n 
3 467 GLU n 
3 468 LYS n 
3 469 LEU n 
3 470 ARG n 
3 471 PHE n 
3 472 THR n 
3 473 TYR n 
3 474 ARG n 
3 475 SER n 
3 476 ASP n 
3 477 SER n 
3 478 PHE n 
3 479 GLU n 
3 480 ASN n 
3 481 PRO n 
3 482 VAL n 
3 483 LEU n 
3 484 GLN n 
3 485 GLN n 
3 486 HIS n 
3 487 PHE n 
3 488 ARG n 
3 489 ASN n 
3 490 LEU n 
3 491 GLU n 
3 492 ALA n 
3 493 LEU n 
3 494 ALA n 
3 495 LEU n 
3 496 ASP n 
3 497 LEU n 
3 498 MET n 
3 499 GLU n 
3 500 PRO n 
3 501 GLU n 
3 502 GLN n 
3 503 ALA n 
3 504 VAL n 
3 505 ASP n 
3 506 LEU n 
3 507 THR n 
3 508 LEU n 
3 509 PRO n 
3 510 LYS n 
3 511 VAL n 
3 512 GLU n 
3 513 ALA n 
3 514 MET n 
3 515 ASN n 
3 516 LYS n 
3 517 ARG n 
3 518 LEU n 
3 519 GLY n 
3 520 SER n 
3 521 LEU n 
3 522 VAL n 
3 523 ASP n 
3 524 GLU n 
3 525 PHE n 
3 526 LYS n 
3 527 GLU n 
3 528 LEU n 
3 529 VAL n 
3 530 TYR n 
3 531 PRO n 
3 532 PRO n 
3 533 ASP n 
3 534 TYR n 
3 535 ASN n 
3 536 PRO n 
3 537 GLU n 
3 538 GLY n 
3 539 LYS n 
3 540 VAL n 
3 541 THR n 
3 542 LYS n 
3 543 ARG n 
3 544 LYS n 
3 545 HIS n 
3 546 ASP n 
3 547 ASN n 
3 548 GLU n 
3 549 GLY n 
3 550 SER n 
3 551 GLY n 
3 552 SER n 
3 553 LYS n 
3 554 ARG n 
3 555 PRO n 
3 556 LYS n 
3 557 VAL n 
3 558 GLU n 
3 559 TYR n 
3 560 SER n 
3 561 GLU n 
3 562 GLU n 
3 563 GLU n 
3 564 LEU n 
3 565 LYS n 
3 566 THR n 
3 567 HIS n 
3 568 ILE n 
3 569 SER n 
3 570 LYS n 
3 571 GLY n 
3 572 THR n 
3 573 LEU n 
3 574 GLY n 
3 575 LYS n 
3 576 PHE n 
3 577 THR n 
3 578 VAL n 
3 579 PRO n 
3 580 MET n 
3 581 LEU n 
3 582 LYS n 
3 583 GLU n 
3 584 ALA n 
3 585 CYS n 
3 586 ARG n 
3 587 ALA n 
3 588 TYR n 
3 589 GLY n 
3 590 LEU n 
3 591 LYS n 
3 592 SER n 
3 593 GLY n 
3 594 LEU n 
3 595 LYS n 
3 596 LYS n 
3 597 GLN n 
3 598 GLU n 
3 599 LEU n 
3 600 LEU n 
3 601 GLU n 
3 602 ALA n 
3 603 LEU n 
3 604 THR n 
3 605 LYS n 
3 606 HIS n 
3 607 PHE n 
3 608 GLN n 
3 609 ASP n 
4 1   MET n 
4 2   VAL n 
4 3   ARG n 
4 4   SER n 
4 5   GLY n 
4 6   ASN n 
4 7   LYS n 
4 8   ALA n 
4 9   ALA n 
4 10  VAL n 
4 11  VAL n 
4 12  LEU n 
4 13  CYS n 
4 14  MET n 
4 15  ASP n 
4 16  VAL n 
4 17  GLY n 
4 18  PHE n 
4 19  THR n 
4 20  MET n 
4 21  SER n 
4 22  ASN n 
4 23  SER n 
4 24  ILE n 
4 25  PRO n 
4 26  GLY n 
4 27  ILE n 
4 28  GLU n 
4 29  SER n 
4 30  PRO n 
4 31  PHE n 
4 32  GLU n 
4 33  GLN n 
4 34  ALA n 
4 35  LYS n 
4 36  LYS n 
4 37  VAL n 
4 38  ILE n 
4 39  THR n 
4 40  MET n 
4 41  PHE n 
4 42  VAL n 
4 43  GLN n 
4 44  ARG n 
4 45  GLN n 
4 46  VAL n 
4 47  PHE n 
4 48  ALA n 
4 49  GLU n 
4 50  ASN n 
4 51  LYS n 
4 52  ASP n 
4 53  GLU n 
4 54  ILE n 
4 55  ALA n 
4 56  LEU n 
4 57  VAL n 
4 58  LEU n 
4 59  PHE n 
4 60  GLY n 
4 61  THR n 
4 62  ASP n 
4 63  GLY n 
4 64  THR n 
4 65  ASP n 
4 66  ASN n 
4 67  PRO n 
4 68  LEU n 
4 69  SER n 
4 70  GLY n 
4 71  GLY n 
4 72  ASP n 
4 73  GLN n 
4 74  TYR n 
4 75  GLN n 
4 76  ASN n 
4 77  ILE n 
4 78  THR n 
4 79  VAL n 
4 80  HIS n 
4 81  ARG n 
4 82  HIS n 
4 83  LEU n 
4 84  MET n 
4 85  LEU n 
4 86  PRO n 
4 87  ASP n 
4 88  PHE n 
4 89  ASP n 
4 90  LEU n 
4 91  LEU n 
4 92  GLU n 
4 93  ASP n 
4 94  ILE n 
4 95  GLU n 
4 96  SER n 
4 97  LYS n 
4 98  ILE n 
4 99  GLN n 
4 100 PRO n 
4 101 GLY n 
4 102 SER n 
4 103 GLN n 
4 104 GLN n 
4 105 ALA n 
4 106 ASP n 
4 107 PHE n 
4 108 LEU n 
4 109 ASP n 
4 110 ALA n 
4 111 LEU n 
4 112 ILE n 
4 113 VAL n 
4 114 SER n 
4 115 MET n 
4 116 ASP n 
4 117 VAL n 
4 118 ILE n 
4 119 GLN n 
4 120 HIS n 
4 121 GLU n 
4 122 THR n 
4 123 ILE n 
4 124 GLY n 
4 125 LYS n 
4 126 LYS n 
4 127 PHE n 
4 128 GLU n 
4 129 LYS n 
4 130 ARG n 
4 131 HIS n 
4 132 ILE n 
4 133 GLU n 
4 134 ILE n 
4 135 PHE n 
4 136 THR n 
4 137 ASP n 
4 138 LEU n 
4 139 SER n 
4 140 SER n 
4 141 ARG n 
4 142 PHE n 
4 143 SER n 
4 144 LYS n 
4 145 SER n 
4 146 GLN n 
4 147 LEU n 
4 148 ASP n 
4 149 ILE n 
4 150 ILE n 
4 151 ILE n 
4 152 HIS n 
4 153 SER n 
4 154 LEU n 
4 155 LYS n 
4 156 LYS n 
4 157 CYS n 
4 158 ASP n 
4 159 ILE n 
4 160 SER n 
4 161 LEU n 
4 162 GLN n 
4 163 PHE n 
4 164 PHE n 
4 165 LEU n 
4 166 PRO n 
4 167 PHE n 
4 168 SER n 
4 169 LEU n 
4 170 GLY n 
4 171 LYS n 
4 172 GLU n 
4 173 ASP n 
4 174 GLY n 
4 175 SER n 
4 176 GLY n 
4 177 ASP n 
4 178 ARG n 
4 179 GLY n 
4 180 ASP n 
4 181 GLY n 
4 182 PRO n 
4 183 PHE n 
4 184 ARG n 
4 185 LEU n 
4 186 GLY n 
4 187 GLY n 
4 188 HIS n 
4 189 GLY n 
4 190 PRO n 
4 191 SER n 
4 192 PHE n 
4 193 PRO n 
4 194 LEU n 
4 195 LYS n 
4 196 GLY n 
4 197 ILE n 
4 198 THR n 
4 199 GLU n 
4 200 GLN n 
4 201 GLN n 
4 202 LYS n 
4 203 GLU n 
4 204 GLY n 
4 205 LEU n 
4 206 GLU n 
4 207 ILE n 
4 208 VAL n 
4 209 LYS n 
4 210 MET n 
4 211 VAL n 
4 212 MET n 
4 213 ILE n 
4 214 SER n 
4 215 LEU n 
4 216 GLU n 
4 217 GLY n 
4 218 GLU n 
4 219 ASP n 
4 220 GLY n 
4 221 LEU n 
4 222 ASP n 
4 223 GLU n 
4 224 ILE n 
4 225 TYR n 
4 226 SER n 
4 227 PHE n 
4 228 SER n 
4 229 GLU n 
4 230 SER n 
4 231 LEU n 
4 232 ARG n 
4 233 LYS n 
4 234 LEU n 
4 235 CYS n 
4 236 VAL n 
4 237 PHE n 
4 238 LYS n 
4 239 LYS n 
4 240 ILE n 
4 241 GLU n 
4 242 ARG n 
4 243 HIS n 
4 244 SER n 
4 245 ILE n 
4 246 HIS n 
4 247 TRP n 
4 248 PRO n 
4 249 CYS n 
4 250 ARG n 
4 251 LEU n 
4 252 THR n 
4 253 ILE n 
4 254 GLY n 
4 255 SER n 
4 256 ASN n 
4 257 LEU n 
4 258 SER n 
4 259 ILE n 
4 260 ARG n 
4 261 ILE n 
4 262 ALA n 
4 263 ALA n 
4 264 TYR n 
4 265 LYS n 
4 266 SER n 
4 267 ILE n 
4 268 LEU n 
4 269 GLN n 
4 270 GLU n 
4 271 ARG n 
4 272 VAL n 
4 273 LYS n 
4 274 LYS n 
4 275 THR n 
4 276 TRP n 
4 277 THR n 
4 278 VAL n 
4 279 VAL n 
4 280 ASP n 
4 281 ALA n 
4 282 LYS n 
4 283 THR n 
4 284 LEU n 
4 285 LYS n 
4 286 LYS n 
4 287 GLU n 
4 288 ASP n 
4 289 ILE n 
4 290 GLN n 
4 291 LYS n 
4 292 GLU n 
4 293 THR n 
4 294 VAL n 
4 295 TYR n 
4 296 CYS n 
4 297 LEU n 
4 298 ASN n 
4 299 ASP n 
4 300 ASP n 
4 301 ASP n 
4 302 GLU n 
4 303 THR n 
4 304 GLU n 
4 305 VAL n 
4 306 LEU n 
4 307 LYS n 
4 308 GLU n 
4 309 ASP n 
4 310 ILE n 
4 311 ILE n 
4 312 GLN n 
4 313 GLY n 
4 314 PHE n 
4 315 ARG n 
4 316 TYR n 
4 317 GLY n 
4 318 SER n 
4 319 ASP n 
4 320 ILE n 
4 321 VAL n 
4 322 PRO n 
4 323 PHE n 
4 324 SER n 
4 325 LYS n 
4 326 VAL n 
4 327 ASP n 
4 328 GLU n 
4 329 GLU n 
4 330 GLN n 
4 331 MET n 
4 332 LYS n 
4 333 TYR n 
4 334 LYS n 
4 335 SER n 
4 336 GLU n 
4 337 GLY n 
4 338 LYS n 
4 339 CYS n 
4 340 PHE n 
4 341 SER n 
4 342 VAL n 
4 343 LEU n 
4 344 GLY n 
4 345 PHE n 
4 346 CYS n 
4 347 LYS n 
4 348 SER n 
4 349 SER n 
4 350 GLN n 
4 351 VAL n 
4 352 GLN n 
4 353 ARG n 
4 354 ARG n 
4 355 PHE n 
4 356 PHE n 
4 357 MET n 
4 358 GLY n 
4 359 ASN n 
4 360 GLN n 
4 361 VAL n 
4 362 LEU n 
4 363 LYS n 
4 364 VAL n 
4 365 PHE n 
4 366 ALA n 
4 367 ALA n 
4 368 ARG n 
4 369 ASP n 
4 370 ASP n 
4 371 GLU n 
4 372 ALA n 
4 373 ALA n 
4 374 ALA n 
4 375 VAL n 
4 376 ALA n 
4 377 LEU n 
4 378 SER n 
4 379 SER n 
4 380 LEU n 
4 381 ILE n 
4 382 HIS n 
4 383 ALA n 
4 384 LEU n 
4 385 ASP n 
4 386 ASP n 
4 387 LEU n 
4 388 ASP n 
4 389 MET n 
4 390 VAL n 
4 391 ALA n 
4 392 ILE n 
4 393 VAL n 
4 394 ARG n 
4 395 TYR n 
4 396 ALA n 
4 397 TYR n 
4 398 ASP n 
4 399 LYS n 
4 400 ARG n 
4 401 ALA n 
4 402 ASN n 
4 403 PRO n 
4 404 GLN n 
4 405 VAL n 
4 406 GLY n 
4 407 VAL n 
4 408 ALA n 
4 409 PHE n 
4 410 PRO n 
4 411 HIS n 
4 412 ILE n 
4 413 LYS n 
4 414 HIS n 
4 415 ASN n 
4 416 TYR n 
4 417 GLU n 
4 418 CYS n 
4 419 LEU n 
4 420 VAL n 
4 421 TYR n 
4 422 VAL n 
4 423 GLN n 
4 424 LEU n 
4 425 PRO n 
4 426 PHE n 
4 427 MET n 
4 428 GLU n 
4 429 ASP n 
4 430 LEU n 
4 431 ARG n 
4 432 GLN n 
4 433 TYR n 
4 434 MET n 
4 435 PHE n 
4 436 SER n 
4 437 SER n 
4 438 LEU n 
4 439 LYS n 
4 440 ASN n 
4 441 SER n 
4 442 LYS n 
4 443 LYS n 
4 444 TYR n 
4 445 ALA n 
4 446 PRO n 
4 447 THR n 
4 448 GLU n 
4 449 ALA n 
4 450 GLN n 
4 451 LEU n 
4 452 ASN n 
4 453 ALA n 
4 454 VAL n 
4 455 ASP n 
4 456 ALA n 
4 457 LEU n 
4 458 ILE n 
4 459 ASP n 
4 460 SER n 
4 461 MET n 
4 462 SER n 
4 463 LEU n 
4 464 ALA n 
4 465 LYS n 
4 466 LYS n 
4 467 ASP n 
4 468 GLU n 
4 469 LYS n 
4 470 THR n 
4 471 ASP n 
4 472 THR n 
4 473 LEU n 
4 474 GLU n 
4 475 ASP n 
4 476 LEU n 
4 477 PHE n 
4 478 PRO n 
4 479 THR n 
4 480 THR n 
4 481 LYS n 
4 482 ILE n 
4 483 PRO n 
4 484 ASN n 
4 485 PRO n 
4 486 ARG n 
4 487 PHE n 
4 488 GLN n 
4 489 ARG n 
4 490 LEU n 
4 491 PHE n 
4 492 GLN n 
4 493 CYS n 
4 494 LEU n 
4 495 LEU n 
4 496 HIS n 
4 497 ARG n 
4 498 ALA n 
4 499 LEU n 
4 500 HIS n 
4 501 PRO n 
4 502 ARG n 
4 503 GLU n 
4 504 PRO n 
4 505 LEU n 
4 506 PRO n 
4 507 PRO n 
4 508 ILE n 
4 509 GLN n 
4 510 GLN n 
4 511 HIS n 
4 512 ILE n 
4 513 TRP n 
4 514 ASN n 
4 515 MET n 
4 516 LEU n 
4 517 ASN n 
4 518 PRO n 
4 519 PRO n 
4 520 ALA n 
4 521 GLU n 
4 522 VAL n 
4 523 THR n 
4 524 THR n 
4 525 LYS n 
4 526 SER n 
4 527 GLN n 
4 528 ILE n 
4 529 PRO n 
4 530 LEU n 
4 531 SER n 
4 532 LYS n 
4 533 ILE n 
4 534 LYS n 
4 535 THR n 
4 536 LEU n 
4 537 PHE n 
4 538 PRO n 
4 539 LEU n 
4 540 ILE n 
4 541 GLU n 
4 542 ALA n 
4 543 LYS n 
4 544 LYS n 
4 545 LYS n 
4 546 ASP n 
4 547 GLN n 
4 548 VAL n 
4 549 THR n 
4 550 ALA n 
4 551 GLN n 
4 552 GLU n 
4 553 ILE n 
4 554 PHE n 
4 555 GLN n 
4 556 ASP n 
4 557 ASN n 
4 558 HIS n 
4 559 GLU n 
4 560 ASP n 
4 561 GLY n 
4 562 PRO n 
4 563 THR n 
4 564 ALA n 
4 565 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? human Homo G22P1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 
Spodoptera ? ? ? ? ? ? ? Sf9 ? ? ? ? ? Baculovirus ? ? ? 'pFASTBAC HT' ? ? 
4 1 sample ? ? ? human Homo XRCC5 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 
Spodoptera ? ? ? ? ? ? ? Sf9 ? ? ? ? ? Baculovirus ? ? ? 'pFASTBAC HT' ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP KU70_HUMAN 3 
;MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDR
DLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFK
MSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLE
DLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQ
IYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRY
TPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFEN
PVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYS
EEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD
;
0 P12956 ? 
2 UNP KU86_HUMAN 4 
;MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVH
RHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDIS
LQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKI
ERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDI
VPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKR
ANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTT
KIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHED
GPTAK
;
0 P13010 ? 
3 PDB 1JEY       1 ? ? 1JEY   ? 
4 PDB 1JEY       2 ? ? 1JEY   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JEY A 1 ? 609 ? P12956 0 ? 608 ? 1 609 
2 2 1JEY B 1 ? 565 ? P13010 0 ? 564 ? 1 565 
3 3 1JEY C 1 ? 21  ? 1JEY   1 ? 21  ? 1 21  
4 4 1JEY D 1 ? 34  ? 1JEY   1 ? 34  ? 1 34  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1JEY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.23 
_exptl_crystal.density_percent_sol   45 
_exptl_crystal.description           ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
;26% polyethylene glycol 350 monomethyl ether, 50 mM Tris-HCL pH 8.0, 5 mM magnesium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 295K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 350 monomethyl ether' ? ? ? 
1 2 1 Tris-HCl                   ? ? ? 
1 3 1 MgCl2                      ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2001-03-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97921 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X9A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X9A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97921 
# 
_reflns.entry_id                     1JEY 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   -3.0 
_reflns.d_resolution_low             25.0 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   46176 
_reflns.number_all                   46460 
_reflns.percent_possible_obs         96.4 
_reflns.pdbx_Rmerge_I_obs            0.0650000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.5 
_reflns.B_iso_Wilson_estimate        28.2 
_reflns.pdbx_redundancy              3.1 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.54 
_reflns_shell.percent_possible_all   67.5 
_reflns_shell.Rmerge_I_obs           0.3060000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.6 
_reflns_shell.pdbx_redundancy        2.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      46385 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1JEY 
_refine.ls_number_reflns_obs                     46176 
_refine.ls_number_reflns_all                     46176 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2533650.68 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             24.74 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    97.8 
_refine.ls_R_factor_obs                          0.2200000 
_refine.ls_R_factor_all                          0.2200000 
_refine.ls_R_factor_R_work                       0.2180000 
_refine.ls_R_factor_R_free                       0.2800000 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2304 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               40.1 
_refine.aniso_B[1][1]                            5.62 
_refine.aniso_B[2][2]                            -3.70 
_refine.aniso_B[3][3]                            -1.92 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.360 
_refine.solvent_model_param_bsol                 34.46 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1JEQ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1JEY 
_refine_analyze.Luzzati_coordinate_error_obs    0.30 
_refine_analyze.Luzzati_sigma_a_obs             0.27 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.40 
_refine_analyze.Luzzati_sigma_a_free            0.40 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8224 
_refine_hist.pdbx_number_atoms_nucleic_acid   993 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             255 
_refine_hist.number_atoms_total               9472 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        24.74 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.8  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.24  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.55  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.65  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.97  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.97  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.66 
_refine_ls_shell.number_reflns_R_work             7271 
_refine_ls_shell.R_factor_R_work                  0.2610000 
_refine_ls_shell.percent_reflns_obs               98.2 
_refine_ls_shell.R_factor_R_free                  0.3450000 
_refine_ls_shell.R_factor_R_free_error            0.019 
_refine_ls_shell.percent_reflns_R_free            4.6 
_refine_ls_shell.number_reflns_R_free             348 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
4 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1JEY 
_struct.title                     'Crystal Structure of the Ku heterodimer bound to DNA' 
_struct.pdbx_descriptor           'Ku Heterodimer/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JEY 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
_struct_keywords.text            
;double-strand DNA break repair, non-homologous end-joining, protein-nucleic acid complex, alpha/beta domain, beta barrel, helical C-terminal arm, SAP domain, DNA BINDING PROTEIN-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER C 45  ? GLU C 50  ? SER A 45  GLU A 50  5 ? 6  
HELX_P HELX_P2  2  THR C 58  ? SER C 77  ? THR A 58  SER A 77  1 ? 20 
HELX_P HELX_P3  3  GLY C 112 ? GLN C 121 ? GLY A 112 GLN A 121 1 ? 10 
HELX_P HELX_P4  4  LYS C 123 ? GLY C 136 ? LYS A 123 GLY A 136 1 ? 14 
HELX_P HELX_P5  5  SER C 142 ? ASP C 156 ? SER A 142 ASP A 156 1 ? 15 
HELX_P HELX_P6  6  ASP C 179 ? GLY C 197 ? ASP A 179 GLY A 197 1 ? 19 
HELX_P HELX_P7  7  PHE C 216 ? ILE C 220 ? PHE A 216 ILE A 220 5 ? 5  
HELX_P HELX_P8  8  LYS C 238 ? THR C 251 ? LYS A 238 THR A 251 1 ? 14 
HELX_P HELX_P9  9  LEU C 312 ? SER C 314 ? LEU A 312 SER A 314 5 ? 3  
HELX_P HELX_P10 10 GLU C 330 ? LEU C 337 ? GLU A 330 LEU A 337 1 ? 8  
HELX_P HELX_P11 11 VAL C 354 ? LEU C 356 ? VAL A 354 LEU A 356 5 ? 3  
HELX_P HELX_P12 12 LYS C 357 ? TYR C 361 ? LYS A 357 TYR A 361 5 ? 5  
HELX_P HELX_P13 13 GLY C 377 ? LYS C 392 ? GLY A 377 LYS A 392 1 ? 16 
HELX_P HELX_P14 14 PHE C 439 ? ASP C 442 ? PHE A 439 ASP A 442 5 ? 4  
HELX_P HELX_P15 15 THR C 455 ? LEU C 469 ? THR A 455 LEU A 469 1 ? 15 
HELX_P HELX_P16 16 ASN C 480 ? LEU C 495 ? ASN A 480 LEU A 495 1 ? 16 
HELX_P HELX_P17 17 LYS C 510 ? GLY C 519 ? LYS A 510 GLY A 519 1 ? 10 
HELX_P HELX_P18 18 SER C 520 ? TYR C 530 ? SER A 520 TYR A 530 1 ? 11 
HELX_P HELX_P19 19 GLY D 17  ? ASN D 22  ? GLY B 17  ASN B 22  5 ? 6  
HELX_P HELX_P20 20 SER D 29  ? ALA D 48  ? SER B 29  ALA B 48  1 ? 20 
HELX_P HELX_P21 21 ASP D 87  ? SER D 96  ? ASP B 87  SER B 96  1 ? 10 
HELX_P HELX_P22 22 ASP D 106 ? THR D 122 ? ASP B 106 THR B 122 1 ? 17 
HELX_P HELX_P23 23 GLN D 146 ? CYS D 157 ? GLN B 146 CYS B 157 1 ? 12 
HELX_P HELX_P24 24 THR D 198 ? GLY D 217 ? THR B 198 GLY B 217 1 ? 20 
HELX_P HELX_P25 25 GLU D 218 ? ASP D 222 ? GLU B 218 ASP B 222 5 ? 5  
HELX_P HELX_P26 26 PHE D 227 ? LEU D 231 ? PHE B 227 LEU B 231 1 ? 5  
HELX_P HELX_P27 27 PHE D 237 ? GLU D 241 ? PHE B 237 GLU B 241 5 ? 5  
HELX_P HELX_P28 28 LEU D 306 ? GLU D 308 ? LEU B 306 GLU B 308 5 ? 3  
HELX_P HELX_P29 29 SER D 324 ? LYS D 332 ? SER B 324 LYS B 332 1 ? 9  
HELX_P HELX_P30 30 SER D 349 ? VAL D 351 ? SER B 349 VAL B 351 5 ? 3  
HELX_P HELX_P31 31 GLN D 352 ? PHE D 356 ? GLN B 352 PHE B 356 5 ? 5  
HELX_P HELX_P32 32 ASP D 370 ? LEU D 387 ? ASP B 370 LEU B 387 1 ? 18 
HELX_P HELX_P33 33 PHE D 426 ? ASP D 429 ? PHE B 426 ASP B 429 5 ? 4  
HELX_P HELX_P34 34 THR D 447 ? MET D 461 ? THR B 447 MET B 461 1 ? 15 
HELX_P HELX_P35 35 PRO D 478 ? ILE D 482 ? PRO B 478 ILE B 482 5 ? 5  
HELX_P HELX_P36 36 ASN D 484 ? HIS D 500 ? ASN B 484 HIS B 500 1 ? 17 
HELX_P HELX_P37 37 GLN D 509 ? ASN D 517 ? GLN B 509 ASN B 517 1 ? 9  
HELX_P HELX_P38 38 PRO D 519 ? PHE D 537 ? PRO B 519 PHE B 537 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DG 1  N1 ? ? ? 1_555 B DC 34 N3 ? ? C DG 1  D DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DG 1  N2 ? ? ? 1_555 B DC 34 O2 ? ? C DG 1  D DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DG 1  O6 ? ? ? 1_555 B DC 34 N4 ? ? C DG 1  D DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DT 2  N3 ? ? ? 1_555 B DA 33 N1 ? ? C DT 2  D DA 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DT 2  O4 ? ? ? 1_555 B DA 33 N6 ? ? C DT 2  D DA 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DT 3  N3 ? ? ? 1_555 B DA 32 N1 ? ? C DT 3  D DA 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DT 3  O4 ? ? ? 1_555 B DA 32 N6 ? ? C DT 3  D DA 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DT 4  N3 ? ? ? 1_555 B DA 31 N1 ? ? C DT 4  D DA 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DT 4  O4 ? ? ? 1_555 B DA 31 N6 ? ? C DT 4  D DA 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DT 5  N3 ? ? ? 1_555 B DA 30 N1 ? ? C DT 5  D DA 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DT 5  O4 ? ? ? 1_555 B DA 30 N6 ? ? C DT 5  D DA 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DT 5  N3 ? ? ? 1_555 B DA 31 N1 ? ? C DT 5  D DA 31 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? 
hydrog13 hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA 29 N1 ? ? C DT 6  D DA 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA 29 N6 ? ? C DT 6  D DA 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT 28 N3 ? ? C DA 7  D DT 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT 28 O4 ? ? C DA 7  D DT 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DG 8  N1 ? ? ? 1_555 B DC 27 N3 ? ? C DG 8  D DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DG 8  N2 ? ? ? 1_555 B DC 27 O2 ? ? C DG 8  D DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DG 8  O6 ? ? ? 1_555 B DC 27 N4 ? ? C DG 8  D DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DT 9  N3 ? ? ? 1_555 B DA 26 N1 ? ? C DT 9  D DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DT 9  O4 ? ? ? 1_555 B DA 26 N6 ? ? C DT 9  D DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA 25 N1 ? ? C DT 10 D DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA 25 N6 ? ? C DT 10 D DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DT 11 N3 ? ? ? 1_555 B DA 24 N1 ? ? C DT 11 D DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA 24 N6 ? ? C DT 11 D DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DA 12 N1 ? ? ? 1_555 B DT 23 N3 ? ? C DA 12 D DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DA 12 N6 ? ? ? 1_555 B DT 23 O4 ? ? C DA 12 D DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DT 13 N3 ? ? ? 1_555 B DA 22 N1 ? ? C DT 13 D DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? A DT 13 O4 ? ? ? 1_555 B DA 22 N6 ? ? C DT 13 D DA 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? A DT 14 N3 ? ? ? 1_555 B DA 21 N1 ? ? C DT 14 D DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? A DT 14 O4 ? ? ? 1_555 B DA 21 N6 ? ? C DT 14 D DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? A DG 15 N1 ? ? ? 1_555 B DC 7  N3 ? ? C DG 15 D DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? A DG 15 N2 ? ? ? 1_555 B DC 7  O2 ? ? C DG 15 D DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? A DG 15 O6 ? ? ? 1_555 B DC 7  N4 ? ? C DG 15 D DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? A DG 16 N1 ? ? ? 1_555 B DC 6  N3 ? ? C DG 16 D DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? A DG 16 N2 ? ? ? 1_555 B DC 6  O2 ? ? C DG 16 D DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? A DG 16 O6 ? ? ? 1_555 B DC 6  N4 ? ? C DG 16 D DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? A DG 17 N1 ? ? ? 1_555 B DC 5  N3 ? ? C DG 17 D DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? A DG 17 N2 ? ? ? 1_555 B DC 5  O2 ? ? C DG 17 D DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? A DG 17 O6 ? ? ? 1_555 B DC 5  N4 ? ? C DG 17 D DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? A DC 18 N3 ? ? ? 1_555 B DG 4  N1 ? ? C DC 18 D DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? A DC 18 N4 ? ? ? 1_555 B DG 4  O6 ? ? C DC 18 D DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? A DC 18 O2 ? ? ? 1_555 B DG 4  N2 ? ? C DC 18 D DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? B DA 8  N1 ? ? ? 1_555 B DT 20 N3 ? ? D DA 8  D DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? B DA 8  N6 ? ? ? 1_555 B DT 20 O4 ? ? D DA 8  D DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? B DG 9  N1 ? ? ? 1_555 B DC 19 N3 ? ? D DG 9  D DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? B DG 9  N2 ? ? ? 1_555 B DC 19 O2 ? ? D DG 9  D DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? B DG 9  O6 ? ? ? 1_555 B DC 19 N4 ? ? D DG 9  D DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? B DC 10 N3 ? ? ? 1_555 B DG 18 N1 ? ? D DC 10 D DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? B DC 10 N4 ? ? ? 1_555 B DG 18 O6 ? ? D DC 10 D DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? B DC 10 O2 ? ? ? 1_555 B DG 18 N2 ? ? D DC 10 D DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? B DT 11 N3 ? ? ? 1_555 B DA 17 N1 ? ? D DT 11 D DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? B DT 11 O4 ? ? ? 1_555 B DA 17 N6 ? ? D DT 11 D DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 8 ? 
C ? 3 ? 
D ? 3 ? 
E ? 3 ? 
F ? 2 ? 
G ? 2 ? 
H ? 6 ? 
I ? 8 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
I 5 6 ? anti-parallel 
I 6 7 ? anti-parallel 
I 7 8 ? parallel      
J 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE C 102 ? ASP C 109 ? ILE A 102 ASP A 109 
A 2 LEU C 82  ? TYR C 88  ? LEU A 82  TYR A 88  
A 3 ARG C 35  ? ASP C 43  ? ARG A 35  ASP A 43  
A 4 MET C 161 ? THR C 170 ? MET A 161 THR A 170 
A 5 ILE C 198 ? HIS C 204 ? ILE A 198 HIS A 204 
B 1 SER C 257 ? LYS C 262 ? SER A 257 LYS A 262 
B 2 VAL C 268 ? TYR C 274 ? VAL A 268 TYR A 274 
B 3 LEU C 366 ? PRO C 370 ? LEU A 366 PRO A 370 
B 4 GLY C 431 ? PHE C 436 ? GLY A 431 PHE A 436 
B 5 TYR C 409 ? GLN C 416 ? TYR A 409 GLN A 416 
B 6 VAL C 394 ? THR C 401 ? VAL A 394 THR A 401 
B 7 GLY C 344 ? PRO C 352 ? GLY A 344 PRO A 352 
B 8 SER C 257 ? LYS C 262 ? SER A 257 LYS A 262 
C 1 ILE C 286 ? TYR C 289 ? ILE A 286 TYR A 289 
C 2 ILE D 310 ? TYR D 316 ? ILE B 310 TYR B 316 
C 3 ASP D 319 ? PRO D 322 ? ASP B 319 PRO B 322 
D 1 VAL C 296 ? ASN C 304 ? VAL A 296 ASN A 304 
D 2 ILE D 289 ? LEU D 297 ? ILE B 289 LEU B 297 
D 3 GLU D 304 ? VAL D 305 ? GLU B 304 VAL B 305 
E 1 ARG C 325 ? LEU C 329 ? ARG A 325 LEU A 329 
E 2 THR C 316 ? TYR C 322 ? THR A 316 TYR A 322 
E 3 THR D 277 ? ASP D 280 ? THR B 277 ASP B 280 
F 1 VAL C 375 ? ILE C 376 ? VAL A 375 ILE A 376 
F 2 ILE D 540 ? GLU D 541 ? ILE B 540 GLU B 541 
G 1 GLU C 419 ? LEU C 420 ? GLU A 419 LEU A 420 
G 2 GLN C 426 ? THR C 428 ? GLN A 426 THR A 428 
H 1 ILE D 77  ? MET D 84  ? ILE B 77  MET B 84  
H 2 GLU D 53  ? PHE D 59  ? GLU B 53  PHE B 59  
H 3 ALA D 8   ? ASP D 15  ? ALA B 8   ASP B 15  
H 4 LYS D 129 ? PHE D 135 ? LYS B 129 PHE B 135 
H 5 ILE D 159 ? LEU D 165 ? ILE B 159 LEU B 165 
H 6 ILE D 224 ? SER D 226 ? ILE B 224 SER B 226 
I 1 TRP D 247 ? ILE D 253 ? TRP B 247 ILE B 253 
I 2 LEU D 257 ? ILE D 267 ? LEU B 257 ILE B 267 
I 3 MET D 357 ? ALA D 366 ? MET B 357 ALA B 366 
I 4 GLU D 417 ? GLN D 423 ? GLU B 417 GLN B 423 
I 5 GLN D 404 ? ILE D 412 ? GLN B 404 ILE B 412 
I 6 MET D 389 ? ALA D 396 ? MET B 389 ALA B 396 
I 7 CYS D 339 ? LYS D 347 ? CYS B 339 LYS B 347 
I 8 TRP D 247 ? ILE D 253 ? TRP B 247 ILE B 253 
J 1 ALA D 464 ? LYS D 465 ? ALA B 464 LYS B 465 
J 2 GLU D 474 ? ASP D 475 ? GLU B 474 ASP B 475 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ASP C 109 ? O ASP A 109 N LEU C 83  ? N LEU A 83  
A 2 3 N LEU C 82  ? N LEU A 82  O ASP C 36  ? O ASP A 36  
A 3 4 O ARG C 35  ? O ARG A 35  N SER C 162 ? N SER A 162 
A 4 5 N ILE C 166 ? N ILE A 166 O PHE C 199 ? O PHE A 199 
B 1 2 N LEU C 261 ? N LEU A 261 O ILE C 269 ? O ILE A 269 
B 2 3 O TYR C 274 ? O TYR A 274 N PHE C 367 ? N PHE A 367 
B 3 4 N VAL C 368 ? N VAL A 368 O PHE C 432 ? O PHE A 432 
B 4 5 O VAL C 435 ? O VAL A 435 N ALA C 412 ? N ALA A 412 
B 5 6 N LEU C 413 ? N LEU A 413 O ALA C 396 ? O ALA A 396 
B 6 7 O THR C 401 ? O THR A 401 N GLY C 344 ? N GLY A 344 
B 7 8 N LEU C 345 ? N LEU A 345 O LYS C 260 ? O LYS A 260 
C 1 2 N LEU C 288 ? N LEU A 288 O ILE D 311 ? O ILE B 311 
C 2 3 O TYR D 316 ? O TYR B 316 N ASP D 319 ? N ASP B 319 
D 1 2 N PHE C 303 ? N PHE A 303 O GLN D 290 ? O GLN B 290 
D 2 3 O TYR D 295 ? O TYR B 295 N VAL D 305 ? N VAL B 305 
E 1 2 O LEU C 329 ? O LEU A 329 N ARG C 318 ? N ARG A 318 
E 2 3 O SER C 319 ? O SER A 319 N THR D 277 ? N THR B 277 
F 1 2 N ILE C 376 ? N ILE A 376 O ILE D 540 ? O ILE B 540 
G 1 2 O GLU C 419 ? O GLU A 419 N VAL C 427 ? N VAL A 427 
H 1 2 O MET D 84  ? O MET B 84  N ILE D 54  ? N ILE B 54  
H 2 3 N GLU D 53  ? N GLU B 53  O ALA D 8   ? O ALA B 8   
H 3 4 N ALA D 9   ? N ALA B 9   O LYS D 129 ? O LYS B 129 
H 4 5 O ARG D 130 ? O ARG B 130 N SER D 160 ? N SER B 160 
H 5 6 N LEU D 165 ? N LEU B 165 O TYR D 225 ? O TYR B 225 
I 1 2 N ILE D 253 ? N ILE B 253 O LEU D 257 ? O LEU B 257 
I 2 3 N SER D 266 ? N SER B 266 O VAL D 361 ? O VAL B 361 
I 3 4 N VAL D 364 ? N VAL B 364 O LEU D 419 ? O LEU B 419 
I 4 5 O VAL D 422 ? O VAL B 422 N VAL D 407 ? N VAL B 407 
I 5 6 N ALA D 408 ? N ALA B 408 O ALA D 391 ? O ALA B 391 
I 6 7 N ALA D 396 ? N ALA B 396 O CYS D 339 ? O CYS B 339 
I 7 8 N PHE D 340 ? N PHE B 340 O ARG D 250 ? O ARG B 250 
J 1 2 O LYS D 465 ? O LYS B 465 N GLU D 474 ? N GLU B 474 
# 
_database_PDB_matrix.entry_id          1JEY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JEY 
_atom_sites.fract_transf_matrix[1][1]   0.011916 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007917 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007909 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DG  A 1 1   ? 8.611   47.334  29.801  1.00 91.01  ? 1   DG  C "O5'" 1 
ATOM   2    C "C5'" . DG  A 1 1   ? 9.490   46.232  29.542  1.00 91.36  ? 1   DG  C "C5'" 1 
ATOM   3    C "C4'" . DG  A 1 1   ? 9.922   45.560  30.825  1.00 93.27  ? 1   DG  C "C4'" 1 
ATOM   4    O "O4'" . DG  A 1 1   ? 8.744   45.074  31.518  1.00 91.63  ? 1   DG  C "O4'" 1 
ATOM   5    C "C3'" . DG  A 1 1   ? 10.837  44.347  30.634  1.00 93.94  ? 1   DG  C "C3'" 1 
ATOM   6    O "O3'" . DG  A 1 1   ? 11.818  44.284  31.686  1.00 96.79  ? 1   DG  C "O3'" 1 
ATOM   7    C "C2'" . DG  A 1 1   ? 9.878   43.174  30.730  1.00 93.65  ? 1   DG  C "C2'" 1 
ATOM   8    C "C1'" . DG  A 1 1   ? 8.850   43.675  31.734  1.00 91.97  ? 1   DG  C "C1'" 1 
ATOM   9    N N9    . DG  A 1 1   ? 7.522   43.088  31.573  1.00 91.32  ? 1   DG  C N9    1 
ATOM   10   C C8    . DG  A 1 1   ? 6.594   43.372  30.596  1.00 90.79  ? 1   DG  C C8    1 
ATOM   11   N N7    . DG  A 1 1   ? 5.501   42.660  30.704  1.00 90.17  ? 1   DG  C N7    1 
ATOM   12   C C5    . DG  A 1 1   ? 5.716   41.863  31.822  1.00 90.17  ? 1   DG  C C5    1 
ATOM   13   C C6    . DG  A 1 1   ? 4.881   40.883  32.434  1.00 89.79  ? 1   DG  C C6    1 
ATOM   14   O O6    . DG  A 1 1   ? 3.744   40.513  32.096  1.00 89.55  ? 1   DG  C O6    1 
ATOM   15   N N1    . DG  A 1 1   ? 5.493   40.314  33.550  1.00 89.86  ? 1   DG  C N1    1 
ATOM   16   C C2    . DG  A 1 1   ? 6.744   40.643  34.021  1.00 89.89  ? 1   DG  C C2    1 
ATOM   17   N N2    . DG  A 1 1   ? 7.159   39.983  35.116  1.00 89.50  ? 1   DG  C N2    1 
ATOM   18   N N3    . DG  A 1 1   ? 7.531   41.554  33.462  1.00 90.44  ? 1   DG  C N3    1 
ATOM   19   C C4    . DG  A 1 1   ? 6.958   42.118  32.375  1.00 90.73  ? 1   DG  C C4    1 
ATOM   20   P P     . DT  A 1 2   ? 13.273  43.640  31.394  1.00 97.94  ? 2   DT  C P     1 
ATOM   21   O OP1   . DT  A 1 2   ? 14.301  44.577  31.940  1.00 98.48  ? 2   DT  C OP1   1 
ATOM   22   O OP2   . DT  A 1 2   ? 13.334  43.227  29.958  1.00 97.01  ? 2   DT  C OP2   1 
ATOM   23   O "O5'" . DT  A 1 2   ? 13.308  42.329  32.307  1.00 99.31  ? 2   DT  C "O5'" 1 
ATOM   24   C "C5'" . DT  A 1 2   ? 13.314  42.428  33.736  1.00 100.25 ? 2   DT  C "C5'" 1 
ATOM   25   C "C4'" . DT  A 1 2   ? 13.093  41.067  34.359  1.00 99.00  ? 2   DT  C "C4'" 1 
ATOM   26   O "O4'" . DT  A 1 2   ? 11.772  40.593  33.982  1.00 96.60  ? 2   DT  C "O4'" 1 
ATOM   27   C "C3'" . DT  A 1 2   ? 14.083  39.987  33.903  1.00 97.68  ? 2   DT  C "C3'" 1 
ATOM   28   O "O3'" . DT  A 1 2   ? 14.439  39.113  34.992  1.00 97.85  ? 2   DT  C "O3'" 1 
ATOM   29   C "C2'" . DT  A 1 2   ? 13.312  39.234  32.834  1.00 96.69  ? 2   DT  C "C2'" 1 
ATOM   30   C "C1'" . DT  A 1 2   ? 11.877  39.331  33.332  1.00 94.52  ? 2   DT  C "C1'" 1 
ATOM   31   N N1    . DT  A 1 2   ? 10.843  39.268  32.272  1.00 91.76  ? 2   DT  C N1    1 
ATOM   32   C C2    . DT  A 1 2   ? 9.686   38.575  32.554  1.00 89.82  ? 2   DT  C C2    1 
ATOM   33   O O2    . DT  A 1 2   ? 9.485   38.031  33.630  1.00 89.25  ? 2   DT  C O2    1 
ATOM   34   N N3    . DT  A 1 2   ? 8.770   38.541  31.527  1.00 87.97  ? 2   DT  C N3    1 
ATOM   35   C C4    . DT  A 1 2   ? 8.893   39.117  30.274  1.00 87.33  ? 2   DT  C C4    1 
ATOM   36   O O4    . DT  A 1 2   ? 7.980   38.997  29.451  1.00 85.79  ? 2   DT  C O4    1 
ATOM   37   C C5    . DT  A 1 2   ? 10.135  39.833  30.047  1.00 88.07  ? 2   DT  C C5    1 
ATOM   38   C C7    . DT  A 1 2   ? 10.364  40.492  28.723  1.00 87.74  ? 2   DT  C C7    1 
ATOM   39   C C6    . DT  A 1 2   ? 11.033  39.873  31.044  1.00 89.86  ? 2   DT  C C6    1 
ATOM   40   P P     . DT  A 1 3   ? 15.539  37.948  34.765  1.00 96.95  ? 3   DT  C P     1 
ATOM   41   O OP1   . DT  A 1 3   ? 16.545  38.034  35.867  1.00 97.23  ? 3   DT  C OP1   1 
ATOM   42   O OP2   . DT  A 1 3   ? 16.001  37.983  33.345  1.00 98.61  ? 3   DT  C OP2   1 
ATOM   43   O "O5'" . DT  A 1 3   ? 14.708  36.603  34.978  1.00 96.35  ? 3   DT  C "O5'" 1 
ATOM   44   C "C5'" . DT  A 1 3   ? 13.954  36.395  36.176  1.00 93.41  ? 3   DT  C "C5'" 1 
ATOM   45   C "C4'" . DT  A 1 3   ? 13.140  35.129  36.061  1.00 91.79  ? 3   DT  C "C4'" 1 
ATOM   46   O "O4'" . DT  A 1 3   ? 12.131  35.318  35.038  1.00 90.28  ? 3   DT  C "O4'" 1 
ATOM   47   C "C3'" . DT  A 1 3   ? 13.967  33.923  35.624  1.00 89.04  ? 3   DT  C "C3'" 1 
ATOM   48   O "O3'" . DT  A 1 3   ? 13.488  32.727  36.246  1.00 86.44  ? 3   DT  C "O3'" 1 
ATOM   49   C "C2'" . DT  A 1 3   ? 13.756  33.888  34.122  1.00 89.63  ? 3   DT  C "C2'" 1 
ATOM   50   C "C1'" . DT  A 1 3   ? 12.335  34.410  33.966  1.00 89.74  ? 3   DT  C "C1'" 1 
ATOM   51   N N1    . DT  A 1 3   ? 12.045  35.131  32.696  1.00 89.17  ? 3   DT  C N1    1 
ATOM   52   C C2    . DT  A 1 3   ? 10.773  35.010  32.165  1.00 88.62  ? 3   DT  C C2    1 
ATOM   53   O O2    . DT  A 1 3   ? 9.889   34.344  32.688  1.00 86.97  ? 3   DT  C O2    1 
ATOM   54   N N3    . DT  A 1 3   ? 10.572  35.703  30.991  1.00 88.01  ? 3   DT  C N3    1 
ATOM   55   C C4    . DT  A 1 3   ? 11.489  36.488  30.308  1.00 87.72  ? 3   DT  C C4    1 
ATOM   56   O O4    . DT  A 1 3   ? 11.157  37.056  29.259  1.00 86.23  ? 3   DT  C O4    1 
ATOM   57   C C5    . DT  A 1 3   ? 12.801  36.569  30.916  1.00 87.72  ? 3   DT  C C5    1 
ATOM   58   C C7    . DT  A 1 3   ? 13.858  37.392  30.245  1.00 86.88  ? 3   DT  C C7    1 
ATOM   59   C C6    . DT  A 1 3   ? 13.011  35.897  32.064  1.00 88.69  ? 3   DT  C C6    1 
ATOM   60   P P     . DT  A 1 4   ? 14.506  31.505  36.511  1.00 85.12  ? 4   DT  C P     1 
ATOM   61   O OP1   . DT  A 1 4   ? 14.638  31.313  37.983  1.00 84.46  ? 4   DT  C OP1   1 
ATOM   62   O OP2   . DT  A 1 4   ? 15.723  31.758  35.691  1.00 84.30  ? 4   DT  C OP2   1 
ATOM   63   O "O5'" . DT  A 1 4   ? 13.734  30.235  35.918  1.00 83.94  ? 4   DT  C "O5'" 1 
ATOM   64   C "C5'" . DT  A 1 4   ? 12.512  29.801  36.510  1.00 82.37  ? 4   DT  C "C5'" 1 
ATOM   65   C "C4'" . DT  A 1 4   ? 11.572  29.227  35.472  1.00 81.00  ? 4   DT  C "C4'" 1 
ATOM   66   O "O4'" . DT  A 1 4   ? 11.316  30.194  34.420  1.00 80.96  ? 4   DT  C "O4'" 1 
ATOM   67   C "C3'" . DT  A 1 4   ? 12.004  27.936  34.772  1.00 79.04  ? 4   DT  C "C3'" 1 
ATOM   68   O "O3'" . DT  A 1 4   ? 10.874  27.052  34.726  1.00 76.28  ? 4   DT  C "O3'" 1 
ATOM   69   C "C2'" . DT  A 1 4   ? 12.375  28.402  33.370  1.00 79.98  ? 4   DT  C "C2'" 1 
ATOM   70   C "C1'" . DT  A 1 4   ? 11.402  29.550  33.158  1.00 81.66  ? 4   DT  C "C1'" 1 
ATOM   71   N N1    . DT  A 1 4   ? 11.764  30.571  32.136  1.00 82.99  ? 4   DT  C N1    1 
ATOM   72   C C2    . DT  A 1 4   ? 10.850  30.830  31.125  1.00 83.99  ? 4   DT  C C2    1 
ATOM   73   O O2    . DT  A 1 4   ? 9.786   30.242  31.012  1.00 83.06  ? 4   DT  C O2    1 
ATOM   74   N N3    . DT  A 1 4   ? 11.234  31.812  30.238  1.00 84.35  ? 4   DT  C N3    1 
ATOM   75   C C4    . DT  A 1 4   ? 12.412  32.538  30.249  1.00 84.24  ? 4   DT  C C4    1 
ATOM   76   O O4    . DT  A 1 4   ? 12.617  33.393  29.386  1.00 83.30  ? 4   DT  C O4    1 
ATOM   77   C C5    . DT  A 1 4   ? 13.329  32.206  31.318  1.00 84.40  ? 4   DT  C C5    1 
ATOM   78   C C7    . DT  A 1 4   ? 14.632  32.936  31.395  1.00 84.28  ? 4   DT  C C7    1 
ATOM   79   C C6    . DT  A 1 4   ? 12.966  31.252  32.196  1.00 84.15  ? 4   DT  C C6    1 
ATOM   80   P P     . DT  A 1 5   ? 11.090  25.451  34.732  1.00 75.23  ? 5   DT  C P     1 
ATOM   81   O OP1   . DT  A 1 5   ? 10.217  24.866  35.781  1.00 73.43  ? 5   DT  C OP1   1 
ATOM   82   O OP2   . DT  A 1 5   ? 12.542  25.132  34.727  1.00 75.07  ? 5   DT  C OP2   1 
ATOM   83   O "O5'" . DT  A 1 5   ? 10.487  25.021  33.326  1.00 75.56  ? 5   DT  C "O5'" 1 
ATOM   84   C "C5'" . DT  A 1 5   ? 9.156   25.388  32.985  1.00 76.71  ? 5   DT  C "C5'" 1 
ATOM   85   C "C4'" . DT  A 1 5   ? 8.959   25.332  31.490  1.00 77.21  ? 5   DT  C "C4'" 1 
ATOM   86   O "O4'" . DT  A 1 5   ? 9.383   26.558  30.844  1.00 75.68  ? 5   DT  C "O4'" 1 
ATOM   87   C "C3'" . DT  A 1 5   ? 9.689   24.188  30.786  1.00 76.85  ? 5   DT  C "C3'" 1 
ATOM   88   O "O3'" . DT  A 1 5   ? 8.775   23.527  29.913  1.00 78.89  ? 5   DT  C "O3'" 1 
ATOM   89   C "C2'" . DT  A 1 5   ? 10.778  24.897  29.992  1.00 76.29  ? 5   DT  C "C2'" 1 
ATOM   90   C "C1'" . DT  A 1 5   ? 10.132  26.238  29.682  1.00 75.85  ? 5   DT  C "C1'" 1 
ATOM   91   N N1    . DT  A 1 5   ? 11.053  27.369  29.398  1.00 75.73  ? 5   DT  C N1    1 
ATOM   92   C C2    . DT  A 1 5   ? 10.636  28.340  28.502  1.00 75.03  ? 5   DT  C C2    1 
ATOM   93   O O2    . DT  A 1 5   ? 9.561   28.305  27.934  1.00 72.47  ? 5   DT  C O2    1 
ATOM   94   N N3    . DT  A 1 5   ? 11.532  29.361  28.295  1.00 74.52  ? 5   DT  C N3    1 
ATOM   95   C C4    . DT  A 1 5   ? 12.776  29.514  28.878  1.00 74.87  ? 5   DT  C C4    1 
ATOM   96   O O4    . DT  A 1 5   ? 13.467  30.496  28.595  1.00 71.91  ? 5   DT  C O4    1 
ATOM   97   C C5    . DT  A 1 5   ? 13.157  28.459  29.806  1.00 75.27  ? 5   DT  C C5    1 
ATOM   98   C C7    . DT  A 1 5   ? 14.488  28.535  30.487  1.00 73.54  ? 5   DT  C C7    1 
ATOM   99   C C6    . DT  A 1 5   ? 12.287  27.454  30.014  1.00 76.40  ? 5   DT  C C6    1 
ATOM   100  P P     . DT  A 1 6   ? 9.022   21.991  29.504  1.00 80.18  ? 6   DT  C P     1 
ATOM   101  O OP1   . DT  A 1 6   ? 7.996   21.129  30.160  1.00 80.78  ? 6   DT  C OP1   1 
ATOM   102  O OP2   . DT  A 1 6   ? 10.470  21.687  29.691  1.00 81.46  ? 6   DT  C OP2   1 
ATOM   103  O "O5'" . DT  A 1 6   ? 8.707   22.012  27.948  1.00 80.00  ? 6   DT  C "O5'" 1 
ATOM   104  C "C5'" . DT  A 1 6   ? 7.627   22.795  27.447  1.00 79.27  ? 6   DT  C "C5'" 1 
ATOM   105  C "C4'" . DT  A 1 6   ? 7.962   23.310  26.070  1.00 79.88  ? 6   DT  C "C4'" 1 
ATOM   106  O "O4'" . DT  A 1 6   ? 8.808   24.486  26.143  1.00 79.14  ? 6   DT  C "O4'" 1 
ATOM   107  C "C3'" . DT  A 1 6   ? 8.715   22.289  25.219  1.00 79.12  ? 6   DT  C "C3'" 1 
ATOM   108  O "O3'" . DT  A 1 6   ? 8.188   22.279  23.895  1.00 78.28  ? 6   DT  C "O3'" 1 
ATOM   109  C "C2'" . DT  A 1 6   ? 10.144  22.811  25.221  1.00 79.76  ? 6   DT  C "C2'" 1 
ATOM   110  C "C1'" . DT  A 1 6   ? 9.929   24.313  25.286  1.00 78.93  ? 6   DT  C "C1'" 1 
ATOM   111  N N1    . DT  A 1 6   ? 11.060  25.103  25.832  1.00 77.69  ? 6   DT  C N1    1 
ATOM   112  C C2    . DT  A 1 6   ? 11.196  26.420  25.422  1.00 76.59  ? 6   DT  C C2    1 
ATOM   113  O O2    . DT  A 1 6   ? 10.438  26.960  24.632  1.00 75.57  ? 6   DT  C O2    1 
ATOM   114  N N3    . DT  A 1 6   ? 12.263  27.086  25.975  1.00 75.97  ? 6   DT  C N3    1 
ATOM   115  C C4    . DT  A 1 6   ? 13.189  26.585  26.872  1.00 76.08  ? 6   DT  C C4    1 
ATOM   116  O O4    . DT  A 1 6   ? 14.100  27.311  27.281  1.00 76.13  ? 6   DT  C O4    1 
ATOM   117  C C5    . DT  A 1 6   ? 12.989  25.200  27.257  1.00 76.40  ? 6   DT  C C5    1 
ATOM   118  C C7    . DT  A 1 6   ? 13.939  24.572  28.227  1.00 75.65  ? 6   DT  C C7    1 
ATOM   119  C C6    . DT  A 1 6   ? 11.950  24.539  26.724  1.00 77.18  ? 6   DT  C C6    1 
ATOM   120  P P     . DA  A 1 7   ? 7.764   20.885  23.216  1.00 76.98  ? 7   DA  C P     1 
ATOM   121  O OP1   . DA  A 1 7   ? 6.416   20.521  23.731  1.00 78.29  ? 7   DA  C OP1   1 
ATOM   122  O OP2   . DA  A 1 7   ? 8.891   19.926  23.364  1.00 76.12  ? 7   DA  C OP2   1 
ATOM   123  O "O5'" . DA  A 1 7   ? 7.629   21.275  21.679  1.00 76.08  ? 7   DA  C "O5'" 1 
ATOM   124  C "C5'" . DA  A 1 7   ? 6.859   22.409  21.291  1.00 74.27  ? 7   DA  C "C5'" 1 
ATOM   125  C "C4'" . DA  A 1 7   ? 7.615   23.229  20.273  1.00 74.16  ? 7   DA  C "C4'" 1 
ATOM   126  O "O4'" . DA  A 1 7   ? 8.729   23.911  20.901  1.00 73.30  ? 7   DA  C "O4'" 1 
ATOM   127  C "C3'" . DA  A 1 7   ? 8.205   22.416  19.122  1.00 73.49  ? 7   DA  C "C3'" 1 
ATOM   128  O "O3'" . DA  A 1 7   ? 8.005   23.107  17.887  1.00 73.03  ? 7   DA  C "O3'" 1 
ATOM   129  C "C2'" . DA  A 1 7   ? 9.681   22.315  19.474  1.00 73.46  ? 7   DA  C "C2'" 1 
ATOM   130  C "C1'" . DA  A 1 7   ? 9.935   23.622  20.203  1.00 73.32  ? 7   DA  C "C1'" 1 
ATOM   131  N N9    . DA  A 1 7   ? 11.023  23.590  21.186  1.00 74.21  ? 7   DA  C N9    1 
ATOM   132  C C8    . DA  A 1 7   ? 11.254  22.658  22.172  1.00 74.06  ? 7   DA  C C8    1 
ATOM   133  N N7    . DA  A 1 7   ? 12.295  22.929  22.927  1.00 73.31  ? 7   DA  C N7    1 
ATOM   134  C C5    . DA  A 1 7   ? 12.790  24.114  22.399  1.00 73.63  ? 7   DA  C C5    1 
ATOM   135  C C6    . DA  A 1 7   ? 13.887  24.926  22.752  1.00 73.37  ? 7   DA  C C6    1 
ATOM   136  N N6    . DA  A 1 7   ? 14.715  24.660  23.766  1.00 73.04  ? 7   DA  C N6    1 
ATOM   137  N N1    . DA  A 1 7   ? 14.110  26.038  22.015  1.00 73.85  ? 7   DA  C N1    1 
ATOM   138  C C2    . DA  A 1 7   ? 13.281  26.306  20.993  1.00 74.00  ? 7   DA  C C2    1 
ATOM   139  N N3    . DA  A 1 7   ? 12.218  25.624  20.565  1.00 74.22  ? 7   DA  C N3    1 
ATOM   140  C C4    . DA  A 1 7   ? 12.023  24.528  21.319  1.00 74.12  ? 7   DA  C C4    1 
ATOM   141  P P     . DG  A 1 8   ? 8.523   22.452  16.515  1.00 73.54  ? 8   DG  C P     1 
ATOM   142  O OP1   . DG  A 1 8   ? 7.555   22.771  15.432  1.00 71.92  ? 8   DG  C OP1   1 
ATOM   143  O OP2   . DG  A 1 8   ? 8.890   21.033  16.778  1.00 74.39  ? 8   DG  C OP2   1 
ATOM   144  O "O5'" . DG  A 1 8   ? 9.865   23.254  16.233  1.00 74.35  ? 8   DG  C "O5'" 1 
ATOM   145  C "C5'" . DG  A 1 8   ? 9.833   24.665  16.048  1.00 76.60  ? 8   DG  C "C5'" 1 
ATOM   146  C "C4'" . DG  A 1 8   ? 11.213  25.163  15.701  1.00 78.34  ? 8   DG  C "C4'" 1 
ATOM   147  O "O4'" . DG  A 1 8   ? 12.053  25.135  16.882  1.00 77.75  ? 8   DG  C "O4'" 1 
ATOM   148  C "C3'" . DG  A 1 8   ? 11.912  24.293  14.658  1.00 78.57  ? 8   DG  C "C3'" 1 
ATOM   149  O "O3'" . DG  A 1 8   ? 12.642  25.120  13.751  1.00 81.11  ? 8   DG  C "O3'" 1 
ATOM   150  C "C2'" . DG  A 1 8   ? 12.833  23.417  15.491  1.00 78.45  ? 8   DG  C "C2'" 1 
ATOM   151  C "C1'" . DG  A 1 8   ? 13.198  24.333  16.647  1.00 77.40  ? 8   DG  C "C1'" 1 
ATOM   152  N N9    . DG  A 1 8   ? 13.541  23.662  17.899  1.00 75.79  ? 8   DG  C N9    1 
ATOM   153  C C8    . DG  A 1 8   ? 12.855  22.645  18.523  1.00 75.77  ? 8   DG  C C8    1 
ATOM   154  N N7    . DG  A 1 8   ? 13.422  22.250  19.634  1.00 73.83  ? 8   DG  C N7    1 
ATOM   155  C C5    . DG  A 1 8   ? 14.547  23.056  19.750  1.00 74.01  ? 8   DG  C C5    1 
ATOM   156  C C6    . DG  A 1 8   ? 15.557  23.095  20.752  1.00 72.67  ? 8   DG  C C6    1 
ATOM   157  O O6    . DG  A 1 8   ? 15.663  22.401  21.776  1.00 72.93  ? 8   DG  C O6    1 
ATOM   158  N N1    . DG  A 1 8   ? 16.513  24.070  20.474  1.00 72.44  ? 8   DG  C N1    1 
ATOM   159  C C2    . DG  A 1 8   ? 16.500  24.898  19.378  1.00 72.86  ? 8   DG  C C2    1 
ATOM   160  N N2    . DG  A 1 8   ? 17.507  25.778  19.280  1.00 73.08  ? 8   DG  C N2    1 
ATOM   161  N N3    . DG  A 1 8   ? 15.569  24.869  18.441  1.00 74.18  ? 8   DG  C N3    1 
ATOM   162  C C4    . DG  A 1 8   ? 14.632  23.933  18.688  1.00 74.65  ? 8   DG  C C4    1 
ATOM   163  P P     . DT  A 1 9   ? 12.844  24.645  12.226  1.00 82.94  ? 9   DT  C P     1 
ATOM   164  O OP1   . DT  A 1 9   ? 12.544  25.798  11.326  1.00 82.47  ? 9   DT  C OP1   1 
ATOM   165  O OP2   . DT  A 1 9   ? 12.107  23.360  12.051  1.00 84.76  ? 9   DT  C OP2   1 
ATOM   166  O "O5'" . DT  A 1 9   ? 14.398  24.316  12.175  1.00 83.21  ? 9   DT  C "O5'" 1 
ATOM   167  C "C5'" . DT  A 1 9   ? 15.078  23.990  13.380  1.00 82.99  ? 9   DT  C "C5'" 1 
ATOM   168  C "C4'" . DT  A 1 9   ? 16.260  24.905  13.574  1.00 82.50  ? 9   DT  C "C4'" 1 
ATOM   169  O "O4'" . DT  A 1 9   ? 16.620  24.914  14.970  1.00 81.29  ? 9   DT  C "O4'" 1 
ATOM   170  C "C3'" . DT  A 1 9   ? 17.502  24.450  12.821  1.00 81.58  ? 9   DT  C "C3'" 1 
ATOM   171  O "O3'" . DT  A 1 9   ? 18.263  25.584  12.406  1.00 81.92  ? 9   DT  C "O3'" 1 
ATOM   172  C "C2'" . DT  A 1 9   ? 18.234  23.597  13.845  1.00 81.13  ? 9   DT  C "C2'" 1 
ATOM   173  C "C1'" . DT  A 1 9   ? 17.842  24.219  15.183  1.00 80.14  ? 9   DT  C "C1'" 1 
ATOM   174  N N1    . DT  A 1 9   ? 17.592  23.234  16.252  1.00 78.66  ? 9   DT  C N1    1 
ATOM   175  C C2    . DT  A 1 9   ? 18.444  23.182  17.336  1.00 77.77  ? 9   DT  C C2    1 
ATOM   176  O O2    . DT  A 1 9   ? 19.416  23.906  17.460  1.00 78.03  ? 9   DT  C O2    1 
ATOM   177  N N3    . DT  A 1 9   ? 18.110  22.241  18.278  1.00 77.15  ? 9   DT  C N3    1 
ATOM   178  C C4    . DT  A 1 9   ? 17.041  21.365  18.245  1.00 77.23  ? 9   DT  C C4    1 
ATOM   179  O O4    . DT  A 1 9   ? 16.864  20.572  19.171  1.00 76.95  ? 9   DT  C O4    1 
ATOM   180  C C5    . DT  A 1 9   ? 16.195  21.471  17.076  1.00 77.66  ? 9   DT  C C5    1 
ATOM   181  C C7    . DT  A 1 9   ? 15.017  20.556  16.946  1.00 78.57  ? 9   DT  C C7    1 
ATOM   182  C C6    . DT  A 1 9   ? 16.508  22.390  16.153  1.00 78.09  ? 9   DT  C C6    1 
ATOM   183  P P     . DT  A 1 10  ? 19.708  25.364  11.743  1.00 82.49  ? 10  DT  C P     1 
ATOM   184  O OP1   . DT  A 1 10  ? 20.265  26.685  11.346  1.00 83.08  ? 10  DT  C OP1   1 
ATOM   185  O OP2   . DT  A 1 10  ? 19.593  24.280  10.729  1.00 82.41  ? 10  DT  C OP2   1 
ATOM   186  O "O5'" . DT  A 1 10  ? 20.582  24.823  12.957  1.00 83.98  ? 10  DT  C "O5'" 1 
ATOM   187  C "C5'" . DT  A 1 10  ? 21.246  25.730  13.829  1.00 86.42  ? 10  DT  C "C5'" 1 
ATOM   188  C "C4'" . DT  A 1 10  ? 22.533  25.112  14.318  1.00 87.72  ? 10  DT  C "C4'" 1 
ATOM   189  O "O4'" . DT  A 1 10  ? 22.251  24.150  15.364  1.00 87.17  ? 10  DT  C "O4'" 1 
ATOM   190  C "C3'" . DT  A 1 10  ? 23.279  24.345  13.226  1.00 87.68  ? 10  DT  C "C3'" 1 
ATOM   191  O "O3'" . DT  A 1 10  ? 24.686  24.557  13.352  1.00 89.11  ? 10  DT  C "O3'" 1 
ATOM   192  C "C2'" . DT  A 1 10  ? 22.931  22.896  13.515  1.00 87.48  ? 10  DT  C "C2'" 1 
ATOM   193  C "C1'" . DT  A 1 10  ? 22.827  22.898  15.030  1.00 86.37  ? 10  DT  C "C1'" 1 
ATOM   194  N N1    . DT  A 1 10  ? 21.987  21.834  15.628  1.00 85.13  ? 10  DT  C N1    1 
ATOM   195  C C2    . DT  A 1 10  ? 22.491  21.149  16.719  1.00 84.70  ? 10  DT  C C2    1 
ATOM   196  O O2    . DT  A 1 10  ? 23.591  21.374  17.199  1.00 84.29  ? 10  DT  C O2    1 
ATOM   197  N N3    . DT  A 1 10  ? 21.651  20.183  17.231  1.00 84.22  ? 10  DT  C N3    1 
ATOM   198  C C4    . DT  A 1 10  ? 20.392  19.845  16.768  1.00 84.03  ? 10  DT  C C4    1 
ATOM   199  O O4    . DT  A 1 10  ? 19.747  18.958  17.327  1.00 82.88  ? 10  DT  C O4    1 
ATOM   200  C C5    . DT  A 1 10  ? 19.933  20.598  15.621  1.00 84.03  ? 10  DT  C C5    1 
ATOM   201  C C7    . DT  A 1 10  ? 18.586  20.289  15.049  1.00 84.25  ? 10  DT  C C7    1 
ATOM   202  C C6    . DT  A 1 10  ? 20.741  21.542  15.116  1.00 84.48  ? 10  DT  C C6    1 
ATOM   203  P P     . DT  A 1 11  ? 25.623  24.473  12.048  1.00 90.05  ? 11  DT  C P     1 
ATOM   204  O OP1   . DT  A 1 11  ? 26.054  25.849  11.677  1.00 90.28  ? 11  DT  C OP1   1 
ATOM   205  O OP2   . DT  A 1 11  ? 24.930  23.618  11.042  1.00 90.58  ? 11  DT  C OP2   1 
ATOM   206  O "O5'" . DT  A 1 11  ? 26.895  23.681  12.575  1.00 91.14  ? 11  DT  C "O5'" 1 
ATOM   207  C "C5'" . DT  A 1 11  ? 27.326  23.830  13.925  1.00 92.61  ? 11  DT  C "C5'" 1 
ATOM   208  C "C4'" . DT  A 1 11  ? 27.661  22.480  14.511  1.00 93.47  ? 11  DT  C "C4'" 1 
ATOM   209  O "O4'" . DT  A 1 11  ? 26.492  21.806  15.059  1.00 92.36  ? 11  DT  C "O4'" 1 
ATOM   210  C "C3'" . DT  A 1 11  ? 28.277  21.514  13.493  1.00 92.65  ? 11  DT  C "C3'" 1 
ATOM   211  O "O3'" . DT  A 1 11  ? 29.365  20.821  14.098  1.00 92.44  ? 11  DT  C "O3'" 1 
ATOM   212  C "C2'" . DT  A 1 11  ? 27.155  20.521  13.248  1.00 92.69  ? 11  DT  C "C2'" 1 
ATOM   213  C "C1'" . DT  A 1 11  ? 26.555  20.452  14.638  1.00 91.97  ? 11  DT  C "C1'" 1 
ATOM   214  N N1    . DT  A 1 11  ? 25.211  19.830  14.736  1.00 90.88  ? 11  DT  C N1    1 
ATOM   215  C C2    . DT  A 1 11  ? 24.935  19.038  15.844  1.00 89.96  ? 11  DT  C C2    1 
ATOM   216  O O2    . DT  A 1 11  ? 25.722  18.872  16.766  1.00 89.62  ? 11  DT  C O2    1 
ATOM   217  N N3    . DT  A 1 11  ? 23.695  18.441  15.829  1.00 89.10  ? 11  DT  C N3    1 
ATOM   218  C C4    . DT  A 1 11  ? 22.728  18.557  14.847  1.00 89.14  ? 11  DT  C C4    1 
ATOM   219  O O4    . DT  A 1 11  ? 21.669  17.953  14.963  1.00 88.58  ? 11  DT  C O4    1 
ATOM   220  C C5    . DT  A 1 11  ? 23.074  19.417  13.729  1.00 89.49  ? 11  DT  C C5    1 
ATOM   221  C C7    . DT  A 1 11  ? 22.082  19.607  12.623  1.00 89.37  ? 11  DT  C C7    1 
ATOM   222  C C6    . DT  A 1 11  ? 24.278  20.006  13.735  1.00 90.53  ? 11  DT  C C6    1 
ATOM   223  P P     . DA  A 1 12  ? 30.694  20.516  13.249  1.00 92.25  ? 12  DA  C P     1 
ATOM   224  O OP1   . DA  A 1 12  ? 31.331  21.821  12.897  1.00 92.20  ? 12  DA  C OP1   1 
ATOM   225  O OP2   . DA  A 1 12  ? 30.355  19.546  12.172  1.00 92.06  ? 12  DA  C OP2   1 
ATOM   226  O "O5'" . DA  A 1 12  ? 31.616  19.774  14.316  1.00 92.44  ? 12  DA  C "O5'" 1 
ATOM   227  C "C5'" . DA  A 1 12  ? 31.679  20.248  15.664  1.00 92.43  ? 12  DA  C "C5'" 1 
ATOM   228  C "C4'" . DA  A 1 12  ? 31.349  19.131  16.628  1.00 91.55  ? 12  DA  C "C4'" 1 
ATOM   229  O "O4'" . DA  A 1 12  ? 29.943  18.774  16.546  1.00 89.90  ? 12  DA  C "O4'" 1 
ATOM   230  C "C3'" . DA  A 1 12  ? 32.128  17.843  16.367  1.00 90.06  ? 12  DA  C "C3'" 1 
ATOM   231  O "O3'" . DA  A 1 12  ? 32.469  17.240  17.606  1.00 90.00  ? 12  DA  C "O3'" 1 
ATOM   232  C "C2'" . DA  A 1 12  ? 31.125  16.970  15.641  1.00 89.64  ? 12  DA  C "C2'" 1 
ATOM   233  C "C1'" . DA  A 1 12  ? 29.813  17.381  16.284  1.00 88.53  ? 12  DA  C "C1'" 1 
ATOM   234  N N9    . DA  A 1 12  ? 28.645  17.189  15.422  1.00 86.48  ? 12  DA  C N9    1 
ATOM   235  C C8    . DA  A 1 12  ? 28.404  17.761  14.196  1.00 86.12  ? 12  DA  C C8    1 
ATOM   236  N N7    . DA  A 1 12  ? 27.267  17.392  13.653  1.00 84.61  ? 12  DA  C N7    1 
ATOM   237  C C5    . DA  A 1 12  ? 26.724  16.517  14.582  1.00 84.52  ? 12  DA  C C5    1 
ATOM   238  C C6    . DA  A 1 12  ? 25.528  15.777  14.598  1.00 83.82  ? 12  DA  C C6    1 
ATOM   239  N N6    . DA  A 1 12  ? 24.628  15.807  13.615  1.00 82.83  ? 12  DA  C N6    1 
ATOM   240  N N1    . DA  A 1 12  ? 25.285  14.995  15.673  1.00 83.77  ? 12  DA  C N1    1 
ATOM   241  C C2    . DA  A 1 12  ? 26.190  14.969  16.661  1.00 84.37  ? 12  DA  C C2    1 
ATOM   242  N N3    . DA  A 1 12  ? 27.350  15.620  16.762  1.00 84.85  ? 12  DA  C N3    1 
ATOM   243  C C4    . DA  A 1 12  ? 27.561  16.384  15.678  1.00 85.35  ? 12  DA  C C4    1 
ATOM   244  P P     . DT  A 1 13  ? 33.896  16.525  17.779  1.00 90.22  ? 13  DT  C P     1 
ATOM   245  O OP1   . DT  A 1 13  ? 34.956  17.575  17.714  1.00 91.43  ? 13  DT  C OP1   1 
ATOM   246  O OP2   . DT  A 1 13  ? 33.951  15.358  16.850  1.00 88.89  ? 13  DT  C OP2   1 
ATOM   247  O "O5'" . DT  A 1 13  ? 33.825  15.971  19.270  1.00 89.62  ? 13  DT  C "O5'" 1 
ATOM   248  C "C5'" . DT  A 1 13  ? 32.635  16.132  20.046  1.00 88.44  ? 13  DT  C "C5'" 1 
ATOM   249  C "C4'" . DT  A 1 13  ? 31.936  14.801  20.209  1.00 86.07  ? 13  DT  C "C4'" 1 
ATOM   250  O "O4'" . DT  A 1 13  ? 30.835  14.634  19.274  1.00 83.83  ? 13  DT  C "O4'" 1 
ATOM   251  C "C3'" . DT  A 1 13  ? 32.854  13.592  20.020  1.00 83.78  ? 13  DT  C "C3'" 1 
ATOM   252  O "O3'" . DT  A 1 13  ? 32.722  12.701  21.121  1.00 82.83  ? 13  DT  C "O3'" 1 
ATOM   253  C "C2'" . DT  A 1 13  ? 32.359  12.950  18.730  1.00 82.96  ? 13  DT  C "C2'" 1 
ATOM   254  C "C1'" . DT  A 1 13  ? 30.886  13.325  18.717  1.00 81.82  ? 13  DT  C "C1'" 1 
ATOM   255  N N1    . DT  A 1 13  ? 30.234  13.357  17.377  1.00 80.15  ? 13  DT  C N1    1 
ATOM   256  C C2    . DT  A 1 13  ? 28.942  12.863  17.261  1.00 78.95  ? 13  DT  C C2    1 
ATOM   257  O O2    . DT  A 1 13  ? 28.318  12.393  18.198  1.00 79.74  ? 13  DT  C O2    1 
ATOM   258  N N3    . DT  A 1 13  ? 28.406  12.939  15.997  1.00 78.10  ? 13  DT  C N3    1 
ATOM   259  C C4    . DT  A 1 13  ? 29.015  13.443  14.863  1.00 77.90  ? 13  DT  C C4    1 
ATOM   260  O O4    . DT  A 1 13  ? 28.409  13.453  13.795  1.00 77.46  ? 13  DT  C O4    1 
ATOM   261  C C5    . DT  A 1 13  ? 30.365  13.932  15.051  1.00 78.35  ? 13  DT  C C5    1 
ATOM   262  C C7    . DT  A 1 13  ? 31.103  14.482  13.872  1.00 78.79  ? 13  DT  C C7    1 
ATOM   263  C C6    . DT  A 1 13  ? 30.899  13.867  16.281  1.00 79.16  ? 13  DT  C C6    1 
ATOM   264  P P     . DT  A 1 14  ? 33.576  11.345  21.145  1.00 81.99  ? 14  DT  C P     1 
ATOM   265  O OP1   . DT  A 1 14  ? 34.068  11.120  22.532  1.00 82.64  ? 14  DT  C OP1   1 
ATOM   266  O OP2   . DT  A 1 14  ? 34.550  11.386  20.016  1.00 82.53  ? 14  DT  C OP2   1 
ATOM   267  O "O5'" . DT  A 1 14  ? 32.471  10.252  20.805  1.00 80.58  ? 14  DT  C "O5'" 1 
ATOM   268  C "C5'" . DT  A 1 14  ? 31.175  10.339  21.389  1.00 77.82  ? 14  DT  C "C5'" 1 
ATOM   269  C "C4'" . DT  A 1 14  ? 30.310  9.213   20.883  1.00 77.07  ? 14  DT  C "C4'" 1 
ATOM   270  O "O4'" . DT  A 1 14  ? 29.717  9.554   19.603  1.00 76.29  ? 14  DT  C "O4'" 1 
ATOM   271  C "C3'" . DT  A 1 14  ? 31.109  7.931   20.669  1.00 75.40  ? 14  DT  C "C3'" 1 
ATOM   272  O "O3'" . DT  A 1 14  ? 30.438  6.809   21.229  1.00 72.37  ? 14  DT  C "O3'" 1 
ATOM   273  C "C2'" . DT  A 1 14  ? 31.234  7.818   19.157  1.00 75.99  ? 14  DT  C "C2'" 1 
ATOM   274  C "C1'" . DT  A 1 14  ? 29.997  8.540   18.646  1.00 75.98  ? 14  DT  C "C1'" 1 
ATOM   275  N N1    . DT  A 1 14  ? 30.176  9.196   17.326  1.00 75.75  ? 14  DT  C N1    1 
ATOM   276  C C2    . DT  A 1 14  ? 29.141  9.133   16.409  1.00 74.81  ? 14  DT  C C2    1 
ATOM   277  O O2    . DT  A 1 14  ? 28.084  8.558   16.630  1.00 74.64  ? 14  DT  C O2    1 
ATOM   278  N N3    . DT  A 1 14  ? 29.391  9.775   15.216  1.00 73.88  ? 14  DT  C N3    1 
ATOM   279  C C4    . DT  A 1 14  ? 30.544  10.453  14.859  1.00 73.88  ? 14  DT  C C4    1 
ATOM   280  O O4    . DT  A 1 14  ? 30.626  10.983  13.756  1.00 74.20  ? 14  DT  C O4    1 
ATOM   281  C C5    . DT  A 1 14  ? 31.587  10.474  15.864  1.00 74.31  ? 14  DT  C C5    1 
ATOM   282  C C7    . DT  A 1 14  ? 32.872  11.179  15.562  1.00 74.00  ? 14  DT  C C7    1 
ATOM   283  C C6    . DT  A 1 14  ? 31.353  9.855   17.029  1.00 75.37  ? 14  DT  C C6    1 
ATOM   284  P P     . DG  A 1 15  ? 31.296  5.539   21.701  1.00 70.77  ? 15  DG  C P     1 
ATOM   285  O OP1   . DG  A 1 15  ? 30.802  5.083   23.030  1.00 69.98  ? 15  DG  C OP1   1 
ATOM   286  O OP2   . DG  A 1 15  ? 32.731  5.886   21.530  1.00 69.72  ? 15  DG  C OP2   1 
ATOM   287  O "O5'" . DG  A 1 15  ? 30.918  4.444   20.612  1.00 70.89  ? 15  DG  C "O5'" 1 
ATOM   288  C "C5'" . DG  A 1 15  ? 29.557  4.223   20.257  1.00 71.49  ? 15  DG  C "C5'" 1 
ATOM   289  C "C4'" . DG  A 1 15  ? 29.425  2.903   19.540  1.00 71.87  ? 15  DG  C "C4'" 1 
ATOM   290  O "O4'" . DG  A 1 15  ? 29.820  3.040   18.154  1.00 71.52  ? 15  DG  C "O4'" 1 
ATOM   291  C "C3'" . DG  A 1 15  ? 30.320  1.823   20.137  1.00 71.71  ? 15  DG  C "C3'" 1 
ATOM   292  O "O3'" . DG  A 1 15  ? 29.630  0.574   20.159  1.00 72.66  ? 15  DG  C "O3'" 1 
ATOM   293  C "C2'" . DG  A 1 15  ? 31.523  1.804   19.208  1.00 71.45  ? 15  DG  C "C2'" 1 
ATOM   294  C "C1'" . DG  A 1 15  ? 30.919  2.189   17.865  1.00 72.17  ? 15  DG  C "C1'" 1 
ATOM   295  N N9    . DG  A 1 15  ? 31.812  2.921   16.970  1.00 73.93  ? 15  DG  C N9    1 
ATOM   296  C C8    . DG  A 1 15  ? 32.244  4.218   17.113  1.00 74.15  ? 15  DG  C C8    1 
ATOM   297  N N7    . DG  A 1 15  ? 33.014  4.614   16.135  1.00 73.79  ? 15  DG  C N7    1 
ATOM   298  C C5    . DG  A 1 15  ? 33.102  3.509   15.297  1.00 74.54  ? 15  DG  C C5    1 
ATOM   299  C C6    . DG  A 1 15  ? 33.802  3.336   14.075  1.00 74.80  ? 15  DG  C C6    1 
ATOM   300  O O6    . DG  A 1 15  ? 34.504  4.147   13.471  1.00 75.31  ? 15  DG  C O6    1 
ATOM   301  N N1    . DG  A 1 15  ? 33.624  2.058   13.557  1.00 75.29  ? 15  DG  C N1    1 
ATOM   302  C C2    . DG  A 1 15  ? 32.871  1.067   14.136  1.00 75.45  ? 15  DG  C C2    1 
ATOM   303  N N2    . DG  A 1 15  ? 32.824  -0.109  13.471  1.00 75.28  ? 15  DG  C N2    1 
ATOM   304  N N3    . DG  A 1 15  ? 32.214  1.213   15.280  1.00 75.61  ? 15  DG  C N3    1 
ATOM   305  C C4    . DG  A 1 15  ? 32.373  2.452   15.800  1.00 74.64  ? 15  DG  C C4    1 
ATOM   306  P P     . DG  A 1 16  ? 30.195  -0.623  21.066  1.00 74.18  ? 16  DG  C P     1 
ATOM   307  O OP1   . DG  A 1 16  ? 29.090  -1.573  21.364  1.00 72.71  ? 16  DG  C OP1   1 
ATOM   308  O OP2   . DG  A 1 16  ? 30.971  -0.020  22.183  1.00 73.91  ? 16  DG  C OP2   1 
ATOM   309  O "O5'" . DG  A 1 16  ? 31.237  -1.333  20.097  1.00 77.37  ? 16  DG  C "O5'" 1 
ATOM   310  C "C5'" . DG  A 1 16  ? 30.802  -2.004  18.914  1.00 82.31  ? 16  DG  C "C5'" 1 
ATOM   311  C "C4'" . DG  A 1 16  ? 31.978  -2.684  18.255  1.00 84.65  ? 16  DG  C "C4'" 1 
ATOM   312  O "O4'" . DG  A 1 16  ? 32.691  -1.761  17.390  1.00 83.24  ? 16  DG  C "O4'" 1 
ATOM   313  C "C3'" . DG  A 1 16  ? 32.998  -3.196  19.277  1.00 85.78  ? 16  DG  C "C3'" 1 
ATOM   314  O "O3'" . DG  A 1 16  ? 33.482  -4.488  18.905  1.00 89.01  ? 16  DG  C "O3'" 1 
ATOM   315  C "C2'" . DG  A 1 16  ? 34.110  -2.162  19.213  1.00 85.11  ? 16  DG  C "C2'" 1 
ATOM   316  C "C1'" . DG  A 1 16  ? 34.067  -1.741  17.751  1.00 83.39  ? 16  DG  C "C1'" 1 
ATOM   317  N N9    . DG  A 1 16  ? 34.602  -0.405  17.482  1.00 82.81  ? 16  DG  C N9    1 
ATOM   318  C C8    . DG  A 1 16  ? 34.632  0.664   18.347  1.00 82.57  ? 16  DG  C C8    1 
ATOM   319  N N7    . DG  A 1 16  ? 35.198  1.725   17.835  1.00 82.37  ? 16  DG  C N7    1 
ATOM   320  C C5    . DG  A 1 16  ? 35.563  1.338   16.548  1.00 81.96  ? 16  DG  C C5    1 
ATOM   321  C C6    . DG  A 1 16  ? 36.220  2.070   15.509  1.00 81.40  ? 16  DG  C C6    1 
ATOM   322  O O6    . DG  A 1 16  ? 36.625  3.244   15.523  1.00 79.89  ? 16  DG  C O6    1 
ATOM   323  N N1    . DG  A 1 16  ? 36.388  1.295   14.364  1.00 80.87  ? 16  DG  C N1    1 
ATOM   324  C C2    . DG  A 1 16  ? 35.987  -0.011  14.225  1.00 81.01  ? 16  DG  C C2    1 
ATOM   325  N N2    . DG  A 1 16  ? 36.243  -0.585  13.033  1.00 79.04  ? 16  DG  C N2    1 
ATOM   326  N N3    . DG  A 1 16  ? 35.379  -0.705  15.182  1.00 82.00  ? 16  DG  C N3    1 
ATOM   327  C C4    . DG  A 1 16  ? 35.199  0.028   16.309  1.00 82.27  ? 16  DG  C C4    1 
ATOM   328  P P     . DG  A 1 17  ? 34.131  -5.451  20.022  1.00 90.54  ? 17  DG  C P     1 
ATOM   329  O OP1   . DG  A 1 17  ? 33.041  -6.213  20.694  1.00 91.09  ? 17  DG  C OP1   1 
ATOM   330  O OP2   . DG  A 1 17  ? 35.059  -4.620  20.845  1.00 90.12  ? 17  DG  C OP2   1 
ATOM   331  O "O5'" . DG  A 1 17  ? 34.992  -6.469  19.143  1.00 91.95  ? 17  DG  C "O5'" 1 
ATOM   332  C "C5'" . DG  A 1 17  ? 34.486  -6.955  17.896  1.00 93.04  ? 17  DG  C "C5'" 1 
ATOM   333  C "C4'" . DG  A 1 17  ? 35.588  -7.029  16.860  1.00 93.16  ? 17  DG  C "C4'" 1 
ATOM   334  O "O4'" . DG  A 1 17  ? 35.948  -5.707  16.375  1.00 91.36  ? 17  DG  C "O4'" 1 
ATOM   335  C "C3'" . DG  A 1 17  ? 36.885  -7.683  17.340  1.00 92.31  ? 17  DG  C "C3'" 1 
ATOM   336  O "O3'" . DG  A 1 17  ? 37.359  -8.610  16.359  1.00 92.64  ? 17  DG  C "O3'" 1 
ATOM   337  C "C2'" . DG  A 1 17  ? 37.847  -6.513  17.489  1.00 91.94  ? 17  DG  C "C2'" 1 
ATOM   338  C "C1'" . DG  A 1 17  ? 37.363  -5.531  16.431  1.00 90.59  ? 17  DG  C "C1'" 1 
ATOM   339  N N9    . DG  A 1 17  ? 37.630  -4.131  16.761  1.00 89.04  ? 17  DG  C N9    1 
ATOM   340  C C8    . DG  A 1 17  ? 37.255  -3.487  17.916  1.00 89.20  ? 17  DG  C C8    1 
ATOM   341  N N7    . DG  A 1 17  ? 37.610  -2.229  17.946  1.00 88.73  ? 17  DG  C N7    1 
ATOM   342  C C5    . DG  A 1 17  ? 38.265  -2.022  16.738  1.00 87.92  ? 17  DG  C C5    1 
ATOM   343  C C6    . DG  A 1 17  ? 38.867  -0.841  16.208  1.00 87.09  ? 17  DG  C C6    1 
ATOM   344  O O6    . DG  A 1 17  ? 38.938  0.289   16.722  1.00 86.18  ? 17  DG  C O6    1 
ATOM   345  N N1    . DG  A 1 17  ? 39.421  -1.067  14.951  1.00 86.63  ? 17  DG  C N1    1 
ATOM   346  C C2    . DG  A 1 17  ? 39.402  -2.269  14.281  1.00 86.46  ? 17  DG  C C2    1 
ATOM   347  N N2    . DG  A 1 17  ? 40.002  -2.266  13.069  1.00 86.74  ? 17  DG  C N2    1 
ATOM   348  N N3    . DG  A 1 17  ? 38.842  -3.383  14.762  1.00 87.01  ? 17  DG  C N3    1 
ATOM   349  C C4    . DG  A 1 17  ? 38.294  -3.186  15.989  1.00 88.10  ? 17  DG  C C4    1 
ATOM   350  P P     . DC  A 1 18  ? 38.672  -9.493  16.664  1.00 92.25  ? 18  DC  C P     1 
ATOM   351  O OP1   . DC  A 1 18  ? 38.517  -10.799 15.958  1.00 93.33  ? 18  DC  C OP1   1 
ATOM   352  O OP2   . DC  A 1 18  ? 38.894  -9.481  18.141  1.00 92.31  ? 18  DC  C OP2   1 
ATOM   353  O "O5'" . DC  A 1 18  ? 39.849  -8.658  15.965  1.00 91.55  ? 18  DC  C "O5'" 1 
ATOM   354  C "C5'" . DC  A 1 18  ? 39.779  -8.324  14.571  1.00 88.93  ? 18  DC  C "C5'" 1 
ATOM   355  C "C4'" . DC  A 1 18  ? 41.044  -7.632  14.110  1.00 87.46  ? 18  DC  C "C4'" 1 
ATOM   356  O "O4'" . DC  A 1 18  ? 41.077  -6.249  14.549  1.00 85.71  ? 18  DC  C "O4'" 1 
ATOM   357  C "C3'" . DC  A 1 18  ? 42.368  -8.257  14.564  1.00 86.51  ? 18  DC  C "C3'" 1 
ATOM   358  O "O3'" . DC  A 1 18  ? 43.370  -8.110  13.548  1.00 86.12  ? 18  DC  C "O3'" 1 
ATOM   359  C "C2'" . DC  A 1 18  ? 42.810  -7.338  15.690  1.00 85.48  ? 18  DC  C "C2'" 1 
ATOM   360  C "C1'" . DC  A 1 18  ? 42.324  -5.984  15.186  1.00 84.25  ? 18  DC  C "C1'" 1 
ATOM   361  N N1    . DC  A 1 18  ? 42.100  -4.974  16.237  1.00 81.73  ? 18  DC  C N1    1 
ATOM   362  C C2    . DC  A 1 18  ? 42.702  -3.699  16.113  1.00 80.46  ? 18  DC  C C2    1 
ATOM   363  O O2    . DC  A 1 18  ? 43.409  -3.447  15.114  1.00 79.14  ? 18  DC  C O2    1 
ATOM   364  N N3    . DC  A 1 18  ? 42.494  -2.778  17.084  1.00 79.64  ? 18  DC  C N3    1 
ATOM   365  C C4    . DC  A 1 18  ? 41.728  -3.080  18.140  1.00 79.28  ? 18  DC  C C4    1 
ATOM   366  N N4    . DC  A 1 18  ? 41.552  -2.141  19.079  1.00 79.16  ? 18  DC  C N4    1 
ATOM   367  C C5    . DC  A 1 18  ? 41.108  -4.358  18.286  1.00 79.36  ? 18  DC  C C5    1 
ATOM   368  C C6    . DC  A 1 18  ? 41.319  -5.264  17.322  1.00 80.58  ? 18  DC  C C6    1 
ATOM   369  O "O5'" . DG  B 2 4   ? 45.208  8.865   15.664  1.00 86.43  ? 4   DG  D "O5'" 1 
ATOM   370  C "C5'" . DG  B 2 4   ? 45.638  7.723   16.421  1.00 89.28  ? 4   DG  D "C5'" 1 
ATOM   371  C "C4'" . DG  B 2 4   ? 46.416  6.757   15.557  1.00 91.17  ? 4   DG  D "C4'" 1 
ATOM   372  O "O4'" . DG  B 2 4   ? 46.622  5.516   16.277  1.00 90.33  ? 4   DG  D "O4'" 1 
ATOM   373  C "C3'" . DG  B 2 4   ? 45.708  6.379   14.258  1.00 91.66  ? 4   DG  D "C3'" 1 
ATOM   374  O "O3'" . DG  B 2 4   ? 46.671  6.226   13.204  1.00 94.40  ? 4   DG  D "O3'" 1 
ATOM   375  C "C2'" . DG  B 2 4   ? 45.024  5.065   14.599  1.00 92.00  ? 4   DG  D "C2'" 1 
ATOM   376  C "C1'" . DG  B 2 4   ? 45.961  4.434   15.622  1.00 91.50  ? 4   DG  D "C1'" 1 
ATOM   377  N N9    . DG  B 2 4   ? 45.270  3.652   16.648  1.00 92.39  ? 4   DG  D N9    1 
ATOM   378  C C8    . DG  B 2 4   ? 44.931  4.084   17.914  1.00 92.51  ? 4   DG  D C8    1 
ATOM   379  N N7    . DG  B 2 4   ? 44.303  3.178   18.618  1.00 92.32  ? 4   DG  D N7    1 
ATOM   380  C C5    . DG  B 2 4   ? 44.221  2.074   17.774  1.00 92.66  ? 4   DG  D C5    1 
ATOM   381  C C6    . DG  B 2 4   ? 43.641  0.787   17.993  1.00 92.42  ? 4   DG  D C6    1 
ATOM   382  O O6    . DG  B 2 4   ? 43.062  0.362   19.004  1.00 91.71  ? 4   DG  D O6    1 
ATOM   383  N N1    . DG  B 2 4   ? 43.782  -0.037  16.877  1.00 92.52  ? 4   DG  D N1    1 
ATOM   384  C C2    . DG  B 2 4   ? 44.397  0.322   15.698  1.00 92.82  ? 4   DG  D C2    1 
ATOM   385  N N2    . DG  B 2 4   ? 44.424  -0.629  14.741  1.00 92.13  ? 4   DG  D N2    1 
ATOM   386  N N3    . DG  B 2 4   ? 44.940  1.521   15.475  1.00 93.09  ? 4   DG  D N3    1 
ATOM   387  C C4    . DG  B 2 4   ? 44.816  2.342   16.552  1.00 92.83  ? 4   DG  D C4    1 
ATOM   388  P P     . DC  B 2 5   ? 46.177  6.125   11.672  1.00 95.60  ? 5   DC  D P     1 
ATOM   389  O OP1   . DC  B 2 5   ? 47.382  6.166   10.787  1.00 94.54  ? 5   DC  D OP1   1 
ATOM   390  O OP2   . DC  B 2 5   ? 45.083  7.125   11.475  1.00 96.85  ? 5   DC  D OP2   1 
ATOM   391  O "O5'" . DC  B 2 5   ? 45.527  4.668   11.587  1.00 96.81  ? 5   DC  D "O5'" 1 
ATOM   392  C "C5'" . DC  B 2 5   ? 46.014  3.692   10.664  1.00 97.60  ? 5   DC  D "C5'" 1 
ATOM   393  C "C4'" . DC  B 2 5   ? 44.852  3.020   9.969   1.00 97.49  ? 5   DC  D "C4'" 1 
ATOM   394  O "O4'" . DC  B 2 5   ? 44.171  2.110   10.878  1.00 95.30  ? 5   DC  D "O4'" 1 
ATOM   395  C "C3'" . DC  B 2 5   ? 43.799  4.021   9.497   1.00 96.44  ? 5   DC  D "C3'" 1 
ATOM   396  O "O3'" . DC  B 2 5   ? 43.300  3.661   8.208   1.00 96.84  ? 5   DC  D "O3'" 1 
ATOM   397  C "C2'" . DC  B 2 5   ? 42.710  3.925   10.553  1.00 95.86  ? 5   DC  D "C2'" 1 
ATOM   398  C "C1'" . DC  B 2 5   ? 42.799  2.474   11.018  1.00 93.83  ? 5   DC  D "C1'" 1 
ATOM   399  N N1    . DC  B 2 5   ? 42.420  2.287   12.436  1.00 91.33  ? 5   DC  D N1    1 
ATOM   400  C C2    . DC  B 2 5   ? 41.894  1.041   12.868  1.00 89.99  ? 5   DC  D C2    1 
ATOM   401  O O2    . DC  B 2 5   ? 41.745  0.114   12.046  1.00 89.34  ? 5   DC  D O2    1 
ATOM   402  N N3    . DC  B 2 5   ? 41.563  0.888   14.175  1.00 88.88  ? 5   DC  D N3    1 
ATOM   403  C C4    . DC  B 2 5   ? 41.731  1.902   15.033  1.00 88.45  ? 5   DC  D C4    1 
ATOM   404  N N4    . DC  B 2 5   ? 41.395  1.704   16.313  1.00 87.23  ? 5   DC  D N4    1 
ATOM   405  C C5    . DC  B 2 5   ? 42.252  3.165   14.620  1.00 88.54  ? 5   DC  D C5    1 
ATOM   406  C C6    . DC  B 2 5   ? 42.579  3.312   13.330  1.00 89.91  ? 5   DC  D C6    1 
ATOM   407  P P     . DC  B 2 6   ? 42.362  4.695   7.406   1.00 96.34  ? 6   DC  D P     1 
ATOM   408  O OP1   . DC  B 2 6   ? 43.179  5.356   6.348   1.00 97.86  ? 6   DC  D OP1   1 
ATOM   409  O OP2   . DC  B 2 6   ? 41.672  5.528   8.436   1.00 96.28  ? 6   DC  D OP2   1 
ATOM   410  O "O5'" . DC  B 2 6   ? 41.291  3.742   6.708   1.00 96.12  ? 6   DC  D "O5'" 1 
ATOM   411  C "C5'" . DC  B 2 6   ? 41.598  2.367   6.458   1.00 94.29  ? 6   DC  D "C5'" 1 
ATOM   412  C "C4'" . DC  B 2 6   ? 40.428  1.492   6.846   1.00 93.76  ? 6   DC  D "C4'" 1 
ATOM   413  O "O4'" . DC  B 2 6   ? 40.263  1.475   8.290   1.00 91.22  ? 6   DC  D "O4'" 1 
ATOM   414  C "C3'" . DC  B 2 6   ? 39.087  1.962   6.274   1.00 92.55  ? 6   DC  D "C3'" 1 
ATOM   415  O "O3'" . DC  B 2 6   ? 38.293  0.833   5.906   1.00 94.06  ? 6   DC  D "O3'" 1 
ATOM   416  C "C2'" . DC  B 2 6   ? 38.439  2.667   7.451   1.00 92.03  ? 6   DC  D "C2'" 1 
ATOM   417  C "C1'" . DC  B 2 6   ? 38.911  1.798   8.603   1.00 89.73  ? 6   DC  D "C1'" 1 
ATOM   418  N N1    . DC  B 2 6   ? 38.867  2.443   9.931   1.00 86.76  ? 6   DC  D N1    1 
ATOM   419  C C2    . DC  B 2 6   ? 38.266  1.752   11.008  1.00 85.33  ? 6   DC  D C2    1 
ATOM   420  O O2    . DC  B 2 6   ? 37.807  0.609   10.818  1.00 83.55  ? 6   DC  D O2    1 
ATOM   421  N N3    . DC  B 2 6   ? 38.203  2.351   12.224  1.00 84.26  ? 6   DC  D N3    1 
ATOM   422  C C4    . DC  B 2 6   ? 38.712  3.575   12.393  1.00 83.66  ? 6   DC  D C4    1 
ATOM   423  N N4    . DC  B 2 6   ? 38.629  4.125   13.611  1.00 81.90  ? 6   DC  D N4    1 
ATOM   424  C C5    . DC  B 2 6   ? 39.330  4.293   11.323  1.00 83.91  ? 6   DC  D C5    1 
ATOM   425  C C6    . DC  B 2 6   ? 39.386  3.694   10.122  1.00 85.51  ? 6   DC  D C6    1 
ATOM   426  P P     . DC  B 2 7   ? 37.085  1.007   4.850   1.00 94.36  ? 7   DC  D P     1 
ATOM   427  O OP1   . DC  B 2 7   ? 37.677  1.069   3.479   1.00 93.70  ? 7   DC  D OP1   1 
ATOM   428  O OP2   . DC  B 2 7   ? 36.197  2.112   5.321   1.00 96.09  ? 7   DC  D OP2   1 
ATOM   429  O "O5'" . DC  B 2 7   ? 36.278  -0.362  4.995   1.00 94.80  ? 7   DC  D "O5'" 1 
ATOM   430  C "C5'" . DC  B 2 7   ? 36.945  -1.561  5.400   1.00 93.74  ? 7   DC  D "C5'" 1 
ATOM   431  C "C4'" . DC  B 2 7   ? 36.171  -2.249  6.501   1.00 92.33  ? 7   DC  D "C4'" 1 
ATOM   432  O "O4'" . DC  B 2 7   ? 36.291  -1.523  7.755   1.00 89.80  ? 7   DC  D "O4'" 1 
ATOM   433  C "C3'" . DC  B 2 7   ? 34.673  -2.381  6.224   1.00 91.03  ? 7   DC  D "C3'" 1 
ATOM   434  O "O3'" . DC  B 2 7   ? 34.205  -3.666  6.639   1.00 90.89  ? 7   DC  D "O3'" 1 
ATOM   435  C "C2'" . DC  B 2 7   ? 34.056  -1.289  7.080   1.00 89.73  ? 7   DC  D "C2'" 1 
ATOM   436  C "C1'" . DC  B 2 7   ? 34.997  -1.227  8.275   1.00 87.81  ? 7   DC  D "C1'" 1 
ATOM   437  N N1    . DC  B 2 7   ? 35.051  0.106   8.906   1.00 84.85  ? 7   DC  D N1    1 
ATOM   438  C C2    . DC  B 2 7   ? 34.502  0.286   10.193  1.00 83.42  ? 7   DC  D C2    1 
ATOM   439  O O2    . DC  B 2 7   ? 34.002  -0.690  10.790  1.00 81.36  ? 7   DC  D O2    1 
ATOM   440  N N3    . DC  B 2 7   ? 34.530  1.524   10.751  1.00 82.17  ? 7   DC  D N3    1 
ATOM   441  C C4    . DC  B 2 7   ? 35.073  2.548   10.082  1.00 81.49  ? 7   DC  D C4    1 
ATOM   442  N N4    . DC  B 2 7   ? 35.069  3.752   10.664  1.00 79.47  ? 7   DC  D N4    1 
ATOM   443  C C5    . DC  B 2 7   ? 35.643  2.387   8.788   1.00 81.23  ? 7   DC  D C5    1 
ATOM   444  C C6    . DC  B 2 7   ? 35.614  1.162   8.244   1.00 83.15  ? 7   DC  D C6    1 
ATOM   445  P P     . DA  B 2 8   ? 32.761  -4.175  6.157   1.00 90.42  ? 8   DA  D P     1 
ATOM   446  O OP1   . DA  B 2 8   ? 32.410  -5.397  6.934   1.00 91.09  ? 8   DA  D OP1   1 
ATOM   447  O OP2   . DA  B 2 8   ? 32.788  -4.233  4.668   1.00 90.91  ? 8   DA  D OP2   1 
ATOM   448  O "O5'" . DA  B 2 8   ? 31.788  -2.988  6.596   1.00 90.91  ? 8   DA  D "O5'" 1 
ATOM   449  C "C5'" . DA  B 2 8   ? 30.479  -3.258  7.101   1.00 90.08  ? 8   DA  D "C5'" 1 
ATOM   450  C "C4'" . DA  B 2 8   ? 29.460  -3.079  6.001   1.00 88.76  ? 8   DA  D "C4'" 1 
ATOM   451  O "O4'" . DA  B 2 8   ? 29.296  -1.665  5.712   1.00 86.23  ? 8   DA  D "O4'" 1 
ATOM   452  C "C3'" . DA  B 2 8   ? 29.883  -3.741  4.687   1.00 87.99  ? 8   DA  D "C3'" 1 
ATOM   453  O "O3'" . DA  B 2 8   ? 28.787  -4.426  4.078   1.00 89.63  ? 8   DA  D "O3'" 1 
ATOM   454  C "C2'" . DA  B 2 8   ? 30.373  -2.581  3.837   1.00 86.57  ? 8   DA  D "C2'" 1 
ATOM   455  C "C1'" . DA  B 2 8   ? 29.544  -1.409  4.335   1.00 84.23  ? 8   DA  D "C1'" 1 
ATOM   456  N N9    . DA  B 2 8   ? 30.238  -0.124  4.226   1.00 81.29  ? 8   DA  D N9    1 
ATOM   457  C C8    . DA  B 2 8   ? 31.597  0.086   4.171   1.00 80.49  ? 8   DA  D C8    1 
ATOM   458  N N7    . DA  B 2 8   ? 31.935  1.347   4.045   1.00 79.49  ? 8   DA  D N7    1 
ATOM   459  C C5    . DA  B 2 8   ? 30.718  2.017   4.020   1.00 78.95  ? 8   DA  D C5    1 
ATOM   460  C C6    . DA  B 2 8   ? 30.391  3.387   3.902   1.00 78.13  ? 8   DA  D C6    1 
ATOM   461  N N6    . DA  B 2 8   ? 31.301  4.357   3.775   1.00 76.57  ? 8   DA  D N6    1 
ATOM   462  N N1    . DA  B 2 8   ? 29.080  3.727   3.915   1.00 77.78  ? 8   DA  D N1    1 
ATOM   463  C C2    . DA  B 2 8   ? 28.167  2.745   4.038   1.00 78.50  ? 8   DA  D C2    1 
ATOM   464  N N3    . DA  B 2 8   ? 28.352  1.423   4.154   1.00 78.80  ? 8   DA  D N3    1 
ATOM   465  C C4    . DA  B 2 8   ? 29.664  1.123   4.138   1.00 79.64  ? 8   DA  D C4    1 
ATOM   466  P P     . DG  B 2 9   ? 28.927  -4.981  2.570   1.00 90.24  ? 9   DG  D P     1 
ATOM   467  O OP1   . DG  B 2 9   ? 28.568  -6.430  2.537   1.00 90.59  ? 9   DG  D OP1   1 
ATOM   468  O OP2   . DG  B 2 9   ? 30.234  -4.536  2.015   1.00 90.42  ? 9   DG  D OP2   1 
ATOM   469  O "O5'" . DG  B 2 9   ? 27.777  -4.177  1.823   1.00 90.93  ? 9   DG  D "O5'" 1 
ATOM   470  C "C5'" . DG  B 2 9   ? 26.596  -3.804  2.534   1.00 91.14  ? 9   DG  D "C5'" 1 
ATOM   471  C "C4'" . DG  B 2 9   ? 25.839  -2.750  1.766   1.00 90.48  ? 9   DG  D "C4'" 1 
ATOM   472  O "O4'" . DG  B 2 9   ? 26.511  -1.469  1.878   1.00 88.24  ? 9   DG  D "O4'" 1 
ATOM   473  C "C3'" . DG  B 2 9   ? 25.739  -3.064  0.275   1.00 89.77  ? 9   DG  D "C3'" 1 
ATOM   474  O "O3'" . DG  B 2 9   ? 24.414  -2.803  -0.186  1.00 90.25  ? 9   DG  D "O3'" 1 
ATOM   475  C "C2'" . DG  B 2 9   ? 26.754  -2.125  -0.359  1.00 88.87  ? 9   DG  D "C2'" 1 
ATOM   476  C "C1'" . DG  B 2 9   ? 26.776  -0.934  0.590   1.00 86.50  ? 9   DG  D "C1'" 1 
ATOM   477  N N9    . DG  B 2 9   ? 28.064  -0.243  0.650   1.00 83.13  ? 9   DG  D N9    1 
ATOM   478  C C8    . DG  B 2 9   ? 29.301  -0.830  0.781   1.00 82.47  ? 9   DG  D C8    1 
ATOM   479  N N7    . DG  B 2 9   ? 30.283  0.034   0.791   1.00 81.58  ? 9   DG  D N7    1 
ATOM   480  C C5    . DG  B 2 9   ? 29.661  1.270   0.661   1.00 80.45  ? 9   DG  D C5    1 
ATOM   481  C C6    . DG  B 2 9   ? 30.219  2.585   0.603   1.00 78.91  ? 9   DG  D C6    1 
ATOM   482  O O6    . DG  B 2 9   ? 31.412  2.925   0.659   1.00 77.46  ? 9   DG  D O6    1 
ATOM   483  N N1    . DG  B 2 9   ? 29.230  3.555   0.467   1.00 77.88  ? 9   DG  D N1    1 
ATOM   484  C C2    . DG  B 2 9   ? 27.882  3.305   0.395   1.00 78.26  ? 9   DG  D C2    1 
ATOM   485  N N2    . DG  B 2 9   ? 27.097  4.391   0.269   1.00 77.40  ? 9   DG  D N2    1 
ATOM   486  N N3    . DG  B 2 9   ? 27.345  2.086   0.444   1.00 79.49  ? 9   DG  D N3    1 
ATOM   487  C C4    . DG  B 2 9   ? 28.288  1.122   0.577   1.00 81.33  ? 9   DG  D C4    1 
ATOM   488  P P     . DC  B 2 10  ? 23.809  -3.651  -1.416  1.00 89.48  ? 10  DC  D P     1 
ATOM   489  O OP1   . DC  B 2 10  ? 22.854  -4.669  -0.902  1.00 89.72  ? 10  DC  D OP1   1 
ATOM   490  O OP2   . DC  B 2 10  ? 24.938  -4.080  -2.298  1.00 90.53  ? 10  DC  D OP2   1 
ATOM   491  O "O5'" . DC  B 2 10  ? 22.959  -2.541  -2.169  1.00 88.56  ? 10  DC  D "O5'" 1 
ATOM   492  C "C5'" . DC  B 2 10  ? 22.363  -1.474  -1.434  1.00 85.23  ? 10  DC  D "C5'" 1 
ATOM   493  C "C4'" . DC  B 2 10  ? 22.443  -0.198  -2.234  1.00 83.08  ? 10  DC  D "C4'" 1 
ATOM   494  O "O4'" . DC  B 2 10  ? 23.696  0.491   -1.979  1.00 80.70  ? 10  DC  D "O4'" 1 
ATOM   495  C "C3'" . DC  B 2 10  ? 22.391  -0.471  -3.738  1.00 81.38  ? 10  DC  D "C3'" 1 
ATOM   496  O "O3'" . DC  B 2 10  ? 21.476  0.390   -4.401  1.00 80.71  ? 10  DC  D "O3'" 1 
ATOM   497  C "C2'" . DC  B 2 10  ? 23.809  -0.206  -4.208  1.00 80.82  ? 10  DC  D "C2'" 1 
ATOM   498  C "C1'" . DC  B 2 10  ? 24.307  0.829   -3.214  1.00 79.52  ? 10  DC  D "C1'" 1 
ATOM   499  N N1    . DC  B 2 10  ? 25.768  0.808   -3.028  1.00 77.83  ? 10  DC  D N1    1 
ATOM   500  C C2    . DC  B 2 10  ? 26.449  2.020   -2.856  1.00 76.58  ? 10  DC  D C2    1 
ATOM   501  O O2    . DC  B 2 10  ? 25.797  3.080   -2.837  1.00 75.48  ? 10  DC  D O2    1 
ATOM   502  N N3    . DC  B 2 10  ? 27.798  2.005   -2.716  1.00 75.33  ? 10  DC  D N3    1 
ATOM   503  C C4    . DC  B 2 10  ? 28.459  0.842   -2.743  1.00 75.23  ? 10  DC  D C4    1 
ATOM   504  N N4    . DC  B 2 10  ? 29.787  0.868   -2.607  1.00 73.95  ? 10  DC  D N4    1 
ATOM   505  C C5    . DC  B 2 10  ? 27.788  -0.402  -2.910  1.00 76.00  ? 10  DC  D C5    1 
ATOM   506  C C6    . DC  B 2 10  ? 26.456  -0.373  -3.043  1.00 77.43  ? 10  DC  D C6    1 
ATOM   507  P P     . DT  B 2 11  ? 20.885  -0.041  -5.833  1.00 80.17  ? 11  DT  D P     1 
ATOM   508  O OP1   . DT  B 2 11  ? 19.469  -0.470  -5.659  1.00 79.38  ? 11  DT  D OP1   1 
ATOM   509  O OP2   . DT  B 2 11  ? 21.865  -0.976  -6.465  1.00 80.05  ? 11  DT  D OP2   1 
ATOM   510  O "O5'" . DT  B 2 11  ? 20.904  1.334   -6.636  1.00 80.63  ? 11  DT  D "O5'" 1 
ATOM   511  C "C5'" . DT  B 2 11  ? 20.661  2.563   -5.951  1.00 80.96  ? 11  DT  D "C5'" 1 
ATOM   512  C "C4'" . DT  B 2 11  ? 21.491  3.675   -6.548  1.00 81.43  ? 11  DT  D "C4'" 1 
ATOM   513  O "O4'" . DT  B 2 11  ? 22.880  3.569   -6.144  1.00 80.71  ? 11  DT  D "O4'" 1 
ATOM   514  C "C3'" . DT  B 2 11  ? 21.479  3.722   -8.077  1.00 81.15  ? 11  DT  D "C3'" 1 
ATOM   515  O "O3'" . DT  B 2 11  ? 21.224  5.057   -8.517  1.00 81.55  ? 11  DT  D "O3'" 1 
ATOM   516  C "C2'" . DT  B 2 11  ? 22.874  3.259   -8.468  1.00 81.21  ? 11  DT  D "C2'" 1 
ATOM   517  C "C1'" . DT  B 2 11  ? 23.720  3.707   -7.284  1.00 81.05  ? 11  DT  D "C1'" 1 
ATOM   518  N N1    . DT  B 2 11  ? 24.951  2.910   -7.047  1.00 80.59  ? 11  DT  D N1    1 
ATOM   519  C C2    . DT  B 2 11  ? 26.147  3.588   -6.877  1.00 79.99  ? 11  DT  D C2    1 
ATOM   520  O O2    . DT  B 2 11  ? 26.239  4.806   -6.940  1.00 78.90  ? 11  DT  D O2    1 
ATOM   521  N N3    . DT  B 2 11  ? 27.239  2.780   -6.634  1.00 79.17  ? 11  DT  D N3    1 
ATOM   522  C C4    . DT  B 2 11  ? 27.250  1.395   -6.558  1.00 79.01  ? 11  DT  D C4    1 
ATOM   523  O O4    . DT  B 2 11  ? 28.302  0.802   -6.333  1.00 77.77  ? 11  DT  D O4    1 
ATOM   524  C C5    . DT  B 2 11  ? 25.964  0.751   -6.762  1.00 79.30  ? 11  DT  D C5    1 
ATOM   525  C C7    . DT  B 2 11  ? 25.885  -0.744  -6.710  1.00 78.09  ? 11  DT  D C7    1 
ATOM   526  C C6    . DT  B 2 11  ? 24.896  1.531   -6.992  1.00 80.46  ? 11  DT  D C6    1 
ATOM   527  P P     . DT  B 2 12  ? 19.702  5.583   -8.587  1.00 81.66  ? 12  DT  D P     1 
ATOM   528  O OP1   . DT  B 2 12  ? 19.352  6.198   -7.276  1.00 81.89  ? 12  DT  D OP1   1 
ATOM   529  O OP2   . DT  B 2 12  ? 18.862  4.480   -9.130  1.00 81.02  ? 12  DT  D OP2   1 
ATOM   530  O "O5'" . DT  B 2 12  ? 19.743  6.758   -9.659  1.00 83.41  ? 12  DT  D "O5'" 1 
ATOM   531  C "C5'" . DT  B 2 12  ? 20.448  6.614   -10.886 1.00 85.32  ? 12  DT  D "C5'" 1 
ATOM   532  C "C4'" . DT  B 2 12  ? 20.417  7.919   -11.643 1.00 86.33  ? 12  DT  D "C4'" 1 
ATOM   533  O "O4'" . DT  B 2 12  ? 19.041  8.229   -11.980 1.00 84.40  ? 12  DT  D "O4'" 1 
ATOM   534  C "C3'" . DT  B 2 12  ? 20.929  9.114   -10.841 1.00 87.28  ? 12  DT  D "C3'" 1 
ATOM   535  O "O3'" . DT  B 2 12  ? 21.593  10.030  -11.727 1.00 90.89  ? 12  DT  D "O3'" 1 
ATOM   536  C "C2'" . DT  B 2 12  ? 19.653  9.708   -10.260 1.00 85.70  ? 12  DT  D "C2'" 1 
ATOM   537  C "C1'" . DT  B 2 12  ? 18.649  9.456   -11.375 1.00 83.78  ? 12  DT  D "C1'" 1 
ATOM   538  N N1    . DT  B 2 12  ? 17.229  9.327   -10.958 1.00 82.19  ? 12  DT  D N1    1 
ATOM   539  C C2    . DT  B 2 12  ? 16.392  10.427  -11.081 1.00 80.99  ? 12  DT  D C2    1 
ATOM   540  O O2    . DT  B 2 12  ? 16.771  11.522  -11.477 1.00 79.09  ? 12  DT  D O2    1 
ATOM   541  N N3    . DT  B 2 12  ? 15.083  10.194  -10.721 1.00 80.22  ? 12  DT  D N3    1 
ATOM   542  C C4    . DT  B 2 12  ? 14.538  9.005   -10.260 1.00 80.16  ? 12  DT  D C4    1 
ATOM   543  O O4    . DT  B 2 12  ? 13.333  8.941   -9.989  1.00 78.43  ? 12  DT  D O4    1 
ATOM   544  C C5    . DT  B 2 12  ? 15.474  7.904   -10.141 1.00 80.29  ? 12  DT  D C5    1 
ATOM   545  C C7    . DT  B 2 12  ? 14.977  6.579   -9.652  1.00 79.02  ? 12  DT  D C7    1 
ATOM   546  C C6    . DT  B 2 12  ? 16.754  8.121   -10.483 1.00 81.46  ? 12  DT  D C6    1 
ATOM   547  P P     . DT  B 2 13  ? 22.077  11.465  -11.180 1.00 93.04  ? 13  DT  D P     1 
ATOM   548  O OP1   . DT  B 2 13  ? 21.571  11.627  -9.784  1.00 94.60  ? 13  DT  D OP1   1 
ATOM   549  O OP2   . DT  B 2 13  ? 21.745  12.495  -12.212 1.00 92.11  ? 13  DT  D OP2   1 
ATOM   550  O "O5'" . DT  B 2 13  ? 23.662  11.338  -11.102 1.00 95.12  ? 13  DT  D "O5'" 1 
ATOM   551  C "C5'" . DT  B 2 13  ? 24.401  11.869  -9.995  1.00 98.02  ? 13  DT  D "C5'" 1 
ATOM   552  C "C4'" . DT  B 2 13  ? 25.854  11.490  -10.144 1.00 99.46  ? 13  DT  D "C4'" 1 
ATOM   553  O "O4'" . DT  B 2 13  ? 26.585  11.884  -8.952  1.00 98.54  ? 13  DT  D "O4'" 1 
ATOM   554  C "C3'" . DT  B 2 13  ? 26.021  9.972   -10.283 1.00 99.56  ? 13  DT  D "C3'" 1 
ATOM   555  O "O3'" . DT  B 2 13  ? 26.909  9.613   -11.342 1.00 99.78  ? 13  DT  D "O3'" 1 
ATOM   556  C "C2'" . DT  B 2 13  ? 26.570  9.526   -8.943  1.00 99.64  ? 13  DT  D "C2'" 1 
ATOM   557  C "C1'" . DT  B 2 13  ? 27.277  10.765  -8.412  1.00 98.54  ? 13  DT  D "C1'" 1 
ATOM   558  N N1    . DT  B 2 13  ? 27.181  10.820  -6.944  1.00 97.44  ? 13  DT  D N1    1 
ATOM   559  C C2    . DT  B 2 13  ? 28.286  11.199  -6.210  1.00 96.79  ? 13  DT  D C2    1 
ATOM   560  O O2    . DT  B 2 13  ? 29.332  11.573  -6.718  1.00 95.39  ? 13  DT  D O2    1 
ATOM   561  N N3    . DT  B 2 13  ? 28.119  11.118  -4.847  1.00 96.30  ? 13  DT  D N3    1 
ATOM   562  C C4    . DT  B 2 13  ? 26.980  10.711  -4.166  1.00 95.90  ? 13  DT  D C4    1 
ATOM   563  O O4    . DT  B 2 13  ? 26.983  10.660  -2.940  1.00 94.72  ? 13  DT  D O4    1 
ATOM   564  C C5    . DT  B 2 13  ? 25.851  10.363  -5.002  1.00 96.07  ? 13  DT  D C5    1 
ATOM   565  C C7    . DT  B 2 13  ? 24.576  9.920   -4.355  1.00 95.50  ? 13  DT  D C7    1 
ATOM   566  C C6    . DT  B 2 13  ? 26.003  10.446  -6.328  1.00 96.97  ? 13  DT  D C6    1 
ATOM   567  P P     . DC  B 2 14  ? 26.545  8.359   -12.288 1.00 98.97  ? 14  DC  D P     1 
ATOM   568  O OP1   . DC  B 2 14  ? 25.516  8.830   -13.261 1.00 98.83  ? 14  DC  D OP1   1 
ATOM   569  O OP2   . DC  B 2 14  ? 26.273  7.148   -11.452 1.00 99.05  ? 14  DC  D OP2   1 
ATOM   570  O "O5'" . DC  B 2 14  ? 27.906  8.087   -13.071 1.00 99.67  ? 14  DC  D "O5'" 1 
ATOM   571  C "C5'" . DC  B 2 14  ? 28.188  6.811   -13.649 1.00 98.13  ? 14  DC  D "C5'" 1 
ATOM   572  C "C4'" . DC  B 2 14  ? 29.349  6.159   -12.935 1.00 95.47  ? 14  DC  D "C4'" 1 
ATOM   573  O "O4'" . DC  B 2 14  ? 30.187  7.175   -12.327 1.00 93.42  ? 14  DC  D "O4'" 1 
ATOM   574  C "C3'" . DC  B 2 14  ? 28.933  5.241   -11.789 1.00 93.16  ? 14  DC  D "C3'" 1 
ATOM   575  O "O3'" . DC  B 2 14  ? 29.959  4.260   -11.567 1.00 91.49  ? 14  DC  D "O3'" 1 
ATOM   576  C "C2'" . DC  B 2 14  ? 28.966  6.185   -10.604 1.00 92.53  ? 14  DC  D "C2'" 1 
ATOM   577  C "C1'" . DC  B 2 14  ? 30.239  6.946   -10.929 1.00 92.38  ? 14  DC  D "C1'" 1 
ATOM   578  N N1    . DC  B 2 14  ? 30.424  8.242   -10.256 1.00 91.99  ? 14  DC  D N1    1 
ATOM   579  C C2    . DC  B 2 14  ? 31.010  8.260   -8.975  1.00 91.64  ? 14  DC  D C2    1 
ATOM   580  O O2    . DC  B 2 14  ? 31.329  7.181   -8.441  1.00 90.84  ? 14  DC  D O2    1 
ATOM   581  N N3    . DC  B 2 14  ? 31.213  9.450   -8.358  1.00 91.27  ? 14  DC  D N3    1 
ATOM   582  C C4    . DC  B 2 14  ? 30.855  10.587  -8.965  1.00 91.42  ? 14  DC  D C4    1 
ATOM   583  N N4    . DC  B 2 14  ? 31.087  11.737  -8.323  1.00 88.96  ? 14  DC  D N4    1 
ATOM   584  C C5    . DC  B 2 14  ? 30.246  10.595  -10.261 1.00 91.51  ? 14  DC  D C5    1 
ATOM   585  C C6    . DC  B 2 14  ? 30.050  9.411   -10.862 1.00 92.18  ? 14  DC  D C6    1 
ATOM   586  P P     . DC  B 2 15  ? 30.853  3.705   -12.795 1.00 89.53  ? 15  DC  D P     1 
ATOM   587  O OP1   . DC  B 2 15  ? 31.516  4.854   -13.481 1.00 90.48  ? 15  DC  D OP1   1 
ATOM   588  O OP2   . DC  B 2 15  ? 30.064  2.728   -13.596 1.00 89.12  ? 15  DC  D OP2   1 
ATOM   589  O "O5'" . DC  B 2 15  ? 32.010  2.911   -12.037 1.00 88.87  ? 15  DC  D "O5'" 1 
ATOM   590  C "C5'" . DC  B 2 15  ? 32.858  3.583   -11.098 1.00 87.45  ? 15  DC  D "C5'" 1 
ATOM   591  C "C4'" . DC  B 2 15  ? 33.193  2.673   -9.939  1.00 87.30  ? 15  DC  D "C4'" 1 
ATOM   592  O "O4'" . DC  B 2 15  ? 32.054  2.559   -9.054  1.00 84.44  ? 15  DC  D "O4'" 1 
ATOM   593  C "C3'" . DC  B 2 15  ? 33.558  1.251   -10.359 1.00 87.11  ? 15  DC  D "C3'" 1 
ATOM   594  O "O3'" . DC  B 2 15  ? 34.628  0.737   -9.566  1.00 89.72  ? 15  DC  D "O3'" 1 
ATOM   595  C "C2'" . DC  B 2 15  ? 32.277  0.467   -10.140 1.00 86.17  ? 15  DC  D "C2'" 1 
ATOM   596  C "C1'" . DC  B 2 15  ? 31.559  1.224   -9.026  1.00 83.00  ? 15  DC  D "C1'" 1 
ATOM   597  N N1    . DC  B 2 15  ? 30.104  1.287   -9.250  1.00 80.13  ? 15  DC  D N1    1 
ATOM   598  C C2    . DC  B 2 15  ? 29.381  0.090   -9.328  1.00 78.69  ? 15  DC  D C2    1 
ATOM   599  O O2    . DC  B 2 15  ? 29.983  -0.986  -9.159  1.00 77.50  ? 15  DC  D O2    1 
ATOM   600  N N3    . DC  B 2 15  ? 28.050  0.136   -9.588  1.00 77.86  ? 15  DC  D N3    1 
ATOM   601  C C4    . DC  B 2 15  ? 27.442  1.317   -9.755  1.00 77.37  ? 15  DC  D C4    1 
ATOM   602  N N4    . DC  B 2 15  ? 26.127  1.316   -10.014 1.00 76.30  ? 15  DC  D N4    1 
ATOM   603  C C5    . DC  B 2 15  ? 28.153  2.552   -9.661  1.00 77.30  ? 15  DC  D C5    1 
ATOM   604  C C6    . DC  B 2 15  ? 29.468  2.490   -9.404  1.00 78.29  ? 15  DC  D C6    1 
ATOM   605  P P     . DC  B 2 16  ? 36.052  0.440   -10.259 1.00 90.89  ? 16  DC  D P     1 
ATOM   606  O OP1   . DC  B 2 16  ? 35.808  -0.303  -11.529 1.00 89.97  ? 16  DC  D OP1   1 
ATOM   607  O OP2   . DC  B 2 16  ? 36.920  -0.164  -9.203  1.00 93.10  ? 16  DC  D OP2   1 
ATOM   608  O "O5'" . DC  B 2 16  ? 36.613  1.896   -10.624 1.00 91.68  ? 16  DC  D "O5'" 1 
ATOM   609  C "C5'" . DC  B 2 16  ? 38.021  2.150   -10.695 1.00 91.72  ? 16  DC  D "C5'" 1 
ATOM   610  C "C4'" . DC  B 2 16  ? 38.374  3.397   -9.916  1.00 92.11  ? 16  DC  D "C4'" 1 
ATOM   611  O "O4'" . DC  B 2 16  ? 37.923  4.580   -10.629 1.00 91.78  ? 16  DC  D "O4'" 1 
ATOM   612  C "C3'" . DC  B 2 16  ? 37.741  3.478   -8.522  1.00 91.02  ? 16  DC  D "C3'" 1 
ATOM   613  O "O3'" . DC  B 2 16  ? 38.653  4.046   -7.571  1.00 89.47  ? 16  DC  D "O3'" 1 
ATOM   614  C "C2'" . DC  B 2 16  ? 36.586  4.439   -8.726  1.00 92.12  ? 16  DC  D "C2'" 1 
ATOM   615  C "C1'" . DC  B 2 16  ? 37.175  5.398   -9.740  1.00 92.24  ? 16  DC  D "C1'" 1 
ATOM   616  N N1    . DC  B 2 16  ? 36.159  6.133   -10.509 1.00 92.61  ? 16  DC  D N1    1 
ATOM   617  C C2    . DC  B 2 16  ? 36.035  7.520   -10.315 1.00 93.23  ? 16  DC  D C2    1 
ATOM   618  O O2    . DC  B 2 16  ? 36.825  8.096   -9.542  1.00 93.45  ? 16  DC  D O2    1 
ATOM   619  N N3    . DC  B 2 16  ? 35.059  8.196   -10.973 1.00 93.67  ? 16  DC  D N3    1 
ATOM   620  C C4    . DC  B 2 16  ? 34.235  7.541   -11.800 1.00 93.68  ? 16  DC  D C4    1 
ATOM   621  N N4    . DC  B 2 16  ? 33.272  8.240   -12.417 1.00 93.86  ? 16  DC  D N4    1 
ATOM   622  C C5    . DC  B 2 16  ? 34.357  6.139   -12.031 1.00 93.60  ? 16  DC  D C5    1 
ATOM   623  C C6    . DC  B 2 16  ? 35.327  5.482   -11.375 1.00 93.25  ? 16  DC  D C6    1 
ATOM   624  P P     . DA  B 2 17  ? 38.250  4.098   -6.006  1.00 88.37  ? 17  DA  D P     1 
ATOM   625  O OP1   . DA  B 2 17  ? 39.496  4.133   -5.184  1.00 86.47  ? 17  DA  D OP1   1 
ATOM   626  O OP2   . DA  B 2 17  ? 37.237  3.030   -5.759  1.00 88.18  ? 17  DA  D OP2   1 
ATOM   627  O "O5'" . DA  B 2 17  ? 37.499  5.492   -5.838  1.00 89.20  ? 17  DA  D "O5'" 1 
ATOM   628  C "C5'" . DA  B 2 17  ? 37.689  6.554   -6.774  1.00 90.65  ? 17  DA  D "C5'" 1 
ATOM   629  C "C4'" . DA  B 2 17  ? 36.521  7.511   -6.711  1.00 91.01  ? 17  DA  D "C4'" 1 
ATOM   630  O "O4'" . DA  B 2 17  ? 35.304  6.824   -7.112  1.00 89.36  ? 17  DA  D "O4'" 1 
ATOM   631  C "C3'" . DA  B 2 17  ? 36.256  8.057   -5.309  1.00 90.65  ? 17  DA  D "C3'" 1 
ATOM   632  O "O3'" . DA  B 2 17  ? 35.864  9.431   -5.372  1.00 92.81  ? 17  DA  D "O3'" 1 
ATOM   633  C "C2'" . DA  B 2 17  ? 35.129  7.179   -4.790  1.00 89.61  ? 17  DA  D "C2'" 1 
ATOM   634  C "C1'" . DA  B 2 17  ? 34.349  6.830   -6.051  1.00 87.79  ? 17  DA  D "C1'" 1 
ATOM   635  N N9    . DA  B 2 17  ? 33.711  5.507   -6.012  1.00 85.89  ? 17  DA  D N9    1 
ATOM   636  C C8    . DA  B 2 17  ? 34.357  4.293   -5.969  1.00 85.01  ? 17  DA  D C8    1 
ATOM   637  N N7    . DA  B 2 17  ? 33.547  3.261   -5.941  1.00 83.78  ? 17  DA  D N7    1 
ATOM   638  C C5    . DA  B 2 17  ? 32.279  3.827   -5.966  1.00 83.05  ? 17  DA  D C5    1 
ATOM   639  C C6    . DA  B 2 17  ? 30.989  3.255   -5.952  1.00 81.61  ? 17  DA  D C6    1 
ATOM   640  N N6    . DA  B 2 17  ? 30.773  1.939   -5.901  1.00 80.37  ? 17  DA  D N6    1 
ATOM   641  N N1    . DA  B 2 17  ? 29.924  4.090   -5.989  1.00 80.80  ? 17  DA  D N1    1 
ATOM   642  C C2    . DA  B 2 17  ? 30.155  5.414   -6.030  1.00 81.20  ? 17  DA  D C2    1 
ATOM   643  N N3    . DA  B 2 17  ? 31.322  6.074   -6.044  1.00 83.01  ? 17  DA  D N3    1 
ATOM   644  C C4    . DA  B 2 17  ? 32.359  5.212   -6.011  1.00 84.11  ? 17  DA  D C4    1 
ATOM   645  P P     . DG  B 2 18  ? 35.861  10.315  -4.029  1.00 93.77  ? 18  DG  D P     1 
ATOM   646  O OP1   . DG  B 2 18  ? 36.465  11.649  -4.314  1.00 95.67  ? 18  DG  D OP1   1 
ATOM   647  O OP2   . DG  B 2 18  ? 36.448  9.457   -2.957  1.00 94.34  ? 18  DG  D OP2   1 
ATOM   648  O "O5'" . DG  B 2 18  ? 34.306  10.525  -3.725  1.00 94.81  ? 18  DG  D "O5'" 1 
ATOM   649  C "C5'" . DG  B 2 18  ? 33.454  11.205  -4.657  1.00 94.67  ? 18  DG  D "C5'" 1 
ATOM   650  C "C4'" . DG  B 2 18  ? 32.024  11.198  -4.161  1.00 93.94  ? 18  DG  D "C4'" 1 
ATOM   651  O "O4'" . DG  B 2 18  ? 31.461  9.867   -4.313  1.00 91.44  ? 18  DG  D "O4'" 1 
ATOM   652  C "C3'" . DG  B 2 18  ? 31.887  11.557  -2.678  1.00 93.76  ? 18  DG  D "C3'" 1 
ATOM   653  O "O3'" . DG  B 2 18  ? 30.746  12.387  -2.424  1.00 95.60  ? 18  DG  D "O3'" 1 
ATOM   654  C "C2'" . DG  B 2 18  ? 31.716  10.210  -2.000  1.00 92.12  ? 18  DG  D "C2'" 1 
ATOM   655  C "C1'" . DG  B 2 18  ? 31.003  9.378   -3.056  1.00 89.10  ? 18  DG  D "C1'" 1 
ATOM   656  N N9    . DG  B 2 18  ? 31.336  7.956   -2.968  1.00 85.16  ? 18  DG  D N9    1 
ATOM   657  C C8    . DG  B 2 18  ? 32.598  7.414   -2.886  1.00 83.46  ? 18  DG  D C8    1 
ATOM   658  N N7    . DG  B 2 18  ? 32.593  6.112   -2.763  1.00 81.56  ? 18  DG  D N7    1 
ATOM   659  C C5    . DG  B 2 18  ? 31.246  5.769   -2.776  1.00 81.01  ? 18  DG  D C5    1 
ATOM   660  C C6    . DG  B 2 18  ? 30.621  4.498   -2.670  1.00 79.13  ? 18  DG  D C6    1 
ATOM   661  O O6    . DG  B 2 18  ? 31.148  3.387   -2.542  1.00 77.62  ? 18  DG  D O6    1 
ATOM   662  N N1    . DG  B 2 18  ? 29.236  4.602   -2.727  1.00 78.36  ? 18  DG  D N1    1 
ATOM   663  C C2    . DG  B 2 18  ? 28.536  5.774   -2.870  1.00 79.00  ? 18  DG  D C2    1 
ATOM   664  N N2    . DG  B 2 18  ? 27.195  5.657   -2.907  1.00 76.73  ? 18  DG  D N2    1 
ATOM   665  N N3    . DG  B 2 18  ? 29.105  6.971   -2.971  1.00 80.80  ? 18  DG  D N3    1 
ATOM   666  C C4    . DG  B 2 18  ? 30.454  6.894   -2.914  1.00 82.47  ? 18  DG  D C4    1 
ATOM   667  P P     . DC  B 2 19  ? 30.656  13.211  -1.037  1.00 96.38  ? 19  DC  D P     1 
ATOM   668  O OP1   . DC  B 2 19  ? 31.243  14.567  -1.248  1.00 98.23  ? 19  DC  D OP1   1 
ATOM   669  O OP2   . DC  B 2 19  ? 31.177  12.346  0.062   1.00 96.00  ? 19  DC  D OP2   1 
ATOM   670  O "O5'" . DC  B 2 19  ? 29.093  13.389  -0.789  1.00 97.27  ? 19  DC  D "O5'" 1 
ATOM   671  C "C5'" . DC  B 2 19  ? 28.142  12.541  -1.430  1.00 98.07  ? 19  DC  D "C5'" 1 
ATOM   672  C "C4'" . DC  B 2 19  ? 27.615  11.515  -0.452  1.00 98.86  ? 19  DC  D "C4'" 1 
ATOM   673  O "O4'" . DC  B 2 19  ? 28.245  10.216  -0.632  1.00 97.01  ? 19  DC  D "O4'" 1 
ATOM   674  C "C3'" . DC  B 2 19  ? 27.796  11.877  1.026   1.00 98.02  ? 19  DC  D "C3'" 1 
ATOM   675  O "O3'" . DC  B 2 19  ? 26.628  11.493  1.753   1.00 98.64  ? 19  DC  D "O3'" 1 
ATOM   676  C "C2'" . DC  B 2 19  ? 28.931  10.966  1.456   1.00 98.21  ? 19  DC  D "C2'" 1 
ATOM   677  C "C1'" . DC  B 2 19  ? 28.582  9.726   0.657   1.00 96.42  ? 19  DC  D "C1'" 1 
ATOM   678  N N1    . DC  B 2 19  ? 29.636  8.699   0.532   1.00 94.36  ? 19  DC  D N1    1 
ATOM   679  C C2    . DC  B 2 19  ? 29.266  7.398   0.146   1.00 93.35  ? 19  DC  D C2    1 
ATOM   680  O O2    . DC  B 2 19  ? 28.069  7.163   -0.123  1.00 91.47  ? 19  DC  D O2    1 
ATOM   681  N N3    . DC  B 2 19  ? 30.219  6.432   0.080   1.00 92.33  ? 19  DC  D N3    1 
ATOM   682  C C4    . DC  B 2 19  ? 31.494  6.728   0.374   1.00 91.93  ? 19  DC  D C4    1 
ATOM   683  N N4    . DC  B 2 19  ? 32.402  5.744   0.306   1.00 90.22  ? 19  DC  D N4    1 
ATOM   684  C C5    . DC  B 2 19  ? 31.896  8.044   0.752   1.00 91.70  ? 19  DC  D C5    1 
ATOM   685  C C6    . DC  B 2 19  ? 30.945  8.989   0.815   1.00 93.18  ? 19  DC  D C6    1 
ATOM   686  P P     . DT  B 2 20  ? 26.041  12.455  2.905   1.00 97.90  ? 20  DT  D P     1 
ATOM   687  O OP1   . DT  B 2 20  ? 26.448  13.868  2.643   1.00 98.88  ? 20  DT  D OP1   1 
ATOM   688  O OP2   . DT  B 2 20  ? 26.367  11.821  4.220   1.00 99.10  ? 20  DT  D OP2   1 
ATOM   689  O "O5'" . DT  B 2 20  ? 24.472  12.334  2.667   1.00 96.94  ? 20  DT  D "O5'" 1 
ATOM   690  C "C5'" . DT  B 2 20  ? 23.969  11.496  1.630   1.00 94.14  ? 20  DT  D "C5'" 1 
ATOM   691  C "C4'" . DT  B 2 20  ? 23.789  10.087  2.148   1.00 93.20  ? 20  DT  D "C4'" 1 
ATOM   692  O "O4'" . DT  B 2 20  ? 25.019  9.312   2.098   1.00 91.12  ? 20  DT  D "O4'" 1 
ATOM   693  C "C3'" . DT  B 2 20  ? 23.312  10.027  3.600   1.00 91.02  ? 20  DT  D "C3'" 1 
ATOM   694  O "O3'" . DT  B 2 20  ? 22.257  9.073   3.720   1.00 89.71  ? 20  DT  D "O3'" 1 
ATOM   695  C "C2'" . DT  B 2 20  ? 24.543  9.551   4.358   1.00 91.13  ? 20  DT  D "C2'" 1 
ATOM   696  C "C1'" . DT  B 2 20  ? 25.159  8.620   3.334   1.00 89.38  ? 20  DT  D "C1'" 1 
ATOM   697  N N1    . DT  B 2 20  ? 26.587  8.251   3.530   1.00 86.77  ? 20  DT  D N1    1 
ATOM   698  C C2    . DT  B 2 20  ? 26.923  6.912   3.418   1.00 85.26  ? 20  DT  D C2    1 
ATOM   699  O O2    . DT  B 2 20  ? 26.109  6.035   3.170   1.00 84.42  ? 20  DT  D O2    1 
ATOM   700  N N3    . DT  B 2 20  ? 28.259  6.635   3.609   1.00 84.23  ? 20  DT  D N3    1 
ATOM   701  C C4    . DT  B 2 20  ? 29.266  7.539   3.891   1.00 83.98  ? 20  DT  D C4    1 
ATOM   702  O O4    . DT  B 2 20  ? 30.425  7.145   4.031   1.00 83.44  ? 20  DT  D O4    1 
ATOM   703  C C5    . DT  B 2 20  ? 28.846  8.918   3.998   1.00 84.10  ? 20  DT  D C5    1 
ATOM   704  C C7    . DT  B 2 20  ? 29.873  9.962   4.306   1.00 84.00  ? 20  DT  D C7    1 
ATOM   705  C C6    . DT  B 2 20  ? 27.546  9.202   3.816   1.00 85.17  ? 20  DT  D C6    1 
ATOM   706  P P     . DA  B 2 21  ? 21.366  9.054   5.053   1.00 88.02  ? 21  DA  D P     1 
ATOM   707  O OP1   . DA  B 2 21  ? 20.392  7.926   4.950   1.00 87.60  ? 21  DA  D OP1   1 
ATOM   708  O OP2   . DA  B 2 21  ? 20.867  10.441  5.267   1.00 89.51  ? 21  DA  D OP2   1 
ATOM   709  O "O5'" . DA  B 2 21  ? 22.441  8.722   6.182   1.00 86.76  ? 21  DA  D "O5'" 1 
ATOM   710  C "C5'" . DA  B 2 21  ? 23.169  7.496   6.142   1.00 83.99  ? 21  DA  D "C5'" 1 
ATOM   711  C "C4'" . DA  B 2 21  ? 23.200  6.883   7.518   1.00 82.64  ? 21  DA  D "C4'" 1 
ATOM   712  O "O4'" . DA  B 2 21  ? 24.375  7.309   8.249   1.00 80.49  ? 21  DA  D "O4'" 1 
ATOM   713  C "C3'" . DA  B 2 21  ? 21.998  7.304   8.354   1.00 80.94  ? 21  DA  D "C3'" 1 
ATOM   714  O "O3'" . DA  B 2 21  ? 21.488  6.196   9.080   1.00 81.14  ? 21  DA  D "O3'" 1 
ATOM   715  C "C2'" . DA  B 2 21  ? 22.566  8.352   9.297   1.00 80.35  ? 21  DA  D "C2'" 1 
ATOM   716  C "C1'" . DA  B 2 21  ? 23.986  7.859   9.499   1.00 78.52  ? 21  DA  D "C1'" 1 
ATOM   717  N N9    . DA  B 2 21  ? 24.960  8.892   9.858   1.00 75.69  ? 21  DA  D N9    1 
ATOM   718  C C8    . DA  B 2 21  ? 25.298  10.023  9.151   1.00 74.50  ? 21  DA  D C8    1 
ATOM   719  N N7    . DA  B 2 21  ? 26.233  10.746  9.724   1.00 73.85  ? 21  DA  D N7    1 
ATOM   720  C C5    . DA  B 2 21  ? 26.528  10.047  10.891  1.00 73.51  ? 21  DA  D C5    1 
ATOM   721  C C6    . DA  B 2 21  ? 27.445  10.290  11.944  1.00 72.25  ? 21  DA  D C6    1 
ATOM   722  N N6    . DA  B 2 21  ? 28.261  11.346  11.992  1.00 70.30  ? 21  DA  D N6    1 
ATOM   723  N N1    . DA  B 2 21  ? 27.489  9.396   12.958  1.00 71.66  ? 21  DA  D N1    1 
ATOM   724  C C2    . DA  B 2 21  ? 26.667  8.337   12.912  1.00 72.36  ? 21  DA  D C2    1 
ATOM   725  N N3    . DA  B 2 21  ? 25.765  8.002   11.983  1.00 72.89  ? 21  DA  D N3    1 
ATOM   726  C C4    . DA  B 2 21  ? 25.746  8.907   10.989  1.00 73.81  ? 21  DA  D C4    1 
ATOM   727  P P     . DA  B 2 22  ? 20.227  6.409   10.040  1.00 80.91  ? 22  DA  D P     1 
ATOM   728  O OP1   . DA  B 2 22  ? 19.404  5.168   10.038  1.00 81.59  ? 22  DA  D OP1   1 
ATOM   729  O OP2   . DA  B 2 22  ? 19.609  7.710   9.653   1.00 80.50  ? 22  DA  D OP2   1 
ATOM   730  O "O5'" . DA  B 2 22  ? 20.893  6.578   11.478  1.00 80.01  ? 22  DA  D "O5'" 1 
ATOM   731  C "C5'" . DA  B 2 22  ? 21.470  5.458   12.141  1.00 77.70  ? 22  DA  D "C5'" 1 
ATOM   732  C "C4'" . DA  B 2 22  ? 21.515  5.707   13.630  1.00 75.58  ? 22  DA  D "C4'" 1 
ATOM   733  O "O4'" . DA  B 2 22  ? 22.606  6.609   13.947  1.00 74.21  ? 22  DA  D "O4'" 1 
ATOM   734  C "C3'" . DA  B 2 22  ? 20.241  6.346   14.184  1.00 73.30  ? 22  DA  D "C3'" 1 
ATOM   735  O "O3'" . DA  B 2 22  ? 19.873  5.717   15.417  1.00 69.66  ? 22  DA  D "O3'" 1 
ATOM   736  C "C2'" . DA  B 2 22  ? 20.617  7.811   14.352  1.00 73.79  ? 22  DA  D "C2'" 1 
ATOM   737  C "C1'" . DA  B 2 22  ? 22.124  7.776   14.596  1.00 73.95  ? 22  DA  D "C1'" 1 
ATOM   738  N N9    . DA  B 2 22  ? 22.850  8.924   14.042  1.00 74.47  ? 22  DA  D N9    1 
ATOM   739  C C8    . DA  B 2 22  ? 22.612  9.564   12.847  1.00 74.18  ? 22  DA  D C8    1 
ATOM   740  N N7    . DA  B 2 22  ? 23.416  10.576  12.618  1.00 74.57  ? 22  DA  D N7    1 
ATOM   741  C C5    . DA  B 2 22  ? 24.244  10.606  13.733  1.00 74.92  ? 22  DA  D C5    1 
ATOM   742  C C6    . DA  B 2 22  ? 25.313  11.456  14.101  1.00 74.94  ? 22  DA  D C6    1 
ATOM   743  N N6    . DA  B 2 22  ? 25.736  12.480  13.355  1.00 74.62  ? 22  DA  D N6    1 
ATOM   744  N N1    . DA  B 2 22  ? 25.937  11.214  15.279  1.00 74.87  ? 22  DA  D N1    1 
ATOM   745  C C2    . DA  B 2 22  ? 25.503  10.191  16.030  1.00 74.90  ? 22  DA  D C2    1 
ATOM   746  N N3    . DA  B 2 22  ? 24.508  9.328   15.796  1.00 75.70  ? 22  DA  D N3    1 
ATOM   747  C C4    . DA  B 2 22  ? 23.911  9.592   14.617  1.00 75.05  ? 22  DA  D C4    1 
ATOM   748  P P     . DT  B 2 23  ? 18.655  6.305   16.285  1.00 66.92  ? 23  DT  D P     1 
ATOM   749  O OP1   . DT  B 2 23  ? 18.156  5.217   17.169  1.00 64.24  ? 23  DT  D OP1   1 
ATOM   750  O OP2   . DT  B 2 23  ? 17.714  7.000   15.364  1.00 66.15  ? 23  DT  D OP2   1 
ATOM   751  O "O5'" . DT  B 2 23  ? 19.377  7.397   17.188  1.00 66.15  ? 23  DT  D "O5'" 1 
ATOM   752  C "C5'" . DT  B 2 23  ? 20.637  7.102   17.786  1.00 65.92  ? 23  DT  D "C5'" 1 
ATOM   753  C "C4'" . DT  B 2 23  ? 21.166  8.308   18.523  1.00 65.85  ? 23  DT  D "C4'" 1 
ATOM   754  O "O4'" . DT  B 2 23  ? 21.900  9.209   17.653  1.00 66.78  ? 23  DT  D "O4'" 1 
ATOM   755  C "C3'" . DT  B 2 23  ? 20.083  9.145   19.199  1.00 65.04  ? 23  DT  D "C3'" 1 
ATOM   756  O "O3'" . DT  B 2 23  ? 20.517  9.484   20.505  1.00 62.99  ? 23  DT  D "O3'" 1 
ATOM   757  C "C2'" . DT  B 2 23  ? 20.040  10.408  18.356  1.00 66.62  ? 23  DT  D "C2'" 1 
ATOM   758  C "C1'" . DT  B 2 23  ? 21.496  10.535  17.949  1.00 67.99  ? 23  DT  D "C1'" 1 
ATOM   759  N N1    . DT  B 2 23  ? 21.767  11.399  16.773  1.00 69.64  ? 23  DT  D N1    1 
ATOM   760  C C2    . DT  B 2 23  ? 22.851  12.257  16.835  1.00 70.27  ? 23  DT  D C2    1 
ATOM   761  O O2    . DT  B 2 23  ? 23.602  12.316  17.792  1.00 71.92  ? 23  DT  D O2    1 
ATOM   762  N N3    . DT  B 2 23  ? 23.022  13.051  15.729  1.00 71.32  ? 23  DT  D N3    1 
ATOM   763  C C4    . DT  B 2 23  ? 22.238  13.075  14.591  1.00 71.99  ? 23  DT  D C4    1 
ATOM   764  O O4    . DT  B 2 23  ? 22.510  13.848  13.677  1.00 73.68  ? 23  DT  D O4    1 
ATOM   765  C C5    . DT  B 2 23  ? 21.126  12.147  14.586  1.00 72.01  ? 23  DT  D C5    1 
ATOM   766  C C7    . DT  B 2 23  ? 20.225  12.107  13.393  1.00 72.74  ? 23  DT  D C7    1 
ATOM   767  C C6    . DT  B 2 23  ? 20.952  11.362  15.661  1.00 70.76  ? 23  DT  D C6    1 
ATOM   768  P P     . DA  B 2 24  ? 19.495  9.381   21.733  1.00 60.73  ? 24  DA  D P     1 
ATOM   769  O OP1   . DA  B 2 24  ? 19.310  7.950   22.085  1.00 58.14  ? 24  DA  D OP1   1 
ATOM   770  O OP2   . DA  B 2 24  ? 18.315  10.209  21.380  1.00 61.30  ? 24  DA  D OP2   1 
ATOM   771  O "O5'" . DA  B 2 24  ? 20.308  10.097  22.895  1.00 60.08  ? 24  DA  D "O5'" 1 
ATOM   772  C "C5'" . DA  B 2 24  ? 21.706  9.857   23.049  1.00 59.63  ? 24  DA  D "C5'" 1 
ATOM   773  C "C4'" . DA  B 2 24  ? 22.454  11.163  23.184  1.00 60.82  ? 24  DA  D "C4'" 1 
ATOM   774  O "O4'" . DA  B 2 24  ? 22.641  11.815  21.902  1.00 60.79  ? 24  DA  D "O4'" 1 
ATOM   775  C "C3'" . DA  B 2 24  ? 21.784  12.195  24.092  1.00 61.17  ? 24  DA  D "C3'" 1 
ATOM   776  O "O3'" . DA  B 2 24  ? 22.790  12.847  24.856  1.00 61.68  ? 24  DA  D "O3'" 1 
ATOM   777  C "C2'" . DA  B 2 24  ? 21.192  13.188  23.109  1.00 61.39  ? 24  DA  D "C2'" 1 
ATOM   778  C "C1'" . DA  B 2 24  ? 22.235  13.172  22.007  1.00 62.45  ? 24  DA  D "C1'" 1 
ATOM   779  N N9    . DA  B 2 24  ? 21.757  13.608  20.693  1.00 64.95  ? 24  DA  D N9    1 
ATOM   780  C C8    . DA  B 2 24  ? 20.642  13.174  20.022  1.00 65.18  ? 24  DA  D C8    1 
ATOM   781  N N7    . DA  B 2 24  ? 20.477  13.737  18.850  1.00 65.23  ? 24  DA  D N7    1 
ATOM   782  C C5    . DA  B 2 24  ? 21.553  14.606  18.742  1.00 66.48  ? 24  DA  D C5    1 
ATOM   783  C C6    . DA  B 2 24  ? 21.951  15.500  17.724  1.00 67.33  ? 24  DA  D C6    1 
ATOM   784  N N6    . DA  B 2 24  ? 21.282  15.660  16.582  1.00 68.35  ? 24  DA  D N6    1 
ATOM   785  N N1    . DA  B 2 24  ? 23.074  16.229  17.924  1.00 67.99  ? 24  DA  D N1    1 
ATOM   786  C C2    . DA  B 2 24  ? 23.744  16.058  19.074  1.00 67.90  ? 24  DA  D C2    1 
ATOM   787  N N3    . DA  B 2 24  ? 23.470  15.249  20.104  1.00 67.74  ? 24  DA  D N3    1 
ATOM   788  C C4    . DA  B 2 24  ? 22.348  14.542  19.871  1.00 66.07  ? 24  DA  D C4    1 
ATOM   789  P P     . DA  B 2 25  ? 22.471  13.345  26.345  1.00 61.69  ? 25  DA  D P     1 
ATOM   790  O OP1   . DA  B 2 25  ? 22.757  12.221  27.272  1.00 60.49  ? 25  DA  D OP1   1 
ATOM   791  O OP2   . DA  B 2 25  ? 21.131  13.983  26.352  1.00 61.65  ? 25  DA  D OP2   1 
ATOM   792  O "O5'" . DA  B 2 25  ? 23.568  14.477  26.564  1.00 64.48  ? 25  DA  D "O5'" 1 
ATOM   793  C "C5'" . DA  B 2 25  ? 24.929  14.240  26.205  1.00 68.67  ? 25  DA  D "C5'" 1 
ATOM   794  C "C4'" . DA  B 2 25  ? 25.542  15.485  25.609  1.00 70.60  ? 25  DA  D "C4'" 1 
ATOM   795  O "O4'" . DA  B 2 25  ? 24.983  15.741  24.294  1.00 71.49  ? 25  DA  D "O4'" 1 
ATOM   796  C "C3'" . DA  B 2 25  ? 25.310  16.755  26.430  1.00 71.72  ? 25  DA  D "C3'" 1 
ATOM   797  O "O3'" . DA  B 2 25  ? 26.508  17.545  26.475  1.00 72.61  ? 25  DA  D "O3'" 1 
ATOM   798  C "C2'" . DA  B 2 25  ? 24.201  17.467  25.674  1.00 72.07  ? 25  DA  D "C2'" 1 
ATOM   799  C "C1'" . DA  B 2 25  ? 24.486  17.072  24.234  1.00 73.03  ? 25  DA  D "C1'" 1 
ATOM   800  N N9    . DA  B 2 25  ? 23.310  17.085  23.358  1.00 74.38  ? 25  DA  D N9    1 
ATOM   801  C C8    . DA  B 2 25  ? 22.111  16.444  23.557  1.00 75.11  ? 25  DA  D C8    1 
ATOM   802  N N7    . DA  B 2 25  ? 21.236  16.645  22.600  1.00 74.88  ? 25  DA  D N7    1 
ATOM   803  C C5    . DA  B 2 25  ? 21.903  17.473  21.707  1.00 75.43  ? 25  DA  D C5    1 
ATOM   804  C C6    . DA  B 2 25  ? 21.517  18.046  20.480  1.00 75.27  ? 25  DA  D C6    1 
ATOM   805  N N6    . DA  B 2 25  ? 20.322  17.857  19.920  1.00 75.14  ? 25  DA  D N6    1 
ATOM   806  N N1    . DA  B 2 25  ? 22.413  18.830  19.839  1.00 75.76  ? 25  DA  D N1    1 
ATOM   807  C C2    . DA  B 2 25  ? 23.614  19.017  20.404  1.00 76.31  ? 25  DA  D C2    1 
ATOM   808  N N3    . DA  B 2 25  ? 24.096  18.529  21.551  1.00 76.93  ? 25  DA  D N3    1 
ATOM   809  C C4    . DA  B 2 25  ? 23.180  17.755  22.161  1.00 75.49  ? 25  DA  D C4    1 
ATOM   810  P P     . DA  B 2 26  ? 26.523  18.934  27.291  1.00 72.97  ? 26  DA  D P     1 
ATOM   811  O OP1   . DA  B 2 26  ? 27.713  18.975  28.179  1.00 74.48  ? 26  DA  D OP1   1 
ATOM   812  O OP2   . DA  B 2 26  ? 25.169  19.147  27.870  1.00 72.91  ? 26  DA  D OP2   1 
ATOM   813  O "O5'" . DA  B 2 26  ? 26.724  20.019  26.147  1.00 74.00  ? 26  DA  D "O5'" 1 
ATOM   814  C "C5'" . DA  B 2 26  ? 25.887  20.011  24.998  1.00 74.75  ? 26  DA  D "C5'" 1 
ATOM   815  C "C4'" . DA  B 2 26  ? 26.168  21.213  24.130  1.00 75.62  ? 26  DA  D "C4'" 1 
ATOM   816  O "O4'" . DA  B 2 26  ? 25.269  21.142  23.003  1.00 74.04  ? 26  DA  D "O4'" 1 
ATOM   817  C "C3'" . DA  B 2 26  ? 25.887  22.551  24.811  1.00 75.89  ? 26  DA  D "C3'" 1 
ATOM   818  O "O3'" . DA  B 2 26  ? 26.783  23.565  24.320  1.00 77.05  ? 26  DA  D "O3'" 1 
ATOM   819  C "C2'" . DA  B 2 26  ? 24.442  22.829  24.446  1.00 75.67  ? 26  DA  D "C2'" 1 
ATOM   820  C "C1'" . DA  B 2 26  ? 24.278  22.156  23.090  1.00 74.43  ? 26  DA  D "C1'" 1 
ATOM   821  N N9    . DA  B 2 26  ? 22.977  21.509  22.930  1.00 73.82  ? 26  DA  D N9    1 
ATOM   822  C C8    . DA  B 2 26  ? 22.360  20.632  23.791  1.00 73.42  ? 26  DA  D C8    1 
ATOM   823  N N7    . DA  B 2 26  ? 21.184  20.226  23.377  1.00 73.66  ? 26  DA  D N7    1 
ATOM   824  C C5    . DA  B 2 26  ? 21.018  20.876  22.161  1.00 73.58  ? 26  DA  D C5    1 
ATOM   825  C C6    . DA  B 2 26  ? 19.975  20.868  21.216  1.00 73.51  ? 26  DA  D C6    1 
ATOM   826  N N6    . DA  B 2 26  ? 18.854  20.152  21.350  1.00 71.97  ? 26  DA  D N6    1 
ATOM   827  N N1    . DA  B 2 26  ? 20.127  21.631  20.111  1.00 73.41  ? 26  DA  D N1    1 
ATOM   828  C C2    . DA  B 2 26  ? 21.251  22.347  19.973  1.00 73.75  ? 26  DA  D C2    1 
ATOM   829  N N3    . DA  B 2 26  ? 22.299  22.435  20.787  1.00 73.48  ? 26  DA  D N3    1 
ATOM   830  C C4    . DA  B 2 26  ? 22.117  21.667  21.874  1.00 73.36  ? 26  DA  D C4    1 
ATOM   831  P P     . DC  B 2 27  ? 26.608  25.098  24.799  1.00 76.79  ? 27  DC  D P     1 
ATOM   832  O OP1   . DC  B 2 27  ? 27.913  25.792  24.610  1.00 77.19  ? 27  DC  D OP1   1 
ATOM   833  O OP2   . DC  B 2 27  ? 25.959  25.097  26.141  1.00 74.89  ? 27  DC  D OP2   1 
ATOM   834  O "O5'" . DC  B 2 27  ? 25.565  25.692  23.748  1.00 76.26  ? 27  DC  D "O5'" 1 
ATOM   835  C "C5'" . DC  B 2 27  ? 25.701  25.407  22.354  1.00 74.84  ? 27  DC  D "C5'" 1 
ATOM   836  C "C4'" . DC  B 2 27  ? 24.545  25.995  21.579  1.00 73.77  ? 27  DC  D "C4'" 1 
ATOM   837  O "O4'" . DC  B 2 27  ? 23.378  25.130  21.589  1.00 73.38  ? 27  DC  D "O4'" 1 
ATOM   838  C "C3'" . DC  B 2 27  ? 24.068  27.361  22.078  1.00 72.20  ? 27  DC  D "C3'" 1 
ATOM   839  O "O3'" . DC  B 2 27  ? 23.857  28.220  20.965  1.00 69.68  ? 27  DC  D "O3'" 1 
ATOM   840  C "C2'" . DC  B 2 27  ? 22.729  27.053  22.729  1.00 72.74  ? 27  DC  D "C2'" 1 
ATOM   841  C "C1'" . DC  B 2 27  ? 22.235  25.930  21.841  1.00 73.31  ? 27  DC  D "C1'" 1 
ATOM   842  N N1    . DC  B 2 27  ? 21.167  25.073  22.387  1.00 74.01  ? 27  DC  D N1    1 
ATOM   843  C C2    . DC  B 2 27  ? 19.925  25.078  21.737  1.00 74.29  ? 27  DC  D C2    1 
ATOM   844  O O2    . DC  B 2 27  ? 19.772  25.815  20.750  1.00 73.79  ? 27  DC  D O2    1 
ATOM   845  N N3    . DC  B 2 27  ? 18.929  24.287  22.200  1.00 74.51  ? 27  DC  D N3    1 
ATOM   846  C C4    . DC  B 2 27  ? 19.131  23.513  23.269  1.00 74.44  ? 27  DC  D C4    1 
ATOM   847  N N4    . DC  B 2 27  ? 18.114  22.741  23.679  1.00 73.88  ? 27  DC  D N4    1 
ATOM   848  C C5    . DC  B 2 27  ? 20.384  23.496  23.962  1.00 74.27  ? 27  DC  D C5    1 
ATOM   849  C C6    . DC  B 2 27  ? 21.366  24.285  23.489  1.00 74.17  ? 27  DC  D C6    1 
ATOM   850  P P     . DT  B 2 28  ? 23.826  29.806  21.183  1.00 68.46  ? 28  DT  D P     1 
ATOM   851  O OP1   . DT  B 2 28  ? 25.007  30.369  20.482  1.00 68.52  ? 28  DT  D OP1   1 
ATOM   852  O OP2   . DT  B 2 28  ? 23.629  30.073  22.630  1.00 67.01  ? 28  DT  D OP2   1 
ATOM   853  O "O5'" . DT  B 2 28  ? 22.507  30.249  20.410  1.00 69.20  ? 28  DT  D "O5'" 1 
ATOM   854  C "C5'" . DT  B 2 28  ? 22.273  29.806  19.080  1.00 71.40  ? 28  DT  D "C5'" 1 
ATOM   855  C "C4'" . DT  B 2 28  ? 20.821  29.996  18.711  1.00 74.12  ? 28  DT  D "C4'" 1 
ATOM   856  O "O4'" . DT  B 2 28  ? 19.988  28.994  19.349  1.00 74.23  ? 28  DT  D "O4'" 1 
ATOM   857  C "C3'" . DT  B 2 28  ? 20.233  31.353  19.100  1.00 74.80  ? 28  DT  D "C3'" 1 
ATOM   858  O "O3'" . DT  B 2 28  ? 19.489  31.885  18.003  1.00 76.08  ? 28  DT  D "O3'" 1 
ATOM   859  C "C2'" . DT  B 2 28  ? 19.312  31.026  20.267  1.00 75.58  ? 28  DT  D "C2'" 1 
ATOM   860  C "C1'" . DT  B 2 28  ? 18.851  29.621  19.922  1.00 75.57  ? 28  DT  D "C1'" 1 
ATOM   861  N N1    . DT  B 2 28  ? 18.384  28.787  21.060  1.00 76.96  ? 28  DT  D N1    1 
ATOM   862  C C2    . DT  B 2 28  ? 17.113  28.245  20.995  1.00 76.89  ? 28  DT  D C2    1 
ATOM   863  O O2    . DT  B 2 28  ? 16.348  28.437  20.066  1.00 77.07  ? 28  DT  D O2    1 
ATOM   864  N N3    . DT  B 2 28  ? 16.769  27.461  22.068  1.00 77.42  ? 28  DT  D N3    1 
ATOM   865  C C4    . DT  B 2 28  ? 17.544  27.174  23.176  1.00 78.05  ? 28  DT  D C4    1 
ATOM   866  O O4    . DT  B 2 28  ? 17.100  26.440  24.061  1.00 79.07  ? 28  DT  D O4    1 
ATOM   867  C C5    . DT  B 2 28  ? 18.856  27.784  23.187  1.00 78.12  ? 28  DT  D C5    1 
ATOM   868  C C7    . DT  B 2 28  ? 19.760  27.533  24.353  1.00 78.46  ? 28  DT  D C7    1 
ATOM   869  C C6    . DT  B 2 28  ? 19.205  28.551  22.144  1.00 77.69  ? 28  DT  D C6    1 
ATOM   870  P P     . DA  B 2 29  ? 18.846  33.350  18.119  1.00 77.28  ? 29  DA  D P     1 
ATOM   871  O OP1   . DA  B 2 29  ? 19.119  34.086  16.855  1.00 76.40  ? 29  DA  D OP1   1 
ATOM   872  O OP2   . DA  B 2 29  ? 19.292  33.925  19.416  1.00 78.11  ? 29  DA  D OP2   1 
ATOM   873  O "O5'" . DA  B 2 29  ? 17.279  33.068  18.229  1.00 78.37  ? 29  DA  D "O5'" 1 
ATOM   874  C "C5'" . DA  B 2 29  ? 16.625  32.203  17.298  1.00 80.10  ? 29  DA  D "C5'" 1 
ATOM   875  C "C4'" . DA  B 2 29  ? 15.196  31.952  17.724  1.00 80.96  ? 29  DA  D "C4'" 1 
ATOM   876  O "O4'" . DA  B 2 29  ? 15.140  31.071  18.874  1.00 80.73  ? 29  DA  D "O4'" 1 
ATOM   877  C "C3'" . DA  B 2 29  ? 14.411  33.203  18.116  1.00 80.37  ? 29  DA  D "C3'" 1 
ATOM   878  O "O3'" . DA  B 2 29  ? 13.063  33.070  17.666  1.00 79.90  ? 29  DA  D "O3'" 1 
ATOM   879  C "C2'" . DA  B 2 29  ? 14.448  33.173  19.633  1.00 81.03  ? 29  DA  D "C2'" 1 
ATOM   880  C "C1'" . DA  B 2 29  ? 14.368  31.683  19.900  1.00 81.06  ? 29  DA  D "C1'" 1 
ATOM   881  N N9    . DA  B 2 29  ? 14.897  31.243  21.192  1.00 81.34  ? 29  DA  D N9    1 
ATOM   882  C C8    . DA  B 2 29  ? 16.094  31.563  21.788  1.00 81.78  ? 29  DA  D C8    1 
ATOM   883  N N7    . DA  B 2 29  ? 16.281  30.977  22.949  1.00 82.09  ? 29  DA  D N7    1 
ATOM   884  C C5    . DA  B 2 29  ? 15.128  30.222  23.131  1.00 81.95  ? 29  DA  D C5    1 
ATOM   885  C C6    . DA  B 2 29  ? 14.708  29.356  24.165  1.00 81.79  ? 29  DA  D C6    1 
ATOM   886  N N6    . DA  B 2 29  ? 15.430  29.093  25.260  1.00 80.73  ? 29  DA  D N6    1 
ATOM   887  N N1    . DA  B 2 29  ? 13.500  28.760  24.032  1.00 81.82  ? 29  DA  D N1    1 
ATOM   888  C C2    . DA  B 2 29  ? 12.774  29.019  22.935  1.00 81.41  ? 29  DA  D C2    1 
ATOM   889  N N3    . DA  B 2 29  ? 13.060  29.807  21.899  1.00 81.43  ? 29  DA  D N3    1 
ATOM   890  C C4    . DA  B 2 29  ? 14.264  30.384  22.060  1.00 81.69  ? 29  DA  D C4    1 
ATOM   891  P P     . DA  B 2 30  ? 12.154  34.380  17.464  1.00 80.28  ? 30  DA  D P     1 
ATOM   892  O OP1   . DA  B 2 30  ? 11.833  34.516  16.014  1.00 79.40  ? 30  DA  D OP1   1 
ATOM   893  O OP2   . DA  B 2 30  ? 12.803  35.509  18.187  1.00 79.42  ? 30  DA  D OP2   1 
ATOM   894  O "O5'" . DA  B 2 30  ? 10.813  34.010  18.236  1.00 80.65  ? 30  DA  D "O5'" 1 
ATOM   895  C "C5'" . DA  B 2 30  ? 10.130  32.792  17.956  1.00 81.51  ? 30  DA  D "C5'" 1 
ATOM   896  C "C4'" . DA  B 2 30  ? 9.183   32.456  19.083  1.00 81.11  ? 30  DA  D "C4'" 1 
ATOM   897  O "O4'" . DA  B 2 30  ? 9.903   31.962  20.242  1.00 78.48  ? 30  DA  D "O4'" 1 
ATOM   898  C "C3'" . DA  B 2 30  ? 8.352   33.643  19.572  1.00 79.93  ? 30  DA  D "C3'" 1 
ATOM   899  O "O3'" . DA  B 2 30  ? 7.023   33.196  19.842  1.00 80.98  ? 30  DA  D "O3'" 1 
ATOM   900  C "C2'" . DA  B 2 30  ? 9.045   34.044  20.863  1.00 79.13  ? 30  DA  D "C2'" 1 
ATOM   901  C "C1'" . DA  B 2 30  ? 9.499   32.697  21.388  1.00 77.50  ? 30  DA  D "C1'" 1 
ATOM   902  N N9    . DA  B 2 30  ? 10.617  32.733  22.333  1.00 75.85  ? 30  DA  D N9    1 
ATOM   903  C C8    . DA  B 2 30  ? 11.726  33.548  22.343  1.00 75.61  ? 30  DA  D C8    1 
ATOM   904  N N7    . DA  B 2 30  ? 12.539  33.321  23.350  1.00 74.73  ? 30  DA  D N7    1 
ATOM   905  C C5    . DA  B 2 30  ? 11.923  32.290  24.048  1.00 73.86  ? 30  DA  D C5    1 
ATOM   906  C C6    . DA  B 2 30  ? 12.278  31.589  25.217  1.00 73.42  ? 30  DA  D C6    1 
ATOM   907  N N6    . DA  B 2 30  ? 13.380  31.831  25.924  1.00 71.64  ? 30  DA  D N6    1 
ATOM   908  N N1    . DA  B 2 30  ? 11.444  30.611  25.642  1.00 73.15  ? 30  DA  D N1    1 
ATOM   909  C C2    . DA  B 2 30  ? 10.336  30.363  24.932  1.00 73.32  ? 30  DA  D C2    1 
ATOM   910  N N3    . DA  B 2 30  ? 9.896   30.953  23.822  1.00 73.52  ? 30  DA  D N3    1 
ATOM   911  C C4    . DA  B 2 30  ? 10.744  31.917  23.429  1.00 74.21  ? 30  DA  D C4    1 
ATOM   912  P P     . DA  B 2 31  ? 5.888   34.255  20.260  1.00 81.18  ? 31  DA  D P     1 
ATOM   913  O OP1   . DA  B 2 31  ? 4.992   34.491  19.091  1.00 82.60  ? 31  DA  D OP1   1 
ATOM   914  O OP2   . DA  B 2 31  ? 6.545   35.411  20.935  1.00 80.59  ? 31  DA  D OP2   1 
ATOM   915  O "O5'" . DA  B 2 31  ? 5.058   33.453  21.351  1.00 79.02  ? 31  DA  D "O5'" 1 
ATOM   916  C "C5'" . DA  B 2 31  ? 4.940   32.037  21.265  1.00 74.63  ? 31  DA  D "C5'" 1 
ATOM   917  C "C4'" . DA  B 2 31  ? 4.599   31.478  22.622  1.00 72.31  ? 31  DA  D "C4'" 1 
ATOM   918  O "O4'" . DA  B 2 31  ? 5.783   31.428  23.458  1.00 70.02  ? 31  DA  D "O4'" 1 
ATOM   919  C "C3'" . DA  B 2 31  ? 3.583   32.344  23.362  1.00 70.07  ? 31  DA  D "C3'" 1 
ATOM   920  O "O3'" . DA  B 2 31  ? 2.619   31.524  24.008  1.00 68.26  ? 31  DA  D "O3'" 1 
ATOM   921  C "C2'" . DA  B 2 31  ? 4.425   33.118  24.363  1.00 69.37  ? 31  DA  D "C2'" 1 
ATOM   922  C "C1'" . DA  B 2 31  ? 5.576   32.167  24.651  1.00 68.47  ? 31  DA  D "C1'" 1 
ATOM   923  N N9    . DA  B 2 31  ? 6.839   32.822  24.998  1.00 67.18  ? 31  DA  D N9    1 
ATOM   924  C C8    . DA  B 2 31  ? 7.405   33.939  24.435  1.00 67.30  ? 31  DA  D C8    1 
ATOM   925  N N7    . DA  B 2 31  ? 8.553   34.280  24.972  1.00 67.62  ? 31  DA  D N7    1 
ATOM   926  C C5    . DA  B 2 31  ? 8.759   33.322  25.955  1.00 67.05  ? 31  DA  D C5    1 
ATOM   927  C C6    . DA  B 2 31  ? 9.802   33.119  26.889  1.00 68.05  ? 31  DA  D C6    1 
ATOM   928  N N6    . DA  B 2 31  ? 10.878  33.903  26.996  1.00 65.88  ? 31  DA  D N6    1 
ATOM   929  N N1    . DA  B 2 31  ? 9.695   32.064  27.728  1.00 68.63  ? 31  DA  D N1    1 
ATOM   930  C C2    . DA  B 2 31  ? 8.612   31.276  27.632  1.00 67.46  ? 31  DA  D C2    1 
ATOM   931  N N3    . DA  B 2 31  ? 7.574   31.365  26.804  1.00 65.35  ? 31  DA  D N3    1 
ATOM   932  C C4    . DA  B 2 31  ? 7.709   32.419  25.982  1.00 66.76  ? 31  DA  D C4    1 
ATOM   933  P P     . DA  B 2 32  ? 1.247   32.172  24.515  1.00 67.74  ? 32  DA  D P     1 
ATOM   934  O OP1   . DA  B 2 32  ? 0.134   31.264  24.138  1.00 66.61  ? 32  DA  D OP1   1 
ATOM   935  O OP2   . DA  B 2 32  ? 1.240   33.582  24.042  1.00 67.94  ? 32  DA  D OP2   1 
ATOM   936  O "O5'" . DA  B 2 32  ? 1.411   32.132  26.101  1.00 68.34  ? 32  DA  D "O5'" 1 
ATOM   937  C "C5'" . DA  B 2 32  ? 1.692   30.894  26.756  1.00 69.43  ? 32  DA  D "C5'" 1 
ATOM   938  C "C4'" . DA  B 2 32  ? 2.306   31.124  28.118  1.00 71.13  ? 32  DA  D "C4'" 1 
ATOM   939  O "O4'" . DA  B 2 32  ? 3.631   31.707  28.005  1.00 70.46  ? 32  DA  D "O4'" 1 
ATOM   940  C "C3'" . DA  B 2 32  ? 1.522   32.028  29.075  1.00 71.46  ? 32  DA  D "C3'" 1 
ATOM   941  O "O3'" . DA  B 2 32  ? 1.586   31.469  30.392  1.00 72.87  ? 32  DA  D "O3'" 1 
ATOM   942  C "C2'" . DA  B 2 32  ? 2.315   33.325  29.047  1.00 71.61  ? 32  DA  D "C2'" 1 
ATOM   943  C "C1'" . DA  B 2 32  ? 3.729   32.794  28.913  1.00 70.89  ? 32  DA  D "C1'" 1 
ATOM   944  N N9    . DA  B 2 32  ? 4.721   33.740  28.400  1.00 70.79  ? 32  DA  D N9    1 
ATOM   945  C C8    . DA  B 2 32  ? 4.604   34.623  27.353  1.00 70.59  ? 32  DA  D C8    1 
ATOM   946  N N7    . DA  B 2 32  ? 5.681   35.343  27.146  1.00 70.76  ? 32  DA  D N7    1 
ATOM   947  C C5    . DA  B 2 32  ? 6.569   34.907  28.123  1.00 70.45  ? 32  DA  D C5    1 
ATOM   948  C C6    . DA  B 2 32  ? 7.893   35.281  28.442  1.00 70.05  ? 32  DA  D C6    1 
ATOM   949  N N6    . DA  B 2 32  ? 8.582   36.217  27.781  1.00 69.93  ? 32  DA  D N6    1 
ATOM   950  N N1    . DA  B 2 32  ? 8.493   34.650  29.477  1.00 69.42  ? 32  DA  D N1    1 
ATOM   951  C C2    . DA  B 2 32  ? 7.804   33.711  30.141  1.00 69.59  ? 32  DA  D C2    1 
ATOM   952  N N3    . DA  B 2 32  ? 6.559   33.274  29.938  1.00 70.33  ? 32  DA  D N3    1 
ATOM   953  C C4    . DA  B 2 32  ? 5.991   33.919  28.901  1.00 70.39  ? 32  DA  D C4    1 
ATOM   954  P P     . DA  B 2 33  ? 0.344   31.634  31.398  1.00 73.54  ? 33  DA  D P     1 
ATOM   955  O OP1   . DA  B 2 33  ? -0.589  30.489  31.188  1.00 73.11  ? 33  DA  D OP1   1 
ATOM   956  O OP2   . DA  B 2 33  ? -0.162  33.026  31.277  1.00 75.01  ? 33  DA  D OP2   1 
ATOM   957  O "O5'" . DA  B 2 33  ? 1.021   31.460  32.828  1.00 73.96  ? 33  DA  D "O5'" 1 
ATOM   958  C "C5'" . DA  B 2 33  ? 1.864   30.342  33.099  1.00 75.46  ? 33  DA  D "C5'" 1 
ATOM   959  C "C4'" . DA  B 2 33  ? 2.994   30.747  34.018  1.00 78.18  ? 33  DA  D "C4'" 1 
ATOM   960  O "O4'" . DA  B 2 33  ? 3.919   31.603  33.303  1.00 76.80  ? 33  DA  D "O4'" 1 
ATOM   961  C "C3'" . DA  B 2 33  ? 2.549   31.532  35.254  1.00 78.99  ? 33  DA  D "C3'" 1 
ATOM   962  O "O3'" . DA  B 2 33  ? 3.279   31.123  36.413  1.00 82.43  ? 33  DA  D "O3'" 1 
ATOM   963  C "C2'" . DA  B 2 33  ? 2.872   32.972  34.903  1.00 78.71  ? 33  DA  D "C2'" 1 
ATOM   964  C "C1'" . DA  B 2 33  ? 4.078   32.839  33.989  1.00 76.11  ? 33  DA  D "C1'" 1 
ATOM   965  N N9    . DA  B 2 33  ? 4.150   33.900  32.986  1.00 73.69  ? 33  DA  D N9    1 
ATOM   966  C C8    . DA  B 2 33  ? 3.166   34.283  32.107  1.00 72.63  ? 33  DA  D C8    1 
ATOM   967  N N7    . DA  B 2 33  ? 3.510   35.279  31.327  1.00 71.83  ? 33  DA  D N7    1 
ATOM   968  C C5    . DA  B 2 33  ? 4.811   35.572  31.716  1.00 71.73  ? 33  DA  D C5    1 
ATOM   969  C C6    . DA  B 2 33  ? 5.736   36.535  31.273  1.00 70.87  ? 33  DA  D C6    1 
ATOM   970  N N6    . DA  B 2 33  ? 5.482   37.416  30.296  1.00 70.95  ? 33  DA  D N6    1 
ATOM   971  N N1    . DA  B 2 33  ? 6.947   36.562  31.874  1.00 70.22  ? 33  DA  D N1    1 
ATOM   972  C C2    . DA  B 2 33  ? 7.201   35.680  32.851  1.00 69.88  ? 33  DA  D C2    1 
ATOM   973  N N3    . DA  B 2 33  ? 6.415   34.731  33.355  1.00 70.93  ? 33  DA  D N3    1 
ATOM   974  C C4    . DA  B 2 33  ? 5.219   34.728  32.737  1.00 72.20  ? 33  DA  D C4    1 
ATOM   975  P P     . DC  B 2 34  ? 2.765   31.567  37.875  1.00 84.67  ? 34  DC  D P     1 
ATOM   976  O OP1   . DC  B 2 34  ? 3.213   30.523  38.842  1.00 84.69  ? 34  DC  D OP1   1 
ATOM   977  O OP2   . DC  B 2 34  ? 1.315   31.904  37.776  1.00 84.77  ? 34  DC  D OP2   1 
ATOM   978  O "O5'" . DC  B 2 34  ? 3.598   32.896  38.176  1.00 85.82  ? 34  DC  D "O5'" 1 
ATOM   979  C "C5'" . DC  B 2 34  ? 4.992   32.816  38.481  1.00 86.88  ? 34  DC  D "C5'" 1 
ATOM   980  C "C4'" . DC  B 2 34  ? 5.578   34.193  38.701  1.00 87.22  ? 34  DC  D "C4'" 1 
ATOM   981  O "O4'" . DC  B 2 34  ? 5.597   34.926  37.450  1.00 85.92  ? 34  DC  D "O4'" 1 
ATOM   982  C "C3'" . DC  B 2 34  ? 4.831   35.079  39.704  1.00 86.93  ? 34  DC  D "C3'" 1 
ATOM   983  O "O3'" . DC  B 2 34  ? 5.744   35.969  40.364  1.00 87.71  ? 34  DC  D "O3'" 1 
ATOM   984  C "C2'" . DC  B 2 34  ? 3.998   35.975  38.805  1.00 86.27  ? 34  DC  D "C2'" 1 
ATOM   985  C "C1'" . DC  B 2 34  ? 4.943   36.174  37.631  1.00 85.43  ? 34  DC  D "C1'" 1 
ATOM   986  N N1    . DC  B 2 34  ? 4.314   36.554  36.353  1.00 84.51  ? 34  DC  D N1    1 
ATOM   987  C C2    . DC  B 2 34  ? 5.108   37.178  35.381  1.00 83.91  ? 34  DC  D C2    1 
ATOM   988  O O2    . DC  B 2 34  ? 6.313   37.370  35.621  1.00 84.06  ? 34  DC  D O2    1 
ATOM   989  N N3    . DC  B 2 34  ? 4.548   37.553  34.208  1.00 83.20  ? 34  DC  D N3    1 
ATOM   990  C C4    . DC  B 2 34  ? 3.251   37.324  33.984  1.00 83.00  ? 34  DC  D C4    1 
ATOM   991  N N4    . DC  B 2 34  ? 2.744   37.717  32.808  1.00 83.44  ? 34  DC  D N4    1 
ATOM   992  C C5    . DC  B 2 34  ? 2.417   36.683  34.954  1.00 83.04  ? 34  DC  D C5    1 
ATOM   993  C C6    . DC  B 2 34  ? 2.985   36.318  36.113  1.00 83.78  ? 34  DC  D C6    1 
ATOM   994  N N     . GLY C 3 34  ? 8.608   39.080  43.252  1.00 50.74  ? 34  GLY A N     1 
ATOM   995  C CA    . GLY C 3 34  ? 8.988   37.917  42.390  1.00 50.85  ? 34  GLY A CA    1 
ATOM   996  C C     . GLY C 3 34  ? 9.935   36.970  43.110  1.00 50.29  ? 34  GLY A C     1 
ATOM   997  O O     . GLY C 3 34  ? 10.182  35.847  42.650  1.00 50.18  ? 34  GLY A O     1 
ATOM   998  N N     . ARG C 3 35  ? 10.466  37.431  44.243  1.00 47.55  ? 35  ARG A N     1 
ATOM   999  C CA    . ARG C 3 35  ? 11.391  36.642  45.058  1.00 44.73  ? 35  ARG A CA    1 
ATOM   1000 C C     . ARG C 3 35  ? 10.767  36.267  46.394  1.00 41.94  ? 35  ARG A C     1 
ATOM   1001 O O     . ARG C 3 35  ? 10.402  37.135  47.187  1.00 42.20  ? 35  ARG A O     1 
ATOM   1002 C CB    . ARG C 3 35  ? 12.674  37.433  45.338  1.00 45.68  ? 35  ARG A CB    1 
ATOM   1003 C CG    . ARG C 3 35  ? 13.561  37.651  44.133  1.00 48.63  ? 35  ARG A CG    1 
ATOM   1004 C CD    . ARG C 3 35  ? 14.526  38.795  44.375  1.00 51.41  ? 35  ARG A CD    1 
ATOM   1005 N NE    . ARG C 3 35  ? 15.484  38.928  43.284  1.00 56.04  ? 35  ARG A NE    1 
ATOM   1006 C CZ    . ARG C 3 35  ? 16.484  38.080  43.060  1.00 58.30  ? 35  ARG A CZ    1 
ATOM   1007 N NH1   . ARG C 3 35  ? 16.665  37.035  43.855  1.00 58.14  ? 35  ARG A NH1   1 
ATOM   1008 N NH2   . ARG C 3 35  ? 17.302  38.275  42.032  1.00 60.05  ? 35  ARG A NH2   1 
ATOM   1009 N N     . ASP C 3 36  ? 10.640  34.973  46.644  1.00 37.75  ? 36  ASP A N     1 
ATOM   1010 C CA    . ASP C 3 36  ? 10.100  34.532  47.908  1.00 34.14  ? 36  ASP A CA    1 
ATOM   1011 C C     . ASP C 3 36  ? 11.211  34.624  48.949  1.00 30.84  ? 36  ASP A C     1 
ATOM   1012 O O     . ASP C 3 36  ? 12.394  34.638  48.605  1.00 28.00  ? 36  ASP A O     1 
ATOM   1013 C CB    . ASP C 3 36  ? 9.578   33.108  47.790  1.00 37.18  ? 36  ASP A CB    1 
ATOM   1014 C CG    . ASP C 3 36  ? 8.374   33.012  46.869  1.00 42.45  ? 36  ASP A CG    1 
ATOM   1015 O OD1   . ASP C 3 36  ? 7.651   34.030  46.728  1.00 43.40  ? 36  ASP A OD1   1 
ATOM   1016 O OD2   . ASP C 3 36  ? 8.141   31.922  46.299  1.00 43.78  ? 36  ASP A OD2   1 
ATOM   1017 N N     . SER C 3 37  ? 10.823  34.715  50.216  1.00 28.02  ? 37  SER A N     1 
ATOM   1018 C CA    . SER C 3 37  ? 11.777  34.819  51.311  1.00 25.68  ? 37  SER A CA    1 
ATOM   1019 C C     . SER C 3 37  ? 11.609  33.735  52.367  1.00 24.83  ? 37  SER A C     1 
ATOM   1020 O O     . SER C 3 37  ? 10.508  33.498  52.874  1.00 20.70  ? 37  SER A O     1 
ATOM   1021 C CB    . SER C 3 37  ? 11.667  36.183  51.990  1.00 26.44  ? 37  SER A CB    1 
ATOM   1022 O OG    . SER C 3 37  ? 12.235  37.198  51.190  1.00 30.97  ? 37  SER A OG    1 
ATOM   1023 N N     . LEU C 3 38  ? 12.726  33.097  52.702  1.00 23.04  ? 38  LEU A N     1 
ATOM   1024 C CA    . LEU C 3 38  ? 12.744  32.043  53.703  1.00 22.49  ? 38  LEU A CA    1 
ATOM   1025 C C     . LEU C 3 38  ? 13.852  32.290  54.722  1.00 21.41  ? 38  LEU A C     1 
ATOM   1026 O O     . LEU C 3 38  ? 15.042  32.391  54.379  1.00 18.65  ? 38  LEU A O     1 
ATOM   1027 C CB    . LEU C 3 38  ? 12.947  30.683  53.028  1.00 23.23  ? 38  LEU A CB    1 
ATOM   1028 C CG    . LEU C 3 38  ? 13.013  29.424  53.894  1.00 25.13  ? 38  LEU A CG    1 
ATOM   1029 C CD1   . LEU C 3 38  ? 11.772  29.323  54.771  1.00 26.96  ? 38  LEU A CD1   1 
ATOM   1030 C CD2   . LEU C 3 38  ? 13.125  28.197  52.982  1.00 24.29  ? 38  LEU A CD2   1 
ATOM   1031 N N     . ILE C 3 39  ? 13.447  32.412  55.978  1.00 18.90  ? 39  ILE A N     1 
ATOM   1032 C CA    . ILE C 3 39  ? 14.396  32.615  57.051  1.00 15.15  ? 39  ILE A CA    1 
ATOM   1033 C C     . ILE C 3 39  ? 14.474  31.318  57.834  1.00 14.98  ? 39  ILE A C     1 
ATOM   1034 O O     . ILE C 3 39  ? 13.449  30.785  58.251  1.00 16.02  ? 39  ILE A O     1 
ATOM   1035 C CB    . ILE C 3 39  ? 13.941  33.726  58.015  1.00 15.81  ? 39  ILE A CB    1 
ATOM   1036 C CG1   . ILE C 3 39  ? 13.866  35.064  57.283  1.00 13.16  ? 39  ILE A CG1   1 
ATOM   1037 C CG2   . ILE C 3 39  ? 14.917  33.826  59.195  1.00 16.13  ? 39  ILE A CG2   1 
ATOM   1038 C CD1   . ILE C 3 39  ? 13.456  36.207  58.177  1.00 12.16  ? 39  ILE A CD1   1 
ATOM   1039 N N     . PHE C 3 40  ? 15.678  30.788  58.007  1.00 15.00  ? 40  PHE A N     1 
ATOM   1040 C CA    . PHE C 3 40  ? 15.845  29.561  58.791  1.00 13.31  ? 40  PHE A CA    1 
ATOM   1041 C C     . PHE C 3 40  ? 16.212  30.000  60.201  1.00 12.54  ? 40  PHE A C     1 
ATOM   1042 O O     . PHE C 3 40  ? 17.222  30.670  60.396  1.00 11.16  ? 40  PHE A O     1 
ATOM   1043 C CB    . PHE C 3 40  ? 16.956  28.684  58.216  1.00 14.19  ? 40  PHE A CB    1 
ATOM   1044 C CG    . PHE C 3 40  ? 16.683  28.202  56.829  1.00 12.97  ? 40  PHE A CG    1 
ATOM   1045 C CD1   . PHE C 3 40  ? 17.324  28.772  55.749  1.00 10.07  ? 40  PHE A CD1   1 
ATOM   1046 C CD2   . PHE C 3 40  ? 15.778  27.166  56.607  1.00 14.50  ? 40  PHE A CD2   1 
ATOM   1047 C CE1   . PHE C 3 40  ? 17.078  28.323  54.454  1.00 13.65  ? 40  PHE A CE1   1 
ATOM   1048 C CE2   . PHE C 3 40  ? 15.519  26.703  55.314  1.00 15.00  ? 40  PHE A CE2   1 
ATOM   1049 C CZ    . PHE C 3 40  ? 16.173  27.284  54.230  1.00 12.92  ? 40  PHE A CZ    1 
ATOM   1050 N N     . LEU C 3 41  ? 15.377  29.629  61.166  1.00 12.31  ? 41  LEU A N     1 
ATOM   1051 C CA    . LEU C 3 41  ? 15.559  30.001  62.565  1.00 12.61  ? 41  LEU A CA    1 
ATOM   1052 C C     . LEU C 3 41  ? 15.896  28.763  63.385  1.00 13.80  ? 41  LEU A C     1 
ATOM   1053 O O     . LEU C 3 41  ? 15.092  27.832  63.494  1.00 15.49  ? 41  LEU A O     1 
ATOM   1054 C CB    . LEU C 3 41  ? 14.272  30.659  63.066  1.00 13.49  ? 41  LEU A CB    1 
ATOM   1055 C CG    . LEU C 3 41  ? 14.223  31.232  64.477  1.00 14.50  ? 41  LEU A CG    1 
ATOM   1056 C CD1   . LEU C 3 41  ? 15.327  32.279  64.642  1.00 14.80  ? 41  LEU A CD1   1 
ATOM   1057 C CD2   . LEU C 3 41  ? 12.832  31.842  64.721  1.00 13.22  ? 41  LEU A CD2   1 
ATOM   1058 N N     . VAL C 3 42  ? 17.087  28.751  63.971  1.00 15.64  ? 42  VAL A N     1 
ATOM   1059 C CA    . VAL C 3 42  ? 17.543  27.582  64.725  1.00 15.43  ? 42  VAL A CA    1 
ATOM   1060 C C     . VAL C 3 42  ? 17.737  27.782  66.221  1.00 17.49  ? 42  VAL A C     1 
ATOM   1061 O O     . VAL C 3 42  ? 18.397  28.722  66.656  1.00 18.76  ? 42  VAL A O     1 
ATOM   1062 C CB    . VAL C 3 42  ? 18.864  27.060  64.113  1.00 15.65  ? 42  VAL A CB    1 
ATOM   1063 C CG1   . VAL C 3 42  ? 19.358  25.837  64.860  1.00 14.32  ? 42  VAL A CG1   1 
ATOM   1064 C CG2   . VAL C 3 42  ? 18.656  26.765  62.632  1.00 12.32  ? 42  VAL A CG2   1 
ATOM   1065 N N     . ASP C 3 43  ? 17.156  26.874  66.999  1.00 19.43  ? 43  ASP A N     1 
ATOM   1066 C CA    . ASP C 3 43  ? 17.253  26.901  68.450  1.00 21.21  ? 43  ASP A CA    1 
ATOM   1067 C C     . ASP C 3 43  ? 18.664  26.453  68.857  1.00 23.37  ? 43  ASP A C     1 
ATOM   1068 O O     . ASP C 3 43  ? 19.185  25.463  68.343  1.00 22.01  ? 43  ASP A O     1 
ATOM   1069 C CB    . ASP C 3 43  ? 16.190  25.962  69.039  1.00 22.09  ? 43  ASP A CB    1 
ATOM   1070 C CG    . ASP C 3 43  ? 16.116  26.012  70.568  1.00 24.22  ? 43  ASP A CG    1 
ATOM   1071 O OD1   . ASP C 3 43  ? 16.661  26.944  71.192  1.00 23.51  ? 43  ASP A OD1   1 
ATOM   1072 O OD2   . ASP C 3 43  ? 15.483  25.110  71.154  1.00 24.89  ? 43  ASP A OD2   1 
ATOM   1073 N N     . ALA C 3 44  ? 19.292  27.197  69.762  1.00 23.88  ? 44  ALA A N     1 
ATOM   1074 C CA    . ALA C 3 44  ? 20.629  26.841  70.220  1.00 24.31  ? 44  ALA A CA    1 
ATOM   1075 C C     . ALA C 3 44  ? 20.611  26.449  71.688  1.00 24.53  ? 44  ALA A C     1 
ATOM   1076 O O     . ALA C 3 44  ? 21.646  26.496  72.352  1.00 25.89  ? 44  ALA A O     1 
ATOM   1077 C CB    . ALA C 3 44  ? 21.603  27.997  69.998  1.00 22.17  ? 44  ALA A CB    1 
ATOM   1078 N N     . SER C 3 45  ? 19.438  26.066  72.193  1.00 24.20  ? 45  SER A N     1 
ATOM   1079 C CA    . SER C 3 45  ? 19.307  25.645  73.592  1.00 22.69  ? 45  SER A CA    1 
ATOM   1080 C C     . SER C 3 45  ? 20.126  24.380  73.852  1.00 23.33  ? 45  SER A C     1 
ATOM   1081 O O     . SER C 3 45  ? 20.532  23.682  72.922  1.00 23.03  ? 45  SER A O     1 
ATOM   1082 C CB    . SER C 3 45  ? 17.838  25.381  73.945  1.00 21.53  ? 45  SER A CB    1 
ATOM   1083 O OG    . SER C 3 45  ? 17.102  26.589  74.082  1.00 22.90  ? 45  SER A OG    1 
ATOM   1084 N N     . LYS C 3 46  ? 20.359  24.086  75.124  1.00 23.66  ? 46  LYS A N     1 
ATOM   1085 C CA    . LYS C 3 46  ? 21.129  22.918  75.521  1.00 23.51  ? 46  LYS A CA    1 
ATOM   1086 C C     . LYS C 3 46  ? 20.690  21.602  74.874  1.00 22.11  ? 46  LYS A C     1 
ATOM   1087 O O     . LYS C 3 46  ? 21.521  20.805  74.428  1.00 22.75  ? 46  LYS A O     1 
ATOM   1088 C CB    . LYS C 3 46  ? 21.071  22.760  77.042  1.00 27.11  ? 46  LYS A CB    1 
ATOM   1089 C CG    . LYS C 3 46  ? 21.681  21.465  77.541  1.00 32.40  ? 46  LYS A CG    1 
ATOM   1090 C CD    . LYS C 3 46  ? 21.440  21.233  79.023  1.00 36.74  ? 46  LYS A CD    1 
ATOM   1091 C CE    . LYS C 3 46  ? 22.101  19.931  79.453  1.00 40.27  ? 46  LYS A CE    1 
ATOM   1092 N NZ    . LYS C 3 46  ? 21.654  19.477  80.793  1.00 45.39  ? 46  LYS A NZ    1 
ATOM   1093 N N     . ALA C 3 47  ? 19.385  21.366  74.844  1.00 20.99  ? 47  ALA A N     1 
ATOM   1094 C CA    . ALA C 3 47  ? 18.849  20.136  74.288  1.00 18.13  ? 47  ALA A CA    1 
ATOM   1095 C C     . ALA C 3 47  ? 19.018  19.970  72.781  1.00 19.25  ? 47  ALA A C     1 
ATOM   1096 O O     . ALA C 3 47  ? 18.867  18.863  72.278  1.00 19.64  ? 47  ALA A O     1 
ATOM   1097 C CB    . ALA C 3 47  ? 17.390  20.007  74.662  1.00 17.65  ? 47  ALA A CB    1 
ATOM   1098 N N     . MET C 3 48  ? 19.313  21.046  72.055  1.00 18.86  ? 48  MET A N     1 
ATOM   1099 C CA    . MET C 3 48  ? 19.494  20.936  70.604  1.00 19.92  ? 48  MET A CA    1 
ATOM   1100 C C     . MET C 3 48  ? 20.804  20.227  70.297  1.00 21.85  ? 48  MET A C     1 
ATOM   1101 O O     . MET C 3 48  ? 20.986  19.706  69.203  1.00 22.17  ? 48  MET A O     1 
ATOM   1102 C CB    . MET C 3 48  ? 19.518  22.317  69.923  1.00 17.05  ? 48  MET A CB    1 
ATOM   1103 C CG    . MET C 3 48  ? 18.175  23.024  69.834  1.00 18.64  ? 48  MET A CG    1 
ATOM   1104 S SD    . MET C 3 48  ? 16.965  22.147  68.827  1.00 21.71  ? 48  MET A SD    1 
ATOM   1105 C CE    . MET C 3 48  ? 17.521  22.577  67.211  1.00 14.44  ? 48  MET A CE    1 
ATOM   1106 N N     . PHE C 3 49  ? 21.717  20.214  71.263  1.00 22.45  ? 49  PHE A N     1 
ATOM   1107 C CA    . PHE C 3 49  ? 23.012  19.578  71.061  1.00 23.87  ? 49  PHE A CA    1 
ATOM   1108 C C     . PHE C 3 49  ? 23.102  18.222  71.734  1.00 25.73  ? 49  PHE A C     1 
ATOM   1109 O O     . PHE C 3 49  ? 24.194  17.706  71.953  1.00 23.84  ? 49  PHE A O     1 
ATOM   1110 C CB    . PHE C 3 49  ? 24.134  20.476  71.581  1.00 21.05  ? 49  PHE A CB    1 
ATOM   1111 C CG    . PHE C 3 49  ? 24.122  21.854  70.990  1.00 22.18  ? 49  PHE A CG    1 
ATOM   1112 C CD1   . PHE C 3 49  ? 23.374  22.869  71.576  1.00 19.64  ? 49  PHE A CD1   1 
ATOM   1113 C CD2   . PHE C 3 49  ? 24.819  22.124  69.809  1.00 21.40  ? 49  PHE A CD2   1 
ATOM   1114 C CE1   . PHE C 3 49  ? 23.313  24.132  70.996  1.00 17.27  ? 49  PHE A CE1   1 
ATOM   1115 C CE2   . PHE C 3 49  ? 24.765  23.377  69.224  1.00 19.00  ? 49  PHE A CE2   1 
ATOM   1116 C CZ    . PHE C 3 49  ? 24.005  24.385  69.822  1.00 19.05  ? 49  PHE A CZ    1 
ATOM   1117 N N     . GLU C 3 50  ? 21.952  17.648  72.063  1.00 29.12  ? 50  GLU A N     1 
ATOM   1118 C CA    . GLU C 3 50  ? 21.925  16.346  72.713  1.00 34.09  ? 50  GLU A CA    1 
ATOM   1119 C C     . GLU C 3 50  ? 21.254  15.324  71.800  1.00 37.40  ? 50  GLU A C     1 
ATOM   1120 O O     . GLU C 3 50  ? 20.092  15.475  71.434  1.00 39.68  ? 50  GLU A O     1 
ATOM   1121 C CB    . GLU C 3 50  ? 21.190  16.461  74.053  1.00 32.43  ? 50  GLU A CB    1 
ATOM   1122 C CG    . GLU C 3 50  ? 21.736  17.576  74.928  1.00 31.38  ? 50  GLU A CG    1 
ATOM   1123 C CD    . GLU C 3 50  ? 20.984  17.740  76.233  1.00 33.22  ? 50  GLU A CD    1 
ATOM   1124 O OE1   . GLU C 3 50  ? 19.762  17.493  76.265  1.00 32.99  ? 50  GLU A OE1   1 
ATOM   1125 O OE2   . GLU C 3 50  ? 21.615  18.140  77.232  1.00 36.20  ? 50  GLU A OE2   1 
ATOM   1126 N N     . SER C 3 51  ? 21.988  14.288  71.422  1.00 42.50  ? 51  SER A N     1 
ATOM   1127 C CA    . SER C 3 51  ? 21.442  13.266  70.534  1.00 49.84  ? 51  SER A CA    1 
ATOM   1128 C C     . SER C 3 51  ? 20.351  12.443  71.211  1.00 54.27  ? 51  SER A C     1 
ATOM   1129 O O     . SER C 3 51  ? 19.512  11.838  70.541  1.00 55.04  ? 51  SER A O     1 
ATOM   1130 C CB    . SER C 3 51  ? 22.555  12.341  70.046  1.00 48.12  ? 51  SER A CB    1 
ATOM   1131 O OG    . SER C 3 51  ? 23.149  11.665  71.130  1.00 49.36  ? 51  SER A OG    1 
ATOM   1132 N N     . GLN C 3 52  ? 20.364  12.439  72.541  1.00 60.34  ? 52  GLN A N     1 
ATOM   1133 C CA    . GLN C 3 52  ? 19.388  11.697  73.333  1.00 65.58  ? 52  GLN A CA    1 
ATOM   1134 C C     . GLN C 3 52  ? 19.791  10.218  73.346  1.00 68.25  ? 52  GLN A C     1 
ATOM   1135 O O     . GLN C 3 52  ? 18.940  9.326   73.439  1.00 68.09  ? 52  GLN A O     1 
ATOM   1136 C CB    . GLN C 3 52  ? 17.973  11.870  72.747  1.00 68.28  ? 52  GLN A CB    1 
ATOM   1137 C CG    . GLN C 3 52  ? 17.528  13.336  72.558  1.00 70.27  ? 52  GLN A CG    1 
ATOM   1138 C CD    . GLN C 3 52  ? 16.143  13.466  71.928  1.00 70.46  ? 52  GLN A CD    1 
ATOM   1139 O OE1   . GLN C 3 52  ? 15.139  13.050  72.511  1.00 70.15  ? 52  GLN A OE1   1 
ATOM   1140 N NE2   . GLN C 3 52  ? 16.088  14.045  70.731  1.00 69.00  ? 52  GLN A NE2   1 
ATOM   1141 N N     . SER C 3 53  ? 21.103  9.986   73.251  1.00 70.81  ? 53  SER A N     1 
ATOM   1142 C CA    . SER C 3 53  ? 21.706  8.648   73.247  1.00 72.39  ? 53  SER A CA    1 
ATOM   1143 C C     . SER C 3 53  ? 21.245  7.751   72.093  1.00 72.68  ? 53  SER A C     1 
ATOM   1144 O O     . SER C 3 53  ? 20.367  6.903   72.267  1.00 73.51  ? 53  SER A O     1 
ATOM   1145 C CB    . SER C 3 53  ? 21.458  7.942   74.593  1.00 73.26  ? 53  SER A CB    1 
ATOM   1146 O OG    . SER C 3 53  ? 20.076  7.826   74.899  1.00 74.57  ? 53  SER A OG    1 
ATOM   1147 N N     . GLU C 3 54  ? 21.856  7.932   70.922  1.00 72.45  ? 54  GLU A N     1 
ATOM   1148 C CA    . GLU C 3 54  ? 21.513  7.150   69.730  1.00 71.17  ? 54  GLU A CA    1 
ATOM   1149 C C     . GLU C 3 54  ? 22.643  7.144   68.699  1.00 70.33  ? 54  GLU A C     1 
ATOM   1150 O O     . GLU C 3 54  ? 23.724  7.696   68.929  1.00 70.65  ? 54  GLU A O     1 
ATOM   1151 C CB    . GLU C 3 54  ? 20.263  7.732   69.059  1.00 71.25  ? 54  GLU A CB    1 
ATOM   1152 C CG    . GLU C 3 54  ? 18.999  7.673   69.889  1.00 71.08  ? 54  GLU A CG    1 
ATOM   1153 C CD    . GLU C 3 54  ? 17.878  8.488   69.286  1.00 71.52  ? 54  GLU A CD    1 
ATOM   1154 O OE1   . GLU C 3 54  ? 17.573  8.285   68.092  1.00 71.22  ? 54  GLU A OE1   1 
ATOM   1155 O OE2   . GLU C 3 54  ? 17.300  9.329   70.007  1.00 72.21  ? 54  GLU A OE2   1 
ATOM   1156 N N     . ASP C 3 55  ? 22.374  6.506   67.562  1.00 68.27  ? 55  ASP A N     1 
ATOM   1157 C CA    . ASP C 3 55  ? 23.322  6.444   66.450  1.00 66.24  ? 55  ASP A CA    1 
ATOM   1158 C C     . ASP C 3 55  ? 22.831  7.505   65.462  1.00 63.40  ? 55  ASP A C     1 
ATOM   1159 O O     . ASP C 3 55  ? 22.994  7.378   64.244  1.00 62.96  ? 55  ASP A O     1 
ATOM   1160 C CB    . ASP C 3 55  ? 23.293  5.061   65.774  1.00 67.97  ? 55  ASP A CB    1 
ATOM   1161 C CG    . ASP C 3 55  ? 23.643  3.924   66.729  1.00 69.10  ? 55  ASP A CG    1 
ATOM   1162 O OD1   . ASP C 3 55  ? 24.574  4.092   67.548  1.00 69.86  ? 55  ASP A OD1   1 
ATOM   1163 O OD2   . ASP C 3 55  ? 22.995  2.855   66.648  1.00 69.29  ? 55  ASP A OD2   1 
ATOM   1164 N N     . GLU C 3 56  ? 22.222  8.551   66.014  1.00 59.46  ? 56  GLU A N     1 
ATOM   1165 C CA    . GLU C 3 56  ? 21.652  9.636   65.225  1.00 54.23  ? 56  GLU A CA    1 
ATOM   1166 C C     . GLU C 3 56  ? 22.305  10.971  65.579  1.00 49.81  ? 56  GLU A C     1 
ATOM   1167 O O     . GLU C 3 56  ? 22.901  11.113  66.648  1.00 48.92  ? 56  GLU A O     1 
ATOM   1168 C CB    . GLU C 3 56  ? 20.141  9.695   65.485  1.00 55.69  ? 56  GLU A CB    1 
ATOM   1169 C CG    . GLU C 3 56  ? 19.358  10.600  64.548  1.00 58.65  ? 56  GLU A CG    1 
ATOM   1170 C CD    . GLU C 3 56  ? 19.503  10.202  63.090  1.00 59.64  ? 56  GLU A CD    1 
ATOM   1171 O OE1   . GLU C 3 56  ? 19.188  9.037   62.750  1.00 59.93  ? 56  GLU A OE1   1 
ATOM   1172 O OE2   . GLU C 3 56  ? 19.933  11.060  62.287  1.00 58.82  ? 56  GLU A OE2   1 
ATOM   1173 N N     . LEU C 3 57  ? 22.189  11.943  64.676  1.00 44.58  ? 57  LEU A N     1 
ATOM   1174 C CA    . LEU C 3 57  ? 22.769  13.265  64.884  1.00 39.31  ? 57  LEU A CA    1 
ATOM   1175 C C     . LEU C 3 57  ? 21.942  14.047  65.903  1.00 36.46  ? 57  LEU A C     1 
ATOM   1176 O O     . LEU C 3 57  ? 20.816  13.673  66.212  1.00 36.65  ? 57  LEU A O     1 
ATOM   1177 C CB    . LEU C 3 57  ? 22.786  14.056  63.569  1.00 38.00  ? 57  LEU A CB    1 
ATOM   1178 C CG    . LEU C 3 57  ? 23.070  13.384  62.219  1.00 36.94  ? 57  LEU A CG    1 
ATOM   1179 C CD1   . LEU C 3 57  ? 22.988  14.438  61.128  1.00 35.87  ? 57  LEU A CD1   1 
ATOM   1180 C CD2   . LEU C 3 57  ? 24.431  12.730  62.204  1.00 35.40  ? 57  LEU A CD2   1 
ATOM   1181 N N     . THR C 3 58  ? 22.505  15.132  66.427  1.00 31.99  ? 58  THR A N     1 
ATOM   1182 C CA    . THR C 3 58  ? 21.782  15.980  67.375  1.00 29.32  ? 58  THR A CA    1 
ATOM   1183 C C     . THR C 3 58  ? 20.751  16.784  66.587  1.00 26.20  ? 58  THR A C     1 
ATOM   1184 O O     . THR C 3 58  ? 20.888  16.964  65.379  1.00 26.59  ? 58  THR A O     1 
ATOM   1185 C CB    . THR C 3 58  ? 22.720  16.981  68.068  1.00 28.21  ? 58  THR A CB    1 
ATOM   1186 O OG1   . THR C 3 58  ? 23.336  17.828  67.082  1.00 25.43  ? 58  THR A OG1   1 
ATOM   1187 C CG2   . THR C 3 58  ? 23.794  16.241  68.851  1.00 27.85  ? 58  THR A CG2   1 
ATOM   1188 N N     . PRO C 3 59  ? 19.690  17.257  67.247  1.00 25.08  ? 59  PRO A N     1 
ATOM   1189 C CA    . PRO C 3 59  ? 18.722  18.032  66.461  1.00 23.94  ? 59  PRO A CA    1 
ATOM   1190 C C     . PRO C 3 59  ? 19.357  19.225  65.753  1.00 21.41  ? 59  PRO A C     1 
ATOM   1191 O O     . PRO C 3 59  ? 18.939  19.588  64.652  1.00 23.36  ? 59  PRO A O     1 
ATOM   1192 C CB    . PRO C 3 59  ? 17.659  18.429  67.489  1.00 26.19  ? 59  PRO A CB    1 
ATOM   1193 C CG    . PRO C 3 59  ? 18.313  18.144  68.851  1.00 27.55  ? 59  PRO A CG    1 
ATOM   1194 C CD    . PRO C 3 59  ? 19.163  16.946  68.585  1.00 22.87  ? 59  PRO A CD    1 
ATOM   1195 N N     . PHE C 3 60  ? 20.378  19.812  66.372  1.00 21.40  ? 60  PHE A N     1 
ATOM   1196 C CA    . PHE C 3 60  ? 21.107  20.957  65.800  1.00 21.35  ? 60  PHE A CA    1 
ATOM   1197 C C     . PHE C 3 60  ? 21.858  20.577  64.518  1.00 21.97  ? 60  PHE A C     1 
ATOM   1198 O O     . PHE C 3 60  ? 21.756  21.263  63.504  1.00 24.50  ? 60  PHE A O     1 
ATOM   1199 C CB    . PHE C 3 60  ? 22.126  21.500  66.810  1.00 18.82  ? 60  PHE A CB    1 
ATOM   1200 C CG    . PHE C 3 60  ? 22.920  22.687  66.312  1.00 16.99  ? 60  PHE A CG    1 
ATOM   1201 C CD1   . PHE C 3 60  ? 22.415  23.978  66.421  1.00 15.11  ? 60  PHE A CD1   1 
ATOM   1202 C CD2   . PHE C 3 60  ? 24.183  22.511  65.748  1.00 15.75  ? 60  PHE A CD2   1 
ATOM   1203 C CE1   . PHE C 3 60  ? 23.160  25.088  65.976  1.00 16.18  ? 60  PHE A CE1   1 
ATOM   1204 C CE2   . PHE C 3 60  ? 24.939  23.612  65.297  1.00 13.81  ? 60  PHE A CE2   1 
ATOM   1205 C CZ    . PHE C 3 60  ? 24.427  24.899  65.412  1.00 14.08  ? 60  PHE A CZ    1 
ATOM   1206 N N     . ASP C 3 61  ? 22.627  19.492  64.575  1.00 23.07  ? 61  ASP A N     1 
ATOM   1207 C CA    . ASP C 3 61  ? 23.401  19.022  63.422  1.00 22.94  ? 61  ASP A CA    1 
ATOM   1208 C C     . ASP C 3 61  ? 22.434  18.704  62.275  1.00 22.96  ? 61  ASP A C     1 
ATOM   1209 O O     . ASP C 3 61  ? 22.685  19.026  61.117  1.00 20.42  ? 61  ASP A O     1 
ATOM   1210 C CB    . ASP C 3 61  ? 24.200  17.777  63.819  1.00 24.64  ? 61  ASP A CB    1 
ATOM   1211 C CG    . ASP C 3 61  ? 25.266  17.404  62.800  1.00 28.36  ? 61  ASP A CG    1 
ATOM   1212 O OD1   . ASP C 3 61  ? 25.368  18.059  61.734  1.00 28.37  ? 61  ASP A OD1   1 
ATOM   1213 O OD2   . ASP C 3 61  ? 26.010  16.440  63.075  1.00 30.84  ? 61  ASP A OD2   1 
ATOM   1214 N N     . MET C 3 62  ? 21.325  18.069  62.630  1.00 23.18  ? 62  MET A N     1 
ATOM   1215 C CA    . MET C 3 62  ? 20.270  17.714  61.690  1.00 23.98  ? 62  MET A CA    1 
ATOM   1216 C C     . MET C 3 62  ? 19.786  19.001  60.991  1.00 24.20  ? 62  MET A C     1 
ATOM   1217 O O     . MET C 3 62  ? 19.659  19.054  59.764  1.00 22.54  ? 62  MET A O     1 
ATOM   1218 C CB    . MET C 3 62  ? 19.129  17.080  62.482  1.00 26.95  ? 62  MET A CB    1 
ATOM   1219 C CG    . MET C 3 62  ? 18.380  15.964  61.794  1.00 31.94  ? 62  MET A CG    1 
ATOM   1220 S SD    . MET C 3 62  ? 17.213  15.213  62.960  1.00 37.76  ? 62  MET A SD    1 
ATOM   1221 C CE    . MET C 3 62  ? 18.278  14.051  63.789  1.00 30.86  ? 62  MET A CE    1 
ATOM   1222 N N     . SER C 3 63  ? 19.538  20.040  61.793  1.00 23.94  ? 63  SER A N     1 
ATOM   1223 C CA    . SER C 3 63  ? 19.067  21.338  61.303  1.00 23.23  ? 63  SER A CA    1 
ATOM   1224 C C     . SER C 3 63  ? 20.058  22.035  60.382  1.00 23.22  ? 63  SER A C     1 
ATOM   1225 O O     . SER C 3 63  ? 19.691  22.466  59.288  1.00 23.16  ? 63  SER A O     1 
ATOM   1226 C CB    . SER C 3 63  ? 18.734  22.248  62.485  1.00 22.97  ? 63  SER A CB    1 
ATOM   1227 O OG    . SER C 3 63  ? 17.705  21.668  63.274  1.00 24.16  ? 63  SER A OG    1 
ATOM   1228 N N     . ILE C 3 64  ? 21.306  22.157  60.829  1.00 22.47  ? 64  ILE A N     1 
ATOM   1229 C CA    . ILE C 3 64  ? 22.352  22.774  60.024  1.00 20.92  ? 64  ILE A CA    1 
ATOM   1230 C C     . ILE C 3 64  ? 22.450  22.042  58.682  1.00 20.52  ? 64  ILE A C     1 
ATOM   1231 O O     . ILE C 3 64  ? 22.343  22.657  57.627  1.00 23.67  ? 64  ILE A O     1 
ATOM   1232 C CB    . ILE C 3 64  ? 23.727  22.702  60.746  1.00 22.46  ? 64  ILE A CB    1 
ATOM   1233 C CG1   . ILE C 3 64  ? 23.694  23.569  62.004  1.00 22.57  ? 64  ILE A CG1   1 
ATOM   1234 C CG2   . ILE C 3 64  ? 24.850  23.161  59.820  1.00 18.73  ? 64  ILE A CG2   1 
ATOM   1235 C CD1   . ILE C 3 64  ? 23.410  25.040  61.735  1.00 22.43  ? 64  ILE A CD1   1 
ATOM   1236 N N     . GLN C 3 65  ? 22.636  20.728  58.721  1.00 21.40  ? 65  GLN A N     1 
ATOM   1237 C CA    . GLN C 3 65  ? 22.753  19.930  57.497  1.00 23.39  ? 65  GLN A CA    1 
ATOM   1238 C C     . GLN C 3 65  ? 21.563  20.065  56.549  1.00 24.50  ? 65  GLN A C     1 
ATOM   1239 O O     . GLN C 3 65  ? 21.724  20.060  55.330  1.00 24.92  ? 65  GLN A O     1 
ATOM   1240 C CB    . GLN C 3 65  ? 22.955  18.457  57.844  1.00 21.53  ? 65  GLN A CB    1 
ATOM   1241 C CG    . GLN C 3 65  ? 24.316  18.141  58.418  1.00 22.72  ? 65  GLN A CG    1 
ATOM   1242 C CD    . GLN C 3 65  ? 24.548  16.654  58.513  1.00 23.69  ? 65  GLN A CD    1 
ATOM   1243 O OE1   . GLN C 3 65  ? 24.228  15.920  57.578  1.00 23.78  ? 65  GLN A OE1   1 
ATOM   1244 N NE2   . GLN C 3 65  ? 25.107  16.195  59.637  1.00 21.41  ? 65  GLN A NE2   1 
ATOM   1245 N N     . CYS C 3 66  ? 20.369  20.179  57.114  1.00 24.78  ? 66  CYS A N     1 
ATOM   1246 C CA    . CYS C 3 66  ? 19.163  20.322  56.319  1.00 26.31  ? 66  CYS A CA    1 
ATOM   1247 C C     . CYS C 3 66  ? 19.113  21.693  55.640  1.00 26.91  ? 66  CYS A C     1 
ATOM   1248 O O     . CYS C 3 66  ? 18.634  21.826  54.505  1.00 26.47  ? 66  CYS A O     1 
ATOM   1249 C CB    . CYS C 3 66  ? 17.947  20.123  57.215  1.00 28.77  ? 66  CYS A CB    1 
ATOM   1250 S SG    . CYS C 3 66  ? 16.402  20.626  56.482  1.00 40.11  ? 66  CYS A SG    1 
ATOM   1251 N N     . ILE C 3 67  ? 19.623  22.708  56.333  1.00 25.18  ? 67  ILE A N     1 
ATOM   1252 C CA    . ILE C 3 67  ? 19.638  24.056  55.795  1.00 24.05  ? 67  ILE A CA    1 
ATOM   1253 C C     . ILE C 3 67  ? 20.644  24.150  54.659  1.00 24.00  ? 67  ILE A C     1 
ATOM   1254 O O     . ILE C 3 67  ? 20.385  24.792  53.645  1.00 25.60  ? 67  ILE A O     1 
ATOM   1255 C CB    . ILE C 3 67  ? 19.979  25.099  56.896  1.00 22.80  ? 67  ILE A CB    1 
ATOM   1256 C CG1   . ILE C 3 67  ? 18.910  25.047  57.982  1.00 21.99  ? 67  ILE A CG1   1 
ATOM   1257 C CG2   . ILE C 3 67  ? 20.043  26.513  56.298  1.00 20.57  ? 67  ILE A CG2   1 
ATOM   1258 C CD1   . ILE C 3 67  ? 19.281  25.749  59.252  1.00 23.41  ? 67  ILE A CD1   1 
ATOM   1259 N N     . GLN C 3 68  ? 21.797  23.519  54.820  1.00 24.40  ? 68  GLN A N     1 
ATOM   1260 C CA    . GLN C 3 68  ? 22.794  23.548  53.754  1.00 25.14  ? 68  GLN A CA    1 
ATOM   1261 C C     . GLN C 3 68  ? 22.155  22.970  52.504  1.00 25.05  ? 68  GLN A C     1 
ATOM   1262 O O     . GLN C 3 68  ? 22.287  23.525  51.420  1.00 26.79  ? 68  GLN A O     1 
ATOM   1263 C CB    . GLN C 3 68  ? 23.994  22.679  54.088  1.00 24.97  ? 68  GLN A CB    1 
ATOM   1264 C CG    . GLN C 3 68  ? 25.180  23.387  54.658  1.00 29.43  ? 68  GLN A CG    1 
ATOM   1265 C CD    . GLN C 3 68  ? 26.408  22.492  54.656  1.00 31.60  ? 68  GLN A CD    1 
ATOM   1266 O OE1   . GLN C 3 68  ? 27.074  22.331  53.630  1.00 27.36  ? 68  GLN A OE1   1 
ATOM   1267 N NE2   . GLN C 3 68  ? 26.697  21.885  55.804  1.00 32.63  ? 68  GLN A NE2   1 
ATOM   1268 N N     . SER C 3 69  ? 21.470  21.840  52.674  1.00 23.31  ? 69  SER A N     1 
ATOM   1269 C CA    . SER C 3 69  ? 20.823  21.159  51.566  1.00 22.39  ? 69  SER A CA    1 
ATOM   1270 C C     . SER C 3 69  ? 19.956  22.083  50.742  1.00 21.19  ? 69  SER A C     1 
ATOM   1271 O O     . SER C 3 69  ? 20.077  22.115  49.515  1.00 21.15  ? 69  SER A O     1 
ATOM   1272 C CB    . SER C 3 69  ? 19.979  19.988  52.073  1.00 21.28  ? 69  SER A CB    1 
ATOM   1273 O OG    . SER C 3 69  ? 20.810  18.998  52.649  1.00 26.74  ? 69  SER A OG    1 
ATOM   1274 N N     . VAL C 3 70  ? 19.083  22.832  51.412  1.00 20.06  ? 70  VAL A N     1 
ATOM   1275 C CA    . VAL C 3 70  ? 18.198  23.743  50.712  1.00 18.52  ? 70  VAL A CA    1 
ATOM   1276 C C     . VAL C 3 70  ? 19.025  24.808  50.026  1.00 19.48  ? 70  VAL A C     1 
ATOM   1277 O O     . VAL C 3 70  ? 18.712  25.216  48.910  1.00 19.67  ? 70  VAL A O     1 
ATOM   1278 C CB    . VAL C 3 70  ? 17.187  24.394  51.660  1.00 17.61  ? 70  VAL A CB    1 
ATOM   1279 C CG1   . VAL C 3 70  ? 16.240  25.287  50.875  1.00 14.77  ? 70  VAL A CG1   1 
ATOM   1280 C CG2   . VAL C 3 70  ? 16.413  23.321  52.386  1.00 17.33  ? 70  VAL A CG2   1 
ATOM   1281 N N     . TYR C 3 71  ? 20.089  25.253  50.683  1.00 19.34  ? 71  TYR A N     1 
ATOM   1282 C CA    . TYR C 3 71  ? 20.951  26.256  50.075  1.00 21.55  ? 71  TYR A CA    1 
ATOM   1283 C C     . TYR C 3 71  ? 21.523  25.706  48.770  1.00 21.93  ? 71  TYR A C     1 
ATOM   1284 O O     . TYR C 3 71  ? 21.457  26.368  47.731  1.00 22.68  ? 71  TYR A O     1 
ATOM   1285 C CB    . TYR C 3 71  ? 22.112  26.643  51.006  1.00 22.44  ? 71  TYR A CB    1 
ATOM   1286 C CG    . TYR C 3 71  ? 21.858  27.848  51.893  1.00 22.24  ? 71  TYR A CG    1 
ATOM   1287 C CD1   . TYR C 3 71  ? 20.929  27.798  52.932  1.00 23.60  ? 71  TYR A CD1   1 
ATOM   1288 C CD2   . TYR C 3 71  ? 22.573  29.029  51.712  1.00 24.32  ? 71  TYR A CD2   1 
ATOM   1289 C CE1   . TYR C 3 71  ? 20.725  28.895  53.778  1.00 22.45  ? 71  TYR A CE1   1 
ATOM   1290 C CE2   . TYR C 3 71  ? 22.376  30.133  52.542  1.00 23.44  ? 71  TYR A CE2   1 
ATOM   1291 C CZ    . TYR C 3 71  ? 21.452  30.059  53.578  1.00 23.51  ? 71  TYR A CZ    1 
ATOM   1292 O OH    . TYR C 3 71  ? 21.265  31.141  54.414  1.00 20.76  ? 71  TYR A OH    1 
ATOM   1293 N N     . ILE C 3 72  ? 22.075  24.494  48.819  1.00 20.59  ? 72  ILE A N     1 
ATOM   1294 C CA    . ILE C 3 72  ? 22.673  23.896  47.629  1.00 23.35  ? 72  ILE A CA    1 
ATOM   1295 C C     . ILE C 3 72  ? 21.680  23.546  46.518  1.00 22.42  ? 72  ILE A C     1 
ATOM   1296 O O     . ILE C 3 72  ? 21.949  23.795  45.345  1.00 21.57  ? 72  ILE A O     1 
ATOM   1297 C CB    . ILE C 3 72  ? 23.527  22.652  47.992  1.00 25.46  ? 72  ILE A CB    1 
ATOM   1298 C CG1   . ILE C 3 72  ? 24.652  23.069  48.951  1.00 28.06  ? 72  ILE A CG1   1 
ATOM   1299 C CG2   . ILE C 3 72  ? 24.158  22.069  46.735  1.00 24.79  ? 72  ILE A CG2   1 
ATOM   1300 C CD1   . ILE C 3 72  ? 25.585  21.945  49.371  1.00 30.48  ? 72  ILE A CD1   1 
ATOM   1301 N N     . SER C 3 73  ? 20.532  22.983  46.876  1.00 24.37  ? 73  SER A N     1 
ATOM   1302 C CA    . SER C 3 73  ? 19.523  22.645  45.870  1.00 26.29  ? 73  SER A CA    1 
ATOM   1303 C C     . SER C 3 73  ? 19.050  23.921  45.189  1.00 26.33  ? 73  SER A C     1 
ATOM   1304 O O     . SER C 3 73  ? 18.808  23.933  43.986  1.00 27.12  ? 73  SER A O     1 
ATOM   1305 C CB    . SER C 3 73  ? 18.331  21.944  46.515  1.00 25.67  ? 73  SER A CB    1 
ATOM   1306 O OG    . SER C 3 73  ? 18.745  20.732  47.114  1.00 35.11  ? 73  SER A OG    1 
ATOM   1307 N N     . LYS C 3 74  ? 18.912  24.992  45.968  1.00 25.67  ? 74  LYS A N     1 
ATOM   1308 C CA    . LYS C 3 74  ? 18.477  26.271  45.425  1.00 26.60  ? 74  LYS A CA    1 
ATOM   1309 C C     . LYS C 3 74  ? 19.504  26.763  44.422  1.00 26.32  ? 74  LYS A C     1 
ATOM   1310 O O     . LYS C 3 74  ? 19.174  27.523  43.524  1.00 25.63  ? 74  LYS A O     1 
ATOM   1311 C CB    . LYS C 3 74  ? 18.312  27.305  46.534  1.00 28.98  ? 74  LYS A CB    1 
ATOM   1312 C CG    . LYS C 3 74  ? 17.127  27.055  47.454  1.00 33.56  ? 74  LYS A CG    1 
ATOM   1313 C CD    . LYS C 3 74  ? 15.799  27.248  46.746  1.00 34.02  ? 74  LYS A CD    1 
ATOM   1314 C CE    . LYS C 3 74  ? 14.666  27.372  47.760  1.00 35.60  ? 74  LYS A CE    1 
ATOM   1315 N NZ    . LYS C 3 74  ? 13.350  27.604  47.106  1.00 36.17  ? 74  LYS A NZ    1 
ATOM   1316 N N     . ILE C 3 75  ? 20.753  26.336  44.579  1.00 26.19  ? 75  ILE A N     1 
ATOM   1317 C CA    . ILE C 3 75  ? 21.780  26.736  43.636  1.00 26.76  ? 75  ILE A CA    1 
ATOM   1318 C C     . ILE C 3 75  ? 21.705  25.830  42.402  1.00 28.15  ? 75  ILE A C     1 
ATOM   1319 O O     . ILE C 3 75  ? 21.754  26.306  41.264  1.00 27.16  ? 75  ILE A O     1 
ATOM   1320 C CB    . ILE C 3 75  ? 23.179  26.673  44.286  1.00 26.79  ? 75  ILE A CB    1 
ATOM   1321 C CG1   . ILE C 3 75  ? 23.377  27.916  45.162  1.00 27.47  ? 75  ILE A CG1   1 
ATOM   1322 C CG2   . ILE C 3 75  ? 24.271  26.612  43.219  1.00 24.77  ? 75  ILE A CG2   1 
ATOM   1323 C CD1   . ILE C 3 75  ? 24.636  27.908  45.978  1.00 27.51  ? 75  ILE A CD1   1 
ATOM   1324 N N     . ILE C 3 76  ? 21.557  24.528  42.629  1.00 28.54  ? 76  ILE A N     1 
ATOM   1325 C CA    . ILE C 3 76  ? 21.480  23.576  41.529  1.00 28.94  ? 76  ILE A CA    1 
ATOM   1326 C C     . ILE C 3 76  ? 20.396  23.973  40.524  1.00 30.32  ? 76  ILE A C     1 
ATOM   1327 O O     . ILE C 3 76  ? 20.576  23.816  39.308  1.00 31.76  ? 76  ILE A O     1 
ATOM   1328 C CB    . ILE C 3 76  ? 21.169  22.143  42.032  1.00 29.81  ? 76  ILE A CB    1 
ATOM   1329 C CG1   . ILE C 3 76  ? 22.190  21.704  43.099  1.00 30.53  ? 76  ILE A CG1   1 
ATOM   1330 C CG2   . ILE C 3 76  ? 21.150  21.175  40.851  1.00 28.21  ? 76  ILE A CG2   1 
ATOM   1331 C CD1   . ILE C 3 76  ? 23.640  21.683  42.642  1.00 29.61  ? 76  ILE A CD1   1 
ATOM   1332 N N     . SER C 3 77  ? 19.282  24.500  41.026  1.00 29.17  ? 77  SER A N     1 
ATOM   1333 C CA    . SER C 3 77  ? 18.172  24.892  40.160  1.00 29.15  ? 77  SER A CA    1 
ATOM   1334 C C     . SER C 3 77  ? 18.043  26.381  39.849  1.00 29.16  ? 77  SER A C     1 
ATOM   1335 O O     . SER C 3 77  ? 17.011  26.818  39.347  1.00 29.31  ? 77  SER A O     1 
ATOM   1336 C CB    . SER C 3 77  ? 16.851  24.386  40.744  1.00 29.47  ? 77  SER A CB    1 
ATOM   1337 O OG    . SER C 3 77  ? 16.651  24.874  42.055  1.00 31.12  ? 77  SER A OG    1 
ATOM   1338 N N     . SER C 3 78  ? 19.081  27.160  40.139  1.00 30.05  ? 78  SER A N     1 
ATOM   1339 C CA    . SER C 3 78  ? 19.055  28.597  39.861  1.00 31.29  ? 78  SER A CA    1 
ATOM   1340 C C     . SER C 3 78  ? 17.830  29.279  40.451  1.00 32.71  ? 78  SER A C     1 
ATOM   1341 O O     . SER C 3 78  ? 17.177  30.084  39.788  1.00 33.63  ? 78  SER A O     1 
ATOM   1342 C CB    . SER C 3 78  ? 19.082  28.855  38.348  1.00 30.51  ? 78  SER A CB    1 
ATOM   1343 O OG    . SER C 3 78  ? 20.232  28.290  37.744  1.00 31.06  ? 78  SER A OG    1 
ATOM   1344 N N     . ASP C 3 79  ? 17.522  28.958  41.701  1.00 34.53  ? 79  ASP A N     1 
ATOM   1345 C CA    . ASP C 3 79  ? 16.374  29.545  42.383  1.00 35.43  ? 79  ASP A CA    1 
ATOM   1346 C C     . ASP C 3 79  ? 16.754  30.964  42.813  1.00 35.42  ? 79  ASP A C     1 
ATOM   1347 O O     . ASP C 3 79  ? 17.854  31.193  43.317  1.00 34.13  ? 79  ASP A O     1 
ATOM   1348 C CB    . ASP C 3 79  ? 16.010  28.695  43.603  1.00 36.05  ? 79  ASP A CB    1 
ATOM   1349 C CG    . ASP C 3 79  ? 14.561  28.842  44.006  1.00 37.75  ? 79  ASP A CG    1 
ATOM   1350 O OD1   . ASP C 3 79  ? 13.685  28.407  43.231  1.00 41.10  ? 79  ASP A OD1   1 
ATOM   1351 O OD2   . ASP C 3 79  ? 14.296  29.391  45.093  1.00 37.10  ? 79  ASP A OD2   1 
ATOM   1352 N N     . ARG C 3 80  ? 15.845  31.913  42.619  1.00 35.51  ? 80  ARG A N     1 
ATOM   1353 C CA    . ARG C 3 80  ? 16.131  33.296  42.973  1.00 35.12  ? 80  ARG A CA    1 
ATOM   1354 C C     . ARG C 3 80  ? 15.633  33.693  44.352  1.00 31.93  ? 80  ARG A C     1 
ATOM   1355 O O     . ARG C 3 80  ? 15.652  34.870  44.699  1.00 31.11  ? 80  ARG A O     1 
ATOM   1356 C CB    . ARG C 3 80  ? 15.525  34.243  41.935  1.00 40.31  ? 80  ARG A CB    1 
ATOM   1357 C CG    . ARG C 3 80  ? 15.915  33.940  40.487  1.00 47.45  ? 80  ARG A CG    1 
ATOM   1358 C CD    . ARG C 3 80  ? 15.399  35.039  39.566  1.00 52.75  ? 80  ARG A CD    1 
ATOM   1359 N NE    . ARG C 3 80  ? 14.015  35.388  39.879  1.00 56.39  ? 80  ARG A NE    1 
ATOM   1360 C CZ    . ARG C 3 80  ? 13.436  36.532  39.534  1.00 57.75  ? 80  ARG A CZ    1 
ATOM   1361 N NH1   . ARG C 3 80  ? 14.121  37.447  38.858  1.00 59.56  ? 80  ARG A NH1   1 
ATOM   1362 N NH2   . ARG C 3 80  ? 12.178  36.770  39.884  1.00 58.75  ? 80  ARG A NH2   1 
ATOM   1363 N N     . ASP C 3 81  ? 15.177  32.728  45.141  1.00 29.20  ? 81  ASP A N     1 
ATOM   1364 C CA    . ASP C 3 81  ? 14.696  33.056  46.474  1.00 28.16  ? 81  ASP A CA    1 
ATOM   1365 C C     . ASP C 3 81  ? 15.825  33.552  47.378  1.00 26.47  ? 81  ASP A C     1 
ATOM   1366 O O     . ASP C 3 81  ? 17.002  33.290  47.132  1.00 24.89  ? 81  ASP A O     1 
ATOM   1367 C CB    . ASP C 3 81  ? 14.022  31.848  47.131  1.00 31.35  ? 81  ASP A CB    1 
ATOM   1368 C CG    . ASP C 3 81  ? 12.732  31.449  46.442  1.00 34.98  ? 81  ASP A CG    1 
ATOM   1369 O OD1   . ASP C 3 81  ? 12.044  32.334  45.877  1.00 35.65  ? 81  ASP A OD1   1 
ATOM   1370 O OD2   . ASP C 3 81  ? 12.399  30.244  46.486  1.00 37.13  ? 81  ASP A OD2   1 
ATOM   1371 N N     . LEU C 3 82  ? 15.450  34.281  48.423  1.00 23.36  ? 82  LEU A N     1 
ATOM   1372 C CA    . LEU C 3 82  ? 16.407  34.814  49.372  1.00 20.50  ? 82  LEU A CA    1 
ATOM   1373 C C     . LEU C 3 82  ? 16.373  33.944  50.620  1.00 19.73  ? 82  LEU A C     1 
ATOM   1374 O O     . LEU C 3 82  ? 15.300  33.598  51.120  1.00 18.06  ? 82  LEU A O     1 
ATOM   1375 C CB    . LEU C 3 82  ? 16.045  36.254  49.725  1.00 18.74  ? 82  LEU A CB    1 
ATOM   1376 C CG    . LEU C 3 82  ? 15.854  37.159  48.506  1.00 20.11  ? 82  LEU A CG    1 
ATOM   1377 C CD1   . LEU C 3 82  ? 15.408  38.540  48.955  1.00 23.15  ? 82  LEU A CD1   1 
ATOM   1378 C CD2   . LEU C 3 82  ? 17.144  37.259  47.725  1.00 20.30  ? 82  LEU A CD2   1 
ATOM   1379 N N     . LEU C 3 83  ? 17.551  33.578  51.108  1.00 18.60  ? 83  LEU A N     1 
ATOM   1380 C CA    . LEU C 3 83  ? 17.655  32.753  52.298  1.00 17.67  ? 83  LEU A CA    1 
ATOM   1381 C C     . LEU C 3 83  ? 18.330  33.526  53.431  1.00 18.00  ? 83  LEU A C     1 
ATOM   1382 O O     . LEU C 3 83  ? 19.159  34.408  53.178  1.00 17.59  ? 83  LEU A O     1 
ATOM   1383 C CB    . LEU C 3 83  ? 18.461  31.500  51.976  1.00 17.62  ? 83  LEU A CB    1 
ATOM   1384 C CG    . LEU C 3 83  ? 18.058  30.831  50.666  1.00 19.12  ? 83  LEU A CG    1 
ATOM   1385 C CD1   . LEU C 3 83  ? 18.955  29.632  50.419  1.00 19.35  ? 83  LEU A CD1   1 
ATOM   1386 C CD2   . LEU C 3 83  ? 16.589  30.420  50.725  1.00 16.69  ? 83  LEU A CD2   1 
ATOM   1387 N N     . ALA C 3 84  ? 17.966  33.199  54.673  1.00 16.73  ? 84  ALA A N     1 
ATOM   1388 C CA    . ALA C 3 84  ? 18.545  33.844  55.851  1.00 15.99  ? 84  ALA A CA    1 
ATOM   1389 C C     . ALA C 3 84  ? 18.783  32.796  56.926  1.00 15.74  ? 84  ALA A C     1 
ATOM   1390 O O     . ALA C 3 84  ? 18.096  31.782  56.965  1.00 12.67  ? 84  ALA A O     1 
ATOM   1391 C CB    . ALA C 3 84  ? 17.616  34.934  56.383  1.00 15.48  ? 84  ALA A CB    1 
ATOM   1392 N N     . VAL C 3 85  ? 19.757  33.046  57.797  1.00 17.85  ? 85  VAL A N     1 
ATOM   1393 C CA    . VAL C 3 85  ? 20.067  32.108  58.875  1.00 19.52  ? 85  VAL A CA    1 
ATOM   1394 C C     . VAL C 3 85  ? 20.219  32.796  60.223  1.00 19.41  ? 85  VAL A C     1 
ATOM   1395 O O     . VAL C 3 85  ? 21.170  33.540  60.455  1.00 19.66  ? 85  VAL A O     1 
ATOM   1396 C CB    . VAL C 3 85  ? 21.349  31.332  58.590  1.00 20.81  ? 85  VAL A CB    1 
ATOM   1397 C CG1   . VAL C 3 85  ? 21.768  30.557  59.835  1.00 25.08  ? 85  VAL A CG1   1 
ATOM   1398 C CG2   . VAL C 3 85  ? 21.124  30.382  57.437  1.00 22.83  ? 85  VAL A CG2   1 
ATOM   1399 N N     . VAL C 3 86  ? 19.282  32.508  61.118  1.00 19.15  ? 86  VAL A N     1 
ATOM   1400 C CA    . VAL C 3 86  ? 19.268  33.104  62.442  1.00 15.78  ? 86  VAL A CA    1 
ATOM   1401 C C     . VAL C 3 86  ? 19.298  32.033  63.520  1.00 14.56  ? 86  VAL A C     1 
ATOM   1402 O O     . VAL C 3 86  ? 18.733  30.959  63.347  1.00 13.54  ? 86  VAL A O     1 
ATOM   1403 C CB    . VAL C 3 86  ? 17.993  33.964  62.631  1.00 12.79  ? 86  VAL A CB    1 
ATOM   1404 C CG1   . VAL C 3 86  ? 18.032  34.677  63.978  1.00 12.24  ? 86  VAL A CG1   1 
ATOM   1405 C CG2   . VAL C 3 86  ? 17.870  34.954  61.503  1.00 9.18   ? 86  VAL A CG2   1 
ATOM   1406 N N     . PHE C 3 87  ? 19.968  32.338  64.628  1.00 16.70  ? 87  PHE A N     1 
ATOM   1407 C CA    . PHE C 3 87  ? 20.065  31.427  65.768  1.00 15.45  ? 87  PHE A CA    1 
ATOM   1408 C C     . PHE C 3 87  ? 19.647  32.177  67.026  1.00 16.79  ? 87  PHE A C     1 
ATOM   1409 O O     . PHE C 3 87  ? 19.856  33.392  67.140  1.00 17.30  ? 87  PHE A O     1 
ATOM   1410 C CB    . PHE C 3 87  ? 21.491  30.909  65.953  1.00 15.15  ? 87  PHE A CB    1 
ATOM   1411 C CG    . PHE C 3 87  ? 22.002  30.092  64.799  1.00 16.78  ? 87  PHE A CG    1 
ATOM   1412 C CD1   . PHE C 3 87  ? 22.764  30.678  63.799  1.00 17.73  ? 87  PHE A CD1   1 
ATOM   1413 C CD2   . PHE C 3 87  ? 21.747  28.728  64.732  1.00 14.68  ? 87  PHE A CD2   1 
ATOM   1414 C CE1   . PHE C 3 87  ? 23.269  29.910  62.752  1.00 19.23  ? 87  PHE A CE1   1 
ATOM   1415 C CE2   . PHE C 3 87  ? 22.243  27.958  63.696  1.00 16.90  ? 87  PHE A CE2   1 
ATOM   1416 C CZ    . PHE C 3 87  ? 23.009  28.546  62.702  1.00 17.95  ? 87  PHE A CZ    1 
ATOM   1417 N N     . TYR C 3 88  ? 19.047  31.461  67.968  1.00 14.53  ? 88  TYR A N     1 
ATOM   1418 C CA    . TYR C 3 88  ? 18.596  32.086  69.189  1.00 14.93  ? 88  TYR A CA    1 
ATOM   1419 C C     . TYR C 3 88  ? 18.885  31.180  70.385  1.00 16.69  ? 88  TYR A C     1 
ATOM   1420 O O     . TYR C 3 88  ? 18.934  29.947  70.263  1.00 15.46  ? 88  TYR A O     1 
ATOM   1421 C CB    . TYR C 3 88  ? 17.104  32.433  69.076  1.00 14.70  ? 88  TYR A CB    1 
ATOM   1422 C CG    . TYR C 3 88  ? 16.164  31.254  69.127  1.00 14.46  ? 88  TYR A CG    1 
ATOM   1423 C CD1   . TYR C 3 88  ? 15.673  30.785  70.342  1.00 13.17  ? 88  TYR A CD1   1 
ATOM   1424 C CD2   . TYR C 3 88  ? 15.743  30.625  67.960  1.00 14.38  ? 88  TYR A CD2   1 
ATOM   1425 C CE1   . TYR C 3 88  ? 14.778  29.726  70.393  1.00 15.15  ? 88  TYR A CE1   1 
ATOM   1426 C CE2   . TYR C 3 88  ? 14.852  29.560  67.998  1.00 15.41  ? 88  TYR A CE2   1 
ATOM   1427 C CZ    . TYR C 3 88  ? 14.372  29.119  69.223  1.00 15.55  ? 88  TYR A CZ    1 
ATOM   1428 O OH    . TYR C 3 88  ? 13.489  28.075  69.275  1.00 18.79  ? 88  TYR A OH    1 
ATOM   1429 N N     . GLY C 3 89  ? 19.081  31.794  71.545  1.00 17.03  ? 89  GLY A N     1 
ATOM   1430 C CA    . GLY C 3 89  ? 19.427  31.008  72.709  1.00 17.00  ? 89  GLY A CA    1 
ATOM   1431 C C     . GLY C 3 89  ? 20.946  31.044  72.823  1.00 16.38  ? 89  GLY A C     1 
ATOM   1432 O O     . GLY C 3 89  ? 21.542  30.397  73.685  1.00 16.27  ? 89  GLY A O     1 
ATOM   1433 N N     . THR C 3 90  ? 21.572  31.805  71.932  1.00 16.86  ? 90  THR A N     1 
ATOM   1434 C CA    . THR C 3 90  ? 23.018  31.964  71.944  1.00 18.83  ? 90  THR A CA    1 
ATOM   1435 C C     . THR C 3 90  ? 23.392  33.006  72.994  1.00 19.79  ? 90  THR A C     1 
ATOM   1436 O O     . THR C 3 90  ? 22.567  33.826  73.406  1.00 18.41  ? 90  THR A O     1 
ATOM   1437 C CB    . THR C 3 90  ? 23.546  32.450  70.588  1.00 19.69  ? 90  THR A CB    1 
ATOM   1438 O OG1   . THR C 3 90  ? 22.876  33.664  70.223  1.00 17.95  ? 90  THR A OG1   1 
ATOM   1439 C CG2   . THR C 3 90  ? 23.320  31.390  69.518  1.00 19.51  ? 90  THR A CG2   1 
ATOM   1440 N N     . GLU C 3 91  ? 24.645  32.963  73.425  1.00 22.07  ? 91  GLU A N     1 
ATOM   1441 C CA    . GLU C 3 91  ? 25.162  33.896  74.422  1.00 23.34  ? 91  GLU A CA    1 
ATOM   1442 C C     . GLU C 3 91  ? 25.471  35.214  73.725  1.00 20.77  ? 91  GLU A C     1 
ATOM   1443 O O     . GLU C 3 91  ? 25.362  36.285  74.306  1.00 19.65  ? 91  GLU A O     1 
ATOM   1444 C CB    . GLU C 3 91  ? 26.427  33.297  75.057  1.00 28.25  ? 91  GLU A CB    1 
ATOM   1445 C CG    . GLU C 3 91  ? 27.257  34.233  75.930  1.00 34.03  ? 91  GLU A CG    1 
ATOM   1446 C CD    . GLU C 3 91  ? 28.369  33.498  76.692  1.00 39.37  ? 91  GLU A CD    1 
ATOM   1447 O OE1   . GLU C 3 91  ? 29.021  32.603  76.098  1.00 39.18  ? 91  GLU A OE1   1 
ATOM   1448 O OE2   . GLU C 3 91  ? 28.598  33.826  77.883  1.00 40.06  ? 91  GLU A OE2   1 
ATOM   1449 N N     . LYS C 3 92  ? 25.825  35.116  72.452  1.00 20.30  ? 92  LYS A N     1 
ATOM   1450 C CA    . LYS C 3 92  ? 26.179  36.272  71.651  1.00 21.28  ? 92  LYS A CA    1 
ATOM   1451 C C     . LYS C 3 92  ? 24.975  36.712  70.830  1.00 21.68  ? 92  LYS A C     1 
ATOM   1452 O O     . LYS C 3 92  ? 24.190  35.879  70.378  1.00 23.09  ? 92  LYS A O     1 
ATOM   1453 C CB    . LYS C 3 92  ? 27.329  35.879  70.722  1.00 24.09  ? 92  LYS A CB    1 
ATOM   1454 C CG    . LYS C 3 92  ? 28.442  36.884  70.544  1.00 23.86  ? 92  LYS A CG    1 
ATOM   1455 C CD    . LYS C 3 92  ? 29.658  36.154  70.006  1.00 26.68  ? 92  LYS A CD    1 
ATOM   1456 C CE    . LYS C 3 92  ? 30.905  37.021  70.013  1.00 32.27  ? 92  LYS A CE    1 
ATOM   1457 N NZ    . LYS C 3 92  ? 32.095  36.296  69.469  1.00 34.27  ? 92  LYS A NZ    1 
ATOM   1458 N N     . ASP C 3 93  ? 24.812  38.019  70.652  1.00 20.72  ? 93  ASP A N     1 
ATOM   1459 C CA    . ASP C 3 93  ? 23.710  38.531  69.842  1.00 21.62  ? 93  ASP A CA    1 
ATOM   1460 C C     . ASP C 3 93  ? 24.231  39.367  68.663  1.00 21.13  ? 93  ASP A C     1 
ATOM   1461 O O     . ASP C 3 93  ? 25.293  39.987  68.743  1.00 20.49  ? 93  ASP A O     1 
ATOM   1462 C CB    . ASP C 3 93  ? 22.755  39.384  70.688  1.00 22.75  ? 93  ASP A CB    1 
ATOM   1463 C CG    . ASP C 3 93  ? 23.414  40.646  71.235  1.00 24.86  ? 93  ASP A CG    1 
ATOM   1464 O OD1   . ASP C 3 93  ? 23.827  40.653  72.416  1.00 23.56  ? 93  ASP A OD1   1 
ATOM   1465 O OD2   . ASP C 3 93  ? 23.519  41.633  70.479  1.00 24.43  ? 93  ASP A OD2   1 
ATOM   1466 N N     . LYS C 3 94  ? 23.488  39.367  67.564  1.00 21.64  ? 94  LYS A N     1 
ATOM   1467 C CA    . LYS C 3 94  ? 23.866  40.148  66.397  1.00 21.80  ? 94  LYS A CA    1 
ATOM   1468 C C     . LYS C 3 94  ? 22.646  40.481  65.538  1.00 21.40  ? 94  LYS A C     1 
ATOM   1469 O O     . LYS C 3 94  ? 22.234  39.684  64.703  1.00 22.04  ? 94  LYS A O     1 
ATOM   1470 C CB    . LYS C 3 94  ? 24.902  39.399  65.555  1.00 21.53  ? 94  LYS A CB    1 
ATOM   1471 C CG    . LYS C 3 94  ? 25.357  40.212  64.358  1.00 23.68  ? 94  LYS A CG    1 
ATOM   1472 C CD    . LYS C 3 94  ? 26.442  39.536  63.546  1.00 24.74  ? 94  LYS A CD    1 
ATOM   1473 C CE    . LYS C 3 94  ? 26.839  40.437  62.382  1.00 26.33  ? 94  LYS A CE    1 
ATOM   1474 N NZ    . LYS C 3 94  ? 27.998  39.904  61.604  1.00 28.11  ? 94  LYS A NZ    1 
ATOM   1475 N N     . ASN C 3 95  ? 22.078  41.664  65.754  1.00 19.89  ? 95  ASN A N     1 
ATOM   1476 C CA    . ASN C 3 95  ? 20.906  42.129  65.012  1.00 20.20  ? 95  ASN A CA    1 
ATOM   1477 C C     . ASN C 3 95  ? 20.790  43.645  65.171  1.00 20.79  ? 95  ASN A C     1 
ATOM   1478 O O     . ASN C 3 95  ? 21.274  44.204  66.148  1.00 21.14  ? 95  ASN A O     1 
ATOM   1479 C CB    . ASN C 3 95  ? 19.634  41.419  65.511  1.00 18.93  ? 95  ASN A CB    1 
ATOM   1480 C CG    . ASN C 3 95  ? 19.403  41.595  67.007  1.00 21.35  ? 95  ASN A CG    1 
ATOM   1481 O OD1   . ASN C 3 95  ? 18.829  42.596  67.448  1.00 23.93  ? 95  ASN A OD1   1 
ATOM   1482 N ND2   . ASN C 3 95  ? 19.858  40.622  67.796  1.00 18.03  ? 95  ASN A ND2   1 
ATOM   1483 N N     . SER C 3 96  ? 20.151  44.308  64.214  1.00 20.74  ? 96  SER A N     1 
ATOM   1484 C CA    . SER C 3 96  ? 20.033  45.760  64.255  1.00 20.60  ? 96  SER A CA    1 
ATOM   1485 C C     . SER C 3 96  ? 19.434  46.394  65.510  1.00 20.62  ? 96  SER A C     1 
ATOM   1486 O O     . SER C 3 96  ? 19.763  47.536  65.822  1.00 22.64  ? 96  SER A O     1 
ATOM   1487 C CB    . SER C 3 96  ? 19.282  46.262  63.018  1.00 18.89  ? 96  SER A CB    1 
ATOM   1488 O OG    . SER C 3 96  ? 17.986  45.709  62.955  1.00 22.72  ? 96  SER A OG    1 
ATOM   1489 N N     . VAL C 3 97  ? 18.565  45.693  66.236  1.00 21.21  ? 97  VAL A N     1 
ATOM   1490 C CA    . VAL C 3 97  ? 17.991  46.293  67.447  1.00 22.60  ? 97  VAL A CA    1 
ATOM   1491 C C     . VAL C 3 97  ? 18.700  45.883  68.732  1.00 21.78  ? 97  VAL A C     1 
ATOM   1492 O O     . VAL C 3 97  ? 18.308  46.292  69.815  1.00 21.52  ? 97  VAL A O     1 
ATOM   1493 C CB    . VAL C 3 97  ? 16.475  45.988  67.595  1.00 21.33  ? 97  VAL A CB    1 
ATOM   1494 C CG1   . VAL C 3 97  ? 15.690  46.766  66.548  1.00 24.64  ? 97  VAL A CG1   1 
ATOM   1495 C CG2   . VAL C 3 97  ? 16.215  44.511  67.440  1.00 23.70  ? 97  VAL A CG2   1 
ATOM   1496 N N     . ASN C 3 98  ? 19.746  45.077  68.603  1.00 21.74  ? 98  ASN A N     1 
ATOM   1497 C CA    . ASN C 3 98  ? 20.519  44.618  69.751  1.00 25.02  ? 98  ASN A CA    1 
ATOM   1498 C C     . ASN C 3 98  ? 19.726  43.800  70.769  1.00 25.60  ? 98  ASN A C     1 
ATOM   1499 O O     . ASN C 3 98  ? 20.027  43.848  71.964  1.00 26.40  ? 98  ASN A O     1 
ATOM   1500 C CB    . ASN C 3 98  ? 21.171  45.803  70.474  1.00 27.18  ? 98  ASN A CB    1 
ATOM   1501 C CG    . ASN C 3 98  ? 22.044  46.638  69.558  1.00 30.86  ? 98  ASN A CG    1 
ATOM   1502 O OD1   . ASN C 3 98  ? 22.953  46.117  68.910  1.00 31.55  ? 98  ASN A OD1   1 
ATOM   1503 N ND2   . ASN C 3 98  ? 21.773  47.947  69.500  1.00 30.55  ? 98  ASN A ND2   1 
ATOM   1504 N N     . PHE C 3 99  ? 18.706  43.076  70.308  1.00 24.09  ? 99  PHE A N     1 
ATOM   1505 C CA    . PHE C 3 99  ? 17.926  42.229  71.194  1.00 22.86  ? 99  PHE A CA    1 
ATOM   1506 C C     . PHE C 3 99  ? 18.895  41.137  71.639  1.00 23.42  ? 99  PHE A C     1 
ATOM   1507 O O     . PHE C 3 99  ? 19.714  40.673  70.854  1.00 26.03  ? 99  PHE A O     1 
ATOM   1508 C CB    . PHE C 3 99  ? 16.737  41.629  70.440  1.00 25.44  ? 99  PHE A CB    1 
ATOM   1509 C CG    . PHE C 3 99  ? 15.481  42.460  70.518  1.00 25.43  ? 99  PHE A CG    1 
ATOM   1510 C CD1   . PHE C 3 99  ? 14.528  42.395  69.512  1.00 25.62  ? 99  PHE A CD1   1 
ATOM   1511 C CD2   . PHE C 3 99  ? 15.238  43.283  71.610  1.00 26.40  ? 99  PHE A CD2   1 
ATOM   1512 C CE1   . PHE C 3 99  ? 13.348  43.137  69.587  1.00 25.41  ? 99  PHE A CE1   1 
ATOM   1513 C CE2   . PHE C 3 99  ? 14.063  44.026  71.693  1.00 28.13  ? 99  PHE A CE2   1 
ATOM   1514 C CZ    . PHE C 3 99  ? 13.114  43.949  70.672  1.00 25.06  ? 99  PHE A CZ    1 
ATOM   1515 N N     . LYS C 3 100 ? 18.819  40.722  72.893  1.00 22.66  ? 100 LYS A N     1 
ATOM   1516 C CA    . LYS C 3 100 ? 19.755  39.724  73.388  1.00 23.54  ? 100 LYS A CA    1 
ATOM   1517 C C     . LYS C 3 100 ? 19.498  38.270  73.025  1.00 22.78  ? 100 LYS A C     1 
ATOM   1518 O O     . LYS C 3 100 ? 18.357  37.842  72.866  1.00 21.44  ? 100 LYS A O     1 
ATOM   1519 C CB    . LYS C 3 100 ? 19.889  39.843  74.910  1.00 23.78  ? 100 LYS A CB    1 
ATOM   1520 C CG    . LYS C 3 100 ? 20.311  41.230  75.365  1.00 28.37  ? 100 LYS A CG    1 
ATOM   1521 C CD    . LYS C 3 100 ? 21.086  41.182  76.667  1.00 32.96  ? 100 LYS A CD    1 
ATOM   1522 C CE    . LYS C 3 100 ? 22.403  40.426  76.508  1.00 35.06  ? 100 LYS A CE    1 
ATOM   1523 N NZ    . LYS C 3 100 ? 23.235  40.480  77.742  1.00 36.88  ? 100 LYS A NZ    1 
ATOM   1524 N N     . ASN C 3 101 ? 20.601  37.533  72.894  1.00 20.31  ? 101 ASN A N     1 
ATOM   1525 C CA    . ASN C 3 101 ? 20.606  36.108  72.597  1.00 19.91  ? 101 ASN A CA    1 
ATOM   1526 C C     . ASN C 3 101 ? 19.995  35.706  71.249  1.00 21.04  ? 101 ASN A C     1 
ATOM   1527 O O     . ASN C 3 101 ? 19.400  34.631  71.112  1.00 20.71  ? 101 ASN A O     1 
ATOM   1528 C CB    . ASN C 3 101 ? 19.934  35.351  73.752  1.00 17.97  ? 101 ASN A CB    1 
ATOM   1529 C CG    . ASN C 3 101 ? 20.385  35.865  75.133  1.00 19.38  ? 101 ASN A CG    1 
ATOM   1530 O OD1   . ASN C 3 101 ? 19.727  36.714  75.748  1.00 18.01  ? 101 ASN A OD1   1 
ATOM   1531 N ND2   . ASN C 3 101 ? 21.513  35.366  75.608  1.00 14.62  ? 101 ASN A ND2   1 
ATOM   1532 N N     . ILE C 3 102 ? 20.168  36.573  70.253  1.00 18.63  ? 102 ILE A N     1 
ATOM   1533 C CA    . ILE C 3 102 ? 19.675  36.320  68.912  1.00 16.15  ? 102 ILE A CA    1 
ATOM   1534 C C     . ILE C 3 102 ? 20.825  36.625  67.960  1.00 14.99  ? 102 ILE A C     1 
ATOM   1535 O O     . ILE C 3 102 ? 21.394  37.704  67.988  1.00 15.67  ? 102 ILE A O     1 
ATOM   1536 C CB    . ILE C 3 102 ? 18.453  37.205  68.597  1.00 16.69  ? 102 ILE A CB    1 
ATOM   1537 C CG1   . ILE C 3 102 ? 17.289  36.813  69.522  1.00 14.34  ? 102 ILE A CG1   1 
ATOM   1538 C CG2   . ILE C 3 102 ? 18.056  37.052  67.133  1.00 14.83  ? 102 ILE A CG2   1 
ATOM   1539 C CD1   . ILE C 3 102 ? 16.160  37.838  69.603  1.00 9.69   ? 102 ILE A CD1   1 
ATOM   1540 N N     . TYR C 3 103 ? 21.175  35.666  67.116  1.00 14.89  ? 103 TYR A N     1 
ATOM   1541 C CA    . TYR C 3 103 ? 22.298  35.865  66.212  1.00 13.85  ? 103 TYR A CA    1 
ATOM   1542 C C     . TYR C 3 103 ? 21.971  35.724  64.732  1.00 14.07  ? 103 TYR A C     1 
ATOM   1543 O O     . TYR C 3 103 ? 21.712  34.624  64.241  1.00 13.13  ? 103 TYR A O     1 
ATOM   1544 C CB    . TYR C 3 103 ? 23.410  34.878  66.563  1.00 15.73  ? 103 TYR A CB    1 
ATOM   1545 C CG    . TYR C 3 103 ? 24.776  35.327  66.119  1.00 16.84  ? 103 TYR A CG    1 
ATOM   1546 C CD1   . TYR C 3 103 ? 25.672  35.890  67.033  1.00 19.97  ? 103 TYR A CD1   1 
ATOM   1547 C CD2   . TYR C 3 103 ? 25.177  35.197  64.788  1.00 18.31  ? 103 TYR A CD2   1 
ATOM   1548 C CE1   . TYR C 3 103 ? 26.947  36.308  66.631  1.00 21.13  ? 103 TYR A CE1   1 
ATOM   1549 C CE2   . TYR C 3 103 ? 26.443  35.614  64.370  1.00 21.07  ? 103 TYR A CE2   1 
ATOM   1550 C CZ    . TYR C 3 103 ? 27.327  36.164  65.301  1.00 22.21  ? 103 TYR A CZ    1 
ATOM   1551 O OH    . TYR C 3 103 ? 28.599  36.524  64.918  1.00 22.76  ? 103 TYR A OH    1 
ATOM   1552 N N     . VAL C 3 104 ? 22.002  36.835  64.016  1.00 12.67  ? 104 VAL A N     1 
ATOM   1553 C CA    . VAL C 3 104 ? 21.730  36.784  62.600  1.00 14.17  ? 104 VAL A CA    1 
ATOM   1554 C C     . VAL C 3 104 ? 23.025  36.452  61.867  1.00 14.45  ? 104 VAL A C     1 
ATOM   1555 O O     . VAL C 3 104 ? 23.828  37.328  61.570  1.00 13.30  ? 104 VAL A O     1 
ATOM   1556 C CB    . VAL C 3 104 ? 21.158  38.123  62.085  1.00 14.81  ? 104 VAL A CB    1 
ATOM   1557 C CG1   . VAL C 3 104 ? 20.947  38.057  60.575  1.00 11.02  ? 104 VAL A CG1   1 
ATOM   1558 C CG2   . VAL C 3 104 ? 19.855  38.414  62.786  1.00 12.68  ? 104 VAL A CG2   1 
ATOM   1559 N N     . LEU C 3 105 ? 23.217  35.165  61.604  1.00 15.91  ? 105 LEU A N     1 
ATOM   1560 C CA    . LEU C 3 105 ? 24.394  34.676  60.903  1.00 17.12  ? 105 LEU A CA    1 
ATOM   1561 C C     . LEU C 3 105 ? 24.377  35.187  59.465  1.00 17.92  ? 105 LEU A C     1 
ATOM   1562 O O     . LEU C 3 105 ? 25.353  35.755  58.981  1.00 17.18  ? 105 LEU A O     1 
ATOM   1563 C CB    . LEU C 3 105 ? 24.401  33.146  60.891  1.00 17.83  ? 105 LEU A CB    1 
ATOM   1564 C CG    . LEU C 3 105 ? 25.588  32.452  60.207  1.00 19.29  ? 105 LEU A CG    1 
ATOM   1565 C CD1   . LEU C 3 105 ? 26.770  32.410  61.159  1.00 21.10  ? 105 LEU A CD1   1 
ATOM   1566 C CD2   . LEU C 3 105 ? 25.205  31.029  59.814  1.00 21.01  ? 105 LEU A CD2   1 
ATOM   1567 N N     . GLN C 3 106 ? 23.256  34.986  58.785  1.00 17.73  ? 106 GLN A N     1 
ATOM   1568 C CA    . GLN C 3 106 ? 23.136  35.411  57.402  1.00 17.39  ? 106 GLN A CA    1 
ATOM   1569 C C     . GLN C 3 106 ? 21.842  36.141  57.131  1.00 17.50  ? 106 GLN A C     1 
ATOM   1570 O O     . GLN C 3 106 ? 20.764  35.566  57.263  1.00 18.67  ? 106 GLN A O     1 
ATOM   1571 C CB    . GLN C 3 106 ? 23.223  34.197  56.474  1.00 17.24  ? 106 GLN A CB    1 
ATOM   1572 C CG    . GLN C 3 106 ? 24.621  33.710  56.200  1.00 17.08  ? 106 GLN A CG    1 
ATOM   1573 C CD    . GLN C 3 106 ? 24.647  32.337  55.538  1.00 21.30  ? 106 GLN A CD    1 
ATOM   1574 O OE1   . GLN C 3 106 ? 23.774  32.006  54.730  1.00 21.02  ? 106 GLN A OE1   1 
ATOM   1575 N NE2   . GLN C 3 106 ? 25.668  31.537  55.864  1.00 19.12  ? 106 GLN A NE2   1 
ATOM   1576 N N     . GLU C 3 107 ? 21.954  37.407  56.751  1.00 17.66  ? 107 GLU A N     1 
ATOM   1577 C CA    . GLU C 3 107 ? 20.790  38.217  56.415  1.00 19.50  ? 107 GLU A CA    1 
ATOM   1578 C C     . GLU C 3 107 ? 20.163  37.691  55.123  1.00 18.46  ? 107 GLU A C     1 
ATOM   1579 O O     . GLU C 3 107 ? 20.770  36.894  54.413  1.00 17.91  ? 107 GLU A O     1 
ATOM   1580 C CB    . GLU C 3 107 ? 21.202  39.680  56.225  1.00 21.81  ? 107 GLU A CB    1 
ATOM   1581 C CG    . GLU C 3 107 ? 21.436  40.434  57.519  1.00 23.99  ? 107 GLU A CG    1 
ATOM   1582 C CD    . GLU C 3 107 ? 21.729  41.901  57.279  1.00 29.14  ? 107 GLU A CD    1 
ATOM   1583 O OE1   . GLU C 3 107 ? 21.129  42.486  56.353  1.00 33.86  ? 107 GLU A OE1   1 
ATOM   1584 O OE2   . GLU C 3 107 ? 22.546  42.479  58.019  1.00 31.36  ? 107 GLU A OE2   1 
ATOM   1585 N N     . LEU C 3 108 ? 18.950  38.132  54.816  1.00 18.60  ? 108 LEU A N     1 
ATOM   1586 C CA    . LEU C 3 108 ? 18.290  37.675  53.602  1.00 19.66  ? 108 LEU A CA    1 
ATOM   1587 C C     . LEU C 3 108 ? 19.056  38.051  52.343  1.00 20.71  ? 108 LEU A C     1 
ATOM   1588 O O     . LEU C 3 108 ? 19.287  39.229  52.071  1.00 22.44  ? 108 LEU A O     1 
ATOM   1589 C CB    . LEU C 3 108 ? 16.870  38.237  53.529  1.00 19.86  ? 108 LEU A CB    1 
ATOM   1590 C CG    . LEU C 3 108 ? 15.795  37.390  54.215  1.00 19.80  ? 108 LEU A CG    1 
ATOM   1591 C CD1   . LEU C 3 108 ? 14.471  38.138  54.187  1.00 19.07  ? 108 LEU A CD1   1 
ATOM   1592 C CD2   . LEU C 3 108 ? 15.679  36.026  53.514  1.00 15.30  ? 108 LEU A CD2   1 
ATOM   1593 N N     . ASP C 3 109 ? 19.450  37.042  51.573  1.00 22.83  ? 109 ASP A N     1 
ATOM   1594 C CA    . ASP C 3 109 ? 20.182  37.271  50.336  1.00 23.01  ? 109 ASP A CA    1 
ATOM   1595 C C     . ASP C 3 109 ? 20.260  35.997  49.518  1.00 23.53  ? 109 ASP A C     1 
ATOM   1596 O O     . ASP C 3 109 ? 19.906  34.926  50.008  1.00 23.53  ? 109 ASP A O     1 
ATOM   1597 C CB    . ASP C 3 109 ? 21.591  37.782  50.650  1.00 27.25  ? 109 ASP A CB    1 
ATOM   1598 C CG    . ASP C 3 109 ? 22.341  38.251  49.404  1.00 29.70  ? 109 ASP A CG    1 
ATOM   1599 O OD1   . ASP C 3 109 ? 21.686  38.626  48.398  1.00 26.58  ? 109 ASP A OD1   1 
ATOM   1600 O OD2   . ASP C 3 109 ? 23.590  38.256  49.447  1.00 30.71  ? 109 ASP A OD2   1 
ATOM   1601 N N     . ASN C 3 110 ? 20.702  36.116  48.266  1.00 23.89  ? 110 ASN A N     1 
ATOM   1602 C CA    . ASN C 3 110 ? 20.840  34.955  47.380  1.00 25.19  ? 110 ASN A CA    1 
ATOM   1603 C C     . ASN C 3 110 ? 21.963  34.075  47.913  1.00 24.76  ? 110 ASN A C     1 
ATOM   1604 O O     . ASN C 3 110 ? 23.009  34.577  48.330  1.00 24.15  ? 110 ASN A O     1 
ATOM   1605 C CB    . ASN C 3 110 ? 21.225  35.381  45.959  1.00 25.76  ? 110 ASN A CB    1 
ATOM   1606 C CG    . ASN C 3 110 ? 20.289  36.413  45.378  1.00 30.29  ? 110 ASN A CG    1 
ATOM   1607 O OD1   . ASN C 3 110 ? 19.162  36.097  44.973  1.00 29.78  ? 110 ASN A OD1   1 
ATOM   1608 N ND2   . ASN C 3 110 ? 20.749  37.668  45.337  1.00 31.55  ? 110 ASN A ND2   1 
ATOM   1609 N N     . PRO C 3 111 ? 21.767  32.752  47.898  1.00 24.03  ? 111 PRO A N     1 
ATOM   1610 C CA    . PRO C 3 111 ? 22.823  31.867  48.393  1.00 22.90  ? 111 PRO A CA    1 
ATOM   1611 C C     . PRO C 3 111 ? 24.040  31.932  47.481  1.00 24.12  ? 111 PRO A C     1 
ATOM   1612 O O     . PRO C 3 111 ? 23.940  32.339  46.316  1.00 22.93  ? 111 PRO A O     1 
ATOM   1613 C CB    . PRO C 3 111 ? 22.161  30.495  48.391  1.00 22.98  ? 111 PRO A CB    1 
ATOM   1614 C CG    . PRO C 3 111 ? 21.187  30.591  47.252  1.00 24.64  ? 111 PRO A CG    1 
ATOM   1615 C CD    . PRO C 3 111 ? 20.598  31.982  47.434  1.00 24.73  ? 111 PRO A CD    1 
ATOM   1616 N N     . GLY C 3 112 ? 25.187  31.538  48.030  1.00 24.85  ? 112 GLY A N     1 
ATOM   1617 C CA    . GLY C 3 112 ? 26.433  31.552  47.287  1.00 23.32  ? 112 GLY A CA    1 
ATOM   1618 C C     . GLY C 3 112 ? 27.398  30.537  47.866  1.00 24.29  ? 112 GLY A C     1 
ATOM   1619 O O     . GLY C 3 112 ? 27.049  29.799  48.791  1.00 24.84  ? 112 GLY A O     1 
ATOM   1620 N N     . ALA C 3 113 ? 28.612  30.493  47.330  1.00 24.04  ? 113 ALA A N     1 
ATOM   1621 C CA    . ALA C 3 113 ? 29.613  29.551  47.809  1.00 23.80  ? 113 ALA A CA    1 
ATOM   1622 C C     . ALA C 3 113 ? 30.015  29.819  49.260  1.00 24.31  ? 113 ALA A C     1 
ATOM   1623 O O     . ALA C 3 113 ? 29.970  28.919  50.096  1.00 25.56  ? 113 ALA A O     1 
ATOM   1624 C CB    . ALA C 3 113 ? 30.832  29.592  46.911  1.00 23.56  ? 113 ALA A CB    1 
ATOM   1625 N N     . LYS C 3 114 ? 30.397  31.054  49.562  1.00 24.96  ? 114 LYS A N     1 
ATOM   1626 C CA    . LYS C 3 114 ? 30.811  31.406  50.920  1.00 25.88  ? 114 LYS A CA    1 
ATOM   1627 C C     . LYS C 3 114 ? 29.751  31.157  51.982  1.00 25.20  ? 114 LYS A C     1 
ATOM   1628 O O     . LYS C 3 114 ? 30.066  30.650  53.063  1.00 27.45  ? 114 LYS A O     1 
ATOM   1629 C CB    . LYS C 3 114 ? 31.263  32.866  50.986  1.00 27.23  ? 114 LYS A CB    1 
ATOM   1630 C CG    . LYS C 3 114 ? 32.602  33.132  50.306  1.00 30.57  ? 114 LYS A CG    1 
ATOM   1631 C CD    . LYS C 3 114 ? 32.930  34.614  50.321  1.00 35.02  ? 114 LYS A CD    1 
ATOM   1632 C CE    . LYS C 3 114 ? 34.286  34.918  49.677  1.00 39.33  ? 114 LYS A CE    1 
ATOM   1633 N NZ    . LYS C 3 114 ? 34.581  36.395  49.701  1.00 40.19  ? 114 LYS A NZ    1 
ATOM   1634 N N     . ARG C 3 115 ? 28.498  31.497  51.693  1.00 23.78  ? 115 ARG A N     1 
ATOM   1635 C CA    . ARG C 3 115 ? 27.447  31.280  52.680  1.00 22.50  ? 115 ARG A CA    1 
ATOM   1636 C C     . ARG C 3 115 ? 27.269  29.801  52.965  1.00 21.39  ? 115 ARG A C     1 
ATOM   1637 O O     . ARG C 3 115 ? 27.052  29.406  54.109  1.00 21.73  ? 115 ARG A O     1 
ATOM   1638 C CB    . ARG C 3 115 ? 26.132  31.898  52.214  1.00 23.67  ? 115 ARG A CB    1 
ATOM   1639 C CG    . ARG C 3 115 ? 26.075  33.406  52.381  1.00 22.34  ? 115 ARG A CG    1 
ATOM   1640 C CD    . ARG C 3 115 ? 24.738  33.934  51.901  1.00 25.16  ? 115 ARG A CD    1 
ATOM   1641 N NE    . ARG C 3 115 ? 24.448  35.258  52.439  1.00 27.17  ? 115 ARG A NE    1 
ATOM   1642 C CZ    . ARG C 3 115 ? 23.284  35.601  52.979  1.00 28.77  ? 115 ARG A CZ    1 
ATOM   1643 N NH1   . ARG C 3 115 ? 22.290  34.720  53.053  1.00 28.47  ? 115 ARG A NH1   1 
ATOM   1644 N NH2   . ARG C 3 115 ? 23.119  36.823  53.460  1.00 30.62  ? 115 ARG A NH2   1 
ATOM   1645 N N     . ILE C 3 116 ? 27.369  28.981  51.927  1.00 21.88  ? 116 ILE A N     1 
ATOM   1646 C CA    . ILE C 3 116 ? 27.246  27.538  52.094  1.00 24.63  ? 116 ILE A CA    1 
ATOM   1647 C C     . ILE C 3 116 ? 28.444  27.031  52.895  1.00 23.56  ? 116 ILE A C     1 
ATOM   1648 O O     . ILE C 3 116 ? 28.285  26.253  53.830  1.00 21.71  ? 116 ILE A O     1 
ATOM   1649 C CB    . ILE C 3 116 ? 27.196  26.796  50.727  1.00 26.88  ? 116 ILE A CB    1 
ATOM   1650 C CG1   . ILE C 3 116 ? 25.828  27.004  50.069  1.00 28.79  ? 116 ILE A CG1   1 
ATOM   1651 C CG2   . ILE C 3 116 ? 27.442  25.304  50.926  1.00 29.73  ? 116 ILE A CG2   1 
ATOM   1652 C CD1   . ILE C 3 116 ? 25.680  26.326  48.726  1.00 25.23  ? 116 ILE A CD1   1 
ATOM   1653 N N     . LEU C 3 117 ? 29.640  27.485  52.530  1.00 24.92  ? 117 LEU A N     1 
ATOM   1654 C CA    . LEU C 3 117 ? 30.851  27.071  53.235  1.00 24.82  ? 117 LEU A CA    1 
ATOM   1655 C C     . LEU C 3 117 ? 30.744  27.433  54.712  1.00 24.82  ? 117 LEU A C     1 
ATOM   1656 O O     . LEU C 3 117 ? 31.164  26.675  55.576  1.00 26.99  ? 117 LEU A O     1 
ATOM   1657 C CB    . LEU C 3 117 ? 32.078  27.753  52.635  1.00 24.82  ? 117 LEU A CB    1 
ATOM   1658 C CG    . LEU C 3 117 ? 33.410  27.508  53.355  1.00 26.33  ? 117 LEU A CG    1 
ATOM   1659 C CD1   . LEU C 3 117 ? 33.882  26.071  53.130  1.00 24.64  ? 117 LEU A CD1   1 
ATOM   1660 C CD2   . LEU C 3 117 ? 34.443  28.488  52.828  1.00 24.45  ? 117 LEU A CD2   1 
ATOM   1661 N N     . GLU C 3 118 ? 30.166  28.593  54.995  1.00 24.41  ? 118 GLU A N     1 
ATOM   1662 C CA    . GLU C 3 118 ? 30.007  29.041  56.371  1.00 24.44  ? 118 GLU A CA    1 
ATOM   1663 C C     . GLU C 3 118 ? 29.127  28.096  57.181  1.00 24.25  ? 118 GLU A C     1 
ATOM   1664 O O     . GLU C 3 118 ? 29.436  27.775  58.327  1.00 24.25  ? 118 GLU A O     1 
ATOM   1665 C CB    . GLU C 3 118 ? 29.424  30.457  56.391  1.00 25.04  ? 118 GLU A CB    1 
ATOM   1666 C CG    . GLU C 3 118 ? 29.203  31.035  57.782  1.00 26.86  ? 118 GLU A CG    1 
ATOM   1667 C CD    . GLU C 3 118 ? 28.870  32.524  57.760  1.00 28.69  ? 118 GLU A CD    1 
ATOM   1668 O OE1   . GLU C 3 118 ? 27.942  32.929  57.024  1.00 25.86  ? 118 GLU A OE1   1 
ATOM   1669 O OE2   . GLU C 3 118 ? 29.542  33.291  58.487  1.00 29.96  ? 118 GLU A OE2   1 
ATOM   1670 N N     . LEU C 3 119 ? 28.030  27.646  56.588  1.00 24.83  ? 119 LEU A N     1 
ATOM   1671 C CA    . LEU C 3 119 ? 27.125  26.739  57.286  1.00 24.99  ? 119 LEU A CA    1 
ATOM   1672 C C     . LEU C 3 119 ? 27.808  25.415  57.592  1.00 28.03  ? 119 LEU A C     1 
ATOM   1673 O O     . LEU C 3 119 ? 27.519  24.767  58.610  1.00 28.36  ? 119 LEU A O     1 
ATOM   1674 C CB    . LEU C 3 119 ? 25.881  26.478  56.441  1.00 23.39  ? 119 LEU A CB    1 
ATOM   1675 C CG    . LEU C 3 119 ? 24.971  27.674  56.164  1.00 23.94  ? 119 LEU A CG    1 
ATOM   1676 C CD1   . LEU C 3 119 ? 23.929  27.303  55.134  1.00 22.87  ? 119 LEU A CD1   1 
ATOM   1677 C CD2   . LEU C 3 119 ? 24.318  28.112  57.455  1.00 25.04  ? 119 LEU A CD2   1 
ATOM   1678 N N     . ASP C 3 120 ? 28.719  25.020  56.709  1.00 29.13  ? 120 ASP A N     1 
ATOM   1679 C CA    . ASP C 3 120 ? 29.432  23.757  56.850  1.00 30.99  ? 120 ASP A CA    1 
ATOM   1680 C C     . ASP C 3 120 ? 30.350  23.751  58.071  1.00 30.39  ? 120 ASP A C     1 
ATOM   1681 O O     . ASP C 3 120 ? 30.768  22.692  58.541  1.00 29.70  ? 120 ASP A O     1 
ATOM   1682 C CB    . ASP C 3 120 ? 30.250  23.488  55.584  1.00 34.08  ? 120 ASP A CB    1 
ATOM   1683 C CG    . ASP C 3 120 ? 30.599  22.027  55.415  1.00 35.71  ? 120 ASP A CG    1 
ATOM   1684 O OD1   . ASP C 3 120 ? 29.682  21.218  55.146  1.00 36.34  ? 120 ASP A OD1   1 
ATOM   1685 O OD2   . ASP C 3 120 ? 31.790  21.690  55.553  1.00 37.61  ? 120 ASP A OD2   1 
ATOM   1686 N N     . GLN C 3 121 ? 30.653  24.937  58.583  1.00 29.75  ? 121 GLN A N     1 
ATOM   1687 C CA    . GLN C 3 121 ? 31.528  25.059  59.738  1.00 32.39  ? 121 GLN A CA    1 
ATOM   1688 C C     . GLN C 3 121 ? 30.866  24.593  61.030  1.00 30.97  ? 121 GLN A C     1 
ATOM   1689 O O     . GLN C 3 121 ? 31.541  24.410  62.044  1.00 30.71  ? 121 GLN A O     1 
ATOM   1690 C CB    . GLN C 3 121 ? 31.990  26.514  59.913  1.00 34.53  ? 121 GLN A CB    1 
ATOM   1691 C CG    . GLN C 3 121 ? 32.830  27.066  58.769  1.00 40.95  ? 121 GLN A CG    1 
ATOM   1692 C CD    . GLN C 3 121 ? 34.043  26.203  58.441  1.00 45.06  ? 121 GLN A CD    1 
ATOM   1693 O OE1   . GLN C 3 121 ? 34.864  25.894  59.314  1.00 46.98  ? 121 GLN A OE1   1 
ATOM   1694 N NE2   . GLN C 3 121 ? 34.165  25.818  57.171  1.00 46.49  ? 121 GLN A NE2   1 
ATOM   1695 N N     . PHE C 3 122 ? 29.552  24.404  60.990  1.00 30.09  ? 122 PHE A N     1 
ATOM   1696 C CA    . PHE C 3 122 ? 28.798  23.994  62.169  1.00 28.93  ? 122 PHE A CA    1 
ATOM   1697 C C     . PHE C 3 122 ? 28.279  22.574  62.036  1.00 28.75  ? 122 PHE A C     1 
ATOM   1698 O O     . PHE C 3 122 ? 27.505  22.102  62.864  1.00 28.06  ? 122 PHE A O     1 
ATOM   1699 C CB    . PHE C 3 122 ? 27.630  24.959  62.383  1.00 28.55  ? 122 PHE A CB    1 
ATOM   1700 C CG    . PHE C 3 122 ? 28.036  26.409  62.387  1.00 27.80  ? 122 PHE A CG    1 
ATOM   1701 C CD1   . PHE C 3 122 ? 27.361  27.333  61.602  1.00 27.21  ? 122 PHE A CD1   1 
ATOM   1702 C CD2   . PHE C 3 122 ? 29.102  26.848  63.167  1.00 27.19  ? 122 PHE A CD2   1 
ATOM   1703 C CE1   . PHE C 3 122 ? 27.743  28.677  61.592  1.00 28.37  ? 122 PHE A CE1   1 
ATOM   1704 C CE2   . PHE C 3 122 ? 29.491  28.188  63.164  1.00 26.02  ? 122 PHE A CE2   1 
ATOM   1705 C CZ    . PHE C 3 122 ? 28.811  29.103  62.376  1.00 25.46  ? 122 PHE A CZ    1 
ATOM   1706 N N     . LYS C 3 123 ? 28.732  21.900  60.987  1.00 29.16  ? 123 LYS A N     1 
ATOM   1707 C CA    . LYS C 3 123 ? 28.338  20.532  60.680  1.00 30.42  ? 123 LYS A CA    1 
ATOM   1708 C C     . LYS C 3 123 ? 29.106  19.540  61.554  1.00 30.32  ? 123 LYS A C     1 
ATOM   1709 O O     . LYS C 3 123 ? 30.289  19.735  61.808  1.00 29.86  ? 123 LYS A O     1 
ATOM   1710 C CB    . LYS C 3 123 ? 28.645  20.270  59.205  1.00 30.20  ? 123 LYS A CB    1 
ATOM   1711 C CG    . LYS C 3 123 ? 27.740  19.297  58.509  1.00 35.09  ? 123 LYS A CG    1 
ATOM   1712 C CD    . LYS C 3 123 ? 27.797  19.513  56.997  1.00 36.97  ? 123 LYS A CD    1 
ATOM   1713 C CE    . LYS C 3 123 ? 26.645  18.792  56.301  1.00 41.08  ? 123 LYS A CE    1 
ATOM   1714 N NZ    . LYS C 3 123 ? 26.456  19.189  54.873  1.00 41.59  ? 123 LYS A NZ    1 
ATOM   1715 N N     . GLY C 3 124 ? 28.428  18.492  62.024  1.00 31.93  ? 124 GLY A N     1 
ATOM   1716 C CA    . GLY C 3 124 ? 29.079  17.463  62.828  1.00 30.25  ? 124 GLY A CA    1 
ATOM   1717 C C     . GLY C 3 124 ? 29.518  17.839  64.227  1.00 32.42  ? 124 GLY A C     1 
ATOM   1718 O O     . GLY C 3 124 ? 29.159  18.904  64.727  1.00 32.78  ? 124 GLY A O     1 
ATOM   1719 N N     . GLN C 3 125 ? 30.306  16.972  64.865  1.00 34.59  ? 125 GLN A N     1 
ATOM   1720 C CA    . GLN C 3 125 ? 30.767  17.244  66.222  1.00 36.30  ? 125 GLN A CA    1 
ATOM   1721 C C     . GLN C 3 125 ? 31.770  18.389  66.313  1.00 36.19  ? 125 GLN A C     1 
ATOM   1722 O O     . GLN C 3 125 ? 31.773  19.129  67.301  1.00 34.21  ? 125 GLN A O     1 
ATOM   1723 C CB    . GLN C 3 125 ? 31.362  15.989  66.877  1.00 40.81  ? 125 GLN A CB    1 
ATOM   1724 C CG    . GLN C 3 125 ? 31.800  16.232  68.333  1.00 46.91  ? 125 GLN A CG    1 
ATOM   1725 C CD    . GLN C 3 125 ? 31.843  14.968  69.184  1.00 52.41  ? 125 GLN A CD    1 
ATOM   1726 O OE1   . GLN C 3 125 ? 32.544  14.003  68.858  1.00 55.54  ? 125 GLN A OE1   1 
ATOM   1727 N NE2   . GLN C 3 125 ? 31.096  14.973  70.286  1.00 52.12  ? 125 GLN A NE2   1 
ATOM   1728 N N     . GLN C 3 126 ? 32.619  18.541  65.298  1.00 35.63  ? 126 GLN A N     1 
ATOM   1729 C CA    . GLN C 3 126 ? 33.586  19.632  65.307  1.00 34.42  ? 126 GLN A CA    1 
ATOM   1730 C C     . GLN C 3 126 ? 32.829  20.928  65.077  1.00 32.75  ? 126 GLN A C     1 
ATOM   1731 O O     . GLN C 3 126 ? 33.191  21.971  65.621  1.00 33.52  ? 126 GLN A O     1 
ATOM   1732 C CB    . GLN C 3 126 ? 34.647  19.456  64.216  1.00 35.52  ? 126 GLN A CB    1 
ATOM   1733 C CG    . GLN C 3 126 ? 35.518  18.223  64.383  1.00 40.04  ? 126 GLN A CG    1 
ATOM   1734 C CD    . GLN C 3 126 ? 34.913  16.987  63.739  1.00 43.07  ? 126 GLN A CD    1 
ATOM   1735 O OE1   . GLN C 3 126 ? 33.709  16.736  63.858  1.00 46.29  ? 126 GLN A OE1   1 
ATOM   1736 N NE2   . GLN C 3 126 ? 35.747  16.203  63.057  1.00 42.87  ? 126 GLN A NE2   1 
ATOM   1737 N N     . GLY C 3 127 ? 31.772  20.855  64.270  1.00 30.42  ? 127 GLY A N     1 
ATOM   1738 C CA    . GLY C 3 127 ? 30.972  22.035  63.994  1.00 27.53  ? 127 GLY A CA    1 
ATOM   1739 C C     . GLY C 3 127 ? 30.334  22.529  65.278  1.00 28.63  ? 127 GLY A C     1 
ATOM   1740 O O     . GLY C 3 127 ? 30.336  23.723  65.566  1.00 27.15  ? 127 GLY A O     1 
ATOM   1741 N N     . GLN C 3 128 ? 29.799  21.598  66.063  1.00 28.62  ? 128 GLN A N     1 
ATOM   1742 C CA    . GLN C 3 128 ? 29.158  21.939  67.320  1.00 29.26  ? 128 GLN A CA    1 
ATOM   1743 C C     . GLN C 3 128 ? 30.084  22.812  68.158  1.00 30.08  ? 128 GLN A C     1 
ATOM   1744 O O     . GLN C 3 128 ? 29.656  23.800  68.756  1.00 30.40  ? 128 GLN A O     1 
ATOM   1745 C CB    . GLN C 3 128 ? 28.818  20.670  68.091  1.00 29.84  ? 128 GLN A CB    1 
ATOM   1746 C CG    . GLN C 3 128 ? 27.927  20.914  69.284  1.00 31.03  ? 128 GLN A CG    1 
ATOM   1747 C CD    . GLN C 3 128 ? 27.792  19.695  70.167  1.00 30.94  ? 128 GLN A CD    1 
ATOM   1748 O OE1   . GLN C 3 128 ? 28.367  19.637  71.255  1.00 31.43  ? 128 GLN A OE1   1 
ATOM   1749 N NE2   . GLN C 3 128 ? 27.039  18.708  69.700  1.00 30.59  ? 128 GLN A NE2   1 
ATOM   1750 N N     . LYS C 3 129 ? 31.359  22.436  68.181  1.00 30.64  ? 129 LYS A N     1 
ATOM   1751 C CA    . LYS C 3 129 ? 32.383  23.148  68.930  1.00 30.24  ? 129 LYS A CA    1 
ATOM   1752 C C     . LYS C 3 129 ? 32.630  24.528  68.324  1.00 29.30  ? 129 LYS A C     1 
ATOM   1753 O O     . LYS C 3 129 ? 32.796  25.503  69.050  1.00 28.72  ? 129 LYS A O     1 
ATOM   1754 C CB    . LYS C 3 129 ? 33.680  22.332  68.930  1.00 32.56  ? 129 LYS A CB    1 
ATOM   1755 C CG    . LYS C 3 129 ? 34.762  22.849  69.852  1.00 35.22  ? 129 LYS A CG    1 
ATOM   1756 C CD    . LYS C 3 129 ? 34.372  22.657  71.312  1.00 39.92  ? 129 LYS A CD    1 
ATOM   1757 C CE    . LYS C 3 129 ? 35.403  23.278  72.255  1.00 41.14  ? 129 LYS A CE    1 
ATOM   1758 N NZ    . LYS C 3 129 ? 34.897  23.332  73.655  1.00 42.85  ? 129 LYS A NZ    1 
ATOM   1759 N N     . ARG C 3 130 ? 32.651  24.618  66.996  1.00 27.76  ? 130 ARG A N     1 
ATOM   1760 C CA    . ARG C 3 130 ? 32.871  25.908  66.346  1.00 27.20  ? 130 ARG A CA    1 
ATOM   1761 C C     . ARG C 3 130 ? 31.700  26.874  66.547  1.00 27.42  ? 130 ARG A C     1 
ATOM   1762 O O     . ARG C 3 130 ? 31.894  28.091  66.630  1.00 27.74  ? 130 ARG A O     1 
ATOM   1763 C CB    . ARG C 3 130 ? 33.110  25.737  64.846  1.00 27.59  ? 130 ARG A CB    1 
ATOM   1764 C CG    . ARG C 3 130 ? 34.410  25.080  64.501  1.00 27.66  ? 130 ARG A CG    1 
ATOM   1765 C CD    . ARG C 3 130 ? 34.790  25.308  63.050  1.00 27.89  ? 130 ARG A CD    1 
ATOM   1766 N NE    . ARG C 3 130 ? 35.657  24.226  62.602  1.00 28.84  ? 130 ARG A NE    1 
ATOM   1767 C CZ    . ARG C 3 130 ? 35.214  23.060  62.148  1.00 29.56  ? 130 ARG A CZ    1 
ATOM   1768 N NH1   . ARG C 3 130 ? 33.915  22.830  62.060  1.00 32.08  ? 130 ARG A NH1   1 
ATOM   1769 N NH2   . ARG C 3 130 ? 36.070  22.101  61.834  1.00 30.97  ? 130 ARG A NH2   1 
ATOM   1770 N N     . PHE C 3 131 ? 30.485  26.337  66.605  1.00 26.18  ? 131 PHE A N     1 
ATOM   1771 C CA    . PHE C 3 131 ? 29.310  27.175  66.804  1.00 24.58  ? 131 PHE A CA    1 
ATOM   1772 C C     . PHE C 3 131 ? 29.289  27.712  68.228  1.00 24.31  ? 131 PHE A C     1 
ATOM   1773 O O     . PHE C 3 131 ? 29.125  28.909  68.451  1.00 25.03  ? 131 PHE A O     1 
ATOM   1774 C CB    . PHE C 3 131 ? 28.017  26.394  66.558  1.00 19.85  ? 131 PHE A CB    1 
ATOM   1775 C CG    . PHE C 3 131 ? 26.775  27.210  66.789  1.00 17.54  ? 131 PHE A CG    1 
ATOM   1776 C CD1   . PHE C 3 131 ? 26.226  27.970  65.766  1.00 13.74  ? 131 PHE A CD1   1 
ATOM   1777 C CD2   . PHE C 3 131 ? 26.170  27.244  68.048  1.00 18.29  ? 131 PHE A CD2   1 
ATOM   1778 C CE1   . PHE C 3 131 ? 25.092  28.749  65.989  1.00 13.81  ? 131 PHE A CE1   1 
ATOM   1779 C CE2   . PHE C 3 131 ? 25.034  28.028  68.276  1.00 13.86  ? 131 PHE A CE2   1 
ATOM   1780 C CZ    . PHE C 3 131 ? 24.498  28.777  67.241  1.00 12.67  ? 131 PHE A CZ    1 
ATOM   1781 N N     . GLN C 3 132 ? 29.448  26.813  69.190  1.00 24.05  ? 132 GLN A N     1 
ATOM   1782 C CA    . GLN C 3 132 ? 29.437  27.198  70.588  1.00 24.65  ? 132 GLN A CA    1 
ATOM   1783 C C     . GLN C 3 132 ? 30.562  28.158  70.959  1.00 26.16  ? 132 GLN A C     1 
ATOM   1784 O O     . GLN C 3 132 ? 30.376  29.011  71.822  1.00 27.71  ? 132 GLN A O     1 
ATOM   1785 C CB    . GLN C 3 132 ? 29.467  25.948  71.467  1.00 23.38  ? 132 GLN A CB    1 
ATOM   1786 C CG    . GLN C 3 132 ? 28.275  25.036  71.188  1.00 22.35  ? 132 GLN A CG    1 
ATOM   1787 C CD    . GLN C 3 132 ? 28.207  23.829  72.105  1.00 25.72  ? 132 GLN A CD    1 
ATOM   1788 O OE1   . GLN C 3 132 ? 29.229  23.349  72.602  1.00 26.20  ? 132 GLN A OE1   1 
ATOM   1789 N NE2   . GLN C 3 132 ? 26.996  23.313  72.310  1.00 24.70  ? 132 GLN A NE2   1 
ATOM   1790 N N     . ASP C 3 133 ? 31.715  28.050  70.307  1.00 25.66  ? 133 ASP A N     1 
ATOM   1791 C CA    . ASP C 3 133 ? 32.812  28.958  70.623  1.00 27.98  ? 133 ASP A CA    1 
ATOM   1792 C C     . ASP C 3 133 ? 32.662  30.297  69.901  1.00 28.91  ? 133 ASP A C     1 
ATOM   1793 O O     . ASP C 3 133 ? 33.212  31.307  70.339  1.00 28.25  ? 133 ASP A O     1 
ATOM   1794 C CB    . ASP C 3 133 ? 34.175  28.331  70.287  1.00 31.17  ? 133 ASP A CB    1 
ATOM   1795 C CG    . ASP C 3 133 ? 34.498  27.117  71.156  1.00 32.67  ? 133 ASP A CG    1 
ATOM   1796 O OD1   . ASP C 3 133 ? 33.994  27.044  72.297  1.00 34.73  ? 133 ASP A OD1   1 
ATOM   1797 O OD2   . ASP C 3 133 ? 35.267  26.240  70.704  1.00 34.81  ? 133 ASP A OD2   1 
ATOM   1798 N N     . MET C 3 134 ? 31.916  30.308  68.799  1.00 28.87  ? 134 MET A N     1 
ATOM   1799 C CA    . MET C 3 134 ? 31.692  31.539  68.051  1.00 29.03  ? 134 MET A CA    1 
ATOM   1800 C C     . MET C 3 134 ? 30.471  32.314  68.567  1.00 29.78  ? 134 MET A C     1 
ATOM   1801 O O     . MET C 3 134 ? 30.411  33.539  68.430  1.00 30.15  ? 134 MET A O     1 
ATOM   1802 C CB    . MET C 3 134 ? 31.483  31.239  66.558  1.00 30.15  ? 134 MET A CB    1 
ATOM   1803 C CG    . MET C 3 134 ? 31.254  32.492  65.707  1.00 33.23  ? 134 MET A CG    1 
ATOM   1804 S SD    . MET C 3 134 ? 30.481  32.270  64.065  1.00 37.74  ? 134 MET A SD    1 
ATOM   1805 C CE    . MET C 3 134 ? 31.905  31.755  63.056  1.00 38.85  ? 134 MET A CE    1 
ATOM   1806 N N     . MET C 3 135 ? 29.510  31.611  69.168  1.00 28.67  ? 135 MET A N     1 
ATOM   1807 C CA    . MET C 3 135 ? 28.277  32.257  69.635  1.00 30.57  ? 135 MET A CA    1 
ATOM   1808 C C     . MET C 3 135 ? 27.784  31.856  71.010  1.00 29.44  ? 135 MET A C     1 
ATOM   1809 O O     . MET C 3 135 ? 26.954  32.549  71.593  1.00 28.35  ? 135 MET A O     1 
ATOM   1810 C CB    . MET C 3 135 ? 27.133  31.970  68.666  1.00 33.48  ? 135 MET A CB    1 
ATOM   1811 C CG    . MET C 3 135 ? 27.235  32.643  67.339  1.00 37.50  ? 135 MET A CG    1 
ATOM   1812 S SD    . MET C 3 135 ? 25.972  31.971  66.271  1.00 45.69  ? 135 MET A SD    1 
ATOM   1813 C CE    . MET C 3 135 ? 27.000  31.528  64.829  1.00 41.65  ? 135 MET A CE    1 
ATOM   1814 N N     . GLY C 3 136 ? 28.270  30.733  71.516  1.00 28.27  ? 136 GLY A N     1 
ATOM   1815 C CA    . GLY C 3 136 ? 27.808  30.275  72.806  1.00 27.33  ? 136 GLY A CA    1 
ATOM   1816 C C     . GLY C 3 136 ? 26.466  29.615  72.574  1.00 27.56  ? 136 GLY A C     1 
ATOM   1817 O O     . GLY C 3 136 ? 25.939  29.652  71.460  1.00 27.61  ? 136 GLY A O     1 
ATOM   1818 N N     . HIS C 3 137 ? 25.902  29.014  73.614  1.00 26.65  ? 137 HIS A N     1 
ATOM   1819 C CA    . HIS C 3 137 ? 24.615  28.353  73.473  1.00 25.39  ? 137 HIS A CA    1 
ATOM   1820 C C     . HIS C 3 137 ? 23.984  28.182  74.843  1.00 23.82  ? 137 HIS A C     1 
ATOM   1821 O O     . HIS C 3 137 ? 24.607  28.470  75.860  1.00 23.35  ? 137 HIS A O     1 
ATOM   1822 C CB    . HIS C 3 137 ? 24.805  26.979  72.844  1.00 24.27  ? 137 HIS A CB    1 
ATOM   1823 C CG    . HIS C 3 137 ? 25.488  26.003  73.750  1.00 23.87  ? 137 HIS A CG    1 
ATOM   1824 N ND1   . HIS C 3 137 ? 26.819  26.109  74.089  1.00 24.15  ? 137 HIS A ND1   1 
ATOM   1825 C CD2   . HIS C 3 137 ? 25.012  24.927  74.421  1.00 23.42  ? 137 HIS A CD2   1 
ATOM   1826 C CE1   . HIS C 3 137 ? 27.133  25.139  74.930  1.00 26.16  ? 137 HIS A CE1   1 
ATOM   1827 N NE2   . HIS C 3 137 ? 26.054  24.408  75.148  1.00 22.88  ? 137 HIS A NE2   1 
ATOM   1828 N N     . GLY C 3 138 ? 22.745  27.702  74.851  1.00 22.65  ? 138 GLY A N     1 
ATOM   1829 C CA    . GLY C 3 138 ? 22.032  27.473  76.090  1.00 20.64  ? 138 GLY A CA    1 
ATOM   1830 C C     . GLY C 3 138 ? 21.765  28.710  76.918  1.00 21.06  ? 138 GLY A C     1 
ATOM   1831 O O     . GLY C 3 138 ? 21.652  28.629  78.135  1.00 19.69  ? 138 GLY A O     1 
ATOM   1832 N N     . SER C 3 139 ? 21.674  29.864  76.270  1.00 21.90  ? 139 SER A N     1 
ATOM   1833 C CA    . SER C 3 139 ? 21.388  31.088  76.987  1.00 22.05  ? 139 SER A CA    1 
ATOM   1834 C C     . SER C 3 139 ? 19.889  31.293  77.000  1.00 23.81  ? 139 SER A C     1 
ATOM   1835 O O     . SER C 3 139 ? 19.140  30.552  76.362  1.00 24.10  ? 139 SER A O     1 
ATOM   1836 C CB    . SER C 3 139 ? 22.056  32.279  76.319  1.00 21.41  ? 139 SER A CB    1 
ATOM   1837 O OG    . SER C 3 139 ? 23.449  32.252  76.544  1.00 25.59  ? 139 SER A OG    1 
ATOM   1838 N N     . ASP C 3 140 ? 19.453  32.301  77.743  1.00 25.72  ? 140 ASP A N     1 
ATOM   1839 C CA    . ASP C 3 140 ? 18.040  32.618  77.832  1.00 24.71  ? 140 ASP A CA    1 
ATOM   1840 C C     . ASP C 3 140 ? 17.631  33.363  76.576  1.00 21.72  ? 140 ASP A C     1 
ATOM   1841 O O     . ASP C 3 140 ? 18.490  33.749  75.780  1.00 20.75  ? 140 ASP A O     1 
ATOM   1842 C CB    . ASP C 3 140 ? 17.773  33.481  79.056  1.00 28.86  ? 140 ASP A CB    1 
ATOM   1843 C CG    . ASP C 3 140 ? 16.638  32.950  79.885  1.00 33.74  ? 140 ASP A CG    1 
ATOM   1844 O OD1   . ASP C 3 140 ? 16.862  32.745  81.098  1.00 36.18  ? 140 ASP A OD1   1 
ATOM   1845 O OD2   . ASP C 3 140 ? 15.532  32.733  79.319  1.00 33.85  ? 140 ASP A OD2   1 
ATOM   1846 N N     . TYR C 3 141 ? 16.325  33.557  76.404  1.00 17.86  ? 141 TYR A N     1 
ATOM   1847 C CA    . TYR C 3 141 ? 15.784  34.244  75.237  1.00 16.01  ? 141 TYR A CA    1 
ATOM   1848 C C     . TYR C 3 141 ? 14.282  34.474  75.384  1.00 16.03  ? 141 TYR A C     1 
ATOM   1849 O O     . TYR C 3 141 ? 13.655  33.953  76.291  1.00 18.29  ? 141 TYR A O     1 
ATOM   1850 C CB    . TYR C 3 141 ? 16.042  33.396  73.981  1.00 15.99  ? 141 TYR A CB    1 
ATOM   1851 C CG    . TYR C 3 141 ? 15.360  32.038  74.004  1.00 15.30  ? 141 TYR A CG    1 
ATOM   1852 C CD1   . TYR C 3 141 ? 14.025  31.887  73.603  1.00 16.98  ? 141 TYR A CD1   1 
ATOM   1853 C CD2   . TYR C 3 141 ? 16.026  30.917  74.485  1.00 15.57  ? 141 TYR A CD2   1 
ATOM   1854 C CE1   . TYR C 3 141 ? 13.375  30.642  73.689  1.00 13.82  ? 141 TYR A CE1   1 
ATOM   1855 C CE2   . TYR C 3 141 ? 15.390  29.676  74.577  1.00 15.74  ? 141 TYR A CE2   1 
ATOM   1856 C CZ    . TYR C 3 141 ? 14.069  29.548  74.182  1.00 15.54  ? 141 TYR A CZ    1 
ATOM   1857 O OH    . TYR C 3 141 ? 13.450  28.329  74.321  1.00 18.35  ? 141 TYR A OH    1 
ATOM   1858 N N     . SER C 3 142 ? 13.711  35.283  74.504  1.00 17.70  ? 142 SER A N     1 
ATOM   1859 C CA    . SER C 3 142 ? 12.267  35.485  74.510  1.00 20.15  ? 142 SER A CA    1 
ATOM   1860 C C     . SER C 3 142 ? 11.796  35.463  73.055  1.00 18.48  ? 142 SER A C     1 
ATOM   1861 O O     . SER C 3 142 ? 12.063  36.387  72.294  1.00 16.21  ? 142 SER A O     1 
ATOM   1862 C CB    . SER C 3 142 ? 11.858  36.789  75.223  1.00 17.97  ? 142 SER A CB    1 
ATOM   1863 O OG    . SER C 3 142 ? 12.480  37.926  74.682  1.00 24.89  ? 142 SER A OG    1 
ATOM   1864 N N     . LEU C 3 143 ? 11.121  34.373  72.685  1.00 17.43  ? 143 LEU A N     1 
ATOM   1865 C CA    . LEU C 3 143 ? 10.606  34.174  71.336  1.00 18.27  ? 143 LEU A CA    1 
ATOM   1866 C C     . LEU C 3 143 ? 10.063  35.417  70.648  1.00 19.29  ? 143 LEU A C     1 
ATOM   1867 O O     . LEU C 3 143 ? 10.219  35.578  69.437  1.00 20.03  ? 143 LEU A O     1 
ATOM   1868 C CB    . LEU C 3 143 ? 9.520   33.104  71.337  1.00 19.82  ? 143 LEU A CB    1 
ATOM   1869 C CG    . LEU C 3 143 ? 9.959   31.656  71.125  1.00 23.22  ? 143 LEU A CG    1 
ATOM   1870 C CD1   . LEU C 3 143 ? 8.722   30.789  70.919  1.00 24.20  ? 143 LEU A CD1   1 
ATOM   1871 C CD2   . LEU C 3 143 ? 10.863  31.565  69.888  1.00 25.59  ? 143 LEU A CD2   1 
ATOM   1872 N N     . SER C 3 144 ? 9.408   36.283  71.410  1.00 18.58  ? 144 SER A N     1 
ATOM   1873 C CA    . SER C 3 144 ? 8.856   37.510  70.855  1.00 20.10  ? 144 SER A CA    1 
ATOM   1874 C C     . SER C 3 144 ? 9.978   38.333  70.219  1.00 20.10  ? 144 SER A C     1 
ATOM   1875 O O     . SER C 3 144 ? 9.882   38.767  69.061  1.00 18.38  ? 144 SER A O     1 
ATOM   1876 C CB    . SER C 3 144 ? 8.176   38.320  71.967  1.00 21.91  ? 144 SER A CB    1 
ATOM   1877 O OG    . SER C 3 144 ? 7.642   39.529  71.465  1.00 24.74  ? 144 SER A OG    1 
ATOM   1878 N N     . GLU C 3 145 ? 11.046  38.540  70.985  1.00 19.21  ? 145 GLU A N     1 
ATOM   1879 C CA    . GLU C 3 145 ? 12.193  39.301  70.502  1.00 20.21  ? 145 GLU A CA    1 
ATOM   1880 C C     . GLU C 3 145 ? 12.798  38.622  69.266  1.00 19.56  ? 145 GLU A C     1 
ATOM   1881 O O     . GLU C 3 145 ? 13.230  39.283  68.314  1.00 18.63  ? 145 GLU A O     1 
ATOM   1882 C CB    . GLU C 3 145 ? 13.234  39.433  71.623  1.00 19.51  ? 145 GLU A CB    1 
ATOM   1883 C CG    . GLU C 3 145 ? 12.857  40.474  72.679  1.00 24.73  ? 145 GLU A CG    1 
ATOM   1884 C CD    . GLU C 3 145 ? 13.888  40.614  73.797  1.00 26.04  ? 145 GLU A CD    1 
ATOM   1885 O OE1   . GLU C 3 145 ? 15.099  40.369  73.552  1.00 24.19  ? 145 GLU A OE1   1 
ATOM   1886 O OE2   . GLU C 3 145 ? 13.483  40.988  74.919  1.00 23.12  ? 145 GLU A OE2   1 
ATOM   1887 N N     . VAL C 3 146 ? 12.814  37.296  69.292  1.00 18.10  ? 146 VAL A N     1 
ATOM   1888 C CA    . VAL C 3 146 ? 13.347  36.511  68.193  1.00 19.79  ? 146 VAL A CA    1 
ATOM   1889 C C     . VAL C 3 146 ? 12.528  36.708  66.920  1.00 19.61  ? 146 VAL A C     1 
ATOM   1890 O O     . VAL C 3 146 ? 13.081  36.885  65.837  1.00 21.90  ? 146 VAL A O     1 
ATOM   1891 C CB    . VAL C 3 146 ? 13.371  35.008  68.553  1.00 17.54  ? 146 VAL A CB    1 
ATOM   1892 C CG1   . VAL C 3 146 ? 13.937  34.205  67.387  1.00 15.76  ? 146 VAL A CG1   1 
ATOM   1893 C CG2   . VAL C 3 146 ? 14.203  34.794  69.801  1.00 14.67  ? 146 VAL A CG2   1 
ATOM   1894 N N     . LEU C 3 147 ? 11.209  36.686  67.053  1.00 19.11  ? 147 LEU A N     1 
ATOM   1895 C CA    . LEU C 3 147 ? 10.340  36.858  65.896  1.00 18.81  ? 147 LEU A CA    1 
ATOM   1896 C C     . LEU C 3 147 ? 10.381  38.299  65.367  1.00 17.26  ? 147 LEU A C     1 
ATOM   1897 O O     . LEU C 3 147 ? 10.180  38.524  64.181  1.00 16.89  ? 147 LEU A O     1 
ATOM   1898 C CB    . LEU C 3 147 ? 8.904   36.424  66.251  1.00 15.32  ? 147 LEU A CB    1 
ATOM   1899 C CG    . LEU C 3 147 ? 8.772   34.938  66.616  1.00 17.22  ? 147 LEU A CG    1 
ATOM   1900 C CD1   . LEU C 3 147 ? 7.402   34.671  67.195  1.00 18.89  ? 147 LEU A CD1   1 
ATOM   1901 C CD2   . LEU C 3 147 ? 9.010   34.063  65.394  1.00 15.07  ? 147 LEU A CD2   1 
ATOM   1902 N N     . TRP C 3 148 ? 10.635  39.268  66.245  1.00 18.25  ? 148 TRP A N     1 
ATOM   1903 C CA    . TRP C 3 148 ? 10.730  40.659  65.812  1.00 20.12  ? 148 TRP A CA    1 
ATOM   1904 C C     . TRP C 3 148 ? 11.938  40.794  64.891  1.00 20.86  ? 148 TRP A C     1 
ATOM   1905 O O     . TRP C 3 148 ? 11.858  41.404  63.823  1.00 21.53  ? 148 TRP A O     1 
ATOM   1906 C CB    . TRP C 3 148 ? 10.914  41.614  67.003  1.00 21.89  ? 148 TRP A CB    1 
ATOM   1907 C CG    . TRP C 3 148 ? 9.636   42.115  67.617  1.00 26.72  ? 148 TRP A CG    1 
ATOM   1908 C CD1   . TRP C 3 148 ? 8.902   41.512  68.589  1.00 27.56  ? 148 TRP A CD1   1 
ATOM   1909 C CD2   . TRP C 3 148 ? 8.926   43.302  67.259  1.00 28.20  ? 148 TRP A CD2   1 
ATOM   1910 N NE1   . TRP C 3 148 ? 7.777   42.243  68.859  1.00 28.57  ? 148 TRP A NE1   1 
ATOM   1911 C CE2   . TRP C 3 148 ? 7.765   43.349  68.054  1.00 29.00  ? 148 TRP A CE2   1 
ATOM   1912 C CE3   . TRP C 3 148 ? 9.156   44.330  66.341  1.00 30.90  ? 148 TRP A CE3   1 
ATOM   1913 C CZ2   . TRP C 3 148 ? 6.833   44.385  67.961  1.00 29.63  ? 148 TRP A CZ2   1 
ATOM   1914 C CZ3   . TRP C 3 148 ? 8.227   45.362  66.247  1.00 32.91  ? 148 TRP A CZ3   1 
ATOM   1915 C CH2   . TRP C 3 148 ? 7.084   45.378  67.052  1.00 30.87  ? 148 TRP A CH2   1 
ATOM   1916 N N     . VAL C 3 149 ? 13.064  40.224  65.317  1.00 20.93  ? 149 VAL A N     1 
ATOM   1917 C CA    . VAL C 3 149 ? 14.290  40.278  64.533  1.00 20.61  ? 149 VAL A CA    1 
ATOM   1918 C C     . VAL C 3 149 ? 14.107  39.640  63.167  1.00 19.63  ? 149 VAL A C     1 
ATOM   1919 O O     . VAL C 3 149 ? 14.623  40.145  62.177  1.00 19.05  ? 149 VAL A O     1 
ATOM   1920 C CB    . VAL C 3 149 ? 15.451  39.555  65.229  1.00 19.49  ? 149 VAL A CB    1 
ATOM   1921 C CG1   . VAL C 3 149 ? 16.664  39.570  64.328  1.00 16.07  ? 149 VAL A CG1   1 
ATOM   1922 C CG2   . VAL C 3 149 ? 15.765  40.222  66.558  1.00 21.17  ? 149 VAL A CG2   1 
ATOM   1923 N N     . CYS C 3 150 ? 13.384  38.526  63.122  1.00 20.59  ? 150 CYS A N     1 
ATOM   1924 C CA    . CYS C 3 150 ? 13.143  37.826  61.860  1.00 21.26  ? 150 CYS A CA    1 
ATOM   1925 C C     . CYS C 3 150 ? 12.282  38.659  60.924  1.00 21.94  ? 150 CYS A C     1 
ATOM   1926 O O     . CYS C 3 150 ? 12.609  38.812  59.747  1.00 20.47  ? 150 CYS A O     1 
ATOM   1927 C CB    . CYS C 3 150 ? 12.472  36.466  62.110  1.00 19.05  ? 150 CYS A CB    1 
ATOM   1928 S SG    . CYS C 3 150 ? 13.562  35.252  62.903  1.00 22.66  ? 150 CYS A SG    1 
ATOM   1929 N N     . ALA C 3 151 ? 11.182  39.200  61.448  1.00 22.94  ? 151 ALA A N     1 
ATOM   1930 C CA    . ALA C 3 151 ? 10.286  40.016  60.631  1.00 23.13  ? 151 ALA A CA    1 
ATOM   1931 C C     . ALA C 3 151 ? 11.063  41.184  60.043  1.00 22.78  ? 151 ALA A C     1 
ATOM   1932 O O     . ALA C 3 151 ? 10.865  41.561  58.892  1.00 23.64  ? 151 ALA A O     1 
ATOM   1933 C CB    . ALA C 3 151 ? 9.118   40.530  61.472  1.00 22.16  ? 151 ALA A CB    1 
ATOM   1934 N N     . ASN C 3 152 ? 11.963  41.744  60.837  1.00 23.36  ? 152 ASN A N     1 
ATOM   1935 C CA    . ASN C 3 152 ? 12.754  42.875  60.392  1.00 24.93  ? 152 ASN A CA    1 
ATOM   1936 C C     . ASN C 3 152 ? 13.682  42.524  59.220  1.00 25.66  ? 152 ASN A C     1 
ATOM   1937 O O     . ASN C 3 152 ? 13.968  43.382  58.378  1.00 26.43  ? 152 ASN A O     1 
ATOM   1938 C CB    . ASN C 3 152 ? 13.541  43.436  61.573  1.00 27.87  ? 152 ASN A CB    1 
ATOM   1939 C CG    . ASN C 3 152 ? 14.299  44.700  61.225  1.00 31.46  ? 152 ASN A CG    1 
ATOM   1940 O OD1   . ASN C 3 152 ? 15.530  44.711  61.243  1.00 34.68  ? 152 ASN A OD1   1 
ATOM   1941 N ND2   . ASN C 3 152 ? 13.570  45.775  60.906  1.00 30.81  ? 152 ASN A ND2   1 
ATOM   1942 N N     . LEU C 3 153 ? 14.148  41.276  59.150  1.00 23.75  ? 153 LEU A N     1 
ATOM   1943 C CA    . LEU C 3 153 ? 15.003  40.869  58.033  1.00 23.04  ? 153 LEU A CA    1 
ATOM   1944 C C     . LEU C 3 153 ? 14.208  40.949  56.715  1.00 24.06  ? 153 LEU A C     1 
ATOM   1945 O O     . LEU C 3 153 ? 14.774  41.233  55.657  1.00 22.63  ? 153 LEU A O     1 
ATOM   1946 C CB    . LEU C 3 153 ? 15.543  39.439  58.238  1.00 20.53  ? 153 LEU A CB    1 
ATOM   1947 C CG    . LEU C 3 153 ? 16.554  39.200  59.366  1.00 18.83  ? 153 LEU A CG    1 
ATOM   1948 C CD1   . LEU C 3 153 ? 16.953  37.753  59.375  1.00 19.34  ? 153 LEU A CD1   1 
ATOM   1949 C CD2   . LEU C 3 153 ? 17.791  40.084  59.177  1.00 19.43  ? 153 LEU A CD2   1 
ATOM   1950 N N     . PHE C 3 154 ? 12.902  40.688  56.785  1.00 25.99  ? 154 PHE A N     1 
ATOM   1951 C CA    . PHE C 3 154 ? 12.035  40.765  55.602  1.00 29.71  ? 154 PHE A CA    1 
ATOM   1952 C C     . PHE C 3 154 ? 11.923  42.222  55.143  1.00 32.90  ? 154 PHE A C     1 
ATOM   1953 O O     . PHE C 3 154 ? 11.900  42.507  53.956  1.00 35.88  ? 154 PHE A O     1 
ATOM   1954 C CB    . PHE C 3 154 ? 10.617  40.243  55.907  1.00 25.97  ? 154 PHE A CB    1 
ATOM   1955 C CG    . PHE C 3 154 ? 10.528  38.744  56.104  1.00 22.72  ? 154 PHE A CG    1 
ATOM   1956 C CD1   . PHE C 3 154 ? 9.993   38.216  57.275  1.00 20.52  ? 154 PHE A CD1   1 
ATOM   1957 C CD2   . PHE C 3 154 ? 10.956  37.867  55.114  1.00 21.93  ? 154 PHE A CD2   1 
ATOM   1958 C CE1   . PHE C 3 154 ? 9.888   36.838  57.463  1.00 21.23  ? 154 PHE A CE1   1 
ATOM   1959 C CE2   . PHE C 3 154 ? 10.856  36.487  55.289  1.00 21.76  ? 154 PHE A CE2   1 
ATOM   1960 C CZ    . PHE C 3 154 ? 10.323  35.969  56.466  1.00 21.59  ? 154 PHE A CZ    1 
ATOM   1961 N N     . SER C 3 155 ? 11.861  43.143  56.095  1.00 37.15  ? 155 SER A N     1 
ATOM   1962 C CA    . SER C 3 155 ? 11.737  44.563  55.785  1.00 42.40  ? 155 SER A CA    1 
ATOM   1963 C C     . SER C 3 155 ? 12.984  45.172  55.166  1.00 46.45  ? 155 SER A C     1 
ATOM   1964 O O     . SER C 3 155 ? 12.891  46.112  54.374  1.00 45.47  ? 155 SER A O     1 
ATOM   1965 C CB    . SER C 3 155 ? 11.382  45.347  57.048  1.00 40.80  ? 155 SER A CB    1 
ATOM   1966 O OG    . SER C 3 155 ? 10.178  44.866  57.617  1.00 43.62  ? 155 SER A OG    1 
ATOM   1967 N N     . ASP C 3 156 ? 14.149  44.646  55.530  1.00 51.39  ? 156 ASP A N     1 
ATOM   1968 C CA    . ASP C 3 156 ? 15.406  45.179  55.015  1.00 56.34  ? 156 ASP A CA    1 
ATOM   1969 C C     . ASP C 3 156 ? 15.691  44.771  53.575  1.00 59.67  ? 156 ASP A C     1 
ATOM   1970 O O     . ASP C 3 156 ? 16.649  45.251  52.970  1.00 60.78  ? 156 ASP A O     1 
ATOM   1971 C CB    . ASP C 3 156 ? 16.587  44.755  55.904  1.00 57.74  ? 156 ASP A CB    1 
ATOM   1972 C CG    . ASP C 3 156 ? 16.416  45.180  57.361  1.00 59.06  ? 156 ASP A CG    1 
ATOM   1973 O OD1   . ASP C 3 156 ? 15.822  46.253  57.618  1.00 58.92  ? 156 ASP A OD1   1 
ATOM   1974 O OD2   . ASP C 3 156 ? 16.894  44.440  58.251  1.00 59.39  ? 156 ASP A OD2   1 
ATOM   1975 N N     . VAL C 3 157 ? 14.863  43.893  53.023  1.00 62.99  ? 157 VAL A N     1 
ATOM   1976 C CA    . VAL C 3 157 ? 15.066  43.443  51.653  1.00 66.05  ? 157 VAL A CA    1 
ATOM   1977 C C     . VAL C 3 157 ? 14.851  44.587  50.670  1.00 67.77  ? 157 VAL A C     1 
ATOM   1978 O O     . VAL C 3 157 ? 13.762  45.165  50.598  1.00 66.37  ? 157 VAL A O     1 
ATOM   1979 C CB    . VAL C 3 157 ? 14.111  42.286  51.283  1.00 66.80  ? 157 VAL A CB    1 
ATOM   1980 C CG1   . VAL C 3 157 ? 12.671  42.787  51.206  1.00 67.46  ? 157 VAL A CG1   1 
ATOM   1981 C CG2   . VAL C 3 157 ? 14.532  41.681  49.960  1.00 67.54  ? 157 VAL A CG2   1 
ATOM   1982 N N     . GLN C 3 158 ? 15.901  44.917  49.918  1.00 70.87  ? 158 GLN A N     1 
ATOM   1983 C CA    . GLN C 3 158 ? 15.818  45.985  48.931  1.00 73.08  ? 158 GLN A CA    1 
ATOM   1984 C C     . GLN C 3 158 ? 14.969  45.514  47.757  1.00 74.58  ? 158 GLN A C     1 
ATOM   1985 O O     . GLN C 3 158 ? 14.358  46.323  47.056  1.00 75.75  ? 158 GLN A O     1 
ATOM   1986 C CB    . GLN C 3 158 ? 17.217  46.394  48.439  1.00 73.72  ? 158 GLN A CB    1 
ATOM   1987 C CG    . GLN C 3 158 ? 18.037  45.293  47.767  1.00 74.27  ? 158 GLN A CG    1 
ATOM   1988 C CD    . GLN C 3 158 ? 18.902  44.510  48.744  1.00 74.78  ? 158 GLN A CD    1 
ATOM   1989 O OE1   . GLN C 3 158 ? 18.396  43.818  49.626  1.00 74.72  ? 158 GLN A OE1   1 
ATOM   1990 N NE2   . GLN C 3 158 ? 20.217  44.618  48.586  1.00 75.43  ? 158 GLN A NE2   1 
ATOM   1991 N N     . PHE C 3 159 ? 14.925  44.199  47.554  1.00 75.09  ? 159 PHE A N     1 
ATOM   1992 C CA    . PHE C 3 159 ? 14.146  43.623  46.466  1.00 75.25  ? 159 PHE A CA    1 
ATOM   1993 C C     . PHE C 3 159 ? 12.674  43.584  46.865  1.00 75.20  ? 159 PHE A C     1 
ATOM   1994 O O     . PHE C 3 159 ? 12.326  43.783  48.031  1.00 75.01  ? 159 PHE A O     1 
ATOM   1995 C CB    . PHE C 3 159 ? 14.588  42.181  46.159  1.00 76.01  ? 159 PHE A CB    1 
ATOM   1996 C CG    . PHE C 3 159 ? 16.082  41.961  46.167  1.00 76.99  ? 159 PHE A CG    1 
ATOM   1997 C CD1   . PHE C 3 159 ? 16.791  41.907  47.367  1.00 77.18  ? 159 PHE A CD1   1 
ATOM   1998 C CD2   . PHE C 3 159 ? 16.772  41.747  44.975  1.00 77.25  ? 159 PHE A CD2   1 
ATOM   1999 C CE1   . PHE C 3 159 ? 18.167  41.637  47.378  1.00 77.29  ? 159 PHE A CE1   1 
ATOM   2000 C CE2   . PHE C 3 159 ? 18.148  41.477  44.977  1.00 77.12  ? 159 PHE A CE2   1 
ATOM   2001 C CZ    . PHE C 3 159 ? 18.843  41.421  46.181  1.00 76.70  ? 159 PHE A CZ    1 
ATOM   2002 N N     . LYS C 3 160 ? 11.813  43.333  45.885  1.00 74.90  ? 160 LYS A N     1 
ATOM   2003 C CA    . LYS C 3 160 ? 10.386  43.211  46.139  1.00 74.19  ? 160 LYS A CA    1 
ATOM   2004 C C     . LYS C 3 160 ? 10.207  41.739  46.481  1.00 72.99  ? 160 LYS A C     1 
ATOM   2005 O O     . LYS C 3 160 ? 10.883  40.881  45.911  1.00 72.38  ? 160 LYS A O     1 
ATOM   2006 C CB    . LYS C 3 160 ? 9.570   43.546  44.888  1.00 75.47  ? 160 LYS A CB    1 
ATOM   2007 C CG    . LYS C 3 160 ? 9.630   44.998  44.451  1.00 77.14  ? 160 LYS A CG    1 
ATOM   2008 C CD    . LYS C 3 160 ? 8.743   45.227  43.230  1.00 79.24  ? 160 LYS A CD    1 
ATOM   2009 C CE    . LYS C 3 160 ? 8.747   46.687  42.794  1.00 80.11  ? 160 LYS A CE    1 
ATOM   2010 N NZ    . LYS C 3 160 ? 7.862   46.923  41.617  1.00 80.42  ? 160 LYS A NZ    1 
ATOM   2011 N N     . MET C 3 161 ? 9.309   41.438  47.411  1.00 71.46  ? 161 MET A N     1 
ATOM   2012 C CA    . MET C 3 161 ? 9.096   40.050  47.790  1.00 69.41  ? 161 MET A CA    1 
ATOM   2013 C C     . MET C 3 161 ? 7.658   39.604  47.654  1.00 66.80  ? 161 MET A C     1 
ATOM   2014 O O     . MET C 3 161 ? 6.735   40.418  47.572  1.00 67.36  ? 161 MET A O     1 
ATOM   2015 C CB    . MET C 3 161 ? 9.526   39.812  49.233  1.00 70.48  ? 161 MET A CB    1 
ATOM   2016 C CG    . MET C 3 161 ? 10.950  40.187  49.537  1.00 72.94  ? 161 MET A CG    1 
ATOM   2017 S SD    . MET C 3 161 ? 11.304  39.799  51.245  1.00 74.06  ? 161 MET A SD    1 
ATOM   2018 C CE    . MET C 3 161 ? 10.108  40.842  52.060  1.00 74.64  ? 161 MET A CE    1 
ATOM   2019 N N     . SER C 3 162 ? 7.488   38.290  47.637  1.00 63.01  ? 162 SER A N     1 
ATOM   2020 C CA    . SER C 3 162 ? 6.177   37.680  47.548  1.00 58.78  ? 162 SER A CA    1 
ATOM   2021 C C     . SER C 3 162 ? 5.952   37.052  48.918  1.00 55.11  ? 162 SER A C     1 
ATOM   2022 O O     . SER C 3 162 ? 5.572   37.733  49.871  1.00 54.20  ? 162 SER A O     1 
ATOM   2023 C CB    . SER C 3 162 ? 6.165   36.599  46.462  1.00 60.68  ? 162 SER A CB    1 
ATOM   2024 O OG    . SER C 3 162 ? 6.620   37.112  45.218  1.00 63.04  ? 162 SER A OG    1 
ATOM   2025 N N     . HIS C 3 163 ? 6.225   35.757  49.015  1.00 51.18  ? 163 HIS A N     1 
ATOM   2026 C CA    . HIS C 3 163 ? 6.056   35.025  50.260  1.00 47.32  ? 163 HIS A CA    1 
ATOM   2027 C C     . HIS C 3 163 ? 7.144   35.326  51.288  1.00 41.90  ? 163 HIS A C     1 
ATOM   2028 O O     . HIS C 3 163 ? 8.324   35.412  50.956  1.00 40.26  ? 163 HIS A O     1 
ATOM   2029 C CB    . HIS C 3 163 ? 6.027   33.522  49.974  1.00 51.67  ? 163 HIS A CB    1 
ATOM   2030 C CG    . HIS C 3 163 ? 4.656   32.983  49.717  1.00 56.54  ? 163 HIS A CG    1 
ATOM   2031 N ND1   . HIS C 3 163 ? 3.744   32.762  50.727  1.00 58.22  ? 163 HIS A ND1   1 
ATOM   2032 C CD2   . HIS C 3 163 ? 4.040   32.621  48.565  1.00 58.70  ? 163 HIS A CD2   1 
ATOM   2033 C CE1   . HIS C 3 163 ? 2.625   32.285  50.208  1.00 60.38  ? 163 HIS A CE1   1 
ATOM   2034 N NE2   . HIS C 3 163 ? 2.779   32.190  48.899  1.00 59.98  ? 163 HIS A NE2   1 
ATOM   2035 N N     . LYS C 3 164 ? 6.725   35.493  52.537  1.00 35.64  ? 164 LYS A N     1 
ATOM   2036 C CA    . LYS C 3 164 ? 7.635   35.756  53.643  1.00 31.38  ? 164 LYS A CA    1 
ATOM   2037 C C     . LYS C 3 164 ? 7.416   34.602  54.608  1.00 28.73  ? 164 LYS A C     1 
ATOM   2038 O O     . LYS C 3 164 ? 6.375   34.503  55.250  1.00 29.03  ? 164 LYS A O     1 
ATOM   2039 C CB    . LYS C 3 164 ? 7.302   37.107  54.278  1.00 30.69  ? 164 LYS A CB    1 
ATOM   2040 C CG    . LYS C 3 164 ? 7.665   38.268  53.359  1.00 31.91  ? 164 LYS A CG    1 
ATOM   2041 C CD    . LYS C 3 164 ? 6.738   39.461  53.492  1.00 34.97  ? 164 LYS A CD    1 
ATOM   2042 C CE    . LYS C 3 164 ? 6.921   40.391  52.292  1.00 38.01  ? 164 LYS A CE    1 
ATOM   2043 N NZ    . LYS C 3 164 ? 5.963   41.534  52.242  1.00 39.12  ? 164 LYS A NZ    1 
ATOM   2044 N N     . ARG C 3 165 ? 8.398   33.717  54.697  1.00 24.45  ? 165 ARG A N     1 
ATOM   2045 C CA    . ARG C 3 165 ? 8.261   32.545  55.540  1.00 24.59  ? 165 ARG A CA    1 
ATOM   2046 C C     . ARG C 3 165 ? 9.410   32.306  56.521  1.00 23.53  ? 165 ARG A C     1 
ATOM   2047 O O     . ARG C 3 165 ? 10.587  32.465  56.175  1.00 24.01  ? 165 ARG A O     1 
ATOM   2048 C CB    . ARG C 3 165 ? 8.070   31.325  54.623  1.00 24.69  ? 165 ARG A CB    1 
ATOM   2049 C CG    . ARG C 3 165 ? 8.006   29.979  55.315  1.00 27.69  ? 165 ARG A CG    1 
ATOM   2050 C CD    . ARG C 3 165 ? 7.788   28.869  54.296  1.00 31.42  ? 165 ARG A CD    1 
ATOM   2051 N NE    . ARG C 3 165 ? 6.568   29.098  53.529  1.00 34.07  ? 165 ARG A NE    1 
ATOM   2052 C CZ    . ARG C 3 165 ? 5.564   28.233  53.437  1.00 34.52  ? 165 ARG A CZ    1 
ATOM   2053 N NH1   . ARG C 3 165 ? 5.628   27.064  54.059  1.00 33.95  ? 165 ARG A NH1   1 
ATOM   2054 N NH2   . ARG C 3 165 ? 4.482   28.549  52.739  1.00 36.81  ? 165 ARG A NH2   1 
ATOM   2055 N N     . ILE C 3 166 ? 9.057   31.924  57.747  1.00 21.20  ? 166 ILE A N     1 
ATOM   2056 C CA    . ILE C 3 166 ? 10.045  31.619  58.780  1.00 19.67  ? 166 ILE A CA    1 
ATOM   2057 C C     . ILE C 3 166 ? 9.913   30.139  59.130  1.00 18.96  ? 166 ILE A C     1 
ATOM   2058 O O     . ILE C 3 166 ? 8.823   29.663  59.425  1.00 18.91  ? 166 ILE A O     1 
ATOM   2059 C CB    . ILE C 3 166 ? 9.818   32.417  60.077  1.00 18.09  ? 166 ILE A CB    1 
ATOM   2060 C CG1   . ILE C 3 166 ? 9.839   33.908  59.802  1.00 17.68  ? 166 ILE A CG1   1 
ATOM   2061 C CG2   . ILE C 3 166 ? 10.922  32.103  61.081  1.00 14.93  ? 166 ILE A CG2   1 
ATOM   2062 C CD1   . ILE C 3 166 ? 9.526   34.722  61.052  1.00 20.99  ? 166 ILE A CD1   1 
ATOM   2063 N N     . MET C 3 167 ? 11.028  29.423  59.097  1.00 19.57  ? 167 MET A N     1 
ATOM   2064 C CA    . MET C 3 167 ? 11.051  28.002  59.404  1.00 20.62  ? 167 MET A CA    1 
ATOM   2065 C C     . MET C 3 167 ? 11.807  27.834  60.723  1.00 20.86  ? 167 MET A C     1 
ATOM   2066 O O     . MET C 3 167 ? 13.005  28.097  60.792  1.00 20.60  ? 167 MET A O     1 
ATOM   2067 C CB    . MET C 3 167 ? 11.759  27.258  58.273  1.00 23.00  ? 167 MET A CB    1 
ATOM   2068 C CG    . MET C 3 167 ? 11.423  25.789  58.155  1.00 29.31  ? 167 MET A CG    1 
ATOM   2069 S SD    . MET C 3 167 ? 11.651  25.190  56.452  1.00 36.43  ? 167 MET A SD    1 
ATOM   2070 C CE    . MET C 3 167 ? 10.164  25.852  55.676  1.00 35.13  ? 167 MET A CE    1 
ATOM   2071 N N     . LEU C 3 168 ? 11.101  27.402  61.766  1.00 19.19  ? 168 LEU A N     1 
ATOM   2072 C CA    . LEU C 3 168 ? 11.695  27.232  63.087  1.00 19.60  ? 168 LEU A CA    1 
ATOM   2073 C C     . LEU C 3 168 ? 12.119  25.793  63.420  1.00 19.91  ? 168 LEU A C     1 
ATOM   2074 O O     . LEU C 3 168 ? 11.305  24.869  63.356  1.00 21.49  ? 168 LEU A O     1 
ATOM   2075 C CB    . LEU C 3 168 ? 10.710  27.739  64.146  1.00 17.58  ? 168 LEU A CB    1 
ATOM   2076 C CG    . LEU C 3 168 ? 11.074  27.526  65.618  1.00 16.49  ? 168 LEU A CG    1 
ATOM   2077 C CD1   . LEU C 3 168 ? 12.320  28.293  65.949  1.00 14.74  ? 168 LEU A CD1   1 
ATOM   2078 C CD2   . LEU C 3 168 ? 9.928   27.985  66.506  1.00 17.12  ? 168 LEU A CD2   1 
ATOM   2079 N N     . PHE C 3 169 ? 13.389  25.607  63.788  1.00 18.41  ? 169 PHE A N     1 
ATOM   2080 C CA    . PHE C 3 169 ? 13.892  24.274  64.145  1.00 17.94  ? 169 PHE A CA    1 
ATOM   2081 C C     . PHE C 3 169 ? 14.153  24.217  65.659  1.00 18.27  ? 169 PHE A C     1 
ATOM   2082 O O     . PHE C 3 169 ? 15.019  24.921  66.184  1.00 18.36  ? 169 PHE A O     1 
ATOM   2083 C CB    . PHE C 3 169 ? 15.194  23.952  63.405  1.00 17.35  ? 169 PHE A CB    1 
ATOM   2084 C CG    . PHE C 3 169 ? 15.100  24.040  61.911  1.00 17.29  ? 169 PHE A CG    1 
ATOM   2085 C CD1   . PHE C 3 169 ? 14.919  25.262  61.275  1.00 18.02  ? 169 PHE A CD1   1 
ATOM   2086 C CD2   . PHE C 3 169 ? 15.260  22.900  61.129  1.00 19.27  ? 169 PHE A CD2   1 
ATOM   2087 C CE1   . PHE C 3 169 ? 14.903  25.345  59.885  1.00 16.55  ? 169 PHE A CE1   1 
ATOM   2088 C CE2   . PHE C 3 169 ? 15.245  22.978  59.749  1.00 15.99  ? 169 PHE A CE2   1 
ATOM   2089 C CZ    . PHE C 3 169 ? 15.067  24.202  59.127  1.00 15.62  ? 169 PHE A CZ    1 
ATOM   2090 N N     . THR C 3 170 ? 13.407  23.370  66.358  1.00 19.08  ? 170 THR A N     1 
ATOM   2091 C CA    . THR C 3 170 ? 13.547  23.258  67.802  1.00 17.62  ? 170 THR A CA    1 
ATOM   2092 C C     . THR C 3 170 ? 12.957  21.958  68.304  1.00 18.60  ? 170 THR A C     1 
ATOM   2093 O O     . THR C 3 170 ? 12.016  21.420  67.712  1.00 16.37  ? 170 THR A O     1 
ATOM   2094 C CB    . THR C 3 170 ? 12.808  24.409  68.533  1.00 18.34  ? 170 THR A CB    1 
ATOM   2095 O OG1   . THR C 3 170 ? 12.987  24.273  69.951  1.00 19.05  ? 170 THR A OG1   1 
ATOM   2096 C CG2   . THR C 3 170 ? 11.303  24.373  68.219  1.00 14.52  ? 170 THR A CG2   1 
ATOM   2097 N N     . ASN C 3 171 ? 13.513  21.468  69.406  1.00 18.96  ? 171 ASN A N     1 
ATOM   2098 C CA    . ASN C 3 171 ? 13.033  20.247  70.023  1.00 20.40  ? 171 ASN A CA    1 
ATOM   2099 C C     . ASN C 3 171 ? 12.467  20.610  71.394  1.00 19.72  ? 171 ASN A C     1 
ATOM   2100 O O     . ASN C 3 171 ? 12.350  19.777  72.281  1.00 19.45  ? 171 ASN A O     1 
ATOM   2101 C CB    . ASN C 3 171 ? 14.162  19.209  70.120  1.00 18.58  ? 171 ASN A CB    1 
ATOM   2102 C CG    . ASN C 3 171 ? 15.195  19.543  71.176  1.00 19.71  ? 171 ASN A CG    1 
ATOM   2103 O OD1   . ASN C 3 171 ? 15.380  20.703  71.543  1.00 21.44  ? 171 ASN A OD1   1 
ATOM   2104 N ND2   . ASN C 3 171 ? 15.892  18.518  71.657  1.00 16.86  ? 171 ASN A ND2   1 
ATOM   2105 N N     . GLU C 3 172 ? 12.113  21.878  71.540  1.00 20.44  ? 172 GLU A N     1 
ATOM   2106 C CA    . GLU C 3 172 ? 11.531  22.400  72.773  1.00 21.77  ? 172 GLU A CA    1 
ATOM   2107 C C     . GLU C 3 172 ? 10.068  22.727  72.467  1.00 21.35  ? 172 GLU A C     1 
ATOM   2108 O O     . GLU C 3 172 ? 9.791   23.593  71.644  1.00 21.61  ? 172 GLU A O     1 
ATOM   2109 C CB    . GLU C 3 172 ? 12.286  23.664  73.205  1.00 20.41  ? 172 GLU A CB    1 
ATOM   2110 C CG    . GLU C 3 172 ? 11.663  24.410  74.360  1.00 22.40  ? 172 GLU A CG    1 
ATOM   2111 C CD    . GLU C 3 172 ? 11.450  23.533  75.573  1.00 25.14  ? 172 GLU A CD    1 
ATOM   2112 O OE1   . GLU C 3 172 ? 12.454  23.057  76.147  1.00 28.12  ? 172 GLU A OE1   1 
ATOM   2113 O OE2   . GLU C 3 172 ? 10.276  23.311  75.947  1.00 26.05  ? 172 GLU A OE2   1 
ATOM   2114 N N     . ASP C 3 173 ? 9.137   22.039  73.122  1.00 21.13  ? 173 ASP A N     1 
ATOM   2115 C CA    . ASP C 3 173 ? 7.720   22.267  72.863  1.00 22.37  ? 173 ASP A CA    1 
ATOM   2116 C C     . ASP C 3 173 ? 7.011   23.208  73.827  1.00 22.61  ? 173 ASP A C     1 
ATOM   2117 O O     . ASP C 3 173 ? 5.806   23.428  73.698  1.00 21.39  ? 173 ASP A O     1 
ATOM   2118 C CB    . ASP C 3 173 ? 6.970   20.930  72.807  1.00 22.18  ? 173 ASP A CB    1 
ATOM   2119 C CG    . ASP C 3 173 ? 7.075   20.137  74.103  1.00 26.05  ? 173 ASP A CG    1 
ATOM   2120 O OD1   . ASP C 3 173 ? 6.563   18.992  74.143  1.00 26.66  ? 173 ASP A OD1   1 
ATOM   2121 O OD2   . ASP C 3 173 ? 7.666   20.649  75.081  1.00 26.82  ? 173 ASP A OD2   1 
ATOM   2122 N N     . ASN C 3 174 ? 7.752   23.768  74.781  1.00 23.40  ? 174 ASN A N     1 
ATOM   2123 C CA    . ASN C 3 174 ? 7.167   24.690  75.756  1.00 24.36  ? 174 ASN A CA    1 
ATOM   2124 C C     . ASN C 3 174 ? 8.237   25.678  76.265  1.00 24.03  ? 174 ASN A C     1 
ATOM   2125 O O     . ASN C 3 174 ? 8.605   25.681  77.440  1.00 25.41  ? 174 ASN A O     1 
ATOM   2126 C CB    . ASN C 3 174 ? 6.556   23.881  76.906  1.00 24.29  ? 174 ASN A CB    1 
ATOM   2127 C CG    . ASN C 3 174 ? 5.587   24.695  77.753  1.00 28.03  ? 174 ASN A CG    1 
ATOM   2128 O OD1   . ASN C 3 174 ? 4.975   25.658  77.278  1.00 30.11  ? 174 ASN A OD1   1 
ATOM   2129 N ND2   . ASN C 3 174 ? 5.424   24.294  79.008  1.00 28.59  ? 174 ASN A ND2   1 
ATOM   2130 N N     . PRO C 3 175 ? 8.731   26.546  75.368  1.00 23.42  ? 175 PRO A N     1 
ATOM   2131 C CA    . PRO C 3 175 ? 9.759   27.563  75.622  1.00 23.21  ? 175 PRO A CA    1 
ATOM   2132 C C     . PRO C 3 175 ? 9.572   28.403  76.878  1.00 22.91  ? 175 PRO A C     1 
ATOM   2133 O O     . PRO C 3 175 ? 10.510  28.618  77.649  1.00 23.48  ? 175 PRO A O     1 
ATOM   2134 C CB    . PRO C 3 175 ? 9.701   28.446  74.376  1.00 22.32  ? 175 PRO A CB    1 
ATOM   2135 C CG    . PRO C 3 175 ? 9.176   27.555  73.332  1.00 26.39  ? 175 PRO A CG    1 
ATOM   2136 C CD    . PRO C 3 175 ? 8.129   26.739  74.035  1.00 24.24  ? 175 PRO A CD    1 
ATOM   2137 N N     . HIS C 3 176 ? 8.358   28.887  77.079  1.00 21.86  ? 176 HIS A N     1 
ATOM   2138 C CA    . HIS C 3 176 ? 8.107   29.744  78.214  1.00 21.73  ? 176 HIS A CA    1 
ATOM   2139 C C     . HIS C 3 176 ? 7.022   29.276  79.155  1.00 21.18  ? 176 HIS A C     1 
ATOM   2140 O O     . HIS C 3 176 ? 6.268   30.082  79.694  1.00 22.64  ? 176 HIS A O     1 
ATOM   2141 C CB    . HIS C 3 176 ? 7.827   31.150  77.683  1.00 22.60  ? 176 HIS A CB    1 
ATOM   2142 C CG    . HIS C 3 176 ? 8.951   31.687  76.852  1.00 24.35  ? 176 HIS A CG    1 
ATOM   2143 N ND1   . HIS C 3 176 ? 8.768   32.207  75.590  1.00 25.01  ? 176 HIS A ND1   1 
ATOM   2144 C CD2   . HIS C 3 176 ? 10.284  31.727  77.085  1.00 23.02  ? 176 HIS A CD2   1 
ATOM   2145 C CE1   . HIS C 3 176 ? 9.941   32.542  75.081  1.00 24.23  ? 176 HIS A CE1   1 
ATOM   2146 N NE2   . HIS C 3 176 ? 10.877  32.259  75.968  1.00 21.82  ? 176 HIS A NE2   1 
ATOM   2147 N N     . GLY C 3 177 ? 6.965   27.965  79.371  1.00 22.77  ? 177 GLY A N     1 
ATOM   2148 C CA    . GLY C 3 177 ? 5.965   27.412  80.263  1.00 25.65  ? 177 GLY A CA    1 
ATOM   2149 C C     . GLY C 3 177 ? 6.198   27.853  81.695  1.00 26.60  ? 177 GLY A C     1 
ATOM   2150 O O     . GLY C 3 177 ? 5.378   27.611  82.574  1.00 28.98  ? 177 GLY A O     1 
ATOM   2151 N N     . ASN C 3 178 ? 7.315   28.531  81.914  1.00 27.50  ? 178 ASN A N     1 
ATOM   2152 C CA    . ASN C 3 178 ? 7.710   29.000  83.235  1.00 28.88  ? 178 ASN A CA    1 
ATOM   2153 C C     . ASN C 3 178 ? 7.756   30.525  83.324  1.00 27.82  ? 178 ASN A C     1 
ATOM   2154 O O     . ASN C 3 178 ? 8.160   31.065  84.346  1.00 28.37  ? 178 ASN A O     1 
ATOM   2155 C CB    . ASN C 3 178 ? 9.102   28.467  83.535  1.00 31.78  ? 178 ASN A CB    1 
ATOM   2156 C CG    . ASN C 3 178 ? 10.157  29.083  82.615  1.00 34.23  ? 178 ASN A CG    1 
ATOM   2157 O OD1   . ASN C 3 178 ? 10.921  29.959  83.030  1.00 37.50  ? 178 ASN A OD1   1 
ATOM   2158 N ND2   . ASN C 3 178 ? 10.179  28.649  81.355  1.00 28.00  ? 178 ASN A ND2   1 
ATOM   2159 N N     . ASP C 3 179 ? 7.367   31.215  82.257  1.00 27.01  ? 179 ASP A N     1 
ATOM   2160 C CA    . ASP C 3 179 ? 7.407   32.675  82.250  1.00 25.87  ? 179 ASP A CA    1 
ATOM   2161 C C     . ASP C 3 179 ? 6.247   33.245  81.409  1.00 25.59  ? 179 ASP A C     1 
ATOM   2162 O O     . ASP C 3 179 ? 6.407   33.498  80.206  1.00 23.70  ? 179 ASP A O     1 
ATOM   2163 C CB    . ASP C 3 179 ? 8.754   33.128  81.672  1.00 26.63  ? 179 ASP A CB    1 
ATOM   2164 C CG    . ASP C 3 179 ? 8.975   34.627  81.786  1.00 28.82  ? 179 ASP A CG    1 
ATOM   2165 O OD1   . ASP C 3 179 ? 7.983   35.390  81.760  1.00 31.13  ? 179 ASP A OD1   1 
ATOM   2166 O OD2   . ASP C 3 179 ? 10.148  35.047  81.878  1.00 28.28  ? 179 ASP A OD2   1 
ATOM   2167 N N     . SER C 3 180 ? 5.094   33.464  82.044  1.00 22.46  ? 180 SER A N     1 
ATOM   2168 C CA    . SER C 3 180 ? 3.925   33.974  81.325  1.00 22.95  ? 180 SER A CA    1 
ATOM   2169 C C     . SER C 3 180 ? 4.200   35.286  80.585  1.00 20.06  ? 180 SER A C     1 
ATOM   2170 O O     . SER C 3 180 ? 3.688   35.498  79.490  1.00 19.82  ? 180 SER A O     1 
ATOM   2171 C CB    . SER C 3 180 ? 2.727   34.139  82.273  1.00 22.08  ? 180 SER A CB    1 
ATOM   2172 O OG    . SER C 3 180 ? 2.866   35.275  83.109  1.00 28.16  ? 180 SER A OG    1 
ATOM   2173 N N     . ALA C 3 181 ? 5.015   36.154  81.168  1.00 16.80  ? 181 ALA A N     1 
ATOM   2174 C CA    . ALA C 3 181 ? 5.349   37.428  80.530  1.00 17.25  ? 181 ALA A CA    1 
ATOM   2175 C C     . ALA C 3 181 ? 5.971   37.206  79.152  1.00 19.78  ? 181 ALA A C     1 
ATOM   2176 O O     . ALA C 3 181 ? 5.801   38.020  78.245  1.00 20.97  ? 181 ALA A O     1 
ATOM   2177 C CB    . ALA C 3 181 ? 6.309   38.225  81.405  1.00 11.14  ? 181 ALA A CB    1 
ATOM   2178 N N     . LYS C 3 182 ? 6.704   36.105  78.996  1.00 22.65  ? 182 LYS A N     1 
ATOM   2179 C CA    . LYS C 3 182 ? 7.325   35.807  77.716  1.00 21.81  ? 182 LYS A CA    1 
ATOM   2180 C C     . LYS C 3 182 ? 6.372   35.010  76.829  1.00 21.55  ? 182 LYS A C     1 
ATOM   2181 O O     . LYS C 3 182 ? 6.238   35.291  75.639  1.00 22.15  ? 182 LYS A O     1 
ATOM   2182 C CB    . LYS C 3 182 ? 8.632   35.031  77.915  1.00 20.51  ? 182 LYS A CB    1 
ATOM   2183 C CG    . LYS C 3 182 ? 9.773   35.842  78.506  1.00 17.44  ? 182 LYS A CG    1 
ATOM   2184 C CD    . LYS C 3 182 ? 11.049  35.034  78.443  1.00 17.43  ? 182 LYS A CD    1 
ATOM   2185 C CE    . LYS C 3 182 ? 12.190  35.698  79.165  1.00 17.57  ? 182 LYS A CE    1 
ATOM   2186 N NZ    . LYS C 3 182 ? 13.333  34.743  79.263  1.00 18.76  ? 182 LYS A NZ    1 
ATOM   2187 N N     . ALA C 3 183 ? 5.706   34.021  77.407  1.00 20.49  ? 183 ALA A N     1 
ATOM   2188 C CA    . ALA C 3 183 ? 4.764   33.210  76.645  1.00 21.79  ? 183 ALA A CA    1 
ATOM   2189 C C     . ALA C 3 183 ? 3.725   34.110  75.981  1.00 19.70  ? 183 ALA A C     1 
ATOM   2190 O O     . ALA C 3 183 ? 3.412   33.945  74.804  1.00 20.63  ? 183 ALA A O     1 
ATOM   2191 C CB    . ALA C 3 183 ? 4.071   32.197  77.558  1.00 20.08  ? 183 ALA A CB    1 
ATOM   2192 N N     . SER C 3 184 ? 3.209   35.069  76.743  1.00 18.89  ? 184 SER A N     1 
ATOM   2193 C CA    . SER C 3 184 ? 2.199   35.989  76.245  1.00 19.78  ? 184 SER A CA    1 
ATOM   2194 C C     . SER C 3 184 ? 2.727   36.895  75.137  1.00 20.81  ? 184 SER A C     1 
ATOM   2195 O O     . SER C 3 184 ? 2.057   37.095  74.132  1.00 22.84  ? 184 SER A O     1 
ATOM   2196 C CB    . SER C 3 184 ? 1.652   36.829  77.398  1.00 18.42  ? 184 SER A CB    1 
ATOM   2197 O OG    . SER C 3 184 ? 2.693   37.571  78.005  1.00 22.73  ? 184 SER A OG    1 
ATOM   2198 N N     . ARG C 3 185 ? 3.928   37.444  75.305  1.00 20.69  ? 185 ARG A N     1 
ATOM   2199 C CA    . ARG C 3 185 ? 4.489   38.303  74.266  1.00 18.79  ? 185 ARG A CA    1 
ATOM   2200 C C     . ARG C 3 185 ? 4.726   37.501  72.986  1.00 18.05  ? 185 ARG A C     1 
ATOM   2201 O O     . ARG C 3 185 ? 4.521   38.001  71.878  1.00 18.74  ? 185 ARG A O     1 
ATOM   2202 C CB    . ARG C 3 185 ? 5.795   38.951  74.747  1.00 20.02  ? 185 ARG A CB    1 
ATOM   2203 C CG    . ARG C 3 185 ? 5.586   40.109  75.714  1.00 21.10  ? 185 ARG A CG    1 
ATOM   2204 C CD    . ARG C 3 185 ? 6.903   40.636  76.277  1.00 23.04  ? 185 ARG A CD    1 
ATOM   2205 N NE    . ARG C 3 185 ? 6.708   41.840  77.088  1.00 26.16  ? 185 ARG A NE    1 
ATOM   2206 C CZ    . ARG C 3 185 ? 5.957   41.902  78.190  1.00 25.96  ? 185 ARG A CZ    1 
ATOM   2207 N NH1   . ARG C 3 185 ? 5.319   40.825  78.632  1.00 21.89  ? 185 ARG A NH1   1 
ATOM   2208 N NH2   . ARG C 3 185 ? 5.844   43.049  78.856  1.00 24.04  ? 185 ARG A NH2   1 
ATOM   2209 N N     . ALA C 3 186 ? 5.148   36.252  73.129  1.00 16.31  ? 186 ALA A N     1 
ATOM   2210 C CA    . ALA C 3 186 ? 5.388   35.428  71.951  1.00 17.47  ? 186 ALA A CA    1 
ATOM   2211 C C     . ALA C 3 186 ? 4.096   35.143  71.169  1.00 17.10  ? 186 ALA A C     1 
ATOM   2212 O O     . ALA C 3 186 ? 4.107   35.156  69.937  1.00 17.87  ? 186 ALA A O     1 
ATOM   2213 C CB    . ALA C 3 186 ? 6.089   34.120  72.344  1.00 14.20  ? 186 ALA A CB    1 
ATOM   2214 N N     . ARG C 3 187 ? 2.987   34.902  71.866  1.00 16.36  ? 187 ARG A N     1 
ATOM   2215 C CA    . ARG C 3 187 ? 1.717   34.627  71.180  1.00 19.13  ? 187 ARG A CA    1 
ATOM   2216 C C     . ARG C 3 187 ? 1.251   35.847  70.404  1.00 18.59  ? 187 ARG A C     1 
ATOM   2217 O O     . ARG C 3 187 ? 0.830   35.741  69.248  1.00 17.28  ? 187 ARG A O     1 
ATOM   2218 C CB    . ARG C 3 187 ? 0.614   34.224  72.173  1.00 20.24  ? 187 ARG A CB    1 
ATOM   2219 C CG    . ARG C 3 187 ? 0.907   32.945  72.921  1.00 24.49  ? 187 ARG A CG    1 
ATOM   2220 C CD    . ARG C 3 187 ? -0.324  32.389  73.604  1.00 29.35  ? 187 ARG A CD    1 
ATOM   2221 N NE    . ARG C 3 187 ? 0.029   31.271  74.477  1.00 29.81  ? 187 ARG A NE    1 
ATOM   2222 C CZ    . ARG C 3 187 ? 0.356   31.397  75.758  1.00 30.28  ? 187 ARG A CZ    1 
ATOM   2223 N NH1   . ARG C 3 187 ? 0.366   32.600  76.331  1.00 28.14  ? 187 ARG A NH1   1 
ATOM   2224 N NH2   . ARG C 3 187 ? 0.686   30.318  76.465  1.00 31.24  ? 187 ARG A NH2   1 
ATOM   2225 N N     . THR C 3 188 ? 1.327   37.007  71.055  1.00 17.92  ? 188 THR A N     1 
ATOM   2226 C CA    . THR C 3 188 ? 0.924   38.256  70.435  1.00 17.76  ? 188 THR A CA    1 
ATOM   2227 C C     . THR C 3 188 ? 1.756   38.475  69.168  1.00 19.11  ? 188 THR A C     1 
ATOM   2228 O O     . THR C 3 188 ? 1.208   38.670  68.072  1.00 18.88  ? 188 THR A O     1 
ATOM   2229 C CB    . THR C 3 188 ? 1.122   39.431  71.420  1.00 18.57  ? 188 THR A CB    1 
ATOM   2230 O OG1   . THR C 3 188 ? 0.391   39.165  72.621  1.00 17.97  ? 188 THR A OG1   1 
ATOM   2231 C CG2   . THR C 3 188 ? 0.633   40.737  70.821  1.00 16.72  ? 188 THR A CG2   1 
ATOM   2232 N N     . LYS C 3 189 ? 3.078   38.424  69.310  1.00 17.87  ? 189 LYS A N     1 
ATOM   2233 C CA    . LYS C 3 189 ? 3.941   38.610  68.159  1.00 17.73  ? 189 LYS A CA    1 
ATOM   2234 C C     . LYS C 3 189 ? 3.637   37.566  67.091  1.00 19.32  ? 189 LYS A C     1 
ATOM   2235 O O     . LYS C 3 189 ? 3.651   37.875  65.903  1.00 20.14  ? 189 LYS A O     1 
ATOM   2236 C CB    . LYS C 3 189 ? 5.413   38.529  68.567  1.00 17.52  ? 189 LYS A CB    1 
ATOM   2237 C CG    . LYS C 3 189 ? 6.379   38.775  67.417  1.00 15.78  ? 189 LYS A CG    1 
ATOM   2238 C CD    . LYS C 3 189 ? 6.091   40.104  66.770  1.00 18.16  ? 189 LYS A CD    1 
ATOM   2239 C CE    . LYS C 3 189 ? 6.828   40.268  65.456  1.00 16.49  ? 189 LYS A CE    1 
ATOM   2240 N NZ    . LYS C 3 189 ? 6.612   41.644  64.908  1.00 18.61  ? 189 LYS A NZ    1 
ATOM   2241 N N     . ALA C 3 190 ? 3.364   36.330  67.506  1.00 20.69  ? 190 ALA A N     1 
ATOM   2242 C CA    . ALA C 3 190 ? 3.059   35.276  66.541  1.00 22.26  ? 190 ALA A CA    1 
ATOM   2243 C C     . ALA C 3 190 ? 1.809   35.665  65.772  1.00 24.45  ? 190 ALA A C     1 
ATOM   2244 O O     . ALA C 3 190 ? 1.744   35.532  64.549  1.00 24.39  ? 190 ALA A O     1 
ATOM   2245 C CB    . ALA C 3 190 ? 2.845   33.961  67.244  1.00 21.90  ? 190 ALA A CB    1 
ATOM   2246 N N     . GLY C 3 191 ? 0.820   36.164  66.504  1.00 25.92  ? 191 GLY A N     1 
ATOM   2247 C CA    . GLY C 3 191 ? -0.418  36.584  65.878  1.00 26.03  ? 191 GLY A CA    1 
ATOM   2248 C C     . GLY C 3 191 ? -0.228  37.764  64.947  1.00 25.31  ? 191 GLY A C     1 
ATOM   2249 O O     . GLY C 3 191 ? -0.889  37.864  63.915  1.00 25.57  ? 191 GLY A O     1 
ATOM   2250 N N     . ASP C 3 192 ? 0.673   38.669  65.311  1.00 26.85  ? 192 ASP A N     1 
ATOM   2251 C CA    . ASP C 3 192 ? 0.933   39.841  64.487  1.00 27.48  ? 192 ASP A CA    1 
ATOM   2252 C C     . ASP C 3 192 ? 1.579   39.420  63.172  1.00 27.92  ? 192 ASP A C     1 
ATOM   2253 O O     . ASP C 3 192 ? 1.362   40.057  62.145  1.00 28.60  ? 192 ASP A O     1 
ATOM   2254 C CB    . ASP C 3 192 ? 1.842   40.819  65.225  1.00 29.53  ? 192 ASP A CB    1 
ATOM   2255 C CG    . ASP C 3 192 ? 1.755   42.221  64.668  1.00 33.33  ? 192 ASP A CG    1 
ATOM   2256 O OD1   . ASP C 3 192 ? 2.735   42.704  64.050  1.00 32.54  ? 192 ASP A OD1   1 
ATOM   2257 O OD2   . ASP C 3 192 ? 0.686   42.837  64.851  1.00 35.17  ? 192 ASP A OD2   1 
ATOM   2258 N N     . LEU C 3 193 ? 2.371   38.349  63.210  1.00 26.94  ? 193 LEU A N     1 
ATOM   2259 C CA    . LEU C 3 193 ? 3.017   37.832  62.006  1.00 26.88  ? 193 LEU A CA    1 
ATOM   2260 C C     . LEU C 3 193 ? 1.947   37.364  61.032  1.00 27.05  ? 193 LEU A C     1 
ATOM   2261 O O     . LEU C 3 193 ? 1.980   37.722  59.853  1.00 25.89  ? 193 LEU A O     1 
ATOM   2262 C CB    . LEU C 3 193 ? 3.941   36.652  62.335  1.00 26.85  ? 193 LEU A CB    1 
ATOM   2263 C CG    . LEU C 3 193 ? 5.216   36.939  63.124  1.00 26.81  ? 193 LEU A CG    1 
ATOM   2264 C CD1   . LEU C 3 193 ? 5.976   35.645  63.367  1.00 25.65  ? 193 LEU A CD1   1 
ATOM   2265 C CD2   . LEU C 3 193 ? 6.068   37.926  62.355  1.00 27.14  ? 193 LEU A CD2   1 
ATOM   2266 N N     . ARG C 3 194 ? 1.010   36.553  61.531  1.00 28.69  ? 194 ARG A N     1 
ATOM   2267 C CA    . ARG C 3 194 ? -0.087  36.034  60.715  1.00 31.04  ? 194 ARG A CA    1 
ATOM   2268 C C     . ARG C 3 194 ? -0.901  37.162  60.089  1.00 32.08  ? 194 ARG A C     1 
ATOM   2269 O O     . ARG C 3 194 ? -1.287  37.079  58.924  1.00 33.29  ? 194 ARG A O     1 
ATOM   2270 C CB    . ARG C 3 194 ? -1.034  35.146  61.542  1.00 32.62  ? 194 ARG A CB    1 
ATOM   2271 C CG    . ARG C 3 194 ? -0.505  33.752  61.852  1.00 37.50  ? 194 ARG A CG    1 
ATOM   2272 C CD    . ARG C 3 194 ? -1.619  32.800  62.308  1.00 39.67  ? 194 ARG A CD    1 
ATOM   2273 N NE    . ARG C 3 194 ? -1.529  32.440  63.723  1.00 39.74  ? 194 ARG A NE    1 
ATOM   2274 C CZ    . ARG C 3 194 ? -1.850  33.254  64.722  1.00 41.81  ? 194 ARG A CZ    1 
ATOM   2275 N NH1   . ARG C 3 194 ? -2.286  34.475  64.459  1.00 44.65  ? 194 ARG A NH1   1 
ATOM   2276 N NH2   . ARG C 3 194 ? -1.741  32.854  65.982  1.00 44.44  ? 194 ARG A NH2   1 
ATOM   2277 N N     . ASP C 3 195 ? -1.165  38.214  60.859  1.00 32.49  ? 195 ASP A N     1 
ATOM   2278 C CA    . ASP C 3 195 ? -1.945  39.336  60.344  1.00 33.46  ? 195 ASP A CA    1 
ATOM   2279 C C     . ASP C 3 195 ? -1.126  40.128  59.343  1.00 33.08  ? 195 ASP A C     1 
ATOM   2280 O O     . ASP C 3 195 ? -1.661  40.703  58.396  1.00 34.84  ? 195 ASP A O     1 
ATOM   2281 C CB    . ASP C 3 195 ? -2.390  40.270  61.482  1.00 32.77  ? 195 ASP A CB    1 
ATOM   2282 C CG    . ASP C 3 195 ? -3.225  39.560  62.538  1.00 34.38  ? 195 ASP A CG    1 
ATOM   2283 O OD1   . ASP C 3 195 ? -3.979  38.622  62.192  1.00 37.18  ? 195 ASP A OD1   1 
ATOM   2284 O OD2   . ASP C 3 195 ? -3.139  39.949  63.719  1.00 35.18  ? 195 ASP A OD2   1 
ATOM   2285 N N     . THR C 3 196 ? 0.183   40.136  59.557  1.00 33.05  ? 196 THR A N     1 
ATOM   2286 C CA    . THR C 3 196 ? 1.116   40.871  58.714  1.00 31.53  ? 196 THR A CA    1 
ATOM   2287 C C     . THR C 3 196 ? 1.525   40.152  57.414  1.00 28.81  ? 196 THR A C     1 
ATOM   2288 O O     . THR C 3 196 ? 2.221   40.719  56.577  1.00 29.40  ? 196 THR A O     1 
ATOM   2289 C CB    . THR C 3 196 ? 2.346   41.280  59.592  1.00 32.74  ? 196 THR A CB    1 
ATOM   2290 O OG1   . THR C 3 196 ? 2.145   42.619  60.070  1.00 35.45  ? 196 THR A OG1   1 
ATOM   2291 C CG2   . THR C 3 196 ? 3.659   41.182  58.844  1.00 33.73  ? 196 THR A CG2   1 
ATOM   2292 N N     . GLY C 3 197 ? 1.075   38.915  57.233  1.00 26.50  ? 197 GLY A N     1 
ATOM   2293 C CA    . GLY C 3 197 ? 1.412   38.188  56.020  1.00 23.83  ? 197 GLY A CA    1 
ATOM   2294 C C     . GLY C 3 197 ? 2.644   37.297  56.085  1.00 25.56  ? 197 GLY A C     1 
ATOM   2295 O O     . GLY C 3 197 ? 3.057   36.734  55.072  1.00 25.69  ? 197 GLY A O     1 
ATOM   2296 N N     . ILE C 3 198 ? 3.241   37.163  57.265  1.00 24.74  ? 198 ILE A N     1 
ATOM   2297 C CA    . ILE C 3 198 ? 4.420   36.319  57.426  1.00 23.21  ? 198 ILE A CA    1 
ATOM   2298 C C     . ILE C 3 198 ? 3.973   34.938  57.926  1.00 24.00  ? 198 ILE A C     1 
ATOM   2299 O O     . ILE C 3 198 ? 3.164   34.838  58.840  1.00 24.59  ? 198 ILE A O     1 
ATOM   2300 C CB    . ILE C 3 198 ? 5.428   36.967  58.422  1.00 20.41  ? 198 ILE A CB    1 
ATOM   2301 C CG1   . ILE C 3 198 ? 5.889   38.321  57.874  1.00 20.98  ? 198 ILE A CG1   1 
ATOM   2302 C CG2   . ILE C 3 198 ? 6.631   36.069  58.617  1.00 18.96  ? 198 ILE A CG2   1 
ATOM   2303 C CD1   . ILE C 3 198 ? 6.700   39.168  58.845  1.00 17.79  ? 198 ILE A CD1   1 
ATOM   2304 N N     . PHE C 3 199 ? 4.491   33.878  57.314  1.00 25.50  ? 199 PHE A N     1 
ATOM   2305 C CA    . PHE C 3 199 ? 4.133   32.514  57.700  1.00 28.40  ? 199 PHE A CA    1 
ATOM   2306 C C     . PHE C 3 199 ? 5.232   31.914  58.553  1.00 27.56  ? 199 PHE A C     1 
ATOM   2307 O O     . PHE C 3 199 ? 6.409   32.061  58.234  1.00 30.16  ? 199 PHE A O     1 
ATOM   2308 C CB    . PHE C 3 199 ? 3.960   31.616  56.464  1.00 32.24  ? 199 PHE A CB    1 
ATOM   2309 C CG    . PHE C 3 199 ? 2.891   32.071  55.513  1.00 37.94  ? 199 PHE A CG    1 
ATOM   2310 C CD1   . PHE C 3 199 ? 3.029   33.264  54.801  1.00 41.52  ? 199 PHE A CD1   1 
ATOM   2311 C CD2   . PHE C 3 199 ? 1.740   31.313  55.334  1.00 38.05  ? 199 PHE A CD2   1 
ATOM   2312 C CE1   . PHE C 3 199 ? 2.030   33.695  53.926  1.00 43.90  ? 199 PHE A CE1   1 
ATOM   2313 C CE2   . PHE C 3 199 ? 0.735   31.733  54.461  1.00 40.59  ? 199 PHE A CE2   1 
ATOM   2314 C CZ    . PHE C 3 199 ? 0.876   32.924  53.756  1.00 41.70  ? 199 PHE A CZ    1 
ATOM   2315 N N     . LEU C 3 200 ? 4.850   31.236  59.628  1.00 26.06  ? 200 LEU A N     1 
ATOM   2316 C CA    . LEU C 3 200 ? 5.822   30.588  60.496  1.00 25.43  ? 200 LEU A CA    1 
ATOM   2317 C C     . LEU C 3 200 ? 5.569   29.087  60.501  1.00 26.24  ? 200 LEU A C     1 
ATOM   2318 O O     . LEU C 3 200 ? 4.529   28.623  60.986  1.00 25.36  ? 200 LEU A O     1 
ATOM   2319 C CB    . LEU C 3 200 ? 5.720   31.128  61.923  1.00 25.55  ? 200 LEU A CB    1 
ATOM   2320 C CG    . LEU C 3 200 ? 6.767   30.589  62.913  1.00 27.97  ? 200 LEU A CG    1 
ATOM   2321 C CD1   . LEU C 3 200 ? 7.015   31.610  63.991  1.00 28.69  ? 200 LEU A CD1   1 
ATOM   2322 C CD2   . LEU C 3 200 ? 6.307   29.272  63.525  1.00 28.01  ? 200 LEU A CD2   1 
ATOM   2323 N N     . ASP C 3 201 ? 6.498   28.323  59.938  1.00 26.23  ? 201 ASP A N     1 
ATOM   2324 C CA    . ASP C 3 201 ? 6.346   26.873  59.918  1.00 26.94  ? 201 ASP A CA    1 
ATOM   2325 C C     . ASP C 3 201 ? 7.256   26.272  60.979  1.00 27.38  ? 201 ASP A C     1 
ATOM   2326 O O     . ASP C 3 201 ? 8.399   26.704  61.155  1.00 25.48  ? 201 ASP A O     1 
ATOM   2327 C CB    . ASP C 3 201 ? 6.687   26.312  58.540  1.00 29.41  ? 201 ASP A CB    1 
ATOM   2328 C CG    . ASP C 3 201 ? 5.704   26.762  57.475  1.00 32.30  ? 201 ASP A CG    1 
ATOM   2329 O OD1   . ASP C 3 201 ? 4.522   26.351  57.535  1.00 32.93  ? 201 ASP A OD1   1 
ATOM   2330 O OD2   . ASP C 3 201 ? 6.111   27.536  56.582  1.00 36.27  ? 201 ASP A OD2   1 
ATOM   2331 N N     . LEU C 3 202 ? 6.729   25.286  61.697  1.00 25.67  ? 202 LEU A N     1 
ATOM   2332 C CA    . LEU C 3 202 ? 7.466   24.631  62.764  1.00 24.70  ? 202 LEU A CA    1 
ATOM   2333 C C     . LEU C 3 202 ? 8.039   23.298  62.340  1.00 25.33  ? 202 LEU A C     1 
ATOM   2334 O O     . LEU C 3 202 ? 7.313   22.403  61.910  1.00 27.92  ? 202 LEU A O     1 
ATOM   2335 C CB    . LEU C 3 202 ? 6.558   24.418  63.981  1.00 24.47  ? 202 LEU A CB    1 
ATOM   2336 C CG    . LEU C 3 202 ? 7.142   23.579  65.123  1.00 25.15  ? 202 LEU A CG    1 
ATOM   2337 C CD1   . LEU C 3 202 ? 8.372   24.280  65.706  1.00 22.70  ? 202 LEU A CD1   1 
ATOM   2338 C CD2   . LEU C 3 202 ? 6.082   23.361  66.196  1.00 23.67  ? 202 LEU A CD2   1 
ATOM   2339 N N     . MET C 3 203 ? 9.352   23.180  62.461  1.00 25.19  ? 203 MET A N     1 
ATOM   2340 C CA    . MET C 3 203 ? 10.057  21.955  62.135  1.00 26.02  ? 203 MET A CA    1 
ATOM   2341 C C     . MET C 3 203 ? 10.474  21.396  63.486  1.00 26.36  ? 203 MET A C     1 
ATOM   2342 O O     . MET C 3 203 ? 11.639  21.492  63.881  1.00 28.63  ? 203 MET A O     1 
ATOM   2343 C CB    . MET C 3 203 ? 11.286  22.266  61.290  1.00 24.03  ? 203 MET A CB    1 
ATOM   2344 C CG    . MET C 3 203 ? 10.956  22.876  59.950  1.00 27.39  ? 203 MET A CG    1 
ATOM   2345 S SD    . MET C 3 203 ? 10.153  21.694  58.852  1.00 30.81  ? 203 MET A SD    1 
ATOM   2346 C CE    . MET C 3 203 ? 8.926   22.723  58.132  1.00 27.65  ? 203 MET A CE    1 
ATOM   2347 N N     . HIS C 3 204 ? 9.509   20.837  64.205  1.00 24.42  ? 204 HIS A N     1 
ATOM   2348 C CA    . HIS C 3 204 ? 9.777   20.297  65.525  1.00 25.08  ? 204 HIS A CA    1 
ATOM   2349 C C     . HIS C 3 204 ? 10.596  19.017  65.460  1.00 25.56  ? 204 HIS A C     1 
ATOM   2350 O O     . HIS C 3 204 ? 10.316  18.109  64.677  1.00 26.95  ? 204 HIS A O     1 
ATOM   2351 C CB    . HIS C 3 204 ? 8.459   20.092  66.287  1.00 24.67  ? 204 HIS A CB    1 
ATOM   2352 C CG    . HIS C 3 204 ? 7.435   19.298  65.536  1.00 26.74  ? 204 HIS A CG    1 
ATOM   2353 N ND1   . HIS C 3 204 ? 7.330   19.323  64.161  1.00 28.98  ? 204 HIS A ND1   1 
ATOM   2354 C CD2   . HIS C 3 204 ? 6.449   18.480  65.971  1.00 27.67  ? 204 HIS A CD2   1 
ATOM   2355 C CE1   . HIS C 3 204 ? 6.326   18.554  63.783  1.00 28.95  ? 204 HIS A CE1   1 
ATOM   2356 N NE2   . HIS C 3 204 ? 5.775   18.030  64.863  1.00 29.02  ? 204 HIS A NE2   1 
ATOM   2357 N N     . LEU C 3 205 ? 11.622  18.971  66.295  1.00 25.15  ? 205 LEU A N     1 
ATOM   2358 C CA    . LEU C 3 205 ? 12.542  17.853  66.361  1.00 25.70  ? 205 LEU A CA    1 
ATOM   2359 C C     . LEU C 3 205 ? 12.259  16.995  67.594  1.00 26.81  ? 205 LEU A C     1 
ATOM   2360 O O     . LEU C 3 205 ? 11.637  17.462  68.545  1.00 28.61  ? 205 LEU A O     1 
ATOM   2361 C CB    . LEU C 3 205 ? 13.964  18.417  66.376  1.00 24.54  ? 205 LEU A CB    1 
ATOM   2362 C CG    . LEU C 3 205 ? 14.195  19.321  65.152  1.00 23.00  ? 205 LEU A CG    1 
ATOM   2363 C CD1   . LEU C 3 205 ? 15.401  20.214  65.336  1.00 20.91  ? 205 LEU A CD1   1 
ATOM   2364 C CD2   . LEU C 3 205 ? 14.363  18.441  63.918  1.00 24.14  ? 205 LEU A CD2   1 
ATOM   2365 N N     . LYS C 3 206 ? 12.721  15.749  67.587  1.00 27.69  ? 206 LYS A N     1 
ATOM   2366 C CA    . LYS C 3 206 ? 12.461  14.838  68.700  1.00 30.62  ? 206 LYS A CA    1 
ATOM   2367 C C     . LYS C 3 206 ? 12.877  15.287  70.090  1.00 30.11  ? 206 LYS A C     1 
ATOM   2368 O O     . LYS C 3 206 ? 13.896  15.939  70.284  1.00 30.73  ? 206 LYS A O     1 
ATOM   2369 C CB    . LYS C 3 206 ? 13.071  13.469  68.430  1.00 32.66  ? 206 LYS A CB    1 
ATOM   2370 C CG    . LYS C 3 206 ? 12.707  12.445  69.494  1.00 35.90  ? 206 LYS A CG    1 
ATOM   2371 C CD    . LYS C 3 206 ? 13.333  11.101  69.189  1.00 38.74  ? 206 LYS A CD    1 
ATOM   2372 C CE    . LYS C 3 206 ? 12.847  10.034  70.129  1.00 37.00  ? 206 LYS A CE    1 
ATOM   2373 N NZ    . LYS C 3 206 ? 13.382  8.733   69.675  1.00 40.90  ? 206 LYS A NZ    1 
ATOM   2374 N N     . LYS C 3 207 ? 12.075  14.877  71.060  1.00 31.10  ? 207 LYS A N     1 
ATOM   2375 C CA    . LYS C 3 207 ? 12.264  15.217  72.464  1.00 32.50  ? 207 LYS A CA    1 
ATOM   2376 C C     . LYS C 3 207 ? 11.716  14.047  73.298  1.00 32.16  ? 207 LYS A C     1 
ATOM   2377 O O     . LYS C 3 207 ? 10.721  13.426  72.928  1.00 32.21  ? 207 LYS A O     1 
ATOM   2378 C CB    . LYS C 3 207 ? 11.478  16.503  72.751  1.00 32.63  ? 207 LYS A CB    1 
ATOM   2379 C CG    . LYS C 3 207 ? 11.377  16.909  74.192  1.00 36.82  ? 207 LYS A CG    1 
ATOM   2380 C CD    . LYS C 3 207 ? 10.083  17.680  74.445  1.00 37.54  ? 207 LYS A CD    1 
ATOM   2381 C CE    . LYS C 3 207 ? 9.983   18.094  75.905  1.00 37.63  ? 207 LYS A CE    1 
ATOM   2382 N NZ    . LYS C 3 207 ? 8.582   18.315  76.339  1.00 40.28  ? 207 LYS A NZ    1 
ATOM   2383 N N     . PRO C 3 208 ? 12.361  13.724  74.429  1.00 33.49  ? 208 PRO A N     1 
ATOM   2384 C CA    . PRO C 3 208 ? 11.868  12.610  75.254  1.00 33.93  ? 208 PRO A CA    1 
ATOM   2385 C C     . PRO C 3 208 ? 10.394  12.737  75.616  1.00 33.95  ? 208 PRO A C     1 
ATOM   2386 O O     . PRO C 3 208 ? 9.955   13.762  76.123  1.00 35.22  ? 208 PRO A O     1 
ATOM   2387 C CB    . PRO C 3 208 ? 12.783  12.649  76.481  1.00 33.95  ? 208 PRO A CB    1 
ATOM   2388 C CG    . PRO C 3 208 ? 13.261  14.072  76.524  1.00 34.93  ? 208 PRO A CG    1 
ATOM   2389 C CD    . PRO C 3 208 ? 13.509  14.384  75.071  1.00 33.55  ? 208 PRO A CD    1 
ATOM   2390 N N     . GLY C 3 209 ? 9.631   11.687  75.342  1.00 34.93  ? 209 GLY A N     1 
ATOM   2391 C CA    . GLY C 3 209 ? 8.210   11.713  75.636  1.00 34.69  ? 209 GLY A CA    1 
ATOM   2392 C C     . GLY C 3 209 ? 7.441   12.221  74.436  1.00 35.59  ? 209 GLY A C     1 
ATOM   2393 O O     . GLY C 3 209 ? 6.215   12.104  74.367  1.00 35.36  ? 209 GLY A O     1 
ATOM   2394 N N     . GLY C 3 210 ? 8.175   12.784  73.481  1.00 34.68  ? 210 GLY A N     1 
ATOM   2395 C CA    . GLY C 3 210 ? 7.560   13.318  72.281  1.00 34.55  ? 210 GLY A CA    1 
ATOM   2396 C C     . GLY C 3 210 ? 7.437   14.831  72.321  1.00 34.70  ? 210 GLY A C     1 
ATOM   2397 O O     . GLY C 3 210 ? 7.562   15.449  73.380  1.00 37.88  ? 210 GLY A O     1 
ATOM   2398 N N     . PHE C 3 211 ? 7.199   15.430  71.161  1.00 31.75  ? 211 PHE A N     1 
ATOM   2399 C CA    . PHE C 3 211 ? 7.046   16.871  71.052  1.00 28.50  ? 211 PHE A CA    1 
ATOM   2400 C C     . PHE C 3 211 ? 5.540   17.121  70.999  1.00 27.92  ? 211 PHE A C     1 
ATOM   2401 O O     . PHE C 3 211 ? 4.858   16.644  70.098  1.00 27.09  ? 211 PHE A O     1 
ATOM   2402 C CB    . PHE C 3 211 ? 7.733   17.365  69.771  1.00 26.20  ? 211 PHE A CB    1 
ATOM   2403 C CG    . PHE C 3 211 ? 7.719   18.859  69.599  1.00 23.07  ? 211 PHE A CG    1 
ATOM   2404 C CD1   . PHE C 3 211 ? 8.882   19.598  69.758  1.00 23.95  ? 211 PHE A CD1   1 
ATOM   2405 C CD2   . PHE C 3 211 ? 6.547   19.526  69.270  1.00 21.56  ? 211 PHE A CD2   1 
ATOM   2406 C CE1   . PHE C 3 211 ? 8.880   20.986  69.590  1.00 22.39  ? 211 PHE A CE1   1 
ATOM   2407 C CE2   . PHE C 3 211 ? 6.537   20.906  69.103  1.00 21.83  ? 211 PHE A CE2   1 
ATOM   2408 C CZ    . PHE C 3 211 ? 7.706   21.635  69.263  1.00 20.43  ? 211 PHE A CZ    1 
ATOM   2409 N N     . ASP C 3 212 ? 5.028   17.859  71.978  1.00 27.80  ? 212 ASP A N     1 
ATOM   2410 C CA    . ASP C 3 212 ? 3.603   18.152  72.069  1.00 27.50  ? 212 ASP A CA    1 
ATOM   2411 C C     . ASP C 3 212 ? 3.309   19.560  71.546  1.00 27.18  ? 212 ASP A C     1 
ATOM   2412 O O     . ASP C 3 212 ? 3.629   20.548  72.199  1.00 25.66  ? 212 ASP A O     1 
ATOM   2413 C CB    . ASP C 3 212 ? 3.164   18.029  73.528  1.00 29.01  ? 212 ASP A CB    1 
ATOM   2414 C CG    . ASP C 3 212 ? 1.657   18.093  73.704  1.00 32.44  ? 212 ASP A CG    1 
ATOM   2415 O OD1   . ASP C 3 212 ? 0.949   18.598  72.807  1.00 31.85  ? 212 ASP A OD1   1 
ATOM   2416 O OD2   . ASP C 3 212 ? 1.184   17.641  74.762  1.00 35.43  ? 212 ASP A OD2   1 
ATOM   2417 N N     . ILE C 3 213 ? 2.686   19.639  70.373  1.00 27.55  ? 213 ILE A N     1 
ATOM   2418 C CA    . ILE C 3 213 ? 2.365   20.918  69.756  1.00 29.56  ? 213 ILE A CA    1 
ATOM   2419 C C     . ILE C 3 213 ? 1.185   21.605  70.412  1.00 29.86  ? 213 ILE A C     1 
ATOM   2420 O O     . ILE C 3 213 ? 1.068   22.826  70.348  1.00 31.82  ? 213 ILE A O     1 
ATOM   2421 C CB    . ILE C 3 213 ? 2.057   20.768  68.246  1.00 29.29  ? 213 ILE A CB    1 
ATOM   2422 C CG1   . ILE C 3 213 ? 3.316   20.340  67.494  1.00 29.04  ? 213 ILE A CG1   1 
ATOM   2423 C CG2   . ILE C 3 213 ? 1.553   22.095  67.679  1.00 28.63  ? 213 ILE A CG2   1 
ATOM   2424 C CD1   . ILE C 3 213 ? 3.111   20.187  65.988  1.00 28.35  ? 213 ILE A CD1   1 
ATOM   2425 N N     . SER C 3 214 ? 0.306   20.832  71.041  1.00 30.69  ? 214 SER A N     1 
ATOM   2426 C CA    . SER C 3 214 ? -0.857  21.425  71.699  1.00 31.02  ? 214 SER A CA    1 
ATOM   2427 C C     . SER C 3 214 ? -0.476  22.315  72.892  1.00 29.52  ? 214 SER A C     1 
ATOM   2428 O O     . SER C 3 214 ? -1.227  23.213  73.259  1.00 30.97  ? 214 SER A O     1 
ATOM   2429 C CB    . SER C 3 214 ? -1.815  20.331  72.171  1.00 31.92  ? 214 SER A CB    1 
ATOM   2430 O OG    . SER C 3 214 ? -1.270  19.613  73.267  1.00 36.22  ? 214 SER A OG    1 
ATOM   2431 N N     . LEU C 3 215 ? 0.684   22.065  73.494  1.00 28.46  ? 215 LEU A N     1 
ATOM   2432 C CA    . LEU C 3 215 ? 1.134   22.844  74.647  1.00 28.19  ? 215 LEU A CA    1 
ATOM   2433 C C     . LEU C 3 215 ? 1.370   24.324  74.364  1.00 27.57  ? 215 LEU A C     1 
ATOM   2434 O O     . LEU C 3 215 ? 0.977   25.176  75.163  1.00 27.50  ? 215 LEU A O     1 
ATOM   2435 C CB    . LEU C 3 215 ? 2.435   22.272  75.230  1.00 26.66  ? 215 LEU A CB    1 
ATOM   2436 C CG    . LEU C 3 215 ? 2.459   20.903  75.917  1.00 29.44  ? 215 LEU A CG    1 
ATOM   2437 C CD1   . LEU C 3 215 ? 3.888   20.591  76.392  1.00 23.75  ? 215 LEU A CD1   1 
ATOM   2438 C CD2   . LEU C 3 215 ? 1.478   20.904  77.092  1.00 24.58  ? 215 LEU A CD2   1 
ATOM   2439 N N     . PHE C 3 216 ? 2.003   24.635  73.233  1.00 26.84  ? 216 PHE A N     1 
ATOM   2440 C CA    . PHE C 3 216 ? 2.318   26.025  72.930  1.00 25.24  ? 216 PHE A CA    1 
ATOM   2441 C C     . PHE C 3 216 ? 2.262   26.460  71.457  1.00 27.43  ? 216 PHE A C     1 
ATOM   2442 O O     . PHE C 3 216 ? 1.629   27.464  71.125  1.00 27.83  ? 216 PHE A O     1 
ATOM   2443 C CB    . PHE C 3 216 ? 3.713   26.329  73.501  1.00 23.79  ? 216 PHE A CB    1 
ATOM   2444 C CG    . PHE C 3 216 ? 4.200   27.717  73.225  1.00 21.66  ? 216 PHE A CG    1 
ATOM   2445 C CD1   . PHE C 3 216 ? 3.596   28.819  73.829  1.00 22.62  ? 216 PHE A CD1   1 
ATOM   2446 C CD2   . PHE C 3 216 ? 5.275   27.926  72.372  1.00 21.16  ? 216 PHE A CD2   1 
ATOM   2447 C CE1   . PHE C 3 216 ? 4.064   30.115  73.583  1.00 22.41  ? 216 PHE A CE1   1 
ATOM   2448 C CE2   . PHE C 3 216 ? 5.752   29.214  72.117  1.00 21.89  ? 216 PHE A CE2   1 
ATOM   2449 C CZ    . PHE C 3 216 ? 5.144   30.312  72.725  1.00 21.48  ? 216 PHE A CZ    1 
ATOM   2450 N N     . TYR C 3 217 ? 2.926   25.717  70.579  1.00 26.73  ? 217 TYR A N     1 
ATOM   2451 C CA    . TYR C 3 217 ? 2.986   26.081  69.171  1.00 26.41  ? 217 TYR A CA    1 
ATOM   2452 C C     . TYR C 3 217 ? 1.698   26.042  68.370  1.00 28.58  ? 217 TYR A C     1 
ATOM   2453 O O     . TYR C 3 217 ? 1.631   26.578  67.265  1.00 27.01  ? 217 TYR A O     1 
ATOM   2454 C CB    . TYR C 3 217 ? 4.072   25.259  68.485  1.00 23.68  ? 217 TYR A CB    1 
ATOM   2455 C CG    . TYR C 3 217 ? 5.447   25.793  68.807  1.00 22.52  ? 217 TYR A CG    1 
ATOM   2456 C CD1   . TYR C 3 217 ? 6.234   25.220  69.812  1.00 19.68  ? 217 TYR A CD1   1 
ATOM   2457 C CD2   . TYR C 3 217 ? 5.937   26.926  68.150  1.00 21.73  ? 217 TYR A CD2   1 
ATOM   2458 C CE1   . TYR C 3 217 ? 7.474   25.762  70.153  1.00 19.11  ? 217 TYR A CE1   1 
ATOM   2459 C CE2   . TYR C 3 217 ? 7.173   27.480  68.490  1.00 22.54  ? 217 TYR A CE2   1 
ATOM   2460 C CZ    . TYR C 3 217 ? 7.934   26.893  69.486  1.00 20.84  ? 217 TYR A CZ    1 
ATOM   2461 O OH    . TYR C 3 217 ? 9.153   27.435  69.787  1.00 18.51  ? 217 TYR A OH    1 
ATOM   2462 N N     . ARG C 3 218 ? 0.673   25.412  68.926  1.00 32.75  ? 218 ARG A N     1 
ATOM   2463 C CA    . ARG C 3 218 ? -0.620  25.336  68.269  1.00 35.92  ? 218 ARG A CA    1 
ATOM   2464 C C     . ARG C 3 218 ? -1.111  26.770  67.983  1.00 36.23  ? 218 ARG A C     1 
ATOM   2465 O O     . ARG C 3 218 ? -1.782  27.016  66.981  1.00 35.33  ? 218 ARG A O     1 
ATOM   2466 C CB    . ARG C 3 218 ? -1.600  24.616  69.191  1.00 40.61  ? 218 ARG A CB    1 
ATOM   2467 C CG    . ARG C 3 218 ? -2.869  24.114  68.534  1.00 46.22  ? 218 ARG A CG    1 
ATOM   2468 C CD    . ARG C 3 218 ? -3.914  23.846  69.605  1.00 51.17  ? 218 ARG A CD    1 
ATOM   2469 N NE    . ARG C 3 218 ? -4.959  22.930  69.163  1.00 55.91  ? 218 ARG A NE    1 
ATOM   2470 C CZ    . ARG C 3 218 ? -6.093  22.723  69.827  1.00 59.32  ? 218 ARG A CZ    1 
ATOM   2471 N NH1   . ARG C 3 218 ? -6.326  23.375  70.962  1.00 60.16  ? 218 ARG A NH1   1 
ATOM   2472 N NH2   . ARG C 3 218 ? -6.992  21.861  69.364  1.00 59.72  ? 218 ARG A NH2   1 
ATOM   2473 N N     . ASP C 3 219 ? -0.761  27.708  68.868  1.00 37.03  ? 219 ASP A N     1 
ATOM   2474 C CA    . ASP C 3 219 ? -1.148  29.121  68.733  1.00 37.93  ? 219 ASP A CA    1 
ATOM   2475 C C     . ASP C 3 219 ? -0.065  29.987  68.095  1.00 37.51  ? 219 ASP A C     1 
ATOM   2476 O O     . ASP C 3 219 ? -0.058  31.205  68.276  1.00 38.23  ? 219 ASP A O     1 
ATOM   2477 C CB    . ASP C 3 219 ? -1.460  29.749  70.098  1.00 38.62  ? 219 ASP A CB    1 
ATOM   2478 C CG    . ASP C 3 219 ? -2.620  29.088  70.805  1.00 42.04  ? 219 ASP A CG    1 
ATOM   2479 O OD1   . ASP C 3 219 ? -3.680  28.900  70.165  1.00 44.81  ? 219 ASP A OD1   1 
ATOM   2480 O OD2   . ASP C 3 219 ? -2.473  28.773  72.008  1.00 40.13  ? 219 ASP A OD2   1 
ATOM   2481 N N     . ILE C 3 220 ? 0.849   29.384  67.353  1.00 35.05  ? 220 ILE A N     1 
ATOM   2482 C CA    . ILE C 3 220 ? 1.912   30.174  66.754  1.00 34.65  ? 220 ILE A CA    1 
ATOM   2483 C C     . ILE C 3 220 ? 2.091   29.911  65.274  1.00 34.14  ? 220 ILE A C     1 
ATOM   2484 O O     . ILE C 3 220 ? 2.131   30.831  64.465  1.00 33.68  ? 220 ILE A O     1 
ATOM   2485 C CB    . ILE C 3 220 ? 3.244   29.902  67.473  1.00 35.29  ? 220 ILE A CB    1 
ATOM   2486 C CG1   . ILE C 3 220 ? 3.177   30.472  68.881  1.00 34.03  ? 220 ILE A CG1   1 
ATOM   2487 C CG2   . ILE C 3 220 ? 4.413   30.481  66.683  1.00 35.49  ? 220 ILE A CG2   1 
ATOM   2488 C CD1   . ILE C 3 220 ? 4.457   30.369  69.590  1.00 37.24  ? 220 ILE A CD1   1 
ATOM   2489 N N     . ILE C 3 221 ? 2.212   28.641  64.928  1.00 34.85  ? 221 ILE A N     1 
ATOM   2490 C CA    . ILE C 3 221 ? 2.402   28.265  63.551  1.00 34.44  ? 221 ILE A CA    1 
ATOM   2491 C C     . ILE C 3 221 ? 1.291   28.836  62.692  1.00 36.01  ? 221 ILE A C     1 
ATOM   2492 O O     . ILE C 3 221 ? 0.182   29.094  63.169  1.00 34.64  ? 221 ILE A O     1 
ATOM   2493 C CB    . ILE C 3 221 ? 2.408   26.741  63.394  1.00 33.49  ? 221 ILE A CB    1 
ATOM   2494 C CG1   . ILE C 3 221 ? 1.043   26.172  63.771  1.00 32.81  ? 221 ILE A CG1   1 
ATOM   2495 C CG2   . ILE C 3 221 ? 3.473   26.138  64.286  1.00 35.08  ? 221 ILE A CG2   1 
ATOM   2496 C CD1   . ILE C 3 221 ? 0.902   24.707  63.460  1.00 35.56  ? 221 ILE A CD1   1 
ATOM   2497 N N     . SER C 3 222 ? 1.617   29.047  61.424  1.00 37.13  ? 222 SER A N     1 
ATOM   2498 C CA    . SER C 3 222 ? 0.673   29.542  60.440  1.00 38.93  ? 222 SER A CA    1 
ATOM   2499 C C     . SER C 3 222 ? 0.447   28.364  59.504  1.00 39.38  ? 222 SER A C     1 
ATOM   2500 O O     . SER C 3 222 ? 0.795   28.481  58.308  1.00 40.38  ? 222 SER A O     1 
ATOM   2501 C CB    . SER C 3 222 ? 1.264   30.726  59.663  1.00 40.86  ? 222 SER A CB    1 
ATOM   2502 O OG    . SER C 3 222 ? 1.455   31.856  60.506  1.00 45.76  ? 222 SER A OG    1 
ATOM   2503 N N     . VAL C 3 231 ? -3.854  17.332  58.951  1.00 38.17  ? 231 VAL A N     1 
ATOM   2504 C CA    . VAL C 3 231 ? -2.877  16.968  60.020  1.00 38.06  ? 231 VAL A CA    1 
ATOM   2505 C C     . VAL C 3 231 ? -1.471  17.505  59.790  1.00 36.79  ? 231 VAL A C     1 
ATOM   2506 O O     . VAL C 3 231 ? -0.971  17.545  58.662  1.00 35.55  ? 231 VAL A O     1 
ATOM   2507 C CB    . VAL C 3 231 ? -2.768  15.456  60.185  1.00 37.68  ? 231 VAL A CB    1 
ATOM   2508 C CG1   . VAL C 3 231 ? -4.031  14.923  60.825  1.00 41.60  ? 231 VAL A CG1   1 
ATOM   2509 C CG2   . VAL C 3 231 ? -2.532  14.815  58.829  1.00 39.58  ? 231 VAL A CG2   1 
ATOM   2510 N N     . HIS C 3 232 ? -0.839  17.886  60.896  1.00 35.20  ? 232 HIS A N     1 
ATOM   2511 C CA    . HIS C 3 232 ? 0.508   18.445  60.913  1.00 32.94  ? 232 HIS A CA    1 
ATOM   2512 C C     . HIS C 3 232 ? 1.564   17.343  60.794  1.00 29.95  ? 232 HIS A C     1 
ATOM   2513 O O     . HIS C 3 232 ? 1.300   16.184  61.133  1.00 28.38  ? 232 HIS A O     1 
ATOM   2514 C CB    . HIS C 3 232 ? 0.688   19.221  62.228  1.00 33.91  ? 232 HIS A CB    1 
ATOM   2515 C CG    . HIS C 3 232 ? 1.889   20.111  62.261  1.00 36.27  ? 232 HIS A CG    1 
ATOM   2516 N ND1   . HIS C 3 232 ? 3.180   19.626  62.277  1.00 38.03  ? 232 HIS A ND1   1 
ATOM   2517 C CD2   . HIS C 3 232 ? 1.995   21.460  62.294  1.00 36.98  ? 232 HIS A CD2   1 
ATOM   2518 C CE1   . HIS C 3 232 ? 4.028   20.638  62.318  1.00 37.61  ? 232 HIS A CE1   1 
ATOM   2519 N NE2   . HIS C 3 232 ? 3.335   21.762  62.329  1.00 37.29  ? 232 HIS A NE2   1 
ATOM   2520 N N     . PHE C 3 233 ? 2.751   17.703  60.302  1.00 28.20  ? 233 PHE A N     1 
ATOM   2521 C CA    . PHE C 3 233 ? 3.847   16.742  60.182  1.00 27.53  ? 233 PHE A CA    1 
ATOM   2522 C C     . PHE C 3 233 ? 4.176   16.209  61.575  1.00 28.16  ? 233 PHE A C     1 
ATOM   2523 O O     . PHE C 3 233 ? 3.999   16.904  62.579  1.00 27.20  ? 233 PHE A O     1 
ATOM   2524 C CB    . PHE C 3 233 ? 5.134   17.395  59.645  1.00 24.83  ? 233 PHE A CB    1 
ATOM   2525 C CG    . PHE C 3 233 ? 5.069   17.824  58.213  1.00 23.76  ? 233 PHE A CG    1 
ATOM   2526 C CD1   . PHE C 3 233 ? 4.421   17.049  57.258  1.00 23.65  ? 233 PHE A CD1   1 
ATOM   2527 C CD2   . PHE C 3 233 ? 5.708   18.992  57.805  1.00 24.70  ? 233 PHE A CD2   1 
ATOM   2528 C CE1   . PHE C 3 233 ? 4.409   17.431  55.913  1.00 23.09  ? 233 PHE A CE1   1 
ATOM   2529 C CE2   . PHE C 3 233 ? 5.702   19.383  56.462  1.00 24.67  ? 233 PHE A CE2   1 
ATOM   2530 C CZ    . PHE C 3 233 ? 5.053   18.602  55.516  1.00 21.73  ? 233 PHE A CZ    1 
ATOM   2531 N N     . GLU C 3 234 ? 4.665   14.980  61.634  1.00 29.64  ? 234 GLU A N     1 
ATOM   2532 C CA    . GLU C 3 234 ? 5.060   14.395  62.910  1.00 29.82  ? 234 GLU A CA    1 
ATOM   2533 C C     . GLU C 3 234 ? 6.435   14.980  63.243  1.00 29.09  ? 234 GLU A C     1 
ATOM   2534 O O     . GLU C 3 234 ? 7.044   15.647  62.407  1.00 25.73  ? 234 GLU A O     1 
ATOM   2535 C CB    . GLU C 3 234 ? 5.156   12.874  62.784  1.00 30.18  ? 234 GLU A CB    1 
ATOM   2536 C CG    . GLU C 3 234 ? 3.815   12.176  62.586  1.00 33.66  ? 234 GLU A CG    1 
ATOM   2537 C CD    . GLU C 3 234 ? 3.008   12.082  63.873  1.00 34.55  ? 234 GLU A CD    1 
ATOM   2538 O OE1   . GLU C 3 234 ? 3.526   11.527  64.865  1.00 35.12  ? 234 GLU A OE1   1 
ATOM   2539 O OE2   . GLU C 3 234 ? 1.856   12.559  63.897  1.00 36.82  ? 234 GLU A OE2   1 
ATOM   2540 N N     . GLU C 3 235 ? 6.913   14.745  64.460  1.00 28.47  ? 235 GLU A N     1 
ATOM   2541 C CA    . GLU C 3 235 ? 8.224   15.240  64.862  1.00 28.74  ? 235 GLU A CA    1 
ATOM   2542 C C     . GLU C 3 235 ? 9.286   14.535  64.009  1.00 28.80  ? 235 GLU A C     1 
ATOM   2543 O O     . GLU C 3 235 ? 9.072   13.411  63.561  1.00 28.96  ? 235 GLU A O     1 
ATOM   2544 C CB    . GLU C 3 235 ? 8.472   14.935  66.346  1.00 29.50  ? 235 GLU A CB    1 
ATOM   2545 C CG    . GLU C 3 235 ? 8.254   13.467  66.723  1.00 31.85  ? 235 GLU A CG    1 
ATOM   2546 C CD    . GLU C 3 235 ? 8.723   13.118  68.134  1.00 34.62  ? 235 GLU A CD    1 
ATOM   2547 O OE1   . GLU C 3 235 ? 8.392   13.852  69.084  1.00 35.21  ? 235 GLU A OE1   1 
ATOM   2548 O OE2   . GLU C 3 235 ? 9.419   12.093  68.299  1.00 38.15  ? 235 GLU A OE2   1 
ATOM   2549 N N     . SER C 3 236 ? 10.419  15.188  63.767  1.00 28.10  ? 236 SER A N     1 
ATOM   2550 C CA    . SER C 3 236 ? 11.483  14.554  62.995  1.00 30.19  ? 236 SER A CA    1 
ATOM   2551 C C     . SER C 3 236 ? 12.524  13.972  63.945  1.00 32.45  ? 236 SER A C     1 
ATOM   2552 O O     . SER C 3 236 ? 12.854  14.591  64.957  1.00 32.56  ? 236 SER A O     1 
ATOM   2553 C CB    . SER C 3 236 ? 12.151  15.558  62.060  1.00 28.95  ? 236 SER A CB    1 
ATOM   2554 O OG    . SER C 3 236 ? 11.273  15.929  61.017  1.00 29.88  ? 236 SER A OG    1 
ATOM   2555 N N     . SER C 3 237 ? 13.024  12.780  63.624  1.00 34.33  ? 237 SER A N     1 
ATOM   2556 C CA    . SER C 3 237 ? 14.032  12.123  64.449  1.00 36.98  ? 237 SER A CA    1 
ATOM   2557 C C     . SER C 3 237 ? 15.218  11.672  63.608  1.00 39.10  ? 237 SER A C     1 
ATOM   2558 O O     . SER C 3 237 ? 16.238  11.245  64.147  1.00 40.50  ? 237 SER A O     1 
ATOM   2559 C CB    . SER C 3 237 ? 13.437  10.914  65.182  1.00 37.62  ? 237 SER A CB    1 
ATOM   2560 O OG    . SER C 3 237 ? 13.236  9.819   64.304  1.00 39.81  ? 237 SER A OG    1 
ATOM   2561 N N     . LYS C 3 238 ? 15.074  11.762  62.288  1.00 40.92  ? 238 LYS A N     1 
ATOM   2562 C CA    . LYS C 3 238 ? 16.133  11.383  61.348  1.00 41.71  ? 238 LYS A CA    1 
ATOM   2563 C C     . LYS C 3 238 ? 16.261  12.517  60.344  1.00 41.70  ? 238 LYS A C     1 
ATOM   2564 O O     . LYS C 3 238 ? 15.255  13.102  59.940  1.00 41.26  ? 238 LYS A O     1 
ATOM   2565 C CB    . LYS C 3 238 ? 15.776  10.133  60.530  1.00 43.67  ? 238 LYS A CB    1 
ATOM   2566 C CG    . LYS C 3 238 ? 15.195  8.930   61.251  1.00 45.95  ? 238 LYS A CG    1 
ATOM   2567 C CD    . LYS C 3 238 ? 14.774  7.917   60.176  1.00 47.91  ? 238 LYS A CD    1 
ATOM   2568 C CE    . LYS C 3 238 ? 13.820  6.846   60.686  1.00 50.05  ? 238 LYS A CE    1 
ATOM   2569 N NZ    . LYS C 3 238 ? 13.198  6.110   59.534  1.00 50.15  ? 238 LYS A NZ    1 
ATOM   2570 N N     . LEU C 3 239 ? 17.487  12.803  59.920  1.00 41.76  ? 239 LEU A N     1 
ATOM   2571 C CA    . LEU C 3 239 ? 17.724  13.852  58.943  1.00 41.10  ? 239 LEU A CA    1 
ATOM   2572 C C     . LEU C 3 239 ? 16.792  13.688  57.750  1.00 42.35  ? 239 LEU A C     1 
ATOM   2573 O O     . LEU C 3 239 ? 16.176  14.653  57.302  1.00 43.78  ? 239 LEU A O     1 
ATOM   2574 C CB    . LEU C 3 239 ? 19.168  13.795  58.462  1.00 41.65  ? 239 LEU A CB    1 
ATOM   2575 C CG    . LEU C 3 239 ? 19.521  14.692  57.279  1.00 40.28  ? 239 LEU A CG    1 
ATOM   2576 C CD1   . LEU C 3 239 ? 19.431  16.152  57.687  1.00 40.45  ? 239 LEU A CD1   1 
ATOM   2577 C CD2   . LEU C 3 239 ? 20.916  14.349  56.807  1.00 41.66  ? 239 LEU A CD2   1 
ATOM   2578 N N     . GLU C 3 240 ? 16.700  12.459  57.245  1.00 43.14  ? 240 GLU A N     1 
ATOM   2579 C CA    . GLU C 3 240 ? 15.855  12.127  56.094  1.00 43.94  ? 240 GLU A CA    1 
ATOM   2580 C C     . GLU C 3 240 ? 14.476  12.770  56.204  1.00 42.41  ? 240 GLU A C     1 
ATOM   2581 O O     . GLU C 3 240 ? 14.036  13.476  55.297  1.00 42.56  ? 240 GLU A O     1 
ATOM   2582 C CB    . GLU C 3 240 ? 15.681  10.610  55.988  1.00 47.07  ? 240 GLU A CB    1 
ATOM   2583 C CG    . GLU C 3 240 ? 16.956  9.816   56.204  1.00 53.94  ? 240 GLU A CG    1 
ATOM   2584 C CD    . GLU C 3 240 ? 16.700  8.317   56.336  1.00 58.56  ? 240 GLU A CD    1 
ATOM   2585 O OE1   . GLU C 3 240 ? 16.152  7.721   55.379  1.00 60.99  ? 240 GLU A OE1   1 
ATOM   2586 O OE2   . GLU C 3 240 ? 17.046  7.733   57.393  1.00 59.11  ? 240 GLU A OE2   1 
ATOM   2587 N N     . ASP C 3 241 ? 13.793  12.518  57.318  1.00 40.81  ? 241 ASP A N     1 
ATOM   2588 C CA    . ASP C 3 241 ? 12.461  13.078  57.533  1.00 39.23  ? 241 ASP A CA    1 
ATOM   2589 C C     . ASP C 3 241 ? 12.464  14.605  57.603  1.00 38.58  ? 241 ASP A C     1 
ATOM   2590 O O     . ASP C 3 241 ? 11.651  15.257  56.950  1.00 40.31  ? 241 ASP A O     1 
ATOM   2591 C CB    . ASP C 3 241 ? 11.839  12.484  58.793  1.00 37.63  ? 241 ASP A CB    1 
ATOM   2592 C CG    . ASP C 3 241 ? 11.709  10.973  58.714  1.00 39.01  ? 241 ASP A CG    1 
ATOM   2593 O OD1   . ASP C 3 241 ? 11.276  10.473  57.659  1.00 40.14  ? 241 ASP A OD1   1 
ATOM   2594 O OD2   . ASP C 3 241 ? 12.030  10.281  59.703  1.00 38.80  ? 241 ASP A OD2   1 
ATOM   2595 N N     . LEU C 3 242 ? 13.379  15.180  58.378  1.00 37.43  ? 242 LEU A N     1 
ATOM   2596 C CA    . LEU C 3 242 ? 13.458  16.633  58.482  1.00 36.85  ? 242 LEU A CA    1 
ATOM   2597 C C     . LEU C 3 242 ? 13.676  17.237  57.095  1.00 36.48  ? 242 LEU A C     1 
ATOM   2598 O O     . LEU C 3 242 ? 13.118  18.282  56.767  1.00 36.49  ? 242 LEU A O     1 
ATOM   2599 C CB    . LEU C 3 242 ? 14.608  17.046  59.410  1.00 34.81  ? 242 LEU A CB    1 
ATOM   2600 C CG    . LEU C 3 242 ? 14.765  18.543  59.708  1.00 32.51  ? 242 LEU A CG    1 
ATOM   2601 C CD1   . LEU C 3 242 ? 13.527  19.056  60.413  1.00 29.92  ? 242 LEU A CD1   1 
ATOM   2602 C CD2   . LEU C 3 242 ? 15.991  18.776  60.577  1.00 31.11  ? 242 LEU A CD2   1 
ATOM   2603 N N     . LEU C 3 243 ? 14.479  16.560  56.281  1.00 36.46  ? 243 LEU A N     1 
ATOM   2604 C CA    . LEU C 3 243 ? 14.782  17.026  54.934  1.00 36.49  ? 243 LEU A CA    1 
ATOM   2605 C C     . LEU C 3 243 ? 13.537  17.091  54.043  1.00 37.40  ? 243 LEU A C     1 
ATOM   2606 O O     . LEU C 3 243 ? 13.256  18.125  53.430  1.00 37.15  ? 243 LEU A O     1 
ATOM   2607 C CB    . LEU C 3 243 ? 15.831  16.114  54.303  1.00 37.29  ? 243 LEU A CB    1 
ATOM   2608 C CG    . LEU C 3 243 ? 16.878  16.831  53.452  1.00 38.64  ? 243 LEU A CG    1 
ATOM   2609 C CD1   . LEU C 3 243 ? 17.880  15.830  52.910  1.00 38.92  ? 243 LEU A CD1   1 
ATOM   2610 C CD2   . LEU C 3 243 ? 16.197  17.563  52.325  1.00 39.49  ? 243 LEU A CD2   1 
ATOM   2611 N N     . ARG C 3 244 ? 12.791  15.990  53.968  1.00 37.50  ? 244 ARG A N     1 
ATOM   2612 C CA    . ARG C 3 244 ? 11.573  15.953  53.151  1.00 37.92  ? 244 ARG A CA    1 
ATOM   2613 C C     . ARG C 3 244 ? 10.545  16.982  53.614  1.00 36.70  ? 244 ARG A C     1 
ATOM   2614 O O     . ARG C 3 244 ? 9.944   17.676  52.796  1.00 35.27  ? 244 ARG A O     1 
ATOM   2615 C CB    . ARG C 3 244 ? 10.942  14.557  53.185  1.00 41.79  ? 244 ARG A CB    1 
ATOM   2616 C CG    . ARG C 3 244 ? 11.740  13.496  52.436  1.00 46.70  ? 244 ARG A CG    1 
ATOM   2617 C CD    . ARG C 3 244 ? 11.042  12.151  52.484  1.00 49.90  ? 244 ARG A CD    1 
ATOM   2618 N NE    . ARG C 3 244 ? 11.353  11.382  53.688  1.00 53.29  ? 244 ARG A NE    1 
ATOM   2619 C CZ    . ARG C 3 244 ? 10.602  10.377  54.133  1.00 55.65  ? 244 ARG A CZ    1 
ATOM   2620 N NH1   . ARG C 3 244 ? 9.500   10.037  53.474  1.00 55.67  ? 244 ARG A NH1   1 
ATOM   2621 N NH2   . ARG C 3 244 ? 10.950  9.706   55.226  1.00 56.55  ? 244 ARG A NH2   1 
ATOM   2622 N N     . LYS C 3 245 ? 10.340  17.077  54.926  1.00 34.47  ? 245 LYS A N     1 
ATOM   2623 C CA    . LYS C 3 245 ? 9.386   18.037  55.465  1.00 33.19  ? 245 LYS A CA    1 
ATOM   2624 C C     . LYS C 3 245 ? 9.811   19.444  55.082  1.00 33.35  ? 245 LYS A C     1 
ATOM   2625 O O     . LYS C 3 245 ? 8.970   20.288  54.778  1.00 32.60  ? 245 LYS A O     1 
ATOM   2626 C CB    . LYS C 3 245 ? 9.298   17.916  56.990  1.00 29.93  ? 245 LYS A CB    1 
ATOM   2627 C CG    . LYS C 3 245 ? 8.709   16.608  57.453  1.00 27.15  ? 245 LYS A CG    1 
ATOM   2628 C CD    . LYS C 3 245 ? 8.891   16.400  58.934  1.00 26.48  ? 245 LYS A CD    1 
ATOM   2629 C CE    . LYS C 3 245 ? 8.452   15.008  59.329  1.00 26.93  ? 245 LYS A CE    1 
ATOM   2630 N NZ    . LYS C 3 245 ? 8.669   14.736  60.779  1.00 28.34  ? 245 LYS A NZ    1 
ATOM   2631 N N     . VAL C 3 246 ? 11.117  19.695  55.100  1.00 34.92  ? 246 VAL A N     1 
ATOM   2632 C CA    . VAL C 3 246 ? 11.632  21.011  54.735  1.00 36.74  ? 246 VAL A CA    1 
ATOM   2633 C C     . VAL C 3 246 ? 11.565  21.190  53.221  1.00 39.38  ? 246 VAL A C     1 
ATOM   2634 O O     . VAL C 3 246 ? 11.220  22.269  52.734  1.00 38.01  ? 246 VAL A O     1 
ATOM   2635 C CB    . VAL C 3 246 ? 13.086  21.198  55.210  1.00 35.89  ? 246 VAL A CB    1 
ATOM   2636 C CG1   . VAL C 3 246 ? 13.682  22.442  54.578  1.00 36.47  ? 246 VAL A CG1   1 
ATOM   2637 C CG2   . VAL C 3 246 ? 13.119  21.324  56.727  1.00 34.50  ? 246 VAL A CG2   1 
ATOM   2638 N N     . ARG C 3 247 ? 11.897  20.131  52.481  1.00 42.30  ? 247 ARG A N     1 
ATOM   2639 C CA    . ARG C 3 247 ? 11.842  20.170  51.017  1.00 44.26  ? 247 ARG A CA    1 
ATOM   2640 C C     . ARG C 3 247 ? 10.413  20.448  50.568  1.00 44.09  ? 247 ARG A C     1 
ATOM   2641 O O     . ARG C 3 247 ? 10.192  21.149  49.582  1.00 45.58  ? 247 ARG A O     1 
ATOM   2642 C CB    . ARG C 3 247 ? 12.286  18.835  50.407  1.00 46.33  ? 247 ARG A CB    1 
ATOM   2643 C CG    . ARG C 3 247 ? 13.790  18.622  50.263  1.00 49.30  ? 247 ARG A CG    1 
ATOM   2644 C CD    . ARG C 3 247 ? 14.069  17.242  49.649  1.00 50.88  ? 247 ARG A CD    1 
ATOM   2645 N NE    . ARG C 3 247 ? 15.495  16.964  49.503  1.00 53.91  ? 247 ARG A NE    1 
ATOM   2646 C CZ    . ARG C 3 247 ? 15.998  15.826  49.028  1.00 56.39  ? 247 ARG A CZ    1 
ATOM   2647 N NH1   . ARG C 3 247 ? 15.195  14.842  48.643  1.00 57.11  ? 247 ARG A NH1   1 
ATOM   2648 N NH2   . ARG C 3 247 ? 17.312  15.666  48.950  1.00 57.13  ? 247 ARG A NH2   1 
ATOM   2649 N N     . ALA C 3 248 ? 9.447   19.889  51.292  1.00 43.31  ? 248 ALA A N     1 
ATOM   2650 C CA    . ALA C 3 248 ? 8.039   20.074  50.955  1.00 44.05  ? 248 ALA A CA    1 
ATOM   2651 C C     . ALA C 3 248 ? 7.627   21.526  51.079  1.00 46.21  ? 248 ALA A C     1 
ATOM   2652 O O     . ALA C 3 248 ? 6.509   21.891  50.705  1.00 45.82  ? 248 ALA A O     1 
ATOM   2653 C CB    . ALA C 3 248 ? 7.162   19.215  51.854  1.00 42.02  ? 248 ALA A CB    1 
ATOM   2654 N N     . LYS C 3 249 ? 8.532   22.357  51.594  1.00 48.99  ? 249 LYS A N     1 
ATOM   2655 C CA    . LYS C 3 249 ? 8.235   23.775  51.778  1.00 50.07  ? 249 LYS A CA    1 
ATOM   2656 C C     . LYS C 3 249 ? 9.357   24.748  51.401  1.00 51.62  ? 249 LYS A C     1 
ATOM   2657 O O     . LYS C 3 249 ? 9.205   25.963  51.557  1.00 52.46  ? 249 LYS A O     1 
ATOM   2658 C CB    . LYS C 3 249 ? 7.800   24.012  53.225  1.00 47.64  ? 249 LYS A CB    1 
ATOM   2659 C CG    . LYS C 3 249 ? 6.582   23.206  53.612  1.00 44.30  ? 249 LYS A CG    1 
ATOM   2660 C CD    . LYS C 3 249 ? 6.095   23.563  54.997  1.00 44.51  ? 249 LYS A CD    1 
ATOM   2661 C CE    . LYS C 3 249 ? 4.855   22.764  55.344  1.00 43.36  ? 249 LYS A CE    1 
ATOM   2662 N NZ    . LYS C 3 249 ? 4.343   23.082  56.691  1.00 43.40  ? 249 LYS A NZ    1 
ATOM   2663 N N     . GLU C 3 250 ? 10.472  24.226  50.892  1.00 54.08  ? 250 GLU A N     1 
ATOM   2664 C CA    . GLU C 3 250 ? 11.596  25.080  50.494  1.00 54.97  ? 250 GLU A CA    1 
ATOM   2665 C C     . GLU C 3 250 ? 11.240  25.888  49.250  1.00 54.93  ? 250 GLU A C     1 
ATOM   2666 O O     . GLU C 3 250 ? 11.859  26.914  48.976  1.00 54.67  ? 250 GLU A O     1 
ATOM   2667 C CB    . GLU C 3 250 ? 12.849  24.244  50.198  1.00 56.27  ? 250 GLU A CB    1 
ATOM   2668 C CG    . GLU C 3 250 ? 12.872  23.591  48.811  1.00 59.30  ? 250 GLU A CG    1 
ATOM   2669 C CD    . GLU C 3 250 ? 14.151  22.797  48.539  1.00 60.80  ? 250 GLU A CD    1 
ATOM   2670 O OE1   . GLU C 3 250 ? 14.399  21.790  49.236  1.00 62.13  ? 250 GLU A OE1   1 
ATOM   2671 O OE2   . GLU C 3 250 ? 14.911  23.180  47.624  1.00 62.39  ? 250 GLU A OE2   1 
ATOM   2672 N N     . THR C 3 251 ? 10.240  25.414  48.506  1.00 55.71  ? 251 THR A N     1 
ATOM   2673 C CA    . THR C 3 251 ? 9.795   26.069  47.277  1.00 55.74  ? 251 THR A CA    1 
ATOM   2674 C C     . THR C 3 251 ? 8.271   26.036  47.165  1.00 55.26  ? 251 THR A C     1 
ATOM   2675 O O     . THR C 3 251 ? 7.655   24.994  47.372  1.00 54.44  ? 251 THR A O     1 
ATOM   2676 C CB    . THR C 3 251 ? 10.384  25.363  46.028  1.00 56.59  ? 251 THR A CB    1 
ATOM   2677 O OG1   . THR C 3 251 ? 11.784  25.109  46.223  1.00 57.70  ? 251 THR A OG1   1 
ATOM   2678 C CG2   . THR C 3 251 ? 10.198  26.237  44.790  1.00 55.90  ? 251 THR A CG2   1 
ATOM   2679 N N     . ARG C 3 252 ? 7.670   27.173  46.826  1.00 55.45  ? 252 ARG A N     1 
ATOM   2680 C CA    . ARG C 3 252 ? 6.214   27.256  46.689  1.00 56.61  ? 252 ARG A CA    1 
ATOM   2681 C C     . ARG C 3 252 ? 5.744   26.792  45.317  1.00 55.03  ? 252 ARG A C     1 
ATOM   2682 O O     . ARG C 3 252 ? 6.502   26.831  44.345  1.00 54.57  ? 252 ARG A O     1 
ATOM   2683 C CB    . ARG C 3 252 ? 5.724   28.692  46.922  1.00 58.51  ? 252 ARG A CB    1 
ATOM   2684 C CG    . ARG C 3 252 ? 5.734   29.155  48.375  1.00 61.45  ? 252 ARG A CG    1 
ATOM   2685 C CD    . ARG C 3 252 ? 7.132   29.099  48.975  1.00 64.75  ? 252 ARG A CD    1 
ATOM   2686 N NE    . ARG C 3 252 ? 7.327   30.112  50.009  1.00 67.60  ? 252 ARG A NE    1 
ATOM   2687 C CZ    . ARG C 3 252 ? 8.464   30.286  50.680  1.00 69.08  ? 252 ARG A CZ    1 
ATOM   2688 N NH1   . ARG C 3 252 ? 9.512   29.507  50.432  1.00 69.33  ? 252 ARG A NH1   1 
ATOM   2689 N NH2   . ARG C 3 252 ? 8.559   31.249  51.589  1.00 68.80  ? 252 ARG A NH2   1 
ATOM   2690 N N     . LYS C 3 253 ? 4.490   26.353  45.244  1.00 53.97  ? 253 LYS A N     1 
ATOM   2691 C CA    . LYS C 3 253 ? 3.921   25.890  43.984  1.00 54.43  ? 253 LYS A CA    1 
ATOM   2692 C C     . LYS C 3 253 ? 4.178   26.921  42.894  1.00 53.75  ? 253 LYS A C     1 
ATOM   2693 O O     . LYS C 3 253 ? 4.169   28.125  43.146  1.00 54.58  ? 253 LYS A O     1 
ATOM   2694 C CB    . LYS C 3 253 ? 2.407   25.702  44.093  1.00 54.38  ? 253 LYS A CB    1 
ATOM   2695 C CG    . LYS C 3 253 ? 1.930   24.702  45.114  1.00 56.62  ? 253 LYS A CG    1 
ATOM   2696 C CD    . LYS C 3 253 ? 0.411   24.619  45.064  1.00 57.81  ? 253 LYS A CD    1 
ATOM   2697 C CE    . LYS C 3 253 ? -0.140  23.783  46.203  1.00 61.50  ? 253 LYS A CE    1 
ATOM   2698 N NZ    . LYS C 3 253 ? -1.633  23.636  46.174  1.00 64.82  ? 253 LYS A NZ    1 
ATOM   2699 N N     . ARG C 3 254 ? 4.405   26.444  41.680  1.00 52.79  ? 254 ARG A N     1 
ATOM   2700 C CA    . ARG C 3 254 ? 4.625   27.334  40.561  1.00 51.84  ? 254 ARG A CA    1 
ATOM   2701 C C     . ARG C 3 254 ? 4.090   26.647  39.308  1.00 49.57  ? 254 ARG A C     1 
ATOM   2702 O O     . ARG C 3 254 ? 4.760   25.811  38.700  1.00 49.46  ? 254 ARG A O     1 
ATOM   2703 C CB    . ARG C 3 254 ? 6.112   27.657  40.419  1.00 56.41  ? 254 ARG A CB    1 
ATOM   2704 C CG    . ARG C 3 254 ? 6.369   28.919  39.613  1.00 61.79  ? 254 ARG A CG    1 
ATOM   2705 C CD    . ARG C 3 254 ? 7.845   29.277  39.558  1.00 66.04  ? 254 ARG A CD    1 
ATOM   2706 N NE    . ARG C 3 254 ? 8.049   30.594  38.956  1.00 70.31  ? 254 ARG A NE    1 
ATOM   2707 C CZ    . ARG C 3 254 ? 9.240   31.141  38.730  1.00 71.75  ? 254 ARG A CZ    1 
ATOM   2708 N NH1   . ARG C 3 254 ? 10.349  30.484  39.054  1.00 71.82  ? 254 ARG A NH1   1 
ATOM   2709 N NH2   . ARG C 3 254 ? 9.321   32.349  38.184  1.00 72.49  ? 254 ARG A NH2   1 
ATOM   2710 N N     . ALA C 3 255 ? 2.862   26.998  38.944  1.00 46.00  ? 255 ALA A N     1 
ATOM   2711 C CA    . ALA C 3 255 ? 2.205   26.424  37.785  1.00 42.31  ? 255 ALA A CA    1 
ATOM   2712 C C     . ALA C 3 255 ? 2.991   26.651  36.513  1.00 40.91  ? 255 ALA A C     1 
ATOM   2713 O O     . ALA C 3 255 ? 3.648   27.678  36.343  1.00 41.01  ? 255 ALA A O     1 
ATOM   2714 C CB    . ALA C 3 255 ? 0.811   27.006  37.636  1.00 41.80  ? 255 ALA A CB    1 
ATOM   2715 N N     . LEU C 3 256 ? 2.909   25.669  35.625  1.00 38.91  ? 256 LEU A N     1 
ATOM   2716 C CA    . LEU C 3 256 ? 3.569   25.699  34.332  1.00 37.85  ? 256 LEU A CA    1 
ATOM   2717 C C     . LEU C 3 256 ? 2.632   26.398  33.342  1.00 36.85  ? 256 LEU A C     1 
ATOM   2718 O O     . LEU C 3 256 ? 3.038   26.812  32.258  1.00 37.03  ? 256 LEU A O     1 
ATOM   2719 C CB    . LEU C 3 256 ? 3.867   24.266  33.890  1.00 38.74  ? 256 LEU A CB    1 
ATOM   2720 C CG    . LEU C 3 256 ? 4.428   23.997  32.498  1.00 41.24  ? 256 LEU A CG    1 
ATOM   2721 C CD1   . LEU C 3 256 ? 5.542   24.975  32.155  1.00 43.03  ? 256 LEU A CD1   1 
ATOM   2722 C CD2   . LEU C 3 256 ? 4.935   22.562  32.467  1.00 42.51  ? 256 LEU A CD2   1 
ATOM   2723 N N     . SER C 3 257 ? 1.367   26.510  33.737  1.00 35.35  ? 257 SER A N     1 
ATOM   2724 C CA    . SER C 3 257 ? 0.341   27.190  32.951  1.00 33.70  ? 257 SER A CA    1 
ATOM   2725 C C     . SER C 3 257 ? -1.026  27.020  33.598  1.00 31.52  ? 257 SER A C     1 
ATOM   2726 O O     . SER C 3 257 ? -1.320  25.989  34.191  1.00 29.99  ? 257 SER A O     1 
ATOM   2727 C CB    . SER C 3 257 ? 0.301   26.669  31.510  1.00 33.01  ? 257 SER A CB    1 
ATOM   2728 O OG    . SER C 3 257 ? -0.140  25.330  31.456  1.00 36.73  ? 257 SER A OG    1 
ATOM   2729 N N     . ARG C 3 258 ? -1.845  28.059  33.511  1.00 31.27  ? 258 ARG A N     1 
ATOM   2730 C CA    . ARG C 3 258 ? -3.196  28.011  34.051  1.00 32.32  ? 258 ARG A CA    1 
ATOM   2731 C C     . ARG C 3 258 ? -4.076  27.897  32.820  1.00 29.82  ? 258 ARG A C     1 
ATOM   2732 O O     . ARG C 3 258 ? -4.091  28.793  31.987  1.00 29.65  ? 258 ARG A O     1 
ATOM   2733 C CB    . ARG C 3 258 ? -3.540  29.298  34.794  1.00 35.86  ? 258 ARG A CB    1 
ATOM   2734 C CG    . ARG C 3 258 ? -2.679  29.638  36.002  1.00 40.79  ? 258 ARG A CG    1 
ATOM   2735 C CD    . ARG C 3 258 ? -3.205  30.946  36.592  1.00 47.08  ? 258 ARG A CD    1 
ATOM   2736 N NE    . ARG C 3 258 ? -2.415  31.491  37.693  1.00 50.54  ? 258 ARG A NE    1 
ATOM   2737 C CZ    . ARG C 3 258 ? -2.592  32.714  38.191  1.00 53.06  ? 258 ARG A CZ    1 
ATOM   2738 N NH1   . ARG C 3 258 ? -3.527  33.507  37.679  1.00 52.94  ? 258 ARG A NH1   1 
ATOM   2739 N NH2   . ARG C 3 258 ? -1.838  33.149  39.197  1.00 54.03  ? 258 ARG A NH2   1 
ATOM   2740 N N     . LEU C 3 259 ? -4.808  26.801  32.694  1.00 29.34  ? 259 LEU A N     1 
ATOM   2741 C CA    . LEU C 3 259 ? -5.648  26.617  31.520  1.00 28.11  ? 259 LEU A CA    1 
ATOM   2742 C C     . LEU C 3 259 ? -7.098  26.336  31.845  1.00 27.05  ? 259 LEU A C     1 
ATOM   2743 O O     . LEU C 3 259 ? -7.455  26.062  32.989  1.00 25.59  ? 259 LEU A O     1 
ATOM   2744 C CB    . LEU C 3 259 ? -5.110  25.465  30.674  1.00 27.97  ? 259 LEU A CB    1 
ATOM   2745 C CG    . LEU C 3 259 ? -3.694  25.635  30.128  1.00 30.27  ? 259 LEU A CG    1 
ATOM   2746 C CD1   . LEU C 3 259 ? -3.187  24.289  29.626  1.00 29.69  ? 259 LEU A CD1   1 
ATOM   2747 C CD2   . LEU C 3 259 ? -3.691  26.687  29.019  1.00 29.45  ? 259 LEU A CD2   1 
ATOM   2748 N N     . LYS C 3 260 ? -7.924  26.393  30.809  1.00 26.56  ? 260 LYS A N     1 
ATOM   2749 C CA    . LYS C 3 260 ? -9.340  26.110  30.934  1.00 27.13  ? 260 LYS A CA    1 
ATOM   2750 C C     . LYS C 3 260 ? -9.525  24.646  30.588  1.00 24.69  ? 260 LYS A C     1 
ATOM   2751 O O     . LYS C 3 260 ? -8.932  24.146  29.644  1.00 24.92  ? 260 LYS A O     1 
ATOM   2752 C CB    . LYS C 3 260 ? -10.148 26.970  29.956  1.00 29.59  ? 260 LYS A CB    1 
ATOM   2753 C CG    . LYS C 3 260 ? -9.846  28.454  30.072  1.00 34.32  ? 260 LYS A CG    1 
ATOM   2754 C CD    . LYS C 3 260 ? -10.456 29.256  28.933  1.00 37.37  ? 260 LYS A CD    1 
ATOM   2755 C CE    . LYS C 3 260 ? -10.001 30.720  28.972  1.00 38.79  ? 260 LYS A CE    1 
ATOM   2756 N NZ    . LYS C 3 260 ? -10.642 31.523  27.889  1.00 39.65  ? 260 LYS A NZ    1 
ATOM   2757 N N     . LEU C 3 261 ? -10.328 23.953  31.376  1.00 23.99  ? 261 LEU A N     1 
ATOM   2758 C CA    . LEU C 3 261 ? -10.616 22.565  31.118  1.00 22.26  ? 261 LEU A CA    1 
ATOM   2759 C C     . LEU C 3 261 ? -12.086 22.620  30.758  1.00 23.42  ? 261 LEU A C     1 
ATOM   2760 O O     . LEU C 3 261 ? -12.942 22.808  31.625  1.00 22.86  ? 261 LEU A O     1 
ATOM   2761 C CB    . LEU C 3 261 ? -10.391 21.726  32.370  1.00 24.03  ? 261 LEU A CB    1 
ATOM   2762 C CG    . LEU C 3 261 ? -10.386 20.205  32.203  1.00 23.46  ? 261 LEU A CG    1 
ATOM   2763 C CD1   . LEU C 3 261 ? -9.809  19.576  33.454  1.00 25.89  ? 261 LEU A CD1   1 
ATOM   2764 C CD2   . LEU C 3 261 ? -11.781 19.695  31.945  1.00 21.71  ? 261 LEU A CD2   1 
ATOM   2765 N N     . LYS C 3 262 ? -12.354 22.486  29.462  1.00 23.33  ? 262 LYS A N     1 
ATOM   2766 C CA    . LYS C 3 262 ? -13.695 22.537  28.899  1.00 23.61  ? 262 LYS A CA    1 
ATOM   2767 C C     . LYS C 3 262 ? -14.392 21.182  28.797  1.00 22.53  ? 262 LYS A C     1 
ATOM   2768 O O     . LYS C 3 262 ? -13.932 20.301  28.069  1.00 21.71  ? 262 LYS A O     1 
ATOM   2769 C CB    . LYS C 3 262 ? -13.616 23.157  27.503  1.00 24.60  ? 262 LYS A CB    1 
ATOM   2770 C CG    . LYS C 3 262 ? -12.831 24.449  27.482  1.00 27.63  ? 262 LYS A CG    1 
ATOM   2771 C CD    . LYS C 3 262 ? -12.510 24.930  26.079  1.00 28.67  ? 262 LYS A CD    1 
ATOM   2772 C CE    . LYS C 3 262 ? -11.641 26.179  26.150  1.00 29.96  ? 262 LYS A CE    1 
ATOM   2773 N NZ    . LYS C 3 262 ? -10.870 26.429  24.895  1.00 31.42  ? 262 LYS A NZ    1 
ATOM   2774 N N     . LEU C 3 263 ? -15.500 21.018  29.517  1.00 20.84  ? 263 LEU A N     1 
ATOM   2775 C CA    . LEU C 3 263 ? -16.256 19.768  29.433  1.00 22.34  ? 263 LEU A CA    1 
ATOM   2776 C C     . LEU C 3 263 ? -17.000 19.901  28.100  1.00 21.30  ? 263 LEU A C     1 
ATOM   2777 O O     . LEU C 3 263 ? -17.272 18.925  27.400  1.00 18.77  ? 263 LEU A O     1 
ATOM   2778 C CB    . LEU C 3 263 ? -17.238 19.625  30.601  1.00 21.00  ? 263 LEU A CB    1 
ATOM   2779 C CG    . LEU C 3 263 ? -16.754 19.903  32.028  1.00 24.01  ? 263 LEU A CG    1 
ATOM   2780 C CD1   . LEU C 3 263 ? -17.506 18.994  32.994  1.00 23.80  ? 263 LEU A CD1   1 
ATOM   2781 C CD2   . LEU C 3 263 ? -15.258 19.658  32.154  1.00 26.36  ? 263 LEU A CD2   1 
ATOM   2782 N N     . ASN C 3 264 ? -17.305 21.150  27.771  1.00 22.83  ? 264 ASN A N     1 
ATOM   2783 C CA    . ASN C 3 264 ? -17.939 21.520  26.519  1.00 25.67  ? 264 ASN A CA    1 
ATOM   2784 C C     . ASN C 3 264 ? -17.724 23.031  26.418  1.00 28.61  ? 264 ASN A C     1 
ATOM   2785 O O     . ASN C 3 264 ? -17.001 23.604  27.232  1.00 28.91  ? 264 ASN A O     1 
ATOM   2786 C CB    . ASN C 3 264 ? -19.429 21.102  26.484  1.00 25.68  ? 264 ASN A CB    1 
ATOM   2787 C CG    . ASN C 3 264 ? -20.367 22.088  27.174  1.00 27.91  ? 264 ASN A CG    1 
ATOM   2788 O OD1   . ASN C 3 264 ? -19.951 23.048  27.838  1.00 25.20  ? 264 ASN A OD1   1 
ATOM   2789 N ND2   . ASN C 3 264 ? -21.662 21.839  27.015  1.00 25.98  ? 264 ASN A ND2   1 
ATOM   2790 N N     . LYS C 3 265 ? -18.317 23.678  25.427  1.00 32.42  ? 265 LYS A N     1 
ATOM   2791 C CA    . LYS C 3 265 ? -18.125 25.111  25.257  1.00 34.65  ? 265 LYS A CA    1 
ATOM   2792 C C     . LYS C 3 265 ? -18.643 25.987  26.395  1.00 35.14  ? 265 LYS A C     1 
ATOM   2793 O O     . LYS C 3 265 ? -18.083 27.048  26.665  1.00 35.72  ? 265 LYS A O     1 
ATOM   2794 C CB    . LYS C 3 265 ? -18.758 25.564  23.938  1.00 37.05  ? 265 LYS A CB    1 
ATOM   2795 C CG    . LYS C 3 265 ? -18.053 25.005  22.705  1.00 43.27  ? 265 LYS A CG    1 
ATOM   2796 C CD    . LYS C 3 265 ? -18.421 25.792  21.446  1.00 47.09  ? 265 LYS A CD    1 
ATOM   2797 C CE    . LYS C 3 265 ? -17.523 25.429  20.269  1.00 45.95  ? 265 LYS A CE    1 
ATOM   2798 N NZ    . LYS C 3 265 ? -17.710 26.394  19.145  1.00 47.32  ? 265 LYS A NZ    1 
ATOM   2799 N N     . ASP C 3 266 ? -19.703 25.542  27.061  1.00 34.89  ? 266 ASP A N     1 
ATOM   2800 C CA    . ASP C 3 266 ? -20.306 26.314  28.140  1.00 35.74  ? 266 ASP A CA    1 
ATOM   2801 C C     . ASP C 3 266 ? -19.770 26.020  29.534  1.00 34.21  ? 266 ASP A C     1 
ATOM   2802 O O     . ASP C 3 266 ? -19.705 26.906  30.381  1.00 35.84  ? 266 ASP A O     1 
ATOM   2803 C CB    . ASP C 3 266 ? -21.820 26.089  28.149  1.00 39.36  ? 266 ASP A CB    1 
ATOM   2804 C CG    . ASP C 3 266 ? -22.469 26.469  26.838  1.00 44.43  ? 266 ASP A CG    1 
ATOM   2805 O OD1   . ASP C 3 266 ? -22.243 27.609  26.379  1.00 46.12  ? 266 ASP A OD1   1 
ATOM   2806 O OD2   . ASP C 3 266 ? -23.204 25.631  26.267  1.00 47.35  ? 266 ASP A OD2   1 
ATOM   2807 N N     . ILE C 3 267 ? -19.397 24.770  29.766  1.00 31.76  ? 267 ILE A N     1 
ATOM   2808 C CA    . ILE C 3 267 ? -18.912 24.329  31.065  1.00 27.04  ? 267 ILE A CA    1 
ATOM   2809 C C     . ILE C 3 267 ? -17.385 24.319  31.114  1.00 25.80  ? 267 ILE A C     1 
ATOM   2810 O O     . ILE C 3 267 ? -16.738 23.377  30.669  1.00 26.05  ? 267 ILE A O     1 
ATOM   2811 C CB    . ILE C 3 267 ? -19.497 22.947  31.342  1.00 25.94  ? 267 ILE A CB    1 
ATOM   2812 C CG1   . ILE C 3 267 ? -21.000 22.991  31.008  1.00 24.98  ? 267 ILE A CG1   1 
ATOM   2813 C CG2   . ILE C 3 267 ? -19.262 22.548  32.788  1.00 25.56  ? 267 ILE A CG2   1 
ATOM   2814 C CD1   . ILE C 3 267 ? -21.705 21.672  31.066  1.00 24.04  ? 267 ILE A CD1   1 
ATOM   2815 N N     . VAL C 3 268 ? -16.821 25.385  31.671  1.00 24.31  ? 268 VAL A N     1 
ATOM   2816 C CA    . VAL C 3 268 ? -15.378 25.545  31.749  1.00 24.80  ? 268 VAL A CA    1 
ATOM   2817 C C     . VAL C 3 268 ? -14.856 25.791  33.168  1.00 24.97  ? 268 VAL A C     1 
ATOM   2818 O O     . VAL C 3 268 ? -15.354 26.666  33.870  1.00 27.07  ? 268 VAL A O     1 
ATOM   2819 C CB    . VAL C 3 268 ? -14.935 26.737  30.851  1.00 24.17  ? 268 VAL A CB    1 
ATOM   2820 C CG1   . VAL C 3 268 ? -13.434 26.932  30.926  1.00 23.59  ? 268 VAL A CG1   1 
ATOM   2821 C CG2   . VAL C 3 268 ? -15.374 26.496  29.414  1.00 24.26  ? 268 VAL A CG2   1 
ATOM   2822 N N     . ILE C 3 269 ? -13.860 25.012  33.583  1.00 23.77  ? 269 ILE A N     1 
ATOM   2823 C CA    . ILE C 3 269 ? -13.245 25.183  34.903  1.00 23.83  ? 269 ILE A CA    1 
ATOM   2824 C C     . ILE C 3 269 ? -11.782 25.558  34.665  1.00 24.18  ? 269 ILE A C     1 
ATOM   2825 O O     . ILE C 3 269 ? -11.250 25.347  33.575  1.00 22.67  ? 269 ILE A O     1 
ATOM   2826 C CB    . ILE C 3 269 ? -13.289 23.883  35.765  1.00 22.57  ? 269 ILE A CB    1 
ATOM   2827 C CG1   . ILE C 3 269 ? -12.263 22.870  35.257  1.00 20.52  ? 269 ILE A CG1   1 
ATOM   2828 C CG2   . ILE C 3 269 ? -14.690 23.269  35.728  1.00 23.24  ? 269 ILE A CG2   1 
ATOM   2829 C CD1   . ILE C 3 269 ? -12.207 21.597  36.086  1.00 18.28  ? 269 ILE A CD1   1 
ATOM   2830 N N     . SER C 3 270 ? -11.129 26.126  35.673  1.00 23.57  ? 270 SER A N     1 
ATOM   2831 C CA    . SER C 3 270 ? -9.733  26.505  35.510  1.00 23.01  ? 270 SER A CA    1 
ATOM   2832 C C     . SER C 3 270 ? -8.853  25.546  36.275  1.00 20.78  ? 270 SER A C     1 
ATOM   2833 O O     . SER C 3 270 ? -9.201  25.110  37.370  1.00 19.09  ? 270 SER A O     1 
ATOM   2834 C CB    . SER C 3 270 ? -9.496  27.943  35.984  1.00 25.38  ? 270 SER A CB    1 
ATOM   2835 O OG    . SER C 3 270 ? -10.092 28.171  37.252  1.00 32.15  ? 270 SER A OG    1 
ATOM   2836 N N     . VAL C 3 271 ? -7.717  25.203  35.678  1.00 19.60  ? 271 VAL A N     1 
ATOM   2837 C CA    . VAL C 3 271 ? -6.782  24.286  36.302  1.00 19.48  ? 271 VAL A CA    1 
ATOM   2838 C C     . VAL C 3 271 ? -5.345  24.747  36.204  1.00 20.96  ? 271 VAL A C     1 
ATOM   2839 O O     . VAL C 3 271 ? -4.969  25.485  35.292  1.00 21.62  ? 271 VAL A O     1 
ATOM   2840 C CB    . VAL C 3 271 ? -6.843  22.873  35.671  1.00 16.72  ? 271 VAL A CB    1 
ATOM   2841 C CG1   . VAL C 3 271 ? -8.233  22.292  35.832  1.00 17.08  ? 271 VAL A CG1   1 
ATOM   2842 C CG2   . VAL C 3 271 ? -6.430  22.935  34.203  1.00 10.98  ? 271 VAL A CG2   1 
ATOM   2843 N N     . GLY C 3 272 ? -4.547  24.303  37.165  1.00 20.88  ? 272 GLY A N     1 
ATOM   2844 C CA    . GLY C 3 272 ? -3.136  24.621  37.149  1.00 20.83  ? 272 GLY A CA    1 
ATOM   2845 C C     . GLY C 3 272 ? -2.451  23.360  36.647  1.00 20.58  ? 272 GLY A C     1 
ATOM   2846 O O     . GLY C 3 272 ? -2.861  22.253  36.986  1.00 20.82  ? 272 GLY A O     1 
ATOM   2847 N N     . ILE C 3 273 ? -1.434  23.526  35.813  1.00 18.72  ? 273 ILE A N     1 
ATOM   2848 C CA    . ILE C 3 273 ? -0.684  22.409  35.275  1.00 16.30  ? 273 ILE A CA    1 
ATOM   2849 C C     . ILE C 3 273 ? 0.684   22.544  35.930  1.00 16.74  ? 273 ILE A C     1 
ATOM   2850 O O     . ILE C 3 273 ? 1.272   23.611  35.884  1.00 14.72  ? 273 ILE A O     1 
ATOM   2851 C CB    . ILE C 3 273 ? -0.497  22.529  33.734  1.00 18.27  ? 273 ILE A CB    1 
ATOM   2852 C CG1   . ILE C 3 273 ? -1.843  22.790  33.038  1.00 15.38  ? 273 ILE A CG1   1 
ATOM   2853 C CG2   . ILE C 3 273 ? 0.171   21.256  33.196  1.00 17.07  ? 273 ILE A CG2   1 
ATOM   2854 C CD1   . ILE C 3 273 ? -2.803  21.626  33.051  1.00 12.48  ? 273 ILE A CD1   1 
ATOM   2855 N N     . TYR C 3 274 ? 1.177   21.479  36.551  1.00 16.79  ? 274 TYR A N     1 
ATOM   2856 C CA    . TYR C 3 274 ? 2.481   21.523  37.197  1.00 18.25  ? 274 TYR A CA    1 
ATOM   2857 C C     . TYR C 3 274 ? 3.371   20.372  36.782  1.00 19.60  ? 274 TYR A C     1 
ATOM   2858 O O     . TYR C 3 274 ? 2.899   19.286  36.420  1.00 21.29  ? 274 TYR A O     1 
ATOM   2859 C CB    . TYR C 3 274 ? 2.352   21.479  38.726  1.00 18.68  ? 274 TYR A CB    1 
ATOM   2860 C CG    . TYR C 3 274 ? 1.438   22.526  39.315  1.00 19.31  ? 274 TYR A CG    1 
ATOM   2861 C CD1   . TYR C 3 274 ? 0.052   22.440  39.150  1.00 20.72  ? 274 TYR A CD1   1 
ATOM   2862 C CD2   . TYR C 3 274 ? 1.950   23.595  40.056  1.00 18.19  ? 274 TYR A CD2   1 
ATOM   2863 C CE1   . TYR C 3 274 ? -0.801  23.390  39.712  1.00 19.33  ? 274 TYR A CE1   1 
ATOM   2864 C CE2   . TYR C 3 274 ? 1.103   24.549  40.624  1.00 18.36  ? 274 TYR A CE2   1 
ATOM   2865 C CZ    . TYR C 3 274 ? -0.268  24.436  40.444  1.00 18.01  ? 274 TYR A CZ    1 
ATOM   2866 O OH    . TYR C 3 274 ? -1.108  25.373  40.980  1.00 20.08  ? 274 TYR A OH    1 
ATOM   2867 N N     . ASN C 3 275 ? 4.672   20.614  36.833  1.00 19.87  ? 275 ASN A N     1 
ATOM   2868 C CA    . ASN C 3 275 ? 5.616   19.574  36.519  1.00 20.97  ? 275 ASN A CA    1 
ATOM   2869 C C     . ASN C 3 275 ? 6.241   19.155  37.837  1.00 20.17  ? 275 ASN A C     1 
ATOM   2870 O O     . ASN C 3 275 ? 7.131   19.821  38.347  1.00 23.24  ? 275 ASN A O     1 
ATOM   2871 C CB    . ASN C 3 275 ? 6.677   20.051  35.499  1.00 24.78  ? 275 ASN A CB    1 
ATOM   2872 C CG    . ASN C 3 275 ? 7.233   21.443  35.799  1.00 30.19  ? 275 ASN A CG    1 
ATOM   2873 O OD1   . ASN C 3 275 ? 6.825   22.114  36.751  1.00 33.93  ? 275 ASN A OD1   1 
ATOM   2874 N ND2   . ASN C 3 275 ? 8.175   21.882  34.970  1.00 30.46  ? 275 ASN A ND2   1 
ATOM   2875 N N     . LEU C 3 276 ? 5.736   18.065  38.410  1.00 20.28  ? 276 LEU A N     1 
ATOM   2876 C CA    . LEU C 3 276 ? 6.269   17.564  39.668  1.00 21.83  ? 276 LEU A CA    1 
ATOM   2877 C C     . LEU C 3 276 ? 7.628   16.923  39.396  1.00 23.03  ? 276 LEU A C     1 
ATOM   2878 O O     . LEU C 3 276 ? 8.404   16.666  40.314  1.00 24.24  ? 276 LEU A O     1 
ATOM   2879 C CB    . LEU C 3 276 ? 5.301   16.559  40.311  1.00 23.01  ? 276 LEU A CB    1 
ATOM   2880 C CG    . LEU C 3 276 ? 3.901   17.113  40.628  1.00 25.47  ? 276 LEU A CG    1 
ATOM   2881 C CD1   . LEU C 3 276 ? 3.086   16.069  41.366  1.00 24.07  ? 276 LEU A CD1   1 
ATOM   2882 C CD2   . LEU C 3 276 ? 4.007   18.378  41.465  1.00 24.83  ? 276 LEU A CD2   1 
ATOM   2883 N N     . VAL C 3 277 ? 7.901   16.667  38.122  1.00 22.85  ? 277 VAL A N     1 
ATOM   2884 C CA    . VAL C 3 277 ? 9.179   16.125  37.692  1.00 24.80  ? 277 VAL A CA    1 
ATOM   2885 C C     . VAL C 3 277 ? 9.641   17.039  36.555  1.00 24.57  ? 277 VAL A C     1 
ATOM   2886 O O     . VAL C 3 277 ? 8.835   17.466  35.739  1.00 23.61  ? 277 VAL A O     1 
ATOM   2887 C CB    . VAL C 3 277 ? 9.056   14.660  37.186  1.00 25.72  ? 277 VAL A CB    1 
ATOM   2888 C CG1   . VAL C 3 277 ? 8.451   13.790  38.276  1.00 25.68  ? 277 VAL A CG1   1 
ATOM   2889 C CG2   . VAL C 3 277 ? 8.213   14.598  35.927  1.00 26.27  ? 277 VAL A CG2   1 
ATOM   2890 N N     . GLN C 3 278 ? 10.927  17.376  36.540  1.00 25.95  ? 278 GLN A N     1 
ATOM   2891 C CA    . GLN C 3 278 ? 11.497  18.238  35.510  1.00 26.28  ? 278 GLN A CA    1 
ATOM   2892 C C     . GLN C 3 278 ? 12.983  17.936  35.469  1.00 27.10  ? 278 GLN A C     1 
ATOM   2893 O O     . GLN C 3 278 ? 13.672  18.033  36.483  1.00 26.98  ? 278 GLN A O     1 
ATOM   2894 C CB    . GLN C 3 278 ? 11.286  19.718  35.846  1.00 27.40  ? 278 GLN A CB    1 
ATOM   2895 C CG    . GLN C 3 278 ? 11.708  20.676  34.736  1.00 28.54  ? 278 GLN A CG    1 
ATOM   2896 C CD    . GLN C 3 278 ? 10.877  20.502  33.470  1.00 34.97  ? 278 GLN A CD    1 
ATOM   2897 O OE1   . GLN C 3 278 ? 9.653   20.665  33.489  1.00 35.82  ? 278 GLN A OE1   1 
ATOM   2898 N NE2   . GLN C 3 278 ? 11.539  20.164  32.362  1.00 36.17  ? 278 GLN A NE2   1 
ATOM   2899 N N     . LYS C 3 279 ? 13.475  17.584  34.290  1.00 28.40  ? 279 LYS A N     1 
ATOM   2900 C CA    . LYS C 3 279 ? 14.873  17.225  34.133  1.00 28.26  ? 279 LYS A CA    1 
ATOM   2901 C C     . LYS C 3 279 ? 15.864  18.342  34.461  1.00 27.27  ? 279 LYS A C     1 
ATOM   2902 O O     . LYS C 3 279 ? 16.078  19.247  33.653  1.00 26.24  ? 279 LYS A O     1 
ATOM   2903 C CB    . LYS C 3 279 ? 15.127  16.716  32.710  1.00 26.75  ? 279 LYS A CB    1 
ATOM   2904 C CG    . LYS C 3 279 ? 16.489  16.085  32.568  1.00 29.82  ? 279 LYS A CG    1 
ATOM   2905 C CD    . LYS C 3 279 ? 16.741  15.571  31.169  1.00 34.74  ? 279 LYS A CD    1 
ATOM   2906 C CE    . LYS C 3 279 ? 18.107  14.902  31.090  1.00 33.94  ? 279 LYS A CE    1 
ATOM   2907 N NZ    . LYS C 3 279 ? 18.314  14.233  29.785  1.00 36.43  ? 279 LYS A NZ    1 
ATOM   2908 N N     . ALA C 3 280 ? 16.480  18.260  35.638  1.00 24.53  ? 280 ALA A N     1 
ATOM   2909 C CA    . ALA C 3 280 ? 17.459  19.263  36.039  1.00 25.94  ? 280 ALA A CA    1 
ATOM   2910 C C     . ALA C 3 280 ? 18.637  19.217  35.070  1.00 26.80  ? 280 ALA A C     1 
ATOM   2911 O O     . ALA C 3 280 ? 19.341  18.213  34.964  1.00 28.16  ? 280 ALA A O     1 
ATOM   2912 C CB    . ALA C 3 280 ? 17.930  19.007  37.458  1.00 20.05  ? 280 ALA A CB    1 
ATOM   2913 N N     . LEU C 3 281 ? 18.842  20.313  34.352  1.00 29.25  ? 281 LEU A N     1 
ATOM   2914 C CA    . LEU C 3 281 ? 19.923  20.389  33.380  1.00 31.04  ? 281 LEU A CA    1 
ATOM   2915 C C     . LEU C 3 281 ? 21.132  21.194  33.865  1.00 33.47  ? 281 LEU A C     1 
ATOM   2916 O O     . LEU C 3 281 ? 21.041  21.992  34.810  1.00 33.26  ? 281 LEU A O     1 
ATOM   2917 C CB    . LEU C 3 281 ? 19.403  20.992  32.067  1.00 31.03  ? 281 LEU A CB    1 
ATOM   2918 C CG    . LEU C 3 281 ? 18.284  20.260  31.313  1.00 30.05  ? 281 LEU A CG    1 
ATOM   2919 C CD1   . LEU C 3 281 ? 18.124  20.890  29.951  1.00 30.13  ? 281 LEU A CD1   1 
ATOM   2920 C CD2   . LEU C 3 281 ? 18.622  18.779  31.150  1.00 31.85  ? 281 LEU A CD2   1 
ATOM   2921 N N     . LYS C 3 282 ? 22.267  20.961  33.214  1.00 34.43  ? 282 LYS A N     1 
ATOM   2922 C CA    . LYS C 3 282 ? 23.503  21.663  33.529  1.00 37.11  ? 282 LYS A CA    1 
ATOM   2923 C C     . LYS C 3 282 ? 23.280  23.095  33.061  1.00 37.31  ? 282 LYS A C     1 
ATOM   2924 O O     . LYS C 3 282 ? 23.094  23.338  31.873  1.00 38.76  ? 282 LYS A O     1 
ATOM   2925 C CB    . LYS C 3 282 ? 24.658  21.010  32.770  1.00 38.56  ? 282 LYS A CB    1 
ATOM   2926 C CG    . LYS C 3 282 ? 25.958  21.787  32.733  1.00 41.74  ? 282 LYS A CG    1 
ATOM   2927 C CD    . LYS C 3 282 ? 26.993  21.013  31.925  1.00 42.25  ? 282 LYS A CD    1 
ATOM   2928 C CE    . LYS C 3 282 ? 28.024  21.943  31.327  1.00 44.35  ? 282 LYS A CE    1 
ATOM   2929 N NZ    . LYS C 3 282 ? 29.004  21.195  30.487  1.00 48.23  ? 282 LYS A NZ    1 
ATOM   2930 N N     . PRO C 3 283 ? 23.284  24.062  33.990  1.00 37.70  ? 283 PRO A N     1 
ATOM   2931 C CA    . PRO C 3 283 ? 23.065  25.453  33.595  1.00 37.45  ? 283 PRO A CA    1 
ATOM   2932 C C     . PRO C 3 283 ? 23.927  25.856  32.412  1.00 37.82  ? 283 PRO A C     1 
ATOM   2933 O O     . PRO C 3 283 ? 25.107  25.518  32.346  1.00 38.45  ? 283 PRO A O     1 
ATOM   2934 C CB    . PRO C 3 283 ? 23.408  26.229  34.861  1.00 38.05  ? 283 PRO A CB    1 
ATOM   2935 C CG    . PRO C 3 283 ? 23.024  25.278  35.952  1.00 38.51  ? 283 PRO A CG    1 
ATOM   2936 C CD    . PRO C 3 283 ? 23.586  23.969  35.428  1.00 38.02  ? 283 PRO A CD    1 
ATOM   2937 N N     . PRO C 3 284 ? 23.339  26.577  31.447  1.00 38.09  ? 284 PRO A N     1 
ATOM   2938 C CA    . PRO C 3 284 ? 24.116  26.997  30.281  1.00 38.51  ? 284 PRO A CA    1 
ATOM   2939 C C     . PRO C 3 284 ? 25.195  28.008  30.660  1.00 39.39  ? 284 PRO A C     1 
ATOM   2940 O O     . PRO C 3 284 ? 25.084  28.706  31.671  1.00 37.99  ? 284 PRO A O     1 
ATOM   2941 C CB    . PRO C 3 284 ? 23.056  27.593  29.365  1.00 37.50  ? 284 PRO A CB    1 
ATOM   2942 C CG    . PRO C 3 284 ? 22.079  28.172  30.333  1.00 36.25  ? 284 PRO A CG    1 
ATOM   2943 C CD    . PRO C 3 284 ? 21.956  27.079  31.367  1.00 36.07  ? 284 PRO A CD    1 
ATOM   2944 N N     . PRO C 3 285 ? 26.264  28.086  29.856  1.00 39.67  ? 285 PRO A N     1 
ATOM   2945 C CA    . PRO C 3 285 ? 27.356  29.024  30.121  1.00 40.15  ? 285 PRO A CA    1 
ATOM   2946 C C     . PRO C 3 285 ? 26.888  30.468  29.962  1.00 40.70  ? 285 PRO A C     1 
ATOM   2947 O O     . PRO C 3 285 ? 25.786  30.730  29.477  1.00 42.07  ? 285 PRO A O     1 
ATOM   2948 C CB    . PRO C 3 285 ? 28.396  28.643  29.071  1.00 39.71  ? 285 PRO A CB    1 
ATOM   2949 C CG    . PRO C 3 285 ? 28.135  27.179  28.855  1.00 40.59  ? 285 PRO A CG    1 
ATOM   2950 C CD    . PRO C 3 285 ? 26.633  27.144  28.788  1.00 40.56  ? 285 PRO A CD    1 
ATOM   2951 N N     . ILE C 3 286 ? 27.728  31.402  30.380  1.00 40.51  ? 286 ILE A N     1 
ATOM   2952 C CA    . ILE C 3 286 ? 27.409  32.817  30.259  1.00 39.94  ? 286 ILE A CA    1 
ATOM   2953 C C     . ILE C 3 286 ? 28.667  33.553  29.855  1.00 39.88  ? 286 ILE A C     1 
ATOM   2954 O O     . ILE C 3 286 ? 29.746  33.281  30.372  1.00 39.84  ? 286 ILE A O     1 
ATOM   2955 C CB    . ILE C 3 286 ? 26.892  33.390  31.573  1.00 40.72  ? 286 ILE A CB    1 
ATOM   2956 C CG1   . ILE C 3 286 ? 25.538  32.765  31.898  1.00 42.02  ? 286 ILE A CG1   1 
ATOM   2957 C CG2   . ILE C 3 286 ? 26.779  34.906  31.466  1.00 43.16  ? 286 ILE A CG2   1 
ATOM   2958 C CD1   . ILE C 3 286 ? 24.940  33.237  33.198  1.00 45.85  ? 286 ILE A CD1   1 
ATOM   2959 N N     . LYS C 3 287 ? 28.533  34.482  28.922  1.00 41.34  ? 287 LYS A N     1 
ATOM   2960 C CA    . LYS C 3 287 ? 29.682  35.233  28.446  1.00 42.34  ? 287 LYS A CA    1 
ATOM   2961 C C     . LYS C 3 287 ? 30.091  36.358  29.387  1.00 42.50  ? 287 LYS A C     1 
ATOM   2962 O O     . LYS C 3 287 ? 29.263  37.138  29.844  1.00 41.90  ? 287 LYS A O     1 
ATOM   2963 C CB    . LYS C 3 287 ? 29.382  35.761  27.047  1.00 42.04  ? 287 LYS A CB    1 
ATOM   2964 C CG    . LYS C 3 287 ? 29.183  34.628  26.061  1.00 44.29  ? 287 LYS A CG    1 
ATOM   2965 C CD    . LYS C 3 287 ? 28.485  35.059  24.793  1.00 46.72  ? 287 LYS A CD    1 
ATOM   2966 C CE    . LYS C 3 287 ? 28.142  33.840  23.934  1.00 47.99  ? 287 LYS A CE    1 
ATOM   2967 N NZ    . LYS C 3 287 ? 27.301  34.188  22.745  1.00 49.47  ? 287 LYS A NZ    1 
ATOM   2968 N N     . LEU C 3 288 ? 31.382  36.423  29.678  1.00 44.44  ? 288 LEU A N     1 
ATOM   2969 C CA    . LEU C 3 288 ? 31.919  37.447  30.566  1.00 47.03  ? 288 LEU A CA    1 
ATOM   2970 C C     . LEU C 3 288 ? 32.972  38.298  29.861  1.00 49.68  ? 288 LEU A C     1 
ATOM   2971 O O     . LEU C 3 288 ? 33.496  37.918  28.811  1.00 48.54  ? 288 LEU A O     1 
ATOM   2972 C CB    . LEU C 3 288 ? 32.545  36.789  31.796  1.00 45.17  ? 288 LEU A CB    1 
ATOM   2973 C CG    . LEU C 3 288 ? 31.629  35.828  32.554  1.00 44.09  ? 288 LEU A CG    1 
ATOM   2974 C CD1   . LEU C 3 288 ? 32.409  35.142  33.658  1.00 43.19  ? 288 LEU A CD1   1 
ATOM   2975 C CD2   . LEU C 3 288 ? 30.440  36.588  33.112  1.00 42.41  ? 288 LEU A CD2   1 
ATOM   2976 N N     . TYR C 3 289 ? 33.267  39.455  30.448  1.00 54.33  ? 289 TYR A N     1 
ATOM   2977 C CA    . TYR C 3 289 ? 34.272  40.373  29.915  1.00 58.42  ? 289 TYR A CA    1 
ATOM   2978 C C     . TYR C 3 289 ? 35.590  40.091  30.640  1.00 59.32  ? 289 TYR A C     1 
ATOM   2979 O O     . TYR C 3 289 ? 35.760  40.460  31.801  1.00 59.16  ? 289 TYR A O     1 
ATOM   2980 C CB    . TYR C 3 289 ? 33.851  41.822  30.164  1.00 60.59  ? 289 TYR A CB    1 
ATOM   2981 C CG    . TYR C 3 289 ? 34.796  42.849  29.583  1.00 63.45  ? 289 TYR A CG    1 
ATOM   2982 C CD1   . TYR C 3 289 ? 34.714  43.217  28.241  1.00 64.26  ? 289 TYR A CD1   1 
ATOM   2983 C CD2   . TYR C 3 289 ? 35.772  43.456  30.374  1.00 64.79  ? 289 TYR A CD2   1 
ATOM   2984 C CE1   . TYR C 3 289 ? 35.577  44.167  27.699  1.00 66.11  ? 289 TYR A CE1   1 
ATOM   2985 C CE2   . TYR C 3 289 ? 36.644  44.409  29.841  1.00 66.47  ? 289 TYR A CE2   1 
ATOM   2986 C CZ    . TYR C 3 289 ? 36.538  44.760  28.502  1.00 66.63  ? 289 TYR A CZ    1 
ATOM   2987 O OH    . TYR C 3 289 ? 37.383  45.709  27.968  1.00 67.77  ? 289 TYR A OH    1 
ATOM   2988 N N     . ARG C 3 290 ? 36.512  39.435  29.943  1.00 61.37  ? 290 ARG A N     1 
ATOM   2989 C CA    . ARG C 3 290 ? 37.807  39.067  30.501  1.00 63.89  ? 290 ARG A CA    1 
ATOM   2990 C C     . ARG C 3 290 ? 38.395  39.993  31.559  1.00 64.84  ? 290 ARG A C     1 
ATOM   2991 O O     . ARG C 3 290 ? 38.743  39.544  32.651  1.00 65.05  ? 290 ARG A O     1 
ATOM   2992 C CB    . ARG C 3 290 ? 38.831  38.882  29.371  1.00 65.59  ? 290 ARG A CB    1 
ATOM   2993 C CG    . ARG C 3 290 ? 40.255  39.298  29.735  1.00 67.62  ? 290 ARG A CG    1 
ATOM   2994 C CD    . ARG C 3 290 ? 41.295  38.502  28.970  1.00 69.85  ? 290 ARG A CD    1 
ATOM   2995 N NE    . ARG C 3 290 ? 41.367  37.127  29.457  1.00 72.57  ? 290 ARG A NE    1 
ATOM   2996 C CZ    . ARG C 3 290 ? 42.273  36.235  29.067  1.00 73.80  ? 290 ARG A CZ    1 
ATOM   2997 N NH1   . ARG C 3 290 ? 43.197  36.567  28.172  1.00 73.66  ? 290 ARG A NH1   1 
ATOM   2998 N NH2   . ARG C 3 290 ? 42.262  35.010  29.580  1.00 73.42  ? 290 ARG A NH2   1 
ATOM   2999 N N     . GLU C 3 291 ? 38.496  41.279  31.246  1.00 65.42  ? 291 GLU A N     1 
ATOM   3000 C CA    . GLU C 3 291 ? 39.100  42.234  32.166  1.00 66.72  ? 291 GLU A CA    1 
ATOM   3001 C C     . GLU C 3 291 ? 38.343  42.599  33.445  1.00 66.47  ? 291 GLU A C     1 
ATOM   3002 O O     . GLU C 3 291 ? 38.878  43.312  34.296  1.00 66.56  ? 291 GLU A O     1 
ATOM   3003 C CB    . GLU C 3 291 ? 39.486  43.495  31.387  1.00 68.89  ? 291 GLU A CB    1 
ATOM   3004 C CG    . GLU C 3 291 ? 40.543  43.218  30.309  1.00 71.43  ? 291 GLU A CG    1 
ATOM   3005 C CD    . GLU C 3 291 ? 40.863  44.432  29.457  1.00 72.99  ? 291 GLU A CD    1 
ATOM   3006 O OE1   . GLU C 3 291 ? 41.238  45.477  30.029  1.00 74.95  ? 291 GLU A OE1   1 
ATOM   3007 O OE2   . GLU C 3 291 ? 40.745  44.342  28.215  1.00 72.84  ? 291 GLU A OE2   1 
ATOM   3008 N N     . THR C 3 292 ? 37.116  42.111  33.599  1.00 65.71  ? 292 THR A N     1 
ATOM   3009 C CA    . THR C 3 292 ? 36.343  42.399  34.808  1.00 64.94  ? 292 THR A CA    1 
ATOM   3010 C C     . THR C 3 292 ? 35.404  41.259  35.195  1.00 63.91  ? 292 THR A C     1 
ATOM   3011 O O     . THR C 3 292 ? 34.695  41.343  36.195  1.00 63.65  ? 292 THR A O     1 
ATOM   3012 C CB    . THR C 3 292 ? 35.505  43.685  34.655  1.00 65.65  ? 292 THR A CB    1 
ATOM   3013 O OG1   . THR C 3 292 ? 34.602  43.544  33.551  1.00 66.05  ? 292 THR A OG1   1 
ATOM   3014 C CG2   . THR C 3 292 ? 36.411  44.885  34.423  1.00 65.74  ? 292 THR A CG2   1 
ATOM   3015 N N     . ASN C 3 293 ? 35.408  40.193  34.405  1.00 62.62  ? 293 ASN A N     1 
ATOM   3016 C CA    . ASN C 3 293 ? 34.554  39.040  34.660  1.00 62.24  ? 293 ASN A CA    1 
ATOM   3017 C C     . ASN C 3 293 ? 33.093  39.440  34.794  1.00 62.31  ? 293 ASN A C     1 
ATOM   3018 O O     . ASN C 3 293 ? 32.307  38.753  35.441  1.00 62.13  ? 293 ASN A O     1 
ATOM   3019 C CB    . ASN C 3 293 ? 35.007  38.310  35.921  1.00 61.71  ? 293 ASN A CB    1 
ATOM   3020 C CG    . ASN C 3 293 ? 36.389  37.721  35.778  1.00 62.69  ? 293 ASN A CG    1 
ATOM   3021 O OD1   . ASN C 3 293 ? 36.674  37.016  34.812  1.00 64.02  ? 293 ASN A OD1   1 
ATOM   3022 N ND2   . ASN C 3 293 ? 37.258  38.001  36.741  1.00 63.33  ? 293 ASN A ND2   1 
ATOM   3023 N N     . GLU C 3 294 ? 32.739  40.558  34.174  1.00 62.63  ? 294 GLU A N     1 
ATOM   3024 C CA    . GLU C 3 294 ? 31.369  41.053  34.199  1.00 63.72  ? 294 GLU A CA    1 
ATOM   3025 C C     . GLU C 3 294 ? 30.544  40.420  33.078  1.00 62.77  ? 294 GLU A C     1 
ATOM   3026 O O     . GLU C 3 294 ? 31.013  40.279  31.948  1.00 61.51  ? 294 GLU A O     1 
ATOM   3027 C CB    . GLU C 3 294 ? 31.356  42.577  34.043  1.00 65.30  ? 294 GLU A CB    1 
ATOM   3028 C CG    . GLU C 3 294 ? 29.998  43.146  33.647  1.00 67.92  ? 294 GLU A CG    1 
ATOM   3029 C CD    . GLU C 3 294 ? 30.040  44.638  33.347  1.00 69.47  ? 294 GLU A CD    1 
ATOM   3030 O OE1   . GLU C 3 294 ? 30.908  45.066  32.555  1.00 68.62  ? 294 GLU A OE1   1 
ATOM   3031 O OE2   . GLU C 3 294 ? 29.195  45.380  33.894  1.00 70.46  ? 294 GLU A OE2   1 
ATOM   3032 N N     . PRO C 3 295 ? 29.303  40.019  33.383  1.00 62.41  ? 295 PRO A N     1 
ATOM   3033 C CA    . PRO C 3 295 ? 28.428  39.407  32.381  1.00 62.72  ? 295 PRO A CA    1 
ATOM   3034 C C     . PRO C 3 295 ? 28.211  40.355  31.207  1.00 63.06  ? 295 PRO A C     1 
ATOM   3035 O O     . PRO C 3 295 ? 28.164  41.573  31.380  1.00 62.26  ? 295 PRO A O     1 
ATOM   3036 C CB    . PRO C 3 295 ? 27.144  39.149  33.159  1.00 62.43  ? 295 PRO A CB    1 
ATOM   3037 C CG    . PRO C 3 295 ? 27.649  38.876  34.529  1.00 62.58  ? 295 PRO A CG    1 
ATOM   3038 C CD    . PRO C 3 295 ? 28.693  39.948  34.720  1.00 61.98  ? 295 PRO A CD    1 
ATOM   3039 N N     . VAL C 3 296 ? 28.068  39.792  30.014  1.00 64.05  ? 296 VAL A N     1 
ATOM   3040 C CA    . VAL C 3 296 ? 27.879  40.606  28.828  1.00 65.51  ? 296 VAL A CA    1 
ATOM   3041 C C     . VAL C 3 296 ? 26.543  40.359  28.133  1.00 67.01  ? 296 VAL A C     1 
ATOM   3042 O O     . VAL C 3 296 ? 26.049  39.229  28.085  1.00 67.40  ? 296 VAL A O     1 
ATOM   3043 C CB    . VAL C 3 296 ? 29.024  40.363  27.827  1.00 65.44  ? 296 VAL A CB    1 
ATOM   3044 C CG1   . VAL C 3 296 ? 28.858  41.251  26.612  1.00 65.40  ? 296 VAL A CG1   1 
ATOM   3045 C CG2   . VAL C 3 296 ? 30.357  40.635  28.498  1.00 65.43  ? 296 VAL A CG2   1 
ATOM   3046 N N     . LYS C 3 297 ? 25.965  41.438  27.610  1.00 68.25  ? 297 LYS A N     1 
ATOM   3047 C CA    . LYS C 3 297 ? 24.696  41.402  26.885  1.00 69.59  ? 297 LYS A CA    1 
ATOM   3048 C C     . LYS C 3 297 ? 24.991  40.987  25.446  1.00 69.28  ? 297 LYS A C     1 
ATOM   3049 O O     . LYS C 3 297 ? 26.083  41.235  24.938  1.00 69.08  ? 297 LYS A O     1 
ATOM   3050 C CB    . LYS C 3 297 ? 24.047  42.794  26.902  1.00 71.53  ? 297 LYS A CB    1 
ATOM   3051 C CG    . LYS C 3 297 ? 22.827  42.962  25.989  1.00 73.27  ? 297 LYS A CG    1 
ATOM   3052 C CD    . LYS C 3 297 ? 21.620  42.180  26.490  1.00 74.88  ? 297 LYS A CD    1 
ATOM   3053 C CE    . LYS C 3 297 ? 20.410  42.391  25.587  1.00 74.99  ? 297 LYS A CE    1 
ATOM   3054 N NZ    . LYS C 3 297 ? 19.199  41.699  26.118  1.00 75.86  ? 297 LYS A NZ    1 
ATOM   3055 N N     . THR C 3 298 ? 24.023  40.366  24.784  1.00 69.41  ? 298 THR A N     1 
ATOM   3056 C CA    . THR C 3 298 ? 24.241  39.932  23.414  1.00 69.94  ? 298 THR A CA    1 
ATOM   3057 C C     . THR C 3 298 ? 23.082  40.264  22.479  1.00 70.34  ? 298 THR A C     1 
ATOM   3058 O O     . THR C 3 298 ? 21.952  39.816  22.687  1.00 69.73  ? 298 THR A O     1 
ATOM   3059 C CB    . THR C 3 298 ? 24.499  38.421  23.359  1.00 69.71  ? 298 THR A CB    1 
ATOM   3060 O OG1   . THR C 3 298 ? 25.511  38.077  24.314  1.00 70.35  ? 298 THR A OG1   1 
ATOM   3061 C CG2   . THR C 3 298 ? 24.970  38.017  21.974  1.00 69.41  ? 298 THR A CG2   1 
ATOM   3062 N N     . LYS C 3 299 ? 23.378  41.053  21.448  1.00 70.57  ? 299 LYS A N     1 
ATOM   3063 C CA    . LYS C 3 299 ? 22.375  41.446  20.464  1.00 70.27  ? 299 LYS A CA    1 
ATOM   3064 C C     . LYS C 3 299 ? 22.629  40.754  19.135  1.00 69.90  ? 299 LYS A C     1 
ATOM   3065 O O     . LYS C 3 299 ? 23.708  40.875  18.559  1.00 69.07  ? 299 LYS A O     1 
ATOM   3066 C CB    . LYS C 3 299 ? 22.384  42.963  20.253  1.00 70.17  ? 299 LYS A CB    1 
ATOM   3067 C CG    . LYS C 3 299 ? 21.863  43.759  21.436  1.00 70.55  ? 299 LYS A CG    1 
ATOM   3068 C CD    . LYS C 3 299 ? 21.759  45.241  21.115  1.00 69.62  ? 299 LYS A CD    1 
ATOM   3069 C CE    . LYS C 3 299 ? 21.254  46.016  22.324  1.00 69.71  ? 299 LYS A CE    1 
ATOM   3070 N NZ    . LYS C 3 299 ? 21.078  47.469  22.048  1.00 68.90  ? 299 LYS A NZ    1 
ATOM   3071 N N     . THR C 3 300 ? 21.625  40.024  18.659  1.00 70.62  ? 300 THR A N     1 
ATOM   3072 C CA    . THR C 3 300 ? 21.724  39.314  17.391  1.00 70.58  ? 300 THR A CA    1 
ATOM   3073 C C     . THR C 3 300 ? 20.848  39.995  16.345  1.00 70.33  ? 300 THR A C     1 
ATOM   3074 O O     . THR C 3 300 ? 19.618  39.961  16.425  1.00 70.16  ? 300 THR A O     1 
ATOM   3075 C CB    . THR C 3 300 ? 21.278  37.849  17.532  1.00 71.00  ? 300 THR A CB    1 
ATOM   3076 O OG1   . THR C 3 300 ? 22.046  37.214  18.560  1.00 72.83  ? 300 THR A OG1   1 
ATOM   3077 C CG2   . THR C 3 300 ? 21.491  37.100  16.220  1.00 71.19  ? 300 THR A CG2   1 
ATOM   3078 N N     . ARG C 3 301 ? 21.495  40.620  15.367  1.00 69.93  ? 301 ARG A N     1 
ATOM   3079 C CA    . ARG C 3 301 ? 20.785  41.311  14.300  1.00 68.93  ? 301 ARG A CA    1 
ATOM   3080 C C     . ARG C 3 301 ? 20.943  40.578  12.979  1.00 66.80  ? 301 ARG A C     1 
ATOM   3081 O O     . ARG C 3 301 ? 21.796  39.702  12.835  1.00 65.91  ? 301 ARG A O     1 
ATOM   3082 C CB    . ARG C 3 301 ? 21.309  42.741  14.162  1.00 70.11  ? 301 ARG A CB    1 
ATOM   3083 C CG    . ARG C 3 301 ? 20.951  43.647  15.331  1.00 72.23  ? 301 ARG A CG    1 
ATOM   3084 C CD    . ARG C 3 301 ? 21.581  45.023  15.163  1.00 74.84  ? 301 ARG A CD    1 
ATOM   3085 N NE    . ARG C 3 301 ? 21.018  46.016  16.077  1.00 75.50  ? 301 ARG A NE    1 
ATOM   3086 C CZ    . ARG C 3 301 ? 21.373  47.298  16.093  1.00 76.31  ? 301 ARG A CZ    1 
ATOM   3087 N NH1   . ARG C 3 301 ? 22.292  47.746  15.246  1.00 76.40  ? 301 ARG A NH1   1 
ATOM   3088 N NH2   . ARG C 3 301 ? 20.808  48.136  16.951  1.00 76.72  ? 301 ARG A NH2   1 
ATOM   3089 N N     . THR C 3 302 ? 20.105  40.936  12.016  1.00 64.99  ? 302 THR A N     1 
ATOM   3090 C CA    . THR C 3 302 ? 20.156  40.322  10.700  1.00 64.35  ? 302 THR A CA    1 
ATOM   3091 C C     . THR C 3 302 ? 20.203  41.426  9.657   1.00 63.98  ? 302 THR A C     1 
ATOM   3092 O O     . THR C 3 302 ? 19.391  42.351  9.685   1.00 64.41  ? 302 THR A O     1 
ATOM   3093 C CB    . THR C 3 302 ? 18.924  39.439  10.453  1.00 64.24  ? 302 THR A CB    1 
ATOM   3094 O OG1   . THR C 3 302 ? 18.902  38.374  11.409  1.00 64.00  ? 302 THR A OG1   1 
ATOM   3095 C CG2   . THR C 3 302 ? 18.964  38.851  9.051   1.00 64.87  ? 302 THR A CG2   1 
ATOM   3096 N N     . PHE C 3 303 ? 21.151  41.336  8.734   1.00 63.74  ? 303 PHE A N     1 
ATOM   3097 C CA    . PHE C 3 303 ? 21.275  42.368  7.720   1.00 64.11  ? 303 PHE A CA    1 
ATOM   3098 C C     . PHE C 3 303 ? 21.495  41.860  6.304   1.00 62.90  ? 303 PHE A C     1 
ATOM   3099 O O     . PHE C 3 303 ? 22.069  40.791  6.086   1.00 62.50  ? 303 PHE A O     1 
ATOM   3100 C CB    . PHE C 3 303 ? 22.405  43.329  8.101   1.00 66.00  ? 303 PHE A CB    1 
ATOM   3101 C CG    . PHE C 3 303 ? 23.751  42.671  8.226   1.00 68.68  ? 303 PHE A CG    1 
ATOM   3102 C CD1   . PHE C 3 303 ? 24.392  42.141  7.108   1.00 69.15  ? 303 PHE A CD1   1 
ATOM   3103 C CD2   . PHE C 3 303 ? 24.385  42.591  9.462   1.00 70.08  ? 303 PHE A CD2   1 
ATOM   3104 C CE1   . PHE C 3 303 ? 25.644  41.542  7.215   1.00 70.51  ? 303 PHE A CE1   1 
ATOM   3105 C CE2   . PHE C 3 303 ? 25.640  41.994  9.583   1.00 71.36  ? 303 PHE A CE2   1 
ATOM   3106 C CZ    . PHE C 3 303 ? 26.270  41.469  8.455   1.00 71.43  ? 303 PHE A CZ    1 
ATOM   3107 N N     . ASN C 3 304 ? 21.021  42.647  5.345   1.00 61.26  ? 304 ASN A N     1 
ATOM   3108 C CA    . ASN C 3 304 ? 21.168  42.330  3.935   1.00 59.20  ? 304 ASN A CA    1 
ATOM   3109 C C     . ASN C 3 304 ? 22.669  42.272  3.695   1.00 57.86  ? 304 ASN A C     1 
ATOM   3110 O O     . ASN C 3 304 ? 23.404  43.142  4.152   1.00 56.87  ? 304 ASN A O     1 
ATOM   3111 C CB    . ASN C 3 304 ? 20.530  43.439  3.095   1.00 59.53  ? 304 ASN A CB    1 
ATOM   3112 C CG    . ASN C 3 304 ? 20.568  43.148  1.615   1.00 61.29  ? 304 ASN A CG    1 
ATOM   3113 O OD1   . ASN C 3 304 ? 21.631  42.920  1.042   1.00 61.55  ? 304 ASN A OD1   1 
ATOM   3114 N ND2   . ASN C 3 304 ? 19.401  43.162  0.981   1.00 63.10  ? 304 ASN A ND2   1 
ATOM   3115 N N     . THR C 3 305 ? 23.128  41.244  2.993   1.00 58.06  ? 305 THR A N     1 
ATOM   3116 C CA    . THR C 3 305 ? 24.554  41.093  2.722   1.00 58.30  ? 305 THR A CA    1 
ATOM   3117 C C     . THR C 3 305 ? 25.117  42.185  1.815   1.00 58.18  ? 305 THR A C     1 
ATOM   3118 O O     . THR C 3 305 ? 26.200  42.713  2.069   1.00 58.18  ? 305 THR A O     1 
ATOM   3119 C CB    . THR C 3 305 ? 24.861  39.718  2.087   1.00 59.02  ? 305 THR A CB    1 
ATOM   3120 O OG1   . THR C 3 305 ? 24.545  38.675  3.020   1.00 59.65  ? 305 THR A OG1   1 
ATOM   3121 C CG2   . THR C 3 305 ? 26.335  39.619  1.719   1.00 60.64  ? 305 THR A CG2   1 
ATOM   3122 N N     . SER C 3 306 ? 24.381  42.528  0.762   1.00 58.13  ? 306 SER A N     1 
ATOM   3123 C CA    . SER C 3 306 ? 24.830  43.551  -0.177  1.00 57.94  ? 306 SER A CA    1 
ATOM   3124 C C     . SER C 3 306 ? 24.915  44.959  0.421   1.00 57.33  ? 306 SER A C     1 
ATOM   3125 O O     . SER C 3 306 ? 26.004  45.531  0.512   1.00 58.15  ? 306 SER A O     1 
ATOM   3126 C CB    . SER C 3 306 ? 23.921  43.566  -1.415  1.00 59.15  ? 306 SER A CB    1 
ATOM   3127 O OG    . SER C 3 306 ? 22.572  43.851  -1.079  1.00 60.39  ? 306 SER A OG    1 
ATOM   3128 N N     . THR C 3 307 ? 23.773  45.509  0.832   1.00 56.24  ? 307 THR A N     1 
ATOM   3129 C CA    . THR C 3 307 ? 23.719  46.857  1.399   1.00 54.32  ? 307 THR A CA    1 
ATOM   3130 C C     . THR C 3 307 ? 24.189  46.959  2.850   1.00 53.88  ? 307 THR A C     1 
ATOM   3131 O O     . THR C 3 307 ? 24.709  47.993  3.266   1.00 53.25  ? 307 THR A O     1 
ATOM   3132 C CB    . THR C 3 307 ? 22.290  47.437  1.334   1.00 54.08  ? 307 THR A CB    1 
ATOM   3133 O OG1   . THR C 3 307 ? 21.445  46.732  2.247   1.00 54.66  ? 307 THR A OG1   1 
ATOM   3134 C CG2   . THR C 3 307 ? 21.719  47.305  -0.070  1.00 53.57  ? 307 THR A CG2   1 
ATOM   3135 N N     . GLY C 3 308 ? 24.003  45.891  3.619   1.00 53.57  ? 308 GLY A N     1 
ATOM   3136 C CA    . GLY C 3 308 ? 24.407  45.910  5.014   1.00 51.36  ? 308 GLY A CA    1 
ATOM   3137 C C     . GLY C 3 308 ? 23.293  46.460  5.883   1.00 51.21  ? 308 GLY A C     1 
ATOM   3138 O O     . GLY C 3 308 ? 23.456  46.626  7.091   1.00 51.25  ? 308 GLY A O     1 
ATOM   3139 N N     . GLY C 3 309 ? 22.151  46.739  5.263   1.00 50.87  ? 309 GLY A N     1 
ATOM   3140 C CA    . GLY C 3 309 ? 21.022  47.277  5.996   1.00 52.56  ? 309 GLY A CA    1 
ATOM   3141 C C     . GLY C 3 309 ? 20.367  46.291  6.945   1.00 53.92  ? 309 GLY A C     1 
ATOM   3142 O O     . GLY C 3 309 ? 20.340  45.087  6.686   1.00 53.34  ? 309 GLY A O     1 
ATOM   3143 N N     . LEU C 3 310 ? 19.843  46.807  8.053   1.00 55.64  ? 310 LEU A N     1 
ATOM   3144 C CA    . LEU C 3 310 ? 19.168  45.983  9.049   1.00 57.06  ? 310 LEU A CA    1 
ATOM   3145 C C     . LEU C 3 310 ? 17.923  45.387  8.401   1.00 58.06  ? 310 LEU A C     1 
ATOM   3146 O O     . LEU C 3 310 ? 17.220  46.069  7.655   1.00 58.11  ? 310 LEU A O     1 
ATOM   3147 C CB    . LEU C 3 310 ? 18.774  46.835  10.262  1.00 58.11  ? 310 LEU A CB    1 
ATOM   3148 C CG    . LEU C 3 310 ? 17.911  46.191  11.355  1.00 59.41  ? 310 LEU A CG    1 
ATOM   3149 C CD1   . LEU C 3 310 ? 18.618  44.975  11.939  1.00 60.21  ? 310 LEU A CD1   1 
ATOM   3150 C CD2   . LEU C 3 310 ? 17.624  47.216  12.444  1.00 60.27  ? 310 LEU A CD2   1 
ATOM   3151 N N     . LEU C 3 311 ? 17.652  44.117  8.686   1.00 58.25  ? 311 LEU A N     1 
ATOM   3152 C CA    . LEU C 3 311 ? 16.502  43.438  8.105   1.00 58.61  ? 311 LEU A CA    1 
ATOM   3153 C C     . LEU C 3 311 ? 15.307  43.288  9.028   1.00 59.82  ? 311 LEU A C     1 
ATOM   3154 O O     . LEU C 3 311 ? 15.349  42.520  9.988   1.00 61.00  ? 311 LEU A O     1 
ATOM   3155 C CB    . LEU C 3 311 ? 16.918  42.058  7.613   1.00 57.20  ? 311 LEU A CB    1 
ATOM   3156 C CG    . LEU C 3 311 ? 17.535  42.028  6.223   1.00 56.15  ? 311 LEU A CG    1 
ATOM   3157 C CD1   . LEU C 3 311 ? 18.235  40.700  6.004   1.00 55.60  ? 311 LEU A CD1   1 
ATOM   3158 C CD2   . LEU C 3 311 ? 16.444  42.259  5.193   1.00 55.65  ? 311 LEU A CD2   1 
ATOM   3159 N N     . LEU C 3 312 ? 14.235  44.014  8.730   1.00 60.76  ? 312 LEU A N     1 
ATOM   3160 C CA    . LEU C 3 312 ? 13.025  43.920  9.537   1.00 62.91  ? 312 LEU A CA    1 
ATOM   3161 C C     . LEU C 3 312 ? 12.443  42.518  9.374   1.00 64.42  ? 312 LEU A C     1 
ATOM   3162 O O     . LEU C 3 312 ? 12.727  41.829  8.390   1.00 64.80  ? 312 LEU A O     1 
ATOM   3163 C CB    . LEU C 3 312 ? 11.989  44.950  9.081   1.00 61.60  ? 312 LEU A CB    1 
ATOM   3164 C CG    . LEU C 3 312 ? 12.301  46.421  9.335   1.00 61.65  ? 312 LEU A CG    1 
ATOM   3165 C CD1   . LEU C 3 312 ? 11.184  47.278  8.753   1.00 60.93  ? 312 LEU A CD1   1 
ATOM   3166 C CD2   . LEU C 3 312 ? 12.450  46.660  10.831  1.00 60.46  ? 312 LEU A CD2   1 
ATOM   3167 N N     . PRO C 3 313 ? 11.625  42.070  10.339  1.00 65.38  ? 313 PRO A N     1 
ATOM   3168 C CA    . PRO C 3 313 ? 11.047  40.731  10.206  1.00 65.74  ? 313 PRO A CA    1 
ATOM   3169 C C     . PRO C 3 313 ? 10.180  40.642  8.946   1.00 65.69  ? 313 PRO A C     1 
ATOM   3170 O O     . PRO C 3 313 ? 9.984   39.561  8.390   1.00 66.38  ? 313 PRO A O     1 
ATOM   3171 C CB    . PRO C 3 313 ? 10.240  40.574  11.496  1.00 65.71  ? 313 PRO A CB    1 
ATOM   3172 C CG    . PRO C 3 313 ? 9.839   41.987  11.818  1.00 65.88  ? 313 PRO A CG    1 
ATOM   3173 C CD    . PRO C 3 313 ? 11.113  42.750  11.542  1.00 65.61  ? 313 PRO A CD    1 
ATOM   3174 N N     . SER C 3 314 ? 9.680   41.791  8.497   1.00 65.38  ? 314 SER A N     1 
ATOM   3175 C CA    . SER C 3 314 ? 8.837   41.858  7.307   1.00 64.83  ? 314 SER A CA    1 
ATOM   3176 C C     . SER C 3 314 ? 9.656   42.052  6.031   1.00 64.22  ? 314 SER A C     1 
ATOM   3177 O O     . SER C 3 314 ? 9.110   42.388  4.979   1.00 64.14  ? 314 SER A O     1 
ATOM   3178 C CB    . SER C 3 314 ? 7.826   43.001  7.441   1.00 65.69  ? 314 SER A CB    1 
ATOM   3179 O OG    . SER C 3 314 ? 8.479   44.258  7.518   1.00 67.42  ? 314 SER A OG    1 
ATOM   3180 N N     . ASP C 3 315 ? 10.966  41.850  6.129   1.00 63.71  ? 315 ASP A N     1 
ATOM   3181 C CA    . ASP C 3 315 ? 11.848  41.989  4.973   1.00 62.74  ? 315 ASP A CA    1 
ATOM   3182 C C     . ASP C 3 315 ? 12.452  40.640  4.609   1.00 60.54  ? 315 ASP A C     1 
ATOM   3183 O O     . ASP C 3 315 ? 13.333  40.544  3.751   1.00 60.87  ? 315 ASP A O     1 
ATOM   3184 C CB    . ASP C 3 315 ? 12.970  42.991  5.261   1.00 64.93  ? 315 ASP A CB    1 
ATOM   3185 C CG    . ASP C 3 315 ? 12.495  44.431  5.202   1.00 67.43  ? 315 ASP A CG    1 
ATOM   3186 O OD1   . ASP C 3 315 ? 11.899  44.815  4.169   1.00 66.59  ? 315 ASP A OD1   1 
ATOM   3187 O OD2   . ASP C 3 315 ? 12.722  45.176  6.183   1.00 68.75  ? 315 ASP A OD2   1 
ATOM   3188 N N     . THR C 3 316 ? 11.965  39.597  5.268   1.00 57.15  ? 316 THR A N     1 
ATOM   3189 C CA    . THR C 3 316 ? 12.453  38.254  5.026   1.00 53.82  ? 316 THR A CA    1 
ATOM   3190 C C     . THR C 3 316 ? 11.275  37.288  5.007   1.00 51.21  ? 316 THR A C     1 
ATOM   3191 O O     . THR C 3 316 ? 10.260  37.521  5.662   1.00 51.92  ? 316 THR A O     1 
ATOM   3192 C CB    . THR C 3 316 ? 13.451  37.836  6.125   1.00 53.50  ? 316 THR A CB    1 
ATOM   3193 O OG1   . THR C 3 316 ? 14.211  36.712  5.679   1.00 54.96  ? 316 THR A OG1   1 
ATOM   3194 C CG2   . THR C 3 316 ? 12.717  37.464  7.401   1.00 53.68  ? 316 THR A CG2   1 
ATOM   3195 N N     . LYS C 3 317 ? 11.406  36.212  4.239   1.00 47.80  ? 317 LYS A N     1 
ATOM   3196 C CA    . LYS C 3 317 ? 10.354  35.206  4.142   1.00 44.14  ? 317 LYS A CA    1 
ATOM   3197 C C     . LYS C 3 317 ? 10.918  33.819  4.443   1.00 41.62  ? 317 LYS A C     1 
ATOM   3198 O O     . LYS C 3 317 ? 12.131  33.645  4.579   1.00 40.89  ? 317 LYS A O     1 
ATOM   3199 C CB    . LYS C 3 317 ? 9.710   35.240  2.748   1.00 43.96  ? 317 LYS A CB    1 
ATOM   3200 C CG    . LYS C 3 317 ? 8.962   36.542  2.446   1.00 43.99  ? 317 LYS A CG    1 
ATOM   3201 C CD    . LYS C 3 317 ? 8.248   36.517  1.103   1.00 41.98  ? 317 LYS A CD    1 
ATOM   3202 C CE    . LYS C 3 317 ? 7.448   37.798  0.882   1.00 43.18  ? 317 LYS A CE    1 
ATOM   3203 N NZ    . LYS C 3 317 ? 6.525   37.717  -0.294  1.00 40.51  ? 317 LYS A NZ    1 
ATOM   3204 N N     . ARG C 3 318 ? 10.034  32.833  4.550   1.00 40.06  ? 318 ARG A N     1 
ATOM   3205 C CA    . ARG C 3 318 ? 10.453  31.472  4.854   1.00 37.24  ? 318 ARG A CA    1 
ATOM   3206 C C     . ARG C 3 318 ? 10.428  30.559  3.636   1.00 35.86  ? 318 ARG A C     1 
ATOM   3207 O O     . ARG C 3 318 ? 9.475   30.564  2.853   1.00 34.73  ? 318 ARG A O     1 
ATOM   3208 C CB    . ARG C 3 318 ? 9.579   30.918  5.974   1.00 37.60  ? 318 ARG A CB    1 
ATOM   3209 C CG    . ARG C 3 318 ? 9.688   31.733  7.260   1.00 39.66  ? 318 ARG A CG    1 
ATOM   3210 C CD    . ARG C 3 318 ? 11.121  31.739  7.785   1.00 41.43  ? 318 ARG A CD    1 
ATOM   3211 N NE    . ARG C 3 318 ? 11.285  32.631  8.931   1.00 44.65  ? 318 ARG A NE    1 
ATOM   3212 C CZ    . ARG C 3 318 ? 11.253  33.961  8.862   1.00 45.91  ? 318 ARG A CZ    1 
ATOM   3213 N NH1   . ARG C 3 318 ? 11.065  34.568  7.694   1.00 45.24  ? 318 ARG A NH1   1 
ATOM   3214 N NH2   . ARG C 3 318 ? 11.400  34.687  9.964   1.00 45.28  ? 318 ARG A NH2   1 
ATOM   3215 N N     . SER C 3 319 ? 11.487  29.770  3.489   1.00 34.76  ? 319 SER A N     1 
ATOM   3216 C CA    . SER C 3 319 ? 11.617  28.871  2.352   1.00 36.12  ? 319 SER A CA    1 
ATOM   3217 C C     . SER C 3 319 ? 11.930  27.419  2.704   1.00 36.19  ? 319 SER A C     1 
ATOM   3218 O O     . SER C 3 319 ? 12.585  27.131  3.707   1.00 36.33  ? 319 SER A O     1 
ATOM   3219 C CB    . SER C 3 319 ? 12.706  29.401  1.405   1.00 35.29  ? 319 SER A CB    1 
ATOM   3220 O OG    . SER C 3 319 ? 13.177  28.385  0.527   1.00 33.83  ? 319 SER A OG    1 
ATOM   3221 N N     . GLN C 3 320 ? 11.453  26.516  1.851   1.00 36.02  ? 320 GLN A N     1 
ATOM   3222 C CA    . GLN C 3 320 ? 11.675  25.080  1.993   1.00 35.72  ? 320 GLN A CA    1 
ATOM   3223 C C     . GLN C 3 320 ? 11.809  24.541  0.563   1.00 35.12  ? 320 GLN A C     1 
ATOM   3224 O O     . GLN C 3 320 ? 10.955  24.800  -0.282  1.00 33.98  ? 320 GLN A O     1 
ATOM   3225 C CB    . GLN C 3 320 ? 10.495  24.429  2.723   1.00 35.17  ? 320 GLN A CB    1 
ATOM   3226 C CG    . GLN C 3 320 ? 10.903  23.584  3.915   1.00 36.58  ? 320 GLN A CG    1 
ATOM   3227 C CD    . GLN C 3 320 ? 9.728   23.181  4.792   1.00 36.32  ? 320 GLN A CD    1 
ATOM   3228 O OE1   . GLN C 3 320 ? 8.717   22.671  4.309   1.00 35.78  ? 320 GLN A OE1   1 
ATOM   3229 N NE2   . GLN C 3 320 ? 9.862   23.406  6.088   1.00 36.73  ? 320 GLN A NE2   1 
ATOM   3230 N N     . ILE C 3 321 ? 12.890  23.811  0.297   1.00 35.50  ? 321 ILE A N     1 
ATOM   3231 C CA    . ILE C 3 321 ? 13.165  23.267  -1.033  1.00 35.60  ? 321 ILE A CA    1 
ATOM   3232 C C     . ILE C 3 321 ? 13.005  21.751  -1.187  1.00 35.90  ? 321 ILE A C     1 
ATOM   3233 O O     . ILE C 3 321 ? 13.715  20.970  -0.550  1.00 34.64  ? 321 ILE A O     1 
ATOM   3234 C CB    . ILE C 3 321 ? 14.596  23.656  -1.471  1.00 36.67  ? 321 ILE A CB    1 
ATOM   3235 C CG1   . ILE C 3 321 ? 14.618  25.130  -1.872  1.00 37.97  ? 321 ILE A CG1   1 
ATOM   3236 C CG2   . ILE C 3 321 ? 15.081  22.756  -2.601  1.00 36.09  ? 321 ILE A CG2   1 
ATOM   3237 C CD1   . ILE C 3 321 ? 16.007  25.669  -2.146  1.00 37.12  ? 321 ILE A CD1   1 
ATOM   3238 N N     . TYR C 3 322 ? 12.081  21.345  -2.055  1.00 36.05  ? 322 TYR A N     1 
ATOM   3239 C CA    . TYR C 3 322 ? 11.843  19.925  -2.308  1.00 38.09  ? 322 TYR A CA    1 
ATOM   3240 C C     . TYR C 3 322 ? 12.169  19.585  -3.752  1.00 40.72  ? 322 TYR A C     1 
ATOM   3241 O O     . TYR C 3 322 ? 11.602  20.159  -4.679  1.00 40.73  ? 322 TYR A O     1 
ATOM   3242 C CB    . TYR C 3 322 ? 10.390  19.549  -2.022  1.00 34.98  ? 322 TYR A CB    1 
ATOM   3243 C CG    . TYR C 3 322 ? 9.997   19.747  -0.585  1.00 32.75  ? 322 TYR A CG    1 
ATOM   3244 C CD1   . TYR C 3 322 ? 9.420   20.940  -0.161  1.00 31.07  ? 322 TYR A CD1   1 
ATOM   3245 C CD2   . TYR C 3 322 ? 10.234  18.753  0.362   1.00 31.27  ? 322 TYR A CD2   1 
ATOM   3246 C CE1   . TYR C 3 322 ? 9.089   21.136  1.167   1.00 32.06  ? 322 TYR A CE1   1 
ATOM   3247 C CE2   . TYR C 3 322 ? 9.909   18.942  1.694   1.00 29.50  ? 322 TYR A CE2   1 
ATOM   3248 C CZ    . TYR C 3 322 ? 9.338   20.134  2.089   1.00 30.33  ? 322 TYR A CZ    1 
ATOM   3249 O OH    . TYR C 3 322 ? 9.020   20.332  3.409   1.00 32.61  ? 322 TYR A OH    1 
ATOM   3250 N N     . GLY C 3 323 ? 13.079  18.637  -3.937  1.00 43.34  ? 323 GLY A N     1 
ATOM   3251 C CA    . GLY C 3 323 ? 13.467  18.265  -5.281  1.00 45.96  ? 323 GLY A CA    1 
ATOM   3252 C C     . GLY C 3 323 ? 14.197  19.443  -5.891  1.00 48.35  ? 323 GLY A C     1 
ATOM   3253 O O     . GLY C 3 323 ? 15.352  19.717  -5.548  1.00 48.96  ? 323 GLY A O     1 
ATOM   3254 N N     . SER C 3 324 ? 13.519  20.154  -6.783  1.00 48.63  ? 324 SER A N     1 
ATOM   3255 C CA    . SER C 3 324 ? 14.110  21.312  -7.435  1.00 49.99  ? 324 SER A CA    1 
ATOM   3256 C C     . SER C 3 324 ? 13.070  22.421  -7.440  1.00 49.45  ? 324 SER A C     1 
ATOM   3257 O O     . SER C 3 324 ? 13.021  23.246  -8.351  1.00 49.81  ? 324 SER A O     1 
ATOM   3258 C CB    . SER C 3 324 ? 14.505  20.959  -8.871  1.00 51.83  ? 324 SER A CB    1 
ATOM   3259 O OG    . SER C 3 324 ? 13.370  20.545  -9.614  1.00 54.24  ? 324 SER A OG    1 
ATOM   3260 N N     . ARG C 3 325 ? 12.237  22.434  -6.409  1.00 48.50  ? 325 ARG A N     1 
ATOM   3261 C CA    . ARG C 3 325 ? 11.187  23.430  -6.310  1.00 47.45  ? 325 ARG A CA    1 
ATOM   3262 C C     . ARG C 3 325 ? 11.173  24.137  -4.960  1.00 46.99  ? 325 ARG A C     1 
ATOM   3263 O O     . ARG C 3 325 ? 11.323  23.514  -3.906  1.00 48.34  ? 325 ARG A O     1 
ATOM   3264 C CB    . ARG C 3 325 ? 9.848   22.763  -6.574  1.00 47.01  ? 325 ARG A CB    1 
ATOM   3265 C CG    . ARG C 3 325 ? 8.711   23.717  -6.714  1.00 48.87  ? 325 ARG A CG    1 
ATOM   3266 C CD    . ARG C 3 325 ? 7.612   23.067  -7.508  1.00 50.12  ? 325 ARG A CD    1 
ATOM   3267 N NE    . ARG C 3 325 ? 6.474   23.955  -7.677  1.00 52.03  ? 325 ARG A NE    1 
ATOM   3268 C CZ    . ARG C 3 325 ? 5.438   23.681  -8.458  1.00 54.82  ? 325 ARG A CZ    1 
ATOM   3269 N NH1   . ARG C 3 325 ? 5.405   22.547  -9.145  1.00 55.77  ? 325 ARG A NH1   1 
ATOM   3270 N NH2   . ARG C 3 325 ? 4.428   24.533  -8.542  1.00 57.56  ? 325 ARG A NH2   1 
ATOM   3271 N N     . GLN C 3 326 ? 10.989  25.450  -4.997  1.00 46.81  ? 326 GLN A N     1 
ATOM   3272 C CA    . GLN C 3 326 ? 10.966  26.240  -3.779  1.00 44.40  ? 326 GLN A CA    1 
ATOM   3273 C C     . GLN C 3 326 ? 9.541   26.593  -3.400  1.00 43.17  ? 326 GLN A C     1 
ATOM   3274 O O     . GLN C 3 326 ? 8.735   26.964  -4.254  1.00 43.70  ? 326 GLN A O     1 
ATOM   3275 C CB    . GLN C 3 326 ? 11.785  27.522  -3.969  1.00 45.55  ? 326 GLN A CB    1 
ATOM   3276 C CG    . GLN C 3 326 ? 12.072  28.277  -2.680  1.00 47.00  ? 326 GLN A CG    1 
ATOM   3277 C CD    . GLN C 3 326 ? 12.981  29.481  -2.886  1.00 46.34  ? 326 GLN A CD    1 
ATOM   3278 O OE1   . GLN C 3 326 ? 12.604  30.449  -3.542  1.00 47.04  ? 326 GLN A OE1   1 
ATOM   3279 N NE2   . GLN C 3 326 ? 14.182  29.423  -2.323  1.00 44.52  ? 326 GLN A NE2   1 
ATOM   3280 N N     . ILE C 3 327 ? 9.230   26.446  -2.116  1.00 41.43  ? 327 ILE A N     1 
ATOM   3281 C CA    . ILE C 3 327 ? 7.912   26.778  -1.589  1.00 38.80  ? 327 ILE A CA    1 
ATOM   3282 C C     . ILE C 3 327 ? 8.150   27.891  -0.579  1.00 37.14  ? 327 ILE A C     1 
ATOM   3283 O O     . ILE C 3 327 ? 8.854   27.704  0.409   1.00 37.63  ? 327 ILE A O     1 
ATOM   3284 C CB    . ILE C 3 327 ? 7.253   25.572  -0.886  1.00 37.21  ? 327 ILE A CB    1 
ATOM   3285 C CG1   . ILE C 3 327 ? 7.033   24.445  -1.892  1.00 35.05  ? 327 ILE A CG1   1 
ATOM   3286 C CG2   . ILE C 3 327 ? 5.904   25.982  -0.290  1.00 35.77  ? 327 ILE A CG2   1 
ATOM   3287 C CD1   . ILE C 3 327 ? 6.431   23.185  -1.279  1.00 34.53  ? 327 ILE A CD1   1 
ATOM   3288 N N     . ILE C 3 328 ? 7.565   29.052  -0.838  1.00 37.06  ? 328 ILE A N     1 
ATOM   3289 C CA    . ILE C 3 328 ? 7.742   30.211  0.028   1.00 36.05  ? 328 ILE A CA    1 
ATOM   3290 C C     . ILE C 3 328 ? 6.514   30.533  0.860   1.00 35.83  ? 328 ILE A C     1 
ATOM   3291 O O     . ILE C 3 328 ? 5.393   30.576  0.348   1.00 36.29  ? 328 ILE A O     1 
ATOM   3292 C CB    . ILE C 3 328 ? 8.099   31.471  -0.803  1.00 34.96  ? 328 ILE A CB    1 
ATOM   3293 C CG1   . ILE C 3 328 ? 9.371   31.219  -1.610  1.00 34.12  ? 328 ILE A CG1   1 
ATOM   3294 C CG2   . ILE C 3 328 ? 8.275   32.676  0.115   1.00 33.54  ? 328 ILE A CG2   1 
ATOM   3295 C CD1   . ILE C 3 328 ? 10.596  30.957  -0.754  1.00 34.63  ? 328 ILE A CD1   1 
ATOM   3296 N N     . LEU C 3 329 ? 6.734   30.759  2.150   1.00 34.97  ? 329 LEU A N     1 
ATOM   3297 C CA    . LEU C 3 329 ? 5.645   31.111  3.041   1.00 36.05  ? 329 LEU A CA    1 
ATOM   3298 C C     . LEU C 3 329 ? 6.096   32.286  3.877   1.00 36.01  ? 329 LEU A C     1 
ATOM   3299 O O     . LEU C 3 329 ? 7.291   32.522  4.033   1.00 35.21  ? 329 LEU A O     1 
ATOM   3300 C CB    . LEU C 3 329 ? 5.285   29.963  4.000   1.00 36.66  ? 329 LEU A CB    1 
ATOM   3301 C CG    . LEU C 3 329 ? 4.814   28.563  3.594   1.00 36.15  ? 329 LEU A CG    1 
ATOM   3302 C CD1   . LEU C 3 329 ? 4.068   27.997  4.790   1.00 35.22  ? 329 LEU A CD1   1 
ATOM   3303 C CD2   . LEU C 3 329 ? 3.895   28.584  2.382   1.00 34.87  ? 329 LEU A CD2   1 
ATOM   3304 N N     . GLU C 3 330 ? 5.129   33.020  4.409   1.00 37.12  ? 330 GLU A N     1 
ATOM   3305 C CA    . GLU C 3 330 ? 5.418   34.146  5.279   1.00 39.61  ? 330 GLU A CA    1 
ATOM   3306 C C     . GLU C 3 330 ? 5.656   33.535  6.654   1.00 41.27  ? 330 GLU A C     1 
ATOM   3307 O O     . GLU C 3 330 ? 5.225   32.410  6.913   1.00 41.48  ? 330 GLU A O     1 
ATOM   3308 C CB    . GLU C 3 330 ? 4.217   35.089  5.344   1.00 41.57  ? 330 GLU A CB    1 
ATOM   3309 C CG    . GLU C 3 330 ? 3.934   35.858  4.060   1.00 44.47  ? 330 GLU A CG    1 
ATOM   3310 C CD    . GLU C 3 330 ? 5.087   36.765  3.660   1.00 46.49  ? 330 GLU A CD    1 
ATOM   3311 O OE1   . GLU C 3 330 ? 5.958   37.032  4.520   1.00 47.07  ? 330 GLU A OE1   1 
ATOM   3312 O OE2   . GLU C 3 330 ? 5.114   37.218  2.494   1.00 47.72  ? 330 GLU A OE2   1 
ATOM   3313 N N     . LYS C 3 331 ? 6.346   34.258  7.529   1.00 42.57  ? 331 LYS A N     1 
ATOM   3314 C CA    . LYS C 3 331 ? 6.598   33.756  8.876   1.00 44.00  ? 331 LYS A CA    1 
ATOM   3315 C C     . LYS C 3 331 ? 5.244   33.461  9.509   1.00 43.99  ? 331 LYS A C     1 
ATOM   3316 O O     . LYS C 3 331 ? 5.013   32.390  10.068  1.00 45.14  ? 331 LYS A O     1 
ATOM   3317 C CB    . LYS C 3 331 ? 7.330   34.812  9.708   1.00 45.39  ? 331 LYS A CB    1 
ATOM   3318 C CG    . LYS C 3 331 ? 7.458   34.468  11.188  1.00 46.59  ? 331 LYS A CG    1 
ATOM   3319 C CD    . LYS C 3 331 ? 7.890   35.691  11.982  1.00 49.05  ? 331 LYS A CD    1 
ATOM   3320 C CE    . LYS C 3 331 ? 7.768   35.468  13.484  1.00 50.45  ? 331 LYS A CE    1 
ATOM   3321 N NZ    . LYS C 3 331 ? 8.003   36.731  14.243  1.00 50.82  ? 331 LYS A NZ    1 
ATOM   3322 N N     . GLU C 3 332 ? 4.352   34.435  9.394   1.00 44.53  ? 332 GLU A N     1 
ATOM   3323 C CA    . GLU C 3 332 ? 3.002   34.361  9.927   1.00 43.63  ? 332 GLU A CA    1 
ATOM   3324 C C     . GLU C 3 332 ? 2.286   33.079  9.510   1.00 41.18  ? 332 GLU A C     1 
ATOM   3325 O O     . GLU C 3 332 ? 1.509   32.510  10.280  1.00 41.00  ? 332 GLU A O     1 
ATOM   3326 C CB    . GLU C 3 332 ? 2.217   35.576  9.436   1.00 46.37  ? 332 GLU A CB    1 
ATOM   3327 C CG    . GLU C 3 332 ? 2.968   36.895  9.637   1.00 53.06  ? 332 GLU A CG    1 
ATOM   3328 C CD    . GLU C 3 332 ? 2.563   37.970  8.637   1.00 56.46  ? 332 GLU A CD    1 
ATOM   3329 O OE1   . GLU C 3 332 ? 2.911   37.835  7.438   1.00 56.81  ? 332 GLU A OE1   1 
ATOM   3330 O OE2   . GLU C 3 332 ? 1.895   38.947  9.050   1.00 57.48  ? 332 GLU A OE2   1 
ATOM   3331 N N     . GLU C 3 333 ? 2.553   32.620  8.293   1.00 38.37  ? 333 GLU A N     1 
ATOM   3332 C CA    . GLU C 3 333 ? 1.905   31.415  7.790   1.00 35.70  ? 333 GLU A CA    1 
ATOM   3333 C C     . GLU C 3 333 ? 2.498   30.123  8.314   1.00 34.46  ? 333 GLU A C     1 
ATOM   3334 O O     . GLU C 3 333 ? 1.791   29.127  8.444   1.00 33.69  ? 333 GLU A O     1 
ATOM   3335 C CB    . GLU C 3 333 ? 1.924   31.407  6.272   1.00 32.56  ? 333 GLU A CB    1 
ATOM   3336 C CG    . GLU C 3 333 ? 1.139   32.545  5.685   1.00 30.56  ? 333 GLU A CG    1 
ATOM   3337 C CD    . GLU C 3 333 ? 1.116   32.501  4.180   1.00 31.14  ? 333 GLU A CD    1 
ATOM   3338 O OE1   . GLU C 3 333 ? 2.205   32.305  3.588   1.00 27.43  ? 333 GLU A OE1   1 
ATOM   3339 O OE2   . GLU C 3 333 ? 0.015   32.665  3.601   1.00 27.54  ? 333 GLU A OE2   1 
ATOM   3340 N N     . THR C 3 334 ? 3.790   30.139  8.617   1.00 33.45  ? 334 THR A N     1 
ATOM   3341 C CA    . THR C 3 334 ? 4.435   28.952  9.147   1.00 35.37  ? 334 THR A CA    1 
ATOM   3342 C C     . THR C 3 334 ? 3.905   28.682  10.554  1.00 37.57  ? 334 THR A C     1 
ATOM   3343 O O     . THR C 3 334 ? 3.948   27.551  11.041  1.00 37.93  ? 334 THR A O     1 
ATOM   3344 C CB    . THR C 3 334 ? 5.957   29.110  9.212   1.00 33.99  ? 334 THR A CB    1 
ATOM   3345 O OG1   . THR C 3 334 ? 6.287   30.225  10.047  1.00 35.08  ? 334 THR A OG1   1 
ATOM   3346 C CG2   . THR C 3 334 ? 6.529   29.320  7.813   1.00 35.61  ? 334 THR A CG2   1 
ATOM   3347 N N     . GLU C 3 335 ? 3.405   29.724  11.209  1.00 38.96  ? 335 GLU A N     1 
ATOM   3348 C CA    . GLU C 3 335 ? 2.858   29.563  12.550  1.00 40.20  ? 335 GLU A CA    1 
ATOM   3349 C C     . GLU C 3 335 ? 1.399   29.150  12.414  1.00 38.43  ? 335 GLU A C     1 
ATOM   3350 O O     . GLU C 3 335 ? 0.911   28.294  13.144  1.00 39.30  ? 335 GLU A O     1 
ATOM   3351 C CB    . GLU C 3 335 ? 2.951   30.875  13.341  1.00 42.59  ? 335 GLU A CB    1 
ATOM   3352 C CG    . GLU C 3 335 ? 4.363   31.396  13.575  1.00 47.03  ? 335 GLU A CG    1 
ATOM   3353 C CD    . GLU C 3 335 ? 5.236   30.409  14.328  1.00 50.89  ? 335 GLU A CD    1 
ATOM   3354 O OE1   . GLU C 3 335 ? 4.808   29.925  15.403  1.00 51.68  ? 335 GLU A OE1   1 
ATOM   3355 O OE2   . GLU C 3 335 ? 6.355   30.119  13.845  1.00 52.22  ? 335 GLU A OE2   1 
ATOM   3356 N N     . GLU C 3 336 ? 0.713   29.757  11.457  1.00 37.12  ? 336 GLU A N     1 
ATOM   3357 C CA    . GLU C 3 336 ? -0.695  29.476  11.224  1.00 37.39  ? 336 GLU A CA    1 
ATOM   3358 C C     . GLU C 3 336 ? -0.987  28.006  10.903  1.00 36.20  ? 336 GLU A C     1 
ATOM   3359 O O     . GLU C 3 336 ? -1.976  27.447  11.378  1.00 34.88  ? 336 GLU A O     1 
ATOM   3360 C CB    . GLU C 3 336 ? -1.210  30.377  10.099  1.00 38.64  ? 336 GLU A CB    1 
ATOM   3361 C CG    . GLU C 3 336 ? -2.655  30.135  9.679   1.00 44.85  ? 336 GLU A CG    1 
ATOM   3362 C CD    . GLU C 3 336 ? -3.641  30.266  10.825  1.00 48.02  ? 336 GLU A CD    1 
ATOM   3363 O OE1   . GLU C 3 336 ? -3.516  31.228  11.618  1.00 50.91  ? 336 GLU A OE1   1 
ATOM   3364 O OE2   . GLU C 3 336 ? -4.548  29.409  10.924  1.00 50.22  ? 336 GLU A OE2   1 
ATOM   3365 N N     . LEU C 3 337 ? -0.127  27.378  10.106  1.00 35.82  ? 337 LEU A N     1 
ATOM   3366 C CA    . LEU C 3 337 ? -0.341  25.984  9.746   1.00 34.13  ? 337 LEU A CA    1 
ATOM   3367 C C     . LEU C 3 337 ? -0.169  25.061  10.949  1.00 33.62  ? 337 LEU A C     1 
ATOM   3368 O O     . LEU C 3 337 ? -0.429  23.861  10.860  1.00 32.15  ? 337 LEU A O     1 
ATOM   3369 C CB    . LEU C 3 337 ? 0.591   25.582  8.595   1.00 31.02  ? 337 LEU A CB    1 
ATOM   3370 C CG    . LEU C 3 337 ? 2.105   25.690  8.751   1.00 30.41  ? 337 LEU A CG    1 
ATOM   3371 C CD1   . LEU C 3 337 ? 2.636   24.551  9.608   1.00 29.71  ? 337 LEU A CD1   1 
ATOM   3372 C CD2   . LEU C 3 337 ? 2.737   25.633  7.375   1.00 27.41  ? 337 LEU A CD2   1 
ATOM   3373 N N     . LYS C 3 338 ? 0.255   25.641  12.072  1.00 34.06  ? 338 LYS A N     1 
ATOM   3374 C CA    . LYS C 3 338 ? 0.448   24.908  13.326  1.00 33.91  ? 338 LYS A CA    1 
ATOM   3375 C C     . LYS C 3 338 ? -0.794  25.045  14.216  1.00 35.07  ? 338 LYS A C     1 
ATOM   3376 O O     . LYS C 3 338 ? -0.953  24.311  15.196  1.00 35.10  ? 338 LYS A O     1 
ATOM   3377 C CB    . LYS C 3 338 ? 1.651   25.467  14.103  1.00 34.37  ? 338 LYS A CB    1 
ATOM   3378 C CG    . LYS C 3 338 ? 3.033   25.034  13.629  1.00 33.04  ? 338 LYS A CG    1 
ATOM   3379 C CD    . LYS C 3 338 ? 4.122   25.784  14.403  1.00 32.62  ? 338 LYS A CD    1 
ATOM   3380 C CE    . LYS C 3 338 ? 5.515   25.404  13.904  1.00 36.45  ? 338 LYS A CE    1 
ATOM   3381 N NZ    . LYS C 3 338 ? 6.630   26.104  14.612  1.00 34.81  ? 338 LYS A NZ    1 
ATOM   3382 N N     . ARG C 3 339 ? -1.672  25.983  13.864  1.00 35.52  ? 339 ARG A N     1 
ATOM   3383 C CA    . ARG C 3 339 ? -2.878  26.267  14.641  1.00 34.59  ? 339 ARG A CA    1 
ATOM   3384 C C     . ARG C 3 339 ? -4.062  25.320  14.468  1.00 33.57  ? 339 ARG A C     1 
ATOM   3385 O O     . ARG C 3 339 ? -4.525  25.054  13.356  1.00 33.94  ? 339 ARG A O     1 
ATOM   3386 C CB    . ARG C 3 339 ? -3.329  27.703  14.361  1.00 37.62  ? 339 ARG A CB    1 
ATOM   3387 C CG    . ARG C 3 339 ? -4.541  28.173  15.146  1.00 42.92  ? 339 ARG A CG    1 
ATOM   3388 C CD    . ARG C 3 339 ? -4.904  29.604  14.745  1.00 48.12  ? 339 ARG A CD    1 
ATOM   3389 N NE    . ARG C 3 339 ? -5.912  30.205  15.618  1.00 52.40  ? 339 ARG A NE    1 
ATOM   3390 C CZ    . ARG C 3 339 ? -6.225  31.501  15.615  1.00 55.61  ? 339 ARG A CZ    1 
ATOM   3391 N NH1   . ARG C 3 339 ? -5.611  32.336  14.779  1.00 56.34  ? 339 ARG A NH1   1 
ATOM   3392 N NH2   . ARG C 3 339 ? -7.137  31.973  16.460  1.00 54.80  ? 339 ARG A NH2   1 
ATOM   3393 N N     . PHE C 3 340 ? -4.543  24.828  15.605  1.00 31.86  ? 340 PHE A N     1 
ATOM   3394 C CA    . PHE C 3 340 ? -5.681  23.935  15.680  1.00 29.12  ? 340 PHE A CA    1 
ATOM   3395 C C     . PHE C 3 340 ? -6.643  24.435  16.764  1.00 29.59  ? 340 PHE A C     1 
ATOM   3396 O O     . PHE C 3 340 ? -7.548  25.208  16.464  1.00 30.39  ? 340 PHE A O     1 
ATOM   3397 C CB    . PHE C 3 340 ? -5.221  22.512  15.990  1.00 29.98  ? 340 PHE A CB    1 
ATOM   3398 C CG    . PHE C 3 340 ? -4.653  21.787  14.804  1.00 28.15  ? 340 PHE A CG    1 
ATOM   3399 C CD1   . PHE C 3 340 ? -3.338  21.994  14.405  1.00 26.40  ? 340 PHE A CD1   1 
ATOM   3400 C CD2   . PHE C 3 340 ? -5.449  20.896  14.076  1.00 28.07  ? 340 PHE A CD2   1 
ATOM   3401 C CE1   . PHE C 3 340 ? -2.817  21.325  13.303  1.00 26.08  ? 340 PHE A CE1   1 
ATOM   3402 C CE2   . PHE C 3 340 ? -4.941  20.221  12.972  1.00 27.22  ? 340 PHE A CE2   1 
ATOM   3403 C CZ    . PHE C 3 340 ? -3.622  20.434  12.584  1.00 27.33  ? 340 PHE A CZ    1 
ATOM   3404 N N     . ASP C 3 341 ? -6.458  24.006  18.014  1.00 28.88  ? 341 ASP A N     1 
ATOM   3405 C CA    . ASP C 3 341 ? -7.331  24.453  19.113  1.00 28.84  ? 341 ASP A CA    1 
ATOM   3406 C C     . ASP C 3 341 ? -6.780  25.685  19.834  1.00 28.70  ? 341 ASP A C     1 
ATOM   3407 O O     . ASP C 3 341 ? -5.599  26.020  19.705  1.00 29.41  ? 341 ASP A O     1 
ATOM   3408 C CB    . ASP C 3 341 ? -7.497  23.366  20.188  1.00 26.31  ? 341 ASP A CB    1 
ATOM   3409 C CG    . ASP C 3 341 ? -8.159  22.103  19.675  1.00 26.96  ? 341 ASP A CG    1 
ATOM   3410 O OD1   . ASP C 3 341 ? -9.085  22.194  18.840  1.00 26.90  ? 341 ASP A OD1   1 
ATOM   3411 O OD2   . ASP C 3 341 ? -7.758  21.012  20.136  1.00 24.80  ? 341 ASP A OD2   1 
ATOM   3412 N N     . ASP C 3 342 ? -7.641  26.364  20.588  1.00 28.94  ? 342 ASP A N     1 
ATOM   3413 C CA    . ASP C 3 342 ? -7.189  27.493  21.392  1.00 28.33  ? 342 ASP A CA    1 
ATOM   3414 C C     . ASP C 3 342 ? -6.550  26.775  22.582  1.00 26.81  ? 342 ASP A C     1 
ATOM   3415 O O     . ASP C 3 342 ? -6.874  25.618  22.857  1.00 24.76  ? 342 ASP A O     1 
ATOM   3416 C CB    . ASP C 3 342 ? -8.359  28.355  21.880  1.00 30.33  ? 342 ASP A CB    1 
ATOM   3417 C CG    . ASP C 3 342 ? -9.011  29.143  20.763  1.00 33.22  ? 342 ASP A CG    1 
ATOM   3418 O OD1   . ASP C 3 342 ? -8.319  29.430  19.767  1.00 35.72  ? 342 ASP A OD1   1 
ATOM   3419 O OD2   . ASP C 3 342 ? -10.206 29.492  20.883  1.00 34.00  ? 342 ASP A OD2   1 
ATOM   3420 N N     . PRO C 3 343 ? -5.639  27.441  23.303  1.00 25.03  ? 343 PRO A N     1 
ATOM   3421 C CA    . PRO C 3 343 ? -5.002  26.779  24.449  1.00 23.30  ? 343 PRO A CA    1 
ATOM   3422 C C     . PRO C 3 343 ? -6.027  26.247  25.444  1.00 22.54  ? 343 PRO A C     1 
ATOM   3423 O O     . PRO C 3 343 ? -7.038  26.905  25.721  1.00 21.47  ? 343 PRO A O     1 
ATOM   3424 C CB    . PRO C 3 343 ? -4.130  27.878  25.044  1.00 23.65  ? 343 PRO A CB    1 
ATOM   3425 C CG    . PRO C 3 343 ? -3.820  28.740  23.836  1.00 25.69  ? 343 PRO A CG    1 
ATOM   3426 C CD    . PRO C 3 343 ? -5.163  28.824  23.166  1.00 23.73  ? 343 PRO A CD    1 
ATOM   3427 N N     . GLY C 3 344 ? -5.772  25.048  25.961  1.00 21.17  ? 344 GLY A N     1 
ATOM   3428 C CA    . GLY C 3 344 ? -6.689  24.453  26.916  1.00 19.54  ? 344 GLY A CA    1 
ATOM   3429 C C     . GLY C 3 344 ? -6.761  22.941  26.860  1.00 19.12  ? 344 GLY A C     1 
ATOM   3430 O O     . GLY C 3 344 ? -5.962  22.289  26.203  1.00 19.78  ? 344 GLY A O     1 
ATOM   3431 N N     . LEU C 3 345 ? -7.726  22.390  27.585  1.00 20.63  ? 345 LEU A N     1 
ATOM   3432 C CA    . LEU C 3 345 ? -7.971  20.960  27.645  1.00 19.25  ? 345 LEU A CA    1 
ATOM   3433 C C     . LEU C 3 345 ? -9.428  20.765  27.263  1.00 18.77  ? 345 LEU A C     1 
ATOM   3434 O O     . LEU C 3 345 ? -10.320 21.258  27.938  1.00 20.22  ? 345 LEU A O     1 
ATOM   3435 C CB    . LEU C 3 345 ? -7.729  20.430  29.062  1.00 17.73  ? 345 LEU A CB    1 
ATOM   3436 C CG    . LEU C 3 345 ? -6.275  20.232  29.504  1.00 20.79  ? 345 LEU A CG    1 
ATOM   3437 C CD1   . LEU C 3 345 ? -6.176  20.286  31.027  1.00 19.63  ? 345 LEU A CD1   1 
ATOM   3438 C CD2   . LEU C 3 345 ? -5.755  18.896  28.982  1.00 15.71  ? 345 LEU A CD2   1 
ATOM   3439 N N     . MET C 3 346 ? -9.663  20.072  26.159  1.00 20.47  ? 346 MET A N     1 
ATOM   3440 C CA    . MET C 3 346 ? -11.017 19.799  25.695  1.00 19.25  ? 346 MET A CA    1 
ATOM   3441 C C     . MET C 3 346 ? -11.327 18.337  26.002  1.00 18.69  ? 346 MET A C     1 
ATOM   3442 O O     . MET C 3 346 ? -10.645 17.434  25.510  1.00 19.49  ? 346 MET A O     1 
ATOM   3443 C CB    . MET C 3 346 ? -11.124 20.061  24.192  1.00 17.93  ? 346 MET A CB    1 
ATOM   3444 C CG    . MET C 3 346 ? -10.979 21.525  23.811  1.00 22.99  ? 346 MET A CG    1 
ATOM   3445 S SD    . MET C 3 346 ? -11.100 21.847  22.029  1.00 27.47  ? 346 MET A SD    1 
ATOM   3446 C CE    . MET C 3 346 ? -12.703 20.992  21.652  1.00 18.90  ? 346 MET A CE    1 
ATOM   3447 N N     . LEU C 3 347 ? -12.339 18.110  26.834  1.00 16.31  ? 347 LEU A N     1 
ATOM   3448 C CA    . LEU C 3 347 ? -12.743 16.759  27.213  1.00 15.28  ? 347 LEU A CA    1 
ATOM   3449 C C     . LEU C 3 347 ? -13.273 15.958  26.012  1.00 15.96  ? 347 LEU A C     1 
ATOM   3450 O O     . LEU C 3 347 ? -14.149 16.419  25.275  1.00 14.51  ? 347 LEU A O     1 
ATOM   3451 C CB    . LEU C 3 347 ? -13.820 16.823  28.295  1.00 15.24  ? 347 LEU A CB    1 
ATOM   3452 C CG    . LEU C 3 347 ? -14.342 15.475  28.801  1.00 18.10  ? 347 LEU A CG    1 
ATOM   3453 C CD1   . LEU C 3 347 ? -13.201 14.666  29.448  1.00 17.34  ? 347 LEU A CD1   1 
ATOM   3454 C CD2   . LEU C 3 347 ? -15.441 15.717  29.802  1.00 17.48  ? 347 LEU A CD2   1 
ATOM   3455 N N     . MET C 3 348 ? -12.723 14.766  25.808  1.00 15.95  ? 348 MET A N     1 
ATOM   3456 C CA    . MET C 3 348 ? -13.159 13.906  24.717  1.00 15.68  ? 348 MET A CA    1 
ATOM   3457 C C     . MET C 3 348 ? -14.101 12.838  25.287  1.00 13.91  ? 348 MET A C     1 
ATOM   3458 O O     . MET C 3 348 ? -15.025 12.373  24.624  1.00 11.57  ? 348 MET A O     1 
ATOM   3459 C CB    . MET C 3 348 ? -11.952 13.223  24.052  1.00 16.83  ? 348 MET A CB    1 
ATOM   3460 C CG    . MET C 3 348 ? -10.926 14.172  23.416  1.00 20.60  ? 348 MET A CG    1 
ATOM   3461 S SD    . MET C 3 348 ? -11.619 15.299  22.177  1.00 25.84  ? 348 MET A SD    1 
ATOM   3462 C CE    . MET C 3 348 ? -11.733 14.283  20.843  1.00 27.79  ? 348 MET A CE    1 
ATOM   3463 N N     . GLY C 3 349 ? -13.848 12.452  26.529  1.00 13.08  ? 349 GLY A N     1 
ATOM   3464 C CA    . GLY C 3 349 ? -14.659 11.441  27.164  1.00 11.99  ? 349 GLY A CA    1 
ATOM   3465 C C     . GLY C 3 349 ? -13.864 10.712  28.223  1.00 14.14  ? 349 GLY A C     1 
ATOM   3466 O O     . GLY C 3 349 ? -12.795 11.165  28.635  1.00 13.53  ? 349 GLY A O     1 
ATOM   3467 N N     . PHE C 3 350 ? -14.389 9.577   28.668  1.00 15.04  ? 350 PHE A N     1 
ATOM   3468 C CA    . PHE C 3 350 ? -13.737 8.790   29.696  1.00 16.26  ? 350 PHE A CA    1 
ATOM   3469 C C     . PHE C 3 350 ? -13.403 7.393   29.209  1.00 16.98  ? 350 PHE A C     1 
ATOM   3470 O O     . PHE C 3 350 ? -14.241 6.693   28.627  1.00 15.24  ? 350 PHE A O     1 
ATOM   3471 C CB    . PHE C 3 350 ? -14.624 8.742   30.944  1.00 17.93  ? 350 PHE A CB    1 
ATOM   3472 C CG    . PHE C 3 350 ? -14.968 10.101  31.475  1.00 18.15  ? 350 PHE A CG    1 
ATOM   3473 C CD1   . PHE C 3 350 ? -15.971 10.862  30.876  1.00 17.95  ? 350 PHE A CD1   1 
ATOM   3474 C CD2   . PHE C 3 350 ? -14.246 10.653  32.531  1.00 17.95  ? 350 PHE A CD2   1 
ATOM   3475 C CE1   . PHE C 3 350 ? -16.247 12.158  31.320  1.00 16.39  ? 350 PHE A CE1   1 
ATOM   3476 C CE2   . PHE C 3 350 ? -14.518 11.946  32.977  1.00 18.45  ? 350 PHE A CE2   1 
ATOM   3477 C CZ    . PHE C 3 350 ? -15.520 12.696  32.367  1.00 17.30  ? 350 PHE A CZ    1 
ATOM   3478 N N     . LYS C 3 351 ? -12.159 7.004   29.463  1.00 18.97  ? 351 LYS A N     1 
ATOM   3479 C CA    . LYS C 3 351 ? -11.637 5.717   29.043  1.00 19.88  ? 351 LYS A CA    1 
ATOM   3480 C C     . LYS C 3 351 ? -11.093 4.915   30.218  1.00 20.67  ? 351 LYS A C     1 
ATOM   3481 O O     . LYS C 3 351 ? -10.302 5.430   31.019  1.00 20.02  ? 351 LYS A O     1 
ATOM   3482 C CB    . LYS C 3 351 ? -10.527 5.949   28.011  1.00 21.76  ? 351 LYS A CB    1 
ATOM   3483 C CG    . LYS C 3 351 ? -9.839  4.687   27.522  1.00 24.51  ? 351 LYS A CG    1 
ATOM   3484 C CD    . LYS C 3 351 ? -8.837  4.996   26.414  1.00 27.00  ? 351 LYS A CD    1 
ATOM   3485 C CE    . LYS C 3 351 ? -9.533  5.613   25.203  1.00 28.06  ? 351 LYS A CE    1 
ATOM   3486 N NZ    . LYS C 3 351 ? -8.663  5.605   24.000  1.00 28.60  ? 351 LYS A NZ    1 
ATOM   3487 N N     . PRO C 3 352 ? -11.533 3.647   30.357  1.00 20.89  ? 352 PRO A N     1 
ATOM   3488 C CA    . PRO C 3 352 ? -11.067 2.783   31.449  1.00 18.59  ? 352 PRO A CA    1 
ATOM   3489 C C     . PRO C 3 352 ? -9.543  2.676   31.495  1.00 19.59  ? 352 PRO A C     1 
ATOM   3490 O O     . PRO C 3 352 ? -8.886  2.440   30.474  1.00 17.01  ? 352 PRO A O     1 
ATOM   3491 C CB    . PRO C 3 352 ? -11.752 1.439   31.160  1.00 19.16  ? 352 PRO A CB    1 
ATOM   3492 C CG    . PRO C 3 352 ? -12.275 1.559   29.741  1.00 20.36  ? 352 PRO A CG    1 
ATOM   3493 C CD    . PRO C 3 352 ? -12.636 3.005   29.625  1.00 21.31  ? 352 PRO A CD    1 
ATOM   3494 N N     . LEU C 3 353 ? -8.993  2.854   32.692  1.00 20.08  ? 353 LEU A N     1 
ATOM   3495 C CA    . LEU C 3 353 ? -7.552  2.818   32.914  1.00 22.05  ? 353 LEU A CA    1 
ATOM   3496 C C     . LEU C 3 353 ? -6.809  1.600   32.363  1.00 23.95  ? 353 LEU A C     1 
ATOM   3497 O O     . LEU C 3 353 ? -5.647  1.726   31.952  1.00 25.81  ? 353 LEU A O     1 
ATOM   3498 C CB    . LEU C 3 353 ? -7.263  2.961   34.408  1.00 22.04  ? 353 LEU A CB    1 
ATOM   3499 C CG    . LEU C 3 353 ? -7.952  4.175   35.041  1.00 24.21  ? 353 LEU A CG    1 
ATOM   3500 C CD1   . LEU C 3 353 ? -7.793  4.172   36.563  1.00 22.04  ? 353 LEU A CD1   1 
ATOM   3501 C CD2   . LEU C 3 353 ? -7.364  5.435   34.441  1.00 22.73  ? 353 LEU A CD2   1 
ATOM   3502 N N     . VAL C 3 354 ? -7.444  0.429   32.352  1.00 23.16  ? 354 VAL A N     1 
ATOM   3503 C CA    . VAL C 3 354 ? -6.771  -0.762  31.825  1.00 25.36  ? 354 VAL A CA    1 
ATOM   3504 C C     . VAL C 3 354 ? -6.402  -0.636  30.347  1.00 25.44  ? 354 VAL A C     1 
ATOM   3505 O O     . VAL C 3 354 ? -5.547  -1.370  29.858  1.00 27.79  ? 354 VAL A O     1 
ATOM   3506 C CB    . VAL C 3 354 ? -7.623  -2.041  31.968  1.00 26.07  ? 354 VAL A CB    1 
ATOM   3507 C CG1   . VAL C 3 354 ? -7.707  -2.465  33.427  1.00 28.70  ? 354 VAL A CG1   1 
ATOM   3508 C CG2   . VAL C 3 354 ? -9.007  -1.805  31.388  1.00 27.68  ? 354 VAL A CG2   1 
ATOM   3509 N N     . LEU C 3 355 ? -7.048  0.287   29.640  1.00 25.06  ? 355 LEU A N     1 
ATOM   3510 C CA    . LEU C 3 355 ? -6.783  0.493   28.222  1.00 24.77  ? 355 LEU A CA    1 
ATOM   3511 C C     . LEU C 3 355 ? -5.591  1.390   27.975  1.00 25.92  ? 355 LEU A C     1 
ATOM   3512 O O     . LEU C 3 355 ? -5.235  1.656   26.823  1.00 27.98  ? 355 LEU A O     1 
ATOM   3513 C CB    . LEU C 3 355 ? -7.995  1.107   27.525  1.00 22.53  ? 355 LEU A CB    1 
ATOM   3514 C CG    . LEU C 3 355 ? -9.176  0.198   27.223  1.00 23.14  ? 355 LEU A CG    1 
ATOM   3515 C CD1   . LEU C 3 355 ? -10.238 1.010   26.505  1.00 21.75  ? 355 LEU A CD1   1 
ATOM   3516 C CD2   . LEU C 3 355 ? -8.728  -0.979  26.359  1.00 23.93  ? 355 LEU A CD2   1 
ATOM   3517 N N     . LEU C 3 356 ? -4.984  1.880   29.046  1.00 26.32  ? 356 LEU A N     1 
ATOM   3518 C CA    . LEU C 3 356 ? -3.832  2.753   28.905  1.00 27.44  ? 356 LEU A CA    1 
ATOM   3519 C C     . LEU C 3 356 ? -2.601  1.947   29.247  1.00 28.55  ? 356 LEU A C     1 
ATOM   3520 O O     . LEU C 3 356 ? -2.425  1.536   30.391  1.00 29.80  ? 356 LEU A O     1 
ATOM   3521 C CB    . LEU C 3 356 ? -3.953  3.943   29.850  1.00 27.25  ? 356 LEU A CB    1 
ATOM   3522 C CG    . LEU C 3 356 ? -5.206  4.796   29.655  1.00 25.15  ? 356 LEU A CG    1 
ATOM   3523 C CD1   . LEU C 3 356 ? -5.250  5.861   30.755  1.00 24.73  ? 356 LEU A CD1   1 
ATOM   3524 C CD2   . LEU C 3 356 ? -5.217  5.411   28.260  1.00 22.54  ? 356 LEU A CD2   1 
ATOM   3525 N N     . LYS C 3 357 ? -1.741  1.731   28.261  1.00 27.73  ? 357 LYS A N     1 
ATOM   3526 C CA    . LYS C 3 357 ? -0.550  0.934   28.491  1.00 27.94  ? 357 LYS A CA    1 
ATOM   3527 C C     . LYS C 3 357 ? 0.645   1.635   29.121  1.00 27.70  ? 357 LYS A C     1 
ATOM   3528 O O     . LYS C 3 357 ? 0.967   2.787   28.809  1.00 25.45  ? 357 LYS A O     1 
ATOM   3529 C CB    . LYS C 3 357 ? -0.131  0.260   27.192  1.00 29.86  ? 357 LYS A CB    1 
ATOM   3530 C CG    . LYS C 3 357 ? -1.093  -0.831  26.755  1.00 32.87  ? 357 LYS A CG    1 
ATOM   3531 C CD    . LYS C 3 357 ? -1.622  -0.559  25.359  1.00 34.08  ? 357 LYS A CD    1 
ATOM   3532 C CE    . LYS C 3 357 ? -2.445  -1.726  24.847  1.00 35.36  ? 357 LYS A CE    1 
ATOM   3533 N NZ    . LYS C 3 357 ? -2.796  -1.535  23.415  1.00 36.38  ? 357 LYS A NZ    1 
ATOM   3534 N N     . LYS C 3 358 ? 1.292   0.897   30.017  1.00 27.25  ? 358 LYS A N     1 
ATOM   3535 C CA    . LYS C 3 358 ? 2.472   1.342   30.750  1.00 28.50  ? 358 LYS A CA    1 
ATOM   3536 C C     . LYS C 3 358 ? 3.621   1.637   29.774  1.00 28.38  ? 358 LYS A C     1 
ATOM   3537 O O     . LYS C 3 358 ? 4.391   2.576   29.963  1.00 29.45  ? 358 LYS A O     1 
ATOM   3538 C CB    . LYS C 3 358 ? 2.858   0.226   31.719  1.00 30.08  ? 358 LYS A CB    1 
ATOM   3539 C CG    . LYS C 3 358 ? 3.852   0.527   32.821  1.00 31.41  ? 358 LYS A CG    1 
ATOM   3540 C CD    . LYS C 3 358 ? 3.900   -0.723  33.732  1.00 33.05  ? 358 LYS A CD    1 
ATOM   3541 C CE    . LYS C 3 358 ? 5.083   -0.748  34.704  1.00 34.72  ? 358 LYS A CE    1 
ATOM   3542 N NZ    . LYS C 3 358 ? 5.130   -2.031  35.489  1.00 31.76  ? 358 LYS A NZ    1 
ATOM   3543 N N     . HIS C 3 359 ? 3.710   0.844   28.711  1.00 27.44  ? 359 HIS A N     1 
ATOM   3544 C CA    . HIS C 3 359 ? 4.776   1.005   27.738  1.00 24.59  ? 359 HIS A CA    1 
ATOM   3545 C C     . HIS C 3 359 ? 4.508   1.992   26.609  1.00 23.48  ? 359 HIS A C     1 
ATOM   3546 O O     . HIS C 3 359 ? 5.186   1.953   25.590  1.00 22.25  ? 359 HIS A O     1 
ATOM   3547 C CB    . HIS C 3 359 ? 5.147   -0.358  27.151  1.00 24.58  ? 359 HIS A CB    1 
ATOM   3548 C CG    . HIS C 3 359 ? 3.976   -1.124  26.630  1.00 24.90  ? 359 HIS A CG    1 
ATOM   3549 N ND1   . HIS C 3 359 ? 3.071   -1.749  27.459  1.00 23.51  ? 359 HIS A ND1   1 
ATOM   3550 C CD2   . HIS C 3 359 ? 3.539   -1.337  25.364  1.00 24.71  ? 359 HIS A CD2   1 
ATOM   3551 C CE1   . HIS C 3 359 ? 2.128   -2.316  26.727  1.00 23.25  ? 359 HIS A CE1   1 
ATOM   3552 N NE2   . HIS C 3 359 ? 2.387   -2.079  25.453  1.00 23.05  ? 359 HIS A NE2   1 
ATOM   3553 N N     . HIS C 3 360 ? 3.527   2.873   26.776  1.00 24.01  ? 360 HIS A N     1 
ATOM   3554 C CA    . HIS C 3 360 ? 3.258   3.876   25.752  1.00 22.18  ? 360 HIS A CA    1 
ATOM   3555 C C     . HIS C 3 360 ? 3.747   5.248   26.173  1.00 22.31  ? 360 HIS A C     1 
ATOM   3556 O O     . HIS C 3 360 ? 3.422   6.251   25.543  1.00 24.77  ? 360 HIS A O     1 
ATOM   3557 C CB    . HIS C 3 360 ? 1.782   3.930   25.400  1.00 22.04  ? 360 HIS A CB    1 
ATOM   3558 C CG    . HIS C 3 360 ? 1.376   2.887   24.411  1.00 24.62  ? 360 HIS A CG    1 
ATOM   3559 N ND1   . HIS C 3 360 ? 0.117   2.832   23.857  1.00 26.77  ? 360 HIS A ND1   1 
ATOM   3560 C CD2   . HIS C 3 360 ? 2.064   1.844   23.888  1.00 25.42  ? 360 HIS A CD2   1 
ATOM   3561 C CE1   . HIS C 3 360 ? 0.046   1.799   23.037  1.00 28.06  ? 360 HIS A CE1   1 
ATOM   3562 N NE2   . HIS C 3 360 ? 1.214   1.182   23.039  1.00 26.38  ? 360 HIS A NE2   1 
ATOM   3563 N N     . TYR C 3 361 ? 4.542   5.284   27.237  1.00 19.58  ? 361 TYR A N     1 
ATOM   3564 C CA    . TYR C 3 361 ? 5.127   6.533   27.722  1.00 19.21  ? 361 TYR A CA    1 
ATOM   3565 C C     . TYR C 3 361 ? 5.738   7.314   26.555  1.00 17.46  ? 361 TYR A C     1 
ATOM   3566 O O     . TYR C 3 361 ? 6.366   6.721   25.685  1.00 17.28  ? 361 TYR A O     1 
ATOM   3567 C CB    . TYR C 3 361 ? 6.223   6.215   28.740  1.00 19.25  ? 361 TYR A CB    1 
ATOM   3568 C CG    . TYR C 3 361 ? 7.028   7.409   29.131  1.00 19.61  ? 361 TYR A CG    1 
ATOM   3569 C CD1   . TYR C 3 361 ? 6.522   8.350   30.031  1.00 19.01  ? 361 TYR A CD1   1 
ATOM   3570 C CD2   . TYR C 3 361 ? 8.291   7.626   28.578  1.00 18.30  ? 361 TYR A CD2   1 
ATOM   3571 C CE1   . TYR C 3 361 ? 7.255   9.473   30.368  1.00 17.78  ? 361 TYR A CE1   1 
ATOM   3572 C CE2   . TYR C 3 361 ? 9.028   8.756   28.905  1.00 18.00  ? 361 TYR A CE2   1 
ATOM   3573 C CZ    . TYR C 3 361 ? 8.507   9.669   29.800  1.00 16.57  ? 361 TYR A CZ    1 
ATOM   3574 O OH    . TYR C 3 361 ? 9.241   10.770  30.137  1.00 18.24  ? 361 TYR A OH    1 
ATOM   3575 N N     . LEU C 3 362 ? 5.594   8.638   26.554  1.00 17.48  ? 362 LEU A N     1 
ATOM   3576 C CA    . LEU C 3 362 ? 6.116   9.467   25.462  1.00 16.93  ? 362 LEU A CA    1 
ATOM   3577 C C     . LEU C 3 362 ? 7.045   10.563  25.944  1.00 19.89  ? 362 LEU A C     1 
ATOM   3578 O O     . LEU C 3 362 ? 8.070   10.865  25.305  1.00 19.95  ? 362 LEU A O     1 
ATOM   3579 C CB    . LEU C 3 362 ? 4.958   10.108  24.696  1.00 15.49  ? 362 LEU A CB    1 
ATOM   3580 C CG    . LEU C 3 362 ? 5.330   11.109  23.595  1.00 15.49  ? 362 LEU A CG    1 
ATOM   3581 C CD1   . LEU C 3 362 ? 5.950   10.385  22.413  1.00 15.95  ? 362 LEU A CD1   1 
ATOM   3582 C CD2   . LEU C 3 362 ? 4.091   11.848  23.145  1.00 17.90  ? 362 LEU A CD2   1 
ATOM   3583 N N     . ARG C 3 363 ? 6.649   11.174  27.060  1.00 21.08  ? 363 ARG A N     1 
ATOM   3584 C CA    . ARG C 3 363 ? 7.386   12.250  27.715  1.00 20.53  ? 363 ARG A CA    1 
ATOM   3585 C C     . ARG C 3 363 ? 6.782   12.391  29.115  1.00 20.96  ? 363 ARG A C     1 
ATOM   3586 O O     . ARG C 3 363 ? 5.644   11.979  29.347  1.00 21.98  ? 363 ARG A O     1 
ATOM   3587 C CB    . ARG C 3 363 ? 7.248   13.558  26.930  1.00 21.58  ? 363 ARG A CB    1 
ATOM   3588 C CG    . ARG C 3 363 ? 5.830   13.979  26.677  1.00 25.26  ? 363 ARG A CG    1 
ATOM   3589 C CD    . ARG C 3 363 ? 5.753   15.368  26.078  1.00 28.77  ? 363 ARG A CD    1 
ATOM   3590 N NE    . ARG C 3 363 ? 6.325   16.411  26.931  1.00 33.02  ? 363 ARG A NE    1 
ATOM   3591 C CZ    . ARG C 3 363 ? 6.100   16.534  28.237  1.00 35.21  ? 363 ARG A CZ    1 
ATOM   3592 N NH1   . ARG C 3 363 ? 5.315   15.671  28.860  1.00 38.44  ? 363 ARG A NH1   1 
ATOM   3593 N NH2   . ARG C 3 363 ? 6.643   17.532  28.920  1.00 33.04  ? 363 ARG A NH2   1 
ATOM   3594 N N     . PRO C 3 364 ? 7.526   12.982  30.063  1.00 21.15  ? 364 PRO A N     1 
ATOM   3595 C CA    . PRO C 3 364 ? 7.045   13.153  31.441  1.00 20.28  ? 364 PRO A CA    1 
ATOM   3596 C C     . PRO C 3 364 ? 5.623   13.689  31.656  1.00 20.92  ? 364 PRO A C     1 
ATOM   3597 O O     . PRO C 3 364 ? 5.186   14.632  31.008  1.00 22.31  ? 364 PRO A O     1 
ATOM   3598 C CB    . PRO C 3 364 ? 8.128   14.029  32.080  1.00 18.69  ? 364 PRO A CB    1 
ATOM   3599 C CG    . PRO C 3 364 ? 8.742   14.733  30.914  1.00 22.39  ? 364 PRO A CG    1 
ATOM   3600 C CD    . PRO C 3 364 ? 8.802   13.689  29.862  1.00 20.03  ? 364 PRO A CD    1 
ATOM   3601 N N     . SER C 3 365 ? 4.901   13.058  32.575  1.00 20.15  ? 365 SER A N     1 
ATOM   3602 C CA    . SER C 3 365 ? 3.536   13.447  32.883  1.00 19.80  ? 365 SER A CA    1 
ATOM   3603 C C     . SER C 3 365 ? 3.531   14.738  33.677  1.00 21.28  ? 365 SER A C     1 
ATOM   3604 O O     . SER C 3 365 ? 4.514   15.078  34.329  1.00 21.77  ? 365 SER A O     1 
ATOM   3605 C CB    . SER C 3 365 ? 2.844   12.372  33.720  1.00 19.64  ? 365 SER A CB    1 
ATOM   3606 O OG    . SER C 3 365 ? 2.770   11.134  33.044  1.00 20.22  ? 365 SER A OG    1 
ATOM   3607 N N     . LEU C 3 366 ? 2.404   15.440  33.623  1.00 20.60  ? 366 LEU A N     1 
ATOM   3608 C CA    . LEU C 3 366 ? 2.219   16.680  34.356  1.00 19.80  ? 366 LEU A CA    1 
ATOM   3609 C C     . LEU C 3 366 ? 1.175   16.438  35.442  1.00 18.13  ? 366 LEU A C     1 
ATOM   3610 O O     . LEU C 3 366 ? 0.611   15.352  35.530  1.00 19.33  ? 366 LEU A O     1 
ATOM   3611 C CB    . LEU C 3 366 ? 1.780   17.791  33.400  1.00 18.21  ? 366 LEU A CB    1 
ATOM   3612 C CG    . LEU C 3 366 ? 2.873   18.076  32.357  1.00 19.11  ? 366 LEU A CG    1 
ATOM   3613 C CD1   . LEU C 3 366 ? 2.427   19.146  31.377  1.00 17.20  ? 366 LEU A CD1   1 
ATOM   3614 C CD2   . LEU C 3 366 ? 4.146   18.503  33.065  1.00 19.64  ? 366 LEU A CD2   1 
ATOM   3615 N N     . PHE C 3 367 ? 0.928   17.429  36.285  1.00 17.77  ? 367 PHE A N     1 
ATOM   3616 C CA    . PHE C 3 367 ? -0.059  17.260  37.347  1.00 17.81  ? 367 PHE A CA    1 
ATOM   3617 C C     . PHE C 3 367 ? -1.098  18.366  37.249  1.00 18.02  ? 367 PHE A C     1 
ATOM   3618 O O     . PHE C 3 367 ? -0.749  19.530  37.112  1.00 17.71  ? 367 PHE A O     1 
ATOM   3619 C CB    . PHE C 3 367 ? 0.626   17.285  38.723  1.00 17.48  ? 367 PHE A CB    1 
ATOM   3620 C CG    . PHE C 3 367 ? -0.331  17.199  39.880  1.00 17.33  ? 367 PHE A CG    1 
ATOM   3621 C CD1   . PHE C 3 367 ? -1.081  16.040  40.099  1.00 16.75  ? 367 PHE A CD1   1 
ATOM   3622 C CD2   . PHE C 3 367 ? -0.498  18.282  40.743  1.00 13.50  ? 367 PHE A CD2   1 
ATOM   3623 C CE1   . PHE C 3 367 ? -1.981  15.965  41.161  1.00 13.98  ? 367 PHE A CE1   1 
ATOM   3624 C CE2   . PHE C 3 367 ? -1.395  18.216  41.806  1.00 11.59  ? 367 PHE A CE2   1 
ATOM   3625 C CZ    . PHE C 3 367 ? -2.137  17.061  42.018  1.00 15.10  ? 367 PHE A CZ    1 
ATOM   3626 N N     . VAL C 3 368 ? -2.371  17.990  37.329  1.00 18.29  ? 368 VAL A N     1 
ATOM   3627 C CA    . VAL C 3 368 ? -3.472  18.938  37.220  1.00 18.62  ? 368 VAL A CA    1 
ATOM   3628 C C     . VAL C 3 368 ? -4.190  19.152  38.553  1.00 18.67  ? 368 VAL A C     1 
ATOM   3629 O O     . VAL C 3 368 ? -4.592  18.203  39.221  1.00 18.10  ? 368 VAL A O     1 
ATOM   3630 C CB    . VAL C 3 368 ? -4.494  18.453  36.159  1.00 19.62  ? 368 VAL A CB    1 
ATOM   3631 C CG1   . VAL C 3 368 ? -5.564  19.505  35.933  1.00 19.64  ? 368 VAL A CG1   1 
ATOM   3632 C CG2   . VAL C 3 368 ? -3.770  18.142  34.862  1.00 19.61  ? 368 VAL A CG2   1 
ATOM   3633 N N     . TYR C 3 369 ? -4.341  20.416  38.928  1.00 17.73  ? 369 TYR A N     1 
ATOM   3634 C CA    . TYR C 3 369 ? -4.988  20.786  40.168  1.00 14.55  ? 369 TYR A CA    1 
ATOM   3635 C C     . TYR C 3 369 ? -5.864  21.983  39.847  1.00 15.06  ? 369 TYR A C     1 
ATOM   3636 O O     . TYR C 3 369 ? -5.512  22.805  39.009  1.00 13.24  ? 369 TYR A O     1 
ATOM   3637 C CB    . TYR C 3 369 ? -3.941  21.165  41.209  1.00 14.98  ? 369 TYR A CB    1 
ATOM   3638 C CG    . TYR C 3 369 ? -4.444  21.177  42.635  1.00 17.85  ? 369 TYR A CG    1 
ATOM   3639 C CD1   . TYR C 3 369 ? -4.710  19.990  43.314  1.00 19.95  ? 369 TYR A CD1   1 
ATOM   3640 C CD2   . TYR C 3 369 ? -4.663  22.376  43.307  1.00 20.41  ? 369 TYR A CD2   1 
ATOM   3641 C CE1   . TYR C 3 369 ? -5.184  20.002  44.634  1.00 21.13  ? 369 TYR A CE1   1 
ATOM   3642 C CE2   . TYR C 3 369 ? -5.133  22.399  44.620  1.00 19.70  ? 369 TYR A CE2   1 
ATOM   3643 C CZ    . TYR C 3 369 ? -5.393  21.212  45.278  1.00 20.96  ? 369 TYR A CZ    1 
ATOM   3644 O OH    . TYR C 3 369 ? -5.861  21.240  46.578  1.00 23.03  ? 369 TYR A OH    1 
ATOM   3645 N N     . PRO C 3 370 ? -7.028  22.085  40.500  1.00 17.82  ? 370 PRO A N     1 
ATOM   3646 C CA    . PRO C 3 370 ? -7.978  23.183  40.294  1.00 19.36  ? 370 PRO A CA    1 
ATOM   3647 C C     . PRO C 3 370 ? -7.466  24.562  40.684  1.00 21.23  ? 370 PRO A C     1 
ATOM   3648 O O     . PRO C 3 370 ? -6.850  24.737  41.725  1.00 22.12  ? 370 PRO A O     1 
ATOM   3649 C CB    . PRO C 3 370 ? -9.179  22.759  41.137  1.00 17.87  ? 370 PRO A CB    1 
ATOM   3650 C CG    . PRO C 3 370 ? -8.553  21.960  42.221  1.00 15.68  ? 370 PRO A CG    1 
ATOM   3651 C CD    . PRO C 3 370 ? -7.559  21.122  41.478  1.00 16.72  ? 370 PRO A CD    1 
ATOM   3652 N N     . GLU C 3 371 ? -7.727  25.544  39.834  1.00 24.50  ? 371 GLU A N     1 
ATOM   3653 C CA    . GLU C 3 371 ? -7.304  26.905  40.115  1.00 27.08  ? 371 GLU A CA    1 
ATOM   3654 C C     . GLU C 3 371 ? -8.554  27.729  40.438  1.00 27.86  ? 371 GLU A C     1 
ATOM   3655 O O     . GLU C 3 371 ? -9.192  28.291  39.550  1.00 28.71  ? 371 GLU A O     1 
ATOM   3656 C CB    . GLU C 3 371 ? -6.569  27.481  38.908  1.00 27.85  ? 371 GLU A CB    1 
ATOM   3657 C CG    . GLU C 3 371 ? -5.782  28.746  39.198  1.00 33.61  ? 371 GLU A CG    1 
ATOM   3658 C CD    . GLU C 3 371 ? -4.814  28.601  40.363  1.00 36.37  ? 371 GLU A CD    1 
ATOM   3659 O OE1   . GLU C 3 371 ? -4.576  27.462  40.826  1.00 38.53  ? 371 GLU A OE1   1 
ATOM   3660 O OE2   . GLU C 3 371 ? -4.281  29.637  40.812  1.00 39.63  ? 371 GLU A OE2   1 
ATOM   3661 N N     . GLU C 3 372 ? -8.889  27.781  41.724  1.00 27.01  ? 372 GLU A N     1 
ATOM   3662 C CA    . GLU C 3 372 ? -10.057 28.498  42.209  1.00 27.48  ? 372 GLU A CA    1 
ATOM   3663 C C     . GLU C 3 372 ? -9.978  30.011  42.008  1.00 28.27  ? 372 GLU A C     1 
ATOM   3664 O O     . GLU C 3 372 ? -11.004 30.689  42.016  1.00 27.87  ? 372 GLU A O     1 
ATOM   3665 C CB    . GLU C 3 372 ? -10.259 28.197  43.698  1.00 26.07  ? 372 GLU A CB    1 
ATOM   3666 C CG    . GLU C 3 372 ? -11.633 28.552  44.229  1.00 27.08  ? 372 GLU A CG    1 
ATOM   3667 C CD    . GLU C 3 372 ? -12.727 27.662  43.663  1.00 28.39  ? 372 GLU A CD    1 
ATOM   3668 O OE1   . GLU C 3 372 ? -12.401 26.591  43.111  1.00 26.76  ? 372 GLU A OE1   1 
ATOM   3669 O OE2   . GLU C 3 372 ? -13.915 28.026  43.781  1.00 28.89  ? 372 GLU A OE2   1 
ATOM   3670 N N     . SER C 3 373 ? -8.773  30.540  41.815  1.00 28.96  ? 373 SER A N     1 
ATOM   3671 C CA    . SER C 3 373 ? -8.615  31.982  41.647  1.00 32.18  ? 373 SER A CA    1 
ATOM   3672 C C     . SER C 3 373 ? -9.125  32.536  40.312  1.00 33.25  ? 373 SER A C     1 
ATOM   3673 O O     . SER C 3 373 ? -9.455  33.713  40.217  1.00 35.53  ? 373 SER A O     1 
ATOM   3674 C CB    . SER C 3 373 ? -7.148  32.391  41.861  1.00 30.32  ? 373 SER A CB    1 
ATOM   3675 O OG    . SER C 3 373 ? -6.318  31.980  40.786  1.00 33.60  ? 373 SER A OG    1 
ATOM   3676 N N     . LEU C 3 374 ? -9.202  31.702  39.281  1.00 35.12  ? 374 LEU A N     1 
ATOM   3677 C CA    . LEU C 3 374 ? -9.686  32.175  37.983  1.00 34.93  ? 374 LEU A CA    1 
ATOM   3678 C C     . LEU C 3 374 ? -11.180 31.932  37.832  1.00 32.33  ? 374 LEU A C     1 
ATOM   3679 O O     . LEU C 3 374 ? -11.941 32.862  37.603  1.00 33.86  ? 374 LEU A O     1 
ATOM   3680 C CB    . LEU C 3 374 ? -8.923  31.492  36.841  1.00 37.65  ? 374 LEU A CB    1 
ATOM   3681 C CG    . LEU C 3 374 ? -7.399  31.685  36.849  1.00 40.94  ? 374 LEU A CG    1 
ATOM   3682 C CD1   . LEU C 3 374 ? -6.784  30.994  35.636  1.00 41.66  ? 374 LEU A CD1   1 
ATOM   3683 C CD2   . LEU C 3 374 ? -7.062  33.183  36.840  1.00 41.19  ? 374 LEU A CD2   1 
ATOM   3684 N N     . VAL C 3 375 ? -11.600 30.680  37.964  1.00 31.62  ? 375 VAL A N     1 
ATOM   3685 C CA    . VAL C 3 375 ? -13.018 30.343  37.848  1.00 27.87  ? 375 VAL A CA    1 
ATOM   3686 C C     . VAL C 3 375 ? -13.538 29.796  39.168  1.00 26.35  ? 375 VAL A C     1 
ATOM   3687 O O     . VAL C 3 375 ? -13.251 28.662  39.543  1.00 27.60  ? 375 VAL A O     1 
ATOM   3688 C CB    . VAL C 3 375 ? -13.275 29.275  36.748  1.00 26.70  ? 375 VAL A CB    1 
ATOM   3689 C CG1   . VAL C 3 375 ? -14.773 28.965  36.654  1.00 23.15  ? 375 VAL A CG1   1 
ATOM   3690 C CG2   . VAL C 3 375 ? -12.737 29.762  35.409  1.00 24.31  ? 375 VAL A CG2   1 
ATOM   3691 N N     . ILE C 3 376 ? -14.301 30.614  39.878  1.00 25.47  ? 376 ILE A N     1 
ATOM   3692 C CA    . ILE C 3 376 ? -14.877 30.193  41.142  1.00 23.57  ? 376 ILE A CA    1 
ATOM   3693 C C     . ILE C 3 376 ? -15.801 29.019  40.844  1.00 21.65  ? 376 ILE A C     1 
ATOM   3694 O O     . ILE C 3 376 ? -16.571 29.065  39.880  1.00 18.69  ? 376 ILE A O     1 
ATOM   3695 C CB    . ILE C 3 376 ? -15.651 31.357  41.797  1.00 24.58  ? 376 ILE A CB    1 
ATOM   3696 C CG1   . ILE C 3 376 ? -14.648 32.378  42.357  1.00 26.34  ? 376 ILE A CG1   1 
ATOM   3697 C CG2   . ILE C 3 376 ? -16.572 30.835  42.882  1.00 26.14  ? 376 ILE A CG2   1 
ATOM   3698 C CD1   . ILE C 3 376 ? -15.273 33.653  42.899  1.00 25.47  ? 376 ILE A CD1   1 
ATOM   3699 N N     . GLY C 3 377 ? -15.694 27.963  41.653  1.00 19.43  ? 377 GLY A N     1 
ATOM   3700 C CA    . GLY C 3 377 ? -16.514 26.779  41.460  1.00 18.83  ? 377 GLY A CA    1 
ATOM   3701 C C     . GLY C 3 377 ? -15.752 25.619  40.828  1.00 20.23  ? 377 GLY A C     1 
ATOM   3702 O O     . GLY C 3 377 ? -16.222 24.475  40.822  1.00 16.98  ? 377 GLY A O     1 
ATOM   3703 N N     . SER C 3 378 ? -14.569 25.917  40.300  1.00 20.37  ? 378 SER A N     1 
ATOM   3704 C CA    . SER C 3 378 ? -13.727 24.909  39.664  1.00 21.99  ? 378 SER A CA    1 
ATOM   3705 C C     . SER C 3 378 ? -13.355 23.710  40.551  1.00 21.38  ? 378 SER A C     1 
ATOM   3706 O O     . SER C 3 378 ? -13.373 22.567  40.089  1.00 20.81  ? 378 SER A O     1 
ATOM   3707 C CB    . SER C 3 378 ? -12.436 25.559  39.157  1.00 22.49  ? 378 SER A CB    1 
ATOM   3708 O OG    . SER C 3 378 ? -12.700 26.612  38.244  1.00 25.88  ? 378 SER A OG    1 
ATOM   3709 N N     . SER C 3 379 ? -13.025 23.969  41.815  1.00 19.87  ? 379 SER A N     1 
ATOM   3710 C CA    . SER C 3 379 ? -12.604 22.908  42.738  1.00 19.74  ? 379 SER A CA    1 
ATOM   3711 C C     . SER C 3 379 ? -13.663 21.846  43.025  1.00 21.26  ? 379 SER A C     1 
ATOM   3712 O O     . SER C 3 379 ? -13.360 20.649  43.075  1.00 18.82  ? 379 SER A O     1 
ATOM   3713 C CB    . SER C 3 379 ? -12.128 23.519  44.064  1.00 18.93  ? 379 SER A CB    1 
ATOM   3714 O OG    . SER C 3 379 ? -11.051 24.413  43.858  1.00 16.77  ? 379 SER A OG    1 
ATOM   3715 N N     . THR C 3 380 ? -14.896 22.297  43.233  1.00 21.32  ? 380 THR A N     1 
ATOM   3716 C CA    . THR C 3 380 ? -16.019 21.413  43.500  1.00 20.54  ? 380 THR A CA    1 
ATOM   3717 C C     . THR C 3 380 ? -16.234 20.458  42.335  1.00 19.01  ? 380 THR A C     1 
ATOM   3718 O O     . THR C 3 380 ? -16.318 19.244  42.525  1.00 17.70  ? 380 THR A O     1 
ATOM   3719 C CB    . THR C 3 380 ? -17.321 22.219  43.709  1.00 21.91  ? 380 THR A CB    1 
ATOM   3720 O OG1   . THR C 3 380 ? -17.185 23.050  44.865  1.00 24.51  ? 380 THR A OG1   1 
ATOM   3721 C CG2   . THR C 3 380 ? -18.508 21.291  43.903  1.00 18.44  ? 380 THR A CG2   1 
ATOM   3722 N N     . LEU C 3 381 ? -16.333 21.006  41.129  1.00 18.12  ? 381 LEU A N     1 
ATOM   3723 C CA    . LEU C 3 381 ? -16.554 20.168  39.952  1.00 18.39  ? 381 LEU A CA    1 
ATOM   3724 C C     . LEU C 3 381 ? -15.360 19.229  39.827  1.00 17.73  ? 381 LEU A C     1 
ATOM   3725 O O     . LEU C 3 381 ? -15.519 18.029  39.645  1.00 17.98  ? 381 LEU A O     1 
ATOM   3726 C CB    . LEU C 3 381 ? -16.690 21.022  38.680  1.00 16.33  ? 381 LEU A CB    1 
ATOM   3727 C CG    . LEU C 3 381 ? -17.753 20.620  37.644  1.00 18.11  ? 381 LEU A CG    1 
ATOM   3728 C CD1   . LEU C 3 381 ? -17.376 21.224  36.307  1.00 18.91  ? 381 LEU A CD1   1 
ATOM   3729 C CD2   . LEU C 3 381 ? -17.879 19.113  37.515  1.00 12.95  ? 381 LEU A CD2   1 
ATOM   3730 N N     . PHE C 3 382 ? -14.162 19.795  39.938  1.00 18.29  ? 382 PHE A N     1 
ATOM   3731 C CA    . PHE C 3 382 ? -12.929 19.029  39.863  1.00 16.24  ? 382 PHE A CA    1 
ATOM   3732 C C     . PHE C 3 382 ? -12.962 17.862  40.858  1.00 18.12  ? 382 PHE A C     1 
ATOM   3733 O O     . PHE C 3 382 ? -12.746 16.708  40.472  1.00 20.09  ? 382 PHE A O     1 
ATOM   3734 C CB    . PHE C 3 382 ? -11.749 19.938  40.172  1.00 14.96  ? 382 PHE A CB    1 
ATOM   3735 C CG    . PHE C 3 382 ? -10.418 19.288  39.990  1.00 12.98  ? 382 PHE A CG    1 
ATOM   3736 C CD1   . PHE C 3 382 ? -9.701  19.469  38.819  1.00 14.36  ? 382 PHE A CD1   1 
ATOM   3737 C CD2   . PHE C 3 382 ? -9.872  18.504  40.998  1.00 13.79  ? 382 PHE A CD2   1 
ATOM   3738 C CE1   . PHE C 3 382 ? -8.447  18.878  38.653  1.00 15.10  ? 382 PHE A CE1   1 
ATOM   3739 C CE2   . PHE C 3 382 ? -8.621  17.902  40.848  1.00 13.28  ? 382 PHE A CE2   1 
ATOM   3740 C CZ    . PHE C 3 382 ? -7.907  18.092  39.673  1.00 13.84  ? 382 PHE A CZ    1 
ATOM   3741 N N     . SER C 3 383 ? -13.240 18.158  42.128  1.00 16.82  ? 383 SER A N     1 
ATOM   3742 C CA    . SER C 3 383 ? -13.301 17.122  43.168  1.00 18.26  ? 383 SER A CA    1 
ATOM   3743 C C     . SER C 3 383 ? -14.252 15.982  42.839  1.00 16.70  ? 383 SER A C     1 
ATOM   3744 O O     . SER C 3 383 ? -13.949 14.816  43.105  1.00 15.87  ? 383 SER A O     1 
ATOM   3745 C CB    . SER C 3 383 ? -13.711 17.723  44.516  1.00 17.17  ? 383 SER A CB    1 
ATOM   3746 O OG    . SER C 3 383 ? -12.709 18.596  44.992  1.00 20.44  ? 383 SER A OG    1 
ATOM   3747 N N     . ALA C 3 384 ? -15.402 16.336  42.267  1.00 15.07  ? 384 ALA A N     1 
ATOM   3748 C CA    . ALA C 3 384 ? -16.421 15.375  41.894  1.00 14.69  ? 384 ALA A CA    1 
ATOM   3749 C C     . ALA C 3 384 ? -15.899 14.477  40.776  1.00 16.09  ? 384 ALA A C     1 
ATOM   3750 O O     . ALA C 3 384 ? -16.038 13.243  40.814  1.00 12.17  ? 384 ALA A O     1 
ATOM   3751 C CB    . ALA C 3 384 ? -17.659 16.105  41.439  1.00 16.34  ? 384 ALA A CB    1 
ATOM   3752 N N     . LEU C 3 385 ? -15.306 15.114  39.774  1.00 16.04  ? 385 LEU A N     1 
ATOM   3753 C CA    . LEU C 3 385 ? -14.745 14.394  38.650  1.00 17.82  ? 385 LEU A CA    1 
ATOM   3754 C C     . LEU C 3 385 ? -13.717 13.413  39.178  1.00 20.44  ? 385 LEU A C     1 
ATOM   3755 O O     . LEU C 3 385 ? -13.687 12.258  38.757  1.00 22.87  ? 385 LEU A O     1 
ATOM   3756 C CB    . LEU C 3 385 ? -14.100 15.374  37.677  1.00 15.96  ? 385 LEU A CB    1 
ATOM   3757 C CG    . LEU C 3 385 ? -15.133 15.990  36.740  1.00 14.31  ? 385 LEU A CG    1 
ATOM   3758 C CD1   . LEU C 3 385 ? -14.615 17.259  36.105  1.00 10.48  ? 385 LEU A CD1   1 
ATOM   3759 C CD2   . LEU C 3 385 ? -15.499 14.942  35.702  1.00 12.96  ? 385 LEU A CD2   1 
ATOM   3760 N N     . LEU C 3 386 ? -12.897 13.879  40.119  1.00 20.01  ? 386 LEU A N     1 
ATOM   3761 C CA    . LEU C 3 386 ? -11.859 13.058  40.729  1.00 20.19  ? 386 LEU A CA    1 
ATOM   3762 C C     . LEU C 3 386 ? -12.419 11.883  41.518  1.00 21.39  ? 386 LEU A C     1 
ATOM   3763 O O     . LEU C 3 386 ? -11.946 10.753  41.387  1.00 23.21  ? 386 LEU A O     1 
ATOM   3764 C CB    . LEU C 3 386 ? -10.991 13.910  41.656  1.00 19.31  ? 386 LEU A CB    1 
ATOM   3765 C CG    . LEU C 3 386 ? -9.991  13.140  42.522  1.00 17.64  ? 386 LEU A CG    1 
ATOM   3766 C CD1   . LEU C 3 386 ? -9.090  12.309  41.625  1.00 15.21  ? 386 LEU A CD1   1 
ATOM   3767 C CD2   . LEU C 3 386 ? -9.176  14.118  43.362  1.00 13.88  ? 386 LEU A CD2   1 
ATOM   3768 N N     . ILE C 3 387 ? -13.416 12.158  42.354  1.00 22.55  ? 387 ILE A N     1 
ATOM   3769 C CA    . ILE C 3 387 ? -14.041 11.117  43.163  1.00 21.89  ? 387 ILE A CA    1 
ATOM   3770 C C     . ILE C 3 387 ? -14.647 10.025  42.290  1.00 20.71  ? 387 ILE A C     1 
ATOM   3771 O O     . ILE C 3 387 ? -14.463 8.844   42.549  1.00 23.03  ? 387 ILE A O     1 
ATOM   3772 C CB    . ILE C 3 387 ? -15.157 11.709  44.085  1.00 21.50  ? 387 ILE A CB    1 
ATOM   3773 C CG1   . ILE C 3 387 ? -14.523 12.513  45.231  1.00 21.44  ? 387 ILE A CG1   1 
ATOM   3774 C CG2   . ILE C 3 387 ? -16.025 10.590  44.647  1.00 17.98  ? 387 ILE A CG2   1 
ATOM   3775 C CD1   . ILE C 3 387 ? -15.505 13.351  46.035  1.00 19.70  ? 387 ILE A CD1   1 
ATOM   3776 N N     . LYS C 3 388 ? -15.359 10.427  41.248  1.00 20.94  ? 388 LYS A N     1 
ATOM   3777 C CA    . LYS C 3 388 ? -16.003 9.470   40.367  1.00 21.18  ? 388 LYS A CA    1 
ATOM   3778 C C     . LYS C 3 388 ? -15.069 8.767   39.399  1.00 22.74  ? 388 LYS A C     1 
ATOM   3779 O O     . LYS C 3 388 ? -15.275 7.596   39.086  1.00 23.15  ? 388 LYS A O     1 
ATOM   3780 C CB    . LYS C 3 388 ? -17.154 10.136  39.612  1.00 19.95  ? 388 LYS A CB    1 
ATOM   3781 C CG    . LYS C 3 388 ? -18.415 10.293  40.464  1.00 21.77  ? 388 LYS A CG    1 
ATOM   3782 C CD    . LYS C 3 388 ? -18.902 8.938   40.984  1.00 23.40  ? 388 LYS A CD    1 
ATOM   3783 C CE    . LYS C 3 388 ? -20.202 9.064   41.771  1.00 26.52  ? 388 LYS A CE    1 
ATOM   3784 N NZ    . LYS C 3 388 ? -20.650 7.741   42.316  1.00 26.47  ? 388 LYS A NZ    1 
ATOM   3785 N N     . CYS C 3 389 ? -14.049 9.461   38.909  1.00 21.30  ? 389 CYS A N     1 
ATOM   3786 C CA    . CYS C 3 389 ? -13.123 8.807   38.007  1.00 20.61  ? 389 CYS A CA    1 
ATOM   3787 C C     . CYS C 3 389 ? -12.425 7.703   38.807  1.00 20.36  ? 389 CYS A C     1 
ATOM   3788 O O     . CYS C 3 389 ? -12.106 6.639   38.272  1.00 20.40  ? 389 CYS A O     1 
ATOM   3789 C CB    . CYS C 3 389 ? -12.103 9.807   37.444  1.00 19.64  ? 389 CYS A CB    1 
ATOM   3790 S SG    . CYS C 3 389 ? -12.692 10.818  36.027  1.00 19.21  ? 389 CYS A SG    1 
ATOM   3791 N N     . LEU C 3 390 ? -12.210 7.945   40.097  1.00 21.19  ? 390 LEU A N     1 
ATOM   3792 C CA    . LEU C 3 390 ? -11.556 6.948   40.937  1.00 21.64  ? 390 LEU A CA    1 
ATOM   3793 C C     . LEU C 3 390 ? -12.425 5.708   41.137  1.00 22.95  ? 390 LEU A C     1 
ATOM   3794 O O     . LEU C 3 390 ? -11.951 4.590   40.952  1.00 22.80  ? 390 LEU A O     1 
ATOM   3795 C CB    . LEU C 3 390 ? -11.163 7.555   42.286  1.00 19.94  ? 390 LEU A CB    1 
ATOM   3796 C CG    . LEU C 3 390 ? -9.860  8.380   42.252  1.00 22.16  ? 390 LEU A CG    1 
ATOM   3797 C CD1   . LEU C 3 390 ? -9.716  9.266   43.496  1.00 17.35  ? 390 LEU A CD1   1 
ATOM   3798 C CD2   . LEU C 3 390 ? -8.685  7.422   42.135  1.00 19.64  ? 390 LEU A CD2   1 
ATOM   3799 N N     . GLU C 3 391 ? -13.695 5.904   41.488  1.00 25.02  ? 391 GLU A N     1 
ATOM   3800 C CA    . GLU C 3 391 ? -14.614 4.785   41.707  1.00 26.60  ? 391 GLU A CA    1 
ATOM   3801 C C     . GLU C 3 391 ? -14.799 3.928   40.456  1.00 26.90  ? 391 GLU A C     1 
ATOM   3802 O O     . GLU C 3 391 ? -14.901 2.705   40.536  1.00 25.95  ? 391 GLU A O     1 
ATOM   3803 C CB    . GLU C 3 391 ? -15.990 5.287   42.147  1.00 28.68  ? 391 GLU A CB    1 
ATOM   3804 C CG    . GLU C 3 391 ? -15.950 6.490   43.052  1.00 32.65  ? 391 GLU A CG    1 
ATOM   3805 C CD    . GLU C 3 391 ? -17.223 6.656   43.855  1.00 34.96  ? 391 GLU A CD    1 
ATOM   3806 O OE1   . GLU C 3 391 ? -18.326 6.581   43.252  1.00 33.76  ? 391 GLU A OE1   1 
ATOM   3807 O OE2   . GLU C 3 391 ? -17.101 6.866   45.090  1.00 32.39  ? 391 GLU A OE2   1 
ATOM   3808 N N     . LYS C 3 392 ? -14.852 4.578   39.302  1.00 28.43  ? 392 LYS A N     1 
ATOM   3809 C CA    . LYS C 3 392 ? -15.043 3.870   38.045  1.00 28.76  ? 392 LYS A CA    1 
ATOM   3810 C C     . LYS C 3 392 ? -13.759 3.450   37.350  1.00 28.64  ? 392 LYS A C     1 
ATOM   3811 O O     . LYS C 3 392 ? -13.808 2.873   36.276  1.00 31.11  ? 392 LYS A O     1 
ATOM   3812 C CB    . LYS C 3 392 ? -15.893 4.716   37.106  1.00 28.04  ? 392 LYS A CB    1 
ATOM   3813 C CG    . LYS C 3 392 ? -17.259 4.995   37.677  1.00 29.99  ? 392 LYS A CG    1 
ATOM   3814 C CD    . LYS C 3 392 ? -18.161 5.643   36.653  1.00 32.41  ? 392 LYS A CD    1 
ATOM   3815 C CE    . LYS C 3 392 ? -19.605 5.586   37.106  1.00 33.31  ? 392 LYS A CE    1 
ATOM   3816 N NZ    . LYS C 3 392 ? -20.497 6.193   36.095  1.00 37.68  ? 392 LYS A NZ    1 
ATOM   3817 N N     . GLU C 3 393 ? -12.617 3.734   37.972  1.00 30.32  ? 393 GLU A N     1 
ATOM   3818 C CA    . GLU C 3 393 ? -11.305 3.366   37.426  1.00 29.91  ? 393 GLU A CA    1 
ATOM   3819 C C     . GLU C 3 393 ? -11.234 3.774   35.962  1.00 27.59  ? 393 GLU A C     1 
ATOM   3820 O O     . GLU C 3 393 ? -10.838 3.007   35.079  1.00 27.32  ? 393 GLU A O     1 
ATOM   3821 C CB    . GLU C 3 393 ? -11.088 1.863   37.583  1.00 32.19  ? 393 GLU A CB    1 
ATOM   3822 C CG    . GLU C 3 393 ? -11.615 1.340   38.910  1.00 37.52  ? 393 GLU A CG    1 
ATOM   3823 C CD    . GLU C 3 393 ? -11.125 -0.053  39.244  1.00 40.64  ? 393 GLU A CD    1 
ATOM   3824 O OE1   . GLU C 3 393 ? -11.199 -0.950  38.374  1.00 41.25  ? 393 GLU A OE1   1 
ATOM   3825 O OE2   . GLU C 3 393 ? -10.672 -0.250  40.391  1.00 43.52  ? 393 GLU A OE2   1 
ATOM   3826 N N     . VAL C 3 394 ? -11.611 5.020   35.742  1.00 23.85  ? 394 VAL A N     1 
ATOM   3827 C CA    . VAL C 3 394 ? -11.665 5.609   34.429  1.00 21.45  ? 394 VAL A CA    1 
ATOM   3828 C C     . VAL C 3 394 ? -10.773 6.850   34.335  1.00 20.62  ? 394 VAL A C     1 
ATOM   3829 O O     . VAL C 3 394 ? -10.470 7.496   35.341  1.00 19.64  ? 394 VAL A O     1 
ATOM   3830 C CB    . VAL C 3 394 ? -13.154 5.968   34.128  1.00 22.08  ? 394 VAL A CB    1 
ATOM   3831 C CG1   . VAL C 3 394 ? -13.292 7.408   33.691  1.00 20.24  ? 394 VAL A CG1   1 
ATOM   3832 C CG2   . VAL C 3 394 ? -13.721 5.005   33.102  1.00 18.78  ? 394 VAL A CG2   1 
ATOM   3833 N N     . ALA C 3 395 ? -10.350 7.180   33.120  1.00 19.55  ? 395 ALA A N     1 
ATOM   3834 C CA    . ALA C 3 395 ? -9.527  8.368   32.907  1.00 18.83  ? 395 ALA A CA    1 
ATOM   3835 C C     . ALA C 3 395 ? -10.266 9.329   31.990  1.00 18.86  ? 395 ALA A C     1 
ATOM   3836 O O     . ALA C 3 395 ? -11.070 8.910   31.154  1.00 19.06  ? 395 ALA A O     1 
ATOM   3837 C CB    . ALA C 3 395 ? -8.182  7.991   32.287  1.00 13.30  ? 395 ALA A CB    1 
ATOM   3838 N N     . ALA C 3 396 ? -10.001 10.620  32.159  1.00 20.34  ? 396 ALA A N     1 
ATOM   3839 C CA    . ALA C 3 396 ? -10.616 11.639  31.327  1.00 19.58  ? 396 ALA A CA    1 
ATOM   3840 C C     . ALA C 3 396 ? -9.713  11.905  30.117  1.00 21.58  ? 396 ALA A C     1 
ATOM   3841 O O     . ALA C 3 396 ? -8.617  12.461  30.265  1.00 22.81  ? 396 ALA A O     1 
ATOM   3842 C CB    . ALA C 3 396 ? -10.795 12.907  32.124  1.00 17.55  ? 396 ALA A CB    1 
ATOM   3843 N N     . LEU C 3 397 ? -10.161 11.499  28.931  1.00 20.18  ? 397 LEU A N     1 
ATOM   3844 C CA    . LEU C 3 397 ? -9.377  11.726  27.714  1.00 21.87  ? 397 LEU A CA    1 
ATOM   3845 C C     . LEU C 3 397 ? -9.605  13.154  27.234  1.00 21.08  ? 397 LEU A C     1 
ATOM   3846 O O     . LEU C 3 397 ? -10.749 13.626  27.172  1.00 20.52  ? 397 LEU A O     1 
ATOM   3847 C CB    . LEU C 3 397 ? -9.767  10.731  26.610  1.00 21.11  ? 397 LEU A CB    1 
ATOM   3848 C CG    . LEU C 3 397 ? -8.951  10.795  25.302  1.00 24.05  ? 397 LEU A CG    1 
ATOM   3849 C CD1   . LEU C 3 397 ? -7.483  10.556  25.586  1.00 24.91  ? 397 LEU A CD1   1 
ATOM   3850 C CD2   . LEU C 3 397 ? -9.446  9.734   24.321  1.00 26.84  ? 397 LEU A CD2   1 
ATOM   3851 N N     . CYS C 3 398 ? -8.516  13.842  26.900  1.00 20.26  ? 398 CYS A N     1 
ATOM   3852 C CA    . CYS C 3 398 ? -8.603  15.231  26.449  1.00 20.55  ? 398 CYS A CA    1 
ATOM   3853 C C     . CYS C 3 398 ? -7.663  15.579  25.303  1.00 18.43  ? 398 CYS A C     1 
ATOM   3854 O O     . CYS C 3 398 ? -6.628  14.944  25.115  1.00 16.98  ? 398 CYS A O     1 
ATOM   3855 C CB    . CYS C 3 398 ? -8.272  16.191  27.598  1.00 21.89  ? 398 CYS A CB    1 
ATOM   3856 S SG    . CYS C 3 398 ? -9.305  16.107  29.052  1.00 27.61  ? 398 CYS A SG    1 
ATOM   3857 N N     . ARG C 3 399 ? -8.038  16.608  24.548  1.00 19.45  ? 399 ARG A N     1 
ATOM   3858 C CA    . ARG C 3 399 ? -7.212  17.111  23.456  1.00 21.14  ? 399 ARG A CA    1 
ATOM   3859 C C     . ARG C 3 399 ? -6.536  18.319  24.123  1.00 21.26  ? 399 ARG A C     1 
ATOM   3860 O O     . ARG C 3 399 ? -7.199  19.236  24.619  1.00 19.97  ? 399 ARG A O     1 
ATOM   3861 C CB    . ARG C 3 399 ? -8.078  17.510  22.256  1.00 20.10  ? 399 ARG A CB    1 
ATOM   3862 C CG    . ARG C 3 399 ? -7.305  17.550  20.945  1.00 22.49  ? 399 ARG A CG    1 
ATOM   3863 C CD    . ARG C 3 399 ? -8.238  17.497  19.741  1.00 20.47  ? 399 ARG A CD    1 
ATOM   3864 N NE    . ARG C 3 399 ? -9.103  18.666  19.690  1.00 20.43  ? 399 ARG A NE    1 
ATOM   3865 C CZ    . ARG C 3 399 ? -10.349 18.655  19.237  1.00 18.26  ? 399 ARG A CZ    1 
ATOM   3866 N NH1   . ARG C 3 399 ? -10.884 17.525  18.797  1.00 15.77  ? 399 ARG A NH1   1 
ATOM   3867 N NH2   . ARG C 3 399 ? -11.054 19.780  19.219  1.00 22.19  ? 399 ARG A NH2   1 
ATOM   3868 N N     . TYR C 3 400 ? -5.211  18.295  24.151  1.00 21.00  ? 400 TYR A N     1 
ATOM   3869 C CA    . TYR C 3 400 ? -4.439  19.314  24.845  1.00 20.67  ? 400 TYR A CA    1 
ATOM   3870 C C     . TYR C 3 400 ? -3.606  20.245  23.978  1.00 21.40  ? 400 TYR A C     1 
ATOM   3871 O O     . TYR C 3 400 ? -2.889  19.802  23.086  1.00 21.51  ? 400 TYR A O     1 
ATOM   3872 C CB    . TYR C 3 400 ? -3.567  18.582  25.870  1.00 20.17  ? 400 TYR A CB    1 
ATOM   3873 C CG    . TYR C 3 400 ? -2.495  19.365  26.583  1.00 18.88  ? 400 TYR A CG    1 
ATOM   3874 C CD1   . TYR C 3 400 ? -2.805  20.428  27.436  1.00 19.17  ? 400 TYR A CD1   1 
ATOM   3875 C CD2   . TYR C 3 400 ? -1.167  18.977  26.475  1.00 17.40  ? 400 TYR A CD2   1 
ATOM   3876 C CE1   . TYR C 3 400 ? -1.805  21.077  28.171  1.00 17.13  ? 400 TYR A CE1   1 
ATOM   3877 C CE2   . TYR C 3 400 ? -0.175  19.611  27.192  1.00 16.56  ? 400 TYR A CE2   1 
ATOM   3878 C CZ    . TYR C 3 400 ? -0.492  20.656  28.036  1.00 18.49  ? 400 TYR A CZ    1 
ATOM   3879 O OH    . TYR C 3 400 ? 0.527   21.270  28.713  1.00 18.74  ? 400 TYR A OH    1 
ATOM   3880 N N     . THR C 3 401 ? -3.721  21.540  24.271  1.00 22.05  ? 401 THR A N     1 
ATOM   3881 C CA    . THR C 3 401 ? -3.008  22.609  23.585  1.00 22.73  ? 401 THR A CA    1 
ATOM   3882 C C     . THR C 3 401 ? -2.485  23.544  24.676  1.00 23.33  ? 401 THR A C     1 
ATOM   3883 O O     . THR C 3 401 ? -3.248  24.306  25.265  1.00 25.00  ? 401 THR A O     1 
ATOM   3884 C CB    . THR C 3 401 ? -3.955  23.362  22.663  1.00 23.83  ? 401 THR A CB    1 
ATOM   3885 O OG1   . THR C 3 401 ? -4.471  22.448  21.691  1.00 26.50  ? 401 THR A OG1   1 
ATOM   3886 C CG2   . THR C 3 401 ? -3.240  24.498  21.955  1.00 24.06  ? 401 THR A CG2   1 
ATOM   3887 N N     . PRO C 3 402 ? -1.176  23.471  24.974  1.00 24.80  ? 402 PRO A N     1 
ATOM   3888 C CA    . PRO C 3 402 ? -0.417  24.232  25.975  1.00 27.83  ? 402 PRO A CA    1 
ATOM   3889 C C     . PRO C 3 402 ? -0.379  25.745  25.817  1.00 30.36  ? 402 PRO A C     1 
ATOM   3890 O O     . PRO C 3 402 ? -0.454  26.487  26.795  1.00 30.30  ? 402 PRO A O     1 
ATOM   3891 C CB    . PRO C 3 402 ? 0.982   23.632  25.870  1.00 25.74  ? 402 PRO A CB    1 
ATOM   3892 C CG    . PRO C 3 402 ? 0.726   22.268  25.399  1.00 26.40  ? 402 PRO A CG    1 
ATOM   3893 C CD    . PRO C 3 402 ? -0.300  22.477  24.341  1.00 26.16  ? 402 PRO A CD    1 
ATOM   3894 N N     . ARG C 3 403 ? -0.227  26.186  24.578  1.00 32.90  ? 403 ARG A N     1 
ATOM   3895 C CA    . ARG C 3 403 ? -0.157  27.600  24.260  1.00 36.23  ? 403 ARG A CA    1 
ATOM   3896 C C     . ARG C 3 403 ? -0.680  27.767  22.838  1.00 35.91  ? 403 ARG A C     1 
ATOM   3897 O O     . ARG C 3 403 ? -0.998  26.786  22.170  1.00 36.60  ? 403 ARG A O     1 
ATOM   3898 C CB    . ARG C 3 403 ? 1.290   28.073  24.344  1.00 39.01  ? 403 ARG A CB    1 
ATOM   3899 C CG    . ARG C 3 403 ? 2.215   27.244  23.485  1.00 44.61  ? 403 ARG A CG    1 
ATOM   3900 C CD    . ARG C 3 403 ? 3.590   27.865  23.348  1.00 50.50  ? 403 ARG A CD    1 
ATOM   3901 N NE    . ARG C 3 403 ? 4.365   27.180  22.317  1.00 54.58  ? 403 ARG A NE    1 
ATOM   3902 C CZ    . ARG C 3 403 ? 5.546   27.588  21.868  1.00 56.92  ? 403 ARG A CZ    1 
ATOM   3903 N NH1   . ARG C 3 403 ? 6.105   28.686  22.363  1.00 59.21  ? 403 ARG A NH1   1 
ATOM   3904 N NH2   . ARG C 3 403 ? 6.161   26.906  20.910  1.00 58.09  ? 403 ARG A NH2   1 
ATOM   3905 N N     . ARG C 3 404 ? -0.756  29.004  22.372  1.00 34.72  ? 404 ARG A N     1 
ATOM   3906 C CA    . ARG C 3 404 ? -1.255  29.272  21.036  1.00 35.88  ? 404 ARG A CA    1 
ATOM   3907 C C     . ARG C 3 404 ? -0.364  28.747  19.911  1.00 34.35  ? 404 ARG A C     1 
ATOM   3908 O O     . ARG C 3 404 ? 0.847   28.601  20.068  1.00 33.75  ? 404 ARG A O     1 
ATOM   3909 C CB    . ARG C 3 404 ? -1.485  30.773  20.883  1.00 37.62  ? 404 ARG A CB    1 
ATOM   3910 C CG    . ARG C 3 404 ? -2.518  31.276  21.861  1.00 39.92  ? 404 ARG A CG    1 
ATOM   3911 C CD    . ARG C 3 404 ? -2.865  32.748  21.688  1.00 44.03  ? 404 ARG A CD    1 
ATOM   3912 N NE    . ARG C 3 404 ? -4.129  33.036  22.365  1.00 45.00  ? 404 ARG A NE    1 
ATOM   3913 C CZ    . ARG C 3 404 ? -5.312  32.590  21.949  1.00 46.14  ? 404 ARG A CZ    1 
ATOM   3914 N NH1   . ARG C 3 404 ? -5.397  31.846  20.849  1.00 44.67  ? 404 ARG A NH1   1 
ATOM   3915 N NH2   . ARG C 3 404 ? -6.408  32.863  22.650  1.00 46.87  ? 404 ARG A NH2   1 
ATOM   3916 N N     . ASN C 3 405 ? -0.981  28.446  18.776  1.00 33.83  ? 405 ASN A N     1 
ATOM   3917 C CA    . ASN C 3 405 ? -0.254  27.942  17.618  1.00 34.94  ? 405 ASN A CA    1 
ATOM   3918 C C     . ASN C 3 405 ? 0.574   26.692  17.880  1.00 34.08  ? 405 ASN A C     1 
ATOM   3919 O O     . ASN C 3 405 ? 1.767   26.665  17.586  1.00 35.63  ? 405 ASN A O     1 
ATOM   3920 C CB    . ASN C 3 405 ? 0.667   29.026  17.041  1.00 36.18  ? 405 ASN A CB    1 
ATOM   3921 C CG    . ASN C 3 405 ? -0.068  30.309  16.734  1.00 38.57  ? 405 ASN A CG    1 
ATOM   3922 O OD1   . ASN C 3 405 ? -1.108  30.300  16.076  1.00 39.39  ? 405 ASN A OD1   1 
ATOM   3923 N ND2   . ASN C 3 405 ? 0.471   31.427  17.206  1.00 40.74  ? 405 ASN A ND2   1 
ATOM   3924 N N     . ILE C 3 406 ? -0.052  25.663  18.439  1.00 32.08  ? 406 ILE A N     1 
ATOM   3925 C CA    . ILE C 3 406 ? 0.635   24.401  18.686  1.00 29.42  ? 406 ILE A CA    1 
ATOM   3926 C C     . ILE C 3 406 ? -0.348  23.288  18.358  1.00 26.97  ? 406 ILE A C     1 
ATOM   3927 O O     . ILE C 3 406 ? -1.509  23.325  18.778  1.00 27.00  ? 406 ILE A O     1 
ATOM   3928 C CB    . ILE C 3 406 ? 1.101   24.256  20.147  1.00 30.06  ? 406 ILE A CB    1 
ATOM   3929 C CG1   . ILE C 3 406 ? 1.944   22.991  20.293  1.00 30.91  ? 406 ILE A CG1   1 
ATOM   3930 C CG2   . ILE C 3 406 ? -0.089  24.168  21.070  1.00 32.46  ? 406 ILE A CG2   1 
ATOM   3931 C CD1   . ILE C 3 406 ? 2.343   22.675  21.719  1.00 32.96  ? 406 ILE A CD1   1 
ATOM   3932 N N     . PRO C 3 407 ? 0.092   22.290  17.579  1.00 24.67  ? 407 PRO A N     1 
ATOM   3933 C CA    . PRO C 3 407 ? -0.821  21.197  17.234  1.00 20.87  ? 407 PRO A CA    1 
ATOM   3934 C C     . PRO C 3 407 ? -1.242  20.479  18.510  1.00 19.54  ? 407 PRO A C     1 
ATOM   3935 O O     . PRO C 3 407 ? -0.513  20.484  19.498  1.00 16.66  ? 407 PRO A O     1 
ATOM   3936 C CB    . PRO C 3 407 ? 0.018   20.325  16.303  1.00 22.47  ? 407 PRO A CB    1 
ATOM   3937 C CG    . PRO C 3 407 ? 1.038   21.298  15.731  1.00 22.83  ? 407 PRO A CG    1 
ATOM   3938 C CD    . PRO C 3 407 ? 1.403   22.105  16.941  1.00 20.85  ? 407 PRO A CD    1 
ATOM   3939 N N     . PRO C 3 408 ? -2.428  19.851  18.508  1.00 20.95  ? 408 PRO A N     1 
ATOM   3940 C CA    . PRO C 3 408 ? -2.891  19.150  19.708  1.00 18.99  ? 408 PRO A CA    1 
ATOM   3941 C C     . PRO C 3 408 ? -2.296  17.764  19.971  1.00 20.06  ? 408 PRO A C     1 
ATOM   3942 O O     . PRO C 3 408 ? -1.830  17.087  19.056  1.00 21.99  ? 408 PRO A O     1 
ATOM   3943 C CB    . PRO C 3 408 ? -4.403  19.092  19.494  1.00 17.92  ? 408 PRO A CB    1 
ATOM   3944 C CG    . PRO C 3 408 ? -4.506  18.922  18.021  1.00 15.02  ? 408 PRO A CG    1 
ATOM   3945 C CD    . PRO C 3 408 ? -3.497  19.911  17.493  1.00 18.35  ? 408 PRO A CD    1 
ATOM   3946 N N     . TYR C 3 409 ? -2.309  17.363  21.238  1.00 20.11  ? 409 TYR A N     1 
ATOM   3947 C CA    . TYR C 3 409 ? -1.837  16.042  21.649  1.00 17.44  ? 409 TYR A CA    1 
ATOM   3948 C C     . TYR C 3 409 ? -2.926  15.460  22.540  1.00 18.32  ? 409 TYR A C     1 
ATOM   3949 O O     . TYR C 3 409 ? -3.559  16.183  23.331  1.00 15.29  ? 409 TYR A O     1 
ATOM   3950 C CB    . TYR C 3 409 ? -0.524  16.116  22.443  1.00 17.51  ? 409 TYR A CB    1 
ATOM   3951 C CG    . TYR C 3 409 ? 0.644   15.489  21.718  1.00 18.34  ? 409 TYR A CG    1 
ATOM   3952 C CD1   . TYR C 3 409 ? 1.365   16.212  20.775  1.00 17.32  ? 409 TYR A CD1   1 
ATOM   3953 C CD2   . TYR C 3 409 ? 0.944   14.139  21.884  1.00 17.16  ? 409 TYR A CD2   1 
ATOM   3954 C CE1   . TYR C 3 409 ? 2.347   15.609  20.004  1.00 18.46  ? 409 TYR A CE1   1 
ATOM   3955 C CE2   . TYR C 3 409 ? 1.920   13.517  21.119  1.00 19.49  ? 409 TYR A CE2   1 
ATOM   3956 C CZ    . TYR C 3 409 ? 2.619   14.256  20.173  1.00 22.17  ? 409 TYR A CZ    1 
ATOM   3957 O OH    . TYR C 3 409 ? 3.554   13.643  19.367  1.00 20.45  ? 409 TYR A OH    1 
ATOM   3958 N N     . PHE C 3 410 ? -3.181  14.167  22.390  1.00 17.04  ? 410 PHE A N     1 
ATOM   3959 C CA    . PHE C 3 410 ? -4.181  13.527  23.222  1.00 15.16  ? 410 PHE A CA    1 
ATOM   3960 C C     . PHE C 3 410 ? -3.505  13.152  24.521  1.00 15.10  ? 410 PHE A C     1 
ATOM   3961 O O     . PHE C 3 410 ? -2.382  12.661  24.520  1.00 15.65  ? 410 PHE A O     1 
ATOM   3962 C CB    . PHE C 3 410 ? -4.749  12.280  22.545  1.00 14.78  ? 410 PHE A CB    1 
ATOM   3963 C CG    . PHE C 3 410 ? -5.723  12.587  21.459  1.00 13.49  ? 410 PHE A CG    1 
ATOM   3964 C CD1   . PHE C 3 410 ? -5.381  12.403  20.123  1.00 12.76  ? 410 PHE A CD1   1 
ATOM   3965 C CD2   . PHE C 3 410 ? -6.981  13.107  21.771  1.00 10.82  ? 410 PHE A CD2   1 
ATOM   3966 C CE1   . PHE C 3 410 ? -6.287  12.740  19.103  1.00 13.06  ? 410 PHE A CE1   1 
ATOM   3967 C CE2   . PHE C 3 410 ? -7.878  13.440  20.775  1.00 8.50   ? 410 PHE A CE2   1 
ATOM   3968 C CZ    . PHE C 3 410 ? -7.535  13.260  19.435  1.00 11.22  ? 410 PHE A CZ    1 
ATOM   3969 N N     . VAL C 3 411 ? -4.190  13.394  25.628  1.00 14.91  ? 411 VAL A N     1 
ATOM   3970 C CA    . VAL C 3 411 ? -3.645  13.079  26.934  1.00 14.66  ? 411 VAL A CA    1 
ATOM   3971 C C     . VAL C 3 411 ? -4.737  12.388  27.737  1.00 14.98  ? 411 VAL A C     1 
ATOM   3972 O O     . VAL C 3 411 ? -5.928  12.524  27.424  1.00 15.19  ? 411 VAL A O     1 
ATOM   3973 C CB    . VAL C 3 411 ? -3.174  14.378  27.674  1.00 16.37  ? 411 VAL A CB    1 
ATOM   3974 C CG1   . VAL C 3 411 ? -2.161  15.138  26.825  1.00 13.36  ? 411 VAL A CG1   1 
ATOM   3975 C CG2   . VAL C 3 411 ? -4.366  15.288  27.969  1.00 19.03  ? 411 VAL A CG2   1 
ATOM   3976 N N     . ALA C 3 412 ? -4.330  11.620  28.744  1.00 14.34  ? 412 ALA A N     1 
ATOM   3977 C CA    . ALA C 3 412 ? -5.267  10.924  29.625  1.00 14.98  ? 412 ALA A CA    1 
ATOM   3978 C C     . ALA C 3 412 ? -5.112  11.511  31.028  1.00 15.29  ? 412 ALA A C     1 
ATOM   3979 O O     . ALA C 3 412 ? -4.033  11.452  31.600  1.00 16.82  ? 412 ALA A O     1 
ATOM   3980 C CB    . ALA C 3 412 ? -4.962  9.420   29.660  1.00 11.17  ? 412 ALA A CB    1 
ATOM   3981 N N     . LEU C 3 413 ? -6.162  12.107  31.579  1.00 14.86  ? 413 LEU A N     1 
ATOM   3982 C CA    . LEU C 3 413 ? -6.037  12.640  32.933  1.00 15.75  ? 413 LEU A CA    1 
ATOM   3983 C C     . LEU C 3 413 ? -6.319  11.451  33.834  1.00 14.07  ? 413 LEU A C     1 
ATOM   3984 O O     . LEU C 3 413 ? -7.444  10.974  33.914  1.00 14.69  ? 413 LEU A O     1 
ATOM   3985 C CB    . LEU C 3 413 ? -7.041  13.776  33.195  1.00 15.68  ? 413 LEU A CB    1 
ATOM   3986 C CG    . LEU C 3 413 ? -6.882  15.057  32.363  1.00 16.37  ? 413 LEU A CG    1 
ATOM   3987 C CD1   . LEU C 3 413 ? -7.631  16.184  33.041  1.00 18.94  ? 413 LEU A CD1   1 
ATOM   3988 C CD2   . LEU C 3 413 ? -5.426  15.436  32.239  1.00 15.41  ? 413 LEU A CD2   1 
ATOM   3989 N N     . VAL C 3 414 ? -5.280  10.953  34.488  1.00 15.14  ? 414 VAL A N     1 
ATOM   3990 C CA    . VAL C 3 414 ? -5.419  9.793   35.349  1.00 15.43  ? 414 VAL A CA    1 
ATOM   3991 C C     . VAL C 3 414 ? -5.657  10.191  36.802  1.00 16.40  ? 414 VAL A C     1 
ATOM   3992 O O     . VAL C 3 414 ? -4.837  10.883  37.424  1.00 16.19  ? 414 VAL A O     1 
ATOM   3993 C CB    . VAL C 3 414 ? -4.175  8.893   35.242  1.00 13.36  ? 414 VAL A CB    1 
ATOM   3994 C CG1   . VAL C 3 414 ? -4.295  7.707   36.189  1.00 10.52  ? 414 VAL A CG1   1 
ATOM   3995 C CG2   . VAL C 3 414 ? -4.003  8.440   33.801  1.00 11.17  ? 414 VAL A CG2   1 
ATOM   3996 N N     . PRO C 3 415 ? -6.799  9.763   37.359  1.00 15.38  ? 415 PRO A N     1 
ATOM   3997 C CA    . PRO C 3 415 ? -7.134  10.086  38.748  1.00 17.61  ? 415 PRO A CA    1 
ATOM   3998 C C     . PRO C 3 415 ? -6.029  9.656   39.710  1.00 17.24  ? 415 PRO A C     1 
ATOM   3999 O O     . PRO C 3 415 ? -5.514  8.546   39.620  1.00 18.30  ? 415 PRO A O     1 
ATOM   4000 C CB    . PRO C 3 415 ? -8.460  9.350   38.965  1.00 14.64  ? 415 PRO A CB    1 
ATOM   4001 C CG    . PRO C 3 415 ? -8.421  8.238   37.961  1.00 13.57  ? 415 PRO A CG    1 
ATOM   4002 C CD    . PRO C 3 415 ? -7.826  8.899   36.753  1.00 14.67  ? 415 PRO A CD    1 
ATOM   4003 N N     . GLN C 3 416 ? -5.674  10.551  40.624  1.00 16.82  ? 416 GLN A N     1 
ATOM   4004 C CA    . GLN C 3 416 ? -4.618  10.296  41.591  1.00 20.74  ? 416 GLN A CA    1 
ATOM   4005 C C     . GLN C 3 416 ? -5.067  10.671  43.017  1.00 23.67  ? 416 GLN A C     1 
ATOM   4006 O O     . GLN C 3 416 ? -5.288  11.848  43.341  1.00 22.77  ? 416 GLN A O     1 
ATOM   4007 C CB    . GLN C 3 416 ? -3.381  11.098  41.171  1.00 19.37  ? 416 GLN A CB    1 
ATOM   4008 C CG    . GLN C 3 416 ? -2.154  10.897  42.014  1.00 22.14  ? 416 GLN A CG    1 
ATOM   4009 C CD    . GLN C 3 416 ? -0.958  11.637  41.448  1.00 24.42  ? 416 GLN A CD    1 
ATOM   4010 O OE1   . GLN C 3 416 ? -0.378  11.215  40.445  1.00 26.85  ? 416 GLN A OE1   1 
ATOM   4011 N NE2   . GLN C 3 416 ? -0.589  12.754  42.079  1.00 20.05  ? 416 GLN A NE2   1 
ATOM   4012 N N     . GLU C 3 417 ? -5.203  9.661   43.867  1.00 25.71  ? 417 GLU A N     1 
ATOM   4013 C CA    . GLU C 3 417 ? -5.633  9.876   45.239  1.00 27.13  ? 417 GLU A CA    1 
ATOM   4014 C C     . GLU C 3 417 ? -4.479  10.287  46.155  1.00 27.11  ? 417 GLU A C     1 
ATOM   4015 O O     . GLU C 3 417 ? -3.363  9.784   46.033  1.00 26.22  ? 417 GLU A O     1 
ATOM   4016 C CB    . GLU C 3 417 ? -6.290  8.602   45.768  1.00 30.50  ? 417 GLU A CB    1 
ATOM   4017 C CG    . GLU C 3 417 ? -6.895  8.735   47.157  1.00 38.35  ? 417 GLU A CG    1 
ATOM   4018 C CD    . GLU C 3 417 ? -7.631  7.478   47.592  1.00 43.00  ? 417 GLU A CD    1 
ATOM   4019 O OE1   . GLU C 3 417 ? -8.157  7.450   48.732  1.00 46.08  ? 417 GLU A OE1   1 
ATOM   4020 O OE2   . GLU C 3 417 ? -7.683  6.517   46.789  1.00 43.69  ? 417 GLU A OE2   1 
ATOM   4021 N N     . GLU C 3 418 ? -4.760  11.207  47.074  1.00 26.30  ? 418 GLU A N     1 
ATOM   4022 C CA    . GLU C 3 418 ? -3.767  11.688  48.032  1.00 25.79  ? 418 GLU A CA    1 
ATOM   4023 C C     . GLU C 3 418 ? -3.196  10.565  48.887  1.00 25.87  ? 418 GLU A C     1 
ATOM   4024 O O     . GLU C 3 418 ? -3.902  9.624   49.248  1.00 23.20  ? 418 GLU A O     1 
ATOM   4025 C CB    . GLU C 3 418 ? -4.399  12.722  48.957  1.00 26.98  ? 418 GLU A CB    1 
ATOM   4026 C CG    . GLU C 3 418 ? -3.463  13.302  50.009  1.00 29.27  ? 418 GLU A CG    1 
ATOM   4027 C CD    . GLU C 3 418 ? -4.165  14.309  50.911  1.00 30.29  ? 418 GLU A CD    1 
ATOM   4028 O OE1   . GLU C 3 418 ? -3.501  15.249  51.384  1.00 29.08  ? 418 GLU A OE1   1 
ATOM   4029 O OE2   . GLU C 3 418 ? -5.384  14.157  51.153  1.00 33.61  ? 418 GLU A OE2   1 
ATOM   4030 N N     . GLU C 3 419 ? -1.912  10.669  49.211  1.00 27.11  ? 419 GLU A N     1 
ATOM   4031 C CA    . GLU C 3 419 ? -1.266  9.672   50.053  1.00 28.57  ? 419 GLU A CA    1 
ATOM   4032 C C     . GLU C 3 419 ? -0.262  10.333  51.000  1.00 27.82  ? 419 GLU A C     1 
ATOM   4033 O O     . GLU C 3 419 ? 0.573   11.139  50.580  1.00 27.65  ? 419 GLU A O     1 
ATOM   4034 C CB    . GLU C 3 419 ? -0.560  8.616   49.196  1.00 30.01  ? 419 GLU A CB    1 
ATOM   4035 C CG    . GLU C 3 419 ? 0.109   7.495   49.996  1.00 32.92  ? 419 GLU A CG    1 
ATOM   4036 C CD    . GLU C 3 419 ? 0.913   6.551   49.112  1.00 37.31  ? 419 GLU A CD    1 
ATOM   4037 O OE1   . GLU C 3 419 ? 0.337   5.980   48.163  1.00 40.53  ? 419 GLU A OE1   1 
ATOM   4038 O OE2   . GLU C 3 419 ? 2.124   6.376   49.359  1.00 39.08  ? 419 GLU A OE2   1 
ATOM   4039 N N     . LEU C 3 420 ? -0.364  9.991   52.280  1.00 26.95  ? 420 LEU A N     1 
ATOM   4040 C CA    . LEU C 3 420 ? 0.531   10.522  53.295  1.00 26.99  ? 420 LEU A CA    1 
ATOM   4041 C C     . LEU C 3 420 ? 1.292   9.351   53.869  1.00 27.56  ? 420 LEU A C     1 
ATOM   4042 O O     . LEU C 3 420 ? 0.734   8.263   53.968  1.00 28.26  ? 420 LEU A O     1 
ATOM   4043 C CB    . LEU C 3 420 ? -0.266  11.194  54.420  1.00 26.75  ? 420 LEU A CB    1 
ATOM   4044 C CG    . LEU C 3 420 ? -1.199  12.362  54.081  1.00 26.88  ? 420 LEU A CG    1 
ATOM   4045 C CD1   . LEU C 3 420 ? -1.752  12.948  55.367  1.00 26.94  ? 420 LEU A CD1   1 
ATOM   4046 C CD2   . LEU C 3 420 ? -0.461  13.424  53.288  1.00 20.80  ? 420 LEU A CD2   1 
ATOM   4047 N N     . ASP C 3 421 ? 2.561   9.546   54.225  1.00 28.45  ? 421 ASP A N     1 
ATOM   4048 C CA    . ASP C 3 421 ? 3.312   8.450   54.831  1.00 28.74  ? 421 ASP A CA    1 
ATOM   4049 C C     . ASP C 3 421 ? 3.196   8.514   56.356  1.00 29.99  ? 421 ASP A C     1 
ATOM   4050 O O     . ASP C 3 421 ? 2.367   9.271   56.886  1.00 30.61  ? 421 ASP A O     1 
ATOM   4051 C CB    . ASP C 3 421 ? 4.786   8.439   54.390  1.00 28.19  ? 421 ASP A CB    1 
ATOM   4052 C CG    . ASP C 3 421 ? 5.539   9.697   54.757  1.00 26.80  ? 421 ASP A CG    1 
ATOM   4053 O OD1   . ASP C 3 421 ? 5.057   10.513  55.559  1.00 26.38  ? 421 ASP A OD1   1 
ATOM   4054 O OD2   . ASP C 3 421 ? 6.654   9.856   54.232  1.00 30.46  ? 421 ASP A OD2   1 
ATOM   4055 N N     . ASP C 3 422 ? 4.008   7.727   57.060  1.00 30.70  ? 422 ASP A N     1 
ATOM   4056 C CA    . ASP C 3 422 ? 3.944   7.690   58.523  1.00 31.20  ? 422 ASP A CA    1 
ATOM   4057 C C     . ASP C 3 422 ? 4.311   9.003   59.188  1.00 30.41  ? 422 ASP A C     1 
ATOM   4058 O O     . ASP C 3 422 ? 3.963   9.230   60.344  1.00 31.80  ? 422 ASP A O     1 
ATOM   4059 C CB    . ASP C 3 422 ? 4.846   6.583   59.082  1.00 34.09  ? 422 ASP A CB    1 
ATOM   4060 C CG    . ASP C 3 422 ? 6.304   6.749   58.668  1.00 38.32  ? 422 ASP A CG    1 
ATOM   4061 O OD1   . ASP C 3 422 ? 6.739   7.907   58.466  1.00 38.43  ? 422 ASP A OD1   1 
ATOM   4062 O OD2   . ASP C 3 422 ? 7.016   5.723   58.558  1.00 38.37  ? 422 ASP A OD2   1 
ATOM   4063 N N     . GLN C 3 423 ? 5.021   9.861   58.464  1.00 29.03  ? 423 GLN A N     1 
ATOM   4064 C CA    . GLN C 3 423 ? 5.437   11.156  58.990  1.00 26.05  ? 423 GLN A CA    1 
ATOM   4065 C C     . GLN C 3 423 ? 4.399   12.228  58.721  1.00 25.98  ? 423 GLN A C     1 
ATOM   4066 O O     . GLN C 3 423 ? 4.518   13.354  59.211  1.00 27.42  ? 423 GLN A O     1 
ATOM   4067 C CB    . GLN C 3 423 ? 6.766   11.576  58.358  1.00 26.89  ? 423 GLN A CB    1 
ATOM   4068 C CG    . GLN C 3 423 ? 7.950   10.745  58.806  1.00 24.49  ? 423 GLN A CG    1 
ATOM   4069 C CD    . GLN C 3 423 ? 8.147   10.815  60.305  1.00 26.17  ? 423 GLN A CD    1 
ATOM   4070 O OE1   . GLN C 3 423 ? 8.582   11.836  60.841  1.00 27.44  ? 423 GLN A OE1   1 
ATOM   4071 N NE2   . GLN C 3 423 ? 7.807   9.736   60.994  1.00 24.23  ? 423 GLN A NE2   1 
ATOM   4072 N N     . LYS C 3 424 ? 3.381   11.866  57.946  1.00 25.30  ? 424 LYS A N     1 
ATOM   4073 C CA    . LYS C 3 424 ? 2.301   12.774  57.558  1.00 24.54  ? 424 LYS A CA    1 
ATOM   4074 C C     . LYS C 3 424 ? 2.745   13.658  56.403  1.00 23.70  ? 424 LYS A C     1 
ATOM   4075 O O     . LYS C 3 424 ? 2.197   14.735  56.188  1.00 24.00  ? 424 LYS A O     1 
ATOM   4076 C CB    . LYS C 3 424 ? 1.845   13.660  58.724  1.00 25.45  ? 424 LYS A CB    1 
ATOM   4077 C CG    . LYS C 3 424 ? 1.268   12.907  59.918  1.00 30.49  ? 424 LYS A CG    1 
ATOM   4078 C CD    . LYS C 3 424 ? 0.096   12.031  59.526  1.00 33.04  ? 424 LYS A CD    1 
ATOM   4079 C CE    . LYS C 3 424 ? -0.386  11.195  60.708  1.00 35.42  ? 424 LYS A CE    1 
ATOM   4080 N NZ    . LYS C 3 424 ? -1.299  10.099  60.256  1.00 35.92  ? 424 LYS A NZ    1 
ATOM   4081 N N     . ILE C 3 425 ? 3.756   13.204  55.674  1.00 21.89  ? 425 ILE A N     1 
ATOM   4082 C CA    . ILE C 3 425 ? 4.246   13.937  54.525  1.00 21.32  ? 425 ILE A CA    1 
ATOM   4083 C C     . ILE C 3 425 ? 3.370   13.535  53.341  1.00 21.42  ? 425 ILE A C     1 
ATOM   4084 O O     . ILE C 3 425 ? 3.019   12.361  53.188  1.00 20.43  ? 425 ILE A O     1 
ATOM   4085 C CB    . ILE C 3 425 ? 5.716   13.571  54.211  1.00 22.55  ? 425 ILE A CB    1 
ATOM   4086 C CG1   . ILE C 3 425 ? 6.617   13.984  55.382  1.00 21.49  ? 425 ILE A CG1   1 
ATOM   4087 C CG2   . ILE C 3 425 ? 6.167   14.250  52.924  1.00 22.19  ? 425 ILE A CG2   1 
ATOM   4088 C CD1   . ILE C 3 425 ? 8.017   13.410  55.317  1.00 16.61  ? 425 ILE A CD1   1 
ATOM   4089 N N     . GLN C 3 426 ? 2.998   14.514  52.521  1.00 21.05  ? 426 GLN A N     1 
ATOM   4090 C CA    . GLN C 3 426 ? 2.188   14.238  51.353  1.00 21.63  ? 426 GLN A CA    1 
ATOM   4091 C C     . GLN C 3 426 ? 3.085   13.618  50.275  1.00 23.79  ? 426 GLN A C     1 
ATOM   4092 O O     . GLN C 3 426 ? 3.800   14.317  49.564  1.00 25.37  ? 426 GLN A O     1 
ATOM   4093 C CB    . GLN C 3 426 ? 1.537   15.522  50.832  1.00 20.41  ? 426 GLN A CB    1 
ATOM   4094 C CG    . GLN C 3 426 ? 0.438   15.260  49.817  1.00 20.38  ? 426 GLN A CG    1 
ATOM   4095 C CD    . GLN C 3 426 ? -0.215  16.517  49.297  1.00 19.58  ? 426 GLN A CD    1 
ATOM   4096 O OE1   . GLN C 3 426 ? 0.414   17.311  48.618  1.00 21.38  ? 426 GLN A OE1   1 
ATOM   4097 N NE2   . GLN C 3 426 ? -1.494  16.698  49.607  1.00 20.45  ? 426 GLN A NE2   1 
ATOM   4098 N N     . VAL C 3 427 ? 3.056   12.296  50.178  1.00 23.66  ? 427 VAL A N     1 
ATOM   4099 C CA    . VAL C 3 427 ? 3.853   11.581  49.194  1.00 23.60  ? 427 VAL A CA    1 
ATOM   4100 C C     . VAL C 3 427 ? 3.214   11.699  47.812  1.00 24.00  ? 427 VAL A C     1 
ATOM   4101 O O     . VAL C 3 427 ? 3.906   11.788  46.798  1.00 24.81  ? 427 VAL A O     1 
ATOM   4102 C CB    . VAL C 3 427 ? 3.973   10.090  49.578  1.00 24.24  ? 427 VAL A CB    1 
ATOM   4103 C CG1   . VAL C 3 427 ? 4.372   9.269   48.375  1.00 27.82  ? 427 VAL A CG1   1 
ATOM   4104 C CG2   . VAL C 3 427 ? 5.004   9.928   50.677  1.00 24.62  ? 427 VAL A CG2   1 
ATOM   4105 N N     . THR C 3 428 ? 1.888   11.705  47.776  1.00 23.07  ? 428 THR A N     1 
ATOM   4106 C CA    . THR C 3 428 ? 1.164   11.812  46.516  1.00 20.73  ? 428 THR A CA    1 
ATOM   4107 C C     . THR C 3 428 ? 0.046   12.835  46.635  1.00 20.06  ? 428 THR A C     1 
ATOM   4108 O O     . THR C 3 428 ? -0.900  12.648  47.395  1.00 21.17  ? 428 THR A O     1 
ATOM   4109 C CB    . THR C 3 428 ? 0.560   10.464  46.127  1.00 21.92  ? 428 THR A CB    1 
ATOM   4110 O OG1   . THR C 3 428 ? 1.601   9.483   46.112  1.00 22.31  ? 428 THR A OG1   1 
ATOM   4111 C CG2   . THR C 3 428 ? -0.104  10.539  44.752  1.00 19.69  ? 428 THR A CG2   1 
ATOM   4112 N N     . PRO C 3 429 ? 0.145   13.936  45.882  1.00 20.31  ? 429 PRO A N     1 
ATOM   4113 C CA    . PRO C 3 429 ? -0.869  14.995  45.909  1.00 19.49  ? 429 PRO A CA    1 
ATOM   4114 C C     . PRO C 3 429 ? -2.152  14.558  45.209  1.00 20.32  ? 429 PRO A C     1 
ATOM   4115 O O     . PRO C 3 429 ? -2.101  13.853  44.206  1.00 21.38  ? 429 PRO A O     1 
ATOM   4116 C CB    . PRO C 3 429 ? -0.177  16.145  45.187  1.00 19.04  ? 429 PRO A CB    1 
ATOM   4117 C CG    . PRO C 3 429 ? 0.608   15.422  44.140  1.00 19.03  ? 429 PRO A CG    1 
ATOM   4118 C CD    . PRO C 3 429 ? 1.196   14.236  44.893  1.00 17.50  ? 429 PRO A CD    1 
ATOM   4119 N N     . PRO C 3 430 ? -3.321  14.970  45.734  1.00 21.81  ? 430 PRO A N     1 
ATOM   4120 C CA    . PRO C 3 430 ? -4.607  14.599  45.124  1.00 19.36  ? 430 PRO A CA    1 
ATOM   4121 C C     . PRO C 3 430 ? -4.907  15.408  43.850  1.00 18.65  ? 430 PRO A C     1 
ATOM   4122 O O     . PRO C 3 430 ? -4.809  16.638  43.841  1.00 17.48  ? 430 PRO A O     1 
ATOM   4123 C CB    . PRO C 3 430 ? -5.604  14.870  46.250  1.00 17.18  ? 430 PRO A CB    1 
ATOM   4124 C CG    . PRO C 3 430 ? -5.032  16.068  46.903  1.00 16.03  ? 430 PRO A CG    1 
ATOM   4125 C CD    . PRO C 3 430 ? -3.535  15.766  46.958  1.00 18.21  ? 430 PRO A CD    1 
ATOM   4126 N N     . GLY C 3 431 ? -5.266  14.706  42.779  1.00 18.80  ? 431 GLY A N     1 
ATOM   4127 C CA    . GLY C 3 431 ? -5.566  15.368  41.516  1.00 19.01  ? 431 GLY A CA    1 
ATOM   4128 C C     . GLY C 3 431 ? -5.528  14.426  40.318  1.00 19.82  ? 431 GLY A C     1 
ATOM   4129 O O     . GLY C 3 431 ? -5.918  13.265  40.417  1.00 19.96  ? 431 GLY A O     1 
ATOM   4130 N N     . PHE C 3 432 ? -5.064  14.921  39.175  1.00 20.54  ? 432 PHE A N     1 
ATOM   4131 C CA    . PHE C 3 432 ? -4.981  14.093  37.977  1.00 20.20  ? 432 PHE A CA    1 
ATOM   4132 C C     . PHE C 3 432 ? -3.597  14.066  37.375  1.00 20.70  ? 432 PHE A C     1 
ATOM   4133 O O     . PHE C 3 432 ? -2.936  15.091  37.268  1.00 22.76  ? 432 PHE A O     1 
ATOM   4134 C CB    . PHE C 3 432 ? -5.938  14.585  36.891  1.00 18.26  ? 432 PHE A CB    1 
ATOM   4135 C CG    . PHE C 3 432 ? -7.385  14.380  37.208  1.00 17.93  ? 432 PHE A CG    1 
ATOM   4136 C CD1   . PHE C 3 432 ? -8.116  15.369  37.851  1.00 17.54  ? 432 PHE A CD1   1 
ATOM   4137 C CD2   . PHE C 3 432 ? -8.028  13.207  36.832  1.00 16.77  ? 432 PHE A CD2   1 
ATOM   4138 C CE1   . PHE C 3 432 ? -9.469  15.195  38.109  1.00 15.37  ? 432 PHE A CE1   1 
ATOM   4139 C CE2   . PHE C 3 432 ? -9.380  13.022  37.087  1.00 14.45  ? 432 PHE A CE2   1 
ATOM   4140 C CZ    . PHE C 3 432 ? -10.102 14.018  37.726  1.00 14.09  ? 432 PHE A CZ    1 
ATOM   4141 N N     . GLN C 3 433 ? -3.158  12.882  36.976  1.00 21.57  ? 433 GLN A N     1 
ATOM   4142 C CA    . GLN C 3 433 ? -1.864  12.755  36.329  1.00 20.52  ? 433 GLN A CA    1 
ATOM   4143 C C     . GLN C 3 433 ? -2.133  13.014  34.849  1.00 19.68  ? 433 GLN A C     1 
ATOM   4144 O O     . GLN C 3 433 ? -2.890  12.273  34.221  1.00 18.00  ? 433 GLN A O     1 
ATOM   4145 C CB    . GLN C 3 433 ? -1.314  11.337  36.500  1.00 20.18  ? 433 GLN A CB    1 
ATOM   4146 C CG    . GLN C 3 433 ? 0.076   11.128  35.912  1.00 19.25  ? 433 GLN A CG    1 
ATOM   4147 C CD    . GLN C 3 433 ? 0.496   9.655   35.850  1.00 20.24  ? 433 GLN A CD    1 
ATOM   4148 O OE1   . GLN C 3 433 ? -0.071  8.798   36.541  1.00 16.70  ? 433 GLN A OE1   1 
ATOM   4149 N NE2   . GLN C 3 433 ? 1.504   9.363   35.028  1.00 15.19  ? 433 GLN A NE2   1 
ATOM   4150 N N     . LEU C 3 434 ? -1.552  14.072  34.295  1.00 17.51  ? 434 LEU A N     1 
ATOM   4151 C CA    . LEU C 3 434 ? -1.747  14.344  32.878  1.00 16.18  ? 434 LEU A CA    1 
ATOM   4152 C C     . LEU C 3 434 ? -0.743  13.462  32.144  1.00 17.37  ? 434 LEU A C     1 
ATOM   4153 O O     . LEU C 3 434 ? 0.454   13.744  32.127  1.00 19.74  ? 434 LEU A O     1 
ATOM   4154 C CB    . LEU C 3 434 ? -1.512  15.822  32.567  1.00 15.04  ? 434 LEU A CB    1 
ATOM   4155 C CG    . LEU C 3 434 ? -1.828  16.262  31.129  1.00 15.29  ? 434 LEU A CG    1 
ATOM   4156 C CD1   . LEU C 3 434 ? -2.042  17.757  31.089  1.00 13.74  ? 434 LEU A CD1   1 
ATOM   4157 C CD2   . LEU C 3 434 ? -0.707  15.851  30.189  1.00 12.82  ? 434 LEU A CD2   1 
ATOM   4158 N N     . VAL C 3 435 ? -1.245  12.372  31.573  1.00 16.68  ? 435 VAL A N     1 
ATOM   4159 C CA    . VAL C 3 435 ? -0.427  11.402  30.857  1.00 17.03  ? 435 VAL A CA    1 
ATOM   4160 C C     . VAL C 3 435 ? -0.514  11.606  29.348  1.00 18.59  ? 435 VAL A C     1 
ATOM   4161 O O     . VAL C 3 435 ? -1.582  11.409  28.762  1.00 20.29  ? 435 VAL A O     1 
ATOM   4162 C CB    . VAL C 3 435 ? -0.884  9.954   31.185  1.00 17.43  ? 435 VAL A CB    1 
ATOM   4163 C CG1   . VAL C 3 435 ? -0.095  8.944   30.361  1.00 13.98  ? 435 VAL A CG1   1 
ATOM   4164 C CG2   . VAL C 3 435 ? -0.716  9.677   32.674  1.00 15.27  ? 435 VAL A CG2   1 
ATOM   4165 N N     . PHE C 3 436 ? 0.605   11.988  28.728  1.00 15.90  ? 436 PHE A N     1 
ATOM   4166 C CA    . PHE C 3 436 ? 0.650   12.211  27.287  1.00 16.55  ? 436 PHE A CA    1 
ATOM   4167 C C     . PHE C 3 436 ? 0.527   10.901  26.534  1.00 18.04  ? 436 PHE A C     1 
ATOM   4168 O O     . PHE C 3 436 ? 1.162   9.914   26.896  1.00 16.77  ? 436 PHE A O     1 
ATOM   4169 C CB    . PHE C 3 436 ? 1.958   12.888  26.866  1.00 17.55  ? 436 PHE A CB    1 
ATOM   4170 C CG    . PHE C 3 436 ? 2.018   14.358  27.169  1.00 15.76  ? 436 PHE A CG    1 
ATOM   4171 C CD1   . PHE C 3 436 ? 2.432   14.811  28.414  1.00 16.14  ? 436 PHE A CD1   1 
ATOM   4172 C CD2   . PHE C 3 436 ? 1.697   15.293  26.190  1.00 15.50  ? 436 PHE A CD2   1 
ATOM   4173 C CE1   . PHE C 3 436 ? 2.530   16.184  28.677  1.00 16.61  ? 436 PHE A CE1   1 
ATOM   4174 C CE2   . PHE C 3 436 ? 1.794   16.665  26.445  1.00 14.40  ? 436 PHE A CE2   1 
ATOM   4175 C CZ    . PHE C 3 436 ? 2.211   17.107  27.685  1.00 14.11  ? 436 PHE A CZ    1 
ATOM   4176 N N     . LEU C 3 437 ? -0.299  10.906  25.487  1.00 18.38  ? 437 LEU A N     1 
ATOM   4177 C CA    . LEU C 3 437 ? -0.520  9.721   24.664  1.00 18.93  ? 437 LEU A CA    1 
ATOM   4178 C C     . LEU C 3 437 ? 0.140   9.925   23.310  1.00 19.66  ? 437 LEU A C     1 
ATOM   4179 O O     . LEU C 3 437 ? -0.003  10.982  22.693  1.00 20.60  ? 437 LEU A O     1 
ATOM   4180 C CB    . LEU C 3 437 ? -2.016  9.478   24.477  1.00 17.64  ? 437 LEU A CB    1 
ATOM   4181 C CG    . LEU C 3 437 ? -2.798  9.332   25.783  1.00 20.15  ? 437 LEU A CG    1 
ATOM   4182 C CD1   . LEU C 3 437 ? -4.307  9.185   25.497  1.00 18.71  ? 437 LEU A CD1   1 
ATOM   4183 C CD2   . LEU C 3 437 ? -2.267  8.121   26.534  1.00 19.19  ? 437 LEU A CD2   1 
ATOM   4184 N N     . PRO C 3 438 ? 0.868   8.911   22.828  1.00 19.25  ? 438 PRO A N     1 
ATOM   4185 C CA    . PRO C 3 438 ? 1.560   8.973   21.541  1.00 18.39  ? 438 PRO A CA    1 
ATOM   4186 C C     . PRO C 3 438 ? 0.611   8.859   20.360  1.00 19.42  ? 438 PRO A C     1 
ATOM   4187 O O     . PRO C 3 438 ? -0.383  8.138   20.434  1.00 19.60  ? 438 PRO A O     1 
ATOM   4188 C CB    . PRO C 3 438 ? 2.496   7.773   21.609  1.00 20.13  ? 438 PRO A CB    1 
ATOM   4189 C CG    . PRO C 3 438 ? 1.653   6.767   22.313  1.00 19.12  ? 438 PRO A CG    1 
ATOM   4190 C CD    . PRO C 3 438 ? 1.081   7.598   23.465  1.00 20.39  ? 438 PRO A CD    1 
ATOM   4191 N N     . PHE C 3 439 ? 0.903   9.586   19.284  1.00 18.42  ? 439 PHE A N     1 
ATOM   4192 C CA    . PHE C 3 439 ? 0.096   9.487   18.074  1.00 18.05  ? 439 PHE A CA    1 
ATOM   4193 C C     . PHE C 3 439 ? 0.698   8.279   17.380  1.00 18.71  ? 439 PHE A C     1 
ATOM   4194 O O     . PHE C 3 439 ? 1.777   7.820   17.764  1.00 18.52  ? 439 PHE A O     1 
ATOM   4195 C CB    . PHE C 3 439 ? 0.265   10.710  17.162  1.00 15.70  ? 439 PHE A CB    1 
ATOM   4196 C CG    . PHE C 3 439 ? -0.600  11.879  17.535  1.00 18.20  ? 439 PHE A CG    1 
ATOM   4197 C CD1   . PHE C 3 439 ? -0.040  13.032  18.083  1.00 16.14  ? 439 PHE A CD1   1 
ATOM   4198 C CD2   . PHE C 3 439 ? -1.982  11.831  17.342  1.00 17.39  ? 439 PHE A CD2   1 
ATOM   4199 C CE1   . PHE C 3 439 ? -0.835  14.113  18.431  1.00 13.18  ? 439 PHE A CE1   1 
ATOM   4200 C CE2   . PHE C 3 439 ? -2.787  12.914  17.691  1.00 14.81  ? 439 PHE A CE2   1 
ATOM   4201 C CZ    . PHE C 3 439 ? -2.213  14.055  18.234  1.00 13.39  ? 439 PHE A CZ    1 
ATOM   4202 N N     . ALA C 3 440 ? 0.031   7.776   16.348  1.00 18.92  ? 440 ALA A N     1 
ATOM   4203 C CA    . ALA C 3 440 ? 0.543   6.612   15.639  1.00 18.98  ? 440 ALA A CA    1 
ATOM   4204 C C     . ALA C 3 440 ? 1.982   6.809   15.145  1.00 18.96  ? 440 ALA A C     1 
ATOM   4205 O O     . ALA C 3 440 ? 2.771   5.862   15.137  1.00 18.09  ? 440 ALA A O     1 
ATOM   4206 C CB    . ALA C 3 440 ? -0.382  6.263   14.474  1.00 15.08  ? 440 ALA A CB    1 
ATOM   4207 N N     . ASP C 3 441 ? 2.315   8.038   14.748  1.00 20.10  ? 441 ASP A N     1 
ATOM   4208 C CA    . ASP C 3 441 ? 3.650   8.375   14.234  1.00 19.96  ? 441 ASP A CA    1 
ATOM   4209 C C     . ASP C 3 441 ? 4.745   8.177   15.285  1.00 21.64  ? 441 ASP A C     1 
ATOM   4210 O O     . ASP C 3 441 ? 5.901   7.923   14.944  1.00 21.61  ? 441 ASP A O     1 
ATOM   4211 C CB    . ASP C 3 441 ? 3.714   9.845   13.783  1.00 19.90  ? 441 ASP A CB    1 
ATOM   4212 C CG    . ASP C 3 441 ? 2.518   10.270  12.931  1.00 23.42  ? 441 ASP A CG    1 
ATOM   4213 O OD1   . ASP C 3 441 ? 1.378   10.272  13.452  1.00 21.50  ? 441 ASP A OD1   1 
ATOM   4214 O OD2   . ASP C 3 441 ? 2.723   10.615  11.740  1.00 23.33  ? 441 ASP A OD2   1 
ATOM   4215 N N     . ASP C 3 442 ? 4.384   8.312   16.560  1.00 21.34  ? 442 ASP A N     1 
ATOM   4216 C CA    . ASP C 3 442 ? 5.355   8.187   17.637  1.00 22.68  ? 442 ASP A CA    1 
ATOM   4217 C C     . ASP C 3 442 ? 5.673   6.745   17.992  1.00 23.85  ? 442 ASP A C     1 
ATOM   4218 O O     . ASP C 3 442 ? 6.573   6.478   18.789  1.00 24.24  ? 442 ASP A O     1 
ATOM   4219 C CB    . ASP C 3 442 ? 4.861   8.918   18.883  1.00 22.78  ? 442 ASP A CB    1 
ATOM   4220 C CG    . ASP C 3 442 ? 4.448   10.347  18.594  1.00 22.10  ? 442 ASP A CG    1 
ATOM   4221 O OD1   . ASP C 3 442 ? 5.199   11.056  17.898  1.00 19.99  ? 442 ASP A OD1   1 
ATOM   4222 O OD2   . ASP C 3 442 ? 3.372   10.759  19.067  1.00 21.92  ? 442 ASP A OD2   1 
ATOM   4223 N N     . LYS C 3 443 ? 4.927   5.820   17.406  1.00 25.74  ? 443 LYS A N     1 
ATOM   4224 C CA    . LYS C 3 443 ? 5.137   4.407   17.662  1.00 28.84  ? 443 LYS A CA    1 
ATOM   4225 C C     . LYS C 3 443 ? 6.071   3.829   16.609  1.00 30.55  ? 443 LYS A C     1 
ATOM   4226 O O     . LYS C 3 443 ? 6.036   4.225   15.451  1.00 31.54  ? 443 LYS A O     1 
ATOM   4227 C CB    . LYS C 3 443 ? 3.812   3.665   17.624  1.00 27.98  ? 443 LYS A CB    1 
ATOM   4228 C CG    . LYS C 3 443 ? 2.909   3.920   18.800  1.00 31.37  ? 443 LYS A CG    1 
ATOM   4229 C CD    . LYS C 3 443 ? 1.622   3.159   18.588  1.00 32.29  ? 443 LYS A CD    1 
ATOM   4230 C CE    . LYS C 3 443 ? 0.884   2.913   19.867  1.00 34.09  ? 443 LYS A CE    1 
ATOM   4231 N NZ    . LYS C 3 443 ? -0.384  2.188   19.553  1.00 39.07  ? 443 LYS A NZ    1 
ATOM   4232 N N     . ARG C 3 444 ? 6.910   2.891   17.012  1.00 33.04  ? 444 ARG A N     1 
ATOM   4233 C CA    . ARG C 3 444 ? 7.842   2.284   16.081  1.00 37.13  ? 444 ARG A CA    1 
ATOM   4234 C C     . ARG C 3 444 ? 7.711   0.780   16.064  1.00 38.85  ? 444 ARG A C     1 
ATOM   4235 O O     . ARG C 3 444 ? 7.644   0.141   17.107  1.00 37.98  ? 444 ARG A O     1 
ATOM   4236 C CB    . ARG C 3 444 ? 9.265   2.692   16.436  1.00 37.89  ? 444 ARG A CB    1 
ATOM   4237 C CG    . ARG C 3 444 ? 9.477   4.181   16.311  1.00 41.15  ? 444 ARG A CG    1 
ATOM   4238 C CD    . ARG C 3 444 ? 10.943  4.514   16.208  1.00 45.69  ? 444 ARG A CD    1 
ATOM   4239 N NE    . ARG C 3 444 ? 11.147  5.859   15.682  1.00 48.00  ? 444 ARG A NE    1 
ATOM   4240 C CZ    . ARG C 3 444 ? 12.338  6.377   15.409  1.00 47.89  ? 444 ARG A CZ    1 
ATOM   4241 N NH1   . ARG C 3 444 ? 13.437  5.661   15.615  1.00 48.95  ? 444 ARG A NH1   1 
ATOM   4242 N NH2   . ARG C 3 444 ? 12.427  7.604   14.918  1.00 49.42  ? 444 ARG A NH2   1 
ATOM   4243 N N     . LYS C 3 445 ? 7.658   0.221   14.864  1.00 44.06  ? 445 LYS A N     1 
ATOM   4244 C CA    . LYS C 3 445 ? 7.527   -1.219  14.701  1.00 50.37  ? 445 LYS A CA    1 
ATOM   4245 C C     . LYS C 3 445 ? 8.903   -1.881  14.699  1.00 52.16  ? 445 LYS A C     1 
ATOM   4246 O O     . LYS C 3 445 ? 9.929   -1.229  14.475  1.00 52.44  ? 445 LYS A O     1 
ATOM   4247 C CB    . LYS C 3 445 ? 6.793   -1.531  13.386  1.00 52.94  ? 445 LYS A CB    1 
ATOM   4248 C CG    . LYS C 3 445 ? 6.555   -3.022  13.104  1.00 57.98  ? 445 LYS A CG    1 
ATOM   4249 C CD    . LYS C 3 445 ? 5.585   -3.671  14.110  1.00 61.51  ? 445 LYS A CD    1 
ATOM   4250 C CE    . LYS C 3 445 ? 5.401   -5.172  13.828  1.00 62.50  ? 445 LYS A CE    1 
ATOM   4251 N NZ    . LYS C 3 445 ? 4.367   -5.828  14.693  1.00 62.30  ? 445 LYS A NZ    1 
ATOM   4252 N N     . MET C 3 446 ? 8.915   -3.178  14.975  1.00 54.33  ? 446 MET A N     1 
ATOM   4253 C CA    . MET C 3 446 ? 10.145  -3.957  14.977  1.00 56.15  ? 446 MET A CA    1 
ATOM   4254 C C     . MET C 3 446 ? 9.835   -5.413  14.648  1.00 58.03  ? 446 MET A C     1 
ATOM   4255 O O     . MET C 3 446 ? 8.833   -5.973  15.106  1.00 56.94  ? 446 MET A O     1 
ATOM   4256 C CB    . MET C 3 446 ? 10.849  -3.851  16.332  1.00 53.02  ? 446 MET A CB    1 
ATOM   4257 C CG    . MET C 3 446 ? 9.952   -4.078  17.537  1.00 48.92  ? 446 MET A CG    1 
ATOM   4258 S SD    . MET C 3 446 ? 10.627  -3.179  18.953  1.00 42.08  ? 446 MET A SD    1 
ATOM   4259 C CE    . MET C 3 446 ? 10.295  -1.498  18.449  1.00 40.46  ? 446 MET A CE    1 
ATOM   4260 N N     . PRO C 3 447 ? 10.681  -6.035  13.816  1.00 60.53  ? 447 PRO A N     1 
ATOM   4261 C CA    . PRO C 3 447 ? 10.479  -7.433  13.435  1.00 61.96  ? 447 PRO A CA    1 
ATOM   4262 C C     . PRO C 3 447 ? 10.838  -8.341  14.599  1.00 62.57  ? 447 PRO A C     1 
ATOM   4263 O O     . PRO C 3 447 ? 11.719  -8.026  15.397  1.00 61.57  ? 447 PRO A O     1 
ATOM   4264 C CB    . PRO C 3 447 ? 11.423  -7.605  12.247  1.00 62.23  ? 447 PRO A CB    1 
ATOM   4265 C CG    . PRO C 3 447 ? 12.581  -6.721  12.628  1.00 63.42  ? 447 PRO A CG    1 
ATOM   4266 C CD    . PRO C 3 447 ? 11.877  -5.473  13.158  1.00 63.00  ? 447 PRO A CD    1 
ATOM   4267 N N     . PHE C 3 448 ? 10.143  -9.463  14.704  1.00 64.59  ? 448 PHE A N     1 
ATOM   4268 C CA    . PHE C 3 448 ? 10.420  -10.398 15.776  1.00 65.88  ? 448 PHE A CA    1 
ATOM   4269 C C     . PHE C 3 448 ? 10.641  -11.787 15.204  1.00 66.32  ? 448 PHE A C     1 
ATOM   4270 O O     . PHE C 3 448 ? 9.970   -12.196 14.251  1.00 66.34  ? 448 PHE A O     1 
ATOM   4271 C CB    . PHE C 3 448 ? 9.268   -10.404 16.796  1.00 66.80  ? 448 PHE A CB    1 
ATOM   4272 C CG    . PHE C 3 448 ? 7.927   -10.771 16.212  1.00 68.56  ? 448 PHE A CG    1 
ATOM   4273 C CD1   . PHE C 3 448 ? 7.596   -12.101 15.959  1.00 69.83  ? 448 PHE A CD1   1 
ATOM   4274 C CD2   . PHE C 3 448 ? 6.992   -9.783  15.914  1.00 69.48  ? 448 PHE A CD2   1 
ATOM   4275 C CE1   . PHE C 3 448 ? 6.353   -12.444 15.417  1.00 70.09  ? 448 PHE A CE1   1 
ATOM   4276 C CE2   . PHE C 3 448 ? 5.748   -10.113 15.373  1.00 70.39  ? 448 PHE A CE2   1 
ATOM   4277 C CZ    . PHE C 3 448 ? 5.428   -11.447 15.124  1.00 70.44  ? 448 PHE A CZ    1 
ATOM   4278 N N     . THR C 3 449 ? 11.614  -12.494 15.769  1.00 66.30  ? 449 THR A N     1 
ATOM   4279 C CA    . THR C 3 449 ? 11.920  -13.850 15.341  1.00 65.49  ? 449 THR A CA    1 
ATOM   4280 C C     . THR C 3 449 ? 11.192  -14.782 16.302  1.00 64.73  ? 449 THR A C     1 
ATOM   4281 O O     . THR C 3 449 ? 10.454  -14.323 17.177  1.00 64.41  ? 449 THR A O     1 
ATOM   4282 C CB    . THR C 3 449 ? 13.444  -14.140 15.394  1.00 65.94  ? 449 THR A CB    1 
ATOM   4283 O OG1   . THR C 3 449 ? 13.953  -13.797 16.688  1.00 65.35  ? 449 THR A OG1   1 
ATOM   4284 C CG2   . THR C 3 449 ? 14.187  -13.335 14.324  1.00 65.93  ? 449 THR A CG2   1 
ATOM   4285 N N     . GLU C 3 450 ? 11.391  -16.084 16.135  1.00 63.44  ? 450 GLU A N     1 
ATOM   4286 C CA    . GLU C 3 450 ? 10.750  -17.062 17.002  1.00 60.91  ? 450 GLU A CA    1 
ATOM   4287 C C     . GLU C 3 450 ? 10.953  -16.708 18.467  1.00 57.18  ? 450 GLU A C     1 
ATOM   4288 O O     . GLU C 3 450 ? 11.988  -16.169 18.847  1.00 55.44  ? 450 GLU A O     1 
ATOM   4289 C CB    . GLU C 3 450 ? 11.317  -18.456 16.733  1.00 63.32  ? 450 GLU A CB    1 
ATOM   4290 C CG    . GLU C 3 450 ? 10.941  -19.023 15.385  1.00 67.48  ? 450 GLU A CG    1 
ATOM   4291 C CD    . GLU C 3 450 ? 11.534  -20.395 15.153  1.00 70.97  ? 450 GLU A CD    1 
ATOM   4292 O OE1   . GLU C 3 450 ? 12.776  -20.487 15.012  1.00 72.21  ? 450 GLU A OE1   1 
ATOM   4293 O OE2   . GLU C 3 450 ? 10.759  -21.379 15.119  1.00 71.32  ? 450 GLU A OE2   1 
ATOM   4294 N N     . LYS C 3 451 ? 9.950   -17.008 19.283  1.00 54.81  ? 451 LYS A N     1 
ATOM   4295 C CA    . LYS C 3 451 ? 10.016  -16.745 20.715  1.00 51.80  ? 451 LYS A CA    1 
ATOM   4296 C C     . LYS C 3 451 ? 10.767  -17.906 21.371  1.00 50.01  ? 451 LYS A C     1 
ATOM   4297 O O     . LYS C 3 451 ? 10.351  -19.062 21.277  1.00 49.64  ? 451 LYS A O     1 
ATOM   4298 C CB    . LYS C 3 451 ? 8.597   -16.628 21.293  1.00 51.46  ? 451 LYS A CB    1 
ATOM   4299 C CG    . LYS C 3 451 ? 8.531   -16.362 22.792  1.00 49.95  ? 451 LYS A CG    1 
ATOM   4300 C CD    . LYS C 3 451 ? 7.096   -16.152 23.274  1.00 48.52  ? 451 LYS A CD    1 
ATOM   4301 C CE    . LYS C 3 451 ? 7.039   -16.105 24.804  1.00 49.54  ? 451 LYS A CE    1 
ATOM   4302 N NZ    . LYS C 3 451 ? 5.674   -15.904 25.369  1.00 46.95  ? 451 LYS A NZ    1 
ATOM   4303 N N     . ILE C 3 452 ? 11.888  -17.597 22.009  1.00 47.67  ? 452 ILE A N     1 
ATOM   4304 C CA    . ILE C 3 452 ? 12.688  -18.608 22.681  1.00 45.71  ? 452 ILE A CA    1 
ATOM   4305 C C     . ILE C 3 452 ? 12.506  -18.450 24.182  1.00 44.96  ? 452 ILE A C     1 
ATOM   4306 O O     . ILE C 3 452 ? 12.880  -17.424 24.746  1.00 45.87  ? 452 ILE A O     1 
ATOM   4307 C CB    . ILE C 3 452 ? 14.177  -18.462 22.312  1.00 45.03  ? 452 ILE A CB    1 
ATOM   4308 C CG1   . ILE C 3 452 ? 14.395  -18.961 20.883  1.00 43.83  ? 452 ILE A CG1   1 
ATOM   4309 C CG2   . ILE C 3 452 ? 15.046  -19.227 23.297  1.00 45.15  ? 452 ILE A CG2   1 
ATOM   4310 C CD1   . ILE C 3 452 ? 15.810  -18.839 20.393  1.00 44.16  ? 452 ILE A CD1   1 
ATOM   4311 N N     . MET C 3 453 ? 11.926  -19.462 24.824  1.00 44.73  ? 453 MET A N     1 
ATOM   4312 C CA    . MET C 3 453 ? 11.681  -19.406 26.258  1.00 44.95  ? 453 MET A CA    1 
ATOM   4313 C C     . MET C 3 453 ? 12.560  -20.319 27.113  1.00 43.92  ? 453 MET A C     1 
ATOM   4314 O O     . MET C 3 453 ? 12.973  -21.399 26.690  1.00 44.68  ? 453 MET A O     1 
ATOM   4315 C CB    . MET C 3 453 ? 10.207  -19.691 26.545  1.00 48.62  ? 453 MET A CB    1 
ATOM   4316 C CG    . MET C 3 453 ? 9.838   -19.507 28.009  1.00 54.97  ? 453 MET A CG    1 
ATOM   4317 S SD    . MET C 3 453 ? 8.071   -19.352 28.291  1.00 62.09  ? 453 MET A SD    1 
ATOM   4318 C CE    . MET C 3 453 ? 7.570   -21.101 28.311  1.00 60.87  ? 453 MET A CE    1 
ATOM   4319 N N     . ALA C 3 454 ? 12.835  -19.868 28.331  1.00 42.70  ? 454 ALA A N     1 
ATOM   4320 C CA    . ALA C 3 454 ? 13.670  -20.607 29.269  1.00 40.40  ? 454 ALA A CA    1 
ATOM   4321 C C     . ALA C 3 454 ? 12.884  -21.687 30.004  1.00 38.57  ? 454 ALA A C     1 
ATOM   4322 O O     . ALA C 3 454 ? 11.661  -21.626 30.087  1.00 36.41  ? 454 ALA A O     1 
ATOM   4323 C CB    . ALA C 3 454 ? 14.286  -19.638 30.272  1.00 41.07  ? 454 ALA A CB    1 
ATOM   4324 N N     . THR C 3 455 ? 13.599  -22.671 30.544  1.00 37.56  ? 455 THR A N     1 
ATOM   4325 C CA    . THR C 3 455 ? 12.975  -23.771 31.279  1.00 37.50  ? 455 THR A CA    1 
ATOM   4326 C C     . THR C 3 455 ? 12.754  -23.384 32.738  1.00 37.86  ? 455 THR A C     1 
ATOM   4327 O O     . THR C 3 455 ? 13.359  -22.435 33.234  1.00 37.72  ? 455 THR A O     1 
ATOM   4328 C CB    . THR C 3 455 ? 13.866  -25.027 31.265  1.00 36.47  ? 455 THR A CB    1 
ATOM   4329 O OG1   . THR C 3 455 ? 15.134  -24.716 31.853  1.00 36.47  ? 455 THR A OG1   1 
ATOM   4330 C CG2   . THR C 3 455 ? 14.088  -25.513 29.848  1.00 37.95  ? 455 THR A CG2   1 
ATOM   4331 N N     . PRO C 3 456 ? 11.877  -24.113 33.449  1.00 39.27  ? 456 PRO A N     1 
ATOM   4332 C CA    . PRO C 3 456 ? 11.640  -23.781 34.856  1.00 39.23  ? 456 PRO A CA    1 
ATOM   4333 C C     . PRO C 3 456 ? 12.923  -23.801 35.680  1.00 39.29  ? 456 PRO A C     1 
ATOM   4334 O O     . PRO C 3 456 ? 13.091  -22.993 36.591  1.00 39.84  ? 456 PRO A O     1 
ATOM   4335 C CB    . PRO C 3 456 ? 10.632  -24.844 35.302  1.00 38.34  ? 456 PRO A CB    1 
ATOM   4336 C CG    . PRO C 3 456 ? 10.807  -25.947 34.308  1.00 38.32  ? 456 PRO A CG    1 
ATOM   4337 C CD    . PRO C 3 456 ? 10.995  -25.211 33.023  1.00 38.09  ? 456 PRO A CD    1 
ATOM   4338 N N     . GLU C 3 457 ? 13.834  -24.710 35.343  1.00 39.68  ? 457 GLU A N     1 
ATOM   4339 C CA    . GLU C 3 457 ? 15.102  -24.819 36.063  1.00 40.22  ? 457 GLU A CA    1 
ATOM   4340 C C     . GLU C 3 457 ? 15.979  -23.572 35.876  1.00 39.56  ? 457 GLU A C     1 
ATOM   4341 O O     . GLU C 3 457 ? 16.649  -23.139 36.812  1.00 40.55  ? 457 GLU A O     1 
ATOM   4342 C CB    . GLU C 3 457 ? 15.858  -26.088 35.629  1.00 41.71  ? 457 GLU A CB    1 
ATOM   4343 C CG    . GLU C 3 457 ? 17.232  -26.260 36.283  1.00 45.47  ? 457 GLU A CG    1 
ATOM   4344 C CD    . GLU C 3 457 ? 17.753  -27.691 36.216  1.00 48.31  ? 457 GLU A CD    1 
ATOM   4345 O OE1   . GLU C 3 457 ? 17.676  -28.305 35.127  1.00 50.04  ? 457 GLU A OE1   1 
ATOM   4346 O OE2   . GLU C 3 457 ? 18.248  -28.198 37.251  1.00 47.79  ? 457 GLU A OE2   1 
ATOM   4347 N N     . GLN C 3 458 ? 15.970  -22.993 34.679  1.00 37.03  ? 458 GLN A N     1 
ATOM   4348 C CA    . GLN C 3 458 ? 16.751  -21.788 34.417  1.00 35.98  ? 458 GLN A CA    1 
ATOM   4349 C C     . GLN C 3 458 ? 16.095  -20.564 35.073  1.00 35.16  ? 458 GLN A C     1 
ATOM   4350 O O     . GLN C 3 458 ? 16.778  -19.744 35.693  1.00 34.58  ? 458 GLN A O     1 
ATOM   4351 C CB    . GLN C 3 458 ? 16.892  -21.570 32.910  1.00 35.71  ? 458 GLN A CB    1 
ATOM   4352 C CG    . GLN C 3 458 ? 17.672  -22.670 32.207  1.00 33.18  ? 458 GLN A CG    1 
ATOM   4353 C CD    . GLN C 3 458 ? 17.441  -22.661 30.713  1.00 32.90  ? 458 GLN A CD    1 
ATOM   4354 O OE1   . GLN C 3 458 ? 16.326  -22.404 30.253  1.00 32.43  ? 458 GLN A OE1   1 
ATOM   4355 N NE2   . GLN C 3 458 ? 18.482  -22.961 29.947  1.00 27.30  ? 458 GLN A NE2   1 
ATOM   4356 N N     . VAL C 3 459 ? 14.774  -20.449 34.936  1.00 33.49  ? 459 VAL A N     1 
ATOM   4357 C CA    . VAL C 3 459 ? 14.023  -19.343 35.533  1.00 31.62  ? 459 VAL A CA    1 
ATOM   4358 C C     . VAL C 3 459 ? 14.179  -19.374 37.051  1.00 32.04  ? 459 VAL A C     1 
ATOM   4359 O O     . VAL C 3 459 ? 14.219  -18.331 37.710  1.00 31.06  ? 459 VAL A O     1 
ATOM   4360 C CB    . VAL C 3 459 ? 12.518  -19.442 35.201  1.00 29.65  ? 459 VAL A CB    1 
ATOM   4361 C CG1   . VAL C 3 459 ? 11.724  -18.505 36.089  1.00 28.36  ? 459 VAL A CG1   1 
ATOM   4362 C CG2   . VAL C 3 459 ? 12.290  -19.096 33.746  1.00 29.10  ? 459 VAL A CG2   1 
ATOM   4363 N N     . GLY C 3 460 ? 14.244  -20.591 37.588  1.00 32.25  ? 460 GLY A N     1 
ATOM   4364 C CA    . GLY C 3 460 ? 14.403  -20.778 39.015  1.00 30.63  ? 460 GLY A CA    1 
ATOM   4365 C C     . GLY C 3 460 ? 15.739  -20.215 39.440  1.00 30.92  ? 460 GLY A C     1 
ATOM   4366 O O     . GLY C 3 460 ? 15.809  -19.485 40.417  1.00 34.02  ? 460 GLY A O     1 
ATOM   4367 N N     . LYS C 3 461 ? 16.800  -20.545 38.711  1.00 30.14  ? 461 LYS A N     1 
ATOM   4368 C CA    . LYS C 3 461 ? 18.125  -20.031 39.040  1.00 31.53  ? 461 LYS A CA    1 
ATOM   4369 C C     . LYS C 3 461 ? 18.139  -18.510 39.014  1.00 31.75  ? 461 LYS A C     1 
ATOM   4370 O O     . LYS C 3 461 ? 18.720  -17.877 39.892  1.00 32.33  ? 461 LYS A O     1 
ATOM   4371 C CB    . LYS C 3 461 ? 19.185  -20.547 38.062  1.00 30.69  ? 461 LYS A CB    1 
ATOM   4372 C CG    . LYS C 3 461 ? 19.915  -21.763 38.558  1.00 36.19  ? 461 LYS A CG    1 
ATOM   4373 C CD    . LYS C 3 461 ? 20.487  -21.517 39.942  1.00 36.71  ? 461 LYS A CD    1 
ATOM   4374 C CE    . LYS C 3 461 ? 20.763  -22.825 40.650  1.00 35.98  ? 461 LYS A CE    1 
ATOM   4375 N NZ    . LYS C 3 461 ? 20.628  -22.651 42.125  1.00 39.56  ? 461 LYS A NZ    1 
ATOM   4376 N N     . MET C 3 462 ? 17.502  -17.931 37.999  1.00 31.04  ? 462 MET A N     1 
ATOM   4377 C CA    . MET C 3 462 ? 17.450  -16.484 37.866  1.00 32.06  ? 462 MET A CA    1 
ATOM   4378 C C     . MET C 3 462 ? 16.639  -15.890 39.016  1.00 32.50  ? 462 MET A C     1 
ATOM   4379 O O     . MET C 3 462 ? 16.995  -14.844 39.550  1.00 32.07  ? 462 MET A O     1 
ATOM   4380 C CB    . MET C 3 462 ? 16.850  -16.095 36.506  1.00 30.73  ? 462 MET A CB    1 
ATOM   4381 C CG    . MET C 3 462 ? 16.856  -14.600 36.213  1.00 32.45  ? 462 MET A CG    1 
ATOM   4382 S SD    . MET C 3 462 ? 18.468  -13.811 36.491  1.00 30.91  ? 462 MET A SD    1 
ATOM   4383 C CE    . MET C 3 462 ? 19.348  -14.276 35.003  1.00 33.14  ? 462 MET A CE    1 
ATOM   4384 N N     . LYS C 3 463 ? 15.559  -16.565 39.405  1.00 33.63  ? 463 LYS A N     1 
ATOM   4385 C CA    . LYS C 3 463 ? 14.728  -16.090 40.512  1.00 34.56  ? 463 LYS A CA    1 
ATOM   4386 C C     . LYS C 3 463 ? 15.593  -15.931 41.755  1.00 34.40  ? 463 LYS A C     1 
ATOM   4387 O O     . LYS C 3 463 ? 15.529  -14.916 42.450  1.00 34.67  ? 463 LYS A O     1 
ATOM   4388 C CB    . LYS C 3 463 ? 13.611  -17.089 40.828  1.00 34.98  ? 463 LYS A CB    1 
ATOM   4389 C CG    . LYS C 3 463 ? 12.354  -16.979 39.988  1.00 37.70  ? 463 LYS A CG    1 
ATOM   4390 C CD    . LYS C 3 463 ? 11.320  -17.963 40.509  1.00 39.65  ? 463 LYS A CD    1 
ATOM   4391 C CE    . LYS C 3 463 ? 9.970   -17.778 39.854  1.00 43.09  ? 463 LYS A CE    1 
ATOM   4392 N NZ    . LYS C 3 463 ? 8.942   -18.663 40.465  1.00 42.96  ? 463 LYS A NZ    1 
ATOM   4393 N N     . ALA C 3 464 ? 16.398  -16.954 42.025  1.00 33.94  ? 464 ALA A N     1 
ATOM   4394 C CA    . ALA C 3 464 ? 17.280  -16.962 43.182  1.00 34.22  ? 464 ALA A CA    1 
ATOM   4395 C C     . ALA C 3 464 ? 18.259  -15.805 43.113  1.00 33.51  ? 464 ALA A C     1 
ATOM   4396 O O     . ALA C 3 464 ? 18.609  -15.223 44.136  1.00 34.91  ? 464 ALA A O     1 
ATOM   4397 C CB    . ALA C 3 464 ? 18.039  -18.288 43.258  1.00 34.15  ? 464 ALA A CB    1 
ATOM   4398 N N     . ILE C 3 465 ? 18.710  -15.483 41.907  1.00 32.60  ? 465 ILE A N     1 
ATOM   4399 C CA    . ILE C 3 465 ? 19.639  -14.382 41.723  1.00 32.89  ? 465 ILE A CA    1 
ATOM   4400 C C     . ILE C 3 465 ? 18.917  -13.059 41.948  1.00 34.39  ? 465 ILE A C     1 
ATOM   4401 O O     . ILE C 3 465 ? 19.428  -12.167 42.624  1.00 35.67  ? 465 ILE A O     1 
ATOM   4402 C CB    . ILE C 3 465 ? 20.246  -14.404 40.315  1.00 30.76  ? 465 ILE A CB    1 
ATOM   4403 C CG1   . ILE C 3 465 ? 21.219  -15.574 40.211  1.00 27.56  ? 465 ILE A CG1   1 
ATOM   4404 C CG2   . ILE C 3 465 ? 20.938  -13.079 40.017  1.00 28.98  ? 465 ILE A CG2   1 
ATOM   4405 C CD1   . ILE C 3 465 ? 21.766  -15.778 38.828  1.00 27.78  ? 465 ILE A CD1   1 
ATOM   4406 N N     . VAL C 3 466 ? 17.719  -12.943 41.389  1.00 34.95  ? 466 VAL A N     1 
ATOM   4407 C CA    . VAL C 3 466 ? 16.924  -11.736 41.540  1.00 36.21  ? 466 VAL A CA    1 
ATOM   4408 C C     . VAL C 3 466 ? 16.670  -11.449 43.012  1.00 38.00  ? 466 VAL A C     1 
ATOM   4409 O O     . VAL C 3 466 ? 16.794  -10.307 43.461  1.00 38.40  ? 466 VAL A O     1 
ATOM   4410 C CB    . VAL C 3 466 ? 15.567  -11.863 40.815  1.00 34.24  ? 466 VAL A CB    1 
ATOM   4411 C CG1   . VAL C 3 466 ? 14.636  -10.738 41.242  1.00 33.05  ? 466 VAL A CG1   1 
ATOM   4412 C CG2   . VAL C 3 466 ? 15.783  -11.818 39.308  1.00 31.58  ? 466 VAL A CG2   1 
ATOM   4413 N N     . GLU C 3 467 ? 16.323  -12.486 43.764  1.00 38.89  ? 467 GLU A N     1 
ATOM   4414 C CA    . GLU C 3 467 ? 16.046  -12.318 45.180  1.00 40.28  ? 467 GLU A CA    1 
ATOM   4415 C C     . GLU C 3 467 ? 17.283  -11.905 45.969  1.00 40.22  ? 467 GLU A C     1 
ATOM   4416 O O     . GLU C 3 467 ? 17.170  -11.245 47.004  1.00 41.55  ? 467 GLU A O     1 
ATOM   4417 C CB    . GLU C 3 467 ? 15.449  -13.602 45.751  1.00 42.79  ? 467 GLU A CB    1 
ATOM   4418 C CG    . GLU C 3 467 ? 14.068  -13.396 46.345  1.00 47.24  ? 467 GLU A CG    1 
ATOM   4419 C CD    . GLU C 3 467 ? 13.169  -14.610 46.190  1.00 50.95  ? 467 GLU A CD    1 
ATOM   4420 O OE1   . GLU C 3 467 ? 12.047  -14.590 46.747  1.00 53.40  ? 467 GLU A OE1   1 
ATOM   4421 O OE2   . GLU C 3 467 ? 13.575  -15.579 45.507  1.00 51.68  ? 467 GLU A OE2   1 
ATOM   4422 N N     . LYS C 3 468 ? 18.462  -12.272 45.477  1.00 39.22  ? 468 LYS A N     1 
ATOM   4423 C CA    . LYS C 3 468 ? 19.704  -11.915 46.156  1.00 38.57  ? 468 LYS A CA    1 
ATOM   4424 C C     . LYS C 3 468 ? 20.033  -10.429 46.057  1.00 38.49  ? 468 LYS A C     1 
ATOM   4425 O O     . LYS C 3 468 ? 20.537  -9.838  47.008  1.00 39.08  ? 468 LYS A O     1 
ATOM   4426 C CB    . LYS C 3 468 ? 20.883  -12.730 45.599  1.00 37.68  ? 468 LYS A CB    1 
ATOM   4427 C CG    . LYS C 3 468 ? 21.053  -14.102 46.246  1.00 39.28  ? 468 LYS A CG    1 
ATOM   4428 C CD    . LYS C 3 468 ? 21.236  -13.962 47.756  1.00 38.29  ? 468 LYS A CD    1 
ATOM   4429 C CE    . LYS C 3 468 ? 21.368  -15.303 48.456  1.00 38.66  ? 468 LYS A CE    1 
ATOM   4430 N NZ    . LYS C 3 468 ? 21.408  -15.140 49.944  1.00 40.17  ? 468 LYS A NZ    1 
ATOM   4431 N N     . LEU C 3 469 ? 19.746  -9.834  44.901  1.00 38.42  ? 469 LEU A N     1 
ATOM   4432 C CA    . LEU C 3 469 ? 20.030  -8.425  44.651  1.00 37.10  ? 469 LEU A CA    1 
ATOM   4433 C C     . LEU C 3 469 ? 18.793  -7.554  44.796  1.00 37.75  ? 469 LEU A C     1 
ATOM   4434 O O     . LEU C 3 469 ? 18.629  -6.559  44.092  1.00 36.83  ? 469 LEU A O     1 
ATOM   4435 C CB    . LEU C 3 469 ? 20.617  -8.261  43.249  1.00 36.61  ? 469 LEU A CB    1 
ATOM   4436 C CG    . LEU C 3 469 ? 21.851  -9.128  42.990  1.00 36.78  ? 469 LEU A CG    1 
ATOM   4437 C CD1   . LEU C 3 469 ? 22.402  -8.865  41.595  1.00 37.92  ? 469 LEU A CD1   1 
ATOM   4438 C CD2   . LEU C 3 469 ? 22.901  -8.817  44.043  1.00 37.24  ? 469 LEU A CD2   1 
ATOM   4439 N N     . ARG C 3 470 ? 17.919  -7.938  45.715  1.00 37.98  ? 470 ARG A N     1 
ATOM   4440 C CA    . ARG C 3 470 ? 16.696  -7.193  45.965  1.00 39.58  ? 470 ARG A CA    1 
ATOM   4441 C C     . ARG C 3 470 ? 17.014  -5.973  46.822  1.00 39.34  ? 470 ARG A C     1 
ATOM   4442 O O     . ARG C 3 470 ? 17.934  -6.007  47.640  1.00 40.77  ? 470 ARG A O     1 
ATOM   4443 C CB    . ARG C 3 470 ? 15.707  -8.096  46.685  1.00 41.59  ? 470 ARG A CB    1 
ATOM   4444 C CG    . ARG C 3 470 ? 14.310  -7.566  46.734  1.00 44.91  ? 470 ARG A CG    1 
ATOM   4445 C CD    . ARG C 3 470 ? 13.351  -8.699  47.059  1.00 49.20  ? 470 ARG A CD    1 
ATOM   4446 N NE    . ARG C 3 470 ? 11.980  -8.228  47.234  1.00 52.41  ? 470 ARG A NE    1 
ATOM   4447 C CZ    . ARG C 3 470 ? 10.934  -9.034  47.364  1.00 53.23  ? 470 ARG A CZ    1 
ATOM   4448 N NH1   . ARG C 3 470 ? 11.107  -10.349 47.333  1.00 53.30  ? 470 ARG A NH1   1 
ATOM   4449 N NH2   . ARG C 3 470 ? 9.722   -8.528  47.532  1.00 54.68  ? 470 ARG A NH2   1 
ATOM   4450 N N     . PHE C 3 471 ? 16.269  -4.888  46.634  1.00 37.20  ? 471 PHE A N     1 
ATOM   4451 C CA    . PHE C 3 471 ? 16.516  -3.693  47.419  1.00 33.50  ? 471 PHE A CA    1 
ATOM   4452 C C     . PHE C 3 471 ? 15.306  -2.783  47.376  1.00 32.89  ? 471 PHE A C     1 
ATOM   4453 O O     . PHE C 3 471 ? 14.419  -2.976  46.552  1.00 34.02  ? 471 PHE A O     1 
ATOM   4454 C CB    . PHE C 3 471 ? 17.772  -2.979  46.909  1.00 34.32  ? 471 PHE A CB    1 
ATOM   4455 C CG    . PHE C 3 471 ? 17.537  -2.067  45.741  1.00 34.21  ? 471 PHE A CG    1 
ATOM   4456 C CD1   . PHE C 3 471 ? 17.485  -0.688  45.925  1.00 34.36  ? 471 PHE A CD1   1 
ATOM   4457 C CD2   . PHE C 3 471 ? 17.392  -2.578  44.456  1.00 33.52  ? 471 PHE A CD2   1 
ATOM   4458 C CE1   . PHE C 3 471 ? 17.296  0.166   44.847  1.00 33.66  ? 471 PHE A CE1   1 
ATOM   4459 C CE2   . PHE C 3 471 ? 17.202  -1.734  43.365  1.00 32.30  ? 471 PHE A CE2   1 
ATOM   4460 C CZ    . PHE C 3 471 ? 17.155  -0.360  43.561  1.00 34.97  ? 471 PHE A CZ    1 
ATOM   4461 N N     . THR C 3 472 ? 15.262  -1.799  48.270  1.00 32.18  ? 472 THR A N     1 
ATOM   4462 C CA    . THR C 3 472 ? 14.131  -0.880  48.337  1.00 30.58  ? 472 THR A CA    1 
ATOM   4463 C C     . THR C 3 472 ? 14.378  0.370   47.517  1.00 31.98  ? 472 THR A C     1 
ATOM   4464 O O     . THR C 3 472 ? 15.224  1.190   47.860  1.00 32.56  ? 472 THR A O     1 
ATOM   4465 C CB    . THR C 3 472 ? 13.848  -0.444  49.782  1.00 30.11  ? 472 THR A CB    1 
ATOM   4466 O OG1   . THR C 3 472 ? 13.748  -1.602  50.618  1.00 26.65  ? 472 THR A OG1   1 
ATOM   4467 C CG2   . THR C 3 472 ? 12.549  0.359   49.854  1.00 27.94  ? 472 THR A CG2   1 
ATOM   4468 N N     . TYR C 3 473 ? 13.618  0.514   46.440  1.00 32.21  ? 473 TYR A N     1 
ATOM   4469 C CA    . TYR C 3 473 ? 13.746  1.659   45.557  1.00 31.48  ? 473 TYR A CA    1 
ATOM   4470 C C     . TYR C 3 473 ? 12.943  2.849   46.056  1.00 31.97  ? 473 TYR A C     1 
ATOM   4471 O O     . TYR C 3 473 ? 11.819  2.703   46.530  1.00 31.98  ? 473 TYR A O     1 
ATOM   4472 C CB    . TYR C 3 473 ? 13.272  1.300   44.147  1.00 28.87  ? 473 TYR A CB    1 
ATOM   4473 C CG    . TYR C 3 473 ? 13.224  2.490   43.212  1.00 26.69  ? 473 TYR A CG    1 
ATOM   4474 C CD1   . TYR C 3 473 ? 14.394  3.075   42.736  1.00 24.74  ? 473 TYR A CD1   1 
ATOM   4475 C CD2   . TYR C 3 473 ? 12.007  3.049   42.835  1.00 26.51  ? 473 TYR A CD2   1 
ATOM   4476 C CE1   . TYR C 3 473 ? 14.352  4.190   41.908  1.00 25.87  ? 473 TYR A CE1   1 
ATOM   4477 C CE2   . TYR C 3 473 ? 11.953  4.163   42.015  1.00 27.08  ? 473 TYR A CE2   1 
ATOM   4478 C CZ    . TYR C 3 473 ? 13.126  4.731   41.556  1.00 27.17  ? 473 TYR A CZ    1 
ATOM   4479 O OH    . TYR C 3 473 ? 13.064  5.850   40.764  1.00 28.80  ? 473 TYR A OH    1 
ATOM   4480 N N     . ARG C 3 474 ? 13.538  4.027   45.923  1.00 32.67  ? 474 ARG A N     1 
ATOM   4481 C CA    . ARG C 3 474 ? 12.921  5.277   46.327  1.00 35.37  ? 474 ARG A CA    1 
ATOM   4482 C C     . ARG C 3 474 ? 13.249  6.291   45.236  1.00 36.30  ? 474 ARG A C     1 
ATOM   4483 O O     . ARG C 3 474 ? 14.416  6.442   44.855  1.00 36.50  ? 474 ARG A O     1 
ATOM   4484 C CB    . ARG C 3 474 ? 13.489  5.716   47.676  1.00 38.68  ? 474 ARG A CB    1 
ATOM   4485 C CG    . ARG C 3 474 ? 13.105  4.770   48.802  1.00 44.61  ? 474 ARG A CG    1 
ATOM   4486 C CD    . ARG C 3 474 ? 14.000  4.915   50.023  1.00 49.11  ? 474 ARG A CD    1 
ATOM   4487 N NE    . ARG C 3 474 ? 13.792  3.810   50.959  1.00 52.30  ? 474 ARG A NE    1 
ATOM   4488 C CZ    . ARG C 3 474 ? 14.630  3.491   51.941  1.00 52.99  ? 474 ARG A CZ    1 
ATOM   4489 N NH1   . ARG C 3 474 ? 15.741  4.197   52.118  1.00 53.91  ? 474 ARG A NH1   1 
ATOM   4490 N NH2   . ARG C 3 474 ? 14.364  2.461   52.737  1.00 50.93  ? 474 ARG A NH2   1 
ATOM   4491 N N     . SER C 3 475 ? 12.225  6.976   44.729  1.00 34.79  ? 475 SER A N     1 
ATOM   4492 C CA    . SER C 3 475 ? 12.422  7.939   43.656  1.00 36.45  ? 475 SER A CA    1 
ATOM   4493 C C     . SER C 3 475 ? 13.535  8.970   43.866  1.00 36.76  ? 475 SER A C     1 
ATOM   4494 O O     . SER C 3 475 ? 13.996  9.570   42.891  1.00 37.36  ? 475 SER A O     1 
ATOM   4495 C CB    . SER C 3 475 ? 11.092  8.648   43.307  1.00 37.13  ? 475 SER A CB    1 
ATOM   4496 O OG    . SER C 3 475 ? 10.514  9.343   44.403  1.00 39.25  ? 475 SER A OG    1 
ATOM   4497 N N     . ASP C 3 476 ? 13.983  9.167   45.111  1.00 35.92  ? 476 ASP A N     1 
ATOM   4498 C CA    . ASP C 3 476 ? 15.052  10.137  45.386  1.00 35.90  ? 476 ASP A CA    1 
ATOM   4499 C C     . ASP C 3 476 ? 16.364  9.529   45.875  1.00 35.76  ? 476 ASP A C     1 
ATOM   4500 O O     . ASP C 3 476 ? 17.118  10.176  46.600  1.00 35.39  ? 476 ASP A O     1 
ATOM   4501 C CB    . ASP C 3 476 ? 14.602  11.191  46.414  1.00 36.85  ? 476 ASP A CB    1 
ATOM   4502 C CG    . ASP C 3 476 ? 14.332  10.602  47.802  1.00 37.37  ? 476 ASP A CG    1 
ATOM   4503 O OD1   . ASP C 3 476 ? 14.943  9.576   48.169  1.00 37.38  ? 476 ASP A OD1   1 
ATOM   4504 O OD2   . ASP C 3 476 ? 13.511  11.189  48.539  1.00 37.87  ? 476 ASP A OD2   1 
ATOM   4505 N N     . SER C 3 477 ? 16.654  8.302   45.472  1.00 35.71  ? 477 SER A N     1 
ATOM   4506 C CA    . SER C 3 477 ? 17.877  7.653   45.922  1.00 36.04  ? 477 SER A CA    1 
ATOM   4507 C C     . SER C 3 477 ? 19.100  7.961   45.065  1.00 35.65  ? 477 SER A C     1 
ATOM   4508 O O     . SER C 3 477 ? 20.228  7.817   45.524  1.00 37.29  ? 477 SER A O     1 
ATOM   4509 C CB    . SER C 3 477 ? 17.682  6.134   45.961  1.00 38.05  ? 477 SER A CB    1 
ATOM   4510 O OG    . SER C 3 477 ? 16.449  5.789   46.561  1.00 43.52  ? 477 SER A OG    1 
ATOM   4511 N N     . PHE C 3 478 ? 18.893  8.380   43.825  1.00 33.92  ? 478 PHE A N     1 
ATOM   4512 C CA    . PHE C 3 478 ? 20.030  8.644   42.954  1.00 33.22  ? 478 PHE A CA    1 
ATOM   4513 C C     . PHE C 3 478 ? 20.257  10.099  42.606  1.00 32.15  ? 478 PHE A C     1 
ATOM   4514 O O     . PHE C 3 478 ? 19.318  10.852  42.365  1.00 33.35  ? 478 PHE A O     1 
ATOM   4515 C CB    . PHE C 3 478 ? 19.894  7.840   41.661  1.00 32.42  ? 478 PHE A CB    1 
ATOM   4516 C CG    . PHE C 3 478 ? 19.711  6.376   41.885  1.00 31.87  ? 478 PHE A CG    1 
ATOM   4517 C CD1   . PHE C 3 478 ? 18.441  5.848   42.098  1.00 33.11  ? 478 PHE A CD1   1 
ATOM   4518 C CD2   . PHE C 3 478 ? 20.807  5.530   41.920  1.00 30.40  ? 478 PHE A CD2   1 
ATOM   4519 C CE1   . PHE C 3 478 ? 18.265  4.494   42.341  1.00 33.64  ? 478 PHE A CE1   1 
ATOM   4520 C CE2   . PHE C 3 478 ? 20.647  4.176   42.163  1.00 32.26  ? 478 PHE A CE2   1 
ATOM   4521 C CZ    . PHE C 3 478 ? 19.372  3.654   42.375  1.00 34.70  ? 478 PHE A CZ    1 
ATOM   4522 N N     . GLU C 3 479 ? 21.522  10.489  42.573  1.00 30.17  ? 479 GLU A N     1 
ATOM   4523 C CA    . GLU C 3 479 ? 21.869  11.849  42.235  1.00 29.44  ? 479 GLU A CA    1 
ATOM   4524 C C     . GLU C 3 479 ? 22.469  11.830  40.845  1.00 28.87  ? 479 GLU A C     1 
ATOM   4525 O O     . GLU C 3 479 ? 23.005  10.814  40.410  1.00 27.51  ? 479 GLU A O     1 
ATOM   4526 C CB    . GLU C 3 479 ? 22.853  12.415  43.267  1.00 31.66  ? 479 GLU A CB    1 
ATOM   4527 C CG    . GLU C 3 479 ? 22.159  12.889  44.552  1.00 34.71  ? 479 GLU A CG    1 
ATOM   4528 C CD    . GLU C 3 479 ? 23.119  13.232  45.682  1.00 38.47  ? 479 GLU A CD    1 
ATOM   4529 O OE1   . GLU C 3 479 ? 24.311  13.497  45.407  1.00 39.03  ? 479 GLU A OE1   1 
ATOM   4530 O OE2   . GLU C 3 479 ? 22.668  13.246  46.852  1.00 40.23  ? 479 GLU A OE2   1 
ATOM   4531 N N     . ASN C 3 480 ? 22.349  12.945  40.135  1.00 29.03  ? 480 ASN A N     1 
ATOM   4532 C CA    . ASN C 3 480 ? 22.884  13.045  38.786  1.00 29.55  ? 480 ASN A CA    1 
ATOM   4533 C C     . ASN C 3 480 ? 24.396  13.288  38.837  1.00 30.17  ? 480 ASN A C     1 
ATOM   4534 O O     . ASN C 3 480 ? 24.848  14.394  39.129  1.00 31.97  ? 480 ASN A O     1 
ATOM   4535 C CB    . ASN C 3 480 ? 22.204  14.184  38.038  1.00 26.10  ? 480 ASN A CB    1 
ATOM   4536 C CG    . ASN C 3 480 ? 22.565  14.201  36.580  1.00 25.49  ? 480 ASN A CG    1 
ATOM   4537 O OD1   . ASN C 3 480 ? 23.648  13.760  36.198  1.00 25.74  ? 480 ASN A OD1   1 
ATOM   4538 N ND2   . ASN C 3 480 ? 21.668  14.719  35.751  1.00 23.90  ? 480 ASN A ND2   1 
ATOM   4539 N N     . PRO C 3 481 ? 25.193  12.250  38.537  1.00 30.04  ? 481 PRO A N     1 
ATOM   4540 C CA    . PRO C 3 481 ? 26.662  12.320  38.548  1.00 28.29  ? 481 PRO A CA    1 
ATOM   4541 C C     . PRO C 3 481 ? 27.189  13.576  37.878  1.00 25.71  ? 481 PRO A C     1 
ATOM   4542 O O     . PRO C 3 481 ? 28.054  14.265  38.411  1.00 26.01  ? 481 PRO A O     1 
ATOM   4543 C CB    . PRO C 3 481 ? 27.079  11.067  37.779  1.00 28.20  ? 481 PRO A CB    1 
ATOM   4544 C CG    . PRO C 3 481 ? 25.967  10.112  38.059  1.00 31.30  ? 481 PRO A CG    1 
ATOM   4545 C CD    . PRO C 3 481 ? 24.734  10.976  37.952  1.00 29.88  ? 481 PRO A CD    1 
ATOM   4546 N N     . VAL C 3 482 ? 26.650  13.853  36.699  1.00 22.40  ? 482 VAL A N     1 
ATOM   4547 C CA    . VAL C 3 482 ? 27.054  14.992  35.901  1.00 20.84  ? 482 VAL A CA    1 
ATOM   4548 C C     . VAL C 3 482 ? 26.786  16.350  36.545  1.00 22.01  ? 482 VAL A C     1 
ATOM   4549 O O     . VAL C 3 482 ? 27.671  17.204  36.564  1.00 21.94  ? 482 VAL A O     1 
ATOM   4550 C CB    . VAL C 3 482 ? 26.372  14.934  34.527  1.00 18.83  ? 482 VAL A CB    1 
ATOM   4551 C CG1   . VAL C 3 482 ? 26.846  16.085  33.648  1.00 15.82  ? 482 VAL A CG1   1 
ATOM   4552 C CG2   . VAL C 3 482 ? 26.662  13.575  33.873  1.00 14.58  ? 482 VAL A CG2   1 
ATOM   4553 N N     . LEU C 3 483 ? 25.578  16.563  37.063  1.00 23.20  ? 483 LEU A N     1 
ATOM   4554 C CA    . LEU C 3 483 ? 25.267  17.845  37.687  1.00 24.53  ? 483 LEU A CA    1 
ATOM   4555 C C     . LEU C 3 483 ? 26.099  18.020  38.938  1.00 25.50  ? 483 LEU A C     1 
ATOM   4556 O O     . LEU C 3 483 ? 26.723  19.060  39.125  1.00 24.76  ? 483 LEU A O     1 
ATOM   4557 C CB    . LEU C 3 483 ? 23.788  17.950  38.061  1.00 26.57  ? 483 LEU A CB    1 
ATOM   4558 C CG    . LEU C 3 483 ? 22.830  18.595  37.065  1.00 30.14  ? 483 LEU A CG    1 
ATOM   4559 C CD1   . LEU C 3 483 ? 21.474  18.791  37.729  1.00 31.27  ? 483 LEU A CD1   1 
ATOM   4560 C CD2   . LEU C 3 483 ? 23.379  19.935  36.608  1.00 31.53  ? 483 LEU A CD2   1 
ATOM   4561 N N     . GLN C 3 484 ? 26.112  16.994  39.788  1.00 25.87  ? 484 GLN A N     1 
ATOM   4562 C CA    . GLN C 3 484 ? 26.858  17.051  41.038  1.00 26.55  ? 484 GLN A CA    1 
ATOM   4563 C C     . GLN C 3 484 ? 28.302  17.458  40.820  1.00 27.17  ? 484 GLN A C     1 
ATOM   4564 O O     . GLN C 3 484 ? 28.809  18.365  41.487  1.00 27.50  ? 484 GLN A O     1 
ATOM   4565 C CB    . GLN C 3 484 ? 26.826  15.704  41.751  1.00 25.72  ? 484 GLN A CB    1 
ATOM   4566 C CG    . GLN C 3 484 ? 25.477  15.326  42.318  1.00 27.56  ? 484 GLN A CG    1 
ATOM   4567 C CD    . GLN C 3 484 ? 24.907  16.390  43.224  1.00 29.16  ? 484 GLN A CD    1 
ATOM   4568 O OE1   . GLN C 3 484 ? 25.601  16.915  44.091  1.00 30.62  ? 484 GLN A OE1   1 
ATOM   4569 N NE2   . GLN C 3 484 ? 23.630  16.709  43.038  1.00 28.72  ? 484 GLN A NE2   1 
ATOM   4570 N N     . GLN C 3 485 ? 28.963  16.795  39.878  1.00 26.68  ? 485 GLN A N     1 
ATOM   4571 C CA    . GLN C 3 485 ? 30.357  17.096  39.608  1.00 24.61  ? 485 GLN A CA    1 
ATOM   4572 C C     . GLN C 3 485 ? 30.528  18.522  39.113  1.00 25.49  ? 485 GLN A C     1 
ATOM   4573 O O     . GLN C 3 485 ? 31.506  19.195  39.458  1.00 25.67  ? 485 GLN A O     1 
ATOM   4574 C CB    . GLN C 3 485 ? 30.933  16.126  38.575  1.00 21.14  ? 485 GLN A CB    1 
ATOM   4575 C CG    . GLN C 3 485 ? 32.440  16.236  38.441  1.00 18.51  ? 485 GLN A CG    1 
ATOM   4576 C CD    . GLN C 3 485 ? 33.125  16.207  39.794  1.00 20.23  ? 485 GLN A CD    1 
ATOM   4577 O OE1   . GLN C 3 485 ? 33.013  15.237  40.538  1.00 20.84  ? 485 GLN A OE1   1 
ATOM   4578 N NE2   . GLN C 3 485 ? 33.823  17.283  40.126  1.00 21.47  ? 485 GLN A NE2   1 
ATOM   4579 N N     . HIS C 3 486 ? 29.570  18.981  38.312  1.00 23.34  ? 486 HIS A N     1 
ATOM   4580 C CA    . HIS C 3 486 ? 29.637  20.324  37.763  1.00 22.76  ? 486 HIS A CA    1 
ATOM   4581 C C     . HIS C 3 486 ? 29.665  21.392  38.845  1.00 20.32  ? 486 HIS A C     1 
ATOM   4582 O O     . HIS C 3 486 ? 30.412  22.364  38.746  1.00 19.84  ? 486 HIS A O     1 
ATOM   4583 C CB    . HIS C 3 486 ? 28.457  20.591  36.825  1.00 23.78  ? 486 HIS A CB    1 
ATOM   4584 C CG    . HIS C 3 486 ? 28.436  21.984  36.271  1.00 24.60  ? 486 HIS A CG    1 
ATOM   4585 N ND1   . HIS C 3 486 ? 29.389  22.448  35.390  1.00 25.15  ? 486 HIS A ND1   1 
ATOM   4586 C CD2   . HIS C 3 486 ? 27.583  23.015  36.481  1.00 23.65  ? 486 HIS A CD2   1 
ATOM   4587 C CE1   . HIS C 3 486 ? 29.121  23.704  35.078  1.00 25.46  ? 486 HIS A CE1   1 
ATOM   4588 N NE2   . HIS C 3 486 ? 28.030  24.071  35.726  1.00 24.17  ? 486 HIS A NE2   1 
ATOM   4589 N N     . PHE C 3 487 ? 28.854  21.216  39.877  1.00 19.59  ? 487 PHE A N     1 
ATOM   4590 C CA    . PHE C 3 487 ? 28.816  22.196  40.946  1.00 20.26  ? 487 PHE A CA    1 
ATOM   4591 C C     . PHE C 3 487 ? 29.933  21.999  41.950  1.00 21.53  ? 487 PHE A C     1 
ATOM   4592 O O     . PHE C 3 487 ? 30.378  22.958  42.588  1.00 20.99  ? 487 PHE A O     1 
ATOM   4593 C CB    . PHE C 3 487 ? 27.441  22.209  41.607  1.00 18.79  ? 487 PHE A CB    1 
ATOM   4594 C CG    . PHE C 3 487 ? 26.382  22.827  40.740  1.00 18.85  ? 487 PHE A CG    1 
ATOM   4595 C CD1   . PHE C 3 487 ? 25.639  22.051  39.867  1.00 16.35  ? 487 PHE A CD1   1 
ATOM   4596 C CD2   . PHE C 3 487 ? 26.188  24.205  40.744  1.00 16.31  ? 487 PHE A CD2   1 
ATOM   4597 C CE1   . PHE C 3 487 ? 24.722  22.636  39.007  1.00 19.04  ? 487 PHE A CE1   1 
ATOM   4598 C CE2   . PHE C 3 487 ? 25.273  24.802  39.888  1.00 17.92  ? 487 PHE A CE2   1 
ATOM   4599 C CZ    . PHE C 3 487 ? 24.537  24.022  39.016  1.00 18.91  ? 487 PHE A CZ    1 
ATOM   4600 N N     . ARG C 3 488 ? 30.396  20.762  42.098  1.00 23.55  ? 488 ARG A N     1 
ATOM   4601 C CA    . ARG C 3 488 ? 31.524  20.536  42.983  1.00 24.36  ? 488 ARG A CA    1 
ATOM   4602 C C     . ARG C 3 488 ? 32.655  21.329  42.317  1.00 24.26  ? 488 ARG A C     1 
ATOM   4603 O O     . ARG C 3 488 ? 33.403  22.032  42.990  1.00 25.30  ? 488 ARG A O     1 
ATOM   4604 C CB    . ARG C 3 488 ? 31.904  19.051  43.057  1.00 24.80  ? 488 ARG A CB    1 
ATOM   4605 C CG    . ARG C 3 488 ? 30.983  18.161  43.903  1.00 24.30  ? 488 ARG A CG    1 
ATOM   4606 C CD    . ARG C 3 488 ? 30.838  18.668  45.329  1.00 25.22  ? 488 ARG A CD    1 
ATOM   4607 N NE    . ARG C 3 488 ? 29.808  19.696  45.421  1.00 25.94  ? 488 ARG A NE    1 
ATOM   4608 C CZ    . ARG C 3 488 ? 28.509  19.463  45.244  1.00 27.05  ? 488 ARG A CZ    1 
ATOM   4609 N NH1   . ARG C 3 488 ? 28.082  18.230  44.974  1.00 25.35  ? 488 ARG A NH1   1 
ATOM   4610 N NH2   . ARG C 3 488 ? 27.638  20.461  45.311  1.00 23.52  ? 488 ARG A NH2   1 
ATOM   4611 N N     . ASN C 3 489 ? 32.756  21.242  40.990  1.00 23.31  ? 489 ASN A N     1 
ATOM   4612 C CA    . ASN C 3 489 ? 33.804  21.968  40.273  1.00 25.29  ? 489 ASN A CA    1 
ATOM   4613 C C     . ASN C 3 489 ? 33.715  23.479  40.460  1.00 25.01  ? 489 ASN A C     1 
ATOM   4614 O O     . ASN C 3 489 ? 34.730  24.141  40.677  1.00 26.45  ? 489 ASN A O     1 
ATOM   4615 C CB    . ASN C 3 489 ? 33.795  21.641  38.770  1.00 24.13  ? 489 ASN A CB    1 
ATOM   4616 C CG    . ASN C 3 489 ? 34.359  20.258  38.470  1.00 26.73  ? 489 ASN A CG    1 
ATOM   4617 O OD1   . ASN C 3 489 ? 35.127  19.711  39.257  1.00 26.83  ? 489 ASN A OD1   1 
ATOM   4618 N ND2   . ASN C 3 489 ? 33.988  19.696  37.323  1.00 27.68  ? 489 ASN A ND2   1 
ATOM   4619 N N     . LEU C 3 490 ? 32.507  24.026  40.375  1.00 25.91  ? 490 LEU A N     1 
ATOM   4620 C CA    . LEU C 3 490 ? 32.329  25.459  40.549  1.00 25.64  ? 490 LEU A CA    1 
ATOM   4621 C C     . LEU C 3 490 ? 32.712  25.867  41.963  1.00 25.31  ? 490 LEU A C     1 
ATOM   4622 O O     . LEU C 3 490 ? 33.285  26.935  42.170  1.00 25.54  ? 490 LEU A O     1 
ATOM   4623 C CB    . LEU C 3 490 ? 30.883  25.864  40.267  1.00 25.03  ? 490 LEU A CB    1 
ATOM   4624 C CG    . LEU C 3 490 ? 30.401  25.636  38.837  1.00 25.57  ? 490 LEU A CG    1 
ATOM   4625 C CD1   . LEU C 3 490 ? 28.992  26.213  38.702  1.00 23.51  ? 490 LEU A CD1   1 
ATOM   4626 C CD2   . LEU C 3 490 ? 31.366  26.286  37.835  1.00 22.11  ? 490 LEU A CD2   1 
ATOM   4627 N N     . GLU C 3 491 ? 32.390  25.011  42.929  1.00 25.27  ? 491 GLU A N     1 
ATOM   4628 C CA    . GLU C 3 491 ? 32.713  25.262  44.331  1.00 26.23  ? 491 GLU A CA    1 
ATOM   4629 C C     . GLU C 3 491 ? 34.213  25.425  44.518  1.00 26.49  ? 491 GLU A C     1 
ATOM   4630 O O     . GLU C 3 491 ? 34.668  26.374  45.160  1.00 28.12  ? 491 GLU A O     1 
ATOM   4631 C CB    . GLU C 3 491 ? 32.212  24.109  45.208  1.00 27.50  ? 491 GLU A CB    1 
ATOM   4632 C CG    . GLU C 3 491 ? 30.792  24.295  45.730  1.00 28.10  ? 491 GLU A CG    1 
ATOM   4633 C CD    . GLU C 3 491 ? 30.040  22.980  45.858  1.00 30.92  ? 491 GLU A CD    1 
ATOM   4634 O OE1   . GLU C 3 491 ? 30.707  21.929  46.000  1.00 29.33  ? 491 GLU A OE1   1 
ATOM   4635 O OE2   . GLU C 3 491 ? 28.785  23.006  45.826  1.00 27.47  ? 491 GLU A OE2   1 
ATOM   4636 N N     . ALA C 3 492 ? 34.977  24.499  43.945  1.00 24.67  ? 492 ALA A N     1 
ATOM   4637 C CA    . ALA C 3 492 ? 36.426  24.532  44.047  1.00 22.76  ? 492 ALA A CA    1 
ATOM   4638 C C     . ALA C 3 492 ? 37.013  25.806  43.431  1.00 23.69  ? 492 ALA A C     1 
ATOM   4639 O O     . ALA C 3 492 ? 38.012  26.338  43.929  1.00 21.70  ? 492 ALA A O     1 
ATOM   4640 C CB    . ALA C 3 492 ? 37.015  23.303  43.382  1.00 20.74  ? 492 ALA A CB    1 
ATOM   4641 N N     . LEU C 3 493 ? 36.393  26.294  42.357  1.00 23.25  ? 493 LEU A N     1 
ATOM   4642 C CA    . LEU C 3 493 ? 36.868  27.502  41.691  1.00 24.26  ? 493 LEU A CA    1 
ATOM   4643 C C     . LEU C 3 493 ? 36.454  28.799  42.394  1.00 25.95  ? 493 LEU A C     1 
ATOM   4644 O O     . LEU C 3 493 ? 37.240  29.745  42.458  1.00 27.14  ? 493 LEU A O     1 
ATOM   4645 C CB    . LEU C 3 493 ? 36.380  27.531  40.246  1.00 24.01  ? 493 LEU A CB    1 
ATOM   4646 C CG    . LEU C 3 493 ? 36.987  26.505  39.289  1.00 25.74  ? 493 LEU A CG    1 
ATOM   4647 C CD1   . LEU C 3 493 ? 36.202  26.499  37.998  1.00 24.00  ? 493 LEU A CD1   1 
ATOM   4648 C CD2   . LEU C 3 493 ? 38.456  26.833  39.026  1.00 23.75  ? 493 LEU A CD2   1 
ATOM   4649 N N     . ALA C 3 494 ? 35.229  28.839  42.921  1.00 25.98  ? 494 ALA A N     1 
ATOM   4650 C CA    . ALA C 3 494 ? 34.709  30.022  43.613  1.00 25.62  ? 494 ALA A CA    1 
ATOM   4651 C C     . ALA C 3 494 ? 35.261  30.202  45.020  1.00 27.71  ? 494 ALA A C     1 
ATOM   4652 O O     . ALA C 3 494 ? 35.346  31.325  45.514  1.00 28.84  ? 494 ALA A O     1 
ATOM   4653 C CB    . ALA C 3 494 ? 33.185  29.967  43.673  1.00 23.61  ? 494 ALA A CB    1 
ATOM   4654 N N     . LEU C 3 495 ? 35.619  29.099  45.673  1.00 28.00  ? 495 LEU A N     1 
ATOM   4655 C CA    . LEU C 3 495 ? 36.152  29.160  47.028  1.00 29.15  ? 495 LEU A CA    1 
ATOM   4656 C C     . LEU C 3 495 ? 37.664  28.921  47.110  1.00 30.89  ? 495 LEU A C     1 
ATOM   4657 O O     . LEU C 3 495 ? 38.248  28.957  48.202  1.00 28.98  ? 495 LEU A O     1 
ATOM   4658 C CB    . LEU C 3 495 ? 35.423  28.145  47.904  1.00 28.71  ? 495 LEU A CB    1 
ATOM   4659 C CG    . LEU C 3 495 ? 33.922  28.417  48.037  1.00 30.80  ? 495 LEU A CG    1 
ATOM   4660 C CD1   . LEU C 3 495 ? 33.212  27.249  48.740  1.00 28.08  ? 495 LEU A CD1   1 
ATOM   4661 C CD2   . LEU C 3 495 ? 33.739  29.722  48.804  1.00 29.22  ? 495 LEU A CD2   1 
ATOM   4662 N N     . ASP C 3 496 ? 38.294  28.679  45.962  1.00 33.26  ? 496 ASP A N     1 
ATOM   4663 C CA    . ASP C 3 496 ? 39.735  28.429  45.925  1.00 36.23  ? 496 ASP A CA    1 
ATOM   4664 C C     . ASP C 3 496 ? 40.127  27.261  46.838  1.00 35.65  ? 496 ASP A C     1 
ATOM   4665 O O     . ASP C 3 496 ? 41.042  27.378  47.660  1.00 35.56  ? 496 ASP A O     1 
ATOM   4666 C CB    . ASP C 3 496 ? 40.485  29.692  46.352  1.00 40.96  ? 496 ASP A CB    1 
ATOM   4667 C CG    . ASP C 3 496 ? 41.388  30.230  45.265  1.00 46.50  ? 496 ASP A CG    1 
ATOM   4668 O OD1   . ASP C 3 496 ? 40.937  30.324  44.097  1.00 47.68  ? 496 ASP A OD1   1 
ATOM   4669 O OD2   . ASP C 3 496 ? 42.550  30.572  45.587  1.00 51.10  ? 496 ASP A OD2   1 
ATOM   4670 N N     . LEU C 3 497 ? 39.427  26.138  46.696  1.00 34.65  ? 497 LEU A N     1 
ATOM   4671 C CA    . LEU C 3 497 ? 39.709  24.965  47.506  1.00 32.98  ? 497 LEU A CA    1 
ATOM   4672 C C     . LEU C 3 497 ? 40.991  24.289  47.038  1.00 33.06  ? 497 LEU A C     1 
ATOM   4673 O O     . LEU C 3 497 ? 41.498  24.575  45.949  1.00 31.58  ? 497 LEU A O     1 
ATOM   4674 C CB    . LEU C 3 497 ? 38.553  23.970  47.431  1.00 34.18  ? 497 LEU A CB    1 
ATOM   4675 C CG    . LEU C 3 497 ? 37.174  24.438  47.903  1.00 35.53  ? 497 LEU A CG    1 
ATOM   4676 C CD1   . LEU C 3 497 ? 36.240  23.237  47.941  1.00 33.30  ? 497 LEU A CD1   1 
ATOM   4677 C CD2   . LEU C 3 497 ? 37.268  25.080  49.292  1.00 35.11  ? 497 LEU A CD2   1 
ATOM   4678 N N     . MET C 3 498 ? 41.516  23.396  47.870  1.00 30.35  ? 498 MET A N     1 
ATOM   4679 C CA    . MET C 3 498 ? 42.741  22.686  47.535  1.00 30.92  ? 498 MET A CA    1 
ATOM   4680 C C     . MET C 3 498 ? 42.482  21.799  46.323  1.00 29.83  ? 498 MET A C     1 
ATOM   4681 O O     . MET C 3 498 ? 43.343  21.647  45.460  1.00 29.99  ? 498 MET A O     1 
ATOM   4682 C CB    . MET C 3 498 ? 43.207  21.855  48.738  1.00 30.01  ? 498 MET A CB    1 
ATOM   4683 C CG    . MET C 3 498 ? 43.424  22.702  49.984  1.00 30.63  ? 498 MET A CG    1 
ATOM   4684 S SD    . MET C 3 498 ? 43.827  21.786  51.467  1.00 30.33  ? 498 MET A SD    1 
ATOM   4685 C CE    . MET C 3 498 ? 42.225  21.268  52.024  1.00 27.58  ? 498 MET A CE    1 
ATOM   4686 N N     . GLU C 3 499 ? 41.287  21.219  46.258  1.00 31.22  ? 499 GLU A N     1 
ATOM   4687 C CA    . GLU C 3 499 ? 40.921  20.371  45.133  1.00 32.97  ? 499 GLU A CA    1 
ATOM   4688 C C     . GLU C 3 499 ? 39.415  20.235  44.962  1.00 32.06  ? 499 GLU A C     1 
ATOM   4689 O O     . GLU C 3 499 ? 38.660  20.355  45.915  1.00 33.08  ? 499 GLU A O     1 
ATOM   4690 C CB    . GLU C 3 499 ? 41.546  18.975  45.268  1.00 34.84  ? 499 GLU A CB    1 
ATOM   4691 C CG    . GLU C 3 499 ? 41.140  18.199  46.507  1.00 35.89  ? 499 GLU A CG    1 
ATOM   4692 C CD    . GLU C 3 499 ? 41.678  16.776  46.495  1.00 38.52  ? 499 GLU A CD    1 
ATOM   4693 O OE1   . GLU C 3 499 ? 42.778  16.561  45.932  1.00 38.67  ? 499 GLU A OE1   1 
ATOM   4694 O OE2   . GLU C 3 499 ? 41.008  15.878  47.056  1.00 38.55  ? 499 GLU A OE2   1 
ATOM   4695 N N     . PRO C 3 500 ? 38.966  19.975  43.726  1.00 32.77  ? 500 PRO A N     1 
ATOM   4696 C CA    . PRO C 3 500 ? 37.539  19.817  43.428  1.00 31.20  ? 500 PRO A CA    1 
ATOM   4697 C C     . PRO C 3 500 ? 37.034  18.543  44.086  1.00 32.21  ? 500 PRO A C     1 
ATOM   4698 O O     . PRO C 3 500 ? 37.547  17.467  43.801  1.00 34.10  ? 500 PRO A O     1 
ATOM   4699 C CB    . PRO C 3 500 ? 37.508  19.684  41.905  1.00 30.28  ? 500 PRO A CB    1 
ATOM   4700 C CG    . PRO C 3 500 ? 38.859  20.244  41.447  1.00 30.87  ? 500 PRO A CG    1 
ATOM   4701 C CD    . PRO C 3 500 ? 39.787  19.781  42.516  1.00 31.12  ? 500 PRO A CD    1 
ATOM   4702 N N     . GLU C 3 501 ? 36.051  18.646  44.972  1.00 33.69  ? 501 GLU A N     1 
ATOM   4703 C CA    . GLU C 3 501 ? 35.517  17.439  45.592  1.00 36.04  ? 501 GLU A CA    1 
ATOM   4704 C C     . GLU C 3 501 ? 35.095  16.531  44.435  1.00 36.12  ? 501 GLU A C     1 
ATOM   4705 O O     . GLU C 3 501 ? 34.698  17.016  43.373  1.00 36.89  ? 501 GLU A O     1 
ATOM   4706 C CB    . GLU C 3 501 ? 34.309  17.768  46.466  1.00 36.56  ? 501 GLU A CB    1 
ATOM   4707 C CG    . GLU C 3 501 ? 33.691  16.550  47.123  1.00 41.30  ? 501 GLU A CG    1 
ATOM   4708 C CD    . GLU C 3 501 ? 32.578  16.906  48.098  1.00 43.42  ? 501 GLU A CD    1 
ATOM   4709 O OE1   . GLU C 3 501 ? 31.914  15.978  48.610  1.00 45.42  ? 501 GLU A OE1   1 
ATOM   4710 O OE2   . GLU C 3 501 ? 32.369  18.110  48.357  1.00 45.21  ? 501 GLU A OE2   1 
ATOM   4711 N N     . GLN C 3 502 ? 35.210  15.223  44.615  1.00 35.10  ? 502 GLN A N     1 
ATOM   4712 C CA    . GLN C 3 502 ? 34.830  14.303  43.550  1.00 35.00  ? 502 GLN A CA    1 
ATOM   4713 C C     . GLN C 3 502 ? 33.532  13.635  43.938  1.00 35.09  ? 502 GLN A C     1 
ATOM   4714 O O     . GLN C 3 502 ? 33.444  13.004  44.991  1.00 35.37  ? 502 GLN A O     1 
ATOM   4715 C CB    . GLN C 3 502 ? 35.916  13.248  43.319  1.00 34.97  ? 502 GLN A CB    1 
ATOM   4716 C CG    . GLN C 3 502 ? 37.237  13.818  42.806  1.00 36.03  ? 502 GLN A CG    1 
ATOM   4717 C CD    . GLN C 3 502 ? 37.085  14.593  41.506  1.00 37.85  ? 502 GLN A CD    1 
ATOM   4718 O OE1   . GLN C 3 502 ? 36.631  14.053  40.497  1.00 38.29  ? 502 GLN A OE1   1 
ATOM   4719 N NE2   . GLN C 3 502 ? 37.468  15.866  41.524  1.00 38.06  ? 502 GLN A NE2   1 
ATOM   4720 N N     . ALA C 3 503 ? 32.520  13.787  43.091  1.00 35.05  ? 503 ALA A N     1 
ATOM   4721 C CA    . ALA C 3 503 ? 31.213  13.207  43.364  1.00 35.63  ? 503 ALA A CA    1 
ATOM   4722 C C     . ALA C 3 503 ? 31.252  11.690  43.314  1.00 34.63  ? 503 ALA A C     1 
ATOM   4723 O O     . ALA C 3 503 ? 32.074  11.098  42.618  1.00 33.24  ? 503 ALA A O     1 
ATOM   4724 C CB    . ALA C 3 503 ? 30.183  13.738  42.367  1.00 35.87  ? 503 ALA A CB    1 
ATOM   4725 N N     . VAL C 3 504 ? 30.358  11.070  44.075  1.00 36.36  ? 504 VAL A N     1 
ATOM   4726 C CA    . VAL C 3 504 ? 30.250  9.618   44.118  1.00 38.15  ? 504 VAL A CA    1 
ATOM   4727 C C     . VAL C 3 504 ? 29.138  9.221   43.153  1.00 37.94  ? 504 VAL A C     1 
ATOM   4728 O O     . VAL C 3 504 ? 27.973  9.527   43.395  1.00 38.81  ? 504 VAL A O     1 
ATOM   4729 C CB    . VAL C 3 504 ? 29.881  9.122   45.544  1.00 39.33  ? 504 VAL A CB    1 
ATOM   4730 C CG1   . VAL C 3 504 ? 29.716  7.604   45.550  1.00 40.34  ? 504 VAL A CG1   1 
ATOM   4731 C CG2   . VAL C 3 504 ? 30.962  9.534   46.532  1.00 41.26  ? 504 VAL A CG2   1 
ATOM   4732 N N     . ASP C 3 505 ? 29.495  8.555   42.058  1.00 37.52  ? 505 ASP A N     1 
ATOM   4733 C CA    . ASP C 3 505 ? 28.497  8.131   41.082  1.00 35.83  ? 505 ASP A CA    1 
ATOM   4734 C C     . ASP C 3 505 ? 27.631  7.061   41.726  1.00 36.33  ? 505 ASP A C     1 
ATOM   4735 O O     . ASP C 3 505 ? 28.048  5.918   41.882  1.00 37.03  ? 505 ASP A O     1 
ATOM   4736 C CB    . ASP C 3 505 ? 29.163  7.553   39.836  1.00 36.43  ? 505 ASP A CB    1 
ATOM   4737 C CG    . ASP C 3 505 ? 28.228  7.523   38.628  1.00 38.69  ? 505 ASP A CG    1 
ATOM   4738 O OD1   . ASP C 3 505 ? 26.992  7.390   38.807  1.00 34.86  ? 505 ASP A OD1   1 
ATOM   4739 O OD2   . ASP C 3 505 ? 28.742  7.626   37.490  1.00 39.03  ? 505 ASP A OD2   1 
ATOM   4740 N N     . LEU C 3 506 ? 26.421  7.441   42.108  1.00 36.62  ? 506 LEU A N     1 
ATOM   4741 C CA    . LEU C 3 506 ? 25.504  6.515   42.743  1.00 35.94  ? 506 LEU A CA    1 
ATOM   4742 C C     . LEU C 3 506 ? 24.829  5.609   41.715  1.00 36.11  ? 506 LEU A C     1 
ATOM   4743 O O     . LEU C 3 506 ? 24.060  4.718   42.077  1.00 35.32  ? 506 LEU A O     1 
ATOM   4744 C CB    . LEU C 3 506 ? 24.450  7.302   43.516  1.00 35.60  ? 506 LEU A CB    1 
ATOM   4745 C CG    . LEU C 3 506 ? 25.001  8.309   44.529  1.00 35.96  ? 506 LEU A CG    1 
ATOM   4746 C CD1   . LEU C 3 506 ? 23.885  9.187   45.078  1.00 33.15  ? 506 LEU A CD1   1 
ATOM   4747 C CD2   . LEU C 3 506 ? 25.674  7.552   45.649  1.00 36.08  ? 506 LEU A CD2   1 
ATOM   4748 N N     . THR C 3 507 ? 25.131  5.827   40.437  1.00 36.30  ? 507 THR A N     1 
ATOM   4749 C CA    . THR C 3 507 ? 24.524  5.042   39.367  1.00 36.25  ? 507 THR A CA    1 
ATOM   4750 C C     . THR C 3 507 ? 25.340  3.803   39.016  1.00 37.00  ? 507 THR A C     1 
ATOM   4751 O O     . THR C 3 507 ? 24.859  2.916   38.302  1.00 37.63  ? 507 THR A O     1 
ATOM   4752 C CB    . THR C 3 507 ? 24.337  5.887   38.082  1.00 35.63  ? 507 THR A CB    1 
ATOM   4753 O OG1   . THR C 3 507 ? 25.570  5.952   37.357  1.00 37.09  ? 507 THR A OG1   1 
ATOM   4754 C CG2   . THR C 3 507 ? 23.918  7.297   38.433  1.00 36.86  ? 507 THR A CG2   1 
ATOM   4755 N N     . LEU C 3 508 ? 26.571  3.739   39.516  1.00 36.56  ? 508 LEU A N     1 
ATOM   4756 C CA    . LEU C 3 508 ? 27.444  2.600   39.242  1.00 36.99  ? 508 LEU A CA    1 
ATOM   4757 C C     . LEU C 3 508 ? 27.146  1.427   40.169  1.00 36.78  ? 508 LEU A C     1 
ATOM   4758 O O     . LEU C 3 508 ? 27.030  1.596   41.379  1.00 35.86  ? 508 LEU A O     1 
ATOM   4759 C CB    . LEU C 3 508 ? 28.915  3.000   39.391  1.00 37.33  ? 508 LEU A CB    1 
ATOM   4760 C CG    . LEU C 3 508 ? 29.556  3.875   38.312  1.00 37.26  ? 508 LEU A CG    1 
ATOM   4761 C CD1   . LEU C 3 508 ? 31.008  4.130   38.686  1.00 35.65  ? 508 LEU A CD1   1 
ATOM   4762 C CD2   . LEU C 3 508 ? 29.476  3.195   36.955  1.00 34.02  ? 508 LEU A CD2   1 
ATOM   4763 N N     . PRO C 3 509 ? 27.019  0.216   39.606  1.00 37.05  ? 509 PRO A N     1 
ATOM   4764 C CA    . PRO C 3 509 ? 26.734  -0.981  40.403  1.00 37.13  ? 509 PRO A CA    1 
ATOM   4765 C C     . PRO C 3 509 ? 27.889  -1.314  41.339  1.00 36.54  ? 509 PRO A C     1 
ATOM   4766 O O     . PRO C 3 509 ? 29.053  -1.158  40.986  1.00 35.47  ? 509 PRO A O     1 
ATOM   4767 C CB    . PRO C 3 509 ? 26.539  -2.071  39.348  1.00 37.58  ? 509 PRO A CB    1 
ATOM   4768 C CG    . PRO C 3 509 ? 26.157  -1.315  38.118  1.00 39.77  ? 509 PRO A CG    1 
ATOM   4769 C CD    . PRO C 3 509 ? 27.052  -0.110  38.173  1.00 38.07  ? 509 PRO A CD    1 
ATOM   4770 N N     . LYS C 3 510 ? 27.553  -1.780  42.532  1.00 37.79  ? 510 LYS A N     1 
ATOM   4771 C CA    . LYS C 3 510 ? 28.550  -2.160  43.522  1.00 39.15  ? 510 LYS A CA    1 
ATOM   4772 C C     . LYS C 3 510 ? 28.950  -3.601  43.191  1.00 38.93  ? 510 LYS A C     1 
ATOM   4773 O O     . LYS C 3 510 ? 28.607  -4.542  43.903  1.00 38.11  ? 510 LYS A O     1 
ATOM   4774 C CB    . LYS C 3 510 ? 27.920  -2.052  44.908  1.00 42.21  ? 510 LYS A CB    1 
ATOM   4775 C CG    . LYS C 3 510 ? 27.020  -0.817  45.013  1.00 45.22  ? 510 LYS A CG    1 
ATOM   4776 C CD    . LYS C 3 510 ? 26.288  -0.700  46.333  1.00 48.66  ? 510 LYS A CD    1 
ATOM   4777 C CE    . LYS C 3 510 ? 25.320  0.480   46.295  1.00 50.66  ? 510 LYS A CE    1 
ATOM   4778 N NZ    . LYS C 3 510 ? 24.604  0.678   47.586  1.00 52.50  ? 510 LYS A NZ    1 
ATOM   4779 N N     . VAL C 3 511 ? 29.669  -3.742  42.080  1.00 39.36  ? 511 VAL A N     1 
ATOM   4780 C CA    . VAL C 3 511 ? 30.134  -5.025  41.555  1.00 39.58  ? 511 VAL A CA    1 
ATOM   4781 C C     . VAL C 3 511 ? 30.660  -6.065  42.556  1.00 39.09  ? 511 VAL A C     1 
ATOM   4782 O O     . VAL C 3 511 ? 30.046  -7.121  42.720  1.00 38.47  ? 511 VAL A O     1 
ATOM   4783 C CB    . VAL C 3 511 ? 31.200  -4.788  40.455  1.00 39.76  ? 511 VAL A CB    1 
ATOM   4784 C CG1   . VAL C 3 511 ? 31.887  -6.085  40.102  1.00 42.26  ? 511 VAL A CG1   1 
ATOM   4785 C CG2   . VAL C 3 511 ? 30.535  -4.204  39.222  1.00 39.60  ? 511 VAL A CG2   1 
ATOM   4786 N N     . GLU C 3 512 ? 31.790  -5.782  43.209  1.00 38.42  ? 512 GLU A N     1 
ATOM   4787 C CA    . GLU C 3 512 ? 32.365  -6.718  44.180  1.00 38.06  ? 512 GLU A CA    1 
ATOM   4788 C C     . GLU C 3 512 ? 31.368  -7.223  45.208  1.00 35.92  ? 512 GLU A C     1 
ATOM   4789 O O     . GLU C 3 512 ? 31.282  -8.426  45.453  1.00 34.77  ? 512 GLU A O     1 
ATOM   4790 C CB    . GLU C 3 512 ? 33.545  -6.089  44.917  1.00 38.29  ? 512 GLU A CB    1 
ATOM   4791 C CG    . GLU C 3 512 ? 34.864  -6.372  44.264  1.00 41.23  ? 512 GLU A CG    1 
ATOM   4792 C CD    . GLU C 3 512 ? 34.931  -5.817  42.866  1.00 43.75  ? 512 GLU A CD    1 
ATOM   4793 O OE1   . GLU C 3 512 ? 34.888  -4.572  42.724  1.00 44.33  ? 512 GLU A OE1   1 
ATOM   4794 O OE2   . GLU C 3 512 ? 35.019  -6.627  41.916  1.00 44.61  ? 512 GLU A OE2   1 
ATOM   4795 N N     . ALA C 3 513 ? 30.632  -6.299  45.817  1.00 34.46  ? 513 ALA A N     1 
ATOM   4796 C CA    . ALA C 3 513 ? 29.636  -6.658  46.817  1.00 34.49  ? 513 ALA A CA    1 
ATOM   4797 C C     . ALA C 3 513 ? 28.628  -7.625  46.211  1.00 33.21  ? 513 ALA A C     1 
ATOM   4798 O O     . ALA C 3 513 ? 28.329  -8.661  46.799  1.00 33.25  ? 513 ALA A O     1 
ATOM   4799 C CB    . ALA C 3 513 ? 28.923  -5.408  47.323  1.00 35.27  ? 513 ALA A CB    1 
ATOM   4800 N N     . MET C 3 514 ? 28.113  -7.274  45.035  1.00 33.86  ? 514 MET A N     1 
ATOM   4801 C CA    . MET C 3 514 ? 27.141  -8.103  44.328  1.00 34.64  ? 514 MET A CA    1 
ATOM   4802 C C     . MET C 3 514 ? 27.680  -9.503  44.047  1.00 33.92  ? 514 MET A C     1 
ATOM   4803 O O     . MET C 3 514 ? 26.975  -10.492 44.242  1.00 32.24  ? 514 MET A O     1 
ATOM   4804 C CB    . MET C 3 514 ? 26.726  -7.436  43.014  1.00 36.11  ? 514 MET A CB    1 
ATOM   4805 C CG    . MET C 3 514 ? 25.884  -6.178  43.193  1.00 38.31  ? 514 MET A CG    1 
ATOM   4806 S SD    . MET C 3 514 ? 25.448  -5.391  41.615  1.00 40.95  ? 514 MET A SD    1 
ATOM   4807 C CE    . MET C 3 514 ? 23.705  -5.679  41.529  1.00 38.69  ? 514 MET A CE    1 
ATOM   4808 N N     . ASN C 3 515 ? 28.930  -9.589  43.597  1.00 33.57  ? 515 ASN A N     1 
ATOM   4809 C CA    . ASN C 3 515 ? 29.531  -10.891 43.309  1.00 34.73  ? 515 ASN A CA    1 
ATOM   4810 C C     . ASN C 3 515 ? 29.541  -11.783 44.554  1.00 36.07  ? 515 ASN A C     1 
ATOM   4811 O O     . ASN C 3 515 ? 29.131  -12.948 44.499  1.00 38.20  ? 515 ASN A O     1 
ATOM   4812 C CB    . ASN C 3 515 ? 30.960  -10.736 42.770  1.00 31.45  ? 515 ASN A CB    1 
ATOM   4813 C CG    . ASN C 3 515 ? 31.009  -10.069 41.389  1.00 32.02  ? 515 ASN A CG    1 
ATOM   4814 O OD1   . ASN C 3 515 ? 29.990  -9.915  40.708  1.00 27.22  ? 515 ASN A OD1   1 
ATOM   4815 N ND2   . ASN C 3 515 ? 32.208  -9.684  40.971  1.00 31.28  ? 515 ASN A ND2   1 
ATOM   4816 N N     . LYS C 3 516 ? 29.998  -11.247 45.680  1.00 36.94  ? 516 LYS A N     1 
ATOM   4817 C CA    . LYS C 3 516 ? 30.027  -12.038 46.903  1.00 38.51  ? 516 LYS A CA    1 
ATOM   4818 C C     . LYS C 3 516 ? 28.606  -12.427 47.299  1.00 39.29  ? 516 LYS A C     1 
ATOM   4819 O O     . LYS C 3 516 ? 28.343  -13.564 47.669  1.00 39.99  ? 516 LYS A O     1 
ATOM   4820 C CB    . LYS C 3 516 ? 30.657  -11.253 48.056  1.00 39.92  ? 516 LYS A CB    1 
ATOM   4821 C CG    . LYS C 3 516 ? 30.809  -12.098 49.309  1.00 40.95  ? 516 LYS A CG    1 
ATOM   4822 C CD    . LYS C 3 516 ? 30.886  -11.276 50.573  1.00 43.66  ? 516 LYS A CD    1 
ATOM   4823 C CE    . LYS C 3 516 ? 31.066  -12.196 51.779  1.00 45.45  ? 516 LYS A CE    1 
ATOM   4824 N NZ    . LYS C 3 516 ? 30.991  -11.483 53.084  1.00 45.66  ? 516 LYS A NZ    1 
ATOM   4825 N N     . ARG C 3 517 ? 27.696  -11.466 47.223  1.00 39.54  ? 517 ARG A N     1 
ATOM   4826 C CA    . ARG C 3 517 ? 26.300  -11.684 47.572  1.00 40.24  ? 517 ARG A CA    1 
ATOM   4827 C C     . ARG C 3 517 ? 25.660  -12.801 46.731  1.00 39.59  ? 517 ARG A C     1 
ATOM   4828 O O     . ARG C 3 517 ? 24.783  -13.517 47.214  1.00 39.13  ? 517 ARG A O     1 
ATOM   4829 C CB    . ARG C 3 517 ? 25.548  -10.366 47.384  1.00 43.33  ? 517 ARG A CB    1 
ATOM   4830 C CG    . ARG C 3 517 ? 24.262  -10.184 48.179  1.00 46.62  ? 517 ARG A CG    1 
ATOM   4831 C CD    . ARG C 3 517 ? 23.895  -8.696  48.166  1.00 50.71  ? 517 ARG A CD    1 
ATOM   4832 N NE    . ARG C 3 517 ? 22.513  -8.413  48.551  1.00 55.04  ? 517 ARG A NE    1 
ATOM   4833 C CZ    . ARG C 3 517 ? 21.943  -7.210  48.455  1.00 56.69  ? 517 ARG A CZ    1 
ATOM   4834 N NH1   . ARG C 3 517 ? 22.641  -6.180  47.988  1.00 57.18  ? 517 ARG A NH1   1 
ATOM   4835 N NH2   . ARG C 3 517 ? 20.675  -7.035  48.816  1.00 56.29  ? 517 ARG A NH2   1 
ATOM   4836 N N     . LEU C 3 518 ? 26.111  -12.956 45.484  1.00 38.63  ? 518 LEU A N     1 
ATOM   4837 C CA    . LEU C 3 518 ? 25.569  -13.976 44.582  1.00 38.25  ? 518 LEU A CA    1 
ATOM   4838 C C     . LEU C 3 518 ? 26.230  -15.345 44.701  1.00 39.84  ? 518 LEU A C     1 
ATOM   4839 O O     . LEU C 3 518 ? 25.635  -16.363 44.338  1.00 39.31  ? 518 LEU A O     1 
ATOM   4840 C CB    . LEU C 3 518 ? 25.670  -13.513 43.127  1.00 36.77  ? 518 LEU A CB    1 
ATOM   4841 C CG    . LEU C 3 518 ? 24.782  -12.347 42.686  1.00 37.08  ? 518 LEU A CG    1 
ATOM   4842 C CD1   . LEU C 3 518 ? 25.203  -11.896 41.302  1.00 33.55  ? 518 LEU A CD1   1 
ATOM   4843 C CD2   . LEU C 3 518 ? 23.315  -12.765 42.711  1.00 35.78  ? 518 LEU A CD2   1 
ATOM   4844 N N     . GLY C 3 519 ? 27.466  -15.372 45.187  1.00 39.86  ? 519 GLY A N     1 
ATOM   4845 C CA    . GLY C 3 519 ? 28.163  -16.635 45.337  1.00 38.43  ? 519 GLY A CA    1 
ATOM   4846 C C     . GLY C 3 519 ? 28.288  -17.424 44.046  1.00 39.87  ? 519 GLY A C     1 
ATOM   4847 O O     . GLY C 3 519 ? 28.744  -16.901 43.030  1.00 40.40  ? 519 GLY A O     1 
ATOM   4848 N N     . SER C 3 520 ? 27.870  -18.686 44.089  1.00 39.80  ? 520 SER A N     1 
ATOM   4849 C CA    . SER C 3 520 ? 27.948  -19.581 42.940  1.00 41.10  ? 520 SER A CA    1 
ATOM   4850 C C     . SER C 3 520 ? 26.742  -19.538 41.999  1.00 42.01  ? 520 SER A C     1 
ATOM   4851 O O     . SER C 3 520 ? 26.751  -20.175 40.948  1.00 43.01  ? 520 SER A O     1 
ATOM   4852 C CB    . SER C 3 520 ? 28.149  -21.016 43.427  1.00 40.96  ? 520 SER A CB    1 
ATOM   4853 O OG    . SER C 3 520 ? 27.118  -21.389 44.323  1.00 40.60  ? 520 SER A OG    1 
ATOM   4854 N N     . LEU C 3 521 ? 25.708  -18.793 42.372  1.00 42.75  ? 521 LEU A N     1 
ATOM   4855 C CA    . LEU C 3 521 ? 24.513  -18.684 41.545  1.00 41.66  ? 521 LEU A CA    1 
ATOM   4856 C C     . LEU C 3 521 ? 24.842  -18.318 40.098  1.00 42.39  ? 521 LEU A C     1 
ATOM   4857 O O     . LEU C 3 521 ? 24.161  -18.752 39.160  1.00 41.23  ? 521 LEU A O     1 
ATOM   4858 C CB    . LEU C 3 521 ? 23.569  -17.641 42.139  1.00 40.39  ? 521 LEU A CB    1 
ATOM   4859 C CG    . LEU C 3 521 ? 22.931  -18.016 43.475  1.00 38.64  ? 521 LEU A CG    1 
ATOM   4860 C CD1   . LEU C 3 521 ? 22.079  -16.873 43.967  1.00 40.16  ? 521 LEU A CD1   1 
ATOM   4861 C CD2   . LEU C 3 521 ? 22.086  -19.265 43.303  1.00 38.68  ? 521 LEU A CD2   1 
ATOM   4862 N N     . VAL C 3 522 ? 25.892  -17.522 39.917  1.00 42.08  ? 522 VAL A N     1 
ATOM   4863 C CA    . VAL C 3 522 ? 26.289  -17.102 38.582  1.00 41.36  ? 522 VAL A CA    1 
ATOM   4864 C C     . VAL C 3 522 ? 26.811  -18.282 37.790  1.00 41.26  ? 522 VAL A C     1 
ATOM   4865 O O     . VAL C 3 522 ? 26.346  -18.545 36.680  1.00 41.02  ? 522 VAL A O     1 
ATOM   4866 C CB    . VAL C 3 522 ? 27.376  -16.022 38.631  1.00 41.36  ? 522 VAL A CB    1 
ATOM   4867 C CG1   . VAL C 3 522 ? 27.731  -15.578 37.219  1.00 43.01  ? 522 VAL A CG1   1 
ATOM   4868 C CG2   . VAL C 3 522 ? 26.886  -14.841 39.443  1.00 42.16  ? 522 VAL A CG2   1 
ATOM   4869 N N     . ASP C 3 523 ? 27.779  -18.994 38.355  1.00 41.45  ? 523 ASP A N     1 
ATOM   4870 C CA    . ASP C 3 523 ? 28.337  -20.147 37.670  1.00 41.47  ? 523 ASP A CA    1 
ATOM   4871 C C     . ASP C 3 523 ? 27.250  -21.172 37.403  1.00 40.11  ? 523 ASP A C     1 
ATOM   4872 O O     . ASP C 3 523 ? 27.252  -21.828 36.365  1.00 39.04  ? 523 ASP A O     1 
ATOM   4873 C CB    . ASP C 3 523 ? 29.467  -20.774 38.488  1.00 44.12  ? 523 ASP A CB    1 
ATOM   4874 C CG    . ASP C 3 523 ? 30.729  -19.936 38.465  1.00 48.90  ? 523 ASP A CG    1 
ATOM   4875 O OD1   . ASP C 3 523 ? 31.007  -19.318 37.411  1.00 49.56  ? 523 ASP A OD1   1 
ATOM   4876 O OD2   . ASP C 3 523 ? 31.449  -19.902 39.489  1.00 52.23  ? 523 ASP A OD2   1 
ATOM   4877 N N     . GLU C 3 524 ? 26.319  -21.297 38.343  1.00 39.49  ? 524 GLU A N     1 
ATOM   4878 C CA    . GLU C 3 524 ? 25.211  -22.232 38.204  1.00 39.67  ? 524 GLU A CA    1 
ATOM   4879 C C     . GLU C 3 524 ? 24.343  -21.856 37.009  1.00 39.77  ? 524 GLU A C     1 
ATOM   4880 O O     . GLU C 3 524 ? 24.067  -22.690 36.141  1.00 39.98  ? 524 GLU A O     1 
ATOM   4881 C CB    . GLU C 3 524 ? 24.374  -22.245 39.486  1.00 40.31  ? 524 GLU A CB    1 
ATOM   4882 C CG    . GLU C 3 524 ? 24.960  -23.117 40.583  1.00 39.77  ? 524 GLU A CG    1 
ATOM   4883 C CD    . GLU C 3 524 ? 24.481  -22.725 41.962  1.00 41.49  ? 524 GLU A CD    1 
ATOM   4884 O OE1   . GLU C 3 524 ? 23.256  -22.627 42.176  1.00 40.71  ? 524 GLU A OE1   1 
ATOM   4885 O OE2   . GLU C 3 524 ? 25.339  -22.519 42.841  1.00 45.22  ? 524 GLU A OE2   1 
ATOM   4886 N N     . PHE C 3 525 ? 23.927  -20.593 36.967  1.00 40.14  ? 525 PHE A N     1 
ATOM   4887 C CA    . PHE C 3 525 ? 23.099  -20.088 35.878  1.00 38.90  ? 525 PHE A CA    1 
ATOM   4888 C C     . PHE C 3 525 ? 23.774  -20.373 34.533  1.00 39.60  ? 525 PHE A C     1 
ATOM   4889 O O     . PHE C 3 525 ? 23.134  -20.861 33.597  1.00 40.38  ? 525 PHE A O     1 
ATOM   4890 C CB    . PHE C 3 525 ? 22.884  -18.580 36.041  1.00 37.63  ? 525 PHE A CB    1 
ATOM   4891 C CG    . PHE C 3 525 ? 21.930  -17.993 35.044  1.00 34.69  ? 525 PHE A CG    1 
ATOM   4892 C CD1   . PHE C 3 525 ? 20.567  -18.262 35.124  1.00 35.16  ? 525 PHE A CD1   1 
ATOM   4893 C CD2   . PHE C 3 525 ? 22.394  -17.195 34.009  1.00 34.98  ? 525 PHE A CD2   1 
ATOM   4894 C CE1   . PHE C 3 525 ? 19.677  -17.747 34.184  1.00 35.10  ? 525 PHE A CE1   1 
ATOM   4895 C CE2   . PHE C 3 525 ? 21.510  -16.671 33.059  1.00 36.02  ? 525 PHE A CE2   1 
ATOM   4896 C CZ    . PHE C 3 525 ? 20.148  -16.950 33.148  1.00 35.48  ? 525 PHE A CZ    1 
ATOM   4897 N N     . LYS C 3 526 ? 25.068  -20.076 34.446  1.00 39.47  ? 526 LYS A N     1 
ATOM   4898 C CA    . LYS C 3 526 ? 25.831  -20.291 33.220  1.00 41.31  ? 526 LYS A CA    1 
ATOM   4899 C C     . LYS C 3 526 ? 25.794  -21.732 32.720  1.00 42.35  ? 526 LYS A C     1 
ATOM   4900 O O     . LYS C 3 526 ? 25.601  -21.976 31.526  1.00 41.09  ? 526 LYS A O     1 
ATOM   4901 C CB    . LYS C 3 526 ? 27.284  -19.871 33.419  1.00 41.17  ? 526 LYS A CB    1 
ATOM   4902 C CG    . LYS C 3 526 ? 27.491  -18.368 33.490  1.00 44.43  ? 526 LYS A CG    1 
ATOM   4903 C CD    . LYS C 3 526 ? 28.954  -18.045 33.723  1.00 44.33  ? 526 LYS A CD    1 
ATOM   4904 C CE    . LYS C 3 526 ? 29.213  -16.554 33.705  1.00 44.54  ? 526 LYS A CE    1 
ATOM   4905 N NZ    . LYS C 3 526 ? 30.653  -16.274 33.958  1.00 42.84  ? 526 LYS A NZ    1 
ATOM   4906 N N     . GLU C 3 527 ? 25.983  -22.684 33.626  1.00 42.64  ? 527 GLU A N     1 
ATOM   4907 C CA    . GLU C 3 527 ? 25.964  -24.085 33.239  1.00 42.97  ? 527 GLU A CA    1 
ATOM   4908 C C     . GLU C 3 527 ? 24.614  -24.491 32.668  1.00 42.54  ? 527 GLU A C     1 
ATOM   4909 O O     . GLU C 3 527 ? 24.541  -25.356 31.799  1.00 42.62  ? 527 GLU A O     1 
ATOM   4910 C CB    . GLU C 3 527 ? 26.324  -24.981 34.425  1.00 44.17  ? 527 GLU A CB    1 
ATOM   4911 C CG    . GLU C 3 527 ? 27.745  -25.522 34.352  1.00 47.18  ? 527 GLU A CG    1 
ATOM   4912 C CD    . GLU C 3 527 ? 27.808  -27.034 34.543  1.00 49.62  ? 527 GLU A CD    1 
ATOM   4913 O OE1   . GLU C 3 527 ? 27.720  -27.498 35.703  1.00 49.62  ? 527 GLU A OE1   1 
ATOM   4914 O OE2   . GLU C 3 527 ? 27.934  -27.758 33.526  1.00 49.89  ? 527 GLU A OE2   1 
ATOM   4915 N N     . LEU C 3 528 ? 23.547  -23.861 33.150  1.00 41.91  ? 528 LEU A N     1 
ATOM   4916 C CA    . LEU C 3 528 ? 22.200  -24.160 32.665  1.00 41.87  ? 528 LEU A CA    1 
ATOM   4917 C C     . LEU C 3 528 ? 21.864  -23.462 31.346  1.00 42.09  ? 528 LEU A C     1 
ATOM   4918 O O     . LEU C 3 528 ? 20.921  -23.855 30.665  1.00 40.62  ? 528 LEU A O     1 
ATOM   4919 C CB    . LEU C 3 528 ? 21.154  -23.738 33.698  1.00 40.60  ? 528 LEU A CB    1 
ATOM   4920 C CG    . LEU C 3 528 ? 21.048  -24.521 35.003  1.00 40.76  ? 528 LEU A CG    1 
ATOM   4921 C CD1   . LEU C 3 528 ? 20.030  -23.855 35.917  1.00 38.02  ? 528 LEU A CD1   1 
ATOM   4922 C CD2   . LEU C 3 528 ? 20.644  -25.958 34.702  1.00 41.34  ? 528 LEU A CD2   1 
ATOM   4923 N N     . VAL C 3 529 ? 22.640  -22.440 30.984  1.00 42.90  ? 529 VAL A N     1 
ATOM   4924 C CA    . VAL C 3 529 ? 22.365  -21.663 29.777  1.00 43.85  ? 529 VAL A CA    1 
ATOM   4925 C C     . VAL C 3 529 ? 23.442  -21.565 28.698  1.00 45.86  ? 529 VAL A C     1 
ATOM   4926 O O     . VAL C 3 529 ? 23.157  -21.760 27.519  1.00 45.97  ? 529 VAL A O     1 
ATOM   4927 C CB    . VAL C 3 529 ? 21.957  -20.213 30.166  1.00 43.56  ? 529 VAL A CB    1 
ATOM   4928 C CG1   . VAL C 3 529 ? 21.843  -19.341 28.933  1.00 42.81  ? 529 VAL A CG1   1 
ATOM   4929 C CG2   . VAL C 3 529 ? 20.635  -20.232 30.926  1.00 43.17  ? 529 VAL A CG2   1 
ATOM   4930 N N     . TYR C 3 530 ? 24.671  -21.249 29.088  1.00 48.12  ? 530 TYR A N     1 
ATOM   4931 C CA    . TYR C 3 530 ? 25.748  -21.076 28.116  1.00 49.80  ? 530 TYR A CA    1 
ATOM   4932 C C     . TYR C 3 530 ? 26.588  -22.311 27.823  1.00 52.02  ? 530 TYR A C     1 
ATOM   4933 O O     . TYR C 3 530 ? 27.194  -22.891 28.721  1.00 52.49  ? 530 TYR A O     1 
ATOM   4934 C CB    . TYR C 3 530 ? 26.672  -19.940 28.571  1.00 48.73  ? 530 TYR A CB    1 
ATOM   4935 C CG    . TYR C 3 530 ? 26.002  -18.585 28.668  1.00 50.40  ? 530 TYR A CG    1 
ATOM   4936 C CD1   . TYR C 3 530 ? 26.581  -17.548 29.406  1.00 51.49  ? 530 TYR A CD1   1 
ATOM   4937 C CD2   . TYR C 3 530 ? 24.804  -18.326 28.005  1.00 50.06  ? 530 TYR A CD2   1 
ATOM   4938 C CE1   . TYR C 3 530 ? 25.980  -16.289 29.479  1.00 50.11  ? 530 TYR A CE1   1 
ATOM   4939 C CE2   . TYR C 3 530 ? 24.199  -17.075 28.070  1.00 50.28  ? 530 TYR A CE2   1 
ATOM   4940 C CZ    . TYR C 3 530 ? 24.789  -16.064 28.808  1.00 50.22  ? 530 TYR A CZ    1 
ATOM   4941 O OH    . TYR C 3 530 ? 24.180  -14.835 28.877  1.00 49.14  ? 530 TYR A OH    1 
ATOM   4942 N N     . PRO C 3 531 ? 26.637  -22.730 26.551  1.00 53.80  ? 531 PRO A N     1 
ATOM   4943 C CA    . PRO C 3 531 ? 27.438  -23.905 26.211  1.00 55.02  ? 531 PRO A CA    1 
ATOM   4944 C C     . PRO C 3 531 ? 28.871  -23.542 26.546  1.00 56.98  ? 531 PRO A C     1 
ATOM   4945 O O     . PRO C 3 531 ? 29.286  -22.403 26.343  1.00 55.87  ? 531 PRO A O     1 
ATOM   4946 C CB    . PRO C 3 531 ? 27.234  -24.042 24.705  1.00 54.84  ? 531 PRO A CB    1 
ATOM   4947 C CG    . PRO C 3 531 ? 25.875  -23.451 24.488  1.00 55.36  ? 531 PRO A CG    1 
ATOM   4948 C CD    . PRO C 3 531 ? 25.911  -22.229 25.373  1.00 54.29  ? 531 PRO A CD    1 
ATOM   4949 N N     . PRO C 3 532 ? 29.649  -24.496 27.068  1.00 59.79  ? 532 PRO A N     1 
ATOM   4950 C CA    . PRO C 3 532 ? 31.036  -24.151 27.393  1.00 61.74  ? 532 PRO A CA    1 
ATOM   4951 C C     . PRO C 3 532 ? 31.722  -23.599 26.154  1.00 63.66  ? 532 PRO A C     1 
ATOM   4952 O O     . PRO C 3 532 ? 32.734  -22.905 26.236  1.00 63.19  ? 532 PRO A O     1 
ATOM   4953 C CB    . PRO C 3 532 ? 31.621  -25.484 27.855  1.00 61.46  ? 532 PRO A CB    1 
ATOM   4954 C CG    . PRO C 3 532 ? 30.827  -26.489 27.068  1.00 61.13  ? 532 PRO A CG    1 
ATOM   4955 C CD    . PRO C 3 532 ? 29.425  -25.948 27.171  1.00 60.05  ? 532 PRO A CD    1 
ATOM   4956 N N     . ASP C 3 533 ? 31.134  -23.908 25.005  1.00 66.39  ? 533 ASP A N     1 
ATOM   4957 C CA    . ASP C 3 533 ? 31.651  -23.468 23.717  1.00 69.98  ? 533 ASP A CA    1 
ATOM   4958 C C     . ASP C 3 533 ? 30.897  -22.219 23.259  1.00 71.75  ? 533 ASP A C     1 
ATOM   4959 O O     . ASP C 3 533 ? 30.258  -22.225 22.206  1.00 72.68  ? 533 ASP A O     1 
ATOM   4960 C CB    . ASP C 3 533 ? 31.469  -24.593 22.694  1.00 71.43  ? 533 ASP A CB    1 
ATOM   4961 C CG    . ASP C 3 533 ? 32.076  -24.264 21.347  1.00 72.95  ? 533 ASP A CG    1 
ATOM   4962 O OD1   . ASP C 3 533 ? 33.318  -24.148 21.265  1.00 73.44  ? 533 ASP A OD1   1 
ATOM   4963 O OD2   . ASP C 3 533 ? 31.308  -24.122 20.370  1.00 74.05  ? 533 ASP A OD2   1 
ATOM   4964 N N     . TYR C 3 534 ? 30.970  -21.152 24.052  1.00 72.44  ? 534 TYR A N     1 
ATOM   4965 C CA    . TYR C 3 534 ? 30.282  -19.901 23.730  1.00 73.38  ? 534 TYR A CA    1 
ATOM   4966 C C     . TYR C 3 534 ? 31.276  -18.754 23.530  1.00 73.85  ? 534 TYR A C     1 
ATOM   4967 O O     . TYR C 3 534 ? 32.475  -18.970 23.804  1.00 73.66  ? 534 TYR A O     1 
ATOM   4968 C CB    . TYR C 3 534 ? 29.294  -19.555 24.853  1.00 72.60  ? 534 TYR A CB    1 
ATOM   4969 C CG    . TYR C 3 534 ? 28.419  -18.343 24.591  1.00 73.33  ? 534 TYR A CG    1 
ATOM   4970 C CD1   . TYR C 3 534 ? 27.578  -18.285 23.476  1.00 72.90  ? 534 TYR A CD1   1 
ATOM   4971 C CD2   . TYR C 3 534 ? 28.416  -17.259 25.473  1.00 73.63  ? 534 TYR A CD2   1 
ATOM   4972 C CE1   . TYR C 3 534 ? 26.757  -17.177 23.246  1.00 72.01  ? 534 TYR A CE1   1 
ATOM   4973 C CE2   . TYR C 3 534 ? 27.598  -16.149 25.253  1.00 72.98  ? 534 TYR A CE2   1 
ATOM   4974 C CZ    . TYR C 3 534 ? 26.773  -16.114 24.139  1.00 72.10  ? 534 TYR A CZ    1 
ATOM   4975 O OH    . TYR C 3 534 ? 25.968  -15.019 23.927  1.00 69.24  ? 534 TYR A OH    1 
ATOM   4976 N N     . ASN D 4 6   ? 15.250  -0.392  3.183   1.00 45.01  ? 6   ASN B N     1 
ATOM   4977 C CA    . ASN D 4 6   ? 16.072  0.757   2.708   1.00 45.05  ? 6   ASN B CA    1 
ATOM   4978 C C     . ASN D 4 6   ? 15.335  1.564   1.635   1.00 42.85  ? 6   ASN B C     1 
ATOM   4979 O O     . ASN D 4 6   ? 15.347  2.790   1.661   1.00 43.31  ? 6   ASN B O     1 
ATOM   4980 C CB    . ASN D 4 6   ? 17.413  0.246   2.168   1.00 47.98  ? 6   ASN B CB    1 
ATOM   4981 C CG    . ASN D 4 6   ? 18.352  1.373   1.771   1.00 52.56  ? 6   ASN B CG    1 
ATOM   4982 O OD1   . ASN D 4 6   ? 18.191  1.990   0.715   1.00 55.59  ? 6   ASN B OD1   1 
ATOM   4983 N ND2   . ASN D 4 6   ? 19.336  1.654   2.622   1.00 53.87  ? 6   ASN B ND2   1 
ATOM   4984 N N     . LYS D 4 7   ? 14.682  0.869   0.707   1.00 40.76  ? 7   LYS B N     1 
ATOM   4985 C CA    . LYS D 4 7   ? 13.932  1.502   -0.383  1.00 37.39  ? 7   LYS B CA    1 
ATOM   4986 C C     . LYS D 4 7   ? 12.762  0.571   -0.751  1.00 35.99  ? 7   LYS B C     1 
ATOM   4987 O O     . LYS D 4 7   ? 12.842  -0.641  -0.539  1.00 36.14  ? 7   LYS B O     1 
ATOM   4988 C CB    . LYS D 4 7   ? 14.848  1.673   -1.592  1.00 37.74  ? 7   LYS B CB    1 
ATOM   4989 C CG    . LYS D 4 7   ? 14.350  2.634   -2.653  1.00 39.87  ? 7   LYS B CG    1 
ATOM   4990 C CD    . LYS D 4 7   ? 14.930  2.283   -4.020  1.00 41.84  ? 7   LYS B CD    1 
ATOM   4991 C CE    . LYS D 4 7   ? 16.444  2.122   -3.990  1.00 45.79  ? 7   LYS B CE    1 
ATOM   4992 N NZ    . LYS D 4 7   ? 16.990  1.672   -5.304  1.00 46.53  ? 7   LYS B NZ    1 
ATOM   4993 N N     . ALA D 4 8   ? 11.680  1.115   -1.303  1.00 33.06  ? 8   ALA B N     1 
ATOM   4994 C CA    . ALA D 4 8   ? 10.540  0.274   -1.670  1.00 29.36  ? 8   ALA B CA    1 
ATOM   4995 C C     . ALA D 4 8   ? 9.858   0.676   -2.974  1.00 26.52  ? 8   ALA B C     1 
ATOM   4996 O O     . ALA D 4 8   ? 9.819   1.848   -3.329  1.00 25.61  ? 8   ALA B O     1 
ATOM   4997 C CB    . ALA D 4 8   ? 9.518   0.261   -0.537  1.00 28.82  ? 8   ALA B CB    1 
ATOM   4998 N N     . ALA D 4 9   ? 9.330   -0.317  -3.682  1.00 24.25  ? 9   ALA B N     1 
ATOM   4999 C CA    . ALA D 4 9   ? 8.624   -0.101  -4.945  1.00 23.21  ? 9   ALA B CA    1 
ATOM   5000 C C     . ALA D 4 9   ? 7.122   -0.258  -4.679  1.00 21.72  ? 9   ALA B C     1 
ATOM   5001 O O     . ALA D 4 9   ? 6.673   -1.311  -4.231  1.00 22.98  ? 9   ALA B O     1 
ATOM   5002 C CB    . ALA D 4 9   ? 9.096   -1.124  -5.987  1.00 21.17  ? 9   ALA B CB    1 
ATOM   5003 N N     . VAL D 4 10  ? 6.346   0.784   -4.955  1.00 20.74  ? 10  VAL B N     1 
ATOM   5004 C CA    . VAL D 4 10  ? 4.910   0.745   -4.700  1.00 19.56  ? 10  VAL B CA    1 
ATOM   5005 C C     . VAL D 4 10  ? 4.028   1.088   -5.889  1.00 20.33  ? 10  VAL B C     1 
ATOM   5006 O O     . VAL D 4 10  ? 4.280   2.043   -6.628  1.00 21.30  ? 10  VAL B O     1 
ATOM   5007 C CB    . VAL D 4 10  ? 4.532   1.706   -3.545  1.00 19.31  ? 10  VAL B CB    1 
ATOM   5008 C CG1   . VAL D 4 10  ? 3.014   1.771   -3.383  1.00 17.23  ? 10  VAL B CG1   1 
ATOM   5009 C CG2   . VAL D 4 10  ? 5.189   1.242   -2.250  1.00 19.09  ? 10  VAL B CG2   1 
ATOM   5010 N N     . VAL D 4 11  ? 2.969   0.312   -6.062  1.00 20.10  ? 11  VAL B N     1 
ATOM   5011 C CA    . VAL D 4 11  ? 2.043   0.580   -7.150  1.00 20.47  ? 11  VAL B CA    1 
ATOM   5012 C C     . VAL D 4 11  ? 0.661   0.856   -6.568  1.00 19.14  ? 11  VAL B C     1 
ATOM   5013 O O     . VAL D 4 11  ? 0.095   0.025   -5.871  1.00 18.47  ? 11  VAL B O     1 
ATOM   5014 C CB    . VAL D 4 11  ? 1.958   -0.613  -8.144  1.00 20.25  ? 11  VAL B CB    1 
ATOM   5015 C CG1   . VAL D 4 11  ? 1.134   -0.227  -9.346  1.00 19.26  ? 11  VAL B CG1   1 
ATOM   5016 C CG2   . VAL D 4 11  ? 3.344   -1.020  -8.590  1.00 20.26  ? 11  VAL B CG2   1 
ATOM   5017 N N     . LEU D 4 12  ? 0.139   2.048   -6.815  1.00 18.53  ? 12  LEU B N     1 
ATOM   5018 C CA    . LEU D 4 12  ? -1.192  2.389   -6.339  1.00 18.27  ? 12  LEU B CA    1 
ATOM   5019 C C     . LEU D 4 12  ? -2.098  2.009   -7.507  1.00 18.19  ? 12  LEU B C     1 
ATOM   5020 O O     . LEU D 4 12  ? -1.922  2.504   -8.619  1.00 19.34  ? 12  LEU B O     1 
ATOM   5021 C CB    . LEU D 4 12  ? -1.287  3.886   -6.038  1.00 16.24  ? 12  LEU B CB    1 
ATOM   5022 C CG    . LEU D 4 12  ? -0.262  4.350   -4.996  1.00 18.19  ? 12  LEU B CG    1 
ATOM   5023 C CD1   . LEU D 4 12  ? -0.247  5.867   -4.895  1.00 16.06  ? 12  LEU B CD1   1 
ATOM   5024 C CD2   . LEU D 4 12  ? -0.590  3.717   -3.646  1.00 17.14  ? 12  LEU B CD2   1 
ATOM   5025 N N     . CYS D 4 13  ? -3.038  1.104   -7.262  1.00 17.25  ? 13  CYS B N     1 
ATOM   5026 C CA    . CYS D 4 13  ? -3.948  0.652   -8.298  1.00 19.53  ? 13  CYS B CA    1 
ATOM   5027 C C     . CYS D 4 13  ? -5.320  1.245   -8.001  1.00 19.99  ? 13  CYS B C     1 
ATOM   5028 O O     . CYS D 4 13  ? -6.066  0.727   -7.178  1.00 22.19  ? 13  CYS B O     1 
ATOM   5029 C CB    . CYS D 4 13  ? -3.990  -0.880  -8.292  1.00 19.85  ? 13  CYS B CB    1 
ATOM   5030 S SG    . CYS D 4 13  ? -4.766  -1.683  -9.711  1.00 21.98  ? 13  CYS B SG    1 
ATOM   5031 N N     . MET D 4 14  ? -5.650  2.336   -8.682  1.00 22.25  ? 14  MET B N     1 
ATOM   5032 C CA    . MET D 4 14  ? -6.916  3.026   -8.455  1.00 23.79  ? 14  MET B CA    1 
ATOM   5033 C C     . MET D 4 14  ? -8.059  2.733   -9.426  1.00 23.33  ? 14  MET B C     1 
ATOM   5034 O O     . MET D 4 14  ? -7.863  2.621   -10.635 1.00 23.03  ? 14  MET B O     1 
ATOM   5035 C CB    . MET D 4 14  ? -6.679  4.540   -8.418  1.00 22.85  ? 14  MET B CB    1 
ATOM   5036 C CG    . MET D 4 14  ? -7.952  5.340   -8.248  1.00 23.91  ? 14  MET B CG    1 
ATOM   5037 S SD    . MET D 4 14  ? -7.666  7.096   -8.404  1.00 28.19  ? 14  MET B SD    1 
ATOM   5038 C CE    . MET D 4 14  ? -9.057  7.741   -7.462  1.00 23.68  ? 14  MET B CE    1 
ATOM   5039 N N     . ASP D 4 15  ? -9.259  2.640   -8.863  1.00 24.21  ? 15  ASP B N     1 
ATOM   5040 C CA    . ASP D 4 15  ? -10.487 2.375   -9.611  1.00 24.54  ? 15  ASP B CA    1 
ATOM   5041 C C     . ASP D 4 15  ? -11.157 3.717   -9.913  1.00 23.95  ? 15  ASP B C     1 
ATOM   5042 O O     . ASP D 4 15  ? -11.549 4.446   -9.001  1.00 22.11  ? 15  ASP B O     1 
ATOM   5043 C CB    . ASP D 4 15  ? -11.433 1.519   -8.756  1.00 25.37  ? 15  ASP B CB    1 
ATOM   5044 C CG    . ASP D 4 15  ? -12.554 0.887   -9.558  1.00 27.64  ? 15  ASP B CG    1 
ATOM   5045 O OD1   . ASP D 4 15  ? -13.073 1.530   -10.495 1.00 27.72  ? 15  ASP B OD1   1 
ATOM   5046 O OD2   . ASP D 4 15  ? -12.932 -0.265  -9.234  1.00 30.69  ? 15  ASP B OD2   1 
ATOM   5047 N N     . VAL D 4 16  ? -11.275 4.047   -11.191 1.00 24.37  ? 16  VAL B N     1 
ATOM   5048 C CA    . VAL D 4 16  ? -11.918 5.290   -11.592 1.00 26.94  ? 16  VAL B CA    1 
ATOM   5049 C C     . VAL D 4 16  ? -13.069 4.936   -12.529 1.00 29.65  ? 16  VAL B C     1 
ATOM   5050 O O     . VAL D 4 16  ? -13.385 5.682   -13.455 1.00 30.95  ? 16  VAL B O     1 
ATOM   5051 C CB    . VAL D 4 16  ? -10.933 6.229   -12.330 1.00 26.48  ? 16  VAL B CB    1 
ATOM   5052 C CG1   . VAL D 4 16  ? -9.733  6.540   -11.429 1.00 25.92  ? 16  VAL B CG1   1 
ATOM   5053 C CG2   . VAL D 4 16  ? -10.480 5.589   -13.629 1.00 24.25  ? 16  VAL B CG2   1 
ATOM   5054 N N     . GLY D 4 17  ? -13.687 3.784   -12.275 1.00 29.65  ? 17  GLY B N     1 
ATOM   5055 C CA    . GLY D 4 17  ? -14.789 3.320   -13.097 1.00 30.73  ? 17  GLY B CA    1 
ATOM   5056 C C     . GLY D 4 17  ? -16.075 4.049   -12.785 1.00 31.32  ? 17  GLY B C     1 
ATOM   5057 O O     . GLY D 4 17  ? -16.193 4.666   -11.726 1.00 32.62  ? 17  GLY B O     1 
ATOM   5058 N N     . PHE D 4 18  ? -17.042 3.962   -13.698 1.00 31.52  ? 18  PHE B N     1 
ATOM   5059 C CA    . PHE D 4 18  ? -18.327 4.638   -13.544 1.00 30.51  ? 18  PHE B CA    1 
ATOM   5060 C C     . PHE D 4 18  ? -18.907 4.620   -12.131 1.00 30.53  ? 18  PHE B C     1 
ATOM   5061 O O     . PHE D 4 18  ? -19.197 5.669   -11.564 1.00 30.09  ? 18  PHE B O     1 
ATOM   5062 C CB    . PHE D 4 18  ? -19.360 4.051   -14.505 1.00 31.48  ? 18  PHE B CB    1 
ATOM   5063 C CG    . PHE D 4 18  ? -20.672 4.778   -14.478 1.00 32.61  ? 18  PHE B CG    1 
ATOM   5064 C CD1   . PHE D 4 18  ? -20.773 6.069   -14.990 1.00 32.75  ? 18  PHE B CD1   1 
ATOM   5065 C CD2   . PHE D 4 18  ? -21.790 4.205   -13.882 1.00 32.13  ? 18  PHE B CD2   1 
ATOM   5066 C CE1   . PHE D 4 18  ? -21.970 6.777   -14.902 1.00 34.59  ? 18  PHE B CE1   1 
ATOM   5067 C CE2   . PHE D 4 18  ? -22.992 4.906   -13.791 1.00 32.19  ? 18  PHE B CE2   1 
ATOM   5068 C CZ    . PHE D 4 18  ? -23.081 6.195   -14.301 1.00 32.14  ? 18  PHE B CZ    1 
ATOM   5069 N N     . THR D 4 19  ? -19.093 3.432   -11.572 1.00 30.78  ? 19  THR B N     1 
ATOM   5070 C CA    . THR D 4 19  ? -19.650 3.305   -10.231 1.00 33.16  ? 19  THR B CA    1 
ATOM   5071 C C     . THR D 4 19  ? -18.893 4.061   -9.137  1.00 34.34  ? 19  THR B C     1 
ATOM   5072 O O     . THR D 4 19  ? -19.486 4.440   -8.131  1.00 33.63  ? 19  THR B O     1 
ATOM   5073 C CB    . THR D 4 19  ? -19.736 1.831   -9.806  1.00 35.38  ? 19  THR B CB    1 
ATOM   5074 O OG1   . THR D 4 19  ? -18.447 1.219   -9.957  1.00 36.24  ? 19  THR B OG1   1 
ATOM   5075 C CG2   . THR D 4 19  ? -20.776 1.088   -10.659 1.00 36.67  ? 19  THR B CG2   1 
ATOM   5076 N N     . MET D 4 20  ? -17.593 4.278   -9.319  1.00 34.89  ? 20  MET B N     1 
ATOM   5077 C CA    . MET D 4 20  ? -16.813 4.988   -8.307  1.00 36.93  ? 20  MET B CA    1 
ATOM   5078 C C     . MET D 4 20  ? -17.316 6.407   -8.078  1.00 39.11  ? 20  MET B C     1 
ATOM   5079 O O     . MET D 4 20  ? -16.974 7.031   -7.070  1.00 39.51  ? 20  MET B O     1 
ATOM   5080 C CB    . MET D 4 20  ? -15.326 5.052   -8.696  1.00 35.37  ? 20  MET B CB    1 
ATOM   5081 C CG    . MET D 4 20  ? -14.552 3.759   -8.490  1.00 34.39  ? 20  MET B CG    1 
ATOM   5082 S SD    . MET D 4 20  ? -14.623 3.111   -6.794  1.00 34.70  ? 20  MET B SD    1 
ATOM   5083 C CE    . MET D 4 20  ? -13.116 3.810   -6.052  1.00 29.28  ? 20  MET B CE    1 
ATOM   5084 N N     . SER D 4 21  ? -18.126 6.911   -9.007  1.00 41.37  ? 21  SER B N     1 
ATOM   5085 C CA    . SER D 4 21  ? -18.645 8.270   -8.908  1.00 45.13  ? 21  SER B CA    1 
ATOM   5086 C C     . SER D 4 21  ? -20.073 8.403   -8.397  1.00 47.41  ? 21  SER B C     1 
ATOM   5087 O O     . SER D 4 21  ? -20.573 9.519   -8.252  1.00 47.11  ? 21  SER B O     1 
ATOM   5088 C CB    . SER D 4 21  ? -18.528 8.975   -10.259 1.00 45.81  ? 21  SER B CB    1 
ATOM   5089 O OG    . SER D 4 21  ? -17.168 9.162   -10.608 1.00 48.13  ? 21  SER B OG    1 
ATOM   5090 N N     . ASN D 4 22  ? -20.735 7.284   -8.127  1.00 50.89  ? 22  ASN B N     1 
ATOM   5091 C CA    . ASN D 4 22  ? -22.097 7.350   -7.615  1.00 55.92  ? 22  ASN B CA    1 
ATOM   5092 C C     . ASN D 4 22  ? -22.126 8.196   -6.344  1.00 59.70  ? 22  ASN B C     1 
ATOM   5093 O O     . ASN D 4 22  ? -21.723 7.743   -5.271  1.00 59.69  ? 22  ASN B O     1 
ATOM   5094 C CB    . ASN D 4 22  ? -22.636 5.951   -7.316  1.00 55.96  ? 22  ASN B CB    1 
ATOM   5095 C CG    . ASN D 4 22  ? -22.896 5.147   -8.572  1.00 57.06  ? 22  ASN B CG    1 
ATOM   5096 O OD1   . ASN D 4 22  ? -23.190 5.706   -9.634  1.00 56.54  ? 22  ASN B OD1   1 
ATOM   5097 N ND2   . ASN D 4 22  ? -22.809 3.826   -8.457  1.00 56.38  ? 22  ASN B ND2   1 
ATOM   5098 N N     . SER D 4 23  ? -22.605 9.430   -6.474  1.00 64.37  ? 23  SER B N     1 
ATOM   5099 C CA    . SER D 4 23  ? -22.673 10.351  -5.343  1.00 67.87  ? 23  SER B CA    1 
ATOM   5100 C C     . SER D 4 23  ? -23.913 10.162  -4.468  1.00 69.30  ? 23  SER B C     1 
ATOM   5101 O O     . SER D 4 23  ? -25.046 10.193  -4.953  1.00 69.58  ? 23  SER B O     1 
ATOM   5102 C CB    . SER D 4 23  ? -22.608 11.802  -5.847  1.00 68.60  ? 23  SER B CB    1 
ATOM   5103 O OG    . SER D 4 23  ? -23.623 12.068  -6.802  1.00 70.30  ? 23  SER B OG    1 
ATOM   5104 N N     . ILE D 4 24  ? -23.683 9.954   -3.174  1.00 70.93  ? 24  ILE B N     1 
ATOM   5105 C CA    . ILE D 4 24  ? -24.763 9.777   -2.206  1.00 71.42  ? 24  ILE B CA    1 
ATOM   5106 C C     . ILE D 4 24  ? -25.076 11.159  -1.645  1.00 71.39  ? 24  ILE B C     1 
ATOM   5107 O O     . ILE D 4 24  ? -24.173 11.872  -1.208  1.00 71.28  ? 24  ILE B O     1 
ATOM   5108 C CB    . ILE D 4 24  ? -24.334 8.859   -1.044  1.00 72.17  ? 24  ILE B CB    1 
ATOM   5109 C CG1   . ILE D 4 24  ? -23.824 7.524   -1.594  1.00 73.10  ? 24  ILE B CG1   1 
ATOM   5110 C CG2   . ILE D 4 24  ? -25.507 8.638   -0.097  1.00 72.42  ? 24  ILE B CG2   1 
ATOM   5111 C CD1   . ILE D 4 24  ? -23.299 6.576   -0.524  1.00 74.09  ? 24  ILE B CD1   1 
ATOM   5112 N N     . PRO D 4 25  ? -26.362 11.548  -1.634  1.00 70.97  ? 25  PRO B N     1 
ATOM   5113 C CA    . PRO D 4 25  ? -26.773 12.860  -1.123  1.00 70.08  ? 25  PRO B CA    1 
ATOM   5114 C C     . PRO D 4 25  ? -26.019 13.326  0.120   1.00 68.85  ? 25  PRO B C     1 
ATOM   5115 O O     . PRO D 4 25  ? -26.449 13.081  1.246   1.00 69.40  ? 25  PRO B O     1 
ATOM   5116 C CB    . PRO D 4 25  ? -28.273 12.680  -0.872  1.00 70.70  ? 25  PRO B CB    1 
ATOM   5117 C CG    . PRO D 4 25  ? -28.415 11.192  -0.651  1.00 71.01  ? 25  PRO B CG    1 
ATOM   5118 C CD    . PRO D 4 25  ? -27.522 10.647  -1.727  1.00 71.04  ? 25  PRO B CD    1 
ATOM   5119 N N     . GLY D 4 26  ? -24.892 14.000  -0.102  1.00 67.22  ? 26  GLY B N     1 
ATOM   5120 C CA    . GLY D 4 26  ? -24.082 14.503  0.997   1.00 64.46  ? 26  GLY B CA    1 
ATOM   5121 C C     . GLY D 4 26  ? -22.880 13.641  1.359   1.00 62.07  ? 26  GLY B C     1 
ATOM   5122 O O     . GLY D 4 26  ? -21.945 14.105  2.017   1.00 62.80  ? 26  GLY B O     1 
ATOM   5123 N N     . ILE D 4 27  ? -22.899 12.385  0.927   1.00 58.85  ? 27  ILE B N     1 
ATOM   5124 C CA    . ILE D 4 27  ? -21.813 11.458  1.220   1.00 54.90  ? 27  ILE B CA    1 
ATOM   5125 C C     . ILE D 4 27  ? -20.853 11.320  0.038   1.00 51.11  ? 27  ILE B C     1 
ATOM   5126 O O     . ILE D 4 27  ? -21.242 10.839  -1.028  1.00 51.77  ? 27  ILE B O     1 
ATOM   5127 C CB    . ILE D 4 27  ? -22.382 10.076  1.566   1.00 55.88  ? 27  ILE B CB    1 
ATOM   5128 C CG1   . ILE D 4 27  ? -23.397 10.217  2.702   1.00 55.90  ? 27  ILE B CG1   1 
ATOM   5129 C CG2   . ILE D 4 27  ? -21.258 9.124   1.953   1.00 56.57  ? 27  ILE B CG2   1 
ATOM   5130 C CD1   . ILE D 4 27  ? -24.132 8.926   3.031   1.00 57.91  ? 27  ILE B CD1   1 
ATOM   5131 N N     . GLU D 4 28  ? -19.606 11.746  0.237   1.00 45.71  ? 28  GLU B N     1 
ATOM   5132 C CA    . GLU D 4 28  ? -18.562 11.680  -0.792  1.00 38.36  ? 28  GLU B CA    1 
ATOM   5133 C C     . GLU D 4 28  ? -18.507 10.349  -1.533  1.00 33.85  ? 28  GLU B C     1 
ATOM   5134 O O     . GLU D 4 28  ? -18.674 9.284   -0.935  1.00 30.69  ? 28  GLU B O     1 
ATOM   5135 C CB    . GLU D 4 28  ? -17.199 11.925  -0.166  1.00 40.47  ? 28  GLU B CB    1 
ATOM   5136 C CG    . GLU D 4 28  ? -16.750 13.351  -0.172  1.00 44.57  ? 28  GLU B CG    1 
ATOM   5137 C CD    . GLU D 4 28  ? -15.613 13.580  0.799   1.00 46.62  ? 28  GLU B CD    1 
ATOM   5138 O OE1   . GLU D 4 28  ? -15.892 13.724  2.011   1.00 46.75  ? 28  GLU B OE1   1 
ATOM   5139 O OE2   . GLU D 4 28  ? -14.446 13.597  0.350   1.00 47.07  ? 28  GLU B OE2   1 
ATOM   5140 N N     . SER D 4 29  ? -18.239 10.419  -2.836  1.00 29.08  ? 29  SER B N     1 
ATOM   5141 C CA    . SER D 4 29  ? -18.163 9.221   -3.667  1.00 25.34  ? 29  SER B CA    1 
ATOM   5142 C C     . SER D 4 29  ? -16.854 8.486   -3.416  1.00 22.36  ? 29  SER B C     1 
ATOM   5143 O O     . SER D 4 29  ? -15.878 9.088   -2.966  1.00 21.95  ? 29  SER B O     1 
ATOM   5144 C CB    . SER D 4 29  ? -18.256 9.580   -5.160  1.00 21.27  ? 29  SER B CB    1 
ATOM   5145 O OG    . SER D 4 29  ? -17.018 10.061  -5.656  1.00 16.48  ? 29  SER B OG    1 
ATOM   5146 N N     . PRO D 4 30  ? -16.824 7.173   -3.696  1.00 19.00  ? 30  PRO B N     1 
ATOM   5147 C CA    . PRO D 4 30  ? -15.620 6.364   -3.506  1.00 18.62  ? 30  PRO B CA    1 
ATOM   5148 C C     . PRO D 4 30  ? -14.430 7.009   -4.215  1.00 21.50  ? 30  PRO B C     1 
ATOM   5149 O O     . PRO D 4 30  ? -13.331 7.114   -3.653  1.00 20.47  ? 30  PRO B O     1 
ATOM   5150 C CB    . PRO D 4 30  ? -16.009 5.032   -4.130  1.00 18.58  ? 30  PRO B CB    1 
ATOM   5151 C CG    . PRO D 4 30  ? -17.485 4.940   -3.810  1.00 15.63  ? 30  PRO B CG    1 
ATOM   5152 C CD    . PRO D 4 30  ? -17.971 6.338   -4.100  1.00 17.65  ? 30  PRO B CD    1 
ATOM   5153 N N     . PHE D 4 31  ? -14.666 7.454   -5.449  1.00 21.76  ? 31  PHE B N     1 
ATOM   5154 C CA    . PHE D 4 31  ? -13.630 8.085   -6.248  1.00 22.47  ? 31  PHE B CA    1 
ATOM   5155 C C     . PHE D 4 31  ? -12.952 9.232   -5.494  1.00 24.02  ? 31  PHE B C     1 
ATOM   5156 O O     . PHE D 4 31  ? -11.723 9.295   -5.430  1.00 25.03  ? 31  PHE B O     1 
ATOM   5157 C CB    . PHE D 4 31  ? -14.233 8.606   -7.553  1.00 22.77  ? 31  PHE B CB    1 
ATOM   5158 C CG    . PHE D 4 31  ? -13.236 9.280   -8.464  1.00 21.90  ? 31  PHE B CG    1 
ATOM   5159 C CD1   . PHE D 4 31  ? -12.430 8.535   -9.306  1.00 22.00  ? 31  PHE B CD1   1 
ATOM   5160 C CD2   . PHE D 4 31  ? -13.113 10.665  -8.478  1.00 23.08  ? 31  PHE B CD2   1 
ATOM   5161 C CE1   . PHE D 4 31  ? -11.511 9.156   -10.158 1.00 21.84  ? 31  PHE B CE1   1 
ATOM   5162 C CE2   . PHE D 4 31  ? -12.198 11.297  -9.327  1.00 22.94  ? 31  PHE B CE2   1 
ATOM   5163 C CZ    . PHE D 4 31  ? -11.399 10.541  -10.165 1.00 22.85  ? 31  PHE B CZ    1 
ATOM   5164 N N     . GLU D 4 32  ? -13.749 10.135  -4.926  1.00 24.51  ? 32  GLU B N     1 
ATOM   5165 C CA    . GLU D 4 32  ? -13.207 11.282  -4.191  1.00 24.95  ? 32  GLU B CA    1 
ATOM   5166 C C     . GLU D 4 32  ? -12.543 10.866  -2.879  1.00 24.47  ? 32  GLU B C     1 
ATOM   5167 O O     . GLU D 4 32  ? -11.551 11.460  -2.453  1.00 24.63  ? 32  GLU B O     1 
ATOM   5168 C CB    . GLU D 4 32  ? -14.311 12.305  -3.904  1.00 26.04  ? 32  GLU B CB    1 
ATOM   5169 C CG    . GLU D 4 32  ? -14.895 12.960  -5.138  1.00 28.77  ? 32  GLU B CG    1 
ATOM   5170 C CD    . GLU D 4 32  ? -13.942 13.938  -5.793  1.00 31.85  ? 32  GLU B CD    1 
ATOM   5171 O OE1   . GLU D 4 32  ? -14.144 14.242  -6.991  1.00 31.15  ? 32  GLU B OE1   1 
ATOM   5172 O OE2   . GLU D 4 32  ? -13.001 14.408  -5.109  1.00 31.65  ? 32  GLU B OE2   1 
ATOM   5173 N N     . GLN D 4 33  ? -13.104 9.852   -2.237  1.00 23.38  ? 33  GLN B N     1 
ATOM   5174 C CA    . GLN D 4 33  ? -12.547 9.351   -0.994  1.00 24.29  ? 33  GLN B CA    1 
ATOM   5175 C C     . GLN D 4 33  ? -11.189 8.719   -1.274  1.00 25.11  ? 33  GLN B C     1 
ATOM   5176 O O     . GLN D 4 33  ? -10.215 9.002   -0.586  1.00 26.46  ? 33  GLN B O     1 
ATOM   5177 C CB    . GLN D 4 33  ? -13.480 8.310   -0.369  1.00 22.99  ? 33  GLN B CB    1 
ATOM   5178 C CG    . GLN D 4 33  ? -14.708 8.892   0.297   1.00 23.13  ? 33  GLN B CG    1 
ATOM   5179 C CD    . GLN D 4 33  ? -15.554 7.835   0.985   1.00 24.29  ? 33  GLN B CD    1 
ATOM   5180 O OE1   . GLN D 4 33  ? -15.042 6.991   1.727   1.00 23.48  ? 33  GLN B OE1   1 
ATOM   5181 N NE2   . GLN D 4 33  ? -16.856 7.883   0.749   1.00 25.48  ? 33  GLN B NE2   1 
ATOM   5182 N N     . ALA D 4 34  ? -11.135 7.862   -2.287  1.00 25.46  ? 34  ALA B N     1 
ATOM   5183 C CA    . ALA D 4 34  ? -9.894  7.182   -2.661  1.00 27.43  ? 34  ALA B CA    1 
ATOM   5184 C C     . ALA D 4 34  ? -8.846  8.193   -3.107  1.00 25.70  ? 34  ALA B C     1 
ATOM   5185 O O     . ALA D 4 34  ? -7.649  8.013   -2.890  1.00 25.14  ? 34  ALA B O     1 
ATOM   5186 C CB    . ALA D 4 34  ? -10.165 6.172   -3.796  1.00 26.53  ? 34  ALA B CB    1 
ATOM   5187 N N     . LYS D 4 35  ? -9.319  9.263   -3.725  1.00 25.12  ? 35  LYS B N     1 
ATOM   5188 C CA    . LYS D 4 35  ? -8.446  10.309  -4.226  1.00 26.28  ? 35  LYS B CA    1 
ATOM   5189 C C     . LYS D 4 35  ? -7.721  11.007  -3.075  1.00 25.15  ? 35  LYS B C     1 
ATOM   5190 O O     . LYS D 4 35  ? -6.568  11.418  -3.218  1.00 25.40  ? 35  LYS B O     1 
ATOM   5191 C CB    . LYS D 4 35  ? -9.280  11.303  -5.035  1.00 26.91  ? 35  LYS B CB    1 
ATOM   5192 C CG    . LYS D 4 35  ? -8.523  12.061  -6.100  1.00 31.02  ? 35  LYS B CG    1 
ATOM   5193 C CD    . LYS D 4 35  ? -9.367  12.183  -7.375  1.00 34.22  ? 35  LYS B CD    1 
ATOM   5194 C CE    . LYS D 4 35  ? -10.754 12.791  -7.111  1.00 34.96  ? 35  LYS B CE    1 
ATOM   5195 N NZ    . LYS D 4 35  ? -10.754 14.267  -6.888  1.00 37.96  ? 35  LYS B NZ    1 
ATOM   5196 N N     . LYS D 4 36  ? -8.401  11.136  -1.939  1.00 23.50  ? 36  LYS B N     1 
ATOM   5197 C CA    . LYS D 4 36  ? -7.821  11.768  -0.751  1.00 24.88  ? 36  LYS B CA    1 
ATOM   5198 C C     . LYS D 4 36  ? -6.803  10.863  -0.070  1.00 24.87  ? 36  LYS B C     1 
ATOM   5199 O O     . LYS D 4 36  ? -5.768  11.323  0.420   1.00 26.72  ? 36  LYS B O     1 
ATOM   5200 C CB    . LYS D 4 36  ? -8.913  12.140  0.247   1.00 23.06  ? 36  LYS B CB    1 
ATOM   5201 C CG    . LYS D 4 36  ? -9.574  13.429  -0.093  1.00 23.50  ? 36  LYS B CG    1 
ATOM   5202 C CD    . LYS D 4 36  ? -10.788 13.711  0.747   1.00 24.69  ? 36  LYS B CD    1 
ATOM   5203 C CE    . LYS D 4 36  ? -11.432 15.000  0.266   1.00 25.19  ? 36  LYS B CE    1 
ATOM   5204 N NZ    . LYS D 4 36  ? -12.735 15.220  0.924   1.00 31.32  ? 36  LYS B NZ    1 
ATOM   5205 N N     . VAL D 4 37  ? -7.096  9.573   -0.052  1.00 23.35  ? 37  VAL B N     1 
ATOM   5206 C CA    . VAL D 4 37  ? -6.196  8.611   0.559   1.00 22.99  ? 37  VAL B CA    1 
ATOM   5207 C C     . VAL D 4 37  ? -4.891  8.540   -0.214  1.00 21.20  ? 37  VAL B C     1 
ATOM   5208 O O     . VAL D 4 37  ? -3.806  8.505   0.377   1.00 21.51  ? 37  VAL B O     1 
ATOM   5209 C CB    . VAL D 4 37  ? -6.816  7.212   0.595   1.00 20.07  ? 37  VAL B CB    1 
ATOM   5210 C CG1   . VAL D 4 37  ? -5.884  6.264   1.309   1.00 21.23  ? 37  VAL B CG1   1 
ATOM   5211 C CG2   . VAL D 4 37  ? -8.154  7.265   1.289   1.00 20.19  ? 37  VAL B CG2   1 
ATOM   5212 N N     . ILE D 4 38  ? -5.004  8.519   -1.535  1.00 21.25  ? 38  ILE B N     1 
ATOM   5213 C CA    . ILE D 4 38  ? -3.832  8.442   -2.389  1.00 22.41  ? 38  ILE B CA    1 
ATOM   5214 C C     . ILE D 4 38  ? -2.979  9.700   -2.284  1.00 21.71  ? 38  ILE B C     1 
ATOM   5215 O O     . ILE D 4 38  ? -1.752  9.633   -2.274  1.00 22.26  ? 38  ILE B O     1 
ATOM   5216 C CB    . ILE D 4 38  ? -4.249  8.187   -3.849  1.00 22.49  ? 38  ILE B CB    1 
ATOM   5217 C CG1   . ILE D 4 38  ? -4.716  6.730   -3.981  1.00 23.42  ? 38  ILE B CG1   1 
ATOM   5218 C CG2   . ILE D 4 38  ? -3.096  8.505   -4.801  1.00 23.65  ? 38  ILE B CG2   1 
ATOM   5219 C CD1   . ILE D 4 38  ? -5.138  6.331   -5.377  1.00 21.54  ? 38  ILE B CD1   1 
ATOM   5220 N N     . THR D 4 39  ? -3.638  10.848  -2.199  1.00 22.56  ? 39  THR B N     1 
ATOM   5221 C CA    . THR D 4 39  ? -2.938  12.119  -2.074  1.00 22.34  ? 39  THR B CA    1 
ATOM   5222 C C     . THR D 4 39  ? -2.202  12.099  -0.735  1.00 21.34  ? 39  THR B C     1 
ATOM   5223 O O     . THR D 4 39  ? -1.059  12.515  -0.640  1.00 22.47  ? 39  THR B O     1 
ATOM   5224 C CB    . THR D 4 39  ? -3.929  13.301  -2.070  1.00 22.86  ? 39  THR B CB    1 
ATOM   5225 O OG1   . THR D 4 39  ? -4.752  13.235  -3.240  1.00 24.26  ? 39  THR B OG1   1 
ATOM   5226 C CG2   . THR D 4 39  ? -3.183  14.630  -2.023  1.00 23.02  ? 39  THR B CG2   1 
ATOM   5227 N N     . MET D 4 40  ? -2.879  11.607  0.296   1.00 20.67  ? 40  MET B N     1 
ATOM   5228 C CA    . MET D 4 40  ? -2.302  11.530  1.621   1.00 19.22  ? 40  MET B CA    1 
ATOM   5229 C C     . MET D 4 40  ? -0.990  10.758  1.549   1.00 19.57  ? 40  MET B C     1 
ATOM   5230 O O     . MET D 4 40  ? 0.043   11.226  2.025   1.00 21.63  ? 40  MET B O     1 
ATOM   5231 C CB    . MET D 4 40  ? -3.274  10.837  2.571   1.00 18.57  ? 40  MET B CB    1 
ATOM   5232 C CG    . MET D 4 40  ? -2.756  10.735  3.998   1.00 20.01  ? 40  MET B CG    1 
ATOM   5233 S SD    . MET D 4 40  ? -3.741  9.619   4.989   1.00 20.07  ? 40  MET B SD    1 
ATOM   5234 C CE    . MET D 4 40  ? -3.418  8.089   4.140   1.00 20.45  ? 40  MET B CE    1 
ATOM   5235 N N     . PHE D 4 41  ? -1.039  9.577   0.944   1.00 18.40  ? 41  PHE B N     1 
ATOM   5236 C CA    . PHE D 4 41  ? 0.140   8.734   0.779   1.00 18.27  ? 41  PHE B CA    1 
ATOM   5237 C C     . PHE D 4 41  ? 1.243   9.408   -0.064  1.00 18.74  ? 41  PHE B C     1 
ATOM   5238 O O     . PHE D 4 41  ? 2.406   9.459   0.338   1.00 17.63  ? 41  PHE B O     1 
ATOM   5239 C CB    . PHE D 4 41  ? -0.269  7.410   0.114   1.00 18.45  ? 41  PHE B CB    1 
ATOM   5240 C CG    . PHE D 4 41  ? 0.885   6.511   -0.225  1.00 17.88  ? 41  PHE B CG    1 
ATOM   5241 C CD1   . PHE D 4 41  ? 1.363   5.592   0.700   1.00 19.37  ? 41  PHE B CD1   1 
ATOM   5242 C CD2   . PHE D 4 41  ? 1.496   6.583   -1.476  1.00 17.69  ? 41  PHE B CD2   1 
ATOM   5243 C CE1   . PHE D 4 41  ? 2.440   4.749   0.383   1.00 20.30  ? 41  PHE B CE1   1 
ATOM   5244 C CE2   . PHE D 4 41  ? 2.568   5.754   -1.805  1.00 14.95  ? 41  PHE B CE2   1 
ATOM   5245 C CZ    . PHE D 4 41  ? 3.043   4.834   -0.876  1.00 17.53  ? 41  PHE B CZ    1 
ATOM   5246 N N     . VAL D 4 42  ? 0.884   9.928   -1.234  1.00 19.04  ? 42  VAL B N     1 
ATOM   5247 C CA    . VAL D 4 42  ? 1.891   10.543  -2.095  1.00 20.00  ? 42  VAL B CA    1 
ATOM   5248 C C     . VAL D 4 42  ? 2.515   11.804  -1.469  1.00 19.94  ? 42  VAL B C     1 
ATOM   5249 O O     . VAL D 4 42  ? 3.726   12.026  -1.574  1.00 17.57  ? 42  VAL B O     1 
ATOM   5250 C CB    . VAL D 4 42  ? 1.294   10.799  -3.508  1.00 16.74  ? 42  VAL B CB    1 
ATOM   5251 C CG1   . VAL D 4 42  ? 2.312   11.446  -4.412  1.00 15.59  ? 42  VAL B CG1   1 
ATOM   5252 C CG2   . VAL D 4 42  ? 0.861   9.480   -4.107  1.00 12.15  ? 42  VAL B CG2   1 
ATOM   5253 N N     . GLN D 4 43  ? 1.700   12.599  -0.784  1.00 21.65  ? 43  GLN B N     1 
ATOM   5254 C CA    . GLN D 4 43  ? 2.207   13.792  -0.112  1.00 26.09  ? 43  GLN B CA    1 
ATOM   5255 C C     . GLN D 4 43  ? 3.322   13.427  0.870   1.00 26.89  ? 43  GLN B C     1 
ATOM   5256 O O     . GLN D 4 43  ? 4.409   13.992  0.816   1.00 27.66  ? 43  GLN B O     1 
ATOM   5257 C CB    . GLN D 4 43  ? 1.111   14.494  0.681   1.00 25.82  ? 43  GLN B CB    1 
ATOM   5258 C CG    . GLN D 4 43  ? 0.041   15.145  -0.136  1.00 28.62  ? 43  GLN B CG    1 
ATOM   5259 C CD    . GLN D 4 43  ? -0.809  16.052  0.709   1.00 29.05  ? 43  GLN B CD    1 
ATOM   5260 O OE1   . GLN D 4 43  ? -1.149  15.726  1.843   1.00 28.27  ? 43  GLN B OE1   1 
ATOM   5261 N NE2   . GLN D 4 43  ? -1.161  17.199  0.162   1.00 31.01  ? 43  GLN B NE2   1 
ATOM   5262 N N     . ARG D 4 44  ? 3.041   12.498  1.781   1.00 27.12  ? 44  ARG B N     1 
ATOM   5263 C CA    . ARG D 4 44  ? 4.048   12.098  2.751   1.00 27.32  ? 44  ARG B CA    1 
ATOM   5264 C C     . ARG D 4 44  ? 5.309   11.616  2.062   1.00 27.03  ? 44  ARG B C     1 
ATOM   5265 O O     . ARG D 4 44  ? 6.404   11.969  2.488   1.00 26.77  ? 44  ARG B O     1 
ATOM   5266 C CB    . ARG D 4 44  ? 3.524   11.010  3.699   1.00 27.45  ? 44  ARG B CB    1 
ATOM   5267 C CG    . ARG D 4 44  ? 4.626   10.334  4.522   1.00 29.37  ? 44  ARG B CG    1 
ATOM   5268 C CD    . ARG D 4 44  ? 4.095   9.685   5.794   1.00 32.86  ? 44  ARG B CD    1 
ATOM   5269 N NE    . ARG D 4 44  ? 3.916   10.668  6.859   1.00 36.30  ? 44  ARG B NE    1 
ATOM   5270 C CZ    . ARG D 4 44  ? 4.919   11.262  7.507   1.00 39.00  ? 44  ARG B CZ    1 
ATOM   5271 N NH1   . ARG D 4 44  ? 6.180   10.965  7.205   1.00 38.79  ? 44  ARG B NH1   1 
ATOM   5272 N NH2   . ARG D 4 44  ? 4.665   12.163  8.449   1.00 37.70  ? 44  ARG B NH2   1 
ATOM   5273 N N     . GLN D 4 45  ? 5.164   10.825  0.998   1.00 27.42  ? 45  GLN B N     1 
ATOM   5274 C CA    . GLN D 4 45  ? 6.338   10.317  0.274   1.00 28.60  ? 45  GLN B CA    1 
ATOM   5275 C C     . GLN D 4 45  ? 7.123   11.449  -0.379  1.00 28.67  ? 45  GLN B C     1 
ATOM   5276 O O     . GLN D 4 45  ? 8.351   11.392  -0.478  1.00 30.21  ? 45  GLN B O     1 
ATOM   5277 C CB    . GLN D 4 45  ? 5.936   9.306   -0.805  1.00 27.49  ? 45  GLN B CB    1 
ATOM   5278 C CG    . GLN D 4 45  ? 5.258   8.059   -0.266  1.00 28.37  ? 45  GLN B CG    1 
ATOM   5279 C CD    . GLN D 4 45  ? 6.124   7.302   0.725   1.00 29.81  ? 45  GLN B CD    1 
ATOM   5280 O OE1   . GLN D 4 45  ? 5.691   7.005   1.839   1.00 31.82  ? 45  GLN B OE1   1 
ATOM   5281 N NE2   . GLN D 4 45  ? 7.351   6.979   0.323   1.00 28.27  ? 45  GLN B NE2   1 
ATOM   5282 N N     . VAL D 4 46  ? 6.423   12.484  -0.825  1.00 27.75  ? 46  VAL B N     1 
ATOM   5283 C CA    . VAL D 4 46  ? 7.114   13.590  -1.461  1.00 27.03  ? 46  VAL B CA    1 
ATOM   5284 C C     . VAL D 4 46  ? 7.827   14.515  -0.481  1.00 27.14  ? 46  VAL B C     1 
ATOM   5285 O O     . VAL D 4 46  ? 9.022   14.770  -0.632  1.00 26.98  ? 46  VAL B O     1 
ATOM   5286 C CB    . VAL D 4 46  ? 6.160   14.424  -2.336  1.00 24.04  ? 46  VAL B CB    1 
ATOM   5287 C CG1   . VAL D 4 46  ? 6.860   15.694  -2.801  1.00 22.77  ? 46  VAL B CG1   1 
ATOM   5288 C CG2   . VAL D 4 46  ? 5.721   13.608  -3.534  1.00 20.54  ? 46  VAL B CG2   1 
ATOM   5289 N N     . PHE D 4 47  ? 7.101   15.008  0.521   1.00 27.37  ? 47  PHE B N     1 
ATOM   5290 C CA    . PHE D 4 47  ? 7.674   15.929  1.499   1.00 27.09  ? 47  PHE B CA    1 
ATOM   5291 C C     . PHE D 4 47  ? 8.654   15.345  2.505   1.00 28.32  ? 47  PHE B C     1 
ATOM   5292 O O     . PHE D 4 47  ? 9.376   16.087  3.158   1.00 30.47  ? 47  PHE B O     1 
ATOM   5293 C CB    . PHE D 4 47  ? 6.553   16.674  2.226   1.00 25.51  ? 47  PHE B CB    1 
ATOM   5294 C CG    . PHE D 4 47  ? 5.721   17.521  1.310   1.00 24.30  ? 47  PHE B CG    1 
ATOM   5295 C CD1   . PHE D 4 47  ? 4.368   17.246  1.121   1.00 22.55  ? 47  PHE B CD1   1 
ATOM   5296 C CD2   . PHE D 4 47  ? 6.313   18.543  0.572   1.00 22.53  ? 47  PHE B CD2   1 
ATOM   5297 C CE1   . PHE D 4 47  ? 3.615   17.964  0.209   1.00 22.36  ? 47  PHE B CE1   1 
ATOM   5298 C CE2   . PHE D 4 47  ? 5.570   19.277  -0.350  1.00 24.83  ? 47  PHE B CE2   1 
ATOM   5299 C CZ    . PHE D 4 47  ? 4.216   18.989  -0.538  1.00 25.09  ? 47  PHE B CZ    1 
ATOM   5300 N N     . ALA D 4 48  ? 8.688   14.024  2.627   1.00 29.76  ? 48  ALA B N     1 
ATOM   5301 C CA    . ALA D 4 48  ? 9.610   13.367  3.545   1.00 30.40  ? 48  ALA B CA    1 
ATOM   5302 C C     . ALA D 4 48  ? 10.860  12.996  2.758   1.00 32.77  ? 48  ALA B C     1 
ATOM   5303 O O     . ALA D 4 48  ? 11.849  12.528  3.313   1.00 32.41  ? 48  ALA B O     1 
ATOM   5304 C CB    . ALA D 4 48  ? 8.969   12.124  4.132   1.00 32.14  ? 48  ALA B CB    1 
ATOM   5305 N N     . GLU D 4 49  ? 10.780  13.197  1.447   1.00 35.98  ? 49  GLU B N     1 
ATOM   5306 C CA    . GLU D 4 49  ? 11.875  12.943  0.518   1.00 37.26  ? 49  GLU B CA    1 
ATOM   5307 C C     . GLU D 4 49  ? 12.522  11.562  0.626   1.00 38.14  ? 49  GLU B C     1 
ATOM   5308 O O     . GLU D 4 49  ? 13.740  11.446  0.768   1.00 38.36  ? 49  GLU B O     1 
ATOM   5309 C CB    . GLU D 4 49  ? 12.926  14.052  0.671   1.00 37.31  ? 49  GLU B CB    1 
ATOM   5310 C CG    . GLU D 4 49  ? 12.295  15.451  0.681   1.00 39.05  ? 49  GLU B CG    1 
ATOM   5311 C CD    . GLU D 4 49  ? 13.295  16.579  0.883   1.00 40.06  ? 49  GLU B CD    1 
ATOM   5312 O OE1   . GLU D 4 49  ? 13.864  17.060  -0.117  1.00 41.90  ? 49  GLU B OE1   1 
ATOM   5313 O OE2   . GLU D 4 49  ? 13.514  16.985  2.046   1.00 41.46  ? 49  GLU B OE2   1 
ATOM   5314 N N     . ASN D 4 50  ? 11.698  10.521  0.539   1.00 39.18  ? 50  ASN B N     1 
ATOM   5315 C CA    . ASN D 4 50  ? 12.179  9.142   0.599   1.00 40.24  ? 50  ASN B CA    1 
ATOM   5316 C C     . ASN D 4 50  ? 12.744  8.748   -0.757  1.00 40.50  ? 50  ASN B C     1 
ATOM   5317 O O     . ASN D 4 50  ? 12.796  9.549   -1.687  1.00 39.44  ? 50  ASN B O     1 
ATOM   5318 C CB    . ASN D 4 50  ? 11.041  8.173   0.932   1.00 40.42  ? 50  ASN B CB    1 
ATOM   5319 C CG    . ASN D 4 50  ? 10.299  8.552   2.191   1.00 43.96  ? 50  ASN B CG    1 
ATOM   5320 O OD1   . ASN D 4 50  ? 10.887  8.664   3.266   1.00 45.57  ? 50  ASN B OD1   1 
ATOM   5321 N ND2   . ASN D 4 50  ? 8.993   8.751   2.067   1.00 47.18  ? 50  ASN B ND2   1 
ATOM   5322 N N     . LYS D 4 51  ? 13.154  7.493   -0.866  1.00 40.64  ? 51  LYS B N     1 
ATOM   5323 C CA    . LYS D 4 51  ? 13.693  6.986   -2.112  1.00 39.56  ? 51  LYS B CA    1 
ATOM   5324 C C     . LYS D 4 51  ? 12.739  5.957   -2.700  1.00 36.71  ? 51  LYS B C     1 
ATOM   5325 O O     . LYS D 4 51  ? 13.038  5.345   -3.727  1.00 37.32  ? 51  LYS B O     1 
ATOM   5326 C CB    . LYS D 4 51  ? 15.069  6.358   -1.881  1.00 41.67  ? 51  LYS B CB    1 
ATOM   5327 C CG    . LYS D 4 51  ? 16.137  7.355   -1.470  1.00 46.43  ? 51  LYS B CG    1 
ATOM   5328 C CD    . LYS D 4 51  ? 17.524  6.715   -1.464  1.00 49.92  ? 51  LYS B CD    1 
ATOM   5329 C CE    . LYS D 4 51  ? 18.616  7.745   -1.173  1.00 53.52  ? 51  LYS B CE    1 
ATOM   5330 N NZ    . LYS D 4 51  ? 19.995  7.159   -1.228  1.00 55.56  ? 51  LYS B NZ    1 
ATOM   5331 N N     . ASP D 4 52  ? 11.591  5.768   -2.050  1.00 33.47  ? 52  ASP B N     1 
ATOM   5332 C CA    . ASP D 4 52  ? 10.604  4.808   -2.534  1.00 30.13  ? 52  ASP B CA    1 
ATOM   5333 C C     . ASP D 4 52  ? 10.151  5.237   -3.920  1.00 29.90  ? 52  ASP B C     1 
ATOM   5334 O O     . ASP D 4 52  ? 10.045  6.431   -4.202  1.00 27.14  ? 52  ASP B O     1 
ATOM   5335 C CB    . ASP D 4 52  ? 9.394   4.739   -1.606  1.00 28.84  ? 52  ASP B CB    1 
ATOM   5336 C CG    . ASP D 4 52  ? 9.779   4.465   -0.170  1.00 30.79  ? 52  ASP B CG    1 
ATOM   5337 O OD1   . ASP D 4 52  ? 10.701  3.650   0.050   1.00 31.74  ? 52  ASP B OD1   1 
ATOM   5338 O OD2   . ASP D 4 52  ? 9.157   5.056   0.742   1.00 31.03  ? 52  ASP B OD2   1 
ATOM   5339 N N     . GLU D 4 53  ? 9.905   4.250   -4.781  1.00 30.28  ? 53  GLU B N     1 
ATOM   5340 C CA    . GLU D 4 53  ? 9.462   4.487   -6.149  1.00 28.83  ? 53  GLU B CA    1 
ATOM   5341 C C     . GLU D 4 53  ? 7.969   4.200   -6.215  1.00 27.68  ? 53  GLU B C     1 
ATOM   5342 O O     . GLU D 4 53  ? 7.491   3.229   -5.632  1.00 25.15  ? 53  GLU B O     1 
ATOM   5343 C CB    . GLU D 4 53  ? 10.222  3.571   -7.095  1.00 33.05  ? 53  GLU B CB    1 
ATOM   5344 C CG    . GLU D 4 53  ? 11.722  3.714   -6.979  1.00 37.79  ? 53  GLU B CG    1 
ATOM   5345 C CD    . GLU D 4 53  ? 12.351  4.381   -8.183  1.00 40.03  ? 53  GLU B CD    1 
ATOM   5346 O OE1   . GLU D 4 53  ? 13.528  4.784   -8.080  1.00 42.83  ? 53  GLU B OE1   1 
ATOM   5347 O OE2   . GLU D 4 53  ? 11.679  4.492   -9.231  1.00 41.22  ? 53  GLU B OE2   1 
ATOM   5348 N N     . ILE D 4 54  ? 7.236   5.038   -6.940  1.00 26.41  ? 54  ILE B N     1 
ATOM   5349 C CA    . ILE D 4 54  ? 5.792   4.886   -7.025  1.00 25.18  ? 54  ILE B CA    1 
ATOM   5350 C C     . ILE D 4 54  ? 5.186   4.926   -8.430  1.00 25.73  ? 54  ILE B C     1 
ATOM   5351 O O     . ILE D 4 54  ? 5.492   5.805   -9.236  1.00 28.51  ? 54  ILE B O     1 
ATOM   5352 C CB    . ILE D 4 54  ? 5.112   5.977   -6.165  1.00 23.28  ? 54  ILE B CB    1 
ATOM   5353 C CG1   . ILE D 4 54  ? 5.628   5.890   -4.726  1.00 24.43  ? 54  ILE B CG1   1 
ATOM   5354 C CG2   . ILE D 4 54  ? 3.602   5.815   -6.196  1.00 23.17  ? 54  ILE B CG2   1 
ATOM   5355 C CD1   . ILE D 4 54  ? 5.118   6.998   -3.831  1.00 26.42  ? 54  ILE B CD1   1 
ATOM   5356 N N     . ALA D 4 55  ? 4.318   3.965   -8.718  1.00 24.04  ? 55  ALA B N     1 
ATOM   5357 C CA    . ALA D 4 55  ? 3.637   3.926   -10.006 1.00 22.26  ? 55  ALA B CA    1 
ATOM   5358 C C     . ALA D 4 55  ? 2.130   4.062   -9.733  1.00 22.19  ? 55  ALA B C     1 
ATOM   5359 O O     . ALA D 4 55  ? 1.649   3.750   -8.645  1.00 19.46  ? 55  ALA B O     1 
ATOM   5360 C CB    . ALA D 4 55  ? 3.936   2.613   -10.732 1.00 20.14  ? 55  ALA B CB    1 
ATOM   5361 N N     . LEU D 4 56  ? 1.384   4.539   -10.716 1.00 22.74  ? 56  LEU B N     1 
ATOM   5362 C CA    . LEU D 4 56  ? -0.046  4.701   -10.535 1.00 23.97  ? 56  LEU B CA    1 
ATOM   5363 C C     . LEU D 4 56  ? -0.822  4.104   -11.687 1.00 22.96  ? 56  LEU B C     1 
ATOM   5364 O O     . LEU D 4 56  ? -0.747  4.598   -12.811 1.00 25.78  ? 56  LEU B O     1 
ATOM   5365 C CB    . LEU D 4 56  ? -0.390  6.181   -10.394 1.00 24.69  ? 56  LEU B CB    1 
ATOM   5366 C CG    . LEU D 4 56  ? -1.879  6.491   -10.302 1.00 24.56  ? 56  LEU B CG    1 
ATOM   5367 C CD1   . LEU D 4 56  ? -2.469  5.803   -9.086  1.00 23.55  ? 56  LEU B CD1   1 
ATOM   5368 C CD2   . LEU D 4 56  ? -2.073  7.999   -10.241 1.00 24.31  ? 56  LEU B CD2   1 
ATOM   5369 N N     . VAL D 4 57  ? -1.556  3.033   -11.400 1.00 22.29  ? 57  VAL B N     1 
ATOM   5370 C CA    . VAL D 4 57  ? -2.369  2.351   -12.397 1.00 20.04  ? 57  VAL B CA    1 
ATOM   5371 C C     . VAL D 4 57  ? -3.837  2.703   -12.162 1.00 21.53  ? 57  VAL B C     1 
ATOM   5372 O O     . VAL D 4 57  ? -4.306  2.698   -11.027 1.00 21.60  ? 57  VAL B O     1 
ATOM   5373 C CB    . VAL D 4 57  ? -2.183  0.822   -12.294 1.00 19.58  ? 57  VAL B CB    1 
ATOM   5374 C CG1   . VAL D 4 57  ? -3.248  0.093   -13.124 1.00 16.81  ? 57  VAL B CG1   1 
ATOM   5375 C CG2   . VAL D 4 57  ? -0.782  0.444   -12.768 1.00 16.65  ? 57  VAL B CG2   1 
ATOM   5376 N N     . LEU D 4 58  ? -4.560  3.010   -13.233 1.00 20.99  ? 58  LEU B N     1 
ATOM   5377 C CA    . LEU D 4 58  ? -5.969  3.370   -13.123 1.00 22.37  ? 58  LEU B CA    1 
ATOM   5378 C C     . LEU D 4 58  ? -6.816  2.388   -13.918 1.00 25.29  ? 58  LEU B C     1 
ATOM   5379 O O     . LEU D 4 58  ? -6.426  1.964   -15.010 1.00 26.63  ? 58  LEU B O     1 
ATOM   5380 C CB    . LEU D 4 58  ? -6.206  4.781   -13.677 1.00 20.83  ? 58  LEU B CB    1 
ATOM   5381 C CG    . LEU D 4 58  ? -5.282  5.937   -13.261 1.00 21.59  ? 58  LEU B CG    1 
ATOM   5382 C CD1   . LEU D 4 58  ? -5.647  7.184   -14.068 1.00 19.26  ? 58  LEU B CD1   1 
ATOM   5383 C CD2   . LEU D 4 58  ? -5.389  6.205   -11.766 1.00 17.37  ? 58  LEU B CD2   1 
ATOM   5384 N N     . PHE D 4 59  ? -7.968  2.005   -13.384 1.00 25.32  ? 59  PHE B N     1 
ATOM   5385 C CA    . PHE D 4 59  ? -8.811  1.103   -14.139 1.00 26.17  ? 59  PHE B CA    1 
ATOM   5386 C C     . PHE D 4 59  ? -10.267 1.535   -14.134 1.00 27.99  ? 59  PHE B C     1 
ATOM   5387 O O     . PHE D 4 59  ? -10.789 2.022   -13.133 1.00 30.13  ? 59  PHE B O     1 
ATOM   5388 C CB    . PHE D 4 59  ? -8.627  -0.347  -13.672 1.00 24.99  ? 59  PHE B CB    1 
ATOM   5389 C CG    . PHE D 4 59  ? -9.067  -0.622  -12.272 1.00 22.72  ? 59  PHE B CG    1 
ATOM   5390 C CD1   . PHE D 4 59  ? -10.275 -1.275  -12.030 1.00 23.24  ? 59  PHE B CD1   1 
ATOM   5391 C CD2   . PHE D 4 59  ? -8.228  -0.344  -11.194 1.00 23.28  ? 59  PHE B CD2   1 
ATOM   5392 C CE1   . PHE D 4 59  ? -10.639 -1.661  -10.733 1.00 18.13  ? 59  PHE B CE1   1 
ATOM   5393 C CE2   . PHE D 4 59  ? -8.583  -0.725  -9.890  1.00 18.32  ? 59  PHE B CE2   1 
ATOM   5394 C CZ    . PHE D 4 59  ? -9.784  -1.385  -9.666  1.00 19.88  ? 59  PHE B CZ    1 
ATOM   5395 N N     . GLY D 4 60  ? -10.905 1.381   -15.287 1.00 27.76  ? 60  GLY B N     1 
ATOM   5396 C CA    . GLY D 4 60  ? -12.281 1.797   -15.437 1.00 28.59  ? 60  GLY B CA    1 
ATOM   5397 C C     . GLY D 4 60  ? -12.254 3.042   -16.301 1.00 29.47  ? 60  GLY B C     1 
ATOM   5398 O O     . GLY D 4 60  ? -13.257 3.738   -16.457 1.00 28.16  ? 60  GLY B O     1 
ATOM   5399 N N     . THR D 4 61  ? -11.083 3.325   -16.865 1.00 30.13  ? 61  THR B N     1 
ATOM   5400 C CA    . THR D 4 61  ? -10.916 4.494   -17.718 1.00 32.79  ? 61  THR B CA    1 
ATOM   5401 C C     . THR D 4 61  ? -11.456 4.235   -19.110 1.00 33.36  ? 61  THR B C     1 
ATOM   5402 O O     . THR D 4 61  ? -11.624 3.088   -19.520 1.00 34.32  ? 61  THR B O     1 
ATOM   5403 C CB    . THR D 4 61  ? -9.453  4.877   -17.858 1.00 31.99  ? 61  THR B CB    1 
ATOM   5404 O OG1   . THR D 4 61  ? -8.752  3.821   -18.523 1.00 32.36  ? 61  THR B OG1   1 
ATOM   5405 C CG2   . THR D 4 61  ? -8.842  5.113   -16.495 1.00 32.01  ? 61  THR B CG2   1 
ATOM   5406 N N     . ASP D 4 62  ? -11.717 5.315   -19.836 1.00 35.37  ? 62  ASP B N     1 
ATOM   5407 C CA    . ASP D 4 62  ? -12.253 5.229   -21.192 1.00 35.82  ? 62  ASP B CA    1 
ATOM   5408 C C     . ASP D 4 62  ? -11.250 4.635   -22.168 1.00 35.11  ? 62  ASP B C     1 
ATOM   5409 O O     . ASP D 4 62  ? -11.592 3.779   -22.974 1.00 35.53  ? 62  ASP B O     1 
ATOM   5410 C CB    . ASP D 4 62  ? -12.695 6.618   -21.650 1.00 35.72  ? 62  ASP B CB    1 
ATOM   5411 C CG    . ASP D 4 62  ? -13.908 7.117   -20.881 1.00 38.16  ? 62  ASP B CG    1 
ATOM   5412 O OD1   . ASP D 4 62  ? -14.262 8.311   -21.012 1.00 38.81  ? 62  ASP B OD1   1 
ATOM   5413 O OD2   . ASP D 4 62  ? -14.514 6.304   -20.147 1.00 38.44  ? 62  ASP B OD2   1 
ATOM   5414 N N     . GLY D 4 63  ? -10.004 5.079   -22.083 1.00 36.58  ? 63  GLY B N     1 
ATOM   5415 C CA    . GLY D 4 63  ? -8.989  4.558   -22.975 1.00 36.39  ? 63  GLY B CA    1 
ATOM   5416 C C     . GLY D 4 63  ? -8.325  3.306   -22.444 1.00 37.61  ? 63  GLY B C     1 
ATOM   5417 O O     . GLY D 4 63  ? -8.746  2.733   -21.434 1.00 36.72  ? 63  GLY B O     1 
ATOM   5418 N N     . THR D 4 64  ? -7.276  2.882   -23.139 1.00 38.95  ? 64  THR B N     1 
ATOM   5419 C CA    . THR D 4 64  ? -6.519  1.700   -22.766 1.00 38.74  ? 64  THR B CA    1 
ATOM   5420 C C     . THR D 4 64  ? -5.044  1.930   -23.064 1.00 38.99  ? 64  THR B C     1 
ATOM   5421 O O     . THR D 4 64  ? -4.668  2.120   -24.216 1.00 40.33  ? 64  THR B O     1 
ATOM   5422 C CB    . THR D 4 64  ? -7.004  0.465   -23.552 1.00 38.45  ? 64  THR B CB    1 
ATOM   5423 O OG1   . THR D 4 64  ? -8.276  0.044   -23.049 1.00 39.29  ? 64  THR B OG1   1 
ATOM   5424 C CG2   . THR D 4 64  ? -6.015  -0.675  -23.427 1.00 37.98  ? 64  THR B CG2   1 
ATOM   5425 N N     . ASP D 4 65  ? -4.211  1.920   -22.028 1.00 39.31  ? 65  ASP B N     1 
ATOM   5426 C CA    . ASP D 4 65  ? -2.777  2.114   -22.216 1.00 39.52  ? 65  ASP B CA    1 
ATOM   5427 C C     . ASP D 4 65  ? -1.951  1.398   -21.160 1.00 38.46  ? 65  ASP B C     1 
ATOM   5428 O O     . ASP D 4 65  ? -1.600  1.968   -20.126 1.00 39.89  ? 65  ASP B O     1 
ATOM   5429 C CB    . ASP D 4 65  ? -2.435  3.611   -22.240 1.00 39.65  ? 65  ASP B CB    1 
ATOM   5430 C CG    . ASP D 4 65  ? -0.933  3.874   -22.259 1.00 42.92  ? 65  ASP B CG    1 
ATOM   5431 O OD1   . ASP D 4 65  ? -0.173  3.012   -22.750 1.00 42.52  ? 65  ASP B OD1   1 
ATOM   5432 O OD2   . ASP D 4 65  ? -0.508  4.957   -21.794 1.00 45.16  ? 65  ASP B OD2   1 
ATOM   5433 N N     . ASN D 4 66  ? -1.651  0.133   -21.426 1.00 37.86  ? 66  ASN B N     1 
ATOM   5434 C CA    . ASN D 4 66  ? -0.846  -0.675  -20.514 1.00 38.40  ? 66  ASN B CA    1 
ATOM   5435 C C     . ASN D 4 66  ? -0.127  -1.741  -21.337 1.00 37.98  ? 66  ASN B C     1 
ATOM   5436 O O     . ASN D 4 66  ? -0.616  -2.172  -22.377 1.00 36.09  ? 66  ASN B O     1 
ATOM   5437 C CB    . ASN D 4 66  ? -1.725  -1.316  -19.430 1.00 36.59  ? 66  ASN B CB    1 
ATOM   5438 C CG    . ASN D 4 66  ? -2.637  -2.386  -19.977 1.00 35.15  ? 66  ASN B CG    1 
ATOM   5439 O OD1   . ASN D 4 66  ? -2.203  -3.506  -20.250 1.00 33.17  ? 66  ASN B OD1   1 
ATOM   5440 N ND2   . ASN D 4 66  ? -3.911  -2.046  -20.152 1.00 33.45  ? 66  ASN B ND2   1 
ATOM   5441 N N     . PRO D 4 67  ? 1.039   -2.190  -20.868 1.00 38.71  ? 67  PRO B N     1 
ATOM   5442 C CA    . PRO D 4 67  ? 1.819   -3.197  -21.588 1.00 40.26  ? 67  PRO B CA    1 
ATOM   5443 C C     . PRO D 4 67  ? 1.294   -4.621  -21.630 1.00 40.97  ? 67  PRO B C     1 
ATOM   5444 O O     . PRO D 4 67  ? 2.074   -5.555  -21.578 1.00 44.70  ? 67  PRO B O     1 
ATOM   5445 C CB    . PRO D 4 67  ? 3.182   -3.101  -20.918 1.00 39.64  ? 67  PRO B CB    1 
ATOM   5446 C CG    . PRO D 4 67  ? 2.819   -2.812  -19.504 1.00 40.33  ? 67  PRO B CG    1 
ATOM   5447 C CD    . PRO D 4 67  ? 1.713   -1.790  -19.622 1.00 38.95  ? 67  PRO B CD    1 
ATOM   5448 N N     . LEU D 4 68  ? -0.016  -4.794  -21.738 1.00 42.89  ? 68  LEU B N     1 
ATOM   5449 C CA    . LEU D 4 68  ? -0.595  -6.131  -21.794 1.00 43.21  ? 68  LEU B CA    1 
ATOM   5450 C C     . LEU D 4 68  ? -1.840  -6.134  -22.669 1.00 45.45  ? 68  LEU B C     1 
ATOM   5451 O O     . LEU D 4 68  ? -2.484  -7.171  -22.847 1.00 45.69  ? 68  LEU B O     1 
ATOM   5452 C CB    . LEU D 4 68  ? -0.964  -6.620  -20.390 1.00 43.72  ? 68  LEU B CB    1 
ATOM   5453 C CG    . LEU D 4 68  ? 0.136   -6.798  -19.340 1.00 43.84  ? 68  LEU B CG    1 
ATOM   5454 C CD1   . LEU D 4 68  ? -0.496  -7.267  -18.032 1.00 43.93  ? 68  LEU B CD1   1 
ATOM   5455 C CD2   . LEU D 4 68  ? 1.170   -7.810  -19.814 1.00 43.01  ? 68  LEU B CD2   1 
ATOM   5456 N N     . SER D 4 69  ? -2.172  -4.966  -23.212 1.00 47.02  ? 69  SER B N     1 
ATOM   5457 C CA    . SER D 4 69  ? -3.339  -4.809  -24.073 1.00 49.62  ? 69  SER B CA    1 
ATOM   5458 C C     . SER D 4 69  ? -3.252  -5.655  -25.337 1.00 51.26  ? 69  SER B C     1 
ATOM   5459 O O     . SER D 4 69  ? -4.258  -5.880  -26.016 1.00 50.33  ? 69  SER B O     1 
ATOM   5460 C CB    . SER D 4 69  ? -3.506  -3.341  -24.466 1.00 49.99  ? 69  SER B CB    1 
ATOM   5461 O OG    . SER D 4 69  ? -3.707  -2.534  -23.324 1.00 49.75  ? 69  SER B OG    1 
ATOM   5462 N N     . GLY D 4 70  ? -2.047  -6.115  -25.655 1.00 53.64  ? 70  GLY B N     1 
ATOM   5463 C CA    . GLY D 4 70  ? -1.865  -6.931  -26.842 1.00 57.75  ? 70  GLY B CA    1 
ATOM   5464 C C     . GLY D 4 70  ? -2.901  -8.035  -27.002 1.00 59.60  ? 70  GLY B C     1 
ATOM   5465 O O     . GLY D 4 70  ? -2.876  -9.040  -26.281 1.00 60.19  ? 70  GLY B O     1 
ATOM   5466 N N     . GLY D 4 71  ? -3.817  -7.845  -27.951 1.00 60.55  ? 71  GLY B N     1 
ATOM   5467 C CA    . GLY D 4 71  ? -4.848  -8.837  -28.205 1.00 60.57  ? 71  GLY B CA    1 
ATOM   5468 C C     . GLY D 4 71  ? -6.196  -8.526  -27.579 1.00 60.81  ? 71  GLY B C     1 
ATOM   5469 O O     . GLY D 4 71  ? -6.912  -9.438  -27.164 1.00 62.04  ? 71  GLY B O     1 
ATOM   5470 N N     . ASP D 4 72  ? -6.551  -7.245  -27.519 1.00 59.79  ? 72  ASP B N     1 
ATOM   5471 C CA    . ASP D 4 72  ? -7.822  -6.819  -26.935 1.00 57.69  ? 72  ASP B CA    1 
ATOM   5472 C C     . ASP D 4 72  ? -8.090  -7.421  -25.560 1.00 55.28  ? 72  ASP B C     1 
ATOM   5473 O O     . ASP D 4 72  ? -9.201  -7.879  -25.278 1.00 55.35  ? 72  ASP B O     1 
ATOM   5474 C CB    . ASP D 4 72  ? -8.991  -7.157  -27.868 1.00 60.06  ? 72  ASP B CB    1 
ATOM   5475 C CG    . ASP D 4 72  ? -9.250  -6.071  -28.900 1.00 61.60  ? 72  ASP B CG    1 
ATOM   5476 O OD1   . ASP D 4 72  ? -9.555  -4.923  -28.500 1.00 62.54  ? 72  ASP B OD1   1 
ATOM   5477 O OD2   . ASP D 4 72  ? -9.153  -6.370  -30.110 1.00 62.32  ? 72  ASP B OD2   1 
ATOM   5478 N N     . GLN D 4 73  ? -7.065  -7.426  -24.713 1.00 51.65  ? 73  GLN B N     1 
ATOM   5479 C CA    . GLN D 4 73  ? -7.191  -7.935  -23.350 1.00 47.94  ? 73  GLN B CA    1 
ATOM   5480 C C     . GLN D 4 73  ? -6.939  -6.755  -22.421 1.00 44.22  ? 73  GLN B C     1 
ATOM   5481 O O     . GLN D 4 73  ? -6.655  -5.657  -22.889 1.00 43.31  ? 73  GLN B O     1 
ATOM   5482 C CB    . GLN D 4 73  ? -6.154  -9.020  -23.070 1.00 48.44  ? 73  GLN B CB    1 
ATOM   5483 C CG    . GLN D 4 73  ? -6.209  -10.218 -23.989 1.00 50.51  ? 73  GLN B CG    1 
ATOM   5484 C CD    . GLN D 4 73  ? -5.318  -11.347 -23.497 1.00 53.58  ? 73  GLN B CD    1 
ATOM   5485 O OE1   . GLN D 4 73  ? -5.678  -12.088 -22.572 1.00 51.76  ? 73  GLN B OE1   1 
ATOM   5486 N NE2   . GLN D 4 73  ? -4.136  -11.471 -24.101 1.00 54.11  ? 73  GLN B NE2   1 
ATOM   5487 N N     . TYR D 4 74  ? -7.045  -6.980  -21.115 1.00 40.09  ? 74  TYR B N     1 
ATOM   5488 C CA    . TYR D 4 74  ? -6.804  -5.925  -20.131 1.00 36.81  ? 74  TYR B CA    1 
ATOM   5489 C C     . TYR D 4 74  ? -7.183  -4.534  -20.634 1.00 36.51  ? 74  TYR B C     1 
ATOM   5490 O O     . TYR D 4 74  ? -6.367  -3.613  -20.605 1.00 34.73  ? 74  TYR B O     1 
ATOM   5491 C CB    . TYR D 4 74  ? -5.330  -5.914  -19.731 1.00 33.63  ? 74  TYR B CB    1 
ATOM   5492 C CG    . TYR D 4 74  ? -4.834  -7.248  -19.250 1.00 32.22  ? 74  TYR B CG    1 
ATOM   5493 C CD1   . TYR D 4 74  ? -4.384  -8.215  -20.148 1.00 30.71  ? 74  TYR B CD1   1 
ATOM   5494 C CD2   . TYR D 4 74  ? -4.833  -7.557  -17.893 1.00 28.94  ? 74  TYR B CD2   1 
ATOM   5495 C CE1   . TYR D 4 74  ? -3.944  -9.450  -19.704 1.00 28.62  ? 74  TYR B CE1   1 
ATOM   5496 C CE2   . TYR D 4 74  ? -4.398  -8.780  -17.443 1.00 28.79  ? 74  TYR B CE2   1 
ATOM   5497 C CZ    . TYR D 4 74  ? -3.953  -9.721  -18.347 1.00 30.98  ? 74  TYR B CZ    1 
ATOM   5498 O OH    . TYR D 4 74  ? -3.494  -10.926 -17.877 1.00 34.50  ? 74  TYR B OH    1 
ATOM   5499 N N     . GLN D 4 75  ? -8.421  -4.385  -21.087 1.00 35.96  ? 75  GLN B N     1 
ATOM   5500 C CA    . GLN D 4 75  ? -8.889  -3.108  -21.604 1.00 36.41  ? 75  GLN B CA    1 
ATOM   5501 C C     . GLN D 4 75  ? -9.298  -2.151  -20.485 1.00 36.42  ? 75  GLN B C     1 
ATOM   5502 O O     . GLN D 4 75  ? -9.596  -2.581  -19.371 1.00 35.53  ? 75  GLN B O     1 
ATOM   5503 C CB    . GLN D 4 75  ? -10.073 -3.346  -22.539 1.00 36.53  ? 75  GLN B CB    1 
ATOM   5504 C CG    . GLN D 4 75  ? -9.733  -4.174  -23.768 1.00 38.38  ? 75  GLN B CG    1 
ATOM   5505 C CD    . GLN D 4 75  ? -8.796  -3.446  -24.707 1.00 39.95  ? 75  GLN B CD    1 
ATOM   5506 O OE1   . GLN D 4 75  ? -9.124  -2.366  -25.215 1.00 39.37  ? 75  GLN B OE1   1 
ATOM   5507 N NE2   . GLN D 4 75  ? -7.618  -4.026  -24.944 1.00 39.92  ? 75  GLN B NE2   1 
ATOM   5508 N N     . ASN D 4 76  ? -9.306  -0.853  -20.790 1.00 35.70  ? 76  ASN B N     1 
ATOM   5509 C CA    . ASN D 4 76  ? -9.702  0.171   -19.828 1.00 33.43  ? 76  ASN B CA    1 
ATOM   5510 C C     . ASN D 4 76  ? -8.836  0.211   -18.579 1.00 31.59  ? 76  ASN B C     1 
ATOM   5511 O O     . ASN D 4 76  ? -9.302  0.564   -17.500 1.00 32.29  ? 76  ASN B O     1 
ATOM   5512 C CB    . ASN D 4 76  ? -11.155 -0.047  -19.429 1.00 34.61  ? 76  ASN B CB    1 
ATOM   5513 C CG    . ASN D 4 76  ? -12.065 -0.133  -20.624 1.00 36.98  ? 76  ASN B CG    1 
ATOM   5514 O OD1   . ASN D 4 76  ? -12.232 0.841   -21.364 1.00 35.78  ? 76  ASN B OD1   1 
ATOM   5515 N ND2   . ASN D 4 76  ? -12.652 -1.307  -20.833 1.00 37.13  ? 76  ASN B ND2   1 
ATOM   5516 N N     . ILE D 4 77  ? -7.578  -0.169  -18.736 1.00 29.69  ? 77  ILE B N     1 
ATOM   5517 C CA    . ILE D 4 77  ? -6.622  -0.164  -17.648 1.00 29.70  ? 77  ILE B CA    1 
ATOM   5518 C C     . ILE D 4 77  ? -5.492  0.731   -18.128 1.00 31.74  ? 77  ILE B C     1 
ATOM   5519 O O     . ILE D 4 77  ? -4.922  0.508   -19.189 1.00 33.69  ? 77  ILE B O     1 
ATOM   5520 C CB    . ILE D 4 77  ? -6.102  -1.589  -17.360 1.00 26.13  ? 77  ILE B CB    1 
ATOM   5521 C CG1   . ILE D 4 77  ? -7.255  -2.451  -16.824 1.00 25.23  ? 77  ILE B CG1   1 
ATOM   5522 C CG2   . ILE D 4 77  ? -4.941  -1.538  -16.386 1.00 21.45  ? 77  ILE B CG2   1 
ATOM   5523 C CD1   . ILE D 4 77  ? -6.897  -3.914  -16.582 1.00 22.28  ? 77  ILE B CD1   1 
ATOM   5524 N N     . THR D 4 78  ? -5.175  1.752   -17.347 1.00 33.04  ? 78  THR B N     1 
ATOM   5525 C CA    . THR D 4 78  ? -4.140  2.697   -17.732 1.00 33.94  ? 78  THR B CA    1 
ATOM   5526 C C     . THR D 4 78  ? -3.030  2.884   -16.706 1.00 33.69  ? 78  THR B C     1 
ATOM   5527 O O     . THR D 4 78  ? -3.292  3.073   -15.520 1.00 36.39  ? 78  THR B O     1 
ATOM   5528 C CB    . THR D 4 78  ? -4.770  4.074   -18.007 1.00 33.37  ? 78  THR B CB    1 
ATOM   5529 O OG1   . THR D 4 78  ? -5.682  3.965   -19.102 1.00 34.15  ? 78  THR B OG1   1 
ATOM   5530 C CG2   . THR D 4 78  ? -3.706  5.101   -18.321 1.00 33.48  ? 78  THR B CG2   1 
ATOM   5531 N N     . VAL D 4 79  ? -1.788  2.826   -17.168 1.00 32.02  ? 79  VAL B N     1 
ATOM   5532 C CA    . VAL D 4 79  ? -0.663  3.050   -16.286 1.00 30.51  ? 79  VAL B CA    1 
ATOM   5533 C C     . VAL D 4 79  ? -0.390  4.534   -16.434 1.00 31.59  ? 79  VAL B C     1 
ATOM   5534 O O     . VAL D 4 79  ? 0.369   4.945   -17.306 1.00 32.23  ? 79  VAL B O     1 
ATOM   5535 C CB    . VAL D 4 79  ? 0.581   2.263   -16.722 1.00 29.23  ? 79  VAL B CB    1 
ATOM   5536 C CG1   . VAL D 4 79  ? 1.758   2.605   -15.815 1.00 28.04  ? 79  VAL B CG1   1 
ATOM   5537 C CG2   . VAL D 4 79  ? 0.296   0.777   -16.671 1.00 28.15  ? 79  VAL B CG2   1 
ATOM   5538 N N     . HIS D 4 80  ? -1.041  5.337   -15.599 1.00 31.48  ? 80  HIS B N     1 
ATOM   5539 C CA    . HIS D 4 80  ? -0.884  6.789   -15.629 1.00 29.83  ? 80  HIS B CA    1 
ATOM   5540 C C     . HIS D 4 80  ? 0.537   7.236   -15.302 1.00 30.12  ? 80  HIS B C     1 
ATOM   5541 O O     . HIS D 4 80  ? 1.032   8.208   -15.869 1.00 30.76  ? 80  HIS B O     1 
ATOM   5542 C CB    . HIS D 4 80  ? -1.849  7.439   -14.637 1.00 29.90  ? 80  HIS B CB    1 
ATOM   5543 C CG    . HIS D 4 80  ? -1.644  8.913   -14.476 1.00 31.10  ? 80  HIS B CG    1 
ATOM   5544 N ND1   . HIS D 4 80  ? -2.078  9.832   -15.407 1.00 30.97  ? 80  HIS B ND1   1 
ATOM   5545 C CD2   . HIS D 4 80  ? -1.008  9.623   -13.513 1.00 30.22  ? 80  HIS B CD2   1 
ATOM   5546 C CE1   . HIS D 4 80  ? -1.718  11.045  -15.026 1.00 29.28  ? 80  HIS B CE1   1 
ATOM   5547 N NE2   . HIS D 4 80  ? -1.067  10.946  -13.880 1.00 31.10  ? 80  HIS B NE2   1 
ATOM   5548 N N     . ARG D 4 81  ? 1.189   6.525   -14.388 1.00 30.07  ? 81  ARG B N     1 
ATOM   5549 C CA    . ARG D 4 81  ? 2.547   6.861   -13.970 1.00 29.55  ? 81  ARG B CA    1 
ATOM   5550 C C     . ARG D 4 81  ? 3.403   5.609   -13.834 1.00 29.19  ? 81  ARG B C     1 
ATOM   5551 O O     . ARG D 4 81  ? 2.982   4.644   -13.201 1.00 32.55  ? 81  ARG B O     1 
ATOM   5552 C CB    . ARG D 4 81  ? 2.490   7.564   -12.623 1.00 32.21  ? 81  ARG B CB    1 
ATOM   5553 C CG    . ARG D 4 81  ? 3.824   8.011   -12.085 1.00 32.98  ? 81  ARG B CG    1 
ATOM   5554 C CD    . ARG D 4 81  ? 4.110   9.437   -12.485 1.00 36.16  ? 81  ARG B CD    1 
ATOM   5555 N NE    . ARG D 4 81  ? 5.239   9.945   -11.721 1.00 38.51  ? 81  ARG B NE    1 
ATOM   5556 C CZ    . ARG D 4 81  ? 5.610   11.215  -11.672 1.00 36.03  ? 81  ARG B CZ    1 
ATOM   5557 N NH1   . ARG D 4 81  ? 4.948   12.145  -12.351 1.00 34.50  ? 81  ARG B NH1   1 
ATOM   5558 N NH2   . ARG D 4 81  ? 6.647   11.546  -10.925 1.00 38.55  ? 81  ARG B NH2   1 
ATOM   5559 N N     . HIS D 4 82  ? 4.601   5.616   -14.410 1.00 27.07  ? 82  HIS B N     1 
ATOM   5560 C CA    . HIS D 4 82  ? 5.480   4.451   -14.311 1.00 24.84  ? 82  HIS B CA    1 
ATOM   5561 C C     . HIS D 4 82  ? 6.395   4.570   -13.090 1.00 24.64  ? 82  HIS B C     1 
ATOM   5562 O O     . HIS D 4 82  ? 6.600   5.657   -12.571 1.00 26.41  ? 82  HIS B O     1 
ATOM   5563 C CB    . HIS D 4 82  ? 6.296   4.304   -15.601 1.00 26.01  ? 82  HIS B CB    1 
ATOM   5564 C CG    . HIS D 4 82  ? 5.472   3.946   -16.804 1.00 25.88  ? 82  HIS B CG    1 
ATOM   5565 N ND1   . HIS D 4 82  ? 5.263   2.642   -17.206 1.00 26.31  ? 82  HIS B ND1   1 
ATOM   5566 C CD2   . HIS D 4 82  ? 4.767   4.719   -17.664 1.00 25.10  ? 82  HIS B CD2   1 
ATOM   5567 C CE1   . HIS D 4 82  ? 4.465   2.628   -18.258 1.00 23.90  ? 82  HIS B CE1   1 
ATOM   5568 N NE2   . HIS D 4 82  ? 4.149   3.876   -18.556 1.00 25.62  ? 82  HIS B NE2   1 
ATOM   5569 N N     . LEU D 4 83  ? 6.938   3.451   -12.629 1.00 26.56  ? 83  LEU B N     1 
ATOM   5570 C CA    . LEU D 4 83  ? 7.807   3.439   -11.454 1.00 28.28  ? 83  LEU B CA    1 
ATOM   5571 C C     . LEU D 4 83  ? 8.942   4.443   -11.452 1.00 30.79  ? 83  LEU B C     1 
ATOM   5572 O O     . LEU D 4 83  ? 9.858   4.357   -12.268 1.00 33.34  ? 83  LEU B O     1 
ATOM   5573 C CB    . LEU D 4 83  ? 8.418   2.063   -11.250 1.00 26.68  ? 83  LEU B CB    1 
ATOM   5574 C CG    . LEU D 4 83  ? 7.864   1.218   -10.115 1.00 29.84  ? 83  LEU B CG    1 
ATOM   5575 C CD1   . LEU D 4 83  ? 8.641   -0.103  -10.071 1.00 32.58  ? 83  LEU B CD1   1 
ATOM   5576 C CD2   . LEU D 4 83  ? 7.975   1.965   -8.802  1.00 27.54  ? 83  LEU B CD2   1 
ATOM   5577 N N     . MET D 4 84  ? 8.896   5.367   -10.500 1.00 30.38  ? 84  MET B N     1 
ATOM   5578 C CA    . MET D 4 84  ? 9.921   6.388   -10.361 1.00 30.83  ? 84  MET B CA    1 
ATOM   5579 C C     . MET D 4 84  ? 9.545   7.267   -9.172  1.00 31.59  ? 84  MET B C     1 
ATOM   5580 O O     . MET D 4 84  ? 8.393   7.264   -8.744  1.00 31.99  ? 84  MET B O     1 
ATOM   5581 C CB    . MET D 4 84  ? 10.017  7.226   -11.643 1.00 29.27  ? 84  MET B CB    1 
ATOM   5582 C CG    . MET D 4 84  ? 8.749   7.962   -12.003 1.00 29.57  ? 84  MET B CG    1 
ATOM   5583 S SD    . MET D 4 84  ? 8.894   8.818   -13.577 1.00 35.49  ? 84  MET B SD    1 
ATOM   5584 C CE    . MET D 4 84  ? 8.257   7.538   -14.738 1.00 33.37  ? 84  MET B CE    1 
ATOM   5585 N N     . LEU D 4 85  ? 10.518  8.001   -8.636  1.00 30.44  ? 85  LEU B N     1 
ATOM   5586 C CA    . LEU D 4 85  ? 10.288  8.889   -7.499  1.00 30.60  ? 85  LEU B CA    1 
ATOM   5587 C C     . LEU D 4 85  ? 9.061   9.762   -7.709  1.00 29.24  ? 85  LEU B C     1 
ATOM   5588 O O     . LEU D 4 85  ? 8.857   10.293  -8.795  1.00 30.24  ? 85  LEU B O     1 
ATOM   5589 C CB    . LEU D 4 85  ? 11.491  9.804   -7.287  1.00 30.43  ? 85  LEU B CB    1 
ATOM   5590 C CG    . LEU D 4 85  ? 12.805  9.148   -6.876  1.00 31.38  ? 85  LEU B CG    1 
ATOM   5591 C CD1   . LEU D 4 85  ? 13.889  10.212  -6.825  1.00 30.99  ? 85  LEU B CD1   1 
ATOM   5592 C CD2   . LEU D 4 85  ? 12.648  8.474   -5.523  1.00 31.04  ? 85  LEU B CD2   1 
ATOM   5593 N N     . PRO D 4 86  ? 8.224   9.923   -6.669  1.00 29.23  ? 86  PRO B N     1 
ATOM   5594 C CA    . PRO D 4 86  ? 7.034   10.765  -6.837  1.00 28.25  ? 86  PRO B CA    1 
ATOM   5595 C C     . PRO D 4 86  ? 7.465   12.224  -6.899  1.00 28.57  ? 86  PRO B C     1 
ATOM   5596 O O     . PRO D 4 86  ? 8.564   12.563  -6.467  1.00 27.44  ? 86  PRO B O     1 
ATOM   5597 C CB    . PRO D 4 86  ? 6.204   10.443  -5.597  1.00 27.48  ? 86  PRO B CB    1 
ATOM   5598 C CG    . PRO D 4 86  ? 7.266   10.174  -4.560  1.00 28.17  ? 86  PRO B CG    1 
ATOM   5599 C CD    . PRO D 4 86  ? 8.276   9.335   -5.316  1.00 27.74  ? 86  PRO B CD    1 
ATOM   5600 N N     . ASP D 4 87  ? 6.602   13.082  -7.433  1.00 28.49  ? 87  ASP B N     1 
ATOM   5601 C CA    . ASP D 4 87  ? 6.916   14.501  -7.562  1.00 27.22  ? 87  ASP B CA    1 
ATOM   5602 C C     . ASP D 4 87  ? 5.653   15.356  -7.536  1.00 26.96  ? 87  ASP B C     1 
ATOM   5603 O O     . ASP D 4 87  ? 4.549   14.842  -7.374  1.00 26.29  ? 87  ASP B O     1 
ATOM   5604 C CB    . ASP D 4 87  ? 7.685   14.748  -8.866  1.00 26.40  ? 87  ASP B CB    1 
ATOM   5605 C CG    . ASP D 4 87  ? 6.939   14.237  -10.095 1.00 27.32  ? 87  ASP B CG    1 
ATOM   5606 O OD1   . ASP D 4 87  ? 5.694   14.339  -10.127 1.00 26.13  ? 87  ASP B OD1   1 
ATOM   5607 O OD2   . ASP D 4 87  ? 7.597   13.746  -11.038 1.00 26.08  ? 87  ASP B OD2   1 
ATOM   5608 N N     . PHE D 4 88  ? 5.815   16.665  -7.704  1.00 28.01  ? 88  PHE B N     1 
ATOM   5609 C CA    . PHE D 4 88  ? 4.668   17.563  -7.685  1.00 29.55  ? 88  PHE B CA    1 
ATOM   5610 C C     . PHE D 4 88  ? 3.748   17.414  -8.889  1.00 30.25  ? 88  PHE B C     1 
ATOM   5611 O O     . PHE D 4 88  ? 2.578   17.816  -8.833  1.00 30.04  ? 88  PHE B O     1 
ATOM   5612 C CB    . PHE D 4 88  ? 5.131   19.017  -7.523  1.00 30.47  ? 88  PHE B CB    1 
ATOM   5613 C CG    . PHE D 4 88  ? 5.805   19.274  -6.210  1.00 32.60  ? 88  PHE B CG    1 
ATOM   5614 C CD1   . PHE D 4 88  ? 7.196   19.294  -6.113  1.00 32.27  ? 88  PHE B CD1   1 
ATOM   5615 C CD2   . PHE D 4 88  ? 5.051   19.410  -5.048  1.00 33.29  ? 88  PHE B CD2   1 
ATOM   5616 C CE1   . PHE D 4 88  ? 7.826   19.441  -4.876  1.00 31.41  ? 88  PHE B CE1   1 
ATOM   5617 C CE2   . PHE D 4 88  ? 5.673   19.556  -3.805  1.00 33.46  ? 88  PHE B CE2   1 
ATOM   5618 C CZ    . PHE D 4 88  ? 7.063   19.571  -3.720  1.00 32.53  ? 88  PHE B CZ    1 
ATOM   5619 N N     . ASP D 4 89  ? 4.258   16.833  -9.975  1.00 31.08  ? 89  ASP B N     1 
ATOM   5620 C CA    . ASP D 4 89  ? 3.414   16.619  -11.144 1.00 32.80  ? 89  ASP B CA    1 
ATOM   5621 C C     . ASP D 4 89  ? 2.450   15.447  -10.885 1.00 33.87  ? 89  ASP B C     1 
ATOM   5622 O O     . ASP D 4 89  ? 1.342   15.413  -11.430 1.00 33.88  ? 89  ASP B O     1 
ATOM   5623 C CB    . ASP D 4 89  ? 4.260   16.354  -12.395 1.00 35.83  ? 89  ASP B CB    1 
ATOM   5624 C CG    . ASP D 4 89  ? 4.865   17.626  -12.975 1.00 39.08  ? 89  ASP B CG    1 
ATOM   5625 O OD1   . ASP D 4 89  ? 4.166   18.667  -13.002 1.00 41.15  ? 89  ASP B OD1   1 
ATOM   5626 O OD2   . ASP D 4 89  ? 6.033   17.586  -13.416 1.00 39.92  ? 89  ASP B OD2   1 
ATOM   5627 N N     . LEU D 4 90  ? 2.863   14.492  -10.051 1.00 33.08  ? 90  LEU B N     1 
ATOM   5628 C CA    . LEU D 4 90  ? 1.996   13.362  -9.728  1.00 33.85  ? 90  LEU B CA    1 
ATOM   5629 C C     . LEU D 4 90  ? 0.845   13.877  -8.873  1.00 33.85  ? 90  LEU B C     1 
ATOM   5630 O O     . LEU D 4 90  ? -0.327  13.617  -9.162  1.00 31.97  ? 90  LEU B O     1 
ATOM   5631 C CB    . LEU D 4 90  ? 2.753   12.277  -8.953  1.00 33.99  ? 90  LEU B CB    1 
ATOM   5632 C CG    . LEU D 4 90  ? 1.908   11.053  -8.558  1.00 34.74  ? 90  LEU B CG    1 
ATOM   5633 C CD1   . LEU D 4 90  ? 1.377   10.390  -9.823  1.00 34.17  ? 90  LEU B CD1   1 
ATOM   5634 C CD2   . LEU D 4 90  ? 2.736   10.058  -7.745  1.00 32.07  ? 90  LEU B CD2   1 
ATOM   5635 N N     . LEU D 4 91  ? 1.194   14.614  -7.821  1.00 32.98  ? 91  LEU B N     1 
ATOM   5636 C CA    . LEU D 4 91  ? 0.206   15.185  -6.915  1.00 32.12  ? 91  LEU B CA    1 
ATOM   5637 C C     . LEU D 4 91  ? -0.798  16.051  -7.674  1.00 33.05  ? 91  LEU B C     1 
ATOM   5638 O O     . LEU D 4 91  ? -2.006  15.952  -7.449  1.00 33.30  ? 91  LEU B O     1 
ATOM   5639 C CB    . LEU D 4 91  ? 0.916   16.000  -5.821  1.00 30.88  ? 91  LEU B CB    1 
ATOM   5640 C CG    . LEU D 4 91  ? 1.723   15.126  -4.847  1.00 29.97  ? 91  LEU B CG    1 
ATOM   5641 C CD1   . LEU D 4 91  ? 2.664   15.966  -4.012  1.00 27.79  ? 91  LEU B CD1   1 
ATOM   5642 C CD2   . LEU D 4 91  ? 0.752   14.334  -3.960  1.00 28.30  ? 91  LEU B CD2   1 
ATOM   5643 N N     . GLU D 4 92  ? -0.302  16.881  -8.587  1.00 34.32  ? 92  GLU B N     1 
ATOM   5644 C CA    . GLU D 4 92  ? -1.176  17.746  -9.372  1.00 35.03  ? 92  GLU B CA    1 
ATOM   5645 C C     . GLU D 4 92  ? -2.148  16.933  -10.213 1.00 35.01  ? 92  GLU B C     1 
ATOM   5646 O O     . GLU D 4 92  ? -3.334  17.262  -10.269 1.00 36.61  ? 92  GLU B O     1 
ATOM   5647 C CB    . GLU D 4 92  ? -0.360  18.686  -10.273 1.00 36.50  ? 92  GLU B CB    1 
ATOM   5648 C CG    . GLU D 4 92  ? -1.217  19.513  -11.242 1.00 39.82  ? 92  GLU B CG    1 
ATOM   5649 C CD    . GLU D 4 92  ? -0.513  20.762  -11.769 1.00 41.07  ? 92  GLU B CD    1 
ATOM   5650 O OE1   . GLU D 4 92  ? 0.641   20.662  -12.239 1.00 42.72  ? 92  GLU B OE1   1 
ATOM   5651 O OE2   . GLU D 4 92  ? -1.122  21.850  -11.719 1.00 41.21  ? 92  GLU B OE2   1 
ATOM   5652 N N     . ASP D 4 93  ? -1.666  15.875  -10.862 1.00 34.76  ? 93  ASP B N     1 
ATOM   5653 C CA    . ASP D 4 93  ? -2.552  15.044  -11.679 1.00 34.05  ? 93  ASP B CA    1 
ATOM   5654 C C     . ASP D 4 93  ? -3.649  14.469  -10.811 1.00 33.83  ? 93  ASP B C     1 
ATOM   5655 O O     . ASP D 4 93  ? -4.821  14.507  -11.172 1.00 34.69  ? 93  ASP B O     1 
ATOM   5656 C CB    . ASP D 4 93  ? -1.798  13.889  -12.336 1.00 34.67  ? 93  ASP B CB    1 
ATOM   5657 C CG    . ASP D 4 93  ? -0.770  14.355  -13.339 1.00 36.38  ? 93  ASP B CG    1 
ATOM   5658 O OD1   . ASP D 4 93  ? -0.840  15.530  -13.759 1.00 39.08  ? 93  ASP B OD1   1 
ATOM   5659 O OD2   . ASP D 4 93  ? 0.101   13.544  -13.718 1.00 34.42  ? 93  ASP B OD2   1 
ATOM   5660 N N     . ILE D 4 94  ? -3.253  13.938  -9.659  1.00 35.53  ? 94  ILE B N     1 
ATOM   5661 C CA    . ILE D 4 94  ? -4.182  13.337  -8.710  1.00 35.03  ? 94  ILE B CA    1 
ATOM   5662 C C     . ILE D 4 94  ? -5.232  14.356  -8.306  1.00 35.64  ? 94  ILE B C     1 
ATOM   5663 O O     . ILE D 4 94  ? -6.421  14.053  -8.205  1.00 35.96  ? 94  ILE B O     1 
ATOM   5664 C CB    . ILE D 4 94  ? -3.460  12.893  -7.414  1.00 34.47  ? 94  ILE B CB    1 
ATOM   5665 C CG1   . ILE D 4 94  ? -2.258  12.009  -7.746  1.00 35.69  ? 94  ILE B CG1   1 
ATOM   5666 C CG2   . ILE D 4 94  ? -4.431  12.161  -6.502  1.00 32.86  ? 94  ILE B CG2   1 
ATOM   5667 C CD1   . ILE D 4 94  ? -2.612  10.712  -8.422  1.00 38.14  ? 94  ILE B CD1   1 
ATOM   5668 N N     . GLU D 4 95  ? -4.770  15.575  -8.074  1.00 36.43  ? 95  GLU B N     1 
ATOM   5669 C CA    . GLU D 4 95  ? -5.647  16.643  -7.639  1.00 37.88  ? 95  GLU B CA    1 
ATOM   5670 C C     . GLU D 4 95  ? -6.446  17.307  -8.753  1.00 37.55  ? 95  GLU B C     1 
ATOM   5671 O O     . GLU D 4 95  ? -7.593  17.684  -8.545  1.00 35.47  ? 95  GLU B O     1 
ATOM   5672 C CB    . GLU D 4 95  ? -4.817  17.697  -6.893  1.00 39.85  ? 95  GLU B CB    1 
ATOM   5673 C CG    . GLU D 4 95  ? -5.617  18.840  -6.284  1.00 41.54  ? 95  GLU B CG    1 
ATOM   5674 C CD    . GLU D 4 95  ? -4.762  19.725  -5.393  1.00 43.89  ? 95  GLU B CD    1 
ATOM   5675 O OE1   . GLU D 4 95  ? -4.224  19.215  -4.379  1.00 43.11  ? 95  GLU B OE1   1 
ATOM   5676 O OE2   . GLU D 4 95  ? -4.627  20.928  -5.707  1.00 45.29  ? 95  GLU B OE2   1 
ATOM   5677 N N     . SER D 4 96  ? -5.854  17.426  -9.938  1.00 38.02  ? 96  SER B N     1 
ATOM   5678 C CA    . SER D 4 96  ? -6.533  18.107  -11.031 1.00 39.76  ? 96  SER B CA    1 
ATOM   5679 C C     . SER D 4 96  ? -6.727  17.386  -12.367 1.00 39.53  ? 96  SER B C     1 
ATOM   5680 O O     . SER D 4 96  ? -7.815  17.426  -12.931 1.00 39.95  ? 96  SER B O     1 
ATOM   5681 C CB    . SER D 4 96  ? -5.835  19.448  -11.281 1.00 38.13  ? 96  SER B CB    1 
ATOM   5682 O OG    . SER D 4 96  ? -6.462  20.164  -12.322 1.00 39.39  ? 96  SER B OG    1 
ATOM   5683 N N     . LYS D 4 97  ? -5.697  16.737  -12.890 1.00 40.10  ? 97  LYS B N     1 
ATOM   5684 C CA    . LYS D 4 97  ? -5.857  16.075  -14.179 1.00 40.44  ? 97  LYS B CA    1 
ATOM   5685 C C     . LYS D 4 97  ? -6.759  14.836  -14.190 1.00 38.85  ? 97  LYS B C     1 
ATOM   5686 O O     . LYS D 4 97  ? -7.801  14.835  -14.844 1.00 39.89  ? 97  LYS B O     1 
ATOM   5687 C CB    . LYS D 4 97  ? -4.496  15.710  -14.782 1.00 41.80  ? 97  LYS B CB    1 
ATOM   5688 C CG    . LYS D 4 97  ? -4.635  15.118  -16.185 1.00 47.27  ? 97  LYS B CG    1 
ATOM   5689 C CD    . LYS D 4 97  ? -3.404  14.350  -16.654 1.00 48.52  ? 97  LYS B CD    1 
ATOM   5690 C CE    . LYS D 4 97  ? -3.744  13.511  -17.886 1.00 49.64  ? 97  LYS B CE    1 
ATOM   5691 N NZ    . LYS D 4 97  ? -2.643  12.580  -18.274 1.00 50.29  ? 97  LYS B NZ    1 
ATOM   5692 N N     . ILE D 4 98  ? -6.369  13.789  -13.469 1.00 37.16  ? 98  ILE B N     1 
ATOM   5693 C CA    . ILE D 4 98  ? -7.140  12.544  -13.447 1.00 34.85  ? 98  ILE B CA    1 
ATOM   5694 C C     . ILE D 4 98  ? -8.640  12.697  -13.207 1.00 36.32  ? 98  ILE B C     1 
ATOM   5695 O O     . ILE D 4 98  ? -9.082  13.119  -12.138 1.00 36.72  ? 98  ILE B O     1 
ATOM   5696 C CB    . ILE D 4 98  ? -6.571  11.562  -12.414 1.00 31.87  ? 98  ILE B CB    1 
ATOM   5697 C CG1   . ILE D 4 98  ? -5.123  11.225  -12.775 1.00 30.26  ? 98  ILE B CG1   1 
ATOM   5698 C CG2   . ILE D 4 98  ? -7.414  10.292  -12.384 1.00 32.01  ? 98  ILE B CG2   1 
ATOM   5699 C CD1   . ILE D 4 98  ? -4.405  10.389  -11.751 1.00 29.95  ? 98  ILE B CD1   1 
ATOM   5700 N N     . GLN D 4 99  ? -9.415  12.320  -14.221 1.00 36.94  ? 99  GLN B N     1 
ATOM   5701 C CA    . GLN D 4 99  ? -10.871 12.405  -14.175 1.00 37.42  ? 99  GLN B CA    1 
ATOM   5702 C C     . GLN D 4 99  ? -11.523 11.025  -14.045 1.00 35.52  ? 99  GLN B C     1 
ATOM   5703 O O     . GLN D 4 99  ? -10.921 10.011  -14.400 1.00 34.60  ? 99  GLN B O     1 
ATOM   5704 C CB    . GLN D 4 99  ? -11.383 13.062  -15.461 1.00 39.75  ? 99  GLN B CB    1 
ATOM   5705 C CG    . GLN D 4 99  ? -10.945 14.489  -15.681 1.00 42.17  ? 99  GLN B CG    1 
ATOM   5706 C CD    . GLN D 4 99  ? -11.617 15.448  -14.727 1.00 45.24  ? 99  GLN B CD    1 
ATOM   5707 O OE1   . GLN D 4 99  ? -12.839 15.409  -14.545 1.00 46.38  ? 99  GLN B OE1   1 
ATOM   5708 N NE2   . GLN D 4 99  ? -10.827 16.327  -14.115 1.00 46.66  ? 99  GLN B NE2   1 
ATOM   5709 N N     . PRO D 4 100 ? -12.767 10.973  -13.535 1.00 33.54  ? 100 PRO B N     1 
ATOM   5710 C CA    . PRO D 4 100 ? -13.467 9.694   -13.390 1.00 34.87  ? 100 PRO B CA    1 
ATOM   5711 C C     . PRO D 4 100 ? -13.784 9.110   -14.764 1.00 35.68  ? 100 PRO B C     1 
ATOM   5712 O O     . PRO D 4 100 ? -14.065 9.845   -15.712 1.00 36.41  ? 100 PRO B O     1 
ATOM   5713 C CB    . PRO D 4 100 ? -14.729 10.066  -12.606 1.00 32.56  ? 100 PRO B CB    1 
ATOM   5714 C CG    . PRO D 4 100 ? -14.964 11.466  -12.985 1.00 33.20  ? 100 PRO B CG    1 
ATOM   5715 C CD    . PRO D 4 100 ? -13.574 12.064  -12.970 1.00 33.37  ? 100 PRO B CD    1 
ATOM   5716 N N     . GLY D 4 101 ? -13.727 7.787   -14.861 1.00 36.28  ? 101 GLY B N     1 
ATOM   5717 C CA    . GLY D 4 101 ? -13.990 7.115   -16.116 1.00 36.10  ? 101 GLY B CA    1 
ATOM   5718 C C     . GLY D 4 101 ? -15.457 6.803   -16.308 1.00 37.42  ? 101 GLY B C     1 
ATOM   5719 O O     . GLY D 4 101 ? -16.267 7.009   -15.403 1.00 35.62  ? 101 GLY B O     1 
ATOM   5720 N N     . SER D 4 102 ? -15.791 6.292   -17.492 1.00 37.86  ? 102 SER B N     1 
ATOM   5721 C CA    . SER D 4 102 ? -17.168 5.960   -17.836 1.00 39.01  ? 102 SER B CA    1 
ATOM   5722 C C     . SER D 4 102 ? -17.353 4.464   -17.978 1.00 39.04  ? 102 SER B C     1 
ATOM   5723 O O     . SER D 4 102 ? -18.467 3.993   -18.212 1.00 38.75  ? 102 SER B O     1 
ATOM   5724 C CB    . SER D 4 102 ? -17.549 6.622   -19.159 1.00 39.62  ? 102 SER B CB    1 
ATOM   5725 O OG    . SER D 4 102 ? -17.263 8.006   -19.137 1.00 42.84  ? 102 SER B OG    1 
ATOM   5726 N N     . GLN D 4 103 ? -16.261 3.721   -17.844 1.00 38.19  ? 103 GLN B N     1 
ATOM   5727 C CA    . GLN D 4 103 ? -16.319 2.274   -17.986 1.00 38.52  ? 103 GLN B CA    1 
ATOM   5728 C C     . GLN D 4 103 ? -16.121 1.537   -16.667 1.00 37.78  ? 103 GLN B C     1 
ATOM   5729 O O     . GLN D 4 103 ? -16.209 2.125   -15.585 1.00 38.36  ? 103 GLN B O     1 
ATOM   5730 C CB    . GLN D 4 103 ? -15.258 1.804   -18.985 1.00 40.43  ? 103 GLN B CB    1 
ATOM   5731 C CG    . GLN D 4 103 ? -15.149 2.651   -20.245 1.00 42.84  ? 103 GLN B CG    1 
ATOM   5732 C CD    . GLN D 4 103 ? -16.484 2.869   -20.924 1.00 44.41  ? 103 GLN B CD    1 
ATOM   5733 O OE1   . GLN D 4 103 ? -17.224 1.917   -21.183 1.00 44.77  ? 103 GLN B OE1   1 
ATOM   5734 N NE2   . GLN D 4 103 ? -16.798 4.129   -21.225 1.00 45.99  ? 103 GLN B NE2   1 
ATOM   5735 N N     . GLN D 4 104 ? -15.858 0.239   -16.782 1.00 36.15  ? 104 GLN B N     1 
ATOM   5736 C CA    . GLN D 4 104 ? -15.621 -0.634  -15.639 1.00 35.55  ? 104 GLN B CA    1 
ATOM   5737 C C     . GLN D 4 104 ? -14.598 -1.672  -16.090 1.00 35.61  ? 104 GLN B C     1 
ATOM   5738 O O     . GLN D 4 104 ? -14.751 -2.274  -17.151 1.00 37.13  ? 104 GLN B O     1 
ATOM   5739 C CB    . GLN D 4 104 ? -16.915 -1.347  -15.221 1.00 34.80  ? 104 GLN B CB    1 
ATOM   5740 C CG    . GLN D 4 104 ? -18.063 -0.436  -14.816 1.00 36.90  ? 104 GLN B CG    1 
ATOM   5741 C CD    . GLN D 4 104 ? -17.894 0.177   -13.431 1.00 40.14  ? 104 GLN B CD    1 
ATOM   5742 O OE1   . GLN D 4 104 ? -18.651 1.069   -13.040 1.00 40.77  ? 104 GLN B OE1   1 
ATOM   5743 N NE2   . GLN D 4 104 ? -16.909 -0.307  -12.680 1.00 40.34  ? 104 GLN B NE2   1 
ATOM   5744 N N     . ALA D 4 105 ? -13.550 -1.881  -15.302 1.00 34.54  ? 105 ALA B N     1 
ATOM   5745 C CA    . ALA D 4 105 ? -12.539 -2.866  -15.666 1.00 31.49  ? 105 ALA B CA    1 
ATOM   5746 C C     . ALA D 4 105 ? -12.468 -4.004  -14.646 1.00 31.49  ? 105 ALA B C     1 
ATOM   5747 O O     . ALA D 4 105 ? -12.978 -3.894  -13.531 1.00 30.24  ? 105 ALA B O     1 
ATOM   5748 C CB    . ALA D 4 105 ? -11.177 -2.189  -15.803 1.00 31.25  ? 105 ALA B CB    1 
ATOM   5749 N N     . ASP D 4 106 ? -11.842 -5.102  -15.049 1.00 30.82  ? 106 ASP B N     1 
ATOM   5750 C CA    . ASP D 4 106 ? -11.668 -6.276  -14.196 1.00 29.90  ? 106 ASP B CA    1 
ATOM   5751 C C     . ASP D 4 106 ? -10.622 -5.865  -13.146 1.00 26.69  ? 106 ASP B C     1 
ATOM   5752 O O     . ASP D 4 106 ? -9.504  -5.503  -13.512 1.00 27.13  ? 106 ASP B O     1 
ATOM   5753 C CB    . ASP D 4 106 ? -11.147 -7.424  -15.073 1.00 32.21  ? 106 ASP B CB    1 
ATOM   5754 C CG    . ASP D 4 106 ? -11.294 -8.783  -14.427 1.00 33.63  ? 106 ASP B CG    1 
ATOM   5755 O OD1   . ASP D 4 106 ? -10.750 -8.981  -13.322 1.00 35.90  ? 106 ASP B OD1   1 
ATOM   5756 O OD2   . ASP D 4 106 ? -11.945 -9.658  -15.037 1.00 33.39  ? 106 ASP B OD2   1 
ATOM   5757 N N     . PHE D 4 107 ? -10.957 -5.905  -11.855 1.00 25.71  ? 107 PHE B N     1 
ATOM   5758 C CA    . PHE D 4 107 ? -9.976  -5.475  -10.851 1.00 23.16  ? 107 PHE B CA    1 
ATOM   5759 C C     . PHE D 4 107 ? -8.813  -6.441  -10.682 1.00 22.22  ? 107 PHE B C     1 
ATOM   5760 O O     . PHE D 4 107 ? -7.700  -6.016  -10.396 1.00 22.23  ? 107 PHE B O     1 
ATOM   5761 C CB    . PHE D 4 107 ? -10.650 -5.128  -9.503  1.00 22.88  ? 107 PHE B CB    1 
ATOM   5762 C CG    . PHE D 4 107 ? -10.933 -6.301  -8.605  1.00 25.76  ? 107 PHE B CG    1 
ATOM   5763 C CD1   . PHE D 4 107 ? -9.959  -6.767  -7.720  1.00 25.52  ? 107 PHE B CD1   1 
ATOM   5764 C CD2   . PHE D 4 107 ? -12.197 -6.900  -8.596  1.00 25.45  ? 107 PHE B CD2   1 
ATOM   5765 C CE1   . PHE D 4 107 ? -10.233 -7.805  -6.834  1.00 25.17  ? 107 PHE B CE1   1 
ATOM   5766 C CE2   . PHE D 4 107 ? -12.486 -7.938  -7.715  1.00 26.50  ? 107 PHE B CE2   1 
ATOM   5767 C CZ    . PHE D 4 107 ? -11.498 -8.394  -6.827  1.00 26.08  ? 107 PHE B CZ    1 
ATOM   5768 N N     . LEU D 4 108 ? -9.049  -7.732  -10.880 1.00 20.42  ? 108 LEU B N     1 
ATOM   5769 C CA    . LEU D 4 108 ? -7.948  -8.680  -10.794 1.00 21.44  ? 108 LEU B CA    1 
ATOM   5770 C C     . LEU D 4 108 ? -7.026  -8.463  -12.012 1.00 22.09  ? 108 LEU B C     1 
ATOM   5771 O O     . LEU D 4 108 ? -5.833  -8.767  -11.961 1.00 22.11  ? 108 LEU B O     1 
ATOM   5772 C CB    . LEU D 4 108 ? -8.464  -10.127 -10.745 1.00 18.96  ? 108 LEU B CB    1 
ATOM   5773 C CG    . LEU D 4 108 ? -9.150  -10.556 -9.436  1.00 18.95  ? 108 LEU B CG    1 
ATOM   5774 C CD1   . LEU D 4 108 ? -9.411  -12.064 -9.478  1.00 16.50  ? 108 LEU B CD1   1 
ATOM   5775 C CD2   . LEU D 4 108 ? -8.267  -10.194 -8.224  1.00 16.67  ? 108 LEU B CD2   1 
ATOM   5776 N N     . ASP D 4 109 ? -7.575  -7.931  -13.102 1.00 22.38  ? 109 ASP B N     1 
ATOM   5777 C CA    . ASP D 4 109 ? -6.765  -7.655  -14.287 1.00 24.50  ? 109 ASP B CA    1 
ATOM   5778 C C     . ASP D 4 109 ? -5.871  -6.456  -13.962 1.00 24.93  ? 109 ASP B C     1 
ATOM   5779 O O     . ASP D 4 109 ? -4.695  -6.422  -14.343 1.00 24.85  ? 109 ASP B O     1 
ATOM   5780 C CB    . ASP D 4 109 ? -7.637  -7.318  -15.508 1.00 26.64  ? 109 ASP B CB    1 
ATOM   5781 C CG    . ASP D 4 109 ? -8.095  -8.555  -16.280 1.00 27.81  ? 109 ASP B CG    1 
ATOM   5782 O OD1   . ASP D 4 109 ? -7.500  -9.638  -16.103 1.00 28.09  ? 109 ASP B OD1   1 
ATOM   5783 O OD2   . ASP D 4 109 ? -9.047  -8.434  -17.084 1.00 29.63  ? 109 ASP B OD2   1 
ATOM   5784 N N     . ALA D 4 110 ? -6.438  -5.475  -13.256 1.00 23.89  ? 110 ALA B N     1 
ATOM   5785 C CA    . ALA D 4 110 ? -5.694  -4.282  -12.849 1.00 22.20  ? 110 ALA B CA    1 
ATOM   5786 C C     . ALA D 4 110 ? -4.526  -4.698  -11.958 1.00 21.06  ? 110 ALA B C     1 
ATOM   5787 O O     . ALA D 4 110 ? -3.416  -4.182  -12.090 1.00 19.89  ? 110 ALA B O     1 
ATOM   5788 C CB    . ALA D 4 110 ? -6.607  -3.324  -12.095 1.00 23.90  ? 110 ALA B CB    1 
ATOM   5789 N N     . LEU D 4 111 ? -4.790  -5.634  -11.048 1.00 20.62  ? 111 LEU B N     1 
ATOM   5790 C CA    . LEU D 4 111 ? -3.766  -6.148  -10.145 1.00 20.63  ? 111 LEU B CA    1 
ATOM   5791 C C     . LEU D 4 111 ? -2.629  -6.777  -10.956 1.00 21.38  ? 111 LEU B C     1 
ATOM   5792 O O     . LEU D 4 111 ? -1.450  -6.533  -10.691 1.00 23.05  ? 111 LEU B O     1 
ATOM   5793 C CB    . LEU D 4 111 ? -4.376  -7.188  -9.200  1.00 18.97  ? 111 LEU B CB    1 
ATOM   5794 C CG    . LEU D 4 111 ? -3.474  -7.881  -8.169  1.00 16.62  ? 111 LEU B CG    1 
ATOM   5795 C CD1   . LEU D 4 111 ? -2.794  -6.866  -7.261  1.00 16.04  ? 111 LEU B CD1   1 
ATOM   5796 C CD2   . LEU D 4 111 ? -4.324  -8.828  -7.330  1.00 16.74  ? 111 LEU B CD2   1 
ATOM   5797 N N     . ILE D 4 112 ? -2.990  -7.573  -11.956 1.00 23.26  ? 112 ILE B N     1 
ATOM   5798 C CA    . ILE D 4 112 ? -1.996  -8.230  -12.801 1.00 25.46  ? 112 ILE B CA    1 
ATOM   5799 C C     . ILE D 4 112 ? -1.124  -7.203  -13.511 1.00 25.38  ? 112 ILE B C     1 
ATOM   5800 O O     . ILE D 4 112 ? 0.085   -7.389  -13.618 1.00 26.05  ? 112 ILE B O     1 
ATOM   5801 C CB    . ILE D 4 112 ? -2.674  -9.177  -13.829 1.00 25.38  ? 112 ILE B CB    1 
ATOM   5802 C CG1   . ILE D 4 112 ? -3.151  -10.446 -13.112 1.00 27.09  ? 112 ILE B CG1   1 
ATOM   5803 C CG2   . ILE D 4 112 ? -1.708  -9.550  -14.936 1.00 26.25  ? 112 ILE B CG2   1 
ATOM   5804 C CD1   . ILE D 4 112 ? -4.047  -11.346 -13.956 1.00 28.38  ? 112 ILE B CD1   1 
ATOM   5805 N N     . VAL D 4 113 ? -1.730  -6.119  -13.991 1.00 26.06  ? 113 VAL B N     1 
ATOM   5806 C CA    . VAL D 4 113 ? -0.968  -5.062  -14.657 1.00 26.15  ? 113 VAL B CA    1 
ATOM   5807 C C     . VAL D 4 113 ? -0.072  -4.373  -13.634 1.00 26.96  ? 113 VAL B C     1 
ATOM   5808 O O     . VAL D 4 113 ? 1.028   -3.928  -13.958 1.00 27.48  ? 113 VAL B O     1 
ATOM   5809 C CB    . VAL D 4 113 ? -1.902  -3.999  -15.316 1.00 25.87  ? 113 VAL B CB    1 
ATOM   5810 C CG1   . VAL D 4 113 ? -1.093  -2.759  -15.732 1.00 22.91  ? 113 VAL B CG1   1 
ATOM   5811 C CG2   . VAL D 4 113 ? -2.584  -4.604  -16.546 1.00 26.10  ? 113 VAL B CG2   1 
ATOM   5812 N N     . SER D 4 114 ? -0.556  -4.288  -12.396 1.00 27.88  ? 114 SER B N     1 
ATOM   5813 C CA    . SER D 4 114 ? 0.198   -3.665  -11.321 1.00 27.00  ? 114 SER B CA    1 
ATOM   5814 C C     . SER D 4 114 ? 1.395   -4.537  -10.996 1.00 27.37  ? 114 SER B C     1 
ATOM   5815 O O     . SER D 4 114 ? 2.493   -4.037  -10.765 1.00 26.87  ? 114 SER B O     1 
ATOM   5816 C CB    . SER D 4 114 ? -0.679  -3.497  -10.077 1.00 27.57  ? 114 SER B CB    1 
ATOM   5817 O OG    . SER D 4 114 ? -1.704  -2.547  -10.296 1.00 25.62  ? 114 SER B OG    1 
ATOM   5818 N N     . MET D 4 115 ? 1.179   -5.848  -10.968 1.00 28.37  ? 115 MET B N     1 
ATOM   5819 C CA    . MET D 4 115 ? 2.265   -6.781  -10.685 1.00 28.60  ? 115 MET B CA    1 
ATOM   5820 C C     . MET D 4 115 ? 3.288   -6.723  -11.810 1.00 28.10  ? 115 MET B C     1 
ATOM   5821 O O     . MET D 4 115 ? 4.483   -6.867  -11.579 1.00 27.96  ? 115 MET B O     1 
ATOM   5822 C CB    . MET D 4 115 ? 1.738   -8.210  -10.564 1.00 28.47  ? 115 MET B CB    1 
ATOM   5823 C CG    . MET D 4 115 ? 0.886   -8.457  -9.348  1.00 29.54  ? 115 MET B CG    1 
ATOM   5824 S SD    . MET D 4 115 ? 0.388   -10.177 -9.255  1.00 31.78  ? 115 MET B SD    1 
ATOM   5825 C CE    . MET D 4 115 ? -1.293  -10.014 -9.093  1.00 28.56  ? 115 MET B CE    1 
ATOM   5826 N N     . ASP D 4 116 ? 2.807   -6.508  -13.029 1.00 27.99  ? 116 ASP B N     1 
ATOM   5827 C CA    . ASP D 4 116 ? 3.682   -6.434  -14.184 1.00 29.86  ? 116 ASP B CA    1 
ATOM   5828 C C     . ASP D 4 116 ? 4.641   -5.259  -14.031 1.00 30.94  ? 116 ASP B C     1 
ATOM   5829 O O     . ASP D 4 116 ? 5.844   -5.399  -14.269 1.00 31.40  ? 116 ASP B O     1 
ATOM   5830 C CB    . ASP D 4 116 ? 2.862   -6.270  -15.468 1.00 32.12  ? 116 ASP B CB    1 
ATOM   5831 C CG    . ASP D 4 116 ? 3.672   -6.563  -16.717 1.00 32.53  ? 116 ASP B CG    1 
ATOM   5832 O OD1   . ASP D 4 116 ? 4.045   -7.736  -16.917 1.00 31.48  ? 116 ASP B OD1   1 
ATOM   5833 O OD2   . ASP D 4 116 ? 3.942   -5.625  -17.495 1.00 34.72  ? 116 ASP B OD2   1 
ATOM   5834 N N     . VAL D 4 117 ? 4.106   -4.106  -13.628 1.00 30.10  ? 117 VAL B N     1 
ATOM   5835 C CA    . VAL D 4 117 ? 4.921   -2.912  -13.437 1.00 30.57  ? 117 VAL B CA    1 
ATOM   5836 C C     . VAL D 4 117 ? 6.071   -3.203  -12.476 1.00 33.19  ? 117 VAL B C     1 
ATOM   5837 O O     . VAL D 4 117 ? 7.226   -2.858  -12.743 1.00 33.71  ? 117 VAL B O     1 
ATOM   5838 C CB    . VAL D 4 117 ? 4.086   -1.747  -12.877 1.00 29.76  ? 117 VAL B CB    1 
ATOM   5839 C CG1   . VAL D 4 117 ? 4.985   -0.564  -12.584 1.00 28.64  ? 117 VAL B CG1   1 
ATOM   5840 C CG2   . VAL D 4 117 ? 2.997   -1.357  -13.871 1.00 29.45  ? 117 VAL B CG2   1 
ATOM   5841 N N     . ILE D 4 118 ? 5.759   -3.845  -11.357 1.00 34.85  ? 118 ILE B N     1 
ATOM   5842 C CA    . ILE D 4 118 ? 6.790   -4.173  -10.383 1.00 38.71  ? 118 ILE B CA    1 
ATOM   5843 C C     . ILE D 4 118 ? 7.782   -5.191  -10.935 1.00 41.44  ? 118 ILE B C     1 
ATOM   5844 O O     . ILE D 4 118 ? 8.972   -5.123  -10.642 1.00 42.47  ? 118 ILE B O     1 
ATOM   5845 C CB    . ILE D 4 118 ? 6.179   -4.735  -9.086  1.00 38.33  ? 118 ILE B CB    1 
ATOM   5846 C CG1   . ILE D 4 118 ? 5.521   -3.605  -8.294  1.00 37.30  ? 118 ILE B CG1   1 
ATOM   5847 C CG2   . ILE D 4 118 ? 7.250   -5.421  -8.249  1.00 39.57  ? 118 ILE B CG2   1 
ATOM   5848 C CD1   . ILE D 4 118 ? 4.821   -4.079  -7.046  1.00 37.56  ? 118 ILE B CD1   1 
ATOM   5849 N N     . GLN D 4 119 ? 7.296   -6.128  -11.743 1.00 44.94  ? 119 GLN B N     1 
ATOM   5850 C CA    . GLN D 4 119 ? 8.162   -7.164  -12.300 1.00 47.45  ? 119 GLN B CA    1 
ATOM   5851 C C     . GLN D 4 119 ? 9.055   -6.694  -13.441 1.00 48.00  ? 119 GLN B C     1 
ATOM   5852 O O     . GLN D 4 119 ? 10.189  -7.151  -13.564 1.00 49.28  ? 119 GLN B O     1 
ATOM   5853 C CB    . GLN D 4 119 ? 7.329   -8.356  -12.783 1.00 48.58  ? 119 GLN B CB    1 
ATOM   5854 C CG    . GLN D 4 119 ? 6.519   -9.055  -11.698 1.00 49.73  ? 119 GLN B CG    1 
ATOM   5855 C CD    . GLN D 4 119 ? 5.706   -10.210 -12.250 1.00 50.31  ? 119 GLN B CD    1 
ATOM   5856 O OE1   . GLN D 4 119 ? 5.018   -10.070 -13.266 1.00 49.88  ? 119 GLN B OE1   1 
ATOM   5857 N NE2   . GLN D 4 119 ? 5.780   -11.359 -11.585 1.00 49.55  ? 119 GLN B NE2   1 
ATOM   5858 N N     . HIS D 4 120 ? 8.544   -5.793  -14.274 1.00 48.06  ? 120 HIS B N     1 
ATOM   5859 C CA    . HIS D 4 120 ? 9.302   -5.279  -15.415 1.00 49.10  ? 120 HIS B CA    1 
ATOM   5860 C C     . HIS D 4 120 ? 10.128  -4.024  -15.146 1.00 50.07  ? 120 HIS B C     1 
ATOM   5861 O O     . HIS D 4 120 ? 11.047  -3.716  -15.908 1.00 50.93  ? 120 HIS B O     1 
ATOM   5862 C CB    . HIS D 4 120 ? 8.364   -4.966  -16.585 1.00 49.29  ? 120 HIS B CB    1 
ATOM   5863 C CG    . HIS D 4 120 ? 8.141   -6.115  -17.518 1.00 50.40  ? 120 HIS B CG    1 
ATOM   5864 N ND1   . HIS D 4 120 ? 7.494   -7.271  -17.139 1.00 50.35  ? 120 HIS B ND1   1 
ATOM   5865 C CD2   . HIS D 4 120 ? 8.464   -6.274  -18.823 1.00 50.46  ? 120 HIS B CD2   1 
ATOM   5866 C CE1   . HIS D 4 120 ? 7.424   -8.092  -18.171 1.00 51.75  ? 120 HIS B CE1   1 
ATOM   5867 N NE2   . HIS D 4 120 ? 8.005   -7.511  -19.205 1.00 53.62  ? 120 HIS B NE2   1 
ATOM   5868 N N     . GLU D 4 121 ? 9.807   -3.298  -14.078 1.00 49.33  ? 121 GLU B N     1 
ATOM   5869 C CA    . GLU D 4 121 ? 10.516  -2.061  -13.800 1.00 48.07  ? 121 GLU B CA    1 
ATOM   5870 C C     . GLU D 4 121 ? 11.441  -2.016  -12.588 1.00 49.29  ? 121 GLU B C     1 
ATOM   5871 O O     . GLU D 4 121 ? 12.298  -1.138  -12.512 1.00 50.17  ? 121 GLU B O     1 
ATOM   5872 C CB    . GLU D 4 121 ? 9.503   -0.910  -13.755 1.00 45.56  ? 121 GLU B CB    1 
ATOM   5873 C CG    . GLU D 4 121 ? 8.763   -0.752  -15.085 1.00 42.24  ? 121 GLU B CG    1 
ATOM   5874 C CD    . GLU D 4 121 ? 7.821   0.433   -15.129 1.00 39.56  ? 121 GLU B CD    1 
ATOM   5875 O OE1   . GLU D 4 121 ? 8.162   1.479   -14.558 1.00 40.52  ? 121 GLU B OE1   1 
ATOM   5876 O OE2   . GLU D 4 121 ? 6.746   0.329   -15.757 1.00 37.14  ? 121 GLU B OE2   1 
ATOM   5877 N N     . THR D 4 122 ? 11.294  -2.942  -11.646 1.00 50.70  ? 122 THR B N     1 
ATOM   5878 C CA    . THR D 4 122 ? 12.183  -2.938  -10.485 1.00 53.08  ? 122 THR B CA    1 
ATOM   5879 C C     . THR D 4 122 ? 13.510  -3.525  -10.945 1.00 55.38  ? 122 THR B C     1 
ATOM   5880 O O     . THR D 4 122 ? 14.457  -3.689  -10.170 1.00 55.75  ? 122 THR B O     1 
ATOM   5881 C CB    . THR D 4 122 ? 11.623  -3.783  -9.319  1.00 53.36  ? 122 THR B CB    1 
ATOM   5882 O OG1   . THR D 4 122 ? 11.389  -5.128  -9.757  1.00 54.41  ? 122 THR B OG1   1 
ATOM   5883 C CG2   . THR D 4 122 ? 10.335  -3.178  -8.802  1.00 52.76  ? 122 THR B CG2   1 
ATOM   5884 N N     . ILE D 4 123 ? 13.544  -3.831  -12.236 1.00 57.12  ? 123 ILE B N     1 
ATOM   5885 C CA    . ILE D 4 123 ? 14.690  -4.398  -12.925 1.00 58.00  ? 123 ILE B CA    1 
ATOM   5886 C C     . ILE D 4 123 ? 16.026  -3.801  -12.496 1.00 58.52  ? 123 ILE B C     1 
ATOM   5887 O O     . ILE D 4 123 ? 16.271  -2.605  -12.671 1.00 58.69  ? 123 ILE B O     1 
ATOM   5888 C CB    . ILE D 4 123 ? 14.521  -4.196  -14.448 1.00 59.35  ? 123 ILE B CB    1 
ATOM   5889 C CG1   . ILE D 4 123 ? 15.739  -4.733  -15.199 1.00 60.47  ? 123 ILE B CG1   1 
ATOM   5890 C CG2   . ILE D 4 123 ? 14.307  -2.713  -14.753 1.00 58.67  ? 123 ILE B CG2   1 
ATOM   5891 C CD1   . ILE D 4 123 ? 15.695  -4.452  -16.696 1.00 61.45  ? 123 ILE B CD1   1 
ATOM   5892 N N     . GLY D 4 124 ? 16.890  -4.645  -11.939 1.00 58.60  ? 124 GLY B N     1 
ATOM   5893 C CA    . GLY D 4 124 ? 18.202  -4.191  -11.513 1.00 59.43  ? 124 GLY B CA    1 
ATOM   5894 C C     . GLY D 4 124 ? 18.228  -3.415  -10.209 1.00 59.94  ? 124 GLY B C     1 
ATOM   5895 O O     . GLY D 4 124 ? 19.048  -3.695  -9.334  1.00 60.51  ? 124 GLY B O     1 
ATOM   5896 N N     . LYS D 4 125 ? 17.341  -2.431  -10.082 1.00 59.15  ? 125 LYS B N     1 
ATOM   5897 C CA    . LYS D 4 125 ? 17.268  -1.621  -8.874  1.00 57.54  ? 125 LYS B CA    1 
ATOM   5898 C C     . LYS D 4 125 ? 17.053  -2.538  -7.681  1.00 56.84  ? 125 LYS B C     1 
ATOM   5899 O O     . LYS D 4 125 ? 16.368  -3.554  -7.788  1.00 58.47  ? 125 LYS B O     1 
ATOM   5900 C CB    . LYS D 4 125 ? 16.108  -0.627  -8.967  1.00 56.85  ? 125 LYS B CB    1 
ATOM   5901 C CG    . LYS D 4 125 ? 16.176  0.329   -10.145 1.00 56.20  ? 125 LYS B CG    1 
ATOM   5902 C CD    . LYS D 4 125 ? 15.081  1.387   -10.046 1.00 56.16  ? 125 LYS B CD    1 
ATOM   5903 C CE    . LYS D 4 125 ? 15.147  2.366   -11.207 1.00 57.09  ? 125 LYS B CE    1 
ATOM   5904 N NZ    . LYS D 4 125 ? 14.161  3.476   -11.068 1.00 56.86  ? 125 LYS B NZ    1 
ATOM   5905 N N     . LYS D 4 126 ? 17.644  -2.198  -6.545  1.00 55.78  ? 126 LYS B N     1 
ATOM   5906 C CA    . LYS D 4 126 ? 17.465  -3.027  -5.369  1.00 55.09  ? 126 LYS B CA    1 
ATOM   5907 C C     . LYS D 4 126 ? 16.375  -2.456  -4.475  1.00 53.75  ? 126 LYS B C     1 
ATOM   5908 O O     . LYS D 4 126 ? 16.504  -1.358  -3.934  1.00 54.03  ? 126 LYS B O     1 
ATOM   5909 C CB    . LYS D 4 126 ? 18.762  -3.154  -4.562  1.00 55.98  ? 126 LYS B CB    1 
ATOM   5910 C CG    . LYS D 4 126 ? 18.612  -4.133  -3.403  1.00 58.89  ? 126 LYS B CG    1 
ATOM   5911 C CD    . LYS D 4 126 ? 19.787  -4.146  -2.438  1.00 59.51  ? 126 LYS B CD    1 
ATOM   5912 C CE    . LYS D 4 126 ? 19.471  -5.076  -1.269  1.00 60.08  ? 126 LYS B CE    1 
ATOM   5913 N NZ    . LYS D 4 126 ? 20.491  -5.049  -0.185  1.00 61.65  ? 126 LYS B NZ    1 
ATOM   5914 N N     . PHE D 4 127 ? 15.292  -3.206  -4.339  1.00 51.58  ? 127 PHE B N     1 
ATOM   5915 C CA    . PHE D 4 127 ? 14.188  -2.793  -3.494  1.00 49.12  ? 127 PHE B CA    1 
ATOM   5916 C C     . PHE D 4 127 ? 14.007  -3.825  -2.399  1.00 48.78  ? 127 PHE B C     1 
ATOM   5917 O O     . PHE D 4 127 ? 13.948  -5.017  -2.671  1.00 50.39  ? 127 PHE B O     1 
ATOM   5918 C CB    . PHE D 4 127 ? 12.902  -2.680  -4.301  1.00 45.88  ? 127 PHE B CB    1 
ATOM   5919 C CG    . PHE D 4 127 ? 12.885  -1.528  -5.252  1.00 43.18  ? 127 PHE B CG    1 
ATOM   5920 C CD1   . PHE D 4 127 ? 13.214  -1.709  -6.590  1.00 43.07  ? 127 PHE B CD1   1 
ATOM   5921 C CD2   . PHE D 4 127 ? 12.517  -0.259  -4.812  1.00 41.25  ? 127 PHE B CD2   1 
ATOM   5922 C CE1   . PHE D 4 127 ? 13.172  -0.643  -7.480  1.00 42.47  ? 127 PHE B CE1   1 
ATOM   5923 C CE2   . PHE D 4 127 ? 12.471  0.810   -5.687  1.00 40.52  ? 127 PHE B CE2   1 
ATOM   5924 C CZ    . PHE D 4 127 ? 12.798  0.621   -7.027  1.00 43.07  ? 127 PHE B CZ    1 
ATOM   5925 N N     . GLU D 4 128 ? 13.933  -3.364  -1.158  1.00 47.96  ? 128 GLU B N     1 
ATOM   5926 C CA    . GLU D 4 128 ? 13.756  -4.267  -0.036  1.00 48.67  ? 128 GLU B CA    1 
ATOM   5927 C C     . GLU D 4 128 ? 12.311  -4.745  -0.041  1.00 47.14  ? 128 GLU B C     1 
ATOM   5928 O O     . GLU D 4 128 ? 12.013  -5.874  0.358   1.00 47.81  ? 128 GLU B O     1 
ATOM   5929 C CB    . GLU D 4 128 ? 14.050  -3.544  1.286   1.00 50.50  ? 128 GLU B CB    1 
ATOM   5930 C CG    . GLU D 4 128 ? 14.028  -4.452  2.514   1.00 53.68  ? 128 GLU B CG    1 
ATOM   5931 C CD    . GLU D 4 128 ? 13.874  -3.689  3.827   1.00 56.75  ? 128 GLU B CD    1 
ATOM   5932 O OE1   . GLU D 4 128 ? 14.693  -2.783  4.106   1.00 58.39  ? 128 GLU B OE1   1 
ATOM   5933 O OE2   . GLU D 4 128 ? 12.930  -4.005  4.586   1.00 57.96  ? 128 GLU B OE2   1 
ATOM   5934 N N     . LYS D 4 129 ? 11.417  -3.876  -0.503  1.00 44.01  ? 129 LYS B N     1 
ATOM   5935 C CA    . LYS D 4 129 ? 9.999   -4.192  -0.542  1.00 40.03  ? 129 LYS B CA    1 
ATOM   5936 C C     . LYS D 4 129 ? 9.284   -3.736  -1.800  1.00 37.04  ? 129 LYS B C     1 
ATOM   5937 O O     . LYS D 4 129 ? 9.574   -2.675  -2.355  1.00 35.86  ? 129 LYS B O     1 
ATOM   5938 C CB    . LYS D 4 129 ? 9.304   -3.596  0.683   1.00 40.75  ? 129 LYS B CB    1 
ATOM   5939 C CG    . LYS D 4 129 ? 9.637   -4.317  1.972   1.00 42.73  ? 129 LYS B CG    1 
ATOM   5940 C CD    . LYS D 4 129 ? 8.997   -3.642  3.166   1.00 44.31  ? 129 LYS B CD    1 
ATOM   5941 C CE    . LYS D 4 129 ? 9.251   -4.434  4.440   1.00 45.00  ? 129 LYS B CE    1 
ATOM   5942 N NZ    . LYS D 4 129 ? 8.586   -5.762  4.385   1.00 45.14  ? 129 LYS B NZ    1 
ATOM   5943 N N     . ARG D 4 130 ? 8.348   -4.572  -2.237  1.00 33.74  ? 130 ARG B N     1 
ATOM   5944 C CA    . ARG D 4 130 ? 7.521   -4.331  -3.408  1.00 30.62  ? 130 ARG B CA    1 
ATOM   5945 C C     . ARG D 4 130 ? 6.105   -4.421  -2.839  1.00 29.81  ? 130 ARG B C     1 
ATOM   5946 O O     . ARG D 4 130 ? 5.765   -5.400  -2.166  1.00 29.51  ? 130 ARG B O     1 
ATOM   5947 C CB    . ARG D 4 130 ? 7.766   -5.428  -4.448  1.00 31.20  ? 130 ARG B CB    1 
ATOM   5948 C CG    . ARG D 4 130 ? 9.168   -5.410  -5.046  1.00 31.64  ? 130 ARG B CG    1 
ATOM   5949 C CD    . ARG D 4 130 ? 9.598   -6.803  -5.498  1.00 32.53  ? 130 ARG B CD    1 
ATOM   5950 N NE    . ARG D 4 130 ? 9.757   -7.697  -4.352  1.00 37.86  ? 130 ARG B NE    1 
ATOM   5951 C CZ    . ARG D 4 130 ? 10.743  -7.612  -3.455  1.00 40.00  ? 130 ARG B CZ    1 
ATOM   5952 N NH1   . ARG D 4 130 ? 11.677  -6.675  -3.565  1.00 40.84  ? 130 ARG B NH1   1 
ATOM   5953 N NH2   . ARG D 4 130 ? 10.787  -8.451  -2.430  1.00 39.68  ? 130 ARG B NH2   1 
ATOM   5954 N N     . HIS D 4 131 ? 5.280   -3.410  -3.097  1.00 27.48  ? 131 HIS B N     1 
ATOM   5955 C CA    . HIS D 4 131 ? 3.932   -3.387  -2.534  1.00 25.05  ? 131 HIS B CA    1 
ATOM   5956 C C     . HIS D 4 131 ? 2.900   -2.819  -3.487  1.00 24.51  ? 131 HIS B C     1 
ATOM   5957 O O     . HIS D 4 131 ? 3.198   -1.929  -4.291  1.00 24.29  ? 131 HIS B O     1 
ATOM   5958 C CB    . HIS D 4 131 ? 3.947   -2.566  -1.237  1.00 23.76  ? 131 HIS B CB    1 
ATOM   5959 C CG    . HIS D 4 131 ? 2.645   -2.561  -0.493  1.00 24.21  ? 131 HIS B CG    1 
ATOM   5960 N ND1   . HIS D 4 131 ? 2.058   -3.710  -0.006  1.00 23.60  ? 131 HIS B ND1   1 
ATOM   5961 C CD2   . HIS D 4 131 ? 1.852   -1.538  -0.095  1.00 22.64  ? 131 HIS B CD2   1 
ATOM   5962 C CE1   . HIS D 4 131 ? 0.964   -3.395  0.663   1.00 21.81  ? 131 HIS B CE1   1 
ATOM   5963 N NE2   . HIS D 4 131 ? 0.816   -2.084  0.626   1.00 22.47  ? 131 HIS B NE2   1 
ATOM   5964 N N     . ILE D 4 132 ? 1.679   -3.335  -3.382  1.00 22.26  ? 132 ILE B N     1 
ATOM   5965 C CA    . ILE D 4 132 ? 0.584   -2.893  -4.233  1.00 21.34  ? 132 ILE B CA    1 
ATOM   5966 C C     . ILE D 4 132 ? -0.636  -2.552  -3.397  1.00 21.47  ? 132 ILE B C     1 
ATOM   5967 O O     . ILE D 4 132 ? -1.077  -3.351  -2.562  1.00 21.99  ? 132 ILE B O     1 
ATOM   5968 C CB    . ILE D 4 132 ? 0.191   -3.984  -5.247  1.00 21.00  ? 132 ILE B CB    1 
ATOM   5969 C CG1   . ILE D 4 132 ? 1.324   -4.179  -6.253  1.00 20.47  ? 132 ILE B CG1   1 
ATOM   5970 C CG2   . ILE D 4 132 ? -1.129  -3.615  -5.933  1.00 19.96  ? 132 ILE B CG2   1 
ATOM   5971 C CD1   . ILE D 4 132 ? 1.048   -5.246  -7.290  1.00 20.77  ? 132 ILE B CD1   1 
ATOM   5972 N N     . GLU D 4 133 ? -1.178  -1.363  -3.624  1.00 20.92  ? 133 GLU B N     1 
ATOM   5973 C CA    . GLU D 4 133 ? -2.355  -0.908  -2.899  1.00 21.28  ? 133 GLU B CA    1 
ATOM   5974 C C     . GLU D 4 133 ? -3.496  -0.700  -3.863  1.00 21.74  ? 133 GLU B C     1 
ATOM   5975 O O     . GLU D 4 133 ? -3.384  0.064   -4.817  1.00 21.91  ? 133 GLU B O     1 
ATOM   5976 C CB    . GLU D 4 133 ? -2.049  0.387   -2.151  1.00 20.16  ? 133 GLU B CB    1 
ATOM   5977 C CG    . GLU D 4 133 ? -1.274  0.143   -0.869  1.00 20.88  ? 133 GLU B CG    1 
ATOM   5978 C CD    . GLU D 4 133 ? -0.887  1.419   -0.157  1.00 21.32  ? 133 GLU B CD    1 
ATOM   5979 O OE1   . GLU D 4 133 ? -1.682  2.391   -0.173  1.00 21.65  ? 133 GLU B OE1   1 
ATOM   5980 O OE2   . GLU D 4 133 ? 0.207   1.440   0.436   1.00 19.15  ? 133 GLU B OE2   1 
ATOM   5981 N N     . ILE D 4 134 ? -4.597  -1.398  -3.623  1.00 21.02  ? 134 ILE B N     1 
ATOM   5982 C CA    . ILE D 4 134 ? -5.752  -1.282  -4.504  1.00 22.27  ? 134 ILE B CA    1 
ATOM   5983 C C     . ILE D 4 134 ? -6.893  -0.477  -3.869  1.00 21.12  ? 134 ILE B C     1 
ATOM   5984 O O     . ILE D 4 134 ? -7.248  -0.687  -2.709  1.00 20.70  ? 134 ILE B O     1 
ATOM   5985 C CB    . ILE D 4 134 ? -6.272  -2.683  -4.897  1.00 21.53  ? 134 ILE B CB    1 
ATOM   5986 C CG1   . ILE D 4 134 ? -5.127  -3.490  -5.498  1.00 24.05  ? 134 ILE B CG1   1 
ATOM   5987 C CG2   . ILE D 4 134 ? -7.410  -2.562  -5.897  1.00 21.22  ? 134 ILE B CG2   1 
ATOM   5988 C CD1   . ILE D 4 134 ? -5.479  -4.931  -5.823  1.00 29.80  ? 134 ILE B CD1   1 
ATOM   5989 N N     . PHE D 4 135 ? -7.456  0.440   -4.648  1.00 18.77  ? 135 PHE B N     1 
ATOM   5990 C CA    . PHE D 4 135 ? -8.562  1.274   -4.199  1.00 19.07  ? 135 PHE B CA    1 
ATOM   5991 C C     . PHE D 4 135 ? -9.735  1.054   -5.149  1.00 20.21  ? 135 PHE B C     1 
ATOM   5992 O O     . PHE D 4 135 ? -9.712  1.529   -6.285  1.00 19.96  ? 135 PHE B O     1 
ATOM   5993 C CB    . PHE D 4 135 ? -8.143  2.739   -4.221  1.00 17.25  ? 135 PHE B CB    1 
ATOM   5994 C CG    . PHE D 4 135 ? -6.862  3.004   -3.503  1.00 17.94  ? 135 PHE B CG    1 
ATOM   5995 C CD1   . PHE D 4 135 ? -5.642  2.680   -4.092  1.00 19.38  ? 135 PHE B CD1   1 
ATOM   5996 C CD2   . PHE D 4 135 ? -6.869  3.554   -2.226  1.00 19.02  ? 135 PHE B CD2   1 
ATOM   5997 C CE1   . PHE D 4 135 ? -4.434  2.898   -3.422  1.00 17.98  ? 135 PHE B CE1   1 
ATOM   5998 C CE2   . PHE D 4 135 ? -5.676  3.778   -1.543  1.00 19.98  ? 135 PHE B CE2   1 
ATOM   5999 C CZ    . PHE D 4 135 ? -4.450  3.447   -2.144  1.00 20.92  ? 135 PHE B CZ    1 
ATOM   6000 N N     . THR D 4 136 ? -10.760 0.344   -4.685  1.00 19.91  ? 136 THR B N     1 
ATOM   6001 C CA    . THR D 4 136 ? -11.904 0.044   -5.542  1.00 21.97  ? 136 THR B CA    1 
ATOM   6002 C C     . THR D 4 136 ? -13.216 -0.092  -4.763  1.00 22.41  ? 136 THR B C     1 
ATOM   6003 O O     . THR D 4 136 ? -13.218 -0.108  -3.536  1.00 23.52  ? 136 THR B O     1 
ATOM   6004 C CB    . THR D 4 136 ? -11.632 -1.277  -6.327  1.00 23.09  ? 136 THR B CB    1 
ATOM   6005 O OG1   . THR D 4 136 ? -12.761 -1.611  -7.142  1.00 23.08  ? 136 THR B OG1   1 
ATOM   6006 C CG2   . THR D 4 136 ? -11.353 -2.426  -5.358  1.00 22.92  ? 136 THR B CG2   1 
ATOM   6007 N N     . ASP D 4 137 ? -14.336 -0.178  -5.476  1.00 21.44  ? 137 ASP B N     1 
ATOM   6008 C CA    . ASP D 4 137 ? -15.620 -0.344  -4.805  1.00 21.35  ? 137 ASP B CA    1 
ATOM   6009 C C     . ASP D 4 137 ? -16.191 -1.746  -5.058  1.00 21.09  ? 137 ASP B C     1 
ATOM   6010 O O     . ASP D 4 137 ? -17.320 -2.039  -4.659  1.00 19.27  ? 137 ASP B O     1 
ATOM   6011 C CB    . ASP D 4 137 ? -16.623 0.722   -5.266  1.00 22.00  ? 137 ASP B CB    1 
ATOM   6012 C CG    . ASP D 4 137 ? -16.939 0.634   -6.753  1.00 21.93  ? 137 ASP B CG    1 
ATOM   6013 O OD1   . ASP D 4 137 ? -16.477 -0.314  -7.416  1.00 22.90  ? 137 ASP B OD1   1 
ATOM   6014 O OD2   . ASP D 4 137 ? -17.661 1.517   -7.256  1.00 22.81  ? 137 ASP B OD2   1 
ATOM   6015 N N     . LEU D 4 138 ? -15.404 -2.596  -5.723  1.00 19.30  ? 138 LEU B N     1 
ATOM   6016 C CA    . LEU D 4 138 ? -15.797 -3.980  -6.016  1.00 22.99  ? 138 LEU B CA    1 
ATOM   6017 C C     . LEU D 4 138 ? -17.206 -4.093  -6.610  1.00 24.35  ? 138 LEU B C     1 
ATOM   6018 O O     . LEU D 4 138 ? -17.917 -5.070  -6.383  1.00 23.46  ? 138 LEU B O     1 
ATOM   6019 C CB    . LEU D 4 138 ? -15.719 -4.820  -4.734  1.00 19.06  ? 138 LEU B CB    1 
ATOM   6020 C CG    . LEU D 4 138 ? -14.340 -4.946  -4.085  1.00 20.39  ? 138 LEU B CG    1 
ATOM   6021 C CD1   . LEU D 4 138 ? -14.467 -5.652  -2.729  1.00 16.12  ? 138 LEU B CD1   1 
ATOM   6022 C CD2   . LEU D 4 138 ? -13.397 -5.706  -5.025  1.00 20.33  ? 138 LEU B CD2   1 
ATOM   6023 N N     . SER D 4 139 ? -17.587 -3.087  -7.384  1.00 25.30  ? 139 SER B N     1 
ATOM   6024 C CA    . SER D 4 139 ? -18.906 -3.012  -7.991  1.00 26.07  ? 139 SER B CA    1 
ATOM   6025 C C     . SER D 4 139 ? -19.172 -3.929  -9.173  1.00 27.25  ? 139 SER B C     1 
ATOM   6026 O O     . SER D 4 139 ? -20.278 -4.442  -9.331  1.00 28.47  ? 139 SER B O     1 
ATOM   6027 C CB    . SER D 4 139 ? -19.150 -1.593  -8.485  1.00 25.25  ? 139 SER B CB    1 
ATOM   6028 O OG    . SER D 4 139 ? -18.397 -1.382  -9.674  1.00 23.53  ? 139 SER B OG    1 
ATOM   6029 N N     . SER D 4 140 ? -18.163 -4.123  -10.008 1.00 27.46  ? 140 SER B N     1 
ATOM   6030 C CA    . SER D 4 140 ? -18.347 -4.889  -11.223 1.00 27.68  ? 140 SER B CA    1 
ATOM   6031 C C     . SER D 4 140 ? -17.889 -6.334  -11.279 1.00 28.18  ? 140 SER B C     1 
ATOM   6032 O O     . SER D 4 140 ? -17.186 -6.829  -10.392 1.00 27.09  ? 140 SER B O     1 
ATOM   6033 C CB    . SER D 4 140 ? -17.708 -4.110  -12.359 1.00 27.46  ? 140 SER B CB    1 
ATOM   6034 O OG    . SER D 4 140 ? -17.966 -2.725  -12.173 1.00 30.70  ? 140 SER B OG    1 
ATOM   6035 N N     . ARG D 4 141 ? -18.309 -6.998  -12.353 1.00 27.88  ? 141 ARG B N     1 
ATOM   6036 C CA    . ARG D 4 141 ? -17.974 -8.392  -12.596 1.00 26.94  ? 141 ARG B CA    1 
ATOM   6037 C C     . ARG D 4 141 ? -16.508 -8.497  -12.973 1.00 26.37  ? 141 ARG B C     1 
ATOM   6038 O O     . ARG D 4 141 ? -15.907 -7.525  -13.428 1.00 27.83  ? 141 ARG B O     1 
ATOM   6039 C CB    . ARG D 4 141 ? -18.855 -8.966  -13.719 1.00 26.48  ? 141 ARG B CB    1 
ATOM   6040 C CG    . ARG D 4 141 ? -20.297 -9.233  -13.293 1.00 28.57  ? 141 ARG B CG    1 
ATOM   6041 C CD    . ARG D 4 141 ? -21.086 -9.921  -14.380 1.00 28.57  ? 141 ARG B CD    1 
ATOM   6042 N NE    . ARG D 4 141 ? -20.985 -9.178  -15.626 1.00 34.19  ? 141 ARG B NE    1 
ATOM   6043 C CZ    . ARG D 4 141 ? -22.021 -8.881  -16.404 1.00 36.41  ? 141 ARG B CZ    1 
ATOM   6044 N NH1   . ARG D 4 141 ? -23.242 -9.274  -16.054 1.00 37.14  ? 141 ARG B NH1   1 
ATOM   6045 N NH2   . ARG D 4 141 ? -21.838 -8.178  -17.519 1.00 34.32  ? 141 ARG B NH2   1 
ATOM   6046 N N     . PHE D 4 142 ? -15.939 -9.679  -12.774 1.00 24.36  ? 142 PHE B N     1 
ATOM   6047 C CA    . PHE D 4 142 ? -14.541 -9.919  -13.087 1.00 22.62  ? 142 PHE B CA    1 
ATOM   6048 C C     . PHE D 4 142 ? -14.313 -11.423 -13.192 1.00 21.13  ? 142 PHE B C     1 
ATOM   6049 O O     . PHE D 4 142 ? -15.138 -12.219 -12.750 1.00 21.92  ? 142 PHE B O     1 
ATOM   6050 C CB    . PHE D 4 142 ? -13.672 -9.329  -11.981 1.00 21.75  ? 142 PHE B CB    1 
ATOM   6051 C CG    . PHE D 4 142 ? -13.878 -9.982  -10.652 1.00 20.76  ? 142 PHE B CG    1 
ATOM   6052 C CD1   . PHE D 4 142 ? -13.033 -11.005 -10.226 1.00 22.46  ? 142 PHE B CD1   1 
ATOM   6053 C CD2   . PHE D 4 142 ? -14.947 -9.613  -9.847  1.00 21.29  ? 142 PHE B CD2   1 
ATOM   6054 C CE1   . PHE D 4 142 ? -13.251 -11.656 -9.015  1.00 25.47  ? 142 PHE B CE1   1 
ATOM   6055 C CE2   . PHE D 4 142 ? -15.183 -10.254 -8.631  1.00 23.32  ? 142 PHE B CE2   1 
ATOM   6056 C CZ    . PHE D 4 142 ? -14.332 -11.281 -8.211  1.00 25.74  ? 142 PHE B CZ    1 
ATOM   6057 N N     . SER D 4 143 ? -13.181 -11.809 -13.760 1.00 20.74  ? 143 SER B N     1 
ATOM   6058 C CA    . SER D 4 143 ? -12.855 -13.217 -13.935 1.00 21.00  ? 143 SER B CA    1 
ATOM   6059 C C     . SER D 4 143 ? -12.109 -13.760 -12.718 1.00 21.45  ? 143 SER B C     1 
ATOM   6060 O O     . SER D 4 143 ? -11.414 -13.018 -12.017 1.00 22.08  ? 143 SER B O     1 
ATOM   6061 C CB    . SER D 4 143 ? -12.010 -13.382 -15.199 1.00 20.46  ? 143 SER B CB    1 
ATOM   6062 O OG    . SER D 4 143 ? -11.704 -14.743 -15.457 1.00 26.41  ? 143 SER B OG    1 
ATOM   6063 N N     . LYS D 4 144 ? -12.259 -15.054 -12.459 1.00 20.90  ? 144 LYS B N     1 
ATOM   6064 C CA    . LYS D 4 144 ? -11.588 -15.669 -11.320 1.00 21.83  ? 144 LYS B CA    1 
ATOM   6065 C C     . LYS D 4 144 ? -10.646 -16.760 -11.798 1.00 22.08  ? 144 LYS B C     1 
ATOM   6066 O O     . LYS D 4 144 ? -10.163 -17.571 -11.010 1.00 22.36  ? 144 LYS B O     1 
ATOM   6067 C CB    . LYS D 4 144 ? -12.625 -16.253 -10.366 1.00 21.62  ? 144 LYS B CB    1 
ATOM   6068 C CG    . LYS D 4 144 ? -13.543 -15.207 -9.791  1.00 25.47  ? 144 LYS B CG    1 
ATOM   6069 C CD    . LYS D 4 144 ? -14.877 -15.795 -9.362  1.00 28.80  ? 144 LYS B CD    1 
ATOM   6070 C CE    . LYS D 4 144 ? -15.839 -14.681 -8.980  1.00 32.11  ? 144 LYS B CE    1 
ATOM   6071 N NZ    . LYS D 4 144 ? -16.072 -13.734 -10.117 1.00 30.20  ? 144 LYS B NZ    1 
ATOM   6072 N N     . SER D 4 145 ? -10.378 -16.756 -13.097 1.00 22.24  ? 145 SER B N     1 
ATOM   6073 C CA    . SER D 4 145 ? -9.525  -17.753 -13.719 1.00 22.99  ? 145 SER B CA    1 
ATOM   6074 C C     . SER D 4 145 ? -8.028  -17.618 -13.431 1.00 23.49  ? 145 SER B C     1 
ATOM   6075 O O     . SER D 4 145 ? -7.283  -18.595 -13.566 1.00 23.81  ? 145 SER B O     1 
ATOM   6076 C CB    . SER D 4 145 ? -9.759  -17.740 -15.232 1.00 23.06  ? 145 SER B CB    1 
ATOM   6077 O OG    . SER D 4 145 ? -9.172  -16.597 -15.827 1.00 29.05  ? 145 SER B OG    1 
ATOM   6078 N N     . GLN D 4 146 ? -7.601  -16.418 -13.031 1.00 23.97  ? 146 GLN B N     1 
ATOM   6079 C CA    . GLN D 4 146 ? -6.191  -16.132 -12.748 1.00 25.39  ? 146 GLN B CA    1 
ATOM   6080 C C     . GLN D 4 146 ? -5.846  -16.119 -11.263 1.00 25.66  ? 146 GLN B C     1 
ATOM   6081 O O     . GLN D 4 146 ? -4.747  -15.701 -10.884 1.00 25.17  ? 146 GLN B O     1 
ATOM   6082 C CB    . GLN D 4 146 ? -5.808  -14.770 -13.337 1.00 25.56  ? 146 GLN B CB    1 
ATOM   6083 C CG    . GLN D 4 146 ? -6.302  -14.549 -14.740 1.00 27.33  ? 146 GLN B CG    1 
ATOM   6084 C CD    . GLN D 4 146 ? -5.669  -15.501 -15.718 1.00 31.19  ? 146 GLN B CD    1 
ATOM   6085 O OE1   . GLN D 4 146 ? -4.496  -15.361 -16.062 1.00 33.30  ? 146 GLN B OE1   1 
ATOM   6086 N NE2   . GLN D 4 146 ? -6.436  -16.495 -16.163 1.00 34.06  ? 146 GLN B NE2   1 
ATOM   6087 N N     . LEU D 4 147 ? -6.774  -16.564 -10.419 1.00 25.18  ? 147 LEU B N     1 
ATOM   6088 C CA    . LEU D 4 147 ? -6.521  -16.555 -8.982  1.00 25.91  ? 147 LEU B CA    1 
ATOM   6089 C C     . LEU D 4 147 ? -5.232  -17.241 -8.551  1.00 24.83  ? 147 LEU B C     1 
ATOM   6090 O O     . LEU D 4 147 ? -4.410  -16.635 -7.870  1.00 26.03  ? 147 LEU B O     1 
ATOM   6091 C CB    . LEU D 4 147 ? -7.688  -17.179 -8.211  1.00 27.73  ? 147 LEU B CB    1 
ATOM   6092 C CG    . LEU D 4 147 ? -8.884  -16.276 -7.934  1.00 29.34  ? 147 LEU B CG    1 
ATOM   6093 C CD1   . LEU D 4 147 ? -9.888  -17.045 -7.078  1.00 27.39  ? 147 LEU B CD1   1 
ATOM   6094 C CD2   . LEU D 4 147 ? -8.419  -15.002 -7.226  1.00 27.86  ? 147 LEU B CD2   1 
ATOM   6095 N N     . ASP D 4 148 ? -5.056  -18.500 -8.934  1.00 22.47  ? 148 ASP B N     1 
ATOM   6096 C CA    . ASP D 4 148 ? -3.863  -19.229 -8.529  1.00 24.02  ? 148 ASP B CA    1 
ATOM   6097 C C     . ASP D 4 148 ? -2.595  -18.616 -9.111  1.00 23.15  ? 148 ASP B C     1 
ATOM   6098 O O     . ASP D 4 148 ? -1.565  -18.564 -8.448  1.00 22.84  ? 148 ASP B O     1 
ATOM   6099 C CB    . ASP D 4 148 ? -3.989  -20.701 -8.926  1.00 23.64  ? 148 ASP B CB    1 
ATOM   6100 C CG    . ASP D 4 148 ? -5.244  -21.347 -8.353  1.00 25.64  ? 148 ASP B CG    1 
ATOM   6101 O OD1   . ASP D 4 148 ? -5.427  -21.319 -7.115  1.00 23.79  ? 148 ASP B OD1   1 
ATOM   6102 O OD2   . ASP D 4 148 ? -6.053  -21.878 -9.143  1.00 25.69  ? 148 ASP B OD2   1 
ATOM   6103 N N     . ILE D 4 149 ? -2.687  -18.142 -10.346 1.00 22.35  ? 149 ILE B N     1 
ATOM   6104 C CA    . ILE D 4 149 ? -1.563  -17.522 -11.017 1.00 23.46  ? 149 ILE B CA    1 
ATOM   6105 C C     . ILE D 4 149 ? -1.161  -16.278 -10.237 1.00 24.08  ? 149 ILE B C     1 
ATOM   6106 O O     . ILE D 4 149 ? 0.015   -16.042 -9.958  1.00 22.91  ? 149 ILE B O     1 
ATOM   6107 C CB    . ILE D 4 149 ? -1.959  -17.120 -12.450 1.00 24.23  ? 149 ILE B CB    1 
ATOM   6108 C CG1   . ILE D 4 149 ? -1.895  -18.346 -13.361 1.00 25.27  ? 149 ILE B CG1   1 
ATOM   6109 C CG2   . ILE D 4 149 ? -1.072  -16.001 -12.948 1.00 24.55  ? 149 ILE B CG2   1 
ATOM   6110 C CD1   . ILE D 4 149 ? -2.428  -18.110 -14.771 1.00 23.01  ? 149 ILE B CD1   1 
ATOM   6111 N N     . ILE D 4 150 ? -2.162  -15.484 -9.886  1.00 24.72  ? 150 ILE B N     1 
ATOM   6112 C CA    . ILE D 4 150 ? -1.942  -14.256 -9.148  1.00 24.79  ? 150 ILE B CA    1 
ATOM   6113 C C     . ILE D 4 150 ? -1.275  -14.488 -7.790  1.00 24.31  ? 150 ILE B C     1 
ATOM   6114 O O     . ILE D 4 150 ? -0.290  -13.836 -7.453  1.00 24.71  ? 150 ILE B O     1 
ATOM   6115 C CB    . ILE D 4 150 ? -3.275  -13.514 -8.949  1.00 24.62  ? 150 ILE B CB    1 
ATOM   6116 C CG1   . ILE D 4 150 ? -3.778  -12.987 -10.299 1.00 24.07  ? 150 ILE B CG1   1 
ATOM   6117 C CG2   . ILE D 4 150 ? -3.102  -12.395 -7.933  1.00 26.72  ? 150 ILE B CG2   1 
ATOM   6118 C CD1   . ILE D 4 150 ? -5.118  -12.272 -10.220 1.00 22.15  ? 150 ILE B CD1   1 
ATOM   6119 N N     . ILE D 4 151 ? -1.804  -15.423 -7.013  1.00 22.84  ? 151 ILE B N     1 
ATOM   6120 C CA    . ILE D 4 151 ? -1.245  -15.702 -5.704  1.00 22.84  ? 151 ILE B CA    1 
ATOM   6121 C C     . ILE D 4 151 ? 0.167   -16.276 -5.759  1.00 24.02  ? 151 ILE B C     1 
ATOM   6122 O O     . ILE D 4 151 ? 1.024   -15.919 -4.947  1.00 24.13  ? 151 ILE B O     1 
ATOM   6123 C CB    . ILE D 4 151 ? -2.179  -16.642 -4.917  1.00 22.60  ? 151 ILE B CB    1 
ATOM   6124 C CG1   . ILE D 4 151 ? -3.484  -15.895 -4.628  1.00 23.45  ? 151 ILE B CG1   1 
ATOM   6125 C CG2   . ILE D 4 151 ? -1.519  -17.102 -3.615  1.00 17.85  ? 151 ILE B CG2   1 
ATOM   6126 C CD1   . ILE D 4 151 ? -4.362  -16.570 -3.644  1.00 24.77  ? 151 ILE B CD1   1 
ATOM   6127 N N     . HIS D 4 152 ? 0.404   -17.158 -6.723  1.00 23.88  ? 152 HIS B N     1 
ATOM   6128 C CA    . HIS D 4 152 ? 1.709   -17.777 -6.897  1.00 24.19  ? 152 HIS B CA    1 
ATOM   6129 C C     . HIS D 4 152 ? 2.788   -16.736 -7.230  1.00 24.20  ? 152 HIS B C     1 
ATOM   6130 O O     . HIS D 4 152 ? 3.919   -16.853 -6.775  1.00 24.88  ? 152 HIS B O     1 
ATOM   6131 C CB    . HIS D 4 152 ? 1.628   -18.845 -7.999  1.00 23.10  ? 152 HIS B CB    1 
ATOM   6132 C CG    . HIS D 4 152 ? 2.928   -19.527 -8.284  1.00 25.81  ? 152 HIS B CG    1 
ATOM   6133 N ND1   . HIS D 4 152 ? 3.845   -19.038 -9.192  1.00 27.29  ? 152 HIS B ND1   1 
ATOM   6134 C CD2   . HIS D 4 152 ? 3.467   -20.664 -7.781  1.00 27.42  ? 152 HIS B CD2   1 
ATOM   6135 C CE1   . HIS D 4 152 ? 4.891   -19.846 -9.238  1.00 25.17  ? 152 HIS B CE1   1 
ATOM   6136 N NE2   . HIS D 4 152 ? 4.687   -20.840 -8.391  1.00 26.45  ? 152 HIS B NE2   1 
ATOM   6137 N N     . SER D 4 153 ? 2.440   -15.720 -8.016  1.00 24.25  ? 153 SER B N     1 
ATOM   6138 C CA    . SER D 4 153 ? 3.406   -14.689 -8.383  1.00 24.75  ? 153 SER B CA    1 
ATOM   6139 C C     . SER D 4 153 ? 3.627   -13.682 -7.257  1.00 26.02  ? 153 SER B C     1 
ATOM   6140 O O     . SER D 4 153 ? 4.720   -13.129 -7.118  1.00 27.22  ? 153 SER B O     1 
ATOM   6141 C CB    . SER D 4 153 ? 2.960   -13.951 -9.648  1.00 22.91  ? 153 SER B CB    1 
ATOM   6142 O OG    . SER D 4 153 ? 2.881   -14.838 -10.748 1.00 24.60  ? 153 SER B OG    1 
ATOM   6143 N N     . LEU D 4 154 ? 2.595   -13.426 -6.461  1.00 25.64  ? 154 LEU B N     1 
ATOM   6144 C CA    . LEU D 4 154 ? 2.749   -12.489 -5.360  1.00 26.24  ? 154 LEU B CA    1 
ATOM   6145 C C     . LEU D 4 154 ? 3.703   -13.091 -4.335  1.00 27.45  ? 154 LEU B C     1 
ATOM   6146 O O     . LEU D 4 154 ? 4.606   -12.409 -3.849  1.00 26.74  ? 154 LEU B O     1 
ATOM   6147 C CB    . LEU D 4 154 ? 1.397   -12.179 -4.708  1.00 23.91  ? 154 LEU B CB    1 
ATOM   6148 C CG    . LEU D 4 154 ? 0.448   -11.311 -5.548  1.00 25.84  ? 154 LEU B CG    1 
ATOM   6149 C CD1   . LEU D 4 154 ? -0.886  -11.161 -4.834  1.00 22.08  ? 154 LEU B CD1   1 
ATOM   6150 C CD2   . LEU D 4 154 ? 1.076   -9.943  -5.810  1.00 23.45  ? 154 LEU B CD2   1 
ATOM   6151 N N     . LYS D 4 155 ? 3.514   -14.374 -4.026  1.00 26.85  ? 155 LYS B N     1 
ATOM   6152 C CA    . LYS D 4 155 ? 4.363   -15.051 -3.056  1.00 27.61  ? 155 LYS B CA    1 
ATOM   6153 C C     . LYS D 4 155 ? 5.789   -15.245 -3.559  1.00 29.05  ? 155 LYS B C     1 
ATOM   6154 O O     . LYS D 4 155 ? 6.743   -14.941 -2.847  1.00 29.96  ? 155 LYS B O     1 
ATOM   6155 C CB    . LYS D 4 155 ? 3.755   -16.401 -2.663  1.00 27.46  ? 155 LYS B CB    1 
ATOM   6156 C CG    . LYS D 4 155 ? 2.444   -16.271 -1.887  1.00 30.94  ? 155 LYS B CG    1 
ATOM   6157 C CD    . LYS D 4 155 ? 1.944   -17.599 -1.351  1.00 26.99  ? 155 LYS B CD    1 
ATOM   6158 C CE    . LYS D 4 155 ? 0.775   -17.373 -0.408  1.00 29.53  ? 155 LYS B CE    1 
ATOM   6159 N NZ    . LYS D 4 155 ? 0.306   -18.612 0.273   1.00 31.30  ? 155 LYS B NZ    1 
ATOM   6160 N N     . LYS D 4 156 ? 5.938   -15.737 -4.784  1.00 30.43  ? 156 LYS B N     1 
ATOM   6161 C CA    . LYS D 4 156 ? 7.262   -15.961 -5.346  1.00 33.04  ? 156 LYS B CA    1 
ATOM   6162 C C     . LYS D 4 156 ? 8.061   -14.678 -5.541  1.00 33.70  ? 156 LYS B C     1 
ATOM   6163 O O     . LYS D 4 156 ? 9.283   -14.686 -5.414  1.00 34.20  ? 156 LYS B O     1 
ATOM   6164 C CB    . LYS D 4 156 ? 7.160   -16.690 -6.686  1.00 35.20  ? 156 LYS B CB    1 
ATOM   6165 C CG    . LYS D 4 156 ? 6.734   -18.149 -6.580  1.00 39.53  ? 156 LYS B CG    1 
ATOM   6166 C CD    . LYS D 4 156 ? 7.838   -19.007 -5.992  1.00 39.17  ? 156 LYS B CD    1 
ATOM   6167 C CE    . LYS D 4 156 ? 7.434   -20.468 -5.952  1.00 38.15  ? 156 LYS B CE    1 
ATOM   6168 N NZ    . LYS D 4 156 ? 8.551   -21.302 -5.441  1.00 38.04  ? 156 LYS B NZ    1 
ATOM   6169 N N     . CYS D 4 157 ? 7.372   -13.585 -5.862  1.00 33.33  ? 157 CYS B N     1 
ATOM   6170 C CA    . CYS D 4 157 ? 8.022   -12.295 -6.090  1.00 31.02  ? 157 CYS B CA    1 
ATOM   6171 C C     . CYS D 4 157 ? 8.053   -11.438 -4.831  1.00 29.46  ? 157 CYS B C     1 
ATOM   6172 O O     . CYS D 4 157 ? 8.501   -10.293 -4.853  1.00 27.92  ? 157 CYS B O     1 
ATOM   6173 C CB    . CYS D 4 157 ? 7.304   -11.527 -7.205  1.00 30.79  ? 157 CYS B CB    1 
ATOM   6174 S SG    . CYS D 4 157 ? 7.432   -12.282 -8.840  1.00 34.56  ? 157 CYS B SG    1 
ATOM   6175 N N     . ASP D 4 158 ? 7.570   -12.000 -3.733  1.00 28.52  ? 158 ASP B N     1 
ATOM   6176 C CA    . ASP D 4 158 ? 7.556   -11.285 -2.467  1.00 29.07  ? 158 ASP B CA    1 
ATOM   6177 C C     . ASP D 4 158 ? 6.947   -9.893  -2.642  1.00 27.54  ? 158 ASP B C     1 
ATOM   6178 O O     . ASP D 4 158 ? 7.611   -8.884  -2.435  1.00 29.57  ? 158 ASP B O     1 
ATOM   6179 C CB    . ASP D 4 158 ? 8.981   -11.172 -1.931  1.00 30.46  ? 158 ASP B CB    1 
ATOM   6180 C CG    . ASP D 4 158 ? 9.024   -10.799 -0.475  1.00 34.29  ? 158 ASP B CG    1 
ATOM   6181 O OD1   . ASP D 4 158 ? 8.411   -11.521 0.341   1.00 37.44  ? 158 ASP B OD1   1 
ATOM   6182 O OD2   . ASP D 4 158 ? 9.674   -9.786  -0.140  1.00 37.16  ? 158 ASP B OD2   1 
ATOM   6183 N N     . ILE D 4 159 ? 5.685   -9.855  -3.050  1.00 25.37  ? 159 ILE B N     1 
ATOM   6184 C CA    . ILE D 4 159 ? 4.964   -8.609  -3.247  1.00 22.77  ? 159 ILE B CA    1 
ATOM   6185 C C     . ILE D 4 159 ? 3.818   -8.662  -2.255  1.00 23.03  ? 159 ILE B C     1 
ATOM   6186 O O     . ILE D 4 159 ? 3.067   -9.636  -2.240  1.00 26.53  ? 159 ILE B O     1 
ATOM   6187 C CB    . ILE D 4 159 ? 4.356   -8.506  -4.672  1.00 21.16  ? 159 ILE B CB    1 
ATOM   6188 C CG1   . ILE D 4 159 ? 5.453   -8.592  -5.733  1.00 18.23  ? 159 ILE B CG1   1 
ATOM   6189 C CG2   . ILE D 4 159 ? 3.587   -7.183  -4.827  1.00 19.21  ? 159 ILE B CG2   1 
ATOM   6190 C CD1   . ILE D 4 159 ? 4.922   -8.439  -7.144  1.00 14.81  ? 159 ILE B CD1   1 
ATOM   6191 N N     . SER D 4 160 ? 3.685   -7.635  -1.420  1.00 22.22  ? 160 SER B N     1 
ATOM   6192 C CA    . SER D 4 160 ? 2.606   -7.604  -0.437  1.00 19.46  ? 160 SER B CA    1 
ATOM   6193 C C     . SER D 4 160 ? 1.430   -6.859  -1.028  1.00 19.61  ? 160 SER B C     1 
ATOM   6194 O O     . SER D 4 160 ? 1.573   -6.151  -2.019  1.00 20.97  ? 160 SER B O     1 
ATOM   6195 C CB    . SER D 4 160 ? 3.066   -6.924  0.850   1.00 14.97  ? 160 SER B CB    1 
ATOM   6196 O OG    . SER D 4 160 ? 3.470   -5.601  0.575   1.00 15.84  ? 160 SER B OG    1 
ATOM   6197 N N     . LEU D 4 161 ? 0.269   -6.999  -0.402  1.00 21.36  ? 161 LEU B N     1 
ATOM   6198 C CA    . LEU D 4 161 ? -0.943  -6.376  -0.907  1.00 21.17  ? 161 LEU B CA    1 
ATOM   6199 C C     . LEU D 4 161 ? -1.842  -5.800  0.186   1.00 19.89  ? 161 LEU B C     1 
ATOM   6200 O O     . LEU D 4 161 ? -1.848  -6.280  1.317   1.00 21.32  ? 161 LEU B O     1 
ATOM   6201 C CB    . LEU D 4 161 ? -1.716  -7.430  -1.696  1.00 20.65  ? 161 LEU B CB    1 
ATOM   6202 C CG    . LEU D 4 161 ? -2.670  -7.040  -2.817  1.00 25.62  ? 161 LEU B CG    1 
ATOM   6203 C CD1   . LEU D 4 161 ? -1.874  -6.351  -3.922  1.00 28.83  ? 161 LEU B CD1   1 
ATOM   6204 C CD2   . LEU D 4 161 ? -3.363  -8.299  -3.369  1.00 24.46  ? 161 LEU B CD2   1 
ATOM   6205 N N     . GLN D 4 162 ? -2.595  -4.763  -0.171  1.00 19.13  ? 162 GLN B N     1 
ATOM   6206 C CA    . GLN D 4 162 ? -3.560  -4.126  0.723   1.00 18.53  ? 162 GLN B CA    1 
ATOM   6207 C C     . GLN D 4 162 ? -4.742  -3.627  -0.110  1.00 17.74  ? 162 GLN B C     1 
ATOM   6208 O O     . GLN D 4 162 ? -4.569  -3.206  -1.253  1.00 15.82  ? 162 GLN B O     1 
ATOM   6209 C CB    . GLN D 4 162 ? -2.950  -2.935  1.451   1.00 19.98  ? 162 GLN B CB    1 
ATOM   6210 C CG    . GLN D 4 162 ? -2.021  -3.252  2.606   1.00 17.23  ? 162 GLN B CG    1 
ATOM   6211 C CD    . GLN D 4 162 ? -1.442  -1.978  3.191   1.00 17.35  ? 162 GLN B CD    1 
ATOM   6212 O OE1   . GLN D 4 162 ? -0.859  -1.176  2.467   1.00 15.64  ? 162 GLN B OE1   1 
ATOM   6213 N NE2   . GLN D 4 162 ? -1.611  -1.778  4.495   1.00 14.12  ? 162 GLN B NE2   1 
ATOM   6214 N N     . PHE D 4 163 ? -5.940  -3.669  0.466   1.00 18.27  ? 163 PHE B N     1 
ATOM   6215 C CA    . PHE D 4 163 ? -7.136  -3.211  -0.232  1.00 17.58  ? 163 PHE B CA    1 
ATOM   6216 C C     . PHE D 4 163 ? -7.795  -2.070  0.514   1.00 18.83  ? 163 PHE B C     1 
ATOM   6217 O O     . PHE D 4 163 ? -7.764  -2.015  1.743   1.00 18.65  ? 163 PHE B O     1 
ATOM   6218 C CB    . PHE D 4 163 ? -8.157  -4.346  -0.398  1.00 18.50  ? 163 PHE B CB    1 
ATOM   6219 C CG    . PHE D 4 163 ? -7.792  -5.353  -1.453  1.00 17.68  ? 163 PHE B CG    1 
ATOM   6220 C CD1   . PHE D 4 163 ? -6.936  -6.411  -1.162  1.00 18.54  ? 163 PHE B CD1   1 
ATOM   6221 C CD2   . PHE D 4 163 ? -8.314  -5.245  -2.739  1.00 16.68  ? 163 PHE B CD2   1 
ATOM   6222 C CE1   . PHE D 4 163 ? -6.604  -7.350  -2.131  1.00 16.77  ? 163 PHE B CE1   1 
ATOM   6223 C CE2   . PHE D 4 163 ? -7.994  -6.170  -3.718  1.00 15.59  ? 163 PHE B CE2   1 
ATOM   6224 C CZ    . PHE D 4 163 ? -7.134  -7.229  -3.412  1.00 20.08  ? 163 PHE B CZ    1 
ATOM   6225 N N     . PHE D 4 164 ? -8.410  -1.168  -0.245  1.00 19.60  ? 164 PHE B N     1 
ATOM   6226 C CA    . PHE D 4 164 ? -9.086  -0.007  0.317   1.00 19.97  ? 164 PHE B CA    1 
ATOM   6227 C C     . PHE D 4 164 ? -10.440 0.141   -0.365  1.00 21.22  ? 164 PHE B C     1 
ATOM   6228 O O     . PHE D 4 164 ? -10.527 0.358   -1.577  1.00 20.61  ? 164 PHE B O     1 
ATOM   6229 C CB    . PHE D 4 164 ? -8.212  1.232   0.130   1.00 18.10  ? 164 PHE B CB    1 
ATOM   6230 C CG    . PHE D 4 164 ? -6.848  1.101   0.764   1.00 18.04  ? 164 PHE B CG    1 
ATOM   6231 C CD1   . PHE D 4 164 ? -5.794  0.498   0.071   1.00 16.47  ? 164 PHE B CD1   1 
ATOM   6232 C CD2   . PHE D 4 164 ? -6.630  1.534   2.070   1.00 16.61  ? 164 PHE B CD2   1 
ATOM   6233 C CE1   . PHE D 4 164 ? -4.547  0.328   0.670   1.00 15.31  ? 164 PHE B CE1   1 
ATOM   6234 C CE2   . PHE D 4 164 ? -5.388  1.368   2.679   1.00 16.00  ? 164 PHE B CE2   1 
ATOM   6235 C CZ    . PHE D 4 164 ? -4.341  0.764   1.982   1.00 15.46  ? 164 PHE B CZ    1 
ATOM   6236 N N     . LEU D 4 165 ? -11.491 0.023   0.441   1.00 20.18  ? 165 LEU B N     1 
ATOM   6237 C CA    . LEU D 4 165 ? -12.863 0.056   -0.038  1.00 20.52  ? 165 LEU B CA    1 
ATOM   6238 C C     . LEU D 4 165 ? -13.707 1.167   0.597   1.00 22.16  ? 165 LEU B C     1 
ATOM   6239 O O     . LEU D 4 165 ? -13.284 1.805   1.563   1.00 20.42  ? 165 LEU B O     1 
ATOM   6240 C CB    . LEU D 4 165 ? -13.495 -1.310  0.265   1.00 19.57  ? 165 LEU B CB    1 
ATOM   6241 C CG    . LEU D 4 165 ? -12.584 -2.520  0.000   1.00 19.86  ? 165 LEU B CG    1 
ATOM   6242 C CD1   . LEU D 4 165 ? -13.211 -3.770  0.579   1.00 18.58  ? 165 LEU B CD1   1 
ATOM   6243 C CD2   . LEU D 4 165 ? -12.337 -2.685  -1.507  1.00 18.99  ? 165 LEU B CD2   1 
ATOM   6244 N N     . PRO D 4 166 ? -14.928 1.397   0.070   1.00 24.40  ? 166 PRO B N     1 
ATOM   6245 C CA    . PRO D 4 166 ? -15.840 2.429   0.583   1.00 26.63  ? 166 PRO B CA    1 
ATOM   6246 C C     . PRO D 4 166 ? -16.475 2.011   1.907   1.00 29.01  ? 166 PRO B C     1 
ATOM   6247 O O     . PRO D 4 166 ? -16.985 2.845   2.651   1.00 29.73  ? 166 PRO B O     1 
ATOM   6248 C CB    . PRO D 4 166 ? -16.910 2.545   -0.511  1.00 25.71  ? 166 PRO B CB    1 
ATOM   6249 C CG    . PRO D 4 166 ? -16.349 1.816   -1.689  1.00 25.23  ? 166 PRO B CG    1 
ATOM   6250 C CD    . PRO D 4 166 ? -15.538 0.713   -1.080  1.00 24.91  ? 166 PRO B CD    1 
ATOM   6251 N N     . PHE D 4 167 ? -16.441 0.714   2.193   1.00 30.56  ? 167 PHE B N     1 
ATOM   6252 C CA    . PHE D 4 167 ? -17.039 0.187   3.415   1.00 33.48  ? 167 PHE B CA    1 
ATOM   6253 C C     . PHE D 4 167 ? -16.057 -0.586  4.288   1.00 34.88  ? 167 PHE B C     1 
ATOM   6254 O O     . PHE D 4 167 ? -15.113 -1.188  3.784   1.00 35.12  ? 167 PHE B O     1 
ATOM   6255 C CB    . PHE D 4 167 ? -18.220 -0.708  3.038   1.00 32.19  ? 167 PHE B CB    1 
ATOM   6256 C CG    . PHE D 4 167 ? -17.904 -1.689  1.941   1.00 32.06  ? 167 PHE B CG    1 
ATOM   6257 C CD1   . PHE D 4 167 ? -17.332 -2.919  2.229   1.00 30.10  ? 167 PHE B CD1   1 
ATOM   6258 C CD2   . PHE D 4 167 ? -18.155 -1.365  0.607   1.00 32.90  ? 167 PHE B CD2   1 
ATOM   6259 C CE1   . PHE D 4 167 ? -17.015 -3.810  1.209   1.00 30.60  ? 167 PHE B CE1   1 
ATOM   6260 C CE2   . PHE D 4 167 ? -17.838 -2.256  -0.423  1.00 31.04  ? 167 PHE B CE2   1 
ATOM   6261 C CZ    . PHE D 4 167 ? -17.267 -3.480  -0.118  1.00 28.90  ? 167 PHE B CZ    1 
ATOM   6262 N N     . SER D 4 168 ? -16.289 -0.558  5.600   1.00 39.36  ? 168 SER B N     1 
ATOM   6263 C CA    . SER D 4 168 ? -15.441 -1.267  6.560   1.00 43.14  ? 168 SER B CA    1 
ATOM   6264 C C     . SER D 4 168 ? -15.635 -2.782  6.456   1.00 47.24  ? 168 SER B C     1 
ATOM   6265 O O     . SER D 4 168 ? -16.628 -3.263  5.900   1.00 47.03  ? 168 SER B O     1 
ATOM   6266 C CB    . SER D 4 168 ? -15.760 -0.821  7.989   1.00 40.32  ? 168 SER B CB    1 
ATOM   6267 O OG    . SER D 4 168 ? -15.373 0.519   8.220   1.00 40.57  ? 168 SER B OG    1 
ATOM   6268 N N     . LEU D 4 169 ? -14.684 -3.532  6.999   1.00 51.36  ? 169 LEU B N     1 
ATOM   6269 C CA    . LEU D 4 169 ? -14.756 -4.988  6.966   1.00 54.44  ? 169 LEU B CA    1 
ATOM   6270 C C     . LEU D 4 169 ? -15.177 -5.535  8.326   1.00 56.28  ? 169 LEU B C     1 
ATOM   6271 O O     . LEU D 4 169 ? -15.596 -6.684  8.436   1.00 57.35  ? 169 LEU B O     1 
ATOM   6272 C CB    . LEU D 4 169 ? -13.398 -5.578  6.585   1.00 55.28  ? 169 LEU B CB    1 
ATOM   6273 C CG    . LEU D 4 169 ? -13.369 -7.097  6.425   1.00 56.14  ? 169 LEU B CG    1 
ATOM   6274 C CD1   . LEU D 4 169 ? -14.047 -7.478  5.120   1.00 56.54  ? 169 LEU B CD1   1 
ATOM   6275 C CD2   . LEU D 4 169 ? -11.940 -7.587  6.429   1.00 57.04  ? 169 LEU B CD2   1 
ATOM   6276 N N     . GLY D 4 170 ? -15.062 -4.710  9.363   1.00 57.94  ? 170 GLY B N     1 
ATOM   6277 C CA    . GLY D 4 170 ? -15.434 -5.158  10.693  1.00 59.97  ? 170 GLY B CA    1 
ATOM   6278 C C     . GLY D 4 170 ? -15.798 -4.024  11.632  1.00 60.94  ? 170 GLY B C     1 
ATOM   6279 O O     . GLY D 4 170 ? -15.146 -3.895  12.696  1.00 60.75  ? 170 GLY B O     1 
ATOM   6280 N N     . GLY D 4 181 ? -26.555 6.522   9.784   1.00 57.85  ? 181 GLY B N     1 
ATOM   6281 C CA    . GLY D 4 181 ? -26.349 7.769   10.594  1.00 60.40  ? 181 GLY B CA    1 
ATOM   6282 C C     . GLY D 4 181 ? -25.470 8.784   9.882   1.00 60.64  ? 181 GLY B C     1 
ATOM   6283 O O     . GLY D 4 181 ? -24.797 8.431   8.907   1.00 61.77  ? 181 GLY B O     1 
ATOM   6284 N N     . PRO D 4 182 ? -25.444 10.051  10.339  1.00 59.62  ? 182 PRO B N     1 
ATOM   6285 C CA    . PRO D 4 182 ? -24.622 11.085  9.700   1.00 58.59  ? 182 PRO B CA    1 
ATOM   6286 C C     . PRO D 4 182 ? -23.224 10.557  9.424   1.00 57.55  ? 182 PRO B C     1 
ATOM   6287 O O     . PRO D 4 182 ? -22.553 10.065  10.334  1.00 58.40  ? 182 PRO B O     1 
ATOM   6288 C CB    . PRO D 4 182 ? -24.629 12.214  10.724  1.00 58.76  ? 182 PRO B CB    1 
ATOM   6289 C CG    . PRO D 4 182 ? -25.990 12.085  11.334  1.00 59.89  ? 182 PRO B CG    1 
ATOM   6290 C CD    . PRO D 4 182 ? -26.109 10.584  11.541  1.00 59.91  ? 182 PRO B CD    1 
ATOM   6291 N N     . PHE D 4 183 ? -22.800 10.643  8.165   1.00 55.32  ? 183 PHE B N     1 
ATOM   6292 C CA    . PHE D 4 183 ? -21.485 10.155  7.766   1.00 51.82  ? 183 PHE B CA    1 
ATOM   6293 C C     . PHE D 4 183 ? -20.431 11.242  7.848   1.00 48.88  ? 183 PHE B C     1 
ATOM   6294 O O     . PHE D 4 183 ? -20.585 12.320  7.277   1.00 47.67  ? 183 PHE B O     1 
ATOM   6295 C CB    . PHE D 4 183 ? -21.524 9.602   6.342   1.00 53.33  ? 183 PHE B CB    1 
ATOM   6296 C CG    . PHE D 4 183 ? -20.191 9.125   5.845   1.00 54.28  ? 183 PHE B CG    1 
ATOM   6297 C CD1   . PHE D 4 183 ? -19.608 7.972   6.370   1.00 56.00  ? 183 PHE B CD1   1 
ATOM   6298 C CD2   . PHE D 4 183 ? -19.504 9.840   4.870   1.00 53.81  ? 183 PHE B CD2   1 
ATOM   6299 C CE1   . PHE D 4 183 ? -18.359 7.538   5.932   1.00 55.43  ? 183 PHE B CE1   1 
ATOM   6300 C CE2   . PHE D 4 183 ? -18.255 9.417   4.424   1.00 54.93  ? 183 PHE B CE2   1 
ATOM   6301 C CZ    . PHE D 4 183 ? -17.681 8.263   4.956   1.00 55.17  ? 183 PHE B CZ    1 
ATOM   6302 N N     . ARG D 4 184 ? -19.352 10.942  8.560   1.00 45.81  ? 184 ARG B N     1 
ATOM   6303 C CA    . ARG D 4 184 ? -18.257 11.884  8.727   1.00 42.46  ? 184 ARG B CA    1 
ATOM   6304 C C     . ARG D 4 184 ? -16.967 11.225  8.258   1.00 37.88  ? 184 ARG B C     1 
ATOM   6305 O O     . ARG D 4 184 ? -16.478 10.282  8.881   1.00 36.82  ? 184 ARG B O     1 
ATOM   6306 C CB    . ARG D 4 184 ? -18.146 12.288  10.197  1.00 44.42  ? 184 ARG B CB    1 
ATOM   6307 C CG    . ARG D 4 184 ? -19.495 12.577  10.834  1.00 48.62  ? 184 ARG B CG    1 
ATOM   6308 C CD    . ARG D 4 184 ? -19.573 13.978  11.416  1.00 52.16  ? 184 ARG B CD    1 
ATOM   6309 N NE    . ARG D 4 184 ? -20.926 14.289  11.875  1.00 56.26  ? 184 ARG B NE    1 
ATOM   6310 C CZ    . ARG D 4 184 ? -21.261 15.399  12.530  1.00 59.01  ? 184 ARG B CZ    1 
ATOM   6311 N NH1   . ARG D 4 184 ? -20.338 16.314  12.813  1.00 61.48  ? 184 ARG B NH1   1 
ATOM   6312 N NH2   . ARG D 4 184 ? -22.520 15.602  12.896  1.00 58.88  ? 184 ARG B NH2   1 
ATOM   6313 N N     . LEU D 4 185 ? -16.428 11.716  7.149   1.00 32.96  ? 185 LEU B N     1 
ATOM   6314 C CA    . LEU D 4 185 ? -15.198 11.161  6.605   1.00 30.90  ? 185 LEU B CA    1 
ATOM   6315 C C     . LEU D 4 185 ? -14.062 11.223  7.635   1.00 28.96  ? 185 LEU B C     1 
ATOM   6316 O O     . LEU D 4 185 ? -13.754 12.289  8.176   1.00 25.84  ? 185 LEU B O     1 
ATOM   6317 C CB    . LEU D 4 185 ? -14.798 11.914  5.335   1.00 28.25  ? 185 LEU B CB    1 
ATOM   6318 C CG    . LEU D 4 185 ? -13.673 11.285  4.514   1.00 29.05  ? 185 LEU B CG    1 
ATOM   6319 C CD1   . LEU D 4 185 ? -14.137 9.959   3.921   1.00 25.07  ? 185 LEU B CD1   1 
ATOM   6320 C CD2   . LEU D 4 185 ? -13.261 12.244  3.409   1.00 29.17  ? 185 LEU B CD2   1 
ATOM   6321 N N     . GLY D 4 186 ? -13.460 10.065  7.905   1.00 27.77  ? 186 GLY B N     1 
ATOM   6322 C CA    . GLY D 4 186 ? -12.377 9.989   8.867   1.00 27.31  ? 186 GLY B CA    1 
ATOM   6323 C C     . GLY D 4 186 ? -12.841 9.933   10.317  1.00 27.43  ? 186 GLY B C     1 
ATOM   6324 O O     . GLY D 4 186 ? -12.025 9.931   11.238  1.00 25.30  ? 186 GLY B O     1 
ATOM   6325 N N     . GLY D 4 187 ? -14.153 9.882   10.518  1.00 27.44  ? 187 GLY B N     1 
ATOM   6326 C CA    . GLY D 4 187 ? -14.700 9.840   11.858  1.00 28.68  ? 187 GLY B CA    1 
ATOM   6327 C C     . GLY D 4 187 ? -14.552 8.489   12.516  1.00 31.20  ? 187 GLY B C     1 
ATOM   6328 O O     . GLY D 4 187 ? -14.004 7.568   11.932  1.00 31.93  ? 187 GLY B O     1 
ATOM   6329 N N     . HIS D 4 188 ? -15.055 8.381   13.740  1.00 33.19  ? 188 HIS B N     1 
ATOM   6330 C CA    . HIS D 4 188 ? -14.994 7.153   14.522  1.00 36.41  ? 188 HIS B CA    1 
ATOM   6331 C C     . HIS D 4 188 ? -16.404 6.645   14.820  1.00 39.75  ? 188 HIS B C     1 
ATOM   6332 O O     . HIS D 4 188 ? -17.036 7.125   15.754  1.00 41.16  ? 188 HIS B O     1 
ATOM   6333 C CB    . HIS D 4 188 ? -14.289 7.428   15.855  1.00 33.14  ? 188 HIS B CB    1 
ATOM   6334 C CG    . HIS D 4 188 ? -12.832 7.727   15.727  1.00 31.39  ? 188 HIS B CG    1 
ATOM   6335 N ND1   . HIS D 4 188 ? -11.863 6.750   15.809  1.00 31.99  ? 188 HIS B ND1   1 
ATOM   6336 C CD2   . HIS D 4 188 ? -12.175 8.893   15.516  1.00 31.98  ? 188 HIS B CD2   1 
ATOM   6337 C CE1   . HIS D 4 188 ? -10.672 7.302   15.656  1.00 30.85  ? 188 HIS B CE1   1 
ATOM   6338 N NE2   . HIS D 4 188 ? -10.832 8.600   15.476  1.00 29.66  ? 188 HIS B NE2   1 
ATOM   6339 N N     . GLY D 4 189 ? -16.907 5.685   14.049  1.00 45.06  ? 189 GLY B N     1 
ATOM   6340 C CA    . GLY D 4 189 ? -18.246 5.190   14.341  1.00 52.33  ? 189 GLY B CA    1 
ATOM   6341 C C     . GLY D 4 189 ? -19.086 4.536   13.251  1.00 57.85  ? 189 GLY B C     1 
ATOM   6342 O O     . GLY D 4 189 ? -19.778 3.551   13.535  1.00 57.76  ? 189 GLY B O     1 
ATOM   6343 N N     . PRO D 4 190 ? -19.075 5.053   12.008  1.00 61.82  ? 190 PRO B N     1 
ATOM   6344 C CA    . PRO D 4 190 ? -19.877 4.443   10.940  1.00 65.85  ? 190 PRO B CA    1 
ATOM   6345 C C     . PRO D 4 190 ? -19.387 3.061   10.514  1.00 69.05  ? 190 PRO B C     1 
ATOM   6346 O O     . PRO D 4 190 ? -18.203 2.747   10.632  1.00 71.01  ? 190 PRO B O     1 
ATOM   6347 C CB    . PRO D 4 190 ? -19.776 5.465   9.810   1.00 65.32  ? 190 PRO B CB    1 
ATOM   6348 C CG    . PRO D 4 190 ? -18.400 6.014   9.993   1.00 64.76  ? 190 PRO B CG    1 
ATOM   6349 C CD    . PRO D 4 190 ? -18.338 6.223   11.498  1.00 63.31  ? 190 PRO B CD    1 
ATOM   6350 N N     . SER D 4 191 ? -20.308 2.238   10.025  1.00 72.75  ? 191 SER B N     1 
ATOM   6351 C CA    . SER D 4 191 ? -19.976 0.892   9.562   1.00 75.37  ? 191 SER B CA    1 
ATOM   6352 C C     . SER D 4 191 ? -21.006 0.425   8.537   1.00 76.52  ? 191 SER B C     1 
ATOM   6353 O O     . SER D 4 191 ? -21.971 -0.257  8.885   1.00 76.62  ? 191 SER B O     1 
ATOM   6354 C CB    . SER D 4 191 ? -19.935 -0.097  10.735  1.00 75.72  ? 191 SER B CB    1 
ATOM   6355 O OG    . SER D 4 191 ? -21.237 -0.381  11.226  1.00 76.55  ? 191 SER B OG    1 
ATOM   6356 N N     . PHE D 4 192 ? -20.799 0.803   7.278   1.00 78.23  ? 192 PHE B N     1 
ATOM   6357 C CA    . PHE D 4 192 ? -21.708 0.412   6.203   1.00 79.31  ? 192 PHE B CA    1 
ATOM   6358 C C     . PHE D 4 192 ? -21.957 -1.084  6.345   1.00 79.71  ? 192 PHE B C     1 
ATOM   6359 O O     . PHE D 4 192 ? -21.054 -1.890  6.114   1.00 80.39  ? 192 PHE B O     1 
ATOM   6360 C CB    . PHE D 4 192 ? -21.084 0.684   4.826   1.00 79.22  ? 192 PHE B CB    1 
ATOM   6361 C CG    . PHE D 4 192 ? -20.746 2.131   4.573   1.00 79.93  ? 192 PHE B CG    1 
ATOM   6362 C CD1   . PHE D 4 192 ? -19.901 2.832   5.436   1.00 80.23  ? 192 PHE B CD1   1 
ATOM   6363 C CD2   . PHE D 4 192 ? -21.250 2.787   3.454   1.00 79.60  ? 192 PHE B CD2   1 
ATOM   6364 C CE1   . PHE D 4 192 ? -19.563 4.161   5.187   1.00 79.76  ? 192 PHE B CE1   1 
ATOM   6365 C CE2   . PHE D 4 192 ? -20.918 4.116   3.195   1.00 79.89  ? 192 PHE B CE2   1 
ATOM   6366 C CZ    . PHE D 4 192 ? -20.073 4.804   4.063   1.00 79.89  ? 192 PHE B CZ    1 
ATOM   6367 N N     . PRO D 4 193 ? -23.177 -1.477  6.750   1.00 79.95  ? 193 PRO B N     1 
ATOM   6368 C CA    . PRO D 4 193 ? -23.490 -2.904  6.908   1.00 78.94  ? 193 PRO B CA    1 
ATOM   6369 C C     . PRO D 4 193 ? -23.213 -3.669  5.611   1.00 77.73  ? 193 PRO B C     1 
ATOM   6370 O O     . PRO D 4 193 ? -23.575 -3.210  4.526   1.00 78.03  ? 193 PRO B O     1 
ATOM   6371 C CB    . PRO D 4 193 ? -24.973 -2.890  7.272   1.00 79.46  ? 193 PRO B CB    1 
ATOM   6372 C CG    . PRO D 4 193 ? -25.119 -1.588  8.019   1.00 79.36  ? 193 PRO B CG    1 
ATOM   6373 C CD    . PRO D 4 193 ? -24.322 -0.639  7.151   1.00 79.59  ? 193 PRO B CD    1 
ATOM   6374 N N     . LEU D 4 194 ? -22.570 -4.828  5.721   1.00 75.94  ? 194 LEU B N     1 
ATOM   6375 C CA    . LEU D 4 194 ? -22.254 -5.624  4.540   1.00 73.82  ? 194 LEU B CA    1 
ATOM   6376 C C     . LEU D 4 194 ? -23.525 -6.018  3.782   1.00 72.02  ? 194 LEU B C     1 
ATOM   6377 O O     . LEU D 4 194 ? -23.469 -6.754  2.793   1.00 71.42  ? 194 LEU B O     1 
ATOM   6378 C CB    . LEU D 4 194 ? -21.462 -6.879  4.933   1.00 74.31  ? 194 LEU B CB    1 
ATOM   6379 C CG    . LEU D 4 194 ? -20.146 -6.692  5.703   1.00 74.19  ? 194 LEU B CG    1 
ATOM   6380 C CD1   . LEU D 4 194 ? -19.363 -8.002  5.685   1.00 73.50  ? 194 LEU B CD1   1 
ATOM   6381 C CD2   . LEU D 4 194 ? -19.315 -5.584  5.075   1.00 73.39  ? 194 LEU B CD2   1 
ATOM   6382 N N     . LYS D 4 195 ? -24.665 -5.517  4.256   1.00 69.49  ? 195 LYS B N     1 
ATOM   6383 C CA    . LYS D 4 195 ? -25.962 -5.791  3.642   1.00 66.85  ? 195 LYS B CA    1 
ATOM   6384 C C     . LYS D 4 195 ? -26.344 -4.677  2.664   1.00 64.19  ? 195 LYS B C     1 
ATOM   6385 O O     . LYS D 4 195 ? -27.092 -4.908  1.710   1.00 65.12  ? 195 LYS B O     1 
ATOM   6386 C CB    . LYS D 4 195 ? -27.037 -5.920  4.726   1.00 67.40  ? 195 LYS B CB    1 
ATOM   6387 C CG    . LYS D 4 195 ? -28.429 -6.245  4.203   1.00 67.94  ? 195 LYS B CG    1 
ATOM   6388 C CD    . LYS D 4 195 ? -29.419 -6.354  5.350   1.00 68.83  ? 195 LYS B CD    1 
ATOM   6389 C CE    . LYS D 4 195 ? -30.824 -6.675  4.865   1.00 69.31  ? 195 LYS B CE    1 
ATOM   6390 N NZ    . LYS D 4 195 ? -31.768 -6.824  6.013   1.00 69.32  ? 195 LYS B NZ    1 
ATOM   6391 N N     . GLY D 4 196 ? -25.822 -3.475  2.906   1.00 59.89  ? 196 GLY B N     1 
ATOM   6392 C CA    . GLY D 4 196 ? -26.105 -2.343  2.041   1.00 53.98  ? 196 GLY B CA    1 
ATOM   6393 C C     . GLY D 4 196 ? -25.354 -2.421  0.723   1.00 50.89  ? 196 GLY B C     1 
ATOM   6394 O O     . GLY D 4 196 ? -25.658 -1.689  -0.223  1.00 49.10  ? 196 GLY B O     1 
ATOM   6395 N N     . ILE D 4 197 ? -24.359 -3.304  0.661   1.00 47.27  ? 197 ILE B N     1 
ATOM   6396 C CA    . ILE D 4 197 ? -23.580 -3.478  -0.560  1.00 42.53  ? 197 ILE B CA    1 
ATOM   6397 C C     . ILE D 4 197 ? -24.343 -4.423  -1.479  1.00 40.94  ? 197 ILE B C     1 
ATOM   6398 O O     . ILE D 4 197 ? -25.121 -5.253  -1.017  1.00 41.25  ? 197 ILE B O     1 
ATOM   6399 C CB    . ILE D 4 197 ? -22.182 -4.071  -0.272  1.00 40.01  ? 197 ILE B CB    1 
ATOM   6400 C CG1   . ILE D 4 197 ? -22.328 -5.462  0.344   1.00 38.71  ? 197 ILE B CG1   1 
ATOM   6401 C CG2   . ILE D 4 197 ? -21.396 -3.135  0.642   1.00 36.87  ? 197 ILE B CG2   1 
ATOM   6402 C CD1   . ILE D 4 197 ? -21.020 -6.171  0.602   1.00 36.79  ? 197 ILE B CD1   1 
ATOM   6403 N N     . THR D 4 198 ? -24.126 -4.285  -2.781  1.00 38.77  ? 198 THR B N     1 
ATOM   6404 C CA    . THR D 4 198 ? -24.796 -5.123  -3.762  1.00 37.19  ? 198 THR B CA    1 
ATOM   6405 C C     . THR D 4 198 ? -24.342 -6.575  -3.638  1.00 37.95  ? 198 THR B C     1 
ATOM   6406 O O     . THR D 4 198 ? -23.477 -6.897  -2.822  1.00 38.49  ? 198 THR B O     1 
ATOM   6407 C CB    . THR D 4 198 ? -24.488 -4.638  -5.174  1.00 35.21  ? 198 THR B CB    1 
ATOM   6408 O OG1   . THR D 4 198 ? -23.069 -4.603  -5.353  1.00 33.05  ? 198 THR B OG1   1 
ATOM   6409 C CG2   . THR D 4 198 ? -25.062 -3.243  -5.398  1.00 33.39  ? 198 THR B CG2   1 
ATOM   6410 N N     . GLU D 4 199 ? -24.927 -7.452  -4.445  1.00 37.37  ? 199 GLU B N     1 
ATOM   6411 C CA    . GLU D 4 199 ? -24.544 -8.853  -4.405  1.00 36.99  ? 199 GLU B CA    1 
ATOM   6412 C C     . GLU D 4 199 ? -23.210 -9.011  -5.116  1.00 35.85  ? 199 GLU B C     1 
ATOM   6413 O O     . GLU D 4 199 ? -22.389 -9.857  -4.739  1.00 34.67  ? 199 GLU B O     1 
ATOM   6414 C CB    . GLU D 4 199 ? -25.605 -9.728  -5.080  1.00 39.44  ? 199 GLU B CB    1 
ATOM   6415 C CG    . GLU D 4 199 ? -26.907 -9.836  -4.297  1.00 44.10  ? 199 GLU B CG    1 
ATOM   6416 C CD    . GLU D 4 199 ? -26.737 -10.558 -2.973  1.00 45.93  ? 199 GLU B CD    1 
ATOM   6417 O OE1   . GLU D 4 199 ? -26.281 -11.723 -2.991  1.00 47.80  ? 199 GLU B OE1   1 
ATOM   6418 O OE2   . GLU D 4 199 ? -27.058 -9.965  -1.917  1.00 46.85  ? 199 GLU B OE2   1 
ATOM   6419 N N     . GLN D 4 200 ? -22.996 -8.198  -6.147  1.00 33.00  ? 200 GLN B N     1 
ATOM   6420 C CA    . GLN D 4 200 ? -21.748 -8.265  -6.880  1.00 33.30  ? 200 GLN B CA    1 
ATOM   6421 C C     . GLN D 4 200 ? -20.615 -7.883  -5.925  1.00 33.09  ? 200 GLN B C     1 
ATOM   6422 O O     . GLN D 4 200 ? -19.554 -8.509  -5.922  1.00 33.37  ? 200 GLN B O     1 
ATOM   6423 C CB    . GLN D 4 200 ? -21.777 -7.328  -8.090  1.00 33.85  ? 200 GLN B CB    1 
ATOM   6424 C CG    . GLN D 4 200 ? -20.514 -7.400  -8.931  1.00 36.22  ? 200 GLN B CG    1 
ATOM   6425 C CD    . GLN D 4 200 ? -20.202 -8.816  -9.379  1.00 36.78  ? 200 GLN B CD    1 
ATOM   6426 O OE1   . GLN D 4 200 ? -20.879 -9.365  -10.246 1.00 38.01  ? 200 GLN B OE1   1 
ATOM   6427 N NE2   . GLN D 4 200 ? -19.181 -9.418  -8.779  1.00 36.30  ? 200 GLN B NE2   1 
ATOM   6428 N N     . GLN D 4 201 ? -20.856 -6.868  -5.100  1.00 31.59  ? 201 GLN B N     1 
ATOM   6429 C CA    . GLN D 4 201 ? -19.870 -6.427  -4.128  1.00 30.61  ? 201 GLN B CA    1 
ATOM   6430 C C     . GLN D 4 201 ? -19.583 -7.502  -3.077  1.00 32.23  ? 201 GLN B C     1 
ATOM   6431 O O     . GLN D 4 201 ? -18.461 -7.604  -2.578  1.00 32.58  ? 201 GLN B O     1 
ATOM   6432 C CB    . GLN D 4 201 ? -20.345 -5.161  -3.432  1.00 29.80  ? 201 GLN B CB    1 
ATOM   6433 C CG    . GLN D 4 201 ? -20.202 -3.901  -4.256  1.00 30.66  ? 201 GLN B CG    1 
ATOM   6434 C CD    . GLN D 4 201 ? -20.793 -2.699  -3.547  1.00 30.14  ? 201 GLN B CD    1 
ATOM   6435 O OE1   . GLN D 4 201 ? -21.995 -2.643  -3.304  1.00 29.80  ? 201 GLN B OE1   1 
ATOM   6436 N NE2   . GLN D 4 201 ? -19.948 -1.735  -3.202  1.00 31.08  ? 201 GLN B NE2   1 
ATOM   6437 N N     . LYS D 4 202 ? -20.591 -8.293  -2.727  1.00 32.42  ? 202 LYS B N     1 
ATOM   6438 C CA    . LYS D 4 202 ? -20.395 -9.347  -1.742  1.00 33.76  ? 202 LYS B CA    1 
ATOM   6439 C C     . LYS D 4 202 ? -19.524 -10.451 -2.326  1.00 34.79  ? 202 LYS B C     1 
ATOM   6440 O O     . LYS D 4 202 ? -18.756 -11.096 -1.605  1.00 35.92  ? 202 LYS B O     1 
ATOM   6441 C CB    . LYS D 4 202 ? -21.738 -9.920  -1.284  1.00 33.99  ? 202 LYS B CB    1 
ATOM   6442 C CG    . LYS D 4 202 ? -22.499 -8.998  -0.342  1.00 36.77  ? 202 LYS B CG    1 
ATOM   6443 C CD    . LYS D 4 202 ? -23.893 -9.522  -0.029  1.00 39.37  ? 202 LYS B CD    1 
ATOM   6444 C CE    . LYS D 4 202 ? -24.696 -8.516  0.791   1.00 39.75  ? 202 LYS B CE    1 
ATOM   6445 N NZ    . LYS D 4 202 ? -26.064 -9.017  1.124   1.00 42.03  ? 202 LYS B NZ    1 
ATOM   6446 N N     . GLU D 4 203 ? -19.641 -10.664 -3.634  1.00 33.89  ? 203 GLU B N     1 
ATOM   6447 C CA    . GLU D 4 203 ? -18.841 -11.678 -4.303  1.00 33.97  ? 203 GLU B CA    1 
ATOM   6448 C C     . GLU D 4 203 ? -17.402 -11.173 -4.358  1.00 32.57  ? 203 GLU B C     1 
ATOM   6449 O O     . GLU D 4 203 ? -16.479 -11.871 -3.949  1.00 32.97  ? 203 GLU B O     1 
ATOM   6450 C CB    . GLU D 4 203 ? -19.358 -11.932 -5.721  1.00 35.29  ? 203 GLU B CB    1 
ATOM   6451 C CG    . GLU D 4 203 ? -18.552 -12.975 -6.478  1.00 38.58  ? 203 GLU B CG    1 
ATOM   6452 C CD    . GLU D 4 203 ? -19.011 -13.151 -7.917  1.00 41.18  ? 203 GLU B CD    1 
ATOM   6453 O OE1   . GLU D 4 203 ? -20.192 -13.498 -8.133  1.00 42.18  ? 203 GLU B OE1   1 
ATOM   6454 O OE2   . GLU D 4 203 ? -18.189 -12.945 -8.833  1.00 40.50  ? 203 GLU B OE2   1 
ATOM   6455 N N     . GLY D 4 204 ? -17.223 -9.955  -4.863  1.00 30.75  ? 204 GLY B N     1 
ATOM   6456 C CA    . GLY D 4 204 ? -15.900 -9.369  -4.940  1.00 28.24  ? 204 GLY B CA    1 
ATOM   6457 C C     . GLY D 4 204 ? -15.215 -9.359  -3.579  1.00 28.48  ? 204 GLY B C     1 
ATOM   6458 O O     . GLY D 4 204 ? -14.018 -9.644  -3.475  1.00 26.26  ? 204 GLY B O     1 
ATOM   6459 N N     . LEU D 4 205 ? -15.967 -9.050  -2.524  1.00 27.72  ? 205 LEU B N     1 
ATOM   6460 C CA    . LEU D 4 205 ? -15.386 -9.016  -1.189  1.00 28.60  ? 205 LEU B CA    1 
ATOM   6461 C C     . LEU D 4 205 ? -14.905 -10.383 -0.713  1.00 29.09  ? 205 LEU B C     1 
ATOM   6462 O O     . LEU D 4 205 ? -13.871 -10.482 -0.060  1.00 31.23  ? 205 LEU B O     1 
ATOM   6463 C CB    . LEU D 4 205 ? -16.375 -8.453  -0.175  1.00 27.43  ? 205 LEU B CB    1 
ATOM   6464 C CG    . LEU D 4 205 ? -15.731 -8.255  1.197   1.00 26.02  ? 205 LEU B CG    1 
ATOM   6465 C CD1   . LEU D 4 205 ? -14.533 -7.313  1.059   1.00 24.62  ? 205 LEU B CD1   1 
ATOM   6466 C CD2   . LEU D 4 205 ? -16.758 -7.691  2.183   1.00 27.46  ? 205 LEU B CD2   1 
ATOM   6467 N N     . GLU D 4 206 ? -15.648 -11.436 -1.032  1.00 28.55  ? 206 GLU B N     1 
ATOM   6468 C CA    . GLU D 4 206 ? -15.241 -12.773 -0.623  1.00 27.85  ? 206 GLU B CA    1 
ATOM   6469 C C     . GLU D 4 206 ? -13.912 -13.149 -1.254  1.00 26.29  ? 206 GLU B C     1 
ATOM   6470 O O     . GLU D 4 206 ? -13.057 -13.744 -0.597  1.00 27.84  ? 206 GLU B O     1 
ATOM   6471 C CB    . GLU D 4 206 ? -16.304 -13.799 -1.006  1.00 30.54  ? 206 GLU B CB    1 
ATOM   6472 C CG    . GLU D 4 206 ? -17.425 -13.898 0.002   1.00 31.36  ? 206 GLU B CG    1 
ATOM   6473 C CD    . GLU D 4 206 ? -16.898 -14.183 1.391   1.00 33.74  ? 206 GLU B CD    1 
ATOM   6474 O OE1   . GLU D 4 206 ? -16.067 -15.108 1.529   1.00 36.18  ? 206 GLU B OE1   1 
ATOM   6475 O OE2   . GLU D 4 206 ? -17.312 -13.491 2.340   1.00 32.41  ? 206 GLU B OE2   1 
ATOM   6476 N N     . ILE D 4 207 ? -13.740 -12.791 -2.524  1.00 23.48  ? 207 ILE B N     1 
ATOM   6477 C CA    . ILE D 4 207 ? -12.504 -13.079 -3.248  1.00 23.51  ? 207 ILE B CA    1 
ATOM   6478 C C     . ILE D 4 207 ? -11.334 -12.299 -2.635  1.00 23.17  ? 207 ILE B C     1 
ATOM   6479 O O     . ILE D 4 207 ? -10.243 -12.839 -2.439  1.00 24.68  ? 207 ILE B O     1 
ATOM   6480 C CB    . ILE D 4 207 ? -12.643 -12.715 -4.763  1.00 23.40  ? 207 ILE B CB    1 
ATOM   6481 C CG1   . ILE D 4 207 ? -13.728 -13.581 -5.417  1.00 21.74  ? 207 ILE B CG1   1 
ATOM   6482 C CG2   . ILE D 4 207 ? -11.320 -12.931 -5.484  1.00 22.14  ? 207 ILE B CG2   1 
ATOM   6483 C CD1   . ILE D 4 207 ? -13.418 -15.061 -5.401  1.00 22.09  ? 207 ILE B CD1   1 
ATOM   6484 N N     . VAL D 4 208 ? -11.567 -11.025 -2.340  1.00 22.33  ? 208 VAL B N     1 
ATOM   6485 C CA    . VAL D 4 208 ? -10.555 -10.188 -1.731  1.00 21.83  ? 208 VAL B CA    1 
ATOM   6486 C C     . VAL D 4 208 ? -10.165 -10.827 -0.392  1.00 23.86  ? 208 VAL B C     1 
ATOM   6487 O O     . VAL D 4 208 ? -8.986  -10.892 -0.049  1.00 22.32  ? 208 VAL B O     1 
ATOM   6488 C CB    . VAL D 4 208 ? -11.090 -8.744  -1.498  1.00 21.90  ? 208 VAL B CB    1 
ATOM   6489 C CG1   . VAL D 4 208 ? -10.141 -7.966  -0.594  1.00 19.27  ? 208 VAL B CG1   1 
ATOM   6490 C CG2   . VAL D 4 208 ? -11.252 -8.029  -2.835  1.00 20.27  ? 208 VAL B CG2   1 
ATOM   6491 N N     . LYS D 4 209 ? -11.154 -11.306 0.359   1.00 25.24  ? 209 LYS B N     1 
ATOM   6492 C CA    . LYS D 4 209 ? -10.875 -11.953 1.640   1.00 27.84  ? 209 LYS B CA    1 
ATOM   6493 C C     . LYS D 4 209 ? -10.008 -13.199 1.449   1.00 28.10  ? 209 LYS B C     1 
ATOM   6494 O O     . LYS D 4 209 ? -9.033  -13.404 2.170   1.00 28.35  ? 209 LYS B O     1 
ATOM   6495 C CB    . LYS D 4 209 ? -12.167 -12.388 2.334   1.00 31.24  ? 209 LYS B CB    1 
ATOM   6496 C CG    . LYS D 4 209 ? -12.904 -11.327 3.147   1.00 33.87  ? 209 LYS B CG    1 
ATOM   6497 C CD    . LYS D 4 209 ? -14.010 -12.022 3.944   1.00 35.24  ? 209 LYS B CD    1 
ATOM   6498 C CE    . LYS D 4 209 ? -15.008 -11.046 4.528   1.00 36.82  ? 209 LYS B CE    1 
ATOM   6499 N NZ    . LYS D 4 209 ? -16.100 -11.761 5.265   1.00 39.57  ? 209 LYS B NZ    1 
ATOM   6500 N N     . MET D 4 210 ? -10.387 -14.037 0.486   1.00 27.24  ? 210 MET B N     1 
ATOM   6501 C CA    . MET D 4 210 ? -9.657  -15.267 0.206   1.00 26.85  ? 210 MET B CA    1 
ATOM   6502 C C     . MET D 4 210 ? -8.212  -14.964 -0.167  1.00 25.10  ? 210 MET B C     1 
ATOM   6503 O O     . MET D 4 210 ? -7.285  -15.594 0.336   1.00 23.22  ? 210 MET B O     1 
ATOM   6504 C CB    . MET D 4 210 ? -10.318 -16.031 -0.943  1.00 28.86  ? 210 MET B CB    1 
ATOM   6505 C CG    . MET D 4 210 ? -11.775 -16.392 -0.715  1.00 34.36  ? 210 MET B CG    1 
ATOM   6506 S SD    . MET D 4 210 ? -12.478 -17.272 -2.142  1.00 38.54  ? 210 MET B SD    1 
ATOM   6507 C CE    . MET D 4 210 ? -12.778 -18.881 -1.428  1.00 36.95  ? 210 MET B CE    1 
ATOM   6508 N N     . VAL D 4 211 ? -8.036  -14.006 -1.070  1.00 23.59  ? 211 VAL B N     1 
ATOM   6509 C CA    . VAL D 4 211 ? -6.711  -13.608 -1.511  1.00 22.58  ? 211 VAL B CA    1 
ATOM   6510 C C     . VAL D 4 211 ? -5.851  -13.186 -0.313  1.00 22.77  ? 211 VAL B C     1 
ATOM   6511 O O     . VAL D 4 211 ? -4.751  -13.716 -0.118  1.00 20.10  ? 211 VAL B O     1 
ATOM   6512 C CB    . VAL D 4 211 ? -6.810  -12.442 -2.512  1.00 23.54  ? 211 VAL B CB    1 
ATOM   6513 C CG1   . VAL D 4 211 ? -5.427  -11.886 -2.818  1.00 23.06  ? 211 VAL B CG1   1 
ATOM   6514 C CG2   . VAL D 4 211 ? -7.486  -12.919 -3.787  1.00 23.79  ? 211 VAL B CG2   1 
ATOM   6515 N N     . MET D 4 212 ? -6.364  -12.251 0.491   1.00 21.44  ? 212 MET B N     1 
ATOM   6516 C CA    . MET D 4 212 ? -5.636  -11.763 1.657   1.00 21.82  ? 212 MET B CA    1 
ATOM   6517 C C     . MET D 4 212 ? -5.306  -12.845 2.687   1.00 23.43  ? 212 MET B C     1 
ATOM   6518 O O     . MET D 4 212 ? -4.263  -12.782 3.353   1.00 21.75  ? 212 MET B O     1 
ATOM   6519 C CB    . MET D 4 212 ? -6.400  -10.623 2.335   1.00 20.33  ? 212 MET B CB    1 
ATOM   6520 C CG    . MET D 4 212 ? -6.445  -9.327  1.531   1.00 20.61  ? 212 MET B CG    1 
ATOM   6521 S SD    . MET D 4 212 ? -4.883  -8.850  0.743   1.00 22.86  ? 212 MET B SD    1 
ATOM   6522 C CE    . MET D 4 212 ? -3.748  -8.871  2.088   1.00 23.10  ? 212 MET B CE    1 
ATOM   6523 N N     . ILE D 4 213 ? -6.181  -13.838 2.815   1.00 23.51  ? 213 ILE B N     1 
ATOM   6524 C CA    . ILE D 4 213 ? -5.943  -14.919 3.761   1.00 24.93  ? 213 ILE B CA    1 
ATOM   6525 C C     . ILE D 4 213 ? -4.855  -15.851 3.234   1.00 25.27  ? 213 ILE B C     1 
ATOM   6526 O O     . ILE D 4 213 ? -4.055  -16.375 4.002   1.00 24.53  ? 213 ILE B O     1 
ATOM   6527 C CB    . ILE D 4 213 ? -7.259  -15.681 4.066   1.00 25.93  ? 213 ILE B CB    1 
ATOM   6528 C CG1   . ILE D 4 213 ? -8.145  -14.791 4.948   1.00 25.66  ? 213 ILE B CG1   1 
ATOM   6529 C CG2   . ILE D 4 213 ? -6.975  -17.021 4.762   1.00 25.11  ? 213 ILE B CG2   1 
ATOM   6530 C CD1   . ILE D 4 213 ? -9.558  -15.291 5.127   1.00 26.34  ? 213 ILE B CD1   1 
ATOM   6531 N N     . SER D 4 214 ? -4.794  -16.025 1.920   1.00 25.63  ? 214 SER B N     1 
ATOM   6532 C CA    . SER D 4 214 ? -3.769  -16.879 1.345   1.00 27.37  ? 214 SER B CA    1 
ATOM   6533 C C     . SER D 4 214 ? -2.411  -16.207 1.507   1.00 28.01  ? 214 SER B C     1 
ATOM   6534 O O     . SER D 4 214 ? -1.414  -16.855 1.821   1.00 28.95  ? 214 SER B O     1 
ATOM   6535 C CB    . SER D 4 214 ? -4.020  -17.114 -0.151  1.00 29.40  ? 214 SER B CB    1 
ATOM   6536 O OG    . SER D 4 214 ? -5.293  -17.681 -0.392  1.00 35.67  ? 214 SER B OG    1 
ATOM   6537 N N     . LEU D 4 215 ? -2.379  -14.898 1.285   1.00 29.46  ? 215 LEU B N     1 
ATOM   6538 C CA    . LEU D 4 215 ? -1.137  -14.138 1.369   1.00 30.20  ? 215 LEU B CA    1 
ATOM   6539 C C     . LEU D 4 215 ? -0.657  -13.838 2.772   1.00 31.75  ? 215 LEU B C     1 
ATOM   6540 O O     . LEU D 4 215 ? 0.529   -13.902 3.040   1.00 32.26  ? 215 LEU B O     1 
ATOM   6541 C CB    . LEU D 4 215 ? -1.276  -12.808 0.628   1.00 28.08  ? 215 LEU B CB    1 
ATOM   6542 C CG    . LEU D 4 215 ? -1.548  -12.801 -0.874  1.00 26.12  ? 215 LEU B CG    1 
ATOM   6543 C CD1   . LEU D 4 215 ? -1.859  -11.385 -1.279  1.00 23.29  ? 215 LEU B CD1   1 
ATOM   6544 C CD2   . LEU D 4 215 ? -0.346  -13.339 -1.650  1.00 24.79  ? 215 LEU B CD2   1 
ATOM   6545 N N     . GLU D 4 216 ? -1.578  -13.510 3.670   1.00 35.22  ? 216 GLU B N     1 
ATOM   6546 C CA    . GLU D 4 216 ? -1.199  -13.143 5.032   1.00 38.10  ? 216 GLU B CA    1 
ATOM   6547 C C     . GLU D 4 216 ? -1.654  -14.118 6.104   1.00 38.64  ? 216 GLU B C     1 
ATOM   6548 O O     . GLU D 4 216 ? -1.021  -14.232 7.155   1.00 39.35  ? 216 GLU B O     1 
ATOM   6549 C CB    . GLU D 4 216 ? -1.776  -11.764 5.372   1.00 40.63  ? 216 GLU B CB    1 
ATOM   6550 C CG    . GLU D 4 216 ? -1.454  -10.658 4.380   1.00 44.14  ? 216 GLU B CG    1 
ATOM   6551 C CD    . GLU D 4 216 ? -0.059  -10.111 4.556   1.00 46.78  ? 216 GLU B CD    1 
ATOM   6552 O OE1   . GLU D 4 216 ? 0.287   -9.743  5.699   1.00 48.59  ? 216 GLU B OE1   1 
ATOM   6553 O OE2   . GLU D 4 216 ? 0.684   -10.040 3.555   1.00 49.14  ? 216 GLU B OE2   1 
ATOM   6554 N N     . GLY D 4 217 ? -2.762  -14.804 5.847   1.00 38.81  ? 217 GLY B N     1 
ATOM   6555 C CA    . GLY D 4 217 ? -3.286  -15.734 6.825   1.00 37.30  ? 217 GLY B CA    1 
ATOM   6556 C C     . GLY D 4 217 ? -4.389  -15.045 7.594   1.00 39.00  ? 217 GLY B C     1 
ATOM   6557 O O     . GLY D 4 217 ? -4.940  -14.050 7.133   1.00 38.65  ? 217 GLY B O     1 
ATOM   6558 N N     . GLU D 4 218 ? -4.705  -15.566 8.772   1.00 40.91  ? 218 GLU B N     1 
ATOM   6559 C CA    . GLU D 4 218 ? -5.753  -15.003 9.609   1.00 42.93  ? 218 GLU B CA    1 
ATOM   6560 C C     . GLU D 4 218 ? -5.748  -13.473 9.642   1.00 42.88  ? 218 GLU B C     1 
ATOM   6561 O O     . GLU D 4 218 ? -6.801  -12.840 9.567   1.00 43.68  ? 218 GLU B O     1 
ATOM   6562 C CB    . GLU D 4 218 ? -5.605  -15.546 11.029  1.00 46.77  ? 218 GLU B CB    1 
ATOM   6563 C CG    . GLU D 4 218 ? -6.616  -15.013 12.031  1.00 53.07  ? 218 GLU B CG    1 
ATOM   6564 C CD    . GLU D 4 218 ? -6.359  -15.538 13.438  1.00 56.64  ? 218 GLU B CD    1 
ATOM   6565 O OE1   . GLU D 4 218 ? -6.402  -16.775 13.625  1.00 59.05  ? 218 GLU B OE1   1 
ATOM   6566 O OE2   . GLU D 4 218 ? -6.110  -14.720 14.355  1.00 57.72  ? 218 GLU B OE2   1 
ATOM   6567 N N     . ASP D 4 219 ? -4.562  -12.883 9.748   1.00 42.04  ? 219 ASP B N     1 
ATOM   6568 C CA    . ASP D 4 219 ? -4.439  -11.432 9.820   1.00 41.40  ? 219 ASP B CA    1 
ATOM   6569 C C     . ASP D 4 219 ? -4.673  -10.709 8.497   1.00 39.12  ? 219 ASP B C     1 
ATOM   6570 O O     . ASP D 4 219 ? -4.724  -9.483  8.457   1.00 39.56  ? 219 ASP B O     1 
ATOM   6571 C CB    . ASP D 4 219 ? -3.061  -11.040 10.370  1.00 44.30  ? 219 ASP B CB    1 
ATOM   6572 C CG    . ASP D 4 219 ? -2.854  -11.483 11.813  1.00 47.07  ? 219 ASP B CG    1 
ATOM   6573 O OD1   . ASP D 4 219 ? -3.806  -11.362 12.621  1.00 48.52  ? 219 ASP B OD1   1 
ATOM   6574 O OD2   . ASP D 4 219 ? -1.735  -11.938 12.142  1.00 46.25  ? 219 ASP B OD2   1 
ATOM   6575 N N     . GLY D 4 220 ? -4.814  -11.462 7.416   1.00 35.09  ? 220 GLY B N     1 
ATOM   6576 C CA    . GLY D 4 220 ? -5.034  -10.836 6.130   1.00 31.01  ? 220 GLY B CA    1 
ATOM   6577 C C     . GLY D 4 220 ? -6.248  -9.929  6.128   1.00 27.30  ? 220 GLY B C     1 
ATOM   6578 O O     . GLY D 4 220 ? -6.273  -8.906  5.450   1.00 24.24  ? 220 GLY B O     1 
ATOM   6579 N N     . LEU D 4 221 ? -7.260  -10.316 6.887   1.00 27.66  ? 221 LEU B N     1 
ATOM   6580 C CA    . LEU D 4 221 ? -8.490  -9.547  6.977   1.00 29.02  ? 221 LEU B CA    1 
ATOM   6581 C C     . LEU D 4 221 ? -8.166  -8.130  7.438   1.00 28.91  ? 221 LEU B C     1 
ATOM   6582 O O     . LEU D 4 221 ? -8.821  -7.167  7.040   1.00 29.95  ? 221 LEU B O     1 
ATOM   6583 C CB    . LEU D 4 221 ? -9.444  -10.244 7.946   1.00 30.45  ? 221 LEU B CB    1 
ATOM   6584 C CG    . LEU D 4 221 ? -9.640  -11.723 7.574   1.00 33.17  ? 221 LEU B CG    1 
ATOM   6585 C CD1   . LEU D 4 221 ? -10.363 -12.466 8.682   1.00 34.46  ? 221 LEU B CD1   1 
ATOM   6586 C CD2   . LEU D 4 221 ? -10.419 -11.818 6.269   1.00 33.05  ? 221 LEU B CD2   1 
ATOM   6587 N N     . ASP D 4 222 ? -7.130  -8.017  8.261   1.00 27.66  ? 222 ASP B N     1 
ATOM   6588 C CA    . ASP D 4 222 ? -6.667  -6.737  8.781   1.00 27.26  ? 222 ASP B CA    1 
ATOM   6589 C C     . ASP D 4 222 ? -6.086  -5.802  7.702   1.00 26.72  ? 222 ASP B C     1 
ATOM   6590 O O     . ASP D 4 222 ? -5.886  -4.611  7.952   1.00 26.79  ? 222 ASP B O     1 
ATOM   6591 C CB    . ASP D 4 222 ? -5.608  -6.979  9.867   1.00 29.34  ? 222 ASP B CB    1 
ATOM   6592 C CG    . ASP D 4 222 ? -6.210  -7.484  11.176  1.00 31.95  ? 222 ASP B CG    1 
ATOM   6593 O OD1   . ASP D 4 222 ? -5.543  -8.277  11.874  1.00 33.16  ? 222 ASP B OD1   1 
ATOM   6594 O OD2   . ASP D 4 222 ? -7.344  -7.077  11.511  1.00 30.50  ? 222 ASP B OD2   1 
ATOM   6595 N N     . GLU D 4 223 ? -5.796  -6.322  6.514   1.00 24.46  ? 223 GLU B N     1 
ATOM   6596 C CA    . GLU D 4 223 ? -5.252  -5.462  5.476   1.00 22.91  ? 223 GLU B CA    1 
ATOM   6597 C C     . GLU D 4 223 ? -6.316  -4.949  4.510   1.00 21.59  ? 223 GLU B C     1 
ATOM   6598 O O     . GLU D 4 223 ? -6.007  -4.489  3.416   1.00 20.98  ? 223 GLU B O     1 
ATOM   6599 C CB    . GLU D 4 223 ? -4.140  -6.176  4.708   1.00 25.09  ? 223 GLU B CB    1 
ATOM   6600 C CG    . GLU D 4 223 ? -2.922  -6.534  5.554   1.00 26.98  ? 223 GLU B CG    1 
ATOM   6601 C CD    . GLU D 4 223 ? -2.477  -5.391  6.457   1.00 28.68  ? 223 GLU B CD    1 
ATOM   6602 O OE1   . GLU D 4 223 ? -2.402  -4.237  5.979   1.00 29.03  ? 223 GLU B OE1   1 
ATOM   6603 O OE2   . GLU D 4 223 ? -2.197  -5.651  7.648   1.00 29.13  ? 223 GLU B OE2   1 
ATOM   6604 N N     . ILE D 4 224 ? -7.576  -5.031  4.918   1.00 20.61  ? 224 ILE B N     1 
ATOM   6605 C CA    . ILE D 4 224 ? -8.674  -4.535  4.091   1.00 19.39  ? 224 ILE B CA    1 
ATOM   6606 C C     . ILE D 4 224 ? -9.232  -3.348  4.854   1.00 19.16  ? 224 ILE B C     1 
ATOM   6607 O O     . ILE D 4 224 ? -9.688  -3.510  5.976   1.00 18.65  ? 224 ILE B O     1 
ATOM   6608 C CB    . ILE D 4 224 ? -9.771  -5.580  3.940   1.00 18.47  ? 224 ILE B CB    1 
ATOM   6609 C CG1   . ILE D 4 224 ? -9.171  -6.880  3.416   1.00 18.93  ? 224 ILE B CG1   1 
ATOM   6610 C CG2   . ILE D 4 224 ? -10.829 -5.081  2.998   1.00 16.68  ? 224 ILE B CG2   1 
ATOM   6611 C CD1   . ILE D 4 224 ? -10.123 -8.038  3.445   1.00 19.46  ? 224 ILE B CD1   1 
ATOM   6612 N N     . TYR D 4 225 ? -9.191  -2.160  4.259   1.00 19.04  ? 225 TYR B N     1 
ATOM   6613 C CA    . TYR D 4 225 ? -9.672  -0.964  4.950   1.00 19.18  ? 225 TYR B CA    1 
ATOM   6614 C C     . TYR D 4 225 ? -10.728 -0.163  4.201   1.00 19.12  ? 225 TYR B C     1 
ATOM   6615 O O     . TYR D 4 225 ? -10.901 -0.315  2.996   1.00 22.57  ? 225 TYR B O     1 
ATOM   6616 C CB    . TYR D 4 225 ? -8.511  -0.009  5.241   1.00 15.67  ? 225 TYR B CB    1 
ATOM   6617 C CG    . TYR D 4 225 ? -7.286  -0.642  5.846   1.00 17.95  ? 225 TYR B CG    1 
ATOM   6618 C CD1   . TYR D 4 225 ? -6.328  -1.260  5.040   1.00 16.56  ? 225 TYR B CD1   1 
ATOM   6619 C CD2   . TYR D 4 225 ? -7.058  -0.587  7.224   1.00 14.85  ? 225 TYR B CD2   1 
ATOM   6620 C CE1   . TYR D 4 225 ? -5.181  -1.796  5.584   1.00 17.92  ? 225 TYR B CE1   1 
ATOM   6621 C CE2   . TYR D 4 225 ? -5.915  -1.122  7.779   1.00 14.36  ? 225 TYR B CE2   1 
ATOM   6622 C CZ    . TYR D 4 225 ? -4.980  -1.726  6.957   1.00 18.47  ? 225 TYR B CZ    1 
ATOM   6623 O OH    . TYR D 4 225 ? -3.855  -2.288  7.505   1.00 22.94  ? 225 TYR B OH    1 
ATOM   6624 N N     . SER D 4 226 ? -11.421 0.701   4.934   1.00 18.60  ? 226 SER B N     1 
ATOM   6625 C CA    . SER D 4 226 ? -12.413 1.590   4.347   1.00 19.81  ? 226 SER B CA    1 
ATOM   6626 C C     . SER D 4 226 ? -11.597 2.838   4.078   1.00 18.35  ? 226 SER B C     1 
ATOM   6627 O O     . SER D 4 226 ? -10.641 3.105   4.797   1.00 20.03  ? 226 SER B O     1 
ATOM   6628 C CB    . SER D 4 226 ? -13.532 1.924   5.347   1.00 20.46  ? 226 SER B CB    1 
ATOM   6629 O OG    . SER D 4 226 ? -13.062 2.769   6.394   1.00 23.07  ? 226 SER B OG    1 
ATOM   6630 N N     . PHE D 4 227 ? -11.952 3.596   3.049   1.00 17.36  ? 227 PHE B N     1 
ATOM   6631 C CA    . PHE D 4 227 ? -11.222 4.817   2.751   1.00 17.42  ? 227 PHE B CA    1 
ATOM   6632 C C     . PHE D 4 227 ? -11.281 5.723   3.979   1.00 17.77  ? 227 PHE B C     1 
ATOM   6633 O O     . PHE D 4 227 ? -10.292 6.342   4.363   1.00 17.47  ? 227 PHE B O     1 
ATOM   6634 C CB    . PHE D 4 227 ? -11.855 5.543   1.568   1.00 18.66  ? 227 PHE B CB    1 
ATOM   6635 C CG    . PHE D 4 227 ? -11.912 4.726   0.309   1.00 19.70  ? 227 PHE B CG    1 
ATOM   6636 C CD1   . PHE D 4 227 ? -13.104 4.605   -0.398  1.00 18.93  ? 227 PHE B CD1   1 
ATOM   6637 C CD2   . PHE D 4 227 ? -10.772 4.111   -0.192  1.00 20.13  ? 227 PHE B CD2   1 
ATOM   6638 C CE1   . PHE D 4 227 ? -13.160 3.892   -1.581  1.00 17.38  ? 227 PHE B CE1   1 
ATOM   6639 C CE2   . PHE D 4 227 ? -10.815 3.394   -1.377  1.00 20.71  ? 227 PHE B CE2   1 
ATOM   6640 C CZ    . PHE D 4 227 ? -12.012 3.286   -2.074  1.00 21.43  ? 227 PHE B CZ    1 
ATOM   6641 N N     . SER D 4 228 ? -12.452 5.783   4.595   1.00 17.67  ? 228 SER B N     1 
ATOM   6642 C CA    . SER D 4 228 ? -12.666 6.628   5.757   1.00 20.38  ? 228 SER B CA    1 
ATOM   6643 C C     . SER D 4 228 ? -11.695 6.377   6.905   1.00 20.07  ? 228 SER B C     1 
ATOM   6644 O O     . SER D 4 228 ? -11.142 7.321   7.475   1.00 19.27  ? 228 SER B O     1 
ATOM   6645 C CB    . SER D 4 228 ? -14.098 6.470   6.262   1.00 20.34  ? 228 SER B CB    1 
ATOM   6646 O OG    . SER D 4 228 ? -14.377 7.437   7.260   1.00 28.58  ? 228 SER B OG    1 
ATOM   6647 N N     . GLU D 4 229 ? -11.485 5.115   7.251   1.00 19.96  ? 229 GLU B N     1 
ATOM   6648 C CA    . GLU D 4 229 ? -10.586 4.818   8.348   1.00 22.98  ? 229 GLU B CA    1 
ATOM   6649 C C     . GLU D 4 229 ? -9.128  4.988   7.929   1.00 22.59  ? 229 GLU B C     1 
ATOM   6650 O O     . GLU D 4 229 ? -8.261  5.240   8.763   1.00 22.50  ? 229 GLU B O     1 
ATOM   6651 C CB    . GLU D 4 229 ? -10.833 3.398   8.859   1.00 23.62  ? 229 GLU B CB    1 
ATOM   6652 C CG    . GLU D 4 229 ? -10.376 2.305   7.912   1.00 27.66  ? 229 GLU B CG    1 
ATOM   6653 C CD    . GLU D 4 229 ? -10.819 0.919   8.363   1.00 28.02  ? 229 GLU B CD    1 
ATOM   6654 O OE1   . GLU D 4 229 ? -10.630 0.596   9.555   1.00 23.21  ? 229 GLU B OE1   1 
ATOM   6655 O OE2   . GLU D 4 229 ? -11.343 0.156   7.519   1.00 26.02  ? 229 GLU B OE2   1 
ATOM   6656 N N     . SER D 4 230 ? -8.869  4.849   6.634   1.00 21.90  ? 230 SER B N     1 
ATOM   6657 C CA    . SER D 4 230 ? -7.520  4.978   6.094   1.00 22.34  ? 230 SER B CA    1 
ATOM   6658 C C     . SER D 4 230 ? -6.966  6.372   6.294   1.00 19.72  ? 230 SER B C     1 
ATOM   6659 O O     . SER D 4 230 ? -5.765  6.550   6.476   1.00 20.21  ? 230 SER B O     1 
ATOM   6660 C CB    . SER D 4 230 ? -7.519  4.655   4.600   1.00 20.46  ? 230 SER B CB    1 
ATOM   6661 O OG    . SER D 4 230 ? -7.943  3.326   4.400   1.00 27.48  ? 230 SER B OG    1 
ATOM   6662 N N     . LEU D 4 231 ? -7.853  7.358   6.235   1.00 20.17  ? 231 LEU B N     1 
ATOM   6663 C CA    . LEU D 4 231 ? -7.469  8.751   6.392   1.00 22.21  ? 231 LEU B CA    1 
ATOM   6664 C C     . LEU D 4 231 ? -7.033  9.053   7.822   1.00 21.94  ? 231 LEU B C     1 
ATOM   6665 O O     . LEU D 4 231 ? -6.369  10.058  8.071   1.00 22.15  ? 231 LEU B O     1 
ATOM   6666 C CB    . LEU D 4 231 ? -8.633  9.665   5.994   1.00 21.70  ? 231 LEU B CB    1 
ATOM   6667 C CG    . LEU D 4 231 ? -8.987  9.773   4.505   1.00 25.37  ? 231 LEU B CG    1 
ATOM   6668 C CD1   . LEU D 4 231 ? -10.330 10.476  4.362   1.00 24.36  ? 231 LEU B CD1   1 
ATOM   6669 C CD2   . LEU D 4 231 ? -7.899  10.541  3.749   1.00 23.50  ? 231 LEU B CD2   1 
ATOM   6670 N N     . ARG D 4 232 ? -7.415  8.189   8.760   1.00 21.62  ? 232 ARG B N     1 
ATOM   6671 C CA    . ARG D 4 232 ? -7.036  8.386   10.151  1.00 21.64  ? 232 ARG B CA    1 
ATOM   6672 C C     . ARG D 4 232 ? -6.117  7.288   10.674  1.00 21.75  ? 232 ARG B C     1 
ATOM   6673 O O     . ARG D 4 232 ? -6.186  6.908   11.844  1.00 20.07  ? 232 ARG B O     1 
ATOM   6674 C CB    . ARG D 4 232 ? -8.274  8.527   11.056  1.00 20.30  ? 232 ARG B CB    1 
ATOM   6675 C CG    . ARG D 4 232 ? -9.214  7.327   11.154  1.00 19.05  ? 232 ARG B CG    1 
ATOM   6676 C CD    . ARG D 4 232 ? -10.166 7.521   12.340  1.00 19.94  ? 232 ARG B CD    1 
ATOM   6677 N NE    . ARG D 4 232 ? -11.424 6.793   12.193  1.00 21.83  ? 232 ARG B NE    1 
ATOM   6678 C CZ    . ARG D 4 232 ? -11.541 5.472   12.264  1.00 20.73  ? 232 ARG B CZ    1 
ATOM   6679 N NH1   . ARG D 4 232 ? -10.478 4.717   12.489  1.00 23.85  ? 232 ARG B NH1   1 
ATOM   6680 N NH2   . ARG D 4 232 ? -12.719 4.905   12.089  1.00 20.87  ? 232 ARG B NH2   1 
ATOM   6681 N N     . LYS D 4 233 ? -5.250  6.786   9.798   1.00 21.76  ? 233 LYS B N     1 
ATOM   6682 C CA    . LYS D 4 233 ? -4.279  5.756   10.177  1.00 22.11  ? 233 LYS B CA    1 
ATOM   6683 C C     . LYS D 4 233 ? -3.022  5.938   9.341   1.00 21.87  ? 233 LYS B C     1 
ATOM   6684 O O     . LYS D 4 233 ? -2.992  6.753   8.424   1.00 22.52  ? 233 LYS B O     1 
ATOM   6685 C CB    . LYS D 4 233 ? -4.828  4.350   9.911   1.00 20.30  ? 233 LYS B CB    1 
ATOM   6686 C CG    . LYS D 4 233 ? -6.073  3.978   10.677  1.00 20.04  ? 233 LYS B CG    1 
ATOM   6687 C CD    . LYS D 4 233 ? -6.494  2.560   10.309  1.00 20.32  ? 233 LYS B CD    1 
ATOM   6688 C CE    . LYS D 4 233 ? -7.802  2.162   10.970  1.00 15.52  ? 233 LYS B CE    1 
ATOM   6689 N NZ    . LYS D 4 233 ? -7.675  2.100   12.432  1.00 15.19  ? 233 LYS B NZ    1 
ATOM   6690 N N     . LEU D 4 234 ? -1.987  5.172   9.663   1.00 21.78  ? 234 LEU B N     1 
ATOM   6691 C CA    . LEU D 4 234 ? -0.746  5.202   8.907   1.00 21.42  ? 234 LEU B CA    1 
ATOM   6692 C C     . LEU D 4 234 ? -0.678  3.877   8.144   1.00 23.61  ? 234 LEU B C     1 
ATOM   6693 O O     . LEU D 4 234 ? 0.372   3.495   7.631   1.00 24.87  ? 234 LEU B O     1 
ATOM   6694 C CB    . LEU D 4 234 ? 0.460   5.323   9.839   1.00 18.89  ? 234 LEU B CB    1 
ATOM   6695 C CG    . LEU D 4 234 ? 0.740   6.642   10.565  1.00 18.73  ? 234 LEU B CG    1 
ATOM   6696 C CD1   . LEU D 4 234 ? 1.982   6.469   11.429  1.00 15.46  ? 234 LEU B CD1   1 
ATOM   6697 C CD2   . LEU D 4 234 ? 0.940   7.779   9.558   1.00 16.54  ? 234 LEU B CD2   1 
ATOM   6698 N N     . CYS D 4 235 ? -1.812  3.189   8.054   1.00 23.71  ? 235 CYS B N     1 
ATOM   6699 C CA    . CYS D 4 235 ? -1.863  1.895   7.380   1.00 26.56  ? 235 CYS B CA    1 
ATOM   6700 C C     . CYS D 4 235 ? -1.367  1.872   5.931   1.00 24.78  ? 235 CYS B C     1 
ATOM   6701 O O     . CYS D 4 235 ? -0.810  0.865   5.498   1.00 26.50  ? 235 CYS B O     1 
ATOM   6702 C CB    . CYS D 4 235 ? -3.283  1.300   7.458   1.00 27.07  ? 235 CYS B CB    1 
ATOM   6703 S SG    . CYS D 4 235 ? -4.595  2.224   6.581   1.00 32.21  ? 235 CYS B SG    1 
ATOM   6704 N N     . VAL D 4 236 ? -1.552  2.954   5.176   1.00 23.63  ? 236 VAL B N     1 
ATOM   6705 C CA    . VAL D 4 236 ? -1.076  2.958   3.789   1.00 22.53  ? 236 VAL B CA    1 
ATOM   6706 C C     . VAL D 4 236 ? 0.451   2.922   3.705   1.00 22.73  ? 236 VAL B C     1 
ATOM   6707 O O     . VAL D 4 236 ? 1.004   2.561   2.667   1.00 23.86  ? 236 VAL B O     1 
ATOM   6708 C CB    . VAL D 4 236 ? -1.590  4.185   2.973   1.00 22.28  ? 236 VAL B CB    1 
ATOM   6709 C CG1   . VAL D 4 236 ? -3.107  4.164   2.889   1.00 21.52  ? 236 VAL B CG1   1 
ATOM   6710 C CG2   . VAL D 4 236 ? -1.094  5.483   3.592   1.00 23.11  ? 236 VAL B CG2   1 
ATOM   6711 N N     . PHE D 4 237 ? 1.132   3.287   4.792   1.00 22.92  ? 237 PHE B N     1 
ATOM   6712 C CA    . PHE D 4 237 ? 2.598   3.270   4.809   1.00 22.84  ? 237 PHE B CA    1 
ATOM   6713 C C     . PHE D 4 237 ? 3.104   2.044   5.532   1.00 22.72  ? 237 PHE B C     1 
ATOM   6714 O O     . PHE D 4 237 ? 4.285   1.733   5.480   1.00 25.11  ? 237 PHE B O     1 
ATOM   6715 C CB    . PHE D 4 237 ? 3.170   4.488   5.532   1.00 20.30  ? 237 PHE B CB    1 
ATOM   6716 C CG    . PHE D 4 237 ? 2.584   5.780   5.088   1.00 19.29  ? 237 PHE B CG    1 
ATOM   6717 C CD1   . PHE D 4 237 ? 1.700   6.470   5.910   1.00 18.85  ? 237 PHE B CD1   1 
ATOM   6718 C CD2   . PHE D 4 237 ? 2.880   6.293   3.837   1.00 20.51  ? 237 PHE B CD2   1 
ATOM   6719 C CE1   . PHE D 4 237 ? 1.118   7.647   5.489   1.00 17.24  ? 237 PHE B CE1   1 
ATOM   6720 C CE2   . PHE D 4 237 ? 2.301   7.473   3.404   1.00 18.10  ? 237 PHE B CE2   1 
ATOM   6721 C CZ    . PHE D 4 237 ? 1.417   8.152   4.233   1.00 18.54  ? 237 PHE B CZ    1 
ATOM   6722 N N     . LYS D 4 238 ? 2.191   1.349   6.192   1.00 23.17  ? 238 LYS B N     1 
ATOM   6723 C CA    . LYS D 4 238 ? 2.509   0.180   6.993   1.00 26.01  ? 238 LYS B CA    1 
ATOM   6724 C C     . LYS D 4 238 ? 3.525   -0.818  6.447   1.00 28.52  ? 238 LYS B C     1 
ATOM   6725 O O     . LYS D 4 238 ? 4.401   -1.277  7.177   1.00 28.77  ? 238 LYS B O     1 
ATOM   6726 C CB    . LYS D 4 238 ? 1.207   -0.538  7.336   1.00 27.83  ? 238 LYS B CB    1 
ATOM   6727 C CG    . LYS D 4 238 ? 1.334   -1.789  8.184   1.00 29.74  ? 238 LYS B CG    1 
ATOM   6728 C CD    . LYS D 4 238 ? -0.056  -2.349  8.457   1.00 32.55  ? 238 LYS B CD    1 
ATOM   6729 C CE    . LYS D 4 238 ? -0.016  -3.637  9.256   1.00 34.21  ? 238 LYS B CE    1 
ATOM   6730 N NZ    . LYS D 4 238 ? -1.404  -4.089  9.592   1.00 37.15  ? 238 LYS B NZ    1 
ATOM   6731 N N     . LYS D 4 239 ? 3.417   -1.153  5.170   1.00 31.08  ? 239 LYS B N     1 
ATOM   6732 C CA    . LYS D 4 239 ? 4.305   -2.141  4.574   1.00 33.92  ? 239 LYS B CA    1 
ATOM   6733 C C     . LYS D 4 239 ? 5.564   -1.572  3.954   1.00 36.06  ? 239 LYS B C     1 
ATOM   6734 O O     . LYS D 4 239 ? 6.302   -2.298  3.299   1.00 36.54  ? 239 LYS B O     1 
ATOM   6735 C CB    . LYS D 4 239 ? 3.548   -2.950  3.519   1.00 33.34  ? 239 LYS B CB    1 
ATOM   6736 C CG    . LYS D 4 239 ? 2.302   -3.648  4.045   1.00 32.85  ? 239 LYS B CG    1 
ATOM   6737 C CD    . LYS D 4 239 ? 2.638   -4.871  4.878   1.00 32.23  ? 239 LYS B CD    1 
ATOM   6738 C CE    . LYS D 4 239 ? 1.366   -5.501  5.425   1.00 35.55  ? 239 LYS B CE    1 
ATOM   6739 N NZ    . LYS D 4 239 ? 1.612   -6.772  6.160   1.00 34.27  ? 239 LYS B NZ    1 
ATOM   6740 N N     . ILE D 4 240 ? 5.810   -0.282  4.151   1.00 38.61  ? 240 ILE B N     1 
ATOM   6741 C CA    . ILE D 4 240 ? 7.005   0.340   3.594   1.00 41.85  ? 240 ILE B CA    1 
ATOM   6742 C C     . ILE D 4 240 ? 7.704   1.232   4.618   1.00 44.97  ? 240 ILE B C     1 
ATOM   6743 O O     . ILE D 4 240 ? 8.517   2.087   4.264   1.00 45.38  ? 240 ILE B O     1 
ATOM   6744 C CB    . ILE D 4 240 ? 6.666   1.174   2.338   1.00 42.03  ? 240 ILE B CB    1 
ATOM   6745 C CG1   . ILE D 4 240 ? 5.879   2.429   2.726   1.00 40.58  ? 240 ILE B CG1   1 
ATOM   6746 C CG2   . ILE D 4 240 ? 5.839   0.334   1.369   1.00 39.80  ? 240 ILE B CG2   1 
ATOM   6747 C CD1   . ILE D 4 240 ? 5.721   3.412   1.583   1.00 39.31  ? 240 ILE B CD1   1 
ATOM   6748 N N     . GLU D 4 241 ? 7.385   1.019   5.892   1.00 49.61  ? 241 GLU B N     1 
ATOM   6749 C CA    . GLU D 4 241 ? 7.977   1.790   6.981   1.00 53.80  ? 241 GLU B CA    1 
ATOM   6750 C C     . GLU D 4 241 ? 9.438   1.425   7.219   1.00 55.51  ? 241 GLU B C     1 
ATOM   6751 O O     . GLU D 4 241 ? 9.830   0.257   7.175   1.00 54.75  ? 241 GLU B O     1 
ATOM   6752 C CB    . GLU D 4 241 ? 7.187   1.584   8.282   1.00 55.77  ? 241 GLU B CB    1 
ATOM   6753 C CG    . GLU D 4 241 ? 5.831   2.272   8.308   1.00 58.73  ? 241 GLU B CG    1 
ATOM   6754 C CD    . GLU D 4 241 ? 5.939   3.763   8.571   1.00 60.96  ? 241 GLU B CD    1 
ATOM   6755 O OE1   . GLU D 4 241 ? 6.890   4.391   8.052   1.00 62.81  ? 241 GLU B OE1   1 
ATOM   6756 O OE2   . GLU D 4 241 ? 5.068   4.311   9.286   1.00 61.55  ? 241 GLU B OE2   1 
ATOM   6757 N N     . ARG D 4 242 ? 10.235  2.451   7.471   1.00 57.91  ? 242 ARG B N     1 
ATOM   6758 C CA    . ARG D 4 242 ? 11.652  2.293   7.729   1.00 60.87  ? 242 ARG B CA    1 
ATOM   6759 C C     . ARG D 4 242 ? 11.825  1.539   9.051   1.00 61.82  ? 242 ARG B C     1 
ATOM   6760 O O     . ARG D 4 242 ? 11.418  2.026   10.111  1.00 61.09  ? 242 ARG B O     1 
ATOM   6761 C CB    . ARG D 4 242 ? 12.275  3.683   7.805   1.00 63.03  ? 242 ARG B CB    1 
ATOM   6762 C CG    . ARG D 4 242 ? 13.776  3.744   7.913   1.00 66.40  ? 242 ARG B CG    1 
ATOM   6763 C CD    . ARG D 4 242 ? 14.208  5.198   7.783   1.00 69.78  ? 242 ARG B CD    1 
ATOM   6764 N NE    . ARG D 4 242 ? 15.621  5.404   8.085   1.00 72.24  ? 242 ARG B NE    1 
ATOM   6765 C CZ    . ARG D 4 242 ? 16.225  6.586   8.023   1.00 72.59  ? 242 ARG B CZ    1 
ATOM   6766 N NH1   . ARG D 4 242 ? 15.537  7.665   7.666   1.00 72.40  ? 242 ARG B NH1   1 
ATOM   6767 N NH2   . ARG D 4 242 ? 17.512  6.690   8.329   1.00 72.17  ? 242 ARG B NH2   1 
ATOM   6768 N N     . HIS D 4 243 ? 12.412  0.346   8.981   1.00 61.85  ? 243 HIS B N     1 
ATOM   6769 C CA    . HIS D 4 243 ? 12.637  -0.468  10.173  1.00 62.67  ? 243 HIS B CA    1 
ATOM   6770 C C     . HIS D 4 243 ? 13.679  0.194   11.079  1.00 61.98  ? 243 HIS B C     1 
ATOM   6771 O O     . HIS D 4 243 ? 14.669  0.757   10.607  1.00 61.29  ? 243 HIS B O     1 
ATOM   6772 C CB    . HIS D 4 243 ? 13.085  -1.873  9.766   1.00 65.50  ? 243 HIS B CB    1 
ATOM   6773 C CG    . HIS D 4 243 ? 12.094  -2.592  8.902   1.00 68.77  ? 243 HIS B CG    1 
ATOM   6774 N ND1   . HIS D 4 243 ? 11.582  -2.046  7.743   1.00 69.90  ? 243 HIS B ND1   1 
ATOM   6775 C CD2   . HIS D 4 243 ? 11.521  -3.813  9.026   1.00 69.90  ? 243 HIS B CD2   1 
ATOM   6776 C CE1   . HIS D 4 243 ? 10.737  -2.899  7.191   1.00 69.90  ? 243 HIS B CE1   1 
ATOM   6777 N NE2   . HIS D 4 243 ? 10.682  -3.979  7.949   1.00 70.52  ? 243 HIS B NE2   1 
ATOM   6778 N N     . SER D 4 244 ? 13.454  0.118   12.386  1.00 60.68  ? 244 SER B N     1 
ATOM   6779 C CA    . SER D 4 244 ? 14.347  0.755   13.347  1.00 58.61  ? 244 SER B CA    1 
ATOM   6780 C C     . SER D 4 244 ? 15.739  0.145   13.477  1.00 55.73  ? 244 SER B C     1 
ATOM   6781 O O     . SER D 4 244 ? 15.951  -1.042  13.229  1.00 54.76  ? 244 SER B O     1 
ATOM   6782 C CB    . SER D 4 244 ? 13.678  0.800   14.721  1.00 60.80  ? 244 SER B CB    1 
ATOM   6783 O OG    . SER D 4 244 ? 14.367  1.682   15.591  1.00 64.40  ? 244 SER B OG    1 
ATOM   6784 N N     . ILE D 4 245 ? 16.684  0.990   13.874  1.00 53.51  ? 245 ILE B N     1 
ATOM   6785 C CA    . ILE D 4 245 ? 18.077  0.594   14.066  1.00 51.04  ? 245 ILE B CA    1 
ATOM   6786 C C     . ILE D 4 245 ? 18.238  -0.048  15.442  1.00 47.66  ? 245 ILE B C     1 
ATOM   6787 O O     . ILE D 4 245 ? 17.644  0.414   16.417  1.00 46.09  ? 245 ILE B O     1 
ATOM   6788 C CB    . ILE D 4 245 ? 19.008  1.824   13.992  1.00 52.31  ? 245 ILE B CB    1 
ATOM   6789 C CG1   . ILE D 4 245 ? 18.922  2.468   12.601  1.00 54.05  ? 245 ILE B CG1   1 
ATOM   6790 C CG2   . ILE D 4 245 ? 20.427  1.423   14.344  1.00 53.76  ? 245 ILE B CG2   1 
ATOM   6791 C CD1   . ILE D 4 245 ? 19.337  1.551   11.453  1.00 54.44  ? 245 ILE B CD1   1 
ATOM   6792 N N     . HIS D 4 246 ? 19.040  -1.104  15.527  1.00 44.17  ? 246 HIS B N     1 
ATOM   6793 C CA    . HIS D 4 246 ? 19.246  -1.767  16.806  1.00 41.10  ? 246 HIS B CA    1 
ATOM   6794 C C     . HIS D 4 246 ? 20.451  -1.174  17.523  1.00 39.21  ? 246 HIS B C     1 
ATOM   6795 O O     . HIS D 4 246 ? 21.338  -0.599  16.897  1.00 39.42  ? 246 HIS B O     1 
ATOM   6796 C CB    . HIS D 4 246 ? 19.440  -3.273  16.612  1.00 41.96  ? 246 HIS B CB    1 
ATOM   6797 C CG    . HIS D 4 246 ? 20.847  -3.673  16.296  1.00 42.53  ? 246 HIS B CG    1 
ATOM   6798 N ND1   . HIS D 4 246 ? 21.521  -3.219  15.183  1.00 43.99  ? 246 HIS B ND1   1 
ATOM   6799 C CD2   . HIS D 4 246 ? 21.707  -4.487  16.952  1.00 42.72  ? 246 HIS B CD2   1 
ATOM   6800 C CE1   . HIS D 4 246 ? 22.737  -3.735  15.167  1.00 44.29  ? 246 HIS B CE1   1 
ATOM   6801 N NE2   . HIS D 4 246 ? 22.876  -4.508  16.230  1.00 43.62  ? 246 HIS B NE2   1 
ATOM   6802 N N     . TRP D 4 247 ? 20.464  -1.310  18.842  1.00 37.34  ? 247 TRP B N     1 
ATOM   6803 C CA    . TRP D 4 247 ? 21.545  -0.794  19.678  1.00 35.36  ? 247 TRP B CA    1 
ATOM   6804 C C     . TRP D 4 247 ? 22.135  -1.987  20.438  1.00 34.54  ? 247 TRP B C     1 
ATOM   6805 O O     . TRP D 4 247 ? 21.479  -2.556  21.308  1.00 34.97  ? 247 TRP B O     1 
ATOM   6806 C CB    . TRP D 4 247 ? 20.974  0.245   20.656  1.00 31.76  ? 247 TRP B CB    1 
ATOM   6807 C CG    . TRP D 4 247 ? 21.945  0.783   21.659  1.00 30.27  ? 247 TRP B CG    1 
ATOM   6808 C CD1   . TRP D 4 247 ? 22.936  1.694   21.433  1.00 29.91  ? 247 TRP B CD1   1 
ATOM   6809 C CD2   . TRP D 4 247 ? 22.020  0.444   23.057  1.00 29.27  ? 247 TRP B CD2   1 
ATOM   6810 N NE1   . TRP D 4 247 ? 23.624  1.944   22.601  1.00 28.62  ? 247 TRP B NE1   1 
ATOM   6811 C CE2   . TRP D 4 247 ? 23.084  1.192   23.611  1.00 26.62  ? 247 TRP B CE2   1 
ATOM   6812 C CE3   . TRP D 4 247 ? 21.290  -0.419  23.893  1.00 28.15  ? 247 TRP B CE3   1 
ATOM   6813 C CZ2   . TRP D 4 247 ? 23.442  1.107   24.966  1.00 26.51  ? 247 TRP B CZ2   1 
ATOM   6814 C CZ3   . TRP D 4 247 ? 21.646  -0.505  25.249  1.00 27.19  ? 247 TRP B CZ3   1 
ATOM   6815 C CH2   . TRP D 4 247 ? 22.716  0.256   25.766  1.00 26.68  ? 247 TRP B CH2   1 
ATOM   6816 N N     . PRO D 4 248 ? 23.377  -2.385  20.107  1.00 34.39  ? 248 PRO B N     1 
ATOM   6817 C CA    . PRO D 4 248 ? 24.086  -3.512  20.734  1.00 33.08  ? 248 PRO B CA    1 
ATOM   6818 C C     . PRO D 4 248 ? 24.694  -3.149  22.080  1.00 32.22  ? 248 PRO B C     1 
ATOM   6819 O O     . PRO D 4 248 ? 25.198  -2.040  22.256  1.00 32.67  ? 248 PRO B O     1 
ATOM   6820 C CB    . PRO D 4 248 ? 25.182  -3.853  19.725  1.00 32.41  ? 248 PRO B CB    1 
ATOM   6821 C CG    . PRO D 4 248 ? 24.793  -3.113  18.464  1.00 36.28  ? 248 PRO B CG    1 
ATOM   6822 C CD    . PRO D 4 248 ? 24.160  -1.859  18.983  1.00 35.55  ? 248 PRO B CD    1 
ATOM   6823 N N     . CYS D 4 249 ? 24.653  -4.085  23.024  1.00 31.73  ? 249 CYS B N     1 
ATOM   6824 C CA    . CYS D 4 249 ? 25.225  -3.864  24.350  1.00 31.41  ? 249 CYS B CA    1 
ATOM   6825 C C     . CYS D 4 249 ? 25.069  -5.127  25.175  1.00 31.81  ? 249 CYS B C     1 
ATOM   6826 O O     . CYS D 4 249 ? 24.480  -6.099  24.721  1.00 34.76  ? 249 CYS B O     1 
ATOM   6827 C CB    . CYS D 4 249 ? 24.532  -2.691  25.055  1.00 31.35  ? 249 CYS B CB    1 
ATOM   6828 S SG    . CYS D 4 249 ? 25.554  -1.865  26.324  1.00 35.98  ? 249 CYS B SG    1 
ATOM   6829 N N     . ARG D 4 250 ? 25.605  -5.124  26.386  1.00 32.92  ? 250 ARG B N     1 
ATOM   6830 C CA    . ARG D 4 250 ? 25.497  -6.286  27.249  1.00 32.99  ? 250 ARG B CA    1 
ATOM   6831 C C     . ARG D 4 250 ? 24.799  -5.894  28.541  1.00 32.46  ? 250 ARG B C     1 
ATOM   6832 O O     . ARG D 4 250 ? 25.134  -4.883  29.148  1.00 34.06  ? 250 ARG B O     1 
ATOM   6833 C CB    . ARG D 4 250 ? 26.891  -6.851  27.561  1.00 35.97  ? 250 ARG B CB    1 
ATOM   6834 C CG    . ARG D 4 250 ? 27.583  -7.572  26.392  1.00 40.78  ? 250 ARG B CG    1 
ATOM   6835 C CD    . ARG D 4 250 ? 27.728  -6.685  25.145  1.00 44.55  ? 250 ARG B CD    1 
ATOM   6836 N NE    . ARG D 4 250 ? 28.213  -7.435  23.981  1.00 50.56  ? 250 ARG B NE    1 
ATOM   6837 C CZ    . ARG D 4 250 ? 28.270  -6.958  22.736  1.00 52.49  ? 250 ARG B CZ    1 
ATOM   6838 N NH1   . ARG D 4 250 ? 27.871  -5.716  22.470  1.00 53.51  ? 250 ARG B NH1   1 
ATOM   6839 N NH2   . ARG D 4 250 ? 28.728  -7.725  21.750  1.00 51.96  ? 250 ARG B NH2   1 
ATOM   6840 N N     . LEU D 4 251 ? 23.807  -6.675  28.948  1.00 30.70  ? 251 LEU B N     1 
ATOM   6841 C CA    . LEU D 4 251 ? 23.109  -6.403  30.196  1.00 29.83  ? 251 LEU B CA    1 
ATOM   6842 C C     . LEU D 4 251 ? 23.947  -7.129  31.237  1.00 29.77  ? 251 LEU B C     1 
ATOM   6843 O O     . LEU D 4 251 ? 24.102  -8.341  31.175  1.00 29.44  ? 251 LEU B O     1 
ATOM   6844 C CB    . LEU D 4 251 ? 21.682  -6.963  30.154  1.00 28.94  ? 251 LEU B CB    1 
ATOM   6845 C CG    . LEU D 4 251 ? 20.813  -6.920  31.416  1.00 29.66  ? 251 LEU B CG    1 
ATOM   6846 C CD1   . LEU D 4 251 ? 19.350  -6.999  31.032  1.00 29.14  ? 251 LEU B CD1   1 
ATOM   6847 C CD2   . LEU D 4 251 ? 21.181  -8.069  32.342  1.00 29.35  ? 251 LEU B CD2   1 
ATOM   6848 N N     . THR D 4 252 ? 24.504  -6.381  32.182  1.00 29.72  ? 252 THR B N     1 
ATOM   6849 C CA    . THR D 4 252 ? 25.354  -6.969  33.206  1.00 28.49  ? 252 THR B CA    1 
ATOM   6850 C C     . THR D 4 252 ? 24.730  -7.028  34.594  1.00 29.12  ? 252 THR B C     1 
ATOM   6851 O O     . THR D 4 252 ? 24.045  -6.098  35.027  1.00 28.74  ? 252 THR B O     1 
ATOM   6852 C CB    . THR D 4 252 ? 26.686  -6.193  33.315  1.00 28.62  ? 252 THR B CB    1 
ATOM   6853 O OG1   . THR D 4 252 ? 26.410  -4.798  33.518  1.00 31.13  ? 252 THR B OG1   1 
ATOM   6854 C CG2   . THR D 4 252 ? 27.511  -6.355  32.044  1.00 25.26  ? 252 THR B CG2   1 
ATOM   6855 N N     . ILE D 4 253 ? 24.962  -8.151  35.270  1.00 28.92  ? 253 ILE B N     1 
ATOM   6856 C CA    . ILE D 4 253 ? 24.502  -8.382  36.638  1.00 27.21  ? 253 ILE B CA    1 
ATOM   6857 C C     . ILE D 4 253 ? 25.792  -8.757  37.372  1.00 28.78  ? 253 ILE B C     1 
ATOM   6858 O O     . ILE D 4 253 ? 26.263  -9.898  37.290  1.00 27.70  ? 253 ILE B O     1 
ATOM   6859 C CB    . ILE D 4 253 ? 23.519  -9.558  36.727  1.00 26.12  ? 253 ILE B CB    1 
ATOM   6860 C CG1   . ILE D 4 253 ? 22.275  -9.265  35.882  1.00 26.43  ? 253 ILE B CG1   1 
ATOM   6861 C CG2   . ILE D 4 253 ? 23.158  -9.817  38.184  1.00 25.10  ? 253 ILE B CG2   1 
ATOM   6862 C CD1   . ILE D 4 253 ? 21.169  -10.293 36.032  1.00 21.27  ? 253 ILE B CD1   1 
ATOM   6863 N N     . GLY D 4 254 ? 26.367  -7.790  38.077  1.00 28.23  ? 254 GLY B N     1 
ATOM   6864 C CA    . GLY D 4 254 ? 27.620  -8.038  38.760  1.00 30.38  ? 254 GLY B CA    1 
ATOM   6865 C C     . GLY D 4 254 ? 28.671  -7.827  37.690  1.00 33.14  ? 254 GLY B C     1 
ATOM   6866 O O     . GLY D 4 254 ? 28.465  -7.014  36.790  1.00 34.21  ? 254 GLY B O     1 
ATOM   6867 N N     . SER D 4 255 ? 29.786  -8.544  37.757  1.00 34.95  ? 255 SER B N     1 
ATOM   6868 C CA    . SER D 4 255 ? 30.816  -8.383  36.739  1.00 35.69  ? 255 SER B CA    1 
ATOM   6869 C C     . SER D 4 255 ? 31.166  -9.714  36.096  1.00 36.84  ? 255 SER B C     1 
ATOM   6870 O O     . SER D 4 255 ? 32.044  -9.778  35.231  1.00 37.06  ? 255 SER B O     1 
ATOM   6871 C CB    . SER D 4 255 ? 32.076  -7.758  37.334  1.00 36.98  ? 255 SER B CB    1 
ATOM   6872 O OG    . SER D 4 255 ? 32.633  -8.594  38.324  1.00 40.47  ? 255 SER B OG    1 
ATOM   6873 N N     . ASN D 4 256 ? 30.469  -10.769 36.512  1.00 34.94  ? 256 ASN B N     1 
ATOM   6874 C CA    . ASN D 4 256 ? 30.710  -12.098 35.970  1.00 36.42  ? 256 ASN B CA    1 
ATOM   6875 C C     . ASN D 4 256 ? 29.550  -12.641 35.132  1.00 37.91  ? 256 ASN B C     1 
ATOM   6876 O O     . ASN D 4 256 ? 29.656  -13.727 34.545  1.00 39.27  ? 256 ASN B O     1 
ATOM   6877 C CB    . ASN D 4 256 ? 31.030  -13.073 37.104  1.00 36.23  ? 256 ASN B CB    1 
ATOM   6878 C CG    . ASN D 4 256 ? 32.328  -12.731 37.813  1.00 34.79  ? 256 ASN B CG    1 
ATOM   6879 O OD1   . ASN D 4 256 ? 33.374  -12.593 37.177  1.00 35.16  ? 256 ASN B OD1   1 
ATOM   6880 N ND2   . ASN D 4 256 ? 32.267  -12.593 39.132  1.00 32.66  ? 256 ASN B ND2   1 
ATOM   6881 N N     . LEU D 4 257 ? 28.451  -11.890 35.079  1.00 35.49  ? 257 LEU B N     1 
ATOM   6882 C CA    . LEU D 4 257 ? 27.291  -12.295 34.301  1.00 33.81  ? 257 LEU B CA    1 
ATOM   6883 C C     . LEU D 4 257 ? 26.942  -11.230 33.273  1.00 33.48  ? 257 LEU B C     1 
ATOM   6884 O O     . LEU D 4 257 ? 26.519  -10.126 33.609  1.00 34.18  ? 257 LEU B O     1 
ATOM   6885 C CB    . LEU D 4 257 ? 26.091  -12.553 35.209  1.00 33.35  ? 257 LEU B CB    1 
ATOM   6886 C CG    . LEU D 4 257 ? 24.833  -13.034 34.477  1.00 33.33  ? 257 LEU B CG    1 
ATOM   6887 C CD1   . LEU D 4 257 ? 25.169  -14.241 33.600  1.00 31.57  ? 257 LEU B CD1   1 
ATOM   6888 C CD2   . LEU D 4 257 ? 23.755  -13.392 35.496  1.00 31.11  ? 257 LEU B CD2   1 
ATOM   6889 N N     . SER D 4 258 ? 27.129  -11.583 32.009  1.00 34.34  ? 258 SER B N     1 
ATOM   6890 C CA    . SER D 4 258 ? 26.863  -10.694 30.889  1.00 32.79  ? 258 SER B CA    1 
ATOM   6891 C C     . SER D 4 258 ? 25.800  -11.335 29.991  1.00 31.67  ? 258 SER B C     1 
ATOM   6892 O O     . SER D 4 258 ? 25.716  -12.551 29.888  1.00 32.56  ? 258 SER B O     1 
ATOM   6893 C CB    . SER D 4 258 ? 28.163  -10.473 30.110  1.00 33.22  ? 258 SER B CB    1 
ATOM   6894 O OG    . SER D 4 258 ? 27.990  -9.598  29.013  1.00 38.72  ? 258 SER B OG    1 
ATOM   6895 N N     . ILE D 4 259 ? 24.972  -10.511 29.363  1.00 29.41  ? 259 ILE B N     1 
ATOM   6896 C CA    . ILE D 4 259 ? 23.928  -11.003 28.471  1.00 25.59  ? 259 ILE B CA    1 
ATOM   6897 C C     . ILE D 4 259 ? 23.860  -10.075 27.272  1.00 24.40  ? 259 ILE B C     1 
ATOM   6898 O O     . ILE D 4 259 ? 23.547  -8.891  27.408  1.00 25.56  ? 259 ILE B O     1 
ATOM   6899 C CB    . ILE D 4 259 ? 22.551  -11.020 29.159  1.00 22.76  ? 259 ILE B CB    1 
ATOM   6900 C CG1   . ILE D 4 259 ? 22.547  -12.033 30.293  1.00 22.90  ? 259 ILE B CG1   1 
ATOM   6901 C CG2   . ILE D 4 259 ? 21.477  -11.382 28.162  1.00 20.94  ? 259 ILE B CG2   1 
ATOM   6902 C CD1   . ILE D 4 259 ? 21.240  -12.069 31.061  1.00 25.17  ? 259 ILE B CD1   1 
ATOM   6903 N N     . ARG D 4 260 ? 24.164  -10.609 26.099  1.00 23.43  ? 260 ARG B N     1 
ATOM   6904 C CA    . ARG D 4 260 ? 24.129  -9.808  24.890  1.00 23.20  ? 260 ARG B CA    1 
ATOM   6905 C C     . ARG D 4 260 ? 22.693  -9.430  24.569  1.00 22.52  ? 260 ARG B C     1 
ATOM   6906 O O     . ARG D 4 260 ? 21.818  -10.285 24.488  1.00 21.62  ? 260 ARG B O     1 
ATOM   6907 C CB    . ARG D 4 260 ? 24.752  -10.578 23.725  1.00 25.44  ? 260 ARG B CB    1 
ATOM   6908 C CG    . ARG D 4 260 ? 26.232  -10.895 23.915  1.00 28.62  ? 260 ARG B CG    1 
ATOM   6909 C CD    . ARG D 4 260 ? 26.955  -10.769 22.588  1.00 32.27  ? 260 ARG B CD    1 
ATOM   6910 N NE    . ARG D 4 260 ? 26.301  -11.591 21.579  1.00 37.18  ? 260 ARG B NE    1 
ATOM   6911 C CZ    . ARG D 4 260 ? 26.322  -11.341 20.276  1.00 38.96  ? 260 ARG B CZ    1 
ATOM   6912 N NH1   . ARG D 4 260 ? 26.974  -10.281 19.809  1.00 39.28  ? 260 ARG B NH1   1 
ATOM   6913 N NH2   . ARG D 4 260 ? 25.677  -12.148 19.443  1.00 39.05  ? 260 ARG B NH2   1 
ATOM   6914 N N     . ILE D 4 261 ? 22.457  -8.138  24.384  1.00 20.88  ? 261 ILE B N     1 
ATOM   6915 C CA    . ILE D 4 261 ? 21.119  -7.645  24.101  1.00 20.35  ? 261 ILE B CA    1 
ATOM   6916 C C     . ILE D 4 261 ? 21.130  -6.648  22.948  1.00 20.27  ? 261 ILE B C     1 
ATOM   6917 O O     . ILE D 4 261 ? 22.184  -6.168  22.531  1.00 22.04  ? 261 ILE B O     1 
ATOM   6918 C CB    . ILE D 4 261 ? 20.525  -6.938  25.352  1.00 20.71  ? 261 ILE B CB    1 
ATOM   6919 C CG1   . ILE D 4 261 ? 21.425  -5.764  25.757  1.00 19.22  ? 261 ILE B CG1   1 
ATOM   6920 C CG2   . ILE D 4 261 ? 20.421  -7.909  26.514  1.00 17.38  ? 261 ILE B CG2   1 
ATOM   6921 C CD1   . ILE D 4 261 ? 20.967  -5.046  27.000  1.00 25.24  ? 261 ILE B CD1   1 
ATOM   6922 N N     . ALA D 4 262 ? 19.951  -6.356  22.421  1.00 20.44  ? 262 ALA B N     1 
ATOM   6923 C CA    . ALA D 4 262 ? 19.817  -5.378  21.346  1.00 21.89  ? 262 ALA B CA    1 
ATOM   6924 C C     . ALA D 4 262 ? 18.604  -4.564  21.707  1.00 19.61  ? 262 ALA B C     1 
ATOM   6925 O O     . ALA D 4 262 ? 17.548  -5.119  21.974  1.00 20.29  ? 262 ALA B O     1 
ATOM   6926 C CB    . ALA D 4 262 ? 19.598  -6.059  19.994  1.00 22.15  ? 262 ALA B CB    1 
ATOM   6927 N N     . ALA D 4 263 ? 18.753  -3.251  21.728  1.00 19.46  ? 263 ALA B N     1 
ATOM   6928 C CA    . ALA D 4 263 ? 17.628  -2.394  22.067  1.00 22.10  ? 263 ALA B CA    1 
ATOM   6929 C C     . ALA D 4 263 ? 17.103  -1.625  20.858  1.00 23.14  ? 263 ALA B C     1 
ATOM   6930 O O     . ALA D 4 263 ? 17.859  -1.230  19.967  1.00 22.18  ? 263 ALA B O     1 
ATOM   6931 C CB    . ALA D 4 263 ? 18.026  -1.417  23.181  1.00 19.11  ? 263 ALA B CB    1 
ATOM   6932 N N     . TYR D 4 264 ? 15.792  -1.425  20.838  1.00 24.72  ? 264 TYR B N     1 
ATOM   6933 C CA    . TYR D 4 264 ? 15.138  -0.679  19.772  1.00 26.24  ? 264 TYR B CA    1 
ATOM   6934 C C     . TYR D 4 264 ? 14.246  0.350   20.464  1.00 24.91  ? 264 TYR B C     1 
ATOM   6935 O O     . TYR D 4 264 ? 13.765  0.112   21.565  1.00 27.62  ? 264 TYR B O     1 
ATOM   6936 C CB    . TYR D 4 264 ? 14.269  -1.608  18.904  1.00 26.84  ? 264 TYR B CB    1 
ATOM   6937 C CG    . TYR D 4 264 ? 14.997  -2.831  18.366  1.00 31.93  ? 264 TYR B CG    1 
ATOM   6938 C CD1   . TYR D 4 264 ? 15.245  -3.937  19.184  1.00 32.93  ? 264 TYR B CD1   1 
ATOM   6939 C CD2   . TYR D 4 264 ? 15.459  -2.873  17.046  1.00 32.24  ? 264 TYR B CD2   1 
ATOM   6940 C CE1   . TYR D 4 264 ? 15.934  -5.051  18.705  1.00 32.89  ? 264 TYR B CE1   1 
ATOM   6941 C CE2   . TYR D 4 264 ? 16.149  -3.981  16.560  1.00 33.31  ? 264 TYR B CE2   1 
ATOM   6942 C CZ    . TYR D 4 264 ? 16.383  -5.064  17.396  1.00 34.71  ? 264 TYR B CZ    1 
ATOM   6943 O OH    . TYR D 4 264 ? 17.079  -6.161  16.931  1.00 40.06  ? 264 TYR B OH    1 
ATOM   6944 N N     . LYS D 4 265 ? 14.034  1.496   19.835  1.00 24.32  ? 265 LYS B N     1 
ATOM   6945 C CA    . LYS D 4 265 ? 13.162  2.499   20.417  1.00 25.22  ? 265 LYS B CA    1 
ATOM   6946 C C     . LYS D 4 265 ? 11.715  2.225   20.011  1.00 24.11  ? 265 LYS B C     1 
ATOM   6947 O O     . LYS D 4 265 ? 11.381  2.275   18.836  1.00 25.49  ? 265 LYS B O     1 
ATOM   6948 C CB    . LYS D 4 265 ? 13.594  3.893   19.964  1.00 24.41  ? 265 LYS B CB    1 
ATOM   6949 C CG    . LYS D 4 265 ? 14.992  4.222   20.434  1.00 26.76  ? 265 LYS B CG    1 
ATOM   6950 C CD    . LYS D 4 265 ? 15.456  5.604   20.024  1.00 31.26  ? 265 LYS B CD    1 
ATOM   6951 C CE    . LYS D 4 265 ? 16.903  5.803   20.465  1.00 32.96  ? 265 LYS B CE    1 
ATOM   6952 N NZ    . LYS D 4 265 ? 17.361  7.202   20.281  1.00 38.07  ? 265 LYS B NZ    1 
ATOM   6953 N N     . SER D 4 266 ? 10.875  1.915   20.995  1.00 23.85  ? 266 SER B N     1 
ATOM   6954 C CA    . SER D 4 266 ? 9.450   1.638   20.784  1.00 24.16  ? 266 SER B CA    1 
ATOM   6955 C C     . SER D 4 266 ? 8.631   2.909   20.601  1.00 23.68  ? 266 SER B C     1 
ATOM   6956 O O     . SER D 4 266 ? 7.775   2.997   19.718  1.00 22.38  ? 266 SER B O     1 
ATOM   6957 C CB    . SER D 4 266 ? 8.880   0.883   21.979  1.00 23.23  ? 266 SER B CB    1 
ATOM   6958 O OG    . SER D 4 266 ? 9.203   -0.475  21.888  1.00 27.29  ? 266 SER B OG    1 
ATOM   6959 N N     . ILE D 4 267 ? 8.876   3.876   21.477  1.00 23.24  ? 267 ILE B N     1 
ATOM   6960 C CA    . ILE D 4 267 ? 8.182   5.149   21.422  1.00 22.63  ? 267 ILE B CA    1 
ATOM   6961 C C     . ILE D 4 267 ? 9.233   6.233   21.267  1.00 22.55  ? 267 ILE B C     1 
ATOM   6962 O O     . ILE D 4 267 ? 10.224  6.249   21.976  1.00 22.27  ? 267 ILE B O     1 
ATOM   6963 C CB    . ILE D 4 267 ? 7.378   5.421   22.716  1.00 21.05  ? 267 ILE B CB    1 
ATOM   6964 C CG1   . ILE D 4 267 ? 6.466   4.230   23.044  1.00 18.43  ? 267 ILE B CG1   1 
ATOM   6965 C CG2   . ILE D 4 267 ? 6.567   6.700   22.555  1.00 17.76  ? 267 ILE B CG2   1 
ATOM   6966 C CD1   . ILE D 4 267 ? 5.315   4.014   22.068  1.00 17.34  ? 267 ILE B CD1   1 
ATOM   6967 N N     . LEU D 4 268 ? 9.018   7.120   20.311  1.00 24.55  ? 268 LEU B N     1 
ATOM   6968 C CA    . LEU D 4 268 ? 9.921   8.232   20.058  1.00 26.25  ? 268 LEU B CA    1 
ATOM   6969 C C     . LEU D 4 268 ? 9.125   9.238   19.247  1.00 27.80  ? 268 LEU B C     1 
ATOM   6970 O O     . LEU D 4 268 ? 8.703   8.949   18.122  1.00 28.57  ? 268 LEU B O     1 
ATOM   6971 C CB    . LEU D 4 268 ? 11.147  7.782   19.264  1.00 24.37  ? 268 LEU B CB    1 
ATOM   6972 C CG    . LEU D 4 268 ? 12.121  8.924   18.957  1.00 25.65  ? 268 LEU B CG    1 
ATOM   6973 C CD1   . LEU D 4 268 ? 12.584  9.563   20.254  1.00 26.59  ? 268 LEU B CD1   1 
ATOM   6974 C CD2   . LEU D 4 268 ? 13.318  8.407   18.173  1.00 25.64  ? 268 LEU B CD2   1 
ATOM   6975 N N     . GLN D 4 269 ? 8.911   10.415  19.820  1.00 29.06  ? 269 GLN B N     1 
ATOM   6976 C CA    . GLN D 4 269 ? 8.141   11.439  19.142  1.00 30.73  ? 269 GLN B CA    1 
ATOM   6977 C C     . GLN D 4 269 ? 8.663   11.756  17.746  1.00 30.73  ? 269 GLN B C     1 
ATOM   6978 O O     . GLN D 4 269 ? 9.841   12.036  17.551  1.00 29.98  ? 269 GLN B O     1 
ATOM   6979 C CB    . GLN D 4 269 ? 8.086   12.717  19.981  1.00 32.50  ? 269 GLN B CB    1 
ATOM   6980 C CG    . GLN D 4 269 ? 7.107   13.739  19.434  1.00 37.18  ? 269 GLN B CG    1 
ATOM   6981 C CD    . GLN D 4 269 ? 6.774   14.814  20.436  1.00 40.34  ? 269 GLN B CD    1 
ATOM   6982 O OE1   . GLN D 4 269 ? 6.853   14.591  21.649  1.00 43.50  ? 269 GLN B OE1   1 
ATOM   6983 N NE2   . GLN D 4 269 ? 6.374   15.984  19.943  1.00 39.09  ? 269 GLN B NE2   1 
ATOM   6984 N N     . GLU D 4 270 ? 7.760   11.682  16.779  1.00 32.07  ? 270 GLU B N     1 
ATOM   6985 C CA    . GLU D 4 270 ? 8.068   11.968  15.393  1.00 34.11  ? 270 GLU B CA    1 
ATOM   6986 C C     . GLU D 4 270 ? 8.071   13.493  15.275  1.00 35.71  ? 270 GLU B C     1 
ATOM   6987 O O     . GLU D 4 270 ? 7.198   14.171  15.814  1.00 33.83  ? 270 GLU B O     1 
ATOM   6988 C CB    . GLU D 4 270 ? 6.995   11.336  14.504  1.00 34.36  ? 270 GLU B CB    1 
ATOM   6989 C CG    . GLU D 4 270 ? 7.108   11.615  13.017  1.00 38.83  ? 270 GLU B CG    1 
ATOM   6990 C CD    . GLU D 4 270 ? 8.444   11.204  12.411  1.00 42.56  ? 270 GLU B CD    1 
ATOM   6991 O OE1   . GLU D 4 270 ? 9.099   10.267  12.925  1.00 41.42  ? 270 GLU B OE1   1 
ATOM   6992 O OE2   . GLU D 4 270 ? 8.828   11.817  11.392  1.00 46.07  ? 270 GLU B OE2   1 
ATOM   6993 N N     . ARG D 4 271 ? 9.069   14.029  14.585  1.00 37.84  ? 271 ARG B N     1 
ATOM   6994 C CA    . ARG D 4 271 ? 9.191   15.474  14.426  1.00 40.75  ? 271 ARG B CA    1 
ATOM   6995 C C     . ARG D 4 271 ? 9.338   15.832  12.966  1.00 40.96  ? 271 ARG B C     1 
ATOM   6996 O O     . ARG D 4 271 ? 9.648   14.976  12.143  1.00 42.71  ? 271 ARG B O     1 
ATOM   6997 C CB    . ARG D 4 271 ? 10.418  15.967  15.183  1.00 42.41  ? 271 ARG B CB    1 
ATOM   6998 C CG    . ARG D 4 271 ? 10.448  15.522  16.627  1.00 46.85  ? 271 ARG B CG    1 
ATOM   6999 C CD    . ARG D 4 271 ? 11.763  15.858  17.293  1.00 49.61  ? 271 ARG B CD    1 
ATOM   7000 N NE    . ARG D 4 271 ? 11.692  15.605  18.728  1.00 52.63  ? 271 ARG B NE    1 
ATOM   7001 C CZ    . ARG D 4 271 ? 10.893  16.266  19.560  1.00 54.46  ? 271 ARG B CZ    1 
ATOM   7002 N NH1   . ARG D 4 271 ? 10.098  17.222  19.095  1.00 55.25  ? 271 ARG B NH1   1 
ATOM   7003 N NH2   . ARG D 4 271 ? 10.888  15.974  20.855  1.00 54.62  ? 271 ARG B NH2   1 
ATOM   7004 N N     . VAL D 4 272 ? 9.109   17.094  12.635  1.00 42.41  ? 272 VAL B N     1 
ATOM   7005 C CA    . VAL D 4 272 ? 9.273   17.522  11.252  1.00 44.52  ? 272 VAL B CA    1 
ATOM   7006 C C     . VAL D 4 272 ? 10.773  17.461  10.941  1.00 46.34  ? 272 VAL B C     1 
ATOM   7007 O O     . VAL D 4 272 ? 11.603  17.782  11.794  1.00 45.73  ? 272 VAL B O     1 
ATOM   7008 C CB    . VAL D 4 272 ? 8.775   18.962  11.046  1.00 44.08  ? 272 VAL B CB    1 
ATOM   7009 C CG1   . VAL D 4 272 ? 8.924   19.354  9.589   1.00 44.76  ? 272 VAL B CG1   1 
ATOM   7010 C CG2   . VAL D 4 272 ? 7.323   19.077  11.492  1.00 42.78  ? 272 VAL B CG2   1 
ATOM   7011 N N     . LYS D 4 273 ? 11.121  17.029  9.732   1.00 48.04  ? 273 LYS B N     1 
ATOM   7012 C CA    . LYS D 4 273 ? 12.525  16.938  9.339   1.00 49.59  ? 273 LYS B CA    1 
ATOM   7013 C C     . LYS D 4 273 ? 13.019  18.199  8.641   1.00 49.18  ? 273 LYS B C     1 
ATOM   7014 O O     . LYS D 4 273 ? 14.125  18.666  8.891   1.00 48.45  ? 273 LYS B O     1 
ATOM   7015 C CB    . LYS D 4 273 ? 12.747  15.746  8.404   1.00 52.90  ? 273 LYS B CB    1 
ATOM   7016 C CG    . LYS D 4 273 ? 13.103  14.441  9.100   1.00 56.75  ? 273 LYS B CG    1 
ATOM   7017 C CD    . LYS D 4 273 ? 11.900  13.777  9.758   1.00 59.21  ? 273 LYS B CD    1 
ATOM   7018 C CE    . LYS D 4 273 ? 12.305  12.427  10.344  1.00 59.81  ? 273 LYS B CE    1 
ATOM   7019 N NZ    . LYS D 4 273 ? 11.139  11.585  10.717  1.00 59.17  ? 273 LYS B NZ    1 
ATOM   7020 N N     . LYS D 4 274 ? 12.193  18.743  7.757   1.00 48.83  ? 274 LYS B N     1 
ATOM   7021 C CA    . LYS D 4 274 ? 12.561  19.937  7.018   1.00 47.96  ? 274 LYS B CA    1 
ATOM   7022 C C     . LYS D 4 274 ? 12.449  21.180  7.890   1.00 47.18  ? 274 LYS B C     1 
ATOM   7023 O O     . LYS D 4 274 ? 11.466  21.382  8.590   1.00 47.38  ? 274 LYS B O     1 
ATOM   7024 C CB    . LYS D 4 274 ? 11.664  20.088  5.787   1.00 48.45  ? 274 LYS B CB    1 
ATOM   7025 C CG    . LYS D 4 274 ? 12.388  20.600  4.551   1.00 48.81  ? 274 LYS B CG    1 
ATOM   7026 C CD    . LYS D 4 274 ? 13.484  19.638  4.131   1.00 47.30  ? 274 LYS B CD    1 
ATOM   7027 C CE    . LYS D 4 274 ? 14.154  20.105  2.861   1.00 47.63  ? 274 LYS B CE    1 
ATOM   7028 N NZ    . LYS D 4 274 ? 13.151  20.277  1.785   1.00 48.02  ? 274 LYS B NZ    1 
ATOM   7029 N N     . THR D 4 275 ? 13.476  22.011  7.840   1.00 47.32  ? 275 THR B N     1 
ATOM   7030 C CA    . THR D 4 275 ? 13.504  23.245  8.609   1.00 46.41  ? 275 THR B CA    1 
ATOM   7031 C C     . THR D 4 275 ? 13.150  24.378  7.651   1.00 45.77  ? 275 THR B C     1 
ATOM   7032 O O     . THR D 4 275 ? 13.296  24.234  6.438   1.00 45.90  ? 275 THR B O     1 
ATOM   7033 C CB    . THR D 4 275 ? 14.919  23.513  9.168   1.00 46.66  ? 275 THR B CB    1 
ATOM   7034 O OG1   . THR D 4 275 ? 15.809  23.796  8.081   1.00 45.49  ? 275 THR B OG1   1 
ATOM   7035 C CG2   . THR D 4 275 ? 15.443  22.290  9.921   1.00 45.49  ? 275 THR B CG2   1 
ATOM   7036 N N     . TRP D 4 276 ? 12.666  25.493  8.180   1.00 44.42  ? 276 TRP B N     1 
ATOM   7037 C CA    . TRP D 4 276 ? 12.353  26.622  7.320   1.00 44.92  ? 276 TRP B CA    1 
ATOM   7038 C C     . TRP D 4 276 ? 13.609  27.488  7.250   1.00 46.25  ? 276 TRP B C     1 
ATOM   7039 O O     . TRP D 4 276 ? 14.183  27.846  8.280   1.00 46.98  ? 276 TRP B O     1 
ATOM   7040 C CB    . TRP D 4 276 ? 11.194  27.448  7.879   1.00 42.85  ? 276 TRP B CB    1 
ATOM   7041 C CG    . TRP D 4 276 ? 9.839   26.799  7.770   1.00 42.56  ? 276 TRP B CG    1 
ATOM   7042 C CD1   . TRP D 4 276 ? 9.104   26.258  8.789   1.00 40.77  ? 276 TRP B CD1   1 
ATOM   7043 C CD2   . TRP D 4 276 ? 9.036   26.672  6.587   1.00 40.71  ? 276 TRP B CD2   1 
ATOM   7044 N NE1   . TRP D 4 276 ? 7.894   25.809  8.317   1.00 40.79  ? 276 TRP B NE1   1 
ATOM   7045 C CE2   . TRP D 4 276 ? 7.824   26.049  6.970   1.00 40.82  ? 276 TRP B CE2   1 
ATOM   7046 C CE3   . TRP D 4 276 ? 9.220   27.027  5.243   1.00 39.43  ? 276 TRP B CE3   1 
ATOM   7047 C CZ2   . TRP D 4 276 ? 6.797   25.773  6.057   1.00 38.18  ? 276 TRP B CZ2   1 
ATOM   7048 C CZ3   . TRP D 4 276 ? 8.198   26.754  4.331   1.00 39.29  ? 276 TRP B CZ3   1 
ATOM   7049 C CH2   . TRP D 4 276 ? 7.001   26.132  4.747   1.00 39.88  ? 276 TRP B CH2   1 
ATOM   7050 N N     . THR D 4 277 ? 14.053  27.796  6.037   1.00 44.71  ? 277 THR B N     1 
ATOM   7051 C CA    . THR D 4 277 ? 15.230  28.630  5.862   1.00 43.80  ? 277 THR B CA    1 
ATOM   7052 C C     . THR D 4 277 ? 14.768  30.068  5.664   1.00 43.79  ? 277 THR B C     1 
ATOM   7053 O O     . THR D 4 277 ? 13.876  30.338  4.856   1.00 43.47  ? 277 THR B O     1 
ATOM   7054 C CB    . THR D 4 277 ? 16.053  28.199  4.633   1.00 43.23  ? 277 THR B CB    1 
ATOM   7055 O OG1   . THR D 4 277 ? 16.571  26.882  4.842   1.00 43.19  ? 277 THR B OG1   1 
ATOM   7056 C CG2   . THR D 4 277 ? 17.215  29.146  4.411   1.00 44.27  ? 277 THR B CG2   1 
ATOM   7057 N N     . VAL D 4 278 ? 15.364  30.987  6.412   1.00 43.07  ? 278 VAL B N     1 
ATOM   7058 C CA    . VAL D 4 278 ? 15.004  32.392  6.289   1.00 43.76  ? 278 VAL B CA    1 
ATOM   7059 C C     . VAL D 4 278 ? 15.690  32.944  5.049   1.00 43.22  ? 278 VAL B C     1 
ATOM   7060 O O     . VAL D 4 278 ? 16.903  32.803  4.897   1.00 43.28  ? 278 VAL B O     1 
ATOM   7061 C CB    . VAL D 4 278 ? 15.473  33.195  7.509   1.00 43.66  ? 278 VAL B CB    1 
ATOM   7062 C CG1   . VAL D 4 278 ? 14.863  34.584  7.482   1.00 43.38  ? 278 VAL B CG1   1 
ATOM   7063 C CG2   . VAL D 4 278 ? 15.101  32.463  8.779   1.00 43.53  ? 278 VAL B CG2   1 
ATOM   7064 N N     . VAL D 4 279 ? 14.917  33.558  4.161   1.00 43.18  ? 279 VAL B N     1 
ATOM   7065 C CA    . VAL D 4 279 ? 15.482  34.121  2.938   1.00 44.41  ? 279 VAL B CA    1 
ATOM   7066 C C     . VAL D 4 279 ? 14.962  35.524  2.644   1.00 45.98  ? 279 VAL B C     1 
ATOM   7067 O O     . VAL D 4 279 ? 13.966  35.964  3.216   1.00 43.78  ? 279 VAL B O     1 
ATOM   7068 C CB    . VAL D 4 279 ? 15.182  33.230  1.706   1.00 44.05  ? 279 VAL B CB    1 
ATOM   7069 C CG1   . VAL D 4 279 ? 15.945  31.912  1.808   1.00 41.80  ? 279 VAL B CG1   1 
ATOM   7070 C CG2   . VAL D 4 279 ? 13.683  32.984  1.598   1.00 42.00  ? 279 VAL B CG2   1 
ATOM   7071 N N     . ASP D 4 280 ? 15.647  36.220  1.739   1.00 48.69  ? 280 ASP B N     1 
ATOM   7072 C CA    . ASP D 4 280 ? 15.268  37.577  1.362   1.00 49.89  ? 280 ASP B CA    1 
ATOM   7073 C C     . ASP D 4 280 ? 13.944  37.566  0.613   1.00 50.51  ? 280 ASP B C     1 
ATOM   7074 O O     . ASP D 4 280 ? 13.755  36.783  -0.314  1.00 51.13  ? 280 ASP B O     1 
ATOM   7075 C CB    . ASP D 4 280 ? 16.364  38.206  0.496   1.00 50.33  ? 280 ASP B CB    1 
ATOM   7076 C CG    . ASP D 4 280 ? 16.106  39.668  0.205   1.00 50.95  ? 280 ASP B CG    1 
ATOM   7077 O OD1   . ASP D 4 280 ? 15.378  39.962  -0.765  1.00 51.16  ? 280 ASP B OD1   1 
ATOM   7078 O OD2   . ASP D 4 280 ? 16.621  40.524  0.959   1.00 52.86  ? 280 ASP B OD2   1 
ATOM   7079 N N     . ALA D 4 281 ? 13.032  38.443  1.016   1.00 51.88  ? 281 ALA B N     1 
ATOM   7080 C CA    . ALA D 4 281 ? 11.711  38.524  0.397   1.00 52.93  ? 281 ALA B CA    1 
ATOM   7081 C C     . ALA D 4 281 ? 11.737  38.855  -1.095  1.00 53.30  ? 281 ALA B C     1 
ATOM   7082 O O     . ALA D 4 281 ? 10.730  38.698  -1.789  1.00 53.48  ? 281 ALA B O     1 
ATOM   7083 C CB    . ALA D 4 281 ? 10.862  39.549  1.136   1.00 52.83  ? 281 ALA B CB    1 
ATOM   7084 N N     . LYS D 4 282 ? 12.883  39.308  -1.589  1.00 53.61  ? 282 LYS B N     1 
ATOM   7085 C CA    . LYS D 4 282 ? 13.004  39.671  -2.992  1.00 53.70  ? 282 LYS B CA    1 
ATOM   7086 C C     . LYS D 4 282 ? 13.757  38.626  -3.809  1.00 53.66  ? 282 LYS B C     1 
ATOM   7087 O O     . LYS D 4 282 ? 13.229  38.113  -4.797  1.00 54.11  ? 282 LYS B O     1 
ATOM   7088 C CB    . LYS D 4 282 ? 13.667  41.048  -3.105  1.00 55.63  ? 282 LYS B CB    1 
ATOM   7089 C CG    . LYS D 4 282 ? 12.836  42.153  -2.442  1.00 57.16  ? 282 LYS B CG    1 
ATOM   7090 C CD    . LYS D 4 282 ? 13.547  43.498  -2.375  1.00 59.39  ? 282 LYS B CD    1 
ATOM   7091 C CE    . LYS D 4 282 ? 12.687  44.516  -1.626  1.00 60.74  ? 282 LYS B CE    1 
ATOM   7092 N NZ    . LYS D 4 282 ? 13.337  45.854  -1.473  1.00 62.38  ? 282 LYS B NZ    1 
ATOM   7093 N N     . THR D 4 283 ? 14.978  38.297  -3.402  1.00 52.78  ? 283 THR B N     1 
ATOM   7094 C CA    . THR D 4 283 ? 15.755  37.299  -4.130  1.00 52.60  ? 283 THR B CA    1 
ATOM   7095 C C     . THR D 4 283 ? 15.326  35.890  -3.744  1.00 52.23  ? 283 THR B C     1 
ATOM   7096 O O     . THR D 4 283 ? 15.629  34.925  -4.450  1.00 51.62  ? 283 THR B O     1 
ATOM   7097 C CB    . THR D 4 283 ? 17.259  37.423  -3.839  1.00 53.01  ? 283 THR B CB    1 
ATOM   7098 O OG1   . THR D 4 283 ? 17.522  37.025  -2.486  1.00 54.06  ? 283 THR B OG1   1 
ATOM   7099 C CG2   . THR D 4 283 ? 17.717  38.852  -4.047  1.00 52.91  ? 283 THR B CG2   1 
ATOM   7100 N N     . LEU D 4 284 ? 14.623  35.783  -2.620  1.00 50.70  ? 284 LEU B N     1 
ATOM   7101 C CA    . LEU D 4 284 ? 14.158  34.496  -2.120  1.00 49.87  ? 284 LEU B CA    1 
ATOM   7102 C C     . LEU D 4 284 ? 15.343  33.561  -1.959  1.00 50.72  ? 284 LEU B C     1 
ATOM   7103 O O     . LEU D 4 284 ? 15.189  32.342  -1.998  1.00 51.01  ? 284 LEU B O     1 
ATOM   7104 C CB    . LEU D 4 284 ? 13.134  33.884  -3.081  1.00 47.39  ? 284 LEU B CB    1 
ATOM   7105 C CG    . LEU D 4 284 ? 11.822  34.662  -3.225  1.00 46.60  ? 284 LEU B CG    1 
ATOM   7106 C CD1   . LEU D 4 284 ? 10.951  34.028  -4.296  1.00 43.93  ? 284 LEU B CD1   1 
ATOM   7107 C CD2   . LEU D 4 284 ? 11.103  34.691  -1.888  1.00 43.59  ? 284 LEU B CD2   1 
ATOM   7108 N N     . LYS D 4 285 ? 16.526  34.143  -1.777  1.00 52.28  ? 285 LYS B N     1 
ATOM   7109 C CA    . LYS D 4 285 ? 17.750  33.368  -1.608  1.00 53.41  ? 285 LYS B CA    1 
ATOM   7110 C C     . LYS D 4 285 ? 18.261  33.458  -0.175  1.00 54.01  ? 285 LYS B C     1 
ATOM   7111 O O     . LYS D 4 285 ? 17.970  34.417  0.538   1.00 53.31  ? 285 LYS B O     1 
ATOM   7112 C CB    . LYS D 4 285 ? 18.824  33.860  -2.580  1.00 54.63  ? 285 LYS B CB    1 
ATOM   7113 C CG    . LYS D 4 285 ? 18.432  33.771  -4.054  1.00 57.47  ? 285 LYS B CG    1 
ATOM   7114 C CD    . LYS D 4 285 ? 18.248  32.324  -4.514  1.00 59.30  ? 285 LYS B CD    1 
ATOM   7115 C CE    . LYS D 4 285 ? 17.877  32.254  -5.996  1.00 61.94  ? 285 LYS B CE    1 
ATOM   7116 N NZ    . LYS D 4 285 ? 17.642  30.855  -6.469  1.00 62.68  ? 285 LYS B NZ    1 
ATOM   7117 N N     . LYS D 4 286 ? 19.022  32.450  0.240   1.00 55.44  ? 286 LYS B N     1 
ATOM   7118 C CA    . LYS D 4 286 ? 19.566  32.399  1.590   1.00 56.99  ? 286 LYS B CA    1 
ATOM   7119 C C     . LYS D 4 286 ? 20.831  33.233  1.779   1.00 58.40  ? 286 LYS B C     1 
ATOM   7120 O O     . LYS D 4 286 ? 21.014  33.861  2.825   1.00 58.60  ? 286 LYS B O     1 
ATOM   7121 C CB    . LYS D 4 286 ? 19.866  30.950  1.983   1.00 57.00  ? 286 LYS B CB    1 
ATOM   7122 C CG    . LYS D 4 286 ? 20.494  30.827  3.363   1.00 59.75  ? 286 LYS B CG    1 
ATOM   7123 C CD    . LYS D 4 286 ? 20.802  29.388  3.741   1.00 62.09  ? 286 LYS B CD    1 
ATOM   7124 C CE    . LYS D 4 286 ? 21.218  29.284  5.216   1.00 62.56  ? 286 LYS B CE    1 
ATOM   7125 N NZ    . LYS D 4 286 ? 21.271  27.868  5.698   1.00 61.35  ? 286 LYS B NZ    1 
ATOM   7126 N N     . GLU D 4 287 ? 21.704  33.232  0.775   1.00 59.65  ? 287 GLU B N     1 
ATOM   7127 C CA    . GLU D 4 287 ? 22.961  33.973  0.847   1.00 60.53  ? 287 GLU B CA    1 
ATOM   7128 C C     . GLU D 4 287 ? 22.776  35.469  1.101   1.00 59.98  ? 287 GLU B C     1 
ATOM   7129 O O     . GLU D 4 287 ? 23.662  36.124  1.651   1.00 58.45  ? 287 GLU B O     1 
ATOM   7130 C CB    . GLU D 4 287 ? 23.770  33.774  -0.439  1.00 61.89  ? 287 GLU B CB    1 
ATOM   7131 C CG    . GLU D 4 287 ? 24.185  32.333  -0.724  1.00 64.64  ? 287 GLU B CG    1 
ATOM   7132 C CD    . GLU D 4 287 ? 23.019  31.452  -1.148  1.00 66.84  ? 287 GLU B CD    1 
ATOM   7133 O OE1   . GLU D 4 287 ? 22.271  31.857  -2.066  1.00 67.91  ? 287 GLU B OE1   1 
ATOM   7134 O OE2   . GLU D 4 287 ? 22.856  30.353  -0.572  1.00 66.71  ? 287 GLU B OE2   1 
ATOM   7135 N N     . ASP D 4 288 ? 21.625  36.002  0.703   1.00 59.93  ? 288 ASP B N     1 
ATOM   7136 C CA    . ASP D 4 288 ? 21.327  37.421  0.880   1.00 60.87  ? 288 ASP B CA    1 
ATOM   7137 C C     . ASP D 4 288 ? 21.108  37.823  2.336   1.00 61.09  ? 288 ASP B C     1 
ATOM   7138 O O     . ASP D 4 288 ? 21.015  39.006  2.647   1.00 60.33  ? 288 ASP B O     1 
ATOM   7139 C CB    . ASP D 4 288 ? 20.090  37.798  0.060   1.00 60.95  ? 288 ASP B CB    1 
ATOM   7140 C CG    . ASP D 4 288 ? 20.366  37.814  -1.434  1.00 62.48  ? 288 ASP B CG    1 
ATOM   7141 O OD1   . ASP D 4 288 ? 20.960  36.842  -1.945  1.00 62.36  ? 288 ASP B OD1   1 
ATOM   7142 O OD2   . ASP D 4 288 ? 19.985  38.799  -2.100  1.00 62.28  ? 288 ASP B OD2   1 
ATOM   7143 N N     . ILE D 4 289 ? 21.029  36.837  3.222   1.00 61.80  ? 289 ILE B N     1 
ATOM   7144 C CA    . ILE D 4 289 ? 20.803  37.097  4.638   1.00 62.92  ? 289 ILE B CA    1 
ATOM   7145 C C     . ILE D 4 289 ? 21.995  36.681  5.488   1.00 63.94  ? 289 ILE B C     1 
ATOM   7146 O O     . ILE D 4 289 ? 22.615  35.650  5.236   1.00 64.36  ? 289 ILE B O     1 
ATOM   7147 C CB    . ILE D 4 289 ? 19.562  36.339  5.141   1.00 62.79  ? 289 ILE B CB    1 
ATOM   7148 C CG1   . ILE D 4 289 ? 18.353  36.688  4.273   1.00 63.06  ? 289 ILE B CG1   1 
ATOM   7149 C CG2   . ILE D 4 289 ? 19.295  36.685  6.592   1.00 63.58  ? 289 ILE B CG2   1 
ATOM   7150 C CD1   . ILE D 4 289 ? 18.099  38.170  4.130   1.00 60.81  ? 289 ILE B CD1   1 
ATOM   7151 N N     . GLN D 4 290 ? 22.307  37.484  6.501   1.00 65.35  ? 290 GLN B N     1 
ATOM   7152 C CA    . GLN D 4 290 ? 23.431  37.195  7.383   1.00 66.55  ? 290 GLN B CA    1 
ATOM   7153 C C     . GLN D 4 290 ? 23.188  37.765  8.778   1.00 67.28  ? 290 GLN B C     1 
ATOM   7154 O O     . GLN D 4 290 ? 22.706  38.891  8.924   1.00 66.45  ? 290 GLN B O     1 
ATOM   7155 C CB    . GLN D 4 290 ? 24.712  37.786  6.798   1.00 67.52  ? 290 GLN B CB    1 
ATOM   7156 C CG    . GLN D 4 290 ? 25.970  37.398  7.549   1.00 69.52  ? 290 GLN B CG    1 
ATOM   7157 C CD    . GLN D 4 290 ? 27.194  38.132  7.042   1.00 69.95  ? 290 GLN B CD    1 
ATOM   7158 O OE1   . GLN D 4 290 ? 27.569  38.011  5.873   1.00 70.37  ? 290 GLN B OE1   1 
ATOM   7159 N NE2   . GLN D 4 290 ? 27.824  38.903  7.920   1.00 70.87  ? 290 GLN B NE2   1 
ATOM   7160 N N     . LYS D 4 291 ? 23.528  36.984  9.800   1.00 68.60  ? 291 LYS B N     1 
ATOM   7161 C CA    . LYS D 4 291 ? 23.336  37.412  11.182  1.00 70.05  ? 291 LYS B CA    1 
ATOM   7162 C C     . LYS D 4 291 ? 24.645  37.678  11.917  1.00 71.42  ? 291 LYS B C     1 
ATOM   7163 O O     . LYS D 4 291 ? 25.557  36.852  11.903  1.00 71.57  ? 291 LYS B O     1 
ATOM   7164 C CB    . LYS D 4 291 ? 22.532  36.363  11.958  1.00 69.20  ? 291 LYS B CB    1 
ATOM   7165 C CG    . LYS D 4 291 ? 21.104  36.174  11.469  1.00 69.29  ? 291 LYS B CG    1 
ATOM   7166 C CD    . LYS D 4 291 ? 20.309  35.247  12.387  1.00 69.76  ? 291 LYS B CD    1 
ATOM   7167 C CE    . LYS D 4 291 ? 20.900  33.844  12.427  1.00 70.02  ? 291 LYS B CE    1 
ATOM   7168 N NZ    . LYS D 4 291 ? 20.116  32.929  13.306  1.00 69.36  ? 291 LYS B NZ    1 
ATOM   7169 N N     . GLU D 4 292 ? 24.727  38.842  12.555  1.00 73.17  ? 292 GLU B N     1 
ATOM   7170 C CA    . GLU D 4 292 ? 25.908  39.217  13.317  1.00 75.07  ? 292 GLU B CA    1 
ATOM   7171 C C     . GLU D 4 292 ? 25.536  39.515  14.760  1.00 76.14  ? 292 GLU B C     1 
ATOM   7172 O O     . GLU D 4 292 ? 24.852  40.498  15.053  1.00 75.74  ? 292 GLU B O     1 
ATOM   7173 C CB    . GLU D 4 292 ? 26.600  40.436  12.699  1.00 75.77  ? 292 GLU B CB    1 
ATOM   7174 C CG    . GLU D 4 292 ? 27.618  40.083  11.621  1.00 76.93  ? 292 GLU B CG    1 
ATOM   7175 C CD    . GLU D 4 292 ? 28.535  41.244  11.274  1.00 77.26  ? 292 GLU B CD    1 
ATOM   7176 O OE1   . GLU D 4 292 ? 29.147  41.817  12.204  1.00 77.19  ? 292 GLU B OE1   1 
ATOM   7177 O OE2   . GLU D 4 292 ? 28.653  41.579  10.076  1.00 76.88  ? 292 GLU B OE2   1 
ATOM   7178 N N     . THR D 4 293 ? 25.993  38.647  15.656  1.00 77.35  ? 293 THR B N     1 
ATOM   7179 C CA    . THR D 4 293 ? 25.727  38.780  17.081  1.00 78.03  ? 293 THR B CA    1 
ATOM   7180 C C     . THR D 4 293 ? 26.868  39.504  17.788  1.00 78.59  ? 293 THR B C     1 
ATOM   7181 O O     . THR D 4 293 ? 27.980  38.984  17.888  1.00 78.50  ? 293 THR B O     1 
ATOM   7182 C CB    . THR D 4 293 ? 25.523  37.395  17.724  1.00 77.89  ? 293 THR B CB    1 
ATOM   7183 O OG1   . THR D 4 293 ? 25.528  37.521  19.150  1.00 78.09  ? 293 THR B OG1   1 
ATOM   7184 C CG2   . THR D 4 293 ? 26.619  36.436  17.285  1.00 77.57  ? 293 THR B CG2   1 
ATOM   7185 N N     . VAL D 4 294 ? 26.580  40.708  18.278  1.00 79.60  ? 294 VAL B N     1 
ATOM   7186 C CA    . VAL D 4 294 ? 27.574  41.526  18.972  1.00 80.58  ? 294 VAL B CA    1 
ATOM   7187 C C     . VAL D 4 294 ? 27.399  41.462  20.493  1.00 80.69  ? 294 VAL B C     1 
ATOM   7188 O O     . VAL D 4 294 ? 26.344  41.064  20.986  1.00 80.36  ? 294 VAL B O     1 
ATOM   7189 C CB    . VAL D 4 294 ? 27.481  42.994  18.520  1.00 80.77  ? 294 VAL B CB    1 
ATOM   7190 C CG1   . VAL D 4 294 ? 28.694  43.756  18.999  1.00 81.04  ? 294 VAL B CG1   1 
ATOM   7191 C CG2   . VAL D 4 294 ? 27.365  43.067  17.005  1.00 80.71  ? 294 VAL B CG2   1 
ATOM   7192 N N     . TYR D 4 295 ? 28.432  41.867  21.231  1.00 81.47  ? 295 TYR B N     1 
ATOM   7193 C CA    . TYR D 4 295 ? 28.398  41.829  22.693  1.00 82.90  ? 295 TYR B CA    1 
ATOM   7194 C C     . TYR D 4 295 ? 28.662  43.181  23.355  1.00 83.87  ? 295 TYR B C     1 
ATOM   7195 O O     . TYR D 4 295 ? 29.532  43.934  22.920  1.00 84.29  ? 295 TYR B O     1 
ATOM   7196 C CB    . TYR D 4 295 ? 29.424  40.817  23.207  1.00 82.33  ? 295 TYR B CB    1 
ATOM   7197 C CG    . TYR D 4 295 ? 29.360  39.478  22.512  1.00 82.60  ? 295 TYR B CG    1 
ATOM   7198 C CD1   . TYR D 4 295 ? 29.878  39.309  21.227  1.00 82.52  ? 295 TYR B CD1   1 
ATOM   7199 C CD2   . TYR D 4 295 ? 28.769  38.380  23.132  1.00 82.63  ? 295 TYR B CD2   1 
ATOM   7200 C CE1   . TYR D 4 295 ? 29.808  38.080  20.580  1.00 82.64  ? 295 TYR B CE1   1 
ATOM   7201 C CE2   . TYR D 4 295 ? 28.695  37.151  22.493  1.00 82.70  ? 295 TYR B CE2   1 
ATOM   7202 C CZ    . TYR D 4 295 ? 29.214  37.007  21.221  1.00 82.90  ? 295 TYR B CZ    1 
ATOM   7203 O OH    . TYR D 4 295 ? 29.132  35.787  20.595  1.00 83.75  ? 295 TYR B OH    1 
ATOM   7204 N N     . CYS D 4 296 ? 27.919  43.474  24.420  1.00 84.87  ? 296 CYS B N     1 
ATOM   7205 C CA    . CYS D 4 296 ? 28.075  44.734  25.144  1.00 86.46  ? 296 CYS B CA    1 
ATOM   7206 C C     . CYS D 4 296 ? 27.908  44.558  26.655  1.00 87.58  ? 296 CYS B C     1 
ATOM   7207 O O     . CYS D 4 296 ? 27.375  43.549  27.112  1.00 87.79  ? 296 CYS B O     1 
ATOM   7208 C CB    . CYS D 4 296 ? 27.059  45.760  24.630  1.00 86.08  ? 296 CYS B CB    1 
ATOM   7209 S SG    . CYS D 4 296 ? 25.324  45.249  24.759  1.00 85.38  ? 296 CYS B SG    1 
ATOM   7210 N N     . LEU D 4 297 ? 28.368  45.541  27.424  1.00 88.83  ? 297 LEU B N     1 
ATOM   7211 C CA    . LEU D 4 297 ? 28.257  45.497  28.882  1.00 90.88  ? 297 LEU B CA    1 
ATOM   7212 C C     . LEU D 4 297 ? 26.788  45.609  29.289  1.00 92.86  ? 297 LEU B C     1 
ATOM   7213 O O     . LEU D 4 297 ? 26.192  46.680  29.184  1.00 92.81  ? 297 LEU B O     1 
ATOM   7214 C CB    . LEU D 4 297 ? 29.050  46.647  29.506  1.00 89.85  ? 297 LEU B CB    1 
ATOM   7215 C CG    . LEU D 4 297 ? 30.516  46.777  29.087  1.00 89.08  ? 297 LEU B CG    1 
ATOM   7216 C CD1   . LEU D 4 297 ? 31.120  48.017  29.729  1.00 89.65  ? 297 LEU B CD1   1 
ATOM   7217 C CD2   . LEU D 4 297 ? 31.285  45.534  29.493  1.00 88.58  ? 297 LEU B CD2   1 
ATOM   7218 N N     . ASN D 4 298 ? 26.216  44.500  29.756  1.00 95.13  ? 298 ASN B N     1 
ATOM   7219 C CA    . ASN D 4 298 ? 24.810  44.449  30.165  1.00 96.88  ? 298 ASN B CA    1 
ATOM   7220 C C     . ASN D 4 298 ? 24.401  45.626  31.055  1.00 98.05  ? 298 ASN B C     1 
ATOM   7221 O O     . ASN D 4 298 ? 23.303  46.170  30.912  1.00 97.65  ? 298 ASN B O     1 
ATOM   7222 C CB    . ASN D 4 298 ? 24.519  43.118  30.878  1.00 97.01  ? 298 ASN B CB    1 
ATOM   7223 C CG    . ASN D 4 298 ? 23.026  42.828  31.006  1.00 97.18  ? 298 ASN B CG    1 
ATOM   7224 O OD1   . ASN D 4 298 ? 22.279  42.912  30.029  1.00 97.12  ? 298 ASN B OD1   1 
ATOM   7225 N ND2   . ASN D 4 298 ? 22.592  42.469  32.210  1.00 96.41  ? 298 ASN B ND2   1 
ATOM   7226 N N     . ASP D 4 299 ? 25.281  46.019  31.972  1.00 99.24  ? 299 ASP B N     1 
ATOM   7227 C CA    . ASP D 4 299 ? 24.989  47.137  32.862  1.00 100.51 ? 299 ASP B CA    1 
ATOM   7228 C C     . ASP D 4 299 ? 24.858  48.368  31.970  1.00 100.73 ? 299 ASP B C     1 
ATOM   7229 O O     . ASP D 4 299 ? 25.107  48.286  30.768  1.00 101.44 ? 299 ASP B O     1 
ATOM   7230 C CB    . ASP D 4 299 ? 26.130  47.322  33.870  1.00 100.79 ? 299 ASP B CB    1 
ATOM   7231 C CG    . ASP D 4 299 ? 25.697  48.077  35.119  1.00 101.43 ? 299 ASP B CG    1 
ATOM   7232 O OD1   . ASP D 4 299 ? 25.316  49.261  35.003  1.00 101.44 ? 299 ASP B OD1   1 
ATOM   7233 O OD2   . ASP D 4 299 ? 25.739  47.485  36.219  1.00 101.20 ? 299 ASP B OD2   1 
ATOM   7234 N N     . ASP D 4 300 ? 24.467  49.502  32.541  1.00 101.43 ? 300 ASP B N     1 
ATOM   7235 C CA    . ASP D 4 300 ? 24.312  50.722  31.751  1.00 101.44 ? 300 ASP B CA    1 
ATOM   7236 C C     . ASP D 4 300 ? 25.576  51.070  30.963  1.00 101.44 ? 300 ASP B C     1 
ATOM   7237 O O     . ASP D 4 300 ? 26.625  50.444  31.141  1.00 101.44 ? 300 ASP B O     1 
ATOM   7238 C CB    . ASP D 4 300 ? 23.916  51.893  32.652  1.00 101.44 ? 300 ASP B CB    1 
ATOM   7239 C CG    . ASP D 4 300 ? 22.531  52.425  32.335  1.00 101.44 ? 300 ASP B CG    1 
ATOM   7240 O OD1   . ASP D 4 300 ? 21.561  51.634  32.370  1.00 101.44 ? 300 ASP B OD1   1 
ATOM   7241 O OD2   . ASP D 4 300 ? 22.415  53.636  32.050  1.00 101.44 ? 300 ASP B OD2   1 
ATOM   7242 N N     . ASP D 4 301 ? 25.471  52.076  30.098  1.00 101.44 ? 301 ASP B N     1 
ATOM   7243 C CA    . ASP D 4 301 ? 26.595  52.486  29.265  1.00 101.27 ? 301 ASP B CA    1 
ATOM   7244 C C     . ASP D 4 301 ? 26.946  51.292  28.379  1.00 101.01 ? 301 ASP B C     1 
ATOM   7245 O O     . ASP D 4 301 ? 28.036  50.719  28.467  1.00 101.12 ? 301 ASP B O     1 
ATOM   7246 C CB    . ASP D 4 301 ? 27.786  52.892  30.138  1.00 101.44 ? 301 ASP B CB    1 
ATOM   7247 C CG    . ASP D 4 301 ? 27.443  54.014  31.103  1.00 101.44 ? 301 ASP B CG    1 
ATOM   7248 O OD1   . ASP D 4 301 ? 27.043  55.103  30.639  1.00 101.37 ? 301 ASP B OD1   1 
ATOM   7249 O OD2   . ASP D 4 301 ? 27.571  53.805  32.328  1.00 101.44 ? 301 ASP B OD2   1 
ATOM   7250 N N     . GLU D 4 302 ? 25.982  50.930  27.533  1.00 100.42 ? 302 GLU B N     1 
ATOM   7251 C CA    . GLU D 4 302 ? 26.085  49.807  26.606  1.00 99.38  ? 302 GLU B CA    1 
ATOM   7252 C C     . GLU D 4 302 ? 27.319  49.870  25.715  1.00 98.50  ? 302 GLU B C     1 
ATOM   7253 O O     . GLU D 4 302 ? 27.242  50.271  24.553  1.00 98.58  ? 302 GLU B O     1 
ATOM   7254 C CB    . GLU D 4 302 ? 24.823  49.752  25.742  1.00 99.21  ? 302 GLU B CB    1 
ATOM   7255 C CG    . GLU D 4 302 ? 24.732  48.555  24.826  1.00 99.36  ? 302 GLU B CG    1 
ATOM   7256 C CD    . GLU D 4 302 ? 23.464  48.568  24.003  1.00 99.84  ? 302 GLU B CD    1 
ATOM   7257 O OE1   . GLU D 4 302 ? 22.369  48.673  24.599  1.00 99.59  ? 302 GLU B OE1   1 
ATOM   7258 O OE2   . GLU D 4 302 ? 23.564  48.470  22.763  1.00 99.94  ? 302 GLU B OE2   1 
ATOM   7259 N N     . THR D 4 303 ? 28.454  49.460  26.269  1.00 97.71  ? 303 THR B N     1 
ATOM   7260 C CA    . THR D 4 303 ? 29.714  49.465  25.537  1.00 96.74  ? 303 THR B CA    1 
ATOM   7261 C C     . THR D 4 303 ? 29.954  48.097  24.901  1.00 95.99  ? 303 THR B C     1 
ATOM   7262 O O     . THR D 4 303 ? 29.855  47.068  25.572  1.00 96.27  ? 303 THR B O     1 
ATOM   7263 C CB    . THR D 4 303 ? 30.895  49.796  26.479  1.00 96.95  ? 303 THR B CB    1 
ATOM   7264 O OG1   . THR D 4 303 ? 30.623  51.012  27.189  1.00 96.87  ? 303 THR B OG1   1 
ATOM   7265 C CG2   . THR D 4 303 ? 32.184  49.963  25.684  1.00 97.02  ? 303 THR B CG2   1 
ATOM   7266 N N     . GLU D 4 304 ? 30.263  48.092  23.607  1.00 94.43  ? 304 GLU B N     1 
ATOM   7267 C CA    . GLU D 4 304 ? 30.518  46.850  22.882  1.00 92.78  ? 304 GLU B CA    1 
ATOM   7268 C C     . GLU D 4 304 ? 31.823  46.211  23.354  1.00 91.30  ? 304 GLU B C     1 
ATOM   7269 O O     . GLU D 4 304 ? 32.626  46.847  24.041  1.00 91.13  ? 304 GLU B O     1 
ATOM   7270 C CB    . GLU D 4 304 ? 30.610  47.121  21.379  1.00 92.96  ? 304 GLU B CB    1 
ATOM   7271 C CG    . GLU D 4 304 ? 30.755  45.865  20.522  1.00 93.00  ? 304 GLU B CG    1 
ATOM   7272 C CD    . GLU D 4 304 ? 31.116  46.172  19.080  1.00 92.67  ? 304 GLU B CD    1 
ATOM   7273 O OE1   . GLU D 4 304 ? 32.241  46.661  18.838  1.00 92.83  ? 304 GLU B OE1   1 
ATOM   7274 O OE2   . GLU D 4 304 ? 30.278  45.925  18.189  1.00 91.90  ? 304 GLU B OE2   1 
ATOM   7275 N N     . VAL D 4 305 ? 32.026  44.952  22.982  1.00 89.46  ? 305 VAL B N     1 
ATOM   7276 C CA    . VAL D 4 305 ? 33.232  44.222  23.345  1.00 87.62  ? 305 VAL B CA    1 
ATOM   7277 C C     . VAL D 4 305 ? 33.619  43.323  22.181  1.00 86.66  ? 305 VAL B C     1 
ATOM   7278 O O     . VAL D 4 305 ? 32.753  42.784  21.491  1.00 86.24  ? 305 VAL B O     1 
ATOM   7279 C CB    . VAL D 4 305 ? 33.011  43.343  24.588  1.00 87.64  ? 305 VAL B CB    1 
ATOM   7280 C CG1   . VAL D 4 305 ? 34.291  42.592  24.922  1.00 87.43  ? 305 VAL B CG1   1 
ATOM   7281 C CG2   . VAL D 4 305 ? 32.571  44.206  25.757  1.00 87.01  ? 305 VAL B CG2   1 
ATOM   7282 N N     . LEU D 4 306 ? 34.921  43.163  21.967  1.00 85.51  ? 306 LEU B N     1 
ATOM   7283 C CA    . LEU D 4 306 ? 35.416  42.323  20.883  1.00 84.74  ? 306 LEU B CA    1 
ATOM   7284 C C     . LEU D 4 306 ? 35.537  40.871  21.327  1.00 83.58  ? 306 LEU B C     1 
ATOM   7285 O O     . LEU D 4 306 ? 35.865  40.591  22.479  1.00 83.29  ? 306 LEU B O     1 
ATOM   7286 C CB    . LEU D 4 306 ? 36.773  42.841  20.395  1.00 84.94  ? 306 LEU B CB    1 
ATOM   7287 C CG    . LEU D 4 306 ? 36.775  44.250  19.788  1.00 85.29  ? 306 LEU B CG    1 
ATOM   7288 C CD1   . LEU D 4 306 ? 38.202  44.654  19.453  1.00 85.20  ? 306 LEU B CD1   1 
ATOM   7289 C CD2   . LEU D 4 306 ? 35.894  44.288  18.540  1.00 85.18  ? 306 LEU B CD2   1 
ATOM   7290 N N     . LYS D 4 307 ? 35.269  39.954  20.401  1.00 82.51  ? 307 LYS B N     1 
ATOM   7291 C CA    . LYS D 4 307 ? 35.337  38.522  20.676  1.00 81.76  ? 307 LYS B CA    1 
ATOM   7292 C C     . LYS D 4 307 ? 36.636  38.119  21.370  1.00 80.83  ? 307 LYS B C     1 
ATOM   7293 O O     . LYS D 4 307 ? 36.691  37.093  22.043  1.00 80.55  ? 307 LYS B O     1 
ATOM   7294 C CB    . LYS D 4 307 ? 35.184  37.731  19.372  1.00 82.01  ? 307 LYS B CB    1 
ATOM   7295 C CG    . LYS D 4 307 ? 35.252  36.219  19.540  1.00 82.89  ? 307 LYS B CG    1 
ATOM   7296 C CD    . LYS D 4 307 ? 35.193  35.502  18.197  1.00 83.99  ? 307 LYS B CD    1 
ATOM   7297 C CE    . LYS D 4 307 ? 35.304  33.987  18.364  1.00 85.25  ? 307 LYS B CE    1 
ATOM   7298 N NZ    . LYS D 4 307 ? 35.198  33.256  17.062  1.00 84.49  ? 307 LYS B NZ    1 
ATOM   7299 N N     . GLU D 4 308 ? 37.679  38.926  21.210  1.00 80.26  ? 308 GLU B N     1 
ATOM   7300 C CA    . GLU D 4 308 ? 38.967  38.631  21.828  1.00 79.40  ? 308 GLU B CA    1 
ATOM   7301 C C     . GLU D 4 308 ? 39.037  39.100  23.281  1.00 77.44  ? 308 GLU B C     1 
ATOM   7302 O O     . GLU D 4 308 ? 40.123  39.211  23.851  1.00 77.89  ? 308 GLU B O     1 
ATOM   7303 C CB    . GLU D 4 308 ? 40.103  39.282  21.031  1.00 81.35  ? 308 GLU B CB    1 
ATOM   7304 C CG    . GLU D 4 308 ? 40.176  38.853  19.571  1.00 84.17  ? 308 GLU B CG    1 
ATOM   7305 C CD    . GLU D 4 308 ? 41.453  39.323  18.884  1.00 86.01  ? 308 GLU B CD    1 
ATOM   7306 O OE1   . GLU D 4 308 ? 42.548  38.880  19.301  1.00 86.47  ? 308 GLU B OE1   1 
ATOM   7307 O OE2   . GLU D 4 308 ? 41.363  40.132  17.931  1.00 86.38  ? 308 GLU B OE2   1 
ATOM   7308 N N     . ASP D 4 309 ? 37.881  39.376  23.878  1.00 74.65  ? 309 ASP B N     1 
ATOM   7309 C CA    . ASP D 4 309 ? 37.831  39.829  25.265  1.00 71.63  ? 309 ASP B CA    1 
ATOM   7310 C C     . ASP D 4 309 ? 36.749  39.152  26.100  1.00 68.89  ? 309 ASP B C     1 
ATOM   7311 O O     . ASP D 4 309 ? 36.516  39.538  27.247  1.00 68.84  ? 309 ASP B O     1 
ATOM   7312 C CB    . ASP D 4 309 ? 37.637  41.348  25.327  1.00 72.95  ? 309 ASP B CB    1 
ATOM   7313 C CG    . ASP D 4 309 ? 38.944  42.104  25.225  1.00 73.44  ? 309 ASP B CG    1 
ATOM   7314 O OD1   . ASP D 4 309 ? 39.821  41.879  26.089  1.00 73.81  ? 309 ASP B OD1   1 
ATOM   7315 O OD2   . ASP D 4 309 ? 39.092  42.918  24.287  1.00 73.24  ? 309 ASP B OD2   1 
ATOM   7316 N N     . ILE D 4 310 ? 36.097  38.143  25.529  1.00 64.35  ? 310 ILE B N     1 
ATOM   7317 C CA    . ILE D 4 310 ? 35.047  37.423  26.234  1.00 60.10  ? 310 ILE B CA    1 
ATOM   7318 C C     . ILE D 4 310 ? 35.469  36.003  26.607  1.00 58.43  ? 310 ILE B C     1 
ATOM   7319 O O     . ILE D 4 310 ? 36.025  35.274  25.782  1.00 57.58  ? 310 ILE B O     1 
ATOM   7320 C CB    . ILE D 4 310 ? 33.765  37.357  25.387  1.00 59.29  ? 310 ILE B CB    1 
ATOM   7321 C CG1   . ILE D 4 310 ? 33.177  38.760  25.237  1.00 57.94  ? 310 ILE B CG1   1 
ATOM   7322 C CG2   . ILE D 4 310 ? 32.756  36.429  26.037  1.00 59.98  ? 310 ILE B CG2   1 
ATOM   7323 C CD1   . ILE D 4 310 ? 31.935  38.808  24.402  1.00 55.69  ? 310 ILE B CD1   1 
ATOM   7324 N N     . ILE D 4 311 ? 35.206  35.625  27.859  1.00 55.36  ? 311 ILE B N     1 
ATOM   7325 C CA    . ILE D 4 311 ? 35.536  34.292  28.363  1.00 51.98  ? 311 ILE B CA    1 
ATOM   7326 C C     . ILE D 4 311 ? 34.271  33.578  28.827  1.00 49.03  ? 311 ILE B C     1 
ATOM   7327 O O     . ILE D 4 311 ? 33.207  34.192  28.945  1.00 48.16  ? 311 ILE B O     1 
ATOM   7328 C CB    . ILE D 4 311 ? 36.505  34.346  29.576  1.00 53.03  ? 311 ILE B CB    1 
ATOM   7329 C CG1   . ILE D 4 311 ? 35.857  35.119  30.727  1.00 52.90  ? 311 ILE B CG1   1 
ATOM   7330 C CG2   . ILE D 4 311 ? 37.823  34.979  29.171  1.00 53.38  ? 311 ILE B CG2   1 
ATOM   7331 C CD1   . ILE D 4 311 ? 36.642  35.055  32.021  1.00 53.99  ? 311 ILE B CD1   1 
ATOM   7332 N N     . GLN D 4 312 ? 34.391  32.282  29.098  1.00 45.39  ? 312 GLN B N     1 
ATOM   7333 C CA    . GLN D 4 312 ? 33.249  31.510  29.559  1.00 42.29  ? 312 GLN B CA    1 
ATOM   7334 C C     . GLN D 4 312 ? 33.162  31.480  31.076  1.00 40.00  ? 312 GLN B C     1 
ATOM   7335 O O     . GLN D 4 312 ? 34.182  31.506  31.774  1.00 41.14  ? 312 GLN B O     1 
ATOM   7336 C CB    . GLN D 4 312 ? 33.304  30.081  29.026  1.00 41.15  ? 312 GLN B CB    1 
ATOM   7337 C CG    . GLN D 4 312 ? 32.306  29.168  29.706  1.00 42.42  ? 312 GLN B CG    1 
ATOM   7338 C CD    . GLN D 4 312 ? 32.045  27.898  28.937  1.00 43.49  ? 312 GLN B CD    1 
ATOM   7339 O OE1   . GLN D 4 312 ? 31.422  27.922  27.872  1.00 43.38  ? 312 GLN B OE1   1 
ATOM   7340 N NE2   . GLN D 4 312 ? 32.521  26.774  29.469  1.00 42.66  ? 312 GLN B NE2   1 
ATOM   7341 N N     . GLY D 4 313 ? 31.933  31.426  31.576  1.00 36.07  ? 313 GLY B N     1 
ATOM   7342 C CA    . GLY D 4 313 ? 31.711  31.391  33.006  1.00 33.84  ? 313 GLY B CA    1 
ATOM   7343 C C     . GLY D 4 313 ? 30.374  30.779  33.377  1.00 31.07  ? 313 GLY B C     1 
ATOM   7344 O O     . GLY D 4 313 ? 29.546  30.488  32.521  1.00 28.50  ? 313 GLY B O     1 
ATOM   7345 N N     . PHE D 4 314 ? 30.169  30.572  34.668  1.00 30.50  ? 314 PHE B N     1 
ATOM   7346 C CA    . PHE D 4 314 ? 28.926  30.004  35.146  1.00 30.53  ? 314 PHE B CA    1 
ATOM   7347 C C     . PHE D 4 314 ? 28.494  30.711  36.415  1.00 31.91  ? 314 PHE B C     1 
ATOM   7348 O O     . PHE D 4 314 ? 29.293  31.364  37.086  1.00 33.84  ? 314 PHE B O     1 
ATOM   7349 C CB    . PHE D 4 314 ? 29.079  28.505  35.440  1.00 28.43  ? 314 PHE B CB    1 
ATOM   7350 C CG    . PHE D 4 314 ? 29.392  27.672  34.231  1.00 28.74  ? 314 PHE B CG    1 
ATOM   7351 C CD1   . PHE D 4 314 ? 30.710  27.332  33.924  1.00 27.82  ? 314 PHE B CD1   1 
ATOM   7352 C CD2   . PHE D 4 314 ? 28.371  27.229  33.392  1.00 26.40  ? 314 PHE B CD2   1 
ATOM   7353 C CE1   . PHE D 4 314 ? 31.004  26.562  32.801  1.00 27.06  ? 314 PHE B CE1   1 
ATOM   7354 C CE2   . PHE D 4 314 ? 28.656  26.458  32.267  1.00 26.85  ? 314 PHE B CE2   1 
ATOM   7355 C CZ    . PHE D 4 314 ? 29.971  26.124  31.970  1.00 27.41  ? 314 PHE B CZ    1 
ATOM   7356 N N     . ARG D 4 315 ? 27.219  30.587  36.741  1.00 32.11  ? 315 ARG B N     1 
ATOM   7357 C CA    . ARG D 4 315 ? 26.719  31.192  37.952  1.00 31.85  ? 315 ARG B CA    1 
ATOM   7358 C C     . ARG D 4 315 ? 26.615  30.099  39.001  1.00 31.22  ? 315 ARG B C     1 
ATOM   7359 O O     . ARG D 4 315 ? 26.276  28.953  38.699  1.00 31.67  ? 315 ARG B O     1 
ATOM   7360 C CB    . ARG D 4 315 ? 25.333  31.814  37.729  1.00 32.17  ? 315 ARG B CB    1 
ATOM   7361 C CG    . ARG D 4 315 ? 25.279  32.848  36.615  1.00 36.79  ? 315 ARG B CG    1 
ATOM   7362 C CD    . ARG D 4 315 ? 23.966  33.629  36.638  1.00 39.20  ? 315 ARG B CD    1 
ATOM   7363 N NE    . ARG D 4 315 ? 24.077  34.844  37.439  1.00 41.91  ? 315 ARG B NE    1 
ATOM   7364 C CZ    . ARG D 4 315 ? 24.200  36.068  36.930  1.00 43.67  ? 315 ARG B CZ    1 
ATOM   7365 N NH1   . ARG D 4 315 ? 24.217  36.247  35.613  1.00 43.43  ? 315 ARG B NH1   1 
ATOM   7366 N NH2   . ARG D 4 315 ? 24.336  37.111  37.738  1.00 42.82  ? 315 ARG B NH2   1 
ATOM   7367 N N     . TYR D 4 316 ? 26.953  30.459  40.229  1.00 30.34  ? 316 TYR B N     1 
ATOM   7368 C CA    . TYR D 4 316 ? 26.842  29.570  41.367  1.00 27.34  ? 316 TYR B CA    1 
ATOM   7369 C C     . TYR D 4 316 ? 26.120  30.512  42.326  1.00 27.41  ? 316 TYR B C     1 
ATOM   7370 O O     . TYR D 4 316 ? 26.745  31.285  43.063  1.00 25.04  ? 316 TYR B O     1 
ATOM   7371 C CB    . TYR D 4 316 ? 28.215  29.172  41.915  1.00 24.95  ? 316 TYR B CB    1 
ATOM   7372 C CG    . TYR D 4 316 ? 28.123  28.113  43.002  1.00 26.77  ? 316 TYR B CG    1 
ATOM   7373 C CD1   . TYR D 4 316 ? 28.061  26.754  42.681  1.00 26.45  ? 316 TYR B CD1   1 
ATOM   7374 C CD2   . TYR D 4 316 ? 28.053  28.474  44.349  1.00 25.25  ? 316 TYR B CD2   1 
ATOM   7375 C CE1   . TYR D 4 316 ? 27.930  25.781  43.675  1.00 26.66  ? 316 TYR B CE1   1 
ATOM   7376 C CE2   . TYR D 4 316 ? 27.925  27.513  45.350  1.00 25.67  ? 316 TYR B CE2   1 
ATOM   7377 C CZ    . TYR D 4 316 ? 27.864  26.169  45.012  1.00 27.96  ? 316 TYR B CZ    1 
ATOM   7378 O OH    . TYR D 4 316 ? 27.746  25.218  46.009  1.00 26.51  ? 316 TYR B OH    1 
ATOM   7379 N N     . GLY D 4 317 ? 24.794  30.470  42.279  1.00 26.43  ? 317 GLY B N     1 
ATOM   7380 C CA    . GLY D 4 317 ? 24.016  31.361  43.110  1.00 28.34  ? 317 GLY B CA    1 
ATOM   7381 C C     . GLY D 4 317 ? 24.314  32.780  42.653  1.00 30.65  ? 317 GLY B C     1 
ATOM   7382 O O     . GLY D 4 317 ? 24.156  33.109  41.482  1.00 31.81  ? 317 GLY B O     1 
ATOM   7383 N N     . SER D 4 318 ? 24.772  33.612  43.578  1.00 31.92  ? 318 SER B N     1 
ATOM   7384 C CA    . SER D 4 318 ? 25.105  35.001  43.298  1.00 33.88  ? 318 SER B CA    1 
ATOM   7385 C C     . SER D 4 318 ? 26.528  35.150  42.752  1.00 35.80  ? 318 SER B C     1 
ATOM   7386 O O     . SER D 4 318 ? 26.904  36.212  42.252  1.00 37.46  ? 318 SER B O     1 
ATOM   7387 C CB    . SER D 4 318 ? 24.973  35.811  44.581  1.00 33.51  ? 318 SER B CB    1 
ATOM   7388 O OG    . SER D 4 318 ? 25.677  35.176  45.637  1.00 32.27  ? 318 SER B OG    1 
ATOM   7389 N N     . ASP D 4 319 ? 27.315  34.085  42.861  1.00 35.27  ? 319 ASP B N     1 
ATOM   7390 C CA    . ASP D 4 319 ? 28.693  34.100  42.392  1.00 34.21  ? 319 ASP B CA    1 
ATOM   7391 C C     . ASP D 4 319 ? 28.772  33.891  40.895  1.00 32.30  ? 319 ASP B C     1 
ATOM   7392 O O     . ASP D 4 319 ? 27.937  33.216  40.305  1.00 32.82  ? 319 ASP B O     1 
ATOM   7393 C CB    . ASP D 4 319 ? 29.501  32.988  43.071  1.00 35.19  ? 319 ASP B CB    1 
ATOM   7394 C CG    . ASP D 4 319 ? 29.730  33.242  44.545  1.00 37.93  ? 319 ASP B CG    1 
ATOM   7395 O OD1   . ASP D 4 319 ? 29.655  32.269  45.324  1.00 36.70  ? 319 ASP B OD1   1 
ATOM   7396 O OD2   . ASP D 4 319 ? 30.000  34.407  44.922  1.00 41.43  ? 319 ASP B OD2   1 
ATOM   7397 N N     . ILE D 4 320 ? 29.788  34.481  40.288  1.00 31.11  ? 320 ILE B N     1 
ATOM   7398 C CA    . ILE D 4 320 ? 30.024  34.324  38.867  1.00 30.66  ? 320 ILE B CA    1 
ATOM   7399 C C     . ILE D 4 320 ? 31.385  33.669  38.836  1.00 29.92  ? 320 ILE B C     1 
ATOM   7400 O O     . ILE D 4 320 ? 32.342  34.188  39.399  1.00 30.14  ? 320 ILE B O     1 
ATOM   7401 C CB    . ILE D 4 320 ? 30.025  35.673  38.143  1.00 31.05  ? 320 ILE B CB    1 
ATOM   7402 C CG1   . ILE D 4 320 ? 28.603  36.244  38.186  1.00 30.65  ? 320 ILE B CG1   1 
ATOM   7403 C CG2   . ILE D 4 320 ? 30.514  35.501  36.701  1.00 31.39  ? 320 ILE B CG2   1 
ATOM   7404 C CD1   . ILE D 4 320 ? 28.403  37.496  37.392  1.00 33.76  ? 320 ILE B CD1   1 
ATOM   7405 N N     . VAL D 4 321 ? 31.460  32.505  38.202  1.00 28.80  ? 321 VAL B N     1 
ATOM   7406 C CA    . VAL D 4 321 ? 32.699  31.755  38.172  1.00 27.15  ? 321 VAL B CA    1 
ATOM   7407 C C     . VAL D 4 321 ? 33.273  31.462  36.794  1.00 28.62  ? 321 VAL B C     1 
ATOM   7408 O O     . VAL D 4 321 ? 32.748  30.623  36.057  1.00 28.29  ? 321 VAL B O     1 
ATOM   7409 C CB    . VAL D 4 321 ? 32.516  30.409  38.892  1.00 24.71  ? 321 VAL B CB    1 
ATOM   7410 C CG1   . VAL D 4 321 ? 33.851  29.712  39.031  1.00 22.35  ? 321 VAL B CG1   1 
ATOM   7411 C CG2   . VAL D 4 321 ? 31.863  30.626  40.243  1.00 21.62  ? 321 VAL B CG2   1 
ATOM   7412 N N     . PRO D 4 322 ? 34.353  32.164  36.419  1.00 28.45  ? 322 PRO B N     1 
ATOM   7413 C CA    . PRO D 4 322 ? 34.945  31.896  35.107  1.00 29.67  ? 322 PRO B CA    1 
ATOM   7414 C C     . PRO D 4 322 ? 35.434  30.445  35.061  1.00 30.99  ? 322 PRO B C     1 
ATOM   7415 O O     . PRO D 4 322 ? 36.119  29.976  35.967  1.00 31.59  ? 322 PRO B O     1 
ATOM   7416 C CB    . PRO D 4 322 ? 36.079  32.922  35.010  1.00 29.05  ? 322 PRO B CB    1 
ATOM   7417 C CG    . PRO D 4 322 ? 36.319  33.361  36.424  1.00 30.11  ? 322 PRO B CG    1 
ATOM   7418 C CD    . PRO D 4 322 ? 34.939  33.369  37.025  1.00 29.25  ? 322 PRO B CD    1 
ATOM   7419 N N     . PHE D 4 323 ? 35.053  29.737  34.007  1.00 32.21  ? 323 PHE B N     1 
ATOM   7420 C CA    . PHE D 4 323 ? 35.415  28.336  33.836  1.00 32.50  ? 323 PHE B CA    1 
ATOM   7421 C C     . PHE D 4 323 ? 35.478  28.133  32.332  1.00 33.69  ? 323 PHE B C     1 
ATOM   7422 O O     . PHE D 4 323 ? 34.443  28.059  31.672  1.00 34.44  ? 323 PHE B O     1 
ATOM   7423 C CB    . PHE D 4 323 ? 34.315  27.460  34.440  1.00 31.05  ? 323 PHE B CB    1 
ATOM   7424 C CG    . PHE D 4 323 ? 34.719  26.047  34.694  1.00 28.01  ? 323 PHE B CG    1 
ATOM   7425 C CD1   . PHE D 4 323 ? 33.753  25.082  34.936  1.00 28.77  ? 323 PHE B CD1   1 
ATOM   7426 C CD2   . PHE D 4 323 ? 36.056  25.679  34.737  1.00 29.43  ? 323 PHE B CD2   1 
ATOM   7427 C CE1   . PHE D 4 323 ? 34.105  23.762  35.220  1.00 28.73  ? 323 PHE B CE1   1 
ATOM   7428 C CE2   . PHE D 4 323 ? 36.418  24.362  35.023  1.00 29.67  ? 323 PHE B CE2   1 
ATOM   7429 C CZ    . PHE D 4 323 ? 35.437  23.400  35.265  1.00 26.68  ? 323 PHE B CZ    1 
ATOM   7430 N N     . SER D 4 324 ? 36.686  28.066  31.787  1.00 34.75  ? 324 SER B N     1 
ATOM   7431 C CA    . SER D 4 324 ? 36.861  27.897  30.345  1.00 35.86  ? 324 SER B CA    1 
ATOM   7432 C C     . SER D 4 324 ? 36.394  26.518  29.892  1.00 37.37  ? 324 SER B C     1 
ATOM   7433 O O     . SER D 4 324 ? 36.251  25.608  30.709  1.00 37.45  ? 324 SER B O     1 
ATOM   7434 C CB    . SER D 4 324 ? 38.333  28.086  29.972  1.00 33.97  ? 324 SER B CB    1 
ATOM   7435 O OG    . SER D 4 324 ? 39.136  27.104  30.603  1.00 34.98  ? 324 SER B OG    1 
ATOM   7436 N N     . LYS D 4 325 ? 36.155  26.363  28.593  1.00 38.69  ? 325 LYS B N     1 
ATOM   7437 C CA    . LYS D 4 325 ? 35.712  25.078  28.066  1.00 41.28  ? 325 LYS B CA    1 
ATOM   7438 C C     . LYS D 4 325 ? 36.830  24.049  28.126  1.00 42.04  ? 325 LYS B C     1 
ATOM   7439 O O     . LYS D 4 325 ? 36.581  22.841  28.144  1.00 42.12  ? 325 LYS B O     1 
ATOM   7440 C CB    . LYS D 4 325 ? 35.198  25.234  26.632  1.00 44.11  ? 325 LYS B CB    1 
ATOM   7441 C CG    . LYS D 4 325 ? 33.791  25.810  26.589  1.00 47.03  ? 325 LYS B CG    1 
ATOM   7442 C CD    . LYS D 4 325 ? 33.222  25.923  25.190  1.00 49.61  ? 325 LYS B CD    1 
ATOM   7443 C CE    . LYS D 4 325 ? 31.772  26.386  25.268  1.00 52.00  ? 325 LYS B CE    1 
ATOM   7444 N NZ    . LYS D 4 325 ? 31.142  26.556  23.934  1.00 55.79  ? 325 LYS B NZ    1 
ATOM   7445 N N     . VAL D 4 326 ? 38.063  24.538  28.175  1.00 42.28  ? 326 VAL B N     1 
ATOM   7446 C CA    . VAL D 4 326 ? 39.218  23.667  28.261  1.00 41.99  ? 326 VAL B CA    1 
ATOM   7447 C C     . VAL D 4 326 ? 39.285  23.044  29.652  1.00 42.71  ? 326 VAL B C     1 
ATOM   7448 O O     . VAL D 4 326 ? 39.440  21.827  29.784  1.00 42.93  ? 326 VAL B O     1 
ATOM   7449 C CB    . VAL D 4 326 ? 40.517  24.445  27.994  1.00 42.41  ? 326 VAL B CB    1 
ATOM   7450 C CG1   . VAL D 4 326 ? 41.717  23.569  28.298  1.00 41.91  ? 326 VAL B CG1   1 
ATOM   7451 C CG2   . VAL D 4 326 ? 40.551  24.907  26.545  1.00 42.10  ? 326 VAL B CG2   1 
ATOM   7452 N N     . ASP D 4 327 ? 39.167  23.877  30.686  1.00 43.13  ? 327 ASP B N     1 
ATOM   7453 C CA    . ASP D 4 327 ? 39.219  23.392  32.068  1.00 44.29  ? 327 ASP B CA    1 
ATOM   7454 C C     . ASP D 4 327 ? 38.031  22.506  32.371  1.00 43.42  ? 327 ASP B C     1 
ATOM   7455 O O     . ASP D 4 327 ? 38.158  21.492  33.053  1.00 42.64  ? 327 ASP B O     1 
ATOM   7456 C CB    . ASP D 4 327 ? 39.203  24.549  33.070  1.00 46.51  ? 327 ASP B CB    1 
ATOM   7457 C CG    . ASP D 4 327 ? 40.448  25.389  33.017  1.00 49.51  ? 327 ASP B CG    1 
ATOM   7458 O OD1   . ASP D 4 327 ? 41.560  24.825  33.112  1.00 51.63  ? 327 ASP B OD1   1 
ATOM   7459 O OD2   . ASP D 4 327 ? 40.310  26.621  32.893  1.00 52.56  ? 327 ASP B OD2   1 
ATOM   7460 N N     . GLU D 4 328 ? 36.872  22.924  31.872  1.00 43.91  ? 328 GLU B N     1 
ATOM   7461 C CA    . GLU D 4 328 ? 35.617  22.208  32.061  1.00 44.50  ? 328 GLU B CA    1 
ATOM   7462 C C     . GLU D 4 328 ? 35.672  20.846  31.406  1.00 44.76  ? 328 GLU B C     1 
ATOM   7463 O O     . GLU D 4 328 ? 35.018  19.907  31.845  1.00 43.02  ? 328 GLU B O     1 
ATOM   7464 C CB    . GLU D 4 328 ? 34.474  23.013  31.458  1.00 43.99  ? 328 GLU B CB    1 
ATOM   7465 C CG    . GLU D 4 328 ? 33.162  22.268  31.375  1.00 44.17  ? 328 GLU B CG    1 
ATOM   7466 C CD    . GLU D 4 328 ? 32.115  23.068  30.640  1.00 43.94  ? 328 GLU B CD    1 
ATOM   7467 O OE1   . GLU D 4 328 ? 32.395  23.483  29.495  1.00 43.74  ? 328 GLU B OE1   1 
ATOM   7468 O OE2   . GLU D 4 328 ? 31.020  23.283  31.202  1.00 43.02  ? 328 GLU B OE2   1 
ATOM   7469 N N     . GLU D 4 329 ? 36.461  20.760  30.344  1.00 46.26  ? 329 GLU B N     1 
ATOM   7470 C CA    . GLU D 4 329 ? 36.629  19.535  29.588  1.00 46.80  ? 329 GLU B CA    1 
ATOM   7471 C C     . GLU D 4 329 ? 37.344  18.466  30.389  1.00 46.18  ? 329 GLU B C     1 
ATOM   7472 O O     . GLU D 4 329 ? 37.078  17.279  30.227  1.00 47.71  ? 329 GLU B O     1 
ATOM   7473 C CB    . GLU D 4 329 ? 37.433  19.832  28.324  1.00 50.46  ? 329 GLU B CB    1 
ATOM   7474 C CG    . GLU D 4 329 ? 37.841  18.604  27.532  1.00 52.89  ? 329 GLU B CG    1 
ATOM   7475 C CD    . GLU D 4 329 ? 36.647  17.839  27.014  1.00 54.95  ? 329 GLU B CD    1 
ATOM   7476 O OE1   . GLU D 4 329 ? 35.773  18.477  26.380  1.00 54.48  ? 329 GLU B OE1   1 
ATOM   7477 O OE2   . GLU D 4 329 ? 36.585  16.608  27.240  1.00 55.82  ? 329 GLU B OE2   1 
ATOM   7478 N N     . GLN D 4 330 ? 38.250  18.887  31.260  1.00 45.47  ? 330 GLN B N     1 
ATOM   7479 C CA    . GLN D 4 330 ? 39.024  17.941  32.045  1.00 44.92  ? 330 GLN B CA    1 
ATOM   7480 C C     . GLN D 4 330 ? 38.473  17.617  33.432  1.00 45.45  ? 330 GLN B C     1 
ATOM   7481 O O     . GLN D 4 330 ? 38.628  16.492  33.917  1.00 45.25  ? 330 GLN B O     1 
ATOM   7482 C CB    . GLN D 4 330 ? 40.462  18.444  32.129  1.00 46.47  ? 330 GLN B CB    1 
ATOM   7483 C CG    . GLN D 4 330 ? 41.110  18.538  30.754  1.00 49.36  ? 330 GLN B CG    1 
ATOM   7484 C CD    . GLN D 4 330 ? 42.417  19.297  30.760  1.00 52.54  ? 330 GLN B CD    1 
ATOM   7485 O OE1   . GLN D 4 330 ? 42.447  20.511  30.976  1.00 53.95  ? 330 GLN B OE1   1 
ATOM   7486 N NE2   . GLN D 4 330 ? 43.513  18.585  30.524  1.00 53.73  ? 330 GLN B NE2   1 
ATOM   7487 N N     . MET D 4 331 ? 37.830  18.589  34.072  1.00 45.21  ? 331 MET B N     1 
ATOM   7488 C CA    . MET D 4 331 ? 37.254  18.368  35.395  1.00 44.87  ? 331 MET B CA    1 
ATOM   7489 C C     . MET D 4 331 ? 35.877  17.729  35.238  1.00 45.18  ? 331 MET B C     1 
ATOM   7490 O O     . MET D 4 331 ? 35.314  17.168  36.182  1.00 45.95  ? 331 MET B O     1 
ATOM   7491 C CB    . MET D 4 331 ? 37.141  19.693  36.144  1.00 44.75  ? 331 MET B CB    1 
ATOM   7492 C CG    . MET D 4 331 ? 38.480  20.262  36.578  1.00 46.32  ? 331 MET B CG    1 
ATOM   7493 S SD    . MET D 4 331 ? 38.314  21.842  37.433  1.00 48.01  ? 331 MET B SD    1 
ATOM   7494 C CE    . MET D 4 331 ? 39.127  22.931  36.249  1.00 46.64  ? 331 MET B CE    1 
ATOM   7495 N N     . LYS D 4 332 ? 35.356  17.823  34.021  1.00 44.63  ? 332 LYS B N     1 
ATOM   7496 C CA    . LYS D 4 332 ? 34.055  17.281  33.643  1.00 45.42  ? 332 LYS B CA    1 
ATOM   7497 C C     . LYS D 4 332 ? 33.890  15.813  34.032  1.00 44.73  ? 332 LYS B C     1 
ATOM   7498 O O     . LYS D 4 332 ? 34.824  15.019  33.899  1.00 43.82  ? 332 LYS B O     1 
ATOM   7499 C CB    . LYS D 4 332 ? 33.893  17.430  32.127  1.00 47.19  ? 332 LYS B CB    1 
ATOM   7500 C CG    . LYS D 4 332 ? 32.667  16.799  31.522  1.00 48.90  ? 332 LYS B CG    1 
ATOM   7501 C CD    . LYS D 4 332 ? 32.694  16.966  30.008  1.00 49.49  ? 332 LYS B CD    1 
ATOM   7502 C CE    . LYS D 4 332 ? 31.366  16.574  29.388  1.00 51.26  ? 332 LYS B CE    1 
ATOM   7503 N NZ    . LYS D 4 332 ? 31.337  16.869  27.932  1.00 52.52  ? 332 LYS B NZ    1 
ATOM   7504 N N     . TYR D 4 333 ? 32.702  15.454  34.512  1.00 43.34  ? 333 TYR B N     1 
ATOM   7505 C CA    . TYR D 4 333 ? 32.427  14.070  34.878  1.00 42.22  ? 333 TYR B CA    1 
ATOM   7506 C C     . TYR D 4 333 ? 32.579  13.217  33.624  1.00 42.54  ? 333 TYR B C     1 
ATOM   7507 O O     . TYR D 4 333 ? 32.043  13.557  32.570  1.00 41.42  ? 333 TYR B O     1 
ATOM   7508 C CB    . TYR D 4 333 ? 30.998  13.912  35.397  1.00 40.45  ? 333 TYR B CB    1 
ATOM   7509 C CG    . TYR D 4 333 ? 30.513  12.474  35.365  1.00 36.93  ? 333 TYR B CG    1 
ATOM   7510 C CD1   . TYR D 4 333 ? 30.671  11.643  36.466  1.00 35.23  ? 333 TYR B CD1   1 
ATOM   7511 C CD2   . TYR D 4 333 ? 29.936  11.935  34.211  1.00 34.44  ? 333 TYR B CD2   1 
ATOM   7512 C CE1   . TYR D 4 333 ? 30.271  10.322  36.426  1.00 33.19  ? 333 TYR B CE1   1 
ATOM   7513 C CE2   . TYR D 4 333 ? 29.538  10.609  34.159  1.00 31.87  ? 333 TYR B CE2   1 
ATOM   7514 C CZ    . TYR D 4 333 ? 29.706  9.810   35.272  1.00 32.98  ? 333 TYR B CZ    1 
ATOM   7515 O OH    . TYR D 4 333 ? 29.295  8.501   35.253  1.00 30.40  ? 333 TYR B OH    1 
ATOM   7516 N N     . LYS D 4 334 ? 33.297  12.107  33.742  1.00 44.57  ? 334 LYS B N     1 
ATOM   7517 C CA    . LYS D 4 334 ? 33.496  11.218  32.607  1.00 46.99  ? 334 LYS B CA    1 
ATOM   7518 C C     . LYS D 4 334 ? 33.176  9.777   32.998  1.00 48.11  ? 334 LYS B C     1 
ATOM   7519 O O     . LYS D 4 334 ? 33.564  9.317   34.072  1.00 47.10  ? 334 LYS B O     1 
ATOM   7520 C CB    . LYS D 4 334 ? 34.933  11.340  32.101  1.00 47.97  ? 334 LYS B CB    1 
ATOM   7521 C CG    . LYS D 4 334 ? 35.289  12.751  31.665  1.00 49.56  ? 334 LYS B CG    1 
ATOM   7522 C CD    . LYS D 4 334 ? 36.621  12.814  30.934  1.00 51.07  ? 334 LYS B CD    1 
ATOM   7523 C CE    . LYS D 4 334 ? 36.858  14.213  30.382  1.00 51.60  ? 334 LYS B CE    1 
ATOM   7524 N NZ    . LYS D 4 334 ? 37.959  14.242  29.382  1.00 52.91  ? 334 LYS B NZ    1 
ATOM   7525 N N     . SER D 4 335 ? 32.468  9.075   32.117  1.00 49.69  ? 335 SER B N     1 
ATOM   7526 C CA    . SER D 4 335 ? 32.066  7.688   32.363  1.00 51.81  ? 335 SER B CA    1 
ATOM   7527 C C     . SER D 4 335 ? 32.859  6.667   31.553  1.00 53.06  ? 335 SER B C     1 
ATOM   7528 O O     . SER D 4 335 ? 33.523  7.021   30.575  1.00 53.58  ? 335 SER B O     1 
ATOM   7529 C CB    . SER D 4 335 ? 30.586  7.519   32.023  1.00 51.55  ? 335 SER B CB    1 
ATOM   7530 O OG    . SER D 4 335 ? 30.360  7.791   30.648  1.00 50.77  ? 335 SER B OG    1 
ATOM   7531 N N     . GLU D 4 336 ? 32.772  5.398   31.957  1.00 54.83  ? 336 GLU B N     1 
ATOM   7532 C CA    . GLU D 4 336 ? 33.453  4.319   31.240  1.00 55.51  ? 336 GLU B CA    1 
ATOM   7533 C C     . GLU D 4 336 ? 32.884  4.243   29.826  1.00 55.54  ? 336 GLU B C     1 
ATOM   7534 O O     . GLU D 4 336 ? 33.620  4.021   28.862  1.00 57.39  ? 336 GLU B O     1 
ATOM   7535 C CB    . GLU D 4 336 ? 33.252  2.962   31.925  1.00 56.39  ? 336 GLU B CB    1 
ATOM   7536 C CG    . GLU D 4 336 ? 34.028  2.758   33.216  1.00 58.66  ? 336 GLU B CG    1 
ATOM   7537 C CD    . GLU D 4 336 ? 33.354  3.403   34.409  1.00 60.69  ? 336 GLU B CD    1 
ATOM   7538 O OE1   . GLU D 4 336 ? 33.185  4.641   34.397  1.00 62.84  ? 336 GLU B OE1   1 
ATOM   7539 O OE2   . GLU D 4 336 ? 32.992  2.673   35.358  1.00 60.54  ? 336 GLU B OE2   1 
ATOM   7540 N N     . GLY D 4 337 ? 31.569  4.425   29.711  1.00 53.98  ? 337 GLY B N     1 
ATOM   7541 C CA    . GLY D 4 337 ? 30.934  4.387   28.406  1.00 51.21  ? 337 GLY B CA    1 
ATOM   7542 C C     . GLY D 4 337 ? 29.655  3.576   28.335  1.00 49.20  ? 337 GLY B C     1 
ATOM   7543 O O     . GLY D 4 337 ? 28.962  3.380   29.333  1.00 48.06  ? 337 GLY B O     1 
ATOM   7544 N N     . LYS D 4 338 ? 29.353  3.108   27.128  1.00 47.06  ? 338 LYS B N     1 
ATOM   7545 C CA    . LYS D 4 338 ? 28.170  2.307   26.845  1.00 44.03  ? 338 LYS B CA    1 
ATOM   7546 C C     . LYS D 4 338 ? 27.922  1.304   27.970  1.00 41.98  ? 338 LYS B C     1 
ATOM   7547 O O     . LYS D 4 338 ? 28.871  0.772   28.540  1.00 42.90  ? 338 LYS B O     1 
ATOM   7548 C CB    . LYS D 4 338 ? 28.390  1.574   25.523  1.00 46.81  ? 338 LYS B CB    1 
ATOM   7549 C CG    . LYS D 4 338 ? 27.143  1.263   24.715  1.00 48.14  ? 338 LYS B CG    1 
ATOM   7550 C CD    . LYS D 4 338 ? 27.555  0.800   23.327  1.00 48.64  ? 338 LYS B CD    1 
ATOM   7551 C CE    . LYS D 4 338 ? 26.365  0.603   22.410  1.00 49.66  ? 338 LYS B CE    1 
ATOM   7552 N NZ    . LYS D 4 338 ? 26.804  0.311   21.012  1.00 49.46  ? 338 LYS B NZ    1 
ATOM   7553 N N     . CYS D 4 339 ? 26.656  1.053   28.297  1.00 38.70  ? 339 CYS B N     1 
ATOM   7554 C CA    . CYS D 4 339 ? 26.338  0.101   29.352  1.00 35.32  ? 339 CYS B CA    1 
ATOM   7555 C C     . CYS D 4 339 ? 24.841  -0.053  29.630  1.00 33.01  ? 339 CYS B C     1 
ATOM   7556 O O     . CYS D 4 339 ? 24.029  0.783   29.255  1.00 34.55  ? 339 CYS B O     1 
ATOM   7557 C CB    . CYS D 4 339 ? 27.040  0.501   30.651  1.00 35.79  ? 339 CYS B CB    1 
ATOM   7558 S SG    . CYS D 4 339 ? 26.155  1.753   31.627  1.00 40.01  ? 339 CYS B SG    1 
ATOM   7559 N N     . PHE D 4 340 ? 24.496  -1.140  30.306  1.00 31.11  ? 340 PHE B N     1 
ATOM   7560 C CA    . PHE D 4 340 ? 23.119  -1.437  30.694  1.00 28.22  ? 340 PHE B CA    1 
ATOM   7561 C C     . PHE D 4 340 ? 23.331  -2.355  31.883  1.00 26.14  ? 340 PHE B C     1 
ATOM   7562 O O     . PHE D 4 340 ? 23.208  -3.569  31.769  1.00 27.07  ? 340 PHE B O     1 
ATOM   7563 C CB    . PHE D 4 340 ? 22.382  -2.186  29.585  1.00 26.96  ? 340 PHE B CB    1 
ATOM   7564 C CG    . PHE D 4 340 ? 20.892  -2.059  29.661  1.00 28.00  ? 340 PHE B CG    1 
ATOM   7565 C CD1   . PHE D 4 340 ? 20.259  -0.905  29.212  1.00 26.12  ? 340 PHE B CD1   1 
ATOM   7566 C CD2   . PHE D 4 340 ? 20.117  -3.083  30.209  1.00 28.99  ? 340 PHE B CD2   1 
ATOM   7567 C CE1   . PHE D 4 340 ? 18.874  -0.764  29.304  1.00 27.08  ? 340 PHE B CE1   1 
ATOM   7568 C CE2   . PHE D 4 340 ? 18.726  -2.954  30.309  1.00 28.61  ? 340 PHE B CE2   1 
ATOM   7569 C CZ    . PHE D 4 340 ? 18.102  -1.789  29.854  1.00 26.79  ? 340 PHE B CZ    1 
ATOM   7570 N N     . SER D 4 341 ? 23.659  -1.754  33.020  1.00 23.93  ? 341 SER B N     1 
ATOM   7571 C CA    . SER D 4 341 ? 23.974  -2.497  34.225  1.00 23.21  ? 341 SER B CA    1 
ATOM   7572 C C     . SER D 4 341 ? 22.897  -2.516  35.279  1.00 23.93  ? 341 SER B C     1 
ATOM   7573 O O     . SER D 4 341 ? 22.349  -1.475  35.644  1.00 26.56  ? 341 SER B O     1 
ATOM   7574 C CB    . SER D 4 341 ? 25.248  -1.923  34.851  1.00 23.64  ? 341 SER B CB    1 
ATOM   7575 O OG    . SER D 4 341 ? 26.255  -1.709  33.875  1.00 27.59  ? 341 SER B OG    1 
ATOM   7576 N N     . VAL D 4 342 ? 22.613  -3.702  35.793  1.00 23.52  ? 342 VAL B N     1 
ATOM   7577 C CA    . VAL D 4 342 ? 21.621  -3.839  36.840  1.00 24.82  ? 342 VAL B CA    1 
ATOM   7578 C C     . VAL D 4 342 ? 22.224  -3.345  38.149  1.00 27.47  ? 342 VAL B C     1 
ATOM   7579 O O     . VAL D 4 342 ? 23.369  -3.668  38.488  1.00 28.98  ? 342 VAL B O     1 
ATOM   7580 C CB    . VAL D 4 342 ? 21.187  -5.309  37.020  1.00 24.97  ? 342 VAL B CB    1 
ATOM   7581 C CG1   . VAL D 4 342 ? 20.276  -5.442  38.235  1.00 22.10  ? 342 VAL B CG1   1 
ATOM   7582 C CG2   . VAL D 4 342 ? 20.468  -5.795  35.766  1.00 24.68  ? 342 VAL B CG2   1 
ATOM   7583 N N     . LEU D 4 343 ? 21.453  -2.550  38.877  1.00 27.84  ? 343 LEU B N     1 
ATOM   7584 C CA    . LEU D 4 343 ? 21.892  -2.019  40.155  1.00 27.77  ? 343 LEU B CA    1 
ATOM   7585 C C     . LEU D 4 343 ? 21.223  -2.848  41.237  1.00 27.45  ? 343 LEU B C     1 
ATOM   7586 O O     . LEU D 4 343 ? 21.765  -3.033  42.326  1.00 27.97  ? 343 LEU B O     1 
ATOM   7587 C CB    . LEU D 4 343 ? 21.471  -0.558  40.279  1.00 28.36  ? 343 LEU B CB    1 
ATOM   7588 C CG    . LEU D 4 343 ? 22.001  0.322   39.151  1.00 29.43  ? 343 LEU B CG    1 
ATOM   7589 C CD1   . LEU D 4 343 ? 21.435  1.729   39.279  1.00 30.90  ? 343 LEU B CD1   1 
ATOM   7590 C CD2   . LEU D 4 343 ? 23.519  0.342   39.203  1.00 30.70  ? 343 LEU B CD2   1 
ATOM   7591 N N     . GLY D 4 344 ? 20.038  -3.351  40.909  1.00 26.82  ? 344 GLY B N     1 
ATOM   7592 C CA    . GLY D 4 344 ? 19.273  -4.167  41.835  1.00 25.13  ? 344 GLY B CA    1 
ATOM   7593 C C     . GLY D 4 344 ? 17.886  -4.407  41.273  1.00 24.49  ? 344 GLY B C     1 
ATOM   7594 O O     . GLY D 4 344 ? 17.579  -3.974  40.164  1.00 24.42  ? 344 GLY B O     1 
ATOM   7595 N N     . PHE D 4 345 ? 17.053  -5.117  42.020  1.00 25.81  ? 345 PHE B N     1 
ATOM   7596 C CA    . PHE D 4 345 ? 15.688  -5.385  41.590  1.00 28.23  ? 345 PHE B CA    1 
ATOM   7597 C C     . PHE D 4 345 ? 14.757  -5.006  42.733  1.00 29.53  ? 345 PHE B C     1 
ATOM   7598 O O     . PHE D 4 345 ? 15.110  -5.145  43.907  1.00 30.73  ? 345 PHE B O     1 
ATOM   7599 C CB    . PHE D 4 345 ? 15.482  -6.866  41.259  1.00 27.36  ? 345 PHE B CB    1 
ATOM   7600 C CG    . PHE D 4 345 ? 16.461  -7.417  40.265  1.00 27.59  ? 345 PHE B CG    1 
ATOM   7601 C CD1   . PHE D 4 345 ? 17.669  -7.971  40.689  1.00 27.89  ? 345 PHE B CD1   1 
ATOM   7602 C CD2   . PHE D 4 345 ? 16.163  -7.418  38.905  1.00 26.25  ? 345 PHE B CD2   1 
ATOM   7603 C CE1   . PHE D 4 345 ? 18.565  -8.525  39.768  1.00 26.65  ? 345 PHE B CE1   1 
ATOM   7604 C CE2   . PHE D 4 345 ? 17.051  -7.968  37.979  1.00 26.10  ? 345 PHE B CE2   1 
ATOM   7605 C CZ    . PHE D 4 345 ? 18.253  -8.524  38.412  1.00 25.12  ? 345 PHE B CZ    1 
ATOM   7606 N N     . CYS D 4 346 ? 13.562  -4.545  42.395  1.00 29.56  ? 346 CYS B N     1 
ATOM   7607 C CA    . CYS D 4 346 ? 12.609  -4.157  43.419  1.00 29.54  ? 346 CYS B CA    1 
ATOM   7608 C C     . CYS D 4 346 ? 11.178  -4.477  43.005  1.00 30.27  ? 346 CYS B C     1 
ATOM   7609 O O     . CYS D 4 346 ? 10.922  -4.859  41.865  1.00 30.27  ? 346 CYS B O     1 
ATOM   7610 C CB    . CYS D 4 346 ? 12.742  -2.659  43.699  1.00 30.19  ? 346 CYS B CB    1 
ATOM   7611 S SG    . CYS D 4 346 ? 12.332  -1.623  42.287  1.00 27.26  ? 346 CYS B SG    1 
ATOM   7612 N N     . LYS D 4 347 ? 10.252  -4.338  43.948  1.00 31.05  ? 347 LYS B N     1 
ATOM   7613 C CA    . LYS D 4 347 ? 8.844   -4.569  43.673  1.00 32.51  ? 347 LYS B CA    1 
ATOM   7614 C C     . LYS D 4 347 ? 8.426   -3.544  42.635  1.00 33.47  ? 347 LYS B C     1 
ATOM   7615 O O     . LYS D 4 347 ? 8.836   -2.380  42.697  1.00 34.89  ? 347 LYS B O     1 
ATOM   7616 C CB    . LYS D 4 347 ? 7.999   -4.341  44.923  1.00 36.06  ? 347 LYS B CB    1 
ATOM   7617 C CG    . LYS D 4 347 ? 8.037   -5.420  45.975  1.00 37.84  ? 347 LYS B CG    1 
ATOM   7618 C CD    . LYS D 4 347 ? 7.084   -5.004  47.085  1.00 43.13  ? 347 LYS B CD    1 
ATOM   7619 C CE    . LYS D 4 347 ? 6.696   -6.152  47.993  1.00 45.83  ? 347 LYS B CE    1 
ATOM   7620 N NZ    . LYS D 4 347 ? 5.580   -5.727  48.882  1.00 49.31  ? 347 LYS B NZ    1 
ATOM   7621 N N     . SER D 4 348 ? 7.602   -3.961  41.685  1.00 34.42  ? 348 SER B N     1 
ATOM   7622 C CA    . SER D 4 348 ? 7.162   -3.038  40.654  1.00 35.57  ? 348 SER B CA    1 
ATOM   7623 C C     . SER D 4 348 ? 6.362   -1.909  41.280  1.00 34.27  ? 348 SER B C     1 
ATOM   7624 O O     . SER D 4 348 ? 6.356   -0.791  40.766  1.00 36.76  ? 348 SER B O     1 
ATOM   7625 C CB    . SER D 4 348 ? 6.306   -3.760  39.614  1.00 37.14  ? 348 SER B CB    1 
ATOM   7626 O OG    . SER D 4 348 ? 5.097   -4.214  40.193  1.00 43.41  ? 348 SER B OG    1 
ATOM   7627 N N     . SER D 4 349 ? 5.697   -2.199  42.394  1.00 32.22  ? 349 SER B N     1 
ATOM   7628 C CA    . SER D 4 349 ? 4.886   -1.196  43.076  1.00 30.70  ? 349 SER B CA    1 
ATOM   7629 C C     . SER D 4 349 ? 5.702   0.016   43.512  1.00 28.79  ? 349 SER B C     1 
ATOM   7630 O O     . SER D 4 349 ? 5.165   1.120   43.615  1.00 28.39  ? 349 SER B O     1 
ATOM   7631 C CB    . SER D 4 349 ? 4.173   -1.807  44.291  1.00 32.18  ? 349 SER B CB    1 
ATOM   7632 O OG    . SER D 4 349 ? 5.090   -2.374  45.215  1.00 34.79  ? 349 SER B OG    1 
ATOM   7633 N N     . GLN D 4 350 ? 6.997   -0.175  43.750  1.00 27.32  ? 350 GLN B N     1 
ATOM   7634 C CA    . GLN D 4 350 ? 7.846   0.937   44.172  1.00 26.97  ? 350 GLN B CA    1 
ATOM   7635 C C     . GLN D 4 350 ? 8.237   1.837   42.998  1.00 27.28  ? 350 GLN B C     1 
ATOM   7636 O O     . GLN D 4 350 ? 8.947   2.827   43.169  1.00 28.11  ? 350 GLN B O     1 
ATOM   7637 C CB    . GLN D 4 350 ? 9.108   0.421   44.860  1.00 26.64  ? 350 GLN B CB    1 
ATOM   7638 C CG    . GLN D 4 350 ? 8.856   -0.563  45.992  1.00 28.56  ? 350 GLN B CG    1 
ATOM   7639 C CD    . GLN D 4 350 ? 10.134  -0.932  46.722  1.00 28.34  ? 350 GLN B CD    1 
ATOM   7640 O OE1   . GLN D 4 350 ? 11.224  -0.852  46.164  1.00 30.05  ? 350 GLN B OE1   1 
ATOM   7641 N NE2   . GLN D 4 350 ? 10.004  -1.349  47.971  1.00 30.79  ? 350 GLN B NE2   1 
ATOM   7642 N N     . VAL D 4 351 ? 7.784   1.485   41.802  1.00 25.94  ? 351 VAL B N     1 
ATOM   7643 C CA    . VAL D 4 351 ? 8.076   2.289   40.627  1.00 27.05  ? 351 VAL B CA    1 
ATOM   7644 C C     . VAL D 4 351 ? 6.760   2.727   39.995  1.00 26.87  ? 351 VAL B C     1 
ATOM   7645 O O     . VAL D 4 351 ? 6.094   1.943   39.326  1.00 28.73  ? 351 VAL B O     1 
ATOM   7646 C CB    . VAL D 4 351 ? 8.910   1.496   39.597  1.00 26.93  ? 351 VAL B CB    1 
ATOM   7647 C CG1   . VAL D 4 351 ? 9.095   2.319   38.328  1.00 23.44  ? 351 VAL B CG1   1 
ATOM   7648 C CG2   . VAL D 4 351 ? 10.266  1.143   40.201  1.00 27.86  ? 351 VAL B CG2   1 
ATOM   7649 N N     . GLN D 4 352 ? 6.390   3.982   40.212  1.00 27.29  ? 352 GLN B N     1 
ATOM   7650 C CA    . GLN D 4 352 ? 5.139   4.512   39.676  1.00 28.80  ? 352 GLN B CA    1 
ATOM   7651 C C     . GLN D 4 352 ? 5.341   5.218   38.347  1.00 28.03  ? 352 GLN B C     1 
ATOM   7652 O O     . GLN D 4 352 ? 6.273   6.010   38.192  1.00 28.92  ? 352 GLN B O     1 
ATOM   7653 C CB    . GLN D 4 352 ? 4.516   5.477   40.677  1.00 30.78  ? 352 GLN B CB    1 
ATOM   7654 C CG    . GLN D 4 352 ? 4.305   4.883   42.057  1.00 34.54  ? 352 GLN B CG    1 
ATOM   7655 C CD    . GLN D 4 352 ? 3.751   5.901   43.028  1.00 39.26  ? 352 GLN B CD    1 
ATOM   7656 O OE1   . GLN D 4 352 ? 2.614   6.363   42.887  1.00 42.77  ? 352 GLN B OE1   1 
ATOM   7657 N NE2   . GLN D 4 352 ? 4.558   6.271   44.017  1.00 40.77  ? 352 GLN B NE2   1 
ATOM   7658 N N     . ARG D 4 353 ? 4.449   4.950   37.397  1.00 26.37  ? 353 ARG B N     1 
ATOM   7659 C CA    . ARG D 4 353 ? 4.553   5.540   36.067  1.00 27.04  ? 353 ARG B CA    1 
ATOM   7660 C C     . ARG D 4 353 ? 4.632   7.068   36.047  1.00 26.09  ? 353 ARG B C     1 
ATOM   7661 O O     . ARG D 4 353 ? 5.234   7.638   35.137  1.00 24.63  ? 353 ARG B O     1 
ATOM   7662 C CB    . ARG D 4 353 ? 3.392   5.085   35.181  1.00 28.46  ? 353 ARG B CB    1 
ATOM   7663 C CG    . ARG D 4 353 ? 2.213   6.043   35.162  1.00 32.90  ? 353 ARG B CG    1 
ATOM   7664 C CD    . ARG D 4 353 ? 1.401   5.866   33.894  1.00 35.65  ? 353 ARG B CD    1 
ATOM   7665 N NE    . ARG D 4 353 ? 2.136   6.255   32.690  1.00 36.87  ? 353 ARG B NE    1 
ATOM   7666 C CZ    . ARG D 4 353 ? 1.748   5.943   31.454  1.00 39.68  ? 353 ARG B CZ    1 
ATOM   7667 N NH1   . ARG D 4 353 ? 0.633   5.237   31.263  1.00 38.37  ? 353 ARG B NH1   1 
ATOM   7668 N NH2   . ARG D 4 353 ? 2.473   6.328   30.408  1.00 38.21  ? 353 ARG B NH2   1 
ATOM   7669 N N     . ARG D 4 354 ? 4.029   7.728   37.037  1.00 25.14  ? 354 ARG B N     1 
ATOM   7670 C CA    . ARG D 4 354 ? 4.066   9.188   37.087  1.00 23.28  ? 354 ARG B CA    1 
ATOM   7671 C C     . ARG D 4 354 ? 5.491   9.716   37.224  1.00 20.06  ? 354 ARG B C     1 
ATOM   7672 O O     . ARG D 4 354 ? 5.743   10.909  37.048  1.00 18.69  ? 354 ARG B O     1 
ATOM   7673 C CB    . ARG D 4 354 ? 3.188   9.722   38.232  1.00 23.55  ? 354 ARG B CB    1 
ATOM   7674 C CG    . ARG D 4 354 ? 3.725   9.585   39.659  1.00 24.24  ? 354 ARG B CG    1 
ATOM   7675 C CD    . ARG D 4 354 ? 2.606   9.972   40.649  1.00 25.34  ? 354 ARG B CD    1 
ATOM   7676 N NE    . ARG D 4 354 ? 3.032   10.067  42.048  1.00 28.19  ? 354 ARG B NE    1 
ATOM   7677 C CZ    . ARG D 4 354 ? 3.484   11.178  42.636  1.00 29.94  ? 354 ARG B CZ    1 
ATOM   7678 N NH1   . ARG D 4 354 ? 3.575   12.315  41.953  1.00 30.46  ? 354 ARG B NH1   1 
ATOM   7679 N NH2   . ARG D 4 354 ? 3.850   11.152  43.913  1.00 29.41  ? 354 ARG B NH2   1 
ATOM   7680 N N     . PHE D 4 355 ? 6.428   8.825   37.528  1.00 19.28  ? 355 PHE B N     1 
ATOM   7681 C CA    . PHE D 4 355 ? 7.810   9.239   37.664  1.00 19.37  ? 355 PHE B CA    1 
ATOM   7682 C C     . PHE D 4 355 ? 8.648   8.938   36.429  1.00 18.98  ? 355 PHE B C     1 
ATOM   7683 O O     . PHE D 4 355 ? 9.852   9.184   36.425  1.00 19.37  ? 355 PHE B O     1 
ATOM   7684 C CB    . PHE D 4 355 ? 8.434   8.605   38.907  1.00 18.75  ? 355 PHE B CB    1 
ATOM   7685 C CG    . PHE D 4 355 ? 8.030   9.279   40.190  1.00 20.82  ? 355 PHE B CG    1 
ATOM   7686 C CD1   . PHE D 4 355 ? 7.329   8.580   41.177  1.00 21.65  ? 355 PHE B CD1   1 
ATOM   7687 C CD2   . PHE D 4 355 ? 8.332   10.620  40.408  1.00 18.77  ? 355 PHE B CD2   1 
ATOM   7688 C CE1   . PHE D 4 355 ? 6.936   9.213   42.357  1.00 21.03  ? 355 PHE B CE1   1 
ATOM   7689 C CE2   . PHE D 4 355 ? 7.944   11.265  41.586  1.00 19.71  ? 355 PHE B CE2   1 
ATOM   7690 C CZ    . PHE D 4 355 ? 7.246   10.566  42.561  1.00 20.86  ? 355 PHE B CZ    1 
ATOM   7691 N N     . PHE D 4 356 ? 8.014   8.418   35.378  1.00 18.25  ? 356 PHE B N     1 
ATOM   7692 C CA    . PHE D 4 356 ? 8.730   8.116   34.139  1.00 18.81  ? 356 PHE B CA    1 
ATOM   7693 C C     . PHE D 4 356 ? 9.363   9.385   33.576  1.00 18.07  ? 356 PHE B C     1 
ATOM   7694 O O     . PHE D 4 356 ? 8.754   10.452  33.581  1.00 17.05  ? 356 PHE B O     1 
ATOM   7695 C CB    . PHE D 4 356 ? 7.794   7.488   33.094  1.00 17.29  ? 356 PHE B CB    1 
ATOM   7696 C CG    . PHE D 4 356 ? 7.480   6.036   33.350  1.00 13.65  ? 356 PHE B CG    1 
ATOM   7697 C CD1   . PHE D 4 356 ? 6.719   5.305   32.435  1.00 12.97  ? 356 PHE B CD1   1 
ATOM   7698 C CD2   . PHE D 4 356 ? 7.966   5.390   34.489  1.00 11.87  ? 356 PHE B CD2   1 
ATOM   7699 C CE1   . PHE D 4 356 ? 6.448   3.942   32.645  1.00 13.94  ? 356 PHE B CE1   1 
ATOM   7700 C CE2   . PHE D 4 356 ? 7.704   4.031   34.716  1.00 13.91  ? 356 PHE B CE2   1 
ATOM   7701 C CZ    . PHE D 4 356 ? 6.944   3.304   33.790  1.00 15.20  ? 356 PHE B CZ    1 
ATOM   7702 N N     . MET D 4 357 ? 10.590  9.254   33.092  1.00 19.26  ? 357 MET B N     1 
ATOM   7703 C CA    . MET D 4 357 ? 11.337  10.386  32.552  1.00 20.76  ? 357 MET B CA    1 
ATOM   7704 C C     . MET D 4 357 ? 11.837  10.100  31.144  1.00 19.81  ? 357 MET B C     1 
ATOM   7705 O O     . MET D 4 357 ? 11.719  8.977   30.641  1.00 16.80  ? 357 MET B O     1 
ATOM   7706 C CB    . MET D 4 357 ? 12.549  10.669  33.447  1.00 23.34  ? 357 MET B CB    1 
ATOM   7707 C CG    . MET D 4 357 ? 12.208  10.907  34.910  1.00 30.49  ? 357 MET B CG    1 
ATOM   7708 S SD    . MET D 4 357 ? 12.149  12.660  35.286  1.00 35.09  ? 357 MET B SD    1 
ATOM   7709 C CE    . MET D 4 357 ? 10.728  13.118  34.331  1.00 34.81  ? 357 MET B CE    1 
ATOM   7710 N N     . GLY D 4 358 ? 12.417  11.123  30.523  1.00 19.06  ? 358 GLY B N     1 
ATOM   7711 C CA    . GLY D 4 358 ? 12.965  10.956  29.196  1.00 19.79  ? 358 GLY B CA    1 
ATOM   7712 C C     . GLY D 4 358 ? 11.971  11.188  28.085  1.00 21.96  ? 358 GLY B C     1 
ATOM   7713 O O     . GLY D 4 358 ? 10.827  11.564  28.320  1.00 22.38  ? 358 GLY B O     1 
ATOM   7714 N N     . ASN D 4 359 ? 12.415  10.945  26.861  1.00 21.73  ? 359 ASN B N     1 
ATOM   7715 C CA    . ASN D 4 359 ? 11.583  11.152  25.693  1.00 23.62  ? 359 ASN B CA    1 
ATOM   7716 C C     . ASN D 4 359 ? 11.614  9.921   24.805  1.00 23.04  ? 359 ASN B C     1 
ATOM   7717 O O     . ASN D 4 359 ? 11.612  10.014  23.578  1.00 22.94  ? 359 ASN B O     1 
ATOM   7718 C CB    . ASN D 4 359 ? 12.087  12.383  24.952  1.00 26.93  ? 359 ASN B CB    1 
ATOM   7719 C CG    . ASN D 4 359 ? 11.974  13.647  25.798  1.00 34.81  ? 359 ASN B CG    1 
ATOM   7720 O OD1   . ASN D 4 359 ? 10.894  14.253  25.901  1.00 37.05  ? 359 ASN B OD1   1 
ATOM   7721 N ND2   . ASN D 4 359 ? 13.081  14.037  26.433  1.00 36.56  ? 359 ASN B ND2   1 
ATOM   7722 N N     . GLN D 4 360 ? 11.625  8.757   25.444  1.00 22.19  ? 360 GLN B N     1 
ATOM   7723 C CA    . GLN D 4 360 ? 11.667  7.512   24.706  1.00 21.05  ? 360 GLN B CA    1 
ATOM   7724 C C     . GLN D 4 360 ? 11.342  6.308   25.572  1.00 18.78  ? 360 GLN B C     1 
ATOM   7725 O O     . GLN D 4 360 ? 11.344  6.379   26.797  1.00 17.74  ? 360 GLN B O     1 
ATOM   7726 C CB    . GLN D 4 360 ? 13.063  7.305   24.127  1.00 22.33  ? 360 GLN B CB    1 
ATOM   7727 C CG    . GLN D 4 360 ? 14.017  6.645   25.114  1.00 24.09  ? 360 GLN B CG    1 
ATOM   7728 C CD    . GLN D 4 360 ? 15.463  6.695   24.664  1.00 25.64  ? 360 GLN B CD    1 
ATOM   7729 O OE1   . GLN D 4 360 ? 15.753  6.968   23.497  1.00 26.31  ? 360 GLN B OE1   1 
ATOM   7730 N NE2   . GLN D 4 360 ? 16.381  6.425   25.591  1.00 24.38  ? 360 GLN B NE2   1 
ATOM   7731 N N     . VAL D 4 361 ? 11.044  5.202   24.905  1.00 16.29  ? 361 VAL B N     1 
ATOM   7732 C CA    . VAL D 4 361 ? 10.800  3.941   25.577  1.00 15.22  ? 361 VAL B CA    1 
ATOM   7733 C C     . VAL D 4 361 ? 11.690  2.984   24.797  1.00 15.63  ? 361 VAL B C     1 
ATOM   7734 O O     . VAL D 4 361 ? 11.798  3.087   23.570  1.00 16.34  ? 361 VAL B O     1 
ATOM   7735 C CB    . VAL D 4 361 ? 9.347   3.485   25.473  1.00 14.14  ? 361 VAL B CB    1 
ATOM   7736 C CG1   . VAL D 4 361 ? 9.214   2.093   26.087  1.00 12.49  ? 361 VAL B CG1   1 
ATOM   7737 C CG2   . VAL D 4 361 ? 8.431   4.471   26.185  1.00 12.44  ? 361 VAL B CG2   1 
ATOM   7738 N N     . LEU D 4 362 ? 12.368  2.085   25.490  1.00 16.10  ? 362 LEU B N     1 
ATOM   7739 C CA    . LEU D 4 362 ? 13.240  1.147   24.793  1.00 15.93  ? 362 LEU B CA    1 
ATOM   7740 C C     . LEU D 4 362 ? 12.814  -0.263  25.050  1.00 16.95  ? 362 LEU B C     1 
ATOM   7741 O O     . LEU D 4 362 ? 12.516  -0.638  26.185  1.00 17.16  ? 362 LEU B O     1 
ATOM   7742 C CB    . LEU D 4 362 ? 14.693  1.264   25.253  1.00 15.31  ? 362 LEU B CB    1 
ATOM   7743 C CG    . LEU D 4 362 ? 15.539  2.504   25.005  1.00 17.05  ? 362 LEU B CG    1 
ATOM   7744 C CD1   . LEU D 4 362 ? 16.912  2.253   25.600  1.00 17.32  ? 362 LEU B CD1   1 
ATOM   7745 C CD2   . LEU D 4 362 ? 15.648  2.809   23.523  1.00 17.30  ? 362 LEU B CD2   1 
ATOM   7746 N N     . LYS D 4 363 ? 12.767  -1.045  23.986  1.00 18.54  ? 363 LYS B N     1 
ATOM   7747 C CA    . LYS D 4 363 ? 12.447  -2.450  24.118  1.00 18.68  ? 363 LYS B CA    1 
ATOM   7748 C C     . LYS D 4 363 ? 13.793  -3.139  23.968  1.00 17.55  ? 363 LYS B C     1 
ATOM   7749 O O     . LYS D 4 363 ? 14.567  -2.833  23.062  1.00 18.04  ? 363 LYS B O     1 
ATOM   7750 C CB    . LYS D 4 363 ? 11.454  -2.882  23.042  1.00 19.23  ? 363 LYS B CB    1 
ATOM   7751 C CG    . LYS D 4 363 ? 10.026  -2.563  23.437  1.00 17.92  ? 363 LYS B CG    1 
ATOM   7752 C CD    . LYS D 4 363 ? 8.998   -3.130  22.467  1.00 19.11  ? 363 LYS B CD    1 
ATOM   7753 C CE    . LYS D 4 363 ? 7.574   -2.790  22.935  1.00 18.00  ? 363 LYS B CE    1 
ATOM   7754 N NZ    . LYS D 4 363 ? 6.537   -3.338  22.022  1.00 22.06  ? 363 LYS B NZ    1 
ATOM   7755 N N     . VAL D 4 364 ? 14.080  -4.036  24.895  1.00 17.05  ? 364 VAL B N     1 
ATOM   7756 C CA    . VAL D 4 364 ? 15.342  -4.756  24.921  1.00 17.18  ? 364 VAL B CA    1 
ATOM   7757 C C     . VAL D 4 364 ? 15.118  -6.244  24.665  1.00 19.24  ? 364 VAL B C     1 
ATOM   7758 O O     . VAL D 4 364 ? 14.363  -6.904  25.382  1.00 19.51  ? 364 VAL B O     1 
ATOM   7759 C CB    . VAL D 4 364 ? 16.038  -4.557  26.304  1.00 16.77  ? 364 VAL B CB    1 
ATOM   7760 C CG1   . VAL D 4 364 ? 17.384  -5.273  26.340  1.00 17.75  ? 364 VAL B CG1   1 
ATOM   7761 C CG2   . VAL D 4 364 ? 16.215  -3.069  26.576  1.00 13.36  ? 364 VAL B CG2   1 
ATOM   7762 N N     . PHE D 4 365 ? 15.757  -6.747  23.613  1.00 21.40  ? 365 PHE B N     1 
ATOM   7763 C CA    . PHE D 4 365 ? 15.674  -8.150  23.232  1.00 24.54  ? 365 PHE B CA    1 
ATOM   7764 C C     . PHE D 4 365 ? 17.069  -8.747  23.335  1.00 25.09  ? 365 PHE B C     1 
ATOM   7765 O O     . PHE D 4 365 ? 18.053  -8.034  23.522  1.00 28.33  ? 365 PHE B O     1 
ATOM   7766 C CB    . PHE D 4 365 ? 15.218  -8.319  21.775  1.00 24.43  ? 365 PHE B CB    1 
ATOM   7767 C CG    . PHE D 4 365 ? 13.857  -7.770  21.485  1.00 26.51  ? 365 PHE B CG    1 
ATOM   7768 C CD1   . PHE D 4 365 ? 13.707  -6.494  20.959  1.00 28.25  ? 365 PHE B CD1   1 
ATOM   7769 C CD2   . PHE D 4 365 ? 12.719  -8.541  21.714  1.00 27.85  ? 365 PHE B CD2   1 
ATOM   7770 C CE1   . PHE D 4 365 ? 12.432  -5.990  20.659  1.00 29.02  ? 365 PHE B CE1   1 
ATOM   7771 C CE2   . PHE D 4 365 ? 11.442  -8.048  21.419  1.00 25.94  ? 365 PHE B CE2   1 
ATOM   7772 C CZ    . PHE D 4 365 ? 11.299  -6.774  20.892  1.00 25.76  ? 365 PHE B CZ    1 
ATOM   7773 N N     . ALA D 4 366 ? 17.151  -10.060 23.209  1.00 24.77  ? 366 ALA B N     1 
ATOM   7774 C CA    . ALA D 4 366 ? 18.439  -10.723 23.229  1.00 24.38  ? 366 ALA B CA    1 
ATOM   7775 C C     . ALA D 4 366 ? 19.044  -10.390 21.874  1.00 23.86  ? 366 ALA B C     1 
ATOM   7776 O O     . ALA D 4 366 ? 18.302  -10.149 20.915  1.00 22.46  ? 366 ALA B O     1 
ATOM   7777 C CB    . ALA D 4 366 ? 18.244  -12.222 23.365  1.00 24.66  ? 366 ALA B CB    1 
ATOM   7778 N N     . ALA D 4 367 ? 20.373  -10.352 21.792  1.00 26.17  ? 367 ALA B N     1 
ATOM   7779 C CA    . ALA D 4 367 ? 21.055  -10.055 20.521  1.00 28.26  ? 367 ALA B CA    1 
ATOM   7780 C C     . ALA D 4 367 ? 20.456  -10.951 19.445  1.00 28.61  ? 367 ALA B C     1 
ATOM   7781 O O     . ALA D 4 367 ? 20.040  -12.072 19.733  1.00 29.50  ? 367 ALA B O     1 
ATOM   7782 C CB    . ALA D 4 367 ? 22.556  -10.317 20.642  1.00 27.95  ? 367 ALA B CB    1 
ATOM   7783 N N     . ARG D 4 368 ? 20.407  -10.461 18.213  1.00 29.43  ? 368 ARG B N     1 
ATOM   7784 C CA    . ARG D 4 368 ? 19.821  -11.232 17.122  1.00 30.48  ? 368 ARG B CA    1 
ATOM   7785 C C     . ARG D 4 368 ? 20.529  -12.551 16.836  1.00 30.33  ? 368 ARG B C     1 
ATOM   7786 O O     . ARG D 4 368 ? 21.752  -12.611 16.746  1.00 30.34  ? 368 ARG B O     1 
ATOM   7787 C CB    . ARG D 4 368 ? 19.793  -10.396 15.845  1.00 33.22  ? 368 ARG B CB    1 
ATOM   7788 C CG    . ARG D 4 368 ? 18.987  -11.018 14.718  1.00 38.45  ? 368 ARG B CG    1 
ATOM   7789 C CD    . ARG D 4 368 ? 19.248  -10.297 13.402  1.00 43.64  ? 368 ARG B CD    1 
ATOM   7790 N NE    . ARG D 4 368 ? 18.096  -10.356 12.507  1.00 47.59  ? 368 ARG B NE    1 
ATOM   7791 C CZ    . ARG D 4 368 ? 16.937  -9.746  12.747  1.00 50.11  ? 368 ARG B CZ    1 
ATOM   7792 N NH1   . ARG D 4 368 ? 16.776  -9.024  13.854  1.00 49.42  ? 368 ARG B NH1   1 
ATOM   7793 N NH2   . ARG D 4 368 ? 15.933  -9.867  11.886  1.00 50.89  ? 368 ARG B NH2   1 
ATOM   7794 N N     . ASP D 4 369 ? 19.739  -13.607 16.706  1.00 31.42  ? 369 ASP B N     1 
ATOM   7795 C CA    . ASP D 4 369 ? 20.238  -14.947 16.394  1.00 34.55  ? 369 ASP B CA    1 
ATOM   7796 C C     . ASP D 4 369 ? 21.079  -15.608 17.479  1.00 35.53  ? 369 ASP B C     1 
ATOM   7797 O O     . ASP D 4 369 ? 21.737  -16.618 17.223  1.00 37.62  ? 369 ASP B O     1 
ATOM   7798 C CB    . ASP D 4 369 ? 21.030  -14.927 15.075  1.00 33.94  ? 369 ASP B CB    1 
ATOM   7799 C CG    . ASP D 4 369 ? 20.225  -14.351 13.921  1.00 34.84  ? 369 ASP B CG    1 
ATOM   7800 O OD1   . ASP D 4 369 ? 19.019  -14.668 13.838  1.00 32.68  ? 369 ASP B OD1   1 
ATOM   7801 O OD2   . ASP D 4 369 ? 20.791  -13.592 13.100  1.00 34.37  ? 369 ASP B OD2   1 
ATOM   7802 N N     . ASP D 4 370 ? 21.058  -15.051 18.687  1.00 35.38  ? 370 ASP B N     1 
ATOM   7803 C CA    . ASP D 4 370 ? 21.821  -15.622 19.789  1.00 34.88  ? 370 ASP B CA    1 
ATOM   7804 C C     . ASP D 4 370 ? 20.862  -16.333 20.744  1.00 35.05  ? 370 ASP B C     1 
ATOM   7805 O O     . ASP D 4 370 ? 20.269  -15.717 21.627  1.00 34.60  ? 370 ASP B O     1 
ATOM   7806 C CB    . ASP D 4 370 ? 22.582  -14.523 20.530  1.00 35.69  ? 370 ASP B CB    1 
ATOM   7807 C CG    . ASP D 4 370 ? 23.550  -15.077 21.557  1.00 35.63  ? 370 ASP B CG    1 
ATOM   7808 O OD1   . ASP D 4 370 ? 23.138  -15.927 22.373  1.00 34.51  ? 370 ASP B OD1   1 
ATOM   7809 O OD2   . ASP D 4 370 ? 24.726  -14.656 21.553  1.00 38.34  ? 370 ASP B OD2   1 
ATOM   7810 N N     . GLU D 4 371 ? 20.717  -17.639 20.562  1.00 35.83  ? 371 GLU B N     1 
ATOM   7811 C CA    . GLU D 4 371 ? 19.813  -18.424 21.391  1.00 36.09  ? 371 GLU B CA    1 
ATOM   7812 C C     . GLU D 4 371 ? 20.193  -18.417 22.863  1.00 33.88  ? 371 GLU B C     1 
ATOM   7813 O O     . GLU D 4 371 ? 19.328  -18.271 23.728  1.00 34.10  ? 371 GLU B O     1 
ATOM   7814 C CB    . GLU D 4 371 ? 19.745  -19.862 20.872  1.00 38.38  ? 371 GLU B CB    1 
ATOM   7815 C CG    . GLU D 4 371 ? 18.881  -20.776 21.720  1.00 44.60  ? 371 GLU B CG    1 
ATOM   7816 C CD    . GLU D 4 371 ? 18.793  -22.190 21.169  1.00 49.22  ? 371 GLU B CD    1 
ATOM   7817 O OE1   . GLU D 4 371 ? 18.322  -23.082 21.914  1.00 51.88  ? 371 GLU B OE1   1 
ATOM   7818 O OE2   . GLU D 4 371 ? 19.186  -22.406 19.997  1.00 49.88  ? 371 GLU B OE2   1 
ATOM   7819 N N     . ALA D 4 372 ? 21.480  -18.579 23.150  1.00 31.85  ? 372 ALA B N     1 
ATOM   7820 C CA    . ALA D 4 372 ? 21.957  -18.582 24.532  1.00 30.98  ? 372 ALA B CA    1 
ATOM   7821 C C     . ALA D 4 372 ? 21.562  -17.270 25.234  1.00 29.82  ? 372 ALA B C     1 
ATOM   7822 O O     . ALA D 4 372 ? 21.040  -17.273 26.352  1.00 29.31  ? 372 ALA B O     1 
ATOM   7823 C CB    . ALA D 4 372 ? 23.468  -18.771 24.555  1.00 28.74  ? 372 ALA B CB    1 
ATOM   7824 N N     . ALA D 4 373 ? 21.806  -16.150 24.568  1.00 29.43  ? 373 ALA B N     1 
ATOM   7825 C CA    . ALA D 4 373 ? 21.442  -14.854 25.115  1.00 30.08  ? 373 ALA B CA    1 
ATOM   7826 C C     . ALA D 4 373 ? 19.921  -14.775 25.292  1.00 30.97  ? 373 ALA B C     1 
ATOM   7827 O O     . ALA D 4 373 ? 19.428  -14.278 26.309  1.00 32.59  ? 373 ALA B O     1 
ATOM   7828 C CB    . ALA D 4 373 ? 21.920  -13.751 24.185  1.00 29.86  ? 373 ALA B CB    1 
ATOM   7829 N N     . ALA D 4 374 ? 19.179  -15.280 24.309  1.00 29.52  ? 374 ALA B N     1 
ATOM   7830 C CA    . ALA D 4 374 ? 17.720  -15.254 24.363  1.00 29.64  ? 374 ALA B CA    1 
ATOM   7831 C C     . ALA D 4 374 ? 17.161  -16.024 25.551  1.00 29.96  ? 374 ALA B C     1 
ATOM   7832 O O     . ALA D 4 374 ? 16.246  -15.548 26.224  1.00 31.21  ? 374 ALA B O     1 
ATOM   7833 C CB    . ALA D 4 374 ? 17.137  -15.801 23.068  1.00 29.76  ? 374 ALA B CB    1 
ATOM   7834 N N     . VAL D 4 375 ? 17.701  -17.218 25.793  1.00 28.88  ? 375 VAL B N     1 
ATOM   7835 C CA    . VAL D 4 375 ? 17.272  -18.063 26.909  1.00 26.46  ? 375 VAL B CA    1 
ATOM   7836 C C     . VAL D 4 375 ? 17.625  -17.368 28.232  1.00 25.55  ? 375 VAL B C     1 
ATOM   7837 O O     . VAL D 4 375 ? 16.832  -17.351 29.189  1.00 23.11  ? 375 VAL B O     1 
ATOM   7838 C CB    . VAL D 4 375 ? 17.978  -19.457 26.858  1.00 27.14  ? 375 VAL B CB    1 
ATOM   7839 C CG1   . VAL D 4 375 ? 17.728  -20.238 28.147  1.00 25.80  ? 375 VAL B CG1   1 
ATOM   7840 C CG2   . VAL D 4 375 ? 17.472  -20.255 25.655  1.00 26.79  ? 375 VAL B CG2   1 
ATOM   7841 N N     . ALA D 4 376 ? 18.825  -16.803 28.277  1.00 24.32  ? 376 ALA B N     1 
ATOM   7842 C CA    . ALA D 4 376 ? 19.289  -16.103 29.467  1.00 24.97  ? 376 ALA B CA    1 
ATOM   7843 C C     . ALA D 4 376 ? 18.329  -14.959 29.777  1.00 25.07  ? 376 ALA B C     1 
ATOM   7844 O O     . ALA D 4 376 ? 17.827  -14.846 30.895  1.00 24.35  ? 376 ALA B O     1 
ATOM   7845 C CB    . ALA D 4 376 ? 20.719  -15.562 29.249  1.00 22.28  ? 376 ALA B CB    1 
ATOM   7846 N N     . LEU D 4 377 ? 18.058  -14.122 28.779  1.00 25.61  ? 377 LEU B N     1 
ATOM   7847 C CA    . LEU D 4 377 ? 17.164  -12.991 28.988  1.00 25.57  ? 377 LEU B CA    1 
ATOM   7848 C C     . LEU D 4 377 ? 15.756  -13.456 29.325  1.00 26.33  ? 377 LEU B C     1 
ATOM   7849 O O     . LEU D 4 377 ? 15.083  -12.849 30.165  1.00 26.75  ? 377 LEU B O     1 
ATOM   7850 C CB    . LEU D 4 377 ? 17.127  -12.084 27.757  1.00 23.93  ? 377 LEU B CB    1 
ATOM   7851 C CG    . LEU D 4 377 ? 16.399  -10.761 28.016  1.00 25.82  ? 377 LEU B CG    1 
ATOM   7852 C CD1   . LEU D 4 377 ? 17.143  -9.977  29.124  1.00 22.06  ? 377 LEU B CD1   1 
ATOM   7853 C CD2   . LEU D 4 377 ? 16.314  -9.941  26.728  1.00 23.88  ? 377 LEU B CD2   1 
ATOM   7854 N N     . SER D 4 378 ? 15.302  -14.525 28.674  1.00 25.54  ? 378 SER B N     1 
ATOM   7855 C CA    . SER D 4 378 ? 13.968  -15.037 28.953  1.00 26.49  ? 378 SER B CA    1 
ATOM   7856 C C     . SER D 4 378 ? 13.882  -15.456 30.419  1.00 26.05  ? 378 SER B C     1 
ATOM   7857 O O     . SER D 4 378 ? 12.815  -15.383 31.027  1.00 27.71  ? 378 SER B O     1 
ATOM   7858 C CB    . SER D 4 378 ? 13.635  -16.229 28.046  1.00 28.80  ? 378 SER B CB    1 
ATOM   7859 O OG    . SER D 4 378 ? 12.390  -16.806 28.415  1.00 29.94  ? 378 SER B OG    1 
ATOM   7860 N N     . SER D 4 379 ? 15.005  -15.892 30.985  1.00 25.50  ? 379 SER B N     1 
ATOM   7861 C CA    . SER D 4 379 ? 15.038  -16.305 32.386  1.00 25.97  ? 379 SER B CA    1 
ATOM   7862 C C     . SER D 4 379 ? 14.731  -15.093 33.260  1.00 27.73  ? 379 SER B C     1 
ATOM   7863 O O     . SER D 4 379 ? 13.880  -15.141 34.164  1.00 26.47  ? 379 SER B O     1 
ATOM   7864 C CB    . SER D 4 379 ? 16.424  -16.844 32.761  1.00 26.38  ? 379 SER B CB    1 
ATOM   7865 O OG    . SER D 4 379 ? 16.720  -18.065 32.110  1.00 28.07  ? 379 SER B OG    1 
ATOM   7866 N N     . LEU D 4 380 ? 15.441  -14.005 32.977  1.00 26.86  ? 380 LEU B N     1 
ATOM   7867 C CA    . LEU D 4 380 ? 15.279  -12.769 33.718  1.00 27.08  ? 380 LEU B CA    1 
ATOM   7868 C C     . LEU D 4 380 ? 13.846  -12.263 33.639  1.00 25.49  ? 380 LEU B C     1 
ATOM   7869 O O     . LEU D 4 380 ? 13.211  -12.022 34.657  1.00 27.22  ? 380 LEU B O     1 
ATOM   7870 C CB    . LEU D 4 380 ? 16.230  -11.700 33.173  1.00 27.17  ? 380 LEU B CB    1 
ATOM   7871 C CG    . LEU D 4 380 ? 16.910  -10.803 34.202  1.00 28.11  ? 380 LEU B CG    1 
ATOM   7872 C CD1   . LEU D 4 380 ? 17.413  -9.548  33.498  1.00 26.37  ? 380 LEU B CD1   1 
ATOM   7873 C CD2   . LEU D 4 380 ? 15.929  -10.443 35.316  1.00 27.12  ? 380 LEU B CD2   1 
ATOM   7874 N N     . ILE D 4 381 ? 13.347  -12.111 32.420  1.00 25.12  ? 381 ILE B N     1 
ATOM   7875 C CA    . ILE D 4 381 ? 11.993  -11.618 32.176  1.00 24.44  ? 381 ILE B CA    1 
ATOM   7876 C C     . ILE D 4 381 ? 10.944  -12.344 33.005  1.00 25.67  ? 381 ILE B C     1 
ATOM   7877 O O     . ILE D 4 381 ? 10.168  -11.719 33.736  1.00 25.36  ? 381 ILE B O     1 
ATOM   7878 C CB    . ILE D 4 381 ? 11.629  -11.763 30.683  1.00 23.35  ? 381 ILE B CB    1 
ATOM   7879 C CG1   . ILE D 4 381 ? 12.493  -10.816 29.850  1.00 21.48  ? 381 ILE B CG1   1 
ATOM   7880 C CG2   . ILE D 4 381 ? 10.150  -11.506 30.468  1.00 20.01  ? 381 ILE B CG2   1 
ATOM   7881 C CD1   . ILE D 4 381 ? 12.444  -11.104 28.361  1.00 21.15  ? 381 ILE B CD1   1 
ATOM   7882 N N     . HIS D 4 382 ? 10.925  -13.666 32.883  1.00 26.55  ? 382 HIS B N     1 
ATOM   7883 C CA    . HIS D 4 382 ? 9.961   -14.480 33.604  1.00 27.62  ? 382 HIS B CA    1 
ATOM   7884 C C     . HIS D 4 382 ? 10.149  -14.477 35.121  1.00 28.42  ? 382 HIS B C     1 
ATOM   7885 O O     . HIS D 4 382 ? 9.172   -14.573 35.862  1.00 29.68  ? 382 HIS B O     1 
ATOM   7886 C CB    . HIS D 4 382 ? 9.974   -15.915 33.041  1.00 27.91  ? 382 HIS B CB    1 
ATOM   7887 C CG    . HIS D 4 382 ? 9.161   -16.071 31.792  1.00 26.92  ? 382 HIS B CG    1 
ATOM   7888 N ND1   . HIS D 4 382 ? 7.788   -16.192 31.812  1.00 29.25  ? 382 HIS B ND1   1 
ATOM   7889 C CD2   . HIS D 4 382 ? 9.513   -16.026 30.486  1.00 27.42  ? 382 HIS B CD2   1 
ATOM   7890 C CE1   . HIS D 4 382 ? 7.328   -16.211 30.574  1.00 26.94  ? 382 HIS B CE1   1 
ATOM   7891 N NE2   . HIS D 4 382 ? 8.355   -16.111 29.751  1.00 26.50  ? 382 HIS B NE2   1 
ATOM   7892 N N     . ALA D 4 383 ? 11.389  -14.357 35.589  1.00 28.01  ? 383 ALA B N     1 
ATOM   7893 C CA    . ALA D 4 383 ? 11.633  -14.339 37.026  1.00 27.84  ? 383 ALA B CA    1 
ATOM   7894 C C     . ALA D 4 383 ? 11.067  -13.064 37.598  1.00 29.05  ? 383 ALA B C     1 
ATOM   7895 O O     . ALA D 4 383 ? 10.418  -13.080 38.641  1.00 31.90  ? 383 ALA B O     1 
ATOM   7896 C CB    . ALA D 4 383 ? 13.116  -14.421 37.324  1.00 29.81  ? 383 ALA B CB    1 
ATOM   7897 N N     . LEU D 4 384 ? 11.311  -11.952 36.915  1.00 28.52  ? 384 LEU B N     1 
ATOM   7898 C CA    . LEU D 4 384 ? 10.807  -10.666 37.376  1.00 28.43  ? 384 LEU B CA    1 
ATOM   7899 C C     . LEU D 4 384 ? 9.282   -10.664 37.336  1.00 29.50  ? 384 LEU B C     1 
ATOM   7900 O O     . LEU D 4 384 ? 8.624   -10.177 38.254  1.00 29.70  ? 384 LEU B O     1 
ATOM   7901 C CB    . LEU D 4 384 ? 11.352  -9.540  36.501  1.00 27.28  ? 384 LEU B CB    1 
ATOM   7902 C CG    . LEU D 4 384 ? 12.865  -9.341  36.509  1.00 24.78  ? 384 LEU B CG    1 
ATOM   7903 C CD1   . LEU D 4 384 ? 13.237  -8.329  35.439  1.00 22.73  ? 384 LEU B CD1   1 
ATOM   7904 C CD2   . LEU D 4 384 ? 13.319  -8.889  37.888  1.00 21.63  ? 384 LEU B CD2   1 
ATOM   7905 N N     . ASP D 4 385 ? 8.723   -11.210 36.264  1.00 32.23  ? 385 ASP B N     1 
ATOM   7906 C CA    . ASP D 4 385 ? 7.274   -11.285 36.116  1.00 34.04  ? 385 ASP B CA    1 
ATOM   7907 C C     . ASP D 4 385 ? 6.686   -12.184 37.218  1.00 35.94  ? 385 ASP B C     1 
ATOM   7908 O O     . ASP D 4 385 ? 5.717   -11.816 37.884  1.00 35.78  ? 385 ASP B O     1 
ATOM   7909 C CB    . ASP D 4 385 ? 6.934   -11.840 34.733  1.00 33.92  ? 385 ASP B CB    1 
ATOM   7910 C CG    . ASP D 4 385 ? 5.441   -11.953 34.494  1.00 35.47  ? 385 ASP B CG    1 
ATOM   7911 O OD1   . ASP D 4 385 ? 4.762   -10.908 34.379  1.00 32.61  ? 385 ASP B OD1   1 
ATOM   7912 O OD2   . ASP D 4 385 ? 4.952   -13.100 34.420  1.00 37.54  ? 385 ASP B OD2   1 
ATOM   7913 N N     . ASP D 4 386 ? 7.291   -13.353 37.413  1.00 35.95  ? 386 ASP B N     1 
ATOM   7914 C CA    . ASP D 4 386 ? 6.836   -14.300 38.426  1.00 37.64  ? 386 ASP B CA    1 
ATOM   7915 C C     . ASP D 4 386 ? 7.059   -13.813 39.853  1.00 37.71  ? 386 ASP B C     1 
ATOM   7916 O O     . ASP D 4 386 ? 6.524   -14.389 40.801  1.00 39.17  ? 386 ASP B O     1 
ATOM   7917 C CB    . ASP D 4 386 ? 7.534   -15.649 38.235  1.00 39.21  ? 386 ASP B CB    1 
ATOM   7918 C CG    . ASP D 4 386 ? 6.906   -16.480 37.131  1.00 41.73  ? 386 ASP B CG    1 
ATOM   7919 O OD1   . ASP D 4 386 ? 6.576   -15.912 36.067  1.00 44.23  ? 386 ASP B OD1   1 
ATOM   7920 O OD2   . ASP D 4 386 ? 6.752   -17.705 37.328  1.00 43.15  ? 386 ASP B OD2   1 
ATOM   7921 N N     . LEU D 4 387 ? 7.862   -12.767 40.007  1.00 36.55  ? 387 LEU B N     1 
ATOM   7922 C CA    . LEU D 4 387 ? 8.146   -12.209 41.325  1.00 34.83  ? 387 LEU B CA    1 
ATOM   7923 C C     . LEU D 4 387 ? 7.518   -10.826 41.447  1.00 35.03  ? 387 LEU B C     1 
ATOM   7924 O O     . LEU D 4 387 ? 7.643   -10.169 42.475  1.00 34.28  ? 387 LEU B O     1 
ATOM   7925 C CB    . LEU D 4 387 ? 9.656   -12.094 41.545  1.00 33.95  ? 387 LEU B CB    1 
ATOM   7926 C CG    . LEU D 4 387 ? 10.461  -13.383 41.724  1.00 33.45  ? 387 LEU B CG    1 
ATOM   7927 C CD1   . LEU D 4 387 ? 11.951  -13.068 41.753  1.00 29.65  ? 387 LEU B CD1   1 
ATOM   7928 C CD2   . LEU D 4 387 ? 10.040  -14.067 43.015  1.00 32.58  ? 387 LEU B CD2   1 
ATOM   7929 N N     . ASP D 4 388 ? 6.836   -10.397 40.389  1.00 35.25  ? 388 ASP B N     1 
ATOM   7930 C CA    . ASP D 4 388 ? 6.202   -9.089  40.358  1.00 35.22  ? 388 ASP B CA    1 
ATOM   7931 C C     . ASP D 4 388 ? 7.238   -8.042  40.739  1.00 34.74  ? 388 ASP B C     1 
ATOM   7932 O O     . ASP D 4 388 ? 7.002   -7.177  41.589  1.00 34.82  ? 388 ASP B O     1 
ATOM   7933 C CB    . ASP D 4 388 ? 5.013   -9.038  41.322  1.00 37.49  ? 388 ASP B CB    1 
ATOM   7934 C CG    . ASP D 4 388 ? 4.298   -7.693  41.295  1.00 40.47  ? 388 ASP B CG    1 
ATOM   7935 O OD1   . ASP D 4 388 ? 4.091   -7.151  40.188  1.00 41.42  ? 388 ASP B OD1   1 
ATOM   7936 O OD2   . ASP D 4 388 ? 3.936   -7.181  42.376  1.00 43.29  ? 388 ASP B OD2   1 
ATOM   7937 N N     . MET D 4 389 ? 8.402   -8.140  40.111  1.00 32.05  ? 389 MET B N     1 
ATOM   7938 C CA    . MET D 4 389 ? 9.472   -7.202  40.366  1.00 30.78  ? 389 MET B CA    1 
ATOM   7939 C C     . MET D 4 389 ? 9.983   -6.617  39.064  1.00 30.17  ? 389 MET B C     1 
ATOM   7940 O O     . MET D 4 389 ? 9.535   -7.001  37.984  1.00 28.95  ? 389 MET B O     1 
ATOM   7941 C CB    . MET D 4 389 ? 10.605  -7.893  41.108  1.00 30.76  ? 389 MET B CB    1 
ATOM   7942 C CG    . MET D 4 389 ? 10.201  -8.346  42.486  1.00 32.34  ? 389 MET B CG    1 
ATOM   7943 S SD    . MET D 4 389 ? 11.493  -9.303  43.236  1.00 36.74  ? 389 MET B SD    1 
ATOM   7944 C CE    . MET D 4 389 ? 12.527  -7.954  43.920  1.00 35.37  ? 389 MET B CE    1 
ATOM   7945 N N     . VAL D 4 390 ? 10.913  -5.673  39.188  1.00 29.21  ? 390 VAL B N     1 
ATOM   7946 C CA    . VAL D 4 390 ? 11.527  -5.012  38.046  1.00 27.20  ? 390 VAL B CA    1 
ATOM   7947 C C     . VAL D 4 390 ? 12.983  -4.752  38.365  1.00 26.13  ? 390 VAL B C     1 
ATOM   7948 O O     . VAL D 4 390 ? 13.402  -4.824  39.521  1.00 26.20  ? 390 VAL B O     1 
ATOM   7949 C CB    . VAL D 4 390 ? 10.875  -3.653  37.740  1.00 26.98  ? 390 VAL B CB    1 
ATOM   7950 C CG1   . VAL D 4 390 ? 9.439   -3.848  37.316  1.00 26.58  ? 390 VAL B CG1   1 
ATOM   7951 C CG2   . VAL D 4 390 ? 10.958  -2.753  38.969  1.00 26.73  ? 390 VAL B CG2   1 
ATOM   7952 N N     . ALA D 4 391 ? 13.748  -4.438  37.330  1.00 24.87  ? 391 ALA B N     1 
ATOM   7953 C CA    . ALA D 4 391 ? 15.161  -4.154  37.487  1.00 24.24  ? 391 ALA B CA    1 
ATOM   7954 C C     . ALA D 4 391 ? 15.376  -2.654  37.445  1.00 22.92  ? 391 ALA B C     1 
ATOM   7955 O O     . ALA D 4 391 ? 14.710  -1.945  36.693  1.00 24.67  ? 391 ALA B O     1 
ATOM   7956 C CB    . ALA D 4 391 ? 15.953  -4.825  36.367  1.00 25.04  ? 391 ALA B CB    1 
ATOM   7957 N N     . ILE D 4 392 ? 16.286  -2.172  38.276  1.00 21.44  ? 392 ILE B N     1 
ATOM   7958 C CA    . ILE D 4 392 ? 16.631  -0.754  38.303  1.00 20.75  ? 392 ILE B CA    1 
ATOM   7959 C C     . ILE D 4 392 ? 18.037  -0.766  37.723  1.00 21.01  ? 392 ILE B C     1 
ATOM   7960 O O     . ILE D 4 392 ? 18.948  -1.350  38.302  1.00 21.18  ? 392 ILE B O     1 
ATOM   7961 C CB    . ILE D 4 392 ? 16.661  -0.186  39.742  1.00 19.13  ? 392 ILE B CB    1 
ATOM   7962 C CG1   . ILE D 4 392 ? 15.271  -0.298  40.381  1.00 17.10  ? 392 ILE B CG1   1 
ATOM   7963 C CG2   . ILE D 4 392 ? 17.106  1.260   39.710  1.00 17.87  ? 392 ILE B CG2   1 
ATOM   7964 C CD1   . ILE D 4 392 ? 14.181  0.422   39.612  1.00 13.62  ? 392 ILE B CD1   1 
ATOM   7965 N N     . VAL D 4 393 ? 18.208  -0.119  36.581  1.00 20.65  ? 393 VAL B N     1 
ATOM   7966 C CA    . VAL D 4 393 ? 19.486  -0.149  35.899  1.00 21.19  ? 393 VAL B CA    1 
ATOM   7967 C C     . VAL D 4 393 ? 20.114  1.186   35.514  1.00 21.17  ? 393 VAL B C     1 
ATOM   7968 O O     . VAL D 4 393 ? 19.465  2.232   35.508  1.00 18.61  ? 393 VAL B O     1 
ATOM   7969 C CB    . VAL D 4 393 ? 19.350  -0.972  34.597  1.00 22.86  ? 393 VAL B CB    1 
ATOM   7970 C CG1   . VAL D 4 393 ? 18.706  -2.317  34.892  1.00 22.62  ? 393 VAL B CG1   1 
ATOM   7971 C CG2   . VAL D 4 393 ? 18.508  -0.202  33.589  1.00 21.76  ? 393 VAL B CG2   1 
ATOM   7972 N N     . ARG D 4 394 ? 21.397  1.109   35.175  1.00 21.93  ? 394 ARG B N     1 
ATOM   7973 C CA    . ARG D 4 394 ? 22.171  2.258   34.728  1.00 22.49  ? 394 ARG B CA    1 
ATOM   7974 C C     . ARG D 4 394 ? 22.247  2.109   33.223  1.00 22.62  ? 394 ARG B C     1 
ATOM   7975 O O     . ARG D 4 394 ? 22.718  1.089   32.718  1.00 23.15  ? 394 ARG B O     1 
ATOM   7976 C CB    . ARG D 4 394 ? 23.584  2.220   35.301  1.00 21.08  ? 394 ARG B CB    1 
ATOM   7977 C CG    . ARG D 4 394 ? 24.474  3.371   34.870  1.00 24.28  ? 394 ARG B CG    1 
ATOM   7978 C CD    . ARG D 4 394 ? 25.801  3.284   35.606  1.00 28.58  ? 394 ARG B CD    1 
ATOM   7979 N NE    . ARG D 4 394 ? 26.643  4.479   35.516  1.00 30.74  ? 394 ARG B NE    1 
ATOM   7980 C CZ    . ARG D 4 394 ? 27.388  4.796   34.464  1.00 31.60  ? 394 ARG B CZ    1 
ATOM   7981 N NH1   . ARG D 4 394 ? 27.392  4.014   33.399  1.00 31.98  ? 394 ARG B NH1   1 
ATOM   7982 N NH2   . ARG D 4 394 ? 28.159  5.873   34.496  1.00 30.76  ? 394 ARG B NH2   1 
ATOM   7983 N N     . TYR D 4 395 ? 21.774  3.116   32.505  1.00 21.83  ? 395 TYR B N     1 
ATOM   7984 C CA    . TYR D 4 395 ? 21.801  3.070   31.056  1.00 23.86  ? 395 TYR B CA    1 
ATOM   7985 C C     . TYR D 4 395 ? 22.582  4.252   30.520  1.00 25.58  ? 395 TYR B C     1 
ATOM   7986 O O     . TYR D 4 395 ? 22.363  5.389   30.930  1.00 25.46  ? 395 TYR B O     1 
ATOM   7987 C CB    . TYR D 4 395 ? 20.378  3.098   30.499  1.00 21.08  ? 395 TYR B CB    1 
ATOM   7988 C CG    . TYR D 4 395 ? 20.309  3.426   29.022  1.00 20.36  ? 395 TYR B CG    1 
ATOM   7989 C CD1   . TYR D 4 395 ? 20.657  2.483   28.055  1.00 20.34  ? 395 TYR B CD1   1 
ATOM   7990 C CD2   . TYR D 4 395 ? 19.888  4.686   28.593  1.00 19.62  ? 395 TYR B CD2   1 
ATOM   7991 C CE1   . TYR D 4 395 ? 20.581  2.786   26.696  1.00 20.24  ? 395 TYR B CE1   1 
ATOM   7992 C CE2   . TYR D 4 395 ? 19.810  5.000   27.247  1.00 19.13  ? 395 TYR B CE2   1 
ATOM   7993 C CZ    . TYR D 4 395 ? 20.153  4.047   26.304  1.00 23.40  ? 395 TYR B CZ    1 
ATOM   7994 O OH    . TYR D 4 395 ? 20.041  4.353   24.969  1.00 27.54  ? 395 TYR B OH    1 
ATOM   7995 N N     . ALA D 4 396 ? 23.496  3.971   29.599  1.00 27.78  ? 396 ALA B N     1 
ATOM   7996 C CA    . ALA D 4 396 ? 24.318  5.003   28.982  1.00 28.67  ? 396 ALA B CA    1 
ATOM   7997 C C     . ALA D 4 396 ? 24.461  4.628   27.524  1.00 29.00  ? 396 ALA B C     1 
ATOM   7998 O O     . ALA D 4 396 ? 25.062  3.608   27.197  1.00 28.44  ? 396 ALA B O     1 
ATOM   7999 C CB    . ALA D 4 396 ? 25.684  5.055   29.641  1.00 28.49  ? 396 ALA B CB    1 
ATOM   8000 N N     . TYR D 4 397 ? 23.883  5.450   26.659  1.00 29.91  ? 397 TYR B N     1 
ATOM   8001 C CA    . TYR D 4 397 ? 23.928  5.227   25.232  1.00 30.71  ? 397 TYR B CA    1 
ATOM   8002 C C     . TYR D 4 397 ? 25.367  4.959   24.774  1.00 32.02  ? 397 TYR B C     1 
ATOM   8003 O O     . TYR D 4 397 ? 25.654  3.918   24.182  1.00 32.33  ? 397 TYR B O     1 
ATOM   8004 C CB    . TYR D 4 397 ? 23.343  6.443   24.518  1.00 32.23  ? 397 TYR B CB    1 
ATOM   8005 C CG    . TYR D 4 397 ? 23.205  6.264   23.029  1.00 34.29  ? 397 TYR B CG    1 
ATOM   8006 C CD1   . TYR D 4 397 ? 22.249  5.404   22.497  1.00 34.14  ? 397 TYR B CD1   1 
ATOM   8007 C CD2   . TYR D 4 397 ? 24.052  6.935   22.153  1.00 34.03  ? 397 TYR B CD2   1 
ATOM   8008 C CE1   . TYR D 4 397 ? 22.145  5.219   21.125  1.00 36.62  ? 397 TYR B CE1   1 
ATOM   8009 C CE2   . TYR D 4 397 ? 23.960  6.757   20.784  1.00 34.79  ? 397 TYR B CE2   1 
ATOM   8010 C CZ    . TYR D 4 397 ? 23.009  5.901   20.271  1.00 36.70  ? 397 TYR B CZ    1 
ATOM   8011 O OH    . TYR D 4 397 ? 22.928  5.724   18.903  1.00 36.99  ? 397 TYR B OH    1 
ATOM   8012 N N     . ASP D 4 398 ? 26.268  5.898   25.039  1.00 33.96  ? 398 ASP B N     1 
ATOM   8013 C CA    . ASP D 4 398 ? 27.672  5.731   24.673  1.00 37.08  ? 398 ASP B CA    1 
ATOM   8014 C C     . ASP D 4 398 ? 28.556  6.464   25.679  1.00 39.08  ? 398 ASP B C     1 
ATOM   8015 O O     . ASP D 4 398 ? 28.052  7.025   26.652  1.00 39.82  ? 398 ASP B O     1 
ATOM   8016 C CB    . ASP D 4 398 ? 27.950  6.232   23.246  1.00 36.37  ? 398 ASP B CB    1 
ATOM   8017 C CG    . ASP D 4 398 ? 27.622  7.702   23.058  1.00 37.83  ? 398 ASP B CG    1 
ATOM   8018 O OD1   . ASP D 4 398 ? 27.818  8.473   24.017  1.00 38.98  ? 398 ASP B OD1   1 
ATOM   8019 O OD2   . ASP D 4 398 ? 27.187  8.090   21.948  1.00 36.98  ? 398 ASP B OD2   1 
ATOM   8020 N N     . LYS D 4 399 ? 29.865  6.461   25.445  1.00 42.37  ? 399 LYS B N     1 
ATOM   8021 C CA    . LYS D 4 399 ? 30.810  7.094   26.363  1.00 45.01  ? 399 LYS B CA    1 
ATOM   8022 C C     . LYS D 4 399 ? 30.613  8.597   26.518  1.00 45.62  ? 399 LYS B C     1 
ATOM   8023 O O     . LYS D 4 399 ? 31.157  9.218   27.433  1.00 45.78  ? 399 LYS B O     1 
ATOM   8024 C CB    . LYS D 4 399 ? 32.247  6.821   25.915  1.00 47.35  ? 399 LYS B CB    1 
ATOM   8025 C CG    . LYS D 4 399 ? 32.801  7.808   24.891  1.00 49.30  ? 399 LYS B CG    1 
ATOM   8026 C CD    . LYS D 4 399 ? 34.310  7.613   24.750  1.00 50.55  ? 399 LYS B CD    1 
ATOM   8027 C CE    . LYS D 4 399 ? 34.964  8.740   23.969  1.00 51.88  ? 399 LYS B CE    1 
ATOM   8028 N NZ    . LYS D 4 399 ? 36.449  8.680   24.097  1.00 52.16  ? 399 LYS B NZ    1 
ATOM   8029 N N     . ARG D 4 400 ? 29.824  9.170   25.621  1.00 45.12  ? 400 ARG B N     1 
ATOM   8030 C CA    . ARG D 4 400 ? 29.551  10.598  25.619  1.00 44.26  ? 400 ARG B CA    1 
ATOM   8031 C C     . ARG D 4 400 ? 28.269  10.969  26.366  1.00 43.54  ? 400 ARG B C     1 
ATOM   8032 O O     . ARG D 4 400 ? 28.222  11.973  27.082  1.00 43.94  ? 400 ARG B O     1 
ATOM   8033 C CB    . ARG D 4 400 ? 29.459  11.068  24.167  1.00 46.53  ? 400 ARG B CB    1 
ATOM   8034 C CG    . ARG D 4 400 ? 28.754  12.385  23.957  1.00 50.66  ? 400 ARG B CG    1 
ATOM   8035 C CD    . ARG D 4 400 ? 28.157  12.438  22.557  1.00 56.05  ? 400 ARG B CD    1 
ATOM   8036 N NE    . ARG D 4 400 ? 27.331  13.626  22.362  1.00 59.50  ? 400 ARG B NE    1 
ATOM   8037 C CZ    . ARG D 4 400 ? 26.442  13.769  21.385  1.00 60.14  ? 400 ARG B CZ    1 
ATOM   8038 N NH1   . ARG D 4 400 ? 26.253  12.797  20.503  1.00 60.11  ? 400 ARG B NH1   1 
ATOM   8039 N NH2   . ARG D 4 400 ? 25.737  14.887  21.298  1.00 61.93  ? 400 ARG B NH2   1 
ATOM   8040 N N     . ALA D 4 401 ? 27.237  10.151  26.200  1.00 40.48  ? 401 ALA B N     1 
ATOM   8041 C CA    . ALA D 4 401 ? 25.938  10.410  26.811  1.00 37.78  ? 401 ALA B CA    1 
ATOM   8042 C C     . ALA D 4 401 ? 25.938  10.456  28.328  1.00 35.63  ? 401 ALA B C     1 
ATOM   8043 O O     . ALA D 4 401 ? 26.679  9.730   28.979  1.00 37.11  ? 401 ALA B O     1 
ATOM   8044 C CB    . ALA D 4 401 ? 24.935  9.375   26.329  1.00 35.95  ? 401 ALA B CB    1 
ATOM   8045 N N     . ASN D 4 402 ? 25.107  11.326  28.891  1.00 33.40  ? 402 ASN B N     1 
ATOM   8046 C CA    . ASN D 4 402 ? 25.009  11.407  30.337  1.00 31.78  ? 402 ASN B CA    1 
ATOM   8047 C C     . ASN D 4 402 ? 24.373  10.092  30.741  1.00 30.40  ? 402 ASN B C     1 
ATOM   8048 O O     . ASN D 4 402 ? 23.425  9.635   30.104  1.00 31.15  ? 402 ASN B O     1 
ATOM   8049 C CB    . ASN D 4 402 ? 24.114  12.572  30.775  1.00 31.99  ? 402 ASN B CB    1 
ATOM   8050 C CG    . ASN D 4 402 ? 24.719  13.921  30.457  1.00 33.92  ? 402 ASN B CG    1 
ATOM   8051 O OD1   . ASN D 4 402 ? 25.908  14.148  30.688  1.00 34.90  ? 402 ASN B OD1   1 
ATOM   8052 N ND2   . ASN D 4 402 ? 23.904  14.829  29.933  1.00 33.59  ? 402 ASN B ND2   1 
ATOM   8053 N N     . PRO D 4 403 ? 24.893  9.454   31.793  1.00 27.88  ? 403 PRO B N     1 
ATOM   8054 C CA    . PRO D 4 403 ? 24.302  8.180   32.205  1.00 26.60  ? 403 PRO B CA    1 
ATOM   8055 C C     . PRO D 4 403 ? 22.930  8.378   32.854  1.00 26.21  ? 403 PRO B C     1 
ATOM   8056 O O     . PRO D 4 403 ? 22.661  9.424   33.447  1.00 23.84  ? 403 PRO B O     1 
ATOM   8057 C CB    . PRO D 4 403 ? 25.353  7.614   33.165  1.00 26.52  ? 403 PRO B CB    1 
ATOM   8058 C CG    . PRO D 4 403 ? 25.942  8.839   33.772  1.00 25.02  ? 403 PRO B CG    1 
ATOM   8059 C CD    . PRO D 4 403 ? 26.077  9.784   32.605  1.00 25.66  ? 403 PRO B CD    1 
ATOM   8060 N N     . GLN D 4 404 ? 22.064  7.374   32.738  1.00 25.44  ? 404 GLN B N     1 
ATOM   8061 C CA    . GLN D 4 404 ? 20.727  7.469   33.319  1.00 24.65  ? 404 GLN B CA    1 
ATOM   8062 C C     . GLN D 4 404 ? 20.454  6.305   34.245  1.00 22.99  ? 404 GLN B C     1 
ATOM   8063 O O     . GLN D 4 404 ? 21.072  5.254   34.131  1.00 26.09  ? 404 GLN B O     1 
ATOM   8064 C CB    . GLN D 4 404 ? 19.643  7.438   32.237  1.00 23.31  ? 404 GLN B CB    1 
ATOM   8065 C CG    . GLN D 4 404 ? 19.946  8.173   30.954  1.00 23.46  ? 404 GLN B CG    1 
ATOM   8066 C CD    . GLN D 4 404 ? 18.818  8.015   29.944  1.00 23.86  ? 404 GLN B CD    1 
ATOM   8067 O OE1   . GLN D 4 404 ? 17.948  7.152   30.096  1.00 22.94  ? 404 GLN B OE1   1 
ATOM   8068 N NE2   . GLN D 4 404 ? 18.835  8.834   28.907  1.00 19.15  ? 404 GLN B NE2   1 
ATOM   8069 N N     . VAL D 4 405 ? 19.532  6.503   35.174  1.00 21.27  ? 405 VAL B N     1 
ATOM   8070 C CA    . VAL D 4 405 ? 19.123  5.430   36.059  1.00 21.52  ? 405 VAL B CA    1 
ATOM   8071 C C     . VAL D 4 405 ? 17.747  5.187   35.483  1.00 21.52  ? 405 VAL B C     1 
ATOM   8072 O O     . VAL D 4 405 ? 17.083  6.128   35.070  1.00 22.02  ? 405 VAL B O     1 
ATOM   8073 C CB    . VAL D 4 405 ? 18.967  5.882   37.523  1.00 22.95  ? 405 VAL B CB    1 
ATOM   8074 C CG1   . VAL D 4 405 ? 18.668  4.686   38.402  1.00 23.11  ? 405 VAL B CG1   1 
ATOM   8075 C CG2   . VAL D 4 405 ? 20.227  6.569   37.990  1.00 27.24  ? 405 VAL B CG2   1 
ATOM   8076 N N     . GLY D 4 406 ? 17.316  3.941   35.421  1.00 21.96  ? 406 GLY B N     1 
ATOM   8077 C CA    . GLY D 4 406 ? 16.007  3.688   34.869  1.00 21.25  ? 406 GLY B CA    1 
ATOM   8078 C C     . GLY D 4 406 ? 15.481  2.337   35.276  1.00 21.56  ? 406 GLY B C     1 
ATOM   8079 O O     . GLY D 4 406 ? 16.160  1.579   35.984  1.00 22.19  ? 406 GLY B O     1 
ATOM   8080 N N     . VAL D 4 407 ? 14.266  2.039   34.825  1.00 19.00  ? 407 VAL B N     1 
ATOM   8081 C CA    . VAL D 4 407 ? 13.624  0.779   35.136  1.00 17.28  ? 407 VAL B CA    1 
ATOM   8082 C C     . VAL D 4 407 ? 13.517  -0.090  33.882  1.00 18.84  ? 407 VAL B C     1 
ATOM   8083 O O     . VAL D 4 407 ? 13.338  0.410   32.768  1.00 18.96  ? 407 VAL B O     1 
ATOM   8084 C CB    . VAL D 4 407 ? 12.212  1.025   35.700  1.00 15.63  ? 407 VAL B CB    1 
ATOM   8085 C CG1   . VAL D 4 407 ? 11.369  1.763   34.657  1.00 15.72  ? 407 VAL B CG1   1 
ATOM   8086 C CG2   . VAL D 4 407 ? 11.557  -0.291  36.092  1.00 13.03  ? 407 VAL B CG2   1 
ATOM   8087 N N     . ALA D 4 408 ? 13.658  -1.393  34.075  1.00 18.99  ? 408 ALA B N     1 
ATOM   8088 C CA    . ALA D 4 408 ? 13.526  -2.354  32.991  1.00 19.51  ? 408 ALA B CA    1 
ATOM   8089 C C     . ALA D 4 408 ? 12.480  -3.344  33.492  1.00 20.55  ? 408 ALA B C     1 
ATOM   8090 O O     . ALA D 4 408 ? 12.745  -4.112  34.412  1.00 18.96  ? 408 ALA B O     1 
ATOM   8091 C CB    . ALA D 4 408 ? 14.857  -3.075  32.732  1.00 18.72  ? 408 ALA B CB    1 
ATOM   8092 N N     . PHE D 4 409 ? 11.289  -3.322  32.907  1.00 21.99  ? 409 PHE B N     1 
ATOM   8093 C CA    . PHE D 4 409 ? 10.258  -4.240  33.361  1.00 23.74  ? 409 PHE B CA    1 
ATOM   8094 C C     . PHE D 4 409 ? 9.854   -5.275  32.316  1.00 24.88  ? 409 PHE B C     1 
ATOM   8095 O O     . PHE D 4 409 ? 9.950   -5.037  31.111  1.00 24.54  ? 409 PHE B O     1 
ATOM   8096 C CB    . PHE D 4 409 ? 9.043   -3.457  33.896  1.00 21.40  ? 409 PHE B CB    1 
ATOM   8097 C CG    . PHE D 4 409 ? 8.420   -2.519  32.912  1.00 18.46  ? 409 PHE B CG    1 
ATOM   8098 C CD1   . PHE D 4 409 ? 7.465   -2.972  32.009  1.00 17.76  ? 409 PHE B CD1   1 
ATOM   8099 C CD2   . PHE D 4 409 ? 8.733   -1.162  32.936  1.00 19.71  ? 409 PHE B CD2   1 
ATOM   8100 C CE1   . PHE D 4 409 ? 6.814   -2.081  31.144  1.00 19.32  ? 409 PHE B CE1   1 
ATOM   8101 C CE2   . PHE D 4 409 ? 8.096   -0.263  32.080  1.00 18.96  ? 409 PHE B CE2   1 
ATOM   8102 C CZ    . PHE D 4 409 ? 7.130   -0.722  31.180  1.00 18.72  ? 409 PHE B CZ    1 
ATOM   8103 N N     . PRO D 4 410 ? 9.407   -6.453  32.775  1.00 26.55  ? 410 PRO B N     1 
ATOM   8104 C CA    . PRO D 4 410 ? 8.994   -7.550  31.898  1.00 27.03  ? 410 PRO B CA    1 
ATOM   8105 C C     . PRO D 4 410 ? 7.807   -7.258  30.994  1.00 26.78  ? 410 PRO B C     1 
ATOM   8106 O O     . PRO D 4 410 ? 6.816   -6.677  31.420  1.00 25.39  ? 410 PRO B O     1 
ATOM   8107 C CB    . PRO D 4 410 ? 8.719   -8.681  32.880  1.00 27.54  ? 410 PRO B CB    1 
ATOM   8108 C CG    . PRO D 4 410 ? 8.204   -7.946  34.077  1.00 28.32  ? 410 PRO B CG    1 
ATOM   8109 C CD    . PRO D 4 410 ? 9.184   -6.806  34.187  1.00 26.54  ? 410 PRO B CD    1 
ATOM   8110 N N     . HIS D 4 411 ? 7.941   -7.662  29.734  1.00 27.87  ? 411 HIS B N     1 
ATOM   8111 C CA    . HIS D 4 411 ? 6.904   -7.486  28.722  1.00 28.60  ? 411 HIS B CA    1 
ATOM   8112 C C     . HIS D 4 411 ? 6.769   -8.824  27.985  1.00 30.06  ? 411 HIS B C     1 
ATOM   8113 O O     . HIS D 4 411 ? 7.511   -9.106  27.041  1.00 29.43  ? 411 HIS B O     1 
ATOM   8114 C CB    . HIS D 4 411 ? 7.305   -6.395  27.738  1.00 28.05  ? 411 HIS B CB    1 
ATOM   8115 C CG    . HIS D 4 411 ? 6.196   -5.964  26.833  1.00 30.24  ? 411 HIS B CG    1 
ATOM   8116 N ND1   . HIS D 4 411 ? 5.009   -5.448  27.307  1.00 29.26  ? 411 HIS B ND1   1 
ATOM   8117 C CD2   . HIS D 4 411 ? 6.102   -5.946  25.482  1.00 30.05  ? 411 HIS B CD2   1 
ATOM   8118 C CE1   . HIS D 4 411 ? 4.233   -5.128  26.287  1.00 30.32  ? 411 HIS B CE1   1 
ATOM   8119 N NE2   . HIS D 4 411 ? 4.872   -5.419  25.169  1.00 30.07  ? 411 HIS B NE2   1 
ATOM   8120 N N     . ILE D 4 412 ? 5.814   -9.638  28.427  1.00 31.16  ? 412 ILE B N     1 
ATOM   8121 C CA    . ILE D 4 412 ? 5.586   -10.958 27.855  1.00 32.92  ? 412 ILE B CA    1 
ATOM   8122 C C     . ILE D 4 412 ? 4.338   -11.022 26.980  1.00 34.64  ? 412 ILE B C     1 
ATOM   8123 O O     . ILE D 4 412 ? 3.225   -10.795 27.447  1.00 35.25  ? 412 ILE B O     1 
ATOM   8124 C CB    . ILE D 4 412 ? 5.474   -12.002 28.987  1.00 31.71  ? 412 ILE B CB    1 
ATOM   8125 C CG1   . ILE D 4 412 ? 6.708   -11.903 29.885  1.00 30.59  ? 412 ILE B CG1   1 
ATOM   8126 C CG2   . ILE D 4 412 ? 5.343   -13.402 28.411  1.00 30.17  ? 412 ILE B CG2   1 
ATOM   8127 C CD1   . ILE D 4 412 ? 6.595   -12.679 31.195  1.00 31.60  ? 412 ILE B CD1   1 
ATOM   8128 N N     . LYS D 4 413 ? 4.535   -11.330 25.705  1.00 38.20  ? 413 LYS B N     1 
ATOM   8129 C CA    . LYS D 4 413 ? 3.435   -11.442 24.750  1.00 41.70  ? 413 LYS B CA    1 
ATOM   8130 C C     . LYS D 4 413 ? 3.449   -12.854 24.175  1.00 44.14  ? 413 LYS B C     1 
ATOM   8131 O O     . LYS D 4 413 ? 4.210   -13.704 24.639  1.00 45.46  ? 413 LYS B O     1 
ATOM   8132 C CB    . LYS D 4 413 ? 3.604   -10.425 23.617  1.00 42.65  ? 413 LYS B CB    1 
ATOM   8133 C CG    . LYS D 4 413 ? 3.334   -8.978  24.006  1.00 45.18  ? 413 LYS B CG    1 
ATOM   8134 C CD    . LYS D 4 413 ? 1.875   -8.775  24.394  1.00 47.46  ? 413 LYS B CD    1 
ATOM   8135 C CE    . LYS D 4 413 ? 1.534   -7.300  24.556  1.00 49.49  ? 413 LYS B CE    1 
ATOM   8136 N NZ    . LYS D 4 413 ? 0.116   -7.086  24.976  1.00 50.70  ? 413 LYS B NZ    1 
ATOM   8137 N N     . HIS D 4 414 ? 2.618   -13.111 23.170  1.00 45.98  ? 414 HIS B N     1 
ATOM   8138 C CA    . HIS D 4 414 ? 2.588   -14.439 22.575  1.00 47.93  ? 414 HIS B CA    1 
ATOM   8139 C C     . HIS D 4 414 ? 3.596   -14.600 21.440  1.00 47.77  ? 414 HIS B C     1 
ATOM   8140 O O     . HIS D 4 414 ? 4.074   -15.707 21.202  1.00 48.19  ? 414 HIS B O     1 
ATOM   8141 C CB    . HIS D 4 414 ? 1.178   -14.789 22.084  1.00 50.86  ? 414 HIS B CB    1 
ATOM   8142 C CG    . HIS D 4 414 ? 0.601   -13.793 21.126  1.00 54.59  ? 414 HIS B CG    1 
ATOM   8143 N ND1   . HIS D 4 414 ? 0.178   -12.540 21.519  1.00 56.66  ? 414 HIS B ND1   1 
ATOM   8144 C CD2   . HIS D 4 414 ? 0.374   -13.867 19.793  1.00 54.50  ? 414 HIS B CD2   1 
ATOM   8145 C CE1   . HIS D 4 414 ? -0.286  -11.885 20.469  1.00 56.54  ? 414 HIS B CE1   1 
ATOM   8146 N NE2   . HIS D 4 414 ? -0.178  -12.668 19.409  1.00 56.65  ? 414 HIS B NE2   1 
ATOM   8147 N N     . ASN D 4 415 ? 3.923   -13.510 20.744  1.00 46.59  ? 415 ASN B N     1 
ATOM   8148 C CA    . ASN D 4 415 ? 4.899   -13.584 19.651  1.00 46.58  ? 415 ASN B CA    1 
ATOM   8149 C C     . ASN D 4 415 ? 6.331   -13.282 20.101  1.00 45.49  ? 415 ASN B C     1 
ATOM   8150 O O     . ASN D 4 415 ? 7.285   -13.687 19.441  1.00 46.91  ? 415 ASN B O     1 
ATOM   8151 C CB    . ASN D 4 415 ? 4.555   -12.626 18.496  1.00 46.46  ? 415 ASN B CB    1 
ATOM   8152 C CG    . ASN D 4 415 ? 3.281   -11.841 18.727  1.00 47.98  ? 415 ASN B CG    1 
ATOM   8153 O OD1   . ASN D 4 415 ? 3.118   -11.176 19.751  1.00 49.28  ? 415 ASN B OD1   1 
ATOM   8154 N ND2   . ASN D 4 415 ? 2.371   -11.899 17.758  1.00 47.70  ? 415 ASN B ND2   1 
ATOM   8155 N N     . TYR D 4 416 ? 6.486   -12.564 21.212  1.00 44.65  ? 416 TYR B N     1 
ATOM   8156 C CA    . TYR D 4 416 ? 7.819   -12.221 21.707  1.00 42.78  ? 416 TYR B CA    1 
ATOM   8157 C C     . TYR D 4 416 ? 7.834   -11.733 23.153  1.00 40.03  ? 416 TYR B C     1 
ATOM   8158 O O     . TYR D 4 416 ? 6.809   -11.326 23.696  1.00 39.44  ? 416 TYR B O     1 
ATOM   8159 C CB    . TYR D 4 416 ? 8.451   -11.148 20.808  1.00 44.35  ? 416 TYR B CB    1 
ATOM   8160 C CG    . TYR D 4 416 ? 7.795   -9.783  20.887  1.00 45.91  ? 416 TYR B CG    1 
ATOM   8161 C CD1   . TYR D 4 416 ? 8.037   -8.924  21.965  1.00 46.78  ? 416 TYR B CD1   1 
ATOM   8162 C CD2   . TYR D 4 416 ? 6.943   -9.343  19.874  1.00 47.02  ? 416 TYR B CD2   1 
ATOM   8163 C CE1   . TYR D 4 416 ? 7.448   -7.660  22.027  1.00 48.32  ? 416 TYR B CE1   1 
ATOM   8164 C CE2   . TYR D 4 416 ? 6.349   -8.084  19.925  1.00 48.84  ? 416 TYR B CE2   1 
ATOM   8165 C CZ    . TYR D 4 416 ? 6.604   -7.245  20.999  1.00 50.35  ? 416 TYR B CZ    1 
ATOM   8166 O OH    . TYR D 4 416 ? 6.032   -5.991  21.024  1.00 51.29  ? 416 TYR B OH    1 
ATOM   8167 N N     . GLU D 4 417 ? 9.011   -11.779 23.767  1.00 37.29  ? 417 GLU B N     1 
ATOM   8168 C CA    . GLU D 4 417 ? 9.178   -11.322 25.140  1.00 35.28  ? 417 GLU B CA    1 
ATOM   8169 C C     . GLU D 4 417 ? 10.340  -10.360 25.170  1.00 32.55  ? 417 GLU B C     1 
ATOM   8170 O O     . GLU D 4 417 ? 11.277  -10.487 24.385  1.00 33.35  ? 417 GLU B O     1 
ATOM   8171 C CB    . GLU D 4 417 ? 9.538   -12.463 26.076  1.00 36.73  ? 417 GLU B CB    1 
ATOM   8172 C CG    . GLU D 4 417 ? 8.765   -13.719 25.898  1.00 38.34  ? 417 GLU B CG    1 
ATOM   8173 C CD    . GLU D 4 417 ? 9.384   -14.834 26.692  1.00 38.30  ? 417 GLU B CD    1 
ATOM   8174 O OE1   . GLU D 4 417 ? 10.623  -14.978 26.628  1.00 38.12  ? 417 GLU B OE1   1 
ATOM   8175 O OE2   . GLU D 4 417 ? 8.638   -15.561 27.372  1.00 41.44  ? 417 GLU B OE2   1 
ATOM   8176 N N     . CYS D 4 418 ? 10.292  -9.416  26.098  1.00 29.93  ? 418 CYS B N     1 
ATOM   8177 C CA    . CYS D 4 418 ? 11.366  -8.455  26.233  1.00 26.78  ? 418 CYS B CA    1 
ATOM   8178 C C     . CYS D 4 418 ? 11.231  -7.628  27.508  1.00 25.78  ? 418 CYS B C     1 
ATOM   8179 O O     . CYS D 4 418 ? 10.279  -7.775  28.275  1.00 23.52  ? 418 CYS B O     1 
ATOM   8180 C CB    . CYS D 4 418 ? 11.394  -7.523  25.014  1.00 26.40  ? 418 CYS B CB    1 
ATOM   8181 S SG    . CYS D 4 418 ? 10.042  -6.322  24.937  1.00 24.06  ? 418 CYS B SG    1 
ATOM   8182 N N     . LEU D 4 419 ? 12.224  -6.780  27.737  1.00 24.05  ? 419 LEU B N     1 
ATOM   8183 C CA    . LEU D 4 419 ? 12.216  -5.883  28.871  1.00 22.32  ? 419 LEU B CA    1 
ATOM   8184 C C     . LEU D 4 419 ? 11.892  -4.526  28.257  1.00 20.84  ? 419 LEU B C     1 
ATOM   8185 O O     . LEU D 4 419 ? 12.306  -4.236  27.138  1.00 20.80  ? 419 LEU B O     1 
ATOM   8186 C CB    . LEU D 4 419 ? 13.595  -5.837  29.537  1.00 20.44  ? 419 LEU B CB    1 
ATOM   8187 C CG    . LEU D 4 419 ? 14.040  -7.056  30.342  1.00 20.78  ? 419 LEU B CG    1 
ATOM   8188 C CD1   . LEU D 4 419 ? 15.516  -6.930  30.689  1.00 20.61  ? 419 LEU B CD1   1 
ATOM   8189 C CD2   . LEU D 4 419 ? 13.212  -7.158  31.606  1.00 17.85  ? 419 LEU B CD2   1 
ATOM   8190 N N     . VAL D 4 420 ? 11.108  -3.723  28.958  1.00 19.97  ? 420 VAL B N     1 
ATOM   8191 C CA    . VAL D 4 420 ? 10.784  -2.385  28.481  1.00 21.02  ? 420 VAL B CA    1 
ATOM   8192 C C     . VAL D 4 420 ? 11.638  -1.476  29.356  1.00 21.48  ? 420 VAL B C     1 
ATOM   8193 O O     . VAL D 4 420 ? 11.660  -1.641  30.589  1.00 21.16  ? 420 VAL B O     1 
ATOM   8194 C CB    . VAL D 4 420 ? 9.287   -2.035  28.690  1.00 21.82  ? 420 VAL B CB    1 
ATOM   8195 C CG1   . VAL D 4 420 ? 9.055   -0.567  28.426  1.00 22.97  ? 420 VAL B CG1   1 
ATOM   8196 C CG2   . VAL D 4 420 ? 8.418   -2.868  27.764  1.00 24.54  ? 420 VAL B CG2   1 
ATOM   8197 N N     . TYR D 4 421 ? 12.371  -0.558  28.725  1.00 19.24  ? 421 TYR B N     1 
ATOM   8198 C CA    . TYR D 4 421 ? 13.213  0.372   29.463  1.00 18.18  ? 421 TYR B CA    1 
ATOM   8199 C C     . TYR D 4 421 ? 12.666  1.786   29.413  1.00 18.25  ? 421 TYR B C     1 
ATOM   8200 O O     . TYR D 4 421 ? 12.312  2.297   28.342  1.00 15.67  ? 421 TYR B O     1 
ATOM   8201 C CB    . TYR D 4 421 ? 14.648  0.411   28.914  1.00 18.01  ? 421 TYR B CB    1 
ATOM   8202 C CG    . TYR D 4 421 ? 15.475  1.506   29.571  1.00 15.17  ? 421 TYR B CG    1 
ATOM   8203 C CD1   . TYR D 4 421 ? 16.061  1.305   30.816  1.00 15.30  ? 421 TYR B CD1   1 
ATOM   8204 C CD2   . TYR D 4 421 ? 15.567  2.783   29.003  1.00 16.38  ? 421 TYR B CD2   1 
ATOM   8205 C CE1   . TYR D 4 421 ? 16.702  2.333   31.488  1.00 13.65  ? 421 TYR B CE1   1 
ATOM   8206 C CE2   . TYR D 4 421 ? 16.217  3.830   29.674  1.00 13.27  ? 421 TYR B CE2   1 
ATOM   8207 C CZ    . TYR D 4 421 ? 16.775  3.590   30.918  1.00 14.76  ? 421 TYR B CZ    1 
ATOM   8208 O OH    . TYR D 4 421 ? 17.394  4.603   31.617  1.00 17.87  ? 421 TYR B OH    1 
ATOM   8209 N N     . VAL D 4 422 ? 12.601  2.414   30.582  1.00 18.35  ? 422 VAL B N     1 
ATOM   8210 C CA    . VAL D 4 422 ? 12.154  3.796   30.691  1.00 18.43  ? 422 VAL B CA    1 
ATOM   8211 C C     . VAL D 4 422 ? 13.017  4.423   31.770  1.00 20.23  ? 422 VAL B C     1 
ATOM   8212 O O     . VAL D 4 422 ? 13.254  3.809   32.815  1.00 23.79  ? 422 VAL B O     1 
ATOM   8213 C CB    . VAL D 4 422 ? 10.671  3.913   31.108  1.00 18.81  ? 422 VAL B CB    1 
ATOM   8214 C CG1   . VAL D 4 422 ? 10.194  5.352   30.907  1.00 18.97  ? 422 VAL B CG1   1 
ATOM   8215 C CG2   . VAL D 4 422 ? 9.815   2.957   30.296  1.00 19.24  ? 422 VAL B CG2   1 
ATOM   8216 N N     . GLN D 4 423 ? 13.501  5.634   31.515  1.00 19.74  ? 423 GLN B N     1 
ATOM   8217 C CA    . GLN D 4 423 ? 14.338  6.346   32.466  1.00 19.66  ? 423 GLN B CA    1 
ATOM   8218 C C     . GLN D 4 423 ? 13.567  6.793   33.717  1.00 20.56  ? 423 GLN B C     1 
ATOM   8219 O O     . GLN D 4 423 ? 12.396  7.155   33.646  1.00 20.45  ? 423 GLN B O     1 
ATOM   8220 C CB    . GLN D 4 423 ? 14.968  7.559   31.778  1.00 19.48  ? 423 GLN B CB    1 
ATOM   8221 C CG    . GLN D 4 423 ? 15.727  8.509   32.706  1.00 17.26  ? 423 GLN B CG    1 
ATOM   8222 C CD    . GLN D 4 423 ? 16.435  9.624   31.943  1.00 16.83  ? 423 GLN B CD    1 
ATOM   8223 O OE1   . GLN D 4 423 ? 15.929  10.114  30.938  1.00 13.71  ? 423 GLN B OE1   1 
ATOM   8224 N NE2   . GLN D 4 423 ? 17.602  10.037  32.432  1.00 15.82  ? 423 GLN B NE2   1 
ATOM   8225 N N     . LEU D 4 424 ? 14.233  6.738   34.865  1.00 20.07  ? 424 LEU B N     1 
ATOM   8226 C CA    . LEU D 4 424 ? 13.646  7.164   36.127  1.00 19.37  ? 424 LEU B CA    1 
ATOM   8227 C C     . LEU D 4 424 ? 14.263  8.509   36.480  1.00 20.21  ? 424 LEU B C     1 
ATOM   8228 O O     . LEU D 4 424 ? 15.255  8.923   35.883  1.00 18.67  ? 424 LEU B O     1 
ATOM   8229 C CB    . LEU D 4 424 ? 13.906  6.127   37.217  1.00 19.31  ? 424 LEU B CB    1 
ATOM   8230 C CG    . LEU D 4 424 ? 13.051  4.879   36.972  1.00 20.41  ? 424 LEU B CG    1 
ATOM   8231 C CD1   . LEU D 4 424 ? 13.354  3.785   37.981  1.00 17.24  ? 424 LEU B CD1   1 
ATOM   8232 C CD2   . LEU D 4 424 ? 11.576  5.302   37.033  1.00 21.30  ? 424 LEU B CD2   1 
ATOM   8233 N N     . PRO D 4 425 ? 13.688  9.212   37.455  1.00 21.07  ? 425 PRO B N     1 
ATOM   8234 C CA    . PRO D 4 425 ? 14.255  10.515  37.796  1.00 22.78  ? 425 PRO B CA    1 
ATOM   8235 C C     . PRO D 4 425 ? 15.417  10.575  38.783  1.00 23.61  ? 425 PRO B C     1 
ATOM   8236 O O     . PRO D 4 425 ? 15.623  9.669   39.596  1.00 24.49  ? 425 PRO B O     1 
ATOM   8237 C CB    . PRO D 4 425 ? 13.039  11.274  38.308  1.00 23.96  ? 425 PRO B CB    1 
ATOM   8238 C CG    . PRO D 4 425 ? 12.312  10.219  39.054  1.00 24.24  ? 425 PRO B CG    1 
ATOM   8239 C CD    . PRO D 4 425 ? 12.413  8.992   38.156  1.00 21.77  ? 425 PRO B CD    1 
ATOM   8240 N N     . PHE D 4 426 ? 16.200  11.643  38.673  1.00 22.53  ? 426 PHE B N     1 
ATOM   8241 C CA    . PHE D 4 426 ? 17.292  11.870  39.608  1.00 22.72  ? 426 PHE B CA    1 
ATOM   8242 C C     . PHE D 4 426 ? 16.656  12.759  40.683  1.00 23.33  ? 426 PHE B C     1 
ATOM   8243 O O     . PHE D 4 426 ? 15.702  13.487  40.408  1.00 22.35  ? 426 PHE B O     1 
ATOM   8244 C CB    . PHE D 4 426 ? 18.446  12.619  38.947  1.00 18.08  ? 426 PHE B CB    1 
ATOM   8245 C CG    . PHE D 4 426 ? 19.316  11.767  38.071  1.00 17.68  ? 426 PHE B CG    1 
ATOM   8246 C CD1   . PHE D 4 426 ? 19.522  12.106  36.731  1.00 17.32  ? 426 PHE B CD1   1 
ATOM   8247 C CD2   . PHE D 4 426 ? 19.988  10.663  38.591  1.00 18.48  ? 426 PHE B CD2   1 
ATOM   8248 C CE1   . PHE D 4 426 ? 20.389  11.360  35.927  1.00 13.91  ? 426 PHE B CE1   1 
ATOM   8249 C CE2   . PHE D 4 426 ? 20.855  9.913   37.794  1.00 15.36  ? 426 PHE B CE2   1 
ATOM   8250 C CZ    . PHE D 4 426 ? 21.054  10.266  36.462  1.00 15.92  ? 426 PHE B CZ    1 
ATOM   8251 N N     . MET D 4 427 ? 17.166  12.684  41.903  1.00 26.33  ? 427 MET B N     1 
ATOM   8252 C CA    . MET D 4 427 ? 16.649  13.489  43.009  1.00 28.02  ? 427 MET B CA    1 
ATOM   8253 C C     . MET D 4 427 ? 16.496  14.965  42.622  1.00 26.89  ? 427 MET B C     1 
ATOM   8254 O O     . MET D 4 427 ? 15.524  15.615  43.002  1.00 28.83  ? 427 MET B O     1 
ATOM   8255 C CB    . MET D 4 427 ? 17.589  13.358  44.209  1.00 30.31  ? 427 MET B CB    1 
ATOM   8256 C CG    . MET D 4 427 ? 17.232  14.227  45.394  1.00 36.82  ? 427 MET B CG    1 
ATOM   8257 S SD    . MET D 4 427 ? 18.565  15.382  45.760  1.00 42.04  ? 427 MET B SD    1 
ATOM   8258 C CE    . MET D 4 427 ? 18.006  16.832  44.864  1.00 40.74  ? 427 MET B CE    1 
ATOM   8259 N N     . GLU D 4 428 ? 17.448  15.479  41.850  1.00 24.95  ? 428 GLU B N     1 
ATOM   8260 C CA    . GLU D 4 428 ? 17.435  16.869  41.413  1.00 23.67  ? 428 GLU B CA    1 
ATOM   8261 C C     . GLU D 4 428 ? 16.337  17.170  40.396  1.00 24.22  ? 428 GLU B C     1 
ATOM   8262 O O     . GLU D 4 428 ? 16.175  18.321  39.979  1.00 25.09  ? 428 GLU B O     1 
ATOM   8263 C CB    . GLU D 4 428 ? 18.785  17.249  40.800  1.00 23.15  ? 428 GLU B CB    1 
ATOM   8264 C CG    . GLU D 4 428 ? 19.987  16.934  41.668  1.00 24.99  ? 428 GLU B CG    1 
ATOM   8265 C CD    . GLU D 4 428 ? 20.600  15.574  41.370  1.00 26.39  ? 428 GLU B CD    1 
ATOM   8266 O OE1   . GLU D 4 428 ? 21.767  15.535  40.926  1.00 28.12  ? 428 GLU B OE1   1 
ATOM   8267 O OE2   . GLU D 4 428 ? 19.924  14.546  41.581  1.00 27.31  ? 428 GLU B OE2   1 
ATOM   8268 N N     . ASP D 4 429 ? 15.595  16.140  39.994  1.00 22.17  ? 429 ASP B N     1 
ATOM   8269 C CA    . ASP D 4 429 ? 14.517  16.300  39.023  1.00 20.91  ? 429 ASP B CA    1 
ATOM   8270 C C     . ASP D 4 429 ? 13.163  16.454  39.706  1.00 21.53  ? 429 ASP B C     1 
ATOM   8271 O O     . ASP D 4 429 ? 12.185  16.865  39.076  1.00 22.07  ? 429 ASP B O     1 
ATOM   8272 C CB    . ASP D 4 429 ? 14.427  15.079  38.095  1.00 20.98  ? 429 ASP B CB    1 
ATOM   8273 C CG    . ASP D 4 429 ? 15.693  14.832  37.314  1.00 22.71  ? 429 ASP B CG    1 
ATOM   8274 O OD1   . ASP D 4 429 ? 16.317  15.809  36.851  1.00 23.44  ? 429 ASP B OD1   1 
ATOM   8275 O OD2   . ASP D 4 429 ? 16.053  13.649  37.144  1.00 25.01  ? 429 ASP B OD2   1 
ATOM   8276 N N     . LEU D 4 430 ? 13.112  16.117  40.989  1.00 21.35  ? 430 LEU B N     1 
ATOM   8277 C CA    . LEU D 4 430 ? 11.872  16.155  41.753  1.00 26.16  ? 430 LEU B CA    1 
ATOM   8278 C C     . LEU D 4 430 ? 11.498  17.491  42.369  1.00 29.61  ? 430 LEU B C     1 
ATOM   8279 O O     . LEU D 4 430 ? 12.351  18.326  42.677  1.00 30.62  ? 430 LEU B O     1 
ATOM   8280 C CB    . LEU D 4 430 ? 11.919  15.108  42.872  1.00 25.48  ? 430 LEU B CB    1 
ATOM   8281 C CG    . LEU D 4 430 ? 12.427  13.707  42.509  1.00 25.35  ? 430 LEU B CG    1 
ATOM   8282 C CD1   . LEU D 4 430 ? 12.565  12.884  43.768  1.00 26.59  ? 430 LEU B CD1   1 
ATOM   8283 C CD2   . LEU D 4 430 ? 11.483  13.032  41.539  1.00 25.57  ? 430 LEU B CD2   1 
ATOM   8284 N N     . ARG D 4 431 ? 10.198  17.670  42.557  1.00 33.06  ? 431 ARG B N     1 
ATOM   8285 C CA    . ARG D 4 431 ? 9.650   18.866  43.164  1.00 35.55  ? 431 ARG B CA    1 
ATOM   8286 C C     . ARG D 4 431 ? 8.537   18.432  44.098  1.00 37.88  ? 431 ARG B C     1 
ATOM   8287 O O     . ARG D 4 431 ? 7.521   17.884  43.662  1.00 38.09  ? 431 ARG B O     1 
ATOM   8288 C CB    . ARG D 4 431 ? 9.152   19.815  42.075  1.00 37.08  ? 431 ARG B CB    1 
ATOM   8289 C CG    . ARG D 4 431 ? 10.332  20.373  41.293  1.00 39.60  ? 431 ARG B CG    1 
ATOM   8290 C CD    . ARG D 4 431 ? 9.954   21.177  40.092  1.00 41.18  ? 431 ARG B CD    1 
ATOM   8291 N NE    . ARG D 4 431 ? 11.158  21.580  39.380  1.00 43.64  ? 431 ARG B NE    1 
ATOM   8292 C CZ    . ARG D 4 431 ? 11.154  22.196  38.204  1.00 45.80  ? 431 ARG B CZ    1 
ATOM   8293 N NH1   . ARG D 4 431 ? 10.001  22.478  37.615  1.00 47.59  ? 431 ARG B NH1   1 
ATOM   8294 N NH2   . ARG D 4 431 ? 12.299  22.519  37.613  1.00 47.03  ? 431 ARG B NH2   1 
ATOM   8295 N N     . GLN D 4 432 ? 8.754   18.652  45.392  1.00 39.77  ? 432 GLN B N     1 
ATOM   8296 C CA    . GLN D 4 432 ? 7.787   18.265  46.408  1.00 41.76  ? 432 GLN B CA    1 
ATOM   8297 C C     . GLN D 4 432 ? 6.775   19.347  46.770  1.00 41.15  ? 432 GLN B C     1 
ATOM   8298 O O     . GLN D 4 432 ? 6.634   19.724  47.930  1.00 42.55  ? 432 GLN B O     1 
ATOM   8299 C CB    . GLN D 4 432 ? 8.510   17.794  47.676  1.00 44.49  ? 432 GLN B CB    1 
ATOM   8300 C CG    . GLN D 4 432 ? 8.528   16.272  47.851  1.00 50.93  ? 432 GLN B CG    1 
ATOM   8301 C CD    . GLN D 4 432 ? 8.621   15.843  49.318  1.00 52.80  ? 432 GLN B CD    1 
ATOM   8302 O OE1   . GLN D 4 432 ? 9.651   16.028  49.973  1.00 54.19  ? 432 GLN B OE1   1 
ATOM   8303 N NE2   . GLN D 4 432 ? 7.533   15.273  49.838  1.00 53.39  ? 432 GLN B NE2   1 
ATOM   8304 N N     . TYR D 4 433 ? 6.066   19.848  45.773  1.00 40.17  ? 433 TYR B N     1 
ATOM   8305 C CA    . TYR D 4 433 ? 5.047   20.857  46.015  1.00 39.08  ? 433 TYR B CA    1 
ATOM   8306 C C     . TYR D 4 433 ? 3.928   20.193  46.810  1.00 36.91  ? 433 TYR B C     1 
ATOM   8307 O O     . TYR D 4 433 ? 3.411   19.154  46.402  1.00 36.92  ? 433 TYR B O     1 
ATOM   8308 C CB    . TYR D 4 433 ? 4.478   21.362  44.687  1.00 39.24  ? 433 TYR B CB    1 
ATOM   8309 C CG    . TYR D 4 433 ? 5.471   22.087  43.813  1.00 40.87  ? 433 TYR B CG    1 
ATOM   8310 C CD1   . TYR D 4 433 ? 5.340   22.071  42.422  1.00 41.14  ? 433 TYR B CD1   1 
ATOM   8311 C CD2   . TYR D 4 433 ? 6.531   22.804  44.370  1.00 41.93  ? 433 TYR B CD2   1 
ATOM   8312 C CE1   . TYR D 4 433 ? 6.241   22.753  41.603  1.00 41.94  ? 433 TYR B CE1   1 
ATOM   8313 C CE2   . TYR D 4 433 ? 7.442   23.489  43.563  1.00 42.72  ? 433 TYR B CE2   1 
ATOM   8314 C CZ    . TYR D 4 433 ? 7.291   23.461  42.179  1.00 43.85  ? 433 TYR B CZ    1 
ATOM   8315 O OH    . TYR D 4 433 ? 8.182   24.143  41.375  1.00 45.24  ? 433 TYR B OH    1 
ATOM   8316 N N     . MET D 4 434 ? 3.571   20.766  47.951  1.00 34.41  ? 434 MET B N     1 
ATOM   8317 C CA    . MET D 4 434 ? 2.477   20.212  48.739  1.00 33.65  ? 434 MET B CA    1 
ATOM   8318 C C     . MET D 4 434 ? 1.176   20.785  48.190  1.00 30.84  ? 434 MET B C     1 
ATOM   8319 O O     . MET D 4 434 ? 1.136   21.943  47.789  1.00 30.44  ? 434 MET B O     1 
ATOM   8320 C CB    . MET D 4 434 ? 2.590   20.609  50.207  1.00 37.56  ? 434 MET B CB    1 
ATOM   8321 C CG    . MET D 4 434 ? 3.441   19.701  51.068  1.00 42.82  ? 434 MET B CG    1 
ATOM   8322 S SD    . MET D 4 434 ? 2.857   19.790  52.788  1.00 46.95  ? 434 MET B SD    1 
ATOM   8323 C CE    . MET D 4 434 ? 2.892   21.547  53.056  1.00 46.04  ? 434 MET B CE    1 
ATOM   8324 N N     . PHE D 4 435 ? 0.119   19.979  48.168  1.00 27.53  ? 435 PHE B N     1 
ATOM   8325 C CA    . PHE D 4 435 ? -1.178  20.432  47.681  1.00 24.74  ? 435 PHE B CA    1 
ATOM   8326 C C     . PHE D 4 435 ? -2.236  20.142  48.725  1.00 24.41  ? 435 PHE B C     1 
ATOM   8327 O O     . PHE D 4 435 ? -2.221  19.084  49.343  1.00 26.95  ? 435 PHE B O     1 
ATOM   8328 C CB    . PHE D 4 435 ? -1.556  19.723  46.385  1.00 22.29  ? 435 PHE B CB    1 
ATOM   8329 C CG    . PHE D 4 435 ? -0.717  20.120  45.209  1.00 21.24  ? 435 PHE B CG    1 
ATOM   8330 C CD1   . PHE D 4 435 ? 0.586   19.672  45.089  1.00 18.99  ? 435 PHE B CD1   1 
ATOM   8331 C CD2   . PHE D 4 435 ? -1.239  20.952  44.219  1.00 18.46  ? 435 PHE B CD2   1 
ATOM   8332 C CE1   . PHE D 4 435 ? 1.354   20.046  44.001  1.00 20.91  ? 435 PHE B CE1   1 
ATOM   8333 C CE2   . PHE D 4 435 ? -0.486  21.328  43.137  1.00 14.73  ? 435 PHE B CE2   1 
ATOM   8334 C CZ    . PHE D 4 435 ? 0.811   20.880  43.020  1.00 20.02  ? 435 PHE B CZ    1 
ATOM   8335 N N     . SER D 4 436 ? -3.163  21.071  48.913  1.00 23.18  ? 436 SER B N     1 
ATOM   8336 C CA    . SER D 4 436 ? -4.215  20.883  49.894  1.00 23.34  ? 436 SER B CA    1 
ATOM   8337 C C     . SER D 4 436 ? -5.080  19.674  49.598  1.00 22.59  ? 436 SER B C     1 
ATOM   8338 O O     . SER D 4 436 ? -5.389  19.378  48.445  1.00 23.47  ? 436 SER B O     1 
ATOM   8339 C CB    . SER D 4 436 ? -5.103  22.123  49.969  1.00 24.19  ? 436 SER B CB    1 
ATOM   8340 O OG    . SER D 4 436 ? -4.362  23.226  50.444  1.00 26.92  ? 436 SER B OG    1 
ATOM   8341 N N     . SER D 4 437 ? -5.478  18.990  50.660  1.00 22.39  ? 437 SER B N     1 
ATOM   8342 C CA    . SER D 4 437 ? -6.322  17.816  50.550  1.00 24.70  ? 437 SER B CA    1 
ATOM   8343 C C     . SER D 4 437 ? -7.690  18.191  50.001  1.00 25.59  ? 437 SER B C     1 
ATOM   8344 O O     . SER D 4 437 ? -8.237  19.251  50.328  1.00 23.51  ? 437 SER B O     1 
ATOM   8345 C CB    . SER D 4 437 ? -6.467  17.165  51.920  1.00 25.94  ? 437 SER B CB    1 
ATOM   8346 O OG    . SER D 4 437 ? -5.189  17.049  52.534  1.00 29.34  ? 437 SER B OG    1 
ATOM   8347 N N     . LEU D 4 438 ? -8.226  17.316  49.154  1.00 26.94  ? 438 LEU B N     1 
ATOM   8348 C CA    . LEU D 4 438 ? -9.525  17.525  48.536  1.00 28.89  ? 438 LEU B CA    1 
ATOM   8349 C C     . LEU D 4 438 ? -10.557 16.555  49.099  1.00 30.87  ? 438 LEU B C     1 
ATOM   8350 O O     . LEU D 4 438 ? -11.741 16.869  49.155  1.00 31.61  ? 438 LEU B O     1 
ATOM   8351 C CB    . LEU D 4 438 ? -9.428  17.356  47.012  1.00 27.54  ? 438 LEU B CB    1 
ATOM   8352 C CG    . LEU D 4 438 ? -8.604  18.411  46.262  1.00 27.92  ? 438 LEU B CG    1 
ATOM   8353 C CD1   . LEU D 4 438 ? -8.506  18.063  44.777  1.00 24.50  ? 438 LEU B CD1   1 
ATOM   8354 C CD2   . LEU D 4 438 ? -9.243  19.775  46.455  1.00 25.21  ? 438 LEU B CD2   1 
ATOM   8355 N N     . LYS D 4 439 ? -10.115 15.373  49.505  1.00 32.21  ? 439 LYS B N     1 
ATOM   8356 C CA    . LYS D 4 439 ? -11.040 14.399  50.065  1.00 34.07  ? 439 LYS B CA    1 
ATOM   8357 C C     . LYS D 4 439 ? -11.560 15.006  51.362  1.00 35.35  ? 439 LYS B C     1 
ATOM   8358 O O     . LYS D 4 439 ? -12.771 15.078  51.604  1.00 34.72  ? 439 LYS B O     1 
ATOM   8359 C CB    . LYS D 4 439 ? -10.325 13.074  50.361  1.00 32.97  ? 439 LYS B CB    1 
ATOM   8360 C CG    . LYS D 4 439 ? -11.254 12.001  50.923  1.00 36.67  ? 439 LYS B CG    1 
ATOM   8361 C CD    . LYS D 4 439 ? -10.512 10.728  51.321  1.00 40.13  ? 439 LYS B CD    1 
ATOM   8362 C CE    . LYS D 4 439 ? -11.487 9.629   51.753  1.00 40.46  ? 439 LYS B CE    1 
ATOM   8363 N NZ    . LYS D 4 439 ? -10.795 8.410   52.273  1.00 40.37  ? 439 LYS B NZ    1 
ATOM   8364 N N     . ASN D 4 440 ? -10.617 15.441  52.189  1.00 37.12  ? 440 ASN B N     1 
ATOM   8365 C CA    . ASN D 4 440 ? -10.922 16.063  53.467  1.00 41.30  ? 440 ASN B CA    1 
ATOM   8366 C C     . ASN D 4 440 ? -11.139 17.556  53.245  1.00 42.25  ? 440 ASN B C     1 
ATOM   8367 O O     . ASN D 4 440 ? -10.546 18.381  53.945  1.00 43.93  ? 440 ASN B O     1 
ATOM   8368 C CB    . ASN D 4 440 ? -9.757  15.874  54.448  1.00 43.26  ? 440 ASN B CB    1 
ATOM   8369 C CG    . ASN D 4 440 ? -9.526  14.422  54.818  1.00 45.40  ? 440 ASN B CG    1 
ATOM   8370 O OD1   . ASN D 4 440 ? -10.365 13.794  55.470  1.00 48.06  ? 440 ASN B OD1   1 
ATOM   8371 N ND2   . ASN D 4 440 ? -8.383  13.880  54.407  1.00 44.16  ? 440 ASN B ND2   1 
ATOM   8372 N N     . SER D 4 441 ? -11.974 17.906  52.271  1.00 40.82  ? 441 SER B N     1 
ATOM   8373 C CA    . SER D 4 441 ? -12.228 19.314  51.991  1.00 38.39  ? 441 SER B CA    1 
ATOM   8374 C C     . SER D 4 441 ? -13.471 19.837  52.695  1.00 36.67  ? 441 SER B C     1 
ATOM   8375 O O     . SER D 4 441 ? -14.546 19.229  52.631  1.00 36.97  ? 441 SER B O     1 
ATOM   8376 C CB    . SER D 4 441 ? -12.373 19.562  50.487  1.00 37.20  ? 441 SER B CB    1 
ATOM   8377 O OG    . SER D 4 441 ? -12.498 20.955  50.236  1.00 31.63  ? 441 SER B OG    1 
ATOM   8378 N N     . LYS D 4 442 ? -13.311 20.970  53.366  1.00 32.86  ? 442 LYS B N     1 
ATOM   8379 C CA    . LYS D 4 442 ? -14.418 21.589  54.066  1.00 30.96  ? 442 LYS B CA    1 
ATOM   8380 C C     . LYS D 4 442 ? -14.872 22.790  53.261  1.00 28.57  ? 442 LYS B C     1 
ATOM   8381 O O     . LYS D 4 442 ? -15.534 23.681  53.775  1.00 30.80  ? 442 LYS B O     1 
ATOM   8382 C CB    . LYS D 4 442 ? -13.999 22.012  55.478  1.00 30.27  ? 442 LYS B CB    1 
ATOM   8383 C CG    . LYS D 4 442 ? -13.649 20.849  56.395  1.00 30.38  ? 442 LYS B CG    1 
ATOM   8384 C CD    . LYS D 4 442 ? -14.837 19.910  56.576  1.00 31.87  ? 442 LYS B CD    1 
ATOM   8385 C CE    . LYS D 4 442 ? -14.419 18.596  57.226  1.00 31.79  ? 442 LYS B CE    1 
ATOM   8386 N NZ    . LYS D 4 442 ? -15.555 17.620  57.283  1.00 32.78  ? 442 LYS B NZ    1 
ATOM   8387 N N     . LYS D 4 443 ? -14.507 22.809  51.987  1.00 27.54  ? 443 LYS B N     1 
ATOM   8388 C CA    . LYS D 4 443 ? -14.901 23.899  51.111  1.00 26.44  ? 443 LYS B CA    1 
ATOM   8389 C C     . LYS D 4 443 ? -15.418 23.402  49.777  1.00 23.54  ? 443 LYS B C     1 
ATOM   8390 O O     . LYS D 4 443 ? -16.415 23.899  49.263  1.00 25.57  ? 443 LYS B O     1 
ATOM   8391 C CB    . LYS D 4 443 ? -13.722 24.841  50.839  1.00 27.09  ? 443 LYS B CB    1 
ATOM   8392 C CG    . LYS D 4 443 ? -13.308 25.700  52.004  1.00 30.65  ? 443 LYS B CG    1 
ATOM   8393 C CD    . LYS D 4 443 ? -12.236 26.706  51.603  1.00 31.97  ? 443 LYS B CD    1 
ATOM   8394 C CE    . LYS D 4 443 ? -10.962 26.011  51.189  1.00 35.51  ? 443 LYS B CE    1 
ATOM   8395 N NZ    . LYS D 4 443 ? -9.836  26.972  51.018  1.00 38.82  ? 443 LYS B NZ    1 
ATOM   8396 N N     . TYR D 4 444 ? -14.752 22.397  49.229  1.00 23.12  ? 444 TYR B N     1 
ATOM   8397 C CA    . TYR D 4 444 ? -15.104 21.900  47.908  1.00 22.58  ? 444 TYR B CA    1 
ATOM   8398 C C     . TYR D 4 444 ? -15.717 20.514  47.762  1.00 22.16  ? 444 TYR B C     1 
ATOM   8399 O O     . TYR D 4 444 ? -15.752 19.980  46.657  1.00 23.47  ? 444 TYR B O     1 
ATOM   8400 C CB    . TYR D 4 444 ? -13.868 22.018  47.023  1.00 23.44  ? 444 TYR B CB    1 
ATOM   8401 C CG    . TYR D 4 444 ? -13.197 23.364  47.164  1.00 23.33  ? 444 TYR B CG    1 
ATOM   8402 C CD1   . TYR D 4 444 ? -11.876 23.470  47.605  1.00 22.85  ? 444 TYR B CD1   1 
ATOM   8403 C CD2   . TYR D 4 444 ? -13.891 24.535  46.865  1.00 24.22  ? 444 TYR B CD2   1 
ATOM   8404 C CE1   . TYR D 4 444 ? -11.261 24.722  47.743  1.00 24.31  ? 444 TYR B CE1   1 
ATOM   8405 C CE2   . TYR D 4 444 ? -13.293 25.788  46.998  1.00 25.96  ? 444 TYR B CE2   1 
ATOM   8406 C CZ    . TYR D 4 444 ? -11.981 25.876  47.437  1.00 26.52  ? 444 TYR B CZ    1 
ATOM   8407 O OH    . TYR D 4 444 ? -11.408 27.119  47.574  1.00 29.75  ? 444 TYR B OH    1 
ATOM   8408 N N     . ALA D 4 445 ? -16.206 19.933  48.854  1.00 20.90  ? 445 ALA B N     1 
ATOM   8409 C CA    . ALA D 4 445 ? -16.842 18.613  48.791  1.00 22.40  ? 445 ALA B CA    1 
ATOM   8410 C C     . ALA D 4 445 ? -18.166 18.734  48.017  1.00 22.90  ? 445 ALA B C     1 
ATOM   8411 O O     . ALA D 4 445 ? -18.994 19.583  48.331  1.00 26.00  ? 445 ALA B O     1 
ATOM   8412 C CB    . ALA D 4 445 ? -17.105 18.093  50.196  1.00 18.97  ? 445 ALA B CB    1 
ATOM   8413 N N     . PRO D 4 446 ? -18.372 17.895  46.988  1.00 22.78  ? 446 PRO B N     1 
ATOM   8414 C CA    . PRO D 4 446 ? -19.610 17.946  46.197  1.00 23.45  ? 446 PRO B CA    1 
ATOM   8415 C C     . PRO D 4 446 ? -20.821 17.328  46.904  1.00 25.12  ? 446 PRO B C     1 
ATOM   8416 O O     . PRO D 4 446 ? -20.683 16.419  47.716  1.00 26.01  ? 446 PRO B O     1 
ATOM   8417 C CB    . PRO D 4 446 ? -19.235 17.179  44.930  1.00 20.70  ? 446 PRO B CB    1 
ATOM   8418 C CG    . PRO D 4 446 ? -18.314 16.122  45.466  1.00 22.24  ? 446 PRO B CG    1 
ATOM   8419 C CD    . PRO D 4 446 ? -17.428 16.915  46.418  1.00 21.53  ? 446 PRO B CD    1 
ATOM   8420 N N     . THR D 4 447 ? -22.008 17.828  46.589  1.00 26.29  ? 447 THR B N     1 
ATOM   8421 C CA    . THR D 4 447 ? -23.221 17.305  47.188  1.00 26.57  ? 447 THR B CA    1 
ATOM   8422 C C     . THR D 4 447 ? -23.519 15.992  46.498  1.00 28.79  ? 447 THR B C     1 
ATOM   8423 O O     . THR D 4 447 ? -22.848 15.624  45.532  1.00 28.67  ? 447 THR B O     1 
ATOM   8424 C CB    . THR D 4 447 ? -24.426 18.247  46.969  1.00 26.89  ? 447 THR B CB    1 
ATOM   8425 O OG1   . THR D 4 447 ? -24.614 18.464  45.564  1.00 28.33  ? 447 THR B OG1   1 
ATOM   8426 C CG2   . THR D 4 447 ? -24.199 19.585  47.657  1.00 25.81  ? 447 THR B CG2   1 
ATOM   8427 N N     . GLU D 4 448 ? -24.537 15.299  46.992  1.00 29.99  ? 448 GLU B N     1 
ATOM   8428 C CA    . GLU D 4 448 ? -24.944 14.024  46.428  1.00 31.53  ? 448 GLU B CA    1 
ATOM   8429 C C     . GLU D 4 448 ? -25.441 14.172  44.994  1.00 30.88  ? 448 GLU B C     1 
ATOM   8430 O O     . GLU D 4 448 ? -25.165 13.321  44.147  1.00 30.85  ? 448 GLU B O     1 
ATOM   8431 C CB    . GLU D 4 448 ? -26.051 13.407  47.288  1.00 33.91  ? 448 GLU B CB    1 
ATOM   8432 C CG    . GLU D 4 448 ? -26.583 12.083  46.769  1.00 35.56  ? 448 GLU B CG    1 
ATOM   8433 C CD    . GLU D 4 448 ? -25.475 11.096  46.473  1.00 37.35  ? 448 GLU B CD    1 
ATOM   8434 O OE1   . GLU D 4 448 ? -24.478 11.080  47.222  1.00 37.47  ? 448 GLU B OE1   1 
ATOM   8435 O OE2   . GLU D 4 448 ? -25.605 10.328  45.497  1.00 40.59  ? 448 GLU B OE2   1 
ATOM   8436 N N     . ALA D 4 449 ? -26.173 15.251  44.729  1.00 29.82  ? 449 ALA B N     1 
ATOM   8437 C CA    . ALA D 4 449 ? -26.719 15.491  43.395  1.00 28.79  ? 449 ALA B CA    1 
ATOM   8438 C C     . ALA D 4 449 ? -25.609 15.782  42.391  1.00 29.53  ? 449 ALA B C     1 
ATOM   8439 O O     . ALA D 4 449 ? -25.657 15.336  41.240  1.00 30.35  ? 449 ALA B O     1 
ATOM   8440 C CB    . ALA D 4 449 ? -27.713 16.651  43.431  1.00 25.89  ? 449 ALA B CB    1 
ATOM   8441 N N     . GLN D 4 450 ? -24.610 16.537  42.827  1.00 28.66  ? 450 GLN B N     1 
ATOM   8442 C CA    . GLN D 4 450 ? -23.500 16.865  41.954  1.00 27.89  ? 450 GLN B CA    1 
ATOM   8443 C C     . GLN D 4 450 ? -22.731 15.593  41.600  1.00 27.02  ? 450 GLN B C     1 
ATOM   8444 O O     . GLN D 4 450 ? -22.358 15.389  40.444  1.00 28.52  ? 450 GLN B O     1 
ATOM   8445 C CB    . GLN D 4 450 ? -22.602 17.899  42.631  1.00 27.76  ? 450 GLN B CB    1 
ATOM   8446 C CG    . GLN D 4 450 ? -23.245 19.272  42.675  1.00 26.83  ? 450 GLN B CG    1 
ATOM   8447 C CD    . GLN D 4 450 ? -22.380 20.306  43.348  1.00 27.51  ? 450 GLN B CD    1 
ATOM   8448 O OE1   . GLN D 4 450 ? -21.794 20.052  44.406  1.00 30.59  ? 450 GLN B OE1   1 
ATOM   8449 N NE2   . GLN D 4 450 ? -22.305 21.486  42.754  1.00 22.66  ? 450 GLN B NE2   1 
ATOM   8450 N N     . LEU D 4 451 ? -22.515 14.726  42.586  1.00 24.63  ? 451 LEU B N     1 
ATOM   8451 C CA    . LEU D 4 451 ? -21.820 13.472  42.340  1.00 23.53  ? 451 LEU B CA    1 
ATOM   8452 C C     . LEU D 4 451 ? -22.585 12.588  41.358  1.00 24.61  ? 451 LEU B C     1 
ATOM   8453 O O     . LEU D 4 451 ? -21.980 11.945  40.502  1.00 24.28  ? 451 LEU B O     1 
ATOM   8454 C CB    . LEU D 4 451 ? -21.602 12.717  43.646  1.00 20.06  ? 451 LEU B CB    1 
ATOM   8455 C CG    . LEU D 4 451 ? -20.424 13.258  44.448  1.00 22.97  ? 451 LEU B CG    1 
ATOM   8456 C CD1   . LEU D 4 451 ? -20.357 12.594  45.828  1.00 20.81  ? 451 LEU B CD1   1 
ATOM   8457 C CD2   . LEU D 4 451 ? -19.138 13.026  43.641  1.00 18.43  ? 451 LEU B CD2   1 
ATOM   8458 N N     . ASN D 4 452 ? -23.909 12.547  41.482  1.00 25.41  ? 452 ASN B N     1 
ATOM   8459 C CA    . ASN D 4 452 ? -24.715 11.732  40.574  1.00 26.46  ? 452 ASN B CA    1 
ATOM   8460 C C     . ASN D 4 452 ? -24.722 12.291  39.155  1.00 25.65  ? 452 ASN B C     1 
ATOM   8461 O O     . ASN D 4 452 ? -24.799 11.530  38.185  1.00 24.78  ? 452 ASN B O     1 
ATOM   8462 C CB    . ASN D 4 452 ? -26.152 11.607  41.085  1.00 28.36  ? 452 ASN B CB    1 
ATOM   8463 C CG    . ASN D 4 452 ? -26.238 10.789  42.361  1.00 31.35  ? 452 ASN B CG    1 
ATOM   8464 O OD1   . ASN D 4 452 ? -25.521 9.799   42.523  1.00 33.63  ? 452 ASN B OD1   1 
ATOM   8465 N ND2   . ASN D 4 452 ? -27.115 11.192  43.267  1.00 28.03  ? 452 ASN B ND2   1 
ATOM   8466 N N     . ALA D 4 453 ? -24.636 13.615  39.032  1.00 22.69  ? 453 ALA B N     1 
ATOM   8467 C CA    . ALA D 4 453 ? -24.619 14.240  37.717  1.00 22.10  ? 453 ALA B CA    1 
ATOM   8468 C C     . ALA D 4 453 ? -23.291 13.919  37.020  1.00 22.06  ? 453 ALA B C     1 
ATOM   8469 O O     . ALA D 4 453 ? -23.255 13.688  35.810  1.00 21.13  ? 453 ALA B O     1 
ATOM   8470 C CB    . ALA D 4 453 ? -24.803 15.745  37.841  1.00 20.99  ? 453 ALA B CB    1 
ATOM   8471 N N     . VAL D 4 454 ? -22.206 13.896  37.790  1.00 20.35  ? 454 VAL B N     1 
ATOM   8472 C CA    . VAL D 4 454 ? -20.896 13.583  37.233  1.00 20.64  ? 454 VAL B CA    1 
ATOM   8473 C C     . VAL D 4 454 ? -20.852 12.099  36.916  1.00 21.32  ? 454 VAL B C     1 
ATOM   8474 O O     . VAL D 4 454 ? -20.265 11.688  35.909  1.00 23.15  ? 454 VAL B O     1 
ATOM   8475 C CB    . VAL D 4 454 ? -19.760 13.933  38.224  1.00 19.50  ? 454 VAL B CB    1 
ATOM   8476 C CG1   . VAL D 4 454 ? -18.432 13.375  37.732  1.00 17.54  ? 454 VAL B CG1   1 
ATOM   8477 C CG2   . VAL D 4 454 ? -19.670 15.438  38.378  1.00 17.53  ? 454 VAL B CG2   1 
ATOM   8478 N N     . ASP D 4 455 ? -21.484 11.302  37.771  1.00 20.25  ? 455 ASP B N     1 
ATOM   8479 C CA    . ASP D 4 455 ? -21.535 9.859   37.573  1.00 23.62  ? 455 ASP B CA    1 
ATOM   8480 C C     . ASP D 4 455 ? -22.276 9.554   36.281  1.00 23.76  ? 455 ASP B C     1 
ATOM   8481 O O     . ASP D 4 455 ? -21.882 8.663   35.530  1.00 28.51  ? 455 ASP B O     1 
ATOM   8482 C CB    . ASP D 4 455 ? -22.252 9.170   38.741  1.00 25.21  ? 455 ASP B CB    1 
ATOM   8483 C CG    . ASP D 4 455 ? -22.151 7.654   38.676  1.00 27.43  ? 455 ASP B CG    1 
ATOM   8484 O OD1   . ASP D 4 455 ? -22.622 7.072   37.677  1.00 27.04  ? 455 ASP B OD1   1 
ATOM   8485 O OD2   . ASP D 4 455 ? -21.597 7.040   39.620  1.00 29.64  ? 455 ASP B OD2   1 
ATOM   8486 N N     . ALA D 4 456 ? -23.350 10.294  36.020  1.00 21.91  ? 456 ALA B N     1 
ATOM   8487 C CA    . ALA D 4 456 ? -24.128 10.095  34.804  1.00 20.68  ? 456 ALA B CA    1 
ATOM   8488 C C     . ALA D 4 456 ? -23.352 10.620  33.588  1.00 21.45  ? 456 ALA B C     1 
ATOM   8489 O O     . ALA D 4 456 ? -23.429 10.045  32.499  1.00 21.03  ? 456 ALA B O     1 
ATOM   8490 C CB    . ALA D 4 456 ? -25.475 10.794  34.923  1.00 19.52  ? 456 ALA B CB    1 
ATOM   8491 N N     . LEU D 4 457 ? -22.608 11.708  33.776  1.00 18.74  ? 457 LEU B N     1 
ATOM   8492 C CA    . LEU D 4 457 ? -21.806 12.264  32.690  1.00 19.24  ? 457 LEU B CA    1 
ATOM   8493 C C     . LEU D 4 457 ? -20.737 11.270  32.254  1.00 18.96  ? 457 LEU B C     1 
ATOM   8494 O O     . LEU D 4 457 ? -20.546 11.041  31.066  1.00 18.96  ? 457 LEU B O     1 
ATOM   8495 C CB    . LEU D 4 457 ? -21.110 13.557  33.117  1.00 17.97  ? 457 LEU B CB    1 
ATOM   8496 C CG    . LEU D 4 457 ? -20.182 14.172  32.065  1.00 17.90  ? 457 LEU B CG    1 
ATOM   8497 C CD1   . LEU D 4 457 ? -21.000 14.808  30.950  1.00 18.02  ? 457 LEU B CD1   1 
ATOM   8498 C CD2   . LEU D 4 457 ? -19.311 15.227  32.712  1.00 16.91  ? 457 LEU B CD2   1 
ATOM   8499 N N     . ILE D 4 458 ? -20.057 10.661  33.223  1.00 21.41  ? 458 ILE B N     1 
ATOM   8500 C CA    . ILE D 4 458 ? -18.991 9.714   32.913  1.00 20.80  ? 458 ILE B CA    1 
ATOM   8501 C C     . ILE D 4 458 ? -19.511 8.485   32.180  1.00 22.13  ? 458 ILE B C     1 
ATOM   8502 O O     . ILE D 4 458 ? -18.836 7.964   31.297  1.00 21.96  ? 458 ILE B O     1 
ATOM   8503 C CB    . ILE D 4 458 ? -18.201 9.314   34.198  1.00 19.53  ? 458 ILE B CB    1 
ATOM   8504 C CG1   . ILE D 4 458 ? -17.419 10.526  34.720  1.00 21.06  ? 458 ILE B CG1   1 
ATOM   8505 C CG2   . ILE D 4 458 ? -17.219 8.204   33.903  1.00 16.62  ? 458 ILE B CG2   1 
ATOM   8506 C CD1   . ILE D 4 458 ? -16.703 10.284  36.040  1.00 20.15  ? 458 ILE B CD1   1 
ATOM   8507 N N     . ASP D 4 459 ? -20.710 8.028   32.527  1.00 23.77  ? 459 ASP B N     1 
ATOM   8508 C CA    . ASP D 4 459 ? -21.278 6.868   31.844  1.00 25.17  ? 459 ASP B CA    1 
ATOM   8509 C C     . ASP D 4 459 ? -21.710 7.211   30.423  1.00 25.03  ? 459 ASP B C     1 
ATOM   8510 O O     . ASP D 4 459 ? -21.507 6.430   29.501  1.00 27.64  ? 459 ASP B O     1 
ATOM   8511 C CB    . ASP D 4 459 ? -22.486 6.311   32.605  1.00 27.07  ? 459 ASP B CB    1 
ATOM   8512 C CG    . ASP D 4 459 ? -22.085 5.448   33.781  1.00 31.31  ? 459 ASP B CG    1 
ATOM   8513 O OD1   . ASP D 4 459 ? -20.923 4.981   33.790  1.00 32.55  ? 459 ASP B OD1   1 
ATOM   8514 O OD2   . ASP D 4 459 ? -22.926 5.221   34.683  1.00 31.08  ? 459 ASP B OD2   1 
ATOM   8515 N N     . SER D 4 460 ? -22.306 8.380   30.237  1.00 24.51  ? 460 SER B N     1 
ATOM   8516 C CA    . SER D 4 460 ? -22.755 8.744   28.912  1.00 23.48  ? 460 SER B CA    1 
ATOM   8517 C C     . SER D 4 460 ? -21.567 8.918   27.970  1.00 23.14  ? 460 SER B C     1 
ATOM   8518 O O     . SER D 4 460 ? -21.621 8.494   26.817  1.00 20.58  ? 460 SER B O     1 
ATOM   8519 C CB    . SER D 4 460 ? -23.602 10.028  28.959  1.00 23.70  ? 460 SER B CB    1 
ATOM   8520 O OG    . SER D 4 460 ? -22.834 11.184  29.241  1.00 24.50  ? 460 SER B OG    1 
ATOM   8521 N N     . MET D 4 461 ? -20.491 9.520   28.479  1.00 22.27  ? 461 MET B N     1 
ATOM   8522 C CA    . MET D 4 461 ? -19.297 9.770   27.679  1.00 21.68  ? 461 MET B CA    1 
ATOM   8523 C C     . MET D 4 461 ? -18.276 8.647   27.670  1.00 20.32  ? 461 MET B C     1 
ATOM   8524 O O     . MET D 4 461 ? -17.098 8.894   27.465  1.00 19.02  ? 461 MET B O     1 
ATOM   8525 C CB    . MET D 4 461 ? -18.594 11.042  28.140  1.00 22.68  ? 461 MET B CB    1 
ATOM   8526 C CG    . MET D 4 461 ? -19.348 12.317  27.884  1.00 27.99  ? 461 MET B CG    1 
ATOM   8527 S SD    . MET D 4 461 ? -18.214 13.698  27.942  1.00 34.21  ? 461 MET B SD    1 
ATOM   8528 C CE    . MET D 4 461 ? -19.293 15.033  28.279  1.00 31.43  ? 461 MET B CE    1 
ATOM   8529 N N     . SER D 4 462 ? -18.709 7.415   27.895  1.00 22.27  ? 462 SER B N     1 
ATOM   8530 C CA    . SER D 4 462 ? -17.771 6.296   27.877  1.00 22.38  ? 462 SER B CA    1 
ATOM   8531 C C     . SER D 4 462 ? -17.180 6.108   26.484  1.00 21.90  ? 462 SER B C     1 
ATOM   8532 O O     . SER D 4 462 ? -17.891 6.143   25.487  1.00 21.83  ? 462 SER B O     1 
ATOM   8533 C CB    . SER D 4 462 ? -18.453 5.008   28.308  1.00 20.16  ? 462 SER B CB    1 
ATOM   8534 O OG    . SER D 4 462 ? -17.495 3.965   28.357  1.00 24.95  ? 462 SER B OG    1 
ATOM   8535 N N     . LEU D 4 463 ? -15.867 5.914   26.428  1.00 24.82  ? 463 LEU B N     1 
ATOM   8536 C CA    . LEU D 4 463 ? -15.160 5.733   25.166  1.00 26.53  ? 463 LEU B CA    1 
ATOM   8537 C C     . LEU D 4 463 ? -14.823 4.269   24.929  1.00 28.91  ? 463 LEU B C     1 
ATOM   8538 O O     . LEU D 4 463 ? -13.987 3.943   24.085  1.00 29.70  ? 463 LEU B O     1 
ATOM   8539 C CB    . LEU D 4 463 ? -13.871 6.560   25.165  1.00 23.79  ? 463 LEU B CB    1 
ATOM   8540 C CG    . LEU D 4 463 ? -14.043 8.073   25.116  1.00 22.06  ? 463 LEU B CG    1 
ATOM   8541 C CD1   . LEU D 4 463 ? -12.691 8.778   25.255  1.00 19.54  ? 463 LEU B CD1   1 
ATOM   8542 C CD2   . LEU D 4 463 ? -14.716 8.428   23.798  1.00 21.71  ? 463 LEU B CD2   1 
ATOM   8543 N N     . ALA D 4 464 ? -15.470 3.392   25.686  1.00 31.28  ? 464 ALA B N     1 
ATOM   8544 C CA    . ALA D 4 464 ? -15.241 1.963   25.556  1.00 36.40  ? 464 ALA B CA    1 
ATOM   8545 C C     . ALA D 4 464 ? -16.577 1.239   25.592  1.00 39.81  ? 464 ALA B C     1 
ATOM   8546 O O     . ALA D 4 464 ? -17.600 1.818   25.956  1.00 39.55  ? 464 ALA B O     1 
ATOM   8547 C CB    . ALA D 4 464 ? -14.333 1.465   26.676  1.00 34.93  ? 464 ALA B CB    1 
ATOM   8548 N N     . LYS D 4 465 ? -16.557 -0.033  25.220  1.00 45.42  ? 465 LYS B N     1 
ATOM   8549 C CA    . LYS D 4 465 ? -17.768 -0.833  25.174  1.00 51.31  ? 465 LYS B CA    1 
ATOM   8550 C C     . LYS D 4 465 ? -17.412 -2.314  25.131  1.00 55.14  ? 465 LYS B C     1 
ATOM   8551 O O     . LYS D 4 465 ? -16.532 -2.718  24.371  1.00 55.31  ? 465 LYS B O     1 
ATOM   8552 C CB    . LYS D 4 465 ? -18.554 -0.429  23.926  1.00 52.68  ? 465 LYS B CB    1 
ATOM   8553 C CG    . LYS D 4 465 ? -19.622 -1.390  23.458  1.00 55.61  ? 465 LYS B CG    1 
ATOM   8554 C CD    . LYS D 4 465 ? -20.166 -0.912  22.113  1.00 59.43  ? 465 LYS B CD    1 
ATOM   8555 C CE    . LYS D 4 465 ? -21.194 -1.866  21.528  1.00 60.70  ? 465 LYS B CE    1 
ATOM   8556 N NZ    . LYS D 4 465 ? -21.668 -1.385  20.198  1.00 61.13  ? 465 LYS B NZ    1 
ATOM   8557 N N     . LYS D 4 466 ? -18.078 -3.119  25.957  1.00 60.11  ? 466 LYS B N     1 
ATOM   8558 C CA    . LYS D 4 466 ? -17.835 -4.562  25.971  1.00 65.68  ? 466 LYS B CA    1 
ATOM   8559 C C     . LYS D 4 466 ? -18.662 -5.169  24.840  1.00 69.59  ? 466 LYS B C     1 
ATOM   8560 O O     . LYS D 4 466 ? -19.708 -5.773  25.085  1.00 70.44  ? 466 LYS B O     1 
ATOM   8561 C CB    . LYS D 4 466 ? -18.273 -5.174  27.303  1.00 65.56  ? 466 LYS B CB    1 
ATOM   8562 C CG    . LYS D 4 466 ? -17.559 -4.620  28.517  1.00 66.74  ? 466 LYS B CG    1 
ATOM   8563 C CD    . LYS D 4 466 ? -18.010 -5.330  29.783  1.00 67.91  ? 466 LYS B CD    1 
ATOM   8564 C CE    . LYS D 4 466 ? -17.342 -4.743  31.018  1.00 69.34  ? 466 LYS B CE    1 
ATOM   8565 N NZ    . LYS D 4 466 ? -17.761 -5.447  32.264  1.00 70.29  ? 466 LYS B NZ    1 
ATOM   8566 N N     . ASP D 4 467 ? -18.184 -5.008  23.606  1.00 74.13  ? 467 ASP B N     1 
ATOM   8567 C CA    . ASP D 4 467 ? -18.888 -5.499  22.420  1.00 78.30  ? 467 ASP B CA    1 
ATOM   8568 C C     . ASP D 4 467 ? -18.496 -6.913  21.980  1.00 80.14  ? 467 ASP B C     1 
ATOM   8569 O O     . ASP D 4 467 ? -17.631 -7.551  22.587  1.00 80.31  ? 467 ASP B O     1 
ATOM   8570 C CB    . ASP D 4 467 ? -18.678 -4.519  21.255  1.00 79.94  ? 467 ASP B CB    1 
ATOM   8571 C CG    . ASP D 4 467 ? -19.597 -4.801  20.074  1.00 80.98  ? 467 ASP B CG    1 
ATOM   8572 O OD1   . ASP D 4 467 ? -20.833 -4.728  20.248  1.00 81.79  ? 467 ASP B OD1   1 
ATOM   8573 O OD2   . ASP D 4 467 ? -19.081 -5.094  18.972  1.00 80.69  ? 467 ASP B OD2   1 
ATOM   8574 N N     . GLU D 4 468 ? -19.146 -7.383  20.914  1.00 82.14  ? 468 GLU B N     1 
ATOM   8575 C CA    . GLU D 4 468 ? -18.917 -8.715  20.353  1.00 83.35  ? 468 GLU B CA    1 
ATOM   8576 C C     . GLU D 4 468 ? -18.909 -9.763  21.458  1.00 83.90  ? 468 GLU B C     1 
ATOM   8577 O O     . GLU D 4 468 ? -18.291 -10.823 21.333  1.00 83.66  ? 468 GLU B O     1 
ATOM   8578 C CB    . GLU D 4 468 ? -17.605 -8.738  19.563  1.00 84.34  ? 468 GLU B CB    1 
ATOM   8579 C CG    . GLU D 4 468 ? -17.666 -7.881  18.303  1.00 85.49  ? 468 GLU B CG    1 
ATOM   8580 C CD    . GLU D 4 468 ? -16.351 -7.819  17.550  1.00 86.28  ? 468 GLU B CD    1 
ATOM   8581 O OE1   . GLU D 4 468 ? -15.876 -8.874  17.078  1.00 86.21  ? 468 GLU B OE1   1 
ATOM   8582 O OE2   . GLU D 4 468 ? -15.793 -6.707  17.429  1.00 86.68  ? 468 GLU B OE2   1 
ATOM   8583 N N     . LYS D 4 469 ? -19.628 -9.435  22.531  1.00 83.73  ? 469 LYS B N     1 
ATOM   8584 C CA    . LYS D 4 469 ? -19.769 -10.272 23.715  1.00 82.95  ? 469 LYS B CA    1 
ATOM   8585 C C     . LYS D 4 469 ? -18.720 -11.356 23.866  1.00 82.16  ? 469 LYS B C     1 
ATOM   8586 O O     . LYS D 4 469 ? -18.924 -12.505 23.476  1.00 82.18  ? 469 LYS B O     1 
ATOM   8587 C CB    . LYS D 4 469 ? -21.172 -10.878 23.761  1.00 83.15  ? 469 LYS B CB    1 
ATOM   8588 C CG    . LYS D 4 469 ? -22.244 -9.841  24.051  1.00 82.83  ? 469 LYS B CG    1 
ATOM   8589 C CD    . LYS D 4 469 ? -21.881 -9.051  25.303  1.00 82.36  ? 469 LYS B CD    1 
ATOM   8590 C CE    . LYS D 4 469 ? -22.868 -7.938  25.581  1.00 81.53  ? 469 LYS B CE    1 
ATOM   8591 N NZ    . LYS D 4 469 ? -22.456 -7.160  26.776  1.00 81.31  ? 469 LYS B NZ    1 
ATOM   8592 N N     . THR D 4 470 ? -17.590 -10.959 24.439  1.00 80.77  ? 470 THR B N     1 
ATOM   8593 C CA    . THR D 4 470 ? -16.465 -11.844 24.684  1.00 79.58  ? 470 THR B CA    1 
ATOM   8594 C C     . THR D 4 470 ? -15.762 -11.317 25.928  1.00 78.73  ? 470 THR B C     1 
ATOM   8595 O O     . THR D 4 470 ? -14.592 -11.617 26.172  1.00 78.62  ? 470 THR B O     1 
ATOM   8596 C CB    . THR D 4 470 ? -15.475 -11.839 23.493  1.00 79.65  ? 470 THR B CB    1 
ATOM   8597 O OG1   . THR D 4 470 ? -15.174 -10.487 23.121  1.00 80.26  ? 470 THR B OG1   1 
ATOM   8598 C CG2   . THR D 4 470 ? -16.068 -12.570 22.298  1.00 79.19  ? 470 THR B CG2   1 
ATOM   8599 N N     . ASP D 4 471 ? -16.497 -10.529 26.710  1.00 77.22  ? 471 ASP B N     1 
ATOM   8600 C CA    . ASP D 4 471 ? -15.977 -9.922  27.935  1.00 75.45  ? 471 ASP B CA    1 
ATOM   8601 C C     . ASP D 4 471 ? -14.842 -8.963  27.594  1.00 73.03  ? 471 ASP B C     1 
ATOM   8602 O O     . ASP D 4 471 ? -14.137 -8.474  28.480  1.00 72.69  ? 471 ASP B O     1 
ATOM   8603 C CB    . ASP D 4 471 ? -15.464 -10.996 28.897  1.00 76.99  ? 471 ASP B CB    1 
ATOM   8604 C CG    . ASP D 4 471 ? -16.514 -12.034 29.221  1.00 79.09  ? 471 ASP B CG    1 
ATOM   8605 O OD1   . ASP D 4 471 ? -17.621 -11.644 29.651  1.00 79.95  ? 471 ASP B OD1   1 
ATOM   8606 O OD2   . ASP D 4 471 ? -16.230 -13.239 29.046  1.00 80.27  ? 471 ASP B OD2   1 
ATOM   8607 N N     . THR D 4 472 ? -14.681 -8.698  26.302  1.00 68.90  ? 472 THR B N     1 
ATOM   8608 C CA    . THR D 4 472 ? -13.631 -7.815  25.815  1.00 64.93  ? 472 THR B CA    1 
ATOM   8609 C C     . THR D 4 472 ? -14.065 -6.359  25.765  1.00 60.98  ? 472 THR B C     1 
ATOM   8610 O O     . THR D 4 472 ? -15.219 -6.051  25.460  1.00 61.27  ? 472 THR B O     1 
ATOM   8611 C CB    . THR D 4 472 ? -13.189 -8.217  24.397  1.00 65.51  ? 472 THR B CB    1 
ATOM   8612 O OG1   . THR D 4 472 ? -12.764 -9.583  24.397  1.00 66.39  ? 472 THR B OG1   1 
ATOM   8613 C CG2   . THR D 4 472 ? -12.045 -7.332  23.925  1.00 66.17  ? 472 THR B CG2   1 
ATOM   8614 N N     . LEU D 4 473 ? -13.130 -5.465  26.071  1.00 56.20  ? 473 LEU B N     1 
ATOM   8615 C CA    . LEU D 4 473 ? -13.398 -4.037  26.018  1.00 50.83  ? 473 LEU B CA    1 
ATOM   8616 C C     . LEU D 4 473 ? -12.984 -3.536  24.646  1.00 47.03  ? 473 LEU B C     1 
ATOM   8617 O O     . LEU D 4 473 ? -11.833 -3.681  24.247  1.00 46.27  ? 473 LEU B O     1 
ATOM   8618 C CB    . LEU D 4 473 ? -12.607 -3.281  27.093  1.00 49.52  ? 473 LEU B CB    1 
ATOM   8619 C CG    . LEU D 4 473 ? -13.245 -3.171  28.479  1.00 49.72  ? 473 LEU B CG    1 
ATOM   8620 C CD1   . LEU D 4 473 ? -12.339 -2.365  29.394  1.00 48.86  ? 473 LEU B CD1   1 
ATOM   8621 C CD2   . LEU D 4 473 ? -14.609 -2.507  28.368  1.00 48.54  ? 473 LEU B CD2   1 
ATOM   8622 N N     . GLU D 4 474 ? -13.930 -2.965  23.915  1.00 43.94  ? 474 GLU B N     1 
ATOM   8623 C CA    . GLU D 4 474 ? -13.632 -2.430  22.602  1.00 41.70  ? 474 GLU B CA    1 
ATOM   8624 C C     . GLU D 4 474 ? -13.416 -0.929  22.789  1.00 38.85  ? 474 GLU B C     1 
ATOM   8625 O O     . GLU D 4 474 ? -14.306 -0.229  23.272  1.00 38.51  ? 474 GLU B O     1 
ATOM   8626 C CB    . GLU D 4 474 ? -14.806 -2.665  21.643  1.00 45.75  ? 474 GLU B CB    1 
ATOM   8627 C CG    . GLU D 4 474 ? -15.226 -4.127  21.446  1.00 51.69  ? 474 GLU B CG    1 
ATOM   8628 C CD    . GLU D 4 474 ? -14.232 -4.938  20.615  1.00 56.03  ? 474 GLU B CD    1 
ATOM   8629 O OE1   . GLU D 4 474 ? -13.102 -5.186  21.098  1.00 57.43  ? 474 GLU B OE1   1 
ATOM   8630 O OE2   . GLU D 4 474 ? -14.584 -5.326  19.475  1.00 55.88  ? 474 GLU B OE2   1 
ATOM   8631 N N     . ASP D 4 475 ? -12.229 -0.440  22.438  1.00 34.44  ? 475 ASP B N     1 
ATOM   8632 C CA    . ASP D 4 475 ? -11.941 0.986   22.553  1.00 30.60  ? 475 ASP B CA    1 
ATOM   8633 C C     . ASP D 4 475 ? -12.605 1.693   21.368  1.00 28.29  ? 475 ASP B C     1 
ATOM   8634 O O     . ASP D 4 475 ? -12.289 1.415   20.214  1.00 29.98  ? 475 ASP B O     1 
ATOM   8635 C CB    . ASP D 4 475 ? -10.430 1.242   22.524  1.00 27.59  ? 475 ASP B CB    1 
ATOM   8636 C CG    . ASP D 4 475 ? -10.076 2.684   22.873  1.00 28.78  ? 475 ASP B CG    1 
ATOM   8637 O OD1   . ASP D 4 475 ? -10.878 3.586   22.555  1.00 28.43  ? 475 ASP B OD1   1 
ATOM   8638 O OD2   . ASP D 4 475 ? -8.996  2.924   23.454  1.00 28.60  ? 475 ASP B OD2   1 
ATOM   8639 N N     . LEU D 4 476 ? -13.522 2.608   21.657  1.00 24.96  ? 476 LEU B N     1 
ATOM   8640 C CA    . LEU D 4 476 ? -14.227 3.341   20.618  1.00 22.84  ? 476 LEU B CA    1 
ATOM   8641 C C     . LEU D 4 476 ? -13.473 4.558   20.096  1.00 23.06  ? 476 LEU B C     1 
ATOM   8642 O O     . LEU D 4 476 ? -13.883 5.163   19.102  1.00 20.80  ? 476 LEU B O     1 
ATOM   8643 C CB    . LEU D 4 476 ? -15.588 3.807   21.138  1.00 22.64  ? 476 LEU B CB    1 
ATOM   8644 C CG    . LEU D 4 476 ? -16.578 2.736   21.608  1.00 23.55  ? 476 LEU B CG    1 
ATOM   8645 C CD1   . LEU D 4 476 ? -17.860 3.424   22.056  1.00 22.17  ? 476 LEU B CD1   1 
ATOM   8646 C CD2   . LEU D 4 476 ? -16.854 1.730   20.485  1.00 19.56  ? 476 LEU B CD2   1 
ATOM   8647 N N     . PHE D 4 477 ? -12.383 4.927   20.764  1.00 21.14  ? 477 PHE B N     1 
ATOM   8648 C CA    . PHE D 4 477 ? -11.608 6.093   20.349  1.00 21.50  ? 477 PHE B CA    1 
ATOM   8649 C C     . PHE D 4 477 ? -10.126 5.846   20.647  1.00 21.60  ? 477 PHE B C     1 
ATOM   8650 O O     . PHE D 4 477 ? -9.542  6.501   21.507  1.00 22.61  ? 477 PHE B O     1 
ATOM   8651 C CB    . PHE D 4 477 ? -12.123 7.321   21.110  1.00 19.06  ? 477 PHE B CB    1 
ATOM   8652 C CG    . PHE D 4 477 ? -11.646 8.643   20.559  1.00 18.32  ? 477 PHE B CG    1 
ATOM   8653 C CD1   . PHE D 4 477 ? -11.534 8.848   19.190  1.00 15.42  ? 477 PHE B CD1   1 
ATOM   8654 C CD2   . PHE D 4 477 ? -11.361 9.701   21.416  1.00 20.21  ? 477 PHE B CD2   1 
ATOM   8655 C CE1   . PHE D 4 477 ? -11.147 10.082  18.678  1.00 16.56  ? 477 PHE B CE1   1 
ATOM   8656 C CE2   . PHE D 4 477 ? -10.972 10.954  20.916  1.00 19.70  ? 477 PHE B CE2   1 
ATOM   8657 C CZ    . PHE D 4 477 ? -10.864 11.143  19.542  1.00 18.65  ? 477 PHE B CZ    1 
ATOM   8658 N N     . PRO D 4 478 ? -9.497  4.900   19.926  1.00 22.58  ? 478 PRO B N     1 
ATOM   8659 C CA    . PRO D 4 478 ? -8.076  4.551   20.115  1.00 21.94  ? 478 PRO B CA    1 
ATOM   8660 C C     . PRO D 4 478 ? -7.167  5.597   19.486  1.00 21.19  ? 478 PRO B C     1 
ATOM   8661 O O     . PRO D 4 478 ? -6.773  5.468   18.327  1.00 21.79  ? 478 PRO B O     1 
ATOM   8662 C CB    . PRO D 4 478 ? -7.942  3.186   19.421  1.00 21.72  ? 478 PRO B CB    1 
ATOM   8663 C CG    . PRO D 4 478 ? -9.336  2.910   18.783  1.00 22.23  ? 478 PRO B CG    1 
ATOM   8664 C CD    . PRO D 4 478 ? -10.029 4.241   18.724  1.00 22.08  ? 478 PRO B CD    1 
ATOM   8665 N N     . THR D 4 479 ? -6.826  6.620   20.262  1.00 19.78  ? 479 THR B N     1 
ATOM   8666 C CA    . THR D 4 479 ? -6.007  7.718   19.779  1.00 18.18  ? 479 THR B CA    1 
ATOM   8667 C C     . THR D 4 479 ? -4.578  7.382   19.316  1.00 18.76  ? 479 THR B C     1 
ATOM   8668 O O     . THR D 4 479 ? -4.032  8.086   18.465  1.00 19.07  ? 479 THR B O     1 
ATOM   8669 C CB    . THR D 4 479 ? -5.980  8.861   20.828  1.00 18.81  ? 479 THR B CB    1 
ATOM   8670 O OG1   . THR D 4 479 ? -5.185  8.483   21.961  1.00 18.32  ? 479 THR B OG1   1 
ATOM   8671 C CG2   . THR D 4 479 ? -7.398  9.149   21.303  1.00 15.49  ? 479 THR B CG2   1 
ATOM   8672 N N     . THR D 4 480 ? -3.970  6.320   19.838  1.00 16.60  ? 480 THR B N     1 
ATOM   8673 C CA    . THR D 4 480 ? -2.617  5.992   19.390  1.00 18.46  ? 480 THR B CA    1 
ATOM   8674 C C     . THR D 4 480 ? -2.550  5.442   17.961  1.00 18.80  ? 480 THR B C     1 
ATOM   8675 O O     . THR D 4 480 ? -1.465  5.194   17.450  1.00 19.71  ? 480 THR B O     1 
ATOM   8676 C CB    . THR D 4 480 ? -1.919  4.982   20.316  1.00 19.54  ? 480 THR B CB    1 
ATOM   8677 O OG1   . THR D 4 480 ? -2.604  3.724   20.260  1.00 21.41  ? 480 THR B OG1   1 
ATOM   8678 C CG2   . THR D 4 480 ? -1.901  5.509   21.764  1.00 21.84  ? 480 THR B CG2   1 
ATOM   8679 N N     . LYS D 4 481 ? -3.695  5.237   17.315  1.00 19.43  ? 481 LYS B N     1 
ATOM   8680 C CA    . LYS D 4 481 ? -3.693  4.749   15.932  1.00 19.54  ? 481 LYS B CA    1 
ATOM   8681 C C     . LYS D 4 481 ? -3.816  5.940   14.997  1.00 19.08  ? 481 LYS B C     1 
ATOM   8682 O O     . LYS D 4 481 ? -3.501  5.851   13.819  1.00 20.69  ? 481 LYS B O     1 
ATOM   8683 C CB    . LYS D 4 481 ? -4.856  3.799   15.671  1.00 20.15  ? 481 LYS B CB    1 
ATOM   8684 C CG    . LYS D 4 481 ? -4.844  2.551   16.515  1.00 21.22  ? 481 LYS B CG    1 
ATOM   8685 C CD    . LYS D 4 481 ? -6.060  1.696   16.212  1.00 23.10  ? 481 LYS B CD    1 
ATOM   8686 C CE    . LYS D 4 481 ? -6.018  0.379   16.982  1.00 25.18  ? 481 LYS B CE    1 
ATOM   8687 N NZ    . LYS D 4 481 ? -7.115  -0.543  16.552  1.00 27.87  ? 481 LYS B NZ    1 
ATOM   8688 N N     . ILE D 4 482 ? -4.269  7.063   15.532  1.00 18.23  ? 482 ILE B N     1 
ATOM   8689 C CA    . ILE D 4 482 ? -4.430  8.270   14.732  1.00 18.80  ? 482 ILE B CA    1 
ATOM   8690 C C     . ILE D 4 482 ? -3.105  8.997   14.496  1.00 19.95  ? 482 ILE B C     1 
ATOM   8691 O O     . ILE D 4 482 ? -2.307  9.165   15.416  1.00 19.65  ? 482 ILE B O     1 
ATOM   8692 C CB    . ILE D 4 482 ? -5.407  9.247   15.416  1.00 18.51  ? 482 ILE B CB    1 
ATOM   8693 C CG1   . ILE D 4 482 ? -6.766  8.571   15.607  1.00 19.02  ? 482 ILE B CG1   1 
ATOM   8694 C CG2   . ILE D 4 482 ? -5.535  10.505  14.600  1.00 16.89  ? 482 ILE B CG2   1 
ATOM   8695 C CD1   . ILE D 4 482 ? -7.699  9.332   16.520  1.00 20.28  ? 482 ILE B CD1   1 
ATOM   8696 N N     . PRO D 4 483 ? -2.841  9.406   13.247  1.00 21.61  ? 483 PRO B N     1 
ATOM   8697 C CA    . PRO D 4 483 ? -1.589  10.121  12.959  1.00 23.20  ? 483 PRO B CA    1 
ATOM   8698 C C     . PRO D 4 483 ? -1.584  11.568  13.477  1.00 24.12  ? 483 PRO B C     1 
ATOM   8699 O O     . PRO D 4 483 ? -2.627  12.223  13.536  1.00 25.58  ? 483 PRO B O     1 
ATOM   8700 C CB    . PRO D 4 483 ? -1.471  10.028  11.426  1.00 23.56  ? 483 PRO B CB    1 
ATOM   8701 C CG    . PRO D 4 483 ? -2.877  9.820   10.956  1.00 22.93  ? 483 PRO B CG    1 
ATOM   8702 C CD    . PRO D 4 483 ? -3.469  8.914   12.004  1.00 23.23  ? 483 PRO B CD    1 
ATOM   8703 N N     . ASN D 4 484 ? -0.410  12.054  13.875  1.00 24.00  ? 484 ASN B N     1 
ATOM   8704 C CA    . ASN D 4 484 ? -0.272  13.418  14.384  1.00 21.52  ? 484 ASN B CA    1 
ATOM   8705 C C     . ASN D 4 484 ? -0.769  14.360  13.285  1.00 20.79  ? 484 ASN B C     1 
ATOM   8706 O O     . ASN D 4 484 ? -0.153  14.478  12.231  1.00 23.08  ? 484 ASN B O     1 
ATOM   8707 C CB    . ASN D 4 484 ? 1.196   13.704  14.701  1.00 20.46  ? 484 ASN B CB    1 
ATOM   8708 C CG    . ASN D 4 484 ? 1.411   15.074  15.324  1.00 22.34  ? 484 ASN B CG    1 
ATOM   8709 O OD1   . ASN D 4 484 ? 0.620   15.995  15.127  1.00 20.70  ? 484 ASN B OD1   1 
ATOM   8710 N ND2   . ASN D 4 484 ? 2.502   15.216  16.064  1.00 21.04  ? 484 ASN B ND2   1 
ATOM   8711 N N     . PRO D 4 485 ? -1.882  15.057  13.528  1.00 20.12  ? 485 PRO B N     1 
ATOM   8712 C CA    . PRO D 4 485 ? -2.470  15.983  12.553  1.00 19.47  ? 485 PRO B CA    1 
ATOM   8713 C C     . PRO D 4 485 ? -1.580  17.069  11.936  1.00 21.54  ? 485 PRO B C     1 
ATOM   8714 O O     . PRO D 4 485 ? -1.837  17.515  10.809  1.00 23.05  ? 485 PRO B O     1 
ATOM   8715 C CB    . PRO D 4 485 ? -3.657  16.568  13.313  1.00 19.74  ? 485 PRO B CB    1 
ATOM   8716 C CG    . PRO D 4 485 ? -3.205  16.534  14.728  1.00 19.25  ? 485 PRO B CG    1 
ATOM   8717 C CD    . PRO D 4 485 ? -2.542  15.188  14.838  1.00 18.35  ? 485 PRO B CD    1 
ATOM   8718 N N     . ARG D 4 486 ? -0.532  17.483  12.644  1.00 21.77  ? 486 ARG B N     1 
ATOM   8719 C CA    . ARG D 4 486 ? 0.341   18.545  12.137  1.00 21.92  ? 486 ARG B CA    1 
ATOM   8720 C C     . ARG D 4 486 ? 1.033   18.203  10.822  1.00 21.79  ? 486 ARG B C     1 
ATOM   8721 O O     . ARG D 4 486 ? 1.294   19.087  10.007  1.00 21.73  ? 486 ARG B O     1 
ATOM   8722 C CB    . ARG D 4 486 ? 1.400   18.924  13.189  1.00 20.13  ? 486 ARG B CB    1 
ATOM   8723 C CG    . ARG D 4 486 ? 2.585   17.975  13.289  1.00 20.83  ? 486 ARG B CG    1 
ATOM   8724 C CD    . ARG D 4 486 ? 3.558   18.416  14.364  1.00 21.57  ? 486 ARG B CD    1 
ATOM   8725 N NE    . ARG D 4 486 ? 3.969   19.806  14.189  1.00 24.39  ? 486 ARG B NE    1 
ATOM   8726 C CZ    . ARG D 4 486 ? 4.572   20.541  15.120  1.00 22.42  ? 486 ARG B CZ    1 
ATOM   8727 N NH1   . ARG D 4 486 ? 4.842   20.033  16.308  1.00 22.28  ? 486 ARG B NH1   1 
ATOM   8728 N NH2   . ARG D 4 486 ? 4.908   21.793  14.855  1.00 24.62  ? 486 ARG B NH2   1 
ATOM   8729 N N     . PHE D 4 487 ? 1.327   16.921  10.620  1.00 21.00  ? 487 PHE B N     1 
ATOM   8730 C CA    . PHE D 4 487 ? 2.004   16.482  9.413   1.00 20.23  ? 487 PHE B CA    1 
ATOM   8731 C C     . PHE D 4 487 ? 1.177   16.589  8.148   1.00 22.00  ? 487 PHE B C     1 
ATOM   8732 O O     . PHE D 4 487 ? 1.581   17.274  7.201   1.00 22.81  ? 487 PHE B O     1 
ATOM   8733 C CB    . PHE D 4 487 ? 2.522   15.058  9.599   1.00 18.74  ? 487 PHE B CB    1 
ATOM   8734 C CG    . PHE D 4 487 ? 3.570   14.951  10.662  1.00 21.39  ? 487 PHE B CG    1 
ATOM   8735 C CD1   . PHE D 4 487 ? 3.440   14.036  11.701  1.00 19.96  ? 487 PHE B CD1   1 
ATOM   8736 C CD2   . PHE D 4 487 ? 4.666   15.825  10.662  1.00 21.90  ? 487 PHE B CD2   1 
ATOM   8737 C CE1   . PHE D 4 487 ? 4.374   13.991  12.726  1.00 18.06  ? 487 PHE B CE1   1 
ATOM   8738 C CE2   . PHE D 4 487 ? 5.606   15.792  11.682  1.00 20.00  ? 487 PHE B CE2   1 
ATOM   8739 C CZ    . PHE D 4 487 ? 5.461   14.875  12.719  1.00 21.41  ? 487 PHE B CZ    1 
ATOM   8740 N N     . GLN D 4 488 ? 0.023   15.934  8.107   1.00 22.66  ? 488 GLN B N     1 
ATOM   8741 C CA    . GLN D 4 488 ? -0.786  16.022  6.900   1.00 22.11  ? 488 GLN B CA    1 
ATOM   8742 C C     . GLN D 4 488 ? -1.339  17.417  6.699   1.00 21.92  ? 488 GLN B C     1 
ATOM   8743 O O     . GLN D 4 488 ? -1.675  17.792  5.575   1.00 23.10  ? 488 GLN B O     1 
ATOM   8744 C CB    . GLN D 4 488 ? -1.893  14.968  6.901   1.00 21.78  ? 488 GLN B CB    1 
ATOM   8745 C CG    . GLN D 4 488 ? -1.375  13.586  6.461   1.00 23.51  ? 488 GLN B CG    1 
ATOM   8746 C CD    . GLN D 4 488 ? -0.837  13.586  5.018   1.00 28.13  ? 488 GLN B CD    1 
ATOM   8747 O OE1   . GLN D 4 488 ? 0.124   12.873  4.691   1.00 28.20  ? 488 GLN B OE1   1 
ATOM   8748 N NE2   . GLN D 4 488 ? -1.465  14.382  4.151   1.00 27.54  ? 488 GLN B NE2   1 
ATOM   8749 N N     . ARG D 4 489 ? -1.416  18.190  7.781   1.00 21.36  ? 489 ARG B N     1 
ATOM   8750 C CA    . ARG D 4 489 ? -1.877  19.574  7.700   1.00 20.95  ? 489 ARG B CA    1 
ATOM   8751 C C     . ARG D 4 489 ? -0.779  20.373  7.004   1.00 21.46  ? 489 ARG B C     1 
ATOM   8752 O O     . ARG D 4 489 ? -1.050  21.156  6.093   1.00 22.47  ? 489 ARG B O     1 
ATOM   8753 C CB    . ARG D 4 489 ? -2.119  20.151  9.091   1.00 20.27  ? 489 ARG B CB    1 
ATOM   8754 C CG    . ARG D 4 489 ? -2.239  21.674  9.133   1.00 21.89  ? 489 ARG B CG    1 
ATOM   8755 C CD    . ARG D 4 489 ? -3.357  22.219  8.240   1.00 23.70  ? 489 ARG B CD    1 
ATOM   8756 N NE    . ARG D 4 489 ? -3.614  23.630  8.529   1.00 25.68  ? 489 ARG B NE    1 
ATOM   8757 C CZ    . ARG D 4 489 ? -4.373  24.438  7.788   1.00 27.95  ? 489 ARG B CZ    1 
ATOM   8758 N NH1   . ARG D 4 489 ? -4.969  23.997  6.684   1.00 27.53  ? 489 ARG B NH1   1 
ATOM   8759 N NH2   . ARG D 4 489 ? -4.546  25.693  8.160   1.00 25.77  ? 489 ARG B NH2   1 
ATOM   8760 N N     . LEU D 4 490 ? 0.461   20.161  7.442   1.00 21.14  ? 490 LEU B N     1 
ATOM   8761 C CA    . LEU D 4 490 ? 1.617   20.824  6.852   1.00 22.42  ? 490 LEU B CA    1 
ATOM   8762 C C     . LEU D 4 490 ? 1.729   20.478  5.364   1.00 23.38  ? 490 LEU B C     1 
ATOM   8763 O O     . LEU D 4 490 ? 1.959   21.354  4.528   1.00 25.07  ? 490 LEU B O     1 
ATOM   8764 C CB    . LEU D 4 490 ? 2.897   20.396  7.569   1.00 19.11  ? 490 LEU B CB    1 
ATOM   8765 C CG    . LEU D 4 490 ? 4.238   20.749  6.910   1.00 18.47  ? 490 LEU B CG    1 
ATOM   8766 C CD1   . LEU D 4 490 ? 4.405   22.267  6.769   1.00 18.18  ? 490 LEU B CD1   1 
ATOM   8767 C CD2   . LEU D 4 490 ? 5.361   20.172  7.754   1.00 16.74  ? 490 LEU B CD2   1 
ATOM   8768 N N     . PHE D 4 491 ? 1.559   19.198  5.045   1.00 24.03  ? 491 PHE B N     1 
ATOM   8769 C CA    . PHE D 4 491 ? 1.646   18.724  3.667   1.00 23.77  ? 491 PHE B CA    1 
ATOM   8770 C C     . PHE D 4 491 ? 0.581   19.369  2.778   1.00 25.59  ? 491 PHE B C     1 
ATOM   8771 O O     . PHE D 4 491 ? 0.873   19.784  1.656   1.00 26.95  ? 491 PHE B O     1 
ATOM   8772 C CB    . PHE D 4 491 ? 1.528   17.194  3.634   1.00 21.34  ? 491 PHE B CB    1 
ATOM   8773 C CG    . PHE D 4 491 ? 2.634   16.479  4.387   1.00 23.13  ? 491 PHE B CG    1 
ATOM   8774 C CD1   . PHE D 4 491 ? 2.474   15.150  4.790   1.00 20.41  ? 491 PHE B CD1   1 
ATOM   8775 C CD2   . PHE D 4 491 ? 3.829   17.138  4.703   1.00 21.33  ? 491 PHE B CD2   1 
ATOM   8776 C CE1   . PHE D 4 491 ? 3.478   14.490  5.495   1.00 20.80  ? 491 PHE B CE1   1 
ATOM   8777 C CE2   . PHE D 4 491 ? 4.845   16.484  5.408   1.00 22.43  ? 491 PHE B CE2   1 
ATOM   8778 C CZ    . PHE D 4 491 ? 4.668   15.152  5.807   1.00 21.91  ? 491 PHE B CZ    1 
ATOM   8779 N N     . GLN D 4 492 ? -0.652  19.448  3.268   1.00 25.38  ? 492 GLN B N     1 
ATOM   8780 C CA    . GLN D 4 492 ? -1.725  20.072  2.504   1.00 24.91  ? 492 GLN B CA    1 
ATOM   8781 C C     . GLN D 4 492 ? -1.314  21.504  2.145   1.00 25.69  ? 492 GLN B C     1 
ATOM   8782 O O     . GLN D 4 492 ? -1.524  21.966  1.022   1.00 27.32  ? 492 GLN B O     1 
ATOM   8783 C CB    . GLN D 4 492 ? -3.011  20.103  3.330   1.00 24.50  ? 492 GLN B CB    1 
ATOM   8784 C CG    . GLN D 4 492 ? -4.034  21.099  2.829   1.00 25.07  ? 492 GLN B CG    1 
ATOM   8785 C CD    . GLN D 4 492 ? -5.050  21.468  3.884   1.00 26.16  ? 492 GLN B CD    1 
ATOM   8786 O OE1   . GLN D 4 492 ? -4.740  21.509  5.077   1.00 27.48  ? 492 GLN B OE1   1 
ATOM   8787 N NE2   . GLN D 4 492 ? -6.266  21.758  3.453   1.00 24.84  ? 492 GLN B NE2   1 
ATOM   8788 N N     . CYS D 4 493 ? -0.727  22.200  3.110   1.00 26.49  ? 493 CYS B N     1 
ATOM   8789 C CA    . CYS D 4 493 ? -0.287  23.572  2.905   1.00 27.55  ? 493 CYS B CA    1 
ATOM   8790 C C     . CYS D 4 493 ? 0.896   23.655  1.934   1.00 29.09  ? 493 CYS B C     1 
ATOM   8791 O O     . CYS D 4 493 ? 0.840   24.390  0.940   1.00 29.69  ? 493 CYS B O     1 
ATOM   8792 C CB    . CYS D 4 493 ? 0.069   24.209  4.254   1.00 27.25  ? 493 CYS B CB    1 
ATOM   8793 S SG    . CYS D 4 493 ? -1.379  24.570  5.289   1.00 24.00  ? 493 CYS B SG    1 
ATOM   8794 N N     . LEU D 4 494 ? 1.963   22.909  2.216   1.00 27.26  ? 494 LEU B N     1 
ATOM   8795 C CA    . LEU D 4 494 ? 3.120   22.905  1.333   1.00 28.75  ? 494 LEU B CA    1 
ATOM   8796 C C     . LEU D 4 494 ? 2.703   22.679  -0.123  1.00 30.23  ? 494 LEU B C     1 
ATOM   8797 O O     . LEU D 4 494 ? 3.202   23.341  -1.043  1.00 28.80  ? 494 LEU B O     1 
ATOM   8798 C CB    . LEU D 4 494 ? 4.100   21.815  1.746   1.00 26.93  ? 494 LEU B CB    1 
ATOM   8799 C CG    . LEU D 4 494 ? 4.882   22.072  3.027   1.00 24.21  ? 494 LEU B CG    1 
ATOM   8800 C CD1   . LEU D 4 494 ? 5.830   20.913  3.265   1.00 23.12  ? 494 LEU B CD1   1 
ATOM   8801 C CD2   . LEU D 4 494 ? 5.644   23.378  2.901   1.00 21.50  ? 494 LEU B CD2   1 
ATOM   8802 N N     . LEU D 4 495 ? 1.787   21.736  -0.327  1.00 30.32  ? 495 LEU B N     1 
ATOM   8803 C CA    . LEU D 4 495 ? 1.307   21.433  -1.662  1.00 29.78  ? 495 LEU B CA    1 
ATOM   8804 C C     . LEU D 4 495 ? 0.471   22.586  -2.183  1.00 30.59  ? 495 LEU B C     1 
ATOM   8805 O O     . LEU D 4 495 ? 0.632   23.018  -3.325  1.00 31.12  ? 495 LEU B O     1 
ATOM   8806 C CB    . LEU D 4 495 ? 0.461   20.157  -1.662  1.00 29.23  ? 495 LEU B CB    1 
ATOM   8807 C CG    . LEU D 4 495 ? -0.093  19.749  -3.036  1.00 28.44  ? 495 LEU B CG    1 
ATOM   8808 C CD1   . LEU D 4 495 ? 1.072   19.533  -3.997  1.00 27.50  ? 495 LEU B CD1   1 
ATOM   8809 C CD2   . LEU D 4 495 ? -0.947  18.490  -2.911  1.00 24.66  ? 495 LEU B CD2   1 
ATOM   8810 N N     . HIS D 4 496 ? -0.428  23.090  -1.349  1.00 31.23  ? 496 HIS B N     1 
ATOM   8811 C CA    . HIS D 4 496 ? -1.273  24.185  -1.789  1.00 32.15  ? 496 HIS B CA    1 
ATOM   8812 C C     . HIS D 4 496 ? -0.438  25.373  -2.256  1.00 32.44  ? 496 HIS B C     1 
ATOM   8813 O O     . HIS D 4 496 ? -0.733  25.979  -3.282  1.00 33.08  ? 496 HIS B O     1 
ATOM   8814 C CB    . HIS D 4 496 ? -2.219  24.612  -0.679  1.00 31.48  ? 496 HIS B CB    1 
ATOM   8815 C CG    . HIS D 4 496 ? -3.413  25.361  -1.173  1.00 34.04  ? 496 HIS B CG    1 
ATOM   8816 N ND1   . HIS D 4 496 ? -3.428  26.731  -1.310  1.00 35.53  ? 496 HIS B ND1   1 
ATOM   8817 C CD2   . HIS D 4 496 ? -4.628  24.927  -1.585  1.00 33.78  ? 496 HIS B CD2   1 
ATOM   8818 C CE1   . HIS D 4 496 ? -4.602  27.111  -1.783  1.00 35.19  ? 496 HIS B CE1   1 
ATOM   8819 N NE2   . HIS D 4 496 ? -5.349  26.035  -1.958  1.00 34.47  ? 496 HIS B NE2   1 
ATOM   8820 N N     . ARG D 4 497 ? 0.614   25.702  -1.519  1.00 32.43  ? 497 ARG B N     1 
ATOM   8821 C CA    . ARG D 4 497 ? 1.441   26.820  -1.923  1.00 33.72  ? 497 ARG B CA    1 
ATOM   8822 C C     . ARG D 4 497 ? 2.160   26.526  -3.246  1.00 34.05  ? 497 ARG B C     1 
ATOM   8823 O O     . ARG D 4 497 ? 2.413   27.437  -4.033  1.00 35.79  ? 497 ARG B O     1 
ATOM   8824 C CB    . ARG D 4 497 ? 2.457   27.171  -0.829  1.00 33.82  ? 497 ARG B CB    1 
ATOM   8825 C CG    . ARG D 4 497 ? 3.301   28.411  -1.153  1.00 34.00  ? 497 ARG B CG    1 
ATOM   8826 C CD    . ARG D 4 497 ? 2.439   29.669  -1.266  1.00 33.43  ? 497 ARG B CD    1 
ATOM   8827 N NE    . ARG D 4 497 ? 2.146   30.254  0.042   1.00 34.75  ? 497 ARG B NE    1 
ATOM   8828 C CZ    . ARG D 4 497 ? 0.980   30.803  0.359   1.00 36.13  ? 497 ARG B CZ    1 
ATOM   8829 N NH1   . ARG D 4 497 ? 0.004   30.842  -0.532  1.00 39.31  ? 497 ARG B NH1   1 
ATOM   8830 N NH2   . ARG D 4 497 ? 0.775   31.295  1.568   1.00 38.64  ? 497 ARG B NH2   1 
ATOM   8831 N N     . ALA D 4 498 ? 2.481   25.260  -3.495  1.00 33.64  ? 498 ALA B N     1 
ATOM   8832 C CA    . ALA D 4 498 ? 3.166   24.880  -4.725  1.00 34.47  ? 498 ALA B CA    1 
ATOM   8833 C C     . ALA D 4 498 ? 2.275   24.991  -5.968  1.00 36.45  ? 498 ALA B C     1 
ATOM   8834 O O     . ALA D 4 498 ? 2.656   25.594  -6.961  1.00 36.55  ? 498 ALA B O     1 
ATOM   8835 C CB    . ALA D 4 498 ? 3.700   23.467  -4.602  1.00 33.93  ? 498 ALA B CB    1 
ATOM   8836 N N     . LEU D 4 499 ? 1.082   24.415  -5.904  1.00 39.78  ? 499 LEU B N     1 
ATOM   8837 C CA    . LEU D 4 499 ? 0.164   24.437  -7.035  1.00 41.31  ? 499 LEU B CA    1 
ATOM   8838 C C     . LEU D 4 499 ? -0.659  25.725  -7.182  1.00 43.78  ? 499 LEU B C     1 
ATOM   8839 O O     . LEU D 4 499 ? -1.303  25.933  -8.209  1.00 44.17  ? 499 LEU B O     1 
ATOM   8840 C CB    . LEU D 4 499 ? -0.770  23.222  -6.957  1.00 39.87  ? 499 LEU B CB    1 
ATOM   8841 C CG    . LEU D 4 499 ? -0.074  21.874  -6.727  1.00 40.13  ? 499 LEU B CG    1 
ATOM   8842 C CD1   . LEU D 4 499 ? -1.079  20.726  -6.883  1.00 39.39  ? 499 LEU B CD1   1 
ATOM   8843 C CD2   . LEU D 4 499 ? 1.069   21.712  -7.714  1.00 38.90  ? 499 LEU B CD2   1 
ATOM   8844 N N     . HIS D 4 500 ? -0.652  26.581  -6.163  1.00 46.01  ? 500 HIS B N     1 
ATOM   8845 C CA    . HIS D 4 500 ? -1.389  27.847  -6.217  1.00 48.15  ? 500 HIS B CA    1 
ATOM   8846 C C     . HIS D 4 500 ? -0.637  28.903  -5.409  1.00 49.11  ? 500 HIS B C     1 
ATOM   8847 O O     . HIS D 4 500 ? -1.015  29.212  -4.284  1.00 50.03  ? 500 HIS B O     1 
ATOM   8848 C CB    . HIS D 4 500 ? -2.793  27.686  -5.633  1.00 49.70  ? 500 HIS B CB    1 
ATOM   8849 C CG    . HIS D 4 500 ? -3.532  26.491  -6.146  1.00 52.74  ? 500 HIS B CG    1 
ATOM   8850 N ND1   . HIS D 4 500 ? -3.215  25.203  -5.771  1.00 54.72  ? 500 HIS B ND1   1 
ATOM   8851 C CD2   . HIS D 4 500 ? -4.573  26.387  -7.006  1.00 54.20  ? 500 HIS B CD2   1 
ATOM   8852 C CE1   . HIS D 4 500 ? -4.029  24.357  -6.377  1.00 54.45  ? 500 HIS B CE1   1 
ATOM   8853 N NE2   . HIS D 4 500 ? -4.862  25.050  -7.132  1.00 54.13  ? 500 HIS B NE2   1 
ATOM   8854 N N     . PRO D 4 501 ? 0.433   29.478  -5.980  1.00 50.21  ? 501 PRO B N     1 
ATOM   8855 C CA    . PRO D 4 501 ? 1.254   30.502  -5.313  1.00 50.43  ? 501 PRO B CA    1 
ATOM   8856 C C     . PRO D 4 501 ? 0.582   31.802  -4.869  1.00 49.86  ? 501 PRO B C     1 
ATOM   8857 O O     . PRO D 4 501 ? 0.973   32.392  -3.863  1.00 49.32  ? 501 PRO B O     1 
ATOM   8858 C CB    . PRO D 4 501 ? 2.383   30.744  -6.317  1.00 50.20  ? 501 PRO B CB    1 
ATOM   8859 C CG    . PRO D 4 501 ? 1.737   30.441  -7.633  1.00 50.52  ? 501 PRO B CG    1 
ATOM   8860 C CD    . PRO D 4 501 ? 0.952   29.191  -7.328  1.00 49.95  ? 501 PRO B CD    1 
ATOM   8861 N N     . ARG D 4 502 ? -0.429  32.246  -5.603  1.00 50.96  ? 502 ARG B N     1 
ATOM   8862 C CA    . ARG D 4 502 ? -1.111  33.487  -5.261  1.00 51.23  ? 502 ARG B CA    1 
ATOM   8863 C C     . ARG D 4 502 ? -2.193  33.329  -4.193  1.00 50.05  ? 502 ARG B C     1 
ATOM   8864 O O     . ARG D 4 502 ? -2.567  34.299  -3.535  1.00 49.89  ? 502 ARG B O     1 
ATOM   8865 C CB    . ARG D 4 502 ? -1.721  34.107  -6.523  1.00 54.53  ? 502 ARG B CB    1 
ATOM   8866 C CG    . ARG D 4 502 ? -0.699  34.554  -7.571  1.00 58.71  ? 502 ARG B CG    1 
ATOM   8867 C CD    . ARG D 4 502 ? -1.398  35.265  -8.728  1.00 62.43  ? 502 ARG B CD    1 
ATOM   8868 N NE    . ARG D 4 502 ? -0.472  35.761  -9.746  1.00 65.77  ? 502 ARG B NE    1 
ATOM   8869 C CZ    . ARG D 4 502 ? -0.839  36.475  -10.811 1.00 66.16  ? 502 ARG B CZ    1 
ATOM   8870 N NH1   . ARG D 4 502 ? -2.119  36.781  -11.001 1.00 66.19  ? 502 ARG B NH1   1 
ATOM   8871 N NH2   . ARG D 4 502 ? 0.073   36.881  -11.687 1.00 64.88  ? 502 ARG B NH2   1 
ATOM   8872 N N     . GLU D 4 503 ? -2.690  32.109  -4.020  1.00 48.13  ? 503 GLU B N     1 
ATOM   8873 C CA    . GLU D 4 503 ? -3.741  31.833  -3.040  1.00 45.84  ? 503 GLU B CA    1 
ATOM   8874 C C     . GLU D 4 503 ? -3.251  31.742  -1.597  1.00 43.28  ? 503 GLU B C     1 
ATOM   8875 O O     . GLU D 4 503 ? -2.159  31.247  -1.333  1.00 41.69  ? 503 GLU B O     1 
ATOM   8876 C CB    . GLU D 4 503 ? -4.444  30.519  -3.387  1.00 47.86  ? 503 GLU B CB    1 
ATOM   8877 C CG    . GLU D 4 503 ? -5.359  30.581  -4.593  1.00 51.56  ? 503 GLU B CG    1 
ATOM   8878 C CD    . GLU D 4 503 ? -6.600  31.414  -4.332  1.00 53.59  ? 503 GLU B CD    1 
ATOM   8879 O OE1   . GLU D 4 503 ? -7.342  31.094  -3.377  1.00 55.10  ? 503 GLU B OE1   1 
ATOM   8880 O OE2   . GLU D 4 503 ? -6.834  32.386  -5.082  1.00 53.86  ? 503 GLU B OE2   1 
ATOM   8881 N N     . PRO D 4 504 ? -4.056  32.233  -0.640  1.00 40.89  ? 504 PRO B N     1 
ATOM   8882 C CA    . PRO D 4 504 ? -3.640  32.154  0.762   1.00 39.30  ? 504 PRO B CA    1 
ATOM   8883 C C     . PRO D 4 504 ? -3.740  30.680  1.181   1.00 37.58  ? 504 PRO B C     1 
ATOM   8884 O O     . PRO D 4 504 ? -4.219  29.859  0.403   1.00 38.02  ? 504 PRO B O     1 
ATOM   8885 C CB    . PRO D 4 504 ? -4.651  33.057  1.467   1.00 37.77  ? 504 PRO B CB    1 
ATOM   8886 C CG    . PRO D 4 504 ? -5.863  32.938  0.624   1.00 38.67  ? 504 PRO B CG    1 
ATOM   8887 C CD    . PRO D 4 504 ? -5.310  32.993  -0.773  1.00 40.06  ? 504 PRO B CD    1 
ATOM   8888 N N     . LEU D 4 505 ? -3.288  30.331  2.383   1.00 36.01  ? 505 LEU B N     1 
ATOM   8889 C CA    . LEU D 4 505 ? -3.353  28.935  2.810   1.00 33.94  ? 505 LEU B CA    1 
ATOM   8890 C C     . LEU D 4 505 ? -4.789  28.462  3.018   1.00 33.26  ? 505 LEU B C     1 
ATOM   8891 O O     . LEU D 4 505 ? -5.648  29.207  3.481   1.00 32.87  ? 505 LEU B O     1 
ATOM   8892 C CB    . LEU D 4 505 ? -2.527  28.716  4.082   1.00 33.08  ? 505 LEU B CB    1 
ATOM   8893 C CG    . LEU D 4 505 ? -1.033  29.024  3.920   1.00 33.32  ? 505 LEU B CG    1 
ATOM   8894 C CD1   . LEU D 4 505 ? -0.287  28.550  5.152   1.00 33.25  ? 505 LEU B CD1   1 
ATOM   8895 C CD2   . LEU D 4 505 ? -0.484  28.345  2.678   1.00 34.08  ? 505 LEU B CD2   1 
ATOM   8896 N N     . PRO D 4 506 ? -5.069  27.204  2.663   1.00 32.32  ? 506 PRO B N     1 
ATOM   8897 C CA    . PRO D 4 506 ? -6.412  26.641  2.808   1.00 32.81  ? 506 PRO B CA    1 
ATOM   8898 C C     . PRO D 4 506 ? -6.701  26.284  4.257   1.00 31.73  ? 506 PRO B C     1 
ATOM   8899 O O     . PRO D 4 506 ? -5.776  26.075  5.040   1.00 35.25  ? 506 PRO B O     1 
ATOM   8900 C CB    . PRO D 4 506 ? -6.344  25.405  1.925   1.00 29.54  ? 506 PRO B CB    1 
ATOM   8901 C CG    . PRO D 4 506 ? -4.962  24.911  2.234   1.00 30.08  ? 506 PRO B CG    1 
ATOM   8902 C CD    . PRO D 4 506 ? -4.129  26.182  2.169   1.00 31.64  ? 506 PRO B CD    1 
ATOM   8903 N N     . PRO D 4 507 ? -7.985  26.216  4.634   1.00 29.80  ? 507 PRO B N     1 
ATOM   8904 C CA    . PRO D 4 507 ? -8.345  25.865  6.012   1.00 29.10  ? 507 PRO B CA    1 
ATOM   8905 C C     . PRO D 4 507 ? -8.189  24.354  6.237   1.00 30.29  ? 507 PRO B C     1 
ATOM   8906 O O     . PRO D 4 507 ? -8.092  23.567  5.278   1.00 30.26  ? 507 PRO B O     1 
ATOM   8907 C CB    . PRO D 4 507 ? -9.796  26.317  6.112   1.00 28.94  ? 507 PRO B CB    1 
ATOM   8908 C CG    . PRO D 4 507 ? -10.314 26.064  4.712   1.00 28.43  ? 507 PRO B CG    1 
ATOM   8909 C CD    . PRO D 4 507 ? -9.179  26.535  3.828   1.00 27.99  ? 507 PRO B CD    1 
ATOM   8910 N N     . ILE D 4 508 ? -8.163  23.953  7.501   1.00 29.35  ? 508 ILE B N     1 
ATOM   8911 C CA    . ILE D 4 508 ? -8.013  22.550  7.859   1.00 26.90  ? 508 ILE B CA    1 
ATOM   8912 C C     . ILE D 4 508 ? -9.100  21.684  7.232   1.00 29.10  ? 508 ILE B C     1 
ATOM   8913 O O     . ILE D 4 508 ? -10.270 22.052  7.223   1.00 31.78  ? 508 ILE B O     1 
ATOM   8914 C CB    . ILE D 4 508 ? -8.044  22.378  9.387   1.00 23.99  ? 508 ILE B CB    1 
ATOM   8915 C CG1   . ILE D 4 508 ? -6.817  23.063  10.007  1.00 22.81  ? 508 ILE B CG1   1 
ATOM   8916 C CG2   . ILE D 4 508 ? -8.073  20.901  9.748   1.00 23.52  ? 508 ILE B CG2   1 
ATOM   8917 C CD1   . ILE D 4 508 ? -6.894  23.234  11.527  1.00 19.89  ? 508 ILE B CD1   1 
ATOM   8918 N N     . GLN D 4 509 ? -8.706  20.533  6.703   1.00 29.03  ? 509 GLN B N     1 
ATOM   8919 C CA    . GLN D 4 509 ? -9.649  19.613  6.084   1.00 29.28  ? 509 GLN B CA    1 
ATOM   8920 C C     . GLN D 4 509 ? -10.559 19.000  7.150   1.00 30.73  ? 509 GLN B C     1 
ATOM   8921 O O     . GLN D 4 509 ? -10.105 18.663  8.250   1.00 31.75  ? 509 GLN B O     1 
ATOM   8922 C CB    . GLN D 4 509 ? -8.871  18.528  5.331   1.00 28.98  ? 509 GLN B CB    1 
ATOM   8923 C CG    . GLN D 4 509 ? -8.069  19.091  4.154   1.00 29.47  ? 509 GLN B CG    1 
ATOM   8924 C CD    . GLN D 4 509 ? -6.979  18.162  3.653   1.00 30.64  ? 509 GLN B CD    1 
ATOM   8925 O OE1   . GLN D 4 509 ? -5.971  17.942  4.326   1.00 32.46  ? 509 GLN B OE1   1 
ATOM   8926 N NE2   . GLN D 4 509 ? -7.176  17.612  2.458   1.00 33.98  ? 509 GLN B NE2   1 
ATOM   8927 N N     . GLN D 4 510 ? -11.843 18.865  6.829   1.00 29.98  ? 510 GLN B N     1 
ATOM   8928 C CA    . GLN D 4 510 ? -12.806 18.312  7.771   1.00 29.18  ? 510 GLN B CA    1 
ATOM   8929 C C     . GLN D 4 510 ? -12.493 16.916  8.266   1.00 28.02  ? 510 GLN B C     1 
ATOM   8930 O O     . GLN D 4 510 ? -12.714 16.627  9.443   1.00 28.61  ? 510 GLN B O     1 
ATOM   8931 C CB    . GLN D 4 510 ? -14.218 18.314  7.181   1.00 32.18  ? 510 GLN B CB    1 
ATOM   8932 C CG    . GLN D 4 510 ? -14.944 19.635  7.328   1.00 39.13  ? 510 GLN B CG    1 
ATOM   8933 C CD    . GLN D 4 510 ? -15.234 20.001  8.783   1.00 42.57  ? 510 GLN B CD    1 
ATOM   8934 O OE1   . GLN D 4 510 ? -15.573 21.148  9.081   1.00 44.89  ? 510 GLN B OE1   1 
ATOM   8935 N NE2   . GLN D 4 510 ? -15.112 19.028  9.689   1.00 42.10  ? 510 GLN B NE2   1 
ATOM   8936 N N     . HIS D 4 511 ? -11.997 16.037  7.399   1.00 26.20  ? 511 HIS B N     1 
ATOM   8937 C CA    . HIS D 4 511 ? -11.714 14.693  7.880   1.00 25.42  ? 511 HIS B CA    1 
ATOM   8938 C C     . HIS D 4 511 ? -10.715 14.719  9.037   1.00 24.45  ? 511 HIS B C     1 
ATOM   8939 O O     . HIS D 4 511 ? -10.830 13.924  9.974   1.00 24.98  ? 511 HIS B O     1 
ATOM   8940 C CB    . HIS D 4 511 ? -11.275 13.733  6.746   1.00 24.53  ? 511 HIS B CB    1 
ATOM   8941 C CG    . HIS D 4 511 ? -9.918  13.993  6.168   1.00 21.61  ? 511 HIS B CG    1 
ATOM   8942 N ND1   . HIS D 4 511 ? -9.717  14.826  5.089   1.00 22.47  ? 511 HIS B ND1   1 
ATOM   8943 C CD2   . HIS D 4 511 ? -8.715  13.430  6.435   1.00 21.88  ? 511 HIS B CD2   1 
ATOM   8944 C CE1   . HIS D 4 511 ? -8.451  14.758  4.710   1.00 21.66  ? 511 HIS B CE1   1 
ATOM   8945 N NE2   . HIS D 4 511 ? -7.822  13.916  5.510   1.00 20.20  ? 511 HIS B NE2   1 
ATOM   8946 N N     . ILE D 4 512 ? -9.765  15.653  8.996   1.00 24.11  ? 512 ILE B N     1 
ATOM   8947 C CA    . ILE D 4 512 ? -8.794  15.792  10.082  1.00 22.75  ? 512 ILE B CA    1 
ATOM   8948 C C     . ILE D 4 512 ? -9.578  16.103  11.364  1.00 23.09  ? 512 ILE B C     1 
ATOM   8949 O O     . ILE D 4 512 ? -9.424  15.416  12.373  1.00 24.99  ? 512 ILE B O     1 
ATOM   8950 C CB    . ILE D 4 512 ? -7.769  16.933  9.797   1.00 21.17  ? 512 ILE B CB    1 
ATOM   8951 C CG1   . ILE D 4 512 ? -6.888  16.548  8.612   1.00 20.41  ? 512 ILE B CG1   1 
ATOM   8952 C CG2   . ILE D 4 512 ? -6.891  17.189  11.018  1.00 21.06  ? 512 ILE B CG2   1 
ATOM   8953 C CD1   . ILE D 4 512 ? -6.083  15.278  8.821   1.00 20.23  ? 512 ILE B CD1   1 
ATOM   8954 N N     . TRP D 4 513 ? -10.431 17.124  11.324  1.00 22.45  ? 513 TRP B N     1 
ATOM   8955 C CA    . TRP D 4 513 ? -11.233 17.458  12.500  1.00 23.08  ? 513 TRP B CA    1 
ATOM   8956 C C     . TRP D 4 513 ? -12.079 16.262  12.906  1.00 21.79  ? 513 TRP B C     1 
ATOM   8957 O O     . TRP D 4 513 ? -12.236 15.996  14.092  1.00 21.45  ? 513 TRP B O     1 
ATOM   8958 C CB    . TRP D 4 513 ? -12.144 18.669  12.242  1.00 21.28  ? 513 TRP B CB    1 
ATOM   8959 C CG    . TRP D 4 513 ? -11.431 19.986  12.357  1.00 23.22  ? 513 TRP B CG    1 
ATOM   8960 C CD1   . TRP D 4 513 ? -11.258 20.920  11.371  1.00 20.83  ? 513 TRP B CD1   1 
ATOM   8961 C CD2   . TRP D 4 513 ? -10.774 20.508  13.524  1.00 22.75  ? 513 TRP B CD2   1 
ATOM   8962 N NE1   . TRP D 4 513 ? -10.532 21.990  11.854  1.00 22.76  ? 513 TRP B NE1   1 
ATOM   8963 C CE2   . TRP D 4 513 ? -10.224 21.762  13.169  1.00 23.12  ? 513 TRP B CE2   1 
ATOM   8964 C CE3   . TRP D 4 513 ? -10.601 20.037  14.832  1.00 23.86  ? 513 TRP B CE3   1 
ATOM   8965 C CZ2   . TRP D 4 513 ? -9.509  22.554  14.080  1.00 23.82  ? 513 TRP B CZ2   1 
ATOM   8966 C CZ3   . TRP D 4 513 ? -9.891  20.825  15.741  1.00 25.73  ? 513 TRP B CZ3   1 
ATOM   8967 C CH2   . TRP D 4 513 ? -9.352  22.073  15.355  1.00 24.61  ? 513 TRP B CH2   1 
ATOM   8968 N N     . ASN D 4 514 ? -12.607 15.535  11.919  1.00 22.04  ? 514 ASN B N     1 
ATOM   8969 C CA    . ASN D 4 514 ? -13.431 14.362  12.203  1.00 21.30  ? 514 ASN B CA    1 
ATOM   8970 C C     . ASN D 4 514 ? -12.661 13.253  12.928  1.00 20.67  ? 514 ASN B C     1 
ATOM   8971 O O     . ASN D 4 514 ? -13.256 12.489  13.686  1.00 21.36  ? 514 ASN B O     1 
ATOM   8972 C CB    . ASN D 4 514 ? -14.043 13.779  10.922  1.00 21.32  ? 514 ASN B CB    1 
ATOM   8973 C CG    . ASN D 4 514 ? -15.108 14.675  10.305  1.00 22.84  ? 514 ASN B CG    1 
ATOM   8974 O OD1   . ASN D 4 514 ? -15.692 15.528  10.974  1.00 21.93  ? 514 ASN B OD1   1 
ATOM   8975 N ND2   . ASN D 4 514 ? -15.376 14.467  9.020   1.00 20.85  ? 514 ASN B ND2   1 
ATOM   8976 N N     . MET D 4 515 ? -11.353 13.147  12.707  1.00 18.11  ? 515 MET B N     1 
ATOM   8977 C CA    . MET D 4 515 ? -10.598 12.098  13.389  1.00 18.16  ? 515 MET B CA    1 
ATOM   8978 C C     . MET D 4 515 ? -10.124 12.519  14.773  1.00 16.12  ? 515 MET B C     1 
ATOM   8979 O O     . MET D 4 515 ? -9.788  11.676  15.600  1.00 16.25  ? 515 MET B O     1 
ATOM   8980 C CB    . MET D 4 515 ? -9.387  11.639  12.557  1.00 16.22  ? 515 MET B CB    1 
ATOM   8981 C CG    . MET D 4 515 ? -8.298  12.681  12.380  1.00 16.24  ? 515 MET B CG    1 
ATOM   8982 S SD    . MET D 4 515 ? -6.985  12.040  11.350  1.00 16.45  ? 515 MET B SD    1 
ATOM   8983 C CE    . MET D 4 515 ? -5.481  12.955  11.970  1.00 15.02  ? 515 MET B CE    1 
ATOM   8984 N N     . LEU D 4 516 ? -10.100 13.819  15.026  1.00 17.19  ? 516 LEU B N     1 
ATOM   8985 C CA    . LEU D 4 516 ? -9.643  14.313  16.316  1.00 19.18  ? 516 LEU B CA    1 
ATOM   8986 C C     . LEU D 4 516 ? -10.770 14.426  17.320  1.00 21.18  ? 516 LEU B C     1 
ATOM   8987 O O     . LEU D 4 516 ? -10.544 14.793  18.469  1.00 20.49  ? 516 LEU B O     1 
ATOM   8988 C CB    . LEU D 4 516 ? -8.979  15.672  16.155  1.00 17.93  ? 516 LEU B CB    1 
ATOM   8989 C CG    . LEU D 4 516 ? -7.796  15.714  15.200  1.00 17.37  ? 516 LEU B CG    1 
ATOM   8990 C CD1   . LEU D 4 516 ? -7.249  17.139  15.142  1.00 18.88  ? 516 LEU B CD1   1 
ATOM   8991 C CD2   . LEU D 4 516 ? -6.735  14.754  15.661  1.00 15.49  ? 516 LEU B CD2   1 
ATOM   8992 N N     . ASN D 4 517 ? -11.984 14.122  16.877  1.00 22.33  ? 517 ASN B N     1 
ATOM   8993 C CA    . ASN D 4 517 ? -13.144 14.186  17.749  1.00 25.10  ? 517 ASN B CA    1 
ATOM   8994 C C     . ASN D 4 517 ? -13.639 12.774  18.053  1.00 25.57  ? 517 ASN B C     1 
ATOM   8995 O O     . ASN D 4 517 ? -13.402 11.834  17.284  1.00 26.63  ? 517 ASN B O     1 
ATOM   8996 C CB    . ASN D 4 517 ? -14.249 15.031  17.100  1.00 25.21  ? 517 ASN B CB    1 
ATOM   8997 C CG    . ASN D 4 517 ? -13.854 16.497  16.953  1.00 27.86  ? 517 ASN B CG    1 
ATOM   8998 O OD1   . ASN D 4 517 ? -13.457 17.149  17.920  1.00 32.15  ? 517 ASN B OD1   1 
ATOM   8999 N ND2   . ASN D 4 517 ? -13.973 17.020  15.747  1.00 29.28  ? 517 ASN B ND2   1 
ATOM   9000 N N     . PRO D 4 518 ? -14.332 12.601  19.187  1.00 27.08  ? 518 PRO B N     1 
ATOM   9001 C CA    . PRO D 4 518 ? -14.836 11.274  19.558  1.00 26.97  ? 518 PRO B CA    1 
ATOM   9002 C C     . PRO D 4 518 ? -16.014 10.848  18.705  1.00 27.21  ? 518 PRO B C     1 
ATOM   9003 O O     . PRO D 4 518 ? -16.577 11.651  17.972  1.00 25.22  ? 518 PRO B O     1 
ATOM   9004 C CB    . PRO D 4 518 ? -15.219 11.458  21.024  1.00 26.96  ? 518 PRO B CB    1 
ATOM   9005 C CG    . PRO D 4 518 ? -15.738 12.881  21.041  1.00 26.50  ? 518 PRO B CG    1 
ATOM   9006 C CD    . PRO D 4 518 ? -14.739 13.626  20.172  1.00 27.75  ? 518 PRO B CD    1 
ATOM   9007 N N     . PRO D 4 519 ? -16.401 9.570   18.789  1.00 28.86  ? 519 PRO B N     1 
ATOM   9008 C CA    . PRO D 4 519 ? -17.534 9.071   18.006  1.00 29.87  ? 519 PRO B CA    1 
ATOM   9009 C C     . PRO D 4 519 ? -18.747 9.972   18.220  1.00 30.80  ? 519 PRO B C     1 
ATOM   9010 O O     . PRO D 4 519 ? -19.027 10.380  19.341  1.00 33.55  ? 519 PRO B O     1 
ATOM   9011 C CB    . PRO D 4 519 ? -17.749 7.671   18.572  1.00 28.41  ? 519 PRO B CB    1 
ATOM   9012 C CG    . PRO D 4 519 ? -16.377 7.259   18.941  1.00 28.37  ? 519 PRO B CG    1 
ATOM   9013 C CD    . PRO D 4 519 ? -15.828 8.497   19.615  1.00 28.46  ? 519 PRO B CD    1 
ATOM   9014 N N     . ALA D 4 520 ? -19.454 10.289  17.145  1.00 32.77  ? 520 ALA B N     1 
ATOM   9015 C CA    . ALA D 4 520 ? -20.626 11.142  17.238  1.00 34.52  ? 520 ALA B CA    1 
ATOM   9016 C C     . ALA D 4 520 ? -21.601 10.599  18.277  1.00 35.04  ? 520 ALA B C     1 
ATOM   9017 O O     . ALA D 4 520 ? -22.357 11.352  18.882  1.00 35.20  ? 520 ALA B O     1 
ATOM   9018 C CB    . ALA D 4 520 ? -21.305 11.240  15.877  1.00 34.07  ? 520 ALA B CB    1 
ATOM   9019 N N     . GLU D 4 521 ? -21.577 9.289   18.486  1.00 37.01  ? 521 GLU B N     1 
ATOM   9020 C CA    . GLU D 4 521 ? -22.466 8.655   19.454  1.00 39.17  ? 521 GLU B CA    1 
ATOM   9021 C C     . GLU D 4 521 ? -22.217 9.246   20.833  1.00 37.80  ? 521 GLU B C     1 
ATOM   9022 O O     . GLU D 4 521 ? -23.145 9.667   21.511  1.00 39.67  ? 521 GLU B O     1 
ATOM   9023 C CB    . GLU D 4 521 ? -22.211 7.144   19.488  1.00 43.94  ? 521 GLU B CB    1 
ATOM   9024 C CG    . GLU D 4 521 ? -22.044 6.496   18.101  1.00 49.78  ? 521 GLU B CG    1 
ATOM   9025 C CD    . GLU D 4 521 ? -23.333 6.471   17.283  1.00 53.28  ? 521 GLU B CD    1 
ATOM   9026 O OE1   . GLU D 4 521 ? -23.938 7.548   17.077  1.00 54.95  ? 521 GLU B OE1   1 
ATOM   9027 O OE2   . GLU D 4 521 ? -23.738 5.369   16.841  1.00 55.08  ? 521 GLU B OE2   1 
ATOM   9028 N N     . VAL D 4 522 ? -20.947 9.278   21.226  1.00 37.24  ? 522 VAL B N     1 
ATOM   9029 C CA    . VAL D 4 522 ? -20.500 9.798   22.521  1.00 35.85  ? 522 VAL B CA    1 
ATOM   9030 C C     . VAL D 4 522 ? -20.926 11.244  22.776  1.00 34.39  ? 522 VAL B C     1 
ATOM   9031 O O     . VAL D 4 522 ? -21.456 11.577  23.834  1.00 34.52  ? 522 VAL B O     1 
ATOM   9032 C CB    . VAL D 4 522 ? -18.953 9.732   22.625  1.00 35.41  ? 522 VAL B CB    1 
ATOM   9033 C CG1   . VAL D 4 522 ? -18.495 10.233  23.972  1.00 34.66  ? 522 VAL B CG1   1 
ATOM   9034 C CG2   . VAL D 4 522 ? -18.478 8.306   22.391  1.00 35.30  ? 522 VAL B CG2   1 
ATOM   9035 N N     . THR D 4 523 ? -20.674 12.097  21.796  1.00 33.76  ? 523 THR B N     1 
ATOM   9036 C CA    . THR D 4 523 ? -21.011 13.505  21.881  1.00 32.82  ? 523 THR B CA    1 
ATOM   9037 C C     . THR D 4 523 ? -22.510 13.701  22.081  1.00 33.09  ? 523 THR B C     1 
ATOM   9038 O O     . THR D 4 523 ? -22.934 14.516  22.899  1.00 32.94  ? 523 THR B O     1 
ATOM   9039 C CB    . THR D 4 523 ? -20.565 14.225  20.604  1.00 32.54  ? 523 THR B CB    1 
ATOM   9040 O OG1   . THR D 4 523 ? -19.210 13.862  20.316  1.00 33.33  ? 523 THR B OG1   1 
ATOM   9041 C CG2   . THR D 4 523 ? -20.640 15.724  20.775  1.00 33.28  ? 523 THR B CG2   1 
ATOM   9042 N N     . THR D 4 524 ? -23.313 12.941  21.347  1.00 32.73  ? 524 THR B N     1 
ATOM   9043 C CA    . THR D 4 524 ? -24.763 13.054  21.459  1.00 32.43  ? 524 THR B CA    1 
ATOM   9044 C C     . THR D 4 524 ? -25.310 12.615  22.817  1.00 32.26  ? 524 THR B C     1 
ATOM   9045 O O     . THR D 4 524 ? -26.166 13.286  23.376  1.00 33.30  ? 524 THR B O     1 
ATOM   9046 C CB    . THR D 4 524 ? -25.467 12.243  20.368  1.00 32.50  ? 524 THR B CB    1 
ATOM   9047 O OG1   . THR D 4 524 ? -24.973 12.640  19.083  1.00 34.08  ? 524 THR B OG1   1 
ATOM   9048 C CG2   . THR D 4 524 ? -26.959 12.487  20.423  1.00 31.01  ? 524 THR B CG2   1 
ATOM   9049 N N     . LYS D 4 525 ? -24.827 11.492  23.343  1.00 31.72  ? 525 LYS B N     1 
ATOM   9050 C CA    . LYS D 4 525 ? -25.288 10.999  24.643  1.00 32.64  ? 525 LYS B CA    1 
ATOM   9051 C C     . LYS D 4 525 ? -25.022 11.954  25.811  1.00 32.16  ? 525 LYS B C     1 
ATOM   9052 O O     . LYS D 4 525 ? -25.815 12.047  26.741  1.00 32.43  ? 525 LYS B O     1 
ATOM   9053 C CB    . LYS D 4 525 ? -24.611 9.677   24.992  1.00 34.08  ? 525 LYS B CB    1 
ATOM   9054 C CG    . LYS D 4 525 ? -25.179 8.421   24.370  1.00 37.82  ? 525 LYS B CG    1 
ATOM   9055 C CD    . LYS D 4 525 ? -24.343 7.247   24.858  1.00 41.17  ? 525 LYS B CD    1 
ATOM   9056 C CE    . LYS D 4 525 ? -24.824 5.917   24.335  1.00 44.53  ? 525 LYS B CE    1 
ATOM   9057 N NZ    . LYS D 4 525 ? -23.929 4.837   24.841  1.00 46.13  ? 525 LYS B NZ    1 
ATOM   9058 N N     . SER D 4 526 ? -23.897 12.653  25.765  1.00 31.12  ? 526 SER B N     1 
ATOM   9059 C CA    . SER D 4 526 ? -23.520 13.536  26.852  1.00 31.62  ? 526 SER B CA    1 
ATOM   9060 C C     . SER D 4 526 ? -24.328 14.827  27.002  1.00 31.79  ? 526 SER B C     1 
ATOM   9061 O O     . SER D 4 526 ? -24.383 15.405  28.089  1.00 30.23  ? 526 SER B O     1 
ATOM   9062 C CB    . SER D 4 526 ? -22.034 13.869  26.733  1.00 31.28  ? 526 SER B CB    1 
ATOM   9063 O OG    . SER D 4 526 ? -21.789 14.669  25.594  1.00 33.31  ? 526 SER B OG    1 
ATOM   9064 N N     . GLN D 4 527 ? -24.961 15.271  25.923  1.00 32.63  ? 527 GLN B N     1 
ATOM   9065 C CA    . GLN D 4 527 ? -25.741 16.506  25.951  1.00 33.63  ? 527 GLN B CA    1 
ATOM   9066 C C     . GLN D 4 527 ? -26.615 16.717  27.186  1.00 31.21  ? 527 GLN B C     1 
ATOM   9067 O O     . GLN D 4 527 ? -26.430 17.679  27.927  1.00 29.95  ? 527 GLN B O     1 
ATOM   9068 C CB    . GLN D 4 527 ? -26.599 16.612  24.687  1.00 36.22  ? 527 GLN B CB    1 
ATOM   9069 C CG    . GLN D 4 527 ? -25.771 16.590  23.416  1.00 40.95  ? 527 GLN B CG    1 
ATOM   9070 C CD    . GLN D 4 527 ? -24.578 17.523  23.501  1.00 43.23  ? 527 GLN B CD    1 
ATOM   9071 O OE1   . GLN D 4 527 ? -24.720 18.743  23.416  1.00 47.24  ? 527 GLN B OE1   1 
ATOM   9072 N NE2   . GLN D 4 527 ? -23.393 16.954  23.692  1.00 44.27  ? 527 GLN B NE2   1 
ATOM   9073 N N     . ILE D 4 528 ? -27.566 15.824  27.414  1.00 30.98  ? 528 ILE B N     1 
ATOM   9074 C CA    . ILE D 4 528 ? -28.437 15.975  28.567  1.00 30.74  ? 528 ILE B CA    1 
ATOM   9075 C C     . ILE D 4 528 ? -27.599 16.017  29.853  1.00 30.61  ? 528 ILE B C     1 
ATOM   9076 O O     . ILE D 4 528 ? -27.704 16.961  30.646  1.00 30.31  ? 528 ILE B O     1 
ATOM   9077 C CB    . ILE D 4 528 ? -29.506 14.848  28.576  1.00 30.49  ? 528 ILE B CB    1 
ATOM   9078 C CG1   . ILE D 4 528 ? -30.464 15.061  27.392  1.00 31.72  ? 528 ILE B CG1   1 
ATOM   9079 C CG2   . ILE D 4 528 ? -30.292 14.854  29.868  1.00 31.79  ? 528 ILE B CG2   1 
ATOM   9080 C CD1   . ILE D 4 528 ? -31.471 13.929  27.167  1.00 31.09  ? 528 ILE B CD1   1 
ATOM   9081 N N     . PRO D 4 529 ? -26.741 15.005  30.073  1.00 30.26  ? 529 PRO B N     1 
ATOM   9082 C CA    . PRO D 4 529 ? -25.918 15.014  31.284  1.00 28.15  ? 529 PRO B CA    1 
ATOM   9083 C C     . PRO D 4 529 ? -25.112 16.313  31.440  1.00 27.21  ? 529 PRO B C     1 
ATOM   9084 O O     . PRO D 4 529 ? -24.987 16.852  32.540  1.00 26.35  ? 529 PRO B O     1 
ATOM   9085 C CB    . PRO D 4 529 ? -25.038 13.790  31.092  1.00 28.87  ? 529 PRO B CB    1 
ATOM   9086 C CG    . PRO D 4 529 ? -25.989 12.843  30.429  1.00 27.38  ? 529 PRO B CG    1 
ATOM   9087 C CD    . PRO D 4 529 ? -26.600 13.721  29.364  1.00 28.62  ? 529 PRO B CD    1 
ATOM   9088 N N     . LEU D 4 530 ? -24.568 16.819  30.341  1.00 25.59  ? 530 LEU B N     1 
ATOM   9089 C CA    . LEU D 4 530 ? -23.802 18.053  30.415  1.00 26.30  ? 530 LEU B CA    1 
ATOM   9090 C C     . LEU D 4 530 ? -24.718 19.175  30.869  1.00 26.67  ? 530 LEU B C     1 
ATOM   9091 O O     . LEU D 4 530 ? -24.318 20.028  31.660  1.00 25.10  ? 530 LEU B O     1 
ATOM   9092 C CB    . LEU D 4 530 ? -23.177 18.395  29.059  1.00 25.64  ? 530 LEU B CB    1 
ATOM   9093 C CG    . LEU D 4 530 ? -21.832 17.702  28.798  1.00 27.98  ? 530 LEU B CG    1 
ATOM   9094 C CD1   . LEU D 4 530 ? -21.420 17.877  27.344  1.00 23.82  ? 530 LEU B CD1   1 
ATOM   9095 C CD2   . LEU D 4 530 ? -20.770 18.278  29.737  1.00 25.24  ? 530 LEU B CD2   1 
ATOM   9096 N N     . SER D 4 531 ? -25.956 19.159  30.384  1.00 27.48  ? 531 SER B N     1 
ATOM   9097 C CA    . SER D 4 531 ? -26.916 20.194  30.753  1.00 27.84  ? 531 SER B CA    1 
ATOM   9098 C C     . SER D 4 531 ? -27.195 20.163  32.255  1.00 26.74  ? 531 SER B C     1 
ATOM   9099 O O     . SER D 4 531 ? -27.274 21.210  32.886  1.00 26.28  ? 531 SER B O     1 
ATOM   9100 C CB    . SER D 4 531 ? -28.229 20.039  29.971  1.00 27.87  ? 531 SER B CB    1 
ATOM   9101 O OG    . SER D 4 531 ? -29.179 19.282  30.696  1.00 29.90  ? 531 SER B OG    1 
ATOM   9102 N N     . LYS D 4 532 ? -27.333 18.977  32.837  1.00 27.48  ? 532 LYS B N     1 
ATOM   9103 C CA    . LYS D 4 532 ? -27.592 18.921  34.271  1.00 29.39  ? 532 LYS B CA    1 
ATOM   9104 C C     . LYS D 4 532 ? -26.400 19.399  35.085  1.00 29.50  ? 532 LYS B C     1 
ATOM   9105 O O     . LYS D 4 532 ? -26.565 19.966  36.165  1.00 30.42  ? 532 LYS B O     1 
ATOM   9106 C CB    . LYS D 4 532 ? -27.998 17.513  34.696  1.00 31.12  ? 532 LYS B CB    1 
ATOM   9107 C CG    . LYS D 4 532 ? -29.458 17.219  34.380  1.00 36.76  ? 532 LYS B CG    1 
ATOM   9108 C CD    . LYS D 4 532 ? -29.920 15.880  34.928  1.00 39.88  ? 532 LYS B CD    1 
ATOM   9109 C CE    . LYS D 4 532 ? -31.288 15.517  34.364  1.00 41.74  ? 532 LYS B CE    1 
ATOM   9110 N NZ    . LYS D 4 532 ? -31.273 15.509  32.867  1.00 42.32  ? 532 LYS B NZ    1 
ATOM   9111 N N     . ILE D 4 533 ? -25.200 19.181  34.557  1.00 28.65  ? 533 ILE B N     1 
ATOM   9112 C CA    . ILE D 4 533 ? -23.986 19.604  35.233  1.00 27.07  ? 533 ILE B CA    1 
ATOM   9113 C C     . ILE D 4 533 ? -23.855 21.120  35.225  1.00 27.55  ? 533 ILE B C     1 
ATOM   9114 O O     . ILE D 4 533 ? -23.389 21.710  36.199  1.00 27.90  ? 533 ILE B O     1 
ATOM   9115 C CB    . ILE D 4 533 ? -22.727 18.937  34.593  1.00 27.19  ? 533 ILE B CB    1 
ATOM   9116 C CG1   . ILE D 4 533 ? -22.578 17.525  35.165  1.00 27.77  ? 533 ILE B CG1   1 
ATOM   9117 C CG2   . ILE D 4 533 ? -21.460 19.759  34.871  1.00 21.75  ? 533 ILE B CG2   1 
ATOM   9118 C CD1   . ILE D 4 533 ? -21.472 16.720  34.557  1.00 32.17  ? 533 ILE B CD1   1 
ATOM   9119 N N     . LYS D 4 534 ? -24.278 21.754  34.136  1.00 28.19  ? 534 LYS B N     1 
ATOM   9120 C CA    . LYS D 4 534 ? -24.194 23.207  34.045  1.00 28.86  ? 534 LYS B CA    1 
ATOM   9121 C C     . LYS D 4 534 ? -25.044 23.922  35.081  1.00 28.67  ? 534 LYS B C     1 
ATOM   9122 O O     . LYS D 4 534 ? -24.688 25.009  35.531  1.00 27.68  ? 534 LYS B O     1 
ATOM   9123 C CB    . LYS D 4 534 ? -24.610 23.712  32.664  1.00 29.74  ? 534 LYS B CB    1 
ATOM   9124 C CG    . LYS D 4 534 ? -24.543 25.239  32.579  1.00 31.46  ? 534 LYS B CG    1 
ATOM   9125 C CD    . LYS D 4 534 ? -24.721 25.799  31.176  1.00 29.52  ? 534 LYS B CD    1 
ATOM   9126 C CE    . LYS D 4 534 ? -24.558 27.312  31.225  1.00 31.96  ? 534 LYS B CE    1 
ATOM   9127 N NZ    . LYS D 4 534 ? -24.849 27.996  29.938  1.00 34.42  ? 534 LYS B NZ    1 
ATOM   9128 N N     . THR D 4 535 ? -26.169 23.318  35.457  1.00 30.50  ? 535 THR B N     1 
ATOM   9129 C CA    . THR D 4 535 ? -27.054 23.940  36.430  1.00 31.28  ? 535 THR B CA    1 
ATOM   9130 C C     . THR D 4 535 ? -26.680 23.552  37.861  1.00 32.82  ? 535 THR B C     1 
ATOM   9131 O O     . THR D 4 535 ? -26.884 24.336  38.793  1.00 32.83  ? 535 THR B O     1 
ATOM   9132 C CB    . THR D 4 535 ? -28.560 23.594  36.145  1.00 30.76  ? 535 THR B CB    1 
ATOM   9133 O OG1   . THR D 4 535 ? -29.023 22.585  37.050  1.00 33.47  ? 535 THR B OG1   1 
ATOM   9134 C CG2   . THR D 4 535 ? -28.732 23.087  34.734  1.00 29.88  ? 535 THR B CG2   1 
ATOM   9135 N N     . LEU D 4 536 ? -26.112 22.360  38.038  1.00 32.45  ? 536 LEU B N     1 
ATOM   9136 C CA    . LEU D 4 536 ? -25.721 21.897  39.373  1.00 32.35  ? 536 LEU B CA    1 
ATOM   9137 C C     . LEU D 4 536 ? -24.398 22.477  39.869  1.00 32.72  ? 536 LEU B C     1 
ATOM   9138 O O     . LEU D 4 536 ? -24.217 22.659  41.068  1.00 33.94  ? 536 LEU B O     1 
ATOM   9139 C CB    . LEU D 4 536 ? -25.637 20.373  39.398  1.00 31.80  ? 536 LEU B CB    1 
ATOM   9140 C CG    . LEU D 4 536 ? -26.977 19.641  39.369  1.00 31.86  ? 536 LEU B CG    1 
ATOM   9141 C CD1   . LEU D 4 536 ? -26.760 18.147  39.208  1.00 26.94  ? 536 LEU B CD1   1 
ATOM   9142 C CD2   . LEU D 4 536 ? -27.732 19.953  40.655  1.00 29.88  ? 536 LEU B CD2   1 
ATOM   9143 N N     . PHE D 4 537 ? -23.475 22.757  38.950  1.00 32.07  ? 537 PHE B N     1 
ATOM   9144 C CA    . PHE D 4 537 ? -22.171 23.307  39.316  1.00 31.77  ? 537 PHE B CA    1 
ATOM   9145 C C     . PHE D 4 537 ? -21.970 24.759  38.881  1.00 31.50  ? 537 PHE B C     1 
ATOM   9146 O O     . PHE D 4 537 ? -21.512 25.034  37.776  1.00 33.80  ? 537 PHE B O     1 
ATOM   9147 C CB    . PHE D 4 537 ? -21.026 22.468  38.724  1.00 28.01  ? 537 PHE B CB    1 
ATOM   9148 C CG    . PHE D 4 537 ? -20.945 21.071  39.263  1.00 27.77  ? 537 PHE B CG    1 
ATOM   9149 C CD1   . PHE D 4 537 ? -21.620 20.028  38.635  1.00 27.47  ? 537 PHE B CD1   1 
ATOM   9150 C CD2   . PHE D 4 537 ? -20.178 20.792  40.394  1.00 26.18  ? 537 PHE B CD2   1 
ATOM   9151 C CE1   . PHE D 4 537 ? -21.530 18.726  39.125  1.00 26.06  ? 537 PHE B CE1   1 
ATOM   9152 C CE2   . PHE D 4 537 ? -20.081 19.499  40.892  1.00 25.52  ? 537 PHE B CE2   1 
ATOM   9153 C CZ    . PHE D 4 537 ? -20.757 18.462  40.256  1.00 26.60  ? 537 PHE B CZ    1 
ATOM   9154 N N     . PRO D 4 538 ? -22.289 25.710  39.756  1.00 32.08  ? 538 PRO B N     1 
ATOM   9155 C CA    . PRO D 4 538 ? -22.102 27.108  39.372  1.00 32.30  ? 538 PRO B CA    1 
ATOM   9156 C C     . PRO D 4 538 ? -20.636 27.382  39.045  1.00 33.77  ? 538 PRO B C     1 
ATOM   9157 O O     . PRO D 4 538 ? -19.736 26.914  39.749  1.00 33.88  ? 538 PRO B O     1 
ATOM   9158 C CB    . PRO D 4 538 ? -22.581 27.862  40.607  1.00 32.55  ? 538 PRO B CB    1 
ATOM   9159 C CG    . PRO D 4 538 ? -22.239 26.906  41.726  1.00 33.67  ? 538 PRO B CG    1 
ATOM   9160 C CD    . PRO D 4 538 ? -22.700 25.594  41.165  1.00 32.22  ? 538 PRO B CD    1 
ATOM   9161 N N     . LEU D 4 539 ? -20.405 28.133  37.972  1.00 34.82  ? 539 LEU B N     1 
ATOM   9162 C CA    . LEU D 4 539 ? -19.056 28.476  37.532  1.00 36.21  ? 539 LEU B CA    1 
ATOM   9163 C C     . LEU D 4 539 ? -19.016 29.926  37.067  1.00 38.57  ? 539 LEU B C     1 
ATOM   9164 O O     . LEU D 4 539 ? -19.747 30.299  36.155  1.00 40.07  ? 539 LEU B O     1 
ATOM   9165 C CB    . LEU D 4 539 ? -18.623 27.573  36.367  1.00 33.93  ? 539 LEU B CB    1 
ATOM   9166 C CG    . LEU D 4 539 ? -18.535 26.054  36.574  1.00 32.80  ? 539 LEU B CG    1 
ATOM   9167 C CD1   . LEU D 4 539 ? -18.170 25.387  35.251  1.00 29.85  ? 539 LEU B CD1   1 
ATOM   9168 C CD2   . LEU D 4 539 ? -17.491 25.728  37.642  1.00 27.90  ? 539 LEU B CD2   1 
ATOM   9169 N N     . ILE D 4 540 ? -18.161 30.739  37.681  1.00 41.01  ? 540 ILE B N     1 
ATOM   9170 C CA    . ILE D 4 540 ? -18.049 32.144  37.300  1.00 42.74  ? 540 ILE B CA    1 
ATOM   9171 C C     . ILE D 4 540 ? -16.634 32.690  37.502  1.00 43.30  ? 540 ILE B C     1 
ATOM   9172 O O     . ILE D 4 540 ? -15.974 32.388  38.493  1.00 43.60  ? 540 ILE B O     1 
ATOM   9173 C CB    . ILE D 4 540 ? -19.055 33.010  38.092  1.00 44.00  ? 540 ILE B CB    1 
ATOM   9174 C CG1   . ILE D 4 540 ? -19.164 34.395  37.450  1.00 44.30  ? 540 ILE B CG1   1 
ATOM   9175 C CG2   . ILE D 4 540 ? -18.625 33.118  39.548  1.00 41.45  ? 540 ILE B CG2   1 
ATOM   9176 C CD1   . ILE D 4 540 ? -20.314 35.219  37.990  1.00 45.35  ? 540 ILE B CD1   1 
ATOM   9177 N N     . GLU D 4 541 ? -16.181 33.507  36.556  1.00 45.54  ? 541 GLU B N     1 
ATOM   9178 C CA    . GLU D 4 541 ? -14.838 34.081  36.606  1.00 47.22  ? 541 GLU B CA    1 
ATOM   9179 C C     . GLU D 4 541 ? -14.646 35.148  37.674  1.00 47.32  ? 541 GLU B C     1 
ATOM   9180 O O     . GLU D 4 541 ? -15.467 36.049  37.831  1.00 48.95  ? 541 GLU B O     1 
ATOM   9181 C CB    . GLU D 4 541 ? -14.473 34.638  35.232  1.00 47.87  ? 541 GLU B CB    1 
ATOM   9182 C CG    . GLU D 4 541 ? -14.593 33.587  34.150  1.00 50.28  ? 541 GLU B CG    1 
ATOM   9183 C CD    . GLU D 4 541 ? -14.270 34.109  32.771  1.00 52.90  ? 541 GLU B CD    1 
ATOM   9184 O OE1   . GLU D 4 541 ? -13.097 34.475  32.532  1.00 53.36  ? 541 GLU B OE1   1 
ATOM   9185 O OE2   . GLU D 4 541 ? -15.196 34.149  31.928  1.00 53.38  ? 541 GLU B OE2   1 
ATOM   9186 N N     . ALA D 4 542 ? -13.544 35.031  38.407  1.00 47.43  ? 542 ALA B N     1 
ATOM   9187 C CA    . ALA D 4 542 ? -13.216 35.960  39.482  1.00 46.45  ? 542 ALA B CA    1 
ATOM   9188 C C     . ALA D 4 542 ? -13.029 37.388  38.985  1.00 46.53  ? 542 ALA B C     1 
ATOM   9189 O O     . ALA D 4 542 ? -12.514 37.620  37.891  1.00 46.32  ? 542 ALA B O     1 
ATOM   9190 C CB    . ALA D 4 542 ? -11.955 35.487  40.199  1.00 45.39  ? 542 ALA B CB    1 
ATOM   9191 N N     . LYS D 4 543 ? -13.446 38.344  39.804  1.00 47.50  ? 543 LYS B N     1 
ATOM   9192 C CA    . LYS D 4 543 ? -13.321 39.753  39.453  1.00 49.60  ? 543 LYS B CA    1 
ATOM   9193 C C     . LYS D 4 543 ? -12.212 40.401  40.280  1.00 50.49  ? 543 LYS B C     1 
ATOM   9194 O O     . LYS D 4 543 ? -11.622 41.392  39.864  1.00 49.29  ? 543 LYS B O     1 
ATOM   9195 C CB    . LYS D 4 543 ? -14.640 40.489  39.715  1.00 49.35  ? 543 LYS B CB    1 
ATOM   9196 C CG    . LYS D 4 543 ? -15.891 39.749  39.260  1.00 49.39  ? 543 LYS B CG    1 
ATOM   9197 C CD    . LYS D 4 543 ? -15.870 39.467  37.768  1.00 50.35  ? 543 LYS B CD    1 
ATOM   9198 C CE    . LYS D 4 543 ? -17.075 38.645  37.349  1.00 48.95  ? 543 LYS B CE    1 
ATOM   9199 N NZ    . LYS D 4 543 ? -17.038 38.382  35.896  1.00 49.57  ? 543 LYS B NZ    1 
ATOM   9200 N N     . LYS D 4 544 ? -11.931 39.828  41.449  1.00 52.38  ? 544 LYS B N     1 
ATOM   9201 C CA    . LYS D 4 544 ? -10.908 40.362  42.349  1.00 54.85  ? 544 LYS B CA    1 
ATOM   9202 C C     . LYS D 4 544 ? -9.636  39.514  42.405  1.00 55.73  ? 544 LYS B C     1 
ATOM   9203 O O     . LYS D 4 544 ? -9.499  38.533  41.675  1.00 55.62  ? 544 LYS B O     1 
ATOM   9204 C CB    . LYS D 4 544 ? -11.490 40.508  43.767  1.00 55.90  ? 544 LYS B CB    1 
ATOM   9205 C CG    . LYS D 4 544 ? -12.675 41.472  43.862  1.00 56.68  ? 544 LYS B CG    1 
ATOM   9206 C CD    . LYS D 4 544 ? -13.175 41.655  45.295  1.00 57.43  ? 544 LYS B CD    1 
ATOM   9207 C CE    . LYS D 4 544 ? -14.286 42.706  45.356  1.00 57.11  ? 544 LYS B CE    1 
ATOM   9208 N NZ    . LYS D 4 544 ? -14.812 42.939  46.726  1.00 55.62  ? 544 LYS B NZ    1 
ATOM   9209 N N     . LYS D 4 545 ? -8.712  39.916  43.277  1.00 57.77  ? 545 LYS B N     1 
ATOM   9210 C CA    . LYS D 4 545 ? -7.440  39.218  43.489  1.00 60.28  ? 545 LYS B CA    1 
ATOM   9211 C C     . LYS D 4 545 ? -6.673  38.946  42.192  1.00 61.54  ? 545 LYS B C     1 
ATOM   9212 O O     . LYS D 4 545 ? -5.602  39.568  42.006  1.00 60.88  ? 545 LYS B O     1 
ATOM   9213 C CB    . LYS D 4 545 ? -7.702  37.902  44.232  1.00 60.13  ? 545 LYS B CB    1 
ATOM   9214 C CG    . LYS D 4 545 ? -6.477  37.070  44.573  1.00 60.37  ? 545 LYS B CG    1 
ATOM   9215 C CD    . LYS D 4 545 ? -6.911  35.813  45.317  1.00 61.71  ? 545 LYS B CD    1 
ATOM   9216 C CE    . LYS D 4 545 ? -5.735  34.965  45.781  1.00 62.42  ? 545 LYS B CE    1 
ATOM   9217 N NZ    . LYS D 4 545 ? -6.197  33.809  46.608  1.00 59.30  ? 545 LYS B NZ    1 
HETATM 9218 O O     . HOH E 5 .   ? 30.042  22.839  17.509  1.00 37.68  ? 83  HOH C O     1 
HETATM 9219 O O     . HOH E 5 .   ? 34.412  6.443   19.395  1.00 32.31  ? 254 HOH C O     1 
HETATM 9220 O O     . HOH F 5 .   ? 19.288  6.951   24.395  1.00 30.50  ? 158 HOH D O     1 
HETATM 9221 O O     . HOH F 5 .   ? 21.397  25.021  18.818  1.00 43.61  ? 226 HOH D O     1 
HETATM 9222 O O     . HOH G 5 .   ? -17.346 14.670  23.874  1.00 50.98  ? 610 HOH A O     1 
HETATM 9223 O O     . HOH G 5 .   ? 10.492  26.138  71.387  1.00 8.59   ? 611 HOH A O     1 
HETATM 9224 O O     . HOH G 5 .   ? 6.927   25.804  -5.694  1.00 74.57  ? 612 HOH A O     1 
HETATM 9225 O O     . HOH G 5 .   ? -2.185  3.839   25.747  1.00 31.38  ? 613 HOH A O     1 
HETATM 9226 O O     . HOH G 5 .   ? -8.567  24.696  45.170  1.00 23.61  ? 614 HOH A O     1 
HETATM 9227 O O     . HOH G 5 .   ? 3.146   11.551  30.358  1.00 11.70  ? 615 HOH A O     1 
HETATM 9228 O O     . HOH G 5 .   ? 2.543   13.584  37.461  1.00 33.20  ? 616 HOH A O     1 
HETATM 9229 O O     . HOH G 5 .   ? 18.933  15.701  35.729  1.00 15.28  ? 617 HOH A O     1 
HETATM 9230 O O     . HOH G 5 .   ? -11.916 14.490  46.411  1.00 33.00  ? 618 HOH A O     1 
HETATM 9231 O O     . HOH G 5 .   ? -7.918  11.993  47.431  1.00 9.08   ? 619 HOH A O     1 
HETATM 9232 O O     . HOH G 5 .   ? -7.748  23.322  23.961  1.00 23.78  ? 620 HOH A O     1 
HETATM 9233 O O     . HOH G 5 .   ? -4.364  6.744   43.154  1.00 20.21  ? 621 HOH A O     1 
HETATM 9234 O O     . HOH G 5 .   ? 15.720  23.020  72.802  1.00 12.21  ? 622 HOH A O     1 
HETATM 9235 O O     . HOH G 5 .   ? -3.021  21.106  68.361  1.00 36.02  ? 623 HOH A O     1 
HETATM 9236 O O     . HOH G 5 .   ? -20.117 24.561  44.031  1.00 26.70  ? 624 HOH A O     1 
HETATM 9237 O O     . HOH G 5 .   ? 21.873  44.250  74.039  1.00 26.23  ? 625 HOH A O     1 
HETATM 9238 O O     . HOH G 5 .   ? 15.731  37.675  73.778  1.00 27.96  ? 626 HOH A O     1 
HETATM 9239 O O     . HOH G 5 .   ? 17.068  41.167  74.708  1.00 13.00  ? 627 HOH A O     1 
HETATM 9240 O O     . HOH G 5 .   ? -6.286  6.682   23.624  1.00 20.54  ? 628 HOH A O     1 
HETATM 9241 O O     . HOH G 5 .   ? -6.271  5.349   39.865  1.00 35.33  ? 629 HOH A O     1 
HETATM 9242 O O     . HOH G 5 .   ? -1.590  8.876   39.215  1.00 39.71  ? 630 HOH A O     1 
HETATM 9243 O O     . HOH G 5 .   ? -5.300  30.042  28.427  1.00 36.79  ? 631 HOH A O     1 
HETATM 9244 O O     . HOH G 5 .   ? -3.693  28.549  19.277  1.00 33.71  ? 632 HOH A O     1 
HETATM 9245 O O     . HOH G 5 .   ? 1.282   7.127   27.028  1.00 13.22  ? 633 HOH A O     1 
HETATM 9246 O O     . HOH G 5 .   ? 3.433   16.641  66.227  1.00 16.15  ? 634 HOH A O     1 
HETATM 9247 O O     . HOH G 5 .   ? 0.535   14.994  63.318  1.00 49.75  ? 635 HOH A O     1 
HETATM 9248 O O     . HOH G 5 .   ? 2.893   33.051  63.082  1.00 26.85  ? 636 HOH A O     1 
HETATM 9249 O O     . HOH G 5 .   ? 4.533   13.140  16.340  1.00 23.98  ? 637 HOH A O     1 
HETATM 9250 O O     . HOH G 5 .   ? 6.451   0.241   23.527  1.00 27.88  ? 638 HOH A O     1 
HETATM 9251 O O     . HOH G 5 .   ? 5.865   29.571  -3.817  1.00 39.41  ? 639 HOH A O     1 
HETATM 9252 O O     . HOH G 5 .   ? 8.407   42.548  57.229  1.00 44.93  ? 640 HOH A O     1 
HETATM 9253 O O     . HOH G 5 .   ? 12.059  33.310  81.338  1.00 18.89  ? 641 HOH A O     1 
HETATM 9254 O O     . HOH G 5 .   ? 19.706  42.357  62.336  1.00 23.54  ? 642 HOH A O     1 
HETATM 9255 O O     . HOH G 5 .   ? 23.012  28.730  40.442  1.00 33.66  ? 643 HOH A O     1 
HETATM 9256 O O     . HOH G 5 .   ? 29.670  21.471  50.364  1.00 39.72  ? 644 HOH A O     1 
HETATM 9257 O O     . HOH G 5 .   ? -10.958 12.084  46.676  1.00 27.47  ? 645 HOH A O     1 
HETATM 9258 O O     . HOH G 5 .   ? -1.793  12.172  20.986  1.00 12.60  ? 646 HOH A O     1 
HETATM 9259 O O     . HOH G 5 .   ? -1.431  39.622  67.968  1.00 12.29  ? 647 HOH A O     1 
HETATM 9260 O O     . HOH G 5 .   ? -0.291  20.047  22.162  1.00 9.16   ? 648 HOH A O     1 
HETATM 9261 O O     . HOH G 5 .   ? -0.051  28.111  78.917  1.00 44.35  ? 649 HOH A O     1 
HETATM 9262 O O     . HOH G 5 .   ? 0.537   12.944  38.742  1.00 28.98  ? 650 HOH A O     1 
HETATM 9263 O O     . HOH G 5 .   ? 2.473   28.193  77.345  1.00 45.09  ? 651 HOH A O     1 
HETATM 9264 O O     . HOH G 5 .   ? 4.007   36.307  52.536  1.00 28.38  ? 652 HOH A O     1 
HETATM 9265 O O     . HOH G 5 .   ? 6.821   11.041  46.493  1.00 37.82  ? 653 HOH A O     1 
HETATM 9266 O O     . HOH G 5 .   ? 10.097  18.254  61.985  1.00 14.50  ? 654 HOH A O     1 
HETATM 9267 O O     . HOH G 5 .   ? 14.715  26.357  75.584  1.00 23.66  ? 655 HOH A O     1 
HETATM 9268 O O     . HOH G 5 .   ? -15.302 25.328  43.892  1.00 31.96  ? 656 HOH A O     1 
HETATM 9269 O O     . HOH G 5 .   ? -12.096 9.760   47.020  1.00 33.07  ? 657 HOH A O     1 
HETATM 9270 O O     . HOH G 5 .   ? -4.153  22.598  19.038  1.00 14.18  ? 658 HOH A O     1 
HETATM 9271 O O     . HOH G 5 .   ? -3.168  25.489  18.198  1.00 24.92  ? 659 HOH A O     1 
HETATM 9272 O O     . HOH G 5 .   ? -6.863  21.330  22.946  1.00 15.25  ? 660 HOH A O     1 
HETATM 9273 O O     . HOH G 5 .   ? -10.179 0.038   34.488  1.00 25.65  ? 661 HOH A O     1 
HETATM 9274 O O     . HOH G 5 .   ? -7.755  23.265  47.293  1.00 27.15  ? 662 HOH A O     1 
HETATM 9275 O O     . HOH G 5 .   ? -6.733  27.593  28.364  1.00 22.36  ? 663 HOH A O     1 
HETATM 9276 O O     . HOH G 5 .   ? -4.785  3.963   24.563  1.00 23.88  ? 664 HOH A O     1 
HETATM 9277 O O     . HOH G 5 .   ? 4.049   23.416  71.606  1.00 22.39  ? 665 HOH A O     1 
HETATM 9278 O O     . HOH G 5 .   ? 10.501  40.724  75.748  1.00 31.10  ? 666 HOH A O     1 
HETATM 9279 O O     . HOH G 5 .   ? 11.553  31.304  79.620  1.00 33.64  ? 667 HOH A O     1 
HETATM 9280 O O     . HOH G 5 .   ? 11.277  11.235  62.110  1.00 29.88  ? 668 HOH A O     1 
HETATM 9281 O O     . HOH G 5 .   ? 13.448  19.561  74.663  1.00 30.54  ? 669 HOH A O     1 
HETATM 9282 O O     . HOH G 5 .   ? 13.018  26.956  71.808  1.00 20.71  ? 670 HOH A O     1 
HETATM 9283 O O     . HOH G 5 .   ? 17.393  40.760  55.657  1.00 31.18  ? 671 HOH A O     1 
HETATM 9284 O O     . HOH G 5 .   ? 17.199  37.268  76.001  1.00 20.03  ? 672 HOH A O     1 
HETATM 9285 O O     . HOH G 5 .   ? 34.287  -9.514  45.660  1.00 60.28  ? 673 HOH A O     1 
HETATM 9286 O O     . HOH G 5 .   ? -10.546 24.658  23.062  1.00 47.80  ? 674 HOH A O     1 
HETATM 9287 O O     . HOH G 5 .   ? -4.171  11.248  59.001  1.00 47.38  ? 675 HOH A O     1 
HETATM 9288 O O     . HOH G 5 .   ? -0.106  17.369  17.303  1.00 48.60  ? 676 HOH A O     1 
HETATM 9289 O O     . HOH G 5 .   ? 1.572   11.694  9.826   1.00 26.16  ? 677 HOH A O     1 
HETATM 9290 O O     . HOH G 5 .   ? 3.300   9.421   28.482  1.00 19.69  ? 678 HOH A O     1 
HETATM 9291 O O     . HOH G 5 .   ? 4.125   17.085  52.684  1.00 14.21  ? 679 HOH A O     1 
HETATM 9292 O O     . HOH G 5 .   ? 28.990  27.895  74.945  1.00 35.02  ? 680 HOH A O     1 
HETATM 9293 O O     . HOH G 5 .   ? 14.051  30.400  78.367  1.00 41.28  ? 681 HOH A O     1 
HETATM 9294 O O     . HOH G 5 .   ? 15.764  27.030  1.213   1.00 51.92  ? 682 HOH A O     1 
HETATM 9295 O O     . HOH G 5 .   ? 16.496  42.228  61.992  1.00 26.87  ? 683 HOH A O     1 
HETATM 9296 O O     . HOH G 5 .   ? 18.356  27.914  76.035  1.00 27.48  ? 684 HOH A O     1 
HETATM 9297 O O     . HOH G 5 .   ? 18.456  33.355  45.023  1.00 33.89  ? 685 HOH A O     1 
HETATM 9298 O O     . HOH G 5 .   ? 25.774  18.930  67.315  1.00 31.62  ? 686 HOH A O     1 
HETATM 9299 O O     . HOH G 5 .   ? 25.863  26.415  36.206  1.00 33.52  ? 687 HOH A O     1 
HETATM 9300 O O     . HOH G 5 .   ? -2.407  7.732   45.135  1.00 18.62  ? 688 HOH A O     1 
HETATM 9301 O O     . HOH G 5 .   ? 0.041   28.668  73.424  1.00 32.51  ? 689 HOH A O     1 
HETATM 9302 O O     . HOH G 5 .   ? 2.087   19.416  23.478  1.00 26.46  ? 690 HOH A O     1 
HETATM 9303 O O     . HOH G 5 .   ? 4.466   23.884  61.271  1.00 24.95  ? 691 HOH A O     1 
HETATM 9304 O O     . HOH G 5 .   ? 5.287   22.282  59.283  1.00 31.95  ? 692 HOH A O     1 
HETATM 9305 O O     . HOH G 5 .   ? 6.444   -0.450  37.208  1.00 28.30  ? 693 HOH A O     1 
HETATM 9306 O O     . HOH G 5 .   ? 11.976  16.605  31.745  1.00 31.62  ? 694 HOH A O     1 
HETATM 9307 O O     . HOH G 5 .   ? 14.616  17.874  76.466  1.00 32.14  ? 695 HOH A O     1 
HETATM 9308 O O     . HOH G 5 .   ? 16.562  9.234   42.747  1.00 34.42  ? 696 HOH A O     1 
HETATM 9309 O O     . HOH G 5 .   ? 19.442  19.093  81.925  1.00 23.49  ? 697 HOH A O     1 
HETATM 9310 O O     . HOH G 5 .   ? 20.097  22.225  37.253  1.00 26.92  ? 698 HOH A O     1 
HETATM 9311 O O     . HOH G 5 .   ? 23.171  38.527  73.782  1.00 15.63  ? 699 HOH A O     1 
HETATM 9312 O O     . HOH G 5 .   ? 23.387  43.154  68.155  1.00 21.12  ? 700 HOH A O     1 
HETATM 9313 O O     . HOH G 5 .   ? 24.301  39.192  55.832  1.00 37.02  ? 701 HOH A O     1 
HETATM 9314 O O     . HOH G 5 .   ? 25.665  15.517  65.447  1.00 34.64  ? 702 HOH A O     1 
HETATM 9315 O O     . HOH G 5 .   ? 31.433  -3.927  45.705  1.00 30.84  ? 703 HOH A O     1 
HETATM 9316 O O     . HOH G 5 .   ? -18.738 28.104  32.577  1.00 22.30  ? 704 HOH A O     1 
HETATM 9317 O O     . HOH G 5 .   ? -8.826  -0.353  36.497  1.00 32.50  ? 705 HOH A O     1 
HETATM 9318 O O     . HOH G 5 .   ? 8.656   41.957  80.437  1.00 39.40  ? 706 HOH A O     1 
HETATM 9319 O O     . HOH G 5 .   ? -7.161  26.205  43.753  1.00 27.27  ? 707 HOH A O     1 
HETATM 9320 O O     . HOH G 5 .   ? -1.092  34.927  76.050  1.00 42.21  ? 708 HOH A O     1 
HETATM 9321 O O     . HOH G 5 .   ? -1.037  42.337  68.077  1.00 17.01  ? 709 HOH A O     1 
HETATM 9322 O O     . HOH G 5 .   ? 2.954   17.171  68.599  1.00 23.40  ? 710 HOH A O     1 
HETATM 9323 O O     . HOH G 5 .   ? 3.860   16.539  23.379  1.00 48.12  ? 711 HOH A O     1 
HETATM 9324 O O     . HOH G 5 .   ? 3.447   40.257  81.002  1.00 26.22  ? 712 HOH A O     1 
HETATM 9325 O O     . HOH G 5 .   ? 5.044   41.733  62.647  1.00 28.21  ? 713 HOH A O     1 
HETATM 9326 O O     . HOH G 5 .   ? 5.604   22.860  38.751  1.00 45.64  ? 714 HOH A O     1 
HETATM 9327 O O     . HOH G 5 .   ? 8.648   36.067  74.140  1.00 15.42  ? 715 HOH A O     1 
HETATM 9328 O O     . HOH G 5 .   ? 17.153  18.964  49.210  1.00 41.67  ? 716 HOH A O     1 
HETATM 9329 O O     . HOH G 5 .   ? 19.681  25.598  77.291  1.00 38.63  ? 717 HOH A O     1 
HETATM 9330 O O     . HOH G 5 .   ? 23.266  43.645  62.898  1.00 31.62  ? 718 HOH A O     1 
HETATM 9331 O O     . HOH G 5 .   ? 27.000  20.260  64.769  1.00 26.94  ? 719 HOH A O     1 
HETATM 9332 O O     . HOH G 5 .   ? 27.983  33.482  49.277  1.00 25.94  ? 720 HOH A O     1 
HETATM 9333 O O     . HOH G 5 .   ? 28.765  15.907  45.455  1.00 28.55  ? 721 HOH A O     1 
HETATM 9334 O O     . HOH G 5 .   ? 31.036  23.271  51.025  1.00 45.03  ? 722 HOH A O     1 
HETATM 9335 O O     . HOH G 5 .   ? 36.676  13.544  46.450  1.00 29.56  ? 723 HOH A O     1 
HETATM 9336 O O     . HOH G 5 .   ? -17.967 25.584  45.771  1.00 36.21  ? 724 HOH A O     1 
HETATM 9337 O O     . HOH G 5 .   ? -3.310  38.855  65.910  1.00 21.95  ? 725 HOH A O     1 
HETATM 9338 O O     . HOH G 5 .   ? -1.942  8.732   57.373  1.00 39.29  ? 726 HOH A O     1 
HETATM 9339 O O     . HOH G 5 .   ? -1.265  24.531  49.402  1.00 34.48  ? 727 HOH A O     1 
HETATM 9340 O O     . HOH G 5 .   ? 2.815   20.378  59.289  1.00 35.75  ? 728 HOH A O     1 
HETATM 9341 O O     . HOH G 5 .   ? 7.029   -17.289 41.865  1.00 41.10  ? 729 HOH A O     1 
HETATM 9342 O O     . HOH G 5 .   ? 9.985   8.544   15.461  1.00 41.18  ? 730 HOH A O     1 
HETATM 9343 O O     . HOH G 5 .   ? 10.202  37.852  81.436  1.00 34.81  ? 731 HOH A O     1 
HETATM 9344 O O     . HOH G 5 .   ? 10.817  6.540   58.062  1.00 41.79  ? 732 HOH A O     1 
HETATM 9345 O O     . HOH G 5 .   ? 12.947  -16.910 14.189  1.00 58.33  ? 733 HOH A O     1 
HETATM 9346 O O     . HOH G 5 .   ? 14.788  23.703  2.301   1.00 44.88  ? 734 HOH A O     1 
HETATM 9347 O O     . HOH G 5 .   ? 18.573  14.009  33.783  1.00 30.15  ? 735 HOH A O     1 
HETATM 9348 O O     . HOH G 5 .   ? 18.743  42.864  57.090  1.00 45.10  ? 736 HOH A O     1 
HETATM 9349 O O     . HOH G 5 .   ? 24.005  -14.530 49.850  1.00 38.14  ? 737 HOH A O     1 
HETATM 9350 O O     . HOH G 5 .   ? 24.913  45.503  9.673   1.00 40.22  ? 738 HOH A O     1 
HETATM 9351 O O     . HOH G 5 .   ? 32.209  -17.175 36.024  1.00 42.28  ? 739 HOH A O     1 
HETATM 9352 O O     . HOH G 5 .   ? 27.595  30.276  76.248  1.00 36.95  ? 740 HOH A O     1 
HETATM 9353 O O     . HOH G 5 .   ? -6.719  26.809  10.921  1.00 32.62  ? 741 HOH A O     1 
HETATM 9354 O O     . HOH G 5 .   ? -2.397  32.044  13.726  1.00 32.78  ? 742 HOH A O     1 
HETATM 9355 O O     . HOH G 5 .   ? 0.550   7.359   45.959  1.00 33.60  ? 743 HOH A O     1 
HETATM 9356 O O     . HOH G 5 .   ? 12.856  31.185  41.776  1.00 34.48  ? 744 HOH A O     1 
HETATM 9357 O O     . HOH G 5 .   ? 16.625  22.674  34.547  1.00 34.36  ? 745 HOH A O     1 
HETATM 9358 O O     . HOH G 5 .   ? -16.165 29.431  33.407  1.00 36.52  ? 746 HOH A O     1 
HETATM 9359 O O     . HOH G 5 .   ? -11.150 25.618  16.185  1.00 28.09  ? 747 HOH A O     1 
HETATM 9360 O O     . HOH G 5 .   ? -10.992 23.829  18.387  1.00 23.98  ? 748 HOH A O     1 
HETATM 9361 O O     . HOH G 5 .   ? 32.641  21.780  47.500  1.00 45.36  ? 749 HOH A O     1 
HETATM 9362 O O     . HOH G 5 .   ? 23.759  18.421  54.032  1.00 33.00  ? 750 HOH A O     1 
HETATM 9363 O O     . HOH G 5 .   ? 4.789   43.601  65.865  1.00 45.16  ? 751 HOH A O     1 
HETATM 9364 O O     . HOH H 5 .   ? -14.214 -5.555  -11.953 1.00 30.37  ? 566 HOH B O     1 
HETATM 9365 O O     . HOH H 5 .   ? 7.739   17.945  -9.118  1.00 48.56  ? 567 HOH B O     1 
HETATM 9366 O O     . HOH H 5 .   ? 18.047  9.093   35.431  1.00 28.69  ? 568 HOH B O     1 
HETATM 9367 O O     . HOH H 5 .   ? -8.218  -18.325 1.743   1.00 24.31  ? 569 HOH B O     1 
HETATM 9368 O O     . HOH H 5 .   ? 12.987  7.302   29.001  1.00 18.99  ? 570 HOH B O     1 
HETATM 9369 O O     . HOH H 5 .   ? 15.317  5.427   -5.743  1.00 30.01  ? 571 HOH B O     1 
HETATM 9370 O O     . HOH H 5 .   ? -16.134 17.382  54.693  1.00 37.55  ? 572 HOH B O     1 
HETATM 9371 O O     . HOH H 5 .   ? -6.059  19.785  6.618   1.00 21.93  ? 573 HOH B O     1 
HETATM 9372 O O     . HOH H 5 .   ? 6.955   -7.006  37.025  1.00 32.69  ? 574 HOH B O     1 
HETATM 9373 O O     . HOH H 5 .   ? -24.720 15.329  49.755  1.00 37.81  ? 575 HOH B O     1 
HETATM 9374 O O     . HOH H 5 .   ? -21.787 25.630  35.088  1.00 49.85  ? 576 HOH B O     1 
HETATM 9375 O O     . HOH H 5 .   ? -20.379 -15.008 -10.182 1.00 32.50  ? 577 HOH B O     1 
HETATM 9376 O O     . HOH H 5 .   ? -10.451 -4.926  -17.641 1.00 30.99  ? 578 HOH B O     1 
HETATM 9377 O O     . HOH H 5 .   ? -4.989  3.769   21.542  1.00 15.10  ? 579 HOH B O     1 
HETATM 9378 O O     . HOH H 5 .   ? -7.079  -20.190 -10.713 1.00 11.90  ? 580 HOH B O     1 
HETATM 9379 O O     . HOH H 5 .   ? 17.853  30.119  8.576   1.00 42.95  ? 581 HOH B O     1 
HETATM 9380 O O     . HOH H 5 .   ? -3.430  25.162  10.712  1.00 28.03  ? 582 HOH B O     1 
HETATM 9381 O O     . HOH H 5 .   ? -3.640  21.075  -0.420  1.00 21.27  ? 583 HOH B O     1 
HETATM 9382 O O     . HOH H 5 .   ? -1.324  -20.198 -5.682  1.00 27.36  ? 584 HOH B O     1 
HETATM 9383 O O     . HOH H 5 .   ? 0.234   2.679   13.018  1.00 25.77  ? 585 HOH B O     1 
HETATM 9384 O O     . HOH H 5 .   ? 1.279   21.458  11.082  1.00 33.28  ? 586 HOH B O     1 
HETATM 9385 O O     . HOH H 5 .   ? 14.655  -11.701 23.623  1.00 30.86  ? 587 HOH B O     1 
HETATM 9386 O O     . HOH H 5 .   ? 25.498  29.468  34.890  1.00 34.00  ? 588 HOH B O     1 
HETATM 9387 O O     . HOH H 5 .   ? -26.228 21.925  43.214  1.00 56.52  ? 589 HOH B O     1 
HETATM 9388 O O     . HOH H 5 .   ? -20.083 16.171  24.432  1.00 42.76  ? 590 HOH B O     1 
HETATM 9389 O O     . HOH H 5 .   ? -17.081 -7.452  -7.864  1.00 21.45  ? 591 HOH B O     1 
HETATM 9390 O O     . HOH H 5 .   ? -15.705 3.912   30.373  1.00 26.65  ? 592 HOH B O     1 
HETATM 9391 O O     . HOH H 5 .   ? -11.972 16.263  4.374   1.00 31.38  ? 593 HOH B O     1 
HETATM 9392 O O     . HOH H 5 .   ? -9.712  -19.782 -10.360 1.00 11.89  ? 594 HOH B O     1 
HETATM 9393 O O     . HOH H 5 .   ? -9.286  7.567   -20.895 1.00 35.16  ? 595 HOH B O     1 
HETATM 9394 O O     . HOH H 5 .   ? -8.093  11.349  -16.719 1.00 41.95  ? 596 HOH B O     1 
HETATM 9395 O O     . HOH H 5 .   ? -2.913  9.336   21.047  1.00 27.07  ? 597 HOH B O     1 
HETATM 9396 O O     . HOH H 5 .   ? -0.039  0.686   10.560  1.00 41.54  ? 598 HOH B O     1 
HETATM 9397 O O     . HOH H 5 .   ? 0.727   10.968  6.947   1.00 37.79  ? 599 HOH B O     1 
HETATM 9398 O O     . HOH H 5 .   ? 7.918   -7.092  -0.554  1.00 29.20  ? 600 HOH B O     1 
HETATM 9399 O O     . HOH H 5 .   ? 15.739  7.711   28.108  1.00 25.74  ? 601 HOH B O     1 
HETATM 9400 O O     . HOH H 5 .   ? 25.962  10.196  20.457  1.00 39.87  ? 602 HOH B O     1 
HETATM 9401 O O     . HOH H 5 .   ? -18.969 24.522  40.820  1.00 18.56  ? 603 HOH B O     1 
HETATM 9402 O O     . HOH H 5 .   ? -17.058 20.808  51.652  1.00 30.85  ? 604 HOH B O     1 
HETATM 9403 O O     . HOH H 5 .   ? -15.804 16.225  13.454  1.00 30.49  ? 605 HOH B O     1 
HETATM 9404 O O     . HOH H 5 .   ? -14.884 4.968   3.243   1.00 9.07   ? 606 HOH B O     1 
HETATM 9405 O O     . HOH H 5 .   ? -3.554  -20.942 -5.327  1.00 23.35  ? 607 HOH B O     1 
HETATM 9406 O O     . HOH H 5 .   ? -6.588  -11.744 12.788  1.00 57.62  ? 608 HOH B O     1 
HETATM 9407 O O     . HOH H 5 .   ? -4.491  -19.104 -12.253 1.00 15.89  ? 609 HOH B O     1 
HETATM 9408 O O     . HOH H 5 .   ? -3.473  5.083   6.299   1.00 13.08  ? 610 HOH B O     1 
HETATM 9409 O O     . HOH H 5 .   ? -1.265  28.643  -1.609  1.00 25.48  ? 611 HOH B O     1 
HETATM 9410 O O     . HOH H 5 .   ? 1.756   -0.216  3.271   1.00 7.82   ? 612 HOH B O     1 
HETATM 9411 O O     . HOH H 5 .   ? 1.665   7.185   38.643  1.00 13.18  ? 613 HOH B O     1 
HETATM 9412 O O     . HOH H 5 .   ? 2.702   16.761  47.157  1.00 21.77  ? 614 HOH B O     1 
HETATM 9413 O O     . HOH H 5 .   ? 5.080   -4.576  43.403  1.00 24.88  ? 615 HOH B O     1 
HETATM 9414 O O     . HOH H 5 .   ? 6.244   8.496   -9.320  1.00 36.92  ? 616 HOH B O     1 
HETATM 9415 O O     . HOH H 5 .   ? 25.476  -5.152  37.987  1.00 29.96  ? 617 HOH B O     1 
HETATM 9416 O O     . HOH H 5 .   ? 28.381  -11.330 38.209  1.00 38.53  ? 618 HOH B O     1 
HETATM 9417 O O     . HOH H 5 .   ? 30.093  33.758  47.643  1.00 15.77  ? 619 HOH B O     1 
HETATM 9418 O O     . HOH H 5 .   ? -17.451 19.169  53.427  1.00 49.81  ? 620 HOH B O     1 
HETATM 9419 O O     . HOH H 5 .   ? -9.238  -21.606 -8.514  1.00 36.83  ? 621 HOH B O     1 
HETATM 9420 O O     . HOH H 5 .   ? -7.303  -18.134 -18.373 1.00 36.50  ? 622 HOH B O     1 
HETATM 9421 O O     . HOH H 5 .   ? -7.483  14.486  49.130  1.00 32.92  ? 623 HOH B O     1 
HETATM 9422 O O     . HOH H 5 .   ? -0.187  -6.858  3.287   1.00 45.71  ? 624 HOH B O     1 
HETATM 9423 O O     . HOH H 5 .   ? 2.754   3.500   -20.602 1.00 38.47  ? 625 HOH B O     1 
HETATM 9424 O O     . HOH H 5 .   ? 6.180   11.134  34.024  1.00 16.98  ? 626 HOH B O     1 
HETATM 9425 O O     . HOH H 5 .   ? 12.664  14.126  31.074  1.00 20.57  ? 627 HOH B O     1 
HETATM 9426 O O     . HOH H 5 .   ? -18.334 4.410   33.274  1.00 27.79  ? 628 HOH B O     1 
HETATM 9427 O O     . HOH H 5 .   ? -12.679 10.334  -18.191 1.00 29.05  ? 629 HOH B O     1 
HETATM 9428 O O     . HOH H 5 .   ? -5.075  13.971  4.608   1.00 28.45  ? 630 HOH B O     1 
HETATM 9429 O O     . HOH H 5 .   ? -2.408  3.684   12.352  1.00 20.43  ? 631 HOH B O     1 
HETATM 9430 O O     . HOH H 5 .   ? -0.021  -9.166  1.009   1.00 26.21  ? 632 HOH B O     1 
HETATM 9431 O O     . HOH H 5 .   ? 13.473  19.564  40.534  1.00 34.11  ? 633 HOH B O     1 
HETATM 9432 O O     . HOH H 5 .   ? 7.410   13.275  9.193   1.00 36.12  ? 634 HOH B O     1 
HETATM 9433 O O     . HOH H 5 .   ? -23.438 -9.053  -10.553 1.00 34.14  ? 635 HOH B O     1 
HETATM 9434 O O     . HOH H 5 .   ? -21.071 21.828  47.001  1.00 32.14  ? 636 HOH B O     1 
HETATM 9435 O O     . HOH H 5 .   ? -17.566 5.872   31.483  1.00 32.93  ? 637 HOH B O     1 
HETATM 9436 O O     . HOH H 5 .   ? -15.700 9.855   -19.434 1.00 39.32  ? 638 HOH B O     1 
HETATM 9437 O O     . HOH H 5 .   ? -9.001  -19.862 -0.490  1.00 45.31  ? 639 HOH B O     1 
HETATM 9438 O O     . HOH H 5 .   ? -8.540  27.468  46.916  1.00 21.56  ? 640 HOH B O     1 
HETATM 9439 O O     . HOH H 5 .   ? -7.423  5.084   13.306  1.00 29.59  ? 641 HOH B O     1 
HETATM 9440 O O     . HOH H 5 .   ? 1.881   13.547  40.722  1.00 53.98  ? 642 HOH B O     1 
HETATM 9441 O O     . HOH H 5 .   ? 4.019   -15.024 36.070  1.00 40.76  ? 643 HOH B O     1 
HETATM 9442 O O     . HOH H 5 .   ? 6.295   -16.979 33.547  1.00 46.86  ? 644 HOH B O     1 
HETATM 9443 O O     . HOH H 5 .   ? 20.609  -7.835  17.115  1.00 46.35  ? 645 HOH B O     1 
HETATM 9444 O O     . HOH H 5 .   ? 27.653  -4.691  36.058  1.00 27.57  ? 646 HOH B O     1 
HETATM 9445 O O     . HOH H 5 .   ? 37.468  31.508  30.797  1.00 32.33  ? 647 HOH B O     1 
HETATM 9446 O O     . HOH H 5 .   ? -25.597 9.494   16.962  1.00 34.23  ? 648 HOH B O     1 
HETATM 9447 O O     . HOH H 5 .   ? -17.721 -16.657 -9.699  1.00 38.44  ? 649 HOH B O     1 
HETATM 9448 O O     . HOH H 5 .   ? -10.568 -17.948 3.064   1.00 34.97  ? 650 HOH B O     1 
HETATM 9449 O O     . HOH H 5 .   ? -8.765  -13.792 -12.189 1.00 22.65  ? 651 HOH B O     1 
HETATM 9450 O O     . HOH H 5 .   ? -9.950  -6.497  -21.203 1.00 32.10  ? 652 HOH B O     1 
HETATM 9451 O O     . HOH H 5 .   ? -8.522  5.348   16.059  1.00 26.78  ? 653 HOH B O     1 
HETATM 9452 O O     . HOH H 5 .   ? -5.475  13.764  1.714   1.00 23.12  ? 654 HOH B O     1 
HETATM 9453 O O     . HOH H 5 .   ? -1.789  9.442   7.394   1.00 24.73  ? 655 HOH B O     1 
HETATM 9454 O O     . HOH H 5 .   ? 0.452   -13.332 -15.387 1.00 27.11  ? 656 HOH B O     1 
HETATM 9455 O O     . HOH H 5 .   ? 2.669   -12.871 -13.529 1.00 46.04  ? 657 HOH B O     1 
HETATM 9456 O O     . HOH H 5 .   ? 2.478   13.191  -13.838 1.00 38.54  ? 658 HOH B O     1 
HETATM 9457 O O     . HOH H 5 .   ? 5.092   7.773   -16.575 1.00 42.02  ? 659 HOH B O     1 
HETATM 9458 O O     . HOH H 5 .   ? 14.912  18.485  44.484  1.00 39.72  ? 660 HOH B O     1 
HETATM 9459 O O     . HOH H 5 .   ? 10.353  -7.871  1.266   1.00 57.93  ? 661 HOH B O     1 
HETATM 9460 O O     . HOH H 5 .   ? 28.902  -2.535  36.095  1.00 34.30  ? 662 HOH B O     1 
HETATM 9461 O O     . HOH H 5 .   ? 29.288  3.769   31.747  1.00 39.34  ? 663 HOH B O     1 
HETATM 9462 O O     . HOH H 5 .   ? -27.219 16.403  49.427  1.00 34.39  ? 664 HOH B O     1 
HETATM 9463 O O     . HOH H 5 .   ? -22.596 -3.831  -7.637  1.00 31.19  ? 665 HOH B O     1 
HETATM 9464 O O     . HOH H 5 .   ? -14.760 11.274  15.158  1.00 29.63  ? 666 HOH B O     1 
HETATM 9465 O O     . HOH H 5 .   ? 5.280   -0.753  10.531  1.00 39.52  ? 667 HOH B O     1 
HETATM 9466 O O     . HOH H 5 .   ? 10.374  2.917   -14.534 1.00 41.69  ? 668 HOH B O     1 
HETATM 9467 O O     . HOH H 5 .   ? 15.217  3.924   16.895  1.00 67.94  ? 669 HOH B O     1 
HETATM 9468 O O     . HOH H 5 .   ? 25.080  -13.386 26.431  1.00 39.02  ? 670 HOH B O     1 
HETATM 9469 O O     . HOH H 5 .   ? 25.481  35.241  39.469  1.00 37.46  ? 671 HOH B O     1 
HETATM 9470 O O     . HOH H 5 .   ? 28.129  0.154   34.769  1.00 33.29  ? 672 HOH B O     1 
HETATM 9471 O O     . HOH H 5 .   ? 36.371  28.558  27.208  1.00 35.45  ? 673 HOH B O     1 
HETATM 9472 O O     . HOH H 5 .   ? 11.508  12.881  19.275  1.00 37.30  ? 674 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   1   1   DG  G   C . n 
A 1 2   DT  2   2   2   DT  T   C . n 
A 1 3   DT  3   3   3   DT  T   C . n 
A 1 4   DT  4   4   4   DT  T   C . n 
A 1 5   DT  5   5   5   DT  T   C . n 
A 1 6   DT  6   6   6   DT  T   C . n 
A 1 7   DA  7   7   7   DA  A   C . n 
A 1 8   DG  8   8   8   DG  G   C . n 
A 1 9   DT  9   9   9   DT  T   C . n 
A 1 10  DT  10  10  10  DT  T   C . n 
A 1 11  DT  11  11  11  DT  T   C . n 
A 1 12  DA  12  12  12  DA  A   C . n 
A 1 13  DT  13  13  13  DT  T   C . n 
A 1 14  DT  14  14  14  DT  T   C . n 
A 1 15  DG  15  15  15  DG  G   C . n 
A 1 16  DG  16  16  16  DG  G   C . n 
A 1 17  DG  17  17  17  DG  G   C . n 
A 1 18  DC  18  18  18  DC  C   C . n 
A 1 19  DG  19  19  ?   ?   ?   C . n 
A 1 20  DC  20  20  ?   ?   ?   C . n 
A 1 21  DG  21  21  ?   ?   ?   C . n 
B 2 1   DC  1   1   ?   ?   ?   D . n 
B 2 2   DG  2   2   ?   ?   ?   D . n 
B 2 3   DC  3   3   ?   ?   ?   D . n 
B 2 4   DG  4   4   4   DG  G   D . n 
B 2 5   DC  5   5   5   DC  C   D . n 
B 2 6   DC  6   6   6   DC  C   D . n 
B 2 7   DC  7   7   7   DC  C   D . n 
B 2 8   DA  8   8   8   DA  A   D . n 
B 2 9   DG  9   9   9   DG  G   D . n 
B 2 10  DC  10  10  10  DC  C   D . n 
B 2 11  DT  11  11  11  DT  T   D . n 
B 2 12  DT  12  12  12  DT  T   D . n 
B 2 13  DT  13  13  13  DT  T   D . n 
B 2 14  DC  14  14  14  DC  C   D . n 
B 2 15  DC  15  15  15  DC  C   D . n 
B 2 16  DC  16  16  16  DC  C   D . n 
B 2 17  DA  17  17  17  DA  A   D . n 
B 2 18  DG  18  18  18  DG  G   D . n 
B 2 19  DC  19  19  19  DC  C   D . n 
B 2 20  DT  20  20  20  DT  T   D . n 
B 2 21  DA  21  21  21  DA  A   D . n 
B 2 22  DA  22  22  22  DA  A   D . n 
B 2 23  DT  23  23  23  DT  T   D . n 
B 2 24  DA  24  24  24  DA  A   D . n 
B 2 25  DA  25  25  25  DA  A   D . n 
B 2 26  DA  26  26  26  DA  A   D . n 
B 2 27  DC  27  27  27  DC  C   D . n 
B 2 28  DT  28  28  28  DT  T   D . n 
B 2 29  DA  29  29  29  DA  A   D . n 
B 2 30  DA  30  30  30  DA  A   D . n 
B 2 31  DA  31  31  31  DA  A   D . n 
B 2 32  DA  32  32  32  DA  A   D . n 
B 2 33  DA  33  33  33  DA  A   D . n 
B 2 34  DC  34  34  34  DC  C   D . n 
C 3 1   MET 1   1   ?   ?   ?   A . n 
C 3 2   SER 2   2   ?   ?   ?   A . n 
C 3 3   GLY 3   3   ?   ?   ?   A . n 
C 3 4   TRP 4   4   ?   ?   ?   A . n 
C 3 5   GLU 5   5   ?   ?   ?   A . n 
C 3 6   SER 6   6   ?   ?   ?   A . n 
C 3 7   TYR 7   7   ?   ?   ?   A . n 
C 3 8   TYR 8   8   ?   ?   ?   A . n 
C 3 9   LYS 9   9   ?   ?   ?   A . n 
C 3 10  THR 10  10  ?   ?   ?   A . n 
C 3 11  GLU 11  11  ?   ?   ?   A . n 
C 3 12  GLY 12  12  ?   ?   ?   A . n 
C 3 13  ASP 13  13  ?   ?   ?   A . n 
C 3 14  GLU 14  14  ?   ?   ?   A . n 
C 3 15  GLU 15  15  ?   ?   ?   A . n 
C 3 16  ALA 16  16  ?   ?   ?   A . n 
C 3 17  GLU 17  17  ?   ?   ?   A . n 
C 3 18  GLU 18  18  ?   ?   ?   A . n 
C 3 19  GLU 19  19  ?   ?   ?   A . n 
C 3 20  GLN 20  20  ?   ?   ?   A . n 
C 3 21  GLU 21  21  ?   ?   ?   A . n 
C 3 22  GLU 22  22  ?   ?   ?   A . n 
C 3 23  ASN 23  23  ?   ?   ?   A . n 
C 3 24  LEU 24  24  ?   ?   ?   A . n 
C 3 25  GLU 25  25  ?   ?   ?   A . n 
C 3 26  ALA 26  26  ?   ?   ?   A . n 
C 3 27  SER 27  27  ?   ?   ?   A . n 
C 3 28  GLY 28  28  ?   ?   ?   A . n 
C 3 29  ASP 29  29  ?   ?   ?   A . n 
C 3 30  TYR 30  30  ?   ?   ?   A . n 
C 3 31  LYS 31  31  ?   ?   ?   A . n 
C 3 32  TYR 32  32  ?   ?   ?   A . n 
C 3 33  SER 33  33  ?   ?   ?   A . n 
C 3 34  GLY 34  34  34  GLY GLY A . n 
C 3 35  ARG 35  35  35  ARG ARG A . n 
C 3 36  ASP 36  36  36  ASP ASP A . n 
C 3 37  SER 37  37  37  SER SER A . n 
C 3 38  LEU 38  38  38  LEU LEU A . n 
C 3 39  ILE 39  39  39  ILE ILE A . n 
C 3 40  PHE 40  40  40  PHE PHE A . n 
C 3 41  LEU 41  41  41  LEU LEU A . n 
C 3 42  VAL 42  42  42  VAL VAL A . n 
C 3 43  ASP 43  43  43  ASP ASP A . n 
C 3 44  ALA 44  44  44  ALA ALA A . n 
C 3 45  SER 45  45  45  SER SER A . n 
C 3 46  LYS 46  46  46  LYS LYS A . n 
C 3 47  ALA 47  47  47  ALA ALA A . n 
C 3 48  MET 48  48  48  MET MET A . n 
C 3 49  PHE 49  49  49  PHE PHE A . n 
C 3 50  GLU 50  50  50  GLU GLU A . n 
C 3 51  SER 51  51  51  SER SER A . n 
C 3 52  GLN 52  52  52  GLN GLN A . n 
C 3 53  SER 53  53  53  SER SER A . n 
C 3 54  GLU 54  54  54  GLU GLU A . n 
C 3 55  ASP 55  55  55  ASP ASP A . n 
C 3 56  GLU 56  56  56  GLU GLU A . n 
C 3 57  LEU 57  57  57  LEU LEU A . n 
C 3 58  THR 58  58  58  THR THR A . n 
C 3 59  PRO 59  59  59  PRO PRO A . n 
C 3 60  PHE 60  60  60  PHE PHE A . n 
C 3 61  ASP 61  61  61  ASP ASP A . n 
C 3 62  MET 62  62  62  MET MET A . n 
C 3 63  SER 63  63  63  SER SER A . n 
C 3 64  ILE 64  64  64  ILE ILE A . n 
C 3 65  GLN 65  65  65  GLN GLN A . n 
C 3 66  CYS 66  66  66  CYS CYS A . n 
C 3 67  ILE 67  67  67  ILE ILE A . n 
C 3 68  GLN 68  68  68  GLN GLN A . n 
C 3 69  SER 69  69  69  SER SER A . n 
C 3 70  VAL 70  70  70  VAL VAL A . n 
C 3 71  TYR 71  71  71  TYR TYR A . n 
C 3 72  ILE 72  72  72  ILE ILE A . n 
C 3 73  SER 73  73  73  SER SER A . n 
C 3 74  LYS 74  74  74  LYS LYS A . n 
C 3 75  ILE 75  75  75  ILE ILE A . n 
C 3 76  ILE 76  76  76  ILE ILE A . n 
C 3 77  SER 77  77  77  SER SER A . n 
C 3 78  SER 78  78  78  SER SER A . n 
C 3 79  ASP 79  79  79  ASP ASP A . n 
C 3 80  ARG 80  80  80  ARG ARG A . n 
C 3 81  ASP 81  81  81  ASP ASP A . n 
C 3 82  LEU 82  82  82  LEU LEU A . n 
C 3 83  LEU 83  83  83  LEU LEU A . n 
C 3 84  ALA 84  84  84  ALA ALA A . n 
C 3 85  VAL 85  85  85  VAL VAL A . n 
C 3 86  VAL 86  86  86  VAL VAL A . n 
C 3 87  PHE 87  87  87  PHE PHE A . n 
C 3 88  TYR 88  88  88  TYR TYR A . n 
C 3 89  GLY 89  89  89  GLY GLY A . n 
C 3 90  THR 90  90  90  THR THR A . n 
C 3 91  GLU 91  91  91  GLU GLU A . n 
C 3 92  LYS 92  92  92  LYS LYS A . n 
C 3 93  ASP 93  93  93  ASP ASP A . n 
C 3 94  LYS 94  94  94  LYS LYS A . n 
C 3 95  ASN 95  95  95  ASN ASN A . n 
C 3 96  SER 96  96  96  SER SER A . n 
C 3 97  VAL 97  97  97  VAL VAL A . n 
C 3 98  ASN 98  98  98  ASN ASN A . n 
C 3 99  PHE 99  99  99  PHE PHE A . n 
C 3 100 LYS 100 100 100 LYS LYS A . n 
C 3 101 ASN 101 101 101 ASN ASN A . n 
C 3 102 ILE 102 102 102 ILE ILE A . n 
C 3 103 TYR 103 103 103 TYR TYR A . n 
C 3 104 VAL 104 104 104 VAL VAL A . n 
C 3 105 LEU 105 105 105 LEU LEU A . n 
C 3 106 GLN 106 106 106 GLN GLN A . n 
C 3 107 GLU 107 107 107 GLU GLU A . n 
C 3 108 LEU 108 108 108 LEU LEU A . n 
C 3 109 ASP 109 109 109 ASP ASP A . n 
C 3 110 ASN 110 110 110 ASN ASN A . n 
C 3 111 PRO 111 111 111 PRO PRO A . n 
C 3 112 GLY 112 112 112 GLY GLY A . n 
C 3 113 ALA 113 113 113 ALA ALA A . n 
C 3 114 LYS 114 114 114 LYS LYS A . n 
C 3 115 ARG 115 115 115 ARG ARG A . n 
C 3 116 ILE 116 116 116 ILE ILE A . n 
C 3 117 LEU 117 117 117 LEU LEU A . n 
C 3 118 GLU 118 118 118 GLU GLU A . n 
C 3 119 LEU 119 119 119 LEU LEU A . n 
C 3 120 ASP 120 120 120 ASP ASP A . n 
C 3 121 GLN 121 121 121 GLN GLN A . n 
C 3 122 PHE 122 122 122 PHE PHE A . n 
C 3 123 LYS 123 123 123 LYS LYS A . n 
C 3 124 GLY 124 124 124 GLY GLY A . n 
C 3 125 GLN 125 125 125 GLN GLN A . n 
C 3 126 GLN 126 126 126 GLN GLN A . n 
C 3 127 GLY 127 127 127 GLY GLY A . n 
C 3 128 GLN 128 128 128 GLN GLN A . n 
C 3 129 LYS 129 129 129 LYS LYS A . n 
C 3 130 ARG 130 130 130 ARG ARG A . n 
C 3 131 PHE 131 131 131 PHE PHE A . n 
C 3 132 GLN 132 132 132 GLN GLN A . n 
C 3 133 ASP 133 133 133 ASP ASP A . n 
C 3 134 MET 134 134 134 MET MET A . n 
C 3 135 MET 135 135 135 MET MET A . n 
C 3 136 GLY 136 136 136 GLY GLY A . n 
C 3 137 HIS 137 137 137 HIS HIS A . n 
C 3 138 GLY 138 138 138 GLY GLY A . n 
C 3 139 SER 139 139 139 SER SER A . n 
C 3 140 ASP 140 140 140 ASP ASP A . n 
C 3 141 TYR 141 141 141 TYR TYR A . n 
C 3 142 SER 142 142 142 SER SER A . n 
C 3 143 LEU 143 143 143 LEU LEU A . n 
C 3 144 SER 144 144 144 SER SER A . n 
C 3 145 GLU 145 145 145 GLU GLU A . n 
C 3 146 VAL 146 146 146 VAL VAL A . n 
C 3 147 LEU 147 147 147 LEU LEU A . n 
C 3 148 TRP 148 148 148 TRP TRP A . n 
C 3 149 VAL 149 149 149 VAL VAL A . n 
C 3 150 CYS 150 150 150 CYS CYS A . n 
C 3 151 ALA 151 151 151 ALA ALA A . n 
C 3 152 ASN 152 152 152 ASN ASN A . n 
C 3 153 LEU 153 153 153 LEU LEU A . n 
C 3 154 PHE 154 154 154 PHE PHE A . n 
C 3 155 SER 155 155 155 SER SER A . n 
C 3 156 ASP 156 156 156 ASP ASP A . n 
C 3 157 VAL 157 157 157 VAL VAL A . n 
C 3 158 GLN 158 158 158 GLN GLN A . n 
C 3 159 PHE 159 159 159 PHE PHE A . n 
C 3 160 LYS 160 160 160 LYS LYS A . n 
C 3 161 MET 161 161 161 MET MET A . n 
C 3 162 SER 162 162 162 SER SER A . n 
C 3 163 HIS 163 163 163 HIS HIS A . n 
C 3 164 LYS 164 164 164 LYS LYS A . n 
C 3 165 ARG 165 165 165 ARG ARG A . n 
C 3 166 ILE 166 166 166 ILE ILE A . n 
C 3 167 MET 167 167 167 MET MET A . n 
C 3 168 LEU 168 168 168 LEU LEU A . n 
C 3 169 PHE 169 169 169 PHE PHE A . n 
C 3 170 THR 170 170 170 THR THR A . n 
C 3 171 ASN 171 171 171 ASN ASN A . n 
C 3 172 GLU 172 172 172 GLU GLU A . n 
C 3 173 ASP 173 173 173 ASP ASP A . n 
C 3 174 ASN 174 174 174 ASN ASN A . n 
C 3 175 PRO 175 175 175 PRO PRO A . n 
C 3 176 HIS 176 176 176 HIS HIS A . n 
C 3 177 GLY 177 177 177 GLY GLY A . n 
C 3 178 ASN 178 178 178 ASN ASN A . n 
C 3 179 ASP 179 179 179 ASP ASP A . n 
C 3 180 SER 180 180 180 SER SER A . n 
C 3 181 ALA 181 181 181 ALA ALA A . n 
C 3 182 LYS 182 182 182 LYS LYS A . n 
C 3 183 ALA 183 183 183 ALA ALA A . n 
C 3 184 SER 184 184 184 SER SER A . n 
C 3 185 ARG 185 185 185 ARG ARG A . n 
C 3 186 ALA 186 186 186 ALA ALA A . n 
C 3 187 ARG 187 187 187 ARG ARG A . n 
C 3 188 THR 188 188 188 THR THR A . n 
C 3 189 LYS 189 189 189 LYS LYS A . n 
C 3 190 ALA 190 190 190 ALA ALA A . n 
C 3 191 GLY 191 191 191 GLY GLY A . n 
C 3 192 ASP 192 192 192 ASP ASP A . n 
C 3 193 LEU 193 193 193 LEU LEU A . n 
C 3 194 ARG 194 194 194 ARG ARG A . n 
C 3 195 ASP 195 195 195 ASP ASP A . n 
C 3 196 THR 196 196 196 THR THR A . n 
C 3 197 GLY 197 197 197 GLY GLY A . n 
C 3 198 ILE 198 198 198 ILE ILE A . n 
C 3 199 PHE 199 199 199 PHE PHE A . n 
C 3 200 LEU 200 200 200 LEU LEU A . n 
C 3 201 ASP 201 201 201 ASP ASP A . n 
C 3 202 LEU 202 202 202 LEU LEU A . n 
C 3 203 MET 203 203 203 MET MET A . n 
C 3 204 HIS 204 204 204 HIS HIS A . n 
C 3 205 LEU 205 205 205 LEU LEU A . n 
C 3 206 LYS 206 206 206 LYS LYS A . n 
C 3 207 LYS 207 207 207 LYS LYS A . n 
C 3 208 PRO 208 208 208 PRO PRO A . n 
C 3 209 GLY 209 209 209 GLY GLY A . n 
C 3 210 GLY 210 210 210 GLY GLY A . n 
C 3 211 PHE 211 211 211 PHE PHE A . n 
C 3 212 ASP 212 212 212 ASP ASP A . n 
C 3 213 ILE 213 213 213 ILE ILE A . n 
C 3 214 SER 214 214 214 SER SER A . n 
C 3 215 LEU 215 215 215 LEU LEU A . n 
C 3 216 PHE 216 216 216 PHE PHE A . n 
C 3 217 TYR 217 217 217 TYR TYR A . n 
C 3 218 ARG 218 218 218 ARG ARG A . n 
C 3 219 ASP 219 219 219 ASP ASP A . n 
C 3 220 ILE 220 220 220 ILE ILE A . n 
C 3 221 ILE 221 221 221 ILE ILE A . n 
C 3 222 SER 222 222 222 SER SER A . n 
C 3 223 ILE 223 223 ?   ?   ?   A . n 
C 3 224 ALA 224 224 ?   ?   ?   A . n 
C 3 225 GLU 225 225 ?   ?   ?   A . n 
C 3 226 ASP 226 226 ?   ?   ?   A . n 
C 3 227 GLU 227 227 ?   ?   ?   A . n 
C 3 228 ASP 228 228 ?   ?   ?   A . n 
C 3 229 LEU 229 229 ?   ?   ?   A . n 
C 3 230 ARG 230 230 ?   ?   ?   A . n 
C 3 231 VAL 231 231 231 VAL VAL A . n 
C 3 232 HIS 232 232 232 HIS HIS A . n 
C 3 233 PHE 233 233 233 PHE PHE A . n 
C 3 234 GLU 234 234 234 GLU GLU A . n 
C 3 235 GLU 235 235 235 GLU GLU A . n 
C 3 236 SER 236 236 236 SER SER A . n 
C 3 237 SER 237 237 237 SER SER A . n 
C 3 238 LYS 238 238 238 LYS LYS A . n 
C 3 239 LEU 239 239 239 LEU LEU A . n 
C 3 240 GLU 240 240 240 GLU GLU A . n 
C 3 241 ASP 241 241 241 ASP ASP A . n 
C 3 242 LEU 242 242 242 LEU LEU A . n 
C 3 243 LEU 243 243 243 LEU LEU A . n 
C 3 244 ARG 244 244 244 ARG ARG A . n 
C 3 245 LYS 245 245 245 LYS LYS A . n 
C 3 246 VAL 246 246 246 VAL VAL A . n 
C 3 247 ARG 247 247 247 ARG ARG A . n 
C 3 248 ALA 248 248 248 ALA ALA A . n 
C 3 249 LYS 249 249 249 LYS LYS A . n 
C 3 250 GLU 250 250 250 GLU GLU A . n 
C 3 251 THR 251 251 251 THR THR A . n 
C 3 252 ARG 252 252 252 ARG ARG A . n 
C 3 253 LYS 253 253 253 LYS LYS A . n 
C 3 254 ARG 254 254 254 ARG ARG A . n 
C 3 255 ALA 255 255 255 ALA ALA A . n 
C 3 256 LEU 256 256 256 LEU LEU A . n 
C 3 257 SER 257 257 257 SER SER A . n 
C 3 258 ARG 258 258 258 ARG ARG A . n 
C 3 259 LEU 259 259 259 LEU LEU A . n 
C 3 260 LYS 260 260 260 LYS LYS A . n 
C 3 261 LEU 261 261 261 LEU LEU A . n 
C 3 262 LYS 262 262 262 LYS LYS A . n 
C 3 263 LEU 263 263 263 LEU LEU A . n 
C 3 264 ASN 264 264 264 ASN ASN A . n 
C 3 265 LYS 265 265 265 LYS LYS A . n 
C 3 266 ASP 266 266 266 ASP ASP A . n 
C 3 267 ILE 267 267 267 ILE ILE A . n 
C 3 268 VAL 268 268 268 VAL VAL A . n 
C 3 269 ILE 269 269 269 ILE ILE A . n 
C 3 270 SER 270 270 270 SER SER A . n 
C 3 271 VAL 271 271 271 VAL VAL A . n 
C 3 272 GLY 272 272 272 GLY GLY A . n 
C 3 273 ILE 273 273 273 ILE ILE A . n 
C 3 274 TYR 274 274 274 TYR TYR A . n 
C 3 275 ASN 275 275 275 ASN ASN A . n 
C 3 276 LEU 276 276 276 LEU LEU A . n 
C 3 277 VAL 277 277 277 VAL VAL A . n 
C 3 278 GLN 278 278 278 GLN GLN A . n 
C 3 279 LYS 279 279 279 LYS LYS A . n 
C 3 280 ALA 280 280 280 ALA ALA A . n 
C 3 281 LEU 281 281 281 LEU LEU A . n 
C 3 282 LYS 282 282 282 LYS LYS A . n 
C 3 283 PRO 283 283 283 PRO PRO A . n 
C 3 284 PRO 284 284 284 PRO PRO A . n 
C 3 285 PRO 285 285 285 PRO PRO A . n 
C 3 286 ILE 286 286 286 ILE ILE A . n 
C 3 287 LYS 287 287 287 LYS LYS A . n 
C 3 288 LEU 288 288 288 LEU LEU A . n 
C 3 289 TYR 289 289 289 TYR TYR A . n 
C 3 290 ARG 290 290 290 ARG ARG A . n 
C 3 291 GLU 291 291 291 GLU GLU A . n 
C 3 292 THR 292 292 292 THR THR A . n 
C 3 293 ASN 293 293 293 ASN ASN A . n 
C 3 294 GLU 294 294 294 GLU GLU A . n 
C 3 295 PRO 295 295 295 PRO PRO A . n 
C 3 296 VAL 296 296 296 VAL VAL A . n 
C 3 297 LYS 297 297 297 LYS LYS A . n 
C 3 298 THR 298 298 298 THR THR A . n 
C 3 299 LYS 299 299 299 LYS LYS A . n 
C 3 300 THR 300 300 300 THR THR A . n 
C 3 301 ARG 301 301 301 ARG ARG A . n 
C 3 302 THR 302 302 302 THR THR A . n 
C 3 303 PHE 303 303 303 PHE PHE A . n 
C 3 304 ASN 304 304 304 ASN ASN A . n 
C 3 305 THR 305 305 305 THR THR A . n 
C 3 306 SER 306 306 306 SER SER A . n 
C 3 307 THR 307 307 307 THR THR A . n 
C 3 308 GLY 308 308 308 GLY GLY A . n 
C 3 309 GLY 309 309 309 GLY GLY A . n 
C 3 310 LEU 310 310 310 LEU LEU A . n 
C 3 311 LEU 311 311 311 LEU LEU A . n 
C 3 312 LEU 312 312 312 LEU LEU A . n 
C 3 313 PRO 313 313 313 PRO PRO A . n 
C 3 314 SER 314 314 314 SER SER A . n 
C 3 315 ASP 315 315 315 ASP ASP A . n 
C 3 316 THR 316 316 316 THR THR A . n 
C 3 317 LYS 317 317 317 LYS LYS A . n 
C 3 318 ARG 318 318 318 ARG ARG A . n 
C 3 319 SER 319 319 319 SER SER A . n 
C 3 320 GLN 320 320 320 GLN GLN A . n 
C 3 321 ILE 321 321 321 ILE ILE A . n 
C 3 322 TYR 322 322 322 TYR TYR A . n 
C 3 323 GLY 323 323 323 GLY GLY A . n 
C 3 324 SER 324 324 324 SER SER A . n 
C 3 325 ARG 325 325 325 ARG ARG A . n 
C 3 326 GLN 326 326 326 GLN GLN A . n 
C 3 327 ILE 327 327 327 ILE ILE A . n 
C 3 328 ILE 328 328 328 ILE ILE A . n 
C 3 329 LEU 329 329 329 LEU LEU A . n 
C 3 330 GLU 330 330 330 GLU GLU A . n 
C 3 331 LYS 331 331 331 LYS LYS A . n 
C 3 332 GLU 332 332 332 GLU GLU A . n 
C 3 333 GLU 333 333 333 GLU GLU A . n 
C 3 334 THR 334 334 334 THR THR A . n 
C 3 335 GLU 335 335 335 GLU GLU A . n 
C 3 336 GLU 336 336 336 GLU GLU A . n 
C 3 337 LEU 337 337 337 LEU LEU A . n 
C 3 338 LYS 338 338 338 LYS LYS A . n 
C 3 339 ARG 339 339 339 ARG ARG A . n 
C 3 340 PHE 340 340 340 PHE PHE A . n 
C 3 341 ASP 341 341 341 ASP ASP A . n 
C 3 342 ASP 342 342 342 ASP ASP A . n 
C 3 343 PRO 343 343 343 PRO PRO A . n 
C 3 344 GLY 344 344 344 GLY GLY A . n 
C 3 345 LEU 345 345 345 LEU LEU A . n 
C 3 346 MET 346 346 346 MET MET A . n 
C 3 347 LEU 347 347 347 LEU LEU A . n 
C 3 348 MET 348 348 348 MET MET A . n 
C 3 349 GLY 349 349 349 GLY GLY A . n 
C 3 350 PHE 350 350 350 PHE PHE A . n 
C 3 351 LYS 351 351 351 LYS LYS A . n 
C 3 352 PRO 352 352 352 PRO PRO A . n 
C 3 353 LEU 353 353 353 LEU LEU A . n 
C 3 354 VAL 354 354 354 VAL VAL A . n 
C 3 355 LEU 355 355 355 LEU LEU A . n 
C 3 356 LEU 356 356 356 LEU LEU A . n 
C 3 357 LYS 357 357 357 LYS LYS A . n 
C 3 358 LYS 358 358 358 LYS LYS A . n 
C 3 359 HIS 359 359 359 HIS HIS A . n 
C 3 360 HIS 360 360 360 HIS HIS A . n 
C 3 361 TYR 361 361 361 TYR TYR A . n 
C 3 362 LEU 362 362 362 LEU LEU A . n 
C 3 363 ARG 363 363 363 ARG ARG A . n 
C 3 364 PRO 364 364 364 PRO PRO A . n 
C 3 365 SER 365 365 365 SER SER A . n 
C 3 366 LEU 366 366 366 LEU LEU A . n 
C 3 367 PHE 367 367 367 PHE PHE A . n 
C 3 368 VAL 368 368 368 VAL VAL A . n 
C 3 369 TYR 369 369 369 TYR TYR A . n 
C 3 370 PRO 370 370 370 PRO PRO A . n 
C 3 371 GLU 371 371 371 GLU GLU A . n 
C 3 372 GLU 372 372 372 GLU GLU A . n 
C 3 373 SER 373 373 373 SER SER A . n 
C 3 374 LEU 374 374 374 LEU LEU A . n 
C 3 375 VAL 375 375 375 VAL VAL A . n 
C 3 376 ILE 376 376 376 ILE ILE A . n 
C 3 377 GLY 377 377 377 GLY GLY A . n 
C 3 378 SER 378 378 378 SER SER A . n 
C 3 379 SER 379 379 379 SER SER A . n 
C 3 380 THR 380 380 380 THR THR A . n 
C 3 381 LEU 381 381 381 LEU LEU A . n 
C 3 382 PHE 382 382 382 PHE PHE A . n 
C 3 383 SER 383 383 383 SER SER A . n 
C 3 384 ALA 384 384 384 ALA ALA A . n 
C 3 385 LEU 385 385 385 LEU LEU A . n 
C 3 386 LEU 386 386 386 LEU LEU A . n 
C 3 387 ILE 387 387 387 ILE ILE A . n 
C 3 388 LYS 388 388 388 LYS LYS A . n 
C 3 389 CYS 389 389 389 CYS CYS A . n 
C 3 390 LEU 390 390 390 LEU LEU A . n 
C 3 391 GLU 391 391 391 GLU GLU A . n 
C 3 392 LYS 392 392 392 LYS LYS A . n 
C 3 393 GLU 393 393 393 GLU GLU A . n 
C 3 394 VAL 394 394 394 VAL VAL A . n 
C 3 395 ALA 395 395 395 ALA ALA A . n 
C 3 396 ALA 396 396 396 ALA ALA A . n 
C 3 397 LEU 397 397 397 LEU LEU A . n 
C 3 398 CYS 398 398 398 CYS CYS A . n 
C 3 399 ARG 399 399 399 ARG ARG A . n 
C 3 400 TYR 400 400 400 TYR TYR A . n 
C 3 401 THR 401 401 401 THR THR A . n 
C 3 402 PRO 402 402 402 PRO PRO A . n 
C 3 403 ARG 403 403 403 ARG ARG A . n 
C 3 404 ARG 404 404 404 ARG ARG A . n 
C 3 405 ASN 405 405 405 ASN ASN A . n 
C 3 406 ILE 406 406 406 ILE ILE A . n 
C 3 407 PRO 407 407 407 PRO PRO A . n 
C 3 408 PRO 408 408 408 PRO PRO A . n 
C 3 409 TYR 409 409 409 TYR TYR A . n 
C 3 410 PHE 410 410 410 PHE PHE A . n 
C 3 411 VAL 411 411 411 VAL VAL A . n 
C 3 412 ALA 412 412 412 ALA ALA A . n 
C 3 413 LEU 413 413 413 LEU LEU A . n 
C 3 414 VAL 414 414 414 VAL VAL A . n 
C 3 415 PRO 415 415 415 PRO PRO A . n 
C 3 416 GLN 416 416 416 GLN GLN A . n 
C 3 417 GLU 417 417 417 GLU GLU A . n 
C 3 418 GLU 418 418 418 GLU GLU A . n 
C 3 419 GLU 419 419 419 GLU GLU A . n 
C 3 420 LEU 420 420 420 LEU LEU A . n 
C 3 421 ASP 421 421 421 ASP ASP A . n 
C 3 422 ASP 422 422 422 ASP ASP A . n 
C 3 423 GLN 423 423 423 GLN GLN A . n 
C 3 424 LYS 424 424 424 LYS LYS A . n 
C 3 425 ILE 425 425 425 ILE ILE A . n 
C 3 426 GLN 426 426 426 GLN GLN A . n 
C 3 427 VAL 427 427 427 VAL VAL A . n 
C 3 428 THR 428 428 428 THR THR A . n 
C 3 429 PRO 429 429 429 PRO PRO A . n 
C 3 430 PRO 430 430 430 PRO PRO A . n 
C 3 431 GLY 431 431 431 GLY GLY A . n 
C 3 432 PHE 432 432 432 PHE PHE A . n 
C 3 433 GLN 433 433 433 GLN GLN A . n 
C 3 434 LEU 434 434 434 LEU LEU A . n 
C 3 435 VAL 435 435 435 VAL VAL A . n 
C 3 436 PHE 436 436 436 PHE PHE A . n 
C 3 437 LEU 437 437 437 LEU LEU A . n 
C 3 438 PRO 438 438 438 PRO PRO A . n 
C 3 439 PHE 439 439 439 PHE PHE A . n 
C 3 440 ALA 440 440 440 ALA ALA A . n 
C 3 441 ASP 441 441 441 ASP ASP A . n 
C 3 442 ASP 442 442 442 ASP ASP A . n 
C 3 443 LYS 443 443 443 LYS LYS A . n 
C 3 444 ARG 444 444 444 ARG ARG A . n 
C 3 445 LYS 445 445 445 LYS LYS A . n 
C 3 446 MET 446 446 446 MET MET A . n 
C 3 447 PRO 447 447 447 PRO PRO A . n 
C 3 448 PHE 448 448 448 PHE PHE A . n 
C 3 449 THR 449 449 449 THR THR A . n 
C 3 450 GLU 450 450 450 GLU GLU A . n 
C 3 451 LYS 451 451 451 LYS LYS A . n 
C 3 452 ILE 452 452 452 ILE ILE A . n 
C 3 453 MET 453 453 453 MET MET A . n 
C 3 454 ALA 454 454 454 ALA ALA A . n 
C 3 455 THR 455 455 455 THR THR A . n 
C 3 456 PRO 456 456 456 PRO PRO A . n 
C 3 457 GLU 457 457 457 GLU GLU A . n 
C 3 458 GLN 458 458 458 GLN GLN A . n 
C 3 459 VAL 459 459 459 VAL VAL A . n 
C 3 460 GLY 460 460 460 GLY GLY A . n 
C 3 461 LYS 461 461 461 LYS LYS A . n 
C 3 462 MET 462 462 462 MET MET A . n 
C 3 463 LYS 463 463 463 LYS LYS A . n 
C 3 464 ALA 464 464 464 ALA ALA A . n 
C 3 465 ILE 465 465 465 ILE ILE A . n 
C 3 466 VAL 466 466 466 VAL VAL A . n 
C 3 467 GLU 467 467 467 GLU GLU A . n 
C 3 468 LYS 468 468 468 LYS LYS A . n 
C 3 469 LEU 469 469 469 LEU LEU A . n 
C 3 470 ARG 470 470 470 ARG ARG A . n 
C 3 471 PHE 471 471 471 PHE PHE A . n 
C 3 472 THR 472 472 472 THR THR A . n 
C 3 473 TYR 473 473 473 TYR TYR A . n 
C 3 474 ARG 474 474 474 ARG ARG A . n 
C 3 475 SER 475 475 475 SER SER A . n 
C 3 476 ASP 476 476 476 ASP ASP A . n 
C 3 477 SER 477 477 477 SER SER A . n 
C 3 478 PHE 478 478 478 PHE PHE A . n 
C 3 479 GLU 479 479 479 GLU GLU A . n 
C 3 480 ASN 480 480 480 ASN ASN A . n 
C 3 481 PRO 481 481 481 PRO PRO A . n 
C 3 482 VAL 482 482 482 VAL VAL A . n 
C 3 483 LEU 483 483 483 LEU LEU A . n 
C 3 484 GLN 484 484 484 GLN GLN A . n 
C 3 485 GLN 485 485 485 GLN GLN A . n 
C 3 486 HIS 486 486 486 HIS HIS A . n 
C 3 487 PHE 487 487 487 PHE PHE A . n 
C 3 488 ARG 488 488 488 ARG ARG A . n 
C 3 489 ASN 489 489 489 ASN ASN A . n 
C 3 490 LEU 490 490 490 LEU LEU A . n 
C 3 491 GLU 491 491 491 GLU GLU A . n 
C 3 492 ALA 492 492 492 ALA ALA A . n 
C 3 493 LEU 493 493 493 LEU LEU A . n 
C 3 494 ALA 494 494 494 ALA ALA A . n 
C 3 495 LEU 495 495 495 LEU LEU A . n 
C 3 496 ASP 496 496 496 ASP ASP A . n 
C 3 497 LEU 497 497 497 LEU LEU A . n 
C 3 498 MET 498 498 498 MET MET A . n 
C 3 499 GLU 499 499 499 GLU GLU A . n 
C 3 500 PRO 500 500 500 PRO PRO A . n 
C 3 501 GLU 501 501 501 GLU GLU A . n 
C 3 502 GLN 502 502 502 GLN GLN A . n 
C 3 503 ALA 503 503 503 ALA ALA A . n 
C 3 504 VAL 504 504 504 VAL VAL A . n 
C 3 505 ASP 505 505 505 ASP ASP A . n 
C 3 506 LEU 506 506 506 LEU LEU A . n 
C 3 507 THR 507 507 507 THR THR A . n 
C 3 508 LEU 508 508 508 LEU LEU A . n 
C 3 509 PRO 509 509 509 PRO PRO A . n 
C 3 510 LYS 510 510 510 LYS LYS A . n 
C 3 511 VAL 511 511 511 VAL VAL A . n 
C 3 512 GLU 512 512 512 GLU GLU A . n 
C 3 513 ALA 513 513 513 ALA ALA A . n 
C 3 514 MET 514 514 514 MET MET A . n 
C 3 515 ASN 515 515 515 ASN ASN A . n 
C 3 516 LYS 516 516 516 LYS LYS A . n 
C 3 517 ARG 517 517 517 ARG ARG A . n 
C 3 518 LEU 518 518 518 LEU LEU A . n 
C 3 519 GLY 519 519 519 GLY GLY A . n 
C 3 520 SER 520 520 520 SER SER A . n 
C 3 521 LEU 521 521 521 LEU LEU A . n 
C 3 522 VAL 522 522 522 VAL VAL A . n 
C 3 523 ASP 523 523 523 ASP ASP A . n 
C 3 524 GLU 524 524 524 GLU GLU A . n 
C 3 525 PHE 525 525 525 PHE PHE A . n 
C 3 526 LYS 526 526 526 LYS LYS A . n 
C 3 527 GLU 527 527 527 GLU GLU A . n 
C 3 528 LEU 528 528 528 LEU LEU A . n 
C 3 529 VAL 529 529 529 VAL VAL A . n 
C 3 530 TYR 530 530 530 TYR TYR A . n 
C 3 531 PRO 531 531 531 PRO PRO A . n 
C 3 532 PRO 532 532 532 PRO PRO A . n 
C 3 533 ASP 533 533 533 ASP ASP A . n 
C 3 534 TYR 534 534 534 TYR TYR A . n 
C 3 535 ASN 535 535 ?   ?   ?   A . n 
C 3 536 PRO 536 536 ?   ?   ?   A . n 
C 3 537 GLU 537 537 ?   ?   ?   A . n 
C 3 538 GLY 538 538 ?   ?   ?   A . n 
C 3 539 LYS 539 539 ?   ?   ?   A . n 
C 3 540 VAL 540 540 ?   ?   ?   A . n 
C 3 541 THR 541 541 ?   ?   ?   A . n 
C 3 542 LYS 542 542 ?   ?   ?   A . n 
C 3 543 ARG 543 543 ?   ?   ?   A . n 
C 3 544 LYS 544 544 ?   ?   ?   A . n 
C 3 545 HIS 545 545 ?   ?   ?   A . n 
C 3 546 ASP 546 546 ?   ?   ?   A . n 
C 3 547 ASN 547 547 ?   ?   ?   A . n 
C 3 548 GLU 548 548 ?   ?   ?   A . n 
C 3 549 GLY 549 549 ?   ?   ?   A . n 
C 3 550 SER 550 550 ?   ?   ?   A . n 
C 3 551 GLY 551 551 ?   ?   ?   A . n 
C 3 552 SER 552 552 ?   ?   ?   A . n 
C 3 553 LYS 553 553 ?   ?   ?   A . n 
C 3 554 ARG 554 554 ?   ?   ?   A . n 
C 3 555 PRO 555 555 ?   ?   ?   A . n 
C 3 556 LYS 556 556 ?   ?   ?   A . n 
C 3 557 VAL 557 557 ?   ?   ?   A . n 
C 3 558 GLU 558 558 ?   ?   ?   A . n 
C 3 559 TYR 559 559 ?   ?   ?   A . n 
C 3 560 SER 560 560 ?   ?   ?   A . n 
C 3 561 GLU 561 561 ?   ?   ?   A . n 
C 3 562 GLU 562 562 ?   ?   ?   A . n 
C 3 563 GLU 563 563 ?   ?   ?   A . n 
C 3 564 LEU 564 564 ?   ?   ?   A . n 
C 3 565 LYS 565 565 ?   ?   ?   A . n 
C 3 566 THR 566 566 ?   ?   ?   A . n 
C 3 567 HIS 567 567 ?   ?   ?   A . n 
C 3 568 ILE 568 568 ?   ?   ?   A . n 
C 3 569 SER 569 569 ?   ?   ?   A . n 
C 3 570 LYS 570 570 ?   ?   ?   A . n 
C 3 571 GLY 571 571 ?   ?   ?   A . n 
C 3 572 THR 572 572 ?   ?   ?   A . n 
C 3 573 LEU 573 573 ?   ?   ?   A . n 
C 3 574 GLY 574 574 ?   ?   ?   A . n 
C 3 575 LYS 575 575 ?   ?   ?   A . n 
C 3 576 PHE 576 576 ?   ?   ?   A . n 
C 3 577 THR 577 577 ?   ?   ?   A . n 
C 3 578 VAL 578 578 ?   ?   ?   A . n 
C 3 579 PRO 579 579 ?   ?   ?   A . n 
C 3 580 MET 580 580 ?   ?   ?   A . n 
C 3 581 LEU 581 581 ?   ?   ?   A . n 
C 3 582 LYS 582 582 ?   ?   ?   A . n 
C 3 583 GLU 583 583 ?   ?   ?   A . n 
C 3 584 ALA 584 584 ?   ?   ?   A . n 
C 3 585 CYS 585 585 ?   ?   ?   A . n 
C 3 586 ARG 586 586 ?   ?   ?   A . n 
C 3 587 ALA 587 587 ?   ?   ?   A . n 
C 3 588 TYR 588 588 ?   ?   ?   A . n 
C 3 589 GLY 589 589 ?   ?   ?   A . n 
C 3 590 LEU 590 590 ?   ?   ?   A . n 
C 3 591 LYS 591 591 ?   ?   ?   A . n 
C 3 592 SER 592 592 ?   ?   ?   A . n 
C 3 593 GLY 593 593 ?   ?   ?   A . n 
C 3 594 LEU 594 594 ?   ?   ?   A . n 
C 3 595 LYS 595 595 ?   ?   ?   A . n 
C 3 596 LYS 596 596 ?   ?   ?   A . n 
C 3 597 GLN 597 597 ?   ?   ?   A . n 
C 3 598 GLU 598 598 ?   ?   ?   A . n 
C 3 599 LEU 599 599 ?   ?   ?   A . n 
C 3 600 LEU 600 600 ?   ?   ?   A . n 
C 3 601 GLU 601 601 ?   ?   ?   A . n 
C 3 602 ALA 602 602 ?   ?   ?   A . n 
C 3 603 LEU 603 603 ?   ?   ?   A . n 
C 3 604 THR 604 604 ?   ?   ?   A . n 
C 3 605 LYS 605 605 ?   ?   ?   A . n 
C 3 606 HIS 606 606 ?   ?   ?   A . n 
C 3 607 PHE 607 607 ?   ?   ?   A . n 
C 3 608 GLN 608 608 ?   ?   ?   A . n 
C 3 609 ASP 609 609 ?   ?   ?   A . n 
D 4 1   MET 1   1   ?   ?   ?   B . n 
D 4 2   VAL 2   2   ?   ?   ?   B . n 
D 4 3   ARG 3   3   ?   ?   ?   B . n 
D 4 4   SER 4   4   ?   ?   ?   B . n 
D 4 5   GLY 5   5   ?   ?   ?   B . n 
D 4 6   ASN 6   6   6   ASN ASN B . n 
D 4 7   LYS 7   7   7   LYS LYS B . n 
D 4 8   ALA 8   8   8   ALA ALA B . n 
D 4 9   ALA 9   9   9   ALA ALA B . n 
D 4 10  VAL 10  10  10  VAL VAL B . n 
D 4 11  VAL 11  11  11  VAL VAL B . n 
D 4 12  LEU 12  12  12  LEU LEU B . n 
D 4 13  CYS 13  13  13  CYS CYS B . n 
D 4 14  MET 14  14  14  MET MET B . n 
D 4 15  ASP 15  15  15  ASP ASP B . n 
D 4 16  VAL 16  16  16  VAL VAL B . n 
D 4 17  GLY 17  17  17  GLY GLY B . n 
D 4 18  PHE 18  18  18  PHE PHE B . n 
D 4 19  THR 19  19  19  THR THR B . n 
D 4 20  MET 20  20  20  MET MET B . n 
D 4 21  SER 21  21  21  SER SER B . n 
D 4 22  ASN 22  22  22  ASN ASN B . n 
D 4 23  SER 23  23  23  SER SER B . n 
D 4 24  ILE 24  24  24  ILE ILE B . n 
D 4 25  PRO 25  25  25  PRO PRO B . n 
D 4 26  GLY 26  26  26  GLY GLY B . n 
D 4 27  ILE 27  27  27  ILE ILE B . n 
D 4 28  GLU 28  28  28  GLU GLU B . n 
D 4 29  SER 29  29  29  SER SER B . n 
D 4 30  PRO 30  30  30  PRO PRO B . n 
D 4 31  PHE 31  31  31  PHE PHE B . n 
D 4 32  GLU 32  32  32  GLU GLU B . n 
D 4 33  GLN 33  33  33  GLN GLN B . n 
D 4 34  ALA 34  34  34  ALA ALA B . n 
D 4 35  LYS 35  35  35  LYS LYS B . n 
D 4 36  LYS 36  36  36  LYS LYS B . n 
D 4 37  VAL 37  37  37  VAL VAL B . n 
D 4 38  ILE 38  38  38  ILE ILE B . n 
D 4 39  THR 39  39  39  THR THR B . n 
D 4 40  MET 40  40  40  MET MET B . n 
D 4 41  PHE 41  41  41  PHE PHE B . n 
D 4 42  VAL 42  42  42  VAL VAL B . n 
D 4 43  GLN 43  43  43  GLN GLN B . n 
D 4 44  ARG 44  44  44  ARG ARG B . n 
D 4 45  GLN 45  45  45  GLN GLN B . n 
D 4 46  VAL 46  46  46  VAL VAL B . n 
D 4 47  PHE 47  47  47  PHE PHE B . n 
D 4 48  ALA 48  48  48  ALA ALA B . n 
D 4 49  GLU 49  49  49  GLU GLU B . n 
D 4 50  ASN 50  50  50  ASN ASN B . n 
D 4 51  LYS 51  51  51  LYS LYS B . n 
D 4 52  ASP 52  52  52  ASP ASP B . n 
D 4 53  GLU 53  53  53  GLU GLU B . n 
D 4 54  ILE 54  54  54  ILE ILE B . n 
D 4 55  ALA 55  55  55  ALA ALA B . n 
D 4 56  LEU 56  56  56  LEU LEU B . n 
D 4 57  VAL 57  57  57  VAL VAL B . n 
D 4 58  LEU 58  58  58  LEU LEU B . n 
D 4 59  PHE 59  59  59  PHE PHE B . n 
D 4 60  GLY 60  60  60  GLY GLY B . n 
D 4 61  THR 61  61  61  THR THR B . n 
D 4 62  ASP 62  62  62  ASP ASP B . n 
D 4 63  GLY 63  63  63  GLY GLY B . n 
D 4 64  THR 64  64  64  THR THR B . n 
D 4 65  ASP 65  65  65  ASP ASP B . n 
D 4 66  ASN 66  66  66  ASN ASN B . n 
D 4 67  PRO 67  67  67  PRO PRO B . n 
D 4 68  LEU 68  68  68  LEU LEU B . n 
D 4 69  SER 69  69  69  SER SER B . n 
D 4 70  GLY 70  70  70  GLY GLY B . n 
D 4 71  GLY 71  71  71  GLY GLY B . n 
D 4 72  ASP 72  72  72  ASP ASP B . n 
D 4 73  GLN 73  73  73  GLN GLN B . n 
D 4 74  TYR 74  74  74  TYR TYR B . n 
D 4 75  GLN 75  75  75  GLN GLN B . n 
D 4 76  ASN 76  76  76  ASN ASN B . n 
D 4 77  ILE 77  77  77  ILE ILE B . n 
D 4 78  THR 78  78  78  THR THR B . n 
D 4 79  VAL 79  79  79  VAL VAL B . n 
D 4 80  HIS 80  80  80  HIS HIS B . n 
D 4 81  ARG 81  81  81  ARG ARG B . n 
D 4 82  HIS 82  82  82  HIS HIS B . n 
D 4 83  LEU 83  83  83  LEU LEU B . n 
D 4 84  MET 84  84  84  MET MET B . n 
D 4 85  LEU 85  85  85  LEU LEU B . n 
D 4 86  PRO 86  86  86  PRO PRO B . n 
D 4 87  ASP 87  87  87  ASP ASP B . n 
D 4 88  PHE 88  88  88  PHE PHE B . n 
D 4 89  ASP 89  89  89  ASP ASP B . n 
D 4 90  LEU 90  90  90  LEU LEU B . n 
D 4 91  LEU 91  91  91  LEU LEU B . n 
D 4 92  GLU 92  92  92  GLU GLU B . n 
D 4 93  ASP 93  93  93  ASP ASP B . n 
D 4 94  ILE 94  94  94  ILE ILE B . n 
D 4 95  GLU 95  95  95  GLU GLU B . n 
D 4 96  SER 96  96  96  SER SER B . n 
D 4 97  LYS 97  97  97  LYS LYS B . n 
D 4 98  ILE 98  98  98  ILE ILE B . n 
D 4 99  GLN 99  99  99  GLN GLN B . n 
D 4 100 PRO 100 100 100 PRO PRO B . n 
D 4 101 GLY 101 101 101 GLY GLY B . n 
D 4 102 SER 102 102 102 SER SER B . n 
D 4 103 GLN 103 103 103 GLN GLN B . n 
D 4 104 GLN 104 104 104 GLN GLN B . n 
D 4 105 ALA 105 105 105 ALA ALA B . n 
D 4 106 ASP 106 106 106 ASP ASP B . n 
D 4 107 PHE 107 107 107 PHE PHE B . n 
D 4 108 LEU 108 108 108 LEU LEU B . n 
D 4 109 ASP 109 109 109 ASP ASP B . n 
D 4 110 ALA 110 110 110 ALA ALA B . n 
D 4 111 LEU 111 111 111 LEU LEU B . n 
D 4 112 ILE 112 112 112 ILE ILE B . n 
D 4 113 VAL 113 113 113 VAL VAL B . n 
D 4 114 SER 114 114 114 SER SER B . n 
D 4 115 MET 115 115 115 MET MET B . n 
D 4 116 ASP 116 116 116 ASP ASP B . n 
D 4 117 VAL 117 117 117 VAL VAL B . n 
D 4 118 ILE 118 118 118 ILE ILE B . n 
D 4 119 GLN 119 119 119 GLN GLN B . n 
D 4 120 HIS 120 120 120 HIS HIS B . n 
D 4 121 GLU 121 121 121 GLU GLU B . n 
D 4 122 THR 122 122 122 THR THR B . n 
D 4 123 ILE 123 123 123 ILE ILE B . n 
D 4 124 GLY 124 124 124 GLY GLY B . n 
D 4 125 LYS 125 125 125 LYS LYS B . n 
D 4 126 LYS 126 126 126 LYS LYS B . n 
D 4 127 PHE 127 127 127 PHE PHE B . n 
D 4 128 GLU 128 128 128 GLU GLU B . n 
D 4 129 LYS 129 129 129 LYS LYS B . n 
D 4 130 ARG 130 130 130 ARG ARG B . n 
D 4 131 HIS 131 131 131 HIS HIS B . n 
D 4 132 ILE 132 132 132 ILE ILE B . n 
D 4 133 GLU 133 133 133 GLU GLU B . n 
D 4 134 ILE 134 134 134 ILE ILE B . n 
D 4 135 PHE 135 135 135 PHE PHE B . n 
D 4 136 THR 136 136 136 THR THR B . n 
D 4 137 ASP 137 137 137 ASP ASP B . n 
D 4 138 LEU 138 138 138 LEU LEU B . n 
D 4 139 SER 139 139 139 SER SER B . n 
D 4 140 SER 140 140 140 SER SER B . n 
D 4 141 ARG 141 141 141 ARG ARG B . n 
D 4 142 PHE 142 142 142 PHE PHE B . n 
D 4 143 SER 143 143 143 SER SER B . n 
D 4 144 LYS 144 144 144 LYS LYS B . n 
D 4 145 SER 145 145 145 SER SER B . n 
D 4 146 GLN 146 146 146 GLN GLN B . n 
D 4 147 LEU 147 147 147 LEU LEU B . n 
D 4 148 ASP 148 148 148 ASP ASP B . n 
D 4 149 ILE 149 149 149 ILE ILE B . n 
D 4 150 ILE 150 150 150 ILE ILE B . n 
D 4 151 ILE 151 151 151 ILE ILE B . n 
D 4 152 HIS 152 152 152 HIS HIS B . n 
D 4 153 SER 153 153 153 SER SER B . n 
D 4 154 LEU 154 154 154 LEU LEU B . n 
D 4 155 LYS 155 155 155 LYS LYS B . n 
D 4 156 LYS 156 156 156 LYS LYS B . n 
D 4 157 CYS 157 157 157 CYS CYS B . n 
D 4 158 ASP 158 158 158 ASP ASP B . n 
D 4 159 ILE 159 159 159 ILE ILE B . n 
D 4 160 SER 160 160 160 SER SER B . n 
D 4 161 LEU 161 161 161 LEU LEU B . n 
D 4 162 GLN 162 162 162 GLN GLN B . n 
D 4 163 PHE 163 163 163 PHE PHE B . n 
D 4 164 PHE 164 164 164 PHE PHE B . n 
D 4 165 LEU 165 165 165 LEU LEU B . n 
D 4 166 PRO 166 166 166 PRO PRO B . n 
D 4 167 PHE 167 167 167 PHE PHE B . n 
D 4 168 SER 168 168 168 SER SER B . n 
D 4 169 LEU 169 169 169 LEU LEU B . n 
D 4 170 GLY 170 170 170 GLY GLY B . n 
D 4 171 LYS 171 171 ?   ?   ?   B . n 
D 4 172 GLU 172 172 ?   ?   ?   B . n 
D 4 173 ASP 173 173 ?   ?   ?   B . n 
D 4 174 GLY 174 174 ?   ?   ?   B . n 
D 4 175 SER 175 175 ?   ?   ?   B . n 
D 4 176 GLY 176 176 ?   ?   ?   B . n 
D 4 177 ASP 177 177 ?   ?   ?   B . n 
D 4 178 ARG 178 178 ?   ?   ?   B . n 
D 4 179 GLY 179 179 ?   ?   ?   B . n 
D 4 180 ASP 180 180 ?   ?   ?   B . n 
D 4 181 GLY 181 181 181 GLY GLY B . n 
D 4 182 PRO 182 182 182 PRO PRO B . n 
D 4 183 PHE 183 183 183 PHE PHE B . n 
D 4 184 ARG 184 184 184 ARG ARG B . n 
D 4 185 LEU 185 185 185 LEU LEU B . n 
D 4 186 GLY 186 186 186 GLY GLY B . n 
D 4 187 GLY 187 187 187 GLY GLY B . n 
D 4 188 HIS 188 188 188 HIS HIS B . n 
D 4 189 GLY 189 189 189 GLY GLY B . n 
D 4 190 PRO 190 190 190 PRO PRO B . n 
D 4 191 SER 191 191 191 SER SER B . n 
D 4 192 PHE 192 192 192 PHE PHE B . n 
D 4 193 PRO 193 193 193 PRO PRO B . n 
D 4 194 LEU 194 194 194 LEU LEU B . n 
D 4 195 LYS 195 195 195 LYS LYS B . n 
D 4 196 GLY 196 196 196 GLY GLY B . n 
D 4 197 ILE 197 197 197 ILE ILE B . n 
D 4 198 THR 198 198 198 THR THR B . n 
D 4 199 GLU 199 199 199 GLU GLU B . n 
D 4 200 GLN 200 200 200 GLN GLN B . n 
D 4 201 GLN 201 201 201 GLN GLN B . n 
D 4 202 LYS 202 202 202 LYS LYS B . n 
D 4 203 GLU 203 203 203 GLU GLU B . n 
D 4 204 GLY 204 204 204 GLY GLY B . n 
D 4 205 LEU 205 205 205 LEU LEU B . n 
D 4 206 GLU 206 206 206 GLU GLU B . n 
D 4 207 ILE 207 207 207 ILE ILE B . n 
D 4 208 VAL 208 208 208 VAL VAL B . n 
D 4 209 LYS 209 209 209 LYS LYS B . n 
D 4 210 MET 210 210 210 MET MET B . n 
D 4 211 VAL 211 211 211 VAL VAL B . n 
D 4 212 MET 212 212 212 MET MET B . n 
D 4 213 ILE 213 213 213 ILE ILE B . n 
D 4 214 SER 214 214 214 SER SER B . n 
D 4 215 LEU 215 215 215 LEU LEU B . n 
D 4 216 GLU 216 216 216 GLU GLU B . n 
D 4 217 GLY 217 217 217 GLY GLY B . n 
D 4 218 GLU 218 218 218 GLU GLU B . n 
D 4 219 ASP 219 219 219 ASP ASP B . n 
D 4 220 GLY 220 220 220 GLY GLY B . n 
D 4 221 LEU 221 221 221 LEU LEU B . n 
D 4 222 ASP 222 222 222 ASP ASP B . n 
D 4 223 GLU 223 223 223 GLU GLU B . n 
D 4 224 ILE 224 224 224 ILE ILE B . n 
D 4 225 TYR 225 225 225 TYR TYR B . n 
D 4 226 SER 226 226 226 SER SER B . n 
D 4 227 PHE 227 227 227 PHE PHE B . n 
D 4 228 SER 228 228 228 SER SER B . n 
D 4 229 GLU 229 229 229 GLU GLU B . n 
D 4 230 SER 230 230 230 SER SER B . n 
D 4 231 LEU 231 231 231 LEU LEU B . n 
D 4 232 ARG 232 232 232 ARG ARG B . n 
D 4 233 LYS 233 233 233 LYS LYS B . n 
D 4 234 LEU 234 234 234 LEU LEU B . n 
D 4 235 CYS 235 235 235 CYS CYS B . n 
D 4 236 VAL 236 236 236 VAL VAL B . n 
D 4 237 PHE 237 237 237 PHE PHE B . n 
D 4 238 LYS 238 238 238 LYS LYS B . n 
D 4 239 LYS 239 239 239 LYS LYS B . n 
D 4 240 ILE 240 240 240 ILE ILE B . n 
D 4 241 GLU 241 241 241 GLU GLU B . n 
D 4 242 ARG 242 242 242 ARG ARG B . n 
D 4 243 HIS 243 243 243 HIS HIS B . n 
D 4 244 SER 244 244 244 SER SER B . n 
D 4 245 ILE 245 245 245 ILE ILE B . n 
D 4 246 HIS 246 246 246 HIS HIS B . n 
D 4 247 TRP 247 247 247 TRP TRP B . n 
D 4 248 PRO 248 248 248 PRO PRO B . n 
D 4 249 CYS 249 249 249 CYS CYS B . n 
D 4 250 ARG 250 250 250 ARG ARG B . n 
D 4 251 LEU 251 251 251 LEU LEU B . n 
D 4 252 THR 252 252 252 THR THR B . n 
D 4 253 ILE 253 253 253 ILE ILE B . n 
D 4 254 GLY 254 254 254 GLY GLY B . n 
D 4 255 SER 255 255 255 SER SER B . n 
D 4 256 ASN 256 256 256 ASN ASN B . n 
D 4 257 LEU 257 257 257 LEU LEU B . n 
D 4 258 SER 258 258 258 SER SER B . n 
D 4 259 ILE 259 259 259 ILE ILE B . n 
D 4 260 ARG 260 260 260 ARG ARG B . n 
D 4 261 ILE 261 261 261 ILE ILE B . n 
D 4 262 ALA 262 262 262 ALA ALA B . n 
D 4 263 ALA 263 263 263 ALA ALA B . n 
D 4 264 TYR 264 264 264 TYR TYR B . n 
D 4 265 LYS 265 265 265 LYS LYS B . n 
D 4 266 SER 266 266 266 SER SER B . n 
D 4 267 ILE 267 267 267 ILE ILE B . n 
D 4 268 LEU 268 268 268 LEU LEU B . n 
D 4 269 GLN 269 269 269 GLN GLN B . n 
D 4 270 GLU 270 270 270 GLU GLU B . n 
D 4 271 ARG 271 271 271 ARG ARG B . n 
D 4 272 VAL 272 272 272 VAL VAL B . n 
D 4 273 LYS 273 273 273 LYS LYS B . n 
D 4 274 LYS 274 274 274 LYS LYS B . n 
D 4 275 THR 275 275 275 THR THR B . n 
D 4 276 TRP 276 276 276 TRP TRP B . n 
D 4 277 THR 277 277 277 THR THR B . n 
D 4 278 VAL 278 278 278 VAL VAL B . n 
D 4 279 VAL 279 279 279 VAL VAL B . n 
D 4 280 ASP 280 280 280 ASP ASP B . n 
D 4 281 ALA 281 281 281 ALA ALA B . n 
D 4 282 LYS 282 282 282 LYS LYS B . n 
D 4 283 THR 283 283 283 THR THR B . n 
D 4 284 LEU 284 284 284 LEU LEU B . n 
D 4 285 LYS 285 285 285 LYS LYS B . n 
D 4 286 LYS 286 286 286 LYS LYS B . n 
D 4 287 GLU 287 287 287 GLU GLU B . n 
D 4 288 ASP 288 288 288 ASP ASP B . n 
D 4 289 ILE 289 289 289 ILE ILE B . n 
D 4 290 GLN 290 290 290 GLN GLN B . n 
D 4 291 LYS 291 291 291 LYS LYS B . n 
D 4 292 GLU 292 292 292 GLU GLU B . n 
D 4 293 THR 293 293 293 THR THR B . n 
D 4 294 VAL 294 294 294 VAL VAL B . n 
D 4 295 TYR 295 295 295 TYR TYR B . n 
D 4 296 CYS 296 296 296 CYS CYS B . n 
D 4 297 LEU 297 297 297 LEU LEU B . n 
D 4 298 ASN 298 298 298 ASN ASN B . n 
D 4 299 ASP 299 299 299 ASP ASP B . n 
D 4 300 ASP 300 300 300 ASP ASP B . n 
D 4 301 ASP 301 301 301 ASP ASP B . n 
D 4 302 GLU 302 302 302 GLU GLU B . n 
D 4 303 THR 303 303 303 THR THR B . n 
D 4 304 GLU 304 304 304 GLU GLU B . n 
D 4 305 VAL 305 305 305 VAL VAL B . n 
D 4 306 LEU 306 306 306 LEU LEU B . n 
D 4 307 LYS 307 307 307 LYS LYS B . n 
D 4 308 GLU 308 308 308 GLU GLU B . n 
D 4 309 ASP 309 309 309 ASP ASP B . n 
D 4 310 ILE 310 310 310 ILE ILE B . n 
D 4 311 ILE 311 311 311 ILE ILE B . n 
D 4 312 GLN 312 312 312 GLN GLN B . n 
D 4 313 GLY 313 313 313 GLY GLY B . n 
D 4 314 PHE 314 314 314 PHE PHE B . n 
D 4 315 ARG 315 315 315 ARG ARG B . n 
D 4 316 TYR 316 316 316 TYR TYR B . n 
D 4 317 GLY 317 317 317 GLY GLY B . n 
D 4 318 SER 318 318 318 SER SER B . n 
D 4 319 ASP 319 319 319 ASP ASP B . n 
D 4 320 ILE 320 320 320 ILE ILE B . n 
D 4 321 VAL 321 321 321 VAL VAL B . n 
D 4 322 PRO 322 322 322 PRO PRO B . n 
D 4 323 PHE 323 323 323 PHE PHE B . n 
D 4 324 SER 324 324 324 SER SER B . n 
D 4 325 LYS 325 325 325 LYS LYS B . n 
D 4 326 VAL 326 326 326 VAL VAL B . n 
D 4 327 ASP 327 327 327 ASP ASP B . n 
D 4 328 GLU 328 328 328 GLU GLU B . n 
D 4 329 GLU 329 329 329 GLU GLU B . n 
D 4 330 GLN 330 330 330 GLN GLN B . n 
D 4 331 MET 331 331 331 MET MET B . n 
D 4 332 LYS 332 332 332 LYS LYS B . n 
D 4 333 TYR 333 333 333 TYR TYR B . n 
D 4 334 LYS 334 334 334 LYS LYS B . n 
D 4 335 SER 335 335 335 SER SER B . n 
D 4 336 GLU 336 336 336 GLU GLU B . n 
D 4 337 GLY 337 337 337 GLY GLY B . n 
D 4 338 LYS 338 338 338 LYS LYS B . n 
D 4 339 CYS 339 339 339 CYS CYS B . n 
D 4 340 PHE 340 340 340 PHE PHE B . n 
D 4 341 SER 341 341 341 SER SER B . n 
D 4 342 VAL 342 342 342 VAL VAL B . n 
D 4 343 LEU 343 343 343 LEU LEU B . n 
D 4 344 GLY 344 344 344 GLY GLY B . n 
D 4 345 PHE 345 345 345 PHE PHE B . n 
D 4 346 CYS 346 346 346 CYS CYS B . n 
D 4 347 LYS 347 347 347 LYS LYS B . n 
D 4 348 SER 348 348 348 SER SER B . n 
D 4 349 SER 349 349 349 SER SER B . n 
D 4 350 GLN 350 350 350 GLN GLN B . n 
D 4 351 VAL 351 351 351 VAL VAL B . n 
D 4 352 GLN 352 352 352 GLN GLN B . n 
D 4 353 ARG 353 353 353 ARG ARG B . n 
D 4 354 ARG 354 354 354 ARG ARG B . n 
D 4 355 PHE 355 355 355 PHE PHE B . n 
D 4 356 PHE 356 356 356 PHE PHE B . n 
D 4 357 MET 357 357 357 MET MET B . n 
D 4 358 GLY 358 358 358 GLY GLY B . n 
D 4 359 ASN 359 359 359 ASN ASN B . n 
D 4 360 GLN 360 360 360 GLN GLN B . n 
D 4 361 VAL 361 361 361 VAL VAL B . n 
D 4 362 LEU 362 362 362 LEU LEU B . n 
D 4 363 LYS 363 363 363 LYS LYS B . n 
D 4 364 VAL 364 364 364 VAL VAL B . n 
D 4 365 PHE 365 365 365 PHE PHE B . n 
D 4 366 ALA 366 366 366 ALA ALA B . n 
D 4 367 ALA 367 367 367 ALA ALA B . n 
D 4 368 ARG 368 368 368 ARG ARG B . n 
D 4 369 ASP 369 369 369 ASP ASP B . n 
D 4 370 ASP 370 370 370 ASP ASP B . n 
D 4 371 GLU 371 371 371 GLU GLU B . n 
D 4 372 ALA 372 372 372 ALA ALA B . n 
D 4 373 ALA 373 373 373 ALA ALA B . n 
D 4 374 ALA 374 374 374 ALA ALA B . n 
D 4 375 VAL 375 375 375 VAL VAL B . n 
D 4 376 ALA 376 376 376 ALA ALA B . n 
D 4 377 LEU 377 377 377 LEU LEU B . n 
D 4 378 SER 378 378 378 SER SER B . n 
D 4 379 SER 379 379 379 SER SER B . n 
D 4 380 LEU 380 380 380 LEU LEU B . n 
D 4 381 ILE 381 381 381 ILE ILE B . n 
D 4 382 HIS 382 382 382 HIS HIS B . n 
D 4 383 ALA 383 383 383 ALA ALA B . n 
D 4 384 LEU 384 384 384 LEU LEU B . n 
D 4 385 ASP 385 385 385 ASP ASP B . n 
D 4 386 ASP 386 386 386 ASP ASP B . n 
D 4 387 LEU 387 387 387 LEU LEU B . n 
D 4 388 ASP 388 388 388 ASP ASP B . n 
D 4 389 MET 389 389 389 MET MET B . n 
D 4 390 VAL 390 390 390 VAL VAL B . n 
D 4 391 ALA 391 391 391 ALA ALA B . n 
D 4 392 ILE 392 392 392 ILE ILE B . n 
D 4 393 VAL 393 393 393 VAL VAL B . n 
D 4 394 ARG 394 394 394 ARG ARG B . n 
D 4 395 TYR 395 395 395 TYR TYR B . n 
D 4 396 ALA 396 396 396 ALA ALA B . n 
D 4 397 TYR 397 397 397 TYR TYR B . n 
D 4 398 ASP 398 398 398 ASP ASP B . n 
D 4 399 LYS 399 399 399 LYS LYS B . n 
D 4 400 ARG 400 400 400 ARG ARG B . n 
D 4 401 ALA 401 401 401 ALA ALA B . n 
D 4 402 ASN 402 402 402 ASN ASN B . n 
D 4 403 PRO 403 403 403 PRO PRO B . n 
D 4 404 GLN 404 404 404 GLN GLN B . n 
D 4 405 VAL 405 405 405 VAL VAL B . n 
D 4 406 GLY 406 406 406 GLY GLY B . n 
D 4 407 VAL 407 407 407 VAL VAL B . n 
D 4 408 ALA 408 408 408 ALA ALA B . n 
D 4 409 PHE 409 409 409 PHE PHE B . n 
D 4 410 PRO 410 410 410 PRO PRO B . n 
D 4 411 HIS 411 411 411 HIS HIS B . n 
D 4 412 ILE 412 412 412 ILE ILE B . n 
D 4 413 LYS 413 413 413 LYS LYS B . n 
D 4 414 HIS 414 414 414 HIS HIS B . n 
D 4 415 ASN 415 415 415 ASN ASN B . n 
D 4 416 TYR 416 416 416 TYR TYR B . n 
D 4 417 GLU 417 417 417 GLU GLU B . n 
D 4 418 CYS 418 418 418 CYS CYS B . n 
D 4 419 LEU 419 419 419 LEU LEU B . n 
D 4 420 VAL 420 420 420 VAL VAL B . n 
D 4 421 TYR 421 421 421 TYR TYR B . n 
D 4 422 VAL 422 422 422 VAL VAL B . n 
D 4 423 GLN 423 423 423 GLN GLN B . n 
D 4 424 LEU 424 424 424 LEU LEU B . n 
D 4 425 PRO 425 425 425 PRO PRO B . n 
D 4 426 PHE 426 426 426 PHE PHE B . n 
D 4 427 MET 427 427 427 MET MET B . n 
D 4 428 GLU 428 428 428 GLU GLU B . n 
D 4 429 ASP 429 429 429 ASP ASP B . n 
D 4 430 LEU 430 430 430 LEU LEU B . n 
D 4 431 ARG 431 431 431 ARG ARG B . n 
D 4 432 GLN 432 432 432 GLN GLN B . n 
D 4 433 TYR 433 433 433 TYR TYR B . n 
D 4 434 MET 434 434 434 MET MET B . n 
D 4 435 PHE 435 435 435 PHE PHE B . n 
D 4 436 SER 436 436 436 SER SER B . n 
D 4 437 SER 437 437 437 SER SER B . n 
D 4 438 LEU 438 438 438 LEU LEU B . n 
D 4 439 LYS 439 439 439 LYS LYS B . n 
D 4 440 ASN 440 440 440 ASN ASN B . n 
D 4 441 SER 441 441 441 SER SER B . n 
D 4 442 LYS 442 442 442 LYS LYS B . n 
D 4 443 LYS 443 443 443 LYS LYS B . n 
D 4 444 TYR 444 444 444 TYR TYR B . n 
D 4 445 ALA 445 445 445 ALA ALA B . n 
D 4 446 PRO 446 446 446 PRO PRO B . n 
D 4 447 THR 447 447 447 THR THR B . n 
D 4 448 GLU 448 448 448 GLU GLU B . n 
D 4 449 ALA 449 449 449 ALA ALA B . n 
D 4 450 GLN 450 450 450 GLN GLN B . n 
D 4 451 LEU 451 451 451 LEU LEU B . n 
D 4 452 ASN 452 452 452 ASN ASN B . n 
D 4 453 ALA 453 453 453 ALA ALA B . n 
D 4 454 VAL 454 454 454 VAL VAL B . n 
D 4 455 ASP 455 455 455 ASP ASP B . n 
D 4 456 ALA 456 456 456 ALA ALA B . n 
D 4 457 LEU 457 457 457 LEU LEU B . n 
D 4 458 ILE 458 458 458 ILE ILE B . n 
D 4 459 ASP 459 459 459 ASP ASP B . n 
D 4 460 SER 460 460 460 SER SER B . n 
D 4 461 MET 461 461 461 MET MET B . n 
D 4 462 SER 462 462 462 SER SER B . n 
D 4 463 LEU 463 463 463 LEU LEU B . n 
D 4 464 ALA 464 464 464 ALA ALA B . n 
D 4 465 LYS 465 465 465 LYS LYS B . n 
D 4 466 LYS 466 466 466 LYS LYS B . n 
D 4 467 ASP 467 467 467 ASP ASP B . n 
D 4 468 GLU 468 468 468 GLU GLU B . n 
D 4 469 LYS 469 469 469 LYS LYS B . n 
D 4 470 THR 470 470 470 THR THR B . n 
D 4 471 ASP 471 471 471 ASP ASP B . n 
D 4 472 THR 472 472 472 THR THR B . n 
D 4 473 LEU 473 473 473 LEU LEU B . n 
D 4 474 GLU 474 474 474 GLU GLU B . n 
D 4 475 ASP 475 475 475 ASP ASP B . n 
D 4 476 LEU 476 476 476 LEU LEU B . n 
D 4 477 PHE 477 477 477 PHE PHE B . n 
D 4 478 PRO 478 478 478 PRO PRO B . n 
D 4 479 THR 479 479 479 THR THR B . n 
D 4 480 THR 480 480 480 THR THR B . n 
D 4 481 LYS 481 481 481 LYS LYS B . n 
D 4 482 ILE 482 482 482 ILE ILE B . n 
D 4 483 PRO 483 483 483 PRO PRO B . n 
D 4 484 ASN 484 484 484 ASN ASN B . n 
D 4 485 PRO 485 485 485 PRO PRO B . n 
D 4 486 ARG 486 486 486 ARG ARG B . n 
D 4 487 PHE 487 487 487 PHE PHE B . n 
D 4 488 GLN 488 488 488 GLN GLN B . n 
D 4 489 ARG 489 489 489 ARG ARG B . n 
D 4 490 LEU 490 490 490 LEU LEU B . n 
D 4 491 PHE 491 491 491 PHE PHE B . n 
D 4 492 GLN 492 492 492 GLN GLN B . n 
D 4 493 CYS 493 493 493 CYS CYS B . n 
D 4 494 LEU 494 494 494 LEU LEU B . n 
D 4 495 LEU 495 495 495 LEU LEU B . n 
D 4 496 HIS 496 496 496 HIS HIS B . n 
D 4 497 ARG 497 497 497 ARG ARG B . n 
D 4 498 ALA 498 498 498 ALA ALA B . n 
D 4 499 LEU 499 499 499 LEU LEU B . n 
D 4 500 HIS 500 500 500 HIS HIS B . n 
D 4 501 PRO 501 501 501 PRO PRO B . n 
D 4 502 ARG 502 502 502 ARG ARG B . n 
D 4 503 GLU 503 503 503 GLU GLU B . n 
D 4 504 PRO 504 504 504 PRO PRO B . n 
D 4 505 LEU 505 505 505 LEU LEU B . n 
D 4 506 PRO 506 506 506 PRO PRO B . n 
D 4 507 PRO 507 507 507 PRO PRO B . n 
D 4 508 ILE 508 508 508 ILE ILE B . n 
D 4 509 GLN 509 509 509 GLN GLN B . n 
D 4 510 GLN 510 510 510 GLN GLN B . n 
D 4 511 HIS 511 511 511 HIS HIS B . n 
D 4 512 ILE 512 512 512 ILE ILE B . n 
D 4 513 TRP 513 513 513 TRP TRP B . n 
D 4 514 ASN 514 514 514 ASN ASN B . n 
D 4 515 MET 515 515 515 MET MET B . n 
D 4 516 LEU 516 516 516 LEU LEU B . n 
D 4 517 ASN 517 517 517 ASN ASN B . n 
D 4 518 PRO 518 518 518 PRO PRO B . n 
D 4 519 PRO 519 519 519 PRO PRO B . n 
D 4 520 ALA 520 520 520 ALA ALA B . n 
D 4 521 GLU 521 521 521 GLU GLU B . n 
D 4 522 VAL 522 522 522 VAL VAL B . n 
D 4 523 THR 523 523 523 THR THR B . n 
D 4 524 THR 524 524 524 THR THR B . n 
D 4 525 LYS 525 525 525 LYS LYS B . n 
D 4 526 SER 526 526 526 SER SER B . n 
D 4 527 GLN 527 527 527 GLN GLN B . n 
D 4 528 ILE 528 528 528 ILE ILE B . n 
D 4 529 PRO 529 529 529 PRO PRO B . n 
D 4 530 LEU 530 530 530 LEU LEU B . n 
D 4 531 SER 531 531 531 SER SER B . n 
D 4 532 LYS 532 532 532 LYS LYS B . n 
D 4 533 ILE 533 533 533 ILE ILE B . n 
D 4 534 LYS 534 534 534 LYS LYS B . n 
D 4 535 THR 535 535 535 THR THR B . n 
D 4 536 LEU 536 536 536 LEU LEU B . n 
D 4 537 PHE 537 537 537 PHE PHE B . n 
D 4 538 PRO 538 538 538 PRO PRO B . n 
D 4 539 LEU 539 539 539 LEU LEU B . n 
D 4 540 ILE 540 540 540 ILE ILE B . n 
D 4 541 GLU 541 541 541 GLU GLU B . n 
D 4 542 ALA 542 542 542 ALA ALA B . n 
D 4 543 LYS 543 543 543 LYS LYS B . n 
D 4 544 LYS 544 544 544 LYS LYS B . n 
D 4 545 LYS 545 545 545 LYS LYS B . n 
D 4 546 ASP 546 546 ?   ?   ?   B . n 
D 4 547 GLN 547 547 ?   ?   ?   B . n 
D 4 548 VAL 548 548 ?   ?   ?   B . n 
D 4 549 THR 549 549 ?   ?   ?   B . n 
D 4 550 ALA 550 550 ?   ?   ?   B . n 
D 4 551 GLN 551 551 ?   ?   ?   B . n 
D 4 552 GLU 552 552 ?   ?   ?   B . n 
D 4 553 ILE 553 553 ?   ?   ?   B . n 
D 4 554 PHE 554 554 ?   ?   ?   B . n 
D 4 555 GLN 555 555 ?   ?   ?   B . n 
D 4 556 ASP 556 556 ?   ?   ?   B . n 
D 4 557 ASN 557 557 ?   ?   ?   B . n 
D 4 558 HIS 558 558 ?   ?   ?   B . n 
D 4 559 GLU 559 559 ?   ?   ?   B . n 
D 4 560 ASP 560 560 ?   ?   ?   B . n 
D 4 561 GLY 561 561 ?   ?   ?   B . n 
D 4 562 PRO 562 562 ?   ?   ?   B . n 
D 4 563 THR 563 563 ?   ?   ?   B . n 
D 4 564 ALA 564 564 ?   ?   ?   B . n 
D 4 565 LYS 565 565 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 HOH 1   83  83  HOH HOH C . 
E 5 HOH 2   254 254 HOH HOH C . 
F 5 HOH 1   158 158 HOH HOH D . 
F 5 HOH 2   226 226 HOH HOH D . 
G 5 HOH 1   610 2   HOH HOH A . 
G 5 HOH 2   611 3   HOH HOH A . 
G 5 HOH 3   612 4   HOH HOH A . 
G 5 HOH 4   613 6   HOH HOH A . 
G 5 HOH 5   614 7   HOH HOH A . 
G 5 HOH 6   615 8   HOH HOH A . 
G 5 HOH 7   616 9   HOH HOH A . 
G 5 HOH 8   617 11  HOH HOH A . 
G 5 HOH 9   618 12  HOH HOH A . 
G 5 HOH 10  619 14  HOH HOH A . 
G 5 HOH 11  620 15  HOH HOH A . 
G 5 HOH 12  621 16  HOH HOH A . 
G 5 HOH 13  622 22  HOH HOH A . 
G 5 HOH 14  623 24  HOH HOH A . 
G 5 HOH 15  624 25  HOH HOH A . 
G 5 HOH 16  625 27  HOH HOH A . 
G 5 HOH 17  626 28  HOH HOH A . 
G 5 HOH 18  627 29  HOH HOH A . 
G 5 HOH 19  628 32  HOH HOH A . 
G 5 HOH 20  629 35  HOH HOH A . 
G 5 HOH 21  630 36  HOH HOH A . 
G 5 HOH 22  631 37  HOH HOH A . 
G 5 HOH 23  632 41  HOH HOH A . 
G 5 HOH 24  633 44  HOH HOH A . 
G 5 HOH 25  634 45  HOH HOH A . 
G 5 HOH 26  635 46  HOH HOH A . 
G 5 HOH 27  636 48  HOH HOH A . 
G 5 HOH 28  637 49  HOH HOH A . 
G 5 HOH 29  638 50  HOH HOH A . 
G 5 HOH 30  639 51  HOH HOH A . 
G 5 HOH 31  640 52  HOH HOH A . 
G 5 HOH 32  641 53  HOH HOH A . 
G 5 HOH 33  642 55  HOH HOH A . 
G 5 HOH 34  643 56  HOH HOH A . 
G 5 HOH 35  644 58  HOH HOH A . 
G 5 HOH 36  645 64  HOH HOH A . 
G 5 HOH 37  646 69  HOH HOH A . 
G 5 HOH 38  647 70  HOH HOH A . 
G 5 HOH 39  648 71  HOH HOH A . 
G 5 HOH 40  649 72  HOH HOH A . 
G 5 HOH 41  650 75  HOH HOH A . 
G 5 HOH 42  651 76  HOH HOH A . 
G 5 HOH 43  652 77  HOH HOH A . 
G 5 HOH 44  653 78  HOH HOH A . 
G 5 HOH 45  654 80  HOH HOH A . 
G 5 HOH 46  655 81  HOH HOH A . 
G 5 HOH 47  656 89  HOH HOH A . 
G 5 HOH 48  657 90  HOH HOH A . 
G 5 HOH 49  658 91  HOH HOH A . 
G 5 HOH 50  659 93  HOH HOH A . 
G 5 HOH 51  660 94  HOH HOH A . 
G 5 HOH 52  661 95  HOH HOH A . 
G 5 HOH 53  662 96  HOH HOH A . 
G 5 HOH 54  663 97  HOH HOH A . 
G 5 HOH 55  664 99  HOH HOH A . 
G 5 HOH 56  665 106 HOH HOH A . 
G 5 HOH 57  666 109 HOH HOH A . 
G 5 HOH 58  667 110 HOH HOH A . 
G 5 HOH 59  668 111 HOH HOH A . 
G 5 HOH 60  669 112 HOH HOH A . 
G 5 HOH 61  670 113 HOH HOH A . 
G 5 HOH 62  671 114 HOH HOH A . 
G 5 HOH 63  672 115 HOH HOH A . 
G 5 HOH 64  673 119 HOH HOH A . 
G 5 HOH 65  674 121 HOH HOH A . 
G 5 HOH 66  675 125 HOH HOH A . 
G 5 HOH 67  676 127 HOH HOH A . 
G 5 HOH 68  677 128 HOH HOH A . 
G 5 HOH 69  678 130 HOH HOH A . 
G 5 HOH 70  679 131 HOH HOH A . 
G 5 HOH 71  680 133 HOH HOH A . 
G 5 HOH 72  681 135 HOH HOH A . 
G 5 HOH 73  682 136 HOH HOH A . 
G 5 HOH 74  683 137 HOH HOH A . 
G 5 HOH 75  684 138 HOH HOH A . 
G 5 HOH 76  685 139 HOH HOH A . 
G 5 HOH 77  686 140 HOH HOH A . 
G 5 HOH 78  687 141 HOH HOH A . 
G 5 HOH 79  688 146 HOH HOH A . 
G 5 HOH 80  689 148 HOH HOH A . 
G 5 HOH 81  690 149 HOH HOH A . 
G 5 HOH 82  691 150 HOH HOH A . 
G 5 HOH 83  692 151 HOH HOH A . 
G 5 HOH 84  693 153 HOH HOH A . 
G 5 HOH 85  694 155 HOH HOH A . 
G 5 HOH 86  695 156 HOH HOH A . 
G 5 HOH 87  696 157 HOH HOH A . 
G 5 HOH 88  697 159 HOH HOH A . 
G 5 HOH 89  698 160 HOH HOH A . 
G 5 HOH 90  699 161 HOH HOH A . 
G 5 HOH 91  700 162 HOH HOH A . 
G 5 HOH 92  701 163 HOH HOH A . 
G 5 HOH 93  702 164 HOH HOH A . 
G 5 HOH 94  703 165 HOH HOH A . 
G 5 HOH 95  704 168 HOH HOH A . 
G 5 HOH 96  705 172 HOH HOH A . 
G 5 HOH 97  706 173 HOH HOH A . 
G 5 HOH 98  707 175 HOH HOH A . 
G 5 HOH 99  708 177 HOH HOH A . 
G 5 HOH 100 709 178 HOH HOH A . 
G 5 HOH 101 710 180 HOH HOH A . 
G 5 HOH 102 711 181 HOH HOH A . 
G 5 HOH 103 712 182 HOH HOH A . 
G 5 HOH 104 713 185 HOH HOH A . 
G 5 HOH 105 714 186 HOH HOH A . 
G 5 HOH 106 715 187 HOH HOH A . 
G 5 HOH 107 716 188 HOH HOH A . 
G 5 HOH 108 717 189 HOH HOH A . 
G 5 HOH 109 718 191 HOH HOH A . 
G 5 HOH 110 719 192 HOH HOH A . 
G 5 HOH 111 720 194 HOH HOH A . 
G 5 HOH 112 721 195 HOH HOH A . 
G 5 HOH 113 722 197 HOH HOH A . 
G 5 HOH 114 723 198 HOH HOH A . 
G 5 HOH 115 724 200 HOH HOH A . 
G 5 HOH 116 725 207 HOH HOH A . 
G 5 HOH 117 726 208 HOH HOH A . 
G 5 HOH 118 727 210 HOH HOH A . 
G 5 HOH 119 728 214 HOH HOH A . 
G 5 HOH 120 729 216 HOH HOH A . 
G 5 HOH 121 730 217 HOH HOH A . 
G 5 HOH 122 731 218 HOH HOH A . 
G 5 HOH 123 732 221 HOH HOH A . 
G 5 HOH 124 733 222 HOH HOH A . 
G 5 HOH 125 734 223 HOH HOH A . 
G 5 HOH 126 735 224 HOH HOH A . 
G 5 HOH 127 736 225 HOH HOH A . 
G 5 HOH 128 737 227 HOH HOH A . 
G 5 HOH 129 738 228 HOH HOH A . 
G 5 HOH 130 739 231 HOH HOH A . 
G 5 HOH 131 740 234 HOH HOH A . 
G 5 HOH 132 741 236 HOH HOH A . 
G 5 HOH 133 742 237 HOH HOH A . 
G 5 HOH 134 743 238 HOH HOH A . 
G 5 HOH 135 744 241 HOH HOH A . 
G 5 HOH 136 745 243 HOH HOH A . 
G 5 HOH 137 746 248 HOH HOH A . 
G 5 HOH 138 747 249 HOH HOH A . 
G 5 HOH 139 748 250 HOH HOH A . 
G 5 HOH 140 749 251 HOH HOH A . 
G 5 HOH 141 750 252 HOH HOH A . 
G 5 HOH 142 751 255 HOH HOH A . 
H 5 HOH 1   566 1   HOH HOH B . 
H 5 HOH 2   567 5   HOH HOH B . 
H 5 HOH 3   568 10  HOH HOH B . 
H 5 HOH 4   569 13  HOH HOH B . 
H 5 HOH 5   570 17  HOH HOH B . 
H 5 HOH 6   571 18  HOH HOH B . 
H 5 HOH 7   572 19  HOH HOH B . 
H 5 HOH 8   573 20  HOH HOH B . 
H 5 HOH 9   574 21  HOH HOH B . 
H 5 HOH 10  575 23  HOH HOH B . 
H 5 HOH 11  576 26  HOH HOH B . 
H 5 HOH 12  577 30  HOH HOH B . 
H 5 HOH 13  578 31  HOH HOH B . 
H 5 HOH 14  579 33  HOH HOH B . 
H 5 HOH 15  580 34  HOH HOH B . 
H 5 HOH 16  581 38  HOH HOH B . 
H 5 HOH 17  582 39  HOH HOH B . 
H 5 HOH 18  583 40  HOH HOH B . 
H 5 HOH 19  584 42  HOH HOH B . 
H 5 HOH 20  585 43  HOH HOH B . 
H 5 HOH 21  586 47  HOH HOH B . 
H 5 HOH 22  587 54  HOH HOH B . 
H 5 HOH 23  588 57  HOH HOH B . 
H 5 HOH 24  589 59  HOH HOH B . 
H 5 HOH 25  590 60  HOH HOH B . 
H 5 HOH 26  591 61  HOH HOH B . 
H 5 HOH 27  592 62  HOH HOH B . 
H 5 HOH 28  593 63  HOH HOH B . 
H 5 HOH 29  594 65  HOH HOH B . 
H 5 HOH 30  595 66  HOH HOH B . 
H 5 HOH 31  596 67  HOH HOH B . 
H 5 HOH 32  597 68  HOH HOH B . 
H 5 HOH 33  598 73  HOH HOH B . 
H 5 HOH 34  599 74  HOH HOH B . 
H 5 HOH 35  600 79  HOH HOH B . 
H 5 HOH 36  601 82  HOH HOH B . 
H 5 HOH 37  602 84  HOH HOH B . 
H 5 HOH 38  603 85  HOH HOH B . 
H 5 HOH 39  604 86  HOH HOH B . 
H 5 HOH 40  605 87  HOH HOH B . 
H 5 HOH 41  606 88  HOH HOH B . 
H 5 HOH 42  607 92  HOH HOH B . 
H 5 HOH 43  608 98  HOH HOH B . 
H 5 HOH 44  609 100 HOH HOH B . 
H 5 HOH 45  610 101 HOH HOH B . 
H 5 HOH 46  611 102 HOH HOH B . 
H 5 HOH 47  612 103 HOH HOH B . 
H 5 HOH 48  613 104 HOH HOH B . 
H 5 HOH 49  614 105 HOH HOH B . 
H 5 HOH 50  615 107 HOH HOH B . 
H 5 HOH 51  616 108 HOH HOH B . 
H 5 HOH 52  617 116 HOH HOH B . 
H 5 HOH 53  618 117 HOH HOH B . 
H 5 HOH 54  619 118 HOH HOH B . 
H 5 HOH 55  620 120 HOH HOH B . 
H 5 HOH 56  621 122 HOH HOH B . 
H 5 HOH 57  622 123 HOH HOH B . 
H 5 HOH 58  623 124 HOH HOH B . 
H 5 HOH 59  624 126 HOH HOH B . 
H 5 HOH 60  625 129 HOH HOH B . 
H 5 HOH 61  626 132 HOH HOH B . 
H 5 HOH 62  627 134 HOH HOH B . 
H 5 HOH 63  628 142 HOH HOH B . 
H 5 HOH 64  629 143 HOH HOH B . 
H 5 HOH 65  630 144 HOH HOH B . 
H 5 HOH 66  631 145 HOH HOH B . 
H 5 HOH 67  632 147 HOH HOH B . 
H 5 HOH 68  633 152 HOH HOH B . 
H 5 HOH 69  634 154 HOH HOH B . 
H 5 HOH 70  635 166 HOH HOH B . 
H 5 HOH 71  636 167 HOH HOH B . 
H 5 HOH 72  637 169 HOH HOH B . 
H 5 HOH 73  638 170 HOH HOH B . 
H 5 HOH 74  639 171 HOH HOH B . 
H 5 HOH 75  640 174 HOH HOH B . 
H 5 HOH 76  641 176 HOH HOH B . 
H 5 HOH 77  642 179 HOH HOH B . 
H 5 HOH 78  643 183 HOH HOH B . 
H 5 HOH 79  644 184 HOH HOH B . 
H 5 HOH 80  645 190 HOH HOH B . 
H 5 HOH 81  646 193 HOH HOH B . 
H 5 HOH 82  647 196 HOH HOH B . 
H 5 HOH 83  648 199 HOH HOH B . 
H 5 HOH 84  649 201 HOH HOH B . 
H 5 HOH 85  650 202 HOH HOH B . 
H 5 HOH 86  651 203 HOH HOH B . 
H 5 HOH 87  652 204 HOH HOH B . 
H 5 HOH 88  653 205 HOH HOH B . 
H 5 HOH 89  654 206 HOH HOH B . 
H 5 HOH 90  655 209 HOH HOH B . 
H 5 HOH 91  656 211 HOH HOH B . 
H 5 HOH 92  657 212 HOH HOH B . 
H 5 HOH 93  658 213 HOH HOH B . 
H 5 HOH 94  659 215 HOH HOH B . 
H 5 HOH 95  660 219 HOH HOH B . 
H 5 HOH 96  661 220 HOH HOH B . 
H 5 HOH 97  662 229 HOH HOH B . 
H 5 HOH 98  663 230 HOH HOH B . 
H 5 HOH 99  664 232 HOH HOH B . 
H 5 HOH 100 665 233 HOH HOH B . 
H 5 HOH 101 666 235 HOH HOH B . 
H 5 HOH 102 667 239 HOH HOH B . 
H 5 HOH 103 668 240 HOH HOH B . 
H 5 HOH 104 669 242 HOH HOH B . 
H 5 HOH 105 670 244 HOH HOH B . 
H 5 HOH 106 671 245 HOH HOH B . 
H 5 HOH 107 672 246 HOH HOH B . 
H 5 HOH 108 673 247 HOH HOH B . 
H 5 HOH 109 674 253 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-08-10 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-02-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Experimental preparation'  
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            exptl_crystal_grow 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_exptl_crystal_grow.pdbx_details' 
2 4 'Structure model' '_exptl_crystal_grow.temp'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
AMoRE     phasing          .   ? 1 ? ? ? ? 
CNS       refinement       1.0 ? 2 ? ? ? ? 
DENZO     'data reduction' .   ? 3 ? ? ? ? 
SCALEPACK 'data scaling'   .   ? 4 ? ? ? ? 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             THR 
_pdbx_validate_rmsd_angle.auth_seq_id_1              401 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              402 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              402 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                128.76 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            9.46 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 53  ? ? 60.43   81.83   
2  1 LEU A 143 ? ? -37.52  -37.19  
3  1 SER A 162 ? ? -110.13 -97.26  
4  1 ASN A 174 ? ? -152.64 66.07   
5  1 MET A 203 ? ? -108.16 74.98   
6  1 PHE A 216 ? ? -145.24 -50.77  
7  1 ILE A 220 ? ? -130.11 -51.21  
8  1 SER A 257 ? ? 173.97  143.95  
9  1 THR A 292 ? ? -148.15 -0.29   
10 1 PHE A 340 ? ? -132.34 -88.85  
11 1 LYS A 424 ? ? 80.45   21.75   
12 1 SER A 475 ? ? -50.00  -18.25  
13 1 ASN B 22  ? ? -56.06  103.46  
14 1 PRO B 25  ? ? -38.91  88.23   
15 1 ASP B 65  ? ? -150.39 86.97   
16 1 PRO B 67  ? ? -70.90  37.43   
17 1 TYR B 74  ? ? 31.65   54.40   
18 1 GLN B 103 ? ? -109.52 -165.14 
19 1 SER B 191 ? ? -155.22 84.70   
20 1 PHE B 192 ? ? -47.73  109.61  
21 1 LEU B 194 ? ? -59.73  4.04    
22 1 LEU B 268 ? ? -161.59 116.28  
23 1 ASP B 300 ? ? -54.18  172.43  
24 1 ASP B 301 ? ? 62.01   63.34   
25 1 GLU B 302 ? ? -53.83  80.25   
26 1 CYS B 339 ? ? 178.68  162.64  
27 1 PHE B 340 ? ? -156.19 78.01   
28 1 GLN B 432 ? ? -91.46  55.78   
29 1 ASN B 440 ? ? -86.85  49.78   
30 1 LYS B 443 ? ? -134.21 -41.42  
31 1 GLU B 468 ? ? 47.13   26.98   
32 1 LYS B 469 ? ? 18.26   84.35   
33 1 THR B 470 ? ? -149.85 20.37   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 D DG 4 ? P   ? B DG 4 P   
2 1 Y 1 D DG 4 ? OP1 ? B DG 4 OP1 
3 1 Y 1 D DG 4 ? OP2 ? B DG 4 OP2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 C DG  19  ? A DG  19  
2   1 Y 1 C DC  20  ? A DC  20  
3   1 Y 1 C DG  21  ? A DG  21  
4   1 Y 1 D DC  1   ? B DC  1   
5   1 Y 1 D DG  2   ? B DG  2   
6   1 Y 1 D DC  3   ? B DC  3   
7   1 Y 1 A MET 1   ? C MET 1   
8   1 Y 1 A SER 2   ? C SER 2   
9   1 Y 1 A GLY 3   ? C GLY 3   
10  1 Y 1 A TRP 4   ? C TRP 4   
11  1 Y 1 A GLU 5   ? C GLU 5   
12  1 Y 1 A SER 6   ? C SER 6   
13  1 Y 1 A TYR 7   ? C TYR 7   
14  1 Y 1 A TYR 8   ? C TYR 8   
15  1 Y 1 A LYS 9   ? C LYS 9   
16  1 Y 1 A THR 10  ? C THR 10  
17  1 Y 1 A GLU 11  ? C GLU 11  
18  1 Y 1 A GLY 12  ? C GLY 12  
19  1 Y 1 A ASP 13  ? C ASP 13  
20  1 Y 1 A GLU 14  ? C GLU 14  
21  1 Y 1 A GLU 15  ? C GLU 15  
22  1 Y 1 A ALA 16  ? C ALA 16  
23  1 Y 1 A GLU 17  ? C GLU 17  
24  1 Y 1 A GLU 18  ? C GLU 18  
25  1 Y 1 A GLU 19  ? C GLU 19  
26  1 Y 1 A GLN 20  ? C GLN 20  
27  1 Y 1 A GLU 21  ? C GLU 21  
28  1 Y 1 A GLU 22  ? C GLU 22  
29  1 Y 1 A ASN 23  ? C ASN 23  
30  1 Y 1 A LEU 24  ? C LEU 24  
31  1 Y 1 A GLU 25  ? C GLU 25  
32  1 Y 1 A ALA 26  ? C ALA 26  
33  1 Y 1 A SER 27  ? C SER 27  
34  1 Y 1 A GLY 28  ? C GLY 28  
35  1 Y 1 A ASP 29  ? C ASP 29  
36  1 Y 1 A TYR 30  ? C TYR 30  
37  1 Y 1 A LYS 31  ? C LYS 31  
38  1 Y 1 A TYR 32  ? C TYR 32  
39  1 Y 1 A SER 33  ? C SER 33  
40  1 Y 1 A ILE 223 ? C ILE 223 
41  1 Y 1 A ALA 224 ? C ALA 224 
42  1 Y 1 A GLU 225 ? C GLU 225 
43  1 Y 1 A ASP 226 ? C ASP 226 
44  1 Y 1 A GLU 227 ? C GLU 227 
45  1 Y 1 A ASP 228 ? C ASP 228 
46  1 Y 1 A LEU 229 ? C LEU 229 
47  1 Y 1 A ARG 230 ? C ARG 230 
48  1 Y 1 A ASN 535 ? C ASN 535 
49  1 Y 1 A PRO 536 ? C PRO 536 
50  1 Y 1 A GLU 537 ? C GLU 537 
51  1 Y 1 A GLY 538 ? C GLY 538 
52  1 Y 1 A LYS 539 ? C LYS 539 
53  1 Y 1 A VAL 540 ? C VAL 540 
54  1 Y 1 A THR 541 ? C THR 541 
55  1 Y 1 A LYS 542 ? C LYS 542 
56  1 Y 1 A ARG 543 ? C ARG 543 
57  1 Y 1 A LYS 544 ? C LYS 544 
58  1 Y 1 A HIS 545 ? C HIS 545 
59  1 Y 1 A ASP 546 ? C ASP 546 
60  1 Y 1 A ASN 547 ? C ASN 547 
61  1 Y 1 A GLU 548 ? C GLU 548 
62  1 Y 1 A GLY 549 ? C GLY 549 
63  1 Y 1 A SER 550 ? C SER 550 
64  1 Y 1 A GLY 551 ? C GLY 551 
65  1 Y 1 A SER 552 ? C SER 552 
66  1 Y 1 A LYS 553 ? C LYS 553 
67  1 Y 1 A ARG 554 ? C ARG 554 
68  1 Y 1 A PRO 555 ? C PRO 555 
69  1 Y 1 A LYS 556 ? C LYS 556 
70  1 Y 1 A VAL 557 ? C VAL 557 
71  1 Y 1 A GLU 558 ? C GLU 558 
72  1 Y 1 A TYR 559 ? C TYR 559 
73  1 Y 1 A SER 560 ? C SER 560 
74  1 Y 1 A GLU 561 ? C GLU 561 
75  1 Y 1 A GLU 562 ? C GLU 562 
76  1 Y 1 A GLU 563 ? C GLU 563 
77  1 Y 1 A LEU 564 ? C LEU 564 
78  1 Y 1 A LYS 565 ? C LYS 565 
79  1 Y 1 A THR 566 ? C THR 566 
80  1 Y 1 A HIS 567 ? C HIS 567 
81  1 Y 1 A ILE 568 ? C ILE 568 
82  1 Y 1 A SER 569 ? C SER 569 
83  1 Y 1 A LYS 570 ? C LYS 570 
84  1 Y 1 A GLY 571 ? C GLY 571 
85  1 Y 1 A THR 572 ? C THR 572 
86  1 Y 1 A LEU 573 ? C LEU 573 
87  1 Y 1 A GLY 574 ? C GLY 574 
88  1 Y 1 A LYS 575 ? C LYS 575 
89  1 Y 1 A PHE 576 ? C PHE 576 
90  1 Y 1 A THR 577 ? C THR 577 
91  1 Y 1 A VAL 578 ? C VAL 578 
92  1 Y 1 A PRO 579 ? C PRO 579 
93  1 Y 1 A MET 580 ? C MET 580 
94  1 Y 1 A LEU 581 ? C LEU 581 
95  1 Y 1 A LYS 582 ? C LYS 582 
96  1 Y 1 A GLU 583 ? C GLU 583 
97  1 Y 1 A ALA 584 ? C ALA 584 
98  1 Y 1 A CYS 585 ? C CYS 585 
99  1 Y 1 A ARG 586 ? C ARG 586 
100 1 Y 1 A ALA 587 ? C ALA 587 
101 1 Y 1 A TYR 588 ? C TYR 588 
102 1 Y 1 A GLY 589 ? C GLY 589 
103 1 Y 1 A LEU 590 ? C LEU 590 
104 1 Y 1 A LYS 591 ? C LYS 591 
105 1 Y 1 A SER 592 ? C SER 592 
106 1 Y 1 A GLY 593 ? C GLY 593 
107 1 Y 1 A LEU 594 ? C LEU 594 
108 1 Y 1 A LYS 595 ? C LYS 595 
109 1 Y 1 A LYS 596 ? C LYS 596 
110 1 Y 1 A GLN 597 ? C GLN 597 
111 1 Y 1 A GLU 598 ? C GLU 598 
112 1 Y 1 A LEU 599 ? C LEU 599 
113 1 Y 1 A LEU 600 ? C LEU 600 
114 1 Y 1 A GLU 601 ? C GLU 601 
115 1 Y 1 A ALA 602 ? C ALA 602 
116 1 Y 1 A LEU 603 ? C LEU 603 
117 1 Y 1 A THR 604 ? C THR 604 
118 1 Y 1 A LYS 605 ? C LYS 605 
119 1 Y 1 A HIS 606 ? C HIS 606 
120 1 Y 1 A PHE 607 ? C PHE 607 
121 1 Y 1 A GLN 608 ? C GLN 608 
122 1 Y 1 A ASP 609 ? C ASP 609 
123 1 Y 1 B MET 1   ? D MET 1   
124 1 Y 1 B VAL 2   ? D VAL 2   
125 1 Y 1 B ARG 3   ? D ARG 3   
126 1 Y 1 B SER 4   ? D SER 4   
127 1 Y 1 B GLY 5   ? D GLY 5   
128 1 Y 1 B LYS 171 ? D LYS 171 
129 1 Y 1 B GLU 172 ? D GLU 172 
130 1 Y 1 B ASP 173 ? D ASP 173 
131 1 Y 1 B GLY 174 ? D GLY 174 
132 1 Y 1 B SER 175 ? D SER 175 
133 1 Y 1 B GLY 176 ? D GLY 176 
134 1 Y 1 B ASP 177 ? D ASP 177 
135 1 Y 1 B ARG 178 ? D ARG 178 
136 1 Y 1 B GLY 179 ? D GLY 179 
137 1 Y 1 B ASP 180 ? D ASP 180 
138 1 Y 1 B ASP 546 ? D ASP 546 
139 1 Y 1 B GLN 547 ? D GLN 547 
140 1 Y 1 B VAL 548 ? D VAL 548 
141 1 Y 1 B THR 549 ? D THR 549 
142 1 Y 1 B ALA 550 ? D ALA 550 
143 1 Y 1 B GLN 551 ? D GLN 551 
144 1 Y 1 B GLU 552 ? D GLU 552 
145 1 Y 1 B ILE 553 ? D ILE 553 
146 1 Y 1 B PHE 554 ? D PHE 554 
147 1 Y 1 B GLN 555 ? D GLN 555 
148 1 Y 1 B ASP 556 ? D ASP 556 
149 1 Y 1 B ASN 557 ? D ASN 557 
150 1 Y 1 B HIS 558 ? D HIS 558 
151 1 Y 1 B GLU 559 ? D GLU 559 
152 1 Y 1 B ASP 560 ? D ASP 560 
153 1 Y 1 B GLY 561 ? D GLY 561 
154 1 Y 1 B PRO 562 ? D PRO 562 
155 1 Y 1 B THR 563 ? D THR 563 
156 1 Y 1 B ALA 564 ? D ALA 564 
157 1 Y 1 B LYS 565 ? D LYS 565 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1JEY 'b-form double helix' 
1JEY 'hairpin loop'        
1JEY 'bulge loop'          
1JEY 'three-way junction'  
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 1  1_555 B DC 34 1_555 -0.196 -0.437 -1.853 -18.056 -2.808  2.518   1  C_DG1:DC34_D  C 1  ? D 34 ? 19 1 
1 A DT 2  1_555 B DA 33 1_555 0.147  -0.229 -0.464 5.004   -21.745 8.776   2  C_DT2:DA33_D  C 2  ? D 33 ? 20 1 
1 A DT 3  1_555 B DA 32 1_555 -0.001 -0.263 -0.915 0.619   -8.892  8.657   3  C_DT3:DA32_D  C 3  ? D 32 ? 20 1 
1 A DT 4  1_555 B DA 31 1_555 -0.153 -0.056 -0.565 -3.852  -7.881  0.885   4  C_DT4:DA31_D  C 4  ? D 31 ? 20 1 
1 A DT 5  1_555 B DA 30 1_555 -0.190 -0.138 -1.176 14.922  -3.390  -0.044  5  C_DT5:DA30_D  C 5  ? D 30 ? 20 1 
1 A DT 6  1_555 B DA 29 1_555 -0.068 -0.114 -1.466 33.514  -4.047  2.361   6  C_DT6:DA29_D  C 6  ? D 29 ? 20 1 
1 A DA 7  1_555 B DT 28 1_555 0.178  0.078  0.091  19.225  -10.686 -2.376  7  C_DA7:DT28_D  C 7  ? D 28 ? 20 1 
1 A DG 8  1_555 B DC 27 1_555 -0.171 0.027  0.319  13.905  -2.855  4.141   8  C_DG8:DC27_D  C 8  ? D 27 ? 19 1 
1 A DT 9  1_555 B DA 26 1_555 -0.064 -0.181 -0.560 3.584   -8.798  3.990   9  C_DT9:DA26_D  C 9  ? D 26 ? 20 1 
1 A DT 10 1_555 B DA 25 1_555 -0.143 0.040  0.326  -9.176  -5.336  -7.139  10 C_DT10:DA25_D C 10 ? D 25 ? 20 1 
1 A DT 11 1_555 B DA 24 1_555 -0.131 0.045  -0.549 3.718   9.690   -11.824 11 C_DT11:DA24_D C 11 ? D 24 ? 20 1 
1 A DA 12 1_555 B DT 23 1_555 0.166  -0.001 -0.120 7.236   3.369   -5.012  12 C_DA12:DT23_D C 12 ? D 23 ? 20 1 
1 A DT 13 1_555 B DA 22 1_555 -0.057 0.106  -0.440 16.324  -22.498 -8.590  13 C_DT13:DA22_D C 13 ? D 22 ? 20 1 
1 A DT 14 1_555 B DA 21 1_555 -0.072 -0.005 -0.116 6.208   -26.482 -4.818  14 C_DT14:DA21_D C 14 ? D 21 ? 20 1 
1 A DG 15 1_555 B DC 7  1_555 0.077  -0.061 0.392  -4.508  -8.411  -4.521  15 C_DG15:DC7_D  C 15 ? D 7  ? 19 1 
1 A DG 16 1_555 B DC 6  1_555 0.048  -0.091 -0.719 -3.031  7.267   -4.168  16 C_DG16:DC6_D  C 16 ? D 6  ? 19 1 
1 A DG 17 1_555 B DC 5  1_555 0.155  -0.301 -1.290 -5.220  13.105  -11.943 17 C_DG17:DC5_D  C 17 ? D 5  ? 19 1 
1 A DC 18 1_555 B DG 4  1_555 0.092  -0.001 -0.143 -1.022  8.721   -3.720  18 C_DC18:DG4_D  C 18 ? D 4  ? 19 1 
1 B DA 8  1_555 B DT 20 1_555 0.061  0.045  -0.303 -6.937  -15.367 -4.974  19 D_DA8:DT20_D  D 8  ? D 20 ? 20 1 
1 B DG 9  1_555 B DC 19 1_555 -0.166 -0.008 -0.973 -17.981 -2.929  -1.241  20 D_DG9:DC19_D  D 9  ? D 19 ? 19 1 
1 B DC 10 1_555 B DG 18 1_555 0.169  -0.073 -0.215 10.254  -3.232  -2.809  21 D_DC10:DG18_D D 10 ? D 18 ? 19 1 
1 B DT 11 1_555 B DA 17 1_555 -0.079 0.009  0.283  9.131   3.825   -9.928  22 D_DT11:DA17_D D 11 ? D 17 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1  1_555 B DC 34 1_555 A DT 2  1_555 B DA 33 1_555 -0.433 0.777  2.903 -5.289 -0.953 39.685 1.232  0.091  2.916 -1.396  
7.748   40.033 1  CC_DG1DT2:DA33DC34_DD   C 1  ? D 34 ? C 2  ? D 33 ? 
1 A DT 2  1_555 B DA 33 1_555 A DT 3  1_555 B DA 32 1_555 0.452  0.989  3.169 4.158  3.081  42.908 1.046  -0.212 3.257 4.193   
-5.659  43.204 2  CC_DT2DT3:DA32DA33_DD   C 2  ? D 33 ? C 3  ? D 32 ? 
1 A DT 3  1_555 B DA 32 1_555 A DT 4  1_555 B DA 31 1_555 -0.772 0.595  3.398 -3.698 9.759  32.747 -0.642 0.682  3.491 16.786  
6.361   34.326 3  CC_DT3DT4:DA31DA32_DD   C 3  ? D 32 ? C 4  ? D 31 ? 
1 A DT 4  1_555 B DA 31 1_555 A DT 5  1_555 B DA 30 1_555 0.216  0.152  2.675 2.711  1.645  35.297 0.051  -0.028 2.688 2.706   
-4.461  35.435 4  CC_DT4DT5:DA30DA31_DD   C 4  ? D 31 ? C 5  ? D 30 ? 
1 A DT 5  1_555 B DA 30 1_555 A DT 6  1_555 B DA 29 1_555 0.375  0.580  2.867 1.547  4.249  33.356 0.385  -0.424 2.931 7.360   
-2.680  33.652 5  CC_DT5DT6:DA29DA30_DD   C 5  ? D 30 ? C 6  ? D 29 ? 
1 A DT 6  1_555 B DA 29 1_555 A DA 7  1_555 B DT 28 1_555 -0.556 0.562  3.991 -7.695 4.253  39.594 0.219  -0.268 4.061 6.187   
11.192  40.520 6  CC_DT6DA7:DT28DA29_DD   C 6  ? D 29 ? C 7  ? D 28 ? 
1 A DA 7  1_555 B DT 28 1_555 A DG 8  1_555 B DC 27 1_555 0.678  -0.607 3.205 -3.967 0.888  36.980 -1.066 -1.573 3.104 1.395   
6.231   37.195 7  CC_DA7DG8:DC27DT28_DD   C 7  ? D 28 ? C 8  ? D 27 ? 
1 A DG 8  1_555 B DC 27 1_555 A DT 9  1_555 B DA 26 1_555 -0.307 -1.035 3.467 6.296  1.018  29.766 -2.185 1.902  3.298 1.954   
-12.082 30.427 8  CC_DG8DT9:DA26DC27_DD   C 8  ? D 27 ? C 9  ? D 26 ? 
1 A DT 9  1_555 B DA 26 1_555 A DT 10 1_555 B DA 25 1_555 -0.638 -1.170 3.631 -6.073 5.585  33.053 -2.977 0.025  3.453 9.630   
10.472  34.039 9  CC_DT9DT10:DA25DA26_DD  C 9  ? D 26 ? C 10 ? D 25 ? 
1 A DT 10 1_555 B DA 25 1_555 A DT 11 1_555 B DA 24 1_555 0.422  0.386  2.881 4.362  -5.995 33.591 1.477  -0.115 2.803 -10.218 
-7.435  34.376 10 CC_DT10DT11:DA24DA25_DD C 10 ? D 25 ? C 11 ? D 24 ? 
1 A DT 11 1_555 B DA 24 1_555 A DA 12 1_555 B DT 23 1_555 0.344  0.763  3.298 -2.500 -3.078 38.364 1.534  -0.829 3.202 -4.668  
3.792   38.561 11 CC_DT11DA12:DT23DA24_DD C 11 ? D 24 ? C 12 ? D 23 ? 
1 A DA 12 1_555 B DT 23 1_555 A DT 13 1_555 B DA 22 1_555 -1.114 -0.087 2.980 1.527  -5.580 29.054 0.898  2.471  2.885 -10.986 
-3.005  29.612 12 CC_DA12DT13:DA22DT23_DD C 12 ? D 23 ? C 13 ? D 22 ? 
1 A DT 13 1_555 B DA 22 1_555 A DT 14 1_555 B DA 21 1_555 0.613  -0.286 3.220 0.546  7.667  39.570 -1.263 -0.830 3.121 11.197  
-0.798  40.281 13 CC_DT13DT14:DA21DA22_DD C 13 ? D 22 ? C 14 ? D 21 ? 
1 A DG 15 1_555 B DC 7  1_555 A DG 16 1_555 B DC 6  1_555 0.552  0.042  3.366 9.658  -5.825 36.527 0.837  0.438  3.355 -9.032  
-14.975 38.172 14 CC_DG15DG16:DC6DC7_DD   C 15 ? D 7  ? C 16 ? D 6  ? 
1 A DG 16 1_555 B DC 6  1_555 A DG 17 1_555 B DC 5  1_555 -1.011 0.779  3.877 1.629  3.809  31.115 0.587  2.234  3.885 7.061   
-3.021  31.382 15 CC_DG16DG17:DC5DC6_DD   C 16 ? D 6  ? C 17 ? D 5  ? 
1 A DG 17 1_555 B DC 5  1_555 A DC 18 1_555 B DG 4  1_555 1.155  -0.711 3.540 -5.160 5.514  34.276 -2.041 -2.723 3.189 9.218   
8.625   35.074 16 CC_DG17DC18:DG4DC5_DD   C 17 ? D 5  ? C 18 ? D 4  ? 
1 B DA 8  1_555 B DT 20 1_555 B DG 9  1_555 B DC 19 1_555 0.309  0.614  3.696 3.302  3.362  32.009 0.423  0.114  3.752 6.056   
-5.948  32.345 17 DD_DA8DG9:DC19DT20_DD   D 8  ? D 20 ? D 9  ? D 19 ? 
1 B DG 9  1_555 B DC 19 1_555 B DC 10 1_555 B DG 18 1_555 -0.651 0.887  2.440 -5.837 -0.451 30.039 1.750  0.353  2.506 -0.860  
11.129  30.591 18 DD_DG9DC10:DG18DC19_DD  D 9  ? D 19 ? D 10 ? D 18 ? 
1 B DC 10 1_555 B DG 18 1_555 B DT 11 1_555 B DA 17 1_555 0.055  0.248  3.588 -0.019 2.281  34.409 0.030  -0.097 3.596 3.850   
0.032   34.482 19 DD_DC10DT11:DA17DG18_DD D 10 ? D 18 ? D 11 ? D 17 ? 
# 
_pdbx_entity_nonpoly.entity_id   5 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#