data_1JFZ
# 
_entry.id   1JFZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JFZ         
RCSB  RCSB013724   
WWPDB D_1000013724 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1I4S '1I4S IS THE CRYSTAL STRUCTURE OF UNLIGATED RNASE III ENDONUCLEASE DOMAIN FROM AQUIFEX AEOLICUS' unspecified 
PDB 1STU '1STU IS THE NMR SOLUTION STRUCTURE OF A DOUBLE-STRANDED RNA-BINDING DOMAIN FROM DROSOPHILA STAUFEN PROTEIN' unspecified 
PDB 1DI2 
'1DI2 IS THE CRYSTAL STRUCTURE OF A DOUBLE-STRANDED RNA-BINDING DOMAIN FROM XENOPUS LAEVIS COMPLEXED WITH DOUBLE-STRANDED RNA' 
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JFZ 
_pdbx_database_status.recvd_initial_deposition_date   2001-06-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Blaszczyk, J.' 1 
'Ji, X.'        2 
# 
_citation.id                        primary 
_citation.title                     
'Crystallographic and modeling studies of RNase III suggest a mechanism for double-stranded RNA cleavage.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            9 
_citation.page_first                1225 
_citation.page_last                 1236 
_citation.year                      2001 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11738048 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(01)00685-2' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Blaszczyk, J.'  1 
primary 'Tropea, J.E.'   2 
primary 'Bubunenko, M.'  3 
primary 'Routzahn, K.M.' 4 
primary 'Waugh, D.S.'    5 
primary 'Court, D.L.'    6 
primary 'Ji, X.'         7 
# 
_cell.entry_id           1JFZ 
_cell.length_a           49.741 
_cell.length_b           140.549 
_cell.length_c           49.759 
_cell.angle_alpha        90.00 
_cell.angle_beta         117.42 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JFZ 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'RIBONUCLEASE III'   18163.012 4   3.1.26.3 ? 'N-TERMINAL ENDONUCLEASE DOMAIN' ? 
2 non-polymer syn 'MANGANESE (II) ION' 54.938    4   ?        ? ?                                ? 
3 water       nat water                18.015    712 ?        ? ?                                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RNASE III' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GMKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEF
FNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GMKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEF
FNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   MET n 
1 3   LYS n 
1 4   MET n 
1 5   LEU n 
1 6   GLU n 
1 7   GLN n 
1 8   LEU n 
1 9   GLU n 
1 10  LYS n 
1 11  LYS n 
1 12  LEU n 
1 13  GLY n 
1 14  TYR n 
1 15  THR n 
1 16  PHE n 
1 17  LYS n 
1 18  ASP n 
1 19  LYS n 
1 20  SER n 
1 21  LEU n 
1 22  LEU n 
1 23  GLU n 
1 24  LYS n 
1 25  ALA n 
1 26  LEU n 
1 27  THR n 
1 28  HIS n 
1 29  VAL n 
1 30  SER n 
1 31  TYR n 
1 32  SER n 
1 33  LYS n 
1 34  LYS n 
1 35  GLU n 
1 36  HIS n 
1 37  TYR n 
1 38  GLU n 
1 39  THR n 
1 40  LEU n 
1 41  GLU n 
1 42  PHE n 
1 43  LEU n 
1 44  GLY n 
1 45  ASP n 
1 46  ALA n 
1 47  LEU n 
1 48  VAL n 
1 49  ASN n 
1 50  PHE n 
1 51  PHE n 
1 52  ILE n 
1 53  VAL n 
1 54  ASP n 
1 55  LEU n 
1 56  LEU n 
1 57  VAL n 
1 58  GLN n 
1 59  TYR n 
1 60  SER n 
1 61  PRO n 
1 62  ASN n 
1 63  LYS n 
1 64  ARG n 
1 65  GLU n 
1 66  GLY n 
1 67  PHE n 
1 68  LEU n 
1 69  SER n 
1 70  PRO n 
1 71  LEU n 
1 72  LYS n 
1 73  ALA n 
1 74  TYR n 
1 75  LEU n 
1 76  ILE n 
1 77  SER n 
1 78  GLU n 
1 79  GLU n 
1 80  PHE n 
1 81  PHE n 
1 82  ASN n 
1 83  LEU n 
1 84  LEU n 
1 85  ALA n 
1 86  GLN n 
1 87  LYS n 
1 88  LEU n 
1 89  GLU n 
1 90  LEU n 
1 91  HIS n 
1 92  LYS n 
1 93  PHE n 
1 94  ILE n 
1 95  ARG n 
1 96  ILE n 
1 97  LYS n 
1 98  ARG n 
1 99  GLY n 
1 100 LYS n 
1 101 ILE n 
1 102 ASN n 
1 103 GLU n 
1 104 THR n 
1 105 ILE n 
1 106 ILE n 
1 107 GLY n 
1 108 ASP n 
1 109 VAL n 
1 110 PHE n 
1 111 GLU n 
1 112 ALA n 
1 113 LEU n 
1 114 TRP n 
1 115 ALA n 
1 116 ALA n 
1 117 VAL n 
1 118 TYR n 
1 119 ILE n 
1 120 ASP n 
1 121 SER n 
1 122 GLY n 
1 123 ARG n 
1 124 ASP n 
1 125 ALA n 
1 126 ASN n 
1 127 PHE n 
1 128 THR n 
1 129 ARG n 
1 130 GLU n 
1 131 LEU n 
1 132 PHE n 
1 133 TYR n 
1 134 LYS n 
1 135 LEU n 
1 136 PHE n 
1 137 LYS n 
1 138 GLU n 
1 139 ASP n 
1 140 ILE n 
1 141 LEU n 
1 142 SER n 
1 143 ALA n 
1 144 ILE n 
1 145 LYS n 
1 146 GLU n 
1 147 GLY n 
1 148 ARG n 
1 149 HIS n 
1 150 HIS n 
1 151 HIS n 
1 152 HIS n 
1 153 HIS n 
1 154 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Aquifex 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Aquifex aeolicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     63363 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PKM803 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RNC_AQUAE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFF
NLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGR
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          O67082 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JFZ A 2 ? 148 ? O67082 1 ? 147 ? 1   147 
2 1 1JFZ B 2 ? 148 ? O67082 1 ? 147 ? 201 347 
3 1 1JFZ C 2 ? 148 ? O67082 1 ? 147 ? 401 547 
4 1 1JFZ D 2 ? 148 ? O67082 1 ? 147 ? 601 747 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1JFZ GLY A 1   ? UNP O67082 ? ? 'SEE REMARK 999' 0   1  
1 1JFZ HIS A 149 ? UNP O67082 ? ? 'EXPRESSION TAG' 148 2  
1 1JFZ HIS A 150 ? UNP O67082 ? ? 'EXPRESSION TAG' 149 3  
1 1JFZ HIS A 151 ? UNP O67082 ? ? 'EXPRESSION TAG' 150 4  
1 1JFZ HIS A 152 ? UNP O67082 ? ? 'EXPRESSION TAG' 151 5  
1 1JFZ HIS A 153 ? UNP O67082 ? ? 'EXPRESSION TAG' 152 6  
1 1JFZ HIS A 154 ? UNP O67082 ? ? 'EXPRESSION TAG' 153 7  
2 1JFZ GLY B 1   ? UNP O67082 ? ? 'SEE REMARK 999' 200 8  
2 1JFZ HIS B 149 ? UNP O67082 ? ? 'EXPRESSION TAG' 348 9  
2 1JFZ HIS B 150 ? UNP O67082 ? ? 'EXPRESSION TAG' 349 10 
2 1JFZ HIS B 151 ? UNP O67082 ? ? 'EXPRESSION TAG' 350 11 
2 1JFZ HIS B 152 ? UNP O67082 ? ? 'EXPRESSION TAG' 351 12 
2 1JFZ HIS B 153 ? UNP O67082 ? ? 'EXPRESSION TAG' 352 13 
2 1JFZ HIS B 154 ? UNP O67082 ? ? 'EXPRESSION TAG' 353 14 
3 1JFZ GLY C 1   ? UNP O67082 ? ? 'SEE REMARK 999' 400 15 
3 1JFZ HIS C 149 ? UNP O67082 ? ? 'EXPRESSION TAG' 548 16 
3 1JFZ HIS C 150 ? UNP O67082 ? ? 'EXPRESSION TAG' 549 17 
3 1JFZ HIS C 151 ? UNP O67082 ? ? 'EXPRESSION TAG' 550 18 
3 1JFZ HIS C 152 ? UNP O67082 ? ? 'EXPRESSION TAG' 551 19 
3 1JFZ HIS C 153 ? UNP O67082 ? ? 'EXPRESSION TAG' 552 20 
3 1JFZ HIS C 154 ? UNP O67082 ? ? 'EXPRESSION TAG' 553 21 
4 1JFZ GLY D 1   ? UNP O67082 ? ? 'SEE REMARK 999' 600 22 
4 1JFZ HIS D 149 ? UNP O67082 ? ? 'EXPRESSION TAG' 748 23 
4 1JFZ HIS D 150 ? UNP O67082 ? ? 'EXPRESSION TAG' 749 24 
4 1JFZ HIS D 151 ? UNP O67082 ? ? 'EXPRESSION TAG' 750 25 
4 1JFZ HIS D 152 ? UNP O67082 ? ? 'EXPRESSION TAG' 751 26 
4 1JFZ HIS D 153 ? UNP O67082 ? ? 'EXPRESSION TAG' 752 27 
4 1JFZ HIS D 154 ? UNP O67082 ? ? 'EXPRESSION TAG' 753 28 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'           54.938  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1JFZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.13 
_exptl_crystal.density_percent_sol   39.7 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.50 
_exptl_crystal_grow.pdbx_details    
'PEG4000, TRIS-HCL, ACETATE, CHLORIDE, pH 8.50, VAPOR DIFFUSION, HANGING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2001-03-21 
_diffrn_detector.details                MIRROR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SILICON 111' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.04500 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X9B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X9B 
_diffrn_source.pdbx_wavelength             1.04500 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1JFZ 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.100 
_reflns.number_obs                   33591 
_reflns.number_all                   33591 
_reflns.percent_possible_obs         92.9 
_reflns.pdbx_Rmerge_I_obs            0.059 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.3132 
_reflns.B_iso_Wilson_estimate        28.3 
_reflns.pdbx_redundancy              2.165 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.18 
_reflns_shell.percent_possible_all   74.7 
_reflns_shell.Rmerge_I_obs           0.185 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.985 
_reflns_shell.pdbx_redundancy        2.023 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2721 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1JFZ 
_refine.ls_number_reflns_obs                     26653 
_refine.ls_number_reflns_all                     31462 
_refine.pdbx_ls_sigma_I                          2.0 
_refine.pdbx_ls_sigma_F                          4.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    89.2 
_refine.ls_R_factor_obs                          0.1891 
_refine.ls_R_factor_all                          0.2079 
_refine.ls_R_factor_R_work                       0.1947 
_refine.ls_R_factor_R_free                       0.2863 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.464 
_refine.ls_number_reflns_R_free                  1719 
_refine.ls_number_parameters                     21898 
_refine.ls_number_restraints                     20454 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               31.865 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'MOEWS & KRETSINGER, J.MOL.BIOL.91(1975) 201-228' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  
'LEAST-SQUARES REFINEMENT USING THE KONNERT-HENDRICKSON CONJUGATE-GRADIENT ALGORITHM' 
_refine.pdbx_starting_model                      'PDB ID 1I4S' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1JFZ 
_refine_analyze.Luzzati_coordinate_error_obs    0.228 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      7 
_refine_analyze.occupancy_sum_hydrogen          0.00 
_refine_analyze.occupancy_sum_non_hydrogen      5640.0 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4948 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             712 
_refine_hist.number_atoms_total               5664 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.018 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.000 ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.020 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.036 ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.053 ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.034 ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.000 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.085 ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.000 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
. 2.10 2.21  . 0.255 . . . . . 3256 . . 'X-RAY DIFFRACTION' . 
. 2.21 2.33  . 0.231 . . . . . 3100 . . 'X-RAY DIFFRACTION' . 
. 2.33 2.46  . 0.219 . . . . . 3290 . . 'X-RAY DIFFRACTION' . 
. 2.46 2.62  . 0.198 . . . . . 3128 . . 'X-RAY DIFFRACTION' . 
. 2.62 2.81  . 0.185 . . . . . 3001 . . 'X-RAY DIFFRACTION' . 
. 2.81 3.07  . 0.173 . . . . . 3096 . . 'X-RAY DIFFRACTION' . 
. 3.07 3.47  . 0.168 . . . . . 3212 . . 'X-RAY DIFFRACTION' . 
. 3.47 4.20  . 0.166 . . . . . 3124 . . 'X-RAY DIFFRACTION' . 
. 4.20 6.85  . 0.179 . . . . . 3122 . . 'X-RAY DIFFRACTION' . 
. 6.85 30.00 . 0.293 . . . . . 918  . . 'X-RAY DIFFRACTION' . 
# 
_pdbx_refine.entry_id                                    1JFZ 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      0.2079 
_pdbx_refine.free_R_factor_no_cutoff                     0.2863 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     5.464 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            1719 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.1891 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.2642 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   5.440 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          1450 
_pdbx_refine.number_reflns_obs_4sig_cutoff               26653 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1JFZ 
_struct.title                     
'Crystal Structure of MN(II)-Complex of RNAse III Endonuclease Domain from Aquifex Aeolicus at 2.10 Angstrom Resolution' 
_struct.pdbx_descriptor           'RIBONUCLEASE III (E.C.3.1.26.3)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JFZ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'RIBONUCLEASE, RNASE III, DOUBLE-STRANDED RNA, RNA INTERFERENCE, ENDONUCLEASE DOMAIN, ENDONUCLEOLYTIC CLEAVAGE, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 
;The biological assembly is a dimer. The asymmetric unit is composed from two independent dimers: first dimer is composed from identical chains A and B, and second dimer from identical chains C and D
;
? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET A 4   ? GLY A 13  ? MET A 3   GLY A 12  1 ? 10 
HELX_P HELX_P2  2  ASP A 18  ? THR A 27  ? ASP A 17  THR A 26  1 ? 10 
HELX_P HELX_P3  3  TYR A 37  ? TYR A 59  ? TYR A 36  TYR A 58  1 ? 23 
HELX_P HELX_P4  4  ARG A 64  ? ILE A 76  ? ARG A 63  ILE A 75  1 ? 13 
HELX_P HELX_P5  5  SER A 77  ? LYS A 87  ? SER A 76  LYS A 86  1 ? 11 
HELX_P HELX_P6  6  LEU A 88  ? PHE A 93  ? LEU A 87  PHE A 92  5 ? 6  
HELX_P HELX_P7  7  ASN A 102 ? SER A 121 ? ASN A 101 SER A 120 1 ? 20 
HELX_P HELX_P8  8  ASP A 124 ? LYS A 137 ? ASP A 123 LYS A 136 1 ? 14 
HELX_P HELX_P9  9  PHE A 136 ? LYS A 145 ? PHE A 135 LYS A 144 1 ? 10 
HELX_P HELX_P10 10 GLN B 7   ? GLY B 13  ? GLN B 206 GLY B 212 1 ? 7  
HELX_P HELX_P11 11 ASP B 18  ? LEU B 26  ? ASP B 217 LEU B 225 1 ? 9  
HELX_P HELX_P12 12 TYR B 37  ? SER B 60  ? TYR B 236 SER B 259 1 ? 24 
HELX_P HELX_P13 13 ARG B 64  ? ILE B 76  ? ARG B 263 ILE B 275 1 ? 13 
HELX_P HELX_P14 14 SER B 77  ? GLN B 86  ? SER B 276 GLN B 285 1 ? 10 
HELX_P HELX_P15 15 GLU B 89  ? ILE B 94  ? GLU B 288 ILE B 293 1 ? 6  
HELX_P HELX_P16 16 ASN B 102 ? SER B 121 ? ASN B 301 SER B 320 1 ? 20 
HELX_P HELX_P17 17 ASP B 124 ? LYS B 137 ? ASP B 323 LYS B 336 1 ? 14 
HELX_P HELX_P18 18 PHE B 136 ? GLY B 147 ? PHE B 335 GLY B 346 1 ? 12 
HELX_P HELX_P19 19 MET C 4   ? GLY C 13  ? MET C 403 GLY C 412 1 ? 10 
HELX_P HELX_P20 20 ASP C 18  ? THR C 27  ? ASP C 417 THR C 426 1 ? 10 
HELX_P HELX_P21 21 TYR C 37  ? SER C 60  ? TYR C 436 SER C 459 1 ? 24 
HELX_P HELX_P22 22 ARG C 64  ? ILE C 76  ? ARG C 463 ILE C 475 1 ? 13 
HELX_P HELX_P23 23 SER C 77  ? LEU C 88  ? SER C 476 LEU C 487 1 ? 12 
HELX_P HELX_P24 24 GLU C 89  ? PHE C 93  ? GLU C 488 PHE C 492 5 ? 5  
HELX_P HELX_P25 25 ASN C 102 ? SER C 121 ? ASN C 501 SER C 520 1 ? 20 
HELX_P HELX_P26 26 ASP C 124 ? LYS C 137 ? ASP C 523 LYS C 536 1 ? 14 
HELX_P HELX_P27 27 PHE C 136 ? GLY C 147 ? PHE C 535 GLY C 546 1 ? 12 
HELX_P HELX_P28 28 GLN D 7   ? GLY D 13  ? GLN D 606 GLY D 612 1 ? 7  
HELX_P HELX_P29 29 ASP D 18  ? THR D 27  ? ASP D 617 THR D 626 1 ? 10 
HELX_P HELX_P30 30 TYR D 37  ? TYR D 59  ? TYR D 636 TYR D 658 1 ? 23 
HELX_P HELX_P31 31 ARG D 64  ? ILE D 76  ? ARG D 663 ILE D 675 1 ? 13 
HELX_P HELX_P32 32 SER D 77  ? GLU D 89  ? SER D 676 GLU D 688 1 ? 13 
HELX_P HELX_P33 33 GLU D 89  ? ILE D 94  ? GLU D 688 ILE D 693 1 ? 6  
HELX_P HELX_P34 34 ASN D 102 ? SER D 121 ? ASN D 701 SER D 720 1 ? 20 
HELX_P HELX_P35 35 ASP D 124 ? LYS D 137 ? ASP D 723 LYS D 736 1 ? 14 
HELX_P HELX_P36 36 PHE D 136 ? LYS D 145 ? PHE D 735 LYS D 744 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E MN . MN ? ? ? 1_555 A GLU 41  OE2 ? ? A MN 761 A GLU 40   1_555 ? ? ? ? ? ? ? 2.041 ? 
metalc2  metalc ? ? E MN . MN ? ? ? 1_555 A ASP 108 OD1 ? ? A MN 761 A ASP 107  1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc3  metalc ? ? E MN . MN ? ? ? 1_555 A GLU 111 OE1 ? ? A MN 761 A GLU 110  1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc4  metalc ? ? E MN . MN ? ? ? 1_555 I HOH .   O   ? ? A MN 761 A HOH 1137 1_555 ? ? ? ? ? ? ? 2.168 ? 
metalc5  metalc ? ? E MN . MN ? ? ? 1_555 I HOH .   O   ? ? A MN 761 A HOH 1004 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc6  metalc ? ? E MN . MN ? ? ? 1_555 I HOH .   O   ? ? A MN 761 A HOH 1056 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc7  metalc ? ? F MN . MN ? ? ? 1_555 J HOH .   O   ? ? B MN 762 B HOH 1325 1_555 ? ? ? ? ? ? ? 2.577 ? 
metalc8  metalc ? ? F MN . MN ? ? ? 1_555 B GLU 111 OE1 ? ? B MN 762 B GLU 310  1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc9  metalc ? ? F MN . MN ? ? ? 1_555 B GLU 41  OE1 ? ? B MN 762 B GLU 240  1_555 ? ? ? ? ? ? ? 2.680 ? 
metalc10 metalc ? ? F MN . MN ? ? ? 1_555 B ASP 108 OD1 ? ? B MN 762 B ASP 307  1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc11 metalc ? ? F MN . MN ? ? ? 1_555 J HOH .   O   ? ? B MN 762 B HOH 1007 1_555 ? ? ? ? ? ? ? 2.447 ? 
metalc12 metalc ? ? G MN . MN ? ? ? 1_555 C GLU 41  OE2 ? ? C MN 763 C GLU 440  1_555 ? ? ? ? ? ? ? 1.843 ? 
metalc13 metalc ? ? G MN . MN ? ? ? 1_555 K HOH .   O   ? ? C MN 763 C HOH 1008 1_555 ? ? ? ? ? ? ? 2.575 ? 
metalc14 metalc ? ? G MN . MN ? ? ? 1_555 K HOH .   O   ? ? C MN 763 C HOH 1039 1_555 ? ? ? ? ? ? ? 2.749 ? 
metalc15 metalc ? ? G MN . MN ? ? ? 1_555 C GLU 111 OE1 ? ? C MN 763 C GLU 510  1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc16 metalc ? ? G MN . MN ? ? ? 1_555 C ASP 108 OD1 ? ? C MN 763 C ASP 507  1_555 ? ? ? ? ? ? ? 2.513 ? 
metalc17 metalc ? ? G MN . MN ? ? ? 1_555 K HOH .   O   ? ? C MN 763 C HOH 1015 1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc18 metalc ? ? H MN . MN ? ? ? 1_555 D GLU 41  OE2 ? ? D MN 764 D GLU 640  1_555 ? ? ? ? ? ? ? 2.701 ? 
metalc19 metalc ? ? H MN . MN ? ? ? 1_555 D ASP 108 OD1 ? ? D MN 764 D ASP 707  1_555 ? ? ? ? ? ? ? 2.548 ? 
metalc20 metalc ? ? H MN . MN ? ? ? 1_555 D GLU 111 OE1 ? ? D MN 764 D GLU 710  1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc21 metalc ? ? H MN . MN ? ? ? 1_555 L HOH .   O   ? ? D MN 764 D HOH 1124 1_555 ? ? ? ? ? ? ? 2.265 ? 
metalc22 metalc ? ? H MN . MN ? ? ? 1_555 L HOH .   O   ? ? D MN 764 D HOH 1308 1_555 ? ? ? ? ? ? ? 2.773 ? 
metalc23 metalc ? ? H MN . MN ? ? ? 1_555 D GLU 41  OE1 ? ? D MN 764 D GLU 640  1_555 ? ? ? ? ? ? ? 2.370 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN A 761' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN B 762' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN C 763' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN D 764' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 GLU A 41  ? GLU A 40   . ? 1_555 ? 
2  AC1 6 ASP A 108 ? ASP A 107  . ? 1_555 ? 
3  AC1 6 GLU A 111 ? GLU A 110  . ? 1_555 ? 
4  AC1 6 HOH I .   ? HOH A 1004 . ? 1_555 ? 
5  AC1 6 HOH I .   ? HOH A 1056 . ? 1_555 ? 
6  AC1 6 HOH I .   ? HOH A 1137 . ? 1_555 ? 
7  AC2 6 GLU B 41  ? GLU B 240  . ? 1_555 ? 
8  AC2 6 ASP B 108 ? ASP B 307  . ? 1_555 ? 
9  AC2 6 GLU B 111 ? GLU B 310  . ? 1_555 ? 
10 AC2 6 HOH J .   ? HOH B 1007 . ? 1_555 ? 
11 AC2 6 HOH J .   ? HOH B 1246 . ? 1_555 ? 
12 AC2 6 HOH J .   ? HOH B 1325 . ? 1_555 ? 
13 AC3 6 GLU C 41  ? GLU C 440  . ? 1_555 ? 
14 AC3 6 ASP C 108 ? ASP C 507  . ? 1_555 ? 
15 AC3 6 GLU C 111 ? GLU C 510  . ? 1_555 ? 
16 AC3 6 HOH K .   ? HOH C 1008 . ? 1_555 ? 
17 AC3 6 HOH K .   ? HOH C 1015 . ? 1_555 ? 
18 AC3 6 HOH K .   ? HOH C 1039 . ? 1_555 ? 
19 AC4 6 GLU D 41  ? GLU D 640  . ? 1_555 ? 
20 AC4 6 ASP D 108 ? ASP D 707  . ? 1_555 ? 
21 AC4 6 GLU D 111 ? GLU D 710  . ? 1_555 ? 
22 AC4 6 HOH L .   ? HOH D 1124 . ? 1_555 ? 
23 AC4 6 HOH L .   ? HOH D 1308 . ? 1_555 ? 
24 AC4 6 HOH L .   ? HOH D 1311 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1JFZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1JFZ 
_atom_sites.fract_transf_matrix[1][1]   0.020104 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.010430 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007115 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022640 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 1   ? 1.419   -17.690 -1.746  1.00 63.67  ? 0    GLY A N   1 
ATOM   2    C  CA  . GLY A 1 1   ? 0.569   -18.861 -1.872  1.00 64.83  ? 0    GLY A CA  1 
ATOM   3    C  C   . GLY A 1 1   ? -0.847  -18.486 -2.282  1.00 68.09  ? 0    GLY A C   1 
ATOM   4    O  O   . GLY A 1 1   ? -1.080  -17.343 -2.684  1.00 66.67  ? 0    GLY A O   1 
ATOM   5    N  N   . MET A 1 2   ? -1.762  -19.437 -2.137  1.00 68.90  ? 1    MET A N   1 
ATOM   6    C  CA  . MET A 1 2   ? -3.188  -19.295 -2.504  1.00 67.29  ? 1    MET A CA  1 
ATOM   7    C  C   . MET A 1 2   ? -3.387  -18.750 -3.933  1.00 64.35  ? 1    MET A C   1 
ATOM   8    O  O   . MET A 1 2   ? -2.459  -18.563 -4.716  1.00 69.22  ? 1    MET A O   1 
ATOM   9    C  CB  . MET A 1 2   ? -3.811  -18.346 -1.460  1.00 68.45  ? 1    MET A CB  1 
ATOM   10   C  CG  . MET A 1 2   ? -3.687  -16.866 -1.795  1.00 67.40  ? 1    MET A CG  1 
ATOM   11   S  SD  . MET A 1 2   ? -4.751  -15.839 -0.764  1.00 71.52  ? 1    MET A SD  1 
ATOM   12   C  CE  . MET A 1 2   ? -6.247  -15.812 -1.729  1.00 52.72  ? 1    MET A CE  1 
ATOM   13   N  N   . LYS A 1 3   ? -4.648  -18.412 -4.190  1.00 59.15  ? 2    LYS A N   1 
ATOM   14   C  CA  . LYS A 1 3   ? -5.079  -17.805 -5.437  1.00 52.61  ? 2    LYS A CA  1 
ATOM   15   C  C   . LYS A 1 3   ? -4.986  -16.285 -5.362  1.00 47.85  ? 2    LYS A C   1 
ATOM   16   O  O   . LYS A 1 3   ? -5.824  -15.587 -5.941  1.00 48.15  ? 2    LYS A O   1 
ATOM   17   C  CB  . LYS A 1 3   ? -6.523  -18.196 -5.757  1.00 56.58  ? 2    LYS A CB  1 
ATOM   18   C  CG  . LYS A 1 3   ? -6.752  -19.616 -6.244  1.00 55.36  ? 2    LYS A CG  1 
ATOM   19   C  CD  . LYS A 1 3   ? -7.998  -19.706 -7.114  1.00 55.53  ? 2    LYS A CD  1 
ATOM   20   C  CE  . LYS A 1 3   ? -8.181  -21.112 -7.675  1.00 57.52  ? 2    LYS A CE  1 
ATOM   21   N  NZ  . LYS A 1 3   ? -9.122  -21.132 -8.832  1.00 47.82  ? 2    LYS A NZ  1 
ATOM   22   N  N   . MET A 1 4   ? -3.986  -15.760 -4.654  1.00 41.00  ? 3    MET A N   1 
ATOM   23   C  CA  . MET A 1 4   ? -3.923  -14.350 -4.414  1.00 37.95  ? 3    MET A CA  1 
ATOM   24   C  C   . MET A 1 4   ? -2.583  -13.884 -3.918  1.00 35.07  ? 3    MET A C   1 
ATOM   25   O  O   . MET A 1 4   ? -2.018  -12.876 -4.328  1.00 49.97  ? 3    MET A O   1 
ATOM   26   C  CB  . MET A 1 4   ? -5.116  -13.827 -3.669  1.00 35.46  ? 3    MET A CB  1 
ATOM   27   C  CG  . MET A 1 4   ? -5.515  -12.386 -3.946  1.00 36.12  ? 3    MET A CG  1 
ATOM   28   S  SD  . MET A 1 4   ? -6.674  -12.243 -5.332  1.00 60.78  ? 3    MET A SD  1 
ATOM   29   C  CE  . MET A 1 4   ? -6.585  -10.478 -5.636  1.00 66.03  ? 3    MET A CE  1 
ATOM   30   N  N   . LEU A 1 5   ? -2.183  -14.543 -2.823  1.00 26.17  ? 4    LEU A N   1 
ATOM   31   C  CA  . LEU A 1 5   ? -0.967  -14.127 -2.134  1.00 23.76  ? 4    LEU A CA  1 
ATOM   32   C  C   . LEU A 1 5   ? 0.225   -14.085 -3.089  1.00 27.48  ? 4    LEU A C   1 
ATOM   33   O  O   . LEU A 1 5   ? 1.041   -13.169 -2.989  1.00 32.93  ? 4    LEU A O   1 
ATOM   34   C  CB  . LEU A 1 5   ? -0.665  -15.055 -0.959  1.00 19.03  ? 4    LEU A CB  1 
ATOM   35   C  CG  . LEU A 1 5   ? -1.414  -14.789 0.344   1.00 10.30  ? 4    LEU A CG  1 
ATOM   36   C  CD1 . LEU A 1 5   ? -0.916  -15.714 1.444   1.00 21.43  ? 4    LEU A CD1 1 
ATOM   37   C  CD2 . LEU A 1 5   ? -1.285  -13.334 0.762   1.00 17.62  ? 4    LEU A CD2 1 
ATOM   38   N  N   . GLU A 1 6   ? 0.309   -15.054 -3.991  1.00 22.01  ? 5    GLU A N   1 
ATOM   39   C  CA  . GLU A 1 6   ? 1.434   -15.187 -4.910  1.00 25.07  ? 5    GLU A CA  1 
ATOM   40   C  C   . GLU A 1 6   ? 1.678   -13.903 -5.688  1.00 29.09  ? 5    GLU A C   1 
ATOM   41   O  O   . GLU A 1 6   ? 2.797   -13.545 -6.050  1.00 46.47  ? 5    GLU A O   1 
ATOM   42   C  CB  . GLU A 1 6   ? 1.195   -16.344 -5.885  1.00 33.96  ? 5    GLU A CB  1 
ATOM   43   C  CG  . GLU A 1 6   ? 0.106   -17.314 -5.471  1.00 47.62  ? 5    GLU A CG  1 
ATOM   44   C  CD  . GLU A 1 6   ? 0.243   -18.700 -6.074  1.00 53.78  ? 5    GLU A CD  1 
ATOM   45   O  OE1 . GLU A 1 6   ? 1.128   -18.905 -6.928  1.00 73.25  ? 5    GLU A OE1 1 
ATOM   46   O  OE2 . GLU A 1 6   ? -0.534  -19.607 -5.699  1.00 42.29  ? 5    GLU A OE2 1 
ATOM   47   N  N   . GLN A 1 7   ? 0.580   -13.206 -5.950  1.00 28.91  ? 6    GLN A N   1 
ATOM   48   C  CA  . GLN A 1 7   ? 0.617   -11.981 -6.749  1.00 17.12  ? 6    GLN A CA  1 
ATOM   49   C  C   . GLN A 1 7   ? 1.125   -10.798 -5.951  1.00 26.74  ? 6    GLN A C   1 
ATOM   50   O  O   . GLN A 1 7   ? 1.864   -9.955  -6.470  1.00 23.93  ? 6    GLN A O   1 
ATOM   51   C  CB  . GLN A 1 7   ? -0.789  -11.815 -7.323  1.00 19.43  ? 6    GLN A CB  1 
ATOM   52   C  CG  A GLN A 1 7   ? -1.445  -10.455 -7.263  0.50 19.16  ? 6    GLN A CG  1 
ATOM   53   C  CG  B GLN A 1 7   ? -1.187  -13.030 -8.161  0.50 21.42  ? 6    GLN A CG  1 
ATOM   54   C  CD  A GLN A 1 7   ? -2.910  -10.529 -7.669  0.50 23.09  ? 6    GLN A CD  1 
ATOM   55   C  CD  B GLN A 1 7   ? -0.004  -13.586 -8.934  0.50 22.50  ? 6    GLN A CD  1 
ATOM   56   O  OE1 A GLN A 1 7   ? -3.253  -11.103 -8.703  0.50 14.09  ? 6    GLN A OE1 1 
ATOM   57   O  OE1 B GLN A 1 7   ? 0.727   -12.840 -9.588  0.50 20.87  ? 6    GLN A OE1 1 
ATOM   58   N  NE2 A GLN A 1 7   ? -3.789  -9.953  -6.854  0.50 34.06  ? 6    GLN A NE2 1 
ATOM   59   N  NE2 B GLN A 1 7   ? 0.195   -14.895 -8.870  0.50 26.15  ? 6    GLN A NE2 1 
ATOM   60   N  N   . LEU A 1 8   ? 0.772   -10.700 -4.668  1.00 27.00  ? 7    LEU A N   1 
ATOM   61   C  CA  . LEU A 1 8   ? 1.309   -9.623  -3.830  1.00 18.21  ? 7    LEU A CA  1 
ATOM   62   C  C   . LEU A 1 8   ? 2.814   -9.820  -3.643  1.00 7.00   ? 7    LEU A C   1 
ATOM   63   O  O   . LEU A 1 8   ? 3.572   -8.848  -3.655  1.00 15.91  ? 7    LEU A O   1 
ATOM   64   C  CB  . LEU A 1 8   ? 0.556   -9.579  -2.511  1.00 27.06  ? 7    LEU A CB  1 
ATOM   65   C  CG  . LEU A 1 8   ? 1.117   -8.836  -1.308  1.00 29.96  ? 7    LEU A CG  1 
ATOM   66   C  CD1 . LEU A 1 8   ? 1.462   -7.391  -1.633  1.00 14.59  ? 7    LEU A CD1 1 
ATOM   67   C  CD2 . LEU A 1 8   ? 0.113   -8.900  -0.157  1.00 20.88  ? 7    LEU A CD2 1 
ATOM   68   N  N   . GLU A 1 9   ? 3.216   -11.070 -3.483  1.00 4.76   ? 8    GLU A N   1 
ATOM   69   C  CA  . GLU A 1 9   ? 4.610   -11.469 -3.378  1.00 22.44  ? 8    GLU A CA  1 
ATOM   70   C  C   . GLU A 1 9   ? 5.444   -11.144 -4.613  1.00 30.49  ? 8    GLU A C   1 
ATOM   71   O  O   . GLU A 1 9   ? 6.637   -10.834 -4.498  1.00 34.75  ? 8    GLU A O   1 
ATOM   72   C  CB  . GLU A 1 9   ? 4.710   -12.977 -3.143  1.00 18.48  ? 8    GLU A CB  1 
ATOM   73   C  CG  . GLU A 1 9   ? 4.017   -13.486 -1.898  1.00 14.44  ? 8    GLU A CG  1 
ATOM   74   C  CD  . GLU A 1 9   ? 4.094   -14.995 -1.811  1.00 18.07  ? 8    GLU A CD  1 
ATOM   75   O  OE1 . GLU A 1 9   ? 3.828   -15.656 -2.837  1.00 22.22  ? 8    GLU A OE1 1 
ATOM   76   O  OE2 . GLU A 1 9   ? 4.431   -15.517 -0.726  1.00 18.16  ? 8    GLU A OE2 1 
ATOM   77   N  N   . LYS A 1 10  ? 4.871   -11.217 -5.815  1.00 27.59  ? 9    LYS A N   1 
ATOM   78   C  CA  . LYS A 1 10  ? 5.686   -10.866 -6.985  1.00 20.54  ? 9    LYS A CA  1 
ATOM   79   C  C   . LYS A 1 10  ? 5.825   -9.357  -7.077  1.00 21.33  ? 9    LYS A C   1 
ATOM   80   O  O   . LYS A 1 10  ? 6.831   -8.810  -7.525  1.00 25.97  ? 9    LYS A O   1 
ATOM   81   C  CB  . LYS A 1 10  ? 5.101   -11.440 -8.272  1.00 34.95  ? 9    LYS A CB  1 
ATOM   82   C  CG  . LYS A 1 10  ? 5.862   -11.054 -9.528  1.00 45.06  ? 9    LYS A CG  1 
ATOM   83   C  CD  . LYS A 1 10  ? 6.969   -12.027 -9.882  1.00 45.12  ? 9    LYS A CD  1 
ATOM   84   C  CE  . LYS A 1 10  ? 8.106   -12.055 -8.883  1.00 42.59  ? 9    LYS A CE  1 
ATOM   85   N  NZ  . LYS A 1 10  ? 8.692   -10.719 -8.590  1.00 23.56  ? 9    LYS A NZ  1 
ATOM   86   N  N   . LYS A 1 11  ? 4.793   -8.633  -6.627  1.00 21.13  ? 10   LYS A N   1 
ATOM   87   C  CA  . LYS A 1 11  ? 4.971   -7.179  -6.607  1.00 26.75  ? 10   LYS A CA  1 
ATOM   88   C  C   . LYS A 1 11  ? 5.962   -6.837  -5.495  1.00 29.45  ? 10   LYS A C   1 
ATOM   89   O  O   . LYS A 1 11  ? 6.886   -6.052  -5.677  1.00 23.41  ? 10   LYS A O   1 
ATOM   90   C  CB  . LYS A 1 11  ? 3.654   -6.440  -6.411  1.00 34.05  ? 10   LYS A CB  1 
ATOM   91   C  CG  . LYS A 1 11  ? 2.421   -7.232  -6.810  1.00 43.75  ? 10   LYS A CG  1 
ATOM   92   C  CD  . LYS A 1 11  ? 2.197   -7.180  -8.318  1.00 49.24  ? 10   LYS A CD  1 
ATOM   93   C  CE  . LYS A 1 11  ? 1.490   -8.455  -8.802  1.00 49.67  ? 10   LYS A CE  1 
ATOM   94   N  NZ  . LYS A 1 11  ? 0.707   -8.187  -10.055 1.00 62.72  ? 10   LYS A NZ  1 
ATOM   95   N  N   . LEU A 1 12  ? 5.736   -7.457  -4.339  1.00 37.76  ? 11   LEU A N   1 
ATOM   96   C  CA  . LEU A 1 12  ? 6.642   -7.308  -3.205  1.00 38.82  ? 11   LEU A CA  1 
ATOM   97   C  C   . LEU A 1 12  ? 8.071   -7.589  -3.661  1.00 32.03  ? 11   LEU A C   1 
ATOM   98   O  O   . LEU A 1 12  ? 9.007   -6.851  -3.367  1.00 30.65  ? 11   LEU A O   1 
ATOM   99   C  CB  . LEU A 1 12  ? 6.248   -8.237  -2.060  1.00 36.64  ? 11   LEU A CB  1 
ATOM   100  C  CG  . LEU A 1 12  ? 6.419   -7.715  -0.633  1.00 36.51  ? 11   LEU A CG  1 
ATOM   101  C  CD1 . LEU A 1 12  ? 6.073   -6.237  -0.535  1.00 21.08  ? 11   LEU A CD1 1 
ATOM   102  C  CD2 . LEU A 1 12  ? 5.562   -8.509  0.346   1.00 37.63  ? 11   LEU A CD2 1 
ATOM   103  N  N   . GLY A 1 13  ? 8.239   -8.678  -4.403  1.00 24.77  ? 12   GLY A N   1 
ATOM   104  C  CA  . GLY A 1 13  ? 9.588   -9.037  -4.852  1.00 27.05  ? 12   GLY A CA  1 
ATOM   105  C  C   . GLY A 1 13  ? 10.160  -10.004 -3.828  1.00 26.33  ? 12   GLY A C   1 
ATOM   106  O  O   . GLY A 1 13  ? 11.354  -10.202 -3.652  1.00 30.10  ? 12   GLY A O   1 
ATOM   107  N  N   . TYR A 1 14  ? 9.213   -10.622 -3.121  1.00 23.79  ? 13   TYR A N   1 
ATOM   108  C  CA  . TYR A 1 14  ? 9.578   -11.564 -2.076  1.00 19.62  ? 13   TYR A CA  1 
ATOM   109  C  C   . TYR A 1 14  ? 8.432   -12.544 -1.843  1.00 15.70  ? 13   TYR A C   1 
ATOM   110  O  O   . TYR A 1 14  ? 7.285   -12.130 -1.731  1.00 27.24  ? 13   TYR A O   1 
ATOM   111  C  CB  . TYR A 1 14  ? 9.955   -10.831 -0.788  1.00 20.93  ? 13   TYR A CB  1 
ATOM   112  C  CG  . TYR A 1 14  ? 10.320  -11.778 0.334   1.00 19.74  ? 13   TYR A CG  1 
ATOM   113  C  CD1 . TYR A 1 14  ? 11.524  -12.473 0.334   1.00 20.97  ? 13   TYR A CD1 1 
ATOM   114  C  CD2 . TYR A 1 14  ? 9.442   -11.971 1.394   1.00 18.25  ? 13   TYR A CD2 1 
ATOM   115  C  CE1 . TYR A 1 14  ? 11.834  -13.334 1.374   1.00 26.84  ? 13   TYR A CE1 1 
ATOM   116  C  CE2 . TYR A 1 14  ? 9.748   -12.831 2.432   1.00 21.69  ? 13   TYR A CE2 1 
ATOM   117  C  CZ  . TYR A 1 14  ? 10.949  -13.510 2.416   1.00 23.04  ? 13   TYR A CZ  1 
ATOM   118  O  OH  . TYR A 1 14  ? 11.244  -14.367 3.453   1.00 26.23  ? 13   TYR A OH  1 
ATOM   119  N  N   . THR A 1 15  ? 8.813   -13.801 -1.796  1.00 20.21  ? 14   THR A N   1 
ATOM   120  C  CA  . THR A 1 15  ? 8.045   -15.003 -1.549  1.00 16.37  ? 14   THR A CA  1 
ATOM   121  C  C   . THR A 1 15  ? 8.323   -15.479 -0.128  1.00 20.17  ? 14   THR A C   1 
ATOM   122  O  O   . THR A 1 15  ? 9.474   -15.603 0.297   1.00 20.30  ? 14   THR A O   1 
ATOM   123  C  CB  . THR A 1 15  ? 8.400   -16.069 -2.601  1.00 18.38  ? 14   THR A CB  1 
ATOM   124  O  OG1 . THR A 1 15  ? 7.935   -15.644 -3.895  1.00 22.43  ? 14   THR A OG1 1 
ATOM   125  C  CG2 . THR A 1 15  ? 7.717   -17.397 -2.330  1.00 8.42   ? 14   THR A CG2 1 
ATOM   126  N  N   . PHE A 1 16  ? 7.283   -15.734 0.655   1.00 21.00  ? 15   PHE A N   1 
ATOM   127  C  CA  . PHE A 1 16  ? 7.430   -16.089 2.057   1.00 18.69  ? 15   PHE A CA  1 
ATOM   128  C  C   . PHE A 1 16  ? 7.728   -17.557 2.300   1.00 10.62  ? 15   PHE A C   1 
ATOM   129  O  O   . PHE A 1 16  ? 7.327   -18.423 1.526   1.00 14.96  ? 15   PHE A O   1 
ATOM   130  C  CB  . PHE A 1 16  ? 6.134   -15.759 2.826   1.00 10.92  ? 15   PHE A CB  1 
ATOM   131  C  CG  . PHE A 1 16  ? 6.093   -14.316 3.276   1.00 5.97   ? 15   PHE A CG  1 
ATOM   132  C  CD1 . PHE A 1 16  ? 5.935   -13.303 2.352   1.00 5.35   ? 15   PHE A CD1 1 
ATOM   133  C  CD2 . PHE A 1 16  ? 6.202   -13.992 4.618   1.00 10.18  ? 15   PHE A CD2 1 
ATOM   134  C  CE1 . PHE A 1 16  ? 5.902   -11.985 2.769   1.00 15.38  ? 15   PHE A CE1 1 
ATOM   135  C  CE2 . PHE A 1 16  ? 6.192   -12.674 5.038   1.00 13.31  ? 15   PHE A CE2 1 
ATOM   136  C  CZ  . PHE A 1 16  ? 6.042   -11.662 4.108   1.00 17.26  ? 15   PHE A CZ  1 
ATOM   137  N  N   . LYS A 1 17  ? 8.412   -17.837 3.412   1.00 10.82  ? 16   LYS A N   1 
ATOM   138  C  CA  . LYS A 1 17  ? 8.585   -19.229 3.824   1.00 10.64  ? 16   LYS A CA  1 
ATOM   139  C  C   . LYS A 1 17  ? 7.353   -19.688 4.603   1.00 21.77  ? 16   LYS A C   1 
ATOM   140  O  O   . LYS A 1 17  ? 6.877   -20.809 4.440   1.00 30.63  ? 16   LYS A O   1 
ATOM   141  C  CB  . LYS A 1 17  ? 9.821   -19.402 4.694   1.00 17.91  ? 16   LYS A CB  1 
ATOM   142  C  CG  . LYS A 1 17  ? 11.024  -18.584 4.242   1.00 24.97  ? 16   LYS A CG  1 
ATOM   143  C  CD  . LYS A 1 17  ? 12.312  -19.186 4.775   1.00 29.71  ? 16   LYS A CD  1 
ATOM   144  C  CE  . LYS A 1 17  ? 12.778  -18.496 6.049   1.00 36.62  ? 16   LYS A CE  1 
ATOM   145  N  NZ  . LYS A 1 17  ? 13.131  -19.495 7.101   1.00 31.39  ? 16   LYS A NZ  1 
ATOM   146  N  N   . ASP A 1 18  ? 6.877   -18.776 5.446   1.00 22.94  ? 17   ASP A N   1 
ATOM   147  C  CA  . ASP A 1 18  ? 5.698   -18.977 6.280   1.00 19.70  ? 17   ASP A CA  1 
ATOM   148  C  C   . ASP A 1 18  ? 4.569   -18.070 5.786   1.00 20.61  ? 17   ASP A C   1 
ATOM   149  O  O   . ASP A 1 18  ? 4.568   -16.873 6.080   1.00 11.08  ? 17   ASP A O   1 
ATOM   150  C  CB  . ASP A 1 18  ? 6.029   -18.709 7.742   1.00 21.27  ? 17   ASP A CB  1 
ATOM   151  C  CG  . ASP A 1 18  ? 4.864   -18.806 8.695   1.00 24.50  ? 17   ASP A CG  1 
ATOM   152  O  OD1 . ASP A 1 18  ? 3.725   -19.064 8.255   1.00 15.19  ? 17   ASP A OD1 1 
ATOM   153  O  OD2 . ASP A 1 18  ? 5.093   -18.624 9.914   1.00 27.70  ? 17   ASP A OD2 1 
ATOM   154  N  N   . LYS A 1 19  ? 3.657   -18.695 5.051   1.00 27.55  ? 18   LYS A N   1 
ATOM   155  C  CA  . LYS A 1 19  ? 2.540   -18.048 4.377   1.00 21.56  ? 18   LYS A CA  1 
ATOM   156  C  C   . LYS A 1 19  ? 1.602   -17.376 5.372   1.00 11.76  ? 18   LYS A C   1 
ATOM   157  O  O   . LYS A 1 19  ? 1.211   -16.232 5.141   1.00 20.67  ? 18   LYS A O   1 
ATOM   158  C  CB  . LYS A 1 19  ? 1.770   -19.054 3.513   1.00 28.84  ? 18   LYS A CB  1 
ATOM   159  C  CG  . LYS A 1 19  ? 1.893   -18.784 2.019   1.00 39.82  ? 18   LYS A CG  1 
ATOM   160  C  CD  . LYS A 1 19  ? 3.345   -18.637 1.586   1.00 43.49  ? 18   LYS A CD  1 
ATOM   161  C  CE  . LYS A 1 19  ? 3.535   -19.046 0.132   1.00 46.86  ? 18   LYS A CE  1 
ATOM   162  N  NZ  . LYS A 1 19  ? 4.782   -18.485 -0.461  1.00 37.59  ? 18   LYS A NZ  1 
ATOM   163  N  N   . SER A 1 20  ? 1.274   -18.064 6.457   1.00 17.50  ? 19   SER A N   1 
ATOM   164  C  CA  . SER A 1 20  ? 0.445   -17.491 7.515   1.00 20.87  ? 19   SER A CA  1 
ATOM   165  C  C   . SER A 1 20  ? 1.066   -16.250 8.149   1.00 20.14  ? 19   SER A C   1 
ATOM   166  O  O   . SER A 1 20  ? 0.352   -15.462 8.783   1.00 42.05  ? 19   SER A O   1 
ATOM   167  C  CB  . SER A 1 20  ? 0.163   -18.549 8.589   1.00 23.02  ? 19   SER A CB  1 
ATOM   168  O  OG  . SER A 1 20  ? 1.287   -18.750 9.426   1.00 18.34  ? 19   SER A OG  1 
ATOM   169  N  N   . LEU A 1 21  ? 2.370   -16.040 7.998   1.00 19.75  ? 20   LEU A N   1 
ATOM   170  C  CA  . LEU A 1 21  ? 3.037   -14.834 8.482   1.00 17.50  ? 20   LEU A CA  1 
ATOM   171  C  C   . LEU A 1 21  ? 2.581   -13.625 7.671   1.00 21.12  ? 20   LEU A C   1 
ATOM   172  O  O   . LEU A 1 21  ? 2.200   -12.591 8.221   1.00 16.34  ? 20   LEU A O   1 
ATOM   173  C  CB  . LEU A 1 21  ? 4.555   -14.990 8.423   1.00 23.53  ? 20   LEU A CB  1 
ATOM   174  C  CG  . LEU A 1 21  ? 5.412   -14.147 9.366   1.00 27.71  ? 20   LEU A CG  1 
ATOM   175  C  CD1 . LEU A 1 21  ? 4.966   -14.260 10.816  1.00 22.58  ? 20   LEU A CD1 1 
ATOM   176  C  CD2 . LEU A 1 21  ? 6.881   -14.548 9.245   1.00 14.67  ? 20   LEU A CD2 1 
ATOM   177  N  N   . LEU A 1 22  ? 2.609   -13.794 6.353   1.00 20.60  ? 21   LEU A N   1 
ATOM   178  C  CA  . LEU A 1 22  ? 2.097   -12.806 5.409   1.00 20.13  ? 21   LEU A CA  1 
ATOM   179  C  C   . LEU A 1 22  ? 0.620   -12.521 5.638   1.00 15.65  ? 21   LEU A C   1 
ATOM   180  O  O   . LEU A 1 22  ? 0.182   -11.366 5.699   1.00 16.55  ? 21   LEU A O   1 
ATOM   181  C  CB  . LEU A 1 22  ? 2.317   -13.302 3.977   1.00 17.37  ? 21   LEU A CB  1 
ATOM   182  C  CG  . LEU A 1 22  ? 1.686   -12.547 2.818   1.00 9.63   ? 21   LEU A CG  1 
ATOM   183  C  CD1 . LEU A 1 22  ? 1.821   -11.035 2.953   1.00 19.15  ? 21   LEU A CD1 1 
ATOM   184  C  CD2 . LEU A 1 22  ? 2.319   -12.990 1.496   1.00 19.00  ? 21   LEU A CD2 1 
ATOM   185  N  N   . GLU A 1 23  ? -0.172  -13.588 5.755   1.00 16.60  ? 22   GLU A N   1 
ATOM   186  C  CA  . GLU A 1 23  ? -1.611  -13.400 5.926   1.00 26.06  ? 22   GLU A CA  1 
ATOM   187  C  C   . GLU A 1 23  ? -1.947  -12.608 7.184   1.00 23.89  ? 22   GLU A C   1 
ATOM   188  O  O   . GLU A 1 23  ? -2.829  -11.749 7.138   1.00 14.70  ? 22   GLU A O   1 
ATOM   189  C  CB  . GLU A 1 23  ? -2.312  -14.759 5.964   1.00 25.31  ? 22   GLU A CB  1 
ATOM   190  C  CG  . GLU A 1 23  ? -1.919  -15.645 4.792   1.00 26.41  ? 22   GLU A CG  1 
ATOM   191  C  CD  . GLU A 1 23  ? -2.707  -16.937 4.767   1.00 20.99  ? 22   GLU A CD  1 
ATOM   192  O  OE1 . GLU A 1 23  ? -2.800  -17.595 5.823   1.00 34.50  ? 22   GLU A OE1 1 
ATOM   193  O  OE2 . GLU A 1 23  ? -3.230  -17.278 3.691   1.00 32.13  ? 22   GLU A OE2 1 
ATOM   194  N  N   . LYS A 1 24  ? -1.251  -12.903 8.282   1.00 22.29  ? 23   LYS A N   1 
ATOM   195  C  CA  . LYS A 1 24  ? -1.492  -12.187 9.526   1.00 23.25  ? 23   LYS A CA  1 
ATOM   196  C  C   . LYS A 1 24  ? -1.291  -10.687 9.353   1.00 20.76  ? 23   LYS A C   1 
ATOM   197  O  O   . LYS A 1 24  ? -2.031  -9.891  9.928   1.00 17.09  ? 23   LYS A O   1 
ATOM   198  C  CB  . LYS A 1 24  ? -0.569  -12.675 10.650  1.00 28.12  ? 23   LYS A CB  1 
ATOM   199  C  CG  . LYS A 1 24  ? -0.676  -11.805 11.898  1.00 25.50  ? 23   LYS A CG  1 
ATOM   200  C  CD  . LYS A 1 24  ? 0.462   -12.090 12.863  1.00 26.70  ? 23   LYS A CD  1 
ATOM   201  C  CE  . LYS A 1 24  ? 0.388   -13.513 13.390  1.00 26.73  ? 23   LYS A CE  1 
ATOM   202  N  NZ  . LYS A 1 24  ? 1.661   -13.905 14.061  1.00 33.28  ? 23   LYS A NZ  1 
ATOM   203  N  N   . ALA A 1 25  ? -0.286  -10.295 8.566   1.00 20.94  ? 24   ALA A N   1 
ATOM   204  C  CA  . ALA A 1 25  ? -0.042  -8.872  8.357   1.00 20.90  ? 24   ALA A CA  1 
ATOM   205  C  C   . ALA A 1 25  ? -1.129  -8.210  7.517   1.00 14.39  ? 24   ALA A C   1 
ATOM   206  O  O   . ALA A 1 25  ? -1.288  -6.989  7.609   1.00 7.63   ? 24   ALA A O   1 
ATOM   207  C  CB  . ALA A 1 25  ? 1.328   -8.659  7.724   1.00 8.66   ? 24   ALA A CB  1 
ATOM   208  N  N   . LEU A 1 26  ? -1.876  -8.946  6.698   1.00 15.67  ? 25   LEU A N   1 
ATOM   209  C  CA  . LEU A 1 26  ? -2.912  -8.303  5.889   1.00 26.14  ? 25   LEU A CA  1 
ATOM   210  C  C   . LEU A 1 26  ? -4.290  -8.340  6.551   1.00 23.71  ? 25   LEU A C   1 
ATOM   211  O  O   . LEU A 1 26  ? -5.236  -7.716  6.064   1.00 21.50  ? 25   LEU A O   1 
ATOM   212  C  CB  . LEU A 1 26  ? -3.021  -8.971  4.517   1.00 28.43  ? 25   LEU A CB  1 
ATOM   213  C  CG  . LEU A 1 26  ? -1.763  -9.094  3.665   1.00 27.15  ? 25   LEU A CG  1 
ATOM   214  C  CD1 . LEU A 1 26  ? -1.853  -10.309 2.751   1.00 35.79  ? 25   LEU A CD1 1 
ATOM   215  C  CD2 . LEU A 1 26  ? -1.520  -7.840  2.835   1.00 20.86  ? 25   LEU A CD2 1 
ATOM   216  N  N   . THR A 1 27  ? -4.415  -9.083  7.642   1.00 15.99  ? 26   THR A N   1 
ATOM   217  C  CA  . THR A 1 27  ? -5.680  -9.371  8.287   1.00 15.08  ? 26   THR A CA  1 
ATOM   218  C  C   . THR A 1 27  ? -6.015  -8.453  9.460   1.00 20.95  ? 26   THR A C   1 
ATOM   219  O  O   . THR A 1 27  ? -5.255  -8.415  10.432  1.00 14.92  ? 26   THR A O   1 
ATOM   220  C  CB  . THR A 1 27  ? -5.671  -10.820 8.818   1.00 14.47  ? 26   THR A CB  1 
ATOM   221  O  OG1 . THR A 1 27  ? -5.337  -11.687 7.732   1.00 27.81  ? 26   THR A OG1 1 
ATOM   222  C  CG2 . THR A 1 27  ? -7.049  -11.223 9.307   1.00 24.51  ? 26   THR A CG2 1 
ATOM   223  N  N   . HIS A 1 28  ? -7.143  -7.768  9.326   1.00 18.03  ? 27   HIS A N   1 
ATOM   224  C  CA  . HIS A 1 28  ? -7.700  -6.844  10.312  1.00 18.68  ? 27   HIS A CA  1 
ATOM   225  C  C   . HIS A 1 28  ? -8.354  -7.610  11.454  1.00 14.98  ? 27   HIS A C   1 
ATOM   226  O  O   . HIS A 1 28  ? -8.850  -8.717  11.239  1.00 14.30  ? 27   HIS A O   1 
ATOM   227  C  CB  . HIS A 1 28  ? -8.696  -5.909  9.637   1.00 21.94  ? 27   HIS A CB  1 
ATOM   228  C  CG  . HIS A 1 28  ? -9.342  -4.890  10.517  1.00 15.90  ? 27   HIS A CG  1 
ATOM   229  N  ND1 . HIS A 1 28  ? -10.382 -5.184  11.374  1.00 16.92  ? 27   HIS A ND1 1 
ATOM   230  C  CD2 . HIS A 1 28  ? -9.091  -3.569  10.674  1.00 12.87  ? 27   HIS A CD2 1 
ATOM   231  C  CE1 . HIS A 1 28  ? -10.745 -4.087  12.018  1.00 14.05  ? 27   HIS A CE1 1 
ATOM   232  N  NE2 . HIS A 1 28  ? -9.974  -3.091  11.611  1.00 13.08  ? 27   HIS A NE2 1 
ATOM   233  N  N   . VAL A 1 29  ? -8.351  -7.061  12.670  1.00 20.74  ? 28   VAL A N   1 
ATOM   234  C  CA  . VAL A 1 29  ? -8.896  -7.817  13.798  1.00 17.39  ? 28   VAL A CA  1 
ATOM   235  C  C   . VAL A 1 29  ? -10.344 -8.226  13.548  1.00 10.27  ? 28   VAL A C   1 
ATOM   236  O  O   . VAL A 1 29  ? -10.791 -9.259  14.045  1.00 26.04  ? 28   VAL A O   1 
ATOM   237  C  CB  . VAL A 1 29  ? -8.823  -7.031  15.119  1.00 21.34  ? 28   VAL A CB  1 
ATOM   238  C  CG1 . VAL A 1 29  ? -9.274  -5.595  14.901  1.00 18.51  ? 28   VAL A CG1 1 
ATOM   239  C  CG2 . VAL A 1 29  ? -9.648  -7.735  16.187  1.00 16.75  ? 28   VAL A CG2 1 
ATOM   240  N  N   . SER A 1 30  ? -11.059 -7.431  12.755  1.00 10.47  ? 29   SER A N   1 
ATOM   241  C  CA  . SER A 1 30  ? -12.442 -7.762  12.426  1.00 22.43  ? 29   SER A CA  1 
ATOM   242  C  C   . SER A 1 30  ? -12.557 -9.112  11.730  1.00 27.26  ? 29   SER A C   1 
ATOM   243  O  O   . SER A 1 30  ? -13.607 -9.755  11.746  1.00 32.06  ? 29   SER A O   1 
ATOM   244  C  CB  . SER A 1 30  ? -13.045 -6.675  11.536  1.00 21.58  ? 29   SER A CB  1 
ATOM   245  O  OG  . SER A 1 30  ? -12.589 -6.821  10.204  1.00 12.61  ? 29   SER A OG  1 
ATOM   246  N  N   . TYR A 1 31  ? -11.473 -9.547  11.106  1.00 30.24  ? 30   TYR A N   1 
ATOM   247  C  CA  . TYR A 1 31  ? -11.448 -10.780 10.330  1.00 35.80  ? 30   TYR A CA  1 
ATOM   248  C  C   . TYR A 1 31  ? -10.980 -11.972 11.154  1.00 34.22  ? 30   TYR A C   1 
ATOM   249  O  O   . TYR A 1 31  ? -11.457 -13.101 11.030  1.00 16.69  ? 30   TYR A O   1 
ATOM   250  C  CB  . TYR A 1 31  ? -10.531 -10.570 9.117   1.00 32.18  ? 30   TYR A CB  1 
ATOM   251  C  CG  . TYR A 1 31  ? -10.691 -11.627 8.052   1.00 22.96  ? 30   TYR A CG  1 
ATOM   252  C  CD1 . TYR A 1 31  ? -9.925  -12.786 8.088   1.00 24.88  ? 30   TYR A CD1 1 
ATOM   253  C  CD2 . TYR A 1 31  ? -11.600 -11.468 7.016   1.00 16.39  ? 30   TYR A CD2 1 
ATOM   254  C  CE1 . TYR A 1 31  ? -10.060 -13.761 7.118   1.00 23.67  ? 30   TYR A CE1 1 
ATOM   255  C  CE2 . TYR A 1 31  ? -11.740 -12.444 6.042   1.00 15.16  ? 30   TYR A CE2 1 
ATOM   256  C  CZ  . TYR A 1 31  ? -10.970 -13.583 6.098   1.00 23.06  ? 30   TYR A CZ  1 
ATOM   257  O  OH  . TYR A 1 31  ? -11.102 -14.560 5.133   1.00 43.88  ? 30   TYR A OH  1 
ATOM   258  N  N   . SER A 1 32  ? -9.973  -11.721 11.986  1.00 26.13  ? 31   SER A N   1 
ATOM   259  C  CA  . SER A 1 32  ? -9.513  -12.756 12.936  1.00 20.27  ? 31   SER A CA  1 
ATOM   260  C  C   . SER A 1 32  ? -9.086  -12.046 14.229  1.00 26.81  ? 31   SER A C   1 
ATOM   261  O  O   . SER A 1 32  ? -8.099  -11.306 14.279  1.00 45.54  ? 31   SER A O   1 
ATOM   262  C  CB  . SER A 1 32  ? -8.286  -13.431 12.295  1.00 20.06  ? 31   SER A CB  1 
ATOM   263  O  OG  . SER A 1 32  ? -7.659  -14.321 13.202  1.00 16.03  ? 31   SER A OG  1 
ATOM   264  N  N   . LYS A 1 33  ? -9.851  -12.263 15.294  1.00 31.34  ? 32   LYS A N   1 
ATOM   265  C  CA  . LYS A 1 33  ? -9.463  -11.651 16.567  1.00 28.13  ? 32   LYS A CA  1 
ATOM   266  C  C   . LYS A 1 33  ? -8.266  -12.381 17.170  1.00 25.81  ? 32   LYS A C   1 
ATOM   267  O  O   . LYS A 1 33  ? -7.679  -11.927 18.150  1.00 45.39  ? 32   LYS A O   1 
ATOM   268  C  CB  . LYS A 1 33  ? -10.640 -11.652 17.536  1.00 22.97  ? 32   LYS A CB  1 
ATOM   269  C  CG  . LYS A 1 33  ? -11.966 -12.075 16.932  1.00 23.03  ? 32   LYS A CG  1 
ATOM   270  C  CD  . LYS A 1 33  ? -12.768 -12.929 17.906  1.00 32.19  ? 32   LYS A CD  1 
ATOM   271  C  CE  . LYS A 1 33  ? -12.509 -14.412 17.678  1.00 42.43  ? 32   LYS A CE  1 
ATOM   272  N  NZ  . LYS A 1 33  ? -13.390 -15.267 18.525  1.00 45.53  ? 32   LYS A NZ  1 
ATOM   273  N  N   . LYS A 1 34  ? -7.907  -13.520 16.587  1.00 23.21  ? 33   LYS A N   1 
ATOM   274  C  CA  . LYS A 1 34  ? -6.853  -14.374 17.105  1.00 27.41  ? 33   LYS A CA  1 
ATOM   275  C  C   . LYS A 1 34  ? -5.510  -14.147 16.420  1.00 31.21  ? 33   LYS A C   1 
ATOM   276  O  O   . LYS A 1 34  ? -4.467  -14.301 17.059  1.00 28.28  ? 33   LYS A O   1 
ATOM   277  C  CB  . LYS A 1 34  ? -7.260  -15.846 16.946  1.00 31.51  ? 33   LYS A CB  1 
ATOM   278  C  CG  . LYS A 1 34  ? -7.541  -16.550 18.267  1.00 39.26  ? 33   LYS A CG  1 
ATOM   279  C  CD  . LYS A 1 34  ? -8.121  -17.936 18.044  1.00 43.58  ? 33   LYS A CD  1 
ATOM   280  C  CE  . LYS A 1 34  ? -9.081  -18.339 19.151  1.00 53.05  ? 33   LYS A CE  1 
ATOM   281  N  NZ  . LYS A 1 34  ? -10.479 -17.859 18.914  1.00 52.47  ? 33   LYS A NZ  1 
ATOM   282  N  N   . GLU A 1 35  ? -5.540  -13.808 15.137  1.00 34.43  ? 34   GLU A N   1 
ATOM   283  C  CA  . GLU A 1 35  ? -4.354  -13.666 14.297  1.00 26.54  ? 34   GLU A CA  1 
ATOM   284  C  C   . GLU A 1 35  ? -4.481  -12.489 13.337  1.00 18.42  ? 34   GLU A C   1 
ATOM   285  O  O   . GLU A 1 35  ? -4.803  -12.625 12.149  1.00 17.66  ? 34   GLU A O   1 
ATOM   286  C  CB  . GLU A 1 35  ? -4.100  -14.951 13.511  1.00 27.34  ? 34   GLU A CB  1 
ATOM   287  C  CG  . GLU A 1 35  ? -4.156  -16.251 14.283  1.00 35.54  ? 34   GLU A CG  1 
ATOM   288  C  CD  . GLU A 1 35  ? -2.984  -16.447 15.223  1.00 41.64  ? 34   GLU A CD  1 
ATOM   289  O  OE1 . GLU A 1 35  ? -1.826  -16.295 14.781  1.00 43.64  ? 34   GLU A OE1 1 
ATOM   290  O  OE2 . GLU A 1 35  ? -3.225  -16.751 16.411  1.00 54.02  ? 34   GLU A OE2 1 
ATOM   291  N  N   . HIS A 1 36  ? -4.231  -11.288 13.853  1.00 14.55  ? 35   HIS A N   1 
ATOM   292  C  CA  . HIS A 1 36  ? -4.369  -10.092 13.011  1.00 19.68  ? 35   HIS A CA  1 
ATOM   293  C  C   . HIS A 1 36  ? -3.120  -9.235  13.138  1.00 16.06  ? 35   HIS A C   1 
ATOM   294  O  O   . HIS A 1 36  ? -2.224  -9.615  13.892  1.00 21.51  ? 35   HIS A O   1 
ATOM   295  C  CB  . HIS A 1 36  ? -5.640  -9.337  13.365  1.00 17.79  ? 35   HIS A CB  1 
ATOM   296  C  CG  . HIS A 1 36  ? -5.684  -8.708  14.716  1.00 17.20  ? 35   HIS A CG  1 
ATOM   297  N  ND1 . HIS A 1 36  ? -6.057  -9.396  15.854  1.00 19.77  ? 35   HIS A ND1 1 
ATOM   298  C  CD2 . HIS A 1 36  ? -5.416  -7.449  15.120  1.00 10.26  ? 35   HIS A CD2 1 
ATOM   299  C  CE1 . HIS A 1 36  ? -6.007  -8.589  16.892  1.00 10.68  ? 35   HIS A CE1 1 
ATOM   300  N  NE2 . HIS A 1 36  ? -5.618  -7.403  16.472  1.00 14.49  ? 35   HIS A NE2 1 
ATOM   301  N  N   . TYR A 1 37  ? -3.030  -8.125  12.422  1.00 18.74  ? 36   TYR A N   1 
ATOM   302  C  CA  . TYR A 1 37  ? -1.746  -7.476  12.188  1.00 22.83  ? 36   TYR A CA  1 
ATOM   303  C  C   . TYR A 1 37  ? -1.230  -6.608  13.326  1.00 24.60  ? 36   TYR A C   1 
ATOM   304  O  O   . TYR A 1 37  ? -0.066  -6.189  13.239  1.00 30.40  ? 36   TYR A O   1 
ATOM   305  C  CB  . TYR A 1 37  ? -1.811  -6.640  10.900  1.00 18.68  ? 36   TYR A CB  1 
ATOM   306  C  CG  . TYR A 1 37  ? -2.758  -5.477  10.817  1.00 24.26  ? 36   TYR A CG  1 
ATOM   307  C  CD1 . TYR A 1 37  ? -2.480  -4.249  11.403  1.00 31.01  ? 36   TYR A CD1 1 
ATOM   308  C  CD2 . TYR A 1 37  ? -3.964  -5.564  10.130  1.00 28.57  ? 36   TYR A CD2 1 
ATOM   309  C  CE1 . TYR A 1 37  ? -3.331  -3.170  11.335  1.00 33.35  ? 36   TYR A CE1 1 
ATOM   310  C  CE2 . TYR A 1 37  ? -4.833  -4.489  10.053  1.00 27.10  ? 36   TYR A CE2 1 
ATOM   311  C  CZ  . TYR A 1 37  ? -4.525  -3.292  10.654  1.00 27.10  ? 36   TYR A CZ  1 
ATOM   312  O  OH  . TYR A 1 37  ? -5.371  -2.209  10.589  1.00 17.96  ? 36   TYR A OH  1 
ATOM   313  N  N   . GLU A 1 38  ? -2.027  -6.310  14.334  1.00 24.19  ? 37   GLU A N   1 
ATOM   314  C  CA  . GLU A 1 38  ? -1.682  -5.349  15.377  1.00 18.67  ? 37   GLU A CA  1 
ATOM   315  C  C   . GLU A 1 38  ? -0.284  -5.513  15.946  1.00 15.91  ? 37   GLU A C   1 
ATOM   316  O  O   . GLU A 1 38  ? 0.408   -4.530  16.214  1.00 17.15  ? 37   GLU A O   1 
ATOM   317  C  CB  . GLU A 1 38  ? -2.670  -5.443  16.542  1.00 18.58  ? 37   GLU A CB  1 
ATOM   318  C  CG  . GLU A 1 38  ? -2.627  -4.274  17.514  1.00 27.13  ? 37   GLU A CG  1 
ATOM   319  C  CD  . GLU A 1 38  ? -3.428  -4.602  18.766  1.00 30.60  ? 37   GLU A CD  1 
ATOM   320  O  OE1 . GLU A 1 38  ? -4.648  -4.826  18.641  1.00 27.70  ? 37   GLU A OE1 1 
ATOM   321  O  OE2 . GLU A 1 38  ? -2.837  -4.647  19.862  1.00 27.49  ? 37   GLU A OE2 1 
ATOM   322  N  N   . THR A 1 39  ? 0.176   -6.741  16.172  1.00 17.21  ? 38   THR A N   1 
ATOM   323  C  CA  . THR A 1 39  ? 1.512   -6.831  16.781  1.00 18.70  ? 38   THR A CA  1 
ATOM   324  C  C   . THR A 1 39  ? 2.596   -6.603  15.740  1.00 18.24  ? 38   THR A C   1 
ATOM   325  O  O   . THR A 1 39  ? 3.601   -5.938  16.000  1.00 23.80  ? 38   THR A O   1 
ATOM   326  C  CB  . THR A 1 39  ? 1.678   -8.178  17.494  1.00 20.29  ? 38   THR A CB  1 
ATOM   327  O  OG1 . THR A 1 39  ? 0.739   -8.210  18.584  1.00 19.82  ? 38   THR A OG1 1 
ATOM   328  C  CG2 . THR A 1 39  ? 3.062   -8.331  18.100  1.00 13.11  ? 38   THR A CG2 1 
ATOM   329  N  N   . LEU A 1 40  ? 2.408   -7.122  14.533  1.00 21.62  ? 39   LEU A N   1 
ATOM   330  C  CA  . LEU A 1 40  ? 3.375   -6.863  13.460  1.00 17.43  ? 39   LEU A CA  1 
ATOM   331  C  C   . LEU A 1 40  ? 3.467   -5.376  13.133  1.00 19.82  ? 39   LEU A C   1 
ATOM   332  O  O   . LEU A 1 40  ? 4.567   -4.848  12.942  1.00 26.13  ? 39   LEU A O   1 
ATOM   333  C  CB  . LEU A 1 40  ? 3.004   -7.657  12.211  1.00 16.54  ? 39   LEU A CB  1 
ATOM   334  C  CG  . LEU A 1 40  ? 3.085   -9.177  12.320  1.00 21.69  ? 39   LEU A CG  1 
ATOM   335  C  CD1 . LEU A 1 40  ? 2.244   -9.839  11.235  1.00 40.95  ? 39   LEU A CD1 1 
ATOM   336  C  CD2 . LEU A 1 40  ? 4.530   -9.646  12.226  1.00 15.69  ? 39   LEU A CD2 1 
ATOM   337  N  N   . GLU A 1 41  ? 2.314   -4.707  13.066  1.00 10.88  ? 40   GLU A N   1 
ATOM   338  C  CA  . GLU A 1 41  ? 2.294   -3.272  12.845  1.00 9.68   ? 40   GLU A CA  1 
ATOM   339  C  C   . GLU A 1 41  ? 3.202   -2.589  13.866  1.00 15.62  ? 40   GLU A C   1 
ATOM   340  O  O   . GLU A 1 41  ? 3.975   -1.697  13.520  1.00 13.94  ? 40   GLU A O   1 
ATOM   341  C  CB  . GLU A 1 41  ? 0.883   -2.689  12.975  1.00 4.51   ? 40   GLU A CB  1 
ATOM   342  C  CG  . GLU A 1 41  ? 0.816   -1.191  12.785  1.00 3.77   ? 40   GLU A CG  1 
ATOM   343  C  CD  . GLU A 1 41  ? -0.409  -0.540  13.401  1.00 19.97  ? 40   GLU A CD  1 
ATOM   344  O  OE1 . GLU A 1 41  ? -1.303  -1.272  13.877  1.00 18.03  ? 40   GLU A OE1 1 
ATOM   345  O  OE2 . GLU A 1 41  ? -0.469  0.712   13.406  1.00 16.67  ? 40   GLU A OE2 1 
ATOM   346  N  N   . PHE A 1 42  ? 3.080   -3.032  15.125  1.00 15.14  ? 41   PHE A N   1 
ATOM   347  C  CA  . PHE A 1 42  ? 3.902   -2.417  16.170  1.00 20.63  ? 41   PHE A CA  1 
ATOM   348  C  C   . PHE A 1 42  ? 5.382   -2.504  15.801  1.00 12.11  ? 41   PHE A C   1 
ATOM   349  O  O   . PHE A 1 42  ? 6.123   -1.535  15.926  1.00 19.64  ? 41   PHE A O   1 
ATOM   350  C  CB  . PHE A 1 42  ? 3.660   -3.071  17.525  1.00 18.32  ? 41   PHE A CB  1 
ATOM   351  C  CG  . PHE A 1 42  ? 4.146   -2.284  18.731  1.00 16.99  ? 41   PHE A CG  1 
ATOM   352  C  CD1 . PHE A 1 42  ? 3.651   -1.025  19.023  1.00 18.67  ? 41   PHE A CD1 1 
ATOM   353  C  CD2 . PHE A 1 42  ? 5.102   -2.817  19.578  1.00 25.65  ? 41   PHE A CD2 1 
ATOM   354  C  CE1 . PHE A 1 42  ? 4.093   -0.321  20.126  1.00 22.39  ? 41   PHE A CE1 1 
ATOM   355  C  CE2 . PHE A 1 42  ? 5.547   -2.127  20.690  1.00 27.61  ? 41   PHE A CE2 1 
ATOM   356  C  CZ  . PHE A 1 42  ? 5.036   -0.873  20.973  1.00 24.28  ? 41   PHE A CZ  1 
ATOM   357  N  N   . LEU A 1 43  ? 5.785   -3.687  15.349  1.00 15.94  ? 42   LEU A N   1 
ATOM   358  C  CA  . LEU A 1 43  ? 7.184   -3.898  14.977  1.00 20.14  ? 42   LEU A CA  1 
ATOM   359  C  C   . LEU A 1 43  ? 7.532   -3.084  13.730  1.00 30.47  ? 42   LEU A C   1 
ATOM   360  O  O   . LEU A 1 43  ? 8.524   -2.350  13.727  1.00 19.87  ? 42   LEU A O   1 
ATOM   361  C  CB  . LEU A 1 43  ? 7.447   -5.374  14.752  1.00 11.82  ? 42   LEU A CB  1 
ATOM   362  C  CG  . LEU A 1 43  ? 8.811   -5.986  15.030  1.00 23.52  ? 42   LEU A CG  1 
ATOM   363  C  CD1 . LEU A 1 43  ? 9.108   -7.117  14.045  1.00 4.71   ? 42   LEU A CD1 1 
ATOM   364  C  CD2 . LEU A 1 43  ? 9.937   -4.962  14.979  1.00 36.08  ? 42   LEU A CD2 1 
ATOM   365  N  N   . GLY A 1 44  ? 6.721   -3.239  12.690  1.00 26.79  ? 43   GLY A N   1 
ATOM   366  C  CA  . GLY A 1 44  ? 6.993   -2.661  11.381  1.00 13.48  ? 43   GLY A CA  1 
ATOM   367  C  C   . GLY A 1 44  ? 7.079   -1.153  11.452  1.00 10.66  ? 43   GLY A C   1 
ATOM   368  O  O   . GLY A 1 44  ? 7.758   -0.508  10.658  1.00 14.35  ? 43   GLY A O   1 
ATOM   369  N  N   . ASP A 1 45  ? 6.374   -0.600  12.432  1.00 10.97  ? 44   ASP A N   1 
ATOM   370  C  CA  . ASP A 1 45  ? 6.405   0.833   12.705  1.00 4.50   ? 44   ASP A CA  1 
ATOM   371  C  C   . ASP A 1 45  ? 7.831   1.274   12.991  1.00 6.72   ? 44   ASP A C   1 
ATOM   372  O  O   . ASP A 1 45  ? 8.352   2.232   12.421  1.00 15.14  ? 44   ASP A O   1 
ATOM   373  C  CB  . ASP A 1 45  ? 5.476   1.109   13.891  1.00 5.58   ? 44   ASP A CB  1 
ATOM   374  C  CG  . ASP A 1 45  ? 5.311   2.572   14.227  1.00 6.56   ? 44   ASP A CG  1 
ATOM   375  O  OD1 . ASP A 1 45  ? 6.233   3.365   13.942  1.00 23.16  ? 44   ASP A OD1 1 
ATOM   376  O  OD2 . ASP A 1 45  ? 4.252   2.950   14.774  1.00 31.47  ? 44   ASP A OD2 1 
ATOM   377  N  N   . ALA A 1 46  ? 8.512   0.574   13.901  1.00 18.32  ? 45   ALA A N   1 
ATOM   378  C  CA  . ALA A 1 46  ? 9.887   0.936   14.235  1.00 17.62  ? 45   ALA A CA  1 
ATOM   379  C  C   . ALA A 1 46  ? 10.848  0.643   13.082  1.00 3.36   ? 45   ALA A C   1 
ATOM   380  O  O   . ALA A 1 46  ? 11.726  1.454   12.797  1.00 16.60  ? 45   ALA A O   1 
ATOM   381  C  CB  . ALA A 1 46  ? 10.369  0.193   15.471  1.00 7.34   ? 45   ALA A CB  1 
ATOM   382  N  N   . LEU A 1 47  ? 10.668  -0.513  12.482  1.00 4.36   ? 46   LEU A N   1 
ATOM   383  C  CA  . LEU A 1 47  ? 11.424  -1.045  11.350  1.00 4.79   ? 46   LEU A CA  1 
ATOM   384  C  C   . LEU A 1 47  ? 11.453  -0.051  10.195  1.00 12.88  ? 46   LEU A C   1 
ATOM   385  O  O   . LEU A 1 47  ? 12.506  0.414   9.761   1.00 18.33  ? 46   LEU A O   1 
ATOM   386  C  CB  . LEU A 1 47  ? 10.768  -2.347  10.922  1.00 6.45   ? 46   LEU A CB  1 
ATOM   387  C  CG  . LEU A 1 47  ? 11.486  -3.486  10.232  1.00 18.34  ? 46   LEU A CG  1 
ATOM   388  C  CD1 . LEU A 1 47  ? 10.755  -3.856  8.942   1.00 14.05  ? 46   LEU A CD1 1 
ATOM   389  C  CD2 . LEU A 1 47  ? 12.943  -3.152  9.950   1.00 35.69  ? 46   LEU A CD2 1 
ATOM   390  N  N   . VAL A 1 48  ? 10.273  0.291   9.685   1.00 13.59  ? 47   VAL A N   1 
ATOM   391  C  CA  . VAL A 1 48  ? 10.143  1.212   8.565   1.00 10.96  ? 47   VAL A CA  1 
ATOM   392  C  C   . VAL A 1 48  ? 10.653  2.595   8.913   1.00 12.29  ? 47   VAL A C   1 
ATOM   393  O  O   . VAL A 1 48  ? 11.328  3.262   8.131   1.00 16.92  ? 47   VAL A O   1 
ATOM   394  C  CB  . VAL A 1 48  ? 8.673   1.357   8.117   1.00 22.21  ? 47   VAL A CB  1 
ATOM   395  C  CG1 . VAL A 1 48  ? 8.530   2.610   7.269   1.00 8.89   ? 47   VAL A CG1 1 
ATOM   396  C  CG2 . VAL A 1 48  ? 8.197   0.129   7.361   1.00 28.31  ? 47   VAL A CG2 1 
ATOM   397  N  N   . ASN A 1 49  ? 10.316  3.037   10.131  1.00 16.49  ? 48   ASN A N   1 
ATOM   398  C  CA  . ASN A 1 49  ? 10.831  4.340   10.554  1.00 21.16  ? 48   ASN A CA  1 
ATOM   399  C  C   . ASN A 1 49  ? 12.358  4.365   10.478  1.00 17.77  ? 48   ASN A C   1 
ATOM   400  O  O   . ASN A 1 49  ? 12.942  5.411   10.209  1.00 14.53  ? 48   ASN A O   1 
ATOM   401  C  CB  . ASN A 1 49  ? 10.337  4.673   11.959  1.00 21.67  ? 48   ASN A CB  1 
ATOM   402  C  CG  . ASN A 1 49  ? 10.874  5.979   12.507  1.00 25.11  ? 48   ASN A CG  1 
ATOM   403  O  OD1 . ASN A 1 49  ? 10.321  7.060   12.298  1.00 24.72  ? 48   ASN A OD1 1 
ATOM   404  N  ND2 . ASN A 1 49  ? 11.977  5.883   13.242  1.00 32.13  ? 48   ASN A ND2 1 
ATOM   405  N  N   . PHE A 1 50  ? 12.978  3.214   10.701  1.00 22.70  ? 49   PHE A N   1 
ATOM   406  C  CA  . PHE A 1 50  ? 14.428  3.086   10.659  1.00 21.09  ? 49   PHE A CA  1 
ATOM   407  C  C   . PHE A 1 50  ? 14.942  3.119   9.223   1.00 21.13  ? 49   PHE A C   1 
ATOM   408  O  O   . PHE A 1 50  ? 15.961  3.763   8.948   1.00 14.19  ? 49   PHE A O   1 
ATOM   409  C  CB  . PHE A 1 50  ? 14.874  1.788   11.354  1.00 14.69  ? 49   PHE A CB  1 
ATOM   410  C  CG  . PHE A 1 50  ? 16.291  1.376   10.967  1.00 15.22  ? 49   PHE A CG  1 
ATOM   411  C  CD1 . PHE A 1 50  ? 17.382  2.193   11.223  1.00 17.03  ? 49   PHE A CD1 1 
ATOM   412  C  CD2 . PHE A 1 50  ? 16.498  0.165   10.333  1.00 14.46  ? 49   PHE A CD2 1 
ATOM   413  C  CE1 . PHE A 1 50  ? 18.659  1.825   10.843  1.00 17.62  ? 49   PHE A CE1 1 
ATOM   414  C  CE2 . PHE A 1 50  ? 17.774  -0.215  9.950   1.00 18.73  ? 49   PHE A CE2 1 
ATOM   415  C  CZ  . PHE A 1 50  ? 18.847  0.617   10.201  1.00 14.25  ? 49   PHE A CZ  1 
ATOM   416  N  N   . PHE A 1 51  ? 14.262  2.411   8.334   1.00 22.00  ? 50   PHE A N   1 
ATOM   417  C  CA  . PHE A 1 51  ? 14.649  2.305   6.932   1.00 15.32  ? 50   PHE A CA  1 
ATOM   418  C  C   . PHE A 1 51  ? 14.698  3.686   6.291   1.00 18.45  ? 50   PHE A C   1 
ATOM   419  O  O   . PHE A 1 51  ? 15.556  4.030   5.478   1.00 23.33  ? 50   PHE A O   1 
ATOM   420  C  CB  . PHE A 1 51  ? 13.655  1.435   6.180   1.00 13.77  ? 50   PHE A CB  1 
ATOM   421  C  CG  . PHE A 1 51  ? 13.745  -0.058  6.419   1.00 10.91  ? 50   PHE A CG  1 
ATOM   422  C  CD1 . PHE A 1 51  ? 14.777  -0.611  7.151   1.00 13.51  ? 50   PHE A CD1 1 
ATOM   423  C  CD2 . PHE A 1 51  ? 12.788  -0.904  5.887   1.00 9.10   ? 50   PHE A CD2 1 
ATOM   424  C  CE1 . PHE A 1 51  ? 14.860  -1.970  7.354   1.00 3.48   ? 50   PHE A CE1 1 
ATOM   425  C  CE2 . PHE A 1 51  ? 12.854  -2.267  6.086   1.00 9.02   ? 50   PHE A CE2 1 
ATOM   426  C  CZ  . PHE A 1 51  ? 13.899  -2.804  6.816   1.00 13.12  ? 50   PHE A CZ  1 
ATOM   427  N  N   . ILE A 1 52  ? 13.712  4.481   6.707   1.00 8.56   ? 51   ILE A N   1 
ATOM   428  C  CA  . ILE A 1 52  ? 13.517  5.790   6.098   1.00 6.83   ? 51   ILE A CA  1 
ATOM   429  C  C   . ILE A 1 52  ? 14.452  6.842   6.669   1.00 9.25   ? 51   ILE A C   1 
ATOM   430  O  O   . ILE A 1 52  ? 14.921  7.743   5.961   1.00 15.55  ? 51   ILE A O   1 
ATOM   431  C  CB  . ILE A 1 52  ? 12.046  6.238   6.245   1.00 15.33  ? 51   ILE A CB  1 
ATOM   432  C  CG1 . ILE A 1 52  ? 11.121  5.619   5.200   1.00 22.76  ? 51   ILE A CG1 1 
ATOM   433  C  CG2 . ILE A 1 52  ? 11.953  7.758   6.242   1.00 10.43  ? 51   ILE A CG2 1 
ATOM   434  C  CD1 . ILE A 1 52  ? 9.741   5.259   5.691   1.00 20.40  ? 51   ILE A CD1 1 
ATOM   435  N  N   . VAL A 1 53  ? 14.757  6.769   7.968   1.00 12.01  ? 52   VAL A N   1 
ATOM   436  C  CA  . VAL A 1 53  ? 15.668  7.782   8.507   1.00 7.00   ? 52   VAL A CA  1 
ATOM   437  C  C   . VAL A 1 53  ? 17.083  7.538   7.966   1.00 14.24  ? 52   VAL A C   1 
ATOM   438  O  O   . VAL A 1 53  ? 17.831  8.475   7.712   1.00 18.64  ? 52   VAL A O   1 
ATOM   439  C  CB  . VAL A 1 53  ? 15.710  7.780   10.044  1.00 9.01   ? 52   VAL A CB  1 
ATOM   440  C  CG1 . VAL A 1 53  ? 16.987  8.475   10.499  1.00 18.93  ? 52   VAL A CG1 1 
ATOM   441  C  CG2 . VAL A 1 53  ? 14.475  8.432   10.634  1.00 17.84  ? 52   VAL A CG2 1 
ATOM   442  N  N   . ASP A 1 54  ? 17.427  6.270   7.786   1.00 13.55  ? 53   ASP A N   1 
ATOM   443  C  CA  . ASP A 1 54  ? 18.674  5.825   7.188   1.00 10.27  ? 53   ASP A CA  1 
ATOM   444  C  C   . ASP A 1 54  ? 18.838  6.478   5.819   1.00 20.33  ? 53   ASP A C   1 
ATOM   445  O  O   . ASP A 1 54  ? 19.835  7.146   5.542   1.00 22.42  ? 53   ASP A O   1 
ATOM   446  C  CB  . ASP A 1 54  ? 18.716  4.298   7.070   1.00 6.47   ? 53   ASP A CB  1 
ATOM   447  C  CG  . ASP A 1 54  ? 20.129  3.744   7.173   1.00 16.33  ? 53   ASP A CG  1 
ATOM   448  O  OD1 . ASP A 1 54  ? 21.093  4.531   7.293   1.00 16.86  ? 53   ASP A OD1 1 
ATOM   449  O  OD2 . ASP A 1 54  ? 20.313  2.512   7.134   1.00 25.02  ? 53   ASP A OD2 1 
ATOM   450  N  N   . LEU A 1 55  ? 17.843  6.296   4.946   1.00 19.36  ? 54   LEU A N   1 
ATOM   451  C  CA  . LEU A 1 55  ? 17.921  6.968   3.648   1.00 7.36   ? 54   LEU A CA  1 
ATOM   452  C  C   . LEU A 1 55  ? 18.025  8.470   3.871   1.00 15.32  ? 54   LEU A C   1 
ATOM   453  O  O   . LEU A 1 55  ? 18.797  9.179   3.233   1.00 23.21  ? 54   LEU A O   1 
ATOM   454  C  CB  . LEU A 1 55  ? 16.706  6.654   2.778   1.00 9.35   ? 54   LEU A CB  1 
ATOM   455  C  CG  . LEU A 1 55  ? 16.753  5.359   1.969   1.00 23.69  ? 54   LEU A CG  1 
ATOM   456  C  CD1 . LEU A 1 55  ? 15.461  5.160   1.192   1.00 16.00  ? 54   LEU A CD1 1 
ATOM   457  C  CD2 . LEU A 1 55  ? 17.947  5.351   1.022   1.00 14.95  ? 54   LEU A CD2 1 
ATOM   458  N  N   . LEU A 1 56  ? 17.209  8.952   4.812   1.00 18.74  ? 55   LEU A N   1 
ATOM   459  C  CA  . LEU A 1 56  ? 17.204  10.385  5.111   1.00 20.70  ? 55   LEU A CA  1 
ATOM   460  C  C   . LEU A 1 56  ? 18.595  10.852  5.516   1.00 20.94  ? 55   LEU A C   1 
ATOM   461  O  O   . LEU A 1 56  ? 19.170  11.790  4.960   1.00 33.14  ? 55   LEU A O   1 
ATOM   462  C  CB  . LEU A 1 56  ? 16.173  10.669  6.203   1.00 32.09  ? 55   LEU A CB  1 
ATOM   463  C  CG  . LEU A 1 56  ? 15.802  12.123  6.481   1.00 32.79  ? 55   LEU A CG  1 
ATOM   464  C  CD1 . LEU A 1 56  ? 15.211  12.771  5.236   1.00 42.25  ? 55   LEU A CD1 1 
ATOM   465  C  CD2 . LEU A 1 56  ? 14.832  12.226  7.650   1.00 25.62  ? 55   LEU A CD2 1 
ATOM   466  N  N   . VAL A 1 57  ? 19.186  10.189  6.509   1.00 20.40  ? 56   VAL A N   1 
ATOM   467  C  CA  . VAL A 1 57  ? 20.532  10.547  6.940   1.00 26.36  ? 56   VAL A CA  1 
ATOM   468  C  C   . VAL A 1 57  ? 21.512  10.490  5.769   1.00 26.39  ? 56   VAL A C   1 
ATOM   469  O  O   . VAL A 1 57  ? 22.163  11.481  5.450   1.00 30.48  ? 56   VAL A O   1 
ATOM   470  C  CB  . VAL A 1 57  ? 21.018  9.612   8.062   1.00 32.68  ? 56   VAL A CB  1 
ATOM   471  C  CG1 . VAL A 1 57  ? 22.535  9.495   8.032   1.00 37.10  ? 56   VAL A CG1 1 
ATOM   472  C  CG2 . VAL A 1 57  ? 20.542  10.112  9.419   1.00 32.33  ? 56   VAL A CG2 1 
ATOM   473  N  N   . GLN A 1 58  ? 21.603  9.328   5.141   1.00 31.10  ? 57   GLN A N   1 
ATOM   474  C  CA  . GLN A 1 58  ? 22.478  9.034   4.018   1.00 31.73  ? 57   GLN A CA  1 
ATOM   475  C  C   . GLN A 1 58  ? 22.374  10.080  2.918   1.00 42.17  ? 57   GLN A C   1 
ATOM   476  O  O   . GLN A 1 58  ? 23.361  10.499  2.313   1.00 54.38  ? 57   GLN A O   1 
ATOM   477  C  CB  . GLN A 1 58  ? 22.127  7.676   3.414   1.00 30.91  ? 57   GLN A CB  1 
ATOM   478  C  CG  . GLN A 1 58  ? 23.188  6.595   3.491   1.00 31.95  ? 57   GLN A CG  1 
ATOM   479  C  CD  . GLN A 1 58  ? 22.614  5.253   3.063   1.00 35.56  ? 57   GLN A CD  1 
ATOM   480  O  OE1 . GLN A 1 58  ? 23.345  4.324   2.726   1.00 48.63  ? 57   GLN A OE1 1 
ATOM   481  N  NE2 . GLN A 1 58  ? 21.286  5.170   3.080   1.00 31.74  ? 57   GLN A NE2 1 
ATOM   482  N  N   . TYR A 1 59  ? 21.141  10.505  2.639   1.00 45.32  ? 58   TYR A N   1 
ATOM   483  C  CA  . TYR A 1 59  ? 20.982  11.497  1.565   1.00 43.77  ? 58   TYR A CA  1 
ATOM   484  C  C   . TYR A 1 59  ? 20.607  12.831  2.174   1.00 43.13  ? 58   TYR A C   1 
ATOM   485  O  O   . TYR A 1 59  ? 21.094  13.145  3.269   1.00 58.06  ? 58   TYR A O   1 
ATOM   486  C  CB  . TYR A 1 59  ? 19.995  10.966  0.520   1.00 41.28  ? 58   TYR A CB  1 
ATOM   487  C  CG  . TYR A 1 59  ? 20.554  9.719   -0.148  1.00 36.12  ? 58   TYR A CG  1 
ATOM   488  C  CD1 . TYR A 1 59  ? 21.378  9.809   -1.261  1.00 34.31  ? 58   TYR A CD1 1 
ATOM   489  C  CD2 . TYR A 1 59  ? 20.264  8.455   0.341   1.00 26.84  ? 58   TYR A CD2 1 
ATOM   490  C  CE1 . TYR A 1 59  ? 21.891  8.676   -1.870  1.00 28.14  ? 58   TYR A CE1 1 
ATOM   491  C  CE2 . TYR A 1 59  ? 20.770  7.318   -0.258  1.00 25.91  ? 58   TYR A CE2 1 
ATOM   492  C  CZ  . TYR A 1 59  ? 21.583  7.433   -1.365  1.00 31.39  ? 58   TYR A CZ  1 
ATOM   493  O  OH  . TYR A 1 59  ? 22.091  6.297   -1.966  1.00 31.13  ? 58   TYR A OH  1 
ATOM   494  N  N   . SER A 1 60  ? 19.862  13.678  1.477   1.00 43.57  ? 59   SER A N   1 
ATOM   495  C  CA  . SER A 1 60  ? 19.597  14.916  2.154   1.00 39.12  ? 59   SER A CA  1 
ATOM   496  C  C   . SER A 1 60  ? 20.836  15.749  2.189   1.00 43.13  ? 59   SER A C   1 
ATOM   497  O  O   . SER A 1 60  ? 21.689  15.446  3.023   1.00 40.72  ? 59   SER A O   1 
ATOM   498  C  CB  . SER A 1 60  ? 18.879  14.841  3.485   1.00 27.12  ? 59   SER A CB  1 
ATOM   499  O  OG  . SER A 1 60  ? 18.849  16.098  4.145   1.00 22.49  ? 59   SER A OG  1 
ATOM   500  N  N   . PRO A 1 61  ? 20.993  16.727  1.314   1.00 49.33  ? 60   PRO A N   1 
ATOM   501  C  CA  . PRO A 1 61  ? 22.167  17.601  1.267   1.00 47.27  ? 60   PRO A CA  1 
ATOM   502  C  C   . PRO A 1 61  ? 22.221  18.630  2.390   1.00 45.80  ? 60   PRO A C   1 
ATOM   503  O  O   . PRO A 1 61  ? 23.102  19.495  2.401   1.00 64.01  ? 60   PRO A O   1 
ATOM   504  C  CB  . PRO A 1 61  ? 22.015  18.327  -0.080  1.00 50.93  ? 60   PRO A CB  1 
ATOM   505  C  CG  . PRO A 1 61  ? 21.017  17.507  -0.839  1.00 50.42  ? 60   PRO A CG  1 
ATOM   506  C  CD  . PRO A 1 61  ? 20.042  17.056  0.228   1.00 53.50  ? 60   PRO A CD  1 
ATOM   507  N  N   . ASN A 1 62  ? 21.300  18.564  3.336   1.00 47.40  ? 61   ASN A N   1 
ATOM   508  C  CA  . ASN A 1 62  ? 21.392  19.317  4.589   1.00 40.36  ? 61   ASN A CA  1 
ATOM   509  C  C   . ASN A 1 62  ? 21.296  18.307  5.733   1.00 38.96  ? 61   ASN A C   1 
ATOM   510  O  O   . ASN A 1 62  ? 20.476  17.387  5.683   1.00 49.87  ? 61   ASN A O   1 
ATOM   511  C  CB  . ASN A 1 62  ? 20.333  20.395  4.691   1.00 44.00  ? 61   ASN A CB  1 
ATOM   512  C  CG  . ASN A 1 62  ? 20.336  21.181  5.984   1.00 38.80  ? 61   ASN A CG  1 
ATOM   513  O  OD1 . ASN A 1 62  ? 20.718  20.707  7.052   1.00 28.47  ? 61   ASN A OD1 1 
ATOM   514  N  ND2 . ASN A 1 62  ? 19.893  22.430  5.908   1.00 37.93  ? 61   ASN A ND2 1 
ATOM   515  N  N   . LYS A 1 63  ? 22.141  18.453  6.742   1.00 37.64  ? 62   LYS A N   1 
ATOM   516  C  CA  . LYS A 1 63  ? 22.255  17.430  7.776   1.00 42.45  ? 62   LYS A CA  1 
ATOM   517  C  C   . LYS A 1 63  ? 21.899  17.924  9.167   1.00 38.34  ? 62   LYS A C   1 
ATOM   518  O  O   . LYS A 1 63  ? 22.052  17.206  10.162  1.00 58.55  ? 62   LYS A O   1 
ATOM   519  C  CB  . LYS A 1 63  ? 23.690  16.882  7.773   1.00 46.85  ? 62   LYS A CB  1 
ATOM   520  C  CG  . LYS A 1 63  ? 23.844  15.525  7.119   1.00 48.54  ? 62   LYS A CG  1 
ATOM   521  C  CD  . LYS A 1 63  ? 22.807  15.304  6.025   1.00 46.68  ? 62   LYS A CD  1 
ATOM   522  C  CE  . LYS A 1 63  ? 23.370  14.352  4.975   1.00 47.65  ? 62   LYS A CE  1 
ATOM   523  N  NZ  . LYS A 1 63  ? 24.838  14.161  5.164   1.00 57.09  ? 62   LYS A NZ  1 
ATOM   524  N  N   . ARG A 1 64  ? 21.417  19.156  9.309   1.00 35.17  ? 63   ARG A N   1 
ATOM   525  C  CA  . ARG A 1 64  ? 21.029  19.576  10.662  1.00 40.35  ? 63   ARG A CA  1 
ATOM   526  C  C   . ARG A 1 64  ? 19.657  18.983  10.986  1.00 41.97  ? 63   ARG A C   1 
ATOM   527  O  O   . ARG A 1 64  ? 18.801  18.984  10.095  1.00 34.22  ? 63   ARG A O   1 
ATOM   528  C  CB  . ARG A 1 64  ? 21.039  21.095  10.786  1.00 35.87  ? 63   ARG A CB  1 
ATOM   529  C  CG  . ARG A 1 64  ? 22.397  21.708  11.070  1.00 36.98  ? 63   ARG A CG  1 
ATOM   530  C  CD  . ARG A 1 64  ? 22.414  23.220  10.926  1.00 45.46  ? 63   ARG A CD  1 
ATOM   531  N  NE  . ARG A 1 64  ? 22.119  23.691  9.575   1.00 49.60  ? 63   ARG A NE  1 
ATOM   532  C  CZ  . ARG A 1 64  ? 22.051  24.959  9.193   1.00 48.41  ? 63   ARG A CZ  1 
ATOM   533  N  NH1 . ARG A 1 64  ? 22.244  25.939  10.067  1.00 50.00  ? 63   ARG A NH1 1 
ATOM   534  N  NH2 . ARG A 1 64  ? 21.781  25.272  7.929   1.00 41.82  ? 63   ARG A NH2 1 
ATOM   535  N  N   . GLU A 1 65  ? 19.469  18.491  12.207  1.00 38.37  ? 64   GLU A N   1 
ATOM   536  C  CA  . GLU A 1 65  ? 18.196  17.915  12.628  1.00 41.46  ? 64   GLU A CA  1 
ATOM   537  C  C   . GLU A 1 65  ? 17.031  18.833  12.254  1.00 41.00  ? 64   GLU A C   1 
ATOM   538  O  O   . GLU A 1 65  ? 15.968  18.338  11.877  1.00 35.80  ? 64   GLU A O   1 
ATOM   539  C  CB  . GLU A 1 65  ? 18.156  17.635  14.130  1.00 44.63  ? 64   GLU A CB  1 
ATOM   540  C  CG  . GLU A 1 65  ? 17.473  18.693  14.971  1.00 47.88  ? 64   GLU A CG  1 
ATOM   541  C  CD  . GLU A 1 65  ? 16.045  18.373  15.364  1.00 54.33  ? 64   GLU A CD  1 
ATOM   542  O  OE1 . GLU A 1 65  ? 15.726  17.178  15.534  1.00 70.46  ? 64   GLU A OE1 1 
ATOM   543  O  OE2 . GLU A 1 65  ? 15.237  19.320  15.497  1.00 47.35  ? 64   GLU A OE2 1 
ATOM   544  N  N   . GLY A 1 66  ? 17.251  20.137  12.355  1.00 42.55  ? 65   GLY A N   1 
ATOM   545  C  CA  . GLY A 1 66  ? 16.288  21.162  12.008  1.00 41.30  ? 65   GLY A CA  1 
ATOM   546  C  C   . GLY A 1 66  ? 15.742  21.018  10.602  1.00 38.53  ? 65   GLY A C   1 
ATOM   547  O  O   . GLY A 1 66  ? 14.649  21.491  10.285  1.00 38.91  ? 65   GLY A O   1 
ATOM   548  N  N   . PHE A 1 67  ? 16.495  20.354  9.730   1.00 36.29  ? 66   PHE A N   1 
ATOM   549  C  CA  . PHE A 1 67  ? 16.021  20.111  8.371   1.00 42.34  ? 66   PHE A CA  1 
ATOM   550  C  C   . PHE A 1 67  ? 15.345  18.742  8.287   1.00 34.87  ? 66   PHE A C   1 
ATOM   551  O  O   . PHE A 1 67  ? 14.343  18.599  7.590   1.00 38.95  ? 66   PHE A O   1 
ATOM   552  C  CB  . PHE A 1 67  ? 17.175  20.194  7.378   1.00 51.36  ? 66   PHE A CB  1 
ATOM   553  C  CG  . PHE A 1 67  ? 16.796  20.207  5.906   1.00 57.75  ? 66   PHE A CG  1 
ATOM   554  C  CD1 . PHE A 1 67  ? 16.189  21.318  5.337   1.00 60.61  ? 66   PHE A CD1 1 
ATOM   555  C  CD2 . PHE A 1 67  ? 17.052  19.117  5.095   1.00 57.22  ? 66   PHE A CD2 1 
ATOM   556  C  CE1 . PHE A 1 67  ? 15.859  21.328  3.993   1.00 63.04  ? 66   PHE A CE1 1 
ATOM   557  C  CE2 . PHE A 1 67  ? 16.720  19.120  3.751   1.00 58.77  ? 66   PHE A CE2 1 
ATOM   558  C  CZ  . PHE A 1 67  ? 16.118  20.228  3.197   1.00 61.64  ? 66   PHE A CZ  1 
ATOM   559  N  N   . LEU A 1 68  ? 15.922  17.792  9.007   1.00 27.93  ? 67   LEU A N   1 
ATOM   560  C  CA  . LEU A 1 68  ? 15.598  16.377  8.978   1.00 24.11  ? 67   LEU A CA  1 
ATOM   561  C  C   . LEU A 1 68  ? 14.235  16.064  9.574   1.00 30.98  ? 67   LEU A C   1 
ATOM   562  O  O   . LEU A 1 68  ? 13.498  15.201  9.094   1.00 48.89  ? 67   LEU A O   1 
ATOM   563  C  CB  . LEU A 1 68  ? 16.686  15.593  9.729   1.00 19.05  ? 67   LEU A CB  1 
ATOM   564  C  CG  . LEU A 1 68  ? 18.062  15.589  9.056   1.00 28.65  ? 67   LEU A CG  1 
ATOM   565  C  CD1 . LEU A 1 68  ? 19.128  15.111  10.029  1.00 36.28  ? 67   LEU A CD1 1 
ATOM   566  C  CD2 . LEU A 1 68  ? 18.049  14.736  7.793   1.00 15.66  ? 67   LEU A CD2 1 
ATOM   567  N  N   . SER A 1 69  ? 13.855  16.755  10.648  1.00 26.48  ? 68   SER A N   1 
ATOM   568  C  CA  . SER A 1 69  ? 12.524  16.490  11.195  1.00 31.07  ? 68   SER A CA  1 
ATOM   569  C  C   . SER A 1 69  ? 11.416  16.727  10.179  1.00 31.30  ? 68   SER A C   1 
ATOM   570  O  O   . SER A 1 69  ? 10.581  15.828  10.008  1.00 27.72  ? 68   SER A O   1 
ATOM   571  C  CB  . SER A 1 69  ? 12.311  17.337  12.453  1.00 34.34  ? 68   SER A CB  1 
ATOM   572  O  OG  . SER A 1 69  ? 13.288  16.990  13.427  1.00 38.69  ? 68   SER A OG  1 
ATOM   573  N  N   . PRO A 1 70  ? 11.336  17.860  9.500   1.00 35.81  ? 69   PRO A N   1 
ATOM   574  C  CA  . PRO A 1 70  ? 10.184  18.101  8.618   1.00 38.59  ? 69   PRO A CA  1 
ATOM   575  C  C   . PRO A 1 70  ? 9.959   17.025  7.563   1.00 38.98  ? 69   PRO A C   1 
ATOM   576  O  O   . PRO A 1 70  ? 8.897   16.397  7.607   1.00 41.33  ? 69   PRO A O   1 
ATOM   577  C  CB  . PRO A 1 70  ? 10.534  19.428  7.928   1.00 34.59  ? 69   PRO A CB  1 
ATOM   578  C  CG  . PRO A 1 70  ? 11.419  20.111  8.918   1.00 34.19  ? 69   PRO A CG  1 
ATOM   579  C  CD  . PRO A 1 70  ? 12.265  19.004  9.487   1.00 35.32  ? 69   PRO A CD  1 
ATOM   580  N  N   . LEU A 1 71  ? 10.891  16.806  6.639   1.00 44.36  ? 70   LEU A N   1 
ATOM   581  C  CA  . LEU A 1 71  ? 10.636  15.832  5.577   1.00 40.93  ? 70   LEU A CA  1 
ATOM   582  C  C   . LEU A 1 71  ? 10.336  14.465  6.198   1.00 36.42  ? 70   LEU A C   1 
ATOM   583  O  O   . LEU A 1 71  ? 9.498   13.731  5.680   1.00 34.48  ? 70   LEU A O   1 
ATOM   584  C  CB  . LEU A 1 71  ? 11.769  15.725  4.570   1.00 44.51  ? 70   LEU A CB  1 
ATOM   585  C  CG  . LEU A 1 71  ? 13.213  16.010  4.951   1.00 46.36  ? 70   LEU A CG  1 
ATOM   586  C  CD1 . LEU A 1 71  ? 13.496  17.507  4.946   1.00 35.29  ? 70   LEU A CD1 1 
ATOM   587  C  CD2 . LEU A 1 71  ? 13.554  15.414  6.307   1.00 52.66  ? 70   LEU A CD2 1 
ATOM   588  N  N   . LYS A 1 72  ? 11.011  14.182  7.305   1.00 34.24  ? 71   LYS A N   1 
ATOM   589  C  CA  . LYS A 1 72  ? 10.757  12.974  8.074   1.00 30.74  ? 71   LYS A CA  1 
ATOM   590  C  C   . LYS A 1 72  ? 9.290   12.865  8.475   1.00 26.11  ? 71   LYS A C   1 
ATOM   591  O  O   . LYS A 1 72  ? 8.677   11.811  8.329   1.00 28.74  ? 71   LYS A O   1 
ATOM   592  C  CB  . LYS A 1 72  ? 11.621  12.938  9.339   1.00 34.11  ? 71   LYS A CB  1 
ATOM   593  C  CG  . LYS A 1 72  ? 11.729  11.545  9.951   1.00 39.64  ? 71   LYS A CG  1 
ATOM   594  C  CD  . LYS A 1 72  ? 10.687  11.328  11.034  1.00 36.94  ? 71   LYS A CD  1 
ATOM   595  C  CE  . LYS A 1 72  ? 10.700  9.893   11.529  1.00 41.44  ? 71   LYS A CE  1 
ATOM   596  N  NZ  . LYS A 1 72  ? 11.279  9.768   12.895  1.00 30.68  ? 71   LYS A NZ  1 
ATOM   597  N  N   . ALA A 1 73  ? 8.734   13.957  9.001   1.00 25.30  ? 72   ALA A N   1 
ATOM   598  C  CA  . ALA A 1 73  ? 7.335   13.907  9.429   1.00 26.33  ? 72   ALA A CA  1 
ATOM   599  C  C   . ALA A 1 73  ? 6.470   13.528  8.236   1.00 20.64  ? 72   ALA A C   1 
ATOM   600  O  O   . ALA A 1 73  ? 5.472   12.822  8.348   1.00 14.36  ? 72   ALA A O   1 
ATOM   601  C  CB  . ALA A 1 73  ? 6.903   15.229  10.030  1.00 45.32  ? 72   ALA A CB  1 
ATOM   602  N  N   . TYR A 1 74  ? 6.900   14.010  7.066   1.00 20.63  ? 73   TYR A N   1 
ATOM   603  C  CA  . TYR A 1 74  ? 6.177   13.683  5.846   1.00 17.40  ? 73   TYR A CA  1 
ATOM   604  C  C   . TYR A 1 74  ? 6.397   12.228  5.446   1.00 26.38  ? 73   TYR A C   1 
ATOM   605  O  O   . TYR A 1 74  ? 5.445   11.502  5.163   1.00 41.75  ? 73   TYR A O   1 
ATOM   606  C  CB  . TYR A 1 74  ? 6.604   14.600  4.699   1.00 24.25  ? 73   TYR A CB  1 
ATOM   607  C  CG  . TYR A 1 74  ? 5.956   14.211  3.385   1.00 27.04  ? 73   TYR A CG  1 
ATOM   608  C  CD1 . TYR A 1 74  ? 4.578   14.086  3.275   1.00 22.04  ? 73   TYR A CD1 1 
ATOM   609  C  CD2 . TYR A 1 74  ? 6.728   13.968  2.257   1.00 33.65  ? 73   TYR A CD2 1 
ATOM   610  C  CE1 . TYR A 1 74  ? 3.987   13.731  2.077   1.00 28.09  ? 73   TYR A CE1 1 
ATOM   611  C  CE2 . TYR A 1 74  ? 6.144   13.615  1.057   1.00 35.92  ? 73   TYR A CE2 1 
ATOM   612  C  CZ  . TYR A 1 74  ? 4.775   13.498  0.970   1.00 33.81  ? 73   TYR A CZ  1 
ATOM   613  O  OH  . TYR A 1 74  ? 4.198   13.141  -0.228  1.00 52.31  ? 73   TYR A OH  1 
ATOM   614  N  N   . LEU A 1 75  ? 7.660   11.811  5.423   1.00 27.45  ? 74   LEU A N   1 
ATOM   615  C  CA  . LEU A 1 75  ? 8.035   10.490  4.932   1.00 13.73  ? 74   LEU A CA  1 
ATOM   616  C  C   . LEU A 1 75  ? 7.486   9.378   5.798   1.00 6.19   ? 74   LEU A C   1 
ATOM   617  O  O   . LEU A 1 75  ? 7.361   8.217   5.383   1.00 7.71   ? 74   LEU A O   1 
ATOM   618  C  CB  . LEU A 1 75  ? 9.563   10.382  4.826   1.00 13.53  ? 74   LEU A CB  1 
ATOM   619  C  CG  . LEU A 1 75  ? 10.209  11.291  3.775   1.00 10.21  ? 74   LEU A CG  1 
ATOM   620  C  CD1 . LEU A 1 75  ? 11.722  11.290  3.916   1.00 11.41  ? 74   LEU A CD1 1 
ATOM   621  C  CD2 . LEU A 1 75  ? 9.792   10.858  2.379   1.00 16.56  ? 74   LEU A CD2 1 
ATOM   622  N  N   . ILE A 1 76  ? 7.129   9.689   7.045   1.00 17.82  ? 75   ILE A N   1 
ATOM   623  C  CA  . ILE A 1 76  ? 6.452   8.638   7.814   1.00 19.31  ? 75   ILE A CA  1 
ATOM   624  C  C   . ILE A 1 76  ? 4.948   8.896   7.850   1.00 15.41  ? 75   ILE A C   1 
ATOM   625  O  O   . ILE A 1 76  ? 4.180   8.072   8.345   1.00 27.36  ? 75   ILE A O   1 
ATOM   626  C  CB  . ILE A 1 76  ? 6.983   8.524   9.251   1.00 20.02  ? 75   ILE A CB  1 
ATOM   627  C  CG1 . ILE A 1 76  ? 7.099   9.871   9.967   1.00 17.53  ? 75   ILE A CG1 1 
ATOM   628  C  CG2 . ILE A 1 76  ? 8.306   7.773   9.276   1.00 30.95  ? 75   ILE A CG2 1 
ATOM   629  C  CD1 . ILE A 1 76  ? 7.408   9.746   11.445  1.00 29.68  ? 75   ILE A CD1 1 
ATOM   630  N  N   . SER A 1 77  ? 4.520   10.039  7.331   1.00 23.66  ? 76   SER A N   1 
ATOM   631  C  CA  . SER A 1 77  ? 3.122   10.404  7.303   1.00 28.63  ? 76   SER A CA  1 
ATOM   632  C  C   . SER A 1 77  ? 2.234   9.336   6.705   1.00 27.64  ? 76   SER A C   1 
ATOM   633  O  O   . SER A 1 77  ? 2.713   8.531   5.887   1.00 25.58  ? 76   SER A O   1 
ATOM   634  C  CB  . SER A 1 77  ? 2.881   11.717  6.604   1.00 32.61  ? 76   SER A CB  1 
ATOM   635  O  OG  . SER A 1 77  ? 2.642   11.470  5.225   1.00 14.45  ? 76   SER A OG  1 
ATOM   636  N  N   . GLU A 1 78  ? 0.997   9.201   7.160   1.00 23.83  ? 77   GLU A N   1 
ATOM   637  C  CA  . GLU A 1 78  ? 0.116   8.179   6.602   1.00 17.99  ? 77   GLU A CA  1 
ATOM   638  C  C   . GLU A 1 78  ? -0.096  8.384   5.106   1.00 12.88  ? 77   GLU A C   1 
ATOM   639  O  O   . GLU A 1 78  ? -0.421  7.460   4.369   1.00 26.00  ? 77   GLU A O   1 
ATOM   640  C  CB  . GLU A 1 78  ? -1.242  8.219   7.308   1.00 12.04  ? 77   GLU A CB  1 
ATOM   641  C  CG  . GLU A 1 78  ? -2.373  7.614   6.493   1.00 15.11  ? 77   GLU A CG  1 
ATOM   642  C  CD  . GLU A 1 78  ? -3.713  7.864   7.168   1.00 22.37  ? 77   GLU A CD  1 
ATOM   643  O  OE1 . GLU A 1 78  ? -3.806  7.539   8.372   1.00 32.14  ? 77   GLU A OE1 1 
ATOM   644  O  OE2 . GLU A 1 78  ? -4.631  8.373   6.496   1.00 40.98  ? 77   GLU A OE2 1 
ATOM   645  N  N   . GLU A 1 79  ? 0.084   9.630   4.691   1.00 16.77  ? 78   GLU A N   1 
ATOM   646  C  CA  . GLU A 1 79  ? -0.187  10.074  3.328   1.00 26.86  ? 78   GLU A CA  1 
ATOM   647  C  C   . GLU A 1 79  ? 0.880   9.505   2.396   1.00 24.97  ? 78   GLU A C   1 
ATOM   648  O  O   . GLU A 1 79  ? 0.574   9.039   1.303   1.00 30.30  ? 78   GLU A O   1 
ATOM   649  C  CB  . GLU A 1 79  ? -0.222  11.596  3.230   1.00 27.40  ? 78   GLU A CB  1 
ATOM   650  C  CG  A GLU A 1 79  ? -0.473  12.176  1.853   0.50 23.83  ? 78   GLU A CG  1 
ATOM   651  C  CG  B GLU A 1 79  ? -0.733  12.301  4.470   0.50 29.08  ? 78   GLU A CG  1 
ATOM   652  C  CD  A GLU A 1 79  ? 0.401   13.369  1.518   0.50 26.03  ? 78   GLU A CD  1 
ATOM   653  C  CD  B GLU A 1 79  ? -2.016  11.716  5.027   0.50 35.09  ? 78   GLU A CD  1 
ATOM   654  O  OE1 A GLU A 1 79  ? 0.446   14.336  2.306   0.50 17.63  ? 78   GLU A OE1 1 
ATOM   655  O  OE1 B GLU A 1 79  ? -3.110  12.055  4.529   0.50 50.19  ? 78   GLU A OE1 1 
ATOM   656  O  OE2 A GLU A 1 79  ? 1.060   13.350  0.450   0.50 32.20  ? 78   GLU A OE2 1 
ATOM   657  O  OE2 B GLU A 1 79  ? -1.942  10.902  5.979   0.50 52.45  ? 78   GLU A OE2 1 
ATOM   658  N  N   . PHE A 1 80  ? 2.118   9.564   2.886   1.00 21.70  ? 79   PHE A N   1 
ATOM   659  C  CA  . PHE A 1 80  ? 3.251   9.014   2.152   1.00 13.82  ? 79   PHE A CA  1 
ATOM   660  C  C   . PHE A 1 80  ? 3.255   7.496   2.230   1.00 18.98  ? 79   PHE A C   1 
ATOM   661  O  O   . PHE A 1 80  ? 3.628   6.831   1.255   1.00 16.02  ? 79   PHE A O   1 
ATOM   662  C  CB  . PHE A 1 80  ? 4.586   9.586   2.660   1.00 10.85  ? 79   PHE A CB  1 
ATOM   663  C  CG  . PHE A 1 80  ? 5.705   9.212   1.682   1.00 13.24  ? 79   PHE A CG  1 
ATOM   664  C  CD1 . PHE A 1 80  ? 5.797   9.851   0.461   1.00 10.90  ? 79   PHE A CD1 1 
ATOM   665  C  CD2 . PHE A 1 80  ? 6.618   8.225   1.998   1.00 14.22  ? 79   PHE A CD2 1 
ATOM   666  C  CE1 . PHE A 1 80  ? 6.786   9.506   -0.438  1.00 25.31  ? 79   PHE A CE1 1 
ATOM   667  C  CE2 . PHE A 1 80  ? 7.616   7.879   1.111   1.00 26.32  ? 79   PHE A CE2 1 
ATOM   668  C  CZ  . PHE A 1 80  ? 7.701   8.518   -0.115  1.00 28.11  ? 79   PHE A CZ  1 
ATOM   669  N  N   . PHE A 1 81  ? 2.833   6.910   3.364   1.00 15.25  ? 80   PHE A N   1 
ATOM   670  C  CA  . PHE A 1 81  ? 2.854   5.442   3.392   1.00 13.04  ? 80   PHE A CA  1 
ATOM   671  C  C   . PHE A 1 81  ? 1.798   4.890   2.437   1.00 16.70  ? 80   PHE A C   1 
ATOM   672  O  O   . PHE A 1 81  ? 1.916   3.776   1.918   1.00 15.69  ? 80   PHE A O   1 
ATOM   673  C  CB  . PHE A 1 81  ? 2.619   4.846   4.775   1.00 15.25  ? 80   PHE A CB  1 
ATOM   674  C  CG  . PHE A 1 81  ? 3.815   4.796   5.705   1.00 15.39  ? 80   PHE A CG  1 
ATOM   675  C  CD1 . PHE A 1 81  ? 4.968   5.511   5.430   1.00 20.42  ? 80   PHE A CD1 1 
ATOM   676  C  CD2 . PHE A 1 81  ? 3.777   4.030   6.859   1.00 16.88  ? 80   PHE A CD2 1 
ATOM   677  C  CE1 . PHE A 1 81  ? 6.063   5.465   6.272   1.00 17.17  ? 80   PHE A CE1 1 
ATOM   678  C  CE2 . PHE A 1 81  ? 4.860   3.981   7.719   1.00 21.85  ? 80   PHE A CE2 1 
ATOM   679  C  CZ  . PHE A 1 81  ? 5.999   4.714   7.430   1.00 18.89  ? 80   PHE A CZ  1 
ATOM   680  N  N   . ASN A 1 82  ? 0.752   5.689   2.225   1.00 14.72  ? 81   ASN A N   1 
ATOM   681  C  CA  . ASN A 1 82  ? -0.293  5.225   1.301   1.00 19.45  ? 81   ASN A CA  1 
ATOM   682  C  C   . ASN A 1 82  ? 0.271   5.242   -0.117  1.00 15.29  ? 81   ASN A C   1 
ATOM   683  O  O   . ASN A 1 82  ? 0.068   4.302   -0.873  1.00 20.00  ? 81   ASN A O   1 
ATOM   684  C  CB  . ASN A 1 82  ? -1.547  6.075   1.476   1.00 26.89  ? 81   ASN A CB  1 
ATOM   685  C  CG  . ASN A 1 82  ? -2.535  5.400   2.417   1.00 28.56  ? 81   ASN A CG  1 
ATOM   686  O  OD1 . ASN A 1 82  ? -3.450  4.721   1.955   1.00 22.24  ? 81   ASN A OD1 1 
ATOM   687  N  ND2 . ASN A 1 82  ? -2.377  5.543   3.727   1.00 8.97   ? 81   ASN A ND2 1 
ATOM   688  N  N   . LEU A 1 83  ? 1.007   6.293   -0.450  1.00 24.28  ? 82   LEU A N   1 
ATOM   689  C  CA  . LEU A 1 83  ? 1.755   6.445   -1.686  1.00 25.85  ? 82   LEU A CA  1 
ATOM   690  C  C   . LEU A 1 83  ? 2.589   5.212   -2.018  1.00 24.49  ? 82   LEU A C   1 
ATOM   691  O  O   . LEU A 1 83  ? 2.497   4.676   -3.126  1.00 12.23  ? 82   LEU A O   1 
ATOM   692  C  CB  . LEU A 1 83  ? 2.674   7.673   -1.599  1.00 29.65  ? 82   LEU A CB  1 
ATOM   693  C  CG  . LEU A 1 83  ? 2.163   8.929   -2.307  1.00 31.65  ? 82   LEU A CG  1 
ATOM   694  C  CD1 . LEU A 1 83  ? 0.755   9.256   -1.836  1.00 33.43  ? 82   LEU A CD1 1 
ATOM   695  C  CD2 . LEU A 1 83  ? 3.096   10.111  -2.095  1.00 18.67  ? 82   LEU A CD2 1 
ATOM   696  N  N   . LEU A 1 84  ? 3.412   4.738   -1.082  1.00 22.71  ? 83   LEU A N   1 
ATOM   697  C  CA  . LEU A 1 84  ? 4.221   3.552   -1.359  1.00 21.60  ? 83   LEU A CA  1 
ATOM   698  C  C   . LEU A 1 84  ? 3.342   2.306   -1.424  1.00 24.07  ? 83   LEU A C   1 
ATOM   699  O  O   . LEU A 1 84  ? 3.587   1.380   -2.198  1.00 23.66  ? 83   LEU A O   1 
ATOM   700  C  CB  . LEU A 1 84  ? 5.315   3.324   -0.317  1.00 18.86  ? 83   LEU A CB  1 
ATOM   701  C  CG  . LEU A 1 84  ? 6.071   4.535   0.215   1.00 27.36  ? 83   LEU A CG  1 
ATOM   702  C  CD1 . LEU A 1 84  ? 7.045   4.120   1.313   1.00 25.40  ? 83   LEU A CD1 1 
ATOM   703  C  CD2 . LEU A 1 84  ? 6.813   5.266   -0.895  1.00 17.81  ? 83   LEU A CD2 1 
ATOM   704  N  N   . ALA A 1 85  ? 2.307   2.285   -0.591  1.00 27.10  ? 84   ALA A N   1 
ATOM   705  C  CA  . ALA A 1 85  ? 1.410   1.130   -0.578  1.00 28.04  ? 84   ALA A CA  1 
ATOM   706  C  C   . ALA A 1 85  ? 0.754   0.922   -1.941  1.00 16.72  ? 84   ALA A C   1 
ATOM   707  O  O   . ALA A 1 85  ? 0.529   -0.222  -2.336  1.00 22.12  ? 84   ALA A O   1 
ATOM   708  C  CB  . ALA A 1 85  ? 0.356   1.291   0.499   1.00 19.98  ? 84   ALA A CB  1 
ATOM   709  N  N   . GLN A 1 86  ? 0.465   2.025   -2.621  1.00 21.01  ? 85   GLN A N   1 
ATOM   710  C  CA  . GLN A 1 86  ? -0.189  1.950   -3.925  1.00 26.90  ? 85   GLN A CA  1 
ATOM   711  C  C   . GLN A 1 86  ? 0.654   1.167   -4.927  1.00 31.99  ? 85   GLN A C   1 
ATOM   712  O  O   . GLN A 1 86  ? 0.110   0.577   -5.860  1.00 42.25  ? 85   GLN A O   1 
ATOM   713  C  CB  . GLN A 1 86  ? -0.481  3.343   -4.472  1.00 19.81  ? 85   GLN A CB  1 
ATOM   714  C  CG  . GLN A 1 86  ? -1.246  4.248   -3.526  1.00 25.23  ? 85   GLN A CG  1 
ATOM   715  C  CD  . GLN A 1 86  ? -1.504  5.622   -4.117  1.00 32.75  ? 85   GLN A CD  1 
ATOM   716  O  OE1 . GLN A 1 86  ? -1.414  6.633   -3.418  1.00 39.66  ? 85   GLN A OE1 1 
ATOM   717  N  NE2 . GLN A 1 86  ? -1.835  5.672   -5.404  1.00 30.60  ? 85   GLN A NE2 1 
ATOM   718  N  N   . LYS A 1 87  ? 1.965   1.159   -4.735  1.00 30.28  ? 86   LYS A N   1 
ATOM   719  C  CA  . LYS A 1 87  ? 2.887   0.442   -5.608  1.00 32.06  ? 86   LYS A CA  1 
ATOM   720  C  C   . LYS A 1 87  ? 2.701   -1.065  -5.515  1.00 31.99  ? 86   LYS A C   1 
ATOM   721  O  O   . LYS A 1 87  ? 3.217   -1.831  -6.334  1.00 35.56  ? 86   LYS A O   1 
ATOM   722  C  CB  . LYS A 1 87  ? 4.334   0.811   -5.258  1.00 32.06  ? 86   LYS A CB  1 
ATOM   723  C  CG  . LYS A 1 87  ? 4.781   2.168   -5.784  1.00 28.97  ? 86   LYS A CG  1 
ATOM   724  C  CD  . LYS A 1 87  ? 4.059   3.308   -5.084  1.00 25.71  ? 86   LYS A CD  1 
ATOM   725  C  CE  . LYS A 1 87  ? 4.700   4.646   -5.405  1.00 29.99  ? 86   LYS A CE  1 
ATOM   726  N  NZ  . LYS A 1 87  ? 3.773   5.556   -6.141  1.00 42.13  ? 86   LYS A NZ  1 
ATOM   727  N  N   . LEU A 1 88  ? 1.995   -1.521  -4.478  1.00 28.00  ? 87   LEU A N   1 
ATOM   728  C  CA  . LEU A 1 88  ? 1.686   -2.917  -4.315  1.00 27.17  ? 87   LEU A CA  1 
ATOM   729  C  C   . LEU A 1 88  ? 0.216   -3.287  -4.345  1.00 21.39  ? 87   LEU A C   1 
ATOM   730  O  O   . LEU A 1 88  ? -0.102  -4.443  -4.055  1.00 18.27  ? 87   LEU A O   1 
ATOM   731  C  CB  . LEU A 1 88  ? 2.299   -3.478  -3.044  1.00 29.78  ? 87   LEU A CB  1 
ATOM   732  C  CG  . LEU A 1 88  ? 3.624   -2.923  -2.539  1.00 28.15  ? 87   LEU A CG  1 
ATOM   733  C  CD1 . LEU A 1 88  ? 3.745   -3.184  -1.043  1.00 24.63  ? 87   LEU A CD1 1 
ATOM   734  C  CD2 . LEU A 1 88  ? 4.789   -3.534  -3.307  1.00 36.04  ? 87   LEU A CD2 1 
ATOM   735  N  N   . GLU A 1 89  ? -0.610  -2.311  -4.608  1.00 22.91  ? 88   GLU A N   1 
ATOM   736  C  CA  . GLU A 1 89  ? -2.045  -2.421  -4.546  1.00 27.36  ? 88   GLU A CA  1 
ATOM   737  C  C   . GLU A 1 89  ? -2.523  -3.202  -3.313  1.00 29.94  ? 88   GLU A C   1 
ATOM   738  O  O   . GLU A 1 89  ? -3.056  -4.294  -3.472  1.00 38.07  ? 88   GLU A O   1 
ATOM   739  C  CB  . GLU A 1 89  ? -2.746  -2.923  -5.793  1.00 31.80  ? 88   GLU A CB  1 
ATOM   740  C  CG  . GLU A 1 89  ? -2.184  -4.176  -6.424  1.00 35.41  ? 88   GLU A CG  1 
ATOM   741  C  CD  . GLU A 1 89  ? -2.003  -4.050  -7.929  1.00 38.05  ? 88   GLU A CD  1 
ATOM   742  O  OE1 . GLU A 1 89  ? -1.819  -2.917  -8.425  1.00 42.64  ? 88   GLU A OE1 1 
ATOM   743  O  OE2 . GLU A 1 89  ? -2.047  -5.080  -8.631  1.00 35.25  ? 88   GLU A OE2 1 
ATOM   744  N  N   . LEU A 1 90  ? -2.173  -2.695  -2.133  1.00 35.29  ? 89   LEU A N   1 
ATOM   745  C  CA  . LEU A 1 90  ? -2.327  -3.417  -0.873  1.00 33.68  ? 89   LEU A CA  1 
ATOM   746  C  C   . LEU A 1 90  ? -3.777  -3.510  -0.417  1.00 34.44  ? 89   LEU A C   1 
ATOM   747  O  O   . LEU A 1 90  ? -4.134  -4.440  0.308   1.00 34.98  ? 89   LEU A O   1 
ATOM   748  C  CB  . LEU A 1 90  ? -1.494  -2.757  0.232   1.00 28.76  ? 89   LEU A CB  1 
ATOM   749  C  CG  . LEU A 1 90  ? -0.759  -3.685  1.195   1.00 28.86  ? 89   LEU A CG  1 
ATOM   750  C  CD1 . LEU A 1 90  ? 0.032   -2.871  2.210   1.00 33.44  ? 89   LEU A CD1 1 
ATOM   751  C  CD2 . LEU A 1 90  ? -1.718  -4.626  1.904   1.00 45.04  ? 89   LEU A CD2 1 
ATOM   752  N  N   . HIS A 1 91  ? -4.599  -2.558  -0.834  1.00 45.12  ? 90   HIS A N   1 
ATOM   753  C  CA  . HIS A 1 91  ? -6.014  -2.496  -0.503  1.00 38.16  ? 90   HIS A CA  1 
ATOM   754  C  C   . HIS A 1 91  ? -6.731  -3.783  -0.908  1.00 32.90  ? 90   HIS A C   1 
ATOM   755  O  O   . HIS A 1 91  ? -7.711  -4.205  -0.297  1.00 30.74  ? 90   HIS A O   1 
ATOM   756  C  CB  . HIS A 1 91  ? -6.658  -1.304  -1.218  1.00 38.66  ? 90   HIS A CB  1 
ATOM   757  C  CG  . HIS A 1 91  ? -6.482  -1.369  -2.707  1.00 43.06  ? 90   HIS A CG  1 
ATOM   758  N  ND1 . HIS A 1 91  ? -5.481  -0.686  -3.361  1.00 37.64  ? 90   HIS A ND1 1 
ATOM   759  C  CD2 . HIS A 1 91  ? -7.169  -2.032  -3.667  1.00 43.12  ? 90   HIS A CD2 1 
ATOM   760  C  CE1 . HIS A 1 91  ? -5.563  -0.928  -4.659  1.00 42.48  ? 90   HIS A CE1 1 
ATOM   761  N  NE2 . HIS A 1 91  ? -6.582  -1.746  -4.875  1.00 43.01  ? 90   HIS A NE2 1 
ATOM   762  N  N   . LYS A 1 92  ? -6.194  -4.362  -1.967  1.00 26.25  ? 91   LYS A N   1 
ATOM   763  C  CA  . LYS A 1 92  ? -6.669  -5.539  -2.666  1.00 27.00  ? 91   LYS A CA  1 
ATOM   764  C  C   . LYS A 1 92  ? -6.368  -6.821  -1.913  1.00 28.07  ? 91   LYS A C   1 
ATOM   765  O  O   . LYS A 1 92  ? -6.998  -7.862  -2.127  1.00 35.36  ? 91   LYS A O   1 
ATOM   766  C  CB  . LYS A 1 92  ? -6.012  -5.563  -4.054  1.00 29.14  ? 91   LYS A CB  1 
ATOM   767  C  CG  . LYS A 1 92  ? -6.285  -6.797  -4.887  1.00 30.96  ? 91   LYS A CG  1 
ATOM   768  C  CD  . LYS A 1 92  ? -5.575  -6.743  -6.230  1.00 36.87  ? 91   LYS A CD  1 
ATOM   769  C  CE  . LYS A 1 92  ? -5.311  -5.323  -6.704  1.00 34.95  ? 91   LYS A CE  1 
ATOM   770  N  NZ  . LYS A 1 92  ? -4.939  -5.290  -8.151  1.00 36.17  ? 91   LYS A NZ  1 
ATOM   771  N  N   . PHE A 1 93  ? -5.391  -6.780  -1.004  1.00 18.86  ? 92   PHE A N   1 
ATOM   772  C  CA  . PHE A 1 93  ? -5.037  -8.026  -0.322  1.00 19.94  ? 92   PHE A CA  1 
ATOM   773  C  C   . PHE A 1 93  ? -5.433  -8.032  1.144   1.00 22.89  ? 92   PHE A C   1 
ATOM   774  O  O   . PHE A 1 93  ? -5.297  -9.021  1.868   1.00 22.82  ? 92   PHE A O   1 
ATOM   775  C  CB  . PHE A 1 93  ? -3.529  -8.237  -0.463  1.00 21.18  ? 92   PHE A CB  1 
ATOM   776  C  CG  . PHE A 1 93  ? -3.050  -8.255  -1.908  1.00 12.03  ? 92   PHE A CG  1 
ATOM   777  C  CD1 . PHE A 1 93  ? -2.768  -7.069  -2.554  1.00 13.13  ? 92   PHE A CD1 1 
ATOM   778  C  CD2 . PHE A 1 93  ? -2.892  -9.457  -2.578  1.00 15.43  ? 92   PHE A CD2 1 
ATOM   779  C  CE1 . PHE A 1 93  ? -2.316  -7.078  -3.864  1.00 16.84  ? 92   PHE A CE1 1 
ATOM   780  C  CE2 . PHE A 1 93  ? -2.439  -9.474  -3.885  1.00 19.04  ? 92   PHE A CE2 1 
ATOM   781  C  CZ  . PHE A 1 93  ? -2.152  -8.279  -4.521  1.00 12.14  ? 92   PHE A CZ  1 
ATOM   782  N  N   . ILE A 1 94  ? -5.931  -6.896  1.630   1.00 20.52  ? 93   ILE A N   1 
ATOM   783  C  CA  . ILE A 1 94  ? -6.222  -6.823  3.067   1.00 22.44  ? 93   ILE A CA  1 
ATOM   784  C  C   . ILE A 1 94  ? -7.434  -7.653  3.439   1.00 26.17  ? 93   ILE A C   1 
ATOM   785  O  O   . ILE A 1 94  ? -8.437  -7.767  2.728   1.00 19.72  ? 93   ILE A O   1 
ATOM   786  C  CB  . ILE A 1 94  ? -6.356  -5.338  3.458   1.00 22.79  ? 93   ILE A CB  1 
ATOM   787  C  CG1 . ILE A 1 94  ? -5.059  -4.570  3.187   1.00 18.24  ? 93   ILE A CG1 1 
ATOM   788  C  CG2 . ILE A 1 94  ? -6.812  -5.189  4.896   1.00 12.31  ? 93   ILE A CG2 1 
ATOM   789  C  CD1 . ILE A 1 94  ? -5.167  -3.073  3.035   1.00 2.34   ? 93   ILE A CD1 1 
ATOM   790  N  N   . ARG A 1 95  ? -7.354  -8.308  4.604   1.00 22.22  ? 94   ARG A N   1 
ATOM   791  C  CA  . ARG A 1 95  ? -8.455  -9.178  5.010   1.00 20.18  ? 94   ARG A CA  1 
ATOM   792  C  C   . ARG A 1 95  ? -9.345  -8.456  6.009   1.00 27.79  ? 94   ARG A C   1 
ATOM   793  O  O   . ARG A 1 95  ? -8.941  -8.200  7.143   1.00 15.27  ? 94   ARG A O   1 
ATOM   794  C  CB  . ARG A 1 95  ? -7.925  -10.480 5.609   1.00 17.78  ? 94   ARG A CB  1 
ATOM   795  C  CG  . ARG A 1 95  ? -7.375  -11.456 4.589   1.00 17.69  ? 94   ARG A CG  1 
ATOM   796  C  CD  . ARG A 1 95  ? -7.669  -12.897 4.976   1.00 24.30  ? 94   ARG A CD  1 
ATOM   797  N  NE  . ARG A 1 95  ? -6.634  -13.421 5.846   1.00 20.50  ? 94   ARG A NE  1 
ATOM   798  C  CZ  . ARG A 1 95  ? -6.294  -14.674 6.058   1.00 20.08  ? 94   ARG A CZ  1 
ATOM   799  N  NH1 . ARG A 1 95  ? -6.910  -15.678 5.451   1.00 22.62  ? 94   ARG A NH1 1 
ATOM   800  N  NH2 . ARG A 1 95  ? -5.303  -14.935 6.906   1.00 46.21  ? 94   ARG A NH2 1 
ATOM   801  N  N   . ILE A 1 96  ? -10.570 -8.091  5.619   1.00 28.18  ? 95   ILE A N   1 
ATOM   802  C  CA  . ILE A 1 96  ? -11.362 -7.322  6.593   1.00 23.49  ? 95   ILE A CA  1 
ATOM   803  C  C   . ILE A 1 96  ? -12.821 -7.741  6.571   1.00 28.22  ? 95   ILE A C   1 
ATOM   804  O  O   . ILE A 1 96  ? -13.298 -8.389  5.638   1.00 29.72  ? 95   ILE A O   1 
ATOM   805  C  CB  . ILE A 1 96  ? -11.195 -5.813  6.329   1.00 16.58  ? 95   ILE A CB  1 
ATOM   806  C  CG1 . ILE A 1 96  ? -11.889 -4.916  7.356   1.00 9.42   ? 95   ILE A CG1 1 
ATOM   807  C  CG2 . ILE A 1 96  ? -11.616 -5.457  4.909   1.00 8.13   ? 95   ILE A CG2 1 
ATOM   808  C  CD1 . ILE A 1 96  ? -11.343 -3.510  7.431   1.00 1.45   ? 95   ILE A CD1 1 
ATOM   809  N  N   . LYS A 1 97  ? -13.565 -7.396  7.621   1.00 24.10  ? 96   LYS A N   1 
ATOM   810  C  CA  . LYS A 1 97  ? -14.956 -7.821  7.694   1.00 27.66  ? 96   LYS A CA  1 
ATOM   811  C  C   . LYS A 1 97  ? -15.911 -6.637  7.611   1.00 30.55  ? 96   LYS A C   1 
ATOM   812  O  O   . LYS A 1 97  ? -15.721 -5.720  6.818   1.00 58.83  ? 96   LYS A O   1 
ATOM   813  C  CB  . LYS A 1 97  ? -15.237 -8.578  8.997   1.00 25.22  ? 96   LYS A CB  1 
ATOM   814  C  CG  . LYS A 1 97  ? -16.169 -9.761  8.783   1.00 29.06  ? 96   LYS A CG  1 
ATOM   815  C  CD  . LYS A 1 97  ? -15.524 -11.053 9.253   1.00 37.15  ? 96   LYS A CD  1 
ATOM   816  C  CE  . LYS A 1 97  ? -14.684 -11.680 8.155   1.00 41.70  ? 96   LYS A CE  1 
ATOM   817  N  NZ  . LYS A 1 97  ? -15.418 -12.756 7.427   1.00 46.21  ? 96   LYS A NZ  1 
ATOM   818  N  N   . ARG A 1 98  ? -16.922 -6.700  8.458   1.00 33.54  ? 97   ARG A N   1 
ATOM   819  C  CA  . ARG A 1 98  ? -17.921 -5.654  8.597   1.00 31.05  ? 97   ARG A CA  1 
ATOM   820  C  C   . ARG A 1 98  ? -17.290 -4.270  8.624   1.00 21.42  ? 97   ARG A C   1 
ATOM   821  O  O   . ARG A 1 98  ? -17.032 -3.725  9.697   1.00 29.65  ? 97   ARG A O   1 
ATOM   822  C  CB  . ARG A 1 98  ? -18.732 -5.887  9.882   1.00 30.49  ? 97   ARG A CB  1 
ATOM   823  C  CG  . ARG A 1 98  ? -19.527 -7.184  9.865   1.00 35.02  ? 97   ARG A CG  1 
ATOM   824  C  CD  . ARG A 1 98  ? -18.686 -8.350  10.349  1.00 41.17  ? 97   ARG A CD  1 
ATOM   825  N  NE  . ARG A 1 98  ? -19.439 -9.592  10.466  1.00 44.83  ? 97   ARG A NE  1 
ATOM   826  C  CZ  . ARG A 1 98  ? -19.021 -10.682 11.094  1.00 47.52  ? 97   ARG A CZ  1 
ATOM   827  N  NH1 . ARG A 1 98  ? -17.832 -10.705 11.680  1.00 41.15  ? 97   ARG A NH1 1 
ATOM   828  N  NH2 . ARG A 1 98  ? -19.787 -11.765 11.138  1.00 65.43  ? 97   ARG A NH2 1 
ATOM   829  N  N   . GLY A 1 99  ? -17.037 -3.697  7.453   1.00 22.70  ? 98   GLY A N   1 
ATOM   830  C  CA  . GLY A 1 99  ? -16.437 -2.382  7.334   1.00 24.19  ? 98   GLY A CA  1 
ATOM   831  C  C   . GLY A 1 99  ? -15.505 -2.290  6.139   1.00 22.28  ? 98   GLY A C   1 
ATOM   832  O  O   . GLY A 1 99  ? -15.218 -3.299  5.500   1.00 21.77  ? 98   GLY A O   1 
ATOM   833  N  N   . LYS A 1 100 ? -15.036 -1.090  5.831   1.00 24.70  ? 99   LYS A N   1 
ATOM   834  C  CA  . LYS A 1 100 ? -14.194 -0.850  4.672   1.00 30.73  ? 99   LYS A CA  1 
ATOM   835  C  C   . LYS A 1 100 ? -12.773 -0.432  5.054   1.00 34.54  ? 99   LYS A C   1 
ATOM   836  O  O   . LYS A 1 100 ? -12.539 0.198   6.087   1.00 16.64  ? 99   LYS A O   1 
ATOM   837  C  CB  . LYS A 1 100 ? -14.788 0.245   3.777   1.00 29.42  ? 99   LYS A CB  1 
ATOM   838  C  CG  . LYS A 1 100 ? -16.311 0.289   3.791   1.00 30.70  ? 99   LYS A CG  1 
ATOM   839  C  CD  . LYS A 1 100 ? -16.801 1.160   4.941   1.00 25.88  ? 99   LYS A CD  1 
ATOM   840  C  CE  . LYS A 1 100 ? -18.293 1.415   4.846   1.00 24.47  ? 99   LYS A CE  1 
ATOM   841  N  NZ  . LYS A 1 100 ? -18.568 2.763   4.268   1.00 39.04  ? 99   LYS A NZ  1 
ATOM   842  N  N   . ILE A 1 101 ? -11.861 -0.809  4.165   1.00 26.41  ? 100  ILE A N   1 
ATOM   843  C  CA  . ILE A 1 101 ? -10.466 -0.411  4.234   1.00 30.80  ? 100  ILE A CA  1 
ATOM   844  C  C   . ILE A 1 101 ? -10.351 1.108   4.284   1.00 29.34  ? 100  ILE A C   1 
ATOM   845  O  O   . ILE A 1 101 ? -11.207 1.794   3.720   1.00 32.70  ? 100  ILE A O   1 
ATOM   846  C  CB  . ILE A 1 101 ? -9.686  -0.935  3.013   1.00 39.81  ? 100  ILE A CB  1 
ATOM   847  C  CG1 . ILE A 1 101 ? -9.715  -2.460  2.862   1.00 45.05  ? 100  ILE A CG1 1 
ATOM   848  C  CG2 . ILE A 1 101 ? -8.251  -0.436  3.018   1.00 46.57  ? 100  ILE A CG2 1 
ATOM   849  C  CD1 . ILE A 1 101 ? -9.320  -3.193  4.124   1.00 45.44  ? 100  ILE A CD1 1 
ATOM   850  N  N   . ASN A 1 102 ? -9.313  1.606   4.938   1.00 33.88  ? 101  ASN A N   1 
ATOM   851  C  CA  . ASN A 1 102 ? -8.993  3.015   5.030   1.00 36.46  ? 101  ASN A CA  1 
ATOM   852  C  C   . ASN A 1 102 ? -7.543  3.297   4.635   1.00 31.90  ? 101  ASN A C   1 
ATOM   853  O  O   . ASN A 1 102 ? -6.762  2.378   4.436   1.00 24.37  ? 101  ASN A O   1 
ATOM   854  C  CB  . ASN A 1 102 ? -9.180  3.555   6.455   1.00 36.58  ? 101  ASN A CB  1 
ATOM   855  C  CG  . ASN A 1 102 ? -10.650 3.746   6.778   1.00 44.71  ? 101  ASN A CG  1 
ATOM   856  O  OD1 . ASN A 1 102 ? -11.425 4.117   5.892   1.00 55.19  ? 101  ASN A OD1 1 
ATOM   857  N  ND2 . ASN A 1 102 ? -10.997 3.480   8.033   1.00 23.43  ? 101  ASN A ND2 1 
ATOM   858  N  N   . GLU A 1 103 ? -7.230  4.584   4.561   1.00 26.28  ? 102  GLU A N   1 
ATOM   859  C  CA  . GLU A 1 103 ? -5.849  5.010   4.382   1.00 34.17  ? 102  GLU A CA  1 
ATOM   860  C  C   . GLU A 1 103 ? -5.042  4.618   5.620   1.00 31.34  ? 102  GLU A C   1 
ATOM   861  O  O   . GLU A 1 103 ? -3.921  4.136   5.508   1.00 19.76  ? 102  GLU A O   1 
ATOM   862  C  CB  . GLU A 1 103 ? -5.751  6.513   4.157   1.00 37.33  ? 102  GLU A CB  1 
ATOM   863  C  CG  . GLU A 1 103 ? -6.824  7.090   3.251   1.00 48.24  ? 102  GLU A CG  1 
ATOM   864  C  CD  . GLU A 1 103 ? -8.126  7.381   3.975   1.00 50.71  ? 102  GLU A CD  1 
ATOM   865  O  OE1 . GLU A 1 103 ? -8.966  6.456   4.058   1.00 24.45  ? 102  GLU A OE1 1 
ATOM   866  O  OE2 . GLU A 1 103 ? -8.291  8.522   4.451   1.00 65.20  ? 102  GLU A OE2 1 
ATOM   867  N  N   . THR A 1 104 ? -5.659  4.846   6.776   1.00 29.29  ? 103  THR A N   1 
ATOM   868  C  CA  . THR A 1 104 ? -5.057  4.583   8.073   1.00 21.26  ? 103  THR A CA  1 
ATOM   869  C  C   . THR A 1 104 ? -4.710  3.100   8.221   1.00 20.65  ? 103  THR A C   1 
ATOM   870  O  O   . THR A 1 104 ? -3.576  2.783   8.586   1.00 22.45  ? 103  THR A O   1 
ATOM   871  C  CB  . THR A 1 104 ? -5.970  4.982   9.240   1.00 22.67  ? 103  THR A CB  1 
ATOM   872  O  OG1 . THR A 1 104 ? -6.287  6.379   9.165   1.00 16.97  ? 103  THR A OG1 1 
ATOM   873  C  CG2 . THR A 1 104 ? -5.258  4.771   10.569  1.00 11.59  ? 103  THR A CG2 1 
ATOM   874  N  N   . ILE A 1 105 ? -5.687  2.258   7.933   1.00 6.00   ? 104  ILE A N   1 
ATOM   875  C  CA  . ILE A 1 105 ? -5.579  0.808   7.922   1.00 9.51   ? 104  ILE A CA  1 
ATOM   876  C  C   . ILE A 1 105 ? -4.569  0.331   6.881   1.00 16.54  ? 104  ILE A C   1 
ATOM   877  O  O   . ILE A 1 105 ? -3.722  -0.530  7.138   1.00 12.19  ? 104  ILE A O   1 
ATOM   878  C  CB  . ILE A 1 105 ? -6.970  0.179   7.700   1.00 11.57  ? 104  ILE A CB  1 
ATOM   879  C  CG1 . ILE A 1 105 ? -7.933  0.418   8.875   1.00 15.79  ? 104  ILE A CG1 1 
ATOM   880  C  CG2 . ILE A 1 105 ? -6.881  -1.307  7.405   1.00 11.05  ? 104  ILE A CG2 1 
ATOM   881  C  CD1 . ILE A 1 105 ? -9.341  -0.090  8.617   1.00 9.95   ? 104  ILE A CD1 1 
ATOM   882  N  N   . ILE A 1 106 ? -4.631  0.879   5.673   1.00 20.81  ? 105  ILE A N   1 
ATOM   883  C  CA  . ILE A 1 106 ? -3.643  0.577   4.641   1.00 22.10  ? 105  ILE A CA  1 
ATOM   884  C  C   . ILE A 1 106 ? -2.246  0.946   5.136   1.00 18.87  ? 105  ILE A C   1 
ATOM   885  O  O   . ILE A 1 106 ? -1.290  0.243   4.828   1.00 17.38  ? 105  ILE A O   1 
ATOM   886  C  CB  . ILE A 1 106 ? -3.944  1.330   3.336   1.00 22.28  ? 105  ILE A CB  1 
ATOM   887  C  CG1 . ILE A 1 106 ? -5.141  0.761   2.562   1.00 16.28  ? 105  ILE A CG1 1 
ATOM   888  C  CG2 . ILE A 1 106 ? -2.719  1.413   2.436   1.00 12.61  ? 105  ILE A CG2 1 
ATOM   889  C  CD1 . ILE A 1 106 ? -5.571  1.664   1.418   1.00 23.77  ? 105  ILE A CD1 1 
ATOM   890  N  N   . GLY A 1 107 ? -2.181  2.031   5.896   1.00 20.84  ? 106  GLY A N   1 
ATOM   891  C  CA  . GLY A 1 107 ? -0.984  2.558   6.522   1.00 15.84  ? 106  GLY A CA  1 
ATOM   892  C  C   . GLY A 1 107 ? -0.409  1.632   7.576   1.00 14.56  ? 106  GLY A C   1 
ATOM   893  O  O   . GLY A 1 107 ? 0.815   1.487   7.671   1.00 18.09  ? 106  GLY A O   1 
ATOM   894  N  N   . ASP A 1 108 ? -1.280  1.000   8.351   1.00 14.84  ? 107  ASP A N   1 
ATOM   895  C  CA  . ASP A 1 108 ? -0.948  0.024   9.372   1.00 15.64  ? 107  ASP A CA  1 
ATOM   896  C  C   . ASP A 1 108 ? -0.658  -1.358  8.811   1.00 13.12  ? 107  ASP A C   1 
ATOM   897  O  O   . ASP A 1 108 ? 0.124   -2.124  9.374   1.00 10.64  ? 107  ASP A O   1 
ATOM   898  C  CB  . ASP A 1 108 ? -2.098  -0.121  10.386  1.00 14.28  ? 107  ASP A CB  1 
ATOM   899  C  CG  . ASP A 1 108 ? -2.298  1.156   11.176  1.00 16.72  ? 107  ASP A CG  1 
ATOM   900  O  OD1 . ASP A 1 108 ? -1.347  1.965   11.207  1.00 23.38  ? 107  ASP A OD1 1 
ATOM   901  O  OD2 . ASP A 1 108 ? -3.394  1.342   11.745  1.00 26.85  ? 107  ASP A OD2 1 
ATOM   902  N  N   . VAL A 1 109 ? -1.299  -1.739  7.707   1.00 20.33  ? 108  VAL A N   1 
ATOM   903  C  CA  . VAL A 1 109 ? -0.974  -3.055  7.142   1.00 13.34  ? 108  VAL A CA  1 
ATOM   904  C  C   . VAL A 1 109 ? 0.429   -2.974  6.532   1.00 9.58   ? 108  VAL A C   1 
ATOM   905  O  O   . VAL A 1 109 ? 1.209   -3.919  6.575   1.00 19.58  ? 108  VAL A O   1 
ATOM   906  C  CB  . VAL A 1 109 ? -2.005  -3.505  6.103   1.00 14.33  ? 108  VAL A CB  1 
ATOM   907  C  CG1 . VAL A 1 109 ? -1.448  -4.578  5.175   1.00 11.36  ? 108  VAL A CG1 1 
ATOM   908  C  CG2 . VAL A 1 109 ? -3.263  -4.035  6.781   1.00 14.69  ? 108  VAL A CG2 1 
ATOM   909  N  N   . PHE A 1 110 ? 0.700   -1.801  5.974   1.00 6.89   ? 109  PHE A N   1 
ATOM   910  C  CA  . PHE A 1 110 ? 1.987   -1.557  5.322   1.00 17.34  ? 109  PHE A CA  1 
ATOM   911  C  C   . PHE A 1 110 ? 3.112   -1.783  6.325   1.00 16.68  ? 109  PHE A C   1 
ATOM   912  O  O   . PHE A 1 110 ? 4.048   -2.546  6.088   1.00 14.31  ? 109  PHE A O   1 
ATOM   913  C  CB  . PHE A 1 110 ? 1.965   -0.163  4.711   1.00 4.77   ? 109  PHE A CB  1 
ATOM   914  C  CG  . PHE A 1 110 ? 3.225   0.225   3.952   1.00 18.99  ? 109  PHE A CG  1 
ATOM   915  C  CD1 . PHE A 1 110 ? 3.468   -0.262  2.674   1.00 9.09   ? 109  PHE A CD1 1 
ATOM   916  C  CD2 . PHE A 1 110 ? 4.153   1.073   4.533   1.00 16.09  ? 109  PHE A CD2 1 
ATOM   917  C  CE1 . PHE A 1 110 ? 4.615   0.100   2.001   1.00 11.08  ? 109  PHE A CE1 1 
ATOM   918  C  CE2 . PHE A 1 110 ? 5.303   1.439   3.860   1.00 22.20  ? 109  PHE A CE2 1 
ATOM   919  C  CZ  . PHE A 1 110 ? 5.532   0.951   2.585   1.00 14.88  ? 109  PHE A CZ  1 
ATOM   920  N  N   . GLU A 1 111 ? 3.048   -1.153  7.492   1.00 16.35  ? 110  GLU A N   1 
ATOM   921  C  CA  . GLU A 1 111 ? 4.025   -1.428  8.538   1.00 12.69  ? 110  GLU A CA  1 
ATOM   922  C  C   . GLU A 1 111 ? 4.038   -2.916  8.863   1.00 19.93  ? 110  GLU A C   1 
ATOM   923  O  O   . GLU A 1 111 ? 5.075   -3.514  9.157   1.00 34.52  ? 110  GLU A O   1 
ATOM   924  C  CB  . GLU A 1 111 ? 3.739   -0.608  9.794   1.00 14.99  ? 110  GLU A CB  1 
ATOM   925  C  CG  . GLU A 1 111 ? 3.643   0.891   9.574   1.00 21.72  ? 110  GLU A CG  1 
ATOM   926  C  CD  . GLU A 1 111 ? 3.029   1.661   10.726  1.00 21.00  ? 110  GLU A CD  1 
ATOM   927  O  OE1 . GLU A 1 111 ? 2.255   1.085   11.524  1.00 17.29  ? 110  GLU A OE1 1 
ATOM   928  O  OE2 . GLU A 1 111 ? 3.331   2.870   10.836  1.00 18.99  ? 110  GLU A OE2 1 
ATOM   929  N  N   . ALA A 1 112 ? 2.861   -3.542  8.812   1.00 15.93  ? 111  ALA A N   1 
ATOM   930  C  CA  . ALA A 1 112 ? 2.783   -4.945  9.215   1.00 18.68  ? 111  ALA A CA  1 
ATOM   931  C  C   . ALA A 1 112 ? 3.493   -5.856  8.223   1.00 24.48  ? 111  ALA A C   1 
ATOM   932  O  O   . ALA A 1 112 ? 4.218   -6.777  8.597   1.00 32.65  ? 111  ALA A O   1 
ATOM   933  C  CB  . ALA A 1 112 ? 1.325   -5.358  9.370   1.00 40.42  ? 111  ALA A CB  1 
ATOM   934  N  N   . LEU A 1 113 ? 3.272   -5.599  6.940   1.00 22.06  ? 112  LEU A N   1 
ATOM   935  C  CA  . LEU A 1 113 ? 3.924   -6.363  5.887   1.00 21.62  ? 112  LEU A CA  1 
ATOM   936  C  C   . LEU A 1 113 ? 5.433   -6.439  6.101   1.00 7.19   ? 112  LEU A C   1 
ATOM   937  O  O   . LEU A 1 113 ? 6.049   -7.494  6.105   1.00 12.51  ? 112  LEU A O   1 
ATOM   938  C  CB  . LEU A 1 113 ? 3.605   -5.708  4.538   1.00 24.84  ? 112  LEU A CB  1 
ATOM   939  C  CG  . LEU A 1 113 ? 3.912   -6.504  3.273   1.00 21.64  ? 112  LEU A CG  1 
ATOM   940  C  CD1 . LEU A 1 113 ? 3.687   -7.993  3.488   1.00 17.58  ? 112  LEU A CD1 1 
ATOM   941  C  CD2 . LEU A 1 113 ? 3.065   -6.014  2.106   1.00 37.07  ? 112  LEU A CD2 1 
ATOM   942  N  N   . TRP A 1 114 ? 6.046   -5.275  6.269   1.00 17.40  ? 113  TRP A N   1 
ATOM   943  C  CA  . TRP A 1 114 ? 7.495   -5.153  6.396   1.00 11.76  ? 113  TRP A CA  1 
ATOM   944  C  C   . TRP A 1 114 ? 8.042   -5.854  7.623   1.00 22.93  ? 113  TRP A C   1 
ATOM   945  O  O   . TRP A 1 114 ? 9.119   -6.469  7.561   1.00 10.44  ? 113  TRP A O   1 
ATOM   946  C  CB  . TRP A 1 114 ? 7.820   -3.647  6.346   1.00 7.51   ? 113  TRP A CB  1 
ATOM   947  C  CG  . TRP A 1 114 ? 7.722   -3.226  4.899   1.00 10.72  ? 113  TRP A CG  1 
ATOM   948  C  CD1 . TRP A 1 114 ? 6.868   -2.337  4.327   1.00 17.24  ? 113  TRP A CD1 1 
ATOM   949  C  CD2 . TRP A 1 114 ? 8.548   -3.727  3.838   1.00 13.40  ? 113  TRP A CD2 1 
ATOM   950  N  NE1 . TRP A 1 114 ? 7.106   -2.241  2.977   1.00 21.07  ? 113  TRP A NE1 1 
ATOM   951  C  CE2 . TRP A 1 114 ? 8.135   -3.086  2.652   1.00 22.25  ? 113  TRP A CE2 1 
ATOM   952  C  CE3 . TRP A 1 114 ? 9.595   -4.646  3.783   1.00 12.81  ? 113  TRP A CE3 1 
ATOM   953  C  CZ2 . TRP A 1 114 ? 8.732   -3.338  1.416   1.00 28.19  ? 113  TRP A CZ2 1 
ATOM   954  C  CZ3 . TRP A 1 114 ? 10.189  -4.898  2.558   1.00 12.21  ? 113  TRP A CZ3 1 
ATOM   955  C  CH2 . TRP A 1 114 ? 9.757   -4.247  1.395   1.00 23.21  ? 113  TRP A CH2 1 
ATOM   956  N  N   . ALA A 1 115 ? 7.303   -5.797  8.727   1.00 27.80  ? 114  ALA A N   1 
ATOM   957  C  CA  . ALA A 1 115 ? 7.618   -6.570  9.923   1.00 18.32  ? 114  ALA A CA  1 
ATOM   958  C  C   . ALA A 1 115 ? 7.539   -8.064  9.660   1.00 13.23  ? 114  ALA A C   1 
ATOM   959  O  O   . ALA A 1 115 ? 8.357   -8.857  10.134  1.00 18.41  ? 114  ALA A O   1 
ATOM   960  C  CB  . ALA A 1 115 ? 6.674   -6.190  11.057  1.00 27.09  ? 114  ALA A CB  1 
ATOM   961  N  N   . ALA A 1 116 ? 6.540   -8.523  8.891   1.00 13.83  ? 115  ALA A N   1 
ATOM   962  C  CA  . ALA A 1 116 ? 6.538   -9.964  8.608   1.00 16.36  ? 115  ALA A CA  1 
ATOM   963  C  C   . ALA A 1 116 ? 7.650   -10.310 7.619   1.00 3.64   ? 115  ALA A C   1 
ATOM   964  O  O   . ALA A 1 116 ? 8.246   -11.382 7.712   1.00 14.70  ? 115  ALA A O   1 
ATOM   965  C  CB  . ALA A 1 116 ? 5.187   -10.450 8.104   1.00 16.26  ? 115  ALA A CB  1 
ATOM   966  N  N   . VAL A 1 117 ? 7.947   -9.434  6.663   1.00 10.11  ? 116  VAL A N   1 
ATOM   967  C  CA  . VAL A 1 117 ? 9.051   -9.753  5.752   1.00 19.97  ? 116  VAL A CA  1 
ATOM   968  C  C   . VAL A 1 117 ? 10.345  -9.909  6.558   1.00 12.98  ? 116  VAL A C   1 
ATOM   969  O  O   . VAL A 1 117 ? 11.055  -10.896 6.388   1.00 17.29  ? 116  VAL A O   1 
ATOM   970  C  CB  . VAL A 1 117 ? 9.280   -8.700  4.662   1.00 19.28  ? 116  VAL A CB  1 
ATOM   971  C  CG1 . VAL A 1 117 ? 10.568  -9.025  3.914   1.00 18.66  ? 116  VAL A CG1 1 
ATOM   972  C  CG2 . VAL A 1 117 ? 8.107   -8.638  3.698   1.00 21.56  ? 116  VAL A CG2 1 
ATOM   973  N  N   . TYR A 1 118 ? 10.584  -8.934  7.423   1.00 16.57  ? 117  TYR A N   1 
ATOM   974  C  CA  . TYR A 1 118 ? 11.709  -8.938  8.358   1.00 9.01   ? 117  TYR A CA  1 
ATOM   975  C  C   . TYR A 1 118 ? 11.782  -10.296 9.037   1.00 11.68  ? 117  TYR A C   1 
ATOM   976  O  O   . TYR A 1 118 ? 12.779  -11.012 8.926   1.00 19.84  ? 117  TYR A O   1 
ATOM   977  C  CB  . TYR A 1 118 ? 11.568  -7.805  9.365   1.00 16.48  ? 117  TYR A CB  1 
ATOM   978  C  CG  . TYR A 1 118 ? 12.581  -7.749  10.480  1.00 23.74  ? 117  TYR A CG  1 
ATOM   979  C  CD1 . TYR A 1 118 ? 13.947  -7.789  10.214  1.00 28.35  ? 117  TYR A CD1 1 
ATOM   980  C  CD2 . TYR A 1 118 ? 12.198  -7.653  11.812  1.00 19.49  ? 117  TYR A CD2 1 
ATOM   981  C  CE1 . TYR A 1 118 ? 14.880  -7.736  11.231  1.00 21.05  ? 117  TYR A CE1 1 
ATOM   982  C  CE2 . TYR A 1 118 ? 13.127  -7.602  12.836  1.00 19.62  ? 117  TYR A CE2 1 
ATOM   983  C  CZ  . TYR A 1 118 ? 14.475  -7.644  12.542  1.00 22.80  ? 117  TYR A CZ  1 
ATOM   984  O  OH  . TYR A 1 118 ? 15.426  -7.596  13.537  1.00 28.86  ? 117  TYR A OH  1 
ATOM   985  N  N   . ILE A 1 119 ? 10.702  -10.649 9.728   1.00 16.35  ? 118  ILE A N   1 
ATOM   986  C  CA  . ILE A 1 119 ? 10.631  -11.919 10.444  1.00 24.56  ? 118  ILE A CA  1 
ATOM   987  C  C   . ILE A 1 119 ? 10.715  -13.136 9.535   1.00 23.21  ? 118  ILE A C   1 
ATOM   988  O  O   . ILE A 1 119 ? 11.471  -14.086 9.777   1.00 21.77  ? 118  ILE A O   1 
ATOM   989  C  CB  . ILE A 1 119 ? 9.326   -12.014 11.268  1.00 27.63  ? 118  ILE A CB  1 
ATOM   990  C  CG1 . ILE A 1 119 ? 9.130   -10.873 12.271  1.00 32.44  ? 118  ILE A CG1 1 
ATOM   991  C  CG2 . ILE A 1 119 ? 9.239   -13.361 11.970  1.00 21.56  ? 118  ILE A CG2 1 
ATOM   992  C  CD1 . ILE A 1 119 ? 7.843   -10.976 13.062  1.00 45.56  ? 118  ILE A CD1 1 
ATOM   993  N  N   . ASP A 1 120 ? 9.927   -13.162 8.459   1.00 22.88  ? 119  ASP A N   1 
ATOM   994  C  CA  . ASP A 1 120 ? 9.920   -14.353 7.622   1.00 16.04  ? 119  ASP A CA  1 
ATOM   995  C  C   . ASP A 1 120 ? 11.302  -14.679 7.047   1.00 14.80  ? 119  ASP A C   1 
ATOM   996  O  O   . ASP A 1 120 ? 11.591  -15.842 6.771   1.00 12.91  ? 119  ASP A O   1 
ATOM   997  C  CB  . ASP A 1 120 ? 8.929   -14.221 6.454   1.00 5.81   ? 119  ASP A CB  1 
ATOM   998  C  CG  . ASP A 1 120 ? 8.881   -15.561 5.730   1.00 4.59   ? 119  ASP A CG  1 
ATOM   999  O  OD1 . ASP A 1 120 ? 8.125   -16.454 6.168   1.00 20.31  ? 119  ASP A OD1 1 
ATOM   1000 O  OD2 . ASP A 1 120 ? 9.620   -15.717 4.739   1.00 22.53  ? 119  ASP A OD2 1 
ATOM   1001 N  N   . SER A 1 121 ? 12.106  -13.649 6.876   1.00 19.61  ? 120  SER A N   1 
ATOM   1002 C  CA  . SER A 1 121 ? 13.447  -13.711 6.322   1.00 18.09  ? 120  SER A CA  1 
ATOM   1003 C  C   . SER A 1 121 ? 14.484  -14.041 7.395   1.00 27.33  ? 120  SER A C   1 
ATOM   1004 O  O   . SER A 1 121 ? 15.680  -13.946 7.118   1.00 17.37  ? 120  SER A O   1 
ATOM   1005 C  CB  . SER A 1 121 ? 13.815  -12.385 5.669   1.00 7.50   ? 120  SER A CB  1 
ATOM   1006 O  OG  . SER A 1 121 ? 14.114  -11.382 6.627   1.00 16.47  ? 120  SER A OG  1 
ATOM   1007 N  N   . GLY A 1 122 ? 13.971  -14.411 8.560   1.00 27.34  ? 121  GLY A N   1 
ATOM   1008 C  CA  . GLY A 1 122 ? 14.749  -14.745 9.734   1.00 14.03  ? 121  GLY A CA  1 
ATOM   1009 C  C   . GLY A 1 122 ? 15.326  -13.506 10.402  1.00 24.64  ? 121  GLY A C   1 
ATOM   1010 O  O   . GLY A 1 122 ? 16.526  -13.467 10.688  1.00 27.25  ? 121  GLY A O   1 
ATOM   1011 N  N   . ARG A 1 123 ? 14.462  -12.507 10.582  1.00 11.09  ? 122  ARG A N   1 
ATOM   1012 C  CA  . ARG A 1 123 ? 14.871  -11.278 11.214  1.00 12.62  ? 122  ARG A CA  1 
ATOM   1013 C  C   . ARG A 1 123 ? 16.089  -10.668 10.557  1.00 20.27  ? 122  ARG A C   1 
ATOM   1014 O  O   . ARG A 1 123 ? 17.057  -10.357 11.248  1.00 24.96  ? 122  ARG A O   1 
ATOM   1015 C  CB  . ARG A 1 123 ? 14.990  -11.380 12.725  1.00 19.06  ? 122  ARG A CB  1 
ATOM   1016 C  CG  . ARG A 1 123 ? 13.667  -11.577 13.451  1.00 20.49  ? 122  ARG A CG  1 
ATOM   1017 C  CD  . ARG A 1 123 ? 13.772  -11.348 14.947  1.00 24.49  ? 122  ARG A CD  1 
ATOM   1018 N  NE  . ARG A 1 123 ? 12.665  -10.538 15.458  1.00 28.98  ? 122  ARG A NE  1 
ATOM   1019 C  CZ  . ARG A 1 123 ? 11.499  -11.021 15.874  1.00 32.33  ? 122  ARG A CZ  1 
ATOM   1020 N  NH1 . ARG A 1 123 ? 11.259  -12.323 15.851  1.00 14.35  ? 122  ARG A NH1 1 
ATOM   1021 N  NH2 . ARG A 1 123 ? 10.547  -10.212 16.323  1.00 36.26  ? 122  ARG A NH2 1 
ATOM   1022 N  N   . ASP A 1 124 ? 16.106  -10.661 9.227   1.00 20.98  ? 123  ASP A N   1 
ATOM   1023 C  CA  . ASP A 1 124 ? 17.189  -10.124 8.417   1.00 10.85  ? 123  ASP A CA  1 
ATOM   1024 C  C   . ASP A 1 124 ? 16.926  -8.669  8.058   1.00 7.07   ? 123  ASP A C   1 
ATOM   1025 O  O   . ASP A 1 124 ? 16.307  -8.372  7.041   1.00 20.99  ? 123  ASP A O   1 
ATOM   1026 C  CB  . ASP A 1 124 ? 17.381  -10.931 7.129   1.00 10.94  ? 123  ASP A CB  1 
ATOM   1027 C  CG  . ASP A 1 124 ? 18.702  -10.624 6.448   1.00 11.35  ? 123  ASP A CG  1 
ATOM   1028 O  OD1 . ASP A 1 124 ? 19.286  -9.571  6.761   1.00 13.23  ? 123  ASP A OD1 1 
ATOM   1029 O  OD2 . ASP A 1 124 ? 19.169  -11.425 5.607   1.00 15.04  ? 123  ASP A OD2 1 
ATOM   1030 N  N   . ALA A 1 125 ? 17.419  -7.764  8.897   1.00 12.44  ? 124  ALA A N   1 
ATOM   1031 C  CA  . ALA A 1 125 ? 17.198  -6.341  8.706   1.00 12.19  ? 124  ALA A CA  1 
ATOM   1032 C  C   . ALA A 1 125 ? 17.940  -5.760  7.511   1.00 15.97  ? 124  ALA A C   1 
ATOM   1033 O  O   . ALA A 1 125 ? 17.478  -4.736  6.983   1.00 17.88  ? 124  ALA A O   1 
ATOM   1034 C  CB  . ALA A 1 125 ? 17.579  -5.595  9.980   1.00 17.80  ? 124  ALA A CB  1 
ATOM   1035 N  N   . ASN A 1 126 ? 19.053  -6.345  7.071   1.00 14.67  ? 125  ASN A N   1 
ATOM   1036 C  CA  . ASN A 1 126 ? 19.797  -5.774  5.947   1.00 16.34  ? 125  ASN A CA  1 
ATOM   1037 C  C   . ASN A 1 126 ? 19.119  -6.113  4.615   1.00 16.58  ? 125  ASN A C   1 
ATOM   1038 O  O   . ASN A 1 126 ? 19.038  -5.267  3.728   1.00 24.70  ? 125  ASN A O   1 
ATOM   1039 C  CB  . ASN A 1 126 ? 21.242  -6.258  5.890   1.00 20.76  ? 125  ASN A CB  1 
ATOM   1040 C  CG  . ASN A 1 126 ? 22.108  -5.965  7.091   1.00 25.67  ? 125  ASN A CG  1 
ATOM   1041 O  OD1 . ASN A 1 126 ? 21.945  -4.965  7.792   1.00 37.27  ? 125  ASN A OD1 1 
ATOM   1042 N  ND2 . ASN A 1 126 ? 23.068  -6.860  7.347   1.00 9.89   ? 125  ASN A ND2 1 
ATOM   1043 N  N   . PHE A 1 127 ? 18.647  -7.344  4.471   1.00 12.41  ? 126  PHE A N   1 
ATOM   1044 C  CA  . PHE A 1 127 ? 17.932  -7.768  3.278   1.00 17.79  ? 126  PHE A CA  1 
ATOM   1045 C  C   . PHE A 1 127 ? 16.611  -7.017  3.160   1.00 19.29  ? 126  PHE A C   1 
ATOM   1046 O  O   . PHE A 1 127 ? 16.223  -6.513  2.110   1.00 27.28  ? 126  PHE A O   1 
ATOM   1047 C  CB  . PHE A 1 127 ? 17.629  -9.271  3.305   1.00 23.42  ? 126  PHE A CB  1 
ATOM   1048 C  CG  . PHE A 1 127 ? 16.774  -9.743  2.135   1.00 24.12  ? 126  PHE A CG  1 
ATOM   1049 C  CD1 . PHE A 1 127 ? 17.375  -10.004 0.911   1.00 27.31  ? 126  PHE A CD1 1 
ATOM   1050 C  CD2 . PHE A 1 127 ? 15.406  -9.933  2.246   1.00 17.78  ? 126  PHE A CD2 1 
ATOM   1051 C  CE1 . PHE A 1 127 ? 16.633  -10.430 -0.175  1.00 25.88  ? 126  PHE A CE1 1 
ATOM   1052 C  CE2 . PHE A 1 127 ? 14.649  -10.344 1.164   1.00 17.58  ? 126  PHE A CE2 1 
ATOM   1053 C  CZ  . PHE A 1 127 ? 15.264  -10.595 -0.049  1.00 23.49  ? 126  PHE A CZ  1 
ATOM   1054 N  N   . THR A 1 128 ? 15.914  -7.003  4.298   1.00 15.81  ? 127  THR A N   1 
ATOM   1055 C  CA  . THR A 1 128 ? 14.598  -6.374  4.332   1.00 12.02  ? 127  THR A CA  1 
ATOM   1056 C  C   . THR A 1 128 ? 14.687  -4.920  3.887   1.00 8.30   ? 127  THR A C   1 
ATOM   1057 O  O   . THR A 1 128 ? 13.884  -4.461  3.071   1.00 9.32   ? 127  THR A O   1 
ATOM   1058 C  CB  . THR A 1 128 ? 13.974  -6.488  5.739   1.00 8.05   ? 127  THR A CB  1 
ATOM   1059 O  OG1 . THR A 1 128 ? 13.823  -7.874  6.099   1.00 2.23   ? 127  THR A OG1 1 
ATOM   1060 C  CG2 . THR A 1 128 ? 12.586  -5.867  5.728   1.00 3.23   ? 127  THR A CG2 1 
ATOM   1061 N  N   . ARG A 1 129 ? 15.649  -4.183  4.420   1.00 5.93   ? 128  ARG A N   1 
ATOM   1062 C  CA  . ARG A 1 129 ? 15.932  -2.802  4.088   1.00 10.13  ? 128  ARG A CA  1 
ATOM   1063 C  C   . ARG A 1 129 ? 16.238  -2.621  2.605   1.00 7.66   ? 128  ARG A C   1 
ATOM   1064 O  O   . ARG A 1 129 ? 15.860  -1.640  1.968   1.00 14.82  ? 128  ARG A O   1 
ATOM   1065 C  CB  . ARG A 1 129 ? 17.142  -2.292  4.887   1.00 16.35  ? 128  ARG A CB  1 
ATOM   1066 C  CG  . ARG A 1 129 ? 17.545  -0.860  4.574   1.00 12.33  ? 128  ARG A CG  1 
ATOM   1067 C  CD  . ARG A 1 129 ? 18.853  -0.482  5.255   1.00 23.28  ? 128  ARG A CD  1 
ATOM   1068 N  NE  . ARG A 1 129 ? 20.004  -1.024  4.533   1.00 29.70  ? 128  ARG A NE  1 
ATOM   1069 C  CZ  . ARG A 1 129 ? 21.070  -1.588  5.079   1.00 31.25  ? 128  ARG A CZ  1 
ATOM   1070 N  NH1 . ARG A 1 129 ? 21.167  -1.699  6.397   1.00 19.53  ? 128  ARG A NH1 1 
ATOM   1071 N  NH2 . ARG A 1 129 ? 22.053  -2.047  4.315   1.00 33.96  ? 128  ARG A NH2 1 
ATOM   1072 N  N   . GLU A 1 130 ? 16.949  -3.589  2.031   1.00 15.72  ? 129  GLU A N   1 
ATOM   1073 C  CA  . GLU A 1 130 ? 17.294  -3.486  0.614   1.00 18.43  ? 129  GLU A CA  1 
ATOM   1074 C  C   . GLU A 1 130 ? 16.056  -3.750  -0.244  1.00 25.91  ? 129  GLU A C   1 
ATOM   1075 O  O   . GLU A 1 130 ? 15.830  -3.043  -1.225  1.00 29.16  ? 129  GLU A O   1 
ATOM   1076 C  CB  . GLU A 1 130 ? 18.424  -4.451  0.265   1.00 12.11  ? 129  GLU A CB  1 
ATOM   1077 C  CG  . GLU A 1 130 ? 19.786  -4.013  0.783   1.00 12.38  ? 129  GLU A CG  1 
ATOM   1078 C  CD  . GLU A 1 130 ? 19.951  -2.506  0.677   1.00 22.56  ? 129  GLU A CD  1 
ATOM   1079 O  OE1 . GLU A 1 130 ? 20.219  -2.009  -0.437  1.00 37.95  ? 129  GLU A OE1 1 
ATOM   1080 O  OE2 . GLU A 1 130 ? 19.802  -1.820  1.707   1.00 41.86  ? 129  GLU A OE2 1 
ATOM   1081 N  N   . LEU A 1 131 ? 15.281  -4.761  0.140   1.00 29.79  ? 130  LEU A N   1 
ATOM   1082 C  CA  . LEU A 1 131 ? 14.007  -5.061  -0.510  1.00 23.39  ? 130  LEU A CA  1 
ATOM   1083 C  C   . LEU A 1 131 ? 13.195  -3.765  -0.621  1.00 24.44  ? 130  LEU A C   1 
ATOM   1084 O  O   . LEU A 1 131 ? 12.687  -3.444  -1.691  1.00 24.17  ? 130  LEU A O   1 
ATOM   1085 C  CB  . LEU A 1 131 ? 13.209  -6.098  0.267   1.00 20.27  ? 130  LEU A CB  1 
ATOM   1086 C  CG  . LEU A 1 131 ? 12.788  -7.388  -0.429  1.00 31.71  ? 130  LEU A CG  1 
ATOM   1087 C  CD1 . LEU A 1 131 ? 11.413  -7.836  0.061   1.00 26.26  ? 130  LEU A CD1 1 
ATOM   1088 C  CD2 . LEU A 1 131 ? 12.798  -7.236  -1.944  1.00 25.06  ? 130  LEU A CD2 1 
ATOM   1089 N  N   . PHE A 1 132 ? 13.129  -3.081  0.509   1.00 24.97  ? 131  PHE A N   1 
ATOM   1090 C  CA  . PHE A 1 132 ? 12.483  -1.811  0.755   1.00 13.38  ? 131  PHE A CA  1 
ATOM   1091 C  C   . PHE A 1 132 ? 13.024  -0.693  -0.130  1.00 16.83  ? 131  PHE A C   1 
ATOM   1092 O  O   . PHE A 1 132 ? 12.251  0.138   -0.602  1.00 9.00   ? 131  PHE A O   1 
ATOM   1093 C  CB  . PHE A 1 132 ? 12.674  -1.386  2.221   1.00 12.90  ? 131  PHE A CB  1 
ATOM   1094 C  CG  . PHE A 1 132 ? 11.690  -0.308  2.647   1.00 16.61  ? 131  PHE A CG  1 
ATOM   1095 C  CD1 . PHE A 1 132 ? 10.356  -0.617  2.838   1.00 14.44  ? 131  PHE A CD1 1 
ATOM   1096 C  CD2 . PHE A 1 132 ? 12.108  0.994   2.854   1.00 27.94  ? 131  PHE A CD2 1 
ATOM   1097 C  CE1 . PHE A 1 132 ? 9.451   0.351   3.229   1.00 20.23  ? 131  PHE A CE1 1 
ATOM   1098 C  CE2 . PHE A 1 132 ? 11.209  1.972   3.241   1.00 23.47  ? 131  PHE A CE2 1 
ATOM   1099 C  CZ  . PHE A 1 132 ? 9.879   1.648   3.427   1.00 22.99  ? 131  PHE A CZ  1 
ATOM   1100 N  N   . TYR A 1 133 ? 14.340  -0.671  -0.344  1.00 13.21  ? 132  TYR A N   1 
ATOM   1101 C  CA  . TYR A 1 133 ? 14.957  0.360   -1.168  1.00 13.91  ? 132  TYR A CA  1 
ATOM   1102 C  C   . TYR A 1 133 ? 14.741  0.061   -2.650  1.00 10.79  ? 132  TYR A C   1 
ATOM   1103 O  O   . TYR A 1 133 ? 14.536  0.990   -3.431  1.00 24.23  ? 132  TYR A O   1 
ATOM   1104 C  CB  . TYR A 1 133 ? 16.449  0.494   -0.876  1.00 19.45  ? 132  TYR A CB  1 
ATOM   1105 C  CG  . TYR A 1 133 ? 16.755  1.076   0.484   1.00 22.46  ? 132  TYR A CG  1 
ATOM   1106 C  CD1 . TYR A 1 133 ? 15.742  1.642   1.249   1.00 33.21  ? 132  TYR A CD1 1 
ATOM   1107 C  CD2 . TYR A 1 133 ? 18.038  1.061   1.001   1.00 27.46  ? 132  TYR A CD2 1 
ATOM   1108 C  CE1 . TYR A 1 133 ? 15.998  2.179   2.495   1.00 34.62  ? 132  TYR A CE1 1 
ATOM   1109 C  CE2 . TYR A 1 133 ? 18.309  1.595   2.246   1.00 35.52  ? 132  TYR A CE2 1 
ATOM   1110 C  CZ  . TYR A 1 133 ? 17.286  2.151   2.985   1.00 33.91  ? 132  TYR A CZ  1 
ATOM   1111 O  OH  . TYR A 1 133 ? 17.551  2.683   4.224   1.00 19.24  ? 132  TYR A OH  1 
ATOM   1112 N  N   . LYS A 1 134 ? 14.795  -1.214  -3.007  1.00 11.46  ? 133  LYS A N   1 
ATOM   1113 C  CA  . LYS A 1 134 ? 14.525  -1.623  -4.386  1.00 15.87  ? 133  LYS A CA  1 
ATOM   1114 C  C   . LYS A 1 134 ? 13.185  -1.023  -4.814  1.00 20.59  ? 133  LYS A C   1 
ATOM   1115 O  O   . LYS A 1 134 ? 13.064  -0.345  -5.828  1.00 22.49  ? 133  LYS A O   1 
ATOM   1116 C  CB  . LYS A 1 134 ? 14.505  -3.137  -4.521  1.00 20.39  ? 133  LYS A CB  1 
ATOM   1117 C  CG  . LYS A 1 134 ? 15.853  -3.800  -4.722  1.00 31.03  ? 133  LYS A CG  1 
ATOM   1118 C  CD  . LYS A 1 134 ? 16.466  -3.413  -6.062  1.00 37.84  ? 133  LYS A CD  1 
ATOM   1119 C  CE  . LYS A 1 134 ? 17.701  -4.243  -6.369  1.00 38.30  ? 133  LYS A CE  1 
ATOM   1120 N  NZ  . LYS A 1 134 ? 18.576  -3.580  -7.375  1.00 31.62  ? 133  LYS A NZ  1 
ATOM   1121 N  N   . LEU A 1 135 ? 12.184  -1.271  -3.975  1.00 18.40  ? 134  LEU A N   1 
ATOM   1122 C  CA  . LEU A 1 135 ? 10.832  -0.800  -4.189  1.00 10.59  ? 134  LEU A CA  1 
ATOM   1123 C  C   . LEU A 1 135 ? 10.661  0.699   -4.046  1.00 14.64  ? 134  LEU A C   1 
ATOM   1124 O  O   . LEU A 1 135 ? 10.018  1.356   -4.868  1.00 27.71  ? 134  LEU A O   1 
ATOM   1125 C  CB  . LEU A 1 135 ? 9.902   -1.487  -3.168  1.00 12.57  ? 134  LEU A CB  1 
ATOM   1126 C  CG  . LEU A 1 135 ? 9.754   -2.997  -3.372  1.00 14.82  ? 134  LEU A CG  1 
ATOM   1127 C  CD1 . LEU A 1 135 ? 9.181   -3.644  -2.130  1.00 13.30  ? 134  LEU A CD1 1 
ATOM   1128 C  CD2 . LEU A 1 135 ? 8.899   -3.258  -4.604  1.00 22.21  ? 134  LEU A CD2 1 
ATOM   1129 N  N   . PHE A 1 136 ? 11.207  1.281   -2.980  1.00 16.93  ? 135  PHE A N   1 
ATOM   1130 C  CA  . PHE A 1 136 ? 10.802  2.644   -2.654  1.00 16.03  ? 135  PHE A CA  1 
ATOM   1131 C  C   . PHE A 1 136 ? 11.915  3.659   -2.584  1.00 15.06  ? 135  PHE A C   1 
ATOM   1132 O  O   . PHE A 1 136 ? 11.646  4.842   -2.356  1.00 16.26  ? 135  PHE A O   1 
ATOM   1133 C  CB  . PHE A 1 136 ? 10.075  2.591   -1.285  1.00 18.02  ? 135  PHE A CB  1 
ATOM   1134 C  CG  . PHE A 1 136 ? 8.991   1.521   -1.291  1.00 19.95  ? 135  PHE A CG  1 
ATOM   1135 C  CD1 . PHE A 1 136 ? 8.008   1.528   -2.267  1.00 16.11  ? 135  PHE A CD1 1 
ATOM   1136 C  CD2 . PHE A 1 136 ? 8.975   0.525   -0.328  1.00 20.07  ? 135  PHE A CD2 1 
ATOM   1137 C  CE1 . PHE A 1 136 ? 7.026   0.551   -2.278  1.00 14.66  ? 135  PHE A CE1 1 
ATOM   1138 C  CE2 . PHE A 1 136 ? 8.002   -0.454  -0.333  1.00 22.47  ? 135  PHE A CE2 1 
ATOM   1139 C  CZ  . PHE A 1 136 ? 7.025   -0.440  -1.318  1.00 17.42  ? 135  PHE A CZ  1 
ATOM   1140 N  N   . LYS A 1 137 ? 13.172  3.257   -2.769  1.00 20.32  ? 136  LYS A N   1 
ATOM   1141 C  CA  . LYS A 1 137 ? 14.233  4.259   -2.605  1.00 20.19  ? 136  LYS A CA  1 
ATOM   1142 C  C   . LYS A 1 137 ? 14.071  5.370   -3.632  1.00 19.46  ? 136  LYS A C   1 
ATOM   1143 O  O   . LYS A 1 137 ? 14.433  6.525   -3.410  1.00 23.44  ? 136  LYS A O   1 
ATOM   1144 C  CB  . LYS A 1 137 ? 15.607  3.594   -2.682  1.00 16.80  ? 136  LYS A CB  1 
ATOM   1145 C  CG  . LYS A 1 137 ? 16.745  4.578   -2.891  1.00 16.04  ? 136  LYS A CG  1 
ATOM   1146 C  CD  . LYS A 1 137 ? 18.037  4.076   -2.260  1.00 17.82  ? 136  LYS A CD  1 
ATOM   1147 C  CE  . LYS A 1 137 ? 19.134  5.124   -2.411  1.00 23.08  ? 136  LYS A CE  1 
ATOM   1148 N  NZ  . LYS A 1 137 ? 20.342  4.544   -3.077  1.00 21.93  ? 136  LYS A NZ  1 
ATOM   1149 N  N   . GLU A 1 138 ? 13.473  5.008   -4.763  1.00 23.33  ? 137  GLU A N   1 
ATOM   1150 C  CA  . GLU A 1 138 ? 13.232  5.976   -5.827  1.00 32.24  ? 137  GLU A CA  1 
ATOM   1151 C  C   . GLU A 1 138 ? 12.262  7.078   -5.433  1.00 31.56  ? 137  GLU A C   1 
ATOM   1152 O  O   . GLU A 1 138 ? 12.485  8.265   -5.689  1.00 23.23  ? 137  GLU A O   1 
ATOM   1153 C  CB  . GLU A 1 138 ? 12.687  5.241   -7.057  1.00 31.70  ? 137  GLU A CB  1 
ATOM   1154 C  CG  . GLU A 1 138 ? 12.758  6.060   -8.340  1.00 30.60  ? 137  GLU A CG  1 
ATOM   1155 C  CD  . GLU A 1 138 ? 13.455  5.270   -9.433  1.00 27.92  ? 137  GLU A CD  1 
ATOM   1156 O  OE1 . GLU A 1 138 ? 14.619  4.876   -9.214  1.00 29.46  ? 137  GLU A OE1 1 
ATOM   1157 O  OE2 . GLU A 1 138 ? 12.828  5.047   -10.486 1.00 43.14  ? 137  GLU A OE2 1 
ATOM   1158 N  N   . ASP A 1 139 ? 11.141  6.704   -4.809  1.00 25.04  ? 138  ASP A N   1 
ATOM   1159 C  CA  . ASP A 1 139 ? 10.167  7.751   -4.485  1.00 27.40  ? 138  ASP A CA  1 
ATOM   1160 C  C   . ASP A 1 139 ? 10.675  8.611   -3.335  1.00 26.23  ? 138  ASP A C   1 
ATOM   1161 O  O   . ASP A 1 139 ? 10.590  9.834   -3.345  1.00 43.55  ? 138  ASP A O   1 
ATOM   1162 C  CB  . ASP A 1 139 ? 8.804   7.149   -4.137  1.00 25.64  ? 138  ASP A CB  1 
ATOM   1163 C  CG  . ASP A 1 139 ? 7.919   6.963   -5.355  1.00 27.42  ? 138  ASP A CG  1 
ATOM   1164 O  OD1 . ASP A 1 139 ? 7.478   7.967   -5.957  1.00 32.04  ? 138  ASP A OD1 1 
ATOM   1165 O  OD2 . ASP A 1 139 ? 7.657   5.796   -5.717  1.00 17.52  ? 138  ASP A OD2 1 
ATOM   1166 N  N   . ILE A 1 140 ? 11.208  7.927   -2.326  1.00 28.69  ? 139  ILE A N   1 
ATOM   1167 C  CA  . ILE A 1 140 ? 11.694  8.600   -1.129  1.00 24.16  ? 139  ILE A CA  1 
ATOM   1168 C  C   . ILE A 1 140 ? 12.714  9.669   -1.492  1.00 25.70  ? 139  ILE A C   1 
ATOM   1169 O  O   . ILE A 1 140 ? 12.731  10.748  -0.901  1.00 23.04  ? 139  ILE A O   1 
ATOM   1170 C  CB  . ILE A 1 140 ? 12.280  7.566   -0.150  1.00 19.85  ? 139  ILE A CB  1 
ATOM   1171 C  CG1 . ILE A 1 140 ? 11.209  6.827   0.656   1.00 21.29  ? 139  ILE A CG1 1 
ATOM   1172 C  CG2 . ILE A 1 140 ? 13.304  8.211   0.763   1.00 17.31  ? 139  ILE A CG2 1 
ATOM   1173 C  CD1 . ILE A 1 140 ? 11.738  5.743   1.566   1.00 11.92  ? 139  ILE A CD1 1 
ATOM   1174 N  N   . LEU A 1 141 ? 13.547  9.364   -2.478  1.00 27.49  ? 140  LEU A N   1 
ATOM   1175 C  CA  . LEU A 1 141 ? 14.596  10.251  -2.948  1.00 30.60  ? 140  LEU A CA  1 
ATOM   1176 C  C   . LEU A 1 141 ? 14.045  11.427  -3.737  1.00 31.42  ? 140  LEU A C   1 
ATOM   1177 O  O   . LEU A 1 141 ? 14.516  12.562  -3.663  1.00 26.38  ? 140  LEU A O   1 
ATOM   1178 C  CB  . LEU A 1 141 ? 15.589  9.469   -3.825  1.00 33.54  ? 140  LEU A CB  1 
ATOM   1179 C  CG  . LEU A 1 141 ? 16.947  9.224   -3.158  1.00 37.16  ? 140  LEU A CG  1 
ATOM   1180 C  CD1 . LEU A 1 141 ? 17.846  8.365   -4.030  1.00 41.90  ? 140  LEU A CD1 1 
ATOM   1181 C  CD2 . LEU A 1 141 ? 17.608  10.556  -2.835  1.00 37.78  ? 140  LEU A CD2 1 
ATOM   1182 N  N   . SER A 1 142 ? 13.013  11.134  -4.525  1.00 30.59  ? 141  SER A N   1 
ATOM   1183 C  CA  . SER A 1 142 ? 12.363  12.208  -5.271  1.00 26.98  ? 141  SER A CA  1 
ATOM   1184 C  C   . SER A 1 142 ? 11.627  13.108  -4.284  1.00 30.35  ? 141  SER A C   1 
ATOM   1185 O  O   . SER A 1 142 ? 11.559  14.322  -4.447  1.00 25.77  ? 141  SER A O   1 
ATOM   1186 C  CB  . SER A 1 142 ? 11.407  11.640  -6.314  1.00 28.77  ? 141  SER A CB  1 
ATOM   1187 O  OG  . SER A 1 142 ? 10.069  11.673  -5.840  1.00 38.82  ? 141  SER A OG  1 
ATOM   1188 N  N   . ALA A 1 143 ? 11.083  12.470  -3.248  1.00 29.83  ? 142  ALA A N   1 
ATOM   1189 C  CA  . ALA A 1 143 ? 10.362  13.188  -2.205  1.00 38.03  ? 142  ALA A CA  1 
ATOM   1190 C  C   . ALA A 1 143 ? 11.199  14.318  -1.609  1.00 41.60  ? 142  ALA A C   1 
ATOM   1191 O  O   . ALA A 1 143 ? 10.822  15.488  -1.712  1.00 33.75  ? 142  ALA A O   1 
ATOM   1192 C  CB  . ALA A 1 143 ? 9.924   12.224  -1.110  1.00 37.45  ? 142  ALA A CB  1 
ATOM   1193 N  N   . ILE A 1 144 ? 12.313  13.941  -0.996  1.00 42.56  ? 143  ILE A N   1 
ATOM   1194 C  CA  . ILE A 1 144 ? 13.209  14.840  -0.285  1.00 37.91  ? 143  ILE A CA  1 
ATOM   1195 C  C   . ILE A 1 144 ? 13.461  16.144  -1.031  1.00 45.33  ? 143  ILE A C   1 
ATOM   1196 O  O   . ILE A 1 144 ? 13.513  17.210  -0.407  1.00 66.57  ? 143  ILE A O   1 
ATOM   1197 C  CB  . ILE A 1 144 ? 14.574  14.179  0.005   1.00 22.68  ? 143  ILE A CB  1 
ATOM   1198 C  CG1 . ILE A 1 144 ? 14.585  12.655  -0.030  1.00 16.26  ? 143  ILE A CG1 1 
ATOM   1199 C  CG2 . ILE A 1 144 ? 15.118  14.667  1.340   1.00 29.12  ? 143  ILE A CG2 1 
ATOM   1200 C  CD1 . ILE A 1 144 ? 15.212  12.029  1.199   1.00 17.24  ? 143  ILE A CD1 1 
ATOM   1201 N  N   . LYS A 1 145 ? 13.624  16.121  -2.350  1.00 49.30  ? 144  LYS A N   1 
ATOM   1202 C  CA  . LYS A 1 145 ? 13.863  17.390  -3.049  1.00 58.55  ? 144  LYS A CA  1 
ATOM   1203 C  C   . LYS A 1 145 ? 12.563  18.130  -3.345  1.00 69.53  ? 144  LYS A C   1 
ATOM   1204 O  O   . LYS A 1 145 ? 12.447  18.720  -4.423  1.00 86.12  ? 144  LYS A O   1 
ATOM   1205 C  CB  . LYS A 1 145 ? 14.639  17.170  -4.350  1.00 55.98  ? 144  LYS A CB  1 
ATOM   1206 C  CG  . LYS A 1 145 ? 15.846  16.254  -4.234  1.00 51.63  ? 144  LYS A CG  1 
ATOM   1207 C  CD  . LYS A 1 145 ? 16.101  15.527  -5.546  1.00 47.48  ? 144  LYS A CD  1 
ATOM   1208 C  CE  . LYS A 1 145 ? 16.504  16.506  -6.638  1.00 48.04  ? 144  LYS A CE  1 
ATOM   1209 N  NZ  . LYS A 1 145 ? 17.966  16.426  -6.961  1.00 52.07  ? 144  LYS A NZ  1 
ATOM   1210 N  N   . GLU A 1 146 ? 11.626  18.158  -2.406  1.00 76.48  ? 145  GLU A N   1 
ATOM   1211 C  CA  . GLU A 1 146 ? 10.345  18.872  -2.535  1.00 80.29  ? 145  GLU A CA  1 
ATOM   1212 C  C   . GLU A 1 146 ? 9.432   18.271  -3.622  1.00 82.17  ? 145  GLU A C   1 
ATOM   1213 O  O   . GLU A 1 146 ? 9.099   18.921  -4.629  1.00 87.19  ? 145  GLU A O   1 
ATOM   1214 C  CB  . GLU A 1 146 ? 10.686  20.327  -2.952  1.00 81.38  ? 145  GLU A CB  1 
ATOM   1215 C  CG  . GLU A 1 146 ? 10.147  21.354  -1.963  1.00 87.14  ? 145  GLU A CG  1 
ATOM   1216 C  CD  . GLU A 1 146 ? 8.941   22.102  -2.517  1.00 90.88  ? 145  GLU A CD  1 
ATOM   1217 O  OE1 . GLU A 1 146 ? 9.063   22.732  -3.599  1.00 98.98  ? 145  GLU A OE1 1 
ATOM   1218 O  OE2 . GLU A 1 146 ? 7.864   22.065  -1.850  1.00 91.31  ? 145  GLU A OE2 1 
ATOM   1219 N  N   . GLY A 1 147 ? 8.982   17.039  -3.397  1.00 80.69  ? 146  GLY A N   1 
ATOM   1220 C  CA  . GLY A 1 147 ? 8.089   16.365  -4.320  1.00 79.34  ? 146  GLY A CA  1 
ATOM   1221 C  C   . GLY A 1 147 ? 6.639   16.348  -3.858  1.00 80.61  ? 146  GLY A C   1 
ATOM   1222 O  O   . GLY A 1 147 ? 6.164   15.266  -3.517  1.00 85.87  ? 146  GLY A O   1 
ATOM   1223 N  N   . ARG A 1 148 ? 6.015   17.508  -3.894  1.00 81.44  ? 147  ARG A N   1 
ATOM   1224 C  CA  . ARG A 1 148 ? 4.609   17.719  -3.543  1.00 80.76  ? 147  ARG A CA  1 
ATOM   1225 C  C   . ARG A 1 148 ? 4.161   16.854  -2.367  1.00 78.98  ? 147  ARG A C   1 
ATOM   1226 O  O   . ARG A 1 148 ? 4.296   17.300  -1.215  1.00 72.30  ? 147  ARG A O   1 
ATOM   1227 C  CB  . ARG A 1 148 ? 3.723   17.420  -4.758  1.00 83.77  ? 147  ARG A CB  1 
ATOM   1228 C  CG  . ARG A 1 148 ? 2.404   18.214  -4.798  1.00 87.33  ? 147  ARG A CG  1 
ATOM   1229 C  CD  . ARG A 1 148 ? 2.510   19.573  -4.115  1.00 90.50  ? 147  ARG A CD  1 
ATOM   1230 N  NE  . ARG A 1 148 ? 2.198   20.691  -5.017  1.00 91.05  ? 147  ARG A NE  1 
ATOM   1231 C  CZ  . ARG A 1 148 ? 1.732   21.868  -4.611  1.00 91.42  ? 147  ARG A CZ  1 
ATOM   1232 N  NH1 . ARG A 1 148 ? 1.509   22.103  -3.307  1.00 92.93  ? 147  ARG A NH1 1 
ATOM   1233 N  NH2 . ARG A 1 148 ? 1.475   22.827  -5.515  1.00 90.77  ? 147  ARG A NH2 1 
ATOM   1234 N  N   . GLY B 1 1   ? 45.699  2.456   34.939  1.00 104.50 ? 200  GLY B N   1 
ATOM   1235 C  CA  . GLY B 1 1   ? 46.464  3.698   34.685  1.00 105.22 ? 200  GLY B CA  1 
ATOM   1236 C  C   . GLY B 1 1   ? 46.853  3.817   33.221  1.00 105.40 ? 200  GLY B C   1 
ATOM   1237 O  O   . GLY B 1 1   ? 48.045  3.966   32.900  1.00 107.26 ? 200  GLY B O   1 
ATOM   1238 N  N   . MET B 1 2   ? 45.863  3.775   32.334  1.00 103.12 ? 201  MET B N   1 
ATOM   1239 C  CA  . MET B 1 2   ? 46.100  3.910   30.898  1.00 102.76 ? 201  MET B CA  1 
ATOM   1240 C  C   . MET B 1 2   ? 44.812  3.684   30.107  1.00 101.36 ? 201  MET B C   1 
ATOM   1241 O  O   . MET B 1 2   ? 43.835  3.160   30.644  1.00 97.25  ? 201  MET B O   1 
ATOM   1242 C  CB  . MET B 1 2   ? 47.204  2.948   30.438  1.00 103.17 ? 201  MET B CB  1 
ATOM   1243 C  CG  . MET B 1 2   ? 46.731  1.813   29.511  1.00 102.79 ? 201  MET B CG  1 
ATOM   1244 S  SD  . MET B 1 2   ? 47.917  0.452   29.460  1.00 107.14 ? 201  MET B SD  1 
ATOM   1245 C  CE  . MET B 1 2   ? 46.815  -0.963  29.344  1.00 104.11 ? 201  MET B CE  1 
ATOM   1246 N  N   . LYS B 1 3   ? 44.824  4.086   28.845  1.00 95.67  ? 202  LYS B N   1 
ATOM   1247 C  CA  . LYS B 1 3   ? 43.681  3.981   27.947  1.00 98.57  ? 202  LYS B CA  1 
ATOM   1248 C  C   . LYS B 1 3   ? 42.634  5.049   28.264  1.00 92.04  ? 202  LYS B C   1 
ATOM   1249 O  O   . LYS B 1 3   ? 41.479  4.730   28.548  1.00 92.93  ? 202  LYS B O   1 
ATOM   1250 C  CB  . LYS B 1 3   ? 43.049  2.588   28.024  1.00 98.70  ? 202  LYS B CB  1 
ATOM   1251 C  CG  . LYS B 1 3   ? 43.782  1.534   27.214  1.00 96.28  ? 202  LYS B CG  1 
ATOM   1252 C  CD  . LYS B 1 3   ? 43.274  1.486   25.782  1.00 94.43  ? 202  LYS B CD  1 
ATOM   1253 C  CE  . LYS B 1 3   ? 44.250  2.151   24.824  1.00 94.12  ? 202  LYS B CE  1 
ATOM   1254 N  NZ  . LYS B 1 3   ? 43.672  3.399   24.223  1.00 91.95  ? 202  LYS B NZ  1 
ATOM   1255 N  N   . MET B 1 4   ? 43.050  6.307   28.212  1.00 92.84  ? 203  MET B N   1 
ATOM   1256 C  CA  . MET B 1 4   ? 42.202  7.448   28.529  1.00 90.84  ? 203  MET B CA  1 
ATOM   1257 C  C   . MET B 1 4   ? 41.222  7.761   27.402  1.00 80.05  ? 203  MET B C   1 
ATOM   1258 O  O   . MET B 1 4   ? 40.012  7.648   27.597  1.00 61.66  ? 203  MET B O   1 
ATOM   1259 C  CB  . MET B 1 4   ? 43.064  8.682   28.819  1.00 94.21  ? 203  MET B CB  1 
ATOM   1260 C  CG  . MET B 1 4   ? 44.193  8.884   27.819  1.00 96.70  ? 203  MET B CG  1 
ATOM   1261 S  SD  . MET B 1 4   ? 44.940  10.524  27.903  1.00 98.78  ? 203  MET B SD  1 
ATOM   1262 C  CE  . MET B 1 4   ? 45.952  10.339  29.372  1.00 75.22  ? 203  MET B CE  1 
ATOM   1263 N  N   . LEU B 1 5   ? 41.750  8.138   26.248  1.00 74.38  ? 204  LEU B N   1 
ATOM   1264 C  CA  . LEU B 1 5   ? 41.005  8.519   25.054  1.00 69.08  ? 204  LEU B CA  1 
ATOM   1265 C  C   . LEU B 1 5   ? 39.844  7.556   24.804  1.00 65.64  ? 204  LEU B C   1 
ATOM   1266 O  O   . LEU B 1 5   ? 38.769  7.993   24.391  1.00 59.49  ? 204  LEU B O   1 
ATOM   1267 C  CB  . LEU B 1 5   ? 41.908  8.531   23.825  1.00 72.66  ? 204  LEU B CB  1 
ATOM   1268 C  CG  . LEU B 1 5   ? 42.939  9.667   23.684  1.00 67.88  ? 204  LEU B CG  1 
ATOM   1269 C  CD1 . LEU B 1 5   ? 42.707  10.719  24.773  1.00 55.23  ? 204  LEU B CD1 1 
ATOM   1270 C  CD2 . LEU B 1 5   ? 44.344  9.098   23.727  1.00 51.70  ? 204  LEU B CD2 1 
ATOM   1271 N  N   . GLU B 1 6   ? 40.101  6.277   25.056  1.00 57.12  ? 205  GLU B N   1 
ATOM   1272 C  CA  . GLU B 1 6   ? 39.119  5.203   24.832  1.00 40.57  ? 205  GLU B CA  1 
ATOM   1273 C  C   . GLU B 1 6   ? 39.442  4.030   25.759  1.00 37.80  ? 205  GLU B C   1 
ATOM   1274 O  O   . GLU B 1 6   ? 40.195  4.208   26.720  1.00 41.52  ? 205  GLU B O   1 
ATOM   1275 C  CB  . GLU B 1 6   ? 39.087  4.888   23.368  1.00 38.61  ? 205  GLU B CB  1 
ATOM   1276 C  CG  A GLU B 1 6   ? 38.203  5.810   22.537  0.50 38.03  ? 205  GLU B CG  1 
ATOM   1277 C  CG  B GLU B 1 6   ? 38.850  3.418   23.039  0.50 36.38  ? 205  GLU B CG  1 
ATOM   1278 C  CD  A GLU B 1 6   ? 38.423  5.641   21.047  0.50 33.71  ? 205  GLU B CD  1 
ATOM   1279 C  CD  B GLU B 1 6   ? 40.137  2.641   22.895  0.50 36.80  ? 205  GLU B CD  1 
ATOM   1280 O  OE1 A GLU B 1 6   ? 39.552  5.293   20.652  0.50 24.24  ? 205  GLU B OE1 1 
ATOM   1281 O  OE1 B GLU B 1 6   ? 40.988  2.736   23.802  0.50 53.06  ? 205  GLU B OE1 1 
ATOM   1282 O  OE2 A GLU B 1 6   ? 37.469  5.863   20.273  0.50 30.29  ? 205  GLU B OE2 1 
ATOM   1283 O  OE2 B GLU B 1 6   ? 40.301  1.926   21.876  0.50 38.61  ? 205  GLU B OE2 1 
ATOM   1284 N  N   . GLN B 1 7   ? 38.758  2.927   25.507  1.00 39.63  ? 206  GLN B N   1 
ATOM   1285 C  CA  . GLN B 1 7   ? 38.668  1.700   26.259  1.00 38.55  ? 206  GLN B CA  1 
ATOM   1286 C  C   . GLN B 1 7   ? 37.278  1.152   25.885  1.00 33.85  ? 206  GLN B C   1 
ATOM   1287 O  O   . GLN B 1 7   ? 36.857  0.107   26.331  1.00 36.49  ? 206  GLN B O   1 
ATOM   1288 C  CB  . GLN B 1 7   ? 39.021  1.842   27.757  1.00 48.03  ? 206  GLN B CB  1 
ATOM   1289 C  CG  . GLN B 1 7   ? 39.525  0.581   28.443  1.00 55.84  ? 206  GLN B CG  1 
ATOM   1290 C  CD  . GLN B 1 7   ? 39.670  0.938   29.901  1.00 55.65  ? 206  GLN B CD  1 
ATOM   1291 O  OE1 . GLN B 1 7   ? 40.264  0.158   30.640  1.00 52.73  ? 206  GLN B OE1 1 
ATOM   1292 N  NE2 . GLN B 1 7   ? 39.142  2.084   30.321  1.00 47.94  ? 206  GLN B NE2 1 
ATOM   1293 N  N   . LEU B 1 8   ? 36.551  2.079   25.256  1.00 25.86  ? 207  LEU B N   1 
ATOM   1294 C  CA  . LEU B 1 8   ? 35.131  1.986   24.939  1.00 25.39  ? 207  LEU B CA  1 
ATOM   1295 C  C   . LEU B 1 8   ? 34.858  0.917   23.887  1.00 33.32  ? 207  LEU B C   1 
ATOM   1296 O  O   . LEU B 1 8   ? 33.802  0.275   23.905  1.00 32.09  ? 207  LEU B O   1 
ATOM   1297 C  CB  . LEU B 1 8   ? 34.626  3.346   24.468  1.00 22.08  ? 207  LEU B CB  1 
ATOM   1298 C  CG  . LEU B 1 8   ? 33.272  3.435   23.774  1.00 14.34  ? 207  LEU B CG  1 
ATOM   1299 C  CD1 . LEU B 1 8   ? 32.139  3.250   24.779  1.00 36.38  ? 207  LEU B CD1 1 
ATOM   1300 C  CD2 . LEU B 1 8   ? 33.153  4.774   23.062  1.00 22.68  ? 207  LEU B CD2 1 
ATOM   1301 N  N   . GLU B 1 9   ? 35.829  0.727   22.992  1.00 33.44  ? 208  GLU B N   1 
ATOM   1302 C  CA  . GLU B 1 9   ? 35.727  -0.322  21.979  1.00 26.19  ? 208  GLU B CA  1 
ATOM   1303 C  C   . GLU B 1 9   ? 35.702  -1.695  22.636  1.00 22.04  ? 208  GLU B C   1 
ATOM   1304 O  O   . GLU B 1 9   ? 34.928  -2.580  22.266  1.00 27.40  ? 208  GLU B O   1 
ATOM   1305 C  CB  . GLU B 1 9   ? 36.875  -0.221  20.968  1.00 18.78  ? 208  GLU B CB  1 
ATOM   1306 C  CG  . GLU B 1 9   ? 37.064  1.161   20.376  1.00 17.03  ? 208  GLU B CG  1 
ATOM   1307 C  CD  . GLU B 1 9   ? 38.204  1.253   19.383  1.00 24.06  ? 208  GLU B CD  1 
ATOM   1308 O  OE1 . GLU B 1 9   ? 39.358  1.000   19.783  1.00 26.76  ? 208  GLU B OE1 1 
ATOM   1309 O  OE2 . GLU B 1 9   ? 37.970  1.583   18.199  1.00 24.80  ? 208  GLU B OE2 1 
ATOM   1310 N  N   . LYS B 1 10  ? 36.556  -1.905  23.638  1.00 26.24  ? 209  LYS B N   1 
ATOM   1311 C  CA  . LYS B 1 10  ? 36.625  -3.221  24.281  1.00 34.39  ? 209  LYS B CA  1 
ATOM   1312 C  C   . LYS B 1 10  ? 35.395  -3.497  25.138  1.00 29.93  ? 209  LYS B C   1 
ATOM   1313 O  O   . LYS B 1 10  ? 35.051  -4.643  25.435  1.00 25.13  ? 209  LYS B O   1 
ATOM   1314 C  CB  . LYS B 1 10  ? 37.899  -3.323  25.121  1.00 45.20  ? 209  LYS B CB  1 
ATOM   1315 C  CG  . LYS B 1 10  ? 37.722  -4.086  26.429  1.00 54.74  ? 209  LYS B CG  1 
ATOM   1316 C  CD  . LYS B 1 10  ? 38.861  -3.783  27.389  1.00 63.06  ? 209  LYS B CD  1 
ATOM   1317 C  CE  . LYS B 1 10  ? 38.544  -2.565  28.252  1.00 69.91  ? 209  LYS B CE  1 
ATOM   1318 N  NZ  . LYS B 1 10  ? 39.422  -2.560  29.469  1.00 83.65  ? 209  LYS B NZ  1 
ATOM   1319 N  N   . LYS B 1 11  ? 34.737  -2.412  25.531  1.00 27.95  ? 210  LYS B N   1 
ATOM   1320 C  CA  . LYS B 1 11  ? 33.442  -2.495  26.192  1.00 33.73  ? 210  LYS B CA  1 
ATOM   1321 C  C   . LYS B 1 11  ? 32.391  -2.939  25.176  1.00 37.73  ? 210  LYS B C   1 
ATOM   1322 O  O   . LYS B 1 11  ? 31.699  -3.926  25.421  1.00 40.18  ? 210  LYS B O   1 
ATOM   1323 C  CB  . LYS B 1 11  ? 33.072  -1.159  26.833  1.00 32.79  ? 210  LYS B CB  1 
ATOM   1324 C  CG  . LYS B 1 11  ? 33.625  -1.000  28.244  1.00 37.85  ? 210  LYS B CG  1 
ATOM   1325 C  CD  . LYS B 1 11  ? 33.793  0.462   28.612  1.00 42.22  ? 210  LYS B CD  1 
ATOM   1326 C  CE  . LYS B 1 11  ? 34.700  0.661   29.810  1.00 46.90  ? 210  LYS B CE  1 
ATOM   1327 N  NZ  . LYS B 1 11  ? 34.892  -0.579  30.613  1.00 41.78  ? 210  LYS B NZ  1 
ATOM   1328 N  N   . LEU B 1 12  ? 32.289  -2.228  24.054  1.00 35.51  ? 211  LEU B N   1 
ATOM   1329 C  CA  . LEU B 1 12  ? 31.349  -2.562  22.996  1.00 26.73  ? 211  LEU B CA  1 
ATOM   1330 C  C   . LEU B 1 12  ? 31.628  -3.919  22.362  1.00 32.48  ? 211  LEU B C   1 
ATOM   1331 O  O   . LEU B 1 12  ? 30.731  -4.547  21.797  1.00 29.49  ? 211  LEU B O   1 
ATOM   1332 C  CB  . LEU B 1 12  ? 31.396  -1.535  21.863  1.00 20.48  ? 211  LEU B CB  1 
ATOM   1333 C  CG  . LEU B 1 12  ? 31.054  -0.093  22.214  1.00 23.26  ? 211  LEU B CG  1 
ATOM   1334 C  CD1 . LEU B 1 12  ? 31.130  0.771   20.963  1.00 8.85   ? 211  LEU B CD1 1 
ATOM   1335 C  CD2 . LEU B 1 12  ? 29.685  -0.004  22.865  1.00 38.42  ? 211  LEU B CD2 1 
ATOM   1336 N  N   . GLY B 1 13  ? 32.882  -4.363  22.433  1.00 32.91  ? 212  GLY B N   1 
ATOM   1337 C  CA  . GLY B 1 13  ? 33.278  -5.570  21.720  1.00 24.84  ? 212  GLY B CA  1 
ATOM   1338 C  C   . GLY B 1 13  ? 33.407  -5.294  20.231  1.00 15.30  ? 212  GLY B C   1 
ATOM   1339 O  O   . GLY B 1 13  ? 33.266  -6.195  19.403  1.00 26.55  ? 212  GLY B O   1 
ATOM   1340 N  N   . TYR B 1 14  ? 33.683  -4.042  19.865  1.00 20.61  ? 213  TYR B N   1 
ATOM   1341 C  CA  . TYR B 1 14  ? 33.830  -3.709  18.451  1.00 26.70  ? 213  TYR B CA  1 
ATOM   1342 C  C   . TYR B 1 14  ? 34.919  -2.683  18.186  1.00 22.78  ? 213  TYR B C   1 
ATOM   1343 O  O   . TYR B 1 14  ? 34.932  -1.613  18.793  1.00 24.91  ? 213  TYR B O   1 
ATOM   1344 C  CB  . TYR B 1 14  ? 32.522  -3.144  17.886  1.00 24.54  ? 213  TYR B CB  1 
ATOM   1345 C  CG  . TYR B 1 14  ? 32.609  -2.742  16.431  1.00 18.17  ? 213  TYR B CG  1 
ATOM   1346 C  CD1 . TYR B 1 14  ? 32.684  -3.712  15.438  1.00 19.96  ? 213  TYR B CD1 1 
ATOM   1347 C  CD2 . TYR B 1 14  ? 32.611  -1.411  16.047  1.00 22.12  ? 213  TYR B CD2 1 
ATOM   1348 C  CE1 . TYR B 1 14  ? 32.763  -3.353  14.105  1.00 17.13  ? 213  TYR B CE1 1 
ATOM   1349 C  CE2 . TYR B 1 14  ? 32.691  -1.043  14.714  1.00 19.52  ? 213  TYR B CE2 1 
ATOM   1350 C  CZ  . TYR B 1 14  ? 32.767  -2.026  13.753  1.00 11.58  ? 213  TYR B CZ  1 
ATOM   1351 O  OH  . TYR B 1 14  ? 32.840  -1.667  12.427  1.00 18.37  ? 213  TYR B OH  1 
ATOM   1352 N  N   . THR B 1 15  ? 35.824  -2.996  17.262  1.00 21.24  ? 214  THR B N   1 
ATOM   1353 C  CA  . THR B 1 15  ? 36.842  -2.002  16.894  1.00 10.84  ? 214  THR B CA  1 
ATOM   1354 C  C   . THR B 1 15  ? 36.412  -1.286  15.623  1.00 7.45   ? 214  THR B C   1 
ATOM   1355 O  O   . THR B 1 15  ? 36.068  -1.908  14.614  1.00 23.05  ? 214  THR B O   1 
ATOM   1356 C  CB  . THR B 1 15  ? 38.219  -2.666  16.734  1.00 18.80  ? 214  THR B CB  1 
ATOM   1357 O  OG1 . THR B 1 15  ? 38.646  -3.165  18.013  1.00 23.22  ? 214  THR B OG1 1 
ATOM   1358 C  CG2 . THR B 1 15  ? 39.279  -1.675  16.272  1.00 7.37   ? 214  THR B CG2 1 
ATOM   1359 N  N   . PHE B 1 16  ? 36.403  0.040   15.670  1.00 11.57  ? 215  PHE B N   1 
ATOM   1360 C  CA  . PHE B 1 16  ? 36.025  0.851   14.523  1.00 25.38  ? 215  PHE B CA  1 
ATOM   1361 C  C   . PHE B 1 16  ? 37.057  0.786   13.406  1.00 30.47  ? 215  PHE B C   1 
ATOM   1362 O  O   . PHE B 1 16  ? 38.253  0.696   13.682  1.00 18.56  ? 215  PHE B O   1 
ATOM   1363 C  CB  . PHE B 1 16  ? 35.823  2.305   14.986  1.00 23.78  ? 215  PHE B CB  1 
ATOM   1364 C  CG  . PHE B 1 16  ? 34.499  2.453   15.731  1.00 22.79  ? 215  PHE B CG  1 
ATOM   1365 C  CD1 . PHE B 1 16  ? 34.324  1.833   16.957  1.00 26.94  ? 215  PHE B CD1 1 
ATOM   1366 C  CD2 . PHE B 1 16  ? 33.468  3.198   15.192  1.00 19.62  ? 215  PHE B CD2 1 
ATOM   1367 C  CE1 . PHE B 1 16  ? 33.118  1.954   17.630  1.00 29.47  ? 215  PHE B CE1 1 
ATOM   1368 C  CE2 . PHE B 1 16  ? 32.258  3.323   15.857  1.00 18.60  ? 215  PHE B CE2 1 
ATOM   1369 C  CZ  . PHE B 1 16  ? 32.097  2.708   17.083  1.00 20.66  ? 215  PHE B CZ  1 
ATOM   1370 N  N   . LYS B 1 17  ? 36.619  0.835   12.151  1.00 30.39  ? 216  LYS B N   1 
ATOM   1371 C  CA  . LYS B 1 17  ? 37.562  0.947   11.040  1.00 30.74  ? 216  LYS B CA  1 
ATOM   1372 C  C   . LYS B 1 17  ? 37.994  2.406   10.898  1.00 26.53  ? 216  LYS B C   1 
ATOM   1373 O  O   . LYS B 1 17  ? 39.147  2.711   10.613  1.00 18.44  ? 216  LYS B O   1 
ATOM   1374 C  CB  . LYS B 1 17  ? 36.972  0.447   9.727   1.00 31.19  ? 216  LYS B CB  1 
ATOM   1375 C  CG  . LYS B 1 17  ? 35.831  -0.544  9.898   1.00 24.39  ? 216  LYS B CG  1 
ATOM   1376 C  CD  . LYS B 1 17  ? 36.358  -1.886  10.355  1.00 12.68  ? 216  LYS B CD  1 
ATOM   1377 C  CE  . LYS B 1 17  ? 35.451  -3.017  9.876   1.00 14.72  ? 216  LYS B CE  1 
ATOM   1378 N  NZ  . LYS B 1 17  ? 34.820  -3.695  11.033  1.00 17.57  ? 216  LYS B NZ  1 
ATOM   1379 N  N   . ASP B 1 18  ? 37.044  3.309   11.122  1.00 25.20  ? 217  ASP B N   1 
ATOM   1380 C  CA  . ASP B 1 18  ? 37.345  4.737   11.112  1.00 29.43  ? 217  ASP B CA  1 
ATOM   1381 C  C   . ASP B 1 18  ? 37.052  5.336   12.488  1.00 35.43  ? 217  ASP B C   1 
ATOM   1382 O  O   . ASP B 1 18  ? 35.903  5.437   12.925  1.00 36.28  ? 217  ASP B O   1 
ATOM   1383 C  CB  . ASP B 1 18  ? 36.552  5.434   10.017  1.00 24.59  ? 217  ASP B CB  1 
ATOM   1384 C  CG  . ASP B 1 18  ? 36.747  6.932   9.992   1.00 24.88  ? 217  ASP B CG  1 
ATOM   1385 O  OD1 . ASP B 1 18  ? 37.777  7.412   10.504  1.00 32.59  ? 217  ASP B OD1 1 
ATOM   1386 O  OD2 . ASP B 1 18  ? 35.867  7.633   9.451   1.00 45.87  ? 217  ASP B OD2 1 
ATOM   1387 N  N   . LYS B 1 19  ? 38.125  5.718   13.167  1.00 23.46  ? 218  LYS B N   1 
ATOM   1388 C  CA  . LYS B 1 19  ? 38.104  6.226   14.526  1.00 24.20  ? 218  LYS B CA  1 
ATOM   1389 C  C   . LYS B 1 19  ? 37.312  7.518   14.655  1.00 18.87  ? 218  LYS B C   1 
ATOM   1390 O  O   . LYS B 1 19  ? 36.614  7.765   15.642  1.00 31.44  ? 218  LYS B O   1 
ATOM   1391 C  CB  . LYS B 1 19  ? 39.547  6.449   14.993  1.00 24.18  ? 218  LYS B CB  1 
ATOM   1392 C  CG  . LYS B 1 19  ? 40.118  5.352   15.859  1.00 17.72  ? 218  LYS B CG  1 
ATOM   1393 C  CD  . LYS B 1 19  ? 39.745  3.957   15.417  1.00 10.95  ? 218  LYS B CD  1 
ATOM   1394 C  CE  . LYS B 1 19  ? 40.313  2.903   16.348  1.00 7.76   ? 218  LYS B CE  1 
ATOM   1395 N  NZ  . LYS B 1 19  ? 39.735  1.543   16.089  1.00 22.79  ? 218  LYS B NZ  1 
ATOM   1396 N  N   . SER B 1 20  ? 37.391  8.378   13.644  1.00 13.43  ? 219  SER B N   1 
ATOM   1397 C  CA  . SER B 1 20  ? 36.723  9.674   13.734  1.00 20.22  ? 219  SER B CA  1 
ATOM   1398 C  C   . SER B 1 20  ? 35.208  9.556   13.642  1.00 19.91  ? 219  SER B C   1 
ATOM   1399 O  O   . SER B 1 20  ? 34.498  10.556  13.781  1.00 16.27  ? 219  SER B O   1 
ATOM   1400 C  CB  . SER B 1 20  ? 37.256  10.595  12.630  1.00 16.20  ? 219  SER B CB  1 
ATOM   1401 O  OG  . SER B 1 20  ? 37.790  9.820   11.566  1.00 29.37  ? 219  SER B OG  1 
ATOM   1402 N  N   . LEU B 1 21  ? 34.722  8.344   13.396  1.00 23.71  ? 220  LEU B N   1 
ATOM   1403 C  CA  . LEU B 1 21  ? 33.295  8.061   13.355  1.00 21.37  ? 220  LEU B CA  1 
ATOM   1404 C  C   . LEU B 1 21  ? 32.794  7.844   14.780  1.00 23.24  ? 220  LEU B C   1 
ATOM   1405 O  O   . LEU B 1 21  ? 31.695  8.260   15.139  1.00 19.62  ? 220  LEU B O   1 
ATOM   1406 C  CB  . LEU B 1 21  ? 32.981  6.827   12.506  1.00 18.23  ? 220  LEU B CB  1 
ATOM   1407 C  CG  . LEU B 1 21  ? 32.162  7.114   11.245  1.00 25.75  ? 220  LEU B CG  1 
ATOM   1408 C  CD1 . LEU B 1 21  ? 31.696  5.826   10.595  1.00 14.79  ? 220  LEU B CD1 1 
ATOM   1409 C  CD2 . LEU B 1 21  ? 30.988  8.028   11.579  1.00 30.98  ? 220  LEU B CD2 1 
ATOM   1410 N  N   . LEU B 1 22  ? 33.662  7.177   15.537  1.00 19.93  ? 221  LEU B N   1 
ATOM   1411 C  CA  . LEU B 1 22  ? 33.431  6.989   16.972  1.00 15.62  ? 221  LEU B CA  1 
ATOM   1412 C  C   . LEU B 1 22  ? 33.705  8.310   17.675  1.00 21.80  ? 221  LEU B C   1 
ATOM   1413 O  O   . LEU B 1 22  ? 32.975  8.717   18.572  1.00 15.62  ? 221  LEU B O   1 
ATOM   1414 C  CB  . LEU B 1 22  ? 34.331  5.888   17.487  1.00 22.52  ? 221  LEU B CB  1 
ATOM   1415 C  CG  . LEU B 1 22  ? 33.894  4.997   18.637  1.00 28.21  ? 221  LEU B CG  1 
ATOM   1416 C  CD1 . LEU B 1 22  ? 35.115  4.327   19.257  1.00 24.55  ? 221  LEU B CD1 1 
ATOM   1417 C  CD2 . LEU B 1 22  ? 33.113  5.768   19.689  1.00 21.43  ? 221  LEU B CD2 1 
ATOM   1418 N  N   . GLU B 1 23  ? 34.775  8.994   17.245  1.00 26.01  ? 222  GLU B N   1 
ATOM   1419 C  CA  . GLU B 1 23  ? 35.047  10.321  17.796  1.00 25.00  ? 222  GLU B CA  1 
ATOM   1420 C  C   . GLU B 1 23  ? 33.819  11.217  17.640  1.00 25.01  ? 222  GLU B C   1 
ATOM   1421 O  O   . GLU B 1 23  ? 33.330  11.813  18.599  1.00 35.02  ? 222  GLU B O   1 
ATOM   1422 C  CB  . GLU B 1 23  ? 36.275  10.952  17.139  1.00 27.59  ? 222  GLU B CB  1 
ATOM   1423 C  CG  . GLU B 1 23  ? 37.480  10.030  17.036  1.00 41.78  ? 222  GLU B CG  1 
ATOM   1424 C  CD  . GLU B 1 23  ? 38.830  10.709  17.089  1.00 46.64  ? 222  GLU B CD  1 
ATOM   1425 O  OE1 . GLU B 1 23  ? 38.941  11.740  17.787  1.00 56.70  ? 222  GLU B OE1 1 
ATOM   1426 O  OE2 . GLU B 1 23  ? 39.795  10.226  16.447  1.00 35.25  ? 222  GLU B OE2 1 
ATOM   1427 N  N   . LYS B 1 24  ? 33.293  11.313  16.426  1.00 26.33  ? 223  LYS B N   1 
ATOM   1428 C  CA  . LYS B 1 24  ? 32.141  12.142  16.116  1.00 24.95  ? 223  LYS B CA  1 
ATOM   1429 C  C   . LYS B 1 24  ? 30.948  11.897  17.037  1.00 20.53  ? 223  LYS B C   1 
ATOM   1430 O  O   . LYS B 1 24  ? 30.317  12.864  17.472  1.00 16.64  ? 223  LYS B O   1 
ATOM   1431 C  CB  . LYS B 1 24  ? 31.702  11.919  14.656  1.00 20.35  ? 223  LYS B CB  1 
ATOM   1432 C  CG  . LYS B 1 24  ? 30.951  13.119  14.101  1.00 21.12  ? 223  LYS B CG  1 
ATOM   1433 C  CD  . LYS B 1 24  ? 30.248  12.819  12.786  1.00 26.75  ? 223  LYS B CD  1 
ATOM   1434 C  CE  . LYS B 1 24  ? 29.318  13.976  12.434  1.00 38.33  ? 223  LYS B CE  1 
ATOM   1435 N  NZ  . LYS B 1 24  ? 28.984  14.025  10.985  1.00 44.70  ? 223  LYS B NZ  1 
ATOM   1436 N  N   . ALA B 1 25  ? 30.647  10.636  17.325  1.00 22.70  ? 224  ALA B N   1 
ATOM   1437 C  CA  . ALA B 1 25  ? 29.520  10.269  18.174  1.00 25.16  ? 224  ALA B CA  1 
ATOM   1438 C  C   . ALA B 1 25  ? 29.670  10.816  19.590  1.00 26.07  ? 224  ALA B C   1 
ATOM   1439 O  O   . ALA B 1 25  ? 28.687  11.288  20.159  1.00 24.49  ? 224  ALA B O   1 
ATOM   1440 C  CB  . ALA B 1 25  ? 29.341  8.758   18.239  1.00 16.12  ? 224  ALA B CB  1 
ATOM   1441 N  N   . LEU B 1 26  ? 30.873  10.749  20.150  1.00 24.64  ? 225  LEU B N   1 
ATOM   1442 C  CA  . LEU B 1 26  ? 31.110  11.210  21.510  1.00 30.32  ? 225  LEU B CA  1 
ATOM   1443 C  C   . LEU B 1 26  ? 31.462  12.694  21.589  1.00 30.50  ? 225  LEU B C   1 
ATOM   1444 O  O   . LEU B 1 26  ? 31.951  13.162  22.624  1.00 31.01  ? 225  LEU B O   1 
ATOM   1445 C  CB  . LEU B 1 26  ? 32.243  10.406  22.156  1.00 32.75  ? 225  LEU B CB  1 
ATOM   1446 C  CG  . LEU B 1 26  ? 32.218  8.887   22.058  1.00 28.02  ? 225  LEU B CG  1 
ATOM   1447 C  CD1 . LEU B 1 26  ? 33.643  8.341   22.050  1.00 23.93  ? 225  LEU B CD1 1 
ATOM   1448 C  CD2 . LEU B 1 26  ? 31.428  8.264   23.195  1.00 39.98  ? 225  LEU B CD2 1 
ATOM   1449 N  N   . THR B 1 27  ? 31.237  13.450  20.527  1.00 34.05  ? 226  THR B N   1 
ATOM   1450 C  CA  . THR B 1 27  ? 31.610  14.863  20.494  1.00 35.91  ? 226  THR B CA  1 
ATOM   1451 C  C   . THR B 1 27  ? 30.395  15.776  20.423  1.00 33.70  ? 226  THR B C   1 
ATOM   1452 O  O   . THR B 1 27  ? 29.592  15.694  19.491  1.00 27.43  ? 226  THR B O   1 
ATOM   1453 C  CB  . THR B 1 27  ? 32.546  15.127  19.294  1.00 41.82  ? 226  THR B CB  1 
ATOM   1454 O  OG1 . THR B 1 27  ? 33.795  14.452  19.536  1.00 48.04  ? 226  THR B OG1 1 
ATOM   1455 C  CG2 . THR B 1 27  ? 32.880  16.599  19.121  1.00 20.52  ? 226  THR B CG2 1 
ATOM   1456 N  N   . HIS B 1 28  ? 30.271  16.652  21.415  1.00 31.08  ? 227  HIS B N   1 
ATOM   1457 C  CA  . HIS B 1 28  ? 29.189  17.626  21.485  1.00 31.87  ? 227  HIS B CA  1 
ATOM   1458 C  C   . HIS B 1 28  ? 29.651  18.984  20.952  1.00 24.84  ? 227  HIS B C   1 
ATOM   1459 O  O   . HIS B 1 28  ? 30.793  19.356  21.221  1.00 28.94  ? 227  HIS B O   1 
ATOM   1460 C  CB  . HIS B 1 28  ? 28.686  17.769  22.920  1.00 48.45  ? 227  HIS B CB  1 
ATOM   1461 C  CG  . HIS B 1 28  ? 27.494  18.645  23.128  1.00 47.78  ? 227  HIS B CG  1 
ATOM   1462 N  ND1 . HIS B 1 28  ? 27.588  20.004  23.329  1.00 49.46  ? 227  HIS B ND1 1 
ATOM   1463 C  CD2 . HIS B 1 28  ? 26.171  18.362  23.179  1.00 46.85  ? 227  HIS B CD2 1 
ATOM   1464 C  CE1 . HIS B 1 28  ? 26.380  20.518  23.487  1.00 49.17  ? 227  HIS B CE1 1 
ATOM   1465 N  NE2 . HIS B 1 28  ? 25.497  19.538  23.399  1.00 47.62  ? 227  HIS B NE2 1 
ATOM   1466 N  N   . VAL B 1 29  ? 28.756  19.671  20.272  1.00 29.29  ? 228  VAL B N   1 
ATOM   1467 C  CA  . VAL B 1 29  ? 28.918  20.952  19.589  1.00 34.46  ? 228  VAL B CA  1 
ATOM   1468 C  C   . VAL B 1 29  ? 29.916  21.856  20.342  1.00 36.11  ? 228  VAL B C   1 
ATOM   1469 O  O   . VAL B 1 29  ? 30.792  22.428  19.686  1.00 44.58  ? 228  VAL B O   1 
ATOM   1470 C  CB  . VAL B 1 29  ? 27.560  21.737  19.628  1.00 31.22  ? 228  VAL B CB  1 
ATOM   1471 C  CG1 . VAL B 1 29  ? 27.339  22.358  18.256  1.00 25.13  ? 228  VAL B CG1 1 
ATOM   1472 C  CG2 . VAL B 1 29  ? 26.398  20.847  20.026  1.00 24.93  ? 228  VAL B CG2 1 
ATOM   1473 N  N   . SER B 1 30  ? 29.778  21.957  21.656  1.00 34.58  ? 229  SER B N   1 
ATOM   1474 C  CA  . SER B 1 30  ? 30.558  22.848  22.500  1.00 28.71  ? 229  SER B CA  1 
ATOM   1475 C  C   . SER B 1 30  ? 32.055  22.554  22.436  1.00 36.10  ? 229  SER B C   1 
ATOM   1476 O  O   . SER B 1 30  ? 32.846  23.425  22.811  1.00 35.21  ? 229  SER B O   1 
ATOM   1477 C  CB  . SER B 1 30  ? 30.107  22.770  23.965  1.00 14.26  ? 229  SER B CB  1 
ATOM   1478 O  OG  . SER B 1 30  ? 30.073  21.412  24.381  1.00 23.93  ? 229  SER B OG  1 
ATOM   1479 N  N   . TYR B 1 31  ? 32.378  21.356  21.978  1.00 34.31  ? 230  TYR B N   1 
ATOM   1480 C  CA  . TYR B 1 31  ? 33.774  20.905  21.838  1.00 33.24  ? 230  TYR B CA  1 
ATOM   1481 C  C   . TYR B 1 31  ? 34.153  20.954  20.345  1.00 41.11  ? 230  TYR B C   1 
ATOM   1482 O  O   . TYR B 1 31  ? 35.270  21.356  20.022  1.00 26.86  ? 230  TYR B O   1 
ATOM   1483 C  CB  . TYR B 1 31  ? 33.863  19.455  22.345  1.00 36.71  ? 230  TYR B CB  1 
ATOM   1484 C  CG  . TYR B 1 31  ? 35.255  18.885  22.461  1.00 47.18  ? 230  TYR B CG  1 
ATOM   1485 C  CD1 . TYR B 1 31  ? 35.914  18.358  21.357  1.00 52.02  ? 230  TYR B CD1 1 
ATOM   1486 C  CD2 . TYR B 1 31  ? 35.927  18.859  23.678  1.00 49.67  ? 230  TYR B CD2 1 
ATOM   1487 C  CE1 . TYR B 1 31  ? 37.186  17.832  21.451  1.00 53.05  ? 230  TYR B CE1 1 
ATOM   1488 C  CE2 . TYR B 1 31  ? 37.202  18.334  23.786  1.00 50.09  ? 230  TYR B CE2 1 
ATOM   1489 C  CZ  . TYR B 1 31  ? 37.830  17.822  22.670  1.00 50.42  ? 230  TYR B CZ  1 
ATOM   1490 O  OH  . TYR B 1 31  ? 39.097  17.296  22.765  1.00 34.33  ? 230  TYR B OH  1 
ATOM   1491 N  N   . SER B 1 32  ? 33.251  20.570  19.440  1.00 44.99  ? 231  SER B N   1 
ATOM   1492 C  CA  . SER B 1 32  ? 33.549  20.628  18.016  1.00 39.08  ? 231  SER B CA  1 
ATOM   1493 C  C   . SER B 1 32  ? 32.305  20.929  17.180  1.00 50.53  ? 231  SER B C   1 
ATOM   1494 O  O   . SER B 1 32  ? 31.365  20.140  17.120  1.00 59.32  ? 231  SER B O   1 
ATOM   1495 C  CB  . SER B 1 32  ? 34.190  19.319  17.546  1.00 34.10  ? 231  SER B CB  1 
ATOM   1496 O  OG  . SER B 1 32  ? 34.314  19.311  16.130  1.00 34.89  ? 231  SER B OG  1 
ATOM   1497 N  N   . LYS B 1 33  ? 32.333  22.088  16.537  1.00 57.87  ? 232  LYS B N   1 
ATOM   1498 C  CA  . LYS B 1 33  ? 31.310  22.573  15.631  1.00 54.95  ? 232  LYS B CA  1 
ATOM   1499 C  C   . LYS B 1 33  ? 31.416  21.906  14.261  1.00 54.04  ? 232  LYS B C   1 
ATOM   1500 O  O   . LYS B 1 33  ? 30.443  21.885  13.507  1.00 56.60  ? 232  LYS B O   1 
ATOM   1501 C  CB  . LYS B 1 33  ? 31.423  24.090  15.468  1.00 54.81  ? 232  LYS B CB  1 
ATOM   1502 C  CG  . LYS B 1 33  ? 30.958  24.899  16.667  1.00 58.54  ? 232  LYS B CG  1 
ATOM   1503 C  CD  . LYS B 1 33  ? 31.281  26.375  16.478  1.00 58.99  ? 232  LYS B CD  1 
ATOM   1504 C  CE  . LYS B 1 33  ? 30.072  27.248  16.771  1.00 60.40  ? 232  LYS B CE  1 
ATOM   1505 N  NZ  . LYS B 1 33  ? 30.399  28.697  16.667  1.00 64.68  ? 232  LYS B NZ  1 
ATOM   1506 N  N   . LYS B 1 34  ? 32.591  21.369  13.949  1.00 57.09  ? 233  LYS B N   1 
ATOM   1507 C  CA  . LYS B 1 34  ? 32.851  20.706  12.678  1.00 58.12  ? 233  LYS B CA  1 
ATOM   1508 C  C   . LYS B 1 34  ? 32.131  19.363  12.593  1.00 53.71  ? 233  LYS B C   1 
ATOM   1509 O  O   . LYS B 1 34  ? 31.351  19.125  11.672  1.00 52.36  ? 233  LYS B O   1 
ATOM   1510 C  CB  . LYS B 1 34  ? 34.353  20.498  12.462  1.00 58.98  ? 233  LYS B CB  1 
ATOM   1511 C  CG  . LYS B 1 34  ? 35.186  21.756  12.633  1.00 64.94  ? 233  LYS B CG  1 
ATOM   1512 C  CD  . LYS B 1 34  ? 36.336  21.820  11.637  1.00 65.47  ? 233  LYS B CD  1 
ATOM   1513 C  CE  . LYS B 1 34  ? 36.871  23.240  11.519  1.00 66.38  ? 233  LYS B CE  1 
ATOM   1514 N  NZ  . LYS B 1 34  ? 37.104  23.632  10.101  1.00 71.96  ? 233  LYS B NZ  1 
ATOM   1515 N  N   . GLU B 1 35  ? 32.408  18.494  13.557  1.00 50.73  ? 234  GLU B N   1 
ATOM   1516 C  CA  . GLU B 1 35  ? 31.743  17.187  13.624  1.00 41.98  ? 234  GLU B CA  1 
ATOM   1517 C  C   . GLU B 1 35  ? 31.377  16.866  15.085  1.00 32.30  ? 234  GLU B C   1 
ATOM   1518 O  O   . GLU B 1 35  ? 32.203  16.428  15.888  1.00 41.90  ? 234  GLU B O   1 
ATOM   1519 C  CB  . GLU B 1 35  ? 32.719  16.092  13.117  1.00 48.98  ? 234  GLU B CB  1 
ATOM   1520 C  CG  . GLU B 1 35  ? 33.460  16.441  11.839  1.00 50.55  ? 234  GLU B CG  1 
ATOM   1521 C  CD  . GLU B 1 35  ? 32.912  15.720  10.621  1.00 52.90  ? 234  GLU B CD  1 
ATOM   1522 O  OE1 . GLU B 1 35  ? 32.895  14.470  10.632  1.00 47.76  ? 234  GLU B OE1 1 
ATOM   1523 O  OE2 . GLU B 1 35  ? 32.499  16.401  9.654   1.00 59.97  ? 234  GLU B OE2 1 
ATOM   1524 N  N   . HIS B 1 36  ? 30.109  17.092  15.403  1.00 29.18  ? 235  HIS B N   1 
ATOM   1525 C  CA  . HIS B 1 36  ? 29.535  16.677  16.687  1.00 27.64  ? 235  HIS B CA  1 
ATOM   1526 C  C   . HIS B 1 36  ? 28.512  15.580  16.410  1.00 25.82  ? 235  HIS B C   1 
ATOM   1527 O  O   . HIS B 1 36  ? 28.183  15.338  15.246  1.00 40.87  ? 235  HIS B O   1 
ATOM   1528 C  CB  . HIS B 1 36  ? 28.915  17.831  17.460  1.00 27.13  ? 235  HIS B CB  1 
ATOM   1529 C  CG  . HIS B 1 36  ? 27.939  18.646  16.668  1.00 36.75  ? 235  HIS B CG  1 
ATOM   1530 N  ND1 . HIS B 1 36  ? 28.332  19.596  15.745  1.00 31.58  ? 235  HIS B ND1 1 
ATOM   1531 C  CD2 . HIS B 1 36  ? 26.585  18.658  16.658  1.00 32.50  ? 235  HIS B CD2 1 
ATOM   1532 C  CE1 . HIS B 1 36  ? 27.268  20.159  15.199  1.00 23.02  ? 235  HIS B CE1 1 
ATOM   1533 N  NE2 . HIS B 1 36  ? 26.196  19.605  15.737  1.00 28.74  ? 235  HIS B NE2 1 
ATOM   1534 N  N   . TYR B 1 37  ? 28.020  14.901  17.436  1.00 33.06  ? 236  TYR B N   1 
ATOM   1535 C  CA  . TYR B 1 37  ? 27.162  13.753  17.250  1.00 27.38  ? 236  TYR B CA  1 
ATOM   1536 C  C   . TYR B 1 37  ? 25.773  14.025  16.729  1.00 28.76  ? 236  TYR B C   1 
ATOM   1537 O  O   . TYR B 1 37  ? 24.946  13.102  16.768  1.00 25.16  ? 236  TYR B O   1 
ATOM   1538 C  CB  . TYR B 1 37  ? 27.112  12.919  18.521  1.00 34.60  ? 236  TYR B CB  1 
ATOM   1539 C  CG  . TYR B 1 37  ? 26.501  13.652  19.692  1.00 40.84  ? 236  TYR B CG  1 
ATOM   1540 C  CD1 . TYR B 1 37  ? 25.132  13.611  19.929  1.00 45.63  ? 236  TYR B CD1 1 
ATOM   1541 C  CD2 . TYR B 1 37  ? 27.278  14.388  20.576  1.00 36.58  ? 236  TYR B CD2 1 
ATOM   1542 C  CE1 . TYR B 1 37  ? 24.546  14.268  20.988  1.00 45.04  ? 236  TYR B CE1 1 
ATOM   1543 C  CE2 . TYR B 1 37  ? 26.699  15.053  21.644  1.00 38.55  ? 236  TYR B CE2 1 
ATOM   1544 C  CZ  . TYR B 1 37  ? 25.340  14.994  21.851  1.00 40.87  ? 236  TYR B CZ  1 
ATOM   1545 O  OH  . TYR B 1 37  ? 24.749  15.650  22.911  1.00 27.10  ? 236  TYR B OH  1 
ATOM   1546 N  N   . GLU B 1 38  ? 25.434  15.234  16.301  1.00 32.67  ? 237  GLU B N   1 
ATOM   1547 C  CA  . GLU B 1 38  ? 24.043  15.588  16.032  1.00 26.46  ? 237  GLU B CA  1 
ATOM   1548 C  C   . GLU B 1 38  ? 23.368  14.680  15.018  1.00 20.20  ? 237  GLU B C   1 
ATOM   1549 O  O   . GLU B 1 38  ? 22.274  14.150  15.213  1.00 23.90  ? 237  GLU B O   1 
ATOM   1550 C  CB  . GLU B 1 38  ? 23.937  17.034  15.521  1.00 30.76  ? 237  GLU B CB  1 
ATOM   1551 C  CG  . GLU B 1 38  ? 22.712  17.269  14.648  1.00 33.66  ? 237  GLU B CG  1 
ATOM   1552 C  CD  . GLU B 1 38  ? 21.948  18.522  15.020  1.00 36.31  ? 237  GLU B CD  1 
ATOM   1553 O  OE1 . GLU B 1 38  ? 21.673  18.724  16.221  1.00 27.93  ? 237  GLU B OE1 1 
ATOM   1554 O  OE2 . GLU B 1 38  ? 21.613  19.315  14.115  1.00 42.18  ? 237  GLU B OE2 1 
ATOM   1555 N  N   . THR B 1 39  ? 24.024  14.499  13.878  1.00 24.32  ? 238  THR B N   1 
ATOM   1556 C  CA  . THR B 1 39  ? 23.400  13.709  12.818  1.00 28.03  ? 238  THR B CA  1 
ATOM   1557 C  C   . THR B 1 39  ? 23.354  12.226  13.135  1.00 26.08  ? 238  THR B C   1 
ATOM   1558 O  O   . THR B 1 39  ? 22.387  11.537  12.796  1.00 35.06  ? 238  THR B O   1 
ATOM   1559 C  CB  . THR B 1 39  ? 24.144  13.969  11.493  1.00 27.65  ? 238  THR B CB  1 
ATOM   1560 O  OG1 . THR B 1 39  ? 23.871  15.325  11.112  1.00 26.29  ? 238  THR B OG1 1 
ATOM   1561 C  CG2 . THR B 1 39  ? 23.626  13.062  10.394  1.00 32.67  ? 238  THR B CG2 1 
ATOM   1562 N  N   . LEU B 1 40  ? 24.377  11.698  13.798  1.00 29.70  ? 239  LEU B N   1 
ATOM   1563 C  CA  . LEU B 1 40  ? 24.372  10.280  14.159  1.00 29.01  ? 239  LEU B CA  1 
ATOM   1564 C  C   . LEU B 1 40  ? 23.245  9.967   15.136  1.00 25.02  ? 239  LEU B C   1 
ATOM   1565 O  O   . LEU B 1 40  ? 22.506  8.999   14.943  1.00 32.03  ? 239  LEU B O   1 
ATOM   1566 C  CB  . LEU B 1 40  ? 25.727  9.872   14.750  1.00 28.26  ? 239  LEU B CB  1 
ATOM   1567 C  CG  . LEU B 1 40  ? 26.886  9.784   13.745  1.00 19.48  ? 239  LEU B CG  1 
ATOM   1568 C  CD1 . LEU B 1 40  ? 28.239  9.969   14.417  1.00 12.74  ? 239  LEU B CD1 1 
ATOM   1569 C  CD2 . LEU B 1 40  ? 26.828  8.458   13.012  1.00 8.22   ? 239  LEU B CD2 1 
ATOM   1570 N  N   . GLU B 1 41  ? 23.120  10.772  16.186  1.00 20.75  ? 240  GLU B N   1 
ATOM   1571 C  CA  . GLU B 1 41  ? 22.056  10.579  17.168  1.00 27.02  ? 240  GLU B CA  1 
ATOM   1572 C  C   . GLU B 1 41  ? 20.678  10.582  16.501  1.00 18.73  ? 240  GLU B C   1 
ATOM   1573 O  O   . GLU B 1 41  ? 19.812  9.820   16.917  1.00 19.14  ? 240  GLU B O   1 
ATOM   1574 C  CB  . GLU B 1 41  ? 22.106  11.649  18.258  1.00 31.48  ? 240  GLU B CB  1 
ATOM   1575 C  CG  . GLU B 1 41  ? 21.165  12.814  18.041  1.00 34.30  ? 240  GLU B CG  1 
ATOM   1576 C  CD  . GLU B 1 41  ? 20.300  13.176  19.227  1.00 33.74  ? 240  GLU B CD  1 
ATOM   1577 O  OE1 . GLU B 1 41  ? 19.491  12.346  19.696  1.00 48.57  ? 240  GLU B OE1 1 
ATOM   1578 O  OE2 . GLU B 1 41  ? 20.421  14.327  19.700  1.00 27.14  ? 240  GLU B OE2 1 
ATOM   1579 N  N   . PHE B 1 42  ? 20.487  11.413  15.479  1.00 20.86  ? 241  PHE B N   1 
ATOM   1580 C  CA  . PHE B 1 42  ? 19.267  11.371  14.682  1.00 22.83  ? 241  PHE B CA  1 
ATOM   1581 C  C   . PHE B 1 42  ? 19.097  9.960   14.123  1.00 24.30  ? 241  PHE B C   1 
ATOM   1582 O  O   . PHE B 1 42  ? 18.042  9.349   14.312  1.00 27.14  ? 241  PHE B O   1 
ATOM   1583 C  CB  . PHE B 1 42  ? 19.249  12.398  13.551  1.00 26.47  ? 241  PHE B CB  1 
ATOM   1584 C  CG  . PHE B 1 42  ? 17.879  12.574  12.899  1.00 31.21  ? 241  PHE B CG  1 
ATOM   1585 C  CD1 . PHE B 1 42  ? 17.455  11.736  11.882  1.00 34.82  ? 241  PHE B CD1 1 
ATOM   1586 C  CD2 . PHE B 1 42  ? 17.016  13.574  13.306  1.00 31.74  ? 241  PHE B CD2 1 
ATOM   1587 C  CE1 . PHE B 1 42  ? 16.215  11.887  11.289  1.00 33.26  ? 241  PHE B CE1 1 
ATOM   1588 C  CE2 . PHE B 1 42  ? 15.773  13.739  12.722  1.00 25.07  ? 241  PHE B CE2 1 
ATOM   1589 C  CZ  . PHE B 1 42  ? 15.363  12.891  11.709  1.00 24.59  ? 241  PHE B CZ  1 
ATOM   1590 N  N   . LEU B 1 43  ? 20.127  9.446   13.448  1.00 17.16  ? 242  LEU B N   1 
ATOM   1591 C  CA  . LEU B 1 43  ? 20.047  8.061   12.994  1.00 11.62  ? 242  LEU B CA  1 
ATOM   1592 C  C   . LEU B 1 43  ? 19.840  7.126   14.188  1.00 13.04  ? 242  LEU B C   1 
ATOM   1593 O  O   . LEU B 1 43  ? 18.904  6.327   14.173  1.00 14.95  ? 242  LEU B O   1 
ATOM   1594 C  CB  . LEU B 1 43  ? 21.291  7.615   12.234  1.00 15.71  ? 242  LEU B CB  1 
ATOM   1595 C  CG  . LEU B 1 43  ? 21.247  6.212   11.620  1.00 25.33  ? 242  LEU B CG  1 
ATOM   1596 C  CD1 . LEU B 1 43  ? 19.916  5.951   10.928  1.00 7.94   ? 242  LEU B CD1 1 
ATOM   1597 C  CD2 . LEU B 1 43  ? 22.398  6.021   10.639  1.00 15.82  ? 242  LEU B CD2 1 
ATOM   1598 N  N   . GLY B 1 44  ? 20.714  7.229   15.178  1.00 15.23  ? 243  GLY B N   1 
ATOM   1599 C  CA  . GLY B 1 44  ? 20.723  6.382   16.359  1.00 13.98  ? 243  GLY B CA  1 
ATOM   1600 C  C   . GLY B 1 44  ? 19.391  6.300   17.081  1.00 13.87  ? 243  GLY B C   1 
ATOM   1601 O  O   . GLY B 1 44  ? 19.035  5.299   17.707  1.00 19.35  ? 243  GLY B O   1 
ATOM   1602 N  N   . ASP B 1 45  ? 18.608  7.370   17.025  1.00 16.02  ? 244  ASP B N   1 
ATOM   1603 C  CA  . ASP B 1 45  ? 17.273  7.358   17.633  1.00 16.70  ? 244  ASP B CA  1 
ATOM   1604 C  C   . ASP B 1 45  ? 16.472  6.198   17.052  1.00 22.68  ? 244  ASP B C   1 
ATOM   1605 O  O   . ASP B 1 45  ? 16.014  5.336   17.801  1.00 14.61  ? 244  ASP B O   1 
ATOM   1606 C  CB  . ASP B 1 45  ? 16.615  8.700   17.367  1.00 20.73  ? 244  ASP B CB  1 
ATOM   1607 C  CG  . ASP B 1 45  ? 15.189  8.873   17.818  1.00 17.73  ? 244  ASP B CG  1 
ATOM   1608 O  OD1 . ASP B 1 45  ? 14.391  7.917   17.764  1.00 25.76  ? 244  ASP B OD1 1 
ATOM   1609 O  OD2 . ASP B 1 45  ? 14.863  10.004  18.239  1.00 29.46  ? 244  ASP B OD2 1 
ATOM   1610 N  N   . ALA B 1 46  ? 16.358  6.227   15.728  1.00 21.14  ? 245  ALA B N   1 
ATOM   1611 C  CA  . ALA B 1 46  ? 15.579  5.302   14.921  1.00 15.50  ? 245  ALA B CA  1 
ATOM   1612 C  C   . ALA B 1 46  ? 16.101  3.873   14.988  1.00 16.13  ? 245  ALA B C   1 
ATOM   1613 O  O   . ALA B 1 46  ? 15.328  2.912   15.010  1.00 19.29  ? 245  ALA B O   1 
ATOM   1614 C  CB  . ALA B 1 46  ? 15.564  5.786   13.474  1.00 11.28  ? 245  ALA B CB  1 
ATOM   1615 N  N   . LEU B 1 47  ? 17.416  3.756   15.007  1.00 17.38  ? 246  LEU B N   1 
ATOM   1616 C  CA  . LEU B 1 47  ? 18.197  2.541   15.161  1.00 15.35  ? 246  LEU B CA  1 
ATOM   1617 C  C   . LEU B 1 47  ? 17.860  1.807   16.448  1.00 15.11  ? 246  LEU B C   1 
ATOM   1618 O  O   . LEU B 1 47  ? 17.314  0.707   16.519  1.00 10.55  ? 246  LEU B O   1 
ATOM   1619 C  CB  . LEU B 1 47  ? 19.672  2.943   15.179  1.00 29.42  ? 246  LEU B CB  1 
ATOM   1620 C  CG  . LEU B 1 47  ? 20.757  2.041   14.613  1.00 35.45  ? 246  LEU B CG  1 
ATOM   1621 C  CD1 . LEU B 1 47  ? 21.860  1.833   15.647  1.00 32.17  ? 246  LEU B CD1 1 
ATOM   1622 C  CD2 . LEU B 1 47  ? 20.189  0.712   14.145  1.00 30.68  ? 246  LEU B CD2 1 
ATOM   1623 N  N   . VAL B 1 48  ? 18.229  2.435   17.568  1.00 16.96  ? 247  VAL B N   1 
ATOM   1624 C  CA  . VAL B 1 48  ? 17.944  1.801   18.854  1.00 19.19  ? 247  VAL B CA  1 
ATOM   1625 C  C   . VAL B 1 48  ? 16.448  1.634   19.096  1.00 19.95  ? 247  VAL B C   1 
ATOM   1626 O  O   . VAL B 1 48  ? 16.040  0.696   19.788  1.00 33.63  ? 247  VAL B O   1 
ATOM   1627 C  CB  . VAL B 1 48  ? 18.573  2.607   20.009  1.00 15.26  ? 247  VAL B CB  1 
ATOM   1628 C  CG1 . VAL B 1 48  ? 17.950  2.209   21.337  1.00 17.42  ? 247  VAL B CG1 1 
ATOM   1629 C  CG2 . VAL B 1 48  ? 20.077  2.384   19.999  1.00 10.90  ? 247  VAL B CG2 1 
ATOM   1630 N  N   . ASN B 1 49  ? 15.616  2.516   18.545  1.00 23.16  ? 248  ASN B N   1 
ATOM   1631 C  CA  . ASN B 1 49  ? 14.169  2.346   18.705  1.00 27.83  ? 248  ASN B CA  1 
ATOM   1632 C  C   . ASN B 1 49  ? 13.726  0.962   18.235  1.00 26.43  ? 248  ASN B C   1 
ATOM   1633 O  O   . ASN B 1 49  ? 12.993  0.259   18.943  1.00 15.66  ? 248  ASN B O   1 
ATOM   1634 C  CB  . ASN B 1 49  ? 13.413  3.443   17.948  1.00 25.60  ? 248  ASN B CB  1 
ATOM   1635 C  CG  . ASN B 1 49  ? 11.911  3.251   18.033  1.00 28.80  ? 248  ASN B CG  1 
ATOM   1636 O  OD1 . ASN B 1 49  ? 11.314  3.401   19.098  1.00 23.07  ? 248  ASN B OD1 1 
ATOM   1637 N  ND2 . ASN B 1 49  ? 11.286  2.907   16.914  1.00 34.17  ? 248  ASN B ND2 1 
ATOM   1638 N  N   . PHE B 1 50  ? 14.185  0.583   17.042  1.00 19.27  ? 249  PHE B N   1 
ATOM   1639 C  CA  . PHE B 1 50  ? 13.867  -0.706  16.426  1.00 17.84  ? 249  PHE B CA  1 
ATOM   1640 C  C   . PHE B 1 50  ? 14.516  -1.859  17.175  1.00 20.50  ? 249  PHE B C   1 
ATOM   1641 O  O   . PHE B 1 50  ? 13.870  -2.904  17.289  1.00 16.46  ? 249  PHE B O   1 
ATOM   1642 C  CB  . PHE B 1 50  ? 14.280  -0.746  14.955  1.00 20.01  ? 249  PHE B CB  1 
ATOM   1643 C  CG  . PHE B 1 50  ? 14.698  -2.063  14.335  1.00 22.22  ? 249  PHE B CG  1 
ATOM   1644 C  CD1 . PHE B 1 50  ? 13.847  -3.144  14.217  1.00 19.58  ? 249  PHE B CD1 1 
ATOM   1645 C  CD2 . PHE B 1 50  ? 15.988  -2.219  13.839  1.00 28.23  ? 249  PHE B CD2 1 
ATOM   1646 C  CE1 . PHE B 1 50  ? 14.247  -4.338  13.644  1.00 27.27  ? 249  PHE B CE1 1 
ATOM   1647 C  CE2 . PHE B 1 50  ? 16.406  -3.409  13.272  1.00 29.51  ? 249  PHE B CE2 1 
ATOM   1648 C  CZ  . PHE B 1 50  ? 15.539  -4.480  13.161  1.00 31.04  ? 249  PHE B CZ  1 
ATOM   1649 N  N   . PHE B 1 51  ? 15.752  -1.717  17.659  1.00 25.57  ? 250  PHE B N   1 
ATOM   1650 C  CA  . PHE B 1 51  ? 16.328  -2.832  18.412  1.00 17.30  ? 250  PHE B CA  1 
ATOM   1651 C  C   . PHE B 1 51  ? 15.421  -3.172  19.596  1.00 8.64   ? 250  PHE B C   1 
ATOM   1652 O  O   . PHE B 1 51  ? 15.066  -4.310  19.855  1.00 14.35  ? 250  PHE B O   1 
ATOM   1653 C  CB  . PHE B 1 51  ? 17.717  -2.546  18.967  1.00 15.90  ? 250  PHE B CB  1 
ATOM   1654 C  CG  . PHE B 1 51  ? 18.822  -2.285  17.964  1.00 19.51  ? 250  PHE B CG  1 
ATOM   1655 C  CD1 . PHE B 1 51  ? 18.675  -2.578  16.621  1.00 15.98  ? 250  PHE B CD1 1 
ATOM   1656 C  CD2 . PHE B 1 51  ? 20.014  -1.730  18.399  1.00 22.23  ? 250  PHE B CD2 1 
ATOM   1657 C  CE1 . PHE B 1 51  ? 19.699  -2.313  15.732  1.00 20.32  ? 250  PHE B CE1 1 
ATOM   1658 C  CE2 . PHE B 1 51  ? 21.051  -1.472  17.521  1.00 27.85  ? 250  PHE B CE2 1 
ATOM   1659 C  CZ  . PHE B 1 51  ? 20.895  -1.780  16.182  1.00 22.33  ? 250  PHE B CZ  1 
ATOM   1660 N  N   . ILE B 1 52  ? 15.055  -2.130  20.336  1.00 20.23  ? 251  ILE B N   1 
ATOM   1661 C  CA  . ILE B 1 52  ? 14.285  -2.362  21.557  1.00 14.82  ? 251  ILE B CA  1 
ATOM   1662 C  C   . ILE B 1 52  ? 12.928  -2.976  21.258  1.00 13.47  ? 251  ILE B C   1 
ATOM   1663 O  O   . ILE B 1 52  ? 12.542  -3.992  21.827  1.00 25.84  ? 251  ILE B O   1 
ATOM   1664 C  CB  . ILE B 1 52  ? 14.100  -1.029  22.300  1.00 12.42  ? 251  ILE B CB  1 
ATOM   1665 C  CG1 . ILE B 1 52  ? 15.296  -0.608  23.155  1.00 14.52  ? 251  ILE B CG1 1 
ATOM   1666 C  CG2 . ILE B 1 52  ? 12.818  -1.076  23.122  1.00 17.40  ? 251  ILE B CG2 1 
ATOM   1667 C  CD1 . ILE B 1 52  ? 16.615  -0.628  22.409  1.00 30.12  ? 251  ILE B CD1 1 
ATOM   1668 N  N   . VAL B 1 53  ? 12.200  -2.334  20.351  1.00 20.17  ? 252  VAL B N   1 
ATOM   1669 C  CA  . VAL B 1 53  ? 10.865  -2.768  19.966  1.00 18.79  ? 252  VAL B CA  1 
ATOM   1670 C  C   . VAL B 1 53  ? 10.849  -4.209  19.483  1.00 21.93  ? 252  VAL B C   1 
ATOM   1671 O  O   . VAL B 1 53  ? 9.927   -4.958  19.798  1.00 26.69  ? 252  VAL B O   1 
ATOM   1672 C  CB  . VAL B 1 53  ? 10.309  -1.841  18.865  1.00 26.17  ? 252  VAL B CB  1 
ATOM   1673 C  CG1 . VAL B 1 53  ? 9.026   -2.407  18.278  1.00 39.74  ? 252  VAL B CG1 1 
ATOM   1674 C  CG2 . VAL B 1 53  ? 10.087  -0.448  19.431  1.00 25.20  ? 252  VAL B CG2 1 
ATOM   1675 N  N   . ASP B 1 54  ? 11.858  -4.623  18.718  1.00 25.53  ? 253  ASP B N   1 
ATOM   1676 C  CA  . ASP B 1 54  ? 11.921  -5.998  18.220  1.00 22.80  ? 253  ASP B CA  1 
ATOM   1677 C  C   . ASP B 1 54  ? 11.963  -6.996  19.373  1.00 22.53  ? 253  ASP B C   1 
ATOM   1678 O  O   . ASP B 1 54  ? 11.351  -8.062  19.337  1.00 9.04   ? 253  ASP B O   1 
ATOM   1679 C  CB  . ASP B 1 54  ? 13.136  -6.190  17.312  1.00 16.93  ? 253  ASP B CB  1 
ATOM   1680 C  CG  . ASP B 1 54  ? 13.139  -7.497  16.553  1.00 18.31  ? 253  ASP B CG  1 
ATOM   1681 O  OD1 . ASP B 1 54  ? 12.061  -8.058  16.265  1.00 20.92  ? 253  ASP B OD1 1 
ATOM   1682 O  OD2 . ASP B 1 54  ? 14.246  -7.983  16.227  1.00 27.31  ? 253  ASP B OD2 1 
ATOM   1683 N  N   . LEU B 1 55  ? 12.709  -6.627  20.405  1.00 27.08  ? 254  LEU B N   1 
ATOM   1684 C  CA  . LEU B 1 55  ? 12.861  -7.419  21.615  1.00 31.01  ? 254  LEU B CA  1 
ATOM   1685 C  C   . LEU B 1 55  ? 11.540  -7.476  22.384  1.00 26.27  ? 254  LEU B C   1 
ATOM   1686 O  O   . LEU B 1 55  ? 11.106  -8.543  22.813  1.00 28.18  ? 254  LEU B O   1 
ATOM   1687 C  CB  . LEU B 1 55  ? 13.940  -6.805  22.503  1.00 38.59  ? 254  LEU B CB  1 
ATOM   1688 C  CG  . LEU B 1 55  ? 15.200  -7.609  22.798  1.00 40.50  ? 254  LEU B CG  1 
ATOM   1689 C  CD1 . LEU B 1 55  ? 15.530  -8.561  21.662  1.00 30.90  ? 254  LEU B CD1 1 
ATOM   1690 C  CD2 . LEU B 1 55  ? 16.364  -6.663  23.071  1.00 27.46  ? 254  LEU B CD2 1 
ATOM   1691 N  N   . LEU B 1 56  ? 10.955  -6.297  22.535  1.00 27.46  ? 255  LEU B N   1 
ATOM   1692 C  CA  . LEU B 1 56  ? 9.699   -6.052  23.235  1.00 24.36  ? 255  LEU B CA  1 
ATOM   1693 C  C   . LEU B 1 56  ? 8.601   -6.943  22.663  1.00 24.29  ? 255  LEU B C   1 
ATOM   1694 O  O   . LEU B 1 56  ? 7.876   -7.618  23.390  1.00 24.78  ? 255  LEU B O   1 
ATOM   1695 C  CB  . LEU B 1 56  ? 9.306   -4.585  23.116  1.00 19.62  ? 255  LEU B CB  1 
ATOM   1696 C  CG  . LEU B 1 56  ? 8.697   -3.884  24.326  1.00 24.93  ? 255  LEU B CG  1 
ATOM   1697 C  CD1 . LEU B 1 56  ? 7.941   -2.638  23.885  1.00 31.76  ? 255  LEU B CD1 1 
ATOM   1698 C  CD2 . LEU B 1 56  ? 7.787   -4.819  25.108  1.00 21.41  ? 255  LEU B CD2 1 
ATOM   1699 N  N   . VAL B 1 57  ? 8.509   -6.938  21.341  1.00 20.95  ? 256  VAL B N   1 
ATOM   1700 C  CA  . VAL B 1 57  ? 7.527   -7.716  20.600  1.00 22.23  ? 256  VAL B CA  1 
ATOM   1701 C  C   . VAL B 1 57  ? 7.664   -9.211  20.808  1.00 25.08  ? 256  VAL B C   1 
ATOM   1702 O  O   . VAL B 1 57  ? 6.688   -9.942  21.002  1.00 42.91  ? 256  VAL B O   1 
ATOM   1703 C  CB  . VAL B 1 57  ? 7.672   -7.391  19.096  1.00 26.87  ? 256  VAL B CB  1 
ATOM   1704 C  CG1 . VAL B 1 57  ? 7.647   -8.660  18.264  1.00 29.67  ? 256  VAL B CG1 1 
ATOM   1705 C  CG2 . VAL B 1 57  ? 6.585   -6.408  18.700  1.00 11.43  ? 256  VAL B CG2 1 
ATOM   1706 N  N   . GLN B 1 58  ? 8.890   -9.735  20.772  1.00 27.07  ? 257  GLN B N   1 
ATOM   1707 C  CA  . GLN B 1 58  ? 9.009   -11.173 20.988  1.00 32.93  ? 257  GLN B CA  1 
ATOM   1708 C  C   . GLN B 1 58  ? 9.006   -11.551 22.459  1.00 31.30  ? 257  GLN B C   1 
ATOM   1709 O  O   . GLN B 1 58  ? 8.589   -12.671 22.765  1.00 43.64  ? 257  GLN B O   1 
ATOM   1710 C  CB  . GLN B 1 58  ? 10.290  -11.711 20.342  1.00 29.80  ? 257  GLN B CB  1 
ATOM   1711 C  CG  . GLN B 1 58  ? 10.832  -10.806 19.249  1.00 30.83  ? 257  GLN B CG  1 
ATOM   1712 C  CD  . GLN B 1 58  ? 12.331  -10.979 19.089  1.00 32.76  ? 257  GLN B CD  1 
ATOM   1713 O  OE1 . GLN B 1 58  ? 12.798  -12.112 18.948  1.00 34.96  ? 257  GLN B OE1 1 
ATOM   1714 N  NE2 . GLN B 1 58  ? 13.060  -9.872  19.125  1.00 35.71  ? 257  GLN B NE2 1 
ATOM   1715 N  N   . TYR B 1 59  ? 9.456   -10.695 23.379  1.00 28.34  ? 258  TYR B N   1 
ATOM   1716 C  CA  . TYR B 1 59  ? 9.567   -11.210 24.752  1.00 33.31  ? 258  TYR B CA  1 
ATOM   1717 C  C   . TYR B 1 59  ? 8.430   -10.808 25.667  1.00 37.68  ? 258  TYR B C   1 
ATOM   1718 O  O   . TYR B 1 59  ? 8.121   -11.548 26.610  1.00 39.52  ? 258  TYR B O   1 
ATOM   1719 C  CB  . TYR B 1 59  ? 10.933  -10.792 25.345  1.00 33.84  ? 258  TYR B CB  1 
ATOM   1720 C  CG  . TYR B 1 59  ? 12.001  -11.713 24.777  1.00 30.43  ? 258  TYR B CG  1 
ATOM   1721 C  CD1 . TYR B 1 59  ? 12.145  -13.010 25.252  1.00 32.58  ? 258  TYR B CD1 1 
ATOM   1722 C  CD2 . TYR B 1 59  ? 12.842  -11.276 23.762  1.00 29.06  ? 258  TYR B CD2 1 
ATOM   1723 C  CE1 . TYR B 1 59  ? 13.113  -13.853 24.733  1.00 33.20  ? 258  TYR B CE1 1 
ATOM   1724 C  CE2 . TYR B 1 59  ? 13.809  -12.118 23.242  1.00 27.44  ? 258  TYR B CE2 1 
ATOM   1725 C  CZ  . TYR B 1 59  ? 13.940  -13.400 23.728  1.00 25.14  ? 258  TYR B CZ  1 
ATOM   1726 O  OH  . TYR B 1 59  ? 14.906  -14.229 23.205  1.00 23.84  ? 258  TYR B OH  1 
ATOM   1727 N  N   . SER B 1 60  ? 7.769   -9.674  25.447  1.00 41.12  ? 259  SER B N   1 
ATOM   1728 C  CA  . SER B 1 60  ? 6.664   -9.331  26.341  1.00 42.32  ? 259  SER B CA  1 
ATOM   1729 C  C   . SER B 1 60  ? 5.582   -10.410 26.299  1.00 49.78  ? 259  SER B C   1 
ATOM   1730 O  O   . SER B 1 60  ? 5.333   -11.033 25.269  1.00 48.56  ? 259  SER B O   1 
ATOM   1731 C  CB  . SER B 1 60  ? 6.044   -7.979  25.999  1.00 44.90  ? 259  SER B CB  1 
ATOM   1732 O  OG  . SER B 1 60  ? 4.884   -7.732  26.784  1.00 54.41  ? 259  SER B OG  1 
ATOM   1733 N  N   . PRO B 1 61  ? 4.953   -10.594 27.453  1.00 52.69  ? 260  PRO B N   1 
ATOM   1734 C  CA  . PRO B 1 61  ? 3.888   -11.585 27.607  1.00 56.11  ? 260  PRO B CA  1 
ATOM   1735 C  C   . PRO B 1 61  ? 2.629   -11.162 26.855  1.00 52.95  ? 260  PRO B C   1 
ATOM   1736 O  O   . PRO B 1 61  ? 1.968   -11.993 26.236  1.00 62.50  ? 260  PRO B O   1 
ATOM   1737 C  CB  . PRO B 1 61  ? 3.624   -11.585 29.115  1.00 60.96  ? 260  PRO B CB  1 
ATOM   1738 C  CG  . PRO B 1 61  ? 4.039   -10.223 29.567  1.00 59.46  ? 260  PRO B CG  1 
ATOM   1739 C  CD  . PRO B 1 61  ? 5.213   -9.852  28.700  1.00 56.97  ? 260  PRO B CD  1 
ATOM   1740 N  N   . ASN B 1 62  ? 2.316   -9.871  26.911  1.00 47.78  ? 261  ASN B N   1 
ATOM   1741 C  CA  . ASN B 1 62  ? 1.156   -9.324  26.213  1.00 46.04  ? 261  ASN B CA  1 
ATOM   1742 C  C   . ASN B 1 62  ? 1.552   -8.748  24.857  1.00 41.73  ? 261  ASN B C   1 
ATOM   1743 O  O   . ASN B 1 62  ? 2.316   -7.781  24.767  1.00 30.09  ? 261  ASN B O   1 
ATOM   1744 C  CB  . ASN B 1 62  ? 0.486   -8.247  27.066  1.00 45.59  ? 261  ASN B CB  1 
ATOM   1745 C  CG  . ASN B 1 62  ? -0.915  -8.580  27.521  1.00 52.30  ? 261  ASN B CG  1 
ATOM   1746 O  OD1 . ASN B 1 62  ? -1.278  -9.746  27.675  1.00 66.72  ? 261  ASN B OD1 1 
ATOM   1747 N  ND2 . ASN B 1 62  ? -1.724  -7.546  27.750  1.00 47.67  ? 261  ASN B ND2 1 
ATOM   1748 N  N   . LYS B 1 63  ? 1.041   -9.323  23.770  1.00 40.42  ? 262  LYS B N   1 
ATOM   1749 C  CA  . LYS B 1 63  ? 1.398   -8.811  22.447  1.00 41.11  ? 262  LYS B CA  1 
ATOM   1750 C  C   . LYS B 1 63  ? 0.438   -7.735  21.963  1.00 39.76  ? 262  LYS B C   1 
ATOM   1751 O  O   . LYS B 1 63  ? 0.420   -7.388  20.783  1.00 41.75  ? 262  LYS B O   1 
ATOM   1752 C  CB  . LYS B 1 63  ? 1.456   -9.960  21.432  1.00 36.91  ? 262  LYS B CB  1 
ATOM   1753 C  CG  . LYS B 1 63  ? 2.886   -10.380 21.110  1.00 38.09  ? 262  LYS B CG  1 
ATOM   1754 C  CD  . LYS B 1 63  ? 3.765   -10.262 22.345  1.00 35.75  ? 262  LYS B CD  1 
ATOM   1755 C  CE  . LYS B 1 63  ? 4.731   -11.426 22.456  1.00 33.40  ? 262  LYS B CE  1 
ATOM   1756 N  NZ  . LYS B 1 63  ? 4.295   -12.609 21.666  1.00 33.52  ? 262  LYS B NZ  1 
ATOM   1757 N  N   . ARG B 1 64  ? -0.368  -7.188  22.865  1.00 42.87  ? 263  ARG B N   1 
ATOM   1758 C  CA  . ARG B 1 64  ? -1.347  -6.173  22.472  1.00 48.36  ? 263  ARG B CA  1 
ATOM   1759 C  C   . ARG B 1 64  ? -0.726  -4.784  22.463  1.00 48.02  ? 263  ARG B C   1 
ATOM   1760 O  O   . ARG B 1 64  ? 0.146   -4.474  23.281  1.00 59.65  ? 263  ARG B O   1 
ATOM   1761 C  CB  . ARG B 1 64  ? -2.555  -6.251  23.416  1.00 53.29  ? 263  ARG B CB  1 
ATOM   1762 C  CG  . ARG B 1 64  ? -3.378  -7.522  23.246  1.00 51.83  ? 263  ARG B CG  1 
ATOM   1763 C  CD  . ARG B 1 64  ? -4.565  -7.284  22.326  1.00 57.17  ? 263  ARG B CD  1 
ATOM   1764 N  NE  . ARG B 1 64  ? -5.114  -8.509  21.767  1.00 67.64  ? 263  ARG B NE  1 
ATOM   1765 C  CZ  . ARG B 1 64  ? -5.524  -9.573  22.445  1.00 76.42  ? 263  ARG B CZ  1 
ATOM   1766 N  NH1 . ARG B 1 64  ? -5.461  -9.615  23.770  1.00 84.06  ? 263  ARG B NH1 1 
ATOM   1767 N  NH2 . ARG B 1 64  ? -6.004  -10.626 21.787  1.00 77.16  ? 263  ARG B NH2 1 
ATOM   1768 N  N   . GLU B 1 65  ? -1.146  -3.916  21.544  1.00 41.88  ? 264  GLU B N   1 
ATOM   1769 C  CA  . GLU B 1 65  ? -0.549  -2.589  21.468  1.00 38.75  ? 264  GLU B CA  1 
ATOM   1770 C  C   . GLU B 1 65  ? -0.772  -1.796  22.752  1.00 47.97  ? 264  GLU B C   1 
ATOM   1771 O  O   . GLU B 1 65  ? 0.031   -0.937  23.115  1.00 50.24  ? 264  GLU B O   1 
ATOM   1772 C  CB  . GLU B 1 65  ? -1.110  -1.783  20.296  1.00 26.05  ? 264  GLU B CB  1 
ATOM   1773 C  CG  . GLU B 1 65  ? -0.416  -0.439  20.120  1.00 23.24  ? 264  GLU B CG  1 
ATOM   1774 C  CD  . GLU B 1 65  ? -1.229  0.727   20.649  1.00 40.01  ? 264  GLU B CD  1 
ATOM   1775 O  OE1 . GLU B 1 65  ? -2.467  0.605   20.774  1.00 61.81  ? 264  GLU B OE1 1 
ATOM   1776 O  OE2 . GLU B 1 65  ? -0.633  1.788   20.939  1.00 55.32  ? 264  GLU B OE2 1 
ATOM   1777 N  N   . GLY B 1 66  ? -1.883  -2.102  23.415  1.00 47.27  ? 265  GLY B N   1 
ATOM   1778 C  CA  . GLY B 1 66  ? -2.248  -1.433  24.647  1.00 38.90  ? 265  GLY B CA  1 
ATOM   1779 C  C   . GLY B 1 66  ? -1.165  -1.560  25.706  1.00 33.78  ? 265  GLY B C   1 
ATOM   1780 O  O   . GLY B 1 66  ? -0.800  -0.538  26.279  1.00 18.73  ? 265  GLY B O   1 
ATOM   1781 N  N   . PHE B 1 67  ? -0.690  -2.775  25.938  1.00 36.10  ? 266  PHE B N   1 
ATOM   1782 C  CA  . PHE B 1 67  ? 0.293   -3.113  26.953  1.00 41.47  ? 266  PHE B CA  1 
ATOM   1783 C  C   . PHE B 1 67  ? 1.721   -2.797  26.519  1.00 43.08  ? 266  PHE B C   1 
ATOM   1784 O  O   . PHE B 1 67  ? 2.563   -2.423  27.338  1.00 23.99  ? 266  PHE B O   1 
ATOM   1785 C  CB  . PHE B 1 67  ? 0.197   -4.605  27.296  1.00 51.13  ? 266  PHE B CB  1 
ATOM   1786 C  CG  . PHE B 1 67  ? 1.220   -5.108  28.300  1.00 62.94  ? 266  PHE B CG  1 
ATOM   1787 C  CD1 . PHE B 1 67  ? 0.986   -4.981  29.661  1.00 65.56  ? 266  PHE B CD1 1 
ATOM   1788 C  CD2 . PHE B 1 67  ? 2.405   -5.707  27.900  1.00 66.00  ? 266  PHE B CD2 1 
ATOM   1789 C  CE1 . PHE B 1 67  ? 1.909   -5.435  30.584  1.00 66.30  ? 266  PHE B CE1 1 
ATOM   1790 C  CE2 . PHE B 1 67  ? 3.334   -6.162  28.814  1.00 65.75  ? 266  PHE B CE2 1 
ATOM   1791 C  CZ  . PHE B 1 67  ? 3.085   -6.027  30.168  1.00 64.83  ? 266  PHE B CZ  1 
ATOM   1792 N  N   . LEU B 1 68  ? 2.004   -2.979  25.230  1.00 37.82  ? 267  LEU B N   1 
ATOM   1793 C  CA  . LEU B 1 68  ? 3.349   -2.740  24.728  1.00 26.82  ? 267  LEU B CA  1 
ATOM   1794 C  C   . LEU B 1 68  ? 3.758   -1.281  24.842  1.00 23.98  ? 267  LEU B C   1 
ATOM   1795 O  O   . LEU B 1 68  ? 4.903   -0.956  25.157  1.00 31.21  ? 267  LEU B O   1 
ATOM   1796 C  CB  . LEU B 1 68  ? 3.450   -3.171  23.261  1.00 32.16  ? 267  LEU B CB  1 
ATOM   1797 C  CG  . LEU B 1 68  ? 3.607   -4.665  22.980  1.00 29.66  ? 267  LEU B CG  1 
ATOM   1798 C  CD1 . LEU B 1 68  ? 3.441   -4.928  21.491  1.00 29.15  ? 267  LEU B CD1 1 
ATOM   1799 C  CD2 . LEU B 1 68  ? 4.945   -5.192  23.478  1.00 31.66  ? 267  LEU B CD2 1 
ATOM   1800 N  N   . SER B 1 69  ? 2.843   -0.353  24.575  1.00 27.59  ? 268  SER B N   1 
ATOM   1801 C  CA  . SER B 1 69  ? 3.257   1.043   24.460  1.00 33.16  ? 268  SER B CA  1 
ATOM   1802 C  C   . SER B 1 69  ? 3.839   1.614   25.742  1.00 37.51  ? 268  SER B C   1 
ATOM   1803 O  O   . SER B 1 69  ? 4.950   2.157   25.695  1.00 39.83  ? 268  SER B O   1 
ATOM   1804 C  CB  . SER B 1 69  ? 2.078   1.896   23.974  1.00 40.98  ? 268  SER B CB  1 
ATOM   1805 O  OG  . SER B 1 69  ? 2.188   2.109   22.573  1.00 34.71  ? 268  SER B OG  1 
ATOM   1806 N  N   . PRO B 1 70  ? 3.163   1.538   26.879  1.00 46.80  ? 269  PRO B N   1 
ATOM   1807 C  CA  . PRO B 1 70  ? 3.718   2.138   28.104  1.00 47.34  ? 269  PRO B CA  1 
ATOM   1808 C  C   . PRO B 1 70  ? 5.073   1.549   28.491  1.00 38.41  ? 269  PRO B C   1 
ATOM   1809 O  O   . PRO B 1 70  ? 5.894   2.232   29.113  1.00 42.51  ? 269  PRO B O   1 
ATOM   1810 C  CB  . PRO B 1 70  ? 2.669   1.825   29.172  1.00 46.07  ? 269  PRO B CB  1 
ATOM   1811 C  CG  . PRO B 1 70  ? 1.800   0.759   28.605  1.00 44.44  ? 269  PRO B CG  1 
ATOM   1812 C  CD  . PRO B 1 70  ? 1.857   0.906   27.112  1.00 48.05  ? 269  PRO B CD  1 
ATOM   1813 N  N   . LEU B 1 71  ? 5.342   0.298   28.141  1.00 28.11  ? 270  LEU B N   1 
ATOM   1814 C  CA  . LEU B 1 71  ? 6.642   -0.318  28.405  1.00 29.34  ? 270  LEU B CA  1 
ATOM   1815 C  C   . LEU B 1 71  ? 7.692   0.270   27.463  1.00 38.32  ? 270  LEU B C   1 
ATOM   1816 O  O   . LEU B 1 71  ? 8.820   0.579   27.842  1.00 40.02  ? 270  LEU B O   1 
ATOM   1817 C  CB  . LEU B 1 71  ? 6.546   -1.827  28.227  1.00 26.35  ? 270  LEU B CB  1 
ATOM   1818 C  CG  . LEU B 1 71  ? 7.170   -2.743  29.270  1.00 28.40  ? 270  LEU B CG  1 
ATOM   1819 C  CD1 . LEU B 1 71  ? 6.525   -2.571  30.638  1.00 28.20  ? 270  LEU B CD1 1 
ATOM   1820 C  CD2 . LEU B 1 71  ? 7.056   -4.195  28.816  1.00 38.73  ? 270  LEU B CD2 1 
ATOM   1821 N  N   . LYS B 1 72  ? 7.277   0.431   26.210  1.00 37.75  ? 271  LYS B N   1 
ATOM   1822 C  CA  . LYS B 1 72  ? 8.110   0.968   25.146  1.00 36.75  ? 271  LYS B CA  1 
ATOM   1823 C  C   . LYS B 1 72  ? 8.581   2.385   25.424  1.00 35.84  ? 271  LYS B C   1 
ATOM   1824 O  O   . LYS B 1 72  ? 9.711   2.769   25.103  1.00 39.64  ? 271  LYS B O   1 
ATOM   1825 C  CB  . LYS B 1 72  ? 7.334   0.922   23.825  1.00 36.46  ? 271  LYS B CB  1 
ATOM   1826 C  CG  . LYS B 1 72  ? 8.196   0.571   22.622  1.00 38.24  ? 271  LYS B CG  1 
ATOM   1827 C  CD  . LYS B 1 72  ? 8.858   1.825   22.065  1.00 43.55  ? 271  LYS B CD  1 
ATOM   1828 C  CE  . LYS B 1 72  ? 7.824   2.803   21.529  1.00 46.24  ? 271  LYS B CE  1 
ATOM   1829 N  NZ  . LYS B 1 72  ? 8.377   3.631   20.422  1.00 31.26  ? 271  LYS B NZ  1 
ATOM   1830 N  N   . ALA B 1 73  ? 7.735   3.220   26.026  1.00 30.32  ? 272  ALA B N   1 
ATOM   1831 C  CA  . ALA B 1 73  ? 8.205   4.584   26.289  1.00 31.41  ? 272  ALA B CA  1 
ATOM   1832 C  C   . ALA B 1 73  ? 9.251   4.577   27.397  1.00 32.16  ? 272  ALA B C   1 
ATOM   1833 O  O   . ALA B 1 73  ? 10.071  5.486   27.512  1.00 34.81  ? 272  ALA B O   1 
ATOM   1834 C  CB  . ALA B 1 73  ? 7.040   5.494   26.621  1.00 50.75  ? 272  ALA B CB  1 
ATOM   1835 N  N   . TYR B 1 74  ? 9.240   3.534   28.228  1.00 37.54  ? 273  TYR B N   1 
ATOM   1836 C  CA  . TYR B 1 74  ? 10.250  3.421   29.266  1.00 39.81  ? 273  TYR B CA  1 
ATOM   1837 C  C   . TYR B 1 74  ? 11.612  3.034   28.686  1.00 42.60  ? 273  TYR B C   1 
ATOM   1838 O  O   . TYR B 1 74  ? 12.615  3.705   28.908  1.00 39.17  ? 273  TYR B O   1 
ATOM   1839 C  CB  . TYR B 1 74  ? 9.888   2.365   30.321  1.00 39.40  ? 273  TYR B CB  1 
ATOM   1840 C  CG  . TYR B 1 74  ? 11.024  2.201   31.315  1.00 36.41  ? 273  TYR B CG  1 
ATOM   1841 C  CD1 . TYR B 1 74  ? 11.408  3.276   32.113  1.00 35.81  ? 273  TYR B CD1 1 
ATOM   1842 C  CD2 . TYR B 1 74  ? 11.704  1.001   31.447  1.00 34.75  ? 273  TYR B CD2 1 
ATOM   1843 C  CE1 . TYR B 1 74  ? 12.441  3.141   33.020  1.00 35.96  ? 273  TYR B CE1 1 
ATOM   1844 C  CE2 . TYR B 1 74  ? 12.740  0.859   32.353  1.00 29.96  ? 273  TYR B CE2 1 
ATOM   1845 C  CZ  . TYR B 1 74  ? 13.099  1.936   33.134  1.00 30.47  ? 273  TYR B CZ  1 
ATOM   1846 O  OH  . TYR B 1 74  ? 14.127  1.813   34.040  1.00 36.27  ? 273  TYR B OH  1 
ATOM   1847 N  N   . LEU B 1 75  ? 11.591  1.929   27.953  1.00 40.02  ? 274  LEU B N   1 
ATOM   1848 C  CA  . LEU B 1 75  ? 12.757  1.335   27.325  1.00 28.59  ? 274  LEU B CA  1 
ATOM   1849 C  C   . LEU B 1 75  ? 13.403  2.244   26.298  1.00 19.49  ? 274  LEU B C   1 
ATOM   1850 O  O   . LEU B 1 75  ? 14.485  1.942   25.783  1.00 27.49  ? 274  LEU B O   1 
ATOM   1851 C  CB  . LEU B 1 75  ? 12.356  -0.001  26.681  1.00 24.59  ? 274  LEU B CB  1 
ATOM   1852 C  CG  . LEU B 1 75  ? 11.682  -0.985  27.643  1.00 23.23  ? 274  LEU B CG  1 
ATOM   1853 C  CD1 . LEU B 1 75  ? 11.318  -2.278  26.931  1.00 11.90  ? 274  LEU B CD1 1 
ATOM   1854 C  CD2 . LEU B 1 75  ? 12.590  -1.238  28.837  1.00 25.72  ? 274  LEU B CD2 1 
ATOM   1855 N  N   . ILE B 1 76  ? 12.802  3.384   25.955  1.00 25.87  ? 275  ILE B N   1 
ATOM   1856 C  CA  . ILE B 1 76  ? 13.541  4.258   25.030  1.00 31.30  ? 275  ILE B CA  1 
ATOM   1857 C  C   . ILE B 1 76  ? 13.665  5.659   25.618  1.00 32.81  ? 275  ILE B C   1 
ATOM   1858 O  O   . ILE B 1 76  ? 13.892  6.630   24.901  1.00 28.36  ? 275  ILE B O   1 
ATOM   1859 C  CB  . ILE B 1 76  ? 12.909  4.295   23.631  1.00 28.54  ? 275  ILE B CB  1 
ATOM   1860 C  CG1 . ILE B 1 76  ? 11.541  4.965   23.563  1.00 31.15  ? 275  ILE B CG1 1 
ATOM   1861 C  CG2 . ILE B 1 76  ? 12.854  2.877   23.065  1.00 12.81  ? 275  ILE B CG2 1 
ATOM   1862 C  CD1 . ILE B 1 76  ? 11.506  6.242   22.759  1.00 42.95  ? 275  ILE B CD1 1 
ATOM   1863 N  N   . SER B 1 77  ? 13.528  5.731   26.941  1.00 33.81  ? 276  SER B N   1 
ATOM   1864 C  CA  . SER B 1 77  ? 13.676  6.967   27.696  1.00 29.43  ? 276  SER B CA  1 
ATOM   1865 C  C   . SER B 1 77  ? 15.143  7.259   28.015  1.00 20.29  ? 276  SER B C   1 
ATOM   1866 O  O   . SER B 1 77  ? 15.938  6.332   28.151  1.00 26.65  ? 276  SER B O   1 
ATOM   1867 C  CB  . SER B 1 77  ? 12.876  6.896   28.999  1.00 31.01  ? 276  SER B CB  1 
ATOM   1868 O  OG  . SER B 1 77  ? 13.482  6.016   29.934  1.00 50.26  ? 276  SER B OG  1 
ATOM   1869 N  N   . GLU B 1 78  ? 15.473  8.530   28.142  1.00 27.54  ? 277  GLU B N   1 
ATOM   1870 C  CA  . GLU B 1 78  ? 16.777  9.024   28.560  1.00 37.32  ? 277  GLU B CA  1 
ATOM   1871 C  C   . GLU B 1 78  ? 17.227  8.352   29.854  1.00 37.49  ? 277  GLU B C   1 
ATOM   1872 O  O   . GLU B 1 78  ? 18.382  7.948   29.992  1.00 39.11  ? 277  GLU B O   1 
ATOM   1873 C  CB  . GLU B 1 78  ? 16.722  10.544  28.724  1.00 41.55  ? 277  GLU B CB  1 
ATOM   1874 C  CG  . GLU B 1 78  ? 17.964  11.208  29.284  1.00 35.49  ? 277  GLU B CG  1 
ATOM   1875 C  CD  . GLU B 1 78  ? 17.683  12.530  29.967  1.00 38.07  ? 277  GLU B CD  1 
ATOM   1876 O  OE1 . GLU B 1 78  ? 17.354  13.509  29.260  1.00 50.08  ? 277  GLU B OE1 1 
ATOM   1877 O  OE2 . GLU B 1 78  ? 17.786  12.612  31.212  1.00 32.49  ? 277  GLU B OE2 1 
ATOM   1878 N  N   . GLU B 1 79  ? 16.306  8.232   30.804  1.00 43.22  ? 278  GLU B N   1 
ATOM   1879 C  CA  . GLU B 1 79  ? 16.603  7.607   32.092  1.00 42.51  ? 278  GLU B CA  1 
ATOM   1880 C  C   . GLU B 1 79  ? 17.246  6.239   31.887  1.00 39.43  ? 278  GLU B C   1 
ATOM   1881 O  O   . GLU B 1 79  ? 18.392  6.002   32.262  1.00 31.90  ? 278  GLU B O   1 
ATOM   1882 C  CB  . GLU B 1 79  ? 15.323  7.493   32.920  1.00 31.79  ? 278  GLU B CB  1 
ATOM   1883 C  CG  A GLU B 1 79  ? 15.485  6.909   34.311  0.50 23.09  ? 278  GLU B CG  1 
ATOM   1884 C  CG  B GLU B 1 79  ? 14.615  8.819   33.124  0.50 32.77  ? 278  GLU B CG  1 
ATOM   1885 C  CD  A GLU B 1 79  ? 14.177  6.637   35.029  0.50 18.35  ? 278  GLU B CD  1 
ATOM   1886 C  CD  B GLU B 1 79  ? 13.414  9.029   32.222  0.50 33.63  ? 278  GLU B CD  1 
ATOM   1887 O  OE1 A GLU B 1 79  ? 13.567  7.591   35.559  0.50 3.20   ? 278  GLU B OE1 1 
ATOM   1888 O  OE1 B GLU B 1 79  ? 12.599  8.094   32.070  0.50 44.64  ? 278  GLU B OE1 1 
ATOM   1889 O  OE2 A GLU B 1 79  ? 13.734  5.469   35.084  0.50 17.98  ? 278  GLU B OE2 1 
ATOM   1890 O  OE2 B GLU B 1 79  ? 13.261  10.127  31.643  0.50 43.73  ? 278  GLU B OE2 1 
ATOM   1891 N  N   . PHE B 1 80  ? 16.460  5.370   31.262  1.00 33.95  ? 279  PHE B N   1 
ATOM   1892 C  CA  . PHE B 1 80  ? 16.856  4.003   30.977  1.00 26.94  ? 279  PHE B CA  1 
ATOM   1893 C  C   . PHE B 1 80  ? 18.055  3.972   30.037  1.00 34.65  ? 279  PHE B C   1 
ATOM   1894 O  O   . PHE B 1 80  ? 18.988  3.180   30.179  1.00 39.95  ? 279  PHE B O   1 
ATOM   1895 C  CB  . PHE B 1 80  ? 15.669  3.238   30.381  1.00 17.46  ? 279  PHE B CB  1 
ATOM   1896 C  CG  . PHE B 1 80  ? 15.972  1.757   30.226  1.00 23.30  ? 279  PHE B CG  1 
ATOM   1897 C  CD1 . PHE B 1 80  ? 16.386  1.018   31.320  1.00 26.44  ? 279  PHE B CD1 1 
ATOM   1898 C  CD2 . PHE B 1 80  ? 15.841  1.135   28.998  1.00 21.08  ? 279  PHE B CD2 1 
ATOM   1899 C  CE1 . PHE B 1 80  ? 16.674  -0.330  31.188  1.00 24.16  ? 279  PHE B CE1 1 
ATOM   1900 C  CE2 . PHE B 1 80  ? 16.137  -0.211  28.860  1.00 26.91  ? 279  PHE B CE2 1 
ATOM   1901 C  CZ  . PHE B 1 80  ? 16.559  -0.943  29.952  1.00 23.93  ? 279  PHE B CZ  1 
ATOM   1902 N  N   . PHE B 1 81  ? 18.041  4.862   29.048  1.00 34.34  ? 280  PHE B N   1 
ATOM   1903 C  CA  . PHE B 1 81  ? 19.179  4.945   28.136  1.00 33.87  ? 280  PHE B CA  1 
ATOM   1904 C  C   . PHE B 1 81  ? 20.458  5.203   28.924  1.00 38.21  ? 280  PHE B C   1 
ATOM   1905 O  O   . PHE B 1 81  ? 21.519  4.673   28.598  1.00 57.97  ? 280  PHE B O   1 
ATOM   1906 C  CB  . PHE B 1 81  ? 18.949  6.036   27.094  1.00 26.01  ? 280  PHE B CB  1 
ATOM   1907 C  CG  . PHE B 1 81  ? 18.231  5.557   25.843  1.00 17.94  ? 280  PHE B CG  1 
ATOM   1908 C  CD1 . PHE B 1 81  ? 17.672  4.295   25.783  1.00 18.65  ? 280  PHE B CD1 1 
ATOM   1909 C  CD2 . PHE B 1 81  ? 18.132  6.384   24.737  1.00 16.82  ? 280  PHE B CD2 1 
ATOM   1910 C  CE1 . PHE B 1 81  ? 17.018  3.862   24.643  1.00 17.10  ? 280  PHE B CE1 1 
ATOM   1911 C  CE2 . PHE B 1 81  ? 17.475  5.967   23.597  1.00 20.27  ? 280  PHE B CE2 1 
ATOM   1912 C  CZ  . PHE B 1 81  ? 16.917  4.703   23.554  1.00 20.76  ? 280  PHE B CZ  1 
ATOM   1913 N  N   . ASN B 1 82  ? 20.338  6.018   29.968  1.00 39.46  ? 281  ASN B N   1 
ATOM   1914 C  CA  . ASN B 1 82  ? 21.476  6.325   30.830  1.00 31.97  ? 281  ASN B CA  1 
ATOM   1915 C  C   . ASN B 1 82  ? 21.975  5.068   31.533  1.00 33.82  ? 281  ASN B C   1 
ATOM   1916 O  O   . ASN B 1 82  ? 23.175  4.794   31.586  1.00 46.99  ? 281  ASN B O   1 
ATOM   1917 C  CB  . ASN B 1 82  ? 21.098  7.398   31.850  1.00 27.19  ? 281  ASN B CB  1 
ATOM   1918 C  CG  . ASN B 1 82  ? 21.386  8.800   31.355  1.00 27.45  ? 281  ASN B CG  1 
ATOM   1919 O  OD1 . ASN B 1 82  ? 22.446  9.355   31.645  1.00 35.94  ? 281  ASN B OD1 1 
ATOM   1920 N  ND2 . ASN B 1 82  ? 20.453  9.389   30.616  1.00 34.40  ? 281  ASN B ND2 1 
ATOM   1921 N  N   . LEU B 1 83  ? 21.041  4.295   32.077  1.00 30.44  ? 282  LEU B N   1 
ATOM   1922 C  CA  . LEU B 1 83  ? 21.374  3.039   32.736  1.00 32.35  ? 282  LEU B CA  1 
ATOM   1923 C  C   . LEU B 1 83  ? 22.098  2.108   31.776  1.00 31.61  ? 282  LEU B C   1 
ATOM   1924 O  O   . LEU B 1 83  ? 22.889  1.259   32.184  1.00 31.84  ? 282  LEU B O   1 
ATOM   1925 C  CB  . LEU B 1 83  ? 20.117  2.351   33.273  1.00 40.85  ? 282  LEU B CB  1 
ATOM   1926 C  CG  . LEU B 1 83  ? 20.292  0.960   33.881  1.00 46.25  ? 282  LEU B CG  1 
ATOM   1927 C  CD1 . LEU B 1 83  ? 19.419  0.818   35.124  1.00 67.18  ? 282  LEU B CD1 1 
ATOM   1928 C  CD2 . LEU B 1 83  ? 19.964  -0.143  32.885  1.00 37.65  ? 282  LEU B CD2 1 
ATOM   1929 N  N   . LEU B 1 84  ? 21.805  2.263   30.484  1.00 29.38  ? 283  LEU B N   1 
ATOM   1930 C  CA  . LEU B 1 84  ? 22.502  1.437   29.500  1.00 26.64  ? 283  LEU B CA  1 
ATOM   1931 C  C   . LEU B 1 84  ? 23.893  2.012   29.274  1.00 22.35  ? 283  LEU B C   1 
ATOM   1932 O  O   . LEU B 1 84  ? 24.861  1.292   29.063  1.00 21.41  ? 283  LEU B O   1 
ATOM   1933 C  CB  . LEU B 1 84  ? 21.724  1.357   28.189  1.00 32.54  ? 283  LEU B CB  1 
ATOM   1934 C  CG  . LEU B 1 84  ? 20.292  0.819   28.294  1.00 30.00  ? 283  LEU B CG  1 
ATOM   1935 C  CD1 . LEU B 1 84  ? 19.508  1.128   27.031  1.00 35.50  ? 283  LEU B CD1 1 
ATOM   1936 C  CD2 . LEU B 1 84  ? 20.289  -0.676  28.570  1.00 18.97  ? 283  LEU B CD2 1 
ATOM   1937 N  N   . ALA B 1 85  ? 23.992  3.337   29.324  1.00 25.12  ? 284  ALA B N   1 
ATOM   1938 C  CA  . ALA B 1 85  ? 25.286  3.964   29.061  1.00 33.15  ? 284  ALA B CA  1 
ATOM   1939 C  C   . ALA B 1 85  ? 26.230  3.819   30.248  1.00 37.89  ? 284  ALA B C   1 
ATOM   1940 O  O   . ALA B 1 85  ? 27.448  3.759   30.055  1.00 39.26  ? 284  ALA B O   1 
ATOM   1941 C  CB  . ALA B 1 85  ? 25.091  5.423   28.681  1.00 20.78  ? 284  ALA B CB  1 
ATOM   1942 N  N   . GLN B 1 86  ? 25.697  3.755   31.465  1.00 37.94  ? 285  GLN B N   1 
ATOM   1943 C  CA  . GLN B 1 86  ? 26.537  3.629   32.651  1.00 32.47  ? 285  GLN B CA  1 
ATOM   1944 C  C   . GLN B 1 86  ? 27.440  2.398   32.555  1.00 33.43  ? 285  GLN B C   1 
ATOM   1945 O  O   . GLN B 1 86  ? 28.530  2.383   33.122  1.00 54.06  ? 285  GLN B O   1 
ATOM   1946 C  CB  . GLN B 1 86  ? 25.698  3.537   33.925  1.00 28.28  ? 285  GLN B CB  1 
ATOM   1947 C  CG  . GLN B 1 86  ? 24.909  4.787   34.261  1.00 36.03  ? 285  GLN B CG  1 
ATOM   1948 C  CD  . GLN B 1 86  ? 25.804  5.979   34.535  1.00 42.13  ? 285  GLN B CD  1 
ATOM   1949 O  OE1 . GLN B 1 86  ? 25.432  7.124   34.279  1.00 43.62  ? 285  GLN B OE1 1 
ATOM   1950 N  NE2 . GLN B 1 86  ? 26.995  5.703   35.058  1.00 51.90  ? 285  GLN B NE2 1 
ATOM   1951 N  N   . LYS B 1 87  ? 26.958  1.390   31.845  1.00 33.96  ? 286  LYS B N   1 
ATOM   1952 C  CA  . LYS B 1 87  ? 27.637  0.136   31.588  1.00 33.72  ? 286  LYS B CA  1 
ATOM   1953 C  C   . LYS B 1 87  ? 28.766  0.319   30.578  1.00 34.05  ? 286  LYS B C   1 
ATOM   1954 O  O   . LYS B 1 87  ? 29.495  -0.621  30.270  1.00 42.83  ? 286  LYS B O   1 
ATOM   1955 C  CB  . LYS B 1 87  ? 26.652  -0.914  31.064  1.00 41.11  ? 286  LYS B CB  1 
ATOM   1956 C  CG  . LYS B 1 87  ? 25.349  -0.964  31.853  1.00 44.06  ? 286  LYS B CG  1 
ATOM   1957 C  CD  . LYS B 1 87  ? 24.280  -1.751  31.121  1.00 45.70  ? 286  LYS B CD  1 
ATOM   1958 C  CE  . LYS B 1 87  ? 24.336  -3.229  31.463  1.00 47.75  ? 286  LYS B CE  1 
ATOM   1959 N  NZ  . LYS B 1 87  ? 25.736  -3.723  31.573  1.00 45.81  ? 286  LYS B NZ  1 
ATOM   1960 N  N   . LEU B 1 88  ? 28.856  1.531   30.035  1.00 27.75  ? 287  LEU B N   1 
ATOM   1961 C  CA  . LEU B 1 88  ? 29.879  1.901   29.099  1.00 32.13  ? 287  LEU B CA  1 
ATOM   1962 C  C   . LEU B 1 88  ? 30.769  3.028   29.584  1.00 27.22  ? 287  LEU B C   1 
ATOM   1963 O  O   . LEU B 1 88  ? 31.629  3.457   28.813  1.00 39.38  ? 287  LEU B O   1 
ATOM   1964 C  CB  . LEU B 1 88  ? 29.310  2.233   27.741  1.00 35.83  ? 287  LEU B CB  1 
ATOM   1965 C  CG  . LEU B 1 88  ? 28.386  1.218   27.070  1.00 35.11  ? 287  LEU B CG  1 
ATOM   1966 C  CD1 . LEU B 1 88  ? 27.754  1.827   25.825  1.00 28.74  ? 287  LEU B CD1 1 
ATOM   1967 C  CD2 . LEU B 1 88  ? 29.126  -0.065  26.727  1.00 16.69  ? 287  LEU B CD2 1 
ATOM   1968 N  N   . GLU B 1 89  ? 30.437  3.557   30.752  1.00 25.06  ? 288  GLU B N   1 
ATOM   1969 C  CA  . GLU B 1 89  ? 31.155  4.673   31.317  1.00 29.61  ? 288  GLU B CA  1 
ATOM   1970 C  C   . GLU B 1 89  ? 31.207  5.787   30.284  1.00 40.41  ? 288  GLU B C   1 
ATOM   1971 O  O   . GLU B 1 89  ? 32.242  6.432   30.108  1.00 24.12  ? 288  GLU B O   1 
ATOM   1972 C  CB  . GLU B 1 89  ? 32.525  4.428   31.901  1.00 14.51  ? 288  GLU B CB  1 
ATOM   1973 C  CG  . GLU B 1 89  ? 32.781  3.048   32.470  1.00 15.34  ? 288  GLU B CG  1 
ATOM   1974 C  CD  . GLU B 1 89  ? 33.977  3.067   33.414  1.00 28.27  ? 288  GLU B CD  1 
ATOM   1975 O  OE1 . GLU B 1 89  ? 34.582  4.157   33.528  1.00 41.72  ? 288  GLU B OE1 1 
ATOM   1976 O  OE2 . GLU B 1 89  ? 34.315  2.031   34.028  1.00 31.68  ? 288  GLU B OE2 1 
ATOM   1977 N  N   . LEU B 1 90  ? 30.099  5.947   29.571  1.00 39.82  ? 289  LEU B N   1 
ATOM   1978 C  CA  . LEU B 1 90  ? 30.018  6.797   28.391  1.00 35.12  ? 289  LEU B CA  1 
ATOM   1979 C  C   . LEU B 1 90  ? 30.449  8.224   28.699  1.00 28.67  ? 289  LEU B C   1 
ATOM   1980 O  O   . LEU B 1 90  ? 31.196  8.828   27.933  1.00 28.57  ? 289  LEU B O   1 
ATOM   1981 C  CB  . LEU B 1 90  ? 28.597  6.761   27.834  1.00 27.47  ? 289  LEU B CB  1 
ATOM   1982 C  CG  . LEU B 1 90  ? 28.409  6.307   26.392  1.00 23.29  ? 289  LEU B CG  1 
ATOM   1983 C  CD1 . LEU B 1 90  ? 27.244  7.066   25.768  1.00 17.66  ? 289  LEU B CD1 1 
ATOM   1984 C  CD2 . LEU B 1 90  ? 29.680  6.492   25.568  1.00 10.81  ? 289  LEU B CD2 1 
ATOM   1985 N  N   . HIS B 1 91  ? 29.991  8.759   29.818  1.00 30.28  ? 290  HIS B N   1 
ATOM   1986 C  CA  . HIS B 1 91  ? 30.364  10.077  30.306  1.00 29.39  ? 290  HIS B CA  1 
ATOM   1987 C  C   . HIS B 1 91  ? 31.867  10.314  30.206  1.00 33.95  ? 290  HIS B C   1 
ATOM   1988 O  O   . HIS B 1 91  ? 32.318  11.410  29.879  1.00 52.86  ? 290  HIS B O   1 
ATOM   1989 C  CB  . HIS B 1 91  ? 29.923  10.203  31.771  1.00 28.21  ? 290  HIS B CB  1 
ATOM   1990 C  CG  . HIS B 1 91  ? 30.112  8.902   32.498  1.00 34.59  ? 290  HIS B CG  1 
ATOM   1991 N  ND1 . HIS B 1 91  ? 29.139  7.929   32.548  1.00 42.23  ? 290  HIS B ND1 1 
ATOM   1992 C  CD2 . HIS B 1 91  ? 31.161  8.414   33.200  1.00 37.12  ? 290  HIS B CD2 1 
ATOM   1993 C  CE1 . HIS B 1 91  ? 29.577  6.899   33.249  1.00 46.46  ? 290  HIS B CE1 1 
ATOM   1994 N  NE2 . HIS B 1 91  ? 30.806  7.170   33.658  1.00 46.49  ? 290  HIS B NE2 1 
ATOM   1995 N  N   . LYS B 1 92  ? 32.617  9.260   30.488  1.00 28.65  ? 291  LYS B N   1 
ATOM   1996 C  CA  . LYS B 1 92  ? 34.066  9.234   30.499  1.00 38.75  ? 291  LYS B CA  1 
ATOM   1997 C  C   . LYS B 1 92  ? 34.670  9.632   29.156  1.00 35.79  ? 291  LYS B C   1 
ATOM   1998 O  O   . LYS B 1 92  ? 35.695  10.314  29.124  1.00 26.58  ? 291  LYS B O   1 
ATOM   1999 C  CB  . LYS B 1 92  ? 34.542  7.827   30.870  1.00 45.47  ? 291  LYS B CB  1 
ATOM   2000 C  CG  . LYS B 1 92  ? 36.012  7.708   31.225  1.00 49.80  ? 291  LYS B CG  1 
ATOM   2001 C  CD  . LYS B 1 92  ? 36.164  6.845   32.476  1.00 51.46  ? 291  LYS B CD  1 
ATOM   2002 C  CE  . LYS B 1 92  ? 34.998  7.093   33.427  1.00 45.87  ? 291  LYS B CE  1 
ATOM   2003 N  NZ  . LYS B 1 92  ? 35.136  6.303   34.683  1.00 29.53  ? 291  LYS B NZ  1 
ATOM   2004 N  N   . PHE B 1 93  ? 34.017  9.183   28.093  1.00 28.27  ? 292  PHE B N   1 
ATOM   2005 C  CA  . PHE B 1 93  ? 34.495  9.299   26.726  1.00 23.59  ? 292  PHE B CA  1 
ATOM   2006 C  C   . PHE B 1 93  ? 33.957  10.499  25.968  1.00 30.54  ? 292  PHE B C   1 
ATOM   2007 O  O   . PHE B 1 93  ? 34.432  10.804  24.872  1.00 42.59  ? 292  PHE B O   1 
ATOM   2008 C  CB  . PHE B 1 93  ? 34.120  8.021   25.955  1.00 14.04  ? 292  PHE B CB  1 
ATOM   2009 C  CG  . PHE B 1 93  ? 34.660  6.774   26.639  1.00 17.97  ? 292  PHE B CG  1 
ATOM   2010 C  CD1 . PHE B 1 93  ? 35.950  6.342   26.372  1.00 16.69  ? 292  PHE B CD1 1 
ATOM   2011 C  CD2 . PHE B 1 93  ? 33.877  6.066   27.532  1.00 18.38  ? 292  PHE B CD2 1 
ATOM   2012 C  CE1 . PHE B 1 93  ? 36.445  5.210   26.993  1.00 22.19  ? 292  PHE B CE1 1 
ATOM   2013 C  CE2 . PHE B 1 93  ? 34.368  4.934   28.155  1.00 20.57  ? 292  PHE B CE2 1 
ATOM   2014 C  CZ  . PHE B 1 93  ? 35.656  4.509   27.885  1.00 26.14  ? 292  PHE B CZ  1 
ATOM   2015 N  N   . ILE B 1 94  ? 32.963  11.184  26.521  1.00 33.17  ? 293  ILE B N   1 
ATOM   2016 C  CA  . ILE B 1 94  ? 32.358  12.298  25.793  1.00 31.90  ? 293  ILE B CA  1 
ATOM   2017 C  C   . ILE B 1 94  ? 33.297  13.495  25.724  1.00 30.94  ? 293  ILE B C   1 
ATOM   2018 O  O   . ILE B 1 94  ? 33.835  13.908  26.750  1.00 30.27  ? 293  ILE B O   1 
ATOM   2019 C  CB  . ILE B 1 94  ? 31.016  12.684  26.444  1.00 37.68  ? 293  ILE B CB  1 
ATOM   2020 C  CG1 . ILE B 1 94  ? 30.064  11.493  26.588  1.00 36.43  ? 293  ILE B CG1 1 
ATOM   2021 C  CG2 . ILE B 1 94  ? 30.360  13.832  25.696  1.00 34.93  ? 293  ILE B CG2 1 
ATOM   2022 C  CD1 . ILE B 1 94  ? 28.818  11.760  27.405  1.00 31.35  ? 293  ILE B CD1 1 
ATOM   2023 N  N   . ARG B 1 95  ? 33.484  14.029  24.518  1.00 33.53  ? 294  ARG B N   1 
ATOM   2024 C  CA  . ARG B 1 95  ? 34.344  15.217  24.314  1.00 30.80  ? 294  ARG B CA  1 
ATOM   2025 C  C   . ARG B 1 95  ? 33.427  16.454  24.355  1.00 33.45  ? 294  ARG B C   1 
ATOM   2026 O  O   . ARG B 1 95  ? 32.869  16.916  23.366  1.00 37.70  ? 294  ARG B O   1 
ATOM   2027 C  CB  . ARG B 1 95  ? 35.034  15.156  22.943  1.00 35.13  ? 294  ARG B CB  1 
ATOM   2028 C  CG  . ARG B 1 95  ? 35.729  13.840  22.635  1.00 39.68  ? 294  ARG B CG  1 
ATOM   2029 C  CD  . ARG B 1 95  ? 36.964  14.023  21.766  1.00 35.22  ? 294  ARG B CD  1 
ATOM   2030 N  NE  . ARG B 1 95  ? 36.706  14.791  20.558  1.00 36.92  ? 294  ARG B NE  1 
ATOM   2031 C  CZ  . ARG B 1 95  ? 37.449  14.780  19.462  1.00 46.14  ? 294  ARG B CZ  1 
ATOM   2032 N  NH1 . ARG B 1 95  ? 38.539  14.023  19.378  1.00 37.67  ? 294  ARG B NH1 1 
ATOM   2033 N  NH2 . ARG B 1 95  ? 37.105  15.533  18.421  1.00 66.06  ? 294  ARG B NH2 1 
ATOM   2034 N  N   . ILE B 1 96  ? 33.313  16.970  25.573  1.00 38.97  ? 295  ILE B N   1 
ATOM   2035 C  CA  . ILE B 1 96  ? 32.381  18.049  25.872  1.00 33.39  ? 295  ILE B CA  1 
ATOM   2036 C  C   . ILE B 1 96  ? 33.060  19.162  26.657  1.00 30.92  ? 295  ILE B C   1 
ATOM   2037 O  O   . ILE B 1 96  ? 33.866  18.898  27.551  1.00 39.02  ? 295  ILE B O   1 
ATOM   2038 C  CB  . ILE B 1 96  ? 31.171  17.484  26.642  1.00 37.65  ? 295  ILE B CB  1 
ATOM   2039 C  CG1 . ILE B 1 96  ? 30.081  18.506  26.964  1.00 35.02  ? 295  ILE B CG1 1 
ATOM   2040 C  CG2 . ILE B 1 96  ? 31.624  16.770  27.909  1.00 49.65  ? 295  ILE B CG2 1 
ATOM   2041 C  CD1 . ILE B 1 96  ? 28.762  17.872  27.350  1.00 28.78  ? 295  ILE B CD1 1 
ATOM   2042 N  N   . LYS B 1 97  ? 32.736  20.399  26.298  1.00 30.44  ? 296  LYS B N   1 
ATOM   2043 C  CA  . LYS B 1 97  ? 33.333  21.590  26.878  1.00 40.87  ? 296  LYS B CA  1 
ATOM   2044 C  C   . LYS B 1 97  ? 32.511  22.115  28.050  1.00 43.56  ? 296  LYS B C   1 
ATOM   2045 O  O   . LYS B 1 97  ? 31.308  21.859  28.110  1.00 51.52  ? 296  LYS B O   1 
ATOM   2046 C  CB  . LYS B 1 97  ? 33.477  22.694  25.825  1.00 48.52  ? 296  LYS B CB  1 
ATOM   2047 C  CG  . LYS B 1 97  ? 34.733  23.539  25.960  1.00 46.37  ? 296  LYS B CG  1 
ATOM   2048 C  CD  . LYS B 1 97  ? 34.414  24.947  26.437  1.00 48.61  ? 296  LYS B CD  1 
ATOM   2049 C  CE  . LYS B 1 97  ? 35.668  25.803  26.517  1.00 53.75  ? 296  LYS B CE  1 
ATOM   2050 N  NZ  . LYS B 1 97  ? 36.032  26.376  25.189  1.00 54.00  ? 296  LYS B NZ  1 
ATOM   2051 N  N   . ARG B 1 98  ? 33.180  22.836  28.937  1.00 47.66  ? 297  ARG B N   1 
ATOM   2052 C  CA  . ARG B 1 98  ? 32.576  23.500  30.083  1.00 50.60  ? 297  ARG B CA  1 
ATOM   2053 C  C   . ARG B 1 98  ? 32.336  22.550  31.248  1.00 45.42  ? 297  ARG B C   1 
ATOM   2054 O  O   . ARG B 1 98  ? 33.080  21.590  31.443  1.00 34.80  ? 297  ARG B O   1 
ATOM   2055 C  CB  . ARG B 1 98  ? 31.256  24.171  29.682  1.00 54.10  ? 297  ARG B CB  1 
ATOM   2056 C  CG  . ARG B 1 98  ? 31.427  25.645  29.324  1.00 56.67  ? 297  ARG B CG  1 
ATOM   2057 C  CD  . ARG B 1 98  ? 32.784  26.145  29.791  1.00 55.29  ? 297  ARG B CD  1 
ATOM   2058 N  NE  . ARG B 1 98  ? 32.820  27.594  29.944  1.00 57.66  ? 297  ARG B NE  1 
ATOM   2059 C  CZ  . ARG B 1 98  ? 32.030  28.316  30.715  1.00 59.52  ? 297  ARG B CZ  1 
ATOM   2060 N  NH1 . ARG B 1 98  ? 31.087  27.735  31.453  1.00 75.48  ? 297  ARG B NH1 1 
ATOM   2061 N  NH2 . ARG B 1 98  ? 32.162  29.637  30.768  1.00 51.51  ? 297  ARG B NH2 1 
ATOM   2062 N  N   . GLY B 1 99  ? 31.294  22.827  32.031  1.00 47.51  ? 298  GLY B N   1 
ATOM   2063 C  CA  . GLY B 1 99  ? 31.018  22.044  33.217  1.00 47.33  ? 298  GLY B CA  1 
ATOM   2064 C  C   . GLY B 1 99  ? 29.723  21.270  33.194  1.00 49.36  ? 298  GLY B C   1 
ATOM   2065 O  O   . GLY B 1 99  ? 29.576  20.285  33.927  1.00 61.82  ? 298  GLY B O   1 
ATOM   2066 N  N   . LYS B 1 100 ? 28.748  21.671  32.380  1.00 50.81  ? 299  LYS B N   1 
ATOM   2067 C  CA  . LYS B 1 100 ? 27.472  20.952  32.379  1.00 51.25  ? 299  LYS B CA  1 
ATOM   2068 C  C   . LYS B 1 100 ? 27.358  19.996  31.194  1.00 52.59  ? 299  LYS B C   1 
ATOM   2069 O  O   . LYS B 1 100 ? 27.190  20.422  30.051  1.00 59.18  ? 299  LYS B O   1 
ATOM   2070 C  CB  . LYS B 1 100 ? 26.310  21.938  32.359  1.00 47.14  ? 299  LYS B CB  1 
ATOM   2071 C  CG  A LYS B 1 100 ? 25.232  21.723  33.411  0.50 44.15  ? 299  LYS B CG  1 
ATOM   2072 C  CG  B LYS B 1 100 ? 25.477  21.963  33.632  0.50 45.05  ? 299  LYS B CG  1 
ATOM   2073 C  CD  A LYS B 1 100 ? 24.516  20.397  33.215  0.50 40.23  ? 299  LYS B CD  1 
ATOM   2074 C  CD  B LYS B 1 100 ? 24.130  21.288  33.432  0.50 41.54  ? 299  LYS B CD  1 
ATOM   2075 C  CE  A LYS B 1 100 ? 23.175  20.371  33.930  0.50 36.86  ? 299  LYS B CE  1 
ATOM   2076 C  CE  B LYS B 1 100 ? 23.896  20.186  34.452  0.50 38.19  ? 299  LYS B CE  1 
ATOM   2077 N  NZ  A LYS B 1 100 ? 22.116  21.076  33.153  0.50 9.73   ? 299  LYS B NZ  1 
ATOM   2078 N  NZ  B LYS B 1 100 ? 24.653  18.947  34.115  0.50 29.09  ? 299  LYS B NZ  1 
ATOM   2079 N  N   . ILE B 1 101 ? 27.448  18.704  31.493  1.00 45.24  ? 300  ILE B N   1 
ATOM   2080 C  CA  . ILE B 1 101 ? 27.281  17.648  30.470  1.00 37.21  ? 300  ILE B CA  1 
ATOM   2081 C  C   . ILE B 1 101 ? 25.792  17.329  30.226  1.00 42.98  ? 300  ILE B C   1 
ATOM   2082 O  O   . ILE B 1 101 ? 25.229  17.573  29.160  1.00 53.32  ? 300  ILE B O   1 
ATOM   2083 C  CB  . ILE B 1 101 ? 28.154  16.414  30.833  1.00 33.41  ? 300  ILE B CB  1 
ATOM   2084 C  CG1 . ILE B 1 101 ? 27.948  15.237  29.877  1.00 27.75  ? 300  ILE B CG1 1 
ATOM   2085 C  CG2 . ILE B 1 101 ? 27.922  15.985  32.274  1.00 39.55  ? 300  ILE B CG2 1 
ATOM   2086 C  CD1 . ILE B 1 101 ? 28.428  13.906  30.410  1.00 11.17  ? 300  ILE B CD1 1 
ATOM   2087 N  N   . ASN B 1 102 ? 25.235  16.788  31.326  1.00 42.82  ? 301  ASN B N   1 
ATOM   2088 C  CA  . ASN B 1 102 ? 23.869  16.472  31.625  1.00 41.29  ? 301  ASN B CA  1 
ATOM   2089 C  C   . ASN B 1 102 ? 23.411  15.052  31.209  1.00 45.65  ? 301  ASN B C   1 
ATOM   2090 O  O   . ASN B 1 102 ? 24.189  14.298  30.627  1.00 42.05  ? 301  ASN B O   1 
ATOM   2091 C  CB  . ASN B 1 102 ? 22.863  17.522  31.123  1.00 34.53  ? 301  ASN B CB  1 
ATOM   2092 C  CG  . ASN B 1 102 ? 22.628  17.750  29.660  1.00 31.12  ? 301  ASN B CG  1 
ATOM   2093 O  OD1 . ASN B 1 102 ? 22.140  18.814  29.257  1.00 16.94  ? 301  ASN B OD1 1 
ATOM   2094 N  ND2 . ASN B 1 102 ? 22.945  16.808  28.781  1.00 26.70  ? 301  ASN B ND2 1 
ATOM   2095 N  N   . GLU B 1 103 ? 22.125  14.771  31.420  1.00 44.28  ? 302  GLU B N   1 
ATOM   2096 C  CA  . GLU B 1 103 ? 21.483  13.492  31.186  1.00 42.75  ? 302  GLU B CA  1 
ATOM   2097 C  C   . GLU B 1 103 ? 20.897  13.375  29.780  1.00 34.44  ? 302  GLU B C   1 
ATOM   2098 O  O   . GLU B 1 103 ? 20.546  12.285  29.329  1.00 22.12  ? 302  GLU B O   1 
ATOM   2099 C  CB  . GLU B 1 103 ? 20.357  13.265  32.198  1.00 47.79  ? 302  GLU B CB  1 
ATOM   2100 C  CG  . GLU B 1 103 ? 20.810  12.803  33.573  1.00 50.80  ? 302  GLU B CG  1 
ATOM   2101 C  CD  . GLU B 1 103 ? 19.746  11.976  34.269  1.00 54.60  ? 302  GLU B CD  1 
ATOM   2102 O  OE1 . GLU B 1 103 ? 18.722  12.547  34.713  1.00 55.45  ? 302  GLU B OE1 1 
ATOM   2103 O  OE2 . GLU B 1 103 ? 19.940  10.746  34.374  1.00 57.22  ? 302  GLU B OE2 1 
ATOM   2104 N  N   . THR B 1 104 ? 20.797  14.509  29.112  1.00 34.57  ? 303  THR B N   1 
ATOM   2105 C  CA  . THR B 1 104 ? 20.249  14.600  27.768  1.00 42.01  ? 303  THR B CA  1 
ATOM   2106 C  C   . THR B 1 104 ? 21.306  14.386  26.694  1.00 44.83  ? 303  THR B C   1 
ATOM   2107 O  O   . THR B 1 104 ? 21.044  13.815  25.634  1.00 52.85  ? 303  THR B O   1 
ATOM   2108 C  CB  . THR B 1 104 ? 19.599  15.983  27.555  1.00 45.29  ? 303  THR B CB  1 
ATOM   2109 O  OG1 . THR B 1 104 ? 18.732  16.260  28.660  1.00 47.94  ? 303  THR B OG1 1 
ATOM   2110 C  CG2 . THR B 1 104 ? 18.763  15.980  26.287  1.00 36.87  ? 303  THR B CG2 1 
ATOM   2111 N  N   . ILE B 1 105 ? 22.518  14.855  26.973  1.00 47.05  ? 304  ILE B N   1 
ATOM   2112 C  CA  . ILE B 1 105 ? 23.637  14.692  26.047  1.00 47.40  ? 304  ILE B CA  1 
ATOM   2113 C  C   . ILE B 1 105 ? 24.060  13.225  25.995  1.00 38.38  ? 304  ILE B C   1 
ATOM   2114 O  O   . ILE B 1 105 ? 24.354  12.701  24.920  1.00 52.80  ? 304  ILE B O   1 
ATOM   2115 C  CB  . ILE B 1 105 ? 24.827  15.583  26.439  1.00 49.94  ? 304  ILE B CB  1 
ATOM   2116 C  CG1 . ILE B 1 105 ? 25.974  15.613  25.425  1.00 49.48  ? 304  ILE B CG1 1 
ATOM   2117 C  CG2 . ILE B 1 105 ? 25.386  15.197  27.801  1.00 53.13  ? 304  ILE B CG2 1 
ATOM   2118 C  CD1 . ILE B 1 105 ? 27.307  15.227  26.035  1.00 64.42  ? 304  ILE B CD1 1 
ATOM   2119 N  N   . ILE B 1 106 ? 24.066  12.589  27.156  1.00 30.22  ? 305  ILE B N   1 
ATOM   2120 C  CA  . ILE B 1 106 ? 24.521  11.227  27.376  1.00 33.48  ? 305  ILE B CA  1 
ATOM   2121 C  C   . ILE B 1 106 ? 23.681  10.180  26.661  1.00 28.99  ? 305  ILE B C   1 
ATOM   2122 O  O   . ILE B 1 106 ? 24.202  9.374   25.882  1.00 33.26  ? 305  ILE B O   1 
ATOM   2123 C  CB  . ILE B 1 106 ? 24.536  10.923  28.893  1.00 43.27  ? 305  ILE B CB  1 
ATOM   2124 C  CG1 . ILE B 1 106 ? 25.826  11.376  29.584  1.00 47.87  ? 305  ILE B CG1 1 
ATOM   2125 C  CG2 . ILE B 1 106 ? 24.247  9.455   29.158  1.00 32.53  ? 305  ILE B CG2 1 
ATOM   2126 C  CD1 . ILE B 1 106 ? 26.192  10.601  30.830  1.00 45.75  ? 305  ILE B CD1 1 
ATOM   2127 N  N   . GLY B 1 107 ? 22.380  10.162  26.923  1.00 33.66  ? 306  GLY B N   1 
ATOM   2128 C  CA  . GLY B 1 107 ? 21.492  9.207   26.259  1.00 27.77  ? 306  GLY B CA  1 
ATOM   2129 C  C   . GLY B 1 107 ? 21.490  9.481   24.757  1.00 29.79  ? 306  GLY B C   1 
ATOM   2130 O  O   . GLY B 1 107 ? 21.282  8.570   23.963  1.00 21.36  ? 306  GLY B O   1 
ATOM   2131 N  N   . ASP B 1 108 ? 21.735  10.739  24.409  1.00 26.89  ? 307  ASP B N   1 
ATOM   2132 C  CA  . ASP B 1 108 ? 21.912  11.202  23.048  1.00 20.86  ? 307  ASP B CA  1 
ATOM   2133 C  C   . ASP B 1 108 ? 23.224  10.669  22.475  1.00 29.00  ? 307  ASP B C   1 
ATOM   2134 O  O   . ASP B 1 108 ? 23.264  10.226  21.326  1.00 35.74  ? 307  ASP B O   1 
ATOM   2135 C  CB  . ASP B 1 108 ? 21.933  12.726  22.983  1.00 28.26  ? 307  ASP B CB  1 
ATOM   2136 C  CG  . ASP B 1 108 ? 20.567  13.338  22.760  1.00 29.11  ? 307  ASP B CG  1 
ATOM   2137 O  OD1 . ASP B 1 108 ? 19.603  12.576  22.551  1.00 36.20  ? 307  ASP B OD1 1 
ATOM   2138 O  OD2 . ASP B 1 108 ? 20.473  14.583  22.793  1.00 23.88  ? 307  ASP B OD2 1 
ATOM   2139 N  N   . VAL B 1 109 ? 24.283  10.730  23.292  1.00 19.69  ? 308  VAL B N   1 
ATOM   2140 C  CA  . VAL B 1 109 ? 25.556  10.163  22.822  1.00 18.70  ? 308  VAL B CA  1 
ATOM   2141 C  C   . VAL B 1 109 ? 25.377  8.651   22.786  1.00 21.58  ? 308  VAL B C   1 
ATOM   2142 O  O   . VAL B 1 109 ? 25.925  7.946   21.938  1.00 20.91  ? 308  VAL B O   1 
ATOM   2143 C  CB  . VAL B 1 109 ? 26.763  10.577  23.673  1.00 10.19  ? 308  VAL B CB  1 
ATOM   2144 C  CG1 . VAL B 1 109 ? 27.991  9.767   23.315  1.00 16.99  ? 308  VAL B CG1 1 
ATOM   2145 C  CG2 . VAL B 1 109 ? 27.069  12.061  23.498  1.00 3.39   ? 308  VAL B CG2 1 
ATOM   2146 N  N   . PHE B 1 110 ? 24.560  8.153   23.727  1.00 18.09  ? 309  PHE B N   1 
ATOM   2147 C  CA  . PHE B 1 110 ? 24.260  6.725   23.679  1.00 19.18  ? 309  PHE B CA  1 
ATOM   2148 C  C   . PHE B 1 110 ? 23.635  6.367   22.328  1.00 26.26  ? 309  PHE B C   1 
ATOM   2149 O  O   . PHE B 1 110 ? 23.975  5.358   21.716  1.00 26.62  ? 309  PHE B O   1 
ATOM   2150 C  CB  . PHE B 1 110 ? 23.308  6.288   24.791  1.00 14.44  ? 309  PHE B CB  1 
ATOM   2151 C  CG  . PHE B 1 110 ? 23.106  4.782   24.828  1.00 16.57  ? 309  PHE B CG  1 
ATOM   2152 C  CD1 . PHE B 1 110 ? 24.148  3.936   25.170  1.00 19.84  ? 309  PHE B CD1 1 
ATOM   2153 C  CD2 . PHE B 1 110 ? 21.878  4.219   24.520  1.00 25.45  ? 309  PHE B CD2 1 
ATOM   2154 C  CE1 . PHE B 1 110 ? 23.970  2.563   25.209  1.00 24.97  ? 309  PHE B CE1 1 
ATOM   2155 C  CE2 . PHE B 1 110 ? 21.688  2.848   24.556  1.00 23.21  ? 309  PHE B CE2 1 
ATOM   2156 C  CZ  . PHE B 1 110 ? 22.736  2.013   24.905  1.00 26.22  ? 309  PHE B CZ  1 
ATOM   2157 N  N   . GLU B 1 111 ? 22.712  7.221   21.898  1.00 30.90  ? 310  GLU B N   1 
ATOM   2158 C  CA  . GLU B 1 111 ? 22.021  7.056   20.629  1.00 29.50  ? 310  GLU B CA  1 
ATOM   2159 C  C   . GLU B 1 111 ? 22.963  7.235   19.446  1.00 22.76  ? 310  GLU B C   1 
ATOM   2160 O  O   . GLU B 1 111 ? 22.912  6.460   18.496  1.00 22.74  ? 310  GLU B O   1 
ATOM   2161 C  CB  . GLU B 1 111 ? 20.864  8.053   20.487  1.00 20.87  ? 310  GLU B CB  1 
ATOM   2162 C  CG  . GLU B 1 111 ? 19.557  7.495   21.043  1.00 19.89  ? 310  GLU B CG  1 
ATOM   2163 C  CD  . GLU B 1 111 ? 18.450  8.529   21.030  1.00 26.99  ? 310  GLU B CD  1 
ATOM   2164 O  OE1 . GLU B 1 111 ? 18.755  9.737   21.131  1.00 34.02  ? 310  GLU B OE1 1 
ATOM   2165 O  OE2 . GLU B 1 111 ? 17.277  8.122   20.914  1.00 38.34  ? 310  GLU B OE2 1 
ATOM   2166 N  N   . ALA B 1 112 ? 23.805  8.267   19.511  1.00 20.95  ? 311  ALA B N   1 
ATOM   2167 C  CA  . ALA B 1 112 ? 24.704  8.488   18.381  1.00 17.15  ? 311  ALA B CA  1 
ATOM   2168 C  C   . ALA B 1 112 ? 25.784  7.412   18.359  1.00 19.79  ? 311  ALA B C   1 
ATOM   2169 O  O   . ALA B 1 112 ? 26.363  7.171   17.306  1.00 9.08   ? 311  ALA B O   1 
ATOM   2170 C  CB  . ALA B 1 112 ? 25.316  9.871   18.417  1.00 10.45  ? 311  ALA B CB  1 
ATOM   2171 N  N   . LEU B 1 113 ? 26.033  6.781   19.505  1.00 15.34  ? 312  LEU B N   1 
ATOM   2172 C  CA  . LEU B 1 113 ? 27.080  5.774   19.567  1.00 12.08  ? 312  LEU B CA  1 
ATOM   2173 C  C   . LEU B 1 113 ? 26.666  4.513   18.823  1.00 17.60  ? 312  LEU B C   1 
ATOM   2174 O  O   . LEU B 1 113 ? 27.486  3.927   18.114  1.00 16.25  ? 312  LEU B O   1 
ATOM   2175 C  CB  . LEU B 1 113 ? 27.464  5.438   21.010  1.00 17.80  ? 312  LEU B CB  1 
ATOM   2176 C  CG  . LEU B 1 113 ? 28.210  4.111   21.199  1.00 16.88  ? 312  LEU B CG  1 
ATOM   2177 C  CD1 . LEU B 1 113 ? 29.566  4.158   20.515  1.00 34.77  ? 312  LEU B CD1 1 
ATOM   2178 C  CD2 . LEU B 1 113 ? 28.363  3.769   22.673  1.00 7.61   ? 312  LEU B CD2 1 
ATOM   2179 N  N   . TRP B 1 114 ? 25.415  4.063   18.932  1.00 20.69  ? 313  TRP B N   1 
ATOM   2180 C  CA  . TRP B 1 114 ? 25.084  2.820   18.225  1.00 16.84  ? 313  TRP B CA  1 
ATOM   2181 C  C   . TRP B 1 114 ? 24.827  3.061   16.746  1.00 7.76   ? 313  TRP B C   1 
ATOM   2182 O  O   . TRP B 1 114 ? 24.839  2.093   15.982  1.00 11.54  ? 313  TRP B O   1 
ATOM   2183 C  CB  . TRP B 1 114 ? 23.904  2.107   18.917  1.00 25.26  ? 313  TRP B CB  1 
ATOM   2184 C  CG  . TRP B 1 114 ? 24.467  1.443   20.152  1.00 25.30  ? 313  TRP B CG  1 
ATOM   2185 C  CD1 . TRP B 1 114 ? 24.442  1.917   21.428  1.00 21.60  ? 313  TRP B CD1 1 
ATOM   2186 C  CD2 . TRP B 1 114 ? 25.145  0.180   20.187  1.00 22.46  ? 313  TRP B CD2 1 
ATOM   2187 N  NE1 . TRP B 1 114 ? 25.064  1.020   22.267  1.00 25.20  ? 313  TRP B NE1 1 
ATOM   2188 C  CE2 . TRP B 1 114 ? 25.502  -0.052  21.529  1.00 24.54  ? 313  TRP B CE2 1 
ATOM   2189 C  CE3 . TRP B 1 114 ? 25.480  -0.777  19.224  1.00 13.67  ? 313  TRP B CE3 1 
ATOM   2190 C  CZ2 . TRP B 1 114 ? 26.181  -1.207  21.915  1.00 25.98  ? 313  TRP B CZ2 1 
ATOM   2191 C  CZ3 . TRP B 1 114 ? 26.153  -1.918  19.612  1.00 12.84  ? 313  TRP B CZ3 1 
ATOM   2192 C  CH2 . TRP B 1 114 ? 26.501  -2.127  20.954  1.00 13.14  ? 313  TRP B CH2 1 
ATOM   2193 N  N   . ALA B 1 115 ? 24.633  4.315   16.376  1.00 8.78   ? 314  ALA B N   1 
ATOM   2194 C  CA  . ALA B 1 115 ? 24.557  4.734   14.980  1.00 18.42  ? 314  ALA B CA  1 
ATOM   2195 C  C   . ALA B 1 115 ? 25.944  4.778   14.356  1.00 25.25  ? 314  ALA B C   1 
ATOM   2196 O  O   . ALA B 1 115 ? 26.167  4.485   13.177  1.00 11.95  ? 314  ALA B O   1 
ATOM   2197 C  CB  . ALA B 1 115 ? 23.855  6.080   14.886  1.00 9.80   ? 314  ALA B CB  1 
ATOM   2198 N  N   . ALA B 1 116 ? 26.958  5.144   15.149  1.00 27.84  ? 315  ALA B N   1 
ATOM   2199 C  CA  . ALA B 1 116 ? 28.311  5.140   14.570  1.00 20.82  ? 315  ALA B CA  1 
ATOM   2200 C  C   . ALA B 1 116 ? 28.796  3.717   14.305  1.00 22.28  ? 315  ALA B C   1 
ATOM   2201 O  O   . ALA B 1 116 ? 29.463  3.444   13.302  1.00 31.50  ? 315  ALA B O   1 
ATOM   2202 C  CB  . ALA B 1 116 ? 29.264  5.891   15.478  1.00 10.87  ? 315  ALA B CB  1 
ATOM   2203 N  N   . VAL B 1 117 ? 28.467  2.786   15.193  1.00 18.00  ? 316  VAL B N   1 
ATOM   2204 C  CA  . VAL B 1 117 ? 28.765  1.367   15.009  1.00 15.21  ? 316  VAL B CA  1 
ATOM   2205 C  C   . VAL B 1 117 ? 28.108  0.843   13.732  1.00 20.73  ? 316  VAL B C   1 
ATOM   2206 O  O   . VAL B 1 117 ? 28.717  0.146   12.925  1.00 4.52   ? 316  VAL B O   1 
ATOM   2207 C  CB  . VAL B 1 117 ? 28.271  0.537   16.207  1.00 11.40  ? 316  VAL B CB  1 
ATOM   2208 C  CG1 . VAL B 1 117 ? 28.429  -0.954  15.974  1.00 3.73   ? 316  VAL B CG1 1 
ATOM   2209 C  CG2 . VAL B 1 117 ? 29.007  0.987   17.467  1.00 12.74  ? 316  VAL B CG2 1 
ATOM   2210 N  N   . TYR B 1 118 ? 26.841  1.199   13.581  1.00 19.95  ? 317  TYR B N   1 
ATOM   2211 C  CA  . TYR B 1 118 ? 26.000  0.802   12.471  1.00 17.77  ? 317  TYR B CA  1 
ATOM   2212 C  C   . TYR B 1 118 ? 26.720  1.077   11.154  1.00 8.82   ? 317  TYR B C   1 
ATOM   2213 O  O   . TYR B 1 118 ? 26.926  0.177   10.351  1.00 18.61  ? 317  TYR B O   1 
ATOM   2214 C  CB  . TYR B 1 118 ? 24.673  1.570   12.476  1.00 12.09  ? 317  TYR B CB  1 
ATOM   2215 C  CG  . TYR B 1 118 ? 23.773  1.260   11.301  1.00 11.40  ? 317  TYR B CG  1 
ATOM   2216 C  CD1 . TYR B 1 118 ? 23.519  -0.042  10.898  1.00 14.52  ? 317  TYR B CD1 1 
ATOM   2217 C  CD2 . TYR B 1 118 ? 23.162  2.282   10.592  1.00 6.80   ? 317  TYR B CD2 1 
ATOM   2218 C  CE1 . TYR B 1 118 ? 22.689  -0.305  9.820   1.00 17.65  ? 317  TYR B CE1 1 
ATOM   2219 C  CE2 . TYR B 1 118 ? 22.334  2.037   9.518   1.00 12.40  ? 317  TYR B CE2 1 
ATOM   2220 C  CZ  . TYR B 1 118 ? 22.100  0.731   9.139   1.00 17.21  ? 317  TYR B CZ  1 
ATOM   2221 O  OH  . TYR B 1 118 ? 21.276  0.488   8.065   1.00 13.45  ? 317  TYR B OH  1 
ATOM   2222 N  N   . ILE B 1 119 ? 27.064  2.351   11.039  1.00 10.41  ? 318  ILE B N   1 
ATOM   2223 C  CA  . ILE B 1 119 ? 27.686  2.948   9.871   1.00 12.54  ? 318  ILE B CA  1 
ATOM   2224 C  C   . ILE B 1 119 ? 29.100  2.416   9.672   1.00 26.00  ? 318  ILE B C   1 
ATOM   2225 O  O   . ILE B 1 119 ? 29.435  1.990   8.561   1.00 50.48  ? 318  ILE B O   1 
ATOM   2226 C  CB  . ILE B 1 119 ? 27.690  4.481   9.997   1.00 15.33  ? 318  ILE B CB  1 
ATOM   2227 C  CG1 . ILE B 1 119 ? 26.278  5.084   10.078  1.00 14.42  ? 318  ILE B CG1 1 
ATOM   2228 C  CG2 . ILE B 1 119 ? 28.471  5.141   8.876   1.00 8.73   ? 318  ILE B CG2 1 
ATOM   2229 C  CD1 . ILE B 1 119 ? 26.295  6.597   10.140  1.00 14.47  ? 318  ILE B CD1 1 
ATOM   2230 N  N   . ASP B 1 120 ? 29.917  2.430   10.722  1.00 20.27  ? 319  ASP B N   1 
ATOM   2231 C  CA  . ASP B 1 120 ? 31.274  1.896   10.602  1.00 22.51  ? 319  ASP B CA  1 
ATOM   2232 C  C   . ASP B 1 120 ? 31.240  0.474   10.058  1.00 21.66  ? 319  ASP B C   1 
ATOM   2233 O  O   . ASP B 1 120 ? 32.083  0.030   9.286   1.00 13.95  ? 319  ASP B O   1 
ATOM   2234 C  CB  . ASP B 1 120 ? 31.983  1.949   11.961  1.00 14.26  ? 319  ASP B CB  1 
ATOM   2235 C  CG  . ASP B 1 120 ? 33.477  1.716   11.831  1.00 11.67  ? 319  ASP B CG  1 
ATOM   2236 O  OD1 . ASP B 1 120 ? 34.165  2.614   11.300  1.00 15.05  ? 319  ASP B OD1 1 
ATOM   2237 O  OD2 . ASP B 1 120 ? 33.967  0.636   12.232  1.00 16.36  ? 319  ASP B OD2 1 
ATOM   2238 N  N   . SER B 1 121 ? 30.208  -0.261  10.474  1.00 21.36  ? 320  SER B N   1 
ATOM   2239 C  CA  . SER B 1 121 ? 30.071  -1.670  10.151  1.00 8.24   ? 320  SER B CA  1 
ATOM   2240 C  C   . SER B 1 121 ? 29.731  -1.908  8.688   1.00 4.14   ? 320  SER B C   1 
ATOM   2241 O  O   . SER B 1 121 ? 29.572  -3.063  8.290   1.00 5.57   ? 320  SER B O   1 
ATOM   2242 C  CB  . SER B 1 121 ? 28.975  -2.298  11.027  1.00 17.04  ? 320  SER B CB  1 
ATOM   2243 O  OG  . SER B 1 121 ? 27.694  -2.019  10.471  1.00 21.36  ? 320  SER B OG  1 
ATOM   2244 N  N   . GLY B 1 122 ? 29.609  -0.852  7.898   1.00 5.80   ? 321  GLY B N   1 
ATOM   2245 C  CA  . GLY B 1 122 ? 29.127  -1.023  6.529   1.00 14.78  ? 321  GLY B CA  1 
ATOM   2246 C  C   . GLY B 1 122 ? 27.609  -1.108  6.510   1.00 21.41  ? 321  GLY B C   1 
ATOM   2247 O  O   . GLY B 1 122 ? 27.001  -1.701  5.617   1.00 17.26  ? 321  GLY B O   1 
ATOM   2248 N  N   . ARG B 1 123 ? 26.953  -0.477  7.480   1.00 23.51  ? 322  ARG B N   1 
ATOM   2249 C  CA  . ARG B 1 123 ? 25.475  -0.564  7.616   1.00 18.06  ? 322  ARG B CA  1 
ATOM   2250 C  C   . ARG B 1 123 ? 25.010  -2.012  7.797   1.00 13.39  ? 322  ARG B C   1 
ATOM   2251 O  O   . ARG B 1 123 ? 24.081  -2.512  7.164   1.00 6.47   ? 322  ARG B O   1 
ATOM   2252 C  CB  . ARG B 1 123 ? 24.877  -0.014  6.301   1.00 21.27  ? 322  ARG B CB  1 
ATOM   2253 C  CG  . ARG B 1 123 ? 24.051  1.228   6.533   1.00 18.01  ? 322  ARG B CG  1 
ATOM   2254 C  CD  . ARG B 1 123 ? 24.486  2.443   5.749   1.00 6.73   ? 322  ARG B CD  1 
ATOM   2255 N  NE  . ARG B 1 123 ? 23.815  3.639   6.260   1.00 14.30  ? 322  ARG B NE  1 
ATOM   2256 C  CZ  . ARG B 1 123 ? 24.338  4.859   6.223   1.00 17.72  ? 322  ARG B CZ  1 
ATOM   2257 N  NH1 . ARG B 1 123 ? 25.540  5.053   5.703   1.00 24.65  ? 322  ARG B NH1 1 
ATOM   2258 N  NH2 . ARG B 1 123 ? 23.669  5.891   6.706   1.00 13.06  ? 322  ARG B NH2 1 
ATOM   2259 N  N   . ASP B 1 124 ? 25.644  -2.726  8.729   1.00 20.49  ? 323  ASP B N   1 
ATOM   2260 C  CA  . ASP B 1 124 ? 25.179  -4.082  9.014   1.00 19.35  ? 323  ASP B CA  1 
ATOM   2261 C  C   . ASP B 1 124 ? 24.197  -4.023  10.181  1.00 22.63  ? 323  ASP B C   1 
ATOM   2262 O  O   . ASP B 1 124 ? 24.619  -4.070  11.337  1.00 18.80  ? 323  ASP B O   1 
ATOM   2263 C  CB  . ASP B 1 124 ? 26.346  -5.004  9.330   1.00 14.36  ? 323  ASP B CB  1 
ATOM   2264 C  CG  . ASP B 1 124 ? 25.953  -6.446  9.526   1.00 13.04  ? 323  ASP B CG  1 
ATOM   2265 O  OD1 . ASP B 1 124 ? 24.801  -6.735  9.907   1.00 36.93  ? 323  ASP B OD1 1 
ATOM   2266 O  OD2 . ASP B 1 124 ? 26.808  -7.333  9.319   1.00 23.43  ? 323  ASP B OD2 1 
ATOM   2267 N  N   . ALA B 1 125 ? 22.912  -3.917  9.853   1.00 11.22  ? 324  ALA B N   1 
ATOM   2268 C  CA  . ALA B 1 125 ? 21.918  -3.728  10.906  1.00 19.30  ? 324  ALA B CA  1 
ATOM   2269 C  C   . ALA B 1 125 ? 21.904  -4.927  11.847  1.00 17.06  ? 324  ALA B C   1 
ATOM   2270 O  O   . ALA B 1 125 ? 21.761  -4.756  13.058  1.00 16.22  ? 324  ALA B O   1 
ATOM   2271 C  CB  . ALA B 1 125 ? 20.551  -3.462  10.296  1.00 4.97   ? 324  ALA B CB  1 
ATOM   2272 N  N   . ASN B 1 126 ? 22.062  -6.119  11.268  1.00 17.41  ? 325  ASN B N   1 
ATOM   2273 C  CA  . ASN B 1 126 ? 21.973  -7.354  12.025  1.00 16.00  ? 325  ASN B CA  1 
ATOM   2274 C  C   . ASN B 1 126 ? 23.118  -7.463  13.028  1.00 24.26  ? 325  ASN B C   1 
ATOM   2275 O  O   . ASN B 1 126 ? 22.896  -7.694  14.216  1.00 28.36  ? 325  ASN B O   1 
ATOM   2276 C  CB  . ASN B 1 126 ? 21.969  -8.577  11.101  1.00 17.04  ? 325  ASN B CB  1 
ATOM   2277 C  CG  . ASN B 1 126 ? 20.791  -8.564  10.142  1.00 24.73  ? 325  ASN B CG  1 
ATOM   2278 O  OD1 . ASN B 1 126 ? 19.766  -7.921  10.385  1.00 11.84  ? 325  ASN B OD1 1 
ATOM   2279 N  ND2 . ASN B 1 126 ? 20.932  -9.281  9.033   1.00 19.77  ? 325  ASN B ND2 1 
ATOM   2280 N  N   . PHE B 1 127 ? 24.339  -7.300  12.523  1.00 20.87  ? 326  PHE B N   1 
ATOM   2281 C  CA  . PHE B 1 127 ? 25.498  -7.409  13.416  1.00 18.05  ? 326  PHE B CA  1 
ATOM   2282 C  C   . PHE B 1 127 ? 25.348  -6.387  14.540  1.00 12.54  ? 326  PHE B C   1 
ATOM   2283 O  O   . PHE B 1 127 ? 25.460  -6.716  15.718  1.00 20.22  ? 326  PHE B O   1 
ATOM   2284 C  CB  . PHE B 1 127 ? 26.770  -7.228  12.619  1.00 23.64  ? 326  PHE B CB  1 
ATOM   2285 C  CG  . PHE B 1 127 ? 28.102  -7.245  13.322  1.00 22.44  ? 326  PHE B CG  1 
ATOM   2286 C  CD1 . PHE B 1 127 ? 28.583  -8.402  13.909  1.00 28.12  ? 326  PHE B CD1 1 
ATOM   2287 C  CD2 . PHE B 1 127 ? 28.865  -6.091  13.380  1.00 28.97  ? 326  PHE B CD2 1 
ATOM   2288 C  CE1 . PHE B 1 127 ? 29.813  -8.402  14.538  1.00 25.62  ? 326  PHE B CE1 1 
ATOM   2289 C  CE2 . PHE B 1 127 ? 30.094  -6.087  14.011  1.00 30.06  ? 326  PHE B CE2 1 
ATOM   2290 C  CZ  . PHE B 1 127 ? 30.566  -7.246  14.597  1.00 15.12  ? 326  PHE B CZ  1 
ATOM   2291 N  N   . THR B 1 128 ? 25.071  -5.148  14.138  1.00 11.25  ? 327  THR B N   1 
ATOM   2292 C  CA  . THR B 1 128 ? 24.910  -4.072  15.102  1.00 21.16  ? 327  THR B CA  1 
ATOM   2293 C  C   . THR B 1 128 ? 23.805  -4.415  16.099  1.00 18.01  ? 327  THR B C   1 
ATOM   2294 O  O   . THR B 1 128 ? 23.967  -4.227  17.300  1.00 23.03  ? 327  THR B O   1 
ATOM   2295 C  CB  . THR B 1 128 ? 24.586  -2.745  14.400  1.00 23.00  ? 327  THR B CB  1 
ATOM   2296 O  OG1 . THR B 1 128 ? 25.594  -2.468  13.424  1.00 15.45  ? 327  THR B OG1 1 
ATOM   2297 C  CG2 . THR B 1 128 ? 24.607  -1.621  15.423  1.00 25.05  ? 327  THR B CG2 1 
ATOM   2298 N  N   . ARG B 1 129 ? 22.689  -4.935  15.604  1.00 13.27  ? 328  ARG B N   1 
ATOM   2299 C  CA  . ARG B 1 129 ? 21.641  -5.438  16.485  1.00 17.56  ? 328  ARG B CA  1 
ATOM   2300 C  C   . ARG B 1 129 ? 22.152  -6.434  17.516  1.00 18.41  ? 328  ARG B C   1 
ATOM   2301 O  O   . ARG B 1 129 ? 21.857  -6.325  18.706  1.00 17.07  ? 328  ARG B O   1 
ATOM   2302 C  CB  . ARG B 1 129 ? 20.549  -6.127  15.664  1.00 8.86   ? 328  ARG B CB  1 
ATOM   2303 C  CG  . ARG B 1 129 ? 19.159  -5.999  16.266  1.00 14.27  ? 328  ARG B CG  1 
ATOM   2304 C  CD  . ARG B 1 129 ? 18.491  -7.376  16.276  1.00 16.67  ? 328  ARG B CD  1 
ATOM   2305 N  NE  . ARG B 1 129 ? 18.135  -7.734  14.917  1.00 26.70  ? 328  ARG B NE  1 
ATOM   2306 C  CZ  . ARG B 1 129 ? 18.553  -8.733  14.174  1.00 18.87  ? 328  ARG B CZ  1 
ATOM   2307 N  NH1 . ARG B 1 129 ? 19.428  -9.623  14.611  1.00 20.42  ? 328  ARG B NH1 1 
ATOM   2308 N  NH2 . ARG B 1 129 ? 18.062  -8.830  12.943  1.00 21.59  ? 328  ARG B NH2 1 
ATOM   2309 N  N   . GLU B 1 130 ? 22.913  -7.437  17.081  1.00 19.23  ? 329  GLU B N   1 
ATOM   2310 C  CA  . GLU B 1 130 ? 23.363  -8.460  18.027  1.00 21.34  ? 329  GLU B CA  1 
ATOM   2311 C  C   . GLU B 1 130 ? 24.389  -7.899  19.002  1.00 23.29  ? 329  GLU B C   1 
ATOM   2312 O  O   . GLU B 1 130 ? 24.462  -8.290  20.168  1.00 13.87  ? 329  GLU B O   1 
ATOM   2313 C  CB  . GLU B 1 130 ? 23.949  -9.663  17.290  1.00 20.34  ? 329  GLU B CB  1 
ATOM   2314 C  CG  . GLU B 1 130 ? 22.928  -10.445 16.477  1.00 21.60  ? 329  GLU B CG  1 
ATOM   2315 C  CD  . GLU B 1 130 ? 21.741  -10.863 17.329  1.00 26.58  ? 329  GLU B CD  1 
ATOM   2316 O  OE1 . GLU B 1 130 ? 21.947  -11.620 18.299  1.00 24.66  ? 329  GLU B OE1 1 
ATOM   2317 O  OE2 . GLU B 1 130 ? 20.608  -10.438 17.029  1.00 22.65  ? 329  GLU B OE2 1 
ATOM   2318 N  N   . LEU B 1 131 ? 25.190  -6.970  18.495  1.00 27.88  ? 330  LEU B N   1 
ATOM   2319 C  CA  . LEU B 1 131 ? 26.218  -6.351  19.330  1.00 29.90  ? 330  LEU B CA  1 
ATOM   2320 C  C   . LEU B 1 131 ? 25.535  -5.602  20.472  1.00 33.26  ? 330  LEU B C   1 
ATOM   2321 O  O   . LEU B 1 131 ? 25.958  -5.645  21.625  1.00 19.41  ? 330  LEU B O   1 
ATOM   2322 C  CB  . LEU B 1 131 ? 27.088  -5.418  18.501  1.00 17.09  ? 330  LEU B CB  1 
ATOM   2323 C  CG  . LEU B 1 131 ? 28.322  -6.030  17.835  1.00 22.21  ? 330  LEU B CG  1 
ATOM   2324 C  CD1 . LEU B 1 131 ? 28.980  -5.010  16.921  1.00 16.54  ? 330  LEU B CD1 1 
ATOM   2325 C  CD2 . LEU B 1 131 ? 29.319  -6.526  18.874  1.00 28.11  ? 330  LEU B CD2 1 
ATOM   2326 N  N   . PHE B 1 132 ? 24.458  -4.931  20.067  1.00 24.26  ? 331  PHE B N   1 
ATOM   2327 C  CA  . PHE B 1 132 ? 23.612  -4.209  21.006  1.00 20.48  ? 331  PHE B CA  1 
ATOM   2328 C  C   . PHE B 1 132 ? 23.058  -5.175  22.050  1.00 12.33  ? 331  PHE B C   1 
ATOM   2329 O  O   . PHE B 1 132 ? 23.167  -4.935  23.249  1.00 16.90  ? 331  PHE B O   1 
ATOM   2330 C  CB  . PHE B 1 132 ? 22.481  -3.497  20.266  1.00 24.12  ? 331  PHE B CB  1 
ATOM   2331 C  CG  . PHE B 1 132 ? 21.595  -2.632  21.149  1.00 23.98  ? 331  PHE B CG  1 
ATOM   2332 C  CD1 . PHE B 1 132 ? 20.470  -3.153  21.763  1.00 22.30  ? 331  PHE B CD1 1 
ATOM   2333 C  CD2 . PHE B 1 132 ? 21.898  -1.301  21.354  1.00 22.07  ? 331  PHE B CD2 1 
ATOM   2334 C  CE1 . PHE B 1 132 ? 19.665  -2.365  22.561  1.00 24.87  ? 331  PHE B CE1 1 
ATOM   2335 C  CE2 . PHE B 1 132 ? 21.100  -0.506  22.151  1.00 24.74  ? 331  PHE B CE2 1 
ATOM   2336 C  CZ  . PHE B 1 132 ? 19.984  -1.037  22.764  1.00 24.38  ? 331  PHE B CZ  1 
ATOM   2337 N  N   . TYR B 1 133 ? 22.469  -6.265  21.585  1.00 14.34  ? 332  TYR B N   1 
ATOM   2338 C  CA  . TYR B 1 133 ? 21.831  -7.239  22.460  1.00 24.05  ? 332  TYR B CA  1 
ATOM   2339 C  C   . TYR B 1 133 ? 22.823  -7.947  23.380  1.00 28.51  ? 332  TYR B C   1 
ATOM   2340 O  O   . TYR B 1 133 ? 22.483  -8.278  24.522  1.00 16.23  ? 332  TYR B O   1 
ATOM   2341 C  CB  . TYR B 1 133 ? 21.088  -8.304  21.656  1.00 18.77  ? 332  TYR B CB  1 
ATOM   2342 C  CG  . TYR B 1 133 ? 19.849  -7.826  20.933  1.00 19.80  ? 332  TYR B CG  1 
ATOM   2343 C  CD1 . TYR B 1 133 ? 19.321  -6.552  21.054  1.00 19.83  ? 332  TYR B CD1 1 
ATOM   2344 C  CD2 . TYR B 1 133 ? 19.204  -8.721  20.083  1.00 22.61  ? 332  TYR B CD2 1 
ATOM   2345 C  CE1 . TYR B 1 133 ? 18.178  -6.171  20.360  1.00 21.27  ? 332  TYR B CE1 1 
ATOM   2346 C  CE2 . TYR B 1 133 ? 18.071  -8.345  19.395  1.00 21.82  ? 332  TYR B CE2 1 
ATOM   2347 C  CZ  . TYR B 1 133 ? 17.555  -7.075  19.527  1.00 19.40  ? 332  TYR B CZ  1 
ATOM   2348 O  OH  . TYR B 1 133 ? 16.420  -6.752  18.814  1.00 24.15  ? 332  TYR B OH  1 
ATOM   2349 N  N   . LYS B 1 134 ? 24.038  -8.194  22.891  1.00 28.60  ? 333  LYS B N   1 
ATOM   2350 C  CA  . LYS B 1 134 ? 25.015  -8.883  23.742  1.00 27.74  ? 333  LYS B CA  1 
ATOM   2351 C  C   . LYS B 1 134 ? 25.228  -8.080  25.022  1.00 25.19  ? 333  LYS B C   1 
ATOM   2352 O  O   . LYS B 1 134 ? 25.465  -8.633  26.095  1.00 28.05  ? 333  LYS B O   1 
ATOM   2353 C  CB  . LYS B 1 134 ? 26.321  -9.116  22.997  1.00 30.71  ? 333  LYS B CB  1 
ATOM   2354 C  CG  . LYS B 1 134 ? 27.570  -9.116  23.862  1.00 35.48  ? 333  LYS B CG  1 
ATOM   2355 C  CD  . LYS B 1 134 ? 28.277  -10.459 23.806  1.00 41.88  ? 333  LYS B CD  1 
ATOM   2356 C  CE  . LYS B 1 134 ? 29.757  -10.322 23.489  1.00 43.37  ? 333  LYS B CE  1 
ATOM   2357 N  NZ  . LYS B 1 134 ? 30.399  -11.638 23.218  1.00 22.57  ? 333  LYS B NZ  1 
ATOM   2358 N  N   . LEU B 1 135 ? 25.117  -6.762  24.902  1.00 28.15  ? 334  LEU B N   1 
ATOM   2359 C  CA  . LEU B 1 135 ? 25.350  -5.885  26.043  1.00 36.51  ? 334  LEU B CA  1 
ATOM   2360 C  C   . LEU B 1 135 ? 24.098  -5.607  26.861  1.00 39.07  ? 334  LEU B C   1 
ATOM   2361 O  O   . LEU B 1 135 ? 24.149  -5.583  28.098  1.00 25.22  ? 334  LEU B O   1 
ATOM   2362 C  CB  . LEU B 1 135 ? 25.965  -4.572  25.544  1.00 34.97  ? 334  LEU B CB  1 
ATOM   2363 C  CG  . LEU B 1 135 ? 27.356  -4.655  24.914  1.00 35.48  ? 334  LEU B CG  1 
ATOM   2364 C  CD1 . LEU B 1 135 ? 27.556  -3.509  23.931  1.00 28.20  ? 334  LEU B CD1 1 
ATOM   2365 C  CD2 . LEU B 1 135 ? 28.457  -4.641  25.965  1.00 23.94  ? 334  LEU B CD2 1 
ATOM   2366 N  N   . PHE B 1 136 ? 22.949  -5.329  26.236  1.00 35.43  ? 335  PHE B N   1 
ATOM   2367 C  CA  . PHE B 1 136 ? 21.779  -5.012  27.032  1.00 31.84  ? 335  PHE B CA  1 
ATOM   2368 C  C   . PHE B 1 136 ? 20.577  -5.916  26.907  1.00 21.77  ? 335  PHE B C   1 
ATOM   2369 O  O   . PHE B 1 136 ? 19.496  -5.512  27.344  1.00 18.86  ? 335  PHE B O   1 
ATOM   2370 C  CB  . PHE B 1 136 ? 21.403  -3.551  26.839  1.00 33.66  ? 335  PHE B CB  1 
ATOM   2371 C  CG  . PHE B 1 136 ? 22.578  -2.643  26.520  1.00 36.23  ? 335  PHE B CG  1 
ATOM   2372 C  CD1 . PHE B 1 136 ? 23.352  -2.105  27.532  1.00 42.93  ? 335  PHE B CD1 1 
ATOM   2373 C  CD2 . PHE B 1 136 ? 22.899  -2.334  25.212  1.00 37.35  ? 335  PHE B CD2 1 
ATOM   2374 C  CE1 . PHE B 1 136 ? 24.424  -1.280  27.243  1.00 49.89  ? 335  PHE B CE1 1 
ATOM   2375 C  CE2 . PHE B 1 136 ? 23.968  -1.511  24.908  1.00 40.43  ? 335  PHE B CE2 1 
ATOM   2376 C  CZ  . PHE B 1 136 ? 24.735  -0.980  25.928  1.00 46.93  ? 335  PHE B CZ  1 
ATOM   2377 N  N   . LYS B 1 137 ? 20.664  -7.029  26.177  1.00 18.77  ? 336  LYS B N   1 
ATOM   2378 C  CA  . LYS B 1 137 ? 19.484  -7.874  26.016  1.00 30.31  ? 336  LYS B CA  1 
ATOM   2379 C  C   . LYS B 1 137 ? 18.936  -8.250  27.399  1.00 31.95  ? 336  LYS B C   1 
ATOM   2380 O  O   . LYS B 1 137 ? 17.731  -8.322  27.597  1.00 39.60  ? 336  LYS B O   1 
ATOM   2381 C  CB  . LYS B 1 137 ? 19.772  -9.151  25.228  1.00 32.04  ? 336  LYS B CB  1 
ATOM   2382 C  CG  . LYS B 1 137 ? 18.561  -10.068 25.123  1.00 36.19  ? 336  LYS B CG  1 
ATOM   2383 C  CD  . LYS B 1 137 ? 18.891  -11.365 24.403  1.00 34.23  ? 336  LYS B CD  1 
ATOM   2384 C  CE  . LYS B 1 137 ? 17.636  -12.164 24.112  1.00 33.55  ? 336  LYS B CE  1 
ATOM   2385 N  NZ  . LYS B 1 137 ? 17.262  -12.133 22.673  1.00 21.80  ? 336  LYS B NZ  1 
ATOM   2386 N  N   . GLU B 1 138 ? 19.890  -8.464  28.276  1.00 37.62  ? 337  GLU B N   1 
ATOM   2387 C  CA  . GLU B 1 138 ? 19.803  -8.782  29.681  1.00 35.97  ? 337  GLU B CA  1 
ATOM   2388 C  C   . GLU B 1 138 ? 18.857  -7.852  30.425  1.00 22.61  ? 337  GLU B C   1 
ATOM   2389 O  O   . GLU B 1 138 ? 17.844  -8.254  30.986  1.00 35.68  ? 337  GLU B O   1 
ATOM   2390 C  CB  . GLU B 1 138 ? 21.206  -8.668  30.301  1.00 41.03  ? 337  GLU B CB  1 
ATOM   2391 C  CG  . GLU B 1 138 ? 21.526  -9.752  31.315  1.00 41.74  ? 337  GLU B CG  1 
ATOM   2392 C  CD  . GLU B 1 138 ? 20.795  -11.044 31.007  1.00 43.47  ? 337  GLU B CD  1 
ATOM   2393 O  OE1 . GLU B 1 138 ? 20.728  -11.417 29.817  1.00 59.90  ? 337  GLU B OE1 1 
ATOM   2394 O  OE2 . GLU B 1 138 ? 20.291  -11.673 31.958  1.00 53.64  ? 337  GLU B OE2 1 
ATOM   2395 N  N   . ASP B 1 139 ? 19.217  -6.574  30.419  1.00 9.55   ? 338  ASP B N   1 
ATOM   2396 C  CA  . ASP B 1 139 ? 18.477  -5.587  31.188  1.00 20.17  ? 338  ASP B CA  1 
ATOM   2397 C  C   . ASP B 1 139 ? 17.142  -5.263  30.538  1.00 26.07  ? 338  ASP B C   1 
ATOM   2398 O  O   . ASP B 1 139 ? 16.199  -4.826  31.197  1.00 34.57  ? 338  ASP B O   1 
ATOM   2399 C  CB  . ASP B 1 139 ? 19.304  -4.304  31.341  1.00 35.02  ? 338  ASP B CB  1 
ATOM   2400 C  CG  . ASP B 1 139 ? 20.502  -4.491  32.254  1.00 40.33  ? 338  ASP B CG  1 
ATOM   2401 O  OD1 . ASP B 1 139 ? 21.145  -5.557  32.169  1.00 35.67  ? 338  ASP B OD1 1 
ATOM   2402 O  OD2 . ASP B 1 139 ? 20.804  -3.575  33.050  1.00 66.50  ? 338  ASP B OD2 1 
ATOM   2403 N  N   . ILE B 1 140 ? 17.059  -5.471  29.222  1.00 26.68  ? 339  ILE B N   1 
ATOM   2404 C  CA  . ILE B 1 140 ? 15.781  -5.129  28.581  1.00 20.39  ? 339  ILE B CA  1 
ATOM   2405 C  C   . ILE B 1 140 ? 14.724  -6.153  28.974  1.00 15.38  ? 339  ILE B C   1 
ATOM   2406 O  O   . ILE B 1 140 ? 13.662  -5.750  29.445  1.00 18.09  ? 339  ILE B O   1 
ATOM   2407 C  CB  . ILE B 1 140 ? 15.927  -4.993  27.061  1.00 13.95  ? 339  ILE B CB  1 
ATOM   2408 C  CG1 . ILE B 1 140 ? 16.555  -3.655  26.651  1.00 20.54  ? 339  ILE B CG1 1 
ATOM   2409 C  CG2 . ILE B 1 140 ? 14.607  -5.196  26.341  1.00 33.48  ? 339  ILE B CG2 1 
ATOM   2410 C  CD1 . ILE B 1 140 ? 17.682  -3.793  25.652  1.00 22.83  ? 339  ILE B CD1 1 
ATOM   2411 N  N   . LEU B 1 141 ? 15.007  -7.436  28.809  1.00 24.68  ? 340  LEU B N   1 
ATOM   2412 C  CA  . LEU B 1 141 ? 14.087  -8.481  29.238  1.00 25.07  ? 340  LEU B CA  1 
ATOM   2413 C  C   . LEU B 1 141 ? 13.661  -8.258  30.690  1.00 37.76  ? 340  LEU B C   1 
ATOM   2414 O  O   . LEU B 1 141 ? 12.464  -8.260  30.976  1.00 57.21  ? 340  LEU B O   1 
ATOM   2415 C  CB  . LEU B 1 141 ? 14.695  -9.879  29.106  1.00 13.88  ? 340  LEU B CB  1 
ATOM   2416 C  CG  . LEU B 1 141 ? 15.087  -10.325 27.695  1.00 19.05  ? 340  LEU B CG  1 
ATOM   2417 C  CD1 . LEU B 1 141 ? 15.347  -11.819 27.650  1.00 15.30  ? 340  LEU B CD1 1 
ATOM   2418 C  CD2 . LEU B 1 141 ? 14.022  -9.934  26.684  1.00 31.87  ? 340  LEU B CD2 1 
ATOM   2419 N  N   . SER B 1 142 ? 14.639  -8.082  31.569  1.00 36.11  ? 341  SER B N   1 
ATOM   2420 C  CA  . SER B 1 142 ? 14.400  -7.880  32.992  1.00 33.04  ? 341  SER B CA  1 
ATOM   2421 C  C   . SER B 1 142 ? 13.303  -6.844  33.235  1.00 28.58  ? 341  SER B C   1 
ATOM   2422 O  O   . SER B 1 142 ? 12.302  -7.118  33.894  1.00 38.57  ? 341  SER B O   1 
ATOM   2423 C  CB  . SER B 1 142 ? 15.683  -7.430  33.694  1.00 37.16  ? 341  SER B CB  1 
ATOM   2424 O  OG  . SER B 1 142 ? 15.475  -6.193  34.357  1.00 51.27  ? 341  SER B OG  1 
ATOM   2425 N  N   . ALA B 1 143 ? 13.537  -5.675  32.670  1.00 25.61  ? 342  ALA B N   1 
ATOM   2426 C  CA  . ALA B 1 143 ? 12.693  -4.502  32.741  1.00 30.58  ? 342  ALA B CA  1 
ATOM   2427 C  C   . ALA B 1 143 ? 11.309  -4.754  32.153  1.00 35.35  ? 342  ALA B C   1 
ATOM   2428 O  O   . ALA B 1 143 ? 10.357  -4.030  32.448  1.00 36.81  ? 342  ALA B O   1 
ATOM   2429 C  CB  . ALA B 1 143 ? 13.373  -3.343  32.016  1.00 14.67  ? 342  ALA B CB  1 
ATOM   2430 N  N   . ILE B 1 144 ? 11.211  -5.782  31.318  1.00 36.78  ? 343  ILE B N   1 
ATOM   2431 C  CA  . ILE B 1 144 ? 9.936   -6.137  30.700  1.00 40.96  ? 343  ILE B CA  1 
ATOM   2432 C  C   . ILE B 1 144 ? 9.039   -6.867  31.697  1.00 42.09  ? 343  ILE B C   1 
ATOM   2433 O  O   . ILE B 1 144 ? 7.843   -6.592  31.797  1.00 26.87  ? 343  ILE B O   1 
ATOM   2434 C  CB  . ILE B 1 144 ? 10.152  -7.003  29.446  1.00 40.24  ? 343  ILE B CB  1 
ATOM   2435 C  CG1 . ILE B 1 144 ? 10.265  -6.203  28.144  1.00 41.20  ? 343  ILE B CG1 1 
ATOM   2436 C  CG2 . ILE B 1 144 ? 9.070   -8.065  29.328  1.00 39.50  ? 343  ILE B CG2 1 
ATOM   2437 C  CD1 . ILE B 1 144 ? 11.187  -6.832  27.123  1.00 43.41  ? 343  ILE B CD1 1 
ATOM   2438 N  N   . LYS B 1 145 ? 9.630   -7.796  32.440  1.00 42.87  ? 344  LYS B N   1 
ATOM   2439 C  CA  . LYS B 1 145 ? 8.912   -8.585  33.429  1.00 44.33  ? 344  LYS B CA  1 
ATOM   2440 C  C   . LYS B 1 145 ? 8.547   -7.738  34.637  1.00 51.35  ? 344  LYS B C   1 
ATOM   2441 O  O   . LYS B 1 145 ? 7.476   -7.889  35.223  1.00 73.94  ? 344  LYS B O   1 
ATOM   2442 C  CB  . LYS B 1 145 ? 9.741   -9.791  33.875  1.00 44.10  ? 344  LYS B CB  1 
ATOM   2443 C  CG  . LYS B 1 145 ? 10.917  -9.403  34.760  1.00 53.55  ? 344  LYS B CG  1 
ATOM   2444 C  CD  . LYS B 1 145 ? 12.213  -10.008 34.244  1.00 57.90  ? 344  LYS B CD  1 
ATOM   2445 C  CE  . LYS B 1 145 ? 11.987  -11.405 33.685  1.00 60.50  ? 344  LYS B CE  1 
ATOM   2446 N  NZ  . LYS B 1 145 ? 13.268  -12.079 33.336  1.00 59.55  ? 344  LYS B NZ  1 
ATOM   2447 N  N   . GLU B 1 146 ? 9.430   -6.821  35.037  1.00 51.33  ? 345  GLU B N   1 
ATOM   2448 C  CA  . GLU B 1 146 ? 9.004   -5.953  36.139  1.00 54.07  ? 345  GLU B CA  1 
ATOM   2449 C  C   . GLU B 1 146 ? 7.944   -4.966  35.647  1.00 59.42  ? 345  GLU B C   1 
ATOM   2450 O  O   . GLU B 1 146 ? 7.060   -4.587  36.416  1.00 86.81  ? 345  GLU B O   1 
ATOM   2451 C  CB  . GLU B 1 146 ? 10.192  -5.228  36.756  1.00 54.43  ? 345  GLU B CB  1 
ATOM   2452 C  CG  . GLU B 1 146 ? 11.429  -6.100  36.906  1.00 57.99  ? 345  GLU B CG  1 
ATOM   2453 C  CD  . GLU B 1 146 ? 12.690  -5.272  37.066  1.00 59.34  ? 345  GLU B CD  1 
ATOM   2454 O  OE1 . GLU B 1 146 ? 12.668  -4.301  37.849  1.00 59.04  ? 345  GLU B OE1 1 
ATOM   2455 O  OE2 . GLU B 1 146 ? 13.709  -5.585  36.406  1.00 65.26  ? 345  GLU B OE2 1 
ATOM   2456 N  N   . GLY B 1 147 ? 8.021   -4.564  34.385  1.00 53.63  ? 346  GLY B N   1 
ATOM   2457 C  CA  . GLY B 1 147 ? 7.074   -3.651  33.773  1.00 55.78  ? 346  GLY B CA  1 
ATOM   2458 C  C   . GLY B 1 147 ? 6.990   -2.298  34.440  1.00 66.09  ? 346  GLY B C   1 
ATOM   2459 O  O   . GLY B 1 147 ? 6.278   -2.107  35.428  1.00 73.90  ? 346  GLY B O   1 
ATOM   2460 N  N   . ARG B 1 148 ? 7.719   -1.292  33.925  1.00 73.36  ? 347  ARG B N   1 
ATOM   2461 C  CA  . ARG B 1 148 ? 7.619   0.028   34.547  1.00 77.89  ? 347  ARG B CA  1 
ATOM   2462 C  C   . ARG B 1 148 ? 6.976   1.033   33.594  1.00 82.37  ? 347  ARG B C   1 
ATOM   2463 O  O   . ARG B 1 148 ? 6.938   0.805   32.387  1.00 90.63  ? 347  ARG B O   1 
ATOM   2464 C  CB  . ARG B 1 148 ? 8.988   0.531   35.007  1.00 77.94  ? 347  ARG B CB  1 
ATOM   2465 C  CG  . ARG B 1 148 ? 9.129   0.606   36.521  1.00 74.41  ? 347  ARG B CG  1 
ATOM   2466 C  CD  . ARG B 1 148 ? 9.794   1.899   36.948  1.00 67.21  ? 347  ARG B CD  1 
ATOM   2467 N  NE  . ARG B 1 148 ? 9.749   2.096   38.396  1.00 63.48  ? 347  ARG B NE  1 
ATOM   2468 C  CZ  . ARG B 1 148 ? 9.851   3.292   38.972  1.00 65.64  ? 347  ARG B CZ  1 
ATOM   2469 N  NH1 . ARG B 1 148 ? 9.984   4.378   38.228  1.00 58.63  ? 347  ARG B NH1 1 
ATOM   2470 N  NH2 . ARG B 1 148 ? 9.806   3.405   40.293  1.00 73.91  ? 347  ARG B NH2 1 
ATOM   2471 N  N   . HIS B 1 149 ? 6.462   2.128   34.159  1.00 83.55  ? 348  HIS B N   1 
ATOM   2472 C  CA  . HIS B 1 149 ? 5.770   3.183   33.434  1.00 82.65  ? 348  HIS B CA  1 
ATOM   2473 C  C   . HIS B 1 149 ? 4.410   2.703   32.936  1.00 83.87  ? 348  HIS B C   1 
ATOM   2474 O  O   . HIS B 1 149 ? 4.353   1.779   32.120  1.00 87.58  ? 348  HIS B O   1 
ATOM   2475 C  CB  . HIS B 1 149 ? 6.634   3.683   32.272  1.00 82.36  ? 348  HIS B CB  1 
ATOM   2476 C  CG  . HIS B 1 149 ? 7.586   4.790   32.643  1.00 83.23  ? 348  HIS B CG  1 
ATOM   2477 N  ND1 . HIS B 1 149 ? 7.768   5.919   31.868  1.00 82.31  ? 348  HIS B ND1 1 
ATOM   2478 C  CD2 . HIS B 1 149 ? 8.393   4.945   33.717  1.00 83.02  ? 348  HIS B CD2 1 
ATOM   2479 C  CE1 . HIS B 1 149 ? 8.645   6.718   32.439  1.00 82.71  ? 348  HIS B CE1 1 
ATOM   2480 N  NE2 . HIS B 1 149 ? 9.050   6.150   33.562  1.00 81.84  ? 348  HIS B NE2 1 
ATOM   2481 N  N   . GLY C 1 1   ? 6.266   51.412  58.715  1.00 40.06  ? 400  GLY C N   1 
ATOM   2482 C  CA  . GLY C 1 1   ? 5.610   52.673  58.429  1.00 62.07  ? 400  GLY C CA  1 
ATOM   2483 C  C   . GLY C 1 1   ? 6.357   53.881  58.959  1.00 63.78  ? 400  GLY C C   1 
ATOM   2484 O  O   . GLY C 1 1   ? 5.828   54.992  58.996  1.00 75.10  ? 400  GLY C O   1 
ATOM   2485 N  N   . MET C 1 2   ? 7.599   53.675  59.378  1.00 64.27  ? 401  MET C N   1 
ATOM   2486 C  CA  . MET C 1 2   ? 8.459   54.723  59.906  1.00 64.51  ? 401  MET C CA  1 
ATOM   2487 C  C   . MET C 1 2   ? 9.908   54.471  59.488  1.00 64.68  ? 401  MET C C   1 
ATOM   2488 O  O   . MET C 1 2   ? 10.217  54.366  58.300  1.00 67.60  ? 401  MET C O   1 
ATOM   2489 C  CB  . MET C 1 2   ? 8.362   54.806  61.427  1.00 68.14  ? 401  MET C CB  1 
ATOM   2490 C  CG  . MET C 1 2   ? 7.403   53.840  62.087  1.00 70.69  ? 401  MET C CG  1 
ATOM   2491 S  SD  . MET C 1 2   ? 7.950   52.120  62.032  1.00 55.91  ? 401  MET C SD  1 
ATOM   2492 C  CE  . MET C 1 2   ? 7.387   51.549  63.636  1.00 44.42  ? 401  MET C CE  1 
ATOM   2493 N  N   . LYS C 1 3   ? 10.794  54.361  60.473  1.00 61.02  ? 402  LYS C N   1 
ATOM   2494 C  CA  . LYS C 1 3   ? 12.191  54.012  60.225  1.00 50.62  ? 402  LYS C CA  1 
ATOM   2495 C  C   . LYS C 1 3   ? 12.328  52.491  60.178  1.00 43.21  ? 402  LYS C C   1 
ATOM   2496 O  O   . LYS C 1 3   ? 13.419  51.928  60.189  1.00 41.65  ? 402  LYS C O   1 
ATOM   2497 C  CB  . LYS C 1 3   ? 13.109  54.608  61.287  1.00 51.22  ? 402  LYS C CB  1 
ATOM   2498 C  CG  . LYS C 1 3   ? 13.677  55.980  60.942  1.00 54.81  ? 402  LYS C CG  1 
ATOM   2499 C  CD  . LYS C 1 3   ? 14.227  56.687  62.171  1.00 56.18  ? 402  LYS C CD  1 
ATOM   2500 C  CE  . LYS C 1 3   ? 14.866  58.016  61.815  1.00 55.17  ? 402  LYS C CE  1 
ATOM   2501 N  NZ  . LYS C 1 3   ? 14.289  59.154  62.602  1.00 42.01  ? 402  LYS C NZ  1 
ATOM   2502 N  N   . MET C 1 4   ? 11.174  51.837  60.128  1.00 38.84  ? 403  MET C N   1 
ATOM   2503 C  CA  . MET C 1 4   ? 11.090  50.387  60.039  1.00 39.55  ? 403  MET C CA  1 
ATOM   2504 C  C   . MET C 1 4   ? 11.202  49.972  58.572  1.00 33.78  ? 403  MET C C   1 
ATOM   2505 O  O   . MET C 1 4   ? 11.888  49.010  58.240  1.00 31.53  ? 403  MET C O   1 
ATOM   2506 C  CB  . MET C 1 4   ? 9.788   49.876  60.646  1.00 38.28  ? 403  MET C CB  1 
ATOM   2507 C  CG  . MET C 1 4   ? 9.855   49.553  62.129  1.00 36.81  ? 403  MET C CG  1 
ATOM   2508 S  SD  . MET C 1 4   ? 11.214  48.444  62.538  1.00 62.02  ? 403  MET C SD  1 
ATOM   2509 C  CE  . MET C 1 4   ? 10.521  46.866  62.058  1.00 42.31  ? 403  MET C CE  1 
ATOM   2510 N  N   . LEU C 1 5   ? 10.510  50.742  57.739  1.00 29.25  ? 404  LEU C N   1 
ATOM   2511 C  CA  . LEU C 1 5   ? 10.550  50.556  56.296  1.00 31.43  ? 404  LEU C CA  1 
ATOM   2512 C  C   . LEU C 1 5   ? 12.003  50.529  55.820  1.00 29.31  ? 404  LEU C C   1 
ATOM   2513 O  O   . LEU C 1 5   ? 12.462  49.549  55.244  1.00 33.09  ? 404  LEU C O   1 
ATOM   2514 C  CB  . LEU C 1 5   ? 9.791   51.668  55.577  1.00 27.54  ? 404  LEU C CB  1 
ATOM   2515 C  CG  . LEU C 1 5   ? 8.352   51.923  56.021  1.00 32.11  ? 404  LEU C CG  1 
ATOM   2516 C  CD1 . LEU C 1 5   ? 7.704   53.012  55.178  1.00 44.75  ? 404  LEU C CD1 1 
ATOM   2517 C  CD2 . LEU C 1 5   ? 7.542   50.636  55.957  1.00 50.37  ? 404  LEU C CD2 1 
ATOM   2518 N  N   . GLU C 1 6   ? 12.689  51.632  56.099  1.00 27.13  ? 405  GLU C N   1 
ATOM   2519 C  CA  . GLU C 1 6   ? 14.081  51.840  55.740  1.00 33.91  ? 405  GLU C CA  1 
ATOM   2520 C  C   . GLU C 1 6   ? 14.929  50.610  56.030  1.00 34.51  ? 405  GLU C C   1 
ATOM   2521 O  O   . GLU C 1 6   ? 15.841  50.301  55.258  1.00 28.07  ? 405  GLU C O   1 
ATOM   2522 C  CB  . GLU C 1 6   ? 14.619  53.071  56.482  1.00 43.05  ? 405  GLU C CB  1 
ATOM   2523 C  CG  . GLU C 1 6   ? 13.517  54.041  56.886  1.00 53.28  ? 405  GLU C CG  1 
ATOM   2524 C  CD  . GLU C 1 6   ? 12.756  54.605  55.701  1.00 59.09  ? 405  GLU C CD  1 
ATOM   2525 O  OE1 . GLU C 1 6   ? 13.385  55.260  54.841  1.00 79.40  ? 405  GLU C OE1 1 
ATOM   2526 O  OE2 . GLU C 1 6   ? 11.528  54.409  55.614  1.00 55.94  ? 405  GLU C OE2 1 
ATOM   2527 N  N   . GLN C 1 7   ? 14.629  49.914  57.125  1.00 34.19  ? 406  GLN C N   1 
ATOM   2528 C  CA  . GLN C 1 7   ? 15.329  48.683  57.456  1.00 30.98  ? 406  GLN C CA  1 
ATOM   2529 C  C   . GLN C 1 7   ? 15.019  47.610  56.412  1.00 28.26  ? 406  GLN C C   1 
ATOM   2530 O  O   . GLN C 1 7   ? 15.931  46.919  55.961  1.00 22.05  ? 406  GLN C O   1 
ATOM   2531 C  CB  . GLN C 1 7   ? 14.968  48.164  58.852  1.00 36.09  ? 406  GLN C CB  1 
ATOM   2532 C  CG  . GLN C 1 7   ? 15.288  46.688  59.036  1.00 31.28  ? 406  GLN C CG  1 
ATOM   2533 C  CD  . GLN C 1 7   ? 15.479  46.227  60.462  1.00 23.40  ? 406  GLN C CD  1 
ATOM   2534 O  OE1 . GLN C 1 7   ? 16.119  45.200  60.718  1.00 21.23  ? 406  GLN C OE1 1 
ATOM   2535 N  NE2 . GLN C 1 7   ? 14.932  46.968  61.415  1.00 36.92  ? 406  GLN C NE2 1 
ATOM   2536 N  N   . LEU C 1 8   ? 13.742  47.499  56.065  1.00 26.95  ? 407  LEU C N   1 
ATOM   2537 C  CA  . LEU C 1 8   ? 13.271  46.558  55.052  1.00 22.55  ? 407  LEU C CA  1 
ATOM   2538 C  C   . LEU C 1 8   ? 13.942  46.882  53.722  1.00 18.58  ? 407  LEU C C   1 
ATOM   2539 O  O   . LEU C 1 8   ? 14.454  46.012  53.026  1.00 20.71  ? 407  LEU C O   1 
ATOM   2540 C  CB  . LEU C 1 8   ? 11.752  46.606  54.896  1.00 22.55  ? 407  LEU C CB  1 
ATOM   2541 C  CG  . LEU C 1 8   ? 11.090  45.710  53.853  1.00 14.91  ? 407  LEU C CG  1 
ATOM   2542 C  CD1 . LEU C 1 8   ? 11.522  44.258  53.995  1.00 1.36   ? 407  LEU C CD1 1 
ATOM   2543 C  CD2 . LEU C 1 8   ? 9.565   45.788  53.946  1.00 12.98  ? 407  LEU C CD2 1 
ATOM   2544 N  N   . GLU C 1 9   ? 13.939  48.168  53.377  1.00 25.64  ? 408  GLU C N   1 
ATOM   2545 C  CA  . GLU C 1 9   ? 14.565  48.569  52.115  1.00 26.20  ? 408  GLU C CA  1 
ATOM   2546 C  C   . GLU C 1 9   ? 16.015  48.113  52.048  1.00 33.31  ? 408  GLU C C   1 
ATOM   2547 O  O   . GLU C 1 9   ? 16.463  47.565  51.035  1.00 37.19  ? 408  GLU C O   1 
ATOM   2548 C  CB  . GLU C 1 9   ? 14.452  50.082  51.939  1.00 15.92  ? 408  GLU C CB  1 
ATOM   2549 C  CG  . GLU C 1 9   ? 13.009  50.567  51.872  1.00 18.29  ? 408  GLU C CG  1 
ATOM   2550 C  CD  . GLU C 1 9   ? 12.936  52.081  51.911  1.00 21.25  ? 408  GLU C CD  1 
ATOM   2551 O  OE1 . GLU C 1 9   ? 13.663  52.678  52.730  1.00 31.04  ? 408  GLU C OE1 1 
ATOM   2552 O  OE2 . GLU C 1 9   ? 12.163  52.666  51.124  1.00 17.48  ? 408  GLU C OE2 1 
ATOM   2553 N  N   . LYS C 1 10  ? 16.778  48.306  53.126  1.00 31.07  ? 409  LYS C N   1 
ATOM   2554 C  CA  . LYS C 1 10  ? 18.174  47.847  53.059  1.00 25.24  ? 409  LYS C CA  1 
ATOM   2555 C  C   . LYS C 1 10  ? 18.227  46.339  52.909  1.00 26.14  ? 409  LYS C C   1 
ATOM   2556 O  O   . LYS C 1 10  ? 19.062  45.801  52.173  1.00 32.85  ? 409  LYS C O   1 
ATOM   2557 C  CB  . LYS C 1 10  ? 18.938  48.330  54.290  1.00 26.99  ? 409  LYS C CB  1 
ATOM   2558 C  CG  . LYS C 1 10  ? 20.001  47.376  54.810  1.00 24.69  ? 409  LYS C CG  1 
ATOM   2559 C  CD  . LYS C 1 10  ? 20.570  47.886  56.131  1.00 29.96  ? 409  LYS C CD  1 
ATOM   2560 C  CE  . LYS C 1 10  ? 19.582  47.690  57.267  1.00 37.77  ? 409  LYS C CE  1 
ATOM   2561 N  NZ  . LYS C 1 10  ? 19.033  46.303  57.312  1.00 25.60  ? 409  LYS C NZ  1 
ATOM   2562 N  N   . LYS C 1 11  ? 17.333  45.616  53.598  1.00 25.00  ? 410  LYS C N   1 
ATOM   2563 C  CA  . LYS C 1 11  ? 17.383  44.160  53.489  1.00 27.09  ? 410  LYS C CA  1 
ATOM   2564 C  C   . LYS C 1 11  ? 16.974  43.674  52.100  1.00 24.96  ? 410  LYS C C   1 
ATOM   2565 O  O   . LYS C 1 11  ? 17.341  42.573  51.689  1.00 17.60  ? 410  LYS C O   1 
ATOM   2566 C  CB  . LYS C 1 11  ? 16.474  43.483  54.516  1.00 32.49  ? 410  LYS C CB  1 
ATOM   2567 C  CG  . LYS C 1 11  ? 16.859  43.720  55.963  1.00 32.27  ? 410  LYS C CG  1 
ATOM   2568 C  CD  . LYS C 1 11  ? 15.924  42.985  56.917  1.00 28.47  ? 410  LYS C CD  1 
ATOM   2569 C  CE  . LYS C 1 11  ? 16.516  42.995  58.319  1.00 35.44  ? 410  LYS C CE  1 
ATOM   2570 N  NZ  . LYS C 1 11  ? 17.655  42.042  58.453  1.00 23.86  ? 410  LYS C NZ  1 
ATOM   2571 N  N   . LEU C 1 12  ? 16.191  44.492  51.418  1.00 17.99  ? 411  LEU C N   1 
ATOM   2572 C  CA  . LEU C 1 12  ? 15.581  44.138  50.143  1.00 26.49  ? 411  LEU C CA  1 
ATOM   2573 C  C   . LEU C 1 12  ? 16.495  44.504  48.981  1.00 27.45  ? 411  LEU C C   1 
ATOM   2574 O  O   . LEU C 1 12  ? 16.402  43.947  47.890  1.00 30.90  ? 411  LEU C O   1 
ATOM   2575 C  CB  . LEU C 1 12  ? 14.244  44.861  50.025  1.00 28.57  ? 411  LEU C CB  1 
ATOM   2576 C  CG  . LEU C 1 12  ? 13.405  44.690  48.765  1.00 27.07  ? 411  LEU C CG  1 
ATOM   2577 C  CD1 . LEU C 1 12  ? 12.914  43.259  48.618  1.00 23.60  ? 411  LEU C CD1 1 
ATOM   2578 C  CD2 . LEU C 1 12  ? 12.231  45.662  48.797  1.00 34.49  ? 411  LEU C CD2 1 
ATOM   2579 N  N   . GLY C 1 13  ? 17.379  45.459  49.248  1.00 22.08  ? 412  GLY C N   1 
ATOM   2580 C  CA  . GLY C 1 13  ? 18.267  45.981  48.223  1.00 27.62  ? 412  GLY C CA  1 
ATOM   2581 C  C   . GLY C 1 13  ? 17.484  46.939  47.336  1.00 31.42  ? 412  GLY C C   1 
ATOM   2582 O  O   . GLY C 1 13  ? 17.764  47.103  46.151  1.00 50.08  ? 412  GLY C O   1 
ATOM   2583 N  N   . TYR C 1 14  ? 16.482  47.567  47.942  1.00 20.52  ? 413  TYR C N   1 
ATOM   2584 C  CA  . TYR C 1 14  ? 15.644  48.493  47.189  1.00 13.94  ? 413  TYR C CA  1 
ATOM   2585 C  C   . TYR C 1 14  ? 14.934  49.463  48.128  1.00 18.56  ? 413  TYR C C   1 
ATOM   2586 O  O   . TYR C 1 14  ? 14.372  49.048  49.135  1.00 21.54  ? 413  TYR C O   1 
ATOM   2587 C  CB  . TYR C 1 14  ? 14.637  47.712  46.336  1.00 12.23  ? 413  TYR C CB  1 
ATOM   2588 C  CG  . TYR C 1 14  ? 13.769  48.616  45.492  1.00 16.00  ? 413  TYR C CG  1 
ATOM   2589 C  CD1 . TYR C 1 14  ? 14.208  49.075  44.258  1.00 12.23  ? 413  TYR C CD1 1 
ATOM   2590 C  CD2 . TYR C 1 14  ? 12.509  49.010  45.937  1.00 19.92  ? 413  TYR C CD2 1 
ATOM   2591 C  CE1 . TYR C 1 14  ? 13.416  49.904  43.483  1.00 16.54  ? 413  TYR C CE1 1 
ATOM   2592 C  CE2 . TYR C 1 14  ? 11.714  49.838  45.169  1.00 16.40  ? 413  TYR C CE2 1 
ATOM   2593 C  CZ  . TYR C 1 14  ? 12.172  50.280  43.943  1.00 22.08  ? 413  TYR C CZ  1 
ATOM   2594 O  OH  . TYR C 1 14  ? 11.383  51.107  43.171  1.00 24.22  ? 413  TYR C OH  1 
ATOM   2595 N  N   . THR C 1 15  ? 14.995  50.719  47.762  1.00 21.28  ? 414  THR C N   1 
ATOM   2596 C  CA  . THR C 1 15  ? 14.462  51.905  48.384  1.00 18.17  ? 414  THR C CA  1 
ATOM   2597 C  C   . THR C 1 15  ? 13.335  52.476  47.530  1.00 21.84  ? 414  THR C C   1 
ATOM   2598 O  O   . THR C 1 15  ? 13.595  52.818  46.371  1.00 31.93  ? 414  THR C O   1 
ATOM   2599 C  CB  . THR C 1 15  ? 15.594  52.941  48.550  1.00 20.88  ? 414  THR C CB  1 
ATOM   2600 O  OG1 . THR C 1 15  ? 16.680  52.324  49.263  1.00 25.28  ? 414  THR C OG1 1 
ATOM   2601 C  CG2 . THR C 1 15  ? 15.136  54.142  49.355  1.00 6.14   ? 414  THR C CG2 1 
ATOM   2602 N  N   . PHE C 1 16  ? 12.126  52.569  48.058  1.00 24.60  ? 415  PHE C N   1 
ATOM   2603 C  CA  . PHE C 1 16  ? 10.914  52.947  47.356  1.00 21.70  ? 415  PHE C CA  1 
ATOM   2604 C  C   . PHE C 1 16  ? 10.773  54.414  47.002  1.00 19.83  ? 415  PHE C C   1 
ATOM   2605 O  O   . PHE C 1 16  ? 11.001  55.308  47.819  1.00 19.17  ? 415  PHE C O   1 
ATOM   2606 C  CB  . PHE C 1 16  ? 9.667   52.597  48.214  1.00 9.19   ? 415  PHE C CB  1 
ATOM   2607 C  CG  . PHE C 1 16  ? 9.256   51.155  47.956  1.00 8.55   ? 415  PHE C CG  1 
ATOM   2608 C  CD1 . PHE C 1 16  ? 10.091  50.122  48.336  1.00 5.53   ? 415  PHE C CD1 1 
ATOM   2609 C  CD2 . PHE C 1 16  ? 8.055   50.856  47.340  1.00 16.56  ? 415  PHE C CD2 1 
ATOM   2610 C  CE1 . PHE C 1 16  ? 9.744   48.804  48.118  1.00 16.27  ? 415  PHE C CE1 1 
ATOM   2611 C  CE2 . PHE C 1 16  ? 7.693   49.543  47.117  1.00 14.93  ? 415  PHE C CE2 1 
ATOM   2612 C  CZ  . PHE C 1 16  ? 8.535   48.521  47.512  1.00 21.42  ? 415  PHE C CZ  1 
ATOM   2613 N  N   . LYS C 1 17  ? 10.346  54.653  45.759  1.00 20.04  ? 416  LYS C N   1 
ATOM   2614 C  CA  . LYS C 1 17  ? 10.026  56.038  45.390  1.00 16.92  ? 416  LYS C CA  1 
ATOM   2615 C  C   . LYS C 1 17  ? 8.805   56.484  46.191  1.00 22.30  ? 416  LYS C C   1 
ATOM   2616 O  O   . LYS C 1 17  ? 8.739   57.585  46.724  1.00 32.34  ? 416  LYS C O   1 
ATOM   2617 C  CB  . LYS C 1 17  ? 9.790   56.170  43.889  1.00 14.41  ? 416  LYS C CB  1 
ATOM   2618 C  CG  . LYS C 1 17  ? 11.049  55.999  43.046  1.00 18.79  ? 416  LYS C CG  1 
ATOM   2619 C  CD  . LYS C 1 17  ? 10.745  55.399  41.682  1.00 26.02  ? 416  LYS C CD  1 
ATOM   2620 C  CE  . LYS C 1 17  ? 11.599  54.184  41.375  1.00 26.36  ? 416  LYS C CE  1 
ATOM   2621 N  NZ  . LYS C 1 17  ? 11.393  53.663  39.992  1.00 25.59  ? 416  LYS C NZ  1 
ATOM   2622 N  N   . ASP C 1 18  ? 7.840   55.571  46.255  1.00 19.38  ? 417  ASP C N   1 
ATOM   2623 C  CA  . ASP C 1 18  ? 6.573   55.788  46.927  1.00 22.06  ? 417  ASP C CA  1 
ATOM   2624 C  C   . ASP C 1 18  ? 6.451   54.895  48.158  1.00 19.67  ? 417  ASP C C   1 
ATOM   2625 O  O   . ASP C 1 18  ? 6.182   53.700  48.045  1.00 14.19  ? 417  ASP C O   1 
ATOM   2626 C  CB  . ASP C 1 18  ? 5.430   55.524  45.945  1.00 35.25  ? 417  ASP C CB  1 
ATOM   2627 C  CG  . ASP C 1 18  ? 4.102   56.015  46.490  1.00 36.51  ? 417  ASP C CG  1 
ATOM   2628 O  OD1 . ASP C 1 18  ? 3.862   55.839  47.703  1.00 27.27  ? 417  ASP C OD1 1 
ATOM   2629 O  OD2 . ASP C 1 18  ? 3.327   56.570  45.690  1.00 37.36  ? 417  ASP C OD2 1 
ATOM   2630 N  N   . LYS C 1 19  ? 6.675   55.505  49.313  1.00 27.26  ? 418  LYS C N   1 
ATOM   2631 C  CA  . LYS C 1 19  ? 6.664   54.870  50.618  1.00 23.73  ? 418  LYS C CA  1 
ATOM   2632 C  C   . LYS C 1 19  ? 5.382   54.074  50.861  1.00 21.67  ? 418  LYS C C   1 
ATOM   2633 O  O   . LYS C 1 19  ? 5.433   52.872  51.122  1.00 23.09  ? 418  LYS C O   1 
ATOM   2634 C  CB  . LYS C 1 19  ? 6.818   55.916  51.730  1.00 19.35  ? 418  LYS C CB  1 
ATOM   2635 C  CG  . LYS C 1 19  ? 8.195   56.527  51.873  1.00 27.17  ? 418  LYS C CG  1 
ATOM   2636 C  CD  . LYS C 1 19  ? 9.320   55.563  51.531  1.00 29.20  ? 418  LYS C CD  1 
ATOM   2637 C  CE  . LYS C 1 19  ? 10.628  56.306  51.300  1.00 27.15  ? 418  LYS C CE  1 
ATOM   2638 N  NZ  . LYS C 1 19  ? 11.664  55.453  50.650  1.00 18.99  ? 418  LYS C NZ  1 
ATOM   2639 N  N   . SER C 1 20  ? 4.249   54.758  50.781  1.00 26.22  ? 419  SER C N   1 
ATOM   2640 C  CA  . SER C 1 20  ? 2.945   54.194  51.121  1.00 25.42  ? 419  SER C CA  1 
ATOM   2641 C  C   . SER C 1 20  ? 2.628   52.951  50.298  1.00 30.66  ? 419  SER C C   1 
ATOM   2642 O  O   . SER C 1 20  ? 1.809   52.129  50.710  1.00 28.50  ? 419  SER C O   1 
ATOM   2643 C  CB  . SER C 1 20  ? 1.853   55.252  50.960  1.00 27.88  ? 419  SER C CB  1 
ATOM   2644 O  OG  . SER C 1 20  ? 1.798   55.783  49.652  1.00 26.18  ? 419  SER C OG  1 
ATOM   2645 N  N   . LEU C 1 21  ? 3.275   52.806  49.144  1.00 34.70  ? 420  LEU C N   1 
ATOM   2646 C  CA  . LEU C 1 21  ? 3.164   51.593  48.340  1.00 24.87  ? 420  LEU C CA  1 
ATOM   2647 C  C   . LEU C 1 21  ? 3.728   50.404  49.105  1.00 12.53  ? 420  LEU C C   1 
ATOM   2648 O  O   . LEU C 1 21  ? 3.163   49.314  49.125  1.00 11.21  ? 420  LEU C O   1 
ATOM   2649 C  CB  . LEU C 1 21  ? 3.911   51.770  47.020  1.00 35.01  ? 420  LEU C CB  1 
ATOM   2650 C  CG  . LEU C 1 21  ? 3.470   50.908  45.838  1.00 34.21  ? 420  LEU C CG  1 
ATOM   2651 C  CD1 . LEU C 1 21  ? 2.034   51.208  45.442  1.00 36.40  ? 420  LEU C CD1 1 
ATOM   2652 C  CD2 . LEU C 1 21  ? 4.408   51.124  44.659  1.00 31.91  ? 420  LEU C CD2 1 
ATOM   2653 N  N   . LEU C 1 22  ? 4.875   50.634  49.746  1.00 14.04  ? 421  LEU C N   1 
ATOM   2654 C  CA  . LEU C 1 22  ? 5.523   49.647  50.597  1.00 14.22  ? 421  LEU C CA  1 
ATOM   2655 C  C   . LEU C 1 22  ? 4.673   49.345  51.829  1.00 10.28  ? 421  LEU C C   1 
ATOM   2656 O  O   . LEU C 1 22  ? 4.438   48.189  52.163  1.00 8.29   ? 421  LEU C O   1 
ATOM   2657 C  CB  . LEU C 1 22  ? 6.886   50.152  51.073  1.00 13.66  ? 421  LEU C CB  1 
ATOM   2658 C  CG  . LEU C 1 22  ? 8.036   49.163  51.220  1.00 9.44   ? 421  LEU C CG  1 
ATOM   2659 C  CD1 . LEU C 1 22  ? 9.012   49.633  52.290  1.00 12.22  ? 421  LEU C CD1 1 
ATOM   2660 C  CD2 . LEU C 1 22  ? 7.549   47.760  51.529  1.00 29.52  ? 421  LEU C CD2 1 
ATOM   2661 N  N   . GLU C 1 23  ? 4.252   50.419  52.496  1.00 11.21  ? 422  GLU C N   1 
ATOM   2662 C  CA  . GLU C 1 23  ? 3.445   50.302  53.701  1.00 23.68  ? 422  GLU C CA  1 
ATOM   2663 C  C   . GLU C 1 23  ? 2.207   49.438  53.452  1.00 26.60  ? 422  GLU C C   1 
ATOM   2664 O  O   . GLU C 1 23  ? 1.824   48.645  54.312  1.00 16.48  ? 422  GLU C O   1 
ATOM   2665 C  CB  . GLU C 1 23  ? 3.013   51.683  54.192  1.00 25.36  ? 422  GLU C CB  1 
ATOM   2666 C  CG  . GLU C 1 23  ? 4.134   52.685  54.344  1.00 24.88  ? 422  GLU C CG  1 
ATOM   2667 C  CD  . GLU C 1 23  ? 3.740   53.888  55.177  1.00 28.39  ? 422  GLU C CD  1 
ATOM   2668 O  OE1 . GLU C 1 23  ? 2.822   54.624  54.761  1.00 28.83  ? 422  GLU C OE1 1 
ATOM   2669 O  OE2 . GLU C 1 23  ? 4.352   54.098  56.246  1.00 41.92  ? 422  GLU C OE2 1 
ATOM   2670 N  N   . LYS C 1 24  ? 1.638   49.643  52.269  1.00 20.26  ? 423  LYS C N   1 
ATOM   2671 C  CA  . LYS C 1 24  ? 0.412   48.985  51.833  1.00 23.60  ? 423  LYS C CA  1 
ATOM   2672 C  C   . LYS C 1 24  ? 0.591   47.486  51.677  1.00 19.76  ? 423  LYS C C   1 
ATOM   2673 O  O   . LYS C 1 24  ? -0.218  46.692  52.163  1.00 18.52  ? 423  LYS C O   1 
ATOM   2674 C  CB  . LYS C 1 24  ? -0.083  49.600  50.517  1.00 18.63  ? 423  LYS C CB  1 
ATOM   2675 C  CG  . LYS C 1 24  ? -1.168  48.765  49.850  1.00 21.35  ? 423  LYS C CG  1 
ATOM   2676 C  CD  . LYS C 1 24  ? -1.604  49.400  48.538  1.00 22.98  ? 423  LYS C CD  1 
ATOM   2677 C  CE  . LYS C 1 24  ? -2.842  50.255  48.751  1.00 27.91  ? 423  LYS C CE  1 
ATOM   2678 N  NZ  . LYS C 1 24  ? -4.022  49.710  48.018  1.00 23.68  ? 423  LYS C NZ  1 
ATOM   2679 N  N   . ALA C 1 25  ? 1.660   47.039  51.005  1.00 15.37  ? 424  ALA C N   1 
ATOM   2680 C  CA  . ALA C 1 25  ? 1.846   45.590  50.913  1.00 11.34  ? 424  ALA C CA  1 
ATOM   2681 C  C   . ALA C 1 25  ? 2.135   44.972  52.278  1.00 9.49   ? 424  ALA C C   1 
ATOM   2682 O  O   . ALA C 1 25  ? 2.051   43.754  52.423  1.00 19.50  ? 424  ALA C O   1 
ATOM   2683 C  CB  . ALA C 1 25  ? 2.961   45.247  49.935  1.00 24.41  ? 424  ALA C CB  1 
ATOM   2684 N  N   . LEU C 1 26  ? 2.480   45.786  53.266  1.00 24.35  ? 425  LEU C N   1 
ATOM   2685 C  CA  . LEU C 1 26  ? 2.797   45.353  54.620  1.00 24.26  ? 425  LEU C CA  1 
ATOM   2686 C  C   . LEU C 1 26  ? 1.560   45.338  55.515  1.00 13.66  ? 425  LEU C C   1 
ATOM   2687 O  O   . LEU C 1 26  ? 1.541   44.749  56.596  1.00 24.66  ? 425  LEU C O   1 
ATOM   2688 C  CB  . LEU C 1 26  ? 3.827   46.289  55.242  1.00 22.41  ? 425  LEU C CB  1 
ATOM   2689 C  CG  . LEU C 1 26  ? 5.317   46.003  55.179  1.00 18.32  ? 425  LEU C CG  1 
ATOM   2690 C  CD1 . LEU C 1 26  ? 5.634   44.627  54.614  1.00 13.86  ? 425  LEU C CD1 1 
ATOM   2691 C  CD2 . LEU C 1 26  ? 6.030   47.063  54.352  1.00 33.54  ? 425  LEU C CD2 1 
ATOM   2692 N  N   . THR C 1 27  ? 0.505   46.005  55.072  1.00 16.71  ? 426  THR C N   1 
ATOM   2693 C  CA  . THR C 1 27  ? -0.675  46.212  55.906  1.00 19.54  ? 426  THR C CA  1 
ATOM   2694 C  C   . THR C 1 27  ? -1.820  45.242  55.673  1.00 23.21  ? 426  THR C C   1 
ATOM   2695 O  O   . THR C 1 27  ? -2.434  45.233  54.605  1.00 38.01  ? 426  THR C O   1 
ATOM   2696 C  CB  . THR C 1 27  ? -1.155  47.657  55.650  1.00 14.59  ? 426  THR C CB  1 
ATOM   2697 O  OG1 . THR C 1 27  ? 0.008   48.493  55.718  1.00 19.24  ? 426  THR C OG1 1 
ATOM   2698 C  CG2 . THR C 1 27  ? -2.124  48.144  56.709  1.00 11.20  ? 426  THR C CG2 1 
ATOM   2699 N  N   . HIS C 1 28  ? -2.118  44.438  56.686  1.00 20.80  ? 427  HIS C N   1 
ATOM   2700 C  CA  . HIS C 1 28  ? -3.289  43.569  56.755  1.00 15.27  ? 427  HIS C CA  1 
ATOM   2701 C  C   . HIS C 1 28  ? -4.549  44.437  56.826  1.00 13.92  ? 427  HIS C C   1 
ATOM   2702 O  O   . HIS C 1 28  ? -4.466  45.559  57.339  1.00 7.09   ? 427  HIS C O   1 
ATOM   2703 C  CB  . HIS C 1 28  ? -3.215  42.637  57.954  1.00 18.37  ? 427  HIS C CB  1 
ATOM   2704 C  CG  . HIS C 1 28  ? -4.276  41.586  58.046  1.00 25.37  ? 427  HIS C CG  1 
ATOM   2705 N  ND1 . HIS C 1 28  ? -5.417  41.719  58.805  1.00 19.86  ? 427  HIS C ND1 1 
ATOM   2706 C  CD2 . HIS C 1 28  ? -4.367  40.362  57.468  1.00 24.23  ? 427  HIS C CD2 1 
ATOM   2707 C  CE1 . HIS C 1 28  ? -6.161  40.636  58.691  1.00 17.02  ? 427  HIS C CE1 1 
ATOM   2708 N  NE2 . HIS C 1 28  ? -5.544  39.792  57.882  1.00 17.42  ? 427  HIS C NE2 1 
ATOM   2709 N  N   . VAL C 1 29  ? -5.660  43.935  56.306  1.00 15.31  ? 428  VAL C N   1 
ATOM   2710 C  CA  . VAL C 1 29  ? -6.902  44.705  56.221  1.00 14.56  ? 428  VAL C CA  1 
ATOM   2711 C  C   . VAL C 1 29  ? -7.398  45.106  57.602  1.00 16.32  ? 428  VAL C C   1 
ATOM   2712 O  O   . VAL C 1 29  ? -8.158  46.061  57.765  1.00 23.69  ? 428  VAL C O   1 
ATOM   2713 C  CB  . VAL C 1 29  ? -7.990  43.906  55.484  1.00 11.49  ? 428  VAL C CB  1 
ATOM   2714 C  CG1 . VAL C 1 29  ? -8.061  42.495  56.055  1.00 11.79  ? 428  VAL C CG1 1 
ATOM   2715 C  CG2 . VAL C 1 29  ? -9.338  44.601  55.559  1.00 13.94  ? 428  VAL C CG2 1 
ATOM   2716 N  N   . SER C 1 30  ? -6.965  44.393  58.639  1.00 18.77  ? 429  SER C N   1 
ATOM   2717 C  CA  . SER C 1 30  ? -7.343  44.803  59.993  1.00 20.98  ? 429  SER C CA  1 
ATOM   2718 C  C   . SER C 1 30  ? -6.774  46.173  60.339  1.00 30.46  ? 429  SER C C   1 
ATOM   2719 O  O   . SER C 1 30  ? -7.439  46.978  60.999  1.00 27.69  ? 429  SER C O   1 
ATOM   2720 C  CB  . SER C 1 30  ? -6.880  43.748  60.995  1.00 24.70  ? 429  SER C CB  1 
ATOM   2721 O  OG  . SER C 1 30  ? -5.478  43.758  61.164  1.00 14.50  ? 429  SER C OG  1 
ATOM   2722 N  N   . TYR C 1 31  ? -5.547  46.457  59.903  1.00 34.68  ? 430  TYR C N   1 
ATOM   2723 C  CA  . TYR C 1 31  ? -4.899  47.732  60.182  1.00 24.72  ? 430  TYR C CA  1 
ATOM   2724 C  C   . TYR C 1 31  ? -5.571  48.868  59.417  1.00 30.30  ? 430  TYR C C   1 
ATOM   2725 O  O   . TYR C 1 31  ? -5.855  49.919  59.995  1.00 31.29  ? 430  TYR C O   1 
ATOM   2726 C  CB  . TYR C 1 31  ? -3.403  47.686  59.837  1.00 29.54  ? 430  TYR C CB  1 
ATOM   2727 C  CG  . TYR C 1 31  ? -2.645  48.882  60.376  1.00 28.03  ? 430  TYR C CG  1 
ATOM   2728 C  CD1 . TYR C 1 31  ? -2.521  50.071  59.675  1.00 31.06  ? 430  TYR C CD1 1 
ATOM   2729 C  CD2 . TYR C 1 31  ? -2.040  48.816  61.623  1.00 26.47  ? 430  TYR C CD2 1 
ATOM   2730 C  CE1 . TYR C 1 31  ? -1.831  51.154  60.180  1.00 31.81  ? 430  TYR C CE1 1 
ATOM   2731 C  CE2 . TYR C 1 31  ? -1.344  49.887  62.142  1.00 24.00  ? 430  TYR C CE2 1 
ATOM   2732 C  CZ  . TYR C 1 31  ? -1.242  51.053  61.421  1.00 29.18  ? 430  TYR C CZ  1 
ATOM   2733 O  OH  . TYR C 1 31  ? -0.549  52.123  61.941  1.00 35.19  ? 430  TYR C OH  1 
ATOM   2734 N  N   . SER C 1 32  ? -5.801  48.683  58.124  1.00 28.06  ? 431  SER C N   1 
ATOM   2735 C  CA  . SER C 1 32  ? -6.474  49.669  57.289  1.00 22.49  ? 431  SER C CA  1 
ATOM   2736 C  C   . SER C 1 32  ? -7.418  48.966  56.323  1.00 24.97  ? 431  SER C C   1 
ATOM   2737 O  O   . SER C 1 32  ? -6.988  48.118  55.536  1.00 22.58  ? 431  SER C O   1 
ATOM   2738 C  CB  . SER C 1 32  ? -5.485  50.528  56.499  1.00 25.97  ? 431  SER C CB  1 
ATOM   2739 O  OG  . SER C 1 32  ? -6.172  51.284  55.510  1.00 34.35  ? 431  SER C OG  1 
ATOM   2740 N  N   . LYS C 1 33  ? -8.704  49.310  56.397  1.00 28.24  ? 432  LYS C N   1 
ATOM   2741 C  CA  . LYS C 1 33  ? -9.647  48.536  55.580  1.00 29.25  ? 432  LYS C CA  1 
ATOM   2742 C  C   . LYS C 1 33  ? -9.715  49.105  54.163  1.00 24.12  ? 432  LYS C C   1 
ATOM   2743 O  O   . LYS C 1 33  ? -10.249 48.431  53.283  1.00 32.63  ? 432  LYS C O   1 
ATOM   2744 C  CB  . LYS C 1 33  ? -11.021 48.455  56.228  1.00 22.76  ? 432  LYS C CB  1 
ATOM   2745 C  CG  . LYS C 1 33  ? -11.903 49.674  56.251  1.00 27.97  ? 432  LYS C CG  1 
ATOM   2746 C  CD  . LYS C 1 33  ? -12.721 49.753  57.535  1.00 33.70  ? 432  LYS C CD  1 
ATOM   2747 C  CE  . LYS C 1 33  ? -12.630 51.142  58.152  1.00 40.11  ? 432  LYS C CE  1 
ATOM   2748 N  NZ  . LYS C 1 33  ? -12.229 51.127  59.582  1.00 25.96  ? 432  LYS C NZ  1 
ATOM   2749 N  N   . LYS C 1 34  ? -9.172  50.300  53.992  1.00 17.50  ? 433  LYS C N   1 
ATOM   2750 C  CA  . LYS C 1 34  ? -9.167  51.034  52.740  1.00 25.27  ? 433  LYS C CA  1 
ATOM   2751 C  C   . LYS C 1 34  ? -7.822  50.949  52.024  1.00 29.84  ? 433  LYS C C   1 
ATOM   2752 O  O   . LYS C 1 34  ? -7.716  51.305  50.849  1.00 38.63  ? 433  LYS C O   1 
ATOM   2753 C  CB  . LYS C 1 34  ? -9.495  52.511  52.973  1.00 29.38  ? 433  LYS C CB  1 
ATOM   2754 C  CG  . LYS C 1 34  ? -10.958 52.797  53.277  1.00 43.31  ? 433  LYS C CG  1 
ATOM   2755 C  CD  . LYS C 1 34  ? -11.087 53.675  54.517  1.00 46.25  ? 433  LYS C CD  1 
ATOM   2756 C  CE  . LYS C 1 34  ? -12.516 54.165  54.695  1.00 44.43  ? 433  LYS C CE  1 
ATOM   2757 N  NZ  . LYS C 1 34  ? -13.358 53.160  55.407  1.00 53.76  ? 433  LYS C NZ  1 
ATOM   2758 N  N   . GLU C 1 35  ? -6.787  50.494  52.727  1.00 26.28  ? 434  GLU C N   1 
ATOM   2759 C  CA  . GLU C 1 35  ? -5.463  50.462  52.104  1.00 31.42  ? 434  GLU C CA  1 
ATOM   2760 C  C   . GLU C 1 35  ? -4.622  49.337  52.689  1.00 24.06  ? 434  GLU C C   1 
ATOM   2761 O  O   . GLU C 1 35  ? -3.758  49.577  53.528  1.00 18.56  ? 434  GLU C O   1 
ATOM   2762 C  CB  . GLU C 1 35  ? -4.789  51.828  52.259  1.00 37.85  ? 434  GLU C CB  1 
ATOM   2763 C  CG  . GLU C 1 35  ? -5.208  52.813  51.180  1.00 40.47  ? 434  GLU C CG  1 
ATOM   2764 C  CD  . GLU C 1 35  ? -5.378  54.231  51.668  1.00 45.18  ? 434  GLU C CD  1 
ATOM   2765 O  OE1 . GLU C 1 35  ? -5.453  54.450  52.896  1.00 72.03  ? 434  GLU C OE1 1 
ATOM   2766 O  OE2 . GLU C 1 35  ? -5.447  55.150  50.817  1.00 49.19  ? 434  GLU C OE2 1 
ATOM   2767 N  N   . HIS C 1 36  ? -4.911  48.124  52.228  1.00 25.16  ? 435  HIS C N   1 
ATOM   2768 C  CA  . HIS C 1 36  ? -4.234  46.903  52.655  1.00 24.08  ? 435  HIS C CA  1 
ATOM   2769 C  C   . HIS C 1 36  ? -3.653  46.177  51.439  1.00 17.08  ? 435  HIS C C   1 
ATOM   2770 O  O   . HIS C 1 36  ? -3.851  46.662  50.322  1.00 15.69  ? 435  HIS C O   1 
ATOM   2771 C  CB  . HIS C 1 36  ? -5.176  46.003  53.440  1.00 18.21  ? 435  HIS C CB  1 
ATOM   2772 C  CG  . HIS C 1 36  ? -6.475  45.654  52.795  1.00 9.26   ? 435  HIS C CG  1 
ATOM   2773 N  ND1 . HIS C 1 36  ? -7.544  46.528  52.741  1.00 18.20  ? 435  HIS C ND1 1 
ATOM   2774 C  CD2 . HIS C 1 36  ? -6.910  44.530  52.180  1.00 10.43  ? 435  HIS C CD2 1 
ATOM   2775 C  CE1 . HIS C 1 36  ? -8.572  45.965  52.121  1.00 15.61  ? 435  HIS C CE1 1 
ATOM   2776 N  NE2 . HIS C 1 36  ? -8.208  44.743  51.769  1.00 16.73  ? 435  HIS C NE2 1 
ATOM   2777 N  N   . TYR C 1 37  ? -2.968  45.069  51.659  1.00 15.98  ? 436  TYR C N   1 
ATOM   2778 C  CA  . TYR C 1 37  ? -2.172  44.366  50.673  1.00 16.93  ? 436  TYR C CA  1 
ATOM   2779 C  C   . TYR C 1 37  ? -2.957  43.475  49.712  1.00 23.24  ? 436  TYR C C   1 
ATOM   2780 O  O   . TYR C 1 37  ? -2.337  43.085  48.719  1.00 12.85  ? 436  TYR C O   1 
ATOM   2781 C  CB  . TYR C 1 37  ? -1.105  43.486  51.342  1.00 11.61  ? 436  TYR C CB  1 
ATOM   2782 C  CG  . TYR C 1 37  ? -1.492  42.402  52.308  1.00 15.50  ? 436  TYR C CG  1 
ATOM   2783 C  CD1 . TYR C 1 37  ? -2.132  41.220  51.951  1.00 10.14  ? 436  TYR C CD1 1 
ATOM   2784 C  CD2 . TYR C 1 37  ? -1.197  42.533  53.663  1.00 17.37  ? 436  TYR C CD2 1 
ATOM   2785 C  CE1 . TYR C 1 37  ? -2.475  40.239  52.848  1.00 15.03  ? 436  TYR C CE1 1 
ATOM   2786 C  CE2 . TYR C 1 37  ? -1.529  41.561  54.585  1.00 14.04  ? 436  TYR C CE2 1 
ATOM   2787 C  CZ  . TYR C 1 37  ? -2.170  40.413  54.183  1.00 16.49  ? 436  TYR C CZ  1 
ATOM   2788 O  OH  . TYR C 1 37  ? -2.501  39.432  55.088  1.00 21.36  ? 436  TYR C OH  1 
ATOM   2789 N  N   . GLU C 1 38  ? -4.200  43.114  49.986  1.00 24.81  ? 437  GLU C N   1 
ATOM   2790 C  CA  . GLU C 1 38  ? -4.944  42.093  49.252  1.00 17.19  ? 437  GLU C CA  1 
ATOM   2791 C  C   . GLU C 1 38  ? -4.793  42.182  47.737  1.00 16.40  ? 437  GLU C C   1 
ATOM   2792 O  O   . GLU C 1 38  ? -4.646  41.154  47.070  1.00 16.71  ? 437  GLU C O   1 
ATOM   2793 C  CB  . GLU C 1 38  ? -6.434  42.161  49.597  1.00 21.33  ? 437  GLU C CB  1 
ATOM   2794 C  CG  . GLU C 1 38  ? -7.290  41.114  48.898  1.00 28.67  ? 437  GLU C CG  1 
ATOM   2795 C  CD  . GLU C 1 38  ? -8.769  41.415  49.090  1.00 35.82  ? 437  GLU C CD  1 
ATOM   2796 O  OE1 . GLU C 1 38  ? -9.118  41.828  50.217  1.00 40.18  ? 437  GLU C OE1 1 
ATOM   2797 O  OE2 . GLU C 1 38  ? -9.569  41.253  48.146  1.00 29.21  ? 437  GLU C OE2 1 
ATOM   2798 N  N   . THR C 1 39  ? -4.833  43.390  47.189  1.00 13.51  ? 438  THR C N   1 
ATOM   2799 C  CA  . THR C 1 39  ? -4.762  43.541  45.735  1.00 24.26  ? 438  THR C CA  1 
ATOM   2800 C  C   . THR C 1 39  ? -3.344  43.435  45.200  1.00 19.70  ? 438  THR C C   1 
ATOM   2801 O  O   . THR C 1 39  ? -3.109  42.861  44.140  1.00 27.41  ? 438  THR C O   1 
ATOM   2802 C  CB  . THR C 1 39  ? -5.378  44.891  45.320  1.00 31.11  ? 438  THR C CB  1 
ATOM   2803 O  OG1 . THR C 1 39  ? -6.693  44.960  45.894  1.00 29.94  ? 438  THR C OG1 1 
ATOM   2804 C  CG2 . THR C 1 39  ? -5.512  44.982  43.808  1.00 30.93  ? 438  THR C CG2 1 
ATOM   2805 N  N   . LEU C 1 40  ? -2.366  43.976  45.921  1.00 19.01  ? 439  LEU C N   1 
ATOM   2806 C  CA  . LEU C 1 40  ? -0.974  43.752  45.541  1.00 16.37  ? 439  LEU C CA  1 
ATOM   2807 C  C   . LEU C 1 40  ? -0.628  42.287  45.735  1.00 16.22  ? 439  LEU C C   1 
ATOM   2808 O  O   . LEU C 1 40  ? 0.289   41.755  45.114  1.00 23.00  ? 439  LEU C O   1 
ATOM   2809 C  CB  . LEU C 1 40  ? -0.014  44.627  46.342  1.00 17.92  ? 439  LEU C CB  1 
ATOM   2810 C  CG  . LEU C 1 40  ? -0.281  46.131  46.304  1.00 8.81   ? 439  LEU C CG  1 
ATOM   2811 C  CD1 . LEU C 1 40  ? 0.194   46.790  47.590  1.00 20.35  ? 439  LEU C CD1 1 
ATOM   2812 C  CD2 . LEU C 1 40  ? 0.380   46.754  45.082  1.00 9.25   ? 439  LEU C CD2 1 
ATOM   2813 N  N   . GLU C 1 41  ? -1.385  41.596  46.597  1.00 21.41  ? 440  GLU C N   1 
ATOM   2814 C  CA  . GLU C 1 41  ? -1.095  40.174  46.748  1.00 11.40  ? 440  GLU C CA  1 
ATOM   2815 C  C   . GLU C 1 41  ? -1.565  39.381  45.527  1.00 6.79   ? 440  GLU C C   1 
ATOM   2816 O  O   . GLU C 1 41  ? -0.880  38.424  45.180  1.00 8.31   ? 440  GLU C O   1 
ATOM   2817 C  CB  . GLU C 1 41  ? -1.750  39.533  47.976  1.00 10.81  ? 440  GLU C CB  1 
ATOM   2818 C  CG  . GLU C 1 41  ? -1.799  38.019  47.805  1.00 11.57  ? 440  GLU C CG  1 
ATOM   2819 C  CD  . GLU C 1 41  ? -2.679  37.322  48.815  1.00 15.33  ? 440  GLU C CD  1 
ATOM   2820 O  OE1 . GLU C 1 41  ? -3.452  38.028  49.486  1.00 13.50  ? 440  GLU C OE1 1 
ATOM   2821 O  OE2 . GLU C 1 41  ? -2.581  36.082  48.933  1.00 21.94  ? 440  GLU C OE2 1 
ATOM   2822 N  N   . PHE C 1 42  ? -2.687  39.777  44.944  1.00 13.87  ? 441  PHE C N   1 
ATOM   2823 C  CA  . PHE C 1 42  ? -3.225  39.199  43.721  1.00 14.50  ? 441  PHE C CA  1 
ATOM   2824 C  C   . PHE C 1 42  ? -2.245  39.301  42.552  1.00 3.31   ? 441  PHE C C   1 
ATOM   2825 O  O   . PHE C 1 42  ? -2.097  38.420  41.709  1.00 20.60  ? 441  PHE C O   1 
ATOM   2826 C  CB  . PHE C 1 42  ? -4.517  39.917  43.320  1.00 23.09  ? 441  PHE C CB  1 
ATOM   2827 C  CG  . PHE C 1 42  ? -5.357  39.127  42.325  1.00 29.04  ? 441  PHE C CG  1 
ATOM   2828 C  CD1 . PHE C 1 42  ? -6.128  38.056  42.749  1.00 36.15  ? 441  PHE C CD1 1 
ATOM   2829 C  CD2 . PHE C 1 42  ? -5.369  39.458  40.984  1.00 28.46  ? 441  PHE C CD2 1 
ATOM   2830 C  CE1 . PHE C 1 42  ? -6.888  37.344  41.839  1.00 38.78  ? 441  PHE C CE1 1 
ATOM   2831 C  CE2 . PHE C 1 42  ? -6.126  38.751  40.069  1.00 27.58  ? 441  PHE C CE2 1 
ATOM   2832 C  CZ  . PHE C 1 42  ? -6.890  37.681  40.497  1.00 30.55  ? 441  PHE C CZ  1 
ATOM   2833 N  N   . LEU C 1 43  ? -1.560  40.430  42.507  1.00 13.09  ? 442  LEU C N   1 
ATOM   2834 C  CA  . LEU C 1 43  ? -0.530  40.657  41.496  1.00 21.01  ? 442  LEU C CA  1 
ATOM   2835 C  C   . LEU C 1 43  ? 0.767   39.961  41.877  1.00 26.06  ? 442  LEU C C   1 
ATOM   2836 O  O   . LEU C 1 43  ? 1.359   39.223  41.088  1.00 29.50  ? 442  LEU C O   1 
ATOM   2837 C  CB  . LEU C 1 43  ? -0.327  42.157  41.328  1.00 12.48  ? 442  LEU C CB  1 
ATOM   2838 C  CG  . LEU C 1 43  ? 0.807   42.586  40.393  1.00 8.52   ? 442  LEU C CG  1 
ATOM   2839 C  CD1 . LEU C 1 43  ? 0.596   42.006  39.009  1.00 20.06  ? 442  LEU C CD1 1 
ATOM   2840 C  CD2 . LEU C 1 43  ? 0.874   44.103  40.389  1.00 1.25   ? 442  LEU C CD2 1 
ATOM   2841 N  N   . GLY C 1 44  ? 1.231   40.147  43.111  1.00 21.77  ? 443  GLY C N   1 
ATOM   2842 C  CA  . GLY C 1 44  ? 2.416   39.456  43.591  1.00 3.73   ? 443  GLY C CA  1 
ATOM   2843 C  C   . GLY C 1 44  ? 2.341   37.966  43.387  1.00 11.49  ? 443  GLY C C   1 
ATOM   2844 O  O   . GLY C 1 44  ? 3.342   37.276  43.201  1.00 19.21  ? 443  GLY C O   1 
ATOM   2845 N  N   . ASP C 1 45  ? 1.126   37.428  43.422  1.00 17.02  ? 444  ASP C N   1 
ATOM   2846 C  CA  . ASP C 1 45  ? 0.898   36.009  43.194  1.00 15.68  ? 444  ASP C CA  1 
ATOM   2847 C  C   . ASP C 1 45  ? 1.405   35.599  41.814  1.00 12.43  ? 444  ASP C C   1 
ATOM   2848 O  O   . ASP C 1 45  ? 2.192   34.662  41.647  1.00 17.97  ? 444  ASP C O   1 
ATOM   2849 C  CB  . ASP C 1 45  ? -0.598  35.742  43.353  1.00 21.80  ? 444  ASP C CB  1 
ATOM   2850 C  CG  . ASP C 1 45  ? -0.973  34.280  43.340  1.00 20.65  ? 444  ASP C CG  1 
ATOM   2851 O  OD1 . ASP C 1 45  ? -0.728  33.602  42.323  1.00 38.81  ? 444  ASP C OD1 1 
ATOM   2852 O  OD2 . ASP C 1 45  ? -1.528  33.804  44.355  1.00 30.88  ? 444  ASP C OD2 1 
ATOM   2853 N  N   . ALA C 1 46  ? 0.938   36.319  40.807  1.00 10.09  ? 445  ALA C N   1 
ATOM   2854 C  CA  . ALA C 1 46  ? 1.243   36.053  39.406  1.00 13.78  ? 445  ALA C CA  1 
ATOM   2855 C  C   . ALA C 1 46  ? 2.717   36.276  39.081  1.00 8.70   ? 445  ALA C C   1 
ATOM   2856 O  O   . ALA C 1 46  ? 3.420   35.436  38.511  1.00 20.44  ? 445  ALA C O   1 
ATOM   2857 C  CB  . ALA C 1 46  ? 0.366   36.946  38.532  1.00 8.16   ? 445  ALA C CB  1 
ATOM   2858 N  N   . LEU C 1 47  ? 3.191   37.456  39.462  1.00 5.71   ? 446  LEU C N   1 
ATOM   2859 C  CA  . LEU C 1 47  ? 4.587   37.838  39.244  1.00 15.72  ? 446  LEU C CA  1 
ATOM   2860 C  C   . LEU C 1 47  ? 5.563   36.828  39.819  1.00 19.42  ? 446  LEU C C   1 
ATOM   2861 O  O   . LEU C 1 47  ? 6.454   36.323  39.128  1.00 18.50  ? 446  LEU C O   1 
ATOM   2862 C  CB  . LEU C 1 47  ? 4.808   39.224  39.850  1.00 16.64  ? 446  LEU C CB  1 
ATOM   2863 C  CG  . LEU C 1 47  ? 6.247   39.736  39.894  1.00 23.46  ? 446  LEU C CG  1 
ATOM   2864 C  CD1 . LEU C 1 47  ? 6.497   40.692  38.738  1.00 20.90  ? 446  LEU C CD1 1 
ATOM   2865 C  CD2 . LEU C 1 47  ? 6.536   40.408  41.228  1.00 13.10  ? 446  LEU C CD2 1 
ATOM   2866 N  N   . VAL C 1 48  ? 5.424   36.492  41.100  1.00 14.95  ? 447  VAL C N   1 
ATOM   2867 C  CA  . VAL C 1 48  ? 6.402   35.600  41.736  1.00 13.74  ? 447  VAL C CA  1 
ATOM   2868 C  C   . VAL C 1 48  ? 6.428   34.220  41.107  1.00 22.73  ? 447  VAL C C   1 
ATOM   2869 O  O   . VAL C 1 48  ? 7.452   33.568  40.878  1.00 11.48  ? 447  VAL C O   1 
ATOM   2870 C  CB  . VAL C 1 48  ? 6.101   35.530  43.247  1.00 11.64  ? 447  VAL C CB  1 
ATOM   2871 C  CG1 . VAL C 1 48  ? 7.126   34.696  43.994  1.00 18.45  ? 447  VAL C CG1 1 
ATOM   2872 C  CG2 . VAL C 1 48  ? 6.056   36.951  43.800  1.00 10.71  ? 447  VAL C CG2 1 
ATOM   2873 N  N   . ASN C 1 49  ? 5.233   33.721  40.800  1.00 16.95  ? 448  ASN C N   1 
ATOM   2874 C  CA  . ASN C 1 49  ? 5.118   32.442  40.120  1.00 13.19  ? 448  ASN C CA  1 
ATOM   2875 C  C   . ASN C 1 49  ? 5.927   32.432  38.825  1.00 16.79  ? 448  ASN C C   1 
ATOM   2876 O  O   . ASN C 1 49  ? 6.553   31.424  38.486  1.00 17.60  ? 448  ASN C O   1 
ATOM   2877 C  CB  . ASN C 1 49  ? 3.637   32.188  39.843  1.00 7.14   ? 448  ASN C CB  1 
ATOM   2878 C  CG  . ASN C 1 49  ? 3.377   30.883  39.120  1.00 0.70   ? 448  ASN C CG  1 
ATOM   2879 O  OD1 . ASN C 1 49  ? 3.699   29.808  39.615  1.00 19.38  ? 448  ASN C OD1 1 
ATOM   2880 N  ND2 . ASN C 1 49  ? 2.777   31.010  37.944  1.00 18.08  ? 448  ASN C ND2 1 
ATOM   2881 N  N   . PHE C 1 50  ? 5.895   33.551  38.110  1.00 16.82  ? 449  PHE C N   1 
ATOM   2882 C  CA  . PHE C 1 50  ? 6.691   33.703  36.887  1.00 21.30  ? 449  PHE C CA  1 
ATOM   2883 C  C   . PHE C 1 50  ? 8.180   33.743  37.215  1.00 20.83  ? 449  PHE C C   1 
ATOM   2884 O  O   . PHE C 1 50  ? 8.966   33.075  36.539  1.00 15.47  ? 449  PHE C O   1 
ATOM   2885 C  CB  . PHE C 1 50  ? 6.249   34.947  36.124  1.00 15.98  ? 449  PHE C CB  1 
ATOM   2886 C  CG  . PHE C 1 50  ? 7.230   35.613  35.187  1.00 19.04  ? 449  PHE C CG  1 
ATOM   2887 C  CD1 . PHE C 1 50  ? 7.876   34.930  34.164  1.00 27.40  ? 449  PHE C CD1 1 
ATOM   2888 C  CD2 . PHE C 1 50  ? 7.509   36.962  35.338  1.00 18.68  ? 449  PHE C CD2 1 
ATOM   2889 C  CE1 . PHE C 1 50  ? 8.773   35.555  33.324  1.00 21.21  ? 449  PHE C CE1 1 
ATOM   2890 C  CE2 . PHE C 1 50  ? 8.400   37.608  34.508  1.00 13.80  ? 449  PHE C CE2 1 
ATOM   2891 C  CZ  . PHE C 1 50  ? 9.033   36.902  33.499  1.00 20.49  ? 449  PHE C CZ  1 
ATOM   2892 N  N   . PHE C 1 51  ? 8.599   34.513  38.216  1.00 12.03  ? 450  PHE C N   1 
ATOM   2893 C  CA  . PHE C 1 51  ? 10.008  34.570  38.581  1.00 5.76   ? 450  PHE C CA  1 
ATOM   2894 C  C   . PHE C 1 51  ? 10.627  33.197  38.786  1.00 5.49   ? 450  PHE C C   1 
ATOM   2895 O  O   . PHE C 1 51  ? 11.728  32.917  38.309  1.00 17.83  ? 450  PHE C O   1 
ATOM   2896 C  CB  . PHE C 1 51  ? 10.179  35.386  39.867  1.00 6.09   ? 450  PHE C CB  1 
ATOM   2897 C  CG  . PHE C 1 51  ? 9.958   36.873  39.666  1.00 14.84  ? 450  PHE C CG  1 
ATOM   2898 C  CD1 . PHE C 1 51  ? 9.956   37.417  38.393  1.00 17.40  ? 450  PHE C CD1 1 
ATOM   2899 C  CD2 . PHE C 1 51  ? 9.753   37.700  40.756  1.00 17.69  ? 450  PHE C CD2 1 
ATOM   2900 C  CE1 . PHE C 1 51  ? 9.747   38.775  38.219  1.00 15.35  ? 450  PHE C CE1 1 
ATOM   2901 C  CE2 . PHE C 1 51  ? 9.555   39.055  40.584  1.00 17.90  ? 450  PHE C CE2 1 
ATOM   2902 C  CZ  . PHE C 1 51  ? 9.554   39.600  39.314  1.00 14.97  ? 450  PHE C CZ  1 
ATOM   2903 N  N   . ILE C 1 52  ? 9.917   32.344  39.509  1.00 7.58   ? 451  ILE C N   1 
ATOM   2904 C  CA  . ILE C 1 52  ? 10.381  31.023  39.902  1.00 7.47   ? 451  ILE C CA  1 
ATOM   2905 C  C   . ILE C 1 52  ? 10.179  29.997  38.804  1.00 10.98  ? 451  ILE C C   1 
ATOM   2906 O  O   . ILE C 1 52  ? 10.935  29.029  38.668  1.00 19.59  ? 451  ILE C O   1 
ATOM   2907 C  CB  . ILE C 1 52  ? 9.659   30.581  41.194  1.00 18.50  ? 451  ILE C CB  1 
ATOM   2908 C  CG1 . ILE C 1 52  ? 10.333  31.098  42.470  1.00 28.32  ? 451  ILE C CG1 1 
ATOM   2909 C  CG2 . ILE C 1 52  ? 9.491   29.082  41.267  1.00 12.52  ? 451  ILE C CG2 1 
ATOM   2910 C  CD1 . ILE C 1 52  ? 9.514   30.925  43.722  1.00 31.61  ? 451  ILE C CD1 1 
ATOM   2911 N  N   . VAL C 1 53  ? 9.160   30.172  37.966  1.00 13.37  ? 452  VAL C N   1 
ATOM   2912 C  CA  . VAL C 1 53  ? 8.972   29.200  36.879  1.00 15.47  ? 452  VAL C CA  1 
ATOM   2913 C  C   . VAL C 1 53  ? 10.053  29.401  35.816  1.00 6.37   ? 452  VAL C C   1 
ATOM   2914 O  O   . VAL C 1 53  ? 10.504  28.454  35.166  1.00 9.78   ? 452  VAL C O   1 
ATOM   2915 C  CB  . VAL C 1 53  ? 7.568   29.327  36.264  1.00 22.75  ? 452  VAL C CB  1 
ATOM   2916 C  CG1 . VAL C 1 53  ? 7.471   28.643  34.909  1.00 24.87  ? 452  VAL C CG1 1 
ATOM   2917 C  CG2 . VAL C 1 53  ? 6.525   28.750  37.215  1.00 19.29  ? 452  VAL C CG2 1 
ATOM   2918 N  N   . ASP C 1 54  ? 10.462  30.654  35.661  1.00 10.74  ? 453  ASP C N   1 
ATOM   2919 C  CA  . ASP C 1 54  ? 11.562  31.040  34.782  1.00 23.26  ? 453  ASP C CA  1 
ATOM   2920 C  C   . ASP C 1 54  ? 12.889  30.507  35.305  1.00 23.21  ? 453  ASP C C   1 
ATOM   2921 O  O   . ASP C 1 54  ? 13.743  30.046  34.547  1.00 23.10  ? 453  ASP C O   1 
ATOM   2922 C  CB  . ASP C 1 54  ? 11.628  32.563  34.645  1.00 17.95  ? 453  ASP C CB  1 
ATOM   2923 C  CG  . ASP C 1 54  ? 12.392  33.022  33.420  1.00 12.76  ? 453  ASP C CG  1 
ATOM   2924 O  OD1 . ASP C 1 54  ? 12.705  32.181  32.557  1.00 20.25  ? 453  ASP C OD1 1 
ATOM   2925 O  OD2 . ASP C 1 54  ? 12.673  34.236  33.324  1.00 9.58   ? 453  ASP C OD2 1 
ATOM   2926 N  N   . LEU C 1 55  ? 13.084  30.560  36.627  1.00 21.68  ? 454  LEU C N   1 
ATOM   2927 C  CA  . LEU C 1 55  ? 14.342  30.044  37.167  1.00 24.48  ? 454  LEU C CA  1 
ATOM   2928 C  C   . LEU C 1 55  ? 14.386  28.516  37.066  1.00 28.30  ? 454  LEU C C   1 
ATOM   2929 O  O   . LEU C 1 55  ? 15.419  27.966  36.690  1.00 24.98  ? 454  LEU C O   1 
ATOM   2930 C  CB  . LEU C 1 55  ? 14.566  30.495  38.608  1.00 27.69  ? 454  LEU C CB  1 
ATOM   2931 C  CG  . LEU C 1 55  ? 16.031  30.581  39.053  1.00 39.11  ? 454  LEU C CG  1 
ATOM   2932 C  CD1 . LEU C 1 55  ? 16.823  31.503  38.131  1.00 36.91  ? 454  LEU C CD1 1 
ATOM   2933 C  CD2 . LEU C 1 55  ? 16.128  31.036  40.500  1.00 36.81  ? 454  LEU C CD2 1 
ATOM   2934 N  N   . LEU C 1 56  ? 13.275  27.887  37.391  1.00 27.71  ? 455  LEU C N   1 
ATOM   2935 C  CA  . LEU C 1 56  ? 13.013  26.462  37.351  1.00 26.69  ? 455  LEU C CA  1 
ATOM   2936 C  C   . LEU C 1 56  ? 13.261  25.857  35.975  1.00 28.41  ? 455  LEU C C   1 
ATOM   2937 O  O   . LEU C 1 56  ? 14.024  24.901  35.816  1.00 31.99  ? 455  LEU C O   1 
ATOM   2938 C  CB  . LEU C 1 56  ? 11.559  26.205  37.780  1.00 18.52  ? 455  LEU C CB  1 
ATOM   2939 C  CG  . LEU C 1 56  ? 11.177  24.767  38.124  1.00 31.50  ? 455  LEU C CG  1 
ATOM   2940 C  CD1 . LEU C 1 56  ? 12.400  23.955  38.528  1.00 52.70  ? 455  LEU C CD1 1 
ATOM   2941 C  CD2 . LEU C 1 56  ? 10.138  24.721  39.237  1.00 17.88  ? 455  LEU C CD2 1 
ATOM   2942 N  N   . VAL C 1 57  ? 12.598  26.409  34.958  1.00 31.44  ? 456  VAL C N   1 
ATOM   2943 C  CA  . VAL C 1 57  ? 12.730  25.867  33.607  1.00 25.76  ? 456  VAL C CA  1 
ATOM   2944 C  C   . VAL C 1 57  ? 14.178  25.942  33.147  1.00 27.01  ? 456  VAL C C   1 
ATOM   2945 O  O   . VAL C 1 57  ? 14.690  25.102  32.407  1.00 28.66  ? 456  VAL C O   1 
ATOM   2946 C  CB  . VAL C 1 57  ? 11.823  26.615  32.615  1.00 18.55  ? 456  VAL C CB  1 
ATOM   2947 C  CG1 . VAL C 1 57  ? 12.127  28.106  32.666  1.00 32.05  ? 456  VAL C CG1 1 
ATOM   2948 C  CG2 . VAL C 1 57  ? 11.998  26.070  31.208  1.00 39.41  ? 456  VAL C CG2 1 
ATOM   2949 N  N   . GLN C 1 58  ? 14.856  26.988  33.611  1.00 25.40  ? 457  GLN C N   1 
ATOM   2950 C  CA  . GLN C 1 58  ? 16.258  27.156  33.242  1.00 31.45  ? 457  GLN C CA  1 
ATOM   2951 C  C   . GLN C 1 58  ? 17.129  26.104  33.919  1.00 33.03  ? 457  GLN C C   1 
ATOM   2952 O  O   . GLN C 1 58  ? 17.814  25.306  33.284  1.00 42.82  ? 457  GLN C O   1 
ATOM   2953 C  CB  . GLN C 1 58  ? 16.733  28.558  33.624  1.00 28.14  ? 457  GLN C CB  1 
ATOM   2954 C  CG  . GLN C 1 58  ? 16.360  29.660  32.651  1.00 21.85  ? 457  GLN C CG  1 
ATOM   2955 C  CD  . GLN C 1 58  ? 16.898  31.013  33.079  1.00 28.71  ? 457  GLN C CD  1 
ATOM   2956 O  OE1 . GLN C 1 58  ? 17.880  31.524  32.538  1.00 36.92  ? 457  GLN C OE1 1 
ATOM   2957 N  NE2 . GLN C 1 58  ? 16.256  31.612  34.076  1.00 35.96  ? 457  GLN C NE2 1 
ATOM   2958 N  N   . TYR C 1 59  ? 17.094  26.120  35.244  1.00 25.48  ? 458  TYR C N   1 
ATOM   2959 C  CA  . TYR C 1 59  ? 18.054  25.404  36.064  1.00 26.48  ? 458  TYR C CA  1 
ATOM   2960 C  C   . TYR C 1 59  ? 17.643  24.004  36.475  1.00 33.60  ? 458  TYR C C   1 
ATOM   2961 O  O   . TYR C 1 59  ? 18.473  23.297  37.056  1.00 44.69  ? 458  TYR C O   1 
ATOM   2962 C  CB  . TYR C 1 59  ? 18.344  26.265  37.315  1.00 28.64  ? 458  TYR C CB  1 
ATOM   2963 C  CG  . TYR C 1 59  ? 19.170  27.479  36.924  1.00 30.21  ? 458  TYR C CG  1 
ATOM   2964 C  CD1 . TYR C 1 59  ? 20.556  27.384  36.853  1.00 22.77  ? 458  TYR C CD1 1 
ATOM   2965 C  CD2 . TYR C 1 59  ? 18.564  28.690  36.620  1.00 29.57  ? 458  TYR C CD2 1 
ATOM   2966 C  CE1 . TYR C 1 59  ? 21.315  28.475  36.497  1.00 20.71  ? 458  TYR C CE1 1 
ATOM   2967 C  CE2 . TYR C 1 59  ? 19.323  29.787  36.264  1.00 29.23  ? 458  TYR C CE2 1 
ATOM   2968 C  CZ  . TYR C 1 59  ? 20.696  29.670  36.205  1.00 26.75  ? 458  TYR C CZ  1 
ATOM   2969 O  OH  . TYR C 1 59  ? 21.463  30.758  35.849  1.00 35.66  ? 458  TYR C OH  1 
ATOM   2970 N  N   . SER C 1 60  ? 16.412  23.595  36.189  1.00 35.93  ? 459  SER C N   1 
ATOM   2971 C  CA  . SER C 1 60  ? 16.022  22.207  36.433  1.00 40.21  ? 459  SER C CA  1 
ATOM   2972 C  C   . SER C 1 60  ? 17.035  21.269  35.780  1.00 47.63  ? 459  SER C C   1 
ATOM   2973 O  O   . SER C 1 60  ? 17.574  21.603  34.720  1.00 51.82  ? 459  SER C O   1 
ATOM   2974 C  CB  . SER C 1 60  ? 14.615  21.940  35.903  1.00 37.10  ? 459  SER C CB  1 
ATOM   2975 O  OG  . SER C 1 60  ? 14.142  20.654  36.267  1.00 31.42  ? 459  SER C OG  1 
ATOM   2976 N  N   . PRO C 1 61  ? 17.311  20.126  36.390  1.00 49.80  ? 460  PRO C N   1 
ATOM   2977 C  CA  . PRO C 1 61  ? 18.193  19.142  35.747  1.00 52.99  ? 460  PRO C CA  1 
ATOM   2978 C  C   . PRO C 1 61  ? 17.558  18.695  34.430  1.00 54.54  ? 460  PRO C C   1 
ATOM   2979 O  O   . PRO C 1 61  ? 18.173  18.775  33.370  1.00 63.95  ? 460  PRO C O   1 
ATOM   2980 C  CB  . PRO C 1 61  ? 18.250  17.987  36.740  1.00 51.54  ? 460  PRO C CB  1 
ATOM   2981 C  CG  . PRO C 1 61  ? 17.075  18.177  37.635  1.00 52.78  ? 460  PRO C CG  1 
ATOM   2982 C  CD  . PRO C 1 61  ? 16.835  19.660  37.701  1.00 51.84  ? 460  PRO C CD  1 
ATOM   2983 N  N   . ASN C 1 62  ? 16.315  18.250  34.549  1.00 55.34  ? 461  ASN C N   1 
ATOM   2984 C  CA  . ASN C 1 62  ? 15.468  17.876  33.435  1.00 58.97  ? 461  ASN C CA  1 
ATOM   2985 C  C   . ASN C 1 62  ? 14.241  18.784  33.346  1.00 62.57  ? 461  ASN C C   1 
ATOM   2986 O  O   . ASN C 1 62  ? 13.796  19.361  34.336  1.00 60.37  ? 461  ASN C O   1 
ATOM   2987 C  CB  . ASN C 1 62  ? 15.002  16.422  33.548  1.00 64.23  ? 461  ASN C CB  1 
ATOM   2988 C  CG  . ASN C 1 62  ? 14.009  16.259  34.680  1.00 61.41  ? 461  ASN C CG  1 
ATOM   2989 O  OD1 . ASN C 1 62  ? 13.035  15.514  34.580  1.00 47.85  ? 461  ASN C OD1 1 
ATOM   2990 N  ND2 . ASN C 1 62  ? 14.272  16.980  35.763  1.00 69.89  ? 461  ASN C ND2 1 
ATOM   2991 N  N   . LYS C 1 63  ? 13.719  18.879  32.129  1.00 61.52  ? 462  LYS C N   1 
ATOM   2992 C  CA  . LYS C 1 63  ? 12.561  19.709  31.828  1.00 58.09  ? 462  LYS C CA  1 
ATOM   2993 C  C   . LYS C 1 63  ? 11.331  18.860  31.537  1.00 58.08  ? 462  LYS C C   1 
ATOM   2994 O  O   . LYS C 1 63  ? 10.624  19.036  30.543  1.00 53.73  ? 462  LYS C O   1 
ATOM   2995 C  CB  . LYS C 1 63  ? 12.904  20.631  30.653  1.00 56.81  ? 462  LYS C CB  1 
ATOM   2996 C  CG  . LYS C 1 63  ? 13.730  21.850  31.042  1.00 54.88  ? 462  LYS C CG  1 
ATOM   2997 C  CD  . LYS C 1 63  ? 15.223  21.597  30.944  1.00 49.79  ? 462  LYS C CD  1 
ATOM   2998 C  CE  . LYS C 1 63  ? 16.031  22.827  31.317  1.00 43.99  ? 462  LYS C CE  1 
ATOM   2999 N  NZ  . LYS C 1 63  ? 16.685  22.688  32.650  1.00 33.45  ? 462  LYS C NZ  1 
ATOM   3000 N  N   . ARG C 1 64  ? 11.043  17.904  32.423  1.00 59.74  ? 463  ARG C N   1 
ATOM   3001 C  CA  . ARG C 1 64  ? 9.841   17.087  32.262  1.00 66.19  ? 463  ARG C CA  1 
ATOM   3002 C  C   . ARG C 1 64  ? 8.676   17.660  33.066  1.00 61.46  ? 463  ARG C C   1 
ATOM   3003 O  O   . ARG C 1 64  ? 8.811   17.916  34.263  1.00 46.70  ? 463  ARG C O   1 
ATOM   3004 C  CB  . ARG C 1 64  ? 10.109  15.641  32.680  1.00 73.01  ? 463  ARG C CB  1 
ATOM   3005 C  CG  . ARG C 1 64  ? 9.672   14.602  31.655  1.00 74.98  ? 463  ARG C CG  1 
ATOM   3006 C  CD  . ARG C 1 64  ? 10.390  13.280  31.876  1.00 75.77  ? 463  ARG C CD  1 
ATOM   3007 N  NE  . ARG C 1 64  ? 11.840  13.415  31.774  1.00 75.28  ? 463  ARG C NE  1 
ATOM   3008 C  CZ  . ARG C 1 64  ? 12.679  13.379  32.801  1.00 73.82  ? 463  ARG C CZ  1 
ATOM   3009 N  NH1 . ARG C 1 64  ? 12.229  13.209  34.036  1.00 56.87  ? 463  ARG C NH1 1 
ATOM   3010 N  NH2 . ARG C 1 64  ? 13.978  13.515  32.598  1.00 78.40  ? 463  ARG C NH2 1 
ATOM   3011 N  N   . GLU C 1 65  ? 7.540   17.857  32.408  1.00 60.60  ? 464  GLU C N   1 
ATOM   3012 C  CA  . GLU C 1 65  ? 6.357   18.430  33.028  1.00 66.34  ? 464  GLU C CA  1 
ATOM   3013 C  C   . GLU C 1 65  ? 6.019   17.773  34.365  1.00 64.34  ? 464  GLU C C   1 
ATOM   3014 O  O   . GLU C 1 65  ? 5.846   18.461  35.371  1.00 44.91  ? 464  GLU C O   1 
ATOM   3015 C  CB  . GLU C 1 65  ? 5.139   18.302  32.102  1.00 73.90  ? 464  GLU C CB  1 
ATOM   3016 C  CG  . GLU C 1 65  ? 4.002   19.229  32.525  1.00 76.09  ? 464  GLU C CG  1 
ATOM   3017 C  CD  . GLU C 1 65  ? 4.562   20.546  33.039  1.00 77.15  ? 464  GLU C CD  1 
ATOM   3018 O  OE1 . GLU C 1 65  ? 5.057   21.329  32.199  1.00 75.10  ? 464  GLU C OE1 1 
ATOM   3019 O  OE2 . GLU C 1 65  ? 4.518   20.777  34.264  1.00 79.92  ? 464  GLU C OE2 1 
ATOM   3020 N  N   . GLY C 1 66  ? 5.934   16.450  34.334  1.00 63.67  ? 465  GLY C N   1 
ATOM   3021 C  CA  . GLY C 1 66  ? 5.633   15.613  35.475  1.00 62.64  ? 465  GLY C CA  1 
ATOM   3022 C  C   . GLY C 1 66  ? 6.609   15.824  36.617  1.00 61.44  ? 465  GLY C C   1 
ATOM   3023 O  O   . GLY C 1 66  ? 6.297   15.541  37.774  1.00 61.66  ? 465  GLY C O   1 
ATOM   3024 N  N   . PHE C 1 67  ? 7.796   16.319  36.291  1.00 60.12  ? 466  PHE C N   1 
ATOM   3025 C  CA  . PHE C 1 67  ? 8.793   16.669  37.295  1.00 58.73  ? 466  PHE C CA  1 
ATOM   3026 C  C   . PHE C 1 67  ? 8.680   18.148  37.660  1.00 47.50  ? 466  PHE C C   1 
ATOM   3027 O  O   . PHE C 1 67  ? 8.650   18.496  38.840  1.00 42.44  ? 466  PHE C O   1 
ATOM   3028 C  CB  . PHE C 1 67  ? 10.196  16.349  36.792  1.00 66.81  ? 466  PHE C CB  1 
ATOM   3029 C  CG  . PHE C 1 67  ? 11.321  16.900  37.653  1.00 73.91  ? 466  PHE C CG  1 
ATOM   3030 C  CD1 . PHE C 1 67  ? 11.714  16.241  38.806  1.00 78.99  ? 466  PHE C CD1 1 
ATOM   3031 C  CD2 . PHE C 1 67  ? 11.959  18.080  37.306  1.00 72.44  ? 466  PHE C CD2 1 
ATOM   3032 C  CE1 . PHE C 1 67  ? 12.739  16.743  39.587  1.00 79.28  ? 466  PHE C CE1 1 
ATOM   3033 C  CE2 . PHE C 1 67  ? 12.990  18.581  38.077  1.00 72.78  ? 466  PHE C CE2 1 
ATOM   3034 C  CZ  . PHE C 1 67  ? 13.383  17.912  39.218  1.00 76.38  ? 466  PHE C CZ  1 
ATOM   3035 N  N   . LEU C 1 68  ? 8.606   19.003  36.650  1.00 35.61  ? 467  LEU C N   1 
ATOM   3036 C  CA  . LEU C 1 68  ? 8.537   20.442  36.851  1.00 33.51  ? 467  LEU C CA  1 
ATOM   3037 C  C   . LEU C 1 68  ? 7.459   20.826  37.861  1.00 37.63  ? 467  LEU C C   1 
ATOM   3038 O  O   . LEU C 1 68  ? 7.690   21.663  38.736  1.00 32.52  ? 467  LEU C O   1 
ATOM   3039 C  CB  . LEU C 1 68  ? 8.278   21.142  35.515  1.00 34.53  ? 467  LEU C CB  1 
ATOM   3040 C  CG  . LEU C 1 68  ? 9.377   21.037  34.457  1.00 39.60  ? 467  LEU C CG  1 
ATOM   3041 C  CD1 . LEU C 1 68  ? 8.776   21.014  33.060  1.00 48.13  ? 467  LEU C CD1 1 
ATOM   3042 C  CD2 . LEU C 1 68  ? 10.370  22.182  34.595  1.00 30.88  ? 467  LEU C CD2 1 
ATOM   3043 N  N   . SER C 1 69  ? 6.280   20.219  37.736  1.00 31.26  ? 468  SER C N   1 
ATOM   3044 C  CA  . SER C 1 69  ? 5.158   20.581  38.602  1.00 29.79  ? 468  SER C CA  1 
ATOM   3045 C  C   . SER C 1 69  ? 5.459   20.293  40.070  1.00 27.87  ? 468  SER C C   1 
ATOM   3046 O  O   . SER C 1 69  ? 5.277   21.206  40.890  1.00 24.65  ? 468  SER C O   1 
ATOM   3047 C  CB  . SER C 1 69  ? 3.870   19.888  38.139  1.00 27.97  ? 468  SER C CB  1 
ATOM   3048 O  OG  . SER C 1 69  ? 2.989   20.808  37.514  1.00 47.24  ? 468  SER C OG  1 
ATOM   3049 N  N   . PRO C 1 70  ? 5.890   19.095  40.432  1.00 26.51  ? 469  PRO C N   1 
ATOM   3050 C  CA  . PRO C 1 70  ? 6.274   18.819  41.825  1.00 26.89  ? 469  PRO C CA  1 
ATOM   3051 C  C   . PRO C 1 70  ? 7.211   19.870  42.399  1.00 32.29  ? 469  PRO C C   1 
ATOM   3052 O  O   . PRO C 1 70  ? 6.936   20.439  43.459  1.00 38.51  ? 469  PRO C O   1 
ATOM   3053 C  CB  . PRO C 1 70  ? 7.004   17.475  41.722  1.00 25.90  ? 469  PRO C CB  1 
ATOM   3054 C  CG  . PRO C 1 70  ? 6.279   16.794  40.603  1.00 24.10  ? 469  PRO C CG  1 
ATOM   3055 C  CD  . PRO C 1 70  ? 6.031   17.885  39.600  1.00 26.48  ? 469  PRO C CD  1 
ATOM   3056 N  N   . LEU C 1 71  ? 8.311   20.137  41.697  1.00 32.95  ? 470  LEU C N   1 
ATOM   3057 C  CA  . LEU C 1 71  ? 9.219   21.185  42.160  1.00 31.36  ? 470  LEU C CA  1 
ATOM   3058 C  C   . LEU C 1 71  ? 8.505   22.532  42.225  1.00 28.25  ? 470  LEU C C   1 
ATOM   3059 O  O   . LEU C 1 71  ? 8.724   23.348  43.124  1.00 24.26  ? 470  LEU C O   1 
ATOM   3060 C  CB  . LEU C 1 71  ? 10.438  21.268  41.248  1.00 34.83  ? 470  LEU C CB  1 
ATOM   3061 C  CG  . LEU C 1 71  ? 11.697  20.507  41.670  1.00 34.62  ? 470  LEU C CG  1 
ATOM   3062 C  CD1 . LEU C 1 71  ? 12.894  20.978  40.853  1.00 22.18  ? 470  LEU C CD1 1 
ATOM   3063 C  CD2 . LEU C 1 71  ? 11.975  20.665  43.155  1.00 29.15  ? 470  LEU C CD2 1 
ATOM   3064 N  N   . LYS C 1 72  ? 7.635   22.797  41.256  1.00 24.41  ? 471  LYS C N   1 
ATOM   3065 C  CA  . LYS C 1 72  ? 6.926   24.074  41.204  1.00 28.21  ? 471  LYS C CA  1 
ATOM   3066 C  C   . LYS C 1 72  ? 6.026   24.232  42.425  1.00 29.85  ? 471  LYS C C   1 
ATOM   3067 O  O   . LYS C 1 72  ? 6.007   25.281  43.073  1.00 25.08  ? 471  LYS C O   1 
ATOM   3068 C  CB  . LYS C 1 72  ? 6.129   24.155  39.903  1.00 32.54  ? 471  LYS C CB  1 
ATOM   3069 C  CG  . LYS C 1 72  ? 5.655   25.539  39.499  1.00 31.28  ? 471  LYS C CG  1 
ATOM   3070 C  CD  . LYS C 1 72  ? 4.269   25.480  38.869  1.00 35.21  ? 471  LYS C CD  1 
ATOM   3071 C  CE  . LYS C 1 72  ? 3.699   26.875  38.676  1.00 38.27  ? 471  LYS C CE  1 
ATOM   3072 N  NZ  . LYS C 1 72  ? 2.476   27.102  39.500  1.00 33.98  ? 471  LYS C NZ  1 
ATOM   3073 N  N   . ALA C 1 73  ? 5.292   23.169  42.734  1.00 26.61  ? 472  ALA C N   1 
ATOM   3074 C  CA  . ALA C 1 73  ? 4.413   23.122  43.894  1.00 25.65  ? 472  ALA C CA  1 
ATOM   3075 C  C   . ALA C 1 73  ? 5.123   23.529  45.172  1.00 24.09  ? 472  ALA C C   1 
ATOM   3076 O  O   . ALA C 1 73  ? 4.709   24.427  45.905  1.00 32.46  ? 472  ALA C O   1 
ATOM   3077 C  CB  . ALA C 1 73  ? 3.850   21.716  44.062  1.00 23.79  ? 472  ALA C CB  1 
ATOM   3078 N  N   . TYR C 1 74  ? 6.234   22.857  45.478  1.00 25.72  ? 473  TYR C N   1 
ATOM   3079 C  CA  . TYR C 1 74  ? 6.970   23.282  46.671  1.00 16.84  ? 473  TYR C CA  1 
ATOM   3080 C  C   . TYR C 1 74  ? 7.416   24.733  46.545  1.00 16.03  ? 473  TYR C C   1 
ATOM   3081 O  O   . TYR C 1 74  ? 7.164   25.558  47.432  1.00 24.01  ? 473  TYR C O   1 
ATOM   3082 C  CB  . TYR C 1 74  ? 8.163   22.353  46.933  1.00 15.30  ? 473  TYR C CB  1 
ATOM   3083 C  CG  . TYR C 1 74  ? 9.037   22.861  48.061  1.00 29.82  ? 473  TYR C CG  1 
ATOM   3084 C  CD1 . TYR C 1 74  ? 8.603   22.841  49.384  1.00 27.22  ? 473  TYR C CD1 1 
ATOM   3085 C  CD2 . TYR C 1 74  ? 10.301  23.371  47.791  1.00 33.96  ? 473  TYR C CD2 1 
ATOM   3086 C  CE1 . TYR C 1 74  ? 9.415   23.312  50.401  1.00 32.29  ? 473  TYR C CE1 1 
ATOM   3087 C  CE2 . TYR C 1 74  ? 11.114  23.844  48.802  1.00 35.84  ? 473  TYR C CE2 1 
ATOM   3088 C  CZ  . TYR C 1 74  ? 10.667  23.813  50.107  1.00 40.17  ? 473  TYR C CZ  1 
ATOM   3089 O  OH  . TYR C 1 74  ? 11.489  24.290  51.108  1.00 40.62  ? 473  TYR C OH  1 
ATOM   3090 N  N   . LEU C 1 75  ? 8.076   25.098  45.451  1.00 13.36  ? 474  LEU C N   1 
ATOM   3091 C  CA  . LEU C 1 75  ? 8.683   26.416  45.322  1.00 14.65  ? 474  LEU C CA  1 
ATOM   3092 C  C   . LEU C 1 75  ? 7.721   27.582  45.477  1.00 16.49  ? 474  LEU C C   1 
ATOM   3093 O  O   . LEU C 1 75  ? 8.142   28.699  45.810  1.00 12.89  ? 474  LEU C O   1 
ATOM   3094 C  CB  . LEU C 1 75  ? 9.385   26.529  43.957  1.00 7.01   ? 474  LEU C CB  1 
ATOM   3095 C  CG  . LEU C 1 75  ? 10.580  25.586  43.769  1.00 17.11  ? 474  LEU C CG  1 
ATOM   3096 C  CD1 . LEU C 1 75  ? 11.245  25.874  42.431  1.00 13.59  ? 474  LEU C CD1 1 
ATOM   3097 C  CD2 . LEU C 1 75  ? 11.577  25.709  44.913  1.00 4.83   ? 474  LEU C CD2 1 
ATOM   3098 N  N   . ILE C 1 76  ? 6.432   27.365  45.222  1.00 17.60  ? 475  ILE C N   1 
ATOM   3099 C  CA  . ILE C 1 76  ? 5.484   28.467  45.384  1.00 20.08  ? 475  ILE C CA  1 
ATOM   3100 C  C   . ILE C 1 76  ? 4.528   28.187  46.547  1.00 22.32  ? 475  ILE C C   1 
ATOM   3101 O  O   . ILE C 1 76  ? 3.522   28.876  46.698  1.00 18.86  ? 475  ILE C O   1 
ATOM   3102 C  CB  . ILE C 1 76  ? 4.684   28.775  44.107  1.00 23.03  ? 475  ILE C CB  1 
ATOM   3103 C  CG1 . ILE C 1 76  ? 3.668   27.707  43.692  1.00 28.46  ? 475  ILE C CG1 1 
ATOM   3104 C  CG2 . ILE C 1 76  ? 5.624   29.073  42.946  1.00 33.23  ? 475  ILE C CG2 1 
ATOM   3105 C  CD1 . ILE C 1 76  ? 2.522   28.281  42.880  1.00 17.11  ? 475  ILE C CD1 1 
ATOM   3106 N  N   . SER C 1 77  ? 4.877   27.203  47.356  1.00 23.75  ? 476  SER C N   1 
ATOM   3107 C  CA  . SER C 1 77  ? 4.206   26.799  48.576  1.00 14.04  ? 476  SER C CA  1 
ATOM   3108 C  C   . SER C 1 77  ? 4.423   27.802  49.707  1.00 27.78  ? 476  SER C C   1 
ATOM   3109 O  O   . SER C 1 77  ? 5.431   28.507  49.742  1.00 17.19  ? 476  SER C O   1 
ATOM   3110 C  CB  . SER C 1 77  ? 4.699   25.422  49.025  1.00 14.45  ? 476  SER C CB  1 
ATOM   3111 O  OG  . SER C 1 77  ? 5.897   25.503  49.788  1.00 15.96  ? 476  SER C OG  1 
ATOM   3112 N  N   . GLU C 1 78  ? 3.471   27.861  50.638  1.00 29.56  ? 477  GLU C N   1 
ATOM   3113 C  CA  . GLU C 1 78  ? 3.538   28.766  51.778  1.00 25.19  ? 477  GLU C CA  1 
ATOM   3114 C  C   . GLU C 1 78  ? 4.796   28.541  52.616  1.00 10.80  ? 477  GLU C C   1 
ATOM   3115 O  O   . GLU C 1 78  ? 5.407   29.483  53.109  1.00 10.65  ? 477  GLU C O   1 
ATOM   3116 C  CB  . GLU C 1 78  ? 2.297   28.573  52.649  1.00 27.63  ? 477  GLU C CB  1 
ATOM   3117 C  CG  . GLU C 1 78  ? 2.320   29.325  53.970  1.00 32.39  ? 477  GLU C CG  1 
ATOM   3118 C  CD  . GLU C 1 78  ? 1.094   28.960  54.800  1.00 31.84  ? 477  GLU C CD  1 
ATOM   3119 O  OE1 . GLU C 1 78  ? -0.005  29.423  54.429  1.00 10.95  ? 477  GLU C OE1 1 
ATOM   3120 O  OE2 . GLU C 1 78  ? 1.240   28.215  55.786  1.00 24.76  ? 477  GLU C OE2 1 
ATOM   3121 N  N   . GLU C 1 79  ? 5.169   27.282  52.778  1.00 13.19  ? 478  GLU C N   1 
ATOM   3122 C  CA  . GLU C 1 79  ? 6.363   26.900  53.513  1.00 19.26  ? 478  GLU C CA  1 
ATOM   3123 C  C   . GLU C 1 79  ? 7.607   27.512  52.878  1.00 30.82  ? 478  GLU C C   1 
ATOM   3124 O  O   . GLU C 1 79  ? 8.500   28.005  53.568  1.00 37.59  ? 478  GLU C O   1 
ATOM   3125 C  CB  . GLU C 1 79  ? 6.469   25.369  53.547  1.00 19.00  ? 478  GLU C CB  1 
ATOM   3126 C  CG  A GLU C 1 79  ? 5.342   24.688  54.303  0.50 24.28  ? 478  GLU C CG  1 
ATOM   3127 C  CG  B GLU C 1 79  ? 7.590   24.872  54.442  0.50 21.09  ? 478  GLU C CG  1 
ATOM   3128 C  CD  A GLU C 1 79  ? 4.109   24.451  53.454  0.50 26.10  ? 478  GLU C CD  1 
ATOM   3129 C  CD  B GLU C 1 79  ? 7.938   23.414  54.213  0.50 23.29  ? 478  GLU C CD  1 
ATOM   3130 O  OE1 A GLU C 1 79  ? 4.005   25.033  52.352  0.50 33.01  ? 478  GLU C OE1 1 
ATOM   3131 O  OE1 B GLU C 1 79  ? 7.089   22.535  54.479  0.50 44.85  ? 478  GLU C OE1 1 
ATOM   3132 O  OE2 A GLU C 1 79  ? 3.235   23.672  53.900  0.50 34.75  ? 478  GLU C OE2 1 
ATOM   3133 O  OE2 B GLU C 1 79  ? 9.076   23.150  53.762  0.50 40.22  ? 478  GLU C OE2 1 
ATOM   3134 N  N   . PHE C 1 80  ? 7.662   27.485  51.544  1.00 30.85  ? 479  PHE C N   1 
ATOM   3135 C  CA  . PHE C 1 80  ? 8.815   28.017  50.827  1.00 30.91  ? 479  PHE C CA  1 
ATOM   3136 C  C   . PHE C 1 80  ? 8.823   29.541  50.841  1.00 20.63  ? 479  PHE C C   1 
ATOM   3137 O  O   . PHE C 1 80  ? 9.857   30.161  51.121  1.00 12.45  ? 479  PHE C O   1 
ATOM   3138 C  CB  . PHE C 1 80  ? 8.859   27.491  49.383  1.00 31.06  ? 479  PHE C CB  1 
ATOM   3139 C  CG  . PHE C 1 80  ? 10.192  27.841  48.726  1.00 20.28  ? 479  PHE C CG  1 
ATOM   3140 C  CD1 . PHE C 1 80  ? 11.329  27.128  49.047  1.00 24.26  ? 479  PHE C CD1 1 
ATOM   3141 C  CD2 . PHE C 1 80  ? 10.283  28.877  47.820  1.00 19.02  ? 479  PHE C CD2 1 
ATOM   3142 C  CE1 . PHE C 1 80  ? 12.550  27.445  48.475  1.00 27.68  ? 479  PHE C CE1 1 
ATOM   3143 C  CE2 . PHE C 1 80  ? 11.502  29.200  47.243  1.00 12.94  ? 479  PHE C CE2 1 
ATOM   3144 C  CZ  . PHE C 1 80  ? 12.636  28.490  47.575  1.00 15.83  ? 479  PHE C CZ  1 
ATOM   3145 N  N   . PHE C 1 81  ? 7.676   30.153  50.544  1.00 14.36  ? 480  PHE C N   1 
ATOM   3146 C  CA  . PHE C 1 81  ? 7.605   31.615  50.589  1.00 20.26  ? 480  PHE C CA  1 
ATOM   3147 C  C   . PHE C 1 81  ? 7.962   32.144  51.978  1.00 14.03  ? 480  PHE C C   1 
ATOM   3148 O  O   . PHE C 1 81  ? 8.447   33.265  52.132  1.00 16.56  ? 480  PHE C O   1 
ATOM   3149 C  CB  . PHE C 1 81  ? 6.225   32.117  50.170  1.00 16.82  ? 480  PHE C CB  1 
ATOM   3150 C  CG  . PHE C 1 81  ? 5.987   32.117  48.670  1.00 18.91  ? 480  PHE C CG  1 
ATOM   3151 C  CD1 . PHE C 1 81  ? 6.802   31.378  47.835  1.00 22.50  ? 480  PHE C CD1 1 
ATOM   3152 C  CD2 . PHE C 1 81  ? 4.955   32.849  48.111  1.00 15.67  ? 480  PHE C CD2 1 
ATOM   3153 C  CE1 . PHE C 1 81  ? 6.586   31.377  46.471  1.00 22.98  ? 480  PHE C CE1 1 
ATOM   3154 C  CE2 . PHE C 1 81  ? 4.739   32.845  46.748  1.00 18.36  ? 480  PHE C CE2 1 
ATOM   3155 C  CZ  . PHE C 1 81  ? 5.557   32.108  45.911  1.00 11.10  ? 480  PHE C CZ  1 
ATOM   3156 N  N   . ASN C 1 82  ? 7.717   31.322  52.992  1.00 13.65  ? 481  ASN C N   1 
ATOM   3157 C  CA  . ASN C 1 82  ? 8.114   31.644  54.355  1.00 21.06  ? 481  ASN C CA  1 
ATOM   3158 C  C   . ASN C 1 82  ? 9.623   31.535  54.530  1.00 19.90  ? 481  ASN C C   1 
ATOM   3159 O  O   . ASN C 1 82  ? 10.234  32.335  55.236  1.00 16.28  ? 481  ASN C O   1 
ATOM   3160 C  CB  . ASN C 1 82  ? 7.371   30.728  55.340  1.00 16.21  ? 481  ASN C CB  1 
ATOM   3161 C  CG  . ASN C 1 82  ? 6.054   31.376  55.728  1.00 15.41  ? 481  ASN C CG  1 
ATOM   3162 O  OD1 . ASN C 1 82  ? 5.998   32.134  56.693  1.00 16.16  ? 481  ASN C OD1 1 
ATOM   3163 N  ND2 . ASN C 1 82  ? 4.996   31.087  54.977  1.00 12.25  ? 481  ASN C ND2 1 
ATOM   3164 N  N   . LEU C 1 83  ? 10.248  30.561  53.883  1.00 19.94  ? 482  LEU C N   1 
ATOM   3165 C  CA  . LEU C 1 83  ? 11.707  30.454  53.907  1.00 28.76  ? 482  LEU C CA  1 
ATOM   3166 C  C   . LEU C 1 83  ? 12.373  31.751  53.453  1.00 27.63  ? 482  LEU C C   1 
ATOM   3167 O  O   . LEU C 1 83  ? 13.265  32.273  54.121  1.00 44.91  ? 482  LEU C O   1 
ATOM   3168 C  CB  . LEU C 1 83  ? 12.177  29.310  53.012  1.00 30.96  ? 482  LEU C CB  1 
ATOM   3169 C  CG  . LEU C 1 83  ? 12.850  28.111  53.684  1.00 32.72  ? 482  LEU C CG  1 
ATOM   3170 C  CD1 . LEU C 1 83  ? 14.290  28.452  54.048  1.00 27.24  ? 482  LEU C CD1 1 
ATOM   3171 C  CD2 . LEU C 1 83  ? 12.050  27.671  54.898  1.00 37.26  ? 482  LEU C CD2 1 
ATOM   3172 N  N   . LEU C 1 84  ? 11.929  32.250  52.307  1.00 24.97  ? 483  LEU C N   1 
ATOM   3173 C  CA  . LEU C 1 84  ? 12.475  33.452  51.697  1.00 23.01  ? 483  LEU C CA  1 
ATOM   3174 C  C   . LEU C 1 84  ? 12.171  34.696  52.521  1.00 23.56  ? 483  LEU C C   1 
ATOM   3175 O  O   . LEU C 1 84  ? 13.050  35.500  52.822  1.00 18.34  ? 483  LEU C O   1 
ATOM   3176 C  CB  . LEU C 1 84  ? 11.903  33.624  50.283  1.00 20.77  ? 483  LEU C CB  1 
ATOM   3177 C  CG  . LEU C 1 84  ? 12.055  32.410  49.359  1.00 23.42  ? 483  LEU C CG  1 
ATOM   3178 C  CD1 . LEU C 1 84  ? 11.457  32.706  47.993  1.00 14.83  ? 483  LEU C CD1 1 
ATOM   3179 C  CD2 . LEU C 1 84  ? 13.515  31.999  49.251  1.00 16.97  ? 483  LEU C CD2 1 
ATOM   3180 N  N   . ALA C 1 85  ? 10.900  34.852  52.875  1.00 21.39  ? 484  ALA C N   1 
ATOM   3181 C  CA  . ALA C 1 85  ? 10.455  36.025  53.620  1.00 18.10  ? 484  ALA C CA  1 
ATOM   3182 C  C   . ALA C 1 85  ? 11.295  36.216  54.882  1.00 20.76  ? 484  ALA C C   1 
ATOM   3183 O  O   . ALA C 1 85  ? 11.525  37.352  55.283  1.00 27.35  ? 484  ALA C O   1 
ATOM   3184 C  CB  . ALA C 1 85  ? 8.977   35.897  53.957  1.00 14.32  ? 484  ALA C CB  1 
ATOM   3185 N  N   . GLN C 1 86  ? 11.717  35.103  55.458  1.00 24.27  ? 485  GLN C N   1 
ATOM   3186 C  CA  . GLN C 1 86  ? 12.556  34.972  56.632  1.00 36.16  ? 485  GLN C CA  1 
ATOM   3187 C  C   . GLN C 1 86  ? 13.833  35.798  56.495  1.00 39.65  ? 485  GLN C C   1 
ATOM   3188 O  O   . GLN C 1 86  ? 14.175  36.614  57.349  1.00 41.89  ? 485  GLN C O   1 
ATOM   3189 C  CB  . GLN C 1 86  ? 12.941  33.505  56.855  1.00 42.70  ? 485  GLN C CB  1 
ATOM   3190 C  CG  . GLN C 1 86  ? 12.361  32.872  58.107  1.00 45.80  ? 485  GLN C CG  1 
ATOM   3191 C  CD  . GLN C 1 86  ? 12.969  31.515  58.411  1.00 44.12  ? 485  GLN C CD  1 
ATOM   3192 O  OE1 . GLN C 1 86  ? 12.351  30.659  59.043  1.00 46.47  ? 485  GLN C OE1 1 
ATOM   3193 N  NE2 . GLN C 1 86  ? 14.200  31.308  57.959  1.00 39.61  ? 485  GLN C NE2 1 
ATOM   3194 N  N   . LYS C 1 87  ? 14.508  35.555  55.380  1.00 33.19  ? 486  LYS C N   1 
ATOM   3195 C  CA  . LYS C 1 87  ? 15.716  36.244  54.966  1.00 35.70  ? 486  LYS C CA  1 
ATOM   3196 C  C   . LYS C 1 87  ? 15.560  37.755  55.092  1.00 33.29  ? 486  LYS C C   1 
ATOM   3197 O  O   . LYS C 1 87  ? 16.517  38.464  55.406  1.00 28.34  ? 486  LYS C O   1 
ATOM   3198 C  CB  . LYS C 1 87  ? 16.071  35.851  53.526  1.00 33.93  ? 486  LYS C CB  1 
ATOM   3199 C  CG  . LYS C 1 87  ? 16.097  34.348  53.294  1.00 33.26  ? 486  LYS C CG  1 
ATOM   3200 C  CD  . LYS C 1 87  ? 17.182  33.971  52.296  1.00 40.55  ? 486  LYS C CD  1 
ATOM   3201 C  CE  . LYS C 1 87  ? 17.283  34.993  51.176  1.00 46.51  ? 486  LYS C CE  1 
ATOM   3202 N  NZ  . LYS C 1 87  ? 18.674  35.464  50.950  1.00 51.35  ? 486  LYS C NZ  1 
ATOM   3203 N  N   . LEU C 1 88  ? 14.349  38.249  54.856  1.00 28.26  ? 487  LEU C N   1 
ATOM   3204 C  CA  . LEU C 1 88  ? 14.045  39.666  54.982  1.00 21.67  ? 487  LEU C CA  1 
ATOM   3205 C  C   . LEU C 1 88  ? 13.420  39.969  56.346  1.00 21.73  ? 487  LEU C C   1 
ATOM   3206 O  O   . LEU C 1 88  ? 13.050  41.116  56.599  1.00 10.95  ? 487  LEU C O   1 
ATOM   3207 C  CB  . LEU C 1 88  ? 13.094  40.099  53.868  1.00 25.52  ? 487  LEU C CB  1 
ATOM   3208 C  CG  . LEU C 1 88  ? 13.690  40.387  52.490  1.00 26.30  ? 487  LEU C CG  1 
ATOM   3209 C  CD1 . LEU C 1 88  ? 14.600  39.257  52.044  1.00 34.09  ? 487  LEU C CD1 1 
ATOM   3210 C  CD2 . LEU C 1 88  ? 12.580  40.618  51.474  1.00 29.73  ? 487  LEU C CD2 1 
ATOM   3211 N  N   . GLU C 1 89  ? 13.304  38.948  57.178  1.00 21.39  ? 488  GLU C N   1 
ATOM   3212 C  CA  . GLU C 1 89  ? 12.572  39.001  58.431  1.00 30.27  ? 488  GLU C CA  1 
ATOM   3213 C  C   . GLU C 1 89  ? 11.285  39.759  58.293  1.00 33.95  ? 488  GLU C C   1 
ATOM   3214 O  O   . GLU C 1 89  ? 11.029  40.779  58.931  1.00 32.16  ? 488  GLU C O   1 
ATOM   3215 C  CB  . GLU C 1 89  ? 13.430  39.500  59.581  1.00 32.06  ? 488  GLU C CB  1 
ATOM   3216 C  CG  . GLU C 1 89  ? 13.760  40.977  59.467  1.00 32.32  ? 488  GLU C CG  1 
ATOM   3217 C  CD  . GLU C 1 89  ? 14.690  41.434  60.573  1.00 33.82  ? 488  GLU C CD  1 
ATOM   3218 O  OE1 . GLU C 1 89  ? 15.530  40.606  60.978  1.00 36.22  ? 488  GLU C OE1 1 
ATOM   3219 O  OE2 . GLU C 1 89  ? 14.555  42.604  60.979  1.00 42.58  ? 488  GLU C OE2 1 
ATOM   3220 N  N   . LEU C 1 90  ? 10.427  39.273  57.388  1.00 34.54  ? 489  LEU C N   1 
ATOM   3221 C  CA  . LEU C 1 90  ? 9.241   40.076  57.058  1.00 29.96  ? 489  LEU C CA  1 
ATOM   3222 C  C   . LEU C 1 90  ? 8.363   40.230  58.286  1.00 30.64  ? 489  LEU C C   1 
ATOM   3223 O  O   . LEU C 1 90  ? 7.647   41.218  58.457  1.00 55.90  ? 489  LEU C O   1 
ATOM   3224 C  CB  . LEU C 1 90  ? 8.532   39.432  55.877  1.00 31.39  ? 489  LEU C CB  1 
ATOM   3225 C  CG  . LEU C 1 90  ? 7.709   40.288  54.923  1.00 32.51  ? 489  LEU C CG  1 
ATOM   3226 C  CD1 . LEU C 1 90  ? 8.453   41.540  54.477  1.00 15.12  ? 489  LEU C CD1 1 
ATOM   3227 C  CD2 . LEU C 1 90  ? 7.299   39.472  53.701  1.00 15.83  ? 489  LEU C CD2 1 
ATOM   3228 N  N   . HIS C 1 91  ? 8.421   39.261  59.190  1.00 40.37  ? 490  HIS C N   1 
ATOM   3229 C  CA  . HIS C 1 91  ? 7.606   39.243  60.395  1.00 45.26  ? 490  HIS C CA  1 
ATOM   3230 C  C   . HIS C 1 91  ? 7.734   40.488  61.262  1.00 48.46  ? 490  HIS C C   1 
ATOM   3231 O  O   . HIS C 1 91  ? 6.903   40.683  62.155  1.00 51.44  ? 490  HIS C O   1 
ATOM   3232 C  CB  . HIS C 1 91  ? 7.978   38.017  61.244  1.00 45.54  ? 490  HIS C CB  1 
ATOM   3233 C  CG  . HIS C 1 91  ? 9.417   38.014  61.663  1.00 47.04  ? 490  HIS C CG  1 
ATOM   3234 N  ND1 . HIS C 1 91  ? 9.877   38.712  62.754  1.00 47.75  ? 490  HIS C ND1 1 
ATOM   3235 C  CD2 . HIS C 1 91  ? 10.497  37.397  61.138  1.00 47.57  ? 490  HIS C CD2 1 
ATOM   3236 C  CE1 . HIS C 1 91  ? 11.179  38.526  62.885  1.00 44.09  ? 490  HIS C CE1 1 
ATOM   3237 N  NE2 . HIS C 1 91  ? 11.582  37.730  61.914  1.00 44.20  ? 490  HIS C NE2 1 
ATOM   3238 N  N   . LYS C 1 92  ? 8.741   41.326  61.047  1.00 48.89  ? 491  LYS C N   1 
ATOM   3239 C  CA  . LYS C 1 92  ? 8.953   42.519  61.853  1.00 38.71  ? 491  LYS C CA  1 
ATOM   3240 C  C   . LYS C 1 92  ? 8.218   43.740  61.330  1.00 30.48  ? 491  LYS C C   1 
ATOM   3241 O  O   . LYS C 1 92  ? 7.942   44.692  62.061  1.00 33.90  ? 491  LYS C O   1 
ATOM   3242 C  CB  . LYS C 1 92  ? 10.452  42.860  61.900  1.00 29.42  ? 491  LYS C CB  1 
ATOM   3243 C  CG  . LYS C 1 92  ? 11.286  41.811  62.613  1.00 31.25  ? 491  LYS C CG  1 
ATOM   3244 C  CD  . LYS C 1 92  ? 11.996  42.416  63.814  1.00 38.62  ? 491  LYS C CD  1 
ATOM   3245 C  CE  . LYS C 1 92  ? 13.255  43.157  63.392  1.00 41.60  ? 491  LYS C CE  1 
ATOM   3246 N  NZ  . LYS C 1 92  ? 14.479  42.330  63.605  1.00 28.25  ? 491  LYS C NZ  1 
ATOM   3247 N  N   . PHE C 1 93  ? 7.903   43.762  60.033  1.00 20.38  ? 492  PHE C N   1 
ATOM   3248 C  CA  . PHE C 1 93  ? 7.432   45.047  59.507  1.00 21.08  ? 492  PHE C CA  1 
ATOM   3249 C  C   . PHE C 1 93  ? 5.940   45.048  59.235  1.00 19.92  ? 492  PHE C C   1 
ATOM   3250 O  O   . PHE C 1 93  ? 5.366   46.089  58.909  1.00 21.18  ? 492  PHE C O   1 
ATOM   3251 C  CB  . PHE C 1 93  ? 8.218   45.383  58.237  1.00 25.46  ? 492  PHE C CB  1 
ATOM   3252 C  CG  . PHE C 1 93  ? 9.726   45.250  58.413  1.00 17.64  ? 492  PHE C CG  1 
ATOM   3253 C  CD1 . PHE C 1 93  ? 10.345  44.028  58.240  1.00 17.91  ? 492  PHE C CD1 1 
ATOM   3254 C  CD2 . PHE C 1 93  ? 10.496  46.351  58.745  1.00 20.68  ? 492  PHE C CD2 1 
ATOM   3255 C  CE1 . PHE C 1 93  ? 11.712  43.895  58.383  1.00 18.49  ? 492  PHE C CE1 1 
ATOM   3256 C  CE2 . PHE C 1 93  ? 11.869  46.228  58.878  1.00 19.69  ? 492  PHE C CE2 1 
ATOM   3257 C  CZ  . PHE C 1 93  ? 12.474  45.005  58.688  1.00 10.43  ? 492  PHE C CZ  1 
ATOM   3258 N  N   . ILE C 1 94  ? 5.330   43.871  59.378  1.00 17.86  ? 493  ILE C N   1 
ATOM   3259 C  CA  . ILE C 1 94  ? 3.913   43.765  59.051  1.00 16.28  ? 493  ILE C CA  1 
ATOM   3260 C  C   . ILE C 1 94  ? 3.076   44.507  60.096  1.00 28.71  ? 493  ILE C C   1 
ATOM   3261 O  O   . ILE C 1 94  ? 3.315   44.349  61.290  1.00 34.09  ? 493  ILE C O   1 
ATOM   3262 C  CB  . ILE C 1 94  ? 3.445   42.313  58.916  1.00 15.44  ? 493  ILE C CB  1 
ATOM   3263 C  CG1 . ILE C 1 94  ? 4.300   41.487  57.946  1.00 23.69  ? 493  ILE C CG1 1 
ATOM   3264 C  CG2 . ILE C 1 94  ? 1.977   42.254  58.511  1.00 12.59  ? 493  ILE C CG2 1 
ATOM   3265 C  CD1 . ILE C 1 94  ? 3.814   40.070  57.733  1.00 18.99  ? 493  ILE C CD1 1 
ATOM   3266 N  N   . ARG C 1 95  ? 2.150   45.282  59.562  1.00 29.68  ? 494  ARG C N   1 
ATOM   3267 C  CA  . ARG C 1 95  ? 1.162   46.091  60.243  1.00 28.40  ? 494  ARG C CA  1 
ATOM   3268 C  C   . ARG C 1 95  ? -0.184  45.377  60.331  1.00 29.56  ? 494  ARG C C   1 
ATOM   3269 O  O   . ARG C 1 95  ? -0.871  45.207  59.325  1.00 15.42  ? 494  ARG C O   1 
ATOM   3270 C  CB  . ARG C 1 95  ? 1.017   47.428  59.503  1.00 23.91  ? 494  ARG C CB  1 
ATOM   3271 C  CG  . ARG C 1 95  ? 2.366   48.138  59.363  1.00 10.00  ? 494  ARG C CG  1 
ATOM   3272 C  CD  . ARG C 1 95  ? 2.153   49.616  59.118  1.00 11.16  ? 494  ARG C CD  1 
ATOM   3273 N  NE  . ARG C 1 95  ? 1.369   49.870  57.909  1.00 16.83  ? 494  ARG C NE  1 
ATOM   3274 C  CZ  . ARG C 1 95  ? 1.057   51.080  57.460  1.00 13.36  ? 494  ARG C CZ  1 
ATOM   3275 N  NH1 . ARG C 1 95  ? 1.452   52.169  58.104  1.00 28.18  ? 494  ARG C NH1 1 
ATOM   3276 N  NH2 . ARG C 1 95  ? 0.338   51.229  56.353  1.00 28.58  ? 494  ARG C NH2 1 
ATOM   3277 N  N   . ILE C 1 96  ? -0.544  44.956  61.538  1.00 25.50  ? 495  ILE C N   1 
ATOM   3278 C  CA  . ILE C 1 96  ? -1.781  44.214  61.770  1.00 31.61  ? 495  ILE C CA  1 
ATOM   3279 C  C   . ILE C 1 96  ? -2.501  44.708  63.018  1.00 33.55  ? 495  ILE C C   1 
ATOM   3280 O  O   . ILE C 1 96  ? -1.928  45.438  63.831  1.00 47.84  ? 495  ILE C O   1 
ATOM   3281 C  CB  . ILE C 1 96  ? -1.476  42.708  61.885  1.00 31.98  ? 495  ILE C CB  1 
ATOM   3282 C  CG1 . ILE C 1 96  ? -2.706  41.800  61.982  1.00 24.42  ? 495  ILE C CG1 1 
ATOM   3283 C  CG2 . ILE C 1 96  ? -0.528  42.442  63.049  1.00 42.79  ? 495  ILE C CG2 1 
ATOM   3284 C  CD1 . ILE C 1 96  ? -2.381  40.336  61.791  1.00 22.42  ? 495  ILE C CD1 1 
ATOM   3285 N  N   . LYS C 1 97  ? -3.764  44.331  63.192  1.00 29.46  ? 496  LYS C N   1 
ATOM   3286 C  CA  . LYS C 1 97  ? -4.513  44.746  64.375  1.00 32.39  ? 496  LYS C CA  1 
ATOM   3287 C  C   . LYS C 1 97  ? -5.379  43.601  64.895  1.00 30.19  ? 496  LYS C C   1 
ATOM   3288 O  O   . LYS C 1 97  ? -5.840  42.749  64.141  1.00 21.65  ? 496  LYS C O   1 
ATOM   3289 C  CB  . LYS C 1 97  ? -5.396  45.958  64.095  1.00 27.47  ? 496  LYS C CB  1 
ATOM   3290 C  CG  . LYS C 1 97  ? -4.714  47.304  64.220  1.00 26.51  ? 496  LYS C CG  1 
ATOM   3291 C  CD  . LYS C 1 97  ? -5.455  48.355  63.403  1.00 25.61  ? 496  LYS C CD  1 
ATOM   3292 C  CE  . LYS C 1 97  ? -6.959  48.157  63.542  1.00 27.09  ? 496  LYS C CE  1 
ATOM   3293 N  NZ  . LYS C 1 97  ? -7.602  49.351  64.171  1.00 38.35  ? 496  LYS C NZ  1 
ATOM   3294 N  N   . ARG C 1 98  ? -5.586  43.604  66.208  1.00 29.27  ? 497  ARG C N   1 
ATOM   3295 C  CA  . ARG C 1 98  ? -6.395  42.572  66.839  1.00 26.93  ? 497  ARG C CA  1 
ATOM   3296 C  C   . ARG C 1 98  ? -5.948  41.175  66.450  1.00 24.11  ? 497  ARG C C   1 
ATOM   3297 O  O   . ARG C 1 98  ? -6.680  40.424  65.808  1.00 26.34  ? 497  ARG C O   1 
ATOM   3298 C  CB  . ARG C 1 98  ? -7.877  42.742  66.479  1.00 28.15  ? 497  ARG C CB  1 
ATOM   3299 C  CG  . ARG C 1 98  ? -8.642  43.573  67.496  1.00 28.56  ? 497  ARG C CG  1 
ATOM   3300 C  CD  . ARG C 1 98  ? -8.210  45.029  67.425  1.00 23.09  ? 497  ARG C CD  1 
ATOM   3301 N  NE  . ARG C 1 98  ? -9.287  45.877  66.929  1.00 26.13  ? 497  ARG C NE  1 
ATOM   3302 C  CZ  . ARG C 1 98  ? -9.229  47.197  66.839  1.00 28.36  ? 497  ARG C CZ  1 
ATOM   3303 N  NH1 . ARG C 1 98  ? -8.137  47.847  67.215  1.00 44.02  ? 497  ARG C NH1 1 
ATOM   3304 N  NH2 . ARG C 1 98  ? -10.273 47.867  66.372  1.00 37.91  ? 497  ARG C NH2 1 
ATOM   3305 N  N   . GLY C 1 99  ? -4.732  40.789  66.839  1.00 33.22  ? 498  GLY C N   1 
ATOM   3306 C  CA  . GLY C 1 99  ? -4.357  39.416  66.583  1.00 33.37  ? 498  GLY C CA  1 
ATOM   3307 C  C   . GLY C 1 99  ? -2.923  39.207  66.143  1.00 33.86  ? 498  GLY C C   1 
ATOM   3308 O  O   . GLY C 1 99  ? -2.110  40.123  66.146  1.00 33.67  ? 498  GLY C O   1 
ATOM   3309 N  N   . LYS C 1 100 ? -2.692  37.956  65.783  1.00 32.40  ? 499  LYS C N   1 
ATOM   3310 C  CA  . LYS C 1 100 ? -1.424  37.331  65.514  1.00 39.72  ? 499  LYS C CA  1 
ATOM   3311 C  C   . LYS C 1 100 ? -1.144  37.168  64.025  1.00 40.56  ? 499  LYS C C   1 
ATOM   3312 O  O   . LYS C 1 100 ? -2.040  36.951  63.217  1.00 23.25  ? 499  LYS C O   1 
ATOM   3313 C  CB  . LYS C 1 100 ? -1.389  35.936  66.167  1.00 44.74  ? 499  LYS C CB  1 
ATOM   3314 C  CG  . LYS C 1 100 ? -1.133  34.817  65.170  1.00 47.60  ? 499  LYS C CG  1 
ATOM   3315 C  CD  . LYS C 1 100 ? -2.262  33.809  65.122  1.00 46.27  ? 499  LYS C CD  1 
ATOM   3316 C  CE  . LYS C 1 100 ? -3.237  34.078  63.986  1.00 42.66  ? 499  LYS C CE  1 
ATOM   3317 N  NZ  . LYS C 1 100 ? -4.641  33.776  64.395  1.00 40.89  ? 499  LYS C NZ  1 
ATOM   3318 N  N   . ILE C 1 101 ? 0.136   37.265  63.688  1.00 38.98  ? 500  ILE C N   1 
ATOM   3319 C  CA  . ILE C 1 101 ? 0.589   36.975  62.335  1.00 28.96  ? 500  ILE C CA  1 
ATOM   3320 C  C   . ILE C 1 101 ? 0.789   35.471  62.210  1.00 24.45  ? 500  ILE C C   1 
ATOM   3321 O  O   . ILE C 1 101 ? 1.021   34.802  63.220  1.00 36.69  ? 500  ILE C O   1 
ATOM   3322 C  CB  . ILE C 1 101 ? 1.889   37.723  62.001  1.00 34.61  ? 500  ILE C CB  1 
ATOM   3323 C  CG1 . ILE C 1 101 ? 1.744   38.776  60.903  1.00 40.20  ? 500  ILE C CG1 1 
ATOM   3324 C  CG2 . ILE C 1 101 ? 3.002   36.749  61.650  1.00 38.02  ? 500  ILE C CG2 1 
ATOM   3325 C  CD1 . ILE C 1 101 ? 1.579   40.193  61.409  1.00 23.73  ? 500  ILE C CD1 1 
ATOM   3326 N  N   . ASN C 1 102 ? 0.695   34.952  60.991  1.00 22.11  ? 501  ASN C N   1 
ATOM   3327 C  CA  . ASN C 1 102 ? 0.956   33.540  60.748  1.00 22.48  ? 501  ASN C CA  1 
ATOM   3328 C  C   . ASN C 1 102 ? 1.661   33.365  59.394  1.00 21.86  ? 501  ASN C C   1 
ATOM   3329 O  O   . ASN C 1 102 ? 1.886   34.353  58.703  1.00 32.55  ? 501  ASN C O   1 
ATOM   3330 C  CB  . ASN C 1 102 ? -0.308  32.689  60.812  1.00 21.10  ? 501  ASN C CB  1 
ATOM   3331 C  CG  . ASN C 1 102 ? -1.449  33.096  59.914  1.00 25.10  ? 501  ASN C CG  1 
ATOM   3332 O  OD1 . ASN C 1 102 ? -2.574  33.312  60.384  1.00 25.66  ? 501  ASN C OD1 1 
ATOM   3333 N  ND2 . ASN C 1 102 ? -1.217  33.203  58.609  1.00 15.09  ? 501  ASN C ND2 1 
ATOM   3334 N  N   . GLU C 1 103 ? 1.949   32.116  59.088  1.00 19.13  ? 502  GLU C N   1 
ATOM   3335 C  CA  . GLU C 1 103 ? 2.628   31.632  57.905  1.00 28.01  ? 502  GLU C CA  1 
ATOM   3336 C  C   . GLU C 1 103 ? 1.917   32.030  56.621  1.00 27.69  ? 502  GLU C C   1 
ATOM   3337 O  O   . GLU C 1 103 ? 2.566   32.277  55.606  1.00 24.00  ? 502  GLU C O   1 
ATOM   3338 C  CB  . GLU C 1 103 ? 2.749   30.106  57.977  1.00 33.21  ? 502  GLU C CB  1 
ATOM   3339 C  CG  . GLU C 1 103 ? 4.134   29.562  57.696  1.00 51.64  ? 502  GLU C CG  1 
ATOM   3340 C  CD  . GLU C 1 103 ? 4.979   29.278  58.917  1.00 58.06  ? 502  GLU C CD  1 
ATOM   3341 O  OE1 . GLU C 1 103 ? 4.528   29.535  60.053  1.00 77.80  ? 502  GLU C OE1 1 
ATOM   3342 O  OE2 . GLU C 1 103 ? 6.118   28.791  58.749  1.00 44.50  ? 502  GLU C OE2 1 
ATOM   3343 N  N   . THR C 1 104 ? 0.582   32.096  56.606  1.00 18.79  ? 503  THR C N   1 
ATOM   3344 C  CA  . THR C 1 104 ? -0.032  32.435  55.316  1.00 21.25  ? 503  THR C CA  1 
ATOM   3345 C  C   . THR C 1 104 ? -0.086  33.948  55.179  1.00 19.39  ? 503  THR C C   1 
ATOM   3346 O  O   . THR C 1 104 ? -0.024  34.476  54.069  1.00 29.81  ? 503  THR C O   1 
ATOM   3347 C  CB  . THR C 1 104 ? -1.422  31.807  55.114  1.00 25.69  ? 503  THR C CB  1 
ATOM   3348 O  OG1 . THR C 1 104 ? -2.457  32.793  55.226  1.00 27.28  ? 503  THR C OG1 1 
ATOM   3349 C  CG2 . THR C 1 104 ? -1.712  30.767  56.188  1.00 3.59   ? 503  THR C CG2 1 
ATOM   3350 N  N   . ILE C 1 105 ? -0.192  34.662  56.301  1.00 17.44  ? 504  ILE C N   1 
ATOM   3351 C  CA  . ILE C 1 105 ? -0.163  36.117  56.210  1.00 11.54  ? 504  ILE C CA  1 
ATOM   3352 C  C   . ILE C 1 105 ? 1.216   36.588  55.755  1.00 15.78  ? 504  ILE C C   1 
ATOM   3353 O  O   . ILE C 1 105 ? 1.350   37.484  54.921  1.00 25.49  ? 504  ILE C O   1 
ATOM   3354 C  CB  . ILE C 1 105 ? -0.475  36.826  57.539  1.00 20.51  ? 504  ILE C CB  1 
ATOM   3355 C  CG1 . ILE C 1 105 ? -1.926  36.690  58.001  1.00 31.21  ? 504  ILE C CG1 1 
ATOM   3356 C  CG2 . ILE C 1 105 ? -0.047  38.288  57.436  1.00 7.63   ? 504  ILE C CG2 1 
ATOM   3357 C  CD1 . ILE C 1 105 ? -2.323  37.595  59.147  1.00 26.70  ? 504  ILE C CD1 1 
ATOM   3358 N  N   . ILE C 1 106 ? 2.233   35.956  56.343  1.00 10.53  ? 505  ILE C N   1 
ATOM   3359 C  CA  . ILE C 1 106 ? 3.606   36.278  55.960  1.00 20.38  ? 505  ILE C CA  1 
ATOM   3360 C  C   . ILE C 1 106 ? 3.834   35.979  54.480  1.00 17.53  ? 505  ILE C C   1 
ATOM   3361 O  O   . ILE C 1 106 ? 4.480   36.764  53.788  1.00 16.40  ? 505  ILE C O   1 
ATOM   3362 C  CB  . ILE C 1 106 ? 4.622   35.499  56.803  1.00 25.16  ? 505  ILE C CB  1 
ATOM   3363 C  CG1 . ILE C 1 106 ? 4.790   36.059  58.219  1.00 23.08  ? 505  ILE C CG1 1 
ATOM   3364 C  CG2 . ILE C 1 106 ? 5.955   35.415  56.080  1.00 33.00  ? 505  ILE C CG2 1 
ATOM   3365 C  CD1 . ILE C 1 106 ? 5.184   35.008  59.237  1.00 19.92  ? 505  ILE C CD1 1 
ATOM   3366 N  N   . GLY C 1 107 ? 3.288   34.860  54.025  1.00 14.64  ? 506  GLY C N   1 
ATOM   3367 C  CA  . GLY C 1 107 ? 3.260   34.456  52.638  1.00 17.75  ? 506  GLY C CA  1 
ATOM   3368 C  C   . GLY C 1 107 ? 2.522   35.436  51.746  1.00 20.82  ? 506  GLY C C   1 
ATOM   3369 O  O   . GLY C 1 107 ? 3.001   35.777  50.665  1.00 21.79  ? 506  GLY C O   1 
ATOM   3370 N  N   . ASP C 1 108 ? 1.352   35.910  52.174  1.00 20.05  ? 507  ASP C N   1 
ATOM   3371 C  CA  . ASP C 1 108 ? 0.572   36.842  51.357  1.00 12.45  ? 507  ASP C CA  1 
ATOM   3372 C  C   . ASP C 1 108 ? 1.261   38.195  51.287  1.00 14.37  ? 507  ASP C C   1 
ATOM   3373 O  O   . ASP C 1 108 ? 1.273   38.858  50.255  1.00 10.06  ? 507  ASP C O   1 
ATOM   3374 C  CB  . ASP C 1 108 ? -0.854  36.973  51.899  1.00 9.86   ? 507  ASP C CB  1 
ATOM   3375 C  CG  . ASP C 1 108 ? -1.636  35.684  51.720  1.00 15.63  ? 507  ASP C CG  1 
ATOM   3376 O  OD1 . ASP C 1 108 ? -1.216  34.839  50.902  1.00 15.41  ? 507  ASP C OD1 1 
ATOM   3377 O  OD2 . ASP C 1 108 ? -2.668  35.489  52.394  1.00 32.95  ? 507  ASP C OD2 1 
ATOM   3378 N  N   . VAL C 1 109 ? 1.856   38.619  52.402  1.00 8.53   ? 508  VAL C N   1 
ATOM   3379 C  CA  . VAL C 1 109 ? 2.566   39.886  52.425  1.00 0.00   ? 508  VAL C CA  1 
ATOM   3380 C  C   . VAL C 1 109 ? 3.840   39.819  51.580  1.00 11.29  ? 508  VAL C C   1 
ATOM   3381 O  O   . VAL C 1 109 ? 4.367   40.819  51.101  1.00 15.69  ? 508  VAL C O   1 
ATOM   3382 C  CB  . VAL C 1 109 ? 2.965   40.282  53.853  1.00 4.49   ? 508  VAL C CB  1 
ATOM   3383 C  CG1 . VAL C 1 109 ? 3.885   41.493  53.782  1.00 8.69   ? 508  VAL C CG1 1 
ATOM   3384 C  CG2 . VAL C 1 109 ? 1.737   40.563  54.716  1.00 5.97   ? 508  VAL C CG2 1 
ATOM   3385 N  N   . PHE C 1 110 ? 4.348   38.602  51.418  1.00 14.03  ? 509  PHE C N   1 
ATOM   3386 C  CA  . PHE C 1 110 ? 5.555   38.381  50.639  1.00 17.15  ? 509  PHE C CA  1 
ATOM   3387 C  C   . PHE C 1 110 ? 5.274   38.633  49.159  1.00 20.72  ? 509  PHE C C   1 
ATOM   3388 O  O   . PHE C 1 110 ? 6.041   39.334  48.505  1.00 13.61  ? 509  PHE C O   1 
ATOM   3389 C  CB  . PHE C 1 110 ? 6.076   36.962  50.866  1.00 9.19   ? 509  PHE C CB  1 
ATOM   3390 C  CG  . PHE C 1 110 ? 7.358   36.675  50.092  1.00 26.83  ? 509  PHE C CG  1 
ATOM   3391 C  CD1 . PHE C 1 110 ? 8.584   37.084  50.590  1.00 29.31  ? 509  PHE C CD1 1 
ATOM   3392 C  CD2 . PHE C 1 110 ? 7.322   36.004  48.882  1.00 21.11  ? 509  PHE C CD2 1 
ATOM   3393 C  CE1 . PHE C 1 110 ? 9.752   36.826  49.897  1.00 26.51  ? 509  PHE C CE1 1 
ATOM   3394 C  CE2 . PHE C 1 110 ? 8.484   35.741  48.180  1.00 32.48  ? 509  PHE C CE2 1 
ATOM   3395 C  CZ  . PHE C 1 110 ? 9.703   36.155  48.689  1.00 32.92  ? 509  PHE C CZ  1 
ATOM   3396 N  N   . GLU C 1 111 ? 4.177   38.068  48.659  1.00 17.61  ? 510  GLU C N   1 
ATOM   3397 C  CA  . GLU C 1 111 ? 3.749   38.269  47.283  1.00 7.80   ? 510  GLU C CA  1 
ATOM   3398 C  C   . GLU C 1 111 ? 3.511   39.742  46.966  1.00 13.36  ? 510  GLU C C   1 
ATOM   3399 O  O   . GLU C 1 111 ? 3.921   40.239  45.917  1.00 27.88  ? 510  GLU C O   1 
ATOM   3400 C  CB  . GLU C 1 111 ? 2.462   37.501  46.978  1.00 2.18   ? 510  GLU C CB  1 
ATOM   3401 C  CG  . GLU C 1 111 ? 2.640   35.989  46.943  1.00 1.70   ? 510  GLU C CG  1 
ATOM   3402 C  CD  . GLU C 1 111 ? 1.376   35.290  47.417  1.00 11.80  ? 510  GLU C CD  1 
ATOM   3403 O  OE1 . GLU C 1 111 ? 0.411   36.011  47.745  1.00 16.22  ? 510  GLU C OE1 1 
ATOM   3404 O  OE2 . GLU C 1 111 ? 1.378   34.048  47.453  1.00 23.41  ? 510  GLU C OE2 1 
ATOM   3405 N  N   . ALA C 1 112 ? 2.841   40.433  47.873  1.00 10.44  ? 511  ALA C N   1 
ATOM   3406 C  CA  . ALA C 1 112 ? 2.499   41.834  47.708  1.00 6.21   ? 511  ALA C CA  1 
ATOM   3407 C  C   . ALA C 1 112 ? 3.718   42.744  47.721  1.00 4.69   ? 511  ALA C C   1 
ATOM   3408 O  O   . ALA C 1 112 ? 3.740   43.784  47.063  1.00 13.75  ? 511  ALA C O   1 
ATOM   3409 C  CB  . ALA C 1 112 ? 1.543   42.251  48.825  1.00 21.60  ? 511  ALA C CB  1 
ATOM   3410 N  N   . LEU C 1 113 ? 4.734   42.370  48.495  1.00 9.36   ? 512  LEU C N   1 
ATOM   3411 C  CA  . LEU C 1 113 ? 5.953   43.178  48.539  1.00 14.61  ? 512  LEU C CA  1 
ATOM   3412 C  C   . LEU C 1 113 ? 6.585   43.256  47.156  1.00 6.61   ? 512  LEU C C   1 
ATOM   3413 O  O   . LEU C 1 113 ? 7.124   44.264  46.718  1.00 19.64  ? 512  LEU C O   1 
ATOM   3414 C  CB  . LEU C 1 113 ? 6.943   42.575  49.532  1.00 18.17  ? 512  LEU C CB  1 
ATOM   3415 C  CG  . LEU C 1 113 ? 8.339   43.198  49.582  1.00 16.93  ? 512  LEU C CG  1 
ATOM   3416 C  CD1 . LEU C 1 113 ? 8.249   44.661  49.981  1.00 39.78  ? 512  LEU C CD1 1 
ATOM   3417 C  CD2 . LEU C 1 113 ? 9.237   42.417  50.538  1.00 10.50  ? 512  LEU C CD2 1 
ATOM   3418 N  N   . TRP C 1 114 ? 6.501   42.124  46.457  1.00 15.97  ? 513  TRP C N   1 
ATOM   3419 C  CA  . TRP C 1 114 ? 7.100   42.077  45.116  1.00 24.47  ? 513  TRP C CA  1 
ATOM   3420 C  C   . TRP C 1 114 ? 6.229   42.830  44.130  1.00 25.66  ? 513  TRP C C   1 
ATOM   3421 O  O   . TRP C 1 114 ? 6.746   43.531  43.261  1.00 9.55   ? 513  TRP C O   1 
ATOM   3422 C  CB  . TRP C 1 114 ? 7.343   40.605  44.747  1.00 18.13  ? 513  TRP C CB  1 
ATOM   3423 C  CG  . TRP C 1 114 ? 8.538   40.169  45.556  1.00 15.71  ? 513  TRP C CG  1 
ATOM   3424 C  CD1 . TRP C 1 114 ? 8.606   39.311  46.605  1.00 21.65  ? 513  TRP C CD1 1 
ATOM   3425 C  CD2 . TRP C 1 114 ? 9.873   40.647  45.322  1.00 13.21  ? 513  TRP C CD2 1 
ATOM   3426 N  NE1 . TRP C 1 114 ? 9.910   39.213  47.045  1.00 16.84  ? 513  TRP C NE1 1 
ATOM   3427 C  CE2 . TRP C 1 114 ? 10.703  40.024  46.270  1.00 15.12  ? 513  TRP C CE2 1 
ATOM   3428 C  CE3 . TRP C 1 114 ? 10.429  41.533  44.399  1.00 14.87  ? 513  TRP C CE3 1 
ATOM   3429 C  CZ2 . TRP C 1 114 ? 12.073  40.270  46.314  1.00 21.88  ? 513  TRP C CZ2 1 
ATOM   3430 C  CZ3 . TRP C 1 114 ? 11.791  41.778  44.442  1.00 12.61  ? 513  TRP C CZ3 1 
ATOM   3431 C  CH2 . TRP C 1 114 ? 12.592  41.144  45.397  1.00 21.96  ? 513  TRP C CH2 1 
ATOM   3432 N  N   . ALA C 1 115 ? 4.913   42.709  44.302  1.00 18.99  ? 514  ALA C N   1 
ATOM   3433 C  CA  . ALA C 1 115 ? 4.007   43.497  43.463  1.00 13.18  ? 514  ALA C CA  1 
ATOM   3434 C  C   . ALA C 1 115 ? 4.308   44.982  43.634  1.00 16.04  ? 514  ALA C C   1 
ATOM   3435 O  O   . ALA C 1 115 ? 4.215   45.762  42.686  1.00 21.69  ? 514  ALA C O   1 
ATOM   3436 C  CB  . ALA C 1 115 ? 2.554   43.192  43.779  1.00 4.74   ? 514  ALA C CB  1 
ATOM   3437 N  N   . ALA C 1 116 ? 4.670   45.354  44.861  1.00 20.74  ? 515  ALA C N   1 
ATOM   3438 C  CA  . ALA C 1 116 ? 4.954   46.744  45.194  1.00 17.11  ? 515  ALA C CA  1 
ATOM   3439 C  C   . ALA C 1 116 ? 6.277   47.170  44.564  1.00 19.88  ? 515  ALA C C   1 
ATOM   3440 O  O   . ALA C 1 116 ? 6.335   48.239  43.960  1.00 31.29  ? 515  ALA C O   1 
ATOM   3441 C  CB  . ALA C 1 116 ? 4.998   46.963  46.699  1.00 6.89   ? 515  ALA C CB  1 
ATOM   3442 N  N   . VAL C 1 117 ? 7.295   46.320  44.728  1.00 16.61  ? 516  VAL C N   1 
ATOM   3443 C  CA  . VAL C 1 117 ? 8.589   46.609  44.103  1.00 16.81  ? 516  VAL C CA  1 
ATOM   3444 C  C   . VAL C 1 117 ? 8.343   46.700  42.595  1.00 18.61  ? 516  VAL C C   1 
ATOM   3445 O  O   . VAL C 1 117 ? 8.806   47.637  41.951  1.00 9.49   ? 516  VAL C O   1 
ATOM   3446 C  CB  . VAL C 1 117 ? 9.681   45.581  44.412  1.00 16.92  ? 516  VAL C CB  1 
ATOM   3447 C  CG1 . VAL C 1 117 ? 10.971  45.882  43.646  1.00 17.65  ? 516  VAL C CG1 1 
ATOM   3448 C  CG2 . VAL C 1 117 ? 10.008  45.529  45.897  1.00 6.85   ? 516  VAL C CG2 1 
ATOM   3449 N  N   . TYR C 1 118 ? 7.582   45.739  42.070  1.00 21.14  ? 517  TYR C N   1 
ATOM   3450 C  CA  . TYR C 1 118 ? 7.198   45.779  40.657  1.00 16.87  ? 517  TYR C CA  1 
ATOM   3451 C  C   . TYR C 1 118 ? 6.595   47.128  40.312  1.00 14.34  ? 517  TYR C C   1 
ATOM   3452 O  O   . TYR C 1 118 ? 7.070   47.870  39.443  1.00 19.12  ? 517  TYR C O   1 
ATOM   3453 C  CB  . TYR C 1 118 ? 6.238   44.635  40.299  1.00 15.65  ? 517  TYR C CB  1 
ATOM   3454 C  CG  . TYR C 1 118 ? 5.744   44.708  38.868  1.00 24.09  ? 517  TYR C CG  1 
ATOM   3455 C  CD1 . TYR C 1 118 ? 6.648   44.697  37.806  1.00 20.03  ? 517  TYR C CD1 1 
ATOM   3456 C  CD2 . TYR C 1 118 ? 4.392   44.793  38.562  1.00 22.24  ? 517  TYR C CD2 1 
ATOM   3457 C  CE1 . TYR C 1 118 ? 6.204   44.764  36.501  1.00 12.47  ? 517  TYR C CE1 1 
ATOM   3458 C  CE2 . TYR C 1 118 ? 3.943   44.865  37.255  1.00 20.27  ? 517  TYR C CE2 1 
ATOM   3459 C  CZ  . TYR C 1 118 ? 4.858   44.848  36.220  1.00 21.66  ? 517  TYR C CZ  1 
ATOM   3460 O  OH  . TYR C 1 118 ? 4.434   44.923  34.911  1.00 13.08  ? 517  TYR C OH  1 
ATOM   3461 N  N   . ILE C 1 119 ? 5.512   47.517  40.992  1.00 15.89  ? 518  ILE C N   1 
ATOM   3462 C  CA  . ILE C 1 119 ? 4.879   48.769  40.562  1.00 15.91  ? 518  ILE C CA  1 
ATOM   3463 C  C   . ILE C 1 119 ? 5.786   49.968  40.799  1.00 17.47  ? 518  ILE C C   1 
ATOM   3464 O  O   . ILE C 1 119 ? 5.974   50.790  39.895  1.00 13.90  ? 518  ILE C O   1 
ATOM   3465 C  CB  . ILE C 1 119 ? 3.522   48.968  41.264  1.00 14.86  ? 518  ILE C CB  1 
ATOM   3466 C  CG1 . ILE C 1 119 ? 2.514   47.858  40.957  1.00 20.82  ? 518  ILE C CG1 1 
ATOM   3467 C  CG2 . ILE C 1 119 ? 2.931   50.331  40.947  1.00 12.14  ? 518  ILE C CG2 1 
ATOM   3468 C  CD1 . ILE C 1 119 ? 1.141   48.096  41.557  1.00 14.87  ? 518  ILE C CD1 1 
ATOM   3469 N  N   . ASP C 1 120 ? 6.345   50.084  42.002  1.00 13.63  ? 519  ASP C N   1 
ATOM   3470 C  CA  . ASP C 1 120 ? 7.163   51.236  42.350  1.00 11.89  ? 519  ASP C CA  1 
ATOM   3471 C  C   . ASP C 1 120 ? 8.253   51.531  41.322  1.00 6.50   ? 519  ASP C C   1 
ATOM   3472 O  O   . ASP C 1 120 ? 8.486   52.683  40.968  1.00 14.54  ? 519  ASP C O   1 
ATOM   3473 C  CB  . ASP C 1 120 ? 7.836   51.036  43.719  1.00 9.31   ? 519  ASP C CB  1 
ATOM   3474 C  CG  . ASP C 1 120 ? 8.355   52.363  44.246  1.00 3.77   ? 519  ASP C CG  1 
ATOM   3475 O  OD1 . ASP C 1 120 ? 7.527   53.249  44.529  1.00 12.45  ? 519  ASP C OD1 1 
ATOM   3476 O  OD2 . ASP C 1 120 ? 9.580   52.526  44.382  1.00 12.92  ? 519  ASP C OD2 1 
ATOM   3477 N  N   . SER C 1 121 ? 8.875   50.475  40.814  1.00 9.58   ? 520  SER C N   1 
ATOM   3478 C  CA  . SER C 1 121 ? 10.034  50.580  39.956  1.00 8.96   ? 520  SER C CA  1 
ATOM   3479 C  C   . SER C 1 121 ? 9.669   50.914  38.509  1.00 14.79  ? 520  SER C C   1 
ATOM   3480 O  O   . SER C 1 121 ? 10.503  50.717  37.621  1.00 19.37  ? 520  SER C O   1 
ATOM   3481 C  CB  . SER C 1 121 ? 10.919  49.372  40.015  1.00 1.97   ? 520  SER C CB  1 
ATOM   3482 O  OG  . SER C 1 121 ? 10.240  48.193  39.620  1.00 18.45  ? 520  SER C OG  1 
ATOM   3483 N  N   . GLY C 1 122 ? 8.457   51.376  38.273  1.00 12.64  ? 521  GLY C N   1 
ATOM   3484 C  CA  . GLY C 1 122 ? 7.906   51.692  36.976  1.00 14.04  ? 521  GLY C CA  1 
ATOM   3485 C  C   . GLY C 1 122 ? 7.398   50.463  36.245  1.00 24.93  ? 521  GLY C C   1 
ATOM   3486 O  O   . GLY C 1 122 ? 7.548   50.380  35.025  1.00 30.36  ? 521  GLY C O   1 
ATOM   3487 N  N   . ARG C 1 123 ? 6.803   49.529  36.983  1.00 28.23  ? 522  ARG C N   1 
ATOM   3488 C  CA  . ARG C 1 123 ? 6.391   48.272  36.392  1.00 27.59  ? 522  ARG C CA  1 
ATOM   3489 C  C   . ARG C 1 123 ? 7.522   47.647  35.605  1.00 25.47  ? 522  ARG C C   1 
ATOM   3490 O  O   . ARG C 1 123 ? 7.377   47.196  34.472  1.00 19.61  ? 522  ARG C O   1 
ATOM   3491 C  CB  . ARG C 1 123 ? 5.103   48.388  35.615  1.00 29.86  ? 522  ARG C CB  1 
ATOM   3492 C  CG  . ARG C 1 123 ? 3.851   48.510  36.476  1.00 30.24  ? 522  ARG C CG  1 
ATOM   3493 C  CD  . ARG C 1 123 ? 2.595   48.238  35.667  1.00 25.53  ? 522  ARG C CD  1 
ATOM   3494 N  NE  . ARG C 1 123 ? 1.543   47.616  36.464  1.00 21.16  ? 522  ARG C NE  1 
ATOM   3495 C  CZ  . ARG C 1 123 ? 0.820   48.231  37.392  1.00 15.19  ? 522  ARG C CZ  1 
ATOM   3496 N  NH1 . ARG C 1 123 ? 1.026   49.514  37.658  1.00 19.04  ? 522  ARG C NH1 1 
ATOM   3497 N  NH2 . ARG C 1 123 ? -0.117  47.560  38.056  1.00 8.59   ? 522  ARG C NH2 1 
ATOM   3498 N  N   . ASP C 1 124 ? 8.701   47.640  36.211  1.00 15.09  ? 523  ASP C N   1 
ATOM   3499 C  CA  . ASP C 1 124 ? 9.887   47.062  35.580  1.00 15.89  ? 523  ASP C CA  1 
ATOM   3500 C  C   . ASP C 1 124 ? 10.034  45.592  35.928  1.00 19.23  ? 523  ASP C C   1 
ATOM   3501 O  O   . ASP C 1 124 ? 10.587  45.280  36.994  1.00 20.24  ? 523  ASP C O   1 
ATOM   3502 C  CB  . ASP C 1 124 ? 11.102  47.859  36.055  1.00 10.49  ? 523  ASP C CB  1 
ATOM   3503 C  CG  . ASP C 1 124 ? 12.372  47.489  35.312  1.00 11.62  ? 523  ASP C CG  1 
ATOM   3504 O  OD1 . ASP C 1 124 ? 12.425  46.403  34.705  1.00 11.34  ? 523  ASP C OD1 1 
ATOM   3505 O  OD2 . ASP C 1 124 ? 13.331  48.288  35.367  1.00 17.07  ? 523  ASP C OD2 1 
ATOM   3506 N  N   . ALA C 1 125 ? 9.562   44.669  35.086  1.00 14.80  ? 524  ALA C N   1 
ATOM   3507 C  CA  . ALA C 1 125 ? 9.571   43.259  35.475  1.00 12.29  ? 524  ALA C CA  1 
ATOM   3508 C  C   . ALA C 1 125 ? 10.961  42.640  35.459  1.00 20.23  ? 524  ALA C C   1 
ATOM   3509 O  O   . ALA C 1 125 ? 11.246  41.698  36.209  1.00 11.94  ? 524  ALA C O   1 
ATOM   3510 C  CB  . ALA C 1 125 ? 8.653   42.439  34.573  1.00 21.33  ? 524  ALA C CB  1 
ATOM   3511 N  N   . ASN C 1 126 ? 11.819  43.160  34.584  1.00 12.61  ? 525  ASN C N   1 
ATOM   3512 C  CA  . ASN C 1 126 ? 13.188  42.642  34.527  1.00 15.16  ? 525  ASN C CA  1 
ATOM   3513 C  C   . ASN C 1 126 ? 13.954  43.044  35.779  1.00 4.89   ? 525  ASN C C   1 
ATOM   3514 O  O   . ASN C 1 126 ? 14.594  42.214  36.423  1.00 20.25  ? 525  ASN C O   1 
ATOM   3515 C  CB  . ASN C 1 126 ? 13.867  43.137  33.248  1.00 19.90  ? 525  ASN C CB  1 
ATOM   3516 C  CG  . ASN C 1 126 ? 13.105  42.760  31.988  1.00 4.55   ? 525  ASN C CG  1 
ATOM   3517 O  OD1 . ASN C 1 126 ? 12.544  41.675  31.868  1.00 17.61  ? 525  ASN C OD1 1 
ATOM   3518 N  ND2 . ASN C 1 126 ? 13.093  43.662  31.013  1.00 20.23  ? 525  ASN C ND2 1 
ATOM   3519 N  N   . PHE C 1 127 ? 13.889  44.325  36.149  1.00 16.84  ? 526  PHE C N   1 
ATOM   3520 C  CA  . PHE C 1 127 ? 14.574  44.769  37.362  1.00 13.57  ? 526  PHE C CA  1 
ATOM   3521 C  C   . PHE C 1 127 ? 14.114  43.951  38.570  1.00 17.30  ? 526  PHE C C   1 
ATOM   3522 O  O   . PHE C 1 127 ? 14.943  43.419  39.310  1.00 18.82  ? 526  PHE C O   1 
ATOM   3523 C  CB  . PHE C 1 127 ? 14.327  46.244  37.650  1.00 16.69  ? 526  PHE C CB  1 
ATOM   3524 C  CG  . PHE C 1 127 ? 14.874  46.741  38.976  1.00 24.81  ? 526  PHE C CG  1 
ATOM   3525 C  CD1 . PHE C 1 127 ? 16.215  47.085  39.074  1.00 26.34  ? 526  PHE C CD1 1 
ATOM   3526 C  CD2 . PHE C 1 127 ? 14.069  46.869  40.096  1.00 23.79  ? 526  PHE C CD2 1 
ATOM   3527 C  CE1 . PHE C 1 127 ? 16.753  47.537  40.261  1.00 24.55  ? 526  PHE C CE1 1 
ATOM   3528 C  CE2 . PHE C 1 127 ? 14.601  47.310  41.294  1.00 26.81  ? 526  PHE C CE2 1 
ATOM   3529 C  CZ  . PHE C 1 127 ? 15.941  47.647  41.374  1.00 29.20  ? 526  PHE C CZ  1 
ATOM   3530 N  N   . THR C 1 128 ? 12.799  43.892  38.753  1.00 15.57  ? 527  THR C N   1 
ATOM   3531 C  CA  . THR C 1 128 ? 12.200  43.244  39.919  1.00 15.40  ? 527  THR C CA  1 
ATOM   3532 C  C   . THR C 1 128 ? 12.592  41.770  39.963  1.00 12.82  ? 527  THR C C   1 
ATOM   3533 O  O   . THR C 1 128 ? 12.945  41.224  41.009  1.00 10.29  ? 527  THR C O   1 
ATOM   3534 C  CB  . THR C 1 128 ? 10.667  43.391  39.925  1.00 19.27  ? 527  THR C CB  1 
ATOM   3535 O  OG1 . THR C 1 128 ? 10.297  44.780  39.874  1.00 12.68  ? 527  THR C OG1 1 
ATOM   3536 C  CG2 . THR C 1 128 ? 10.067  42.847  41.215  1.00 23.42  ? 527  THR C CG2 1 
ATOM   3537 N  N   . ARG C 1 129 ? 12.536  41.105  38.814  1.00 12.25  ? 528  ARG C N   1 
ATOM   3538 C  CA  . ARG C 1 129 ? 13.009  39.741  38.667  1.00 17.32  ? 528  ARG C CA  1 
ATOM   3539 C  C   . ARG C 1 129 ? 14.480  39.572  39.031  1.00 20.50  ? 528  ARG C C   1 
ATOM   3540 O  O   . ARG C 1 129 ? 14.851  38.623  39.720  1.00 9.81   ? 528  ARG C O   1 
ATOM   3541 C  CB  . ARG C 1 129 ? 12.849  39.264  37.221  1.00 14.98  ? 528  ARG C CB  1 
ATOM   3542 C  CG  . ARG C 1 129 ? 13.053  37.766  37.073  1.00 17.67  ? 528  ARG C CG  1 
ATOM   3543 C  CD  . ARG C 1 129 ? 13.055  37.393  35.593  1.00 18.68  ? 528  ARG C CD  1 
ATOM   3544 N  NE  . ARG C 1 129 ? 14.304  37.809  34.968  1.00 32.76  ? 528  ARG C NE  1 
ATOM   3545 C  CZ  . ARG C 1 129 ? 14.460  38.255  33.732  1.00 41.52  ? 528  ARG C CZ  1 
ATOM   3546 N  NH1 . ARG C 1 129 ? 13.426  38.369  32.906  1.00 28.32  ? 528  ARG C NH1 1 
ATOM   3547 N  NH2 . ARG C 1 129 ? 15.677  38.593  33.315  1.00 42.62  ? 528  ARG C NH2 1 
ATOM   3548 N  N   . GLU C 1 130 ? 15.326  40.483  38.540  1.00 18.70  ? 529  GLU C N   1 
ATOM   3549 C  CA  . GLU C 1 130 ? 16.752  40.355  38.855  1.00 18.44  ? 529  GLU C CA  1 
ATOM   3550 C  C   . GLU C 1 130 ? 16.982  40.632  40.335  1.00 18.15  ? 529  GLU C C   1 
ATOM   3551 O  O   . GLU C 1 130 ? 17.886  40.077  40.963  1.00 15.66  ? 529  GLU C O   1 
ATOM   3552 C  CB  . GLU C 1 130 ? 17.594  41.291  37.986  1.00 18.77  ? 529  GLU C CB  1 
ATOM   3553 C  CG  . GLU C 1 130 ? 17.771  40.852  36.541  1.00 23.42  ? 529  GLU C CG  1 
ATOM   3554 C  CD  . GLU C 1 130 ? 18.065  39.373  36.387  1.00 25.98  ? 529  GLU C CD  1 
ATOM   3555 O  OE1 . GLU C 1 130 ? 19.117  38.910  36.881  1.00 37.86  ? 529  GLU C OE1 1 
ATOM   3556 O  OE2 . GLU C 1 130 ? 17.245  38.651  35.779  1.00 26.97  ? 529  GLU C OE2 1 
ATOM   3557 N  N   . LEU C 1 131 ? 16.159  41.504  40.914  1.00 20.89  ? 530  LEU C N   1 
ATOM   3558 C  CA  . LEU C 1 131 ? 16.240  41.756  42.357  1.00 20.65  ? 530  LEU C CA  1 
ATOM   3559 C  C   . LEU C 1 131 ? 15.889  40.499  43.150  1.00 23.18  ? 530  LEU C C   1 
ATOM   3560 O  O   . LEU C 1 131 ? 16.634  40.052  44.029  1.00 14.74  ? 530  LEU C O   1 
ATOM   3561 C  CB  . LEU C 1 131 ? 15.328  42.924  42.718  1.00 23.60  ? 530  LEU C CB  1 
ATOM   3562 C  CG  . LEU C 1 131 ? 15.560  43.624  44.057  1.00 30.07  ? 530  LEU C CG  1 
ATOM   3563 C  CD1 . LEU C 1 131 ? 17.040  43.903  44.280  1.00 20.29  ? 530  LEU C CD1 1 
ATOM   3564 C  CD2 . LEU C 1 131 ? 14.742  44.905  44.129  1.00 16.62  ? 530  LEU C CD2 1 
ATOM   3565 N  N   . PHE C 1 132 ? 14.744  39.911  42.836  1.00 19.18  ? 531  PHE C N   1 
ATOM   3566 C  CA  . PHE C 1 132 ? 14.253  38.663  43.389  1.00 16.62  ? 531  PHE C CA  1 
ATOM   3567 C  C   . PHE C 1 132 ? 15.278  37.541  43.301  1.00 17.25  ? 531  PHE C C   1 
ATOM   3568 O  O   . PHE C 1 132 ? 15.428  36.770  44.251  1.00 17.22  ? 531  PHE C O   1 
ATOM   3569 C  CB  . PHE C 1 132 ? 12.995  38.217  42.636  1.00 14.16  ? 531  PHE C CB  1 
ATOM   3570 C  CG  . PHE C 1 132 ? 12.235  37.071  43.279  1.00 15.55  ? 531  PHE C CG  1 
ATOM   3571 C  CD1 . PHE C 1 132 ? 11.229  37.322  44.200  1.00 18.74  ? 531  PHE C CD1 1 
ATOM   3572 C  CD2 . PHE C 1 132 ? 12.511  35.751  42.969  1.00 14.28  ? 531  PHE C CD2 1 
ATOM   3573 C  CE1 . PHE C 1 132 ? 10.520  36.296  44.792  1.00 11.01  ? 531  PHE C CE1 1 
ATOM   3574 C  CE2 . PHE C 1 132 ? 11.801  34.718  43.552  1.00 9.18   ? 531  PHE C CE2 1 
ATOM   3575 C  CZ  . PHE C 1 132 ? 10.798  34.978  44.469  1.00 8.88   ? 531  PHE C CZ  1 
ATOM   3576 N  N   . TYR C 1 133 ? 15.954  37.448  42.156  1.00 12.51  ? 532  TYR C N   1 
ATOM   3577 C  CA  . TYR C 1 133 ? 16.968  36.408  41.987  1.00 14.03  ? 532  TYR C CA  1 
ATOM   3578 C  C   . TYR C 1 133 ? 18.195  36.687  42.854  1.00 8.49   ? 532  TYR C C   1 
ATOM   3579 O  O   . TYR C 1 133 ? 18.758  35.793  43.483  1.00 17.59  ? 532  TYR C O   1 
ATOM   3580 C  CB  . TYR C 1 133 ? 17.412  36.296  40.524  1.00 18.86  ? 532  TYR C CB  1 
ATOM   3581 C  CG  . TYR C 1 133 ? 16.401  35.660  39.599  1.00 24.04  ? 532  TYR C CG  1 
ATOM   3582 C  CD1 . TYR C 1 133 ? 15.283  35.003  40.106  1.00 25.02  ? 532  TYR C CD1 1 
ATOM   3583 C  CD2 . TYR C 1 133 ? 16.563  35.719  38.221  1.00 22.87  ? 532  TYR C CD2 1 
ATOM   3584 C  CE1 . TYR C 1 133 ? 14.356  34.421  39.258  1.00 28.87  ? 532  TYR C CE1 1 
ATOM   3585 C  CE2 . TYR C 1 133 ? 15.637  35.138  37.368  1.00 29.21  ? 532  TYR C CE2 1 
ATOM   3586 C  CZ  . TYR C 1 133 ? 14.537  34.491  37.891  1.00 27.86  ? 532  TYR C CZ  1 
ATOM   3587 O  OH  . TYR C 1 133 ? 13.613  33.912  37.047  1.00 23.37  ? 532  TYR C OH  1 
ATOM   3588 N  N   . LYS C 1 134 ? 18.609  37.944  42.858  1.00 13.25  ? 533  LYS C N   1 
ATOM   3589 C  CA  . LYS C 1 134 ? 19.740  38.394  43.669  1.00 28.22  ? 533  LYS C CA  1 
ATOM   3590 C  C   . LYS C 1 134 ? 19.569  37.921  45.110  1.00 29.40  ? 533  LYS C C   1 
ATOM   3591 O  O   . LYS C 1 134 ? 20.502  37.397  45.724  1.00 30.25  ? 533  LYS C O   1 
ATOM   3592 C  CB  . LYS C 1 134 ? 19.873  39.914  43.560  1.00 26.60  ? 533  LYS C CB  1 
ATOM   3593 C  CG  A LYS C 1 134 ? 21.031  40.501  44.351  0.50 28.84  ? 533  LYS C CG  1 
ATOM   3594 C  CG  B LYS C 1 134 ? 21.101  40.487  44.249  0.50 28.67  ? 533  LYS C CG  1 
ATOM   3595 C  CD  A LYS C 1 134 ? 21.056  42.016  44.257  0.50 25.96  ? 533  LYS C CD  1 
ATOM   3596 C  CD  B LYS C 1 134 ? 21.137  42.002  44.149  0.50 25.79  ? 533  LYS C CD  1 
ATOM   3597 C  CE  A LYS C 1 134 ? 21.668  42.642  45.497  0.50 25.71  ? 533  LYS C CE  1 
ATOM   3598 C  CE  B LYS C 1 134 ? 20.981  42.470  42.713  0.50 22.73  ? 533  LYS C CE  1 
ATOM   3599 N  NZ  A LYS C 1 134 ? 23.127  42.363  45.614  0.50 21.03  ? 533  LYS C NZ  1 
ATOM   3600 N  NZ  B LYS C 1 134 ? 21.725  43.733  42.443  0.50 10.19  ? 533  LYS C NZ  1 
ATOM   3601 N  N   . LEU C 1 135 ? 18.377  38.064  45.677  1.00 29.17  ? 534  LEU C N   1 
ATOM   3602 C  CA  . LEU C 1 135 ? 18.119  37.630  47.048  1.00 23.48  ? 534  LEU C CA  1 
ATOM   3603 C  C   . LEU C 1 135 ? 17.932  36.124  47.154  1.00 16.92  ? 534  LEU C C   1 
ATOM   3604 O  O   . LEU C 1 135 ? 18.443  35.517  48.100  1.00 14.91  ? 534  LEU C O   1 
ATOM   3605 C  CB  . LEU C 1 135 ? 16.877  38.326  47.613  1.00 17.87  ? 534  LEU C CB  1 
ATOM   3606 C  CG  . LEU C 1 135 ? 16.891  39.849  47.696  1.00 19.99  ? 534  LEU C CG  1 
ATOM   3607 C  CD1 . LEU C 1 135 ? 15.483  40.396  47.940  1.00 18.52  ? 534  LEU C CD1 1 
ATOM   3608 C  CD2 . LEU C 1 135 ? 17.828  40.325  48.795  1.00 34.74  ? 534  LEU C CD2 1 
ATOM   3609 N  N   . PHE C 1 136 ? 17.216  35.492  46.223  1.00 20.55  ? 535  PHE C N   1 
ATOM   3610 C  CA  . PHE C 1 136 ? 16.783  34.117  46.404  1.00 20.20  ? 535  PHE C CA  1 
ATOM   3611 C  C   . PHE C 1 136 ? 17.215  33.098  45.368  1.00 18.45  ? 535  PHE C C   1 
ATOM   3612 O  O   . PHE C 1 136 ? 16.845  31.924  45.539  1.00 37.05  ? 535  PHE C O   1 
ATOM   3613 C  CB  . PHE C 1 136 ? 15.232  34.067  46.417  1.00 20.24  ? 535  PHE C CB  1 
ATOM   3614 C  CG  . PHE C 1 136 ? 14.659  35.103  47.372  1.00 20.32  ? 535  PHE C CG  1 
ATOM   3615 C  CD1 . PHE C 1 136 ? 15.015  35.071  48.713  1.00 18.78  ? 535  PHE C CD1 1 
ATOM   3616 C  CD2 . PHE C 1 136 ? 13.793  36.076  46.909  1.00 20.11  ? 535  PHE C CD2 1 
ATOM   3617 C  CE1 . PHE C 1 136 ? 14.503  36.023  49.574  1.00 17.83  ? 535  PHE C CE1 1 
ATOM   3618 C  CE2 . PHE C 1 136 ? 13.282  37.032  47.767  1.00 18.55  ? 535  PHE C CE2 1 
ATOM   3619 C  CZ  . PHE C 1 136 ? 13.647  36.997  49.101  1.00 18.88  ? 535  PHE C CZ  1 
ATOM   3620 N  N   . LYS C 1 137 ? 17.938  33.470  44.328  1.00 20.29  ? 536  LYS C N   1 
ATOM   3621 C  CA  . LYS C 1 137 ? 18.323  32.501  43.302  1.00 18.69  ? 536  LYS C CA  1 
ATOM   3622 C  C   . LYS C 1 137 ? 19.027  31.299  43.910  1.00 15.31  ? 536  LYS C C   1 
ATOM   3623 O  O   . LYS C 1 137 ? 18.619  30.149  43.737  1.00 16.19  ? 536  LYS C O   1 
ATOM   3624 C  CB  . LYS C 1 137 ? 19.225  33.166  42.253  1.00 15.25  ? 536  LYS C CB  1 
ATOM   3625 C  CG  . LYS C 1 137 ? 19.611  32.228  41.115  1.00 18.13  ? 536  LYS C CG  1 
ATOM   3626 C  CD  . LYS C 1 137 ? 20.271  33.009  39.983  1.00 20.91  ? 536  LYS C CD  1 
ATOM   3627 C  CE  . LYS C 1 137 ? 21.084  32.079  39.093  1.00 28.01  ? 536  LYS C CE  1 
ATOM   3628 N  NZ  . LYS C 1 137 ? 20.749  32.261  37.656  1.00 43.72  ? 536  LYS C NZ  1 
ATOM   3629 N  N   . GLU C 1 138 ? 20.110  31.577  44.636  1.00 25.16  ? 537  GLU C N   1 
ATOM   3630 C  CA  . GLU C 1 138 ? 20.885  30.507  45.247  1.00 24.80  ? 537  GLU C CA  1 
ATOM   3631 C  C   . GLU C 1 138 ? 20.012  29.611  46.114  1.00 21.81  ? 537  GLU C C   1 
ATOM   3632 O  O   . GLU C 1 138 ? 20.214  28.397  46.148  1.00 19.00  ? 537  GLU C O   1 
ATOM   3633 C  CB  . GLU C 1 138 ? 22.025  31.070  46.102  1.00 32.15  ? 537  GLU C CB  1 
ATOM   3634 C  CG  . GLU C 1 138 ? 22.551  30.054  47.109  1.00 38.24  ? 537  GLU C CG  1 
ATOM   3635 C  CD  . GLU C 1 138 ? 23.717  30.592  47.915  1.00 47.16  ? 537  GLU C CD  1 
ATOM   3636 O  OE1 . GLU C 1 138 ? 24.625  31.205  47.316  1.00 45.48  ? 537  GLU C OE1 1 
ATOM   3637 O  OE2 . GLU C 1 138 ? 23.720  30.397  49.149  1.00 70.19  ? 537  GLU C OE2 1 
ATOM   3638 N  N   . ASP C 1 139 ? 19.049  30.202  46.814  1.00 28.89  ? 538  ASP C N   1 
ATOM   3639 C  CA  . ASP C 1 139 ? 18.168  29.421  47.682  1.00 36.94  ? 538  ASP C CA  1 
ATOM   3640 C  C   . ASP C 1 139 ? 17.229  28.535  46.877  1.00 29.35  ? 538  ASP C C   1 
ATOM   3641 O  O   . ASP C 1 139 ? 16.935  27.408  47.280  1.00 22.24  ? 538  ASP C O   1 
ATOM   3642 C  CB  . ASP C 1 139 ? 17.341  30.329  48.600  1.00 44.18  ? 538  ASP C CB  1 
ATOM   3643 C  CG  . ASP C 1 139 ? 18.130  30.825  49.795  1.00 48.92  ? 538  ASP C CG  1 
ATOM   3644 O  OD1 . ASP C 1 139 ? 19.377  30.772  49.754  1.00 45.48  ? 538  ASP C OD1 1 
ATOM   3645 O  OD2 . ASP C 1 139 ? 17.502  31.268  50.780  1.00 60.26  ? 538  ASP C OD2 1 
ATOM   3646 N  N   . ILE C 1 140 ? 16.751  29.031  45.734  1.00 25.11  ? 539  ILE C N   1 
ATOM   3647 C  CA  . ILE C 1 140 ? 15.851  28.181  44.939  1.00 23.23  ? 539  ILE C CA  1 
ATOM   3648 C  C   . ILE C 1 140 ? 16.624  27.117  44.181  1.00 21.57  ? 539  ILE C C   1 
ATOM   3649 O  O   . ILE C 1 140 ? 16.206  25.967  44.036  1.00 16.58  ? 539  ILE C O   1 
ATOM   3650 C  CB  . ILE C 1 140 ? 15.005  29.034  43.977  1.00 19.12  ? 539  ILE C CB  1 
ATOM   3651 C  CG1 . ILE C 1 140 ? 14.234  30.168  44.664  1.00 19.60  ? 539  ILE C CG1 1 
ATOM   3652 C  CG2 . ILE C 1 140 ? 14.048  28.159  43.182  1.00 35.83  ? 539  ILE C CG2 1 
ATOM   3653 C  CD1 . ILE C 1 140 ? 14.004  31.386  43.789  1.00 4.53   ? 539  ILE C CD1 1 
ATOM   3654 N  N   . LEU C 1 141 ? 17.806  27.454  43.660  1.00 21.94  ? 540  LEU C N   1 
ATOM   3655 C  CA  . LEU C 1 141 ? 18.535  26.430  42.911  1.00 20.14  ? 540  LEU C CA  1 
ATOM   3656 C  C   . LEU C 1 141 ? 18.909  25.270  43.827  1.00 21.27  ? 540  LEU C C   1 
ATOM   3657 O  O   . LEU C 1 141 ? 18.941  24.122  43.384  1.00 33.81  ? 540  LEU C O   1 
ATOM   3658 C  CB  . LEU C 1 141 ? 19.787  27.006  42.262  1.00 21.64  ? 540  LEU C CB  1 
ATOM   3659 C  CG  . LEU C 1 141 ? 19.642  28.090  41.199  1.00 21.33  ? 540  LEU C CG  1 
ATOM   3660 C  CD1 . LEU C 1 141 ? 20.940  28.207  40.402  1.00 26.73  ? 540  LEU C CD1 1 
ATOM   3661 C  CD2 . LEU C 1 141 ? 18.474  27.830  40.263  1.00 16.78  ? 540  LEU C CD2 1 
ATOM   3662 N  N   . SER C 1 142 ? 19.186  25.575  45.092  1.00 22.47  ? 541  SER C N   1 
ATOM   3663 C  CA  . SER C 1 142 ? 19.576  24.545  46.050  1.00 26.04  ? 541  SER C CA  1 
ATOM   3664 C  C   . SER C 1 142 ? 18.448  23.531  46.208  1.00 22.39  ? 541  SER C C   1 
ATOM   3665 O  O   . SER C 1 142 ? 18.678  22.325  46.184  1.00 32.84  ? 541  SER C O   1 
ATOM   3666 C  CB  . SER C 1 142 ? 19.943  25.160  47.401  1.00 35.47  ? 541  SER C CB  1 
ATOM   3667 O  OG  . SER C 1 142 ? 18.843  25.164  48.294  1.00 30.19  ? 541  SER C OG  1 
ATOM   3668 N  N   . ALA C 1 143 ? 17.233  24.041  46.351  1.00 25.47  ? 542  ALA C N   1 
ATOM   3669 C  CA  . ALA C 1 143 ? 16.035  23.215  46.458  1.00 32.01  ? 542  ALA C CA  1 
ATOM   3670 C  C   . ALA C 1 143 ? 15.831  22.373  45.205  1.00 29.35  ? 542  ALA C C   1 
ATOM   3671 O  O   . ALA C 1 143 ? 15.380  21.231  45.278  1.00 28.86  ? 542  ALA C O   1 
ATOM   3672 C  CB  . ALA C 1 143 ? 14.813  24.088  46.718  1.00 24.54  ? 542  ALA C CB  1 
ATOM   3673 N  N   . ILE C 1 144 ? 16.168  22.943  44.048  1.00 30.04  ? 543  ILE C N   1 
ATOM   3674 C  CA  . ILE C 1 144 ? 16.088  22.195  42.797  1.00 33.97  ? 543  ILE C CA  1 
ATOM   3675 C  C   . ILE C 1 144 ? 17.136  21.088  42.751  1.00 38.86  ? 543  ILE C C   1 
ATOM   3676 O  O   . ILE C 1 144 ? 16.976  20.100  42.026  1.00 39.93  ? 543  ILE C O   1 
ATOM   3677 C  CB  . ILE C 1 144 ? 16.255  23.107  41.567  1.00 35.05  ? 543  ILE C CB  1 
ATOM   3678 C  CG1 . ILE C 1 144 ? 15.076  24.045  41.297  1.00 33.99  ? 543  ILE C CG1 1 
ATOM   3679 C  CG2 . ILE C 1 144 ? 16.558  22.282  40.323  1.00 46.39  ? 543  ILE C CG2 1 
ATOM   3680 C  CD1 . ILE C 1 144 ? 15.501  25.443  40.893  1.00 29.15  ? 543  ILE C CD1 1 
ATOM   3681 N  N   . LYS C 1 145 ? 18.225  21.210  43.511  1.00 45.91  ? 544  LYS C N   1 
ATOM   3682 C  CA  . LYS C 1 145 ? 19.247  20.161  43.462  1.00 49.58  ? 544  LYS C CA  1 
ATOM   3683 C  C   . LYS C 1 145 ? 18.927  19.022  44.429  1.00 51.40  ? 544  LYS C C   1 
ATOM   3684 O  O   . LYS C 1 145 ? 19.162  17.856  44.112  1.00 47.62  ? 544  LYS C O   1 
ATOM   3685 C  CB  . LYS C 1 145 ? 20.639  20.710  43.777  1.00 40.59  ? 544  LYS C CB  1 
ATOM   3686 C  CG  . LYS C 1 145 ? 20.897  22.124  43.304  1.00 41.20  ? 544  LYS C CG  1 
ATOM   3687 C  CD  . LYS C 1 145 ? 21.669  22.173  41.998  1.00 50.90  ? 544  LYS C CD  1 
ATOM   3688 C  CE  . LYS C 1 145 ? 21.485  23.509  41.294  1.00 52.64  ? 544  LYS C CE  1 
ATOM   3689 N  NZ  . LYS C 1 145 ? 22.734  24.320  41.293  1.00 46.08  ? 544  LYS C NZ  1 
ATOM   3690 N  N   . GLU C 1 146 ? 18.451  19.392  45.608  1.00 52.04  ? 545  GLU C N   1 
ATOM   3691 C  CA  . GLU C 1 146 ? 18.136  18.424  46.680  1.00 51.84  ? 545  GLU C CA  1 
ATOM   3692 C  C   . GLU C 1 146 ? 16.695  17.879  46.608  1.00 52.09  ? 545  GLU C C   1 
ATOM   3693 O  O   . GLU C 1 146 ? 16.533  16.679  46.385  1.00 59.37  ? 545  GLU C O   1 
ATOM   3694 C  CB  . GLU C 1 146 ? 18.268  19.167  48.026  1.00 45.41  ? 545  GLU C CB  1 
ATOM   3695 C  CG  . GLU C 1 146 ? 19.680  19.153  48.584  1.00 42.25  ? 545  GLU C CG  1 
ATOM   3696 C  CD  . GLU C 1 146 ? 20.290  20.536  48.703  1.00 43.82  ? 545  GLU C CD  1 
ATOM   3697 O  OE1 . GLU C 1 146 ? 19.658  21.410  49.334  1.00 51.58  ? 545  GLU C OE1 1 
ATOM   3698 O  OE2 . GLU C 1 146 ? 21.401  20.762  48.175  1.00 39.66  ? 545  GLU C OE2 1 
ATOM   3699 N  N   . GLY C 1 147 ? 15.695  18.747  46.662  1.00 49.06  ? 546  GLY C N   1 
ATOM   3700 C  CA  . GLY C 1 147 ? 14.296  18.391  46.620  1.00 51.31  ? 546  GLY C CA  1 
ATOM   3701 C  C   . GLY C 1 147 ? 13.901  17.515  45.448  1.00 57.15  ? 546  GLY C C   1 
ATOM   3702 O  O   . GLY C 1 147 ? 13.055  16.628  45.631  1.00 53.66  ? 546  GLY C O   1 
ATOM   3703 N  N   . ARG C 1 148 ? 14.513  17.726  44.299  1.00 62.20  ? 547  ARG C N   1 
ATOM   3704 C  CA  . ARG C 1 148 ? 14.230  17.060  43.040  1.00 67.49  ? 547  ARG C CA  1 
ATOM   3705 C  C   . ARG C 1 148 ? 14.032  15.550  43.182  1.00 73.53  ? 547  ARG C C   1 
ATOM   3706 O  O   . ARG C 1 148 ? 14.680  14.893  43.998  1.00 52.88  ? 547  ARG C O   1 
ATOM   3707 C  CB  . ARG C 1 148 ? 15.400  17.283  42.067  1.00 68.11  ? 547  ARG C CB  1 
ATOM   3708 C  CG  . ARG C 1 148 ? 16.696  16.628  42.487  1.00 74.42  ? 547  ARG C CG  1 
ATOM   3709 C  CD  . ARG C 1 148 ? 17.014  15.402  41.638  1.00 78.18  ? 547  ARG C CD  1 
ATOM   3710 N  NE  . ARG C 1 148 ? 18.328  15.518  40.993  1.00 82.72  ? 547  ARG C NE  1 
ATOM   3711 C  CZ  . ARG C 1 148 ? 19.152  14.518  40.710  1.00 85.60  ? 547  ARG C CZ  1 
ATOM   3712 N  NH1 . ARG C 1 148 ? 18.822  13.268  41.009  1.00 85.71  ? 547  ARG C NH1 1 
ATOM   3713 N  NH2 . ARG C 1 148 ? 20.312  14.753  40.131  1.00 92.94  ? 547  ARG C NH2 1 
ATOM   3714 N  N   . HIS C 1 149 ? 13.028  15.043  42.475  1.00 84.34  ? 548  HIS C N   1 
ATOM   3715 C  CA  . HIS C 1 149 ? 12.664  13.635  42.445  1.00 91.11  ? 548  HIS C CA  1 
ATOM   3716 C  C   . HIS C 1 149 ? 12.096  13.157  43.773  1.00 95.16  ? 548  HIS C C   1 
ATOM   3717 O  O   . HIS C 1 149 ? 11.055  13.707  44.167  1.00 98.41  ? 548  HIS C O   1 
ATOM   3718 C  CB  . HIS C 1 149 ? 13.878  12.779  42.050  1.00 92.58  ? 548  HIS C CB  1 
ATOM   3719 C  CG  . HIS C 1 149 ? 14.017  12.579  40.571  1.00 93.58  ? 548  HIS C CG  1 
ATOM   3720 N  ND1 . HIS C 1 149 ? 13.659  11.407  39.940  1.00 93.95  ? 548  HIS C ND1 1 
ATOM   3721 C  CD2 . HIS C 1 149 ? 14.473  13.396  39.596  1.00 92.23  ? 548  HIS C CD2 1 
ATOM   3722 C  CE1 . HIS C 1 149 ? 13.888  11.510  38.644  1.00 92.43  ? 548  HIS C CE1 1 
ATOM   3723 N  NE2 . HIS C 1 149 ? 14.384  12.713  38.407  1.00 91.98  ? 548  HIS C NE2 1 
ATOM   3724 N  N   . GLY D 1 1   ? 3.702   33.011  -3.465  1.00 79.48  ? 600  GLY D N   1 
ATOM   3725 C  CA  . GLY D 1 1   ? 4.759   33.840  -2.916  1.00 84.22  ? 600  GLY D CA  1 
ATOM   3726 C  C   . GLY D 1 1   ? 4.209   34.933  -2.009  1.00 83.62  ? 600  GLY D C   1 
ATOM   3727 O  O   . GLY D 1 1   ? 4.624   36.097  -2.091  1.00 68.34  ? 600  GLY D O   1 
ATOM   3728 N  N   . MET D 1 2   ? 3.271   34.532  -1.145  1.00 85.54  ? 601  MET D N   1 
ATOM   3729 C  CA  . MET D 1 2   ? 2.550   35.418  -0.252  1.00 84.77  ? 601  MET D CA  1 
ATOM   3730 C  C   . MET D 1 2   ? 3.222   35.537  1.123   1.00 89.50  ? 601  MET D C   1 
ATOM   3731 O  O   . MET D 1 2   ? 3.431   36.663  1.572   1.00 98.28  ? 601  MET D O   1 
ATOM   3732 C  CB  . MET D 1 2   ? 1.119   34.910  -0.104  1.00 78.54  ? 601  MET D CB  1 
ATOM   3733 C  CG  . MET D 1 2   ? 0.667   34.056  -1.274  1.00 71.73  ? 601  MET D CG  1 
ATOM   3734 S  SD  . MET D 1 2   ? -0.341  34.976  -2.478  1.00 85.60  ? 601  MET D SD  1 
ATOM   3735 C  CE  . MET D 1 2   ? 0.096   36.668  -2.029  1.00 18.60  ? 601  MET D CE  1 
ATOM   3736 N  N   . LYS D 1 3   ? 3.629   34.406  1.663   1.00 89.61  ? 602  LYS D N   1 
ATOM   3737 C  CA  . LYS D 1 3   ? 4.232   34.173  2.965   1.00 83.94  ? 602  LYS D CA  1 
ATOM   3738 C  C   . LYS D 1 3   ? 3.310   33.440  3.960   1.00 80.98  ? 602  LYS D C   1 
ATOM   3739 O  O   . LYS D 1 3   ? 2.808   33.924  4.985   1.00 84.08  ? 602  LYS D O   1 
ATOM   3740 C  CB  . LYS D 1 3   ? 4.553   35.492  3.662   1.00 80.85  ? 602  LYS D CB  1 
ATOM   3741 C  CG  . LYS D 1 3   ? 5.713   36.309  3.051   1.00 80.43  ? 602  LYS D CG  1 
ATOM   3742 C  CD  . LYS D 1 3   ? 5.835   37.708  3.645   1.00 82.58  ? 602  LYS D CD  1 
ATOM   3743 C  CE  . LYS D 1 3   ? 6.454   38.667  2.632   1.00 87.14  ? 602  LYS D CE  1 
ATOM   3744 N  NZ  . LYS D 1 3   ? 7.839   39.022  3.040   1.00 89.47  ? 602  LYS D NZ  1 
ATOM   3745 N  N   . MET D 1 4   ? 3.082   32.160  3.612   1.00 73.08  ? 603  MET D N   1 
ATOM   3746 C  CA  . MET D 1 4   ? 2.197   31.244  4.310   1.00 65.24  ? 603  MET D CA  1 
ATOM   3747 C  C   . MET D 1 4   ? 2.952   30.439  5.365   1.00 64.34  ? 603  MET D C   1 
ATOM   3748 O  O   . MET D 1 4   ? 2.416   29.477  5.916   1.00 54.60  ? 603  MET D O   1 
ATOM   3749 C  CB  . MET D 1 4   ? 1.538   30.283  3.319   1.00 61.99  ? 603  MET D CB  1 
ATOM   3750 C  CG  . MET D 1 4   ? 2.531   29.345  2.641   1.00 59.77  ? 603  MET D CG  1 
ATOM   3751 S  SD  . MET D 1 4   ? 3.402   30.142  1.282   1.00 71.49  ? 603  MET D SD  1 
ATOM   3752 C  CE  . MET D 1 4   ? 3.025   29.036  -0.075  1.00 42.43  ? 603  MET D CE  1 
ATOM   3753 N  N   . LEU D 1 5   ? 4.189   30.851  5.614   1.00 65.23  ? 604  LEU D N   1 
ATOM   3754 C  CA  . LEU D 1 5   ? 5.080   30.218  6.551   1.00 68.35  ? 604  LEU D CA  1 
ATOM   3755 C  C   . LEU D 1 5   ? 5.176   30.991  7.848   1.00 64.42  ? 604  LEU D C   1 
ATOM   3756 O  O   . LEU D 1 5   ? 4.160   31.274  8.494   1.00 64.77  ? 604  LEU D O   1 
ATOM   3757 C  CB  . LEU D 1 5   ? 6.447   29.957  5.939   1.00 74.63  ? 604  LEU D CB  1 
ATOM   3758 C  CG  . LEU D 1 5   ? 6.609   28.733  5.040   1.00 81.49  ? 604  LEU D CG  1 
ATOM   3759 C  CD1 . LEU D 1 5   ? 7.126   27.545  5.838   1.00 89.66  ? 604  LEU D CD1 1 
ATOM   3760 C  CD2 . LEU D 1 5   ? 5.302   28.395  4.329   1.00 84.59  ? 604  LEU D CD2 1 
ATOM   3761 N  N   . GLU D 1 6   ? 6.403   31.237  8.316   1.00 59.34  ? 605  GLU D N   1 
ATOM   3762 C  CA  . GLU D 1 6   ? 6.587   31.861  9.621   1.00 54.73  ? 605  GLU D CA  1 
ATOM   3763 C  C   . GLU D 1 6   ? 6.360   33.368  9.581   1.00 50.10  ? 605  GLU D C   1 
ATOM   3764 O  O   . GLU D 1 6   ? 7.026   34.098  10.315  1.00 52.01  ? 605  GLU D O   1 
ATOM   3765 C  CB  . GLU D 1 6   ? 7.986   31.569  10.178  1.00 54.74  ? 605  GLU D CB  1 
ATOM   3766 C  CG  . GLU D 1 6   ? 7.974   30.514  11.284  1.00 58.15  ? 605  GLU D CG  1 
ATOM   3767 C  CD  . GLU D 1 6   ? 9.364   30.038  11.651  1.00 67.93  ? 605  GLU D CD  1 
ATOM   3768 O  OE1 . GLU D 1 6   ? 10.332  30.440  10.970  1.00 80.42  ? 605  GLU D OE1 1 
ATOM   3769 O  OE2 . GLU D 1 6   ? 9.481   29.224  12.633  1.00 82.29  ? 605  GLU D OE2 1 
ATOM   3770 N  N   . GLN D 1 7   ? 5.409   33.825  8.779   1.00 39.83  ? 606  GLN D N   1 
ATOM   3771 C  CA  . GLN D 1 7   ? 4.950   35.200  8.703   1.00 29.56  ? 606  GLN D CA  1 
ATOM   3772 C  C   . GLN D 1 7   ? 3.918   35.490  9.798   1.00 28.53  ? 606  GLN D C   1 
ATOM   3773 O  O   . GLN D 1 7   ? 2.975   36.262  9.641   1.00 24.19  ? 606  GLN D O   1 
ATOM   3774 C  CB  . GLN D 1 7   ? 4.357   35.520  7.333   1.00 37.32  ? 606  GLN D CB  1 
ATOM   3775 C  CG  . GLN D 1 7   ? 4.969   36.751  6.681   1.00 47.02  ? 606  GLN D CG  1 
ATOM   3776 C  CD  . GLN D 1 7   ? 6.485   36.757  6.731   1.00 56.32  ? 606  GLN D CD  1 
ATOM   3777 O  OE1 . GLN D 1 7   ? 7.146   35.716  6.670   1.00 62.45  ? 606  GLN D OE1 1 
ATOM   3778 N  NE2 . GLN D 1 7   ? 7.064   37.956  6.830   1.00 65.20  ? 606  GLN D NE2 1 
ATOM   3779 N  N   . LEU D 1 8   ? 4.138   34.842  10.926  1.00 26.35  ? 607  LEU D N   1 
ATOM   3780 C  CA  . LEU D 1 8   ? 3.504   35.071  12.207  1.00 25.49  ? 607  LEU D CA  1 
ATOM   3781 C  C   . LEU D 1 8   ? 4.263   36.188  12.918  1.00 27.60  ? 607  LEU D C   1 
ATOM   3782 O  O   . LEU D 1 8   ? 3.742   36.897  13.775  1.00 32.49  ? 607  LEU D O   1 
ATOM   3783 C  CB  . LEU D 1 8   ? 3.510   33.781  13.017  1.00 19.46  ? 607  LEU D CB  1 
ATOM   3784 C  CG  . LEU D 1 8   ? 2.963   33.852  14.444  1.00 19.77  ? 607  LEU D CG  1 
ATOM   3785 C  CD1 . LEU D 1 8   ? 1.604   34.530  14.456  1.00 16.89  ? 607  LEU D CD1 1 
ATOM   3786 C  CD2 . LEU D 1 8   ? 2.886   32.457  15.038  1.00 21.51  ? 607  LEU D CD2 1 
ATOM   3787 N  N   . GLU D 1 9   ? 5.529   36.311  12.507  1.00 30.88  ? 608  GLU D N   1 
ATOM   3788 C  CA  . GLU D 1 9   ? 6.424   37.316  13.072  1.00 26.15  ? 608  GLU D CA  1 
ATOM   3789 C  C   . GLU D 1 9   ? 5.920   38.711  12.707  1.00 20.86  ? 608  GLU D C   1 
ATOM   3790 O  O   . GLU D 1 9   ? 6.082   39.641  13.493  1.00 25.15  ? 608  GLU D O   1 
ATOM   3791 C  CB  . GLU D 1 9   ? 7.862   37.125  12.596  1.00 20.44  ? 608  GLU D CB  1 
ATOM   3792 C  CG  . GLU D 1 9   ? 8.319   35.681  12.525  1.00 24.49  ? 608  GLU D CG  1 
ATOM   3793 C  CD  . GLU D 1 9   ? 9.820   35.559  12.316  1.00 31.91  ? 608  GLU D CD  1 
ATOM   3794 O  OE1 . GLU D 1 9   ? 10.296  35.959  11.230  1.00 34.88  ? 608  GLU D OE1 1 
ATOM   3795 O  OE2 . GLU D 1 9   ? 10.515  35.063  13.231  1.00 14.75  ? 608  GLU D OE2 1 
ATOM   3796 N  N   . LYS D 1 10  ? 5.321   38.792  11.527  1.00 25.91  ? 609  LYS D N   1 
ATOM   3797 C  CA  . LYS D 1 10  ? 4.721   40.008  10.996  1.00 21.91  ? 609  LYS D CA  1 
ATOM   3798 C  C   . LYS D 1 10  ? 3.513   40.407  11.834  1.00 24.09  ? 609  LYS D C   1 
ATOM   3799 O  O   . LYS D 1 10  ? 3.438   41.513  12.370  1.00 17.82  ? 609  LYS D O   1 
ATOM   3800 C  CB  . LYS D 1 10  ? 4.295   39.828  9.538   1.00 23.12  ? 609  LYS D CB  1 
ATOM   3801 C  CG  . LYS D 1 10  ? 3.526   40.997  8.948   1.00 27.74  ? 609  LYS D CG  1 
ATOM   3802 C  CD  . LYS D 1 10  ? 3.706   41.057  7.438   1.00 34.56  ? 609  LYS D CD  1 
ATOM   3803 C  CE  . LYS D 1 10  ? 3.225   42.381  6.867   1.00 36.22  ? 609  LYS D CE  1 
ATOM   3804 N  NZ  . LYS D 1 10  ? 2.304   42.165  5.716   1.00 35.89  ? 609  LYS D NZ  1 
ATOM   3805 N  N   . LYS D 1 11  ? 2.572   39.471  11.917  1.00 31.01  ? 610  LYS D N   1 
ATOM   3806 C  CA  . LYS D 1 11  ? 1.381   39.669  12.737  1.00 36.02  ? 610  LYS D CA  1 
ATOM   3807 C  C   . LYS D 1 11  ? 1.786   39.930  14.187  1.00 32.57  ? 610  LYS D C   1 
ATOM   3808 O  O   . LYS D 1 11  ? 1.340   40.889  14.814  1.00 36.55  ? 610  LYS D O   1 
ATOM   3809 C  CB  . LYS D 1 11  ? 0.465   38.454  12.629  1.00 40.12  ? 610  LYS D CB  1 
ATOM   3810 C  CG  . LYS D 1 11  ? 0.122   38.074  11.196  1.00 45.63  ? 610  LYS D CG  1 
ATOM   3811 C  CD  . LYS D 1 11  ? -0.123  36.578  11.053  1.00 49.82  ? 610  LYS D CD  1 
ATOM   3812 C  CE  . LYS D 1 11  ? -1.463  36.173  11.640  1.00 50.33  ? 610  LYS D CE  1 
ATOM   3813 N  NZ  . LYS D 1 11  ? -2.601  36.526  10.746  1.00 49.34  ? 610  LYS D NZ  1 
ATOM   3814 N  N   . LEU D 1 12  ? 2.651   39.064  14.699  1.00 26.60  ? 611  LEU D N   1 
ATOM   3815 C  CA  . LEU D 1 12  ? 3.248   39.211  16.015  1.00 21.05  ? 611  LEU D CA  1 
ATOM   3816 C  C   . LEU D 1 12  ? 3.810   40.610  16.228  1.00 25.11  ? 611  LEU D C   1 
ATOM   3817 O  O   . LEU D 1 12  ? 3.566   41.274  17.236  1.00 27.44  ? 611  LEU D O   1 
ATOM   3818 C  CB  . LEU D 1 12  ? 4.368   38.184  16.181  1.00 17.49  ? 611  LEU D CB  1 
ATOM   3819 C  CG  . LEU D 1 12  ? 4.029   36.849  16.828  1.00 22.48  ? 611  LEU D CG  1 
ATOM   3820 C  CD1 . LEU D 1 12  ? 5.304   36.216  17.377  1.00 32.59  ? 611  LEU D CD1 1 
ATOM   3821 C  CD2 . LEU D 1 12  ? 2.979   37.010  17.919  1.00 24.45  ? 611  LEU D CD2 1 
ATOM   3822 N  N   . GLY D 1 13  ? 4.593   41.075  15.259  1.00 33.03  ? 612  GLY D N   1 
ATOM   3823 C  CA  . GLY D 1 13  ? 5.254   42.370  15.370  1.00 29.29  ? 612  GLY D CA  1 
ATOM   3824 C  C   . GLY D 1 13  ? 6.667   42.182  15.898  1.00 24.17  ? 612  GLY D C   1 
ATOM   3825 O  O   . GLY D 1 13  ? 7.329   43.140  16.294  1.00 25.94  ? 612  GLY D O   1 
ATOM   3826 N  N   . TYR D 1 14  ? 7.123   40.927  15.896  1.00 30.57  ? 613  TYR D N   1 
ATOM   3827 C  CA  . TYR D 1 14  ? 8.462   40.646  16.411  1.00 29.64  ? 613  TYR D CA  1 
ATOM   3828 C  C   . TYR D 1 14  ? 9.248   39.679  15.547  1.00 25.75  ? 613  TYR D C   1 
ATOM   3829 O  O   . TYR D 1 14  ? 8.777   38.603  15.172  1.00 25.23  ? 613  TYR D O   1 
ATOM   3830 C  CB  . TYR D 1 14  ? 8.338   40.084  17.838  1.00 18.74  ? 613  TYR D CB  1 
ATOM   3831 C  CG  . TYR D 1 14  ? 9.682   39.705  18.410  1.00 4.36   ? 613  TYR D CG  1 
ATOM   3832 C  CD1 . TYR D 1 14  ? 10.607  40.684  18.746  1.00 8.97   ? 613  TYR D CD1 1 
ATOM   3833 C  CD2 . TYR D 1 14  ? 10.011  38.372  18.598  1.00 6.31   ? 613  TYR D CD2 1 
ATOM   3834 C  CE1 . TYR D 1 14  ? 11.841  40.334  19.268  1.00 14.67  ? 613  TYR D CE1 1 
ATOM   3835 C  CE2 . TYR D 1 14  ? 11.245  38.017  19.120  1.00 11.01  ? 613  TYR D CE2 1 
ATOM   3836 C  CZ  . TYR D 1 14  ? 12.149  39.002  19.452  1.00 13.88  ? 613  TYR D CZ  1 
ATOM   3837 O  OH  . TYR D 1 14  ? 13.378  38.655  19.969  1.00 17.67  ? 613  TYR D OH  1 
ATOM   3838 N  N   . THR D 1 15  ? 10.494  40.024  15.213  1.00 28.97  ? 614  THR D N   1 
ATOM   3839 C  CA  . THR D 1 15  ? 11.266  39.106  14.375  1.00 27.84  ? 614  THR D CA  1 
ATOM   3840 C  C   . THR D 1 15  ? 12.213  38.235  15.186  1.00 29.10  ? 614  THR D C   1 
ATOM   3841 O  O   . THR D 1 15  ? 13.121  38.725  15.865  1.00 26.63  ? 614  THR D O   1 
ATOM   3842 C  CB  . THR D 1 15  ? 12.089  39.870  13.318  1.00 29.15  ? 614  THR D CB  1 
ATOM   3843 O  OG1 . THR D 1 15  ? 11.203  40.480  12.375  1.00 41.37  ? 614  THR D OG1 1 
ATOM   3844 C  CG2 . THR D 1 15  ? 12.967  38.900  12.543  1.00 20.05  ? 614  THR D CG2 1 
ATOM   3845 N  N   . PHE D 1 16  ? 12.026  36.915  15.110  1.00 24.50  ? 615  PHE D N   1 
ATOM   3846 C  CA  . PHE D 1 16  ? 12.867  36.037  15.916  1.00 26.81  ? 615  PHE D CA  1 
ATOM   3847 C  C   . PHE D 1 16  ? 14.335  36.072  15.516  1.00 26.88  ? 615  PHE D C   1 
ATOM   3848 O  O   . PHE D 1 16  ? 14.667  36.099  14.336  1.00 24.27  ? 615  PHE D O   1 
ATOM   3849 C  CB  . PHE D 1 16  ? 12.360  34.585  15.839  1.00 21.30  ? 615  PHE D CB  1 
ATOM   3850 C  CG  . PHE D 1 16  ? 11.319  34.319  16.920  1.00 21.27  ? 615  PHE D CG  1 
ATOM   3851 C  CD1 . PHE D 1 16  ? 10.011  34.724  16.737  1.00 20.85  ? 615  PHE D CD1 1 
ATOM   3852 C  CD2 . PHE D 1 16  ? 11.660  33.674  18.093  1.00 23.60  ? 615  PHE D CD2 1 
ATOM   3853 C  CE1 . PHE D 1 16  ? 9.051   34.485  17.703  1.00 19.44  ? 615  PHE D CE1 1 
ATOM   3854 C  CE2 . PHE D 1 16  ? 10.709  33.431  19.067  1.00 24.63  ? 615  PHE D CE2 1 
ATOM   3855 C  CZ  . PHE D 1 16  ? 9.403   33.836  18.870  1.00 23.76  ? 615  PHE D CZ  1 
ATOM   3856 N  N   . LYS D 1 17  ? 15.213  36.058  16.518  1.00 29.67  ? 616  LYS D N   1 
ATOM   3857 C  CA  . LYS D 1 17  ? 16.644  35.937  16.250  1.00 33.65  ? 616  LYS D CA  1 
ATOM   3858 C  C   . LYS D 1 17  ? 16.996  34.473  15.977  1.00 32.40  ? 616  LYS D C   1 
ATOM   3859 O  O   . LYS D 1 17  ? 17.715  34.168  15.030  1.00 18.69  ? 616  LYS D O   1 
ATOM   3860 C  CB  . LYS D 1 17  ? 17.469  36.470  17.419  1.00 30.98  ? 616  LYS D CB  1 
ATOM   3861 C  CG  . LYS D 1 17  ? 16.641  37.285  18.399  1.00 25.68  ? 616  LYS D CG  1 
ATOM   3862 C  CD  . LYS D 1 17  ? 16.189  38.598  17.788  1.00 8.38   ? 616  LYS D CD  1 
ATOM   3863 C  CE  . LYS D 1 17  ? 16.285  39.720  18.806  1.00 9.89   ? 616  LYS D CE  1 
ATOM   3864 N  NZ  . LYS D 1 17  ? 15.959  41.045  18.223  1.00 14.41  ? 616  LYS D NZ  1 
ATOM   3865 N  N   . ASP D 1 18  ? 16.495  33.622  16.865  1.00 21.81  ? 617  ASP D N   1 
ATOM   3866 C  CA  . ASP D 1 18  ? 16.550  32.174  16.734  1.00 21.56  ? 617  ASP D CA  1 
ATOM   3867 C  C   . ASP D 1 18  ? 15.151  31.667  16.320  1.00 28.89  ? 617  ASP D C   1 
ATOM   3868 O  O   . ASP D 1 18  ? 14.275  31.434  17.164  1.00 30.19  ? 617  ASP D O   1 
ATOM   3869 C  CB  . ASP D 1 18  ? 16.898  31.592  18.130  1.00 23.21  ? 617  ASP D CB  1 
ATOM   3870 C  CG  . ASP D 1 18  ? 17.217  30.115  18.030  1.00 20.05  ? 617  ASP D CG  1 
ATOM   3871 O  OD1 . ASP D 1 18  ? 17.046  29.565  16.922  1.00 25.71  ? 617  ASP D OD1 1 
ATOM   3872 O  OD2 . ASP D 1 18  ? 17.632  29.512  19.038  1.00 31.66  ? 617  ASP D OD2 1 
ATOM   3873 N  N   . LYS D 1 19  ? 15.016  31.366  15.032  1.00 25.43  ? 618  LYS D N   1 
ATOM   3874 C  CA  . LYS D 1 19  ? 13.760  30.882  14.472  1.00 25.66  ? 618  LYS D CA  1 
ATOM   3875 C  C   . LYS D 1 19  ? 13.387  29.501  14.993  1.00 25.04  ? 618  LYS D C   1 
ATOM   3876 O  O   . LYS D 1 19  ? 12.215  29.124  15.028  1.00 29.47  ? 618  LYS D O   1 
ATOM   3877 C  CB  . LYS D 1 19  ? 13.845  30.855  12.943  1.00 29.89  ? 618  LYS D CB  1 
ATOM   3878 C  CG  . LYS D 1 19  ? 13.542  32.203  12.305  1.00 30.11  ? 618  LYS D CG  1 
ATOM   3879 C  CD  . LYS D 1 19  ? 14.821  32.872  11.846  1.00 29.24  ? 618  LYS D CD  1 
ATOM   3880 C  CE  . LYS D 1 19  ? 14.807  34.362  12.146  1.00 30.70  ? 618  LYS D CE  1 
ATOM   3881 N  NZ  . LYS D 1 19  ? 13.414  34.876  12.281  1.00 33.36  ? 618  LYS D NZ  1 
ATOM   3882 N  N   . SER D 1 20  ? 14.391  28.734  15.400  1.00 29.59  ? 619  SER D N   1 
ATOM   3883 C  CA  . SER D 1 20  ? 14.167  27.409  15.961  1.00 23.79  ? 619  SER D CA  1 
ATOM   3884 C  C   . SER D 1 20  ? 13.325  27.475  17.228  1.00 22.70  ? 619  SER D C   1 
ATOM   3885 O  O   . SER D 1 20  ? 12.652  26.511  17.597  1.00 33.89  ? 619  SER D O   1 
ATOM   3886 C  CB  . SER D 1 20  ? 15.506  26.744  16.281  1.00 21.66  ? 619  SER D CB  1 
ATOM   3887 O  OG  . SER D 1 20  ? 15.952  27.151  17.567  1.00 38.48  ? 619  SER D OG  1 
ATOM   3888 N  N   . LEU D 1 21  ? 13.375  28.622  17.902  1.00 21.24  ? 620  LEU D N   1 
ATOM   3889 C  CA  . LEU D 1 21  ? 12.587  28.799  19.121  1.00 21.33  ? 620  LEU D CA  1 
ATOM   3890 C  C   . LEU D 1 21  ? 11.114  28.912  18.739  1.00 22.99  ? 620  LEU D C   1 
ATOM   3891 O  O   . LEU D 1 21  ? 10.261  28.266  19.341  1.00 21.99  ? 620  LEU D O   1 
ATOM   3892 C  CB  . LEU D 1 21  ? 13.036  30.031  19.895  1.00 28.62  ? 620  LEU D CB  1 
ATOM   3893 C  CG  . LEU D 1 21  ? 14.093  29.815  20.980  1.00 24.70  ? 620  LEU D CG  1 
ATOM   3894 C  CD1 . LEU D 1 21  ? 14.374  31.116  21.709  1.00 9.81   ? 620  LEU D CD1 1 
ATOM   3895 C  CD2 . LEU D 1 21  ? 13.656  28.730  21.952  1.00 24.96  ? 620  LEU D CD2 1 
ATOM   3896 N  N   . LEU D 1 22  ? 10.881  29.739  17.721  1.00 14.98  ? 621  LEU D N   1 
ATOM   3897 C  CA  . LEU D 1 22  ? 9.540   29.873  17.156  1.00 20.39  ? 621  LEU D CA  1 
ATOM   3898 C  C   . LEU D 1 22  ? 9.095   28.488  16.688  1.00 27.98  ? 621  LEU D C   1 
ATOM   3899 O  O   . LEU D 1 22  ? 7.996   28.050  17.031  1.00 21.40  ? 621  LEU D O   1 
ATOM   3900 C  CB  . LEU D 1 22  ? 9.504   30.901  16.033  1.00 15.21  ? 621  LEU D CB  1 
ATOM   3901 C  CG  . LEU D 1 22  ? 8.187   31.565  15.648  1.00 14.57  ? 621  LEU D CG  1 
ATOM   3902 C  CD1 . LEU D 1 22  ? 8.421   32.712  14.668  1.00 36.77  ? 621  LEU D CD1 1 
ATOM   3903 C  CD2 . LEU D 1 22  ? 7.197   30.601  15.022  1.00 29.76  ? 621  LEU D CD2 1 
ATOM   3904 N  N   . GLU D 1 23  ? 9.921   27.783  15.918  1.00 20.78  ? 622  GLU D N   1 
ATOM   3905 C  CA  . GLU D 1 23  ? 9.510   26.448  15.482  1.00 23.28  ? 622  GLU D CA  1 
ATOM   3906 C  C   . GLU D 1 23  ? 9.165   25.530  16.648  1.00 25.13  ? 622  GLU D C   1 
ATOM   3907 O  O   . GLU D 1 23  ? 8.185   24.781  16.585  1.00 28.54  ? 622  GLU D O   1 
ATOM   3908 C  CB  . GLU D 1 23  ? 10.599  25.788  14.620  1.00 13.83  ? 622  GLU D CB  1 
ATOM   3909 C  CG  . GLU D 1 23  ? 10.783  26.502  13.283  1.00 23.80  ? 622  GLU D CG  1 
ATOM   3910 C  CD  . GLU D 1 23  ? 11.707  25.784  12.326  1.00 33.95  ? 622  GLU D CD  1 
ATOM   3911 O  OE1 . GLU D 1 23  ? 12.903  25.609  12.642  1.00 34.27  ? 622  GLU D OE1 1 
ATOM   3912 O  OE2 . GLU D 1 23  ? 11.242  25.379  11.238  1.00 56.45  ? 622  GLU D OE2 1 
ATOM   3913 N  N   . LYS D 1 24  ? 9.958   25.557  17.714  1.00 20.30  ? 623  LYS D N   1 
ATOM   3914 C  CA  . LYS D 1 24  ? 9.726   24.653  18.841  1.00 28.39  ? 623  LYS D CA  1 
ATOM   3915 C  C   . LYS D 1 24  ? 8.367   24.894  19.499  1.00 30.05  ? 623  LYS D C   1 
ATOM   3916 O  O   . LYS D 1 24  ? 7.676   23.949  19.884  1.00 15.39  ? 623  LYS D O   1 
ATOM   3917 C  CB  . LYS D 1 24  ? 10.847  24.809  19.867  1.00 27.66  ? 623  LYS D CB  1 
ATOM   3918 C  CG  . LYS D 1 24  ? 11.208  23.541  20.621  1.00 26.18  ? 623  LYS D CG  1 
ATOM   3919 C  CD  . LYS D 1 24  ? 11.997  23.896  21.877  1.00 30.38  ? 623  LYS D CD  1 
ATOM   3920 C  CE  . LYS D 1 24  ? 12.055  22.708  22.824  1.00 36.56  ? 623  LYS D CE  1 
ATOM   3921 N  NZ  . LYS D 1 24  ? 13.424  22.483  23.370  1.00 32.25  ? 623  LYS D NZ  1 
ATOM   3922 N  N   . ALA D 1 25  ? 8.022   26.167  19.614  1.00 25.13  ? 624  ALA D N   1 
ATOM   3923 C  CA  . ALA D 1 25  ? 6.760   26.669  20.109  1.00 25.63  ? 624  ALA D CA  1 
ATOM   3924 C  C   . ALA D 1 25  ? 5.592   26.218  19.236  1.00 28.84  ? 624  ALA D C   1 
ATOM   3925 O  O   . ALA D 1 25  ? 4.480   26.026  19.725  1.00 23.10  ? 624  ALA D O   1 
ATOM   3926 C  CB  . ALA D 1 25  ? 6.782   28.195  20.168  1.00 16.19  ? 624  ALA D CB  1 
ATOM   3927 N  N   . LEU D 1 26  ? 5.863   26.061  17.943  1.00 25.45  ? 625  LEU D N   1 
ATOM   3928 C  CA  . LEU D 1 26  ? 4.819   25.706  16.996  1.00 27.18  ? 625  LEU D CA  1 
ATOM   3929 C  C   . LEU D 1 26  ? 4.695   24.193  16.849  1.00 27.81  ? 625  LEU D C   1 
ATOM   3930 O  O   . LEU D 1 26  ? 3.740   23.707  16.245  1.00 37.57  ? 625  LEU D O   1 
ATOM   3931 C  CB  . LEU D 1 26  ? 5.111   26.303  15.621  1.00 27.54  ? 625  LEU D CB  1 
ATOM   3932 C  CG  . LEU D 1 26  ? 4.890   27.797  15.417  1.00 34.85  ? 625  LEU D CG  1 
ATOM   3933 C  CD1 . LEU D 1 26  ? 5.212   28.181  13.980  1.00 24.22  ? 625  LEU D CD1 1 
ATOM   3934 C  CD2 . LEU D 1 26  ? 3.466   28.186  15.783  1.00 30.97  ? 625  LEU D CD2 1 
ATOM   3935 N  N   . THR D 1 27  ? 5.685   23.501  17.390  1.00 26.86  ? 626  THR D N   1 
ATOM   3936 C  CA  . THR D 1 27  ? 5.890   22.079  17.164  1.00 22.66  ? 626  THR D CA  1 
ATOM   3937 C  C   . THR D 1 27  ? 5.236   21.212  18.229  1.00 19.34  ? 626  THR D C   1 
ATOM   3938 O  O   . THR D 1 27  ? 5.471   21.369  19.424  1.00 30.46  ? 626  THR D O   1 
ATOM   3939 C  CB  . THR D 1 27  ? 7.399   21.756  17.100  1.00 27.22  ? 626  THR D CB  1 
ATOM   3940 O  OG1 . THR D 1 27  ? 7.964   22.455  15.986  1.00 30.91  ? 626  THR D OG1 1 
ATOM   3941 C  CG2 . THR D 1 27  ? 7.637   20.273  16.869  1.00 27.47  ? 626  THR D CG2 1 
ATOM   3942 N  N   . HIS D 1 28  ? 4.407   20.289  17.751  1.00 27.15  ? 627  HIS D N   1 
ATOM   3943 C  CA  . HIS D 1 28  ? 3.718   19.332  18.597  1.00 25.28  ? 627  HIS D CA  1 
ATOM   3944 C  C   . HIS D 1 28  ? 4.509   18.033  18.699  1.00 30.37  ? 627  HIS D C   1 
ATOM   3945 O  O   . HIS D 1 28  ? 5.348   17.730  17.851  1.00 41.81  ? 627  HIS D O   1 
ATOM   3946 C  CB  . HIS D 1 28  ? 2.301   19.063  18.071  1.00 31.95  ? 627  HIS D CB  1 
ATOM   3947 C  CG  . HIS D 1 28  ? 1.514   18.250  19.058  1.00 24.39  ? 627  HIS D CG  1 
ATOM   3948 N  ND1 . HIS D 1 28  ? 1.421   16.882  18.972  1.00 21.97  ? 627  HIS D ND1 1 
ATOM   3949 C  CD2 . HIS D 1 28  ? 0.819   18.614  20.157  1.00 20.30  ? 627  HIS D CD2 1 
ATOM   3950 C  CE1 . HIS D 1 28  ? 0.686   16.429  19.972  1.00 26.62  ? 627  HIS D CE1 1 
ATOM   3951 N  NE2 . HIS D 1 28  ? 0.307   17.462  20.704  1.00 24.30  ? 627  HIS D NE2 1 
ATOM   3952 N  N   . VAL D 1 29  ? 4.254   17.259  19.753  1.00 34.47  ? 628  VAL D N   1 
ATOM   3953 C  CA  . VAL D 1 29  ? 5.004   16.033  19.987  1.00 32.15  ? 628  VAL D CA  1 
ATOM   3954 C  C   . VAL D 1 29  ? 4.892   15.076  18.805  1.00 30.71  ? 628  VAL D C   1 
ATOM   3955 O  O   . VAL D 1 29  ? 5.877   14.436  18.435  1.00 34.75  ? 628  VAL D O   1 
ATOM   3956 C  CB  . VAL D 1 29  ? 4.532   15.298  21.255  1.00 38.10  ? 628  VAL D CB  1 
ATOM   3957 C  CG1 . VAL D 1 29  ? 5.739   14.760  22.013  1.00 55.35  ? 628  VAL D CG1 1 
ATOM   3958 C  CG2 . VAL D 1 29  ? 3.698   16.202  22.146  1.00 34.65  ? 628  VAL D CG2 1 
ATOM   3959 N  N   . SER D 1 30  ? 3.691   14.986  18.239  1.00 30.03  ? 629  SER D N   1 
ATOM   3960 C  CA  . SER D 1 30  ? 3.465   14.066  17.127  1.00 32.77  ? 629  SER D CA  1 
ATOM   3961 C  C   . SER D 1 30  ? 4.476   14.344  16.016  1.00 36.70  ? 629  SER D C   1 
ATOM   3962 O  O   . SER D 1 30  ? 5.240   13.464  15.627  1.00 48.76  ? 629  SER D O   1 
ATOM   3963 C  CB  . SER D 1 30  ? 2.039   14.179  16.596  1.00 29.90  ? 629  SER D CB  1 
ATOM   3964 O  OG  . SER D 1 30  ? 1.800   15.412  15.950  1.00 38.13  ? 629  SER D OG  1 
ATOM   3965 N  N   . TYR D 1 31  ? 4.456   15.585  15.549  1.00 35.10  ? 630  TYR D N   1 
ATOM   3966 C  CA  . TYR D 1 31  ? 5.384   16.055  14.530  1.00 38.41  ? 630  TYR D CA  1 
ATOM   3967 C  C   . TYR D 1 31  ? 6.822   15.800  14.965  1.00 46.90  ? 630  TYR D C   1 
ATOM   3968 O  O   . TYR D 1 31  ? 7.649   15.362  14.164  1.00 57.22  ? 630  TYR D O   1 
ATOM   3969 C  CB  . TYR D 1 31  ? 5.154   17.537  14.266  1.00 25.90  ? 630  TYR D CB  1 
ATOM   3970 C  CG  . TYR D 1 31  ? 5.713   18.091  12.982  1.00 30.77  ? 630  TYR D CG  1 
ATOM   3971 C  CD1 . TYR D 1 31  ? 5.013   17.995  11.787  1.00 28.30  ? 630  TYR D CD1 1 
ATOM   3972 C  CD2 . TYR D 1 31  ? 6.951   18.724  12.968  1.00 31.42  ? 630  TYR D CD2 1 
ATOM   3973 C  CE1 . TYR D 1 31  ? 5.529   18.509  10.615  1.00 32.26  ? 630  TYR D CE1 1 
ATOM   3974 C  CE2 . TYR D 1 31  ? 7.474   19.239  11.802  1.00 37.44  ? 630  TYR D CE2 1 
ATOM   3975 C  CZ  . TYR D 1 31  ? 6.761   19.129  10.628  1.00 38.96  ? 630  TYR D CZ  1 
ATOM   3976 O  OH  . TYR D 1 31  ? 7.287   19.645  9.467   1.00 46.74  ? 630  TYR D OH  1 
ATOM   3977 N  N   . SER D 1 32  ? 7.134   16.070  16.234  1.00 49.66  ? 631  SER D N   1 
ATOM   3978 C  CA  . SER D 1 32  ? 8.509   15.871  16.683  1.00 51.72  ? 631  SER D CA  1 
ATOM   3979 C  C   . SER D 1 32  ? 8.605   15.606  18.187  1.00 42.29  ? 631  SER D C   1 
ATOM   3980 O  O   . SER D 1 32  ? 8.202   16.459  18.974  1.00 39.57  ? 631  SER D O   1 
ATOM   3981 C  CB  . SER D 1 32  ? 9.370   17.086  16.327  1.00 55.06  ? 631  SER D CB  1 
ATOM   3982 O  OG  . SER D 1 32  ? 10.547  17.108  17.122  1.00 56.96  ? 631  SER D OG  1 
ATOM   3983 N  N   . LYS D 1 33  ? 9.142   14.447  18.517  1.00 36.01  ? 632  LYS D N   1 
ATOM   3984 C  CA  . LYS D 1 33  ? 9.388   13.919  19.840  1.00 35.38  ? 632  LYS D CA  1 
ATOM   3985 C  C   . LYS D 1 33  ? 10.647  14.483  20.481  1.00 37.93  ? 632  LYS D C   1 
ATOM   3986 O  O   . LYS D 1 33  ? 10.978  14.136  21.617  1.00 55.05  ? 632  LYS D O   1 
ATOM   3987 C  CB  . LYS D 1 33  ? 9.537   12.388  19.783  1.00 36.55  ? 632  LYS D CB  1 
ATOM   3988 C  CG  . LYS D 1 33  ? 8.265   11.669  19.372  1.00 39.22  ? 632  LYS D CG  1 
ATOM   3989 C  CD  . LYS D 1 33  ? 8.336   10.178  19.659  1.00 42.05  ? 632  LYS D CD  1 
ATOM   3990 C  CE  . LYS D 1 33  ? 7.552   9.383   18.624  1.00 40.74  ? 632  LYS D CE  1 
ATOM   3991 N  NZ  . LYS D 1 33  ? 6.914   8.177   19.222  1.00 53.53  ? 632  LYS D NZ  1 
ATOM   3992 N  N   . LYS D 1 34  ? 11.372  15.337  19.763  1.00 42.48  ? 633  LYS D N   1 
ATOM   3993 C  CA  . LYS D 1 34  ? 12.625  15.831  20.319  1.00 40.08  ? 633  LYS D CA  1 
ATOM   3994 C  C   . LYS D 1 34  ? 12.613  17.343  20.486  1.00 32.26  ? 633  LYS D C   1 
ATOM   3995 O  O   . LYS D 1 34  ? 13.410  17.869  21.268  1.00 38.16  ? 633  LYS D O   1 
ATOM   3996 C  CB  . LYS D 1 34  ? 13.816  15.433  19.436  1.00 48.73  ? 633  LYS D CB  1 
ATOM   3997 C  CG  . LYS D 1 34  ? 14.950  16.452  19.475  1.00 54.04  ? 633  LYS D CG  1 
ATOM   3998 C  CD  . LYS D 1 34  ? 16.205  15.934  18.796  1.00 56.23  ? 633  LYS D CD  1 
ATOM   3999 C  CE  . LYS D 1 34  ? 17.321  15.665  19.792  1.00 59.50  ? 633  LYS D CE  1 
ATOM   4000 N  NZ  . LYS D 1 34  ? 18.292  16.789  19.882  1.00 65.03  ? 633  LYS D NZ  1 
ATOM   4001 N  N   . GLU D 1 35  ? 11.734  18.029  19.758  1.00 29.62  ? 634  GLU D N   1 
ATOM   4002 C  CA  . GLU D 1 35  ? 11.753  19.493  19.816  1.00 37.20  ? 634  GLU D CA  1 
ATOM   4003 C  C   . GLU D 1 35  ? 10.361  20.106  19.748  1.00 36.57  ? 634  GLU D C   1 
ATOM   4004 O  O   . GLU D 1 35  ? 9.996   20.739  18.756  1.00 44.85  ? 634  GLU D O   1 
ATOM   4005 C  CB  . GLU D 1 35  ? 12.615  20.043  18.675  1.00 45.22  ? 634  GLU D CB  1 
ATOM   4006 C  CG  . GLU D 1 35  ? 14.103  19.766  18.797  1.00 45.84  ? 634  GLU D CG  1 
ATOM   4007 C  CD  . GLU D 1 35  ? 14.709  20.309  20.076  1.00 48.94  ? 634  GLU D CD  1 
ATOM   4008 O  OE1 . GLU D 1 35  ? 13.944  20.795  20.932  1.00 54.45  ? 634  GLU D OE1 1 
ATOM   4009 O  OE2 . GLU D 1 35  ? 15.946  20.248  20.223  1.00 54.12  ? 634  GLU D OE2 1 
ATOM   4010 N  N   . HIS D 1 36  ? 9.572   19.928  20.804  1.00 32.75  ? 635  HIS D N   1 
ATOM   4011 C  CA  . HIS D 1 36  ? 8.195   20.428  20.787  1.00 33.95  ? 635  HIS D CA  1 
ATOM   4012 C  C   . HIS D 1 36  ? 7.992   21.528  21.827  1.00 35.11  ? 635  HIS D C   1 
ATOM   4013 O  O   . HIS D 1 36  ? 8.979   22.029  22.379  1.00 29.20  ? 635  HIS D O   1 
ATOM   4014 C  CB  . HIS D 1 36  ? 7.229   19.258  20.964  1.00 29.43  ? 635  HIS D CB  1 
ATOM   4015 C  CG  . HIS D 1 36  ? 7.418   18.439  22.197  1.00 29.63  ? 635  HIS D CG  1 
ATOM   4016 N  ND1 . HIS D 1 36  ? 7.971   17.177  22.192  1.00 31.69  ? 635  HIS D ND1 1 
ATOM   4017 C  CD2 . HIS D 1 36  ? 7.122   18.696  23.490  1.00 21.91  ? 635  HIS D CD2 1 
ATOM   4018 C  CE1 . HIS D 1 36  ? 8.013   16.690  23.422  1.00 14.30  ? 635  HIS D CE1 1 
ATOM   4019 N  NE2 . HIS D 1 36  ? 7.501   17.600  24.224  1.00 22.95  ? 635  HIS D NE2 1 
ATOM   4020 N  N   . TYR D 1 37  ? 6.748   21.917  22.081  1.00 27.76  ? 636  TYR D N   1 
ATOM   4021 C  CA  . TYR D 1 37  ? 6.401   23.104  22.850  1.00 27.97  ? 636  TYR D CA  1 
ATOM   4022 C  C   . TYR D 1 37  ? 6.176   22.883  24.342  1.00 30.00  ? 636  TYR D C   1 
ATOM   4023 O  O   . TYR D 1 37  ? 5.901   23.855  25.063  1.00 18.79  ? 636  TYR D O   1 
ATOM   4024 C  CB  . TYR D 1 37  ? 5.130   23.730  22.253  1.00 31.73  ? 636  TYR D CB  1 
ATOM   4025 C  CG  . TYR D 1 37  ? 3.861   22.917  22.305  1.00 32.76  ? 636  TYR D CG  1 
ATOM   4026 C  CD1 . TYR D 1 37  ? 3.020   22.902  23.409  1.00 33.66  ? 636  TYR D CD1 1 
ATOM   4027 C  CD2 . TYR D 1 37  ? 3.469   22.142  21.220  1.00 38.83  ? 636  TYR D CD2 1 
ATOM   4028 C  CE1 . TYR D 1 37  ? 1.860   22.158  23.447  1.00 35.16  ? 636  TYR D CE1 1 
ATOM   4029 C  CE2 . TYR D 1 37  ? 2.313   21.391  21.238  1.00 39.48  ? 636  TYR D CE2 1 
ATOM   4030 C  CZ  . TYR D 1 37  ? 1.506   21.400  22.353  1.00 37.44  ? 636  TYR D CZ  1 
ATOM   4031 O  OH  . TYR D 1 37  ? 0.351   20.652  22.373  1.00 35.36  ? 636  TYR D OH  1 
ATOM   4032 N  N   . GLU D 1 38  ? 6.254   21.646  24.807  1.00 21.71  ? 637  GLU D N   1 
ATOM   4033 C  CA  . GLU D 1 38  ? 5.901   21.309  26.185  1.00 20.52  ? 637  GLU D CA  1 
ATOM   4034 C  C   . GLU D 1 38  ? 6.637   22.187  27.186  1.00 25.23  ? 637  GLU D C   1 
ATOM   4035 O  O   . GLU D 1 38  ? 5.991   22.905  27.953  1.00 20.47  ? 637  GLU D O   1 
ATOM   4036 C  CB  . GLU D 1 38  ? 6.163   19.822  26.439  1.00 26.50  ? 637  GLU D CB  1 
ATOM   4037 C  CG  . GLU D 1 38  ? 6.107   19.376  27.889  1.00 34.21  ? 637  GLU D CG  1 
ATOM   4038 C  CD  . GLU D 1 38  ? 6.492   17.922  28.080  1.00 36.06  ? 637  GLU D CD  1 
ATOM   4039 O  OE1 . GLU D 1 38  ? 6.903   17.278  27.092  1.00 33.63  ? 637  GLU D OE1 1 
ATOM   4040 O  OE2 . GLU D 1 38  ? 6.377   17.404  29.213  1.00 53.65  ? 637  GLU D OE2 1 
ATOM   4041 N  N   . THR D 1 39  ? 7.966   22.153  27.199  1.00 31.72  ? 638  THR D N   1 
ATOM   4042 C  CA  . THR D 1 39  ? 8.724   22.994  28.123  1.00 34.19  ? 638  THR D CA  1 
ATOM   4043 C  C   . THR D 1 39  ? 8.311   24.459  27.991  1.00 34.31  ? 638  THR D C   1 
ATOM   4044 O  O   . THR D 1 39  ? 7.979   25.120  28.973  1.00 30.91  ? 638  THR D O   1 
ATOM   4045 C  CB  . THR D 1 39  ? 10.241  22.882  27.893  1.00 33.15  ? 638  THR D CB  1 
ATOM   4046 O  OG1 . THR D 1 39  ? 10.652  21.522  28.072  1.00 37.15  ? 638  THR D OG1 1 
ATOM   4047 C  CG2 . THR D 1 39  ? 10.997  23.716  28.919  1.00 27.92  ? 638  THR D CG2 1 
ATOM   4048 N  N   . LEU D 1 40  ? 8.326   24.929  26.749  1.00 32.44  ? 639  LEU D N   1 
ATOM   4049 C  CA  . LEU D 1 40  ? 7.965   26.303  26.432  1.00 30.51  ? 639  LEU D CA  1 
ATOM   4050 C  C   . LEU D 1 40  ? 6.581   26.668  26.962  1.00 23.64  ? 639  LEU D C   1 
ATOM   4051 O  O   . LEU D 1 40  ? 6.398   27.793  27.437  1.00 13.70  ? 639  LEU D O   1 
ATOM   4052 C  CB  . LEU D 1 40  ? 8.042   26.520  24.918  1.00 23.89  ? 639  LEU D CB  1 
ATOM   4053 C  CG  . LEU D 1 40  ? 9.448   26.652  24.337  1.00 25.48  ? 639  LEU D CG  1 
ATOM   4054 C  CD1 . LEU D 1 40  ? 9.390   26.871  22.833  1.00 35.84  ? 639  LEU D CD1 1 
ATOM   4055 C  CD2 . LEU D 1 40  ? 10.210  27.786  25.007  1.00 25.98  ? 639  LEU D CD2 1 
ATOM   4056 N  N   . GLU D 1 41  ? 5.623   25.750  26.882  1.00 31.25  ? 640  GLU D N   1 
ATOM   4057 C  CA  . GLU D 1 41  ? 4.275   25.990  27.396  1.00 30.82  ? 640  GLU D CA  1 
ATOM   4058 C  C   . GLU D 1 41  ? 4.300   26.197  28.911  1.00 28.84  ? 640  GLU D C   1 
ATOM   4059 O  O   . GLU D 1 41  ? 3.563   27.011  29.466  1.00 15.45  ? 640  GLU D O   1 
ATOM   4060 C  CB  . GLU D 1 41  ? 3.335   24.837  27.047  1.00 33.89  ? 640  GLU D CB  1 
ATOM   4061 C  CG  . GLU D 1 41  ? 2.777   24.094  28.253  1.00 39.13  ? 640  GLU D CG  1 
ATOM   4062 C  CD  . GLU D 1 41  ? 1.395   24.547  28.670  1.00 47.71  ? 640  GLU D CD  1 
ATOM   4063 O  OE1 . GLU D 1 41  ? 0.722   25.251  27.890  1.00 52.72  ? 640  GLU D OE1 1 
ATOM   4064 O  OE2 . GLU D 1 41  ? 0.951   24.203  29.792  1.00 50.54  ? 640  GLU D OE2 1 
ATOM   4065 N  N   . PHE D 1 42  ? 5.174   25.433  29.561  1.00 23.68  ? 641  PHE D N   1 
ATOM   4066 C  CA  . PHE D 1 42  ? 5.337   25.514  31.007  1.00 28.46  ? 641  PHE D CA  1 
ATOM   4067 C  C   . PHE D 1 42  ? 5.610   26.947  31.442  1.00 29.21  ? 641  PHE D C   1 
ATOM   4068 O  O   . PHE D 1 42  ? 4.873   27.532  32.235  1.00 22.64  ? 641  PHE D O   1 
ATOM   4069 C  CB  . PHE D 1 42  ? 6.472   24.591  31.472  1.00 25.78  ? 641  PHE D CB  1 
ATOM   4070 C  CG  . PHE D 1 42  ? 6.463   24.383  32.978  1.00 24.37  ? 641  PHE D CG  1 
ATOM   4071 C  CD1 . PHE D 1 42  ? 5.406   23.732  33.588  1.00 28.40  ? 641  PHE D CD1 1 
ATOM   4072 C  CD2 . PHE D 1 42  ? 7.502   24.844  33.765  1.00 30.32  ? 641  PHE D CD2 1 
ATOM   4073 C  CE1 . PHE D 1 42  ? 5.375   23.538  34.957  1.00 24.35  ? 641  PHE D CE1 1 
ATOM   4074 C  CE2 . PHE D 1 42  ? 7.481   24.657  35.135  1.00 29.26  ? 641  PHE D CE2 1 
ATOM   4075 C  CZ  . PHE D 1 42  ? 6.417   24.006  35.735  1.00 20.11  ? 641  PHE D CZ  1 
ATOM   4076 N  N   . LEU D 1 43  ? 6.687   27.505  30.896  1.00 23.43  ? 642  LEU D N   1 
ATOM   4077 C  CA  . LEU D 1 43  ? 7.047   28.889  31.172  1.00 23.49  ? 642  LEU D CA  1 
ATOM   4078 C  C   . LEU D 1 43  ? 5.944   29.825  30.680  1.00 21.50  ? 642  LEU D C   1 
ATOM   4079 O  O   . LEU D 1 43  ? 5.603   30.765  31.391  1.00 14.84  ? 642  LEU D O   1 
ATOM   4080 C  CB  . LEU D 1 43  ? 8.368   29.249  30.507  1.00 25.59  ? 642  LEU D CB  1 
ATOM   4081 C  CG  . LEU D 1 43  ? 9.336   30.207  31.193  1.00 16.22  ? 642  LEU D CG  1 
ATOM   4082 C  CD1 . LEU D 1 43  ? 10.414  30.626  30.195  1.00 16.30  ? 642  LEU D CD1 1 
ATOM   4083 C  CD2 . LEU D 1 43  ? 8.623   31.413  31.766  1.00 18.45  ? 642  LEU D CD2 1 
ATOM   4084 N  N   . GLY D 1 44  ? 5.409   29.570  29.489  1.00 20.53  ? 643  GLY D N   1 
ATOM   4085 C  CA  . GLY D 1 44  ? 4.439   30.468  28.880  1.00 20.34  ? 643  GLY D CA  1 
ATOM   4086 C  C   . GLY D 1 44  ? 3.235   30.714  29.775  1.00 14.04  ? 643  GLY D C   1 
ATOM   4087 O  O   . GLY D 1 44  ? 2.803   31.846  29.963  1.00 15.80  ? 643  GLY D O   1 
ATOM   4088 N  N   . ASP D 1 45  ? 2.719   29.629  30.327  1.00 15.54  ? 644  ASP D N   1 
ATOM   4089 C  CA  . ASP D 1 45  ? 1.594   29.683  31.259  1.00 15.54  ? 644  ASP D CA  1 
ATOM   4090 C  C   . ASP D 1 45  ? 1.840   30.718  32.343  1.00 7.72   ? 644  ASP D C   1 
ATOM   4091 O  O   . ASP D 1 45  ? 1.043   31.629  32.540  1.00 10.94  ? 644  ASP D O   1 
ATOM   4092 C  CB  . ASP D 1 45  ? 1.382   28.288  31.837  1.00 19.53  ? 644  ASP D CB  1 
ATOM   4093 C  CG  . ASP D 1 45  ? 0.612   28.268  33.141  1.00 18.64  ? 644  ASP D CG  1 
ATOM   4094 O  OD1 . ASP D 1 45  ? -0.238  29.151  33.370  1.00 28.21  ? 644  ASP D OD1 1 
ATOM   4095 O  OD2 . ASP D 1 45  ? 0.879   27.355  33.946  1.00 34.15  ? 644  ASP D OD2 1 
ATOM   4096 N  N   . ALA D 1 46  ? 2.965   30.611  33.040  1.00 17.71  ? 645  ALA D N   1 
ATOM   4097 C  CA  . ALA D 1 46  ? 3.354   31.560  34.074  1.00 16.00  ? 645  ALA D CA  1 
ATOM   4098 C  C   . ALA D 1 46  ? 3.508   32.983  33.552  1.00 23.58  ? 645  ALA D C   1 
ATOM   4099 O  O   . ALA D 1 46  ? 3.134   33.953  34.225  1.00 19.40  ? 645  ALA D O   1 
ATOM   4100 C  CB  . ALA D 1 46  ? 4.667   31.096  34.702  1.00 25.53  ? 645  ALA D CB  1 
ATOM   4101 N  N   . LEU D 1 47  ? 4.072   33.089  32.352  1.00 11.46  ? 646  LEU D N   1 
ATOM   4102 C  CA  . LEU D 1 47  ? 4.316   34.331  31.651  1.00 7.45   ? 646  LEU D CA  1 
ATOM   4103 C  C   . LEU D 1 47  ? 3.039   35.064  31.277  1.00 8.97   ? 646  LEU D C   1 
ATOM   4104 O  O   . LEU D 1 47  ? 2.801   36.228  31.588  1.00 11.49  ? 646  LEU D O   1 
ATOM   4105 C  CB  . LEU D 1 47  ? 5.042   34.044  30.329  1.00 15.92  ? 646  LEU D CB  1 
ATOM   4106 C  CG  . LEU D 1 47  ? 6.196   34.927  29.886  1.00 21.39  ? 646  LEU D CG  1 
ATOM   4107 C  CD1 . LEU D 1 47  ? 6.244   35.011  28.364  1.00 12.10  ? 646  LEU D CD1 1 
ATOM   4108 C  CD2 . LEU D 1 47  ? 6.111   36.313  30.485  1.00 15.69  ? 646  LEU D CD2 1 
ATOM   4109 N  N   . VAL D 1 48  ? 2.209   34.331  30.526  1.00 10.40  ? 647  VAL D N   1 
ATOM   4110 C  CA  . VAL D 1 48  ? 0.997   35.010  30.047  1.00 17.07  ? 647  VAL D CA  1 
ATOM   4111 C  C   . VAL D 1 48  ? 0.077   35.298  31.228  1.00 19.03  ? 647  VAL D C   1 
ATOM   4112 O  O   . VAL D 1 48  ? -0.590  36.328  31.252  1.00 12.42  ? 647  VAL D O   1 
ATOM   4113 C  CB  . VAL D 1 48  ? 0.312   34.173  28.958  1.00 13.77  ? 647  VAL D CB  1 
ATOM   4114 C  CG1 . VAL D 1 48  ? -1.187  34.428  28.922  1.00 20.91  ? 647  VAL D CG1 1 
ATOM   4115 C  CG2 . VAL D 1 48  ? 0.948   34.482  27.607  1.00 30.05  ? 647  VAL D CG2 1 
ATOM   4116 N  N   . ASN D 1 49  ? 0.062   34.411  32.219  1.00 17.93  ? 648  ASN D N   1 
ATOM   4117 C  CA  . ASN D 1 49  ? -0.732  34.660  33.435  1.00 13.47  ? 648  ASN D CA  1 
ATOM   4118 C  C   . ASN D 1 49  ? -0.397  36.015  34.028  1.00 10.12  ? 648  ASN D C   1 
ATOM   4119 O  O   . ASN D 1 49  ? -1.255  36.869  34.275  1.00 7.52   ? 648  ASN D O   1 
ATOM   4120 C  CB  . ASN D 1 49  ? -0.503  33.535  34.436  1.00 13.94  ? 648  ASN D CB  1 
ATOM   4121 C  CG  . ASN D 1 49  ? -1.198  33.741  35.768  1.00 30.75  ? 648  ASN D CG  1 
ATOM   4122 O  OD1 . ASN D 1 49  ? -2.427  33.761  35.871  1.00 29.39  ? 648  ASN D OD1 1 
ATOM   4123 N  ND2 . ASN D 1 49  ? -0.401  33.892  36.824  1.00 29.64  ? 648  ASN D ND2 1 
ATOM   4124 N  N   . PHE D 1 50  ? 0.895   36.264  34.261  1.00 13.00  ? 649  PHE D N   1 
ATOM   4125 C  CA  . PHE D 1 50  ? 1.291   37.577  34.779  1.00 11.48  ? 649  PHE D CA  1 
ATOM   4126 C  C   . PHE D 1 50  ? 0.814   38.713  33.887  1.00 18.22  ? 649  PHE D C   1 
ATOM   4127 O  O   . PHE D 1 50  ? 0.267   39.706  34.393  1.00 15.78  ? 649  PHE D O   1 
ATOM   4128 C  CB  . PHE D 1 50  ? 2.804   37.595  34.987  1.00 13.49  ? 649  PHE D CB  1 
ATOM   4129 C  CG  . PHE D 1 50  ? 3.485   38.941  34.859  1.00 24.03  ? 649  PHE D CG  1 
ATOM   4130 C  CD1 . PHE D 1 50  ? 3.225   39.989  35.727  1.00 22.47  ? 649  PHE D CD1 1 
ATOM   4131 C  CD2 . PHE D 1 50  ? 4.407   39.143  33.843  1.00 24.45  ? 649  PHE D CD2 1 
ATOM   4132 C  CE1 . PHE D 1 50  ? 3.854   41.209  35.588  1.00 16.48  ? 649  PHE D CE1 1 
ATOM   4133 C  CE2 . PHE D 1 50  ? 5.047   40.360  33.700  1.00 22.96  ? 649  PHE D CE2 1 
ATOM   4134 C  CZ  . PHE D 1 50  ? 4.779   41.391  34.573  1.00 14.29  ? 649  PHE D CZ  1 
ATOM   4135 N  N   . PHE D 1 51  ? 1.007   38.617  32.573  1.00 11.13  ? 650  PHE D N   1 
ATOM   4136 C  CA  . PHE D 1 51  ? 0.585   39.699  31.694  1.00 6.83   ? 650  PHE D CA  1 
ATOM   4137 C  C   . PHE D 1 51  ? -0.891  40.054  31.865  1.00 17.65  ? 650  PHE D C   1 
ATOM   4138 O  O   . PHE D 1 51  ? -1.260  41.223  31.771  1.00 13.30  ? 650  PHE D O   1 
ATOM   4139 C  CB  . PHE D 1 51  ? 0.815   39.316  30.229  1.00 13.65  ? 650  PHE D CB  1 
ATOM   4140 C  CG  . PHE D 1 51  ? 2.280   39.227  29.844  1.00 21.04  ? 650  PHE D CG  1 
ATOM   4141 C  CD1 . PHE D 1 51  ? 3.270   39.640  30.723  1.00 23.57  ? 650  PHE D CD1 1 
ATOM   4142 C  CD2 . PHE D 1 51  ? 2.643   38.730  28.601  1.00 30.04  ? 650  PHE D CD2 1 
ATOM   4143 C  CE1 . PHE D 1 51  ? 4.605   39.556  30.365  1.00 24.83  ? 650  PHE D CE1 1 
ATOM   4144 C  CE2 . PHE D 1 51  ? 3.974   38.649  28.235  1.00 29.16  ? 650  PHE D CE2 1 
ATOM   4145 C  CZ  . PHE D 1 51  ? 4.952   39.073  29.117  1.00 26.99  ? 650  PHE D CZ  1 
ATOM   4146 N  N   . ILE D 1 52  ? -1.707  39.031  32.087  1.00 24.16  ? 651  ILE D N   1 
ATOM   4147 C  CA  . ILE D 1 52  ? -3.144  39.157  32.256  1.00 19.13  ? 651  ILE D CA  1 
ATOM   4148 C  C   . ILE D 1 52  ? -3.473  39.657  33.658  1.00 13.92  ? 651  ILE D C   1 
ATOM   4149 O  O   . ILE D 1 52  ? -4.314  40.514  33.879  1.00 17.21  ? 651  ILE D O   1 
ATOM   4150 C  CB  . ILE D 1 52  ? -3.866  37.813  32.053  1.00 11.46  ? 651  ILE D CB  1 
ATOM   4151 C  CG1 . ILE D 1 52  ? -4.082  37.373  30.610  1.00 20.73  ? 651  ILE D CG1 1 
ATOM   4152 C  CG2 . ILE D 1 52  ? -5.209  37.846  32.784  1.00 19.72  ? 651  ILE D CG2 1 
ATOM   4153 C  CD1 . ILE D 1 52  ? -2.835  37.147  29.798  1.00 18.18  ? 651  ILE D CD1 1 
ATOM   4154 N  N   . VAL D 1 53  ? -2.787  39.090  34.653  1.00 23.41  ? 652  VAL D N   1 
ATOM   4155 C  CA  . VAL D 1 53  ? -3.030  39.538  36.020  1.00 20.35  ? 652  VAL D CA  1 
ATOM   4156 C  C   . VAL D 1 53  ? -2.750  41.032  36.141  1.00 25.70  ? 652  VAL D C   1 
ATOM   4157 O  O   . VAL D 1 53  ? -3.521  41.749  36.776  1.00 29.90  ? 652  VAL D O   1 
ATOM   4158 C  CB  . VAL D 1 53  ? -2.183  38.767  37.042  1.00 21.75  ? 652  VAL D CB  1 
ATOM   4159 C  CG1 . VAL D 1 53  ? -2.365  39.346  38.439  1.00 27.52  ? 652  VAL D CG1 1 
ATOM   4160 C  CG2 . VAL D 1 53  ? -2.550  37.290  37.028  1.00 14.75  ? 652  VAL D CG2 1 
ATOM   4161 N  N   . ASP D 1 54  ? -1.658  41.488  35.537  1.00 21.28  ? 653  ASP D N   1 
ATOM   4162 C  CA  . ASP D 1 54  ? -1.258  42.886  35.665  1.00 23.25  ? 653  ASP D CA  1 
ATOM   4163 C  C   . ASP D 1 54  ? -2.288  43.814  35.039  1.00 20.39  ? 653  ASP D C   1 
ATOM   4164 O  O   . ASP D 1 54  ? -2.630  44.872  35.571  1.00 11.84  ? 653  ASP D O   1 
ATOM   4165 C  CB  . ASP D 1 54  ? 0.128   43.079  35.038  1.00 27.92  ? 653  ASP D CB  1 
ATOM   4166 C  CG  . ASP D 1 54  ? 0.806   44.341  35.538  1.00 31.99  ? 653  ASP D CG  1 
ATOM   4167 O  OD1 . ASP D 1 54  ? 0.442   44.797  36.646  1.00 31.60  ? 653  ASP D OD1 1 
ATOM   4168 O  OD2 . ASP D 1 54  ? 1.684   44.870  34.821  1.00 24.83  ? 653  ASP D OD2 1 
ATOM   4169 N  N   . LEU D 1 55  ? -2.820  43.435  33.879  1.00 19.28  ? 654  LEU D N   1 
ATOM   4170 C  CA  . LEU D 1 55  ? -3.864  44.252  33.253  1.00 18.24  ? 654  LEU D CA  1 
ATOM   4171 C  C   . LEU D 1 55  ? -5.066  44.364  34.186  1.00 12.32  ? 654  LEU D C   1 
ATOM   4172 O  O   . LEU D 1 55  ? -5.496  45.455  34.555  1.00 19.25  ? 654  LEU D O   1 
ATOM   4173 C  CB  . LEU D 1 55  ? -4.244  43.644  31.911  1.00 16.56  ? 654  LEU D CB  1 
ATOM   4174 C  CG  . LEU D 1 55  ? -4.105  44.509  30.660  1.00 18.58  ? 654  LEU D CG  1 
ATOM   4175 C  CD1 . LEU D 1 55  ? -2.992  45.534  30.800  1.00 33.64  ? 654  LEU D CD1 1 
ATOM   4176 C  CD2 . LEU D 1 55  ? -3.859  43.636  29.436  1.00 24.99  ? 654  LEU D CD2 1 
ATOM   4177 N  N   . LEU D 1 56  ? -5.608  43.221  34.570  1.00 16.62  ? 655  LEU D N   1 
ATOM   4178 C  CA  . LEU D 1 56  ? -6.741  43.072  35.465  1.00 12.85  ? 655  LEU D CA  1 
ATOM   4179 C  C   . LEU D 1 56  ? -6.695  43.965  36.693  1.00 22.01  ? 655  LEU D C   1 
ATOM   4180 O  O   . LEU D 1 56  ? -7.684  44.596  37.074  1.00 33.92  ? 655  LEU D O   1 
ATOM   4181 C  CB  . LEU D 1 56  ? -6.801  41.620  35.964  1.00 13.29  ? 655  LEU D CB  1 
ATOM   4182 C  CG  . LEU D 1 56  ? -8.133  40.884  35.830  1.00 25.24  ? 655  LEU D CG  1 
ATOM   4183 C  CD1 . LEU D 1 56  ? -8.138  39.644  36.717  1.00 44.32  ? 655  LEU D CD1 1 
ATOM   4184 C  CD2 . LEU D 1 56  ? -9.305  41.789  36.162  1.00 20.61  ? 655  LEU D CD2 1 
ATOM   4185 N  N   . VAL D 1 57  ? -5.552  44.018  37.371  1.00 20.56  ? 656  VAL D N   1 
ATOM   4186 C  CA  . VAL D 1 57  ? -5.497  44.751  38.632  1.00 31.88  ? 656  VAL D CA  1 
ATOM   4187 C  C   . VAL D 1 57  ? -5.654  46.254  38.417  1.00 34.90  ? 656  VAL D C   1 
ATOM   4188 O  O   . VAL D 1 57  ? -6.078  46.962  39.333  1.00 31.80  ? 656  VAL D O   1 
ATOM   4189 C  CB  . VAL D 1 57  ? -4.176  44.462  39.375  1.00 31.69  ? 656  VAL D CB  1 
ATOM   4190 C  CG1 . VAL D 1 57  ? -3.993  45.424  40.538  1.00 31.59  ? 656  VAL D CG1 1 
ATOM   4191 C  CG2 . VAL D 1 57  ? -4.155  43.017  39.850  1.00 25.84  ? 656  VAL D CG2 1 
ATOM   4192 N  N   . GLN D 1 58  ? -5.303  46.690  37.221  1.00 34.05  ? 657  GLN D N   1 
ATOM   4193 C  CA  . GLN D 1 58  ? -5.323  48.045  36.723  1.00 34.59  ? 657  GLN D CA  1 
ATOM   4194 C  C   . GLN D 1 58  ? -6.634  48.430  36.040  1.00 38.18  ? 657  GLN D C   1 
ATOM   4195 O  O   . GLN D 1 58  ? -7.099  49.565  36.184  1.00 38.15  ? 657  GLN D O   1 
ATOM   4196 C  CB  . GLN D 1 58  ? -4.198  48.257  35.697  1.00 38.37  ? 657  GLN D CB  1 
ATOM   4197 C  CG  . GLN D 1 58  ? -2.788  48.242  36.253  1.00 40.35  ? 657  GLN D CG  1 
ATOM   4198 C  CD  . GLN D 1 58  ? -1.761  48.613  35.199  1.00 37.42  ? 657  GLN D CD  1 
ATOM   4199 O  OE1 . GLN D 1 58  ? -1.444  49.789  35.017  1.00 22.63  ? 657  GLN D OE1 1 
ATOM   4200 N  NE2 . GLN D 1 58  ? -1.241  47.607  34.501  1.00 30.41  ? 657  GLN D NE2 1 
ATOM   4201 N  N   . TYR D 1 59  ? -7.238  47.524  35.273  1.00 39.82  ? 658  TYR D N   1 
ATOM   4202 C  CA  . TYR D 1 59  ? -8.425  47.909  34.510  1.00 40.81  ? 658  TYR D CA  1 
ATOM   4203 C  C   . TYR D 1 59  ? -9.688  47.210  34.980  1.00 50.70  ? 658  TYR D C   1 
ATOM   4204 O  O   . TYR D 1 59  ? -10.595 46.942  34.185  1.00 64.93  ? 658  TYR D O   1 
ATOM   4205 C  CB  . TYR D 1 59  ? -8.190  47.637  33.014  1.00 33.85  ? 658  TYR D CB  1 
ATOM   4206 C  CG  . TYR D 1 59  ? -7.074  48.518  32.481  1.00 30.51  ? 658  TYR D CG  1 
ATOM   4207 C  CD1 . TYR D 1 59  ? -7.333  49.787  31.985  1.00 27.54  ? 658  TYR D CD1 1 
ATOM   4208 C  CD2 . TYR D 1 59  ? -5.764  48.063  32.490  1.00 28.21  ? 658  TYR D CD2 1 
ATOM   4209 C  CE1 . TYR D 1 59  ? -6.316  50.591  31.502  1.00 25.74  ? 658  TYR D CE1 1 
ATOM   4210 C  CE2 . TYR D 1 59  ? -4.739  48.859  32.011  1.00 27.17  ? 658  TYR D CE2 1 
ATOM   4211 C  CZ  . TYR D 1 59  ? -5.020  50.116  31.520  1.00 29.78  ? 658  TYR D CZ  1 
ATOM   4212 O  OH  . TYR D 1 59  ? -3.988  50.897  31.045  1.00 49.15  ? 658  TYR D OH  1 
ATOM   4213 N  N   . SER D 1 60  ? -9.760  46.920  36.277  1.00 50.36  ? 659  SER D N   1 
ATOM   4214 C  CA  . SER D 1 60  ? -10.944 46.302  36.857  1.00 46.81  ? 659  SER D CA  1 
ATOM   4215 C  C   . SER D 1 60  ? -11.605 47.240  37.868  1.00 51.30  ? 659  SER D C   1 
ATOM   4216 O  O   . SER D 1 60  ? -10.897 47.803  38.702  1.00 38.46  ? 659  SER D O   1 
ATOM   4217 C  CB  . SER D 1 60  ? -10.603 44.977  37.534  1.00 37.09  ? 659  SER D CB  1 
ATOM   4218 O  OG  . SER D 1 60  ? -11.654 44.568  38.393  1.00 32.55  ? 659  SER D OG  1 
ATOM   4219 N  N   . PRO D 1 61  ? -12.922 47.385  37.775  1.00 54.70  ? 660  PRO D N   1 
ATOM   4220 C  CA  . PRO D 1 61  ? -13.683 48.196  38.731  1.00 51.11  ? 660  PRO D CA  1 
ATOM   4221 C  C   . PRO D 1 61  ? -13.277 47.888  40.168  1.00 47.91  ? 660  PRO D C   1 
ATOM   4222 O  O   . PRO D 1 61  ? -12.681 48.718  40.854  1.00 54.21  ? 660  PRO D O   1 
ATOM   4223 C  CB  . PRO D 1 61  ? -15.124 47.740  38.493  1.00 51.62  ? 660  PRO D CB  1 
ATOM   4224 C  CG  . PRO D 1 61  ? -15.151 47.327  37.061  1.00 53.42  ? 660  PRO D CG  1 
ATOM   4225 C  CD  . PRO D 1 61  ? -13.787 46.784  36.747  1.00 52.15  ? 660  PRO D CD  1 
ATOM   4226 N  N   . ASN D 1 62  ? -13.596 46.673  40.605  1.00 42.94  ? 661  ASN D N   1 
ATOM   4227 C  CA  . ASN D 1 62  ? -13.229 46.232  41.941  1.00 40.84  ? 661  ASN D CA  1 
ATOM   4228 C  C   . ASN D 1 62  ? -11.845 45.580  41.932  1.00 38.49  ? 661  ASN D C   1 
ATOM   4229 O  O   . ASN D 1 62  ? -11.540 44.804  41.024  1.00 37.36  ? 661  ASN D O   1 
ATOM   4230 C  CB  . ASN D 1 62  ? -14.245 45.243  42.512  1.00 44.01  ? 661  ASN D CB  1 
ATOM   4231 C  CG  . ASN D 1 62  ? -13.849 44.747  43.890  1.00 42.88  ? 661  ASN D CG  1 
ATOM   4232 O  OD1 . ASN D 1 62  ? -14.018 45.448  44.889  1.00 66.15  ? 661  ASN D OD1 1 
ATOM   4233 N  ND2 . ASN D 1 62  ? -13.318 43.534  43.964  1.00 24.56  ? 661  ASN D ND2 1 
ATOM   4234 N  N   . LYS D 1 63  ? -11.074 45.924  42.950  1.00 34.63  ? 662  LYS D N   1 
ATOM   4235 C  CA  . LYS D 1 63  ? -9.710  45.480  43.163  1.00 34.53  ? 662  LYS D CA  1 
ATOM   4236 C  C   . LYS D 1 63  ? -9.604  44.396  44.232  1.00 31.28  ? 662  LYS D C   1 
ATOM   4237 O  O   . LYS D 1 63  ? -8.508  44.148  44.741  1.00 29.54  ? 662  LYS D O   1 
ATOM   4238 C  CB  . LYS D 1 63  ? -8.839  46.678  43.560  1.00 35.85  ? 662  LYS D CB  1 
ATOM   4239 C  CG  . LYS D 1 63  ? -8.208  47.424  42.402  1.00 42.96  ? 662  LYS D CG  1 
ATOM   4240 C  CD  . LYS D 1 63  ? -9.204  47.706  41.288  1.00 43.56  ? 662  LYS D CD  1 
ATOM   4241 C  CE  . LYS D 1 63  ? -8.477  48.214  40.048  1.00 45.41  ? 662  LYS D CE  1 
ATOM   4242 N  NZ  . LYS D 1 63  ? -7.206  48.906  40.410  1.00 44.03  ? 662  LYS D NZ  1 
ATOM   4243 N  N   . ARG D 1 64  ? -10.705 43.740  44.587  1.00 33.19  ? 663  ARG D N   1 
ATOM   4244 C  CA  . ARG D 1 64  ? -10.705 42.704  45.618  1.00 29.95  ? 663  ARG D CA  1 
ATOM   4245 C  C   . ARG D 1 64  ? -10.657 41.309  45.005  1.00 38.45  ? 663  ARG D C   1 
ATOM   4246 O  O   . ARG D 1 64  ? -11.304 41.059  43.988  1.00 63.69  ? 663  ARG D O   1 
ATOM   4247 C  CB  . ARG D 1 64  ? -11.926 42.856  46.531  1.00 35.74  ? 663  ARG D CB  1 
ATOM   4248 C  CG  . ARG D 1 64  ? -12.285 44.309  46.797  1.00 42.67  ? 663  ARG D CG  1 
ATOM   4249 C  CD  . ARG D 1 64  ? -12.823 44.540  48.201  1.00 48.52  ? 663  ARG D CD  1 
ATOM   4250 N  NE  . ARG D 1 64  ? -12.683 45.913  48.652  1.00 52.27  ? 663  ARG D NE  1 
ATOM   4251 C  CZ  . ARG D 1 64  ? -13.216 47.011  48.151  1.00 51.47  ? 663  ARG D CZ  1 
ATOM   4252 N  NH1 . ARG D 1 64  ? -14.010 46.977  47.086  1.00 41.16  ? 663  ARG D NH1 1 
ATOM   4253 N  NH2 . ARG D 1 64  ? -12.956 48.184  48.728  1.00 50.56  ? 663  ARG D NH2 1 
ATOM   4254 N  N   . GLU D 1 65  ? -9.887  40.432  45.633  1.00 41.95  ? 664  GLU D N   1 
ATOM   4255 C  CA  . GLU D 1 65  ? -9.596  39.079  45.209  1.00 38.72  ? 664  GLU D CA  1 
ATOM   4256 C  C   . GLU D 1 65  ? -10.830 38.337  44.697  1.00 40.73  ? 664  GLU D C   1 
ATOM   4257 O  O   . GLU D 1 65  ? -10.719 37.528  43.770  1.00 28.40  ? 664  GLU D O   1 
ATOM   4258 C  CB  . GLU D 1 65  ? -8.993  38.262  46.362  1.00 37.32  ? 664  GLU D CB  1 
ATOM   4259 C  CG  . GLU D 1 65  ? -7.636  37.652  46.026  1.00 44.21  ? 664  GLU D CG  1 
ATOM   4260 C  CD  . GLU D 1 65  ? -6.558  38.725  45.987  1.00 48.82  ? 664  GLU D CD  1 
ATOM   4261 O  OE1 . GLU D 1 65  ? -6.652  39.593  45.094  1.00 57.90  ? 664  GLU D OE1 1 
ATOM   4262 O  OE2 . GLU D 1 65  ? -5.645  38.706  46.841  1.00 28.75  ? 664  GLU D OE2 1 
ATOM   4263 N  N   . GLY D 1 66  ? -11.957 38.627  45.331  1.00 40.16  ? 665  GLY D N   1 
ATOM   4264 C  CA  . GLY D 1 66  ? -13.228 37.980  45.088  1.00 34.42  ? 665  GLY D CA  1 
ATOM   4265 C  C   . GLY D 1 66  ? -13.824 38.354  43.747  1.00 26.32  ? 665  GLY D C   1 
ATOM   4266 O  O   . GLY D 1 66  ? -14.215 37.464  42.986  1.00 27.98  ? 665  GLY D O   1 
ATOM   4267 N  N   . PHE D 1 67  ? -13.888 39.653  43.457  1.00 23.34  ? 666  PHE D N   1 
ATOM   4268 C  CA  . PHE D 1 67  ? -14.358 40.082  42.133  1.00 30.33  ? 666  PHE D CA  1 
ATOM   4269 C  C   . PHE D 1 67  ? -13.336 39.657  41.076  1.00 37.99  ? 666  PHE D C   1 
ATOM   4270 O  O   . PHE D 1 67  ? -13.722 39.129  40.034  1.00 57.67  ? 666  PHE D O   1 
ATOM   4271 C  CB  . PHE D 1 67  ? -14.603 41.575  42.103  1.00 35.54  ? 666  PHE D CB  1 
ATOM   4272 C  CG  . PHE D 1 67  ? -14.891 42.265  40.788  1.00 45.63  ? 666  PHE D CG  1 
ATOM   4273 C  CD1 . PHE D 1 67  ? -13.871 42.712  39.963  1.00 41.21  ? 666  PHE D CD1 1 
ATOM   4274 C  CD2 . PHE D 1 67  ? -16.198 42.474  40.374  1.00 51.98  ? 666  PHE D CD2 1 
ATOM   4275 C  CE1 . PHE D 1 67  ? -14.142 43.341  38.766  1.00 42.03  ? 666  PHE D CE1 1 
ATOM   4276 C  CE2 . PHE D 1 67  ? -16.481 43.096  39.173  1.00 48.85  ? 666  PHE D CE2 1 
ATOM   4277 C  CZ  . PHE D 1 67  ? -15.451 43.532  38.367  1.00 48.43  ? 666  PHE D CZ  1 
ATOM   4278 N  N   . LEU D 1 68  ? -12.069 39.898  41.375  1.00 35.36  ? 667  LEU D N   1 
ATOM   4279 C  CA  . LEU D 1 68  ? -10.936 39.660  40.502  1.00 37.91  ? 667  LEU D CA  1 
ATOM   4280 C  C   . LEU D 1 68  ? -10.769 38.212  40.058  1.00 35.85  ? 667  LEU D C   1 
ATOM   4281 O  O   . LEU D 1 68  ? -10.541 37.950  38.872  1.00 48.17  ? 667  LEU D O   1 
ATOM   4282 C  CB  . LEU D 1 68  ? -9.649  40.111  41.211  1.00 37.92  ? 667  LEU D CB  1 
ATOM   4283 C  CG  . LEU D 1 68  ? -9.524  41.605  41.504  1.00 37.47  ? 667  LEU D CG  1 
ATOM   4284 C  CD1 . LEU D 1 68  ? -8.061  41.994  41.650  1.00 36.71  ? 667  LEU D CD1 1 
ATOM   4285 C  CD2 . LEU D 1 68  ? -10.202 42.425  40.417  1.00 47.29  ? 667  LEU D CD2 1 
ATOM   4286 N  N   . SER D 1 69  ? -10.854 37.245  40.962  1.00 38.96  ? 668  SER D N   1 
ATOM   4287 C  CA  . SER D 1 69  ? -10.600 35.858  40.571  1.00 46.04  ? 668  SER D CA  1 
ATOM   4288 C  C   . SER D 1 69  ? -11.499 35.368  39.440  1.00 43.71  ? 668  SER D C   1 
ATOM   4289 O  O   . SER D 1 69  ? -10.962 34.843  38.449  1.00 29.29  ? 668  SER D O   1 
ATOM   4290 C  CB  . SER D 1 69  ? -10.732 34.934  41.789  1.00 48.55  ? 668  SER D CB  1 
ATOM   4291 O  OG  . SER D 1 69  ? -9.632  35.090  42.666  1.00 45.73  ? 668  SER D OG  1 
ATOM   4292 N  N   . PRO D 1 70  ? -12.815 35.494  39.539  1.00 43.78  ? 669  PRO D N   1 
ATOM   4293 C  CA  . PRO D 1 70  ? -13.699 35.008  38.470  1.00 45.06  ? 669  PRO D CA  1 
ATOM   4294 C  C   . PRO D 1 70  ? -13.303 35.543  37.096  1.00 36.92  ? 669  PRO D C   1 
ATOM   4295 O  O   . PRO D 1 70  ? -13.169 34.752  36.162  1.00 33.39  ? 669  PRO D O   1 
ATOM   4296 C  CB  . PRO D 1 70  ? -15.089 35.529  38.848  1.00 41.44  ? 669  PRO D CB  1 
ATOM   4297 C  CG  . PRO D 1 70  ? -14.894 36.461  39.989  1.00 40.11  ? 669  PRO D CG  1 
ATOM   4298 C  CD  . PRO D 1 70  ? -13.600 36.079  40.638  1.00 44.32  ? 669  PRO D CD  1 
ATOM   4299 N  N   . LEU D 1 71  ? -13.125 36.850  36.944  1.00 30.14  ? 670  LEU D N   1 
ATOM   4300 C  CA  . LEU D 1 71  ? -12.705 37.393  35.652  1.00 33.79  ? 670  LEU D CA  1 
ATOM   4301 C  C   . LEU D 1 71  ? -11.407 36.717  35.206  1.00 36.44  ? 670  LEU D C   1 
ATOM   4302 O  O   . LEU D 1 71  ? -11.324 36.192  34.099  1.00 35.11  ? 670  LEU D O   1 
ATOM   4303 C  CB  . LEU D 1 71  ? -12.511 38.903  35.727  1.00 35.20  ? 670  LEU D CB  1 
ATOM   4304 C  CG  . LEU D 1 71  ? -13.448 39.775  34.898  1.00 43.26  ? 670  LEU D CG  1 
ATOM   4305 C  CD1 . LEU D 1 71  ? -14.778 39.983  35.609  1.00 43.22  ? 670  LEU D CD1 1 
ATOM   4306 C  CD2 . LEU D 1 71  ? -12.792 41.114  34.587  1.00 62.12  ? 670  LEU D CD2 1 
ATOM   4307 N  N   . LYS D 1 72  ? -10.447 36.760  36.119  1.00 34.82  ? 671  LYS D N   1 
ATOM   4308 C  CA  . LYS D 1 72  ? -9.158  36.102  36.011  1.00 32.91  ? 671  LYS D CA  1 
ATOM   4309 C  C   . LYS D 1 72  ? -9.327  34.721  35.386  1.00 31.29  ? 671  LYS D C   1 
ATOM   4310 O  O   . LYS D 1 72  ? -8.740  34.404  34.360  1.00 20.79  ? 671  LYS D O   1 
ATOM   4311 C  CB  . LYS D 1 72  ? -8.498  35.967  37.387  1.00 30.24  ? 671  LYS D CB  1 
ATOM   4312 C  CG  . LYS D 1 72  ? -7.254  35.091  37.381  1.00 36.34  ? 671  LYS D CG  1 
ATOM   4313 C  CD  . LYS D 1 72  ? -6.889  34.609  38.773  1.00 35.42  ? 671  LYS D CD  1 
ATOM   4314 C  CE  . LYS D 1 72  ? -5.378  34.618  38.975  1.00 30.80  ? 671  LYS D CE  1 
ATOM   4315 N  NZ  . LYS D 1 72  ? -4.689  33.665  38.064  1.00 24.37  ? 671  LYS D NZ  1 
ATOM   4316 N  N   . ALA D 1 73  ? -10.167 33.930  36.052  1.00 33.62  ? 672  ALA D N   1 
ATOM   4317 C  CA  . ALA D 1 73  ? -10.493 32.593  35.582  1.00 27.23  ? 672  ALA D CA  1 
ATOM   4318 C  C   . ALA D 1 73  ? -10.863 32.600  34.103  1.00 24.63  ? 672  ALA D C   1 
ATOM   4319 O  O   . ALA D 1 73  ? -10.509 31.665  33.381  1.00 29.49  ? 672  ALA D O   1 
ATOM   4320 C  CB  . ALA D 1 73  ? -11.630 31.996  36.400  1.00 48.72  ? 672  ALA D CB  1 
ATOM   4321 N  N   . TYR D 1 74  ? -11.565 33.642  33.660  1.00 25.73  ? 673  TYR D N   1 
ATOM   4322 C  CA  . TYR D 1 74  ? -11.996 33.655  32.249  1.00 35.23  ? 673  TYR D CA  1 
ATOM   4323 C  C   . TYR D 1 74  ? -10.790 33.969  31.330  1.00 34.13  ? 673  TYR D C   1 
ATOM   4324 O  O   . TYR D 1 74  ? -10.476 33.151  30.464  1.00 45.35  ? 673  TYR D O   1 
ATOM   4325 C  CB  . TYR D 1 74  ? -13.046 34.766  32.025  1.00 42.43  ? 673  TYR D CB  1 
ATOM   4326 C  CG  . TYR D 1 74  ? -13.389 34.906  30.552  1.00 42.76  ? 673  TYR D CG  1 
ATOM   4327 C  CD1 . TYR D 1 74  ? -14.031 33.870  29.881  1.00 40.79  ? 673  TYR D CD1 1 
ATOM   4328 C  CD2 . TYR D 1 74  ? -13.071 36.055  29.840  1.00 38.91  ? 673  TYR D CD2 1 
ATOM   4329 C  CE1 . TYR D 1 74  ? -14.352 33.973  28.540  1.00 36.56  ? 673  TYR D CE1 1 
ATOM   4330 C  CE2 . TYR D 1 74  ? -13.388 36.167  28.498  1.00 39.21  ? 673  TYR D CE2 1 
ATOM   4331 C  CZ  . TYR D 1 74  ? -14.027 35.125  27.860  1.00 37.03  ? 673  TYR D CZ  1 
ATOM   4332 O  OH  . TYR D 1 74  ? -14.345 35.224  26.527  1.00 47.51  ? 673  TYR D OH  1 
ATOM   4333 N  N   . LEU D 1 75  ? -10.159 35.112  31.521  1.00 32.46  ? 674  LEU D N   1 
ATOM   4334 C  CA  . LEU D 1 75  ? -9.113  35.655  30.647  1.00 35.38  ? 674  LEU D CA  1 
ATOM   4335 C  C   . LEU D 1 75  ? -7.866  34.755  30.594  1.00 34.74  ? 674  LEU D C   1 
ATOM   4336 O  O   . LEU D 1 75  ? -6.937  35.090  29.848  1.00 27.89  ? 674  LEU D O   1 
ATOM   4337 C  CB  . LEU D 1 75  ? -8.672  37.027  31.217  1.00 37.39  ? 674  LEU D CB  1 
ATOM   4338 C  CG  . LEU D 1 75  ? -9.776  38.037  31.519  1.00 32.86  ? 674  LEU D CG  1 
ATOM   4339 C  CD1 . LEU D 1 75  ? -9.266  39.083  32.502  1.00 43.05  ? 674  LEU D CD1 1 
ATOM   4340 C  CD2 . LEU D 1 75  ? -10.292 38.706  30.255  1.00 26.66  ? 674  LEU D CD2 1 
ATOM   4341 N  N   . ILE D 1 76  ? -7.814  33.633  31.307  1.00 33.02  ? 675  ILE D N   1 
ATOM   4342 C  CA  . ILE D 1 76  ? -6.724  32.684  31.098  1.00 32.67  ? 675  ILE D CA  1 
ATOM   4343 C  C   . ILE D 1 76  ? -7.289  31.311  30.735  1.00 37.63  ? 675  ILE D C   1 
ATOM   4344 O  O   . ILE D 1 76  ? -6.632  30.290  30.943  1.00 52.17  ? 675  ILE D O   1 
ATOM   4345 C  CB  . ILE D 1 76  ? -5.791  32.536  32.312  1.00 32.45  ? 675  ILE D CB  1 
ATOM   4346 C  CG1 . ILE D 1 76  ? -6.310  31.588  33.389  1.00 38.02  ? 675  ILE D CG1 1 
ATOM   4347 C  CG2 . ILE D 1 76  ? -5.449  33.903  32.898  1.00 27.91  ? 675  ILE D CG2 1 
ATOM   4348 C  CD1 . ILE D 1 76  ? -5.525  31.616  34.685  1.00 26.63  ? 675  ILE D CD1 1 
ATOM   4349 N  N   . SER D 1 77  ? -8.507  31.297  30.190  1.00 30.28  ? 676  SER D N   1 
ATOM   4350 C  CA  . SER D 1 77  ? -9.116  30.022  29.824  1.00 28.43  ? 676  SER D CA  1 
ATOM   4351 C  C   . SER D 1 77  ? -8.627  29.549  28.454  1.00 30.95  ? 676  SER D C   1 
ATOM   4352 O  O   . SER D 1 77  ? -7.946  30.280  27.740  1.00 36.30  ? 676  SER D O   1 
ATOM   4353 C  CB  . SER D 1 77  ? -10.641 30.098  29.806  1.00 12.15  ? 676  SER D CB  1 
ATOM   4354 O  OG  . SER D 1 77  ? -11.115 31.086  28.908  1.00 23.72  ? 676  SER D OG  1 
ATOM   4355 N  N   . GLU D 1 78  ? -9.005  28.322  28.127  1.00 30.36  ? 677  GLU D N   1 
ATOM   4356 C  CA  . GLU D 1 78  ? -8.811  27.734  26.807  1.00 25.19  ? 677  GLU D CA  1 
ATOM   4357 C  C   . GLU D 1 78  ? -9.619  28.537  25.793  1.00 16.94  ? 677  GLU D C   1 
ATOM   4358 O  O   . GLU D 1 78  ? -9.188  28.878  24.700  1.00 34.37  ? 677  GLU D O   1 
ATOM   4359 C  CB  . GLU D 1 78  ? -9.237  26.273  26.822  1.00 30.51  ? 677  GLU D CB  1 
ATOM   4360 C  CG  . GLU D 1 78  ? -8.608  25.371  25.777  1.00 37.96  ? 677  GLU D CG  1 
ATOM   4361 C  CD  . GLU D 1 78  ? -9.495  24.193  25.414  1.00 39.53  ? 677  GLU D CD  1 
ATOM   4362 O  OE1 . GLU D 1 78  ? -10.456 24.393  24.640  1.00 33.20  ? 677  GLU D OE1 1 
ATOM   4363 O  OE2 . GLU D 1 78  ? -9.242  23.069  25.899  1.00 31.49  ? 677  GLU D OE2 1 
ATOM   4364 N  N   . GLU D 1 79  ? -10.840 28.860  26.195  1.00 21.69  ? 678  GLU D N   1 
ATOM   4365 C  CA  . GLU D 1 79  ? -11.774 29.661  25.424  1.00 29.74  ? 678  GLU D CA  1 
ATOM   4366 C  C   . GLU D 1 79  ? -11.208 31.020  25.031  1.00 31.82  ? 678  GLU D C   1 
ATOM   4367 O  O   . GLU D 1 79  ? -11.130 31.350  23.845  1.00 46.17  ? 678  GLU D O   1 
ATOM   4368 C  CB  . GLU D 1 79  ? -13.046 29.834  26.260  1.00 36.97  ? 678  GLU D CB  1 
ATOM   4369 C  CG  . GLU D 1 79  ? -14.298 30.169  25.468  1.00 40.84  ? 678  GLU D CG  1 
ATOM   4370 C  CD  . GLU D 1 79  ? -15.507 30.189  26.390  1.00 48.60  ? 678  GLU D CD  1 
ATOM   4371 O  OE1 . GLU D 1 79  ? -15.832 29.105  26.920  1.00 61.44  ? 678  GLU D OE1 1 
ATOM   4372 O  OE2 . GLU D 1 79  ? -16.101 31.269  26.578  1.00 42.85  ? 678  GLU D OE2 1 
ATOM   4373 N  N   . PHE D 1 80  ? -10.806 31.834  26.000  1.00 31.82  ? 679  PHE D N   1 
ATOM   4374 C  CA  . PHE D 1 80  ? -10.214 33.139  25.745  1.00 27.19  ? 679  PHE D CA  1 
ATOM   4375 C  C   . PHE D 1 80  ? -8.846  33.010  25.083  1.00 26.66  ? 679  PHE D C   1 
ATOM   4376 O  O   . PHE D 1 80  ? -8.464  33.840  24.250  1.00 29.82  ? 679  PHE D O   1 
ATOM   4377 C  CB  . PHE D 1 80  ? -10.089 33.947  27.043  1.00 25.22  ? 679  PHE D CB  1 
ATOM   4378 C  CG  . PHE D 1 80  ? -9.721  35.405  26.819  1.00 21.31  ? 679  PHE D CG  1 
ATOM   4379 C  CD1 . PHE D 1 80  ? -10.627 36.295  26.273  1.00 22.13  ? 679  PHE D CD1 1 
ATOM   4380 C  CD2 . PHE D 1 80  ? -8.462  35.876  27.152  1.00 20.77  ? 679  PHE D CD2 1 
ATOM   4381 C  CE1 . PHE D 1 80  ? -10.291 37.620  26.059  1.00 16.21  ? 679  PHE D CE1 1 
ATOM   4382 C  CE2 . PHE D 1 80  ? -8.119  37.201  26.948  1.00 19.07  ? 679  PHE D CE2 1 
ATOM   4383 C  CZ  . PHE D 1 80  ? -9.036  38.082  26.408  1.00 13.99  ? 679  PHE D CZ  1 
ATOM   4384 N  N   . PHE D 1 81  ? -8.082  31.980  25.440  1.00 20.15  ? 680  PHE D N   1 
ATOM   4385 C  CA  . PHE D 1 81  ? -6.777  31.798  24.796  1.00 24.65  ? 680  PHE D CA  1 
ATOM   4386 C  C   . PHE D 1 81  ? -6.947  31.564  23.298  1.00 32.70  ? 680  PHE D C   1 
ATOM   4387 O  O   . PHE D 1 81  ? -6.274  32.196  22.481  1.00 31.06  ? 680  PHE D O   1 
ATOM   4388 C  CB  . PHE D 1 81  ? -6.002  30.645  25.434  1.00 19.91  ? 680  PHE D CB  1 
ATOM   4389 C  CG  . PHE D 1 81  ? -5.080  31.099  26.555  1.00 15.82  ? 680  PHE D CG  1 
ATOM   4390 C  CD1 . PHE D 1 81  ? -5.034  32.430  26.925  1.00 24.16  ? 680  PHE D CD1 1 
ATOM   4391 C  CD2 . PHE D 1 81  ? -4.277  30.197  27.226  1.00 19.14  ? 680  PHE D CD2 1 
ATOM   4392 C  CE1 . PHE D 1 81  ? -4.195  32.858  27.938  1.00 23.76  ? 680  PHE D CE1 1 
ATOM   4393 C  CE2 . PHE D 1 81  ? -3.436  30.616  28.239  1.00 11.06  ? 680  PHE D CE2 1 
ATOM   4394 C  CZ  . PHE D 1 81  ? -3.398  31.947  28.604  1.00 10.57  ? 680  PHE D CZ  1 
ATOM   4395 N  N   . ASN D 1 82  ? -7.855  30.658  22.943  1.00 29.11  ? 681  ASN D N   1 
ATOM   4396 C  CA  . ASN D 1 82  ? -8.148  30.383  21.541  1.00 40.67  ? 681  ASN D CA  1 
ATOM   4397 C  C   . ASN D 1 82  ? -8.620  31.654  20.836  1.00 49.91  ? 681  ASN D C   1 
ATOM   4398 O  O   . ASN D 1 82  ? -8.319  31.895  19.668  1.00 44.80  ? 681  ASN D O   1 
ATOM   4399 C  CB  . ASN D 1 82  ? -9.202  29.286  21.420  1.00 41.12  ? 681  ASN D CB  1 
ATOM   4400 C  CG  . ASN D 1 82  ? -8.614  27.936  21.063  1.00 41.42  ? 681  ASN D CG  1 
ATOM   4401 O  OD1 . ASN D 1 82  ? -8.725  27.497  19.916  1.00 40.27  ? 681  ASN D OD1 1 
ATOM   4402 N  ND2 . ASN D 1 82  ? -7.997  27.285  22.044  1.00 19.74  ? 681  ASN D ND2 1 
ATOM   4403 N  N   . LEU D 1 83  ? -9.370  32.455  21.590  1.00 44.85  ? 682  LEU D N   1 
ATOM   4404 C  CA  . LEU D 1 83  ? -9.872  33.734  21.114  1.00 39.16  ? 682  LEU D CA  1 
ATOM   4405 C  C   . LEU D 1 83  ? -8.729  34.666  20.746  1.00 37.92  ? 682  LEU D C   1 
ATOM   4406 O  O   . LEU D 1 83  ? -8.904  35.587  19.947  1.00 51.31  ? 682  LEU D O   1 
ATOM   4407 C  CB  . LEU D 1 83  ? -10.756 34.401  22.173  1.00 39.57  ? 682  LEU D CB  1 
ATOM   4408 C  CG  . LEU D 1 83  ? -11.823 35.369  21.656  1.00 42.21  ? 682  LEU D CG  1 
ATOM   4409 C  CD1 . LEU D 1 83  ? -12.426 34.861  20.356  1.00 14.39  ? 682  LEU D CD1 1 
ATOM   4410 C  CD2 . LEU D 1 83  ? -12.919 35.587  22.692  1.00 47.99  ? 682  LEU D CD2 1 
ATOM   4411 N  N   . LEU D 1 84  ? -7.548  34.443  21.333  1.00 24.90  ? 683  LEU D N   1 
ATOM   4412 C  CA  . LEU D 1 84  ? -6.453  35.342  20.958  1.00 34.01  ? 683  LEU D CA  1 
ATOM   4413 C  C   . LEU D 1 84  ? -5.608  34.702  19.860  1.00 34.56  ? 683  LEU D C   1 
ATOM   4414 O  O   . LEU D 1 84  ? -4.985  35.366  19.033  1.00 37.17  ? 683  LEU D O   1 
ATOM   4415 C  CB  . LEU D 1 84  ? -5.598  35.698  22.167  1.00 38.99  ? 683  LEU D CB  1 
ATOM   4416 C  CG  . LEU D 1 84  ? -6.331  36.312  23.361  1.00 43.16  ? 683  LEU D CG  1 
ATOM   4417 C  CD1 . LEU D 1 84  ? -5.333  36.735  24.431  1.00 48.24  ? 683  LEU D CD1 1 
ATOM   4418 C  CD2 . LEU D 1 84  ? -7.198  37.481  22.921  1.00 29.97  ? 683  LEU D CD2 1 
ATOM   4419 N  N   . ALA D 1 85  ? -5.593  33.371  19.845  1.00 32.96  ? 684  ALA D N   1 
ATOM   4420 C  CA  . ALA D 1 85  ? -4.805  32.689  18.819  1.00 33.26  ? 684  ALA D CA  1 
ATOM   4421 C  C   . ALA D 1 85  ? -5.330  33.006  17.425  1.00 32.26  ? 684  ALA D C   1 
ATOM   4422 O  O   . ALA D 1 85  ? -4.538  33.273  16.520  1.00 33.41  ? 684  ALA D O   1 
ATOM   4423 C  CB  . ALA D 1 85  ? -4.793  31.196  19.083  1.00 26.25  ? 684  ALA D CB  1 
ATOM   4424 N  N   . GLN D 1 86  ? -6.647  32.981  17.251  1.00 35.57  ? 685  GLN D N   1 
ATOM   4425 C  CA  . GLN D 1 86  ? -7.242  33.248  15.944  1.00 31.71  ? 685  GLN D CA  1 
ATOM   4426 C  C   . GLN D 1 86  ? -6.740  34.586  15.413  1.00 28.44  ? 685  GLN D C   1 
ATOM   4427 O  O   . GLN D 1 86  ? -6.550  34.747  14.208  1.00 65.78  ? 685  GLN D O   1 
ATOM   4428 C  CB  . GLN D 1 86  ? -8.766  33.244  15.988  1.00 40.72  ? 685  GLN D CB  1 
ATOM   4429 C  CG  . GLN D 1 86  ? -9.397  32.534  17.170  1.00 42.37  ? 685  GLN D CG  1 
ATOM   4430 C  CD  . GLN D 1 86  ? -9.810  31.111  16.858  1.00 45.35  ? 685  GLN D CD  1 
ATOM   4431 O  OE1 . GLN D 1 86  ? -9.044  30.353  16.257  1.00 66.27  ? 685  GLN D OE1 1 
ATOM   4432 N  NE2 . GLN D 1 86  ? -11.018 30.731  17.257  1.00 36.14  ? 685  GLN D NE2 1 
ATOM   4433 N  N   . LYS D 1 87  ? -6.514  35.531  16.322  1.00 28.68  ? 686  LYS D N   1 
ATOM   4434 C  CA  . LYS D 1 87  ? -5.933  36.812  15.938  1.00 26.93  ? 686  LYS D CA  1 
ATOM   4435 C  C   . LYS D 1 87  ? -4.604  36.577  15.223  1.00 30.48  ? 686  LYS D C   1 
ATOM   4436 O  O   . LYS D 1 87  ? -4.245  37.330  14.320  1.00 36.01  ? 686  LYS D O   1 
ATOM   4437 C  CB  . LYS D 1 87  ? -5.710  37.721  17.142  1.00 37.25  ? 686  LYS D CB  1 
ATOM   4438 C  CG  . LYS D 1 87  ? -6.960  38.386  17.689  1.00 40.01  ? 686  LYS D CG  1 
ATOM   4439 C  CD  . LYS D 1 87  ? -6.638  39.499  18.674  1.00 33.61  ? 686  LYS D CD  1 
ATOM   4440 C  CE  . LYS D 1 87  ? -7.729  40.561  18.670  1.00 39.12  ? 686  LYS D CE  1 
ATOM   4441 N  NZ  . LYS D 1 87  ? -9.052  39.986  18.299  1.00 38.24  ? 686  LYS D NZ  1 
ATOM   4442 N  N   . LEU D 1 88  ? -3.902  35.525  15.646  1.00 22.10  ? 687  LEU D N   1 
ATOM   4443 C  CA  . LEU D 1 88  ? -2.620  35.165  15.069  1.00 29.57  ? 687  LEU D CA  1 
ATOM   4444 C  C   . LEU D 1 88  ? -2.738  34.088  13.992  1.00 39.34  ? 687  LEU D C   1 
ATOM   4445 O  O   . LEU D 1 88  ? -1.800  33.886  13.219  1.00 39.04  ? 687  LEU D O   1 
ATOM   4446 C  CB  . LEU D 1 88  ? -1.677  34.656  16.167  1.00 25.81  ? 687  LEU D CB  1 
ATOM   4447 C  CG  . LEU D 1 88  ? -1.374  35.649  17.289  1.00 28.96  ? 687  LEU D CG  1 
ATOM   4448 C  CD1 . LEU D 1 88  ? -0.503  34.991  18.348  1.00 10.70  ? 687  LEU D CD1 1 
ATOM   4449 C  CD2 . LEU D 1 88  ? -0.728  36.909  16.723  1.00 26.71  ? 687  LEU D CD2 1 
ATOM   4450 N  N   . GLU D 1 89  ? -3.871  33.400  13.970  1.00 43.10  ? 688  GLU D N   1 
ATOM   4451 C  CA  . GLU D 1 89  ? -4.109  32.283  13.062  1.00 43.13  ? 688  GLU D CA  1 
ATOM   4452 C  C   . GLU D 1 89  ? -3.195  31.106  13.392  1.00 35.57  ? 688  GLU D C   1 
ATOM   4453 O  O   . GLU D 1 89  ? -2.757  30.365  12.507  1.00 43.55  ? 688  GLU D O   1 
ATOM   4454 C  CB  . GLU D 1 89  ? -3.915  32.736  11.612  1.00 44.66  ? 688  GLU D CB  1 
ATOM   4455 C  CG  . GLU D 1 89  ? -4.814  33.903  11.235  1.00 44.98  ? 688  GLU D CG  1 
ATOM   4456 C  CD  . GLU D 1 89  ? -4.948  34.078  9.737   1.00 43.67  ? 688  GLU D CD  1 
ATOM   4457 O  OE1 . GLU D 1 89  ? -4.953  33.066  9.010   1.00 38.86  ? 688  GLU D OE1 1 
ATOM   4458 O  OE2 . GLU D 1 89  ? -5.052  35.235  9.278   1.00 56.28  ? 688  GLU D OE2 1 
ATOM   4459 N  N   . LEU D 1 90  ? -2.916  30.957  14.678  1.00 30.71  ? 689  LEU D N   1 
ATOM   4460 C  CA  . LEU D 1 90  ? -1.939  30.019  15.209  1.00 33.36  ? 689  LEU D CA  1 
ATOM   4461 C  C   . LEU D 1 90  ? -2.167  28.594  14.732  1.00 31.69  ? 689  LEU D C   1 
ATOM   4462 O  O   . LEU D 1 90  ? -1.239  27.811  14.521  1.00 38.23  ? 689  LEU D O   1 
ATOM   4463 C  CB  . LEU D 1 90  ? -1.962  30.039  16.741  1.00 34.69  ? 689  LEU D CB  1 
ATOM   4464 C  CG  . LEU D 1 90  ? -0.797  30.710  17.456  1.00 33.87  ? 689  LEU D CG  1 
ATOM   4465 C  CD1 . LEU D 1 90  ? -0.409  29.911  18.695  1.00 42.14  ? 689  LEU D CD1 1 
ATOM   4466 C  CD2 . LEU D 1 90  ? 0.397   30.886  16.525  1.00 24.98  ? 689  LEU D CD2 1 
ATOM   4467 N  N   . HIS D 1 91  ? -3.429  28.209  14.547  1.00 24.97  ? 690  HIS D N   1 
ATOM   4468 C  CA  . HIS D 1 91  ? -3.658  26.825  14.135  1.00 34.00  ? 690  HIS D CA  1 
ATOM   4469 C  C   . HIS D 1 91  ? -3.068  26.541  12.760  1.00 33.49  ? 690  HIS D C   1 
ATOM   4470 O  O   . HIS D 1 91  ? -2.906  25.373  12.398  1.00 52.90  ? 690  HIS D O   1 
ATOM   4471 C  CB  . HIS D 1 91  ? -5.155  26.508  14.153  1.00 36.09  ? 690  HIS D CB  1 
ATOM   4472 C  CG  . HIS D 1 91  ? -5.964  27.416  13.279  1.00 42.26  ? 690  HIS D CG  1 
ATOM   4473 N  ND1 . HIS D 1 91  ? -6.701  28.465  13.779  1.00 45.90  ? 690  HIS D ND1 1 
ATOM   4474 C  CD2 . HIS D 1 91  ? -6.151  27.431  11.941  1.00 42.36  ? 690  HIS D CD2 1 
ATOM   4475 C  CE1 . HIS D 1 91  ? -7.306  29.088  12.783  1.00 48.00  ? 690  HIS D CE1 1 
ATOM   4476 N  NE2 . HIS D 1 91  ? -6.989  28.481  11.654  1.00 46.29  ? 690  HIS D NE2 1 
ATOM   4477 N  N   . LYS D 1 92  ? -2.739  27.568  11.980  1.00 36.67  ? 691  LYS D N   1 
ATOM   4478 C  CA  . LYS D 1 92  ? -2.138  27.338  10.668  1.00 33.63  ? 691  LYS D CA  1 
ATOM   4479 C  C   . LYS D 1 92  ? -0.623  27.228  10.738  1.00 29.27  ? 691  LYS D C   1 
ATOM   4480 O  O   . LYS D 1 92  ? -0.024  26.625  9.851   1.00 30.54  ? 691  LYS D O   1 
ATOM   4481 C  CB  . LYS D 1 92  ? -2.528  28.459  9.699   1.00 31.80  ? 691  LYS D CB  1 
ATOM   4482 C  CG  . LYS D 1 92  ? -4.028  28.600  9.508   1.00 28.74  ? 691  LYS D CG  1 
ATOM   4483 C  CD  . LYS D 1 92  ? -4.347  29.552  8.362   1.00 32.00  ? 691  LYS D CD  1 
ATOM   4484 C  CE  . LYS D 1 92  ? -5.581  30.382  8.670   1.00 31.57  ? 691  LYS D CE  1 
ATOM   4485 N  NZ  . LYS D 1 92  ? -5.963  31.290  7.560   1.00 35.79  ? 691  LYS D NZ  1 
ATOM   4486 N  N   . PHE D 1 93  ? 0.003   27.797  11.762  1.00 35.51  ? 692  PHE D N   1 
ATOM   4487 C  CA  . PHE D 1 93  ? 1.452   27.749  11.927  1.00 27.10  ? 692  PHE D CA  1 
ATOM   4488 C  C   . PHE D 1 93  ? 1.878   26.565  12.784  1.00 30.39  ? 692  PHE D C   1 
ATOM   4489 O  O   . PHE D 1 93  ? 3.064   26.323  12.989  1.00 32.86  ? 692  PHE D O   1 
ATOM   4490 C  CB  . PHE D 1 93  ? 1.961   29.051  12.561  1.00 15.91  ? 692  PHE D CB  1 
ATOM   4491 C  CG  . PHE D 1 93  ? 1.435   30.262  11.795  1.00 23.71  ? 692  PHE D CG  1 
ATOM   4492 C  CD1 . PHE D 1 93  ? 0.187   30.792  12.078  1.00 24.86  ? 692  PHE D CD1 1 
ATOM   4493 C  CD2 . PHE D 1 93  ? 2.203   30.836  10.798  1.00 28.46  ? 692  PHE D CD2 1 
ATOM   4494 C  CE1 . PHE D 1 93  ? -0.278  31.885  11.366  1.00 29.43  ? 692  PHE D CE1 1 
ATOM   4495 C  CE2 . PHE D 1 93  ? 1.742   31.930  10.089  1.00 26.68  ? 692  PHE D CE2 1 
ATOM   4496 C  CZ  . PHE D 1 93  ? 0.493   32.451  10.368  1.00 26.91  ? 692  PHE D CZ  1 
ATOM   4497 N  N   . ILE D 1 94  ? 0.874   25.853  13.272  1.00 32.68  ? 693  ILE D N   1 
ATOM   4498 C  CA  . ILE D 1 94  ? 1.053   24.688  14.114  1.00 32.61  ? 693  ILE D CA  1 
ATOM   4499 C  C   . ILE D 1 94  ? 1.553   23.490  13.319  1.00 35.23  ? 693  ILE D C   1 
ATOM   4500 O  O   . ILE D 1 94  ? 0.875   23.076  12.378  1.00 45.98  ? 693  ILE D O   1 
ATOM   4501 C  CB  . ILE D 1 94  ? -0.277  24.274  14.776  1.00 29.12  ? 693  ILE D CB  1 
ATOM   4502 C  CG1 . ILE D 1 94  ? -0.816  25.289  15.786  1.00 29.74  ? 693  ILE D CG1 1 
ATOM   4503 C  CG2 . ILE D 1 94  ? -0.124  22.909  15.418  1.00 24.88  ? 693  ILE D CG2 1 
ATOM   4504 C  CD1 . ILE D 1 94  ? 0.297   25.957  16.568  1.00 7.54   ? 693  ILE D CD1 1 
ATOM   4505 N  N   . ARG D 1 95  ? 2.701   22.948  13.700  1.00 36.07  ? 694  ARG D N   1 
ATOM   4506 C  CA  . ARG D 1 95  ? 3.198   21.723  13.088  1.00 30.61  ? 694  ARG D CA  1 
ATOM   4507 C  C   . ARG D 1 95  ? 2.775   20.519  13.930  1.00 34.30  ? 694  ARG D C   1 
ATOM   4508 O  O   . ARG D 1 95  ? 3.294   20.306  15.025  1.00 41.35  ? 694  ARG D O   1 
ATOM   4509 C  CB  . ARG D 1 95  ? 4.714   21.720  12.936  1.00 30.71  ? 694  ARG D CB  1 
ATOM   4510 C  CG  . ARG D 1 95  ? 5.217   22.509  11.737  1.00 36.71  ? 694  ARG D CG  1 
ATOM   4511 C  CD  . ARG D 1 95  ? 6.474   23.280  12.120  1.00 45.00  ? 694  ARG D CD  1 
ATOM   4512 N  NE  . ARG D 1 95  ? 7.299   22.489  13.036  1.00 47.85  ? 694  ARG D NE  1 
ATOM   4513 C  CZ  . ARG D 1 95  ? 8.624   22.443  12.959  1.00 44.69  ? 694  ARG D CZ  1 
ATOM   4514 N  NH1 . ARG D 1 95  ? 9.244   23.141  12.015  1.00 40.71  ? 694  ARG D NH1 1 
ATOM   4515 N  NH2 . ARG D 1 95  ? 9.306   21.705  13.821  1.00 16.21  ? 694  ARG D NH2 1 
ATOM   4516 N  N   . ILE D 1 96  ? 1.831   19.760  13.398  1.00 33.20  ? 695  ILE D N   1 
ATOM   4517 C  CA  . ILE D 1 96  ? 1.321   18.571  14.057  1.00 30.70  ? 695  ILE D CA  1 
ATOM   4518 C  C   . ILE D 1 96  ? 0.784   17.583  13.023  1.00 33.52  ? 695  ILE D C   1 
ATOM   4519 O  O   . ILE D 1 96  ? 0.236   18.025  12.012  1.00 52.47  ? 695  ILE D O   1 
ATOM   4520 C  CB  . ILE D 1 96  ? 0.190   18.913  15.045  1.00 30.53  ? 695  ILE D CB  1 
ATOM   4521 C  CG1 . ILE D 1 96  ? -0.509  17.690  15.633  1.00 36.76  ? 695  ILE D CG1 1 
ATOM   4522 C  CG2 . ILE D 1 96  ? -0.788  19.859  14.366  1.00 13.51  ? 695  ILE D CG2 1 
ATOM   4523 C  CD1 . ILE D 1 96  ? -1.659  17.977  16.569  1.00 42.78  ? 695  ILE D CD1 1 
ATOM   4524 N  N   . LYS D 1 97  ? 0.950   16.300  13.299  1.00 36.64  ? 696  LYS D N   1 
ATOM   4525 C  CA  . LYS D 1 97  ? 0.411   15.244  12.451  1.00 44.77  ? 696  LYS D CA  1 
ATOM   4526 C  C   . LYS D 1 97  ? -1.040  15.545  12.098  1.00 46.41  ? 696  LYS D C   1 
ATOM   4527 O  O   . LYS D 1 97  ? -1.827  15.959  12.945  1.00 43.15  ? 696  LYS D O   1 
ATOM   4528 C  CB  . LYS D 1 97  ? 0.545   13.893  13.153  1.00 49.87  ? 696  LYS D CB  1 
ATOM   4529 C  CG  . LYS D 1 97  ? 1.992   13.426  13.255  1.00 49.94  ? 696  LYS D CG  1 
ATOM   4530 C  CD  . LYS D 1 97  ? 2.391   12.662  12.002  1.00 50.04  ? 696  LYS D CD  1 
ATOM   4531 C  CE  . LYS D 1 97  ? 1.950   11.209  12.076  1.00 45.76  ? 696  LYS D CE  1 
ATOM   4532 N  NZ  . LYS D 1 97  ? 1.343   10.755  10.796  1.00 27.69  ? 696  LYS D NZ  1 
ATOM   4533 N  N   . ARG D 1 98  ? -1.372  15.372  10.826  1.00 51.85  ? 697  ARG D N   1 
ATOM   4534 C  CA  . ARG D 1 98  ? -2.663  15.797  10.300  1.00 53.43  ? 697  ARG D CA  1 
ATOM   4535 C  C   . ARG D 1 98  ? -3.830  15.259  11.110  1.00 55.17  ? 697  ARG D C   1 
ATOM   4536 O  O   . ARG D 1 98  ? -3.818  14.117  11.567  1.00 65.65  ? 697  ARG D O   1 
ATOM   4537 C  CB  . ARG D 1 98  ? -2.763  15.368  8.829   1.00 50.33  ? 697  ARG D CB  1 
ATOM   4538 C  CG  . ARG D 1 98  ? -1.406  15.347  8.136   1.00 56.88  ? 697  ARG D CG  1 
ATOM   4539 C  CD  . ARG D 1 98  ? -1.412  16.161  6.847   1.00 61.04  ? 697  ARG D CD  1 
ATOM   4540 N  NE  . ARG D 1 98  ? -2.284  15.566  5.834   1.00 60.87  ? 697  ARG D NE  1 
ATOM   4541 C  CZ  . ARG D 1 98  ? -2.557  16.038  4.618   1.00 65.40  ? 697  ARG D CZ  1 
ATOM   4542 N  NH1 . ARG D 1 98  ? -2.022  17.184  4.196   1.00 78.65  ? 697  ARG D NH1 1 
ATOM   4543 N  NH2 . ARG D 1 98  ? -3.372  15.354  3.810   1.00 72.86  ? 697  ARG D NH2 1 
ATOM   4544 N  N   . GLY D 1 99  ? -4.851  16.095  11.289  1.00 55.03  ? 698  GLY D N   1 
ATOM   4545 C  CA  . GLY D 1 99  ? -6.121  15.709  11.824  1.00 59.76  ? 698  GLY D CA  1 
ATOM   4546 C  C   . GLY D 1 99  ? -6.442  15.862  13.275  1.00 58.03  ? 698  GLY D C   1 
ATOM   4547 O  O   . GLY D 1 99  ? -7.622  15.768  13.650  1.00 60.67  ? 698  GLY D O   1 
ATOM   4548 N  N   . LYS D 1 100 ? -5.495  16.087  14.192  1.00 56.32  ? 699  LYS D N   1 
ATOM   4549 C  CA  . LYS D 1 100 ? -5.959  16.125  15.582  1.00 51.42  ? 699  LYS D CA  1 
ATOM   4550 C  C   . LYS D 1 100 ? -5.496  17.366  16.317  1.00 42.89  ? 699  LYS D C   1 
ATOM   4551 O  O   . LYS D 1 100 ? -4.905  17.277  17.399  1.00 27.38  ? 699  LYS D O   1 
ATOM   4552 C  CB  . LYS D 1 100 ? -5.508  14.871  16.333  1.00 59.54  ? 699  LYS D CB  1 
ATOM   4553 C  CG  . LYS D 1 100 ? -4.016  14.596  16.355  1.00 63.61  ? 699  LYS D CG  1 
ATOM   4554 C  CD  . LYS D 1 100 ? -3.753  13.135  16.710  1.00 69.15  ? 699  LYS D CD  1 
ATOM   4555 C  CE  . LYS D 1 100 ? -2.681  12.974  17.785  1.00 72.15  ? 699  LYS D CE  1 
ATOM   4556 N  NZ  . LYS D 1 100 ? -2.433  11.536  18.076  1.00 60.31  ? 699  LYS D NZ  1 
ATOM   4557 N  N   . ILE D 1 101 ? -5.776  18.561  15.759  1.00 43.21  ? 700  ILE D N   1 
ATOM   4558 C  CA  . ILE D 1 101 ? -5.385  19.682  16.595  1.00 44.48  ? 700  ILE D CA  1 
ATOM   4559 C  C   . ILE D 1 101 ? -6.138  19.969  17.917  1.00 52.29  ? 700  ILE D C   1 
ATOM   4560 O  O   . ILE D 1 101 ? -6.016  19.237  18.896  1.00 67.45  ? 700  ILE D O   1 
ATOM   4561 C  CB  . ILE D 1 101 ? -5.482  20.903  15.680  1.00 42.72  ? 700  ILE D CB  1 
ATOM   4562 C  CG1 . ILE D 1 101 ? -5.009  20.807  14.252  1.00 45.65  ? 700  ILE D CG1 1 
ATOM   4563 C  CG2 . ILE D 1 101 ? -4.675  22.067  16.280  1.00 30.56  ? 700  ILE D CG2 1 
ATOM   4564 C  CD1 . ILE D 1 101 ? -4.045  21.851  13.733  1.00 43.27  ? 700  ILE D CD1 1 
ATOM   4565 N  N   . ASN D 1 102 ? -6.963  20.977  18.056  1.00 50.57  ? 701  ASN D N   1 
ATOM   4566 C  CA  . ASN D 1 102 ? -7.825  21.183  19.181  1.00 43.81  ? 701  ASN D CA  1 
ATOM   4567 C  C   . ASN D 1 102 ? -7.704  22.578  19.706  1.00 36.88  ? 701  ASN D C   1 
ATOM   4568 O  O   . ASN D 1 102 ? -6.733  23.203  19.355  1.00 36.13  ? 701  ASN D O   1 
ATOM   4569 C  CB  . ASN D 1 102 ? -7.973  20.034  20.152  1.00 52.40  ? 701  ASN D CB  1 
ATOM   4570 C  CG  . ASN D 1 102 ? -9.438  19.857  20.582  1.00 60.04  ? 701  ASN D CG  1 
ATOM   4571 O  OD1 . ASN D 1 102 ? -10.239 20.766  20.807  1.00 75.51  ? 701  ASN D OD1 1 
ATOM   4572 N  ND2 . ASN D 1 102 ? -9.743  18.567  20.705  1.00 70.85  ? 701  ASN D ND2 1 
ATOM   4573 N  N   . GLU D 1 103 ? -8.573  22.903  20.630  1.00 30.96  ? 702  GLU D N   1 
ATOM   4574 C  CA  . GLU D 1 103 ? -8.464  24.194  21.297  1.00 32.33  ? 702  GLU D CA  1 
ATOM   4575 C  C   . GLU D 1 103 ? -7.550  24.112  22.515  1.00 31.34  ? 702  GLU D C   1 
ATOM   4576 O  O   . GLU D 1 103 ? -7.174  25.136  23.082  1.00 38.31  ? 702  GLU D O   1 
ATOM   4577 C  CB  . GLU D 1 103 ? -9.842  24.714  21.710  1.00 39.17  ? 702  GLU D CB  1 
ATOM   4578 C  CG  . GLU D 1 103 ? -10.642 25.356  20.589  1.00 40.59  ? 702  GLU D CG  1 
ATOM   4579 C  CD  . GLU D 1 103 ? -11.975 25.892  21.075  1.00 48.55  ? 702  GLU D CD  1 
ATOM   4580 O  OE1 . GLU D 1 103 ? -12.111 26.151  22.288  1.00 49.85  ? 702  GLU D OE1 1 
ATOM   4581 O  OE2 . GLU D 1 103 ? -12.892 26.053  20.243  1.00 61.51  ? 702  GLU D OE2 1 
ATOM   4582 N  N   . THR D 1 104 ? -7.188  22.887  22.879  1.00 31.33  ? 703  THR D N   1 
ATOM   4583 C  CA  . THR D 1 104 ? -6.239  22.673  23.962  1.00 30.06  ? 703  THR D CA  1 
ATOM   4584 C  C   . THR D 1 104 ? -4.801  22.880  23.496  1.00 33.26  ? 703  THR D C   1 
ATOM   4585 O  O   . THR D 1 104 ? -4.083  23.713  24.056  1.00 33.76  ? 703  THR D O   1 
ATOM   4586 C  CB  . THR D 1 104 ? -6.405  21.264  24.550  1.00 24.89  ? 703  THR D CB  1 
ATOM   4587 O  OG1 . THR D 1 104 ? -7.565  21.243  25.397  1.00 38.12  ? 703  THR D OG1 1 
ATOM   4588 C  CG2 . THR D 1 104 ? -5.222  20.891  25.429  1.00 32.08  ? 703  THR D CG2 1 
ATOM   4589 N  N   . ILE D 1 105 ? -4.361  22.139  22.482  1.00 31.40  ? 704  ILE D N   1 
ATOM   4590 C  CA  . ILE D 1 105 ? -2.980  22.254  22.019  1.00 32.37  ? 704  ILE D CA  1 
ATOM   4591 C  C   . ILE D 1 105 ? -2.718  23.659  21.492  1.00 31.99  ? 704  ILE D C   1 
ATOM   4592 O  O   . ILE D 1 105 ? -1.630  24.215  21.620  1.00 27.66  ? 704  ILE D O   1 
ATOM   4593 C  CB  . ILE D 1 105 ? -2.641  21.248  20.903  1.00 37.91  ? 704  ILE D CB  1 
ATOM   4594 C  CG1 . ILE D 1 105 ? -1.572  21.740  19.926  1.00 34.98  ? 704  ILE D CG1 1 
ATOM   4595 C  CG2 . ILE D 1 105 ? -3.913  20.842  20.183  1.00 55.81  ? 704  ILE D CG2 1 
ATOM   4596 C  CD1 . ILE D 1 105 ? -1.646  21.123  18.544  1.00 41.35  ? 704  ILE D CD1 1 
ATOM   4597 N  N   . ILE D 1 106 ? -3.783  24.192  20.897  1.00 24.91  ? 705  ILE D N   1 
ATOM   4598 C  CA  . ILE D 1 106 ? -3.752  25.556  20.395  1.00 17.65  ? 705  ILE D CA  1 
ATOM   4599 C  C   . ILE D 1 106 ? -3.565  26.523  21.555  1.00 27.23  ? 705  ILE D C   1 
ATOM   4600 O  O   . ILE D 1 106 ? -2.825  27.505  21.492  1.00 22.47  ? 705  ILE D O   1 
ATOM   4601 C  CB  . ILE D 1 106 ? -5.047  25.879  19.630  1.00 18.80  ? 705  ILE D CB  1 
ATOM   4602 C  CG1 . ILE D 1 106 ? -5.133  25.214  18.252  1.00 25.86  ? 705  ILE D CG1 1 
ATOM   4603 C  CG2 . ILE D 1 106 ? -5.253  27.377  19.519  1.00 7.45   ? 705  ILE D CG2 1 
ATOM   4604 C  CD1 . ILE D 1 106 ? -6.298  25.697  17.418  1.00 21.84  ? 705  ILE D CD1 1 
ATOM   4605 N  N   . GLY D 1 107 ? -4.262  26.248  22.661  1.00 35.90  ? 706  GLY D N   1 
ATOM   4606 C  CA  . GLY D 1 107 ? -4.098  27.127  23.818  1.00 37.84  ? 706  GLY D CA  1 
ATOM   4607 C  C   . GLY D 1 107 ? -2.669  27.045  24.328  1.00 34.54  ? 706  GLY D C   1 
ATOM   4608 O  O   . GLY D 1 107 ? -2.020  28.056  24.581  1.00 32.51  ? 706  GLY D O   1 
ATOM   4609 N  N   . ASP D 1 108 ? -2.176  25.814  24.465  1.00 33.26  ? 707  ASP D N   1 
ATOM   4610 C  CA  . ASP D 1 108 ? -0.807  25.630  24.945  1.00 26.53  ? 707  ASP D CA  1 
ATOM   4611 C  C   . ASP D 1 108 ? 0.178   26.310  24.001  1.00 31.93  ? 707  ASP D C   1 
ATOM   4612 O  O   . ASP D 1 108 ? 1.053   27.066  24.432  1.00 39.88  ? 707  ASP D O   1 
ATOM   4613 C  CB  . ASP D 1 108 ? -0.490  24.149  25.097  1.00 23.58  ? 707  ASP D CB  1 
ATOM   4614 C  CG  . ASP D 1 108 ? -1.424  23.424  26.044  1.00 31.00  ? 707  ASP D CG  1 
ATOM   4615 O  OD1 . ASP D 1 108 ? -2.089  24.086  26.863  1.00 38.56  ? 707  ASP D OD1 1 
ATOM   4616 O  OD2 . ASP D 1 108 ? -1.500  22.178  25.987  1.00 38.48  ? 707  ASP D OD2 1 
ATOM   4617 N  N   . VAL D 1 109 ? 0.038   26.052  22.697  1.00 26.24  ? 708  VAL D N   1 
ATOM   4618 C  CA  . VAL D 1 109 ? 0.942   26.708  21.756  1.00 26.11  ? 708  VAL D CA  1 
ATOM   4619 C  C   . VAL D 1 109 ? 0.834   28.223  21.895  1.00 20.78  ? 708  VAL D C   1 
ATOM   4620 O  O   . VAL D 1 109 ? 1.822   28.940  21.715  1.00 24.84  ? 708  VAL D O   1 
ATOM   4621 C  CB  . VAL D 1 109 ? 0.684   26.317  20.290  1.00 21.04  ? 708  VAL D CB  1 
ATOM   4622 C  CG1 . VAL D 1 109 ? 1.419   27.278  19.375  1.00 10.65  ? 708  VAL D CG1 1 
ATOM   4623 C  CG2 . VAL D 1 109 ? 1.114   24.888  20.031  1.00 5.31   ? 708  VAL D CG2 1 
ATOM   4624 N  N   . PHE D 1 110 ? -0.359  28.708  22.229  1.00 15.13  ? 709  PHE D N   1 
ATOM   4625 C  CA  . PHE D 1 110 ? -0.486  30.146  22.475  1.00 19.93  ? 709  PHE D CA  1 
ATOM   4626 C  C   . PHE D 1 110 ? 0.498   30.552  23.575  1.00 25.78  ? 709  PHE D C   1 
ATOM   4627 O  O   . PHE D 1 110 ? 1.166   31.578  23.482  1.00 21.69  ? 709  PHE D O   1 
ATOM   4628 C  CB  . PHE D 1 110 ? -1.897  30.539  22.885  1.00 14.34  ? 709  PHE D CB  1 
ATOM   4629 C  CG  . PHE D 1 110 ? -2.106  32.027  23.108  1.00 13.07  ? 709  PHE D CG  1 
ATOM   4630 C  CD1 . PHE D 1 110 ? -2.090  32.910  22.038  1.00 15.45  ? 709  PHE D CD1 1 
ATOM   4631 C  CD2 . PHE D 1 110 ? -2.322  32.535  24.373  1.00 11.15  ? 709  PHE D CD2 1 
ATOM   4632 C  CE1 . PHE D 1 110 ? -2.289  34.262  22.218  1.00 15.21  ? 709  PHE D CE1 1 
ATOM   4633 C  CE2 . PHE D 1 110 ? -2.520  33.891  24.562  1.00 14.23  ? 709  PHE D CE2 1 
ATOM   4634 C  CZ  . PHE D 1 110 ? -2.502  34.758  23.491  1.00 13.93  ? 709  PHE D CZ  1 
ATOM   4635 N  N   . GLU D 1 111 ? 0.542   29.702  24.596  1.00 27.95  ? 710  GLU D N   1 
ATOM   4636 C  CA  . GLU D 1 111 ? 1.409   29.912  25.747  1.00 28.89  ? 710  GLU D CA  1 
ATOM   4637 C  C   . GLU D 1 111 ? 2.872   29.661  25.387  1.00 22.31  ? 710  GLU D C   1 
ATOM   4638 O  O   . GLU D 1 111 ? 3.757   30.384  25.843  1.00 17.41  ? 710  GLU D O   1 
ATOM   4639 C  CB  . GLU D 1 111 ? 0.978   29.004  26.900  1.00 21.46  ? 710  GLU D CB  1 
ATOM   4640 C  CG  . GLU D 1 111 ? -0.294  29.460  27.604  1.00 18.26  ? 710  GLU D CG  1 
ATOM   4641 C  CD  . GLU D 1 111 ? -0.678  28.499  28.720  1.00 21.53  ? 710  GLU D CD  1 
ATOM   4642 O  OE1 . GLU D 1 111 ? -0.489  27.276  28.535  1.00 9.36   ? 710  GLU D OE1 1 
ATOM   4643 O  OE2 . GLU D 1 111 ? -1.160  28.995  29.767  1.00 18.28  ? 710  GLU D OE2 1 
ATOM   4644 N  N   . ALA D 1 112 ? 3.123   28.646  24.570  1.00 19.79  ? 711  ALA D N   1 
ATOM   4645 C  CA  . ALA D 1 112 ? 4.478   28.307  24.129  1.00 18.89  ? 711  ALA D CA  1 
ATOM   4646 C  C   . ALA D 1 112 ? 5.079   29.440  23.308  1.00 26.90  ? 711  ALA D C   1 
ATOM   4647 O  O   . ALA D 1 112 ? 6.255   29.797  23.421  1.00 30.97  ? 711  ALA D O   1 
ATOM   4648 C  CB  . ALA D 1 112 ? 4.457   27.008  23.341  1.00 5.64   ? 711  ALA D CB  1 
ATOM   4649 N  N   . LEU D 1 113 ? 4.237   30.032  22.460  1.00 19.11  ? 712  LEU D N   1 
ATOM   4650 C  CA  . LEU D 1 113 ? 4.688   31.153  21.653  1.00 13.97  ? 712  LEU D CA  1 
ATOM   4651 C  C   . LEU D 1 113 ? 5.259   32.257  22.536  1.00 19.03  ? 712  LEU D C   1 
ATOM   4652 O  O   . LEU D 1 113 ? 6.456   32.535  22.489  1.00 23.58  ? 712  LEU D O   1 
ATOM   4653 C  CB  . LEU D 1 113 ? 3.548   31.713  20.798  1.00 18.56  ? 712  LEU D CB  1 
ATOM   4654 C  CG  . LEU D 1 113 ? 4.003   32.560  19.600  1.00 28.87  ? 712  LEU D CG  1 
ATOM   4655 C  CD1 . LEU D 1 113 ? 5.068   31.818  18.808  1.00 26.36  ? 712  LEU D CD1 1 
ATOM   4656 C  CD2 . LEU D 1 113 ? 2.826   32.935  18.718  1.00 18.02  ? 712  LEU D CD2 1 
ATOM   4657 N  N   . TRP D 1 114 ? 4.395   32.873  23.339  1.00 13.08  ? 713  TRP D N   1 
ATOM   4658 C  CA  . TRP D 1 114 ? 4.805   34.006  24.162  1.00 11.59  ? 713  TRP D CA  1 
ATOM   4659 C  C   . TRP D 1 114 ? 6.011   33.696  25.031  1.00 3.55   ? 713  TRP D C   1 
ATOM   4660 O  O   . TRP D 1 114 ? 6.795   34.597  25.334  1.00 9.56   ? 713  TRP D O   1 
ATOM   4661 C  CB  . TRP D 1 114 ? 3.582   34.479  24.982  1.00 17.18  ? 713  TRP D CB  1 
ATOM   4662 C  CG  . TRP D 1 114 ? 2.683   35.179  23.986  1.00 23.15  ? 713  TRP D CG  1 
ATOM   4663 C  CD1 . TRP D 1 114 ? 1.477   34.786  23.497  1.00 18.93  ? 713  TRP D CD1 1 
ATOM   4664 C  CD2 . TRP D 1 114 ? 2.995   36.435  23.364  1.00 21.44  ? 713  TRP D CD2 1 
ATOM   4665 N  NE1 . TRP D 1 114 ? 1.009   35.726  22.606  1.00 22.66  ? 713  TRP D NE1 1 
ATOM   4666 C  CE2 . TRP D 1 114 ? 1.921   36.745  22.507  1.00 18.94  ? 713  TRP D CE2 1 
ATOM   4667 C  CE3 . TRP D 1 114 ? 4.076   37.317  23.459  1.00 14.70  ? 713  TRP D CE3 1 
ATOM   4668 C  CZ2 . TRP D 1 114 ? 1.909   37.911  21.748  1.00 17.13  ? 713  TRP D CZ2 1 
ATOM   4669 C  CZ3 . TRP D 1 114 ? 4.064   38.477  22.703  1.00 14.45  ? 713  TRP D CZ3 1 
ATOM   4670 C  CH2 . TRP D 1 114 ? 2.980   38.756  21.860  1.00 19.79  ? 713  TRP D CH2 1 
ATOM   4671 N  N   . ALA D 1 115 ? 6.162   32.436  25.403  1.00 6.43   ? 714  ALA D N   1 
ATOM   4672 C  CA  . ALA D 1 115 ? 7.352   31.971  26.101  1.00 18.37  ? 714  ALA D CA  1 
ATOM   4673 C  C   . ALA D 1 115 ? 8.551   31.999  25.154  1.00 20.41  ? 714  ALA D C   1 
ATOM   4674 O  O   . ALA D 1 115 ? 9.663   32.381  25.514  1.00 15.15  ? 714  ALA D O   1 
ATOM   4675 C  CB  . ALA D 1 115 ? 7.137   30.567  26.638  1.00 21.33  ? 714  ALA D CB  1 
ATOM   4676 N  N   . ALA D 1 116 ? 8.266   31.581  23.924  1.00 13.50  ? 715  ALA D N   1 
ATOM   4677 C  CA  . ALA D 1 116 ? 9.298   31.563  22.888  1.00 18.20  ? 715  ALA D CA  1 
ATOM   4678 C  C   . ALA D 1 116 ? 9.786   32.981  22.630  1.00 24.34  ? 715  ALA D C   1 
ATOM   4679 O  O   . ALA D 1 116 ? 10.982  33.215  22.465  1.00 11.18  ? 715  ALA D O   1 
ATOM   4680 C  CB  . ALA D 1 116 ? 8.771   30.903  21.624  1.00 20.67  ? 715  ALA D CB  1 
ATOM   4681 N  N   . VAL D 1 117 ? 8.858   33.941  22.606  1.00 26.45  ? 716  VAL D N   1 
ATOM   4682 C  CA  . VAL D 1 117 ? 9.258   35.322  22.349  1.00 26.16  ? 716  VAL D CA  1 
ATOM   4683 C  C   . VAL D 1 117 ? 10.063  35.872  23.527  1.00 31.53  ? 716  VAL D C   1 
ATOM   4684 O  O   . VAL D 1 117 ? 11.072  36.553  23.333  1.00 20.73  ? 716  VAL D O   1 
ATOM   4685 C  CB  . VAL D 1 117 ? 8.055   36.235  22.070  1.00 28.28  ? 716  VAL D CB  1 
ATOM   4686 C  CG1 . VAL D 1 117 ? 8.526   37.636  21.702  1.00 33.03  ? 716  VAL D CG1 1 
ATOM   4687 C  CG2 . VAL D 1 117 ? 7.192   35.664  20.956  1.00 16.77  ? 716  VAL D CG2 1 
ATOM   4688 N  N   . TYR D 1 118 ? 9.604   35.557  24.733  1.00 28.19  ? 717  TYR D N   1 
ATOM   4689 C  CA  . TYR D 1 118 ? 10.260  35.966  25.966  1.00 15.60  ? 717  TYR D CA  1 
ATOM   4690 C  C   . TYR D 1 118 ? 11.734  35.603  25.917  1.00 18.28  ? 717  TYR D C   1 
ATOM   4691 O  O   . TYR D 1 118 ? 12.624  36.402  26.188  1.00 22.36  ? 717  TYR D O   1 
ATOM   4692 C  CB  . TYR D 1 118 ? 9.608   35.294  27.179  1.00 14.41  ? 717  TYR D CB  1 
ATOM   4693 C  CG  . TYR D 1 118 ? 10.293  35.561  28.502  1.00 12.22  ? 717  TYR D CG  1 
ATOM   4694 C  CD1 . TYR D 1 118 ? 10.629  36.845  28.917  1.00 13.79  ? 717  TYR D CD1 1 
ATOM   4695 C  CD2 . TYR D 1 118 ? 10.602  34.502  29.353  1.00 10.64  ? 717  TYR D CD2 1 
ATOM   4696 C  CE1 . TYR D 1 118 ? 11.257  37.076  30.138  1.00 10.68  ? 717  TYR D CE1 1 
ATOM   4697 C  CE2 . TYR D 1 118 ? 11.227  34.716  30.568  1.00 6.12   ? 717  TYR D CE2 1 
ATOM   4698 C  CZ  . TYR D 1 118 ? 11.551  36.003  30.954  1.00 6.36   ? 717  TYR D CZ  1 
ATOM   4699 O  OH  . TYR D 1 118 ? 12.175  36.211  32.167  1.00 14.28  ? 717  TYR D OH  1 
ATOM   4700 N  N   . ILE D 1 119 ? 11.973  34.339  25.560  1.00 25.22  ? 718  ILE D N   1 
ATOM   4701 C  CA  . ILE D 1 119 ? 13.359  33.867  25.557  1.00 20.52  ? 718  ILE D CA  1 
ATOM   4702 C  C   . ILE D 1 119 ? 14.142  34.448  24.390  1.00 20.01  ? 718  ILE D C   1 
ATOM   4703 O  O   . ILE D 1 119 ? 15.337  34.727  24.535  1.00 27.35  ? 718  ILE D O   1 
ATOM   4704 C  CB  . ILE D 1 119 ? 13.399  32.332  25.558  1.00 15.89  ? 718  ILE D CB  1 
ATOM   4705 C  CG1 . ILE D 1 119 ? 12.577  31.677  26.682  1.00 8.73   ? 718  ILE D CG1 1 
ATOM   4706 C  CG2 . ILE D 1 119 ? 14.842  31.841  25.598  1.00 16.26  ? 718  ILE D CG2 1 
ATOM   4707 C  CD1 . ILE D 1 119 ? 12.331  30.200  26.425  1.00 1.30   ? 718  ILE D CD1 1 
ATOM   4708 N  N   . ASP D 1 120 ? 13.526  34.670  23.234  1.00 22.83  ? 719  ASP D N   1 
ATOM   4709 C  CA  . ASP D 1 120 ? 14.266  35.211  22.087  1.00 18.04  ? 719  ASP D CA  1 
ATOM   4710 C  C   . ASP D 1 120 ? 14.651  36.665  22.310  1.00 25.50  ? 719  ASP D C   1 
ATOM   4711 O  O   . ASP D 1 120 ? 15.678  37.132  21.807  1.00 21.33  ? 719  ASP D O   1 
ATOM   4712 C  CB  . ASP D 1 120 ? 13.455  35.040  20.799  1.00 13.54  ? 719  ASP D CB  1 
ATOM   4713 C  CG  . ASP D 1 120 ? 14.274  35.295  19.547  1.00 16.87  ? 719  ASP D CG  1 
ATOM   4714 O  OD1 . ASP D 1 120 ? 15.179  34.493  19.241  1.00 18.20  ? 719  ASP D OD1 1 
ATOM   4715 O  OD2 . ASP D 1 120 ? 14.030  36.307  18.854  1.00 21.11  ? 719  ASP D OD2 1 
ATOM   4716 N  N   . SER D 1 121 ? 13.857  37.409  23.077  1.00 24.02  ? 720  SER D N   1 
ATOM   4717 C  CA  . SER D 1 121 ? 14.181  38.828  23.326  1.00 13.87  ? 720  SER D CA  1 
ATOM   4718 C  C   . SER D 1 121 ? 15.255  38.961  24.426  1.00 4.92   ? 720  SER D C   1 
ATOM   4719 O  O   . SER D 1 121 ? 15.464  40.085  24.898  1.00 12.63  ? 720  SER D O   1 
ATOM   4720 C  CB  . SER D 1 121 ? 12.911  39.548  23.844  1.00 18.99  ? 720  SER D CB  1 
ATOM   4721 O  OG  . SER D 1 121 ? 12.462  39.001  25.076  1.00 21.08  ? 720  SER D OG  1 
ATOM   4722 N  N   . GLY D 1 122 ? 15.936  37.888  24.786  1.00 16.38  ? 721  GLY D N   1 
ATOM   4723 C  CA  . GLY D 1 122 ? 16.921  37.911  25.864  1.00 25.55  ? 721  GLY D CA  1 
ATOM   4724 C  C   . GLY D 1 122 ? 16.205  38.137  27.198  1.00 26.44  ? 721  GLY D C   1 
ATOM   4725 O  O   . GLY D 1 122 ? 16.557  39.051  27.940  1.00 26.11  ? 721  GLY D O   1 
ATOM   4726 N  N   . ARG D 1 123 ? 15.182  37.339  27.430  1.00 25.96  ? 722  ARG D N   1 
ATOM   4727 C  CA  . ARG D 1 123 ? 14.280  37.422  28.532  1.00 25.33  ? 722  ARG D CA  1 
ATOM   4728 C  C   . ARG D 1 123 ? 13.945  38.842  28.919  1.00 25.06  ? 722  ARG D C   1 
ATOM   4729 O  O   . ARG D 1 123 ? 14.213  39.259  30.045  1.00 15.04  ? 722  ARG D O   1 
ATOM   4730 C  CB  . ARG D 1 123 ? 14.666  36.611  29.760  1.00 15.92  ? 722  ARG D CB  1 
ATOM   4731 C  CG  . ARG D 1 123 ? 14.950  35.149  29.472  1.00 17.06  ? 722  ARG D CG  1 
ATOM   4732 C  CD  . ARG D 1 123 ? 15.208  34.371  30.756  1.00 14.43  ? 722  ARG D CD  1 
ATOM   4733 N  NE  . ARG D 1 123 ? 14.524  33.083  30.747  1.00 8.81   ? 722  ARG D NE  1 
ATOM   4734 C  CZ  . ARG D 1 123 ? 14.970  31.989  30.147  1.00 13.46  ? 722  ARG D CZ  1 
ATOM   4735 N  NH1 . ARG D 1 123 ? 16.121  31.994  29.480  1.00 34.77  ? 722  ARG D NH1 1 
ATOM   4736 N  NH2 . ARG D 1 123 ? 14.265  30.871  30.207  1.00 10.99  ? 722  ARG D NH2 1 
ATOM   4737 N  N   . ASP D 1 124 ? 13.381  39.581  27.973  1.00 25.57  ? 723  ASP D N   1 
ATOM   4738 C  CA  . ASP D 1 124 ? 12.916  40.941  28.209  1.00 24.33  ? 723  ASP D CA  1 
ATOM   4739 C  C   . ASP D 1 124 ? 11.417  40.923  28.503  1.00 30.73  ? 723  ASP D C   1 
ATOM   4740 O  O   . ASP D 1 124 ? 10.591  40.975  27.591  1.00 12.30  ? 723  ASP D O   1 
ATOM   4741 C  CB  . ASP D 1 124 ? 13.218  41.852  27.016  1.00 12.41  ? 723  ASP D CB  1 
ATOM   4742 C  CG  . ASP D 1 124 ? 12.961  43.311  27.307  1.00 18.53  ? 723  ASP D CG  1 
ATOM   4743 O  OD1 . ASP D 1 124 ? 12.048  43.616  28.107  1.00 19.28  ? 723  ASP D OD1 1 
ATOM   4744 O  OD2 . ASP D 1 124 ? 13.671  44.176  26.750  1.00 24.48  ? 723  ASP D OD2 1 
ATOM   4745 N  N   . ALA D 1 125 ? 11.089  40.859  29.792  1.00 29.40  ? 724  ALA D N   1 
ATOM   4746 C  CA  . ALA D 1 125 ? 9.694   40.735  30.212  1.00 15.78  ? 724  ALA D CA  1 
ATOM   4747 C  C   . ALA D 1 125 ? 8.862   41.957  29.861  1.00 7.42   ? 724  ALA D C   1 
ATOM   4748 O  O   . ALA D 1 125 ? 7.708   41.798  29.447  1.00 17.57  ? 724  ALA D O   1 
ATOM   4749 C  CB  . ALA D 1 125 ? 9.648   40.413  31.700  1.00 16.64  ? 724  ALA D CB  1 
ATOM   4750 N  N   . ASN D 1 126 ? 9.379   43.172  29.986  1.00 9.39   ? 725  ASN D N   1 
ATOM   4751 C  CA  . ASN D 1 126 ? 8.644   44.387  29.667  1.00 11.47  ? 725  ASN D CA  1 
ATOM   4752 C  C   . ASN D 1 126 ? 8.321   44.509  28.179  1.00 22.08  ? 725  ASN D C   1 
ATOM   4753 O  O   . ASN D 1 126 ? 7.177   44.779  27.804  1.00 27.37  ? 725  ASN D O   1 
ATOM   4754 C  CB  . ASN D 1 126 ? 9.447   45.612  30.117  1.00 17.71  ? 725  ASN D CB  1 
ATOM   4755 C  CG  . ASN D 1 126 ? 9.816   45.560  31.589  1.00 24.75  ? 725  ASN D CG  1 
ATOM   4756 O  OD1 . ASN D 1 126 ? 9.140   44.930  32.401  1.00 19.60  ? 725  ASN D OD1 1 
ATOM   4757 N  ND2 . ASN D 1 126 ? 10.904  46.237  31.947  1.00 27.90  ? 725  ASN D ND2 1 
ATOM   4758 N  N   . PHE D 1 127 ? 9.325   44.316  27.330  1.00 18.59  ? 726  PHE D N   1 
ATOM   4759 C  CA  . PHE D 1 127 ? 9.166   44.268  25.884  1.00 12.42  ? 726  PHE D CA  1 
ATOM   4760 C  C   . PHE D 1 127 ? 8.105   43.243  25.475  1.00 1.68   ? 726  PHE D C   1 
ATOM   4761 O  O   . PHE D 1 127 ? 7.126   43.614  24.830  1.00 26.02  ? 726  PHE D O   1 
ATOM   4762 C  CB  . PHE D 1 127 ? 10.494  43.928  25.205  1.00 13.90  ? 726  PHE D CB  1 
ATOM   4763 C  CG  . PHE D 1 127 ? 10.412  43.783  23.693  1.00 21.27  ? 726  PHE D CG  1 
ATOM   4764 C  CD1 . PHE D 1 127 ? 9.949   44.823  22.909  1.00 26.24  ? 726  PHE D CD1 1 
ATOM   4765 C  CD2 . PHE D 1 127 ? 10.807  42.617  23.063  1.00 25.86  ? 726  PHE D CD2 1 
ATOM   4766 C  CE1 . PHE D 1 127 ? 9.876   44.699  21.533  1.00 28.52  ? 726  PHE D CE1 1 
ATOM   4767 C  CE2 . PHE D 1 127 ? 10.737  42.477  21.687  1.00 16.01  ? 726  PHE D CE2 1 
ATOM   4768 C  CZ  . PHE D 1 127 ? 10.272  43.526  20.923  1.00 19.65  ? 726  PHE D CZ  1 
ATOM   4769 N  N   . THR D 1 128 ? 8.302   41.986  25.858  1.00 0.00   ? 727  THR D N   1 
ATOM   4770 C  CA  . THR D 1 128 ? 7.416   40.888  25.514  1.00 10.15  ? 727  THR D CA  1 
ATOM   4771 C  C   . THR D 1 128 ? 5.999   41.162  26.018  1.00 22.30  ? 727  THR D C   1 
ATOM   4772 O  O   . THR D 1 128 ? 5.015   40.675  25.471  1.00 17.43  ? 727  THR D O   1 
ATOM   4773 C  CB  . THR D 1 128 ? 7.889   39.556  26.118  1.00 11.83  ? 727  THR D CB  1 
ATOM   4774 O  OG1 . THR D 1 128 ? 9.292   39.395  25.901  1.00 25.42  ? 727  THR D OG1 1 
ATOM   4775 C  CG2 . THR D 1 128 ? 7.198   38.380  25.446  1.00 8.75   ? 727  THR D CG2 1 
ATOM   4776 N  N   . ARG D 1 129 ? 5.915   41.951  27.087  1.00 14.31  ? 728  ARG D N   1 
ATOM   4777 C  CA  . ARG D 1 129 ? 4.617   42.333  27.639  1.00 17.41  ? 728  ARG D CA  1 
ATOM   4778 C  C   . ARG D 1 129 ? 3.928   43.344  26.740  1.00 17.90  ? 728  ARG D C   1 
ATOM   4779 O  O   . ARG D 1 129 ? 2.752   43.312  26.372  1.00 17.39  ? 728  ARG D O   1 
ATOM   4780 C  CB  . ARG D 1 129 ? 4.837   42.903  29.041  1.00 18.72  ? 728  ARG D CB  1 
ATOM   4781 C  CG  . ARG D 1 129 ? 3.695   43.716  29.608  1.00 16.46  ? 728  ARG D CG  1 
ATOM   4782 C  CD  . ARG D 1 129 ? 4.174   45.083  30.100  1.00 17.47  ? 728  ARG D CD  1 
ATOM   4783 N  NE  . ARG D 1 129 ? 4.924   44.935  31.334  1.00 24.20  ? 728  ARG D NE  1 
ATOM   4784 C  CZ  . ARG D 1 129 ? 5.802   45.753  31.882  1.00 15.34  ? 728  ARG D CZ  1 
ATOM   4785 N  NH1 . ARG D 1 129 ? 6.117   46.904  31.308  1.00 21.15  ? 728  ARG D NH1 1 
ATOM   4786 N  NH2 . ARG D 1 129 ? 6.362   45.388  33.030  1.00 17.25  ? 728  ARG D NH2 1 
ATOM   4787 N  N   . GLU D 1 130 ? 4.722   44.345  26.357  1.00 14.59  ? 729  GLU D N   1 
ATOM   4788 C  CA  . GLU D 1 130 ? 4.138   45.377  25.491  1.00 19.90  ? 729  GLU D CA  1 
ATOM   4789 C  C   . GLU D 1 130 ? 3.770   44.782  24.141  1.00 27.92  ? 729  GLU D C   1 
ATOM   4790 O  O   . GLU D 1 130 ? 2.735   45.127  23.561  1.00 17.14  ? 729  GLU D O   1 
ATOM   4791 C  CB  . GLU D 1 130 ? 5.115   46.546  25.420  1.00 15.33  ? 729  GLU D CB  1 
ATOM   4792 C  CG  . GLU D 1 130 ? 5.398   47.121  26.806  1.00 23.06  ? 729  GLU D CG  1 
ATOM   4793 C  CD  . GLU D 1 130 ? 4.127   47.600  27.491  1.00 38.08  ? 729  GLU D CD  1 
ATOM   4794 O  OE1 . GLU D 1 130 ? 3.136   47.901  26.786  1.00 23.75  ? 729  GLU D OE1 1 
ATOM   4795 O  OE2 . GLU D 1 130 ? 4.120   47.677  28.741  1.00 40.00  ? 729  GLU D OE2 1 
ATOM   4796 N  N   . LEU D 1 131 ? 4.581   43.861  23.627  1.00 28.62  ? 730  LEU D N   1 
ATOM   4797 C  CA  . LEU D 1 131 ? 4.214   43.127  22.418  1.00 30.65  ? 730  LEU D CA  1 
ATOM   4798 C  C   . LEU D 1 131 ? 2.841   42.480  22.582  1.00 32.96  ? 730  LEU D C   1 
ATOM   4799 O  O   . LEU D 1 131 ? 1.922   42.609  21.769  1.00 23.32  ? 730  LEU D O   1 
ATOM   4800 C  CB  . LEU D 1 131 ? 5.263   42.059  22.105  1.00 27.64  ? 730  LEU D CB  1 
ATOM   4801 C  CG  . LEU D 1 131 ? 6.575   42.530  21.485  1.00 30.76  ? 730  LEU D CG  1 
ATOM   4802 C  CD1 . LEU D 1 131 ? 7.408   41.340  21.026  1.00 36.47  ? 730  LEU D CD1 1 
ATOM   4803 C  CD2 . LEU D 1 131 ? 6.322   43.481  20.321  1.00 30.69  ? 730  LEU D CD2 1 
ATOM   4804 N  N   . PHE D 1 132 ? 2.708   41.752  23.694  1.00 22.49  ? 731  PHE D N   1 
ATOM   4805 C  CA  . PHE D 1 132 ? 1.431   41.095  23.987  1.00 23.35  ? 731  PHE D CA  1 
ATOM   4806 C  C   . PHE D 1 132 ? 0.296   42.103  24.095  1.00 23.96  ? 731  PHE D C   1 
ATOM   4807 O  O   . PHE D 1 132 ? -0.799  41.926  23.563  1.00 15.20  ? 731  PHE D O   1 
ATOM   4808 C  CB  . PHE D 1 132 ? 1.589   40.290  25.272  1.00 18.67  ? 731  PHE D CB  1 
ATOM   4809 C  CG  . PHE D 1 132 ? 0.398   39.483  25.736  1.00 5.76   ? 731  PHE D CG  1 
ATOM   4810 C  CD1 . PHE D 1 132 ? -0.590  40.068  26.524  1.00 7.78   ? 731  PHE D CD1 1 
ATOM   4811 C  CD2 . PHE D 1 132 ? 0.285   38.152  25.385  1.00 8.92   ? 731  PHE D CD2 1 
ATOM   4812 C  CE1 . PHE D 1 132 ? -1.678  39.331  26.949  1.00 2.48   ? 731  PHE D CE1 1 
ATOM   4813 C  CE2 . PHE D 1 132 ? -0.803  37.408  25.818  1.00 21.39  ? 731  PHE D CE2 1 
ATOM   4814 C  CZ  . PHE D 1 132 ? -1.774  37.998  26.607  1.00 12.12  ? 731  PHE D CZ  1 
ATOM   4815 N  N   . TYR D 1 133 ? 0.549   43.182  24.828  1.00 29.23  ? 732  TYR D N   1 
ATOM   4816 C  CA  . TYR D 1 133 ? -0.476  44.178  25.094  1.00 28.06  ? 732  TYR D CA  1 
ATOM   4817 C  C   . TYR D 1 133 ? -0.951  44.822  23.795  1.00 27.14  ? 732  TYR D C   1 
ATOM   4818 O  O   . TYR D 1 133 ? -2.145  45.069  23.619  1.00 31.83  ? 732  TYR D O   1 
ATOM   4819 C  CB  . TYR D 1 133 ? 0.037   45.248  26.062  1.00 30.66  ? 732  TYR D CB  1 
ATOM   4820 C  CG  . TYR D 1 133 ? 0.075   44.818  27.508  1.00 27.38  ? 732  TYR D CG  1 
ATOM   4821 C  CD1 . TYR D 1 133 ? -0.536  43.638  27.907  1.00 23.02  ? 732  TYR D CD1 1 
ATOM   4822 C  CD2 . TYR D 1 133 ? 0.714   45.576  28.483  1.00 28.38  ? 732  TYR D CD2 1 
ATOM   4823 C  CE1 . TYR D 1 133 ? -0.520  43.215  29.221  1.00 15.26  ? 732  TYR D CE1 1 
ATOM   4824 C  CE2 . TYR D 1 133 ? 0.736   45.159  29.806  1.00 24.90  ? 732  TYR D CE2 1 
ATOM   4825 C  CZ  . TYR D 1 133 ? 0.123   43.981  30.170  1.00 14.66  ? 732  TYR D CZ  1 
ATOM   4826 O  OH  . TYR D 1 133 ? 0.126   43.546  31.476  1.00 25.36  ? 732  TYR D OH  1 
ATOM   4827 N  N   . LYS D 1 134 ? -0.008  45.100  22.903  1.00 28.69  ? 733  LYS D N   1 
ATOM   4828 C  CA  . LYS D 1 134 ? -0.336  45.744  21.635  1.00 35.91  ? 733  LYS D CA  1 
ATOM   4829 C  C   . LYS D 1 134 ? -1.438  44.970  20.914  1.00 29.68  ? 733  LYS D C   1 
ATOM   4830 O  O   . LYS D 1 134 ? -2.338  45.551  20.322  1.00 25.69  ? 733  LYS D O   1 
ATOM   4831 C  CB  . LYS D 1 134 ? 0.903   45.852  20.743  1.00 36.59  ? 733  LYS D CB  1 
ATOM   4832 C  CG  . LYS D 1 134 ? 0.601   46.043  19.265  1.00 37.68  ? 733  LYS D CG  1 
ATOM   4833 C  CD  . LYS D 1 134 ? -0.019  47.404  18.999  1.00 44.74  ? 733  LYS D CD  1 
ATOM   4834 C  CE  . LYS D 1 134 ? 0.700   48.163  17.897  1.00 47.38  ? 733  LYS D CE  1 
ATOM   4835 N  NZ  . LYS D 1 134 ? 1.020   47.288  16.735  1.00 67.12  ? 733  LYS D NZ  1 
ATOM   4836 N  N   . LEU D 1 135 ? -1.324  43.651  21.002  1.00 27.22  ? 734  LEU D N   1 
ATOM   4837 C  CA  . LEU D 1 135 ? -2.174  42.720  20.289  1.00 31.17  ? 734  LEU D CA  1 
ATOM   4838 C  C   . LEU D 1 135 ? -3.469  42.398  21.018  1.00 32.79  ? 734  LEU D C   1 
ATOM   4839 O  O   . LEU D 1 135 ? -4.516  42.229  20.388  1.00 30.14  ? 734  LEU D O   1 
ATOM   4840 C  CB  . LEU D 1 135 ? -1.421  41.403  20.047  1.00 13.29  ? 734  LEU D CB  1 
ATOM   4841 C  CG  . LEU D 1 135 ? -0.229  41.440  19.092  1.00 22.48  ? 734  LEU D CG  1 
ATOM   4842 C  CD1 . LEU D 1 135 ? 0.457   40.080  19.082  1.00 10.00  ? 734  LEU D CD1 1 
ATOM   4843 C  CD2 . LEU D 1 135 ? -0.652  41.851  17.690  1.00 24.23  ? 734  LEU D CD2 1 
ATOM   4844 N  N   . PHE D 1 136 ? -3.423  42.267  22.345  1.00 24.20  ? 735  PHE D N   1 
ATOM   4845 C  CA  . PHE D 1 136 ? -4.623  41.757  23.008  1.00 17.56  ? 735  PHE D CA  1 
ATOM   4846 C  C   . PHE D 1 136 ? -5.056  42.575  24.210  1.00 28.32  ? 735  PHE D C   1 
ATOM   4847 O  O   . PHE D 1 136 ? -5.910  42.129  24.984  1.00 41.06  ? 735  PHE D O   1 
ATOM   4848 C  CB  . PHE D 1 136 ? -4.361  40.314  23.441  1.00 26.76  ? 735  PHE D CB  1 
ATOM   4849 C  CG  . PHE D 1 136 ? -3.563  39.446  22.486  1.00 24.78  ? 735  PHE D CG  1 
ATOM   4850 C  CD1 . PHE D 1 136 ? -4.023  39.155  21.217  1.00 29.48  ? 735  PHE D CD1 1 
ATOM   4851 C  CD2 . PHE D 1 136 ? -2.344  38.915  22.873  1.00 25.39  ? 735  PHE D CD2 1 
ATOM   4852 C  CE1 . PHE D 1 136 ? -3.302  38.356  20.347  1.00 30.59  ? 735  PHE D CE1 1 
ATOM   4853 C  CE2 . PHE D 1 136 ? -1.612  38.114  22.017  1.00 29.42  ? 735  PHE D CE2 1 
ATOM   4854 C  CZ  . PHE D 1 136 ? -2.089  37.827  20.752  1.00 29.62  ? 735  PHE D CZ  1 
ATOM   4855 N  N   . LYS D 1 137 ? -4.501  43.765  24.416  1.00 30.12  ? 736  LYS D N   1 
ATOM   4856 C  CA  . LYS D 1 137 ? -4.861  44.541  25.603  1.00 28.38  ? 736  LYS D CA  1 
ATOM   4857 C  C   . LYS D 1 137 ? -6.314  44.995  25.555  1.00 30.05  ? 736  LYS D C   1 
ATOM   4858 O  O   . LYS D 1 137 ? -7.065  44.802  26.511  1.00 23.23  ? 736  LYS D O   1 
ATOM   4859 C  CB  . LYS D 1 137 ? -3.937  45.747  25.729  1.00 31.28  ? 736  LYS D CB  1 
ATOM   4860 C  CG  . LYS D 1 137 ? -4.350  46.824  26.710  1.00 27.71  ? 736  LYS D CG  1 
ATOM   4861 C  CD  . LYS D 1 137 ? -3.293  47.919  26.769  1.00 30.12  ? 736  LYS D CD  1 
ATOM   4862 C  CE  . LYS D 1 137 ? -3.582  48.899  27.895  1.00 41.38  ? 736  LYS D CE  1 
ATOM   4863 N  NZ  . LYS D 1 137 ? -2.526  48.865  28.949  1.00 56.39  ? 736  LYS D NZ  1 
ATOM   4864 N  N   . GLU D 1 138 ? -6.670  45.600  24.430  1.00 32.15  ? 737  GLU D N   1 
ATOM   4865 C  CA  . GLU D 1 138 ? -7.998  46.143  24.188  1.00 30.89  ? 737  GLU D CA  1 
ATOM   4866 C  C   . GLU D 1 138 ? -9.071  45.082  24.426  1.00 27.83  ? 737  GLU D C   1 
ATOM   4867 O  O   . GLU D 1 138 ? -10.120 45.347  25.019  1.00 23.34  ? 737  GLU D O   1 
ATOM   4868 C  CB  . GLU D 1 138 ? -8.107  46.674  22.758  1.00 33.82  ? 737  GLU D CB  1 
ATOM   4869 C  CG  . GLU D 1 138 ? -8.003  48.179  22.628  1.00 37.54  ? 737  GLU D CG  1 
ATOM   4870 C  CD  . GLU D 1 138 ? -8.314  48.921  23.913  1.00 51.37  ? 737  GLU D CD  1 
ATOM   4871 O  OE1 . GLU D 1 138 ? -7.531  48.802  24.880  1.00 66.95  ? 737  GLU D OE1 1 
ATOM   4872 O  OE2 . GLU D 1 138 ? -9.342  49.627  23.953  1.00 67.41  ? 737  GLU D OE2 1 
ATOM   4873 N  N   . ASP D 1 139 ? -8.758  43.888  23.939  1.00 22.66  ? 738  ASP D N   1 
ATOM   4874 C  CA  . ASP D 1 139 ? -9.624  42.730  24.065  1.00 27.18  ? 738  ASP D CA  1 
ATOM   4875 C  C   . ASP D 1 139 ? -9.806  42.319  25.522  1.00 30.16  ? 738  ASP D C   1 
ATOM   4876 O  O   . ASP D 1 139 ? -10.939 42.090  25.951  1.00 33.41  ? 738  ASP D O   1 
ATOM   4877 C  CB  . ASP D 1 139 ? -9.057  41.545  23.275  1.00 31.46  ? 738  ASP D CB  1 
ATOM   4878 C  CG  . ASP D 1 139 ? -8.984  41.872  21.794  1.00 40.84  ? 738  ASP D CG  1 
ATOM   4879 O  OD1 . ASP D 1 139 ? -10.018 42.310  21.245  1.00 26.75  ? 738  ASP D OD1 1 
ATOM   4880 O  OD2 . ASP D 1 139 ? -7.891  41.694  21.221  1.00 53.80  ? 738  ASP D OD2 1 
ATOM   4881 N  N   . ILE D 1 140 ? -8.688  42.227  26.241  1.00 19.59  ? 739  ILE D N   1 
ATOM   4882 C  CA  . ILE D 1 140 ? -8.767  41.877  27.661  1.00 21.63  ? 739  ILE D CA  1 
ATOM   4883 C  C   . ILE D 1 140 ? -9.553  42.954  28.400  1.00 21.63  ? 739  ILE D C   1 
ATOM   4884 O  O   . ILE D 1 140 ? -10.382 42.677  29.260  1.00 19.81  ? 739  ILE D O   1 
ATOM   4885 C  CB  . ILE D 1 140 ? -7.382  41.708  28.299  1.00 25.82  ? 739  ILE D CB  1 
ATOM   4886 C  CG1 . ILE D 1 140 ? -6.398  40.898  27.447  1.00 35.45  ? 739  ILE D CG1 1 
ATOM   4887 C  CG2 . ILE D 1 140 ? -7.486  41.099  29.688  1.00 25.54  ? 739  ILE D CG2 1 
ATOM   4888 C  CD1 . ILE D 1 140 ? -5.497  39.985  28.247  1.00 27.32  ? 739  ILE D CD1 1 
ATOM   4889 N  N   . LEU D 1 141 ? -9.288  44.199  28.020  1.00 28.27  ? 740  LEU D N   1 
ATOM   4890 C  CA  . LEU D 1 141 ? -9.901  45.357  28.654  1.00 36.48  ? 740  LEU D CA  1 
ATOM   4891 C  C   . LEU D 1 141 ? -11.403 45.429  28.418  1.00 44.34  ? 740  LEU D C   1 
ATOM   4892 O  O   . LEU D 1 141 ? -12.164 45.775  29.326  1.00 57.79  ? 740  LEU D O   1 
ATOM   4893 C  CB  . LEU D 1 141 ? -9.220  46.628  28.139  1.00 32.51  ? 740  LEU D CB  1 
ATOM   4894 C  CG  . LEU D 1 141 ? -8.379  47.405  29.151  1.00 26.67  ? 740  LEU D CG  1 
ATOM   4895 C  CD1 . LEU D 1 141 ? -7.319  46.518  29.783  1.00 20.55  ? 740  LEU D CD1 1 
ATOM   4896 C  CD2 . LEU D 1 141 ? -7.745  48.618  28.485  1.00 19.50  ? 740  LEU D CD2 1 
ATOM   4897 N  N   . SER D 1 142 ? -11.863 45.115  27.206  1.00 43.28  ? 741  SER D N   1 
ATOM   4898 C  CA  . SER D 1 142 ? -13.309 45.142  26.973  1.00 39.68  ? 741  SER D CA  1 
ATOM   4899 C  C   . SER D 1 142 ? -13.949 43.921  27.630  1.00 33.10  ? 741  SER D C   1 
ATOM   4900 O  O   . SER D 1 142 ? -15.041 43.999  28.188  1.00 34.47  ? 741  SER D O   1 
ATOM   4901 C  CB  . SER D 1 142 ? -13.642 45.175  25.487  1.00 41.61  ? 741  SER D CB  1 
ATOM   4902 O  OG  . SER D 1 142 ? -13.907 43.868  25.003  1.00 37.72  ? 741  SER D OG  1 
ATOM   4903 N  N   . ALA D 1 143 ? -13.228 42.805  27.556  1.00 26.05  ? 742  ALA D N   1 
ATOM   4904 C  CA  . ALA D 1 143 ? -13.673 41.569  28.186  1.00 30.65  ? 742  ALA D CA  1 
ATOM   4905 C  C   . ALA D 1 143 ? -13.792 41.743  29.699  1.00 36.70  ? 742  ALA D C   1 
ATOM   4906 O  O   . ALA D 1 143 ? -14.745 41.280  30.320  1.00 49.41  ? 742  ALA D O   1 
ATOM   4907 C  CB  . ALA D 1 143 ? -12.729 40.421  27.859  1.00 20.68  ? 742  ALA D CB  1 
ATOM   4908 N  N   . ILE D 1 144 ? -12.807 42.421  30.280  1.00 41.61  ? 743  ILE D N   1 
ATOM   4909 C  CA  . ILE D 1 144 ? -12.787 42.718  31.705  1.00 41.01  ? 743  ILE D CA  1 
ATOM   4910 C  C   . ILE D 1 144 ? -14.103 43.323  32.170  1.00 46.03  ? 743  ILE D C   1 
ATOM   4911 O  O   . ILE D 1 144 ? -14.537 43.106  33.301  1.00 52.61  ? 743  ILE D O   1 
ATOM   4912 C  CB  . ILE D 1 144 ? -11.653 43.693  32.074  1.00 31.88  ? 743  ILE D CB  1 
ATOM   4913 C  CG1 . ILE D 1 144 ? -10.337 43.004  32.448  1.00 24.19  ? 743  ILE D CG1 1 
ATOM   4914 C  CG2 . ILE D 1 144 ? -12.107 44.638  33.176  1.00 41.59  ? 743  ILE D CG2 1 
ATOM   4915 C  CD1 . ILE D 1 144 ? -9.155  43.952  32.488  1.00 41.55  ? 743  ILE D CD1 1 
ATOM   4916 N  N   . LYS D 1 145 ? -14.757 44.090  31.299  1.00 48.47  ? 744  LYS D N   1 
ATOM   4917 C  CA  . LYS D 1 145 ? -16.009 44.723  31.703  1.00 48.28  ? 744  LYS D CA  1 
ATOM   4918 C  C   . LYS D 1 145 ? -17.189 43.756  31.648  1.00 46.06  ? 744  LYS D C   1 
ATOM   4919 O  O   . LYS D 1 145 ? -18.239 44.116  31.114  1.00 47.05  ? 744  LYS D O   1 
ATOM   4920 C  CB  . LYS D 1 145 ? -16.318 45.943  30.828  1.00 50.15  ? 744  LYS D CB  1 
ATOM   4921 C  CG  . LYS D 1 145 ? -17.458 46.788  31.388  1.00 51.44  ? 744  LYS D CG  1 
ATOM   4922 C  CD  . LYS D 1 145 ? -17.397 46.844  32.906  1.00 55.10  ? 744  LYS D CD  1 
ATOM   4923 C  CE  . LYS D 1 145 ? -17.173 48.267  33.398  1.00 61.41  ? 744  LYS D CE  1 
ATOM   4924 N  NZ  . LYS D 1 145 ? -15.897 48.415  34.152  1.00 67.44  ? 744  LYS D NZ  1 
ATOM   4925 N  N   . GLU D 1 146 ? -17.000 42.570  32.202  1.00 41.95  ? 745  GLU D N   1 
ATOM   4926 C  CA  . GLU D 1 146 ? -18.010 41.536  32.304  1.00 46.15  ? 745  GLU D CA  1 
ATOM   4927 C  C   . GLU D 1 146 ? -17.385 40.192  32.679  1.00 46.85  ? 745  GLU D C   1 
ATOM   4928 O  O   . GLU D 1 146 ? -18.034 39.394  33.350  1.00 39.18  ? 745  GLU D O   1 
ATOM   4929 C  CB  . GLU D 1 146 ? -18.790 41.376  30.997  1.00 57.47  ? 745  GLU D CB  1 
ATOM   4930 C  CG  . GLU D 1 146 ? -19.829 40.263  31.052  1.00 67.36  ? 745  GLU D CG  1 
ATOM   4931 C  CD  . GLU D 1 146 ? -20.988 40.606  31.961  1.00 73.40  ? 745  GLU D CD  1 
ATOM   4932 O  OE1 . GLU D 1 146 ? -21.743 41.548  31.637  1.00 89.60  ? 745  GLU D OE1 1 
ATOM   4933 O  OE2 . GLU D 1 146 ? -21.153 39.942  33.008  1.00 72.04  ? 745  GLU D OE2 1 
ATOM   4934 N  N   . GLY D 1 147 ? -16.154 39.967  32.240  1.00 59.07  ? 746  GLY D N   1 
ATOM   4935 C  CA  . GLY D 1 147 ? -15.424 38.732  32.481  1.00 63.37  ? 746  GLY D CA  1 
ATOM   4936 C  C   . GLY D 1 147 ? -16.304 37.516  32.212  1.00 69.58  ? 746  GLY D C   1 
ATOM   4937 O  O   . GLY D 1 147 ? -16.928 37.467  31.152  1.00 69.46  ? 746  GLY D O   1 
ATOM   4938 N  N   . ARG D 1 148 ? -16.339 36.603  33.163  1.00 78.61  ? 747  ARG D N   1 
ATOM   4939 C  CA  . ARG D 1 148 ? -17.140 35.392  33.196  1.00 89.23  ? 747  ARG D CA  1 
ATOM   4940 C  C   . ARG D 1 148 ? -17.377 34.789  31.815  1.00 96.32  ? 747  ARG D C   1 
ATOM   4941 O  O   . ARG D 1 148 ? -16.967 35.209  30.710  1.00 91.38  ? 747  ARG D O   1 
ATOM   4942 C  CB  . ARG D 1 148 ? -18.491 35.671  33.876  1.00 89.56  ? 747  ARG D CB  1 
ATOM   4943 C  CG  . ARG D 1 148 ? -18.406 35.787  35.390  1.00 88.43  ? 747  ARG D CG  1 
ATOM   4944 C  CD  . ARG D 1 148 ? -19.359 34.835  36.086  1.00 87.98  ? 747  ARG D CD  1 
ATOM   4945 N  NE  . ARG D 1 148 ? -19.979 35.443  37.263  1.00 84.95  ? 747  ARG D NE  1 
ATOM   4946 C  CZ  . ARG D 1 148 ? -20.974 34.929  37.977  1.00 80.04  ? 747  ARG D CZ  1 
ATOM   4947 N  NH1 . ARG D 1 148 ? -21.509 33.759  37.653  1.00 65.94  ? 747  ARG D NH1 1 
ATOM   4948 N  NH2 . ARG D 1 148 ? -21.440 35.592  39.028  1.00 76.18  ? 747  ARG D NH2 1 
HETATM 4949 MN MN  . MN  E 2 .   ? 0.664   2.186   12.563  1.00 24.60  ? 761  MN  A MN  1 
HETATM 4950 MN MN  . MN  F 2 .   ? 17.710  11.634  21.568  1.00 46.29  ? 762  MN  B MN  1 
HETATM 4951 MN MN  . MN  G 2 .   ? -1.528  34.661  48.415  1.00 29.42  ? 763  MN  C MN  1 
HETATM 4952 MN MN  . MN  H 2 .   ? -1.379  25.305  28.985  1.00 31.19  ? 764  MN  D MN  1 
HETATM 4953 O  O   . HOH I 3 .   ? 12.592  3.090   14.421  1.00 9.99   ? 1003 HOH A O   1 
HETATM 4954 O  O   . HOH I 3 .   ? 2.191   2.059   14.311  1.00 5.61   ? 1004 HOH A O   1 
HETATM 4955 O  O   . HOH I 3 .   ? -4.618  -14.201 9.934   1.00 15.96  ? 1012 HOH A O   1 
HETATM 4956 O  O   . HOH I 3 .   ? 16.909  -7.405  -0.675  1.00 19.28  ? 1016 HOH A O   1 
HETATM 4957 O  O   . HOH I 3 .   ? 6.479   0.664   17.525  1.00 23.09  ? 1024 HOH A O   1 
HETATM 4958 O  O   . HOH I 3 .   ? 0.354   -9.255  14.387  1.00 27.46  ? 1025 HOH A O   1 
HETATM 4959 O  O   . HOH I 3 .   ? 16.475  3.145   -7.835  1.00 18.96  ? 1026 HOH A O   1 
HETATM 4960 O  O   . HOH I 3 .   ? -4.433  9.486   4.120   1.00 32.45  ? 1028 HOH A O   1 
HETATM 4961 O  O   . HOH I 3 .   ? 9.001   -17.971 8.322   1.00 19.07  ? 1029 HOH A O   1 
HETATM 4962 O  O   . HOH I 3 .   ? -13.069 -2.716  2.080   1.00 12.68  ? 1031 HOH A O   1 
HETATM 4963 O  O   . HOH I 3 .   ? 13.385  1.966   -5.822  1.00 27.48  ? 1032 HOH A O   1 
HETATM 4964 O  O   . HOH I 3 .   ? -1.725  4.230   9.108   1.00 21.08  ? 1037 HOH A O   1 
HETATM 4965 O  O   . HOH I 3 .   ? 12.497  -15.523 12.169  1.00 22.23  ? 1043 HOH A O   1 
HETATM 4966 O  O   . HOH I 3 .   ? -1.462  -16.725 12.562  1.00 30.44  ? 1045 HOH A O   1 
HETATM 4967 O  O   . HOH I 3 .   ? -12.312 6.824   5.630   1.00 30.07  ? 1046 HOH A O   1 
HETATM 4968 O  O   . HOH I 3 .   ? 0.141   -1.966  17.312  1.00 30.38  ? 1047 HOH A O   1 
HETATM 4969 O  O   . HOH I 3 .   ? -19.631 5.399   5.263   1.00 19.87  ? 1051 HOH A O   1 
HETATM 4970 O  O   . HOH I 3 .   ? -5.941  -3.224  14.517  1.00 30.83  ? 1052 HOH A O   1 
HETATM 4971 O  O   . HOH I 3 .   ? 1.600   0.526   16.119  1.00 23.69  ? 1054 HOH A O   1 
HETATM 4972 O  O   . HOH I 3 .   ? -0.661  3.276   14.097  1.00 25.44  ? 1056 HOH A O   1 
HETATM 4973 O  O   . HOH I 3 .   ? 8.587   -5.890  -7.820  1.00 21.34  ? 1057 HOH A O   1 
HETATM 4974 O  O   . HOH I 3 .   ? 7.034   -22.270 1.910   1.00 17.32  ? 1059 HOH A O   1 
HETATM 4975 O  O   . HOH I 3 .   ? -6.357  -3.627  17.063  1.00 19.94  ? 1060 HOH A O   1 
HETATM 4976 O  O   . HOH I 3 .   ? 8.908   -20.999 7.549   1.00 21.83  ? 1061 HOH A O   1 
HETATM 4977 O  O   . HOH I 3 .   ? -3.108  0.290   -1.650  1.00 24.59  ? 1063 HOH A O   1 
HETATM 4978 O  O   . HOH I 3 .   ? -2.856  3.445   12.872  1.00 24.76  ? 1064 HOH A O   1 
HETATM 4979 O  O   . HOH I 3 .   ? 19.205  -12.421 12.221  1.00 32.89  ? 1065 HOH A O   1 
HETATM 4980 O  O   . HOH I 3 .   ? 4.791   11.918  10.825  1.00 35.11  ? 1068 HOH A O   1 
HETATM 4981 O  O   . HOH I 3 .   ? -1.841  -15.976 9.756   1.00 23.60  ? 1073 HOH A O   1 
HETATM 4982 O  O   . HOH I 3 .   ? 17.925  0.637   -5.323  1.00 33.61  ? 1075 HOH A O   1 
HETATM 4983 O  O   . HOH I 3 .   ? 0.865   -28.562 -3.409  1.00 53.56  ? 1077 HOH A O   1 
HETATM 4984 O  O   . HOH I 3 .   ? -6.288  -18.117 7.219   1.00 35.44  ? 1083 HOH A O   1 
HETATM 4985 O  O   . HOH I 3 .   ? 16.955  15.026  -9.467  1.00 22.58  ? 1085 HOH A O   1 
HETATM 4986 O  O   . HOH I 3 .   ? -3.490  -1.533  14.996  1.00 29.94  ? 1086 HOH A O   1 
HETATM 4987 O  O   . HOH I 3 .   ? -10.335 -17.052 5.716   1.00 48.52  ? 1090 HOH A O   1 
HETATM 4988 O  O   . HOH I 3 .   ? 7.349   -18.225 10.480  1.00 21.81  ? 1091 HOH A O   1 
HETATM 4989 O  O   . HOH I 3 .   ? 11.437  -4.403  -7.057  1.00 24.72  ? 1095 HOH A O   1 
HETATM 4990 O  O   . HOH I 3 .   ? 7.366   -24.642 1.857   1.00 39.65  ? 1098 HOH A O   1 
HETATM 4991 O  O   . HOH I 3 .   ? -13.035 -8.891  15.711  1.00 44.18  ? 1099 HOH A O   1 
HETATM 4992 O  O   . HOH I 3 .   ? 18.830  -15.243 7.770   1.00 23.43  ? 1100 HOH A O   1 
HETATM 4993 O  O   . HOH I 3 .   ? 0.510   24.881  -4.474  1.00 47.72  ? 1108 HOH A O   1 
HETATM 4994 O  O   . HOH I 3 .   ? 13.148  -15.450 14.862  1.00 23.93  ? 1112 HOH A O   1 
HETATM 4995 O  O   . HOH I 3 .   ? -12.076 -19.768 18.708  1.00 37.44  ? 1113 HOH A O   1 
HETATM 4996 O  O   . HOH I 3 .   ? -12.850 0.059   0.205   1.00 63.95  ? 1116 HOH A O   1 
HETATM 4997 O  O   . HOH I 3 .   ? -5.132  -0.160  11.649  1.00 30.70  ? 1122 HOH A O   1 
HETATM 4998 O  O   . HOH I 3 .   ? 21.518  -7.156  2.507   1.00 37.25  ? 1134 HOH A O   1 
HETATM 4999 O  O   . HOH I 3 .   ? 22.604  22.211  0.266   1.00 29.25  ? 1136 HOH A O   1 
HETATM 5000 O  O   . HOH I 3 .   ? 1.285   4.110   11.781  1.00 40.76  ? 1137 HOH A O   1 
HETATM 5001 O  O   . HOH I 3 .   ? 11.611  -0.083  -8.260  1.00 40.33  ? 1139 HOH A O   1 
HETATM 5002 O  O   . HOH I 3 .   ? -2.697  -11.533 16.816  1.00 20.93  ? 1143 HOH A O   1 
HETATM 5003 O  O   . HOH I 3 .   ? -2.161  -19.367 1.711   1.00 42.48  ? 1145 HOH A O   1 
HETATM 5004 O  O   . HOH I 3 .   ? -3.885  5.246   -1.081  1.00 28.28  ? 1146 HOH A O   1 
HETATM 5005 O  O   . HOH I 3 .   ? -5.444  -5.555  13.064  1.00 19.10  ? 1150 HOH A O   1 
HETATM 5006 O  O   . HOH I 3 .   ? -1.229  -13.692 16.910  1.00 25.86  ? 1155 HOH A O   1 
HETATM 5007 O  O   . HOH I 3 .   ? -2.970  3.966   16.670  1.00 32.35  ? 1159 HOH A O   1 
HETATM 5008 O  O   . HOH I 3 .   ? 6.275   26.423  -2.643  1.00 24.96  ? 1163 HOH A O   1 
HETATM 5009 O  O   . HOH I 3 .   ? 5.564   12.041  -2.430  1.00 43.47  ? 1165 HOH A O   1 
HETATM 5010 O  O   . HOH I 3 .   ? -2.038  -9.200  17.048  1.00 37.10  ? 1167 HOH A O   1 
HETATM 5011 O  O   . HOH I 3 .   ? -9.408  -15.472 15.192  1.00 19.61  ? 1172 HOH A O   1 
HETATM 5012 O  O   . HOH I 3 .   ? 19.307  22.093  -2.112  1.00 42.79  ? 1180 HOH A O   1 
HETATM 5013 O  O   . HOH I 3 .   ? 4.945   -14.828 -6.705  1.00 23.51  ? 1185 HOH A O   1 
HETATM 5014 O  O   . HOH I 3 .   ? -2.701  -20.108 8.301   1.00 34.85  ? 1195 HOH A O   1 
HETATM 5015 O  O   . HOH I 3 .   ? -9.540  5.845   -2.492  1.00 46.53  ? 1196 HOH A O   1 
HETATM 5016 O  O   . HOH I 3 .   ? 9.911   20.028  1.141   1.00 31.67  ? 1198 HOH A O   1 
HETATM 5017 O  O   . HOH I 3 .   ? -14.570 -12.451 12.962  1.00 25.74  ? 1199 HOH A O   1 
HETATM 5018 O  O   . HOH I 3 .   ? 14.745  9.336   -7.518  1.00 32.44  ? 1203 HOH A O   1 
HETATM 5019 O  O   . HOH I 3 .   ? 3.188   6.399   12.558  1.00 38.08  ? 1213 HOH A O   1 
HETATM 5020 O  O   . HOH I 3 .   ? -14.795 -11.121 16.836  1.00 44.46  ? 1221 HOH A O   1 
HETATM 5021 O  O   . HOH I 3 .   ? -5.988  -20.955 2.750   1.00 38.41  ? 1224 HOH A O   1 
HETATM 5022 O  O   . HOH I 3 .   ? 6.103   -20.032 -4.931  1.00 36.19  ? 1225 HOH A O   1 
HETATM 5023 O  O   . HOH I 3 .   ? 6.275   -7.512  -9.813  1.00 30.02  ? 1233 HOH A O   1 
HETATM 5024 O  O   . HOH I 3 .   ? 12.929  22.028  12.117  1.00 26.76  ? 1236 HOH A O   1 
HETATM 5025 O  O   . HOH I 3 .   ? 21.016  -11.113 3.789   1.00 32.53  ? 1237 HOH A O   1 
HETATM 5026 O  O   . HOH I 3 .   ? -4.026  -14.363 19.937  1.00 29.91  ? 1239 HOH A O   1 
HETATM 5027 O  O   . HOH I 3 .   ? 7.166   12.063  -8.372  1.00 39.86  ? 1247 HOH A O   1 
HETATM 5028 O  O   . HOH I 3 .   ? -2.604  -18.985 17.816  1.00 59.71  ? 1249 HOH A O   1 
HETATM 5029 O  O   . HOH I 3 .   ? -18.318 1.529   1.739   1.00 40.21  ? 1253 HOH A O   1 
HETATM 5030 O  O   . HOH I 3 .   ? 21.082  -3.224  -5.027  1.00 34.84  ? 1255 HOH A O   1 
HETATM 5031 O  O   . HOH I 3 .   ? -7.229  -18.696 5.112   1.00 74.36  ? 1267 HOH A O   1 
HETATM 5032 O  O   . HOH I 3 .   ? 6.402   -20.600 -1.728  1.00 23.00  ? 1269 HOH A O   1 
HETATM 5033 O  O   . HOH I 3 .   ? 11.203  -5.835  -4.904  1.00 35.69  ? 1275 HOH A O   1 
HETATM 5034 O  O   . HOH I 3 .   ? -11.142 5.606   2.211   1.00 40.18  ? 1279 HOH A O   1 
HETATM 5035 O  O   . HOH I 3 .   ? -21.680 -9.704  9.384   1.00 35.44  ? 1282 HOH A O   1 
HETATM 5036 O  O   . HOH I 3 .   ? 7.951   -20.913 0.257   1.00 30.33  ? 1284 HOH A O   1 
HETATM 5037 O  O   . HOH I 3 .   ? 11.368  -8.550  -8.457  1.00 28.76  ? 1290 HOH A O   1 
HETATM 5038 O  O   . HOH I 3 .   ? -1.565  9.473   -0.149  1.00 24.03  ? 1297 HOH A O   1 
HETATM 5039 O  O   . HOH I 3 .   ? 5.308   -22.641 6.039   1.00 39.52  ? 1298 HOH A O   1 
HETATM 5040 O  O   . HOH I 3 .   ? -8.542  -15.804 -5.531  1.00 25.92  ? 1300 HOH A O   1 
HETATM 5041 O  O   . HOH I 3 .   ? 22.491  6.392   -4.810  1.00 61.11  ? 1301 HOH A O   1 
HETATM 5042 O  O   . HOH I 3 .   ? -0.410  -6.339  -6.327  1.00 39.33  ? 1305 HOH A O   1 
HETATM 5043 O  O   . HOH I 3 .   ? 5.848   -22.917 -5.308  1.00 57.60  ? 1306 HOH A O   1 
HETATM 5044 O  O   . HOH I 3 .   ? 3.299   -18.519 -3.094  1.00 53.32  ? 1307 HOH A O   1 
HETATM 5045 O  O   . HOH I 3 .   ? -3.304  2.676   -6.058  1.00 36.39  ? 1312 HOH A O   1 
HETATM 5046 O  O   . HOH I 3 .   ? -14.873 -10.331 20.218  1.00 35.34  ? 1327 HOH A O   1 
HETATM 5047 O  O   . HOH I 3 .   ? 20.925  -15.779 11.437  1.00 32.80  ? 1331 HOH A O   1 
HETATM 5048 O  O   . HOH I 3 .   ? 1.183   14.995  5.586   1.00 41.12  ? 1332 HOH A O   1 
HETATM 5049 O  O   . HOH I 3 .   ? -19.925 3.356   6.276   1.00 55.71  ? 1346 HOH A O   1 
HETATM 5050 O  O   . HOH I 3 .   ? 20.027  -9.799  -3.102  1.00 29.75  ? 1347 HOH A O   1 
HETATM 5051 O  O   . HOH I 3 .   ? 0.693   23.883  -7.658  1.00 52.80  ? 1351 HOH A O   1 
HETATM 5052 O  O   . HOH I 3 .   ? 6.298   29.531  -3.320  1.00 42.31  ? 1352 HOH A O   1 
HETATM 5053 O  O   . HOH I 3 .   ? -2.188  9.707   12.819  1.00 57.79  ? 1354 HOH A O   1 
HETATM 5054 O  O   . HOH I 3 .   ? 8.223   -13.391 16.958  1.00 59.28  ? 1360 HOH A O   1 
HETATM 5055 O  O   . HOH I 3 .   ? -10.762 -16.570 10.211  1.00 38.24  ? 1365 HOH A O   1 
HETATM 5056 O  O   . HOH I 3 .   ? 20.848  -12.759 10.447  1.00 41.42  ? 1368 HOH A O   1 
HETATM 5057 O  O   . HOH I 3 .   ? -3.440  -17.787 11.111  1.00 53.27  ? 1370 HOH A O   1 
HETATM 5058 O  O   . HOH I 3 .   ? 15.194  3.326   -5.436  1.00 48.57  ? 1376 HOH A O   1 
HETATM 5059 O  O   . HOH I 3 .   ? -9.321  3.838   0.591   1.00 50.11  ? 1377 HOH A O   1 
HETATM 5060 O  O   . HOH I 3 .   ? 22.390  -8.986  3.830   1.00 34.44  ? 1378 HOH A O   1 
HETATM 5061 O  O   . HOH I 3 .   ? 12.346  12.010  13.163  1.00 51.57  ? 1380 HOH A O   1 
HETATM 5062 O  O   . HOH I 3 .   ? -7.812  -16.461 9.489   1.00 45.01  ? 1381 HOH A O   1 
HETATM 5063 O  O   . HOH I 3 .   ? -0.719  12.016  14.800  1.00 57.73  ? 1390 HOH A O   1 
HETATM 5064 O  O   . HOH I 3 .   ? -5.215  -2.877  -8.623  1.00 48.40  ? 1396 HOH A O   1 
HETATM 5065 O  O   . HOH I 3 .   ? 19.483  -7.746  -0.679  1.00 42.46  ? 1397 HOH A O   1 
HETATM 5066 O  O   . HOH I 3 .   ? -0.381  -19.573 14.174  1.00 29.38  ? 1399 HOH A O   1 
HETATM 5067 O  O   . HOH I 3 .   ? 12.121  -17.868 8.702   1.00 29.89  ? 1400 HOH A O   1 
HETATM 5068 O  O   . HOH I 3 .   ? 15.909  7.432   -10.520 1.00 54.99  ? 1402 HOH A O   1 
HETATM 5069 O  O   . HOH I 3 .   ? 21.170  2.441   3.738   1.00 30.84  ? 1406 HOH A O   1 
HETATM 5070 O  O   . HOH I 3 .   ? 3.504   25.031  -2.909  1.00 39.40  ? 1416 HOH A O   1 
HETATM 5071 O  O   . HOH I 3 .   ? -7.816  3.353   -1.313  1.00 37.34  ? 1417 HOH A O   1 
HETATM 5072 O  O   . HOH I 3 .   ? 15.609  -8.037  -3.190  1.00 49.64  ? 1422 HOH A O   1 
HETATM 5073 O  O   . HOH I 3 .   ? -3.839  -11.525 0.255   1.00 51.79  ? 1423 HOH A O   1 
HETATM 5074 O  O   . HOH I 3 .   ? -2.733  1.000   15.733  1.00 41.78  ? 1427 HOH A O   1 
HETATM 5075 O  O   . HOH I 3 .   ? -4.520  9.195   11.324  1.00 53.94  ? 1432 HOH A O   1 
HETATM 5076 O  O   . HOH I 3 .   ? 14.094  1.543   -9.766  1.00 77.23  ? 1437 HOH A O   1 
HETATM 5077 O  O   . HOH I 3 .   ? -13.785 -17.288 11.732  1.00 49.71  ? 1438 HOH A O   1 
HETATM 5078 O  O   . HOH I 3 .   ? 21.012  21.301  -3.705  1.00 39.73  ? 1442 HOH A O   1 
HETATM 5079 O  O   . HOH I 3 .   ? -12.266 -14.396 14.642  1.00 39.96  ? 1443 HOH A O   1 
HETATM 5080 O  O   . HOH I 3 .   ? 22.022  -5.427  -0.119  1.00 55.49  ? 1444 HOH A O   1 
HETATM 5081 O  O   . HOH I 3 .   ? 9.168   23.482  0.420   1.00 41.32  ? 1447 HOH A O   1 
HETATM 5082 O  O   . HOH I 3 .   ? 13.667  -4.847  -8.319  1.00 39.90  ? 1451 HOH A O   1 
HETATM 5083 O  O   . HOH I 3 .   ? 13.465  -7.244  -6.338  1.00 41.71  ? 1454 HOH A O   1 
HETATM 5084 O  O   . HOH I 3 .   ? 5.687   19.598  -1.595  1.00 26.53  ? 1460 HOH A O   1 
HETATM 5085 O  O   . HOH I 3 .   ? -16.367 -16.995 9.531   1.00 42.59  ? 1466 HOH A O   1 
HETATM 5086 O  O   . HOH I 3 .   ? 25.114  7.160   -1.442  1.00 41.64  ? 1468 HOH A O   1 
HETATM 5087 O  O   . HOH I 3 .   ? -18.355 -8.185  5.673   1.00 48.20  ? 1470 HOH A O   1 
HETATM 5088 O  O   . HOH I 3 .   ? 4.773   21.380  0.758   1.00 43.81  ? 1478 HOH A O   1 
HETATM 5089 O  O   . HOH I 3 .   ? 21.036  -9.120  1.029   1.00 43.09  ? 1479 HOH A O   1 
HETATM 5090 O  O   . HOH I 3 .   ? -2.405  -20.412 5.899   1.00 40.62  ? 1480 HOH A O   1 
HETATM 5091 O  O   . HOH I 3 .   ? -14.955 -14.655 14.466  1.00 33.32  ? 1484 HOH A O   1 
HETATM 5092 O  O   . HOH I 3 .   ? 16.948  7.407   -7.192  1.00 36.26  ? 1486 HOH A O   1 
HETATM 5093 O  O   . HOH I 3 .   ? 21.196  16.233  -5.703  1.00 66.55  ? 1488 HOH A O   1 
HETATM 5094 O  O   . HOH I 3 .   ? 3.474   23.884  1.702   1.00 49.43  ? 1495 HOH A O   1 
HETATM 5095 O  O   . HOH I 3 .   ? 17.942  12.168  -12.819 1.00 47.57  ? 1496 HOH A O   1 
HETATM 5096 O  O   . HOH I 3 .   ? 22.726  21.270  -1.961  1.00 57.73  ? 1502 HOH A O   1 
HETATM 5097 O  O   . HOH I 3 .   ? 10.131  -16.078 14.719  1.00 63.78  ? 1505 HOH A O   1 
HETATM 5098 O  O   . HOH I 3 .   ? 25.514  -6.156  -0.094  1.00 34.60  ? 1507 HOH A O   1 
HETATM 5099 O  O   . HOH I 3 .   ? -19.413 -11.684 7.744   1.00 46.50  ? 1508 HOH A O   1 
HETATM 5100 O  O   . HOH I 3 .   ? 8.502   9.604   -8.122  1.00 58.58  ? 1509 HOH A O   1 
HETATM 5101 O  O   . HOH I 3 .   ? -2.409  6.552   13.131  1.00 26.93  ? 1511 HOH A O   1 
HETATM 5102 O  O   . HOH I 3 .   ? 1.915   6.587   8.877   1.00 62.88  ? 1512 HOH A O   1 
HETATM 5103 O  O   . HOH I 3 .   ? -0.521  -21.851 16.722  1.00 70.47  ? 1513 HOH A O   1 
HETATM 5104 O  O   . HOH I 3 .   ? -16.041 -13.278 17.704  1.00 47.33  ? 1521 HOH A O   1 
HETATM 5105 O  O   . HOH I 3 .   ? -14.261 -4.556  2.979   1.00 63.21  ? 1523 HOH A O   1 
HETATM 5106 O  O   . HOH I 3 .   ? 2.406   -22.401 -7.388  1.00 47.00  ? 1524 HOH A O   1 
HETATM 5107 O  O   . HOH I 3 .   ? 17.950  16.680  -11.773 1.00 37.98  ? 1532 HOH A O   1 
HETATM 5108 O  O   . HOH I 3 .   ? -5.826  7.673   0.462   1.00 41.67  ? 1536 HOH A O   1 
HETATM 5109 O  O   . HOH I 3 .   ? -6.527  2.857   -4.208  1.00 46.88  ? 1539 HOH A O   1 
HETATM 5110 O  O   . HOH I 3 .   ? 3.206   -21.340 4.925   1.00 29.79  ? 1542 HOH A O   1 
HETATM 5111 O  O   . HOH I 3 .   ? 17.445  -0.720  -7.116  1.00 78.43  ? 1544 HOH A O   1 
HETATM 5112 O  O   . HOH I 3 .   ? 8.592   18.956  -0.435  1.00 78.82  ? 1552 HOH A O   1 
HETATM 5113 O  O   . HOH I 3 .   ? 9.864   25.841  -3.392  1.00 57.58  ? 1566 HOH A O   1 
HETATM 5114 O  O   . HOH I 3 .   ? 3.552   -22.574 8.679   1.00 34.82  ? 1576 HOH A O   1 
HETATM 5115 O  O   . HOH I 3 .   ? 1.631   -24.592 8.241   1.00 64.77  ? 1577 HOH A O   1 
HETATM 5116 O  O   . HOH I 3 .   ? -1.493  -22.725 7.620   1.00 54.74  ? 1578 HOH A O   1 
HETATM 5117 O  O   . HOH I 3 .   ? 24.524  -0.923  2.693   1.00 38.07  ? 1583 HOH A O   1 
HETATM 5118 O  O   . HOH I 3 .   ? 6.260   -22.940 9.918   1.00 35.77  ? 1587 HOH A O   1 
HETATM 5119 O  O   . HOH I 3 .   ? -11.178 10.127  5.487   1.00 60.90  ? 1590 HOH A O   1 
HETATM 5120 O  O   . HOH I 3 .   ? 0.741   -23.626 -5.334  1.00 44.19  ? 1591 HOH A O   1 
HETATM 5121 O  O   . HOH I 3 .   ? 22.458  0.159   1.358   1.00 42.18  ? 1592 HOH A O   1 
HETATM 5122 O  O   . HOH I 3 .   ? 22.475  -16.099 9.088   1.00 49.79  ? 1596 HOH A O   1 
HETATM 5123 O  O   . HOH I 3 .   ? -3.388  -20.760 13.089  1.00 49.46  ? 1598 HOH A O   1 
HETATM 5124 O  O   . HOH I 3 .   ? 18.684  14.487  -10.959 1.00 51.28  ? 1599 HOH A O   1 
HETATM 5125 O  O   . HOH I 3 .   ? 21.211  17.861  -11.808 1.00 62.06  ? 1610 HOH A O   1 
HETATM 5126 O  O   . HOH I 3 .   ? -1.457  -12.331 20.648  1.00 57.35  ? 1615 HOH A O   1 
HETATM 5127 O  O   . HOH I 3 .   ? -8.951  7.908   8.468   1.00 29.75  ? 1621 HOH A O   1 
HETATM 5128 O  O   . HOH I 3 .   ? 4.051   -22.615 -2.128  1.00 44.20  ? 1624 HOH A O   1 
HETATM 5129 O  O   . HOH I 3 .   ? 24.833  -3.072  1.204   1.00 38.02  ? 1626 HOH A O   1 
HETATM 5130 O  O   . HOH I 3 .   ? 1.089   -22.339 -2.981  1.00 51.25  ? 1640 HOH A O   1 
HETATM 5131 O  O   . HOH I 3 .   ? 3.383   -5.844  -10.772 1.00 80.27  ? 1644 HOH A O   1 
HETATM 5132 O  O   . HOH I 3 .   ? 0.934   -25.192 -2.932  1.00 36.75  ? 1645 HOH A O   1 
HETATM 5133 O  O   . HOH I 3 .   ? -14.111 11.522  5.973   1.00 38.25  ? 1648 HOH A O   1 
HETATM 5134 O  O   . HOH I 3 .   ? -7.915  12.489  10.228  1.00 59.34  ? 1651 HOH A O   1 
HETATM 5135 O  O   . HOH I 3 .   ? -8.359  10.602  12.439  1.00 49.08  ? 1652 HOH A O   1 
HETATM 5136 O  O   . HOH I 3 .   ? -7.856  7.145   11.783  1.00 40.09  ? 1653 HOH A O   1 
HETATM 5137 O  O   . HOH I 3 .   ? -7.442  8.862   14.042  1.00 44.07  ? 1654 HOH A O   1 
HETATM 5138 O  O   . HOH I 3 .   ? 20.645  2.320   -1.033  1.00 54.52  ? 1656 HOH A O   1 
HETATM 5139 O  O   . HOH I 3 .   ? 23.962  1.712   3.111   1.00 52.00  ? 1657 HOH A O   1 
HETATM 5140 O  O   . HOH I 3 .   ? 25.043  3.719   -1.321  1.00 51.72  ? 1658 HOH A O   1 
HETATM 5141 O  O   . HOH I 3 .   ? -10.620 -13.362 -6.360  1.00 59.80  ? 1663 HOH A O   1 
HETATM 5142 O  O   . HOH I 3 .   ? -12.854 -5.525  0.956   1.00 52.51  ? 1667 HOH A O   1 
HETATM 5143 O  O   . HOH I 3 .   ? -18.852 -14.701 18.705  1.00 50.69  ? 1668 HOH A O   1 
HETATM 5144 O  O   . HOH I 3 .   ? 3.829   15.716  8.599   1.00 83.12  ? 1670 HOH A O   1 
HETATM 5145 O  O   . HOH I 3 .   ? 18.295  -5.189  -10.241 1.00 54.34  ? 1677 HOH A O   1 
HETATM 5146 O  O   . HOH I 3 .   ? 4.865   20.672  -6.692  1.00 66.65  ? 1683 HOH A O   1 
HETATM 5147 O  O   . HOH I 3 .   ? -11.591 -9.074  3.129   1.00 29.91  ? 1685 HOH A O   1 
HETATM 5148 O  O   . HOH I 3 .   ? -17.993 -15.792 13.465  1.00 50.36  ? 1690 HOH A O   1 
HETATM 5149 O  O   . HOH I 3 .   ? -7.354  -14.831 2.211   1.00 34.01  ? 1702 HOH A O   1 
HETATM 5150 O  O   . HOH I 3 .   ? -4.687  -14.300 -8.485  1.00 67.10  ? 1704 HOH A O   1 
HETATM 5151 O  O   . HOH I 3 .   ? 0.152   -22.161 0.246   1.00 39.34  ? 1707 HOH A O   1 
HETATM 5152 O  O   . HOH I 3 .   ? 7.511   4.278   10.376  1.00 42.38  ? 1710 HOH A O   1 
HETATM 5153 O  O   . HOH I 3 .   ? 8.379   11.654  -4.001  1.00 39.24  ? 1712 HOH A O   1 
HETATM 5154 O  O   . HOH J 3 .   ? 34.186  3.285   8.682   1.00 19.31  ? 1001 HOH B O   1 
HETATM 5155 O  O   . HOH J 3 .   ? 36.208  -4.065  13.407  1.00 9.59   ? 1002 HOH B O   1 
HETATM 5156 O  O   . HOH J 3 .   ? 16.431  13.687  21.941  1.00 19.04  ? 1007 HOH B O   1 
HETATM 5157 O  O   . HOH J 3 .   ? 35.677  -6.158  15.691  1.00 25.94  ? 1014 HOH B O   1 
HETATM 5158 O  O   . HOH J 3 .   ? 8.187   2.744   16.975  1.00 26.11  ? 1021 HOH B O   1 
HETATM 5159 O  O   . HOH J 3 .   ? 40.457  -0.249  12.601  1.00 17.80  ? 1033 HOH B O   1 
HETATM 5160 O  O   . HOH J 3 .   ? 22.849  -9.011  27.394  1.00 17.65  ? 1034 HOH B O   1 
HETATM 5161 O  O   . HOH J 3 .   ? 32.727  -7.137  16.739  1.00 20.85  ? 1035 HOH B O   1 
HETATM 5162 O  O   . HOH J 3 .   ? 29.078  -4.658  6.125   1.00 28.04  ? 1036 HOH B O   1 
HETATM 5163 O  O   . HOH J 3 .   ? 23.828  -10.419 9.729   1.00 28.79  ? 1066 HOH B O   1 
HETATM 5164 O  O   . HOH J 3 .   ? 30.344  -6.929  24.464  1.00 29.72  ? 1069 HOH B O   1 
HETATM 5165 O  O   . HOH J 3 .   ? 15.863  5.622   20.784  1.00 21.14  ? 1072 HOH B O   1 
HETATM 5166 O  O   . HOH J 3 .   ? 30.881  31.905  17.912  1.00 31.82  ? 1076 HOH B O   1 
HETATM 5167 O  O   . HOH J 3 .   ? 33.883  5.887   7.954   1.00 37.67  ? 1079 HOH B O   1 
HETATM 5168 O  O   . HOH J 3 .   ? 27.363  25.581  17.281  1.00 39.39  ? 1082 HOH B O   1 
HETATM 5169 O  O   . HOH J 3 .   ? 22.742  -6.247  29.991  1.00 41.70  ? 1087 HOH B O   1 
HETATM 5170 O  O   . HOH J 3 .   ? 17.542  14.897  32.340  1.00 36.38  ? 1106 HOH B O   1 
HETATM 5171 O  O   . HOH J 3 .   ? 28.628  -6.254  22.133  1.00 31.63  ? 1109 HOH B O   1 
HETATM 5172 O  O   . HOH J 3 .   ? 15.712  -10.223 17.667  1.00 36.71  ? 1111 HOH B O   1 
HETATM 5173 O  O   . HOH J 3 .   ? 30.683  30.716  33.613  1.00 66.42  ? 1115 HOH B O   1 
HETATM 5174 O  O   . HOH J 3 .   ? 32.659  10.609  10.888  1.00 45.81  ? 1117 HOH B O   1 
HETATM 5175 O  O   . HOH J 3 .   ? 27.336  6.634   31.371  1.00 28.96  ? 1120 HOH B O   1 
HETATM 5176 O  O   . HOH J 3 .   ? 15.691  -1.988  35.018  1.00 45.05  ? 1126 HOH B O   1 
HETATM 5177 O  O   . HOH J 3 .   ? 33.319  -9.589  15.692  1.00 40.07  ? 1127 HOH B O   1 
HETATM 5178 O  O   . HOH J 3 .   ? 15.311  9.819   14.049  1.00 25.68  ? 1129 HOH B O   1 
HETATM 5179 O  O   . HOH J 3 .   ? 34.639  30.893  30.098  1.00 39.89  ? 1130 HOH B O   1 
HETATM 5180 O  O   . HOH J 3 .   ? 24.098  -10.807 20.237  1.00 66.14  ? 1140 HOH B O   1 
HETATM 5181 O  O   . HOH J 3 .   ? 34.798  15.033  16.523  1.00 26.93  ? 1144 HOH B O   1 
HETATM 5182 O  O   . HOH J 3 .   ? 33.681  -6.211  12.727  1.00 20.56  ? 1154 HOH B O   1 
HETATM 5183 O  O   . HOH J 3 .   ? 27.857  16.244  9.906   1.00 45.94  ? 1156 HOH B O   1 
HETATM 5184 O  O   . HOH J 3 .   ? 12.930  12.102  25.616  1.00 45.58  ? 1157 HOH B O   1 
HETATM 5185 O  O   . HOH J 3 .   ? 34.921  -3.983  30.871  1.00 25.52  ? 1161 HOH B O   1 
HETATM 5186 O  O   . HOH J 3 .   ? 24.145  -4.149  5.029   1.00 29.04  ? 1171 HOH B O   1 
HETATM 5187 O  O   . HOH J 3 .   ? 28.098  24.315  14.113  1.00 36.75  ? 1173 HOH B O   1 
HETATM 5188 O  O   . HOH J 3 .   ? 23.050  1.070   34.965  1.00 25.10  ? 1175 HOH B O   1 
HETATM 5189 O  O   . HOH J 3 .   ? 41.696  2.284   11.866  1.00 34.97  ? 1183 HOH B O   1 
HETATM 5190 O  O   . HOH J 3 .   ? 38.139  0.032   32.998  1.00 32.37  ? 1186 HOH B O   1 
HETATM 5191 O  O   . HOH J 3 .   ? 27.731  3.664   36.270  1.00 32.13  ? 1197 HOH B O   1 
HETATM 5192 O  O   . HOH J 3 .   ? 16.444  -3.481  33.252  1.00 31.14  ? 1200 HOH B O   1 
HETATM 5193 O  O   . HOH J 3 .   ? -3.824  -2.664  21.949  1.00 44.96  ? 1205 HOH B O   1 
HETATM 5194 O  O   . HOH J 3 .   ? 28.138  -3.935  30.925  1.00 23.61  ? 1207 HOH B O   1 
HETATM 5195 O  O   . HOH J 3 .   ? 37.924  11.422  22.049  1.00 25.76  ? 1215 HOH B O   1 
HETATM 5196 O  O   . HOH J 3 .   ? 35.895  13.399  13.516  1.00 52.54  ? 1226 HOH B O   1 
HETATM 5197 O  O   . HOH J 3 .   ? 26.133  16.394  13.915  1.00 36.61  ? 1232 HOH B O   1 
HETATM 5198 O  O   . HOH J 3 .   ? 26.670  13.588  13.242  1.00 37.00  ? 1240 HOH B O   1 
HETATM 5199 O  O   . HOH J 3 .   ? 32.768  13.747  29.364  1.00 46.46  ? 1242 HOH B O   1 
HETATM 5200 O  O   . HOH J 3 .   ? 15.375  11.374  23.560  1.00 44.11  ? 1246 HOH B O   1 
HETATM 5201 O  O   . HOH J 3 .   ? 21.954  23.103  31.111  1.00 36.31  ? 1250 HOH B O   1 
HETATM 5202 O  O   . HOH J 3 .   ? 20.157  14.886  15.769  1.00 32.49  ? 1252 HOH B O   1 
HETATM 5203 O  O   . HOH J 3 .   ? -3.792  -5.294  26.869  1.00 36.29  ? 1254 HOH B O   1 
HETATM 5204 O  O   . HOH J 3 .   ? 18.656  11.855  25.935  1.00 37.32  ? 1256 HOH B O   1 
HETATM 5205 O  O   . HOH J 3 .   ? 36.585  22.216  28.425  1.00 43.45  ? 1260 HOH B O   1 
HETATM 5206 O  O   . HOH J 3 .   ? 30.530  -8.677  20.879  1.00 26.59  ? 1262 HOH B O   1 
HETATM 5207 O  O   . HOH J 3 .   ? 42.314  -0.586  16.080  1.00 38.50  ? 1263 HOH B O   1 
HETATM 5208 O  O   . HOH J 3 .   ? 12.953  0.810   37.108  1.00 35.57  ? 1264 HOH B O   1 
HETATM 5209 O  O   . HOH J 3 .   ? 26.423  17.890  19.323  1.00 28.19  ? 1265 HOH B O   1 
HETATM 5210 O  O   . HOH J 3 .   ? 29.569  -9.388  26.284  1.00 41.96  ? 1266 HOH B O   1 
HETATM 5211 O  O   . HOH J 3 .   ? 21.996  -11.771 22.916  1.00 25.08  ? 1268 HOH B O   1 
HETATM 5212 O  O   . HOH J 3 .   ? 17.267  -12.603 14.905  1.00 37.86  ? 1271 HOH B O   1 
HETATM 5213 O  O   . HOH J 3 .   ? 10.755  -13.818 22.337  1.00 79.45  ? 1272 HOH B O   1 
HETATM 5214 O  O   . HOH J 3 .   ? -6.187  -12.752 20.442  1.00 52.01  ? 1277 HOH B O   1 
HETATM 5215 O  O   . HOH J 3 .   ? 27.054  2.986   4.193   1.00 20.97  ? 1281 HOH B O   1 
HETATM 5216 O  O   . HOH J 3 .   ? 33.421  0.993   7.691   1.00 40.38  ? 1287 HOH B O   1 
HETATM 5217 O  O   . HOH J 3 .   ? 18.541  12.218  17.273  1.00 35.73  ? 1291 HOH B O   1 
HETATM 5218 O  O   . HOH J 3 .   ? 15.652  9.173   24.890  1.00 37.46  ? 1293 HOH B O   1 
HETATM 5219 O  O   . HOH J 3 .   ? 39.207  -0.148  24.158  1.00 34.67  ? 1295 HOH B O   1 
HETATM 5220 O  O   . HOH J 3 .   ? 11.317  -1.836  35.541  1.00 27.66  ? 1296 HOH B O   1 
HETATM 5221 O  O   . HOH J 3 .   ? 3.626   -2.510  38.123  1.00 59.85  ? 1303 HOH B O   1 
HETATM 5222 O  O   . HOH J 3 .   ? 14.772  -14.091 19.052  1.00 29.27  ? 1317 HOH B O   1 
HETATM 5223 O  O   . HOH J 3 .   ? 13.234  8.955   22.257  1.00 35.52  ? 1319 HOH B O   1 
HETATM 5224 O  O   . HOH J 3 .   ? 31.790  28.109  34.897  1.00 45.69  ? 1321 HOH B O   1 
HETATM 5225 O  O   . HOH J 3 .   ? 24.924  -0.316  35.094  1.00 24.28  ? 1322 HOH B O   1 
HETATM 5226 O  O   . HOH J 3 .   ? 15.783  10.020  20.999  1.00 25.68  ? 1325 HOH B O   1 
HETATM 5227 O  O   . HOH J 3 .   ? 34.973  29.447  32.939  1.00 39.89  ? 1328 HOH B O   1 
HETATM 5228 O  O   . HOH J 3 .   ? 19.881  -14.201 23.607  1.00 22.20  ? 1329 HOH B O   1 
HETATM 5229 O  O   . HOH J 3 .   ? 37.221  -6.385  18.274  1.00 37.08  ? 1334 HOH B O   1 
HETATM 5230 O  O   . HOH J 3 .   ? 24.970  -10.825 12.822  1.00 31.37  ? 1336 HOH B O   1 
HETATM 5231 O  O   . HOH J 3 .   ? 8.984   -11.569 28.952  1.00 54.94  ? 1337 HOH B O   1 
HETATM 5232 O  O   . HOH J 3 .   ? 23.086  20.184  23.540  1.00 44.37  ? 1338 HOH B O   1 
HETATM 5233 O  O   . HOH J 3 .   ? 42.628  5.223   19.161  1.00 51.67  ? 1340 HOH B O   1 
HETATM 5234 O  O   . HOH J 3 .   ? 42.792  5.523   25.198  1.00 30.36  ? 1343 HOH B O   1 
HETATM 5235 O  O   . HOH J 3 .   ? 20.587  25.932  30.972  1.00 44.66  ? 1345 HOH B O   1 
HETATM 5236 O  O   . HOH J 3 .   ? 33.196  3.709   36.053  1.00 48.19  ? 1349 HOH B O   1 
HETATM 5237 O  O   . HOH J 3 .   ? 35.614  -6.875  22.929  1.00 49.13  ? 1350 HOH B O   1 
HETATM 5238 O  O   . HOH J 3 .   ? 25.498  18.915  11.621  1.00 44.45  ? 1355 HOH B O   1 
HETATM 5239 O  O   . HOH J 3 .   ? 36.906  11.581  26.843  1.00 40.93  ? 1356 HOH B O   1 
HETATM 5240 O  O   . HOH J 3 .   ? 36.984  -3.957  33.411  1.00 41.10  ? 1371 HOH B O   1 
HETATM 5241 O  O   . HOH J 3 .   ? 43.112  3.626   21.522  1.00 58.93  ? 1379 HOH B O   1 
HETATM 5242 O  O   . HOH J 3 .   ? 29.903  9.990   35.204  1.00 77.53  ? 1384 HOH B O   1 
HETATM 5243 O  O   . HOH J 3 .   ? 4.294   -5.207  36.649  1.00 60.56  ? 1387 HOH B O   1 
HETATM 5244 O  O   . HOH J 3 .   ? 14.722  2.987   41.541  1.00 46.91  ? 1394 HOH B O   1 
HETATM 5245 O  O   . HOH J 3 .   ? 34.614  12.088  10.473  1.00 77.96  ? 1401 HOH B O   1 
HETATM 5246 O  O   . HOH J 3 .   ? -5.465  -0.629  20.099  1.00 73.72  ? 1411 HOH B O   1 
HETATM 5247 O  O   . HOH J 3 .   ? 13.030  4.536   39.377  1.00 32.33  ? 1413 HOH B O   1 
HETATM 5248 O  O   . HOH J 3 .   ? 3.011   -2.179  30.610  1.00 37.10  ? 1414 HOH B O   1 
HETATM 5249 O  O   . HOH J 3 .   ? 26.757  -6.119  29.754  1.00 45.71  ? 1424 HOH B O   1 
HETATM 5250 O  O   . HOH J 3 .   ? 19.964  -14.605 29.862  1.00 66.86  ? 1425 HOH B O   1 
HETATM 5251 O  O   . HOH J 3 .   ? 36.695  10.445  24.861  1.00 74.66  ? 1428 HOH B O   1 
HETATM 5252 O  O   . HOH J 3 .   ? 34.100  -8.326  13.525  1.00 33.46  ? 1429 HOH B O   1 
HETATM 5253 O  O   . HOH J 3 .   ? 8.438   10.656  31.669  1.00 31.77  ? 1433 HOH B O   1 
HETATM 5254 O  O   . HOH J 3 .   ? 28.502  18.082  7.071   1.00 69.30  ? 1446 HOH B O   1 
HETATM 5255 O  O   . HOH J 3 .   ? 7.615   5.913   22.128  1.00 47.68  ? 1450 HOH B O   1 
HETATM 5256 O  O   . HOH J 3 .   ? 45.941  -0.071  32.893  1.00 39.82  ? 1452 HOH B O   1 
HETATM 5257 O  O   . HOH J 3 .   ? 16.551  -14.642 28.070  1.00 68.03  ? 1459 HOH B O   1 
HETATM 5258 O  O   . HOH J 3 .   ? 8.362   8.664   22.608  1.00 44.75  ? 1467 HOH B O   1 
HETATM 5259 O  O   . HOH J 3 .   ? 27.275  -8.888  16.682  1.00 24.52  ? 1469 HOH B O   1 
HETATM 5260 O  O   . HOH J 3 .   ? 5.241   8.789   33.253  1.00 32.33  ? 1471 HOH B O   1 
HETATM 5261 O  O   . HOH J 3 .   ? 8.092   6.672   38.532  1.00 30.86  ? 1477 HOH B O   1 
HETATM 5262 O  O   . HOH J 3 .   ? 5.879   5.302   44.770  1.00 68.18  ? 1487 HOH B O   1 
HETATM 5263 O  O   . HOH J 3 .   ? 7.936   7.189   24.322  1.00 39.93  ? 1489 HOH B O   1 
HETATM 5264 O  O   . HOH J 3 .   ? 1.011   8.835   24.189  1.00 74.03  ? 1491 HOH B O   1 
HETATM 5265 O  O   . HOH J 3 .   ? 22.140  27.261  33.224  1.00 55.89  ? 1492 HOH B O   1 
HETATM 5266 O  O   . HOH J 3 .   ? 7.644   4.643   40.053  1.00 46.34  ? 1493 HOH B O   1 
HETATM 5267 O  O   . HOH J 3 .   ? 1.122   7.973   21.561  1.00 69.35  ? 1497 HOH B O   1 
HETATM 5268 O  O   . HOH J 3 .   ? 44.993  6.087   25.631  1.00 39.77  ? 1498 HOH B O   1 
HETATM 5269 O  O   . HOH J 3 .   ? 8.413   9.394   34.271  1.00 37.77  ? 1510 HOH B O   1 
HETATM 5270 O  O   . HOH J 3 .   ? 10.380  8.760   37.710  1.00 69.74  ? 1515 HOH B O   1 
HETATM 5271 O  O   . HOH J 3 .   ? 36.817  13.854  10.176  1.00 46.53  ? 1517 HOH B O   1 
HETATM 5272 O  O   . HOH J 3 .   ? 15.443  -14.722 16.673  1.00 25.13  ? 1520 HOH B O   1 
HETATM 5273 O  O   . HOH J 3 .   ? 5.198   6.821   29.208  1.00 43.07  ? 1525 HOH B O   1 
HETATM 5274 O  O   . HOH J 3 .   ? 34.991  -5.795  29.040  1.00 38.10  ? 1526 HOH B O   1 
HETATM 5275 O  O   . HOH J 3 .   ? 11.555  -12.155 29.699  1.00 38.39  ? 1529 HOH B O   1 
HETATM 5276 O  O   . HOH J 3 .   ? 29.241  14.221  4.541   1.00 42.10  ? 1530 HOH B O   1 
HETATM 5277 O  O   . HOH J 3 .   ? 20.239  15.736  33.615  1.00 58.41  ? 1531 HOH B O   1 
HETATM 5278 O  O   . HOH J 3 .   ? 31.081  19.755  9.409   1.00 41.34  ? 1533 HOH B O   1 
HETATM 5279 O  O   . HOH J 3 .   ? 20.343  -14.925 26.371  1.00 53.68  ? 1535 HOH B O   1 
HETATM 5280 O  O   . HOH J 3 .   ? 45.183  -2.461  32.636  1.00 40.32  ? 1537 HOH B O   1 
HETATM 5281 O  O   . HOH J 3 .   ? -0.153  6.863   18.693  1.00 41.84  ? 1538 HOH B O   1 
HETATM 5282 O  O   . HOH J 3 .   ? 30.195  -12.504 20.417  1.00 32.53  ? 1554 HOH B O   1 
HETATM 5283 O  O   . HOH J 3 .   ? 19.768  21.172  14.084  1.00 38.03  ? 1557 HOH B O   1 
HETATM 5284 O  O   . HOH J 3 .   ? 44.020  7.141   19.169  1.00 84.59  ? 1559 HOH B O   1 
HETATM 5285 O  O   . HOH J 3 .   ? 10.049  -13.846 31.512  1.00 26.08  ? 1561 HOH B O   1 
HETATM 5286 O  O   . HOH J 3 .   ? 47.471  -1.229  34.222  1.00 59.60  ? 1567 HOH B O   1 
HETATM 5287 O  O   . HOH J 3 .   ? 2.097   -14.441 21.045  1.00 52.79  ? 1568 HOH B O   1 
HETATM 5288 O  O   . HOH J 3 .   ? 31.527  7.339   7.104   1.00 29.72  ? 1570 HOH B O   1 
HETATM 5289 O  O   . HOH J 3 .   ? 26.747  -13.199 20.356  1.00 64.27  ? 1579 HOH B O   1 
HETATM 5290 O  O   . HOH J 3 .   ? 27.524  -10.172 19.251  1.00 47.35  ? 1580 HOH B O   1 
HETATM 5291 O  O   . HOH J 3 .   ? 30.489  -10.831 18.609  1.00 46.95  ? 1581 HOH B O   1 
HETATM 5292 O  O   . HOH J 3 .   ? 31.001  -11.043 15.941  1.00 25.41  ? 1582 HOH B O   1 
HETATM 5293 O  O   . HOH J 3 .   ? 4.060   4.852   30.390  1.00 39.07  ? 1600 HOH B O   1 
HETATM 5294 O  O   . HOH J 3 .   ? 47.424  7.021   31.539  1.00 50.66  ? 1601 HOH B O   1 
HETATM 5295 O  O   . HOH J 3 .   ? -0.018  -13.374 24.043  1.00 45.11  ? 1604 HOH B O   1 
HETATM 5296 O  O   . HOH J 3 .   ? 21.374  18.185  25.353  1.00 52.75  ? 1611 HOH B O   1 
HETATM 5297 O  O   . HOH J 3 .   ? 7.082   10.492  26.601  1.00 32.00  ? 1612 HOH B O   1 
HETATM 5298 O  O   . HOH J 3 .   ? 28.575  17.819  12.592  1.00 37.86  ? 1613 HOH B O   1 
HETATM 5299 O  O   . HOH J 3 .   ? 7.930   8.609   37.299  1.00 62.02  ? 1614 HOH B O   1 
HETATM 5300 O  O   . HOH J 3 .   ? 12.495  -1.253  38.689  1.00 37.16  ? 1617 HOH B O   1 
HETATM 5301 O  O   . HOH J 3 .   ? 33.502  -0.572  33.160  1.00 46.65  ? 1622 HOH B O   1 
HETATM 5302 O  O   . HOH J 3 .   ? 10.476  -1.915  39.820  1.00 36.54  ? 1627 HOH B O   1 
HETATM 5303 O  O   . HOH J 3 .   ? 1.852   4.843   20.501  1.00 45.33  ? 1628 HOH B O   1 
HETATM 5304 O  O   . HOH J 3 .   ? 28.611  8.628   7.898   1.00 40.33  ? 1630 HOH B O   1 
HETATM 5305 O  O   . HOH J 3 .   ? 7.371   10.984  23.221  1.00 29.20  ? 1631 HOH B O   1 
HETATM 5306 O  O   . HOH J 3 .   ? 11.807  7.013   19.336  1.00 57.00  ? 1641 HOH B O   1 
HETATM 5307 O  O   . HOH J 3 .   ? 34.279  -1.740  36.309  1.00 38.37  ? 1643 HOH B O   1 
HETATM 5308 O  O   . HOH J 3 .   ? 7.414   -2.421  40.769  1.00 31.63  ? 1646 HOH B O   1 
HETATM 5309 O  O   . HOH J 3 .   ? 33.365  13.071  8.761   1.00 55.52  ? 1655 HOH B O   1 
HETATM 5310 O  O   . HOH J 3 .   ? 24.233  16.601  34.385  1.00 74.01  ? 1666 HOH B O   1 
HETATM 5311 O  O   . HOH J 3 .   ? 38.489  -6.705  22.859  1.00 35.60  ? 1673 HOH B O   1 
HETATM 5312 O  O   . HOH J 3 .   ? -2.842  -12.189 27.870  1.00 60.77  ? 1680 HOH B O   1 
HETATM 5313 O  O   . HOH J 3 .   ? 14.093  -8.800  36.721  1.00 50.95  ? 1682 HOH B O   1 
HETATM 5314 O  O   . HOH J 3 .   ? 18.116  -12.043 17.397  1.00 39.76  ? 1686 HOH B O   1 
HETATM 5315 O  O   . HOH J 3 .   ? 10.715  9.341   31.168  1.00 43.80  ? 1687 HOH B O   1 
HETATM 5316 O  O   . HOH J 3 .   ? 7.241   4.933   42.294  1.00 62.44  ? 1691 HOH B O   1 
HETATM 5317 O  O   . HOH J 3 .   ? 18.691  -11.959 27.673  1.00 51.27  ? 1693 HOH B O   1 
HETATM 5318 O  O   . HOH J 3 .   ? 43.318  1.820   18.273  1.00 37.56  ? 1700 HOH B O   1 
HETATM 5319 O  O   . HOH J 3 .   ? 29.837  16.191  7.320   1.00 43.32  ? 1711 HOH B O   1 
HETATM 5320 O  O   . HOH K 3 .   ? -2.660  34.912  46.116  1.00 17.05  ? 1008 HOH C O   1 
HETATM 5321 O  O   . HOH K 3 .   ? -1.685  51.006  54.402  1.00 21.63  ? 1009 HOH C O   1 
HETATM 5322 O  O   . HOH K 3 .   ? -5.056  42.885  53.476  1.00 16.73  ? 1010 HOH C O   1 
HETATM 5323 O  O   . HOH K 3 .   ? -3.409  35.858  40.791  1.00 32.19  ? 1013 HOH C O   1 
HETATM 5324 O  O   . HOH K 3 .   ? -3.261  32.965  48.803  1.00 19.87  ? 1015 HOH C O   1 
HETATM 5325 O  O   . HOH K 3 .   ? -3.791  36.943  53.776  1.00 20.08  ? 1019 HOH C O   1 
HETATM 5326 O  O   . HOH K 3 .   ? 8.028   32.169  59.017  1.00 26.61  ? 1022 HOH C O   1 
HETATM 5327 O  O   . HOH K 3 .   ? 13.958  57.544  50.312  1.00 28.29  ? 1027 HOH C O   1 
HETATM 5328 O  O   . HOH K 3 .   ? -1.971  34.340  39.835  1.00 23.08  ? 1030 HOH C O   1 
HETATM 5329 O  O   . HOH K 3 .   ? -0.538  32.752  46.703  1.00 35.21  ? 1039 HOH C O   1 
HETATM 5330 O  O   . HOH K 3 .   ? -3.579  45.691  47.549  1.00 37.03  ? 1041 HOH C O   1 
HETATM 5331 O  O   . HOH K 3 .   ? -8.647  40.546  52.491  1.00 21.03  ? 1044 HOH C O   1 
HETATM 5332 O  O   . HOH K 3 .   ? -9.465  51.258  59.072  1.00 23.35  ? 1049 HOH C O   1 
HETATM 5333 O  O   . HOH K 3 .   ? 22.036  35.968  47.643  1.00 28.05  ? 1050 HOH C O   1 
HETATM 5334 O  O   . HOH K 3 .   ? -3.685  33.422  51.422  1.00 21.90  ? 1062 HOH C O   1 
HETATM 5335 O  O   . HOH K 3 .   ? 8.952   27.563  55.939  1.00 31.78  ? 1067 HOH C O   1 
HETATM 5336 O  O   . HOH K 3 .   ? -6.166  40.422  53.547  1.00 27.43  ? 1071 HOH C O   1 
HETATM 5337 O  O   . HOH K 3 .   ? 7.288   54.526  40.298  1.00 17.82  ? 1074 HOH C O   1 
HETATM 5338 O  O   . HOH K 3 .   ? 9.420   52.661  30.552  1.00 25.08  ? 1078 HOH C O   1 
HETATM 5339 O  O   . HOH K 3 .   ? 0.456   32.472  51.630  1.00 29.23  ? 1081 HOH C O   1 
HETATM 5340 O  O   . HOH K 3 .   ? 16.475  52.838  52.669  1.00 25.16  ? 1084 HOH C O   1 
HETATM 5341 O  O   . HOH K 3 .   ? -3.763  41.685  68.961  1.00 26.83  ? 1092 HOH C O   1 
HETATM 5342 O  O   . HOH K 3 .   ? 1.663   29.041  36.381  1.00 49.61  ? 1094 HOH C O   1 
HETATM 5343 O  O   . HOH K 3 .   ? 3.561   27.155  56.395  1.00 26.98  ? 1097 HOH C O   1 
HETATM 5344 O  O   . HOH K 3 .   ? 2.529   51.803  36.476  1.00 30.06  ? 1101 HOH C O   1 
HETATM 5345 O  O   . HOH K 3 .   ? 22.805  31.240  42.435  1.00 35.29  ? 1102 HOH C O   1 
HETATM 5346 O  O   . HOH K 3 .   ? -8.752  49.467  61.156  1.00 24.49  ? 1103 HOH C O   1 
HETATM 5347 O  O   . HOH K 3 .   ? 21.148  34.239  45.197  1.00 31.34  ? 1104 HOH C O   1 
HETATM 5348 O  O   . HOH K 3 .   ? 6.813   56.446  55.663  1.00 23.53  ? 1105 HOH C O   1 
HETATM 5349 O  O   . HOH K 3 .   ? 14.847  55.758  46.265  1.00 20.12  ? 1110 HOH C O   1 
HETATM 5350 O  O   . HOH K 3 .   ? 7.004   27.113  57.078  1.00 56.05  ? 1114 HOH C O   1 
HETATM 5351 O  O   . HOH K 3 .   ? -3.432  53.289  55.482  1.00 30.02  ? 1118 HOH C O   1 
HETATM 5352 O  O   . HOH K 3 .   ? 8.978   56.936  39.574  1.00 26.38  ? 1121 HOH C O   1 
HETATM 5353 O  O   . HOH K 3 .   ? -8.505  52.731  56.307  1.00 25.19  ? 1125 HOH C O   1 
HETATM 5354 O  O   . HOH K 3 .   ? 18.386  44.348  63.215  1.00 35.98  ? 1132 HOH C O   1 
HETATM 5355 O  O   . HOH K 3 .   ? 15.509  55.943  57.966  1.00 36.17  ? 1142 HOH C O   1 
HETATM 5356 O  O   . HOH K 3 .   ? -14.473 48.042  68.124  1.00 27.48  ? 1148 HOH C O   1 
HETATM 5357 O  O   . HOH K 3 .   ? 15.372  40.941  34.115  1.00 69.26  ? 1151 HOH C O   1 
HETATM 5358 O  O   . HOH K 3 .   ? 16.277  56.460  52.410  1.00 23.91  ? 1152 HOH C O   1 
HETATM 5359 O  O   . HOH K 3 .   ? 8.579   52.320  33.587  1.00 33.25  ? 1162 HOH C O   1 
HETATM 5360 O  O   . HOH K 3 .   ? 16.742  45.208  34.592  1.00 30.13  ? 1164 HOH C O   1 
HETATM 5361 O  O   . HOH K 3 .   ? 3.141   54.750  43.516  1.00 31.07  ? 1168 HOH C O   1 
HETATM 5362 O  O   . HOH K 3 .   ? -3.290  56.597  50.419  1.00 32.94  ? 1170 HOH C O   1 
HETATM 5363 O  O   . HOH K 3 .   ? 15.699  34.607  33.963  1.00 31.75  ? 1176 HOH C O   1 
HETATM 5364 O  O   . HOH K 3 .   ? 2.201   40.223  65.240  1.00 49.36  ? 1178 HOH C O   1 
HETATM 5365 O  O   . HOH K 3 .   ? 17.908  44.384  40.069  1.00 40.49  ? 1181 HOH C O   1 
HETATM 5366 O  O   . HOH K 3 .   ? -12.624 48.801  66.119  1.00 31.13  ? 1187 HOH C O   1 
HETATM 5367 O  O   . HOH K 3 .   ? 9.863   39.270  66.039  1.00 34.83  ? 1188 HOH C O   1 
HETATM 5368 O  O   . HOH K 3 .   ? 1.204   30.392  46.591  1.00 45.73  ? 1191 HOH C O   1 
HETATM 5369 O  O   . HOH K 3 .   ? -0.688  52.988  52.138  1.00 48.93  ? 1192 HOH C O   1 
HETATM 5370 O  O   . HOH K 3 .   ? 13.715  57.922  57.060  1.00 30.51  ? 1193 HOH C O   1 
HETATM 5371 O  O   . HOH K 3 .   ? 2.156   24.988  40.873  1.00 39.71  ? 1194 HOH C O   1 
HETATM 5372 O  O   . HOH K 3 .   ? 1.396   45.775  63.407  1.00 34.51  ? 1202 HOH C O   1 
HETATM 5373 O  O   . HOH K 3 .   ? 5.746   19.120  46.278  1.00 38.69  ? 1204 HOH C O   1 
HETATM 5374 O  O   . HOH K 3 .   ? 3.351   35.851  65.224  1.00 39.60  ? 1209 HOH C O   1 
HETATM 5375 O  O   . HOH K 3 .   ? 16.249  43.087  30.899  1.00 42.91  ? 1210 HOH C O   1 
HETATM 5376 O  O   . HOH K 3 .   ? 13.412  57.953  47.554  1.00 29.11  ? 1219 HOH C O   1 
HETATM 5377 O  O   . HOH K 3 .   ? -15.450 51.237  54.422  1.00 64.07  ? 1220 HOH C O   1 
HETATM 5378 O  O   . HOH K 3 .   ? 5.815   54.394  42.204  1.00 43.16  ? 1223 HOH C O   1 
HETATM 5379 O  O   . HOH K 3 .   ? -4.098  52.512  61.213  1.00 28.08  ? 1228 HOH C O   1 
HETATM 5380 O  O   . HOH K 3 .   ? -4.409  30.673  51.827  1.00 42.45  ? 1229 HOH C O   1 
HETATM 5381 O  O   . HOH K 3 .   ? -4.485  31.807  46.479  1.00 54.50  ? 1235 HOH C O   1 
HETATM 5382 O  O   . HOH K 3 .   ? 24.696  27.984  47.667  1.00 68.47  ? 1238 HOH C O   1 
HETATM 5383 O  O   . HOH K 3 .   ? 15.240  49.981  32.191  1.00 24.04  ? 1251 HOH C O   1 
HETATM 5384 O  O   . HOH K 3 .   ? 19.156  32.700  47.661  1.00 40.92  ? 1258 HOH C O   1 
HETATM 5385 O  O   . HOH K 3 .   ? 4.676   22.861  50.820  1.00 42.18  ? 1259 HOH C O   1 
HETATM 5386 O  O   . HOH K 3 .   ? -5.271  38.461  51.195  1.00 36.78  ? 1261 HOH C O   1 
HETATM 5387 O  O   . HOH K 3 .   ? 20.319  45.133  45.145  1.00 31.23  ? 1273 HOH C O   1 
HETATM 5388 O  O   . HOH K 3 .   ? -5.534  35.257  48.689  1.00 25.28  ? 1274 HOH C O   1 
HETATM 5389 O  O   . HOH K 3 .   ? 17.997  23.112  52.426  1.00 42.45  ? 1283 HOH C O   1 
HETATM 5390 O  O   . HOH K 3 .   ? -2.617  53.792  58.470  1.00 59.55  ? 1285 HOH C O   1 
HETATM 5391 O  O   . HOH K 3 .   ? -2.609  55.541  64.939  1.00 51.10  ? 1289 HOH C O   1 
HETATM 5392 O  O   . HOH K 3 .   ? 17.045  26.592  49.423  1.00 31.58  ? 1292 HOH C O   1 
HETATM 5393 O  O   . HOH K 3 .   ? 25.202  34.682  47.940  1.00 61.78  ? 1294 HOH C O   1 
HETATM 5394 O  O   . HOH K 3 .   ? -13.067 47.912  63.689  1.00 33.06  ? 1299 HOH C O   1 
HETATM 5395 O  O   . HOH K 3 .   ? -1.329  30.453  45.520  1.00 41.96  ? 1310 HOH C O   1 
HETATM 5396 O  O   . HOH K 3 .   ? 9.332   34.109  57.740  1.00 42.17  ? 1313 HOH C O   1 
HETATM 5397 O  O   . HOH K 3 .   ? -1.640  48.554  40.268  1.00 45.00  ? 1314 HOH C O   1 
HETATM 5398 O  O   . HOH K 3 .   ? -0.498  54.465  61.192  1.00 43.45  ? 1315 HOH C O   1 
HETATM 5399 O  O   . HOH K 3 .   ? 10.688  51.807  34.347  1.00 33.18  ? 1316 HOH C O   1 
HETATM 5400 O  O   . HOH K 3 .   ? -4.263  47.875  46.342  1.00 26.32  ? 1323 HOH C O   1 
HETATM 5401 O  O   . HOH K 3 .   ? 4.708   20.605  48.652  1.00 33.07  ? 1324 HOH C O   1 
HETATM 5402 O  O   . HOH K 3 .   ? -2.889  39.629  69.489  1.00 37.14  ? 1326 HOH C O   1 
HETATM 5403 O  O   . HOH K 3 .   ? 20.573  24.903  51.781  1.00 25.07  ? 1335 HOH C O   1 
HETATM 5404 O  O   . HOH K 3 .   ? 16.244  7.562   39.970  1.00 68.75  ? 1339 HOH C O   1 
HETATM 5405 O  O   . HOH K 3 .   ? 15.861  47.785  33.674  1.00 29.65  ? 1341 HOH C O   1 
HETATM 5406 O  O   . HOH K 3 .   ? 9.949   36.769  57.745  1.00 50.29  ? 1342 HOH C O   1 
HETATM 5407 O  O   . HOH K 3 .   ? -6.470  35.361  51.100  1.00 53.12  ? 1357 HOH C O   1 
HETATM 5408 O  O   . HOH K 3 .   ? 0.100   29.662  42.822  1.00 54.36  ? 1358 HOH C O   1 
HETATM 5409 O  O   . HOH K 3 .   ? 22.907  27.755  44.546  1.00 35.06  ? 1359 HOH C O   1 
HETATM 5410 O  O   . HOH K 3 .   ? -0.612  52.916  37.541  1.00 49.98  ? 1363 HOH C O   1 
HETATM 5411 O  O   . HOH K 3 .   ? 12.576  15.361  48.131  1.00 43.63  ? 1367 HOH C O   1 
HETATM 5412 O  O   . HOH K 3 .   ? 18.635  51.782  52.426  1.00 52.10  ? 1369 HOH C O   1 
HETATM 5413 O  O   . HOH K 3 .   ? 15.565  54.686  54.398  1.00 56.10  ? 1382 HOH C O   1 
HETATM 5414 O  O   . HOH K 3 .   ? 6.026   38.200  55.836  1.00 41.88  ? 1388 HOH C O   1 
HETATM 5415 O  O   . HOH K 3 .   ? 13.313  60.201  58.352  1.00 37.02  ? 1389 HOH C O   1 
HETATM 5416 O  O   . HOH K 3 .   ? 5.649   35.454  65.044  1.00 43.71  ? 1391 HOH C O   1 
HETATM 5417 O  O   . HOH K 3 .   ? 0.450   54.991  45.991  1.00 42.02  ? 1393 HOH C O   1 
HETATM 5418 O  O   . HOH K 3 .   ? 23.031  18.818  45.790  1.00 60.29  ? 1398 HOH C O   1 
HETATM 5419 O  O   . HOH K 3 .   ? -7.852  53.195  59.389  1.00 41.65  ? 1403 HOH C O   1 
HETATM 5420 O  O   . HOH K 3 .   ? -7.373  32.965  50.889  1.00 43.79  ? 1405 HOH C O   1 
HETATM 5421 O  O   . HOH K 3 .   ? -3.854  30.763  65.016  1.00 48.37  ? 1408 HOH C O   1 
HETATM 5422 O  O   . HOH K 3 .   ? -4.657  34.547  56.019  1.00 53.20  ? 1409 HOH C O   1 
HETATM 5423 O  O   . HOH K 3 .   ? 2.216   44.550  65.977  1.00 56.94  ? 1412 HOH C O   1 
HETATM 5424 O  O   . HOH K 3 .   ? -3.933  55.931  48.115  1.00 56.22  ? 1419 HOH C O   1 
HETATM 5425 O  O   . HOH K 3 .   ? -0.116  54.715  57.107  1.00 65.30  ? 1426 HOH C O   1 
HETATM 5426 O  O   . HOH K 3 .   ? 19.247  42.283  47.542  1.00 35.63  ? 1430 HOH C O   1 
HETATM 5427 O  O   . HOH K 3 .   ? 2.012   27.782  60.323  1.00 36.30  ? 1434 HOH C O   1 
HETATM 5428 O  O   . HOH K 3 .   ? 5.171   41.620  64.163  1.00 53.49  ? 1436 HOH C O   1 
HETATM 5429 O  O   . HOH K 3 .   ? 0.441   44.035  68.550  1.00 32.95  ? 1439 HOH C O   1 
HETATM 5430 O  O   . HOH K 3 .   ? 18.206  10.771  40.866  1.00 54.74  ? 1445 HOH C O   1 
HETATM 5431 O  O   . HOH K 3 .   ? -0.656  28.080  57.155  1.00 54.60  ? 1448 HOH C O   1 
HETATM 5432 O  O   . HOH K 3 .   ? -2.474  37.389  69.787  1.00 56.46  ? 1449 HOH C O   1 
HETATM 5433 O  O   . HOH K 3 .   ? -1.384  53.414  64.563  1.00 36.97  ? 1455 HOH C O   1 
HETATM 5434 O  O   . HOH K 3 .   ? 3.018   56.176  57.682  1.00 43.88  ? 1458 HOH C O   1 
HETATM 5435 O  O   . HOH K 3 .   ? -1.847  51.454  46.443  1.00 60.39  ? 1462 HOH C O   1 
HETATM 5436 O  O   . HOH K 3 .   ? 6.267   49.351  60.091  1.00 77.24  ? 1463 HOH C O   1 
HETATM 5437 O  O   . HOH K 3 .   ? -1.574  50.001  44.105  1.00 39.97  ? 1472 HOH C O   1 
HETATM 5438 O  O   . HOH K 3 .   ? 25.971  38.138  45.742  1.00 72.97  ? 1474 HOH C O   1 
HETATM 5439 O  O   . HOH K 3 .   ? 6.911   34.376  66.891  1.00 54.60  ? 1483 HOH C O   1 
HETATM 5440 O  O   . HOH K 3 .   ? 3.278   15.106  32.742  1.00 52.18  ? 1490 HOH C O   1 
HETATM 5441 O  O   . HOH K 3 .   ? 21.450  10.005  40.900  1.00 36.81  ? 1494 HOH C O   1 
HETATM 5442 O  O   . HOH K 3 .   ? -0.290  57.499  47.632  1.00 78.75  ? 1499 HOH C O   1 
HETATM 5443 O  O   . HOH K 3 .   ? 1.466   32.612  49.308  1.00 35.92  ? 1500 HOH C O   1 
HETATM 5444 O  O   . HOH K 3 .   ? -2.789  48.012  43.985  1.00 25.54  ? 1506 HOH C O   1 
HETATM 5445 O  O   . HOH K 3 .   ? 3.091   17.590  40.259  1.00 31.88  ? 1514 HOH C O   1 
HETATM 5446 O  O   . HOH K 3 .   ? 22.730  37.434  45.169  1.00 46.39  ? 1516 HOH C O   1 
HETATM 5447 O  O   . HOH K 3 .   ? 21.533  43.860  48.637  1.00 58.97  ? 1519 HOH C O   1 
HETATM 5448 O  O   . HOH K 3 .   ? 17.155  46.475  64.037  1.00 77.43  ? 1522 HOH C O   1 
HETATM 5449 O  O   . HOH K 3 .   ? 19.152  10.946  38.327  1.00 39.72  ? 1527 HOH C O   1 
HETATM 5450 O  O   . HOH K 3 .   ? 2.015   25.341  45.569  1.00 19.68  ? 1528 HOH C O   1 
HETATM 5451 O  O   . HOH K 3 .   ? 22.030  27.611  50.178  1.00 59.33  ? 1534 HOH C O   1 
HETATM 5452 O  O   . HOH K 3 .   ? -4.651  29.372  56.113  1.00 46.19  ? 1541 HOH C O   1 
HETATM 5453 O  O   . HOH K 3 .   ? 23.109  43.764  51.558  1.00 50.13  ? 1543 HOH C O   1 
HETATM 5454 O  O   . HOH K 3 .   ? 15.685  10.448  41.173  1.00 48.94  ? 1545 HOH C O   1 
HETATM 5455 O  O   . HOH K 3 .   ? 22.399  33.478  42.779  1.00 47.93  ? 1546 HOH C O   1 
HETATM 5456 O  O   . HOH K 3 .   ? 16.679  51.174  45.646  1.00 31.22  ? 1549 HOH C O   1 
HETATM 5457 O  O   . HOH K 3 .   ? 10.272  6.218   44.235  1.00 58.27  ? 1550 HOH C O   1 
HETATM 5458 O  O   . HOH K 3 .   ? -6.172  45.960  48.586  1.00 33.26  ? 1556 HOH C O   1 
HETATM 5459 O  O   . HOH K 3 .   ? -10.267 46.118  59.222  1.00 35.05  ? 1560 HOH C O   1 
HETATM 5460 O  O   . HOH K 3 .   ? -1.912  53.487  49.919  1.00 27.91  ? 1563 HOH C O   1 
HETATM 5461 O  O   . HOH K 3 .   ? -6.177  54.242  63.985  1.00 33.68  ? 1564 HOH C O   1 
HETATM 5462 O  O   . HOH K 3 .   ? 24.076  44.229  53.971  1.00 56.47  ? 1569 HOH C O   1 
HETATM 5463 O  O   . HOH K 3 .   ? 16.608  9.668   44.674  1.00 30.98  ? 1572 HOH C O   1 
HETATM 5464 O  O   . HOH K 3 .   ? 1.946   16.702  37.148  1.00 55.35  ? 1573 HOH C O   1 
HETATM 5465 O  O   . HOH K 3 .   ? 8.603   10.064  46.627  1.00 77.55  ? 1574 HOH C O   1 
HETATM 5466 O  O   . HOH K 3 .   ? 20.791  39.352  49.650  1.00 70.08  ? 1584 HOH C O   1 
HETATM 5467 O  O   . HOH K 3 .   ? 21.741  23.480  36.031  1.00 45.15  ? 1593 HOH C O   1 
HETATM 5468 O  O   . HOH K 3 .   ? 22.622  40.481  52.249  1.00 57.61  ? 1594 HOH C O   1 
HETATM 5469 O  O   . HOH K 3 .   ? 2.486   54.242  61.986  1.00 37.52  ? 1603 HOH C O   1 
HETATM 5470 O  O   . HOH K 3 .   ? 3.479   36.921  68.502  1.00 37.89  ? 1605 HOH C O   1 
HETATM 5471 O  O   . HOH K 3 .   ? -8.032  53.588  61.996  1.00 47.39  ? 1606 HOH C O   1 
HETATM 5472 O  O   . HOH K 3 .   ? 3.361   27.498  62.643  1.00 39.31  ? 1607 HOH C O   1 
HETATM 5473 O  O   . HOH K 3 .   ? 1.828   52.883  41.206  1.00 67.72  ? 1620 HOH C O   1 
HETATM 5474 O  O   . HOH K 3 .   ? 0.020   29.112  39.042  1.00 43.95  ? 1623 HOH C O   1 
HETATM 5475 O  O   . HOH K 3 .   ? 5.030   58.356  54.435  1.00 58.60  ? 1642 HOH C O   1 
HETATM 5476 O  O   . HOH K 3 .   ? 11.557  8.786   47.153  1.00 36.69  ? 1649 HOH C O   1 
HETATM 5477 O  O   . HOH K 3 .   ? 0.555   62.898  47.739  1.00 76.91  ? 1659 HOH C O   1 
HETATM 5478 O  O   . HOH K 3 .   ? 16.862  10.312  36.672  1.00 33.07  ? 1660 HOH C O   1 
HETATM 5479 O  O   . HOH K 3 .   ? 3.532   28.656  65.523  1.00 71.28  ? 1662 HOH C O   1 
HETATM 5480 O  O   . HOH K 3 .   ? -3.568  30.691  58.941  1.00 48.24  ? 1665 HOH C O   1 
HETATM 5481 O  O   . HOH K 3 .   ? 11.977  9.050   44.579  1.00 41.87  ? 1672 HOH C O   1 
HETATM 5482 O  O   . HOH K 3 .   ? -3.928  30.391  44.146  1.00 85.16  ? 1675 HOH C O   1 
HETATM 5483 O  O   . HOH K 3 .   ? 4.799   25.529  66.138  1.00 46.07  ? 1678 HOH C O   1 
HETATM 5484 O  O   . HOH K 3 .   ? 12.277  10.865  34.779  1.00 56.49  ? 1679 HOH C O   1 
HETATM 5485 O  O   . HOH K 3 .   ? 11.038  58.629  61.561  1.00 50.63  ? 1688 HOH C O   1 
HETATM 5486 O  O   . HOH K 3 .   ? 9.813   36.041  64.890  1.00 58.35  ? 1694 HOH C O   1 
HETATM 5487 O  O   . HOH K 3 .   ? 0.553   60.726  48.544  1.00 54.50  ? 1696 HOH C O   1 
HETATM 5488 O  O   . HOH K 3 .   ? 3.491   23.954  67.703  1.00 51.01  ? 1697 HOH C O   1 
HETATM 5489 O  O   . HOH K 3 .   ? 23.120  36.494  42.182  1.00 58.50  ? 1699 HOH C O   1 
HETATM 5490 O  O   . HOH K 3 .   ? 3.085   32.257  43.476  1.00 37.66  ? 1703 HOH C O   1 
HETATM 5491 O  O   . HOH K 3 .   ? 3.333   53.592  39.601  1.00 71.04  ? 1705 HOH C O   1 
HETATM 5492 O  O   . HOH K 3 .   ? 14.778  7.841   43.240  1.00 42.20  ? 1706 HOH C O   1 
HETATM 5493 O  O   . HOH K 3 .   ? 7.576   40.586  65.654  1.00 52.58  ? 1708 HOH C O   1 
HETATM 5494 O  O   . HOH K 3 .   ? 24.049  36.475  38.958  1.00 32.84  ? 1709 HOH C O   1 
HETATM 5495 O  O   . HOH L 3 .   ? 16.660  37.029  12.857  1.00 36.24  ? 1005 HOH D O   1 
HETATM 5496 O  O   . HOH L 3 .   ? 14.077  41.277  16.595  1.00 26.59  ? 1006 HOH D O   1 
HETATM 5497 O  O   . HOH L 3 .   ? 11.726  42.655  15.617  1.00 25.67  ? 1011 HOH D O   1 
HETATM 5498 O  O   . HOH L 3 .   ? 3.587   27.261  34.581  1.00 18.15  ? 1017 HOH D O   1 
HETATM 5499 O  O   . HOH L 3 .   ? 2.142   33.558  36.905  1.00 26.13  ? 1018 HOH D O   1 
HETATM 5500 O  O   . HOH L 3 .   ? -4.219  24.643  26.224  1.00 27.25  ? 1020 HOH D O   1 
HETATM 5501 O  O   . HOH L 3 .   ? 7.810   48.833  32.120  1.00 18.42  ? 1023 HOH D O   1 
HETATM 5502 O  O   . HOH L 3 .   ? 9.352   23.749  24.617  1.00 37.28  ? 1038 HOH D O   1 
HETATM 5503 O  O   . HOH L 3 .   ? 9.978   43.965  17.565  1.00 36.87  ? 1040 HOH D O   1 
HETATM 5504 O  O   . HOH L 3 .   ? -5.564  27.857  29.670  1.00 23.02  ? 1042 HOH D O   1 
HETATM 5505 O  O   . HOH L 3 .   ? 12.984  23.570  16.955  1.00 30.99  ? 1048 HOH D O   1 
HETATM 5506 O  O   . HOH L 3 .   ? 19.304  35.829  24.182  1.00 43.61  ? 1053 HOH D O   1 
HETATM 5507 O  O   . HOH L 3 .   ? 17.298  41.290  26.524  1.00 45.85  ? 1055 HOH D O   1 
HETATM 5508 O  O   . HOH L 3 .   ? 18.135  36.256  22.190  1.00 25.06  ? 1058 HOH D O   1 
HETATM 5509 O  O   . HOH L 3 .   ? 1.631   43.146  14.501  1.00 33.54  ? 1070 HOH D O   1 
HETATM 5510 O  O   . HOH L 3 .   ? -1.019  20.253  24.826  1.00 22.30  ? 1080 HOH D O   1 
HETATM 5511 O  O   . HOH L 3 .   ? -0.583  11.643  9.007   1.00 24.91  ? 1088 HOH D O   1 
HETATM 5512 O  O   . HOH L 3 .   ? -2.573  11.737  10.405  1.00 31.28  ? 1089 HOH D O   1 
HETATM 5513 O  O   . HOH L 3 .   ? -15.394 42.654  22.659  1.00 28.77  ? 1093 HOH D O   1 
HETATM 5514 O  O   . HOH L 3 .   ? 10.029  42.942  12.863  1.00 29.39  ? 1096 HOH D O   1 
HETATM 5515 O  O   . HOH L 3 .   ? 4.548   22.085  29.755  1.00 33.43  ? 1107 HOH D O   1 
HETATM 5516 O  O   . HOH L 3 .   ? 9.656   45.201  13.128  1.00 36.81  ? 1119 HOH D O   1 
HETATM 5517 O  O   . HOH L 3 .   ? -9.355  51.859  36.642  1.00 32.28  ? 1123 HOH D O   1 
HETATM 5518 O  O   . HOH L 3 .   ? -2.073  23.438  30.064  1.00 35.35  ? 1124 HOH D O   1 
HETATM 5519 O  O   . HOH L 3 .   ? 3.834   18.989  22.370  1.00 32.72  ? 1128 HOH D O   1 
HETATM 5520 O  O   . HOH L 3 .   ? -6.374  45.719  19.863  1.00 43.32  ? 1131 HOH D O   1 
HETATM 5521 O  O   . HOH L 3 .   ? 14.380  36.911  9.672   1.00 45.07  ? 1133 HOH D O   1 
HETATM 5522 O  O   . HOH L 3 .   ? -6.069  51.540  38.206  1.00 29.31  ? 1135 HOH D O   1 
HETATM 5523 O  O   . HOH L 3 .   ? -1.891  40.291  13.692  1.00 30.11  ? 1138 HOH D O   1 
HETATM 5524 O  O   . HOH L 3 .   ? -4.365  43.820  17.530  1.00 31.63  ? 1141 HOH D O   1 
HETATM 5525 O  O   . HOH L 3 .   ? 11.854  34.298  9.468   1.00 25.03  ? 1147 HOH D O   1 
HETATM 5526 O  O   . HOH L 3 .   ? -15.600 35.339  35.431  1.00 29.10  ? 1149 HOH D O   1 
HETATM 5527 O  O   . HOH L 3 .   ? -4.413  36.011  45.016  1.00 31.00  ? 1153 HOH D O   1 
HETATM 5528 O  O   . HOH L 3 .   ? -0.001  20.956  11.313  1.00 45.99  ? 1158 HOH D O   1 
HETATM 5529 O  O   . HOH L 3 .   ? 13.710  43.453  19.046  1.00 33.81  ? 1160 HOH D O   1 
HETATM 5530 O  O   . HOH L 3 .   ? -4.787  35.995  6.687   1.00 40.69  ? 1166 HOH D O   1 
HETATM 5531 O  O   . HOH L 3 .   ? 0.845   46.432  32.995  1.00 24.90  ? 1169 HOH D O   1 
HETATM 5532 O  O   . HOH L 3 .   ? 12.229  23.828  25.383  1.00 34.66  ? 1174 HOH D O   1 
HETATM 5533 O  O   . HOH L 3 .   ? 0.421   17.671  8.681   1.00 52.27  ? 1177 HOH D O   1 
HETATM 5534 O  O   . HOH L 3 .   ? 2.003   19.558  29.152  1.00 28.05  ? 1179 HOH D O   1 
HETATM 5535 O  O   . HOH L 3 .   ? -3.143  45.819  17.133  1.00 33.31  ? 1182 HOH D O   1 
HETATM 5536 O  O   . HOH L 3 .   ? -0.798  48.241  24.255  1.00 24.07  ? 1184 HOH D O   1 
HETATM 5537 O  O   . HOH L 3 .   ? 0.508   12.771  20.302  1.00 42.41  ? 1189 HOH D O   1 
HETATM 5538 O  O   . HOH L 3 .   ? -0.611  43.569  14.769  1.00 51.03  ? 1190 HOH D O   1 
HETATM 5539 O  O   . HOH L 3 .   ? 2.839   23.878  8.686   1.00 37.42  ? 1201 HOH D O   1 
HETATM 5540 O  O   . HOH L 3 .   ? 5.512   11.958  19.764  1.00 33.94  ? 1206 HOH D O   1 
HETATM 5541 O  O   . HOH L 3 .   ? 0.070   50.421  26.864  1.00 40.96  ? 1208 HOH D O   1 
HETATM 5542 O  O   . HOH L 3 .   ? -3.953  27.571  32.835  1.00 47.00  ? 1211 HOH D O   1 
HETATM 5543 O  O   . HOH L 3 .   ? -14.361 45.328  50.802  1.00 36.55  ? 1212 HOH D O   1 
HETATM 5544 O  O   . HOH L 3 .   ? -13.163 31.021  22.076  1.00 31.29  ? 1214 HOH D O   1 
HETATM 5545 O  O   . HOH L 3 .   ? -2.752  18.319  24.497  1.00 41.06  ? 1216 HOH D O   1 
HETATM 5546 O  O   . HOH L 3 .   ? 15.589  28.993  28.927  1.00 39.38  ? 1217 HOH D O   1 
HETATM 5547 O  O   . HOH L 3 .   ? 14.376  25.379  22.655  1.00 37.01  ? 1218 HOH D O   1 
HETATM 5548 O  O   . HOH L 3 .   ? -18.777 31.230  21.556  1.00 49.50  ? 1222 HOH D O   1 
HETATM 5549 O  O   . HOH L 3 .   ? 1.217   37.897  7.336   1.00 36.69  ? 1227 HOH D O   1 
HETATM 5550 O  O   . HOH L 3 .   ? -6.842  37.274  49.340  1.00 53.31  ? 1230 HOH D O   1 
HETATM 5551 O  O   . HOH L 3 .   ? -18.226 43.217  28.222  1.00 37.14  ? 1231 HOH D O   1 
HETATM 5552 O  O   . HOH L 3 .   ? -9.124  33.196  39.150  1.00 38.58  ? 1234 HOH D O   1 
HETATM 5553 O  O   . HOH L 3 .   ? -4.731  46.189  22.589  1.00 21.43  ? 1241 HOH D O   1 
HETATM 5554 O  O   . HOH L 3 .   ? 13.735  26.910  9.800   1.00 53.25  ? 1243 HOH D O   1 
HETATM 5555 O  O   . HOH L 3 .   ? 6.605   45.680  17.216  1.00 43.76  ? 1244 HOH D O   1 
HETATM 5556 O  O   . HOH L 3 .   ? -2.407  50.126  22.229  1.00 73.35  ? 1245 HOH D O   1 
HETATM 5557 O  O   . HOH L 3 .   ? -2.548  51.007  26.340  1.00 33.97  ? 1248 HOH D O   1 
HETATM 5558 O  O   . HOH L 3 .   ? 12.821  20.606  25.474  1.00 47.07  ? 1257 HOH D O   1 
HETATM 5559 O  O   . HOH L 3 .   ? 5.681   50.408  27.176  1.00 51.19  ? 1270 HOH D O   1 
HETATM 5560 O  O   . HOH L 3 .   ? 7.297   48.389  29.410  1.00 34.49  ? 1276 HOH D O   1 
HETATM 5561 O  O   . HOH L 3 .   ? 15.570  27.568  26.012  1.00 29.53  ? 1278 HOH D O   1 
HETATM 5562 O  O   . HOH L 3 .   ? -15.788 33.750  24.916  1.00 47.03  ? 1280 HOH D O   1 
HETATM 5563 O  O   . HOH L 3 .   ? 0.322   7.990   10.841  1.00 32.33  ? 1286 HOH D O   1 
HETATM 5564 O  O   . HOH L 3 .   ? -2.398  30.755  36.236  1.00 59.02  ? 1288 HOH D O   1 
HETATM 5565 O  O   . HOH L 3 .   ? 8.374   22.929  9.004   1.00 38.89  ? 1302 HOH D O   1 
HETATM 5566 O  O   . HOH L 3 .   ? 0.772   20.562  26.231  1.00 53.15  ? 1304 HOH D O   1 
HETATM 5567 O  O   . HOH L 3 .   ? -1.942  26.620  31.360  1.00 42.13  ? 1308 HOH D O   1 
HETATM 5568 O  O   . HOH L 3 .   ? -10.367 46.533  47.637  1.00 47.23  ? 1309 HOH D O   1 
HETATM 5569 O  O   . HOH L 3 .   ? -3.337  27.069  27.815  1.00 40.43  ? 1311 HOH D O   1 
HETATM 5570 O  O   . HOH L 3 .   ? -11.022 47.478  24.991  1.00 32.34  ? 1318 HOH D O   1 
HETATM 5571 O  O   . HOH L 3 .   ? -21.259 32.289  23.694  1.00 52.44  ? 1320 HOH D O   1 
HETATM 5572 O  O   . HOH L 3 .   ? -8.866  36.336  17.773  1.00 39.77  ? 1330 HOH D O   1 
HETATM 5573 O  O   . HOH L 3 .   ? 4.548   26.286  10.268  1.00 48.01  ? 1333 HOH D O   1 
HETATM 5574 O  O   . HOH L 3 .   ? -4.950  13.022  13.443  1.00 45.03  ? 1344 HOH D O   1 
HETATM 5575 O  O   . HOH L 3 .   ? -16.725 38.497  39.415  1.00 38.42  ? 1348 HOH D O   1 
HETATM 5576 O  O   . HOH L 3 .   ? -0.730  44.605  17.196  1.00 41.20  ? 1353 HOH D O   1 
HETATM 5577 O  O   . HOH L 3 .   ? 1.455   48.013  25.225  1.00 37.80  ? 1361 HOH D O   1 
HETATM 5578 O  O   . HOH L 3 .   ? 18.073  34.127  28.354  1.00 39.99  ? 1362 HOH D O   1 
HETATM 5579 O  O   . HOH L 3 .   ? -15.049 35.614  44.069  1.00 46.87  ? 1364 HOH D O   1 
HETATM 5580 O  O   . HOH L 3 .   ? 2.388   42.415  19.295  1.00 65.12  ? 1366 HOH D O   1 
HETATM 5581 O  O   . HOH L 3 .   ? 6.071   37.678  9.334   1.00 62.00  ? 1372 HOH D O   1 
HETATM 5582 O  O   . HOH L 3 .   ? -1.764  10.672  20.760  1.00 57.60  ? 1373 HOH D O   1 
HETATM 5583 O  O   . HOH L 3 .   ? 4.040   16.883  27.225  1.00 40.75  ? 1374 HOH D O   1 
HETATM 5584 O  O   . HOH L 3 .   ? 14.989  23.172  27.288  1.00 37.58  ? 1375 HOH D O   1 
HETATM 5585 O  O   . HOH L 3 .   ? -5.982  30.003  15.886  1.00 28.47  ? 1383 HOH D O   1 
HETATM 5586 O  O   . HOH L 3 .   ? 9.249   49.526  30.467  1.00 44.51  ? 1385 HOH D O   1 
HETATM 5587 O  O   . HOH L 3 .   ? -2.229  19.568  10.238  1.00 40.63  ? 1386 HOH D O   1 
HETATM 5588 O  O   . HOH L 3 .   ? -5.719  29.529  37.300  1.00 52.49  ? 1392 HOH D O   1 
HETATM 5589 O  O   . HOH L 3 .   ? 5.417   44.029  12.061  1.00 63.88  ? 1395 HOH D O   1 
HETATM 5590 O  O   . HOH L 3 .   ? 7.097   25.904  11.375  1.00 36.11  ? 1404 HOH D O   1 
HETATM 5591 O  O   . HOH L 3 .   ? -11.478 27.341  29.723  1.00 47.84  ? 1407 HOH D O   1 
HETATM 5592 O  O   . HOH L 3 .   ? 6.624   23.739  7.406   1.00 72.31  ? 1410 HOH D O   1 
HETATM 5593 O  O   . HOH L 3 .   ? 12.203  25.612  27.151  1.00 32.66  ? 1415 HOH D O   1 
HETATM 5594 O  O   . HOH L 3 .   ? -16.062 32.011  34.792  1.00 67.06  ? 1418 HOH D O   1 
HETATM 5595 O  O   . HOH L 3 .   ? -3.507  48.257  18.591  1.00 44.93  ? 1420 HOH D O   1 
HETATM 5596 O  O   . HOH L 3 .   ? -0.164  52.847  26.157  1.00 55.11  ? 1421 HOH D O   1 
HETATM 5597 O  O   . HOH L 3 .   ? 7.072   15.004  27.364  1.00 51.91  ? 1431 HOH D O   1 
HETATM 5598 O  O   . HOH L 3 .   ? -4.777  19.202  9.654   1.00 62.74  ? 1435 HOH D O   1 
HETATM 5599 O  O   . HOH L 3 .   ? 1.160   24.135  32.504  1.00 26.08  ? 1440 HOH D O   1 
HETATM 5600 O  O   . HOH L 3 .   ? -10.333 54.061  36.785  1.00 36.71  ? 1441 HOH D O   1 
HETATM 5601 O  O   . HOH L 3 .   ? -15.007 28.427  22.453  1.00 41.21  ? 1453 HOH D O   1 
HETATM 5602 O  O   . HOH L 3 .   ? 15.443  28.556  7.368   1.00 35.20  ? 1456 HOH D O   1 
HETATM 5603 O  O   . HOH L 3 .   ? -15.422 31.991  21.978  1.00 21.97  ? 1457 HOH D O   1 
HETATM 5604 O  O   . HOH L 3 .   ? 3.929   38.693  -2.764  1.00 48.33  ? 1461 HOH D O   1 
HETATM 5605 O  O   . HOH L 3 .   ? -3.700  48.542  23.332  1.00 27.34  ? 1464 HOH D O   1 
HETATM 5606 O  O   . HOH L 3 .   ? 9.664   34.449  7.535   1.00 37.52  ? 1465 HOH D O   1 
HETATM 5607 O  O   . HOH L 3 .   ? 2.291   44.598  17.507  1.00 29.13  ? 1473 HOH D O   1 
HETATM 5608 O  O   . HOH L 3 .   ? 14.208  27.007  5.559   1.00 71.59  ? 1475 HOH D O   1 
HETATM 5609 O  O   . HOH L 3 .   ? 5.709   13.853  25.069  1.00 38.17  ? 1476 HOH D O   1 
HETATM 5610 O  O   . HOH L 3 .   ? -2.241  23.108  9.791   1.00 22.49  ? 1481 HOH D O   1 
HETATM 5611 O  O   . HOH L 3 .   ? -14.510 31.931  18.666  1.00 35.96  ? 1482 HOH D O   1 
HETATM 5612 O  O   . HOH L 3 .   ? -17.218 43.376  25.304  1.00 40.19  ? 1485 HOH D O   1 
HETATM 5613 O  O   . HOH L 3 .   ? -16.511 44.317  52.508  1.00 52.41  ? 1501 HOH D O   1 
HETATM 5614 O  O   . HOH L 3 .   ? -11.612 25.269  32.469  1.00 50.36  ? 1503 HOH D O   1 
HETATM 5615 O  O   . HOH L 3 .   ? -0.502  39.794  8.582   1.00 53.19  ? 1504 HOH D O   1 
HETATM 5616 O  O   . HOH L 3 .   ? 6.458   46.154  19.551  1.00 54.67  ? 1518 HOH D O   1 
HETATM 5617 O  O   . HOH L 3 .   ? 10.031  38.352  10.128  1.00 36.01  ? 1540 HOH D O   1 
HETATM 5618 O  O   . HOH L 3 .   ? 6.512   49.142  24.535  1.00 41.99  ? 1547 HOH D O   1 
HETATM 5619 O  O   . HOH L 3 .   ? 9.555   34.789  4.149   1.00 79.42  ? 1548 HOH D O   1 
HETATM 5620 O  O   . HOH L 3 .   ? -18.245 30.674  25.756  1.00 41.27  ? 1551 HOH D O   1 
HETATM 5621 O  O   . HOH L 3 .   ? -12.915 50.658  47.898  1.00 45.74  ? 1553 HOH D O   1 
HETATM 5622 O  O   . HOH L 3 .   ? -3.941  13.535  1.395   1.00 53.50  ? 1555 HOH D O   1 
HETATM 5623 O  O   . HOH L 3 .   ? 15.321  25.299  9.378   1.00 57.11  ? 1558 HOH D O   1 
HETATM 5624 O  O   . HOH L 3 .   ? -10.201 15.311  15.703  1.00 51.51  ? 1562 HOH D O   1 
HETATM 5625 O  O   . HOH L 3 .   ? -3.872  43.594  14.192  1.00 39.38  ? 1565 HOH D O   1 
HETATM 5626 O  O   . HOH L 3 .   ? 4.516   24.802  6.487   1.00 49.76  ? 1571 HOH D O   1 
HETATM 5627 O  O   . HOH L 3 .   ? 3.990   24.473  4.282   1.00 49.03  ? 1575 HOH D O   1 
HETATM 5628 O  O   . HOH L 3 .   ? 0.752   24.251  6.112   1.00 46.51  ? 1585 HOH D O   1 
HETATM 5629 O  O   . HOH L 3 .   ? -9.206  29.697  33.443  1.00 36.66  ? 1586 HOH D O   1 
HETATM 5630 O  O   . HOH L 3 .   ? 8.676   47.278  26.634  1.00 59.01  ? 1588 HOH D O   1 
HETATM 5631 O  O   . HOH L 3 .   ? -4.272  25.822  40.351  1.00 61.24  ? 1589 HOH D O   1 
HETATM 5632 O  O   . HOH L 3 .   ? -12.261 48.792  44.731  1.00 47.33  ? 1595 HOH D O   1 
HETATM 5633 O  O   . HOH L 3 .   ? 7.165   45.510  22.616  1.00 44.37  ? 1597 HOH D O   1 
HETATM 5634 O  O   . HOH L 3 .   ? 5.173   22.466  4.082   1.00 59.98  ? 1602 HOH D O   1 
HETATM 5635 O  O   . HOH L 3 .   ? 11.264  25.652  5.133   1.00 56.84  ? 1608 HOH D O   1 
HETATM 5636 O  O   . HOH L 3 .   ? -11.789 39.718  23.578  1.00 43.28  ? 1609 HOH D O   1 
HETATM 5637 O  O   . HOH L 3 .   ? -0.142  42.337  9.957   1.00 28.28  ? 1616 HOH D O   1 
HETATM 5638 O  O   . HOH L 3 .   ? -22.600 31.092  29.311  1.00 46.73  ? 1618 HOH D O   1 
HETATM 5639 O  O   . HOH L 3 .   ? -1.079  23.936  4.264   1.00 71.79  ? 1619 HOH D O   1 
HETATM 5640 O  O   . HOH L 3 .   ? -9.463  16.087  19.241  1.00 38.13  ? 1625 HOH D O   1 
HETATM 5641 O  O   . HOH L 3 .   ? 2.055   53.420  24.451  1.00 72.01  ? 1629 HOH D O   1 
HETATM 5642 O  O   . HOH L 3 .   ? 19.212  35.298  30.172  1.00 25.45  ? 1632 HOH D O   1 
HETATM 5643 O  O   . HOH L 3 .   ? 22.553  41.052  32.154  1.00 68.18  ? 1633 HOH D O   1 
HETATM 5644 O  O   . HOH L 3 .   ? 23.321  40.987  34.684  1.00 37.05  ? 1634 HOH D O   1 
HETATM 5645 O  O   . HOH L 3 .   ? 23.980  44.131  31.622  1.00 44.58  ? 1635 HOH D O   1 
HETATM 5646 O  O   . HOH L 3 .   ? 3.360   53.941  21.450  1.00 46.18  ? 1636 HOH D O   1 
HETATM 5647 O  O   . HOH L 3 .   ? 5.812   51.901  21.483  1.00 42.52  ? 1637 HOH D O   1 
HETATM 5648 O  O   . HOH L 3 .   ? 20.845  36.869  30.572  1.00 63.56  ? 1638 HOH D O   1 
HETATM 5649 O  O   . HOH L 3 .   ? 21.619  39.482  30.252  1.00 66.16  ? 1639 HOH D O   1 
HETATM 5650 O  O   . HOH L 3 .   ? -7.953  30.762  38.120  1.00 44.05  ? 1647 HOH D O   1 
HETATM 5651 O  O   . HOH L 3 .   ? 19.298  38.956  28.800  1.00 53.70  ? 1650 HOH D O   1 
HETATM 5652 O  O   . HOH L 3 .   ? -23.062 30.755  25.982  1.00 40.45  ? 1661 HOH D O   1 
HETATM 5653 O  O   . HOH L 3 .   ? -0.515  26.163  6.116   1.00 22.76  ? 1664 HOH D O   1 
HETATM 5654 O  O   . HOH L 3 .   ? 24.882  38.693  33.948  1.00 49.05  ? 1669 HOH D O   1 
HETATM 5655 O  O   . HOH L 3 .   ? -2.030  52.553  29.662  1.00 33.20  ? 1671 HOH D O   1 
HETATM 5656 O  O   . HOH L 3 .   ? 17.745  27.169  30.172  1.00 47.13  ? 1674 HOH D O   1 
HETATM 5657 O  O   . HOH L 3 .   ? 2.902   41.110  -3.442  1.00 48.88  ? 1676 HOH D O   1 
HETATM 5658 O  O   . HOH L 3 .   ? 1.035   50.184  33.098  1.00 70.14  ? 1681 HOH D O   1 
HETATM 5659 O  O   . HOH L 3 .   ? -8.778  28.290  17.234  1.00 31.97  ? 1684 HOH D O   1 
HETATM 5660 O  O   . HOH L 3 .   ? 11.298  29.615  7.723   1.00 53.93  ? 1689 HOH D O   1 
HETATM 5661 O  O   . HOH L 3 .   ? -6.236  15.445  4.564   1.00 50.19  ? 1692 HOH D O   1 
HETATM 5662 O  O   . HOH L 3 .   ? -0.831  48.628  31.510  1.00 51.32  ? 1695 HOH D O   1 
HETATM 5663 O  O   . HOH L 3 .   ? -5.309  27.252  38.760  1.00 61.34  ? 1698 HOH D O   1 
HETATM 5664 O  O   . HOH L 3 .   ? -10.415 26.690  15.035  1.00 44.87  ? 1701 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   0   0   GLY GLY A . n 
A 1 2   MET 2   1   1   MET MET A . n 
A 1 3   LYS 3   2   2   LYS LYS A . n 
A 1 4   MET 4   3   3   MET MET A . n 
A 1 5   LEU 5   4   4   LEU LEU A . n 
A 1 6   GLU 6   5   5   GLU GLU A . n 
A 1 7   GLN 7   6   6   GLN GLN A . n 
A 1 8   LEU 8   7   7   LEU LEU A . n 
A 1 9   GLU 9   8   8   GLU GLU A . n 
A 1 10  LYS 10  9   9   LYS LYS A . n 
A 1 11  LYS 11  10  10  LYS LYS A . n 
A 1 12  LEU 12  11  11  LEU LEU A . n 
A 1 13  GLY 13  12  12  GLY GLY A . n 
A 1 14  TYR 14  13  13  TYR TYR A . n 
A 1 15  THR 15  14  14  THR THR A . n 
A 1 16  PHE 16  15  15  PHE PHE A . n 
A 1 17  LYS 17  16  16  LYS LYS A . n 
A 1 18  ASP 18  17  17  ASP ASP A . n 
A 1 19  LYS 19  18  18  LYS LYS A . n 
A 1 20  SER 20  19  19  SER SER A . n 
A 1 21  LEU 21  20  20  LEU LEU A . n 
A 1 22  LEU 22  21  21  LEU LEU A . n 
A 1 23  GLU 23  22  22  GLU GLU A . n 
A 1 24  LYS 24  23  23  LYS LYS A . n 
A 1 25  ALA 25  24  24  ALA ALA A . n 
A 1 26  LEU 26  25  25  LEU LEU A . n 
A 1 27  THR 27  26  26  THR THR A . n 
A 1 28  HIS 28  27  27  HIS HIS A . n 
A 1 29  VAL 29  28  28  VAL VAL A . n 
A 1 30  SER 30  29  29  SER SER A . n 
A 1 31  TYR 31  30  30  TYR TYR A . n 
A 1 32  SER 32  31  31  SER SER A . n 
A 1 33  LYS 33  32  32  LYS LYS A . n 
A 1 34  LYS 34  33  33  LYS LYS A . n 
A 1 35  GLU 35  34  34  GLU GLU A . n 
A 1 36  HIS 36  35  35  HIS HIS A . n 
A 1 37  TYR 37  36  36  TYR TYR A . n 
A 1 38  GLU 38  37  37  GLU GLU A . n 
A 1 39  THR 39  38  38  THR THR A . n 
A 1 40  LEU 40  39  39  LEU LEU A . n 
A 1 41  GLU 41  40  40  GLU GLU A . n 
A 1 42  PHE 42  41  41  PHE PHE A . n 
A 1 43  LEU 43  42  42  LEU LEU A . n 
A 1 44  GLY 44  43  43  GLY GLY A . n 
A 1 45  ASP 45  44  44  ASP ASP A . n 
A 1 46  ALA 46  45  45  ALA ALA A . n 
A 1 47  LEU 47  46  46  LEU LEU A . n 
A 1 48  VAL 48  47  47  VAL VAL A . n 
A 1 49  ASN 49  48  48  ASN ASN A . n 
A 1 50  PHE 50  49  49  PHE PHE A . n 
A 1 51  PHE 51  50  50  PHE PHE A . n 
A 1 52  ILE 52  51  51  ILE ILE A . n 
A 1 53  VAL 53  52  52  VAL VAL A . n 
A 1 54  ASP 54  53  53  ASP ASP A . n 
A 1 55  LEU 55  54  54  LEU LEU A . n 
A 1 56  LEU 56  55  55  LEU LEU A . n 
A 1 57  VAL 57  56  56  VAL VAL A . n 
A 1 58  GLN 58  57  57  GLN GLN A . n 
A 1 59  TYR 59  58  58  TYR TYR A . n 
A 1 60  SER 60  59  59  SER SER A . n 
A 1 61  PRO 61  60  60  PRO PRO A . n 
A 1 62  ASN 62  61  61  ASN ASN A . n 
A 1 63  LYS 63  62  62  LYS LYS A . n 
A 1 64  ARG 64  63  63  ARG ARG A . n 
A 1 65  GLU 65  64  64  GLU GLU A . n 
A 1 66  GLY 66  65  65  GLY GLY A . n 
A 1 67  PHE 67  66  66  PHE PHE A . n 
A 1 68  LEU 68  67  67  LEU LEU A . n 
A 1 69  SER 69  68  68  SER SER A . n 
A 1 70  PRO 70  69  69  PRO PRO A . n 
A 1 71  LEU 71  70  70  LEU LEU A . n 
A 1 72  LYS 72  71  71  LYS LYS A . n 
A 1 73  ALA 73  72  72  ALA ALA A . n 
A 1 74  TYR 74  73  73  TYR TYR A . n 
A 1 75  LEU 75  74  74  LEU LEU A . n 
A 1 76  ILE 76  75  75  ILE ILE A . n 
A 1 77  SER 77  76  76  SER SER A . n 
A 1 78  GLU 78  77  77  GLU GLU A . n 
A 1 79  GLU 79  78  78  GLU GLU A . n 
A 1 80  PHE 80  79  79  PHE PHE A . n 
A 1 81  PHE 81  80  80  PHE PHE A . n 
A 1 82  ASN 82  81  81  ASN ASN A . n 
A 1 83  LEU 83  82  82  LEU LEU A . n 
A 1 84  LEU 84  83  83  LEU LEU A . n 
A 1 85  ALA 85  84  84  ALA ALA A . n 
A 1 86  GLN 86  85  85  GLN GLN A . n 
A 1 87  LYS 87  86  86  LYS LYS A . n 
A 1 88  LEU 88  87  87  LEU LEU A . n 
A 1 89  GLU 89  88  88  GLU GLU A . n 
A 1 90  LEU 90  89  89  LEU LEU A . n 
A 1 91  HIS 91  90  90  HIS HIS A . n 
A 1 92  LYS 92  91  91  LYS LYS A . n 
A 1 93  PHE 93  92  92  PHE PHE A . n 
A 1 94  ILE 94  93  93  ILE ILE A . n 
A 1 95  ARG 95  94  94  ARG ARG A . n 
A 1 96  ILE 96  95  95  ILE ILE A . n 
A 1 97  LYS 97  96  96  LYS LYS A . n 
A 1 98  ARG 98  97  97  ARG ARG A . n 
A 1 99  GLY 99  98  98  GLY GLY A . n 
A 1 100 LYS 100 99  99  LYS LYS A . n 
A 1 101 ILE 101 100 100 ILE ILE A . n 
A 1 102 ASN 102 101 101 ASN ASN A . n 
A 1 103 GLU 103 102 102 GLU GLU A . n 
A 1 104 THR 104 103 103 THR THR A . n 
A 1 105 ILE 105 104 104 ILE ILE A . n 
A 1 106 ILE 106 105 105 ILE ILE A . n 
A 1 107 GLY 107 106 106 GLY GLY A . n 
A 1 108 ASP 108 107 107 ASP ASP A . n 
A 1 109 VAL 109 108 108 VAL VAL A . n 
A 1 110 PHE 110 109 109 PHE PHE A . n 
A 1 111 GLU 111 110 110 GLU GLU A . n 
A 1 112 ALA 112 111 111 ALA ALA A . n 
A 1 113 LEU 113 112 112 LEU LEU A . n 
A 1 114 TRP 114 113 113 TRP TRP A . n 
A 1 115 ALA 115 114 114 ALA ALA A . n 
A 1 116 ALA 116 115 115 ALA ALA A . n 
A 1 117 VAL 117 116 116 VAL VAL A . n 
A 1 118 TYR 118 117 117 TYR TYR A . n 
A 1 119 ILE 119 118 118 ILE ILE A . n 
A 1 120 ASP 120 119 119 ASP ASP A . n 
A 1 121 SER 121 120 120 SER SER A . n 
A 1 122 GLY 122 121 121 GLY GLY A . n 
A 1 123 ARG 123 122 122 ARG ARG A . n 
A 1 124 ASP 124 123 123 ASP ASP A . n 
A 1 125 ALA 125 124 124 ALA ALA A . n 
A 1 126 ASN 126 125 125 ASN ASN A . n 
A 1 127 PHE 127 126 126 PHE PHE A . n 
A 1 128 THR 128 127 127 THR THR A . n 
A 1 129 ARG 129 128 128 ARG ARG A . n 
A 1 130 GLU 130 129 129 GLU GLU A . n 
A 1 131 LEU 131 130 130 LEU LEU A . n 
A 1 132 PHE 132 131 131 PHE PHE A . n 
A 1 133 TYR 133 132 132 TYR TYR A . n 
A 1 134 LYS 134 133 133 LYS LYS A . n 
A 1 135 LEU 135 134 134 LEU LEU A . n 
A 1 136 PHE 136 135 135 PHE PHE A . n 
A 1 137 LYS 137 136 136 LYS LYS A . n 
A 1 138 GLU 138 137 137 GLU GLU A . n 
A 1 139 ASP 139 138 138 ASP ASP A . n 
A 1 140 ILE 140 139 139 ILE ILE A . n 
A 1 141 LEU 141 140 140 LEU LEU A . n 
A 1 142 SER 142 141 141 SER SER A . n 
A 1 143 ALA 143 142 142 ALA ALA A . n 
A 1 144 ILE 144 143 143 ILE ILE A . n 
A 1 145 LYS 145 144 144 LYS LYS A . n 
A 1 146 GLU 146 145 145 GLU GLU A . n 
A 1 147 GLY 147 146 146 GLY GLY A . n 
A 1 148 ARG 148 147 147 ARG ARG A . n 
A 1 149 HIS 149 148 ?   ?   ?   A . n 
A 1 150 HIS 150 149 ?   ?   ?   A . n 
A 1 151 HIS 151 150 ?   ?   ?   A . n 
A 1 152 HIS 152 151 ?   ?   ?   A . n 
A 1 153 HIS 153 152 ?   ?   ?   A . n 
A 1 154 HIS 154 153 ?   ?   ?   A . n 
B 1 1   GLY 1   200 200 GLY GLY B . n 
B 1 2   MET 2   201 201 MET MET B . n 
B 1 3   LYS 3   202 202 LYS LYS B . n 
B 1 4   MET 4   203 203 MET MET B . n 
B 1 5   LEU 5   204 204 LEU LEU B . n 
B 1 6   GLU 6   205 205 GLU GLU B . n 
B 1 7   GLN 7   206 206 GLN GLN B . n 
B 1 8   LEU 8   207 207 LEU LEU B . n 
B 1 9   GLU 9   208 208 GLU GLU B . n 
B 1 10  LYS 10  209 209 LYS LYS B . n 
B 1 11  LYS 11  210 210 LYS LYS B . n 
B 1 12  LEU 12  211 211 LEU LEU B . n 
B 1 13  GLY 13  212 212 GLY GLY B . n 
B 1 14  TYR 14  213 213 TYR TYR B . n 
B 1 15  THR 15  214 214 THR THR B . n 
B 1 16  PHE 16  215 215 PHE PHE B . n 
B 1 17  LYS 17  216 216 LYS LYS B . n 
B 1 18  ASP 18  217 217 ASP ASP B . n 
B 1 19  LYS 19  218 218 LYS LYS B . n 
B 1 20  SER 20  219 219 SER SER B . n 
B 1 21  LEU 21  220 220 LEU LEU B . n 
B 1 22  LEU 22  221 221 LEU LEU B . n 
B 1 23  GLU 23  222 222 GLU GLU B . n 
B 1 24  LYS 24  223 223 LYS LYS B . n 
B 1 25  ALA 25  224 224 ALA ALA B . n 
B 1 26  LEU 26  225 225 LEU LEU B . n 
B 1 27  THR 27  226 226 THR THR B . n 
B 1 28  HIS 28  227 227 HIS HIS B . n 
B 1 29  VAL 29  228 228 VAL VAL B . n 
B 1 30  SER 30  229 229 SER SER B . n 
B 1 31  TYR 31  230 230 TYR TYR B . n 
B 1 32  SER 32  231 231 SER SER B . n 
B 1 33  LYS 33  232 232 LYS LYS B . n 
B 1 34  LYS 34  233 233 LYS LYS B . n 
B 1 35  GLU 35  234 234 GLU GLU B . n 
B 1 36  HIS 36  235 235 HIS HIS B . n 
B 1 37  TYR 37  236 236 TYR TYR B . n 
B 1 38  GLU 38  237 237 GLU GLU B . n 
B 1 39  THR 39  238 238 THR THR B . n 
B 1 40  LEU 40  239 239 LEU LEU B . n 
B 1 41  GLU 41  240 240 GLU GLU B . n 
B 1 42  PHE 42  241 241 PHE PHE B . n 
B 1 43  LEU 43  242 242 LEU LEU B . n 
B 1 44  GLY 44  243 243 GLY GLY B . n 
B 1 45  ASP 45  244 244 ASP ASP B . n 
B 1 46  ALA 46  245 245 ALA ALA B . n 
B 1 47  LEU 47  246 246 LEU LEU B . n 
B 1 48  VAL 48  247 247 VAL VAL B . n 
B 1 49  ASN 49  248 248 ASN ASN B . n 
B 1 50  PHE 50  249 249 PHE PHE B . n 
B 1 51  PHE 51  250 250 PHE PHE B . n 
B 1 52  ILE 52  251 251 ILE ILE B . n 
B 1 53  VAL 53  252 252 VAL VAL B . n 
B 1 54  ASP 54  253 253 ASP ASP B . n 
B 1 55  LEU 55  254 254 LEU LEU B . n 
B 1 56  LEU 56  255 255 LEU LEU B . n 
B 1 57  VAL 57  256 256 VAL VAL B . n 
B 1 58  GLN 58  257 257 GLN GLN B . n 
B 1 59  TYR 59  258 258 TYR TYR B . n 
B 1 60  SER 60  259 259 SER SER B . n 
B 1 61  PRO 61  260 260 PRO PRO B . n 
B 1 62  ASN 62  261 261 ASN ASN B . n 
B 1 63  LYS 63  262 262 LYS LYS B . n 
B 1 64  ARG 64  263 263 ARG ARG B . n 
B 1 65  GLU 65  264 264 GLU GLU B . n 
B 1 66  GLY 66  265 265 GLY GLY B . n 
B 1 67  PHE 67  266 266 PHE PHE B . n 
B 1 68  LEU 68  267 267 LEU LEU B . n 
B 1 69  SER 69  268 268 SER SER B . n 
B 1 70  PRO 70  269 269 PRO PRO B . n 
B 1 71  LEU 71  270 270 LEU LEU B . n 
B 1 72  LYS 72  271 271 LYS LYS B . n 
B 1 73  ALA 73  272 272 ALA ALA B . n 
B 1 74  TYR 74  273 273 TYR TYR B . n 
B 1 75  LEU 75  274 274 LEU LEU B . n 
B 1 76  ILE 76  275 275 ILE ILE B . n 
B 1 77  SER 77  276 276 SER SER B . n 
B 1 78  GLU 78  277 277 GLU GLU B . n 
B 1 79  GLU 79  278 278 GLU GLU B . n 
B 1 80  PHE 80  279 279 PHE PHE B . n 
B 1 81  PHE 81  280 280 PHE PHE B . n 
B 1 82  ASN 82  281 281 ASN ASN B . n 
B 1 83  LEU 83  282 282 LEU LEU B . n 
B 1 84  LEU 84  283 283 LEU LEU B . n 
B 1 85  ALA 85  284 284 ALA ALA B . n 
B 1 86  GLN 86  285 285 GLN GLN B . n 
B 1 87  LYS 87  286 286 LYS LYS B . n 
B 1 88  LEU 88  287 287 LEU LEU B . n 
B 1 89  GLU 89  288 288 GLU GLU B . n 
B 1 90  LEU 90  289 289 LEU LEU B . n 
B 1 91  HIS 91  290 290 HIS HIS B . n 
B 1 92  LYS 92  291 291 LYS LYS B . n 
B 1 93  PHE 93  292 292 PHE PHE B . n 
B 1 94  ILE 94  293 293 ILE ILE B . n 
B 1 95  ARG 95  294 294 ARG ARG B . n 
B 1 96  ILE 96  295 295 ILE ILE B . n 
B 1 97  LYS 97  296 296 LYS LYS B . n 
B 1 98  ARG 98  297 297 ARG ARG B . n 
B 1 99  GLY 99  298 298 GLY GLY B . n 
B 1 100 LYS 100 299 299 LYS LYS B . n 
B 1 101 ILE 101 300 300 ILE ILE B . n 
B 1 102 ASN 102 301 301 ASN ASN B . n 
B 1 103 GLU 103 302 302 GLU GLU B . n 
B 1 104 THR 104 303 303 THR THR B . n 
B 1 105 ILE 105 304 304 ILE ILE B . n 
B 1 106 ILE 106 305 305 ILE ILE B . n 
B 1 107 GLY 107 306 306 GLY GLY B . n 
B 1 108 ASP 108 307 307 ASP ASP B . n 
B 1 109 VAL 109 308 308 VAL VAL B . n 
B 1 110 PHE 110 309 309 PHE PHE B . n 
B 1 111 GLU 111 310 310 GLU GLU B . n 
B 1 112 ALA 112 311 311 ALA ALA B . n 
B 1 113 LEU 113 312 312 LEU LEU B . n 
B 1 114 TRP 114 313 313 TRP TRP B . n 
B 1 115 ALA 115 314 314 ALA ALA B . n 
B 1 116 ALA 116 315 315 ALA ALA B . n 
B 1 117 VAL 117 316 316 VAL VAL B . n 
B 1 118 TYR 118 317 317 TYR TYR B . n 
B 1 119 ILE 119 318 318 ILE ILE B . n 
B 1 120 ASP 120 319 319 ASP ASP B . n 
B 1 121 SER 121 320 320 SER SER B . n 
B 1 122 GLY 122 321 321 GLY GLY B . n 
B 1 123 ARG 123 322 322 ARG ARG B . n 
B 1 124 ASP 124 323 323 ASP ASP B . n 
B 1 125 ALA 125 324 324 ALA ALA B . n 
B 1 126 ASN 126 325 325 ASN ASN B . n 
B 1 127 PHE 127 326 326 PHE PHE B . n 
B 1 128 THR 128 327 327 THR THR B . n 
B 1 129 ARG 129 328 328 ARG ARG B . n 
B 1 130 GLU 130 329 329 GLU GLU B . n 
B 1 131 LEU 131 330 330 LEU LEU B . n 
B 1 132 PHE 132 331 331 PHE PHE B . n 
B 1 133 TYR 133 332 332 TYR TYR B . n 
B 1 134 LYS 134 333 333 LYS LYS B . n 
B 1 135 LEU 135 334 334 LEU LEU B . n 
B 1 136 PHE 136 335 335 PHE PHE B . n 
B 1 137 LYS 137 336 336 LYS LYS B . n 
B 1 138 GLU 138 337 337 GLU GLU B . n 
B 1 139 ASP 139 338 338 ASP ASP B . n 
B 1 140 ILE 140 339 339 ILE ILE B . n 
B 1 141 LEU 141 340 340 LEU LEU B . n 
B 1 142 SER 142 341 341 SER SER B . n 
B 1 143 ALA 143 342 342 ALA ALA B . n 
B 1 144 ILE 144 343 343 ILE ILE B . n 
B 1 145 LYS 145 344 344 LYS LYS B . n 
B 1 146 GLU 146 345 345 GLU GLU B . n 
B 1 147 GLY 147 346 346 GLY GLY B . n 
B 1 148 ARG 148 347 347 ARG ARG B . n 
B 1 149 HIS 149 348 348 HIS HIS B . n 
B 1 150 HIS 150 349 ?   ?   ?   B . n 
B 1 151 HIS 151 350 ?   ?   ?   B . n 
B 1 152 HIS 152 351 ?   ?   ?   B . n 
B 1 153 HIS 153 352 ?   ?   ?   B . n 
B 1 154 HIS 154 353 ?   ?   ?   B . n 
C 1 1   GLY 1   400 400 GLY GLY C . n 
C 1 2   MET 2   401 401 MET MET C . n 
C 1 3   LYS 3   402 402 LYS LYS C . n 
C 1 4   MET 4   403 403 MET MET C . n 
C 1 5   LEU 5   404 404 LEU LEU C . n 
C 1 6   GLU 6   405 405 GLU GLU C . n 
C 1 7   GLN 7   406 406 GLN GLN C . n 
C 1 8   LEU 8   407 407 LEU LEU C . n 
C 1 9   GLU 9   408 408 GLU GLU C . n 
C 1 10  LYS 10  409 409 LYS LYS C . n 
C 1 11  LYS 11  410 410 LYS LYS C . n 
C 1 12  LEU 12  411 411 LEU LEU C . n 
C 1 13  GLY 13  412 412 GLY GLY C . n 
C 1 14  TYR 14  413 413 TYR TYR C . n 
C 1 15  THR 15  414 414 THR THR C . n 
C 1 16  PHE 16  415 415 PHE PHE C . n 
C 1 17  LYS 17  416 416 LYS LYS C . n 
C 1 18  ASP 18  417 417 ASP ASP C . n 
C 1 19  LYS 19  418 418 LYS LYS C . n 
C 1 20  SER 20  419 419 SER SER C . n 
C 1 21  LEU 21  420 420 LEU LEU C . n 
C 1 22  LEU 22  421 421 LEU LEU C . n 
C 1 23  GLU 23  422 422 GLU GLU C . n 
C 1 24  LYS 24  423 423 LYS LYS C . n 
C 1 25  ALA 25  424 424 ALA ALA C . n 
C 1 26  LEU 26  425 425 LEU LEU C . n 
C 1 27  THR 27  426 426 THR THR C . n 
C 1 28  HIS 28  427 427 HIS HIS C . n 
C 1 29  VAL 29  428 428 VAL VAL C . n 
C 1 30  SER 30  429 429 SER SER C . n 
C 1 31  TYR 31  430 430 TYR TYR C . n 
C 1 32  SER 32  431 431 SER SER C . n 
C 1 33  LYS 33  432 432 LYS LYS C . n 
C 1 34  LYS 34  433 433 LYS LYS C . n 
C 1 35  GLU 35  434 434 GLU GLU C . n 
C 1 36  HIS 36  435 435 HIS HIS C . n 
C 1 37  TYR 37  436 436 TYR TYR C . n 
C 1 38  GLU 38  437 437 GLU GLU C . n 
C 1 39  THR 39  438 438 THR THR C . n 
C 1 40  LEU 40  439 439 LEU LEU C . n 
C 1 41  GLU 41  440 440 GLU GLU C . n 
C 1 42  PHE 42  441 441 PHE PHE C . n 
C 1 43  LEU 43  442 442 LEU LEU C . n 
C 1 44  GLY 44  443 443 GLY GLY C . n 
C 1 45  ASP 45  444 444 ASP ASP C . n 
C 1 46  ALA 46  445 445 ALA ALA C . n 
C 1 47  LEU 47  446 446 LEU LEU C . n 
C 1 48  VAL 48  447 447 VAL VAL C . n 
C 1 49  ASN 49  448 448 ASN ASN C . n 
C 1 50  PHE 50  449 449 PHE PHE C . n 
C 1 51  PHE 51  450 450 PHE PHE C . n 
C 1 52  ILE 52  451 451 ILE ILE C . n 
C 1 53  VAL 53  452 452 VAL VAL C . n 
C 1 54  ASP 54  453 453 ASP ASP C . n 
C 1 55  LEU 55  454 454 LEU LEU C . n 
C 1 56  LEU 56  455 455 LEU LEU C . n 
C 1 57  VAL 57  456 456 VAL VAL C . n 
C 1 58  GLN 58  457 457 GLN GLN C . n 
C 1 59  TYR 59  458 458 TYR TYR C . n 
C 1 60  SER 60  459 459 SER SER C . n 
C 1 61  PRO 61  460 460 PRO PRO C . n 
C 1 62  ASN 62  461 461 ASN ASN C . n 
C 1 63  LYS 63  462 462 LYS LYS C . n 
C 1 64  ARG 64  463 463 ARG ARG C . n 
C 1 65  GLU 65  464 464 GLU GLU C . n 
C 1 66  GLY 66  465 465 GLY GLY C . n 
C 1 67  PHE 67  466 466 PHE PHE C . n 
C 1 68  LEU 68  467 467 LEU LEU C . n 
C 1 69  SER 69  468 468 SER SER C . n 
C 1 70  PRO 70  469 469 PRO PRO C . n 
C 1 71  LEU 71  470 470 LEU LEU C . n 
C 1 72  LYS 72  471 471 LYS LYS C . n 
C 1 73  ALA 73  472 472 ALA ALA C . n 
C 1 74  TYR 74  473 473 TYR TYR C . n 
C 1 75  LEU 75  474 474 LEU LEU C . n 
C 1 76  ILE 76  475 475 ILE ILE C . n 
C 1 77  SER 77  476 476 SER SER C . n 
C 1 78  GLU 78  477 477 GLU GLU C . n 
C 1 79  GLU 79  478 478 GLU GLU C . n 
C 1 80  PHE 80  479 479 PHE PHE C . n 
C 1 81  PHE 81  480 480 PHE PHE C . n 
C 1 82  ASN 82  481 481 ASN ASN C . n 
C 1 83  LEU 83  482 482 LEU LEU C . n 
C 1 84  LEU 84  483 483 LEU LEU C . n 
C 1 85  ALA 85  484 484 ALA ALA C . n 
C 1 86  GLN 86  485 485 GLN GLN C . n 
C 1 87  LYS 87  486 486 LYS LYS C . n 
C 1 88  LEU 88  487 487 LEU LEU C . n 
C 1 89  GLU 89  488 488 GLU GLU C . n 
C 1 90  LEU 90  489 489 LEU LEU C . n 
C 1 91  HIS 91  490 490 HIS HIS C . n 
C 1 92  LYS 92  491 491 LYS LYS C . n 
C 1 93  PHE 93  492 492 PHE PHE C . n 
C 1 94  ILE 94  493 493 ILE ILE C . n 
C 1 95  ARG 95  494 494 ARG ARG C . n 
C 1 96  ILE 96  495 495 ILE ILE C . n 
C 1 97  LYS 97  496 496 LYS LYS C . n 
C 1 98  ARG 98  497 497 ARG ARG C . n 
C 1 99  GLY 99  498 498 GLY GLY C . n 
C 1 100 LYS 100 499 499 LYS LYS C . n 
C 1 101 ILE 101 500 500 ILE ILE C . n 
C 1 102 ASN 102 501 501 ASN ASN C . n 
C 1 103 GLU 103 502 502 GLU GLU C . n 
C 1 104 THR 104 503 503 THR THR C . n 
C 1 105 ILE 105 504 504 ILE ILE C . n 
C 1 106 ILE 106 505 505 ILE ILE C . n 
C 1 107 GLY 107 506 506 GLY GLY C . n 
C 1 108 ASP 108 507 507 ASP ASP C . n 
C 1 109 VAL 109 508 508 VAL VAL C . n 
C 1 110 PHE 110 509 509 PHE PHE C . n 
C 1 111 GLU 111 510 510 GLU GLU C . n 
C 1 112 ALA 112 511 511 ALA ALA C . n 
C 1 113 LEU 113 512 512 LEU LEU C . n 
C 1 114 TRP 114 513 513 TRP TRP C . n 
C 1 115 ALA 115 514 514 ALA ALA C . n 
C 1 116 ALA 116 515 515 ALA ALA C . n 
C 1 117 VAL 117 516 516 VAL VAL C . n 
C 1 118 TYR 118 517 517 TYR TYR C . n 
C 1 119 ILE 119 518 518 ILE ILE C . n 
C 1 120 ASP 120 519 519 ASP ASP C . n 
C 1 121 SER 121 520 520 SER SER C . n 
C 1 122 GLY 122 521 521 GLY GLY C . n 
C 1 123 ARG 123 522 522 ARG ARG C . n 
C 1 124 ASP 124 523 523 ASP ASP C . n 
C 1 125 ALA 125 524 524 ALA ALA C . n 
C 1 126 ASN 126 525 525 ASN ASN C . n 
C 1 127 PHE 127 526 526 PHE PHE C . n 
C 1 128 THR 128 527 527 THR THR C . n 
C 1 129 ARG 129 528 528 ARG ARG C . n 
C 1 130 GLU 130 529 529 GLU GLU C . n 
C 1 131 LEU 131 530 530 LEU LEU C . n 
C 1 132 PHE 132 531 531 PHE PHE C . n 
C 1 133 TYR 133 532 532 TYR TYR C . n 
C 1 134 LYS 134 533 533 LYS LYS C . n 
C 1 135 LEU 135 534 534 LEU LEU C . n 
C 1 136 PHE 136 535 535 PHE PHE C . n 
C 1 137 LYS 137 536 536 LYS LYS C . n 
C 1 138 GLU 138 537 537 GLU GLU C . n 
C 1 139 ASP 139 538 538 ASP ASP C . n 
C 1 140 ILE 140 539 539 ILE ILE C . n 
C 1 141 LEU 141 540 540 LEU LEU C . n 
C 1 142 SER 142 541 541 SER SER C . n 
C 1 143 ALA 143 542 542 ALA ALA C . n 
C 1 144 ILE 144 543 543 ILE ILE C . n 
C 1 145 LYS 145 544 544 LYS LYS C . n 
C 1 146 GLU 146 545 545 GLU GLU C . n 
C 1 147 GLY 147 546 546 GLY GLY C . n 
C 1 148 ARG 148 547 547 ARG ARG C . n 
C 1 149 HIS 149 548 548 HIS HIS C . n 
C 1 150 HIS 150 549 ?   ?   ?   C . n 
C 1 151 HIS 151 550 ?   ?   ?   C . n 
C 1 152 HIS 152 551 ?   ?   ?   C . n 
C 1 153 HIS 153 552 ?   ?   ?   C . n 
C 1 154 HIS 154 553 ?   ?   ?   C . n 
D 1 1   GLY 1   600 600 GLY GLY D . n 
D 1 2   MET 2   601 601 MET MET D . n 
D 1 3   LYS 3   602 602 LYS LYS D . n 
D 1 4   MET 4   603 603 MET MET D . n 
D 1 5   LEU 5   604 604 LEU LEU D . n 
D 1 6   GLU 6   605 605 GLU GLU D . n 
D 1 7   GLN 7   606 606 GLN GLN D . n 
D 1 8   LEU 8   607 607 LEU LEU D . n 
D 1 9   GLU 9   608 608 GLU GLU D . n 
D 1 10  LYS 10  609 609 LYS LYS D . n 
D 1 11  LYS 11  610 610 LYS LYS D . n 
D 1 12  LEU 12  611 611 LEU LEU D . n 
D 1 13  GLY 13  612 612 GLY GLY D . n 
D 1 14  TYR 14  613 613 TYR TYR D . n 
D 1 15  THR 15  614 614 THR THR D . n 
D 1 16  PHE 16  615 615 PHE PHE D . n 
D 1 17  LYS 17  616 616 LYS LYS D . n 
D 1 18  ASP 18  617 617 ASP ASP D . n 
D 1 19  LYS 19  618 618 LYS LYS D . n 
D 1 20  SER 20  619 619 SER SER D . n 
D 1 21  LEU 21  620 620 LEU LEU D . n 
D 1 22  LEU 22  621 621 LEU LEU D . n 
D 1 23  GLU 23  622 622 GLU GLU D . n 
D 1 24  LYS 24  623 623 LYS LYS D . n 
D 1 25  ALA 25  624 624 ALA ALA D . n 
D 1 26  LEU 26  625 625 LEU LEU D . n 
D 1 27  THR 27  626 626 THR THR D . n 
D 1 28  HIS 28  627 627 HIS HIS D . n 
D 1 29  VAL 29  628 628 VAL VAL D . n 
D 1 30  SER 30  629 629 SER SER D . n 
D 1 31  TYR 31  630 630 TYR TYR D . n 
D 1 32  SER 32  631 631 SER SER D . n 
D 1 33  LYS 33  632 632 LYS LYS D . n 
D 1 34  LYS 34  633 633 LYS LYS D . n 
D 1 35  GLU 35  634 634 GLU GLU D . n 
D 1 36  HIS 36  635 635 HIS HIS D . n 
D 1 37  TYR 37  636 636 TYR TYR D . n 
D 1 38  GLU 38  637 637 GLU GLU D . n 
D 1 39  THR 39  638 638 THR THR D . n 
D 1 40  LEU 40  639 639 LEU LEU D . n 
D 1 41  GLU 41  640 640 GLU GLU D . n 
D 1 42  PHE 42  641 641 PHE PHE D . n 
D 1 43  LEU 43  642 642 LEU LEU D . n 
D 1 44  GLY 44  643 643 GLY GLY D . n 
D 1 45  ASP 45  644 644 ASP ASP D . n 
D 1 46  ALA 46  645 645 ALA ALA D . n 
D 1 47  LEU 47  646 646 LEU LEU D . n 
D 1 48  VAL 48  647 647 VAL VAL D . n 
D 1 49  ASN 49  648 648 ASN ASN D . n 
D 1 50  PHE 50  649 649 PHE PHE D . n 
D 1 51  PHE 51  650 650 PHE PHE D . n 
D 1 52  ILE 52  651 651 ILE ILE D . n 
D 1 53  VAL 53  652 652 VAL VAL D . n 
D 1 54  ASP 54  653 653 ASP ASP D . n 
D 1 55  LEU 55  654 654 LEU LEU D . n 
D 1 56  LEU 56  655 655 LEU LEU D . n 
D 1 57  VAL 57  656 656 VAL VAL D . n 
D 1 58  GLN 58  657 657 GLN GLN D . n 
D 1 59  TYR 59  658 658 TYR TYR D . n 
D 1 60  SER 60  659 659 SER SER D . n 
D 1 61  PRO 61  660 660 PRO PRO D . n 
D 1 62  ASN 62  661 661 ASN ASN D . n 
D 1 63  LYS 63  662 662 LYS LYS D . n 
D 1 64  ARG 64  663 663 ARG ARG D . n 
D 1 65  GLU 65  664 664 GLU GLU D . n 
D 1 66  GLY 66  665 665 GLY GLY D . n 
D 1 67  PHE 67  666 666 PHE PHE D . n 
D 1 68  LEU 68  667 667 LEU LEU D . n 
D 1 69  SER 69  668 668 SER SER D . n 
D 1 70  PRO 70  669 669 PRO PRO D . n 
D 1 71  LEU 71  670 670 LEU LEU D . n 
D 1 72  LYS 72  671 671 LYS LYS D . n 
D 1 73  ALA 73  672 672 ALA ALA D . n 
D 1 74  TYR 74  673 673 TYR TYR D . n 
D 1 75  LEU 75  674 674 LEU LEU D . n 
D 1 76  ILE 76  675 675 ILE ILE D . n 
D 1 77  SER 77  676 676 SER SER D . n 
D 1 78  GLU 78  677 677 GLU GLU D . n 
D 1 79  GLU 79  678 678 GLU GLU D . n 
D 1 80  PHE 80  679 679 PHE PHE D . n 
D 1 81  PHE 81  680 680 PHE PHE D . n 
D 1 82  ASN 82  681 681 ASN ASN D . n 
D 1 83  LEU 83  682 682 LEU LEU D . n 
D 1 84  LEU 84  683 683 LEU LEU D . n 
D 1 85  ALA 85  684 684 ALA ALA D . n 
D 1 86  GLN 86  685 685 GLN GLN D . n 
D 1 87  LYS 87  686 686 LYS LYS D . n 
D 1 88  LEU 88  687 687 LEU LEU D . n 
D 1 89  GLU 89  688 688 GLU GLU D . n 
D 1 90  LEU 90  689 689 LEU LEU D . n 
D 1 91  HIS 91  690 690 HIS HIS D . n 
D 1 92  LYS 92  691 691 LYS LYS D . n 
D 1 93  PHE 93  692 692 PHE PHE D . n 
D 1 94  ILE 94  693 693 ILE ILE D . n 
D 1 95  ARG 95  694 694 ARG ARG D . n 
D 1 96  ILE 96  695 695 ILE ILE D . n 
D 1 97  LYS 97  696 696 LYS LYS D . n 
D 1 98  ARG 98  697 697 ARG ARG D . n 
D 1 99  GLY 99  698 698 GLY GLY D . n 
D 1 100 LYS 100 699 699 LYS LYS D . n 
D 1 101 ILE 101 700 700 ILE ILE D . n 
D 1 102 ASN 102 701 701 ASN ASN D . n 
D 1 103 GLU 103 702 702 GLU GLU D . n 
D 1 104 THR 104 703 703 THR THR D . n 
D 1 105 ILE 105 704 704 ILE ILE D . n 
D 1 106 ILE 106 705 705 ILE ILE D . n 
D 1 107 GLY 107 706 706 GLY GLY D . n 
D 1 108 ASP 108 707 707 ASP ASP D . n 
D 1 109 VAL 109 708 708 VAL VAL D . n 
D 1 110 PHE 110 709 709 PHE PHE D . n 
D 1 111 GLU 111 710 710 GLU GLU D . n 
D 1 112 ALA 112 711 711 ALA ALA D . n 
D 1 113 LEU 113 712 712 LEU LEU D . n 
D 1 114 TRP 114 713 713 TRP TRP D . n 
D 1 115 ALA 115 714 714 ALA ALA D . n 
D 1 116 ALA 116 715 715 ALA ALA D . n 
D 1 117 VAL 117 716 716 VAL VAL D . n 
D 1 118 TYR 118 717 717 TYR TYR D . n 
D 1 119 ILE 119 718 718 ILE ILE D . n 
D 1 120 ASP 120 719 719 ASP ASP D . n 
D 1 121 SER 121 720 720 SER SER D . n 
D 1 122 GLY 122 721 721 GLY GLY D . n 
D 1 123 ARG 123 722 722 ARG ARG D . n 
D 1 124 ASP 124 723 723 ASP ASP D . n 
D 1 125 ALA 125 724 724 ALA ALA D . n 
D 1 126 ASN 126 725 725 ASN ASN D . n 
D 1 127 PHE 127 726 726 PHE PHE D . n 
D 1 128 THR 128 727 727 THR THR D . n 
D 1 129 ARG 129 728 728 ARG ARG D . n 
D 1 130 GLU 130 729 729 GLU GLU D . n 
D 1 131 LEU 131 730 730 LEU LEU D . n 
D 1 132 PHE 132 731 731 PHE PHE D . n 
D 1 133 TYR 133 732 732 TYR TYR D . n 
D 1 134 LYS 134 733 733 LYS LYS D . n 
D 1 135 LEU 135 734 734 LEU LEU D . n 
D 1 136 PHE 136 735 735 PHE PHE D . n 
D 1 137 LYS 137 736 736 LYS LYS D . n 
D 1 138 GLU 138 737 737 GLU GLU D . n 
D 1 139 ASP 139 738 738 ASP ASP D . n 
D 1 140 ILE 140 739 739 ILE ILE D . n 
D 1 141 LEU 141 740 740 LEU LEU D . n 
D 1 142 SER 142 741 741 SER SER D . n 
D 1 143 ALA 143 742 742 ALA ALA D . n 
D 1 144 ILE 144 743 743 ILE ILE D . n 
D 1 145 LYS 145 744 744 LYS LYS D . n 
D 1 146 GLU 146 745 745 GLU GLU D . n 
D 1 147 GLY 147 746 746 GLY GLY D . n 
D 1 148 ARG 148 747 747 ARG ARG D . n 
D 1 149 HIS 149 748 ?   ?   ?   D . n 
D 1 150 HIS 150 749 ?   ?   ?   D . n 
D 1 151 HIS 151 750 ?   ?   ?   D . n 
D 1 152 HIS 152 751 ?   ?   ?   D . n 
D 1 153 HIS 153 752 ?   ?   ?   D . n 
D 1 154 HIS 154 753 ?   ?   ?   D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,I,J 
2 1 C,D,G,H,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2560  ? 
1 MORE         -21   ? 
1 'SSA (A^2)'  14500 ? 
2 'ABSA (A^2)' 2600  ? 
2 MORE         -21   ? 
2 'SSA (A^2)'  13900 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE2 ? A GLU 41  ? A GLU 40   ? 1_555 MN ? E MN . ? A MN 761 ? 1_555 OD1 ? A ASP 108 ? A ASP 107  ? 1_555 72.9  ? 
2  OE2 ? A GLU 41  ? A GLU 40   ? 1_555 MN ? E MN . ? A MN 761 ? 1_555 OE1 ? A GLU 111 ? A GLU 110  ? 1_555 103.6 ? 
3  OD1 ? A ASP 108 ? A ASP 107  ? 1_555 MN ? E MN . ? A MN 761 ? 1_555 OE1 ? A GLU 111 ? A GLU 110  ? 1_555 106.8 ? 
4  OE2 ? A GLU 41  ? A GLU 40   ? 1_555 MN ? E MN . ? A MN 761 ? 1_555 O   ? I HOH .   ? A HOH 1137 ? 1_555 161.6 ? 
5  OD1 ? A ASP 108 ? A ASP 107  ? 1_555 MN ? E MN . ? A MN 761 ? 1_555 O   ? I HOH .   ? A HOH 1137 ? 1_555 96.7  ? 
6  OE1 ? A GLU 111 ? A GLU 110  ? 1_555 MN ? E MN . ? A MN 761 ? 1_555 O   ? I HOH .   ? A HOH 1137 ? 1_555 93.8  ? 
7  OE2 ? A GLU 41  ? A GLU 40   ? 1_555 MN ? E MN . ? A MN 761 ? 1_555 O   ? I HOH .   ? A HOH 1004 ? 1_555 90.8  ? 
8  OD1 ? A ASP 108 ? A ASP 107  ? 1_555 MN ? E MN . ? A MN 761 ? 1_555 O   ? I HOH .   ? A HOH 1004 ? 1_555 163.0 ? 
9  OE1 ? A GLU 111 ? A GLU 110  ? 1_555 MN ? E MN . ? A MN 761 ? 1_555 O   ? I HOH .   ? A HOH 1004 ? 1_555 81.5  ? 
10 O   ? I HOH .   ? A HOH 1137 ? 1_555 MN ? E MN . ? A MN 761 ? 1_555 O   ? I HOH .   ? A HOH 1004 ? 1_555 97.6  ? 
11 OE2 ? A GLU 41  ? A GLU 40   ? 1_555 MN ? E MN . ? A MN 761 ? 1_555 O   ? I HOH .   ? A HOH 1056 ? 1_555 75.4  ? 
12 OD1 ? A ASP 108 ? A ASP 107  ? 1_555 MN ? E MN . ? A MN 761 ? 1_555 O   ? I HOH .   ? A HOH 1056 ? 1_555 86.5  ? 
13 OE1 ? A GLU 111 ? A GLU 110  ? 1_555 MN ? E MN . ? A MN 761 ? 1_555 O   ? I HOH .   ? A HOH 1056 ? 1_555 165.9 ? 
14 O   ? I HOH .   ? A HOH 1137 ? 1_555 MN ? E MN . ? A MN 761 ? 1_555 O   ? I HOH .   ? A HOH 1056 ? 1_555 89.1  ? 
15 O   ? I HOH .   ? A HOH 1004 ? 1_555 MN ? E MN . ? A MN 761 ? 1_555 O   ? I HOH .   ? A HOH 1056 ? 1_555 84.4  ? 
16 O   ? J HOH .   ? B HOH 1325 ? 1_555 MN ? F MN . ? B MN 762 ? 1_555 OE1 ? B GLU 111 ? B GLU 310  ? 1_555 76.8  ? 
17 O   ? J HOH .   ? B HOH 1325 ? 1_555 MN ? F MN . ? B MN 762 ? 1_555 OE1 ? B GLU 41  ? B GLU 240  ? 1_555 120.6 ? 
18 OE1 ? B GLU 111 ? B GLU 310  ? 1_555 MN ? F MN . ? B MN 762 ? 1_555 OE1 ? B GLU 41  ? B GLU 240  ? 1_555 77.0  ? 
19 O   ? J HOH .   ? B HOH 1325 ? 1_555 MN ? F MN . ? B MN 762 ? 1_555 OD1 ? B ASP 108 ? B ASP 307  ? 1_555 162.4 ? 
20 OE1 ? B GLU 111 ? B GLU 310  ? 1_555 MN ? F MN . ? B MN 762 ? 1_555 OD1 ? B ASP 108 ? B ASP 307  ? 1_555 92.7  ? 
21 OE1 ? B GLU 41  ? B GLU 240  ? 1_555 MN ? F MN . ? B MN 762 ? 1_555 OD1 ? B ASP 108 ? B ASP 307  ? 1_555 69.4  ? 
22 O   ? J HOH .   ? B HOH 1325 ? 1_555 MN ? F MN . ? B MN 762 ? 1_555 O   ? J HOH .   ? B HOH 1007 ? 1_555 99.7  ? 
23 OE1 ? B GLU 111 ? B GLU 310  ? 1_555 MN ? F MN . ? B MN 762 ? 1_555 O   ? J HOH .   ? B HOH 1007 ? 1_555 176.0 ? 
24 OE1 ? B GLU 41  ? B GLU 240  ? 1_555 MN ? F MN . ? B MN 762 ? 1_555 O   ? J HOH .   ? B HOH 1007 ? 1_555 103.3 ? 
25 OD1 ? B ASP 108 ? B ASP 307  ? 1_555 MN ? F MN . ? B MN 762 ? 1_555 O   ? J HOH .   ? B HOH 1007 ? 1_555 91.2  ? 
26 OE2 ? C GLU 41  ? C GLU 440  ? 1_555 MN ? G MN . ? C MN 763 ? 1_555 O   ? K HOH .   ? C HOH 1008 ? 1_555 85.7  ? 
27 OE2 ? C GLU 41  ? C GLU 440  ? 1_555 MN ? G MN . ? C MN 763 ? 1_555 O   ? K HOH .   ? C HOH 1039 ? 1_555 156.4 ? 
28 O   ? K HOH .   ? C HOH 1008 ? 1_555 MN ? G MN . ? C MN 763 ? 1_555 O   ? K HOH .   ? C HOH 1039 ? 1_555 70.7  ? 
29 OE2 ? C GLU 41  ? C GLU 440  ? 1_555 MN ? G MN . ? C MN 763 ? 1_555 OE1 ? C GLU 111 ? C GLU 510  ? 1_555 96.0  ? 
30 O   ? K HOH .   ? C HOH 1008 ? 1_555 MN ? G MN . ? C MN 763 ? 1_555 OE1 ? C GLU 111 ? C GLU 510  ? 1_555 92.9  ? 
31 O   ? K HOH .   ? C HOH 1039 ? 1_555 MN ? G MN . ? C MN 763 ? 1_555 OE1 ? C GLU 111 ? C GLU 510  ? 1_555 85.8  ? 
32 OE2 ? C GLU 41  ? C GLU 440  ? 1_555 MN ? G MN . ? C MN 763 ? 1_555 OD1 ? C ASP 108 ? C ASP 507  ? 1_555 74.8  ? 
33 O   ? K HOH .   ? C HOH 1008 ? 1_555 MN ? G MN . ? C MN 763 ? 1_555 OD1 ? C ASP 108 ? C ASP 507  ? 1_555 158.7 ? 
34 O   ? K HOH .   ? C HOH 1039 ? 1_555 MN ? G MN . ? C MN 763 ? 1_555 OD1 ? C ASP 108 ? C ASP 507  ? 1_555 128.4 ? 
35 OE1 ? C GLU 111 ? C GLU 510  ? 1_555 MN ? G MN . ? C MN 763 ? 1_555 OD1 ? C ASP 108 ? C ASP 507  ? 1_555 97.6  ? 
36 OE2 ? C GLU 41  ? C GLU 440  ? 1_555 MN ? G MN . ? C MN 763 ? 1_555 O   ? K HOH .   ? C HOH 1015 ? 1_555 94.9  ? 
37 O   ? K HOH .   ? C HOH 1008 ? 1_555 MN ? G MN . ? C MN 763 ? 1_555 O   ? K HOH .   ? C HOH 1015 ? 1_555 84.2  ? 
38 O   ? K HOH .   ? C HOH 1039 ? 1_555 MN ? G MN . ? C MN 763 ? 1_555 O   ? K HOH .   ? C HOH 1015 ? 1_555 82.7  ? 
39 OE1 ? C GLU 111 ? C GLU 510  ? 1_555 MN ? G MN . ? C MN 763 ? 1_555 O   ? K HOH .   ? C HOH 1015 ? 1_555 168.5 ? 
40 OD1 ? C ASP 108 ? C ASP 507  ? 1_555 MN ? G MN . ? C MN 763 ? 1_555 O   ? K HOH .   ? C HOH 1015 ? 1_555 88.9  ? 
41 OE2 ? D GLU 41  ? D GLU 640  ? 1_555 MN ? H MN . ? D MN 764 ? 1_555 OD1 ? D ASP 108 ? D ASP 707  ? 1_555 107.1 ? 
42 OE2 ? D GLU 41  ? D GLU 640  ? 1_555 MN ? H MN . ? D MN 764 ? 1_555 OE1 ? D GLU 111 ? D GLU 710  ? 1_555 94.4  ? 
43 OD1 ? D ASP 108 ? D ASP 707  ? 1_555 MN ? H MN . ? D MN 764 ? 1_555 OE1 ? D GLU 111 ? D GLU 710  ? 1_555 111.7 ? 
44 OE2 ? D GLU 41  ? D GLU 640  ? 1_555 MN ? H MN . ? D MN 764 ? 1_555 O   ? L HOH .   ? D HOH 1124 ? 1_555 77.6  ? 
45 OD1 ? D ASP 108 ? D ASP 707  ? 1_555 MN ? H MN . ? D MN 764 ? 1_555 O   ? L HOH .   ? D HOH 1124 ? 1_555 85.2  ? 
46 OE1 ? D GLU 111 ? D GLU 710  ? 1_555 MN ? H MN . ? D MN 764 ? 1_555 O   ? L HOH .   ? D HOH 1124 ? 1_555 162.9 ? 
47 OE2 ? D GLU 41  ? D GLU 640  ? 1_555 MN ? H MN . ? D MN 764 ? 1_555 O   ? L HOH .   ? D HOH 1308 ? 1_555 96.5  ? 
48 OD1 ? D ASP 108 ? D ASP 707  ? 1_555 MN ? H MN . ? D MN 764 ? 1_555 O   ? L HOH .   ? D HOH 1308 ? 1_555 152.1 ? 
49 OE1 ? D GLU 111 ? D GLU 710  ? 1_555 MN ? H MN . ? D MN 764 ? 1_555 O   ? L HOH .   ? D HOH 1308 ? 1_555 80.4  ? 
50 O   ? L HOH .   ? D HOH 1124 ? 1_555 MN ? H MN . ? D MN 764 ? 1_555 O   ? L HOH .   ? D HOH 1308 ? 1_555 85.4  ? 
51 OE2 ? D GLU 41  ? D GLU 640  ? 1_555 MN ? H MN . ? D MN 764 ? 1_555 OE1 ? D GLU 41  ? D GLU 640  ? 1_555 50.5  ? 
52 OD1 ? D ASP 108 ? D ASP 707  ? 1_555 MN ? H MN . ? D MN 764 ? 1_555 OE1 ? D GLU 41  ? D GLU 640  ? 1_555 81.5  ? 
53 OE1 ? D GLU 111 ? D GLU 710  ? 1_555 MN ? H MN . ? D MN 764 ? 1_555 OE1 ? D GLU 41  ? D GLU 640  ? 1_555 64.5  ? 
54 O   ? L HOH .   ? D HOH 1124 ? 1_555 MN ? H MN . ? D MN 764 ? 1_555 OE1 ? D GLU 41  ? D GLU 640  ? 1_555 118.2 ? 
55 O   ? L HOH .   ? D HOH 1308 ? 1_555 MN ? H MN . ? D MN 764 ? 1_555 OE1 ? D GLU 41  ? D GLU 640  ? 1_555 125.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-12-19 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
AMoRE     phasing          . ? 3 
SHELXL-97 refinement       . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 MET A 1   ? ? 50.13   -169.53 
2  1 LYS A 2   ? ? -89.17  34.78   
3  1 MET A 3   ? ? -165.22 -54.81  
4  1 TYR A 58  ? ? -109.05 -150.25 
5  1 SER A 59  ? ? 72.39   99.58   
6  1 LYS A 96  ? ? -113.75 -137.62 
7  1 ARG A 97  ? ? -44.12  84.86   
8  1 LYS A 144 ? ? -83.07  41.58   
9  1 GLU A 145 ? ? 66.21   65.63   
10 1 MET B 201 ? ? 174.27  164.52  
11 1 LYS B 202 ? ? 75.64   57.68   
12 1 GLN B 206 ? ? 152.45  -12.69  
13 1 ARG B 297 ? ? 80.65   -149.31 
14 1 ASN B 301 ? ? 89.32   -176.71 
15 1 MET C 401 ? ? -144.53 -122.42 
16 1 GLU C 434 ? ? -150.82 77.93   
17 1 LYS C 462 ? ? -109.05 49.92   
18 1 LYS D 602 ? ? 109.04  68.68   
19 1 LEU D 604 ? ? -102.72 -131.36 
20 1 GLU D 605 ? ? -78.60  36.21   
21 1 GLN D 606 ? ? -83.06  34.21   
22 1 HIS D 635 ? ? -115.02 -168.93 
23 1 ILE D 700 ? ? -69.04  -107.09 
24 1 ASN D 701 ? ? 130.58  172.06  
25 1 ARG D 722 ? ? 37.93   59.43   
26 1 LYS D 744 ? ? -79.51  47.32   
27 1 GLU D 745 ? ? 166.15  -31.68  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS 148 ? A HIS 149 
2  1 Y 1 A HIS 149 ? A HIS 150 
3  1 Y 1 A HIS 150 ? A HIS 151 
4  1 Y 1 A HIS 151 ? A HIS 152 
5  1 Y 1 A HIS 152 ? A HIS 153 
6  1 Y 1 A HIS 153 ? A HIS 154 
7  1 Y 1 B HIS 349 ? B HIS 150 
8  1 Y 1 B HIS 350 ? B HIS 151 
9  1 Y 1 B HIS 351 ? B HIS 152 
10 1 Y 1 B HIS 352 ? B HIS 153 
11 1 Y 1 B HIS 353 ? B HIS 154 
12 1 Y 1 C HIS 549 ? C HIS 150 
13 1 Y 1 C HIS 550 ? C HIS 151 
14 1 Y 1 C HIS 551 ? C HIS 152 
15 1 Y 1 C HIS 552 ? C HIS 153 
16 1 Y 1 C HIS 553 ? C HIS 154 
17 1 Y 1 D HIS 748 ? D HIS 149 
18 1 Y 1 D HIS 749 ? D HIS 150 
19 1 Y 1 D HIS 750 ? D HIS 151 
20 1 Y 1 D HIS 751 ? D HIS 152 
21 1 Y 1 D HIS 752 ? D HIS 153 
22 1 Y 1 D HIS 753 ? D HIS 154 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION' MN  
3 water                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 MN  1   761  761  MN  MN  A . 
F 2 MN  1   762  762  MN  MN  B . 
G 2 MN  1   763  763  MN  MN  C . 
H 2 MN  1   764  764  MN  MN  D . 
I 3 HOH 1   1003 1003 HOH HOH A . 
I 3 HOH 2   1004 1004 HOH HOH A . 
I 3 HOH 3   1012 1012 HOH HOH A . 
I 3 HOH 4   1016 1016 HOH HOH A . 
I 3 HOH 5   1024 1024 HOH HOH A . 
I 3 HOH 6   1025 1025 HOH HOH A . 
I 3 HOH 7   1026 1026 HOH HOH A . 
I 3 HOH 8   1028 1028 HOH HOH A . 
I 3 HOH 9   1029 1029 HOH HOH A . 
I 3 HOH 10  1031 1031 HOH HOH A . 
I 3 HOH 11  1032 1032 HOH HOH A . 
I 3 HOH 12  1037 1037 HOH HOH A . 
I 3 HOH 13  1043 1043 HOH HOH A . 
I 3 HOH 14  1045 1045 HOH HOH A . 
I 3 HOH 15  1046 1046 HOH HOH A . 
I 3 HOH 16  1047 1047 HOH HOH A . 
I 3 HOH 17  1051 1051 HOH HOH A . 
I 3 HOH 18  1052 1052 HOH HOH A . 
I 3 HOH 19  1054 1054 HOH HOH A . 
I 3 HOH 20  1056 1056 HOH HOH A . 
I 3 HOH 21  1057 1057 HOH HOH A . 
I 3 HOH 22  1059 1059 HOH HOH A . 
I 3 HOH 23  1060 1060 HOH HOH A . 
I 3 HOH 24  1061 1061 HOH HOH A . 
I 3 HOH 25  1063 1063 HOH HOH A . 
I 3 HOH 26  1064 1064 HOH HOH A . 
I 3 HOH 27  1065 1065 HOH HOH A . 
I 3 HOH 28  1068 1068 HOH HOH A . 
I 3 HOH 29  1073 1073 HOH HOH A . 
I 3 HOH 30  1075 1075 HOH HOH A . 
I 3 HOH 31  1077 1077 HOH HOH A . 
I 3 HOH 32  1083 1083 HOH HOH A . 
I 3 HOH 33  1085 1085 HOH HOH A . 
I 3 HOH 34  1086 1086 HOH HOH A . 
I 3 HOH 35  1090 1090 HOH HOH A . 
I 3 HOH 36  1091 1091 HOH HOH A . 
I 3 HOH 37  1095 1095 HOH HOH A . 
I 3 HOH 38  1098 1098 HOH HOH A . 
I 3 HOH 39  1099 1099 HOH HOH A . 
I 3 HOH 40  1100 1100 HOH HOH A . 
I 3 HOH 41  1108 1108 HOH HOH A . 
I 3 HOH 42  1112 1112 HOH HOH A . 
I 3 HOH 43  1113 1113 HOH HOH A . 
I 3 HOH 44  1116 1116 HOH HOH A . 
I 3 HOH 45  1122 1122 HOH HOH A . 
I 3 HOH 46  1134 1134 HOH HOH A . 
I 3 HOH 47  1136 1136 HOH HOH A . 
I 3 HOH 48  1137 1137 HOH HOH A . 
I 3 HOH 49  1139 1139 HOH HOH A . 
I 3 HOH 50  1143 1143 HOH HOH A . 
I 3 HOH 51  1145 1145 HOH HOH A . 
I 3 HOH 52  1146 1146 HOH HOH A . 
I 3 HOH 53  1150 1150 HOH HOH A . 
I 3 HOH 54  1155 1155 HOH HOH A . 
I 3 HOH 55  1159 1159 HOH HOH A . 
I 3 HOH 56  1163 1163 HOH HOH A . 
I 3 HOH 57  1165 1165 HOH HOH A . 
I 3 HOH 58  1167 1167 HOH HOH A . 
I 3 HOH 59  1172 1172 HOH HOH A . 
I 3 HOH 60  1180 1180 HOH HOH A . 
I 3 HOH 61  1185 1185 HOH HOH A . 
I 3 HOH 62  1195 1195 HOH HOH A . 
I 3 HOH 63  1196 1196 HOH HOH A . 
I 3 HOH 64  1198 1198 HOH HOH A . 
I 3 HOH 65  1199 1199 HOH HOH A . 
I 3 HOH 66  1203 1203 HOH HOH A . 
I 3 HOH 67  1213 1213 HOH HOH A . 
I 3 HOH 68  1221 1221 HOH HOH A . 
I 3 HOH 69  1224 1224 HOH HOH A . 
I 3 HOH 70  1225 1225 HOH HOH A . 
I 3 HOH 71  1233 1233 HOH HOH A . 
I 3 HOH 72  1236 1236 HOH HOH A . 
I 3 HOH 73  1237 1237 HOH HOH A . 
I 3 HOH 74  1239 1239 HOH HOH A . 
I 3 HOH 75  1247 1247 HOH HOH A . 
I 3 HOH 76  1249 1249 HOH HOH A . 
I 3 HOH 77  1253 1253 HOH HOH A . 
I 3 HOH 78  1255 1255 HOH HOH A . 
I 3 HOH 79  1267 1267 HOH HOH A . 
I 3 HOH 80  1269 1269 HOH HOH A . 
I 3 HOH 81  1275 1275 HOH HOH A . 
I 3 HOH 82  1279 1279 HOH HOH A . 
I 3 HOH 83  1282 1282 HOH HOH A . 
I 3 HOH 84  1284 1284 HOH HOH A . 
I 3 HOH 85  1290 1290 HOH HOH A . 
I 3 HOH 86  1297 1297 HOH HOH A . 
I 3 HOH 87  1298 1298 HOH HOH A . 
I 3 HOH 88  1300 1300 HOH HOH A . 
I 3 HOH 89  1301 1301 HOH HOH A . 
I 3 HOH 90  1305 1305 HOH HOH A . 
I 3 HOH 91  1306 1306 HOH HOH A . 
I 3 HOH 92  1307 1307 HOH HOH A . 
I 3 HOH 93  1312 1312 HOH HOH A . 
I 3 HOH 94  1327 1327 HOH HOH A . 
I 3 HOH 95  1331 1331 HOH HOH A . 
I 3 HOH 96  1332 1332 HOH HOH A . 
I 3 HOH 97  1346 1346 HOH HOH A . 
I 3 HOH 98  1347 1347 HOH HOH A . 
I 3 HOH 99  1351 1351 HOH HOH A . 
I 3 HOH 100 1352 1352 HOH HOH A . 
I 3 HOH 101 1354 1354 HOH HOH A . 
I 3 HOH 102 1360 1360 HOH HOH A . 
I 3 HOH 103 1365 1365 HOH HOH A . 
I 3 HOH 104 1368 1368 HOH HOH A . 
I 3 HOH 105 1370 1370 HOH HOH A . 
I 3 HOH 106 1376 1376 HOH HOH A . 
I 3 HOH 107 1377 1377 HOH HOH A . 
I 3 HOH 108 1378 1378 HOH HOH A . 
I 3 HOH 109 1380 1380 HOH HOH A . 
I 3 HOH 110 1381 1381 HOH HOH A . 
I 3 HOH 111 1390 1390 HOH HOH A . 
I 3 HOH 112 1396 1396 HOH HOH A . 
I 3 HOH 113 1397 1397 HOH HOH A . 
I 3 HOH 114 1399 1399 HOH HOH A . 
I 3 HOH 115 1400 1400 HOH HOH A . 
I 3 HOH 116 1402 1402 HOH HOH A . 
I 3 HOH 117 1406 1406 HOH HOH A . 
I 3 HOH 118 1416 1416 HOH HOH A . 
I 3 HOH 119 1417 1417 HOH HOH A . 
I 3 HOH 120 1422 1422 HOH HOH A . 
I 3 HOH 121 1423 1423 HOH HOH A . 
I 3 HOH 122 1427 1427 HOH HOH A . 
I 3 HOH 123 1432 1432 HOH HOH A . 
I 3 HOH 124 1437 1437 HOH HOH A . 
I 3 HOH 125 1438 1438 HOH HOH A . 
I 3 HOH 126 1442 1442 HOH HOH A . 
I 3 HOH 127 1443 1443 HOH HOH A . 
I 3 HOH 128 1444 1444 HOH HOH A . 
I 3 HOH 129 1447 1447 HOH HOH A . 
I 3 HOH 130 1451 1451 HOH HOH A . 
I 3 HOH 131 1454 1454 HOH HOH A . 
I 3 HOH 132 1460 1460 HOH HOH A . 
I 3 HOH 133 1466 1466 HOH HOH A . 
I 3 HOH 134 1468 1468 HOH HOH A . 
I 3 HOH 135 1470 1470 HOH HOH A . 
I 3 HOH 136 1478 1478 HOH HOH A . 
I 3 HOH 137 1479 1479 HOH HOH A . 
I 3 HOH 138 1480 1480 HOH HOH A . 
I 3 HOH 139 1484 1484 HOH HOH A . 
I 3 HOH 140 1486 1486 HOH HOH A . 
I 3 HOH 141 1488 1488 HOH HOH A . 
I 3 HOH 142 1495 1495 HOH HOH A . 
I 3 HOH 143 1496 1496 HOH HOH A . 
I 3 HOH 144 1502 1502 HOH HOH A . 
I 3 HOH 145 1505 1505 HOH HOH A . 
I 3 HOH 146 1507 1507 HOH HOH A . 
I 3 HOH 147 1508 1508 HOH HOH A . 
I 3 HOH 148 1509 1509 HOH HOH A . 
I 3 HOH 149 1511 1511 HOH HOH A . 
I 3 HOH 150 1512 1512 HOH HOH A . 
I 3 HOH 151 1513 1513 HOH HOH A . 
I 3 HOH 152 1521 1521 HOH HOH A . 
I 3 HOH 153 1523 1523 HOH HOH A . 
I 3 HOH 154 1524 1524 HOH HOH A . 
I 3 HOH 155 1532 1532 HOH HOH A . 
I 3 HOH 156 1536 1536 HOH HOH A . 
I 3 HOH 157 1539 1539 HOH HOH A . 
I 3 HOH 158 1542 1542 HOH HOH A . 
I 3 HOH 159 1544 1544 HOH HOH A . 
I 3 HOH 160 1552 1552 HOH HOH A . 
I 3 HOH 161 1566 1566 HOH HOH A . 
I 3 HOH 162 1576 1576 HOH HOH A . 
I 3 HOH 163 1577 1577 HOH HOH A . 
I 3 HOH 164 1578 1578 HOH HOH A . 
I 3 HOH 165 1583 1583 HOH HOH A . 
I 3 HOH 166 1587 1587 HOH HOH A . 
I 3 HOH 167 1590 1590 HOH HOH A . 
I 3 HOH 168 1591 1591 HOH HOH A . 
I 3 HOH 169 1592 1592 HOH HOH A . 
I 3 HOH 170 1596 1596 HOH HOH A . 
I 3 HOH 171 1598 1598 HOH HOH A . 
I 3 HOH 172 1599 1599 HOH HOH A . 
I 3 HOH 173 1610 1610 HOH HOH A . 
I 3 HOH 174 1615 1615 HOH HOH A . 
I 3 HOH 175 1621 1621 HOH HOH A . 
I 3 HOH 176 1624 1624 HOH HOH A . 
I 3 HOH 177 1626 1626 HOH HOH A . 
I 3 HOH 178 1640 1640 HOH HOH A . 
I 3 HOH 179 1644 1644 HOH HOH A . 
I 3 HOH 180 1645 1645 HOH HOH A . 
I 3 HOH 181 1648 1648 HOH HOH A . 
I 3 HOH 182 1651 1651 HOH HOH A . 
I 3 HOH 183 1652 1652 HOH HOH A . 
I 3 HOH 184 1653 1653 HOH HOH A . 
I 3 HOH 185 1654 1654 HOH HOH A . 
I 3 HOH 186 1656 1656 HOH HOH A . 
I 3 HOH 187 1657 1657 HOH HOH A . 
I 3 HOH 188 1658 1658 HOH HOH A . 
I 3 HOH 189 1663 1663 HOH HOH A . 
I 3 HOH 190 1667 1667 HOH HOH A . 
I 3 HOH 191 1668 1668 HOH HOH A . 
I 3 HOH 192 1670 1670 HOH HOH A . 
I 3 HOH 193 1677 1677 HOH HOH A . 
I 3 HOH 194 1683 1683 HOH HOH A . 
I 3 HOH 195 1685 1685 HOH HOH A . 
I 3 HOH 196 1690 1690 HOH HOH A . 
I 3 HOH 197 1702 1702 HOH HOH A . 
I 3 HOH 198 1704 1704 HOH HOH A . 
I 3 HOH 199 1707 1707 HOH HOH A . 
I 3 HOH 200 1710 1710 HOH HOH A . 
I 3 HOH 201 1712 1712 HOH HOH A . 
J 3 HOH 1   1001 1001 HOH HOH B . 
J 3 HOH 2   1002 1002 HOH HOH B . 
J 3 HOH 3   1007 1007 HOH HOH B . 
J 3 HOH 4   1014 1014 HOH HOH B . 
J 3 HOH 5   1021 1021 HOH HOH B . 
J 3 HOH 6   1033 1033 HOH HOH B . 
J 3 HOH 7   1034 1034 HOH HOH B . 
J 3 HOH 8   1035 1035 HOH HOH B . 
J 3 HOH 9   1036 1036 HOH HOH B . 
J 3 HOH 10  1066 1066 HOH HOH B . 
J 3 HOH 11  1069 1069 HOH HOH B . 
J 3 HOH 12  1072 1072 HOH HOH B . 
J 3 HOH 13  1076 1076 HOH HOH B . 
J 3 HOH 14  1079 1079 HOH HOH B . 
J 3 HOH 15  1082 1082 HOH HOH B . 
J 3 HOH 16  1087 1087 HOH HOH B . 
J 3 HOH 17  1106 1106 HOH HOH B . 
J 3 HOH 18  1109 1109 HOH HOH B . 
J 3 HOH 19  1111 1111 HOH HOH B . 
J 3 HOH 20  1115 1115 HOH HOH B . 
J 3 HOH 21  1117 1117 HOH HOH B . 
J 3 HOH 22  1120 1120 HOH HOH B . 
J 3 HOH 23  1126 1126 HOH HOH B . 
J 3 HOH 24  1127 1127 HOH HOH B . 
J 3 HOH 25  1129 1129 HOH HOH B . 
J 3 HOH 26  1130 1130 HOH HOH B . 
J 3 HOH 27  1140 1140 HOH HOH B . 
J 3 HOH 28  1144 1144 HOH HOH B . 
J 3 HOH 29  1154 1154 HOH HOH B . 
J 3 HOH 30  1156 1156 HOH HOH B . 
J 3 HOH 31  1157 1157 HOH HOH B . 
J 3 HOH 32  1161 1161 HOH HOH B . 
J 3 HOH 33  1171 1171 HOH HOH B . 
J 3 HOH 34  1173 1173 HOH HOH B . 
J 3 HOH 35  1175 1175 HOH HOH B . 
J 3 HOH 36  1183 1183 HOH HOH B . 
J 3 HOH 37  1186 1186 HOH HOH B . 
J 3 HOH 38  1197 1197 HOH HOH B . 
J 3 HOH 39  1200 1200 HOH HOH B . 
J 3 HOH 40  1205 1205 HOH HOH B . 
J 3 HOH 41  1207 1207 HOH HOH B . 
J 3 HOH 42  1215 1215 HOH HOH B . 
J 3 HOH 43  1226 1226 HOH HOH B . 
J 3 HOH 44  1232 1232 HOH HOH B . 
J 3 HOH 45  1240 1240 HOH HOH B . 
J 3 HOH 46  1242 1242 HOH HOH B . 
J 3 HOH 47  1246 1246 HOH HOH B . 
J 3 HOH 48  1250 1250 HOH HOH B . 
J 3 HOH 49  1252 1252 HOH HOH B . 
J 3 HOH 50  1254 1254 HOH HOH B . 
J 3 HOH 51  1256 1256 HOH HOH B . 
J 3 HOH 52  1260 1260 HOH HOH B . 
J 3 HOH 53  1262 1262 HOH HOH B . 
J 3 HOH 54  1263 1263 HOH HOH B . 
J 3 HOH 55  1264 1264 HOH HOH B . 
J 3 HOH 56  1265 1265 HOH HOH B . 
J 3 HOH 57  1266 1266 HOH HOH B . 
J 3 HOH 58  1268 1268 HOH HOH B . 
J 3 HOH 59  1271 1271 HOH HOH B . 
J 3 HOH 60  1272 1272 HOH HOH B . 
J 3 HOH 61  1277 1277 HOH HOH B . 
J 3 HOH 62  1281 1281 HOH HOH B . 
J 3 HOH 63  1287 1287 HOH HOH B . 
J 3 HOH 64  1291 1291 HOH HOH B . 
J 3 HOH 65  1293 1293 HOH HOH B . 
J 3 HOH 66  1295 1295 HOH HOH B . 
J 3 HOH 67  1296 1296 HOH HOH B . 
J 3 HOH 68  1303 1303 HOH HOH B . 
J 3 HOH 69  1317 1317 HOH HOH B . 
J 3 HOH 70  1319 1319 HOH HOH B . 
J 3 HOH 71  1321 1321 HOH HOH B . 
J 3 HOH 72  1322 1322 HOH HOH B . 
J 3 HOH 73  1325 1325 HOH HOH B . 
J 3 HOH 74  1328 1328 HOH HOH B . 
J 3 HOH 75  1329 1329 HOH HOH B . 
J 3 HOH 76  1334 1334 HOH HOH B . 
J 3 HOH 77  1336 1336 HOH HOH B . 
J 3 HOH 78  1337 1337 HOH HOH B . 
J 3 HOH 79  1338 1338 HOH HOH B . 
J 3 HOH 80  1340 1340 HOH HOH B . 
J 3 HOH 81  1343 1343 HOH HOH B . 
J 3 HOH 82  1345 1345 HOH HOH B . 
J 3 HOH 83  1349 1349 HOH HOH B . 
J 3 HOH 84  1350 1350 HOH HOH B . 
J 3 HOH 85  1355 1355 HOH HOH B . 
J 3 HOH 86  1356 1356 HOH HOH B . 
J 3 HOH 87  1371 1371 HOH HOH B . 
J 3 HOH 88  1379 1379 HOH HOH B . 
J 3 HOH 89  1384 1384 HOH HOH B . 
J 3 HOH 90  1387 1387 HOH HOH B . 
J 3 HOH 91  1394 1394 HOH HOH B . 
J 3 HOH 92  1401 1401 HOH HOH B . 
J 3 HOH 93  1411 1411 HOH HOH B . 
J 3 HOH 94  1413 1413 HOH HOH B . 
J 3 HOH 95  1414 1414 HOH HOH B . 
J 3 HOH 96  1424 1424 HOH HOH B . 
J 3 HOH 97  1425 1425 HOH HOH B . 
J 3 HOH 98  1428 1428 HOH HOH B . 
J 3 HOH 99  1429 1429 HOH HOH B . 
J 3 HOH 100 1433 1433 HOH HOH B . 
J 3 HOH 101 1446 1446 HOH HOH B . 
J 3 HOH 102 1450 1450 HOH HOH B . 
J 3 HOH 103 1452 1452 HOH HOH B . 
J 3 HOH 104 1459 1459 HOH HOH B . 
J 3 HOH 105 1467 1467 HOH HOH B . 
J 3 HOH 106 1469 1469 HOH HOH B . 
J 3 HOH 107 1471 1471 HOH HOH B . 
J 3 HOH 108 1477 1477 HOH HOH B . 
J 3 HOH 109 1487 1487 HOH HOH B . 
J 3 HOH 110 1489 1489 HOH HOH B . 
J 3 HOH 111 1491 1491 HOH HOH B . 
J 3 HOH 112 1492 1492 HOH HOH B . 
J 3 HOH 113 1493 1493 HOH HOH B . 
J 3 HOH 114 1497 1497 HOH HOH B . 
J 3 HOH 115 1498 1498 HOH HOH B . 
J 3 HOH 116 1510 1510 HOH HOH B . 
J 3 HOH 117 1515 1515 HOH HOH B . 
J 3 HOH 118 1517 1517 HOH HOH B . 
J 3 HOH 119 1520 1520 HOH HOH B . 
J 3 HOH 120 1525 1525 HOH HOH B . 
J 3 HOH 121 1526 1526 HOH HOH B . 
J 3 HOH 122 1529 1529 HOH HOH B . 
J 3 HOH 123 1530 1530 HOH HOH B . 
J 3 HOH 124 1531 1531 HOH HOH B . 
J 3 HOH 125 1533 1533 HOH HOH B . 
J 3 HOH 126 1535 1535 HOH HOH B . 
J 3 HOH 127 1537 1537 HOH HOH B . 
J 3 HOH 128 1538 1538 HOH HOH B . 
J 3 HOH 129 1554 1554 HOH HOH B . 
J 3 HOH 130 1557 1557 HOH HOH B . 
J 3 HOH 131 1559 1559 HOH HOH B . 
J 3 HOH 132 1561 1561 HOH HOH B . 
J 3 HOH 133 1567 1567 HOH HOH B . 
J 3 HOH 134 1568 1568 HOH HOH B . 
J 3 HOH 135 1570 1570 HOH HOH B . 
J 3 HOH 136 1579 1579 HOH HOH B . 
J 3 HOH 137 1580 1580 HOH HOH B . 
J 3 HOH 138 1581 1581 HOH HOH B . 
J 3 HOH 139 1582 1582 HOH HOH B . 
J 3 HOH 140 1600 1600 HOH HOH B . 
J 3 HOH 141 1601 1601 HOH HOH B . 
J 3 HOH 142 1604 1604 HOH HOH B . 
J 3 HOH 143 1611 1611 HOH HOH B . 
J 3 HOH 144 1612 1612 HOH HOH B . 
J 3 HOH 145 1613 1613 HOH HOH B . 
J 3 HOH 146 1614 1614 HOH HOH B . 
J 3 HOH 147 1617 1617 HOH HOH B . 
J 3 HOH 148 1622 1622 HOH HOH B . 
J 3 HOH 149 1627 1627 HOH HOH B . 
J 3 HOH 150 1628 1628 HOH HOH B . 
J 3 HOH 151 1630 1630 HOH HOH B . 
J 3 HOH 152 1631 1631 HOH HOH B . 
J 3 HOH 153 1641 1641 HOH HOH B . 
J 3 HOH 154 1643 1643 HOH HOH B . 
J 3 HOH 155 1646 1646 HOH HOH B . 
J 3 HOH 156 1655 1655 HOH HOH B . 
J 3 HOH 157 1666 1666 HOH HOH B . 
J 3 HOH 158 1673 1673 HOH HOH B . 
J 3 HOH 159 1680 1680 HOH HOH B . 
J 3 HOH 160 1682 1682 HOH HOH B . 
J 3 HOH 161 1686 1686 HOH HOH B . 
J 3 HOH 162 1687 1687 HOH HOH B . 
J 3 HOH 163 1691 1691 HOH HOH B . 
J 3 HOH 164 1693 1693 HOH HOH B . 
J 3 HOH 165 1700 1700 HOH HOH B . 
J 3 HOH 166 1711 1711 HOH HOH B . 
K 3 HOH 1   1008 1008 HOH HOH C . 
K 3 HOH 2   1009 1009 HOH HOH C . 
K 3 HOH 3   1010 1010 HOH HOH C . 
K 3 HOH 4   1013 1013 HOH HOH C . 
K 3 HOH 5   1015 1015 HOH HOH C . 
K 3 HOH 6   1019 1019 HOH HOH C . 
K 3 HOH 7   1022 1022 HOH HOH C . 
K 3 HOH 8   1027 1027 HOH HOH C . 
K 3 HOH 9   1030 1030 HOH HOH C . 
K 3 HOH 10  1039 1039 HOH HOH C . 
K 3 HOH 11  1041 1041 HOH HOH C . 
K 3 HOH 12  1044 1044 HOH HOH C . 
K 3 HOH 13  1049 1049 HOH HOH C . 
K 3 HOH 14  1050 1050 HOH HOH C . 
K 3 HOH 15  1062 1062 HOH HOH C . 
K 3 HOH 16  1067 1067 HOH HOH C . 
K 3 HOH 17  1071 1071 HOH HOH C . 
K 3 HOH 18  1074 1074 HOH HOH C . 
K 3 HOH 19  1078 1078 HOH HOH C . 
K 3 HOH 20  1081 1081 HOH HOH C . 
K 3 HOH 21  1084 1084 HOH HOH C . 
K 3 HOH 22  1092 1092 HOH HOH C . 
K 3 HOH 23  1094 1094 HOH HOH C . 
K 3 HOH 24  1097 1097 HOH HOH C . 
K 3 HOH 25  1101 1101 HOH HOH C . 
K 3 HOH 26  1102 1102 HOH HOH C . 
K 3 HOH 27  1103 1103 HOH HOH C . 
K 3 HOH 28  1104 1104 HOH HOH C . 
K 3 HOH 29  1105 1105 HOH HOH C . 
K 3 HOH 30  1110 1110 HOH HOH C . 
K 3 HOH 31  1114 1114 HOH HOH C . 
K 3 HOH 32  1118 1118 HOH HOH C . 
K 3 HOH 33  1121 1121 HOH HOH C . 
K 3 HOH 34  1125 1125 HOH HOH C . 
K 3 HOH 35  1132 1132 HOH HOH C . 
K 3 HOH 36  1142 1142 HOH HOH C . 
K 3 HOH 37  1148 1148 HOH HOH C . 
K 3 HOH 38  1151 1151 HOH HOH C . 
K 3 HOH 39  1152 1152 HOH HOH C . 
K 3 HOH 40  1162 1162 HOH HOH C . 
K 3 HOH 41  1164 1164 HOH HOH C . 
K 3 HOH 42  1168 1168 HOH HOH C . 
K 3 HOH 43  1170 1170 HOH HOH C . 
K 3 HOH 44  1176 1176 HOH HOH C . 
K 3 HOH 45  1178 1178 HOH HOH C . 
K 3 HOH 46  1181 1181 HOH HOH C . 
K 3 HOH 47  1187 1187 HOH HOH C . 
K 3 HOH 48  1188 1188 HOH HOH C . 
K 3 HOH 49  1191 1191 HOH HOH C . 
K 3 HOH 50  1192 1192 HOH HOH C . 
K 3 HOH 51  1193 1193 HOH HOH C . 
K 3 HOH 52  1194 1194 HOH HOH C . 
K 3 HOH 53  1202 1202 HOH HOH C . 
K 3 HOH 54  1204 1204 HOH HOH C . 
K 3 HOH 55  1209 1209 HOH HOH C . 
K 3 HOH 56  1210 1210 HOH HOH C . 
K 3 HOH 57  1219 1219 HOH HOH C . 
K 3 HOH 58  1220 1220 HOH HOH C . 
K 3 HOH 59  1223 1223 HOH HOH C . 
K 3 HOH 60  1228 1228 HOH HOH C . 
K 3 HOH 61  1229 1229 HOH HOH C . 
K 3 HOH 62  1235 1235 HOH HOH C . 
K 3 HOH 63  1238 1238 HOH HOH C . 
K 3 HOH 64  1251 1251 HOH HOH C . 
K 3 HOH 65  1258 1258 HOH HOH C . 
K 3 HOH 66  1259 1259 HOH HOH C . 
K 3 HOH 67  1261 1261 HOH HOH C . 
K 3 HOH 68  1273 1273 HOH HOH C . 
K 3 HOH 69  1274 1274 HOH HOH C . 
K 3 HOH 70  1283 1283 HOH HOH C . 
K 3 HOH 71  1285 1285 HOH HOH C . 
K 3 HOH 72  1289 1289 HOH HOH C . 
K 3 HOH 73  1292 1292 HOH HOH C . 
K 3 HOH 74  1294 1294 HOH HOH C . 
K 3 HOH 75  1299 1299 HOH HOH C . 
K 3 HOH 76  1310 1310 HOH HOH C . 
K 3 HOH 77  1313 1313 HOH HOH C . 
K 3 HOH 78  1314 1314 HOH HOH C . 
K 3 HOH 79  1315 1315 HOH HOH C . 
K 3 HOH 80  1316 1316 HOH HOH C . 
K 3 HOH 81  1323 1323 HOH HOH C . 
K 3 HOH 82  1324 1324 HOH HOH C . 
K 3 HOH 83  1326 1326 HOH HOH C . 
K 3 HOH 84  1335 1335 HOH HOH C . 
K 3 HOH 85  1339 1339 HOH HOH C . 
K 3 HOH 86  1341 1341 HOH HOH C . 
K 3 HOH 87  1342 1342 HOH HOH C . 
K 3 HOH 88  1357 1357 HOH HOH C . 
K 3 HOH 89  1358 1358 HOH HOH C . 
K 3 HOH 90  1359 1359 HOH HOH C . 
K 3 HOH 91  1363 1363 HOH HOH C . 
K 3 HOH 92  1367 1367 HOH HOH C . 
K 3 HOH 93  1369 1369 HOH HOH C . 
K 3 HOH 94  1382 1382 HOH HOH C . 
K 3 HOH 95  1388 1388 HOH HOH C . 
K 3 HOH 96  1389 1389 HOH HOH C . 
K 3 HOH 97  1391 1391 HOH HOH C . 
K 3 HOH 98  1393 1393 HOH HOH C . 
K 3 HOH 99  1398 1398 HOH HOH C . 
K 3 HOH 100 1403 1403 HOH HOH C . 
K 3 HOH 101 1405 1405 HOH HOH C . 
K 3 HOH 102 1408 1408 HOH HOH C . 
K 3 HOH 103 1409 1409 HOH HOH C . 
K 3 HOH 104 1412 1412 HOH HOH C . 
K 3 HOH 105 1419 1419 HOH HOH C . 
K 3 HOH 106 1426 1426 HOH HOH C . 
K 3 HOH 107 1430 1430 HOH HOH C . 
K 3 HOH 108 1434 1434 HOH HOH C . 
K 3 HOH 109 1436 1436 HOH HOH C . 
K 3 HOH 110 1439 1439 HOH HOH C . 
K 3 HOH 111 1445 1445 HOH HOH C . 
K 3 HOH 112 1448 1448 HOH HOH C . 
K 3 HOH 113 1449 1449 HOH HOH C . 
K 3 HOH 114 1455 1455 HOH HOH C . 
K 3 HOH 115 1458 1458 HOH HOH C . 
K 3 HOH 116 1462 1462 HOH HOH C . 
K 3 HOH 117 1463 1463 HOH HOH C . 
K 3 HOH 118 1472 1472 HOH HOH C . 
K 3 HOH 119 1474 1474 HOH HOH C . 
K 3 HOH 120 1483 1483 HOH HOH C . 
K 3 HOH 121 1490 1490 HOH HOH C . 
K 3 HOH 122 1494 1494 HOH HOH C . 
K 3 HOH 123 1499 1499 HOH HOH C . 
K 3 HOH 124 1500 1500 HOH HOH C . 
K 3 HOH 125 1506 1506 HOH HOH C . 
K 3 HOH 126 1514 1514 HOH HOH C . 
K 3 HOH 127 1516 1516 HOH HOH C . 
K 3 HOH 128 1519 1519 HOH HOH C . 
K 3 HOH 129 1522 1522 HOH HOH C . 
K 3 HOH 130 1527 1527 HOH HOH C . 
K 3 HOH 131 1528 1528 HOH HOH C . 
K 3 HOH 132 1534 1534 HOH HOH C . 
K 3 HOH 133 1541 1541 HOH HOH C . 
K 3 HOH 134 1543 1543 HOH HOH C . 
K 3 HOH 135 1545 1545 HOH HOH C . 
K 3 HOH 136 1546 1546 HOH HOH C . 
K 3 HOH 137 1549 1549 HOH HOH C . 
K 3 HOH 138 1550 1550 HOH HOH C . 
K 3 HOH 139 1556 1556 HOH HOH C . 
K 3 HOH 140 1560 1560 HOH HOH C . 
K 3 HOH 141 1563 1563 HOH HOH C . 
K 3 HOH 142 1564 1564 HOH HOH C . 
K 3 HOH 143 1569 1569 HOH HOH C . 
K 3 HOH 144 1572 1572 HOH HOH C . 
K 3 HOH 145 1573 1573 HOH HOH C . 
K 3 HOH 146 1574 1574 HOH HOH C . 
K 3 HOH 147 1584 1584 HOH HOH C . 
K 3 HOH 148 1593 1593 HOH HOH C . 
K 3 HOH 149 1594 1594 HOH HOH C . 
K 3 HOH 150 1603 1603 HOH HOH C . 
K 3 HOH 151 1605 1605 HOH HOH C . 
K 3 HOH 152 1606 1606 HOH HOH C . 
K 3 HOH 153 1607 1607 HOH HOH C . 
K 3 HOH 154 1620 1620 HOH HOH C . 
K 3 HOH 155 1623 1623 HOH HOH C . 
K 3 HOH 156 1642 1642 HOH HOH C . 
K 3 HOH 157 1649 1649 HOH HOH C . 
K 3 HOH 158 1659 1659 HOH HOH C . 
K 3 HOH 159 1660 1660 HOH HOH C . 
K 3 HOH 160 1662 1662 HOH HOH C . 
K 3 HOH 161 1665 1665 HOH HOH C . 
K 3 HOH 162 1672 1672 HOH HOH C . 
K 3 HOH 163 1675 1675 HOH HOH C . 
K 3 HOH 164 1678 1678 HOH HOH C . 
K 3 HOH 165 1679 1679 HOH HOH C . 
K 3 HOH 166 1688 1688 HOH HOH C . 
K 3 HOH 167 1694 1694 HOH HOH C . 
K 3 HOH 168 1696 1696 HOH HOH C . 
K 3 HOH 169 1697 1697 HOH HOH C . 
K 3 HOH 170 1699 1699 HOH HOH C . 
K 3 HOH 171 1703 1703 HOH HOH C . 
K 3 HOH 172 1705 1705 HOH HOH C . 
K 3 HOH 173 1706 1706 HOH HOH C . 
K 3 HOH 174 1708 1708 HOH HOH C . 
K 3 HOH 175 1709 1709 HOH HOH C . 
L 3 HOH 1   1005 1005 HOH HOH D . 
L 3 HOH 2   1006 1006 HOH HOH D . 
L 3 HOH 3   1011 1011 HOH HOH D . 
L 3 HOH 4   1017 1017 HOH HOH D . 
L 3 HOH 5   1018 1018 HOH HOH D . 
L 3 HOH 6   1020 1020 HOH HOH D . 
L 3 HOH 7   1023 1023 HOH HOH D . 
L 3 HOH 8   1038 1038 HOH HOH D . 
L 3 HOH 9   1040 1040 HOH HOH D . 
L 3 HOH 10  1042 1042 HOH HOH D . 
L 3 HOH 11  1048 1048 HOH HOH D . 
L 3 HOH 12  1053 1053 HOH HOH D . 
L 3 HOH 13  1055 1055 HOH HOH D . 
L 3 HOH 14  1058 1058 HOH HOH D . 
L 3 HOH 15  1070 1070 HOH HOH D . 
L 3 HOH 16  1080 1080 HOH HOH D . 
L 3 HOH 17  1088 1088 HOH HOH D . 
L 3 HOH 18  1089 1089 HOH HOH D . 
L 3 HOH 19  1093 1093 HOH HOH D . 
L 3 HOH 20  1096 1096 HOH HOH D . 
L 3 HOH 21  1107 1107 HOH HOH D . 
L 3 HOH 22  1119 1119 HOH HOH D . 
L 3 HOH 23  1123 1123 HOH HOH D . 
L 3 HOH 24  1124 1124 HOH HOH D . 
L 3 HOH 25  1128 1128 HOH HOH D . 
L 3 HOH 26  1131 1131 HOH HOH D . 
L 3 HOH 27  1133 1133 HOH HOH D . 
L 3 HOH 28  1135 1135 HOH HOH D . 
L 3 HOH 29  1138 1138 HOH HOH D . 
L 3 HOH 30  1141 1141 HOH HOH D . 
L 3 HOH 31  1147 1147 HOH HOH D . 
L 3 HOH 32  1149 1149 HOH HOH D . 
L 3 HOH 33  1153 1153 HOH HOH D . 
L 3 HOH 34  1158 1158 HOH HOH D . 
L 3 HOH 35  1160 1160 HOH HOH D . 
L 3 HOH 36  1166 1166 HOH HOH D . 
L 3 HOH 37  1169 1169 HOH HOH D . 
L 3 HOH 38  1174 1174 HOH HOH D . 
L 3 HOH 39  1177 1177 HOH HOH D . 
L 3 HOH 40  1179 1179 HOH HOH D . 
L 3 HOH 41  1182 1182 HOH HOH D . 
L 3 HOH 42  1184 1184 HOH HOH D . 
L 3 HOH 43  1189 1189 HOH HOH D . 
L 3 HOH 44  1190 1190 HOH HOH D . 
L 3 HOH 45  1201 1201 HOH HOH D . 
L 3 HOH 46  1206 1206 HOH HOH D . 
L 3 HOH 47  1208 1208 HOH HOH D . 
L 3 HOH 48  1211 1211 HOH HOH D . 
L 3 HOH 49  1212 1212 HOH HOH D . 
L 3 HOH 50  1214 1214 HOH HOH D . 
L 3 HOH 51  1216 1216 HOH HOH D . 
L 3 HOH 52  1217 1217 HOH HOH D . 
L 3 HOH 53  1218 1218 HOH HOH D . 
L 3 HOH 54  1222 1222 HOH HOH D . 
L 3 HOH 55  1227 1227 HOH HOH D . 
L 3 HOH 56  1230 1230 HOH HOH D . 
L 3 HOH 57  1231 1231 HOH HOH D . 
L 3 HOH 58  1234 1234 HOH HOH D . 
L 3 HOH 59  1241 1241 HOH HOH D . 
L 3 HOH 60  1243 1243 HOH HOH D . 
L 3 HOH 61  1244 1244 HOH HOH D . 
L 3 HOH 62  1245 1245 HOH HOH D . 
L 3 HOH 63  1248 1248 HOH HOH D . 
L 3 HOH 64  1257 1257 HOH HOH D . 
L 3 HOH 65  1270 1270 HOH HOH D . 
L 3 HOH 66  1276 1276 HOH HOH D . 
L 3 HOH 67  1278 1278 HOH HOH D . 
L 3 HOH 68  1280 1280 HOH HOH D . 
L 3 HOH 69  1286 1286 HOH HOH D . 
L 3 HOH 70  1288 1288 HOH HOH D . 
L 3 HOH 71  1302 1302 HOH HOH D . 
L 3 HOH 72  1304 1304 HOH HOH D . 
L 3 HOH 73  1308 1308 HOH HOH D . 
L 3 HOH 74  1309 1309 HOH HOH D . 
L 3 HOH 75  1311 1311 HOH HOH D . 
L 3 HOH 76  1318 1318 HOH HOH D . 
L 3 HOH 77  1320 1320 HOH HOH D . 
L 3 HOH 78  1330 1330 HOH HOH D . 
L 3 HOH 79  1333 1333 HOH HOH D . 
L 3 HOH 80  1344 1344 HOH HOH D . 
L 3 HOH 81  1348 1348 HOH HOH D . 
L 3 HOH 82  1353 1353 HOH HOH D . 
L 3 HOH 83  1361 1361 HOH HOH D . 
L 3 HOH 84  1362 1362 HOH HOH D . 
L 3 HOH 85  1364 1364 HOH HOH D . 
L 3 HOH 86  1366 1366 HOH HOH D . 
L 3 HOH 87  1372 1372 HOH HOH D . 
L 3 HOH 88  1373 1373 HOH HOH D . 
L 3 HOH 89  1374 1374 HOH HOH D . 
L 3 HOH 90  1375 1375 HOH HOH D . 
L 3 HOH 91  1383 1383 HOH HOH D . 
L 3 HOH 92  1385 1385 HOH HOH D . 
L 3 HOH 93  1386 1386 HOH HOH D . 
L 3 HOH 94  1392 1392 HOH HOH D . 
L 3 HOH 95  1395 1395 HOH HOH D . 
L 3 HOH 96  1404 1404 HOH HOH D . 
L 3 HOH 97  1407 1407 HOH HOH D . 
L 3 HOH 98  1410 1410 HOH HOH D . 
L 3 HOH 99  1415 1415 HOH HOH D . 
L 3 HOH 100 1418 1418 HOH HOH D . 
L 3 HOH 101 1420 1420 HOH HOH D . 
L 3 HOH 102 1421 1421 HOH HOH D . 
L 3 HOH 103 1431 1431 HOH HOH D . 
L 3 HOH 104 1435 1435 HOH HOH D . 
L 3 HOH 105 1440 1440 HOH HOH D . 
L 3 HOH 106 1441 1441 HOH HOH D . 
L 3 HOH 107 1453 1453 HOH HOH D . 
L 3 HOH 108 1456 1456 HOH HOH D . 
L 3 HOH 109 1457 1457 HOH HOH D . 
L 3 HOH 110 1461 1461 HOH HOH D . 
L 3 HOH 111 1464 1464 HOH HOH D . 
L 3 HOH 112 1465 1465 HOH HOH D . 
L 3 HOH 113 1473 1473 HOH HOH D . 
L 3 HOH 114 1475 1475 HOH HOH D . 
L 3 HOH 115 1476 1476 HOH HOH D . 
L 3 HOH 116 1481 1481 HOH HOH D . 
L 3 HOH 117 1482 1482 HOH HOH D . 
L 3 HOH 118 1485 1485 HOH HOH D . 
L 3 HOH 119 1501 1501 HOH HOH D . 
L 3 HOH 120 1503 1503 HOH HOH D . 
L 3 HOH 121 1504 1504 HOH HOH D . 
L 3 HOH 122 1518 1518 HOH HOH D . 
L 3 HOH 123 1540 1540 HOH HOH D . 
L 3 HOH 124 1547 1547 HOH HOH D . 
L 3 HOH 125 1548 1548 HOH HOH D . 
L 3 HOH 126 1551 1551 HOH HOH D . 
L 3 HOH 127 1553 1553 HOH HOH D . 
L 3 HOH 128 1555 1555 HOH HOH D . 
L 3 HOH 129 1558 1558 HOH HOH D . 
L 3 HOH 130 1562 1562 HOH HOH D . 
L 3 HOH 131 1565 1565 HOH HOH D . 
L 3 HOH 132 1571 1571 HOH HOH D . 
L 3 HOH 133 1575 1575 HOH HOH D . 
L 3 HOH 134 1585 1585 HOH HOH D . 
L 3 HOH 135 1586 1586 HOH HOH D . 
L 3 HOH 136 1588 1588 HOH HOH D . 
L 3 HOH 137 1589 1589 HOH HOH D . 
L 3 HOH 138 1595 1595 HOH HOH D . 
L 3 HOH 139 1597 1597 HOH HOH D . 
L 3 HOH 140 1602 1602 HOH HOH D . 
L 3 HOH 141 1608 1608 HOH HOH D . 
L 3 HOH 142 1609 1609 HOH HOH D . 
L 3 HOH 143 1616 1616 HOH HOH D . 
L 3 HOH 144 1618 1618 HOH HOH D . 
L 3 HOH 145 1619 1619 HOH HOH D . 
L 3 HOH 146 1625 1625 HOH HOH D . 
L 3 HOH 147 1629 1629 HOH HOH D . 
L 3 HOH 148 1632 1632 HOH HOH D . 
L 3 HOH 149 1633 1633 HOH HOH D . 
L 3 HOH 150 1634 1634 HOH HOH D . 
L 3 HOH 151 1635 1635 HOH HOH D . 
L 3 HOH 152 1636 1636 HOH HOH D . 
L 3 HOH 153 1637 1637 HOH HOH D . 
L 3 HOH 154 1638 1638 HOH HOH D . 
L 3 HOH 155 1639 1639 HOH HOH D . 
L 3 HOH 156 1647 1647 HOH HOH D . 
L 3 HOH 157 1650 1650 HOH HOH D . 
L 3 HOH 158 1661 1661 HOH HOH D . 
L 3 HOH 159 1664 1664 HOH HOH D . 
L 3 HOH 160 1669 1669 HOH HOH D . 
L 3 HOH 161 1671 1671 HOH HOH D . 
L 3 HOH 162 1674 1674 HOH HOH D . 
L 3 HOH 163 1676 1676 HOH HOH D . 
L 3 HOH 164 1681 1681 HOH HOH D . 
L 3 HOH 165 1684 1684 HOH HOH D . 
L 3 HOH 166 1689 1689 HOH HOH D . 
L 3 HOH 167 1692 1692 HOH HOH D . 
L 3 HOH 168 1695 1695 HOH HOH D . 
L 3 HOH 169 1698 1698 HOH HOH D . 
L 3 HOH 170 1701 1701 HOH HOH D . 
#