data_1JGL
# 
_entry.id   1JGL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JGL         
RCSB  RCSB013746   
WWPDB D_1000013746 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1JHK 
_pdbx_database_related.details        '1JHK contains the same protein(uncomplexed form).' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JGL 
_pdbx_database_status.recvd_initial_deposition_date   2001-06-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lamminmaki, U.' 1 
'Kankare, J.A.'  2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of a recombinant anti-estradiol Fab fragment in complex with 17beta -estradiol.'              
J.Biol.Chem.               276 36687 36694 2001 JBCHA3 US 0021-9258 0071 ? 11451948 10.1074/jbc.M102367200    
1       'Crystallization and preliminary X-ray analysis of a recombinant Fab fragment in complex with 17-beta-estradiol' 
'Acta Crystallogr.,Sect.D' 56  1670  1672  2000 ABCRE6 DK 0907-4449 0766 ? ?        10.1107/S0907444900013317 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lamminmaki, U.' 1 
primary 'Kankare, J.A.'  2 
1       'Lamminmaki, U.' 3 
1       'Kankare, J.A.'  4 
# 
_cell.entry_id           1JGL 
_cell.length_a           48.207 
_cell.length_b           64.496 
_cell.length_c           165.285 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JGL 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ig kappa-chain'   23665.074 1   ? ? ?                ? 
2 polymer     man 'Ig gamma-1-chain' 23460.309 1   ? ? 'residues 1-215' ? 
3 non-polymer syn ESTRADIOL          272.382   1   ? ? ?                ? 
4 water       nat water              18.015    340 ? ? ?                ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQP
EDFGTYYCHHFWSTPWTFGGGTKLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
;DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQP
EDFGTYYCHHFWSTPWTFGGGTKLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
L ? 
2 'polypeptide(L)' no no 
;QIQLVQSGPELKKPGETVRISCKASDYSFMTSGMQWVQQMPGKGLKWIGWLNTQSGVPEYAEDFKGRFAFSLETSATTAY
LQINNLKNEDTATYFCATWGGNSAYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSG
SLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
;
;QIQLVQSGPELKKPGETVRISCKASDYSFMTSGMQWVQQMPGKGLKWIGWLNTQSGVPEYAEDFKGRFAFSLETSATTAY
LQINNLKNEDTATYFCATWGGNSAYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSG
SLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
;
H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ILE n 
1 3   GLN n 
1 4   MET n 
1 5   THR n 
1 6   GLN n 
1 7   SER n 
1 8   PRO n 
1 9   ALA n 
1 10  SER n 
1 11  LEU n 
1 12  SER n 
1 13  ALA n 
1 14  SER n 
1 15  VAL n 
1 16  GLY n 
1 17  GLU n 
1 18  THR n 
1 19  VAL n 
1 20  THR n 
1 21  ILE n 
1 22  THR n 
1 23  CYS n 
1 24  ARG n 
1 25  ALA n 
1 26  SER n 
1 27  GLY n 
1 28  ASN n 
1 29  ILE n 
1 30  HIS n 
1 31  ASN n 
1 32  TYR n 
1 33  LEU n 
1 34  ALA n 
1 35  TRP n 
1 36  TYR n 
1 37  GLN n 
1 38  GLN n 
1 39  LYS n 
1 40  GLN n 
1 41  GLY n 
1 42  LYS n 
1 43  SER n 
1 44  PRO n 
1 45  GLN n 
1 46  LEU n 
1 47  LEU n 
1 48  VAL n 
1 49  TYR n 
1 50  ASN n 
1 51  ALA n 
1 52  LYS n 
1 53  THR n 
1 54  LEU n 
1 55  ALA n 
1 56  ASP n 
1 57  GLY n 
1 58  VAL n 
1 59  PRO n 
1 60  SER n 
1 61  ARG n 
1 62  PHE n 
1 63  SER n 
1 64  GLY n 
1 65  SER n 
1 66  GLY n 
1 67  SER n 
1 68  GLY n 
1 69  THR n 
1 70  GLN n 
1 71  TYR n 
1 72  SER n 
1 73  LEU n 
1 74  LYS n 
1 75  ILE n 
1 76  ASN n 
1 77  SER n 
1 78  LEU n 
1 79  GLN n 
1 80  PRO n 
1 81  GLU n 
1 82  ASP n 
1 83  PHE n 
1 84  GLY n 
1 85  THR n 
1 86  TYR n 
1 87  TYR n 
1 88  CYS n 
1 89  HIS n 
1 90  HIS n 
1 91  PHE n 
1 92  TRP n 
1 93  SER n 
1 94  THR n 
1 95  PRO n 
1 96  TRP n 
1 97  THR n 
1 98  PHE n 
1 99  GLY n 
1 100 GLY n 
1 101 GLY n 
1 102 THR n 
1 103 LYS n 
1 104 LEU n 
1 105 GLU n 
1 106 VAL n 
1 107 LYS n 
1 108 ARG n 
1 109 ALA n 
1 110 ASP n 
1 111 ALA n 
1 112 ALA n 
1 113 PRO n 
1 114 THR n 
1 115 VAL n 
1 116 SER n 
1 117 ILE n 
1 118 PHE n 
1 119 PRO n 
1 120 PRO n 
1 121 SER n 
1 122 SER n 
1 123 GLU n 
1 124 GLN n 
1 125 LEU n 
1 126 THR n 
1 127 SER n 
1 128 GLY n 
1 129 GLY n 
1 130 ALA n 
1 131 SER n 
1 132 VAL n 
1 133 VAL n 
1 134 CYS n 
1 135 PHE n 
1 136 LEU n 
1 137 ASN n 
1 138 ASN n 
1 139 PHE n 
1 140 TYR n 
1 141 PRO n 
1 142 LYS n 
1 143 ASP n 
1 144 ILE n 
1 145 ASN n 
1 146 VAL n 
1 147 LYS n 
1 148 TRP n 
1 149 LYS n 
1 150 ILE n 
1 151 ASP n 
1 152 GLY n 
1 153 SER n 
1 154 GLU n 
1 155 ARG n 
1 156 GLN n 
1 157 ASN n 
1 158 GLY n 
1 159 VAL n 
1 160 LEU n 
1 161 ASN n 
1 162 SER n 
1 163 TRP n 
1 164 THR n 
1 165 ASP n 
1 166 GLN n 
1 167 ASP n 
1 168 SER n 
1 169 LYS n 
1 170 ASP n 
1 171 SER n 
1 172 THR n 
1 173 TYR n 
1 174 SER n 
1 175 MET n 
1 176 SER n 
1 177 SER n 
1 178 THR n 
1 179 LEU n 
1 180 THR n 
1 181 LEU n 
1 182 THR n 
1 183 LYS n 
1 184 ASP n 
1 185 GLU n 
1 186 TYR n 
1 187 GLU n 
1 188 ARG n 
1 189 HIS n 
1 190 ASN n 
1 191 SER n 
1 192 TYR n 
1 193 THR n 
1 194 CYS n 
1 195 GLU n 
1 196 ALA n 
1 197 THR n 
1 198 HIS n 
1 199 LYS n 
1 200 THR n 
1 201 SER n 
1 202 THR n 
1 203 SER n 
1 204 PRO n 
1 205 ILE n 
1 206 VAL n 
1 207 LYS n 
1 208 SER n 
1 209 PHE n 
1 210 ASN n 
1 211 ARG n 
1 212 ASN n 
1 213 GLU n 
1 214 CYS n 
2 1   GLN n 
2 2   ILE n 
2 3   GLN n 
2 4   LEU n 
2 5   VAL n 
2 6   GLN n 
2 7   SER n 
2 8   GLY n 
2 9   PRO n 
2 10  GLU n 
2 11  LEU n 
2 12  LYS n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  GLU n 
2 17  THR n 
2 18  VAL n 
2 19  ARG n 
2 20  ILE n 
2 21  SER n 
2 22  CYS n 
2 23  LYS n 
2 24  ALA n 
2 25  SER n 
2 26  ASP n 
2 27  TYR n 
2 28  SER n 
2 29  PHE n 
2 30  MET n 
2 31  THR n 
2 32  SER n 
2 33  GLY n 
2 34  MET n 
2 35  GLN n 
2 36  TRP n 
2 37  VAL n 
2 38  GLN n 
2 39  GLN n 
2 40  MET n 
2 41  PRO n 
2 42  GLY n 
2 43  LYS n 
2 44  GLY n 
2 45  LEU n 
2 46  LYS n 
2 47  TRP n 
2 48  ILE n 
2 49  GLY n 
2 50  TRP n 
2 51  LEU n 
2 52  ASN n 
2 53  THR n 
2 54  GLN n 
2 55  SER n 
2 56  GLY n 
2 57  VAL n 
2 58  PRO n 
2 59  GLU n 
2 60  TYR n 
2 61  ALA n 
2 62  GLU n 
2 63  ASP n 
2 64  PHE n 
2 65  LYS n 
2 66  GLY n 
2 67  ARG n 
2 68  PHE n 
2 69  ALA n 
2 70  PHE n 
2 71  SER n 
2 72  LEU n 
2 73  GLU n 
2 74  THR n 
2 75  SER n 
2 76  ALA n 
2 77  THR n 
2 78  THR n 
2 79  ALA n 
2 80  TYR n 
2 81  LEU n 
2 82  GLN n 
2 83  ILE n 
2 84  ASN n 
2 85  ASN n 
2 86  LEU n 
2 87  LYS n 
2 88  ASN n 
2 89  GLU n 
2 90  ASP n 
2 91  THR n 
2 92  ALA n 
2 93  THR n 
2 94  TYR n 
2 95  PHE n 
2 96  CYS n 
2 97  ALA n 
2 98  THR n 
2 99  TRP n 
2 100 GLY n 
2 101 GLY n 
2 102 ASN n 
2 103 SER n 
2 104 ALA n 
2 105 TYR n 
2 106 TRP n 
2 107 GLY n 
2 108 GLN n 
2 109 GLY n 
2 110 THR n 
2 111 THR n 
2 112 LEU n 
2 113 THR n 
2 114 VAL n 
2 115 SER n 
2 116 SER n 
2 117 ALA n 
2 118 LYS n 
2 119 THR n 
2 120 THR n 
2 121 PRO n 
2 122 PRO n 
2 123 SER n 
2 124 VAL n 
2 125 TYR n 
2 126 PRO n 
2 127 LEU n 
2 128 ALA n 
2 129 PRO n 
2 130 GLY n 
2 131 SER n 
2 132 ALA n 
2 133 ALA n 
2 134 GLN n 
2 135 THR n 
2 136 ASN n 
2 137 SER n 
2 138 MET n 
2 139 VAL n 
2 140 THR n 
2 141 LEU n 
2 142 GLY n 
2 143 CYS n 
2 144 LEU n 
2 145 VAL n 
2 146 LYS n 
2 147 GLY n 
2 148 TYR n 
2 149 PHE n 
2 150 PRO n 
2 151 GLU n 
2 152 PRO n 
2 153 VAL n 
2 154 THR n 
2 155 VAL n 
2 156 THR n 
2 157 TRP n 
2 158 ASN n 
2 159 SER n 
2 160 GLY n 
2 161 SER n 
2 162 LEU n 
2 163 SER n 
2 164 SER n 
2 165 GLY n 
2 166 VAL n 
2 167 HIS n 
2 168 THR n 
2 169 PHE n 
2 170 PRO n 
2 171 ALA n 
2 172 VAL n 
2 173 LEU n 
2 174 GLN n 
2 175 SER n 
2 176 ASP n 
2 177 LEU n 
2 178 TYR n 
2 179 THR n 
2 180 LEU n 
2 181 SER n 
2 182 SER n 
2 183 SER n 
2 184 VAL n 
2 185 THR n 
2 186 VAL n 
2 187 PRO n 
2 188 SER n 
2 189 SER n 
2 190 THR n 
2 191 TRP n 
2 192 PRO n 
2 193 SER n 
2 194 GLU n 
2 195 THR n 
2 196 VAL n 
2 197 THR n 
2 198 CYS n 
2 199 ASN n 
2 200 VAL n 
2 201 ALA n 
2 202 HIS n 
2 203 PRO n 
2 204 ALA n 
2 205 SER n 
2 206 SER n 
2 207 THR n 
2 208 LYS n 
2 209 VAL n 
2 210 ASP n 
2 211 LYS n 
2 212 LYS n 
2 213 ILE n 
2 214 VAL n 
2 215 PRO n 
2 216 ARG n 
2 217 ASP n 
2 218 CYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 
'XL-1 blue' ? ? ? ? ? ? ? plasmid ? ? ? pCOMB3 ? ? 
2 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 
'XL-1 blue' ? ? ? ? ? ? ? plasmid ? ? ? pCOMB3 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP Q920E6_MOUSE 1 
;DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQP
EDFGTYYCHHFWSTPWTFGGGTKLEVKRADAAPTVSILPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
15 Q920E6  ? 
2 GB  AAB53773     2 
;QIQLVQSGPELKKPGETVRISCKASDYSFMTSGMQWVQQMPGKGLKWIGWLNTQSGVPEYAEDFKGRFAFSLETSATTAY
LQINNLKNEDTATYFCATWGGNSAYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSG
SLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
;
11 2072131 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JGL L 1 ? 214 ? Q920E6  15 ? 228 ? 1 214 
2 2 1JGL H 1 ? 218 ? 2072131 12 ? 229 ? 1 215 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1JGL 
_struct_ref_seq_dif.mon_id                       PHE 
_struct_ref_seq_dif.pdbx_pdb_strand_id           L 
_struct_ref_seq_dif.seq_num                      118 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q920E6 
_struct_ref_seq_dif.db_mon_id                    LEU 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          132 
_struct_ref_seq_dif.details                      'SEE REMARK 999' 
_struct_ref_seq_dif.pdbx_auth_seq_num            118 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
EST non-polymer         . ESTRADIOL       ? 'C18 H24 O2'     272.382 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1JGL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.72 
_exptl_crystal.density_percent_sol   54.86 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.1 
_exptl_crystal_grow.pdbx_details    'PEG4000, PEG8000, Tris-HCl, pH 9.1, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200HB' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1JGL 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.15 
_reflns.number_obs                   25614 
_reflns.number_all                   25614 
_reflns.percent_possible_obs         88.7 
_reflns.pdbx_Rmerge_I_obs            0.051 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        13.8 
_reflns.pdbx_redundancy              2.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.15 
_reflns_shell.d_res_low              2.25 
_reflns_shell.percent_possible_all   71.9 
_reflns_shell.Rmerge_I_obs           0.135 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        1.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1JGL 
_refine.ls_number_reflns_obs                     25614 
_refine.ls_number_reflns_all                     25614 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               450405.29 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             46.28 
_refine.ls_d_res_high                            2.15 
_refine.ls_percent_reflns_obs                    88.6 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.249 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.9 
_refine.ls_number_reflns_R_free                  2529 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               28.8 
_refine.aniso_B[1][1]                            11.60 
_refine.aniso_B[2][2]                            -3.62 
_refine.aniso_B[3][3]                            -7.98 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.345 
_refine.solvent_model_param_bsol                 49.54 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      
'Combination PDB entries 1TET (heavy chain variable domain)and 1FDL (light chain variable domain and both constant_1 domains)' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1JGL 
_refine_analyze.Luzzati_coordinate_error_obs    0.24 
_refine_analyze.Luzzati_sigma_a_obs             0.18 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.31 
_refine_analyze.Luzzati_sigma_a_free            0.26 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3225 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             340 
_refine_hist.number_atoms_total               3585 
_refine_hist.d_res_high                       2.15 
_refine_hist.d_res_low                        46.28 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_d          0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 27.1  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.93  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.15 
_refine_ls_shell.d_res_low                        2.28 
_refine_ls_shell.number_reflns_R_work             2909 
_refine_ls_shell.R_factor_R_work                  0.231 
_refine_ls_shell.percent_reflns_obs               68.2 
_refine_ls_shell.R_factor_R_free                  0.298 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            9.6 
_refine_ls_shell.number_reflns_R_free             310 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1JGL 
_struct.title                     'Crystal structure of immunoglobulin Fab fragment complexed with 17-beta-estradiol' 
_struct.pdbx_descriptor           'Ig kappa-chain, Ig gamma-1-chain, ESTRADIOL' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JGL 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'antibody, four-center hydrogen bond, steroid, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 79  ? PHE A 83  ? GLN L 79  PHE L 83  5 ? 5 
HELX_P HELX_P2 2 SER A 121 ? SER A 127 ? SER L 121 SER L 127 1 ? 7 
HELX_P HELX_P3 3 LYS A 183 ? ARG A 188 ? LYS L 183 ARG L 188 1 ? 6 
HELX_P HELX_P4 4 GLU B 62  ? LYS B 65  ? GLU H 61  LYS H 64  5 ? 4 
HELX_P HELX_P5 5 LYS B 87  ? THR B 91  ? LYS H 83  THR H 87  5 ? 5 
HELX_P HELX_P6 6 SER B 159 ? SER B 161 ? SER H 156 SER H 158 5 ? 3 
HELX_P HELX_P7 7 PRO B 203 ? SER B 206 ? PRO H 200 SER H 203 5 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 23  SG ? ? ? 1_555 A CYS 88  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.016 ? 
disulf2 disulf ? ? A CYS 134 SG ? ? ? 1_555 A CYS 194 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf3 disulf ? ? B CYS 22  SG ? ? ? 1_555 B CYS 96  SG ? ? H CYS 22  H CYS 92  1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf4 disulf ? ? B CYS 143 SG ? ? ? 1_555 B CYS 198 SG ? ? H CYS 140 H CYS 195 1_555 ? ? ? ? ? ? ? 2.035 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 7   A . ? SER 7   L PRO 8   A ? PRO 8   L 1 -0.11 
2 THR 94  A . ? THR 94  L PRO 95  A ? PRO 95  L 1 0.14  
3 TYR 140 A . ? TYR 140 L PRO 141 A ? PRO 141 L 1 1.17  
4 PHE 149 B . ? PHE 146 H PRO 150 B ? PRO 147 H 1 0.20  
5 GLU 151 B . ? GLU 148 H PRO 152 B ? PRO 149 H 1 -0.17 
6 TRP 191 B . ? TRP 188 H PRO 192 B ? PRO 189 H 1 1.51  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 6 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 5 ? 
G ? 6 ? 
H ? 4 ? 
I ? 4 ? 
J ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? parallel      
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 4   ? SER A 7   ? MET L 4   SER L 7   
A 2 VAL A 19  ? ALA A 25  ? VAL L 19  ALA L 25  
A 3 GLN A 70  ? ILE A 75  ? GLN L 70  ILE L 75  
A 4 PHE A 62  ? SER A 67  ? PHE L 62  SER L 67  
B 1 SER A 10  ? ALA A 13  ? SER L 10  ALA L 13  
B 2 THR A 102 ? VAL A 106 ? THR L 102 VAL L 106 
B 3 GLY A 84  ? HIS A 90  ? GLY L 84  HIS L 90  
B 4 LEU A 33  ? GLN A 38  ? LEU L 33  GLN L 38  
B 5 GLN A 45  ? TYR A 49  ? GLN L 45  TYR L 49  
B 6 THR A 53  ? LEU A 54  ? THR L 53  LEU L 54  
C 1 THR A 114 ? PHE A 118 ? THR L 114 PHE L 118 
C 2 GLY A 129 ? PHE A 139 ? GLY L 129 PHE L 139 
C 3 TYR A 173 ? THR A 182 ? TYR L 173 THR L 182 
C 4 VAL A 159 ? TRP A 163 ? VAL L 159 TRP L 163 
D 1 SER A 153 ? ARG A 155 ? SER L 153 ARG L 155 
D 2 ASN A 145 ? ILE A 150 ? ASN L 145 ILE L 150 
D 3 SER A 191 ? THR A 197 ? SER L 191 THR L 197 
D 4 ILE A 205 ? ASN A 210 ? ILE L 205 ASN L 210 
E 1 LEU B 4   ? GLN B 6   ? LEU H 4   GLN H 6   
E 2 VAL B 18  ? ALA B 24  ? VAL H 18  ALA H 24  
E 3 THR B 78  ? ILE B 83  ? THR H 77  ILE H 82  
E 4 PHE B 68  ? LEU B 72  ? PHE H 67  LEU H 71  
F 1 VAL B 57  ? TYR B 60  ? VAL H 56  TYR H 59  
F 2 LEU B 45  ? ASN B 52  ? LEU H 45  ASN H 52  
F 3 MET B 34  ? GLN B 39  ? MET H 34  GLN H 39  
F 4 ALA B 92  ? GLY B 100 ? ALA H 88  GLY H 96  
F 5 SER B 103 ? TRP B 106 ? SER H 99  TRP H 103 
G 1 VAL B 57  ? TYR B 60  ? VAL H 56  TYR H 59  
G 2 LEU B 45  ? ASN B 52  ? LEU H 45  ASN H 52  
G 3 MET B 34  ? GLN B 39  ? MET H 34  GLN H 39  
G 4 ALA B 92  ? GLY B 100 ? ALA H 88  GLY H 96  
G 5 THR B 110 ? VAL B 114 ? THR H 107 VAL H 111 
G 6 GLU B 10  ? LYS B 12  ? GLU H 10  LYS H 12  
H 1 SER B 123 ? LEU B 127 ? SER H 120 LEU H 124 
H 2 MET B 138 ? TYR B 148 ? MET H 135 TYR H 145 
H 3 LEU B 177 ? PRO B 187 ? LEU H 174 PRO H 184 
H 4 VAL B 166 ? THR B 168 ? VAL H 163 THR H 165 
I 1 SER B 123 ? LEU B 127 ? SER H 120 LEU H 124 
I 2 MET B 138 ? TYR B 148 ? MET H 135 TYR H 145 
I 3 LEU B 177 ? PRO B 187 ? LEU H 174 PRO H 184 
I 4 VAL B 172 ? GLN B 174 ? VAL H 169 GLN H 171 
J 1 THR B 154 ? TRP B 157 ? THR H 151 TRP H 154 
J 2 THR B 197 ? HIS B 202 ? THR H 194 HIS H 199 
J 3 THR B 207 ? LYS B 212 ? THR H 204 LYS H 209 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER A 7   ? O SER L 7   N THR A 22  ? N THR L 22  
A 2 3 O CYS A 23  ? O CYS L 23  N TYR A 71  ? N TYR L 71  
A 3 4 N LYS A 74  ? N LYS L 74  O SER A 63  ? O SER L 63  
B 1 2 N LEU A 11  ? N LEU L 11  O LYS A 103 ? O LYS L 103 
B 2 3 N LEU A 104 ? N LEU L 104 O GLY A 84  ? O GLY L 84  
B 3 4 O HIS A 89  ? O HIS L 89  N ALA A 34  ? N ALA L 34  
B 4 5 O GLN A 37  ? O GLN L 37  N GLN A 45  ? N GLN L 45  
B 5 6 N TYR A 49  ? N TYR L 49  O THR A 53  ? O THR L 53  
C 1 2 N PHE A 118 ? N PHE L 118 O VAL A 133 ? O VAL L 133 
C 2 3 O PHE A 139 ? O PHE L 139 N TYR A 173 ? N TYR L 173 
C 3 4 N THR A 178 ? N THR L 178 O LEU A 160 ? O LEU L 160 
D 1 2 N ARG A 155 ? N ARG L 155 O TRP A 148 ? O TRP L 148 
D 2 3 O LYS A 149 ? O LYS L 149 N THR A 193 ? N THR L 193 
D 3 4 N ALA A 196 ? N ALA L 196 O ILE A 205 ? O ILE L 205 
E 1 2 O VAL B 5   ? O VAL H 5   N LYS B 23  ? N LYS H 23  
E 2 3 O CYS B 22  ? O CYS H 22  N ALA B 79  ? N ALA H 78  
E 3 4 N GLN B 82  ? N GLN H 81  O ALA B 69  ? O ALA H 68  
F 1 2 N GLU B 59  ? N GLU H 58  O TRP B 50  ? O TRP H 50  
F 2 3 N LEU B 51  ? N LEU H 51  O MET B 34  ? O MET H 34  
F 3 4 O GLN B 39  ? O GLN H 39  N THR B 93  ? N THR H 89  
F 4 5 N GLY B 100 ? N GLY H 96  O SER B 103 ? O SER H 99  
G 1 2 N GLU B 59  ? N GLU H 58  O TRP B 50  ? O TRP H 50  
G 2 3 N LEU B 51  ? N LEU H 51  O MET B 34  ? O MET H 34  
G 3 4 O GLN B 39  ? O GLN H 39  N THR B 93  ? N THR H 89  
G 4 5 N TYR B 94  ? N TYR H 90  O THR B 110 ? O THR H 107 
G 5 6 O THR B 111 ? O THR H 108 N GLU B 10  ? N GLU H 10  
H 1 2 N LEU B 127 ? N LEU H 124 O GLY B 142 ? O GLY H 139 
H 2 3 O TYR B 148 ? O TYR H 145 N TYR B 178 ? N TYR H 175 
H 3 4 N SER B 183 ? N SER H 180 O HIS B 167 ? O HIS H 164 
I 1 2 N LEU B 127 ? N LEU H 124 O GLY B 142 ? O GLY H 139 
I 2 3 O TYR B 148 ? O TYR H 145 N TYR B 178 ? N TYR H 175 
I 3 4 O THR B 179 ? O THR H 176 N VAL B 172 ? N VAL H 169 
J 1 2 O THR B 156 ? O THR H 153 N ASN B 199 ? N ASN H 196 
J 2 3 N HIS B 202 ? N HIS H 199 O THR B 207 ? O THR H 204 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    9 
_struct_site.details              'BINDING SITE FOR RESIDUE EST L 911' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 9 GLN B 35  ? GLN H 35 . ? 1_555 ? 
2 AC1 9 TRP B 99  ? TRP H 95 . ? 1_555 ? 
3 AC1 9 GLY B 100 ? GLY H 96 . ? 1_555 ? 
4 AC1 9 GLY B 101 ? GLY H 97 . ? 1_555 ? 
5 AC1 9 SER B 103 ? SER H 99 . ? 1_555 ? 
6 AC1 9 TYR A 36  ? TYR L 36 . ? 1_555 ? 
7 AC1 9 TYR A 49  ? TYR L 49 . ? 1_555 ? 
8 AC1 9 HIS A 89  ? HIS L 89 . ? 1_555 ? 
9 AC1 9 PHE A 91  ? PHE L 91 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1JGL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JGL 
_atom_sites.fract_transf_matrix[1][1]   0.020744 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015505 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006050 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 27.269  13.021 58.027 1.00 45.90  ? 1    ASP L N   1 
ATOM   2    C CA  . ASP A 1 1   ? 27.506  14.421 58.486 1.00 45.91  ? 1    ASP L CA  1 
ATOM   3    C C   . ASP A 1 1   ? 26.852  14.656 59.844 1.00 42.94  ? 1    ASP L C   1 
ATOM   4    O O   . ASP A 1 1   ? 25.731  14.213 60.100 1.00 43.62  ? 1    ASP L O   1 
ATOM   5    C CB  . ASP A 1 1   ? 26.949  15.415 57.467 1.00 57.93  ? 1    ASP L CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 25.442  15.392 57.403 1.00 61.98  ? 1    ASP L CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 24.874  14.310 57.140 1.00 63.96  ? 1    ASP L OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 24.822  16.453 57.618 1.00 64.45  ? 1    ASP L OD2 1 
ATOM   9    N N   . ILE A 1 2   ? 27.560  15.366 60.708 1.00 30.34  ? 2    ILE L N   1 
ATOM   10   C CA  . ILE A 1 2   ? 27.070  15.643 62.048 1.00 26.59  ? 2    ILE L CA  1 
ATOM   11   C C   . ILE A 1 2   ? 26.553  17.075 62.203 1.00 24.04  ? 2    ILE L C   1 
ATOM   12   O O   . ILE A 1 2   ? 27.238  18.037 61.862 1.00 23.13  ? 2    ILE L O   1 
ATOM   13   C CB  . ILE A 1 2   ? 28.189  15.353 63.065 1.00 24.35  ? 2    ILE L CB  1 
ATOM   14   C CG1 . ILE A 1 2   ? 28.538  13.858 63.006 1.00 23.52  ? 2    ILE L CG1 1 
ATOM   15   C CG2 . ILE A 1 2   ? 27.767  15.769 64.451 1.00 25.07  ? 2    ILE L CG2 1 
ATOM   16   C CD1 . ILE A 1 2   ? 29.731  13.458 63.843 1.00 22.84  ? 2    ILE L CD1 1 
ATOM   17   N N   . GLN A 1 3   ? 25.331  17.198 62.711 1.00 22.55  ? 3    GLN L N   1 
ATOM   18   C CA  . GLN A 1 3   ? 24.698  18.495 62.923 1.00 22.78  ? 3    GLN L CA  1 
ATOM   19   C C   . GLN A 1 3   ? 24.732  18.847 64.406 1.00 22.10  ? 3    GLN L C   1 
ATOM   20   O O   . GLN A 1 3   ? 24.738  17.956 65.262 1.00 20.67  ? 3    GLN L O   1 
ATOM   21   C CB  . GLN A 1 3   ? 23.241  18.463 62.458 1.00 25.22  ? 3    GLN L CB  1 
ATOM   22   C CG  . GLN A 1 3   ? 23.047  18.141 60.992 1.00 30.58  ? 3    GLN L CG  1 
ATOM   23   C CD  . GLN A 1 3   ? 23.737  19.135 60.082 1.00 36.12  ? 3    GLN L CD  1 
ATOM   24   O OE1 . GLN A 1 3   ? 23.762  20.336 60.361 1.00 39.85  ? 3    GLN L OE1 1 
ATOM   25   N NE2 . GLN A 1 3   ? 24.290  18.644 58.977 1.00 36.55  ? 3    GLN L NE2 1 
ATOM   26   N N   . MET A 1 4   ? 24.745  20.143 64.708 1.00 20.47  ? 4    MET L N   1 
ATOM   27   C CA  . MET A 1 4   ? 24.775  20.600 66.091 1.00 18.77  ? 4    MET L CA  1 
ATOM   28   C C   . MET A 1 4   ? 23.485  21.326 66.445 1.00 19.22  ? 4    MET L C   1 
ATOM   29   O O   . MET A 1 4   ? 23.067  22.257 65.757 1.00 19.65  ? 4    MET L O   1 
ATOM   30   C CB  . MET A 1 4   ? 25.961  21.542 66.328 1.00 17.28  ? 4    MET L CB  1 
ATOM   31   C CG  . MET A 1 4   ? 27.330  20.952 66.004 1.00 19.38  ? 4    MET L CG  1 
ATOM   32   S SD  . MET A 1 4   ? 27.724  19.463 66.949 1.00 19.43  ? 4    MET L SD  1 
ATOM   33   C CE  . MET A 1 4   ? 27.677  20.123 68.608 1.00 21.79  ? 4    MET L CE  1 
ATOM   34   N N   . THR A 1 5   ? 22.863  20.897 67.534 1.00 19.17  ? 5    THR L N   1 
ATOM   35   C CA  . THR A 1 5   ? 21.629  21.508 67.998 1.00 19.94  ? 5    THR L CA  1 
ATOM   36   C C   . THR A 1 5   ? 21.987  22.328 69.237 1.00 19.29  ? 5    THR L C   1 
ATOM   37   O O   . THR A 1 5   ? 22.343  21.785 70.284 1.00 19.09  ? 5    THR L O   1 
ATOM   38   C CB  . THR A 1 5   ? 20.591  20.422 68.332 1.00 18.39  ? 5    THR L CB  1 
ATOM   39   O OG1 . THR A 1 5   ? 20.331  19.651 67.153 1.00 18.85  ? 5    THR L OG1 1 
ATOM   40   C CG2 . THR A 1 5   ? 19.301  21.043 68.820 1.00 18.33  ? 5    THR L CG2 1 
ATOM   41   N N   . GLN A 1 6   ? 21.904  23.643 69.100 1.00 18.34  ? 6    GLN L N   1 
ATOM   42   C CA  . GLN A 1 6   ? 22.262  24.544 70.183 1.00 19.01  ? 6    GLN L CA  1 
ATOM   43   C C   . GLN A 1 6   ? 21.062  25.149 70.888 1.00 19.34  ? 6    GLN L C   1 
ATOM   44   O O   . GLN A 1 6   ? 20.086  25.540 70.249 1.00 21.07  ? 6    GLN L O   1 
ATOM   45   C CB  . GLN A 1 6   ? 23.137  25.663 69.626 1.00 14.62  ? 6    GLN L CB  1 
ATOM   46   C CG  . GLN A 1 6   ? 23.732  26.575 70.670 1.00 14.20  ? 6    GLN L CG  1 
ATOM   47   C CD  . GLN A 1 6   ? 24.645  27.620 70.058 1.00 13.96  ? 6    GLN L CD  1 
ATOM   48   O OE1 . GLN A 1 6   ? 25.195  27.420 68.966 1.00 15.36  ? 6    GLN L OE1 1 
ATOM   49   N NE2 . GLN A 1 6   ? 24.822  28.734 70.760 1.00 11.90  ? 6    GLN L NE2 1 
ATOM   50   N N   . SER A 1 7   ? 21.140  25.238 72.210 1.00 15.50  ? 7    SER L N   1 
ATOM   51   C CA  . SER A 1 7   ? 20.049  25.818 72.975 1.00 15.91  ? 7    SER L CA  1 
ATOM   52   C C   . SER A 1 7   ? 20.559  26.453 74.264 1.00 16.62  ? 7    SER L C   1 
ATOM   53   O O   . SER A 1 7   ? 21.579  26.034 74.815 1.00 15.15  ? 7    SER L O   1 
ATOM   54   C CB  . SER A 1 7   ? 19.009  24.749 73.308 1.00 20.75  ? 7    SER L CB  1 
ATOM   55   O OG  . SER A 1 7   ? 19.572  23.779 74.171 1.00 23.11  ? 7    SER L OG  1 
ATOM   56   N N   . PRO A 1 8   ? 19.843  27.473 74.759 1.00 19.49  ? 8    PRO L N   1 
ATOM   57   C CA  . PRO A 1 8   ? 18.628  27.952 74.085 1.00 20.34  ? 8    PRO L CA  1 
ATOM   58   C C   . PRO A 1 8   ? 18.989  28.944 72.978 1.00 21.51  ? 8    PRO L C   1 
ATOM   59   O O   . PRO A 1 8   ? 20.124  29.415 72.899 1.00 20.89  ? 8    PRO L O   1 
ATOM   60   C CB  . PRO A 1 8   ? 17.855  28.606 75.217 1.00 17.24  ? 8    PRO L CB  1 
ATOM   61   C CG  . PRO A 1 8   ? 18.965  29.249 76.011 1.00 18.15  ? 8    PRO L CG  1 
ATOM   62   C CD  . PRO A 1 8   ? 20.047  28.173 76.040 1.00 16.04  ? 8    PRO L CD  1 
ATOM   63   N N   . ALA A 1 9   ? 18.027  29.257 72.123 1.00 21.30  ? 9    ALA L N   1 
ATOM   64   C CA  . ALA A 1 9   ? 18.269  30.204 71.040 1.00 22.17  ? 9    ALA L CA  1 
ATOM   65   C C   . ALA A 1 9   ? 18.438  31.607 71.604 1.00 21.40  ? 9    ALA L C   1 
ATOM   66   O O   . ALA A 1 9   ? 19.226  32.400 71.093 1.00 20.29  ? 9    ALA L O   1 
ATOM   67   C CB  . ALA A 1 9   ? 17.107  30.176 70.052 1.00 29.32  ? 9    ALA L CB  1 
ATOM   68   N N   . SER A 1 10  ? 17.694  31.903 72.665 1.00 20.66  ? 10   SER L N   1 
ATOM   69   C CA  . SER A 1 10  ? 17.743  33.215 73.305 1.00 21.81  ? 10   SER L CA  1 
ATOM   70   C C   . SER A 1 10  ? 17.882  33.065 74.811 1.00 21.18  ? 10   SER L C   1 
ATOM   71   O O   . SER A 1 10  ? 17.303  32.161 75.411 1.00 20.04  ? 10   SER L O   1 
ATOM   72   C CB  . SER A 1 10  ? 16.462  34.002 73.020 1.00 34.47  ? 10   SER L CB  1 
ATOM   73   O OG  . SER A 1 10  ? 16.113  33.946 71.651 1.00 40.86  ? 10   SER L OG  1 
ATOM   74   N N   . LEU A 1 11  ? 18.644  33.962 75.419 1.00 21.83  ? 11   LEU L N   1 
ATOM   75   C CA  . LEU A 1 11  ? 18.837  33.930 76.855 1.00 22.17  ? 11   LEU L CA  1 
ATOM   76   C C   . LEU A 1 11  ? 18.945  35.360 77.354 1.00 21.44  ? 11   LEU L C   1 
ATOM   77   O O   . LEU A 1 11  ? 19.525  36.218 76.692 1.00 21.30  ? 11   LEU L O   1 
ATOM   78   C CB  . LEU A 1 11  ? 20.099  33.135 77.198 1.00 26.66  ? 11   LEU L CB  1 
ATOM   79   C CG  . LEU A 1 11  ? 20.247  32.618 78.629 1.00 28.96  ? 11   LEU L CG  1 
ATOM   80   C CD1 . LEU A 1 11  ? 18.918  32.091 79.163 1.00 29.55  ? 11   LEU L CD1 1 
ATOM   81   C CD2 . LEU A 1 11  ? 21.293  31.514 78.625 1.00 29.40  ? 11   LEU L CD2 1 
ATOM   82   N N   . SER A 1 12  ? 18.364  35.611 78.520 1.00 22.99  ? 12   SER L N   1 
ATOM   83   C CA  . SER A 1 12  ? 18.380  36.936 79.124 1.00 22.29  ? 12   SER L CA  1 
ATOM   84   C C   . SER A 1 12  ? 18.975  36.826 80.514 1.00 20.59  ? 12   SER L C   1 
ATOM   85   O O   . SER A 1 12  ? 18.634  35.917 81.267 1.00 24.03  ? 12   SER L O   1 
ATOM   86   C CB  . SER A 1 12  ? 16.956  37.485 79.203 1.00 23.29  ? 12   SER L CB  1 
ATOM   87   O OG  . SER A 1 12  ? 16.913  38.676 79.953 1.00 29.17  ? 12   SER L OG  1 
ATOM   88   N N   . ALA A 1 13  ? 19.863  37.744 80.864 1.00 13.87  ? 13   ALA L N   1 
ATOM   89   C CA  . ALA A 1 13  ? 20.478  37.675 82.179 1.00 13.99  ? 13   ALA L CA  1 
ATOM   90   C C   . ALA A 1 13  ? 21.132  38.989 82.548 1.00 13.52  ? 13   ALA L C   1 
ATOM   91   O O   . ALA A 1 13  ? 21.259  39.888 81.708 1.00 13.81  ? 13   ALA L O   1 
ATOM   92   C CB  . ALA A 1 13  ? 21.504  36.548 82.214 1.00 11.97  ? 13   ALA L CB  1 
ATOM   93   N N   . SER A 1 14  ? 21.549  39.097 83.804 1.00 12.54  ? 14   SER L N   1 
ATOM   94   C CA  . SER A 1 14  ? 22.181  40.319 84.285 1.00 13.27  ? 14   SER L CA  1 
ATOM   95   C C   . SER A 1 14  ? 23.615  40.115 84.726 1.00 11.90  ? 14   SER L C   1 
ATOM   96   O O   . SER A 1 14  ? 24.042  38.998 85.013 1.00 11.84  ? 14   SER L O   1 
ATOM   97   C CB  . SER A 1 14  ? 21.381  40.900 85.457 1.00 16.84  ? 14   SER L CB  1 
ATOM   98   O OG  . SER A 1 14  ? 20.071  41.250 85.052 1.00 21.54  ? 14   SER L OG  1 
ATOM   99   N N   . VAL A 1 15  ? 24.353  41.214 84.779 1.00 16.09  ? 15   VAL L N   1 
ATOM   100  C CA  . VAL A 1 15  ? 25.734  41.192 85.223 1.00 15.59  ? 15   VAL L CA  1 
ATOM   101  C C   . VAL A 1 15  ? 25.773  40.491 86.577 1.00 16.53  ? 15   VAL L C   1 
ATOM   102  O O   . VAL A 1 15  ? 24.922  40.736 87.433 1.00 19.66  ? 15   VAL L O   1 
ATOM   103  C CB  . VAL A 1 15  ? 26.268  42.634 85.375 1.00 15.44  ? 15   VAL L CB  1 
ATOM   104  C CG1 . VAL A 1 15  ? 27.507  42.653 86.261 1.00 11.81  ? 15   VAL L CG1 1 
ATOM   105  C CG2 . VAL A 1 15  ? 26.577  43.214 83.995 1.00 10.93  ? 15   VAL L CG2 1 
ATOM   106  N N   . GLY A 1 16  ? 26.745  39.608 86.766 1.00 13.47  ? 16   GLY L N   1 
ATOM   107  C CA  . GLY A 1 16  ? 26.853  38.911 88.030 1.00 13.64  ? 16   GLY L CA  1 
ATOM   108  C C   . GLY A 1 16  ? 26.257  37.516 88.036 1.00 13.77  ? 16   GLY L C   1 
ATOM   109  O O   . GLY A 1 16  ? 26.649  36.677 88.844 1.00 14.35  ? 16   GLY L O   1 
ATOM   110  N N   . GLU A 1 17  ? 25.317  37.255 87.140 1.00 12.59  ? 17   GLU L N   1 
ATOM   111  C CA  . GLU A 1 17  ? 24.688  35.944 87.091 1.00 14.49  ? 17   GLU L CA  1 
ATOM   112  C C   . GLU A 1 17  ? 25.493  34.950 86.260 1.00 15.45  ? 17   GLU L C   1 
ATOM   113  O O   . GLU A 1 17  ? 26.459  35.314 85.595 1.00 13.09  ? 17   GLU L O   1 
ATOM   114  C CB  . GLU A 1 17  ? 23.264  36.072 86.535 1.00 18.18  ? 17   GLU L CB  1 
ATOM   115  C CG  . GLU A 1 17  ? 22.366  36.948 87.412 1.00 19.79  ? 17   GLU L CG  1 
ATOM   116  C CD  . GLU A 1 17  ? 21.026  37.282 86.775 1.00 21.78  ? 17   GLU L CD  1 
ATOM   117  O OE1 . GLU A 1 17  ? 20.187  37.895 87.466 1.00 24.06  ? 17   GLU L OE1 1 
ATOM   118  O OE2 . GLU A 1 17  ? 20.806  36.948 85.592 1.00 21.34  ? 17   GLU L OE2 1 
ATOM   119  N N   . THR A 1 18  ? 25.084  33.689 86.319 1.00 16.51  ? 18   THR L N   1 
ATOM   120  C CA  . THR A 1 18  ? 25.731  32.621 85.570 1.00 17.92  ? 18   THR L CA  1 
ATOM   121  C C   . THR A 1 18  ? 24.738  32.024 84.575 1.00 17.41  ? 18   THR L C   1 
ATOM   122  O O   . THR A 1 18  ? 23.562  31.880 84.888 1.00 20.02  ? 18   THR L O   1 
ATOM   123  C CB  . THR A 1 18  ? 26.200  31.494 86.511 1.00 18.11  ? 18   THR L CB  1 
ATOM   124  O OG1 . THR A 1 18  ? 27.295  31.958 87.312 1.00 18.35  ? 18   THR L OG1 1 
ATOM   125  C CG2 . THR A 1 18  ? 26.626  30.280 85.711 1.00 17.70  ? 18   THR L CG2 1 
ATOM   126  N N   . VAL A 1 19  ? 25.204  31.691 83.377 1.00 14.32  ? 19   VAL L N   1 
ATOM   127  C CA  . VAL A 1 19  ? 24.338  31.079 82.378 1.00 15.36  ? 19   VAL L CA  1 
ATOM   128  C C   . VAL A 1 19  ? 25.039  29.888 81.742 1.00 15.73  ? 19   VAL L C   1 
ATOM   129  O O   . VAL A 1 19  ? 26.266  29.779 81.787 1.00 15.82  ? 19   VAL L O   1 
ATOM   130  C CB  . VAL A 1 19  ? 23.922  32.068 81.252 1.00 19.15  ? 19   VAL L CB  1 
ATOM   131  C CG1 . VAL A 1 19  ? 23.056  33.180 81.831 1.00 19.10  ? 19   VAL L CG1 1 
ATOM   132  C CG2 . VAL A 1 19  ? 25.152  32.641 80.560 1.00 18.64  ? 19   VAL L CG2 1 
ATOM   133  N N   . THR A 1 20  ? 24.252  28.992 81.159 1.00 15.81  ? 20   THR L N   1 
ATOM   134  C CA  . THR A 1 20  ? 24.796  27.805 80.519 1.00 16.74  ? 20   THR L CA  1 
ATOM   135  C C   . THR A 1 20  ? 24.192  27.637 79.142 1.00 16.11  ? 20   THR L C   1 
ATOM   136  O O   . THR A 1 20  ? 22.975  27.725 78.972 1.00 19.38  ? 20   THR L O   1 
ATOM   137  C CB  . THR A 1 20  ? 24.503  26.542 81.353 1.00 18.69  ? 20   THR L CB  1 
ATOM   138  O OG1 . THR A 1 20  ? 25.111  26.680 82.639 1.00 20.12  ? 20   THR L OG1 1 
ATOM   139  C CG2 . THR A 1 20  ? 25.057  25.298 80.673 1.00 18.85  ? 20   THR L CG2 1 
ATOM   140  N N   . ILE A 1 21  ? 25.058  27.416 78.161 1.00 15.08  ? 21   ILE L N   1 
ATOM   141  C CA  . ILE A 1 21  ? 24.651  27.213 76.775 1.00 15.49  ? 21   ILE L CA  1 
ATOM   142  C C   . ILE A 1 21  ? 25.055  25.786 76.420 1.00 17.24  ? 21   ILE L C   1 
ATOM   143  O O   . ILE A 1 21  ? 26.172  25.360 76.721 1.00 17.95  ? 21   ILE L O   1 
ATOM   144  C CB  . ILE A 1 21  ? 25.383  28.199 75.831 1.00 13.02  ? 21   ILE L CB  1 
ATOM   145  C CG1 . ILE A 1 21  ? 24.997  29.633 76.185 1.00 13.98  ? 21   ILE L CG1 1 
ATOM   146  C CG2 . ILE A 1 21  ? 25.035  27.896 74.380 1.00 14.62  ? 21   ILE L CG2 1 
ATOM   147  C CD1 . ILE A 1 21  ? 25.829  30.694 75.482 1.00 13.35  ? 21   ILE L CD1 1 
ATOM   148  N N   . THR A 1 22  ? 24.157  25.039 75.792 1.00 16.85  ? 22   THR L N   1 
ATOM   149  C CA  . THR A 1 22  ? 24.475  23.668 75.428 1.00 17.11  ? 22   THR L CA  1 
ATOM   150  C C   . THR A 1 22  ? 24.377  23.407 73.936 1.00 16.32  ? 22   THR L C   1 
ATOM   151  O O   . THR A 1 22  ? 23.622  24.063 73.220 1.00 14.23  ? 22   THR L O   1 
ATOM   152  C CB  . THR A 1 22  ? 23.533  22.660 76.119 1.00 26.96  ? 22   THR L CB  1 
ATOM   153  O OG1 . THR A 1 22  ? 22.209  22.814 75.600 1.00 28.59  ? 22   THR L OG1 1 
ATOM   154  C CG2 . THR A 1 22  ? 23.509  22.882 77.625 1.00 26.36  ? 22   THR L CG2 1 
ATOM   155  N N   . CYS A 1 23  ? 25.166  22.442 73.486 1.00 18.53  ? 23   CYS L N   1 
ATOM   156  C CA  . CYS A 1 23  ? 25.159  22.012 72.104 1.00 20.29  ? 23   CYS L CA  1 
ATOM   157  C C   . CYS A 1 23  ? 25.192  20.496 72.104 1.00 19.95  ? 23   CYS L C   1 
ATOM   158  O O   . CYS A 1 23  ? 25.919  19.880 72.881 1.00 17.91  ? 23   CYS L O   1 
ATOM   159  C CB  . CYS A 1 23  ? 26.371  22.565 71.334 1.00 22.64  ? 23   CYS L CB  1 
ATOM   160  S SG  . CYS A 1 23  ? 26.069  24.148 70.544 1.00 28.38  ? 23   CYS L SG  1 
ATOM   161  N N   . ARG A 1 24  ? 24.364  19.900 71.258 1.00 19.12  ? 24   ARG L N   1 
ATOM   162  C CA  . ARG A 1 24  ? 24.340  18.455 71.151 1.00 20.74  ? 24   ARG L CA  1 
ATOM   163  C C   . ARG A 1 24  ? 24.571  18.053 69.708 1.00 18.82  ? 24   ARG L C   1 
ATOM   164  O O   . ARG A 1 24  ? 23.935  18.585 68.797 1.00 17.22  ? 24   ARG L O   1 
ATOM   165  C CB  . ARG A 1 24  ? 23.016  17.874 71.635 1.00 35.71  ? 24   ARG L CB  1 
ATOM   166  C CG  . ARG A 1 24  ? 23.095  16.361 71.701 1.00 41.53  ? 24   ARG L CG  1 
ATOM   167  C CD  . ARG A 1 24  ? 21.889  15.732 72.336 1.00 44.42  ? 24   ARG L CD  1 
ATOM   168  N NE  . ARG A 1 24  ? 22.108  14.302 72.529 1.00 47.92  ? 24   ARG L NE  1 
ATOM   169  C CZ  . ARG A 1 24  ? 21.208  13.477 73.047 1.00 48.31  ? 24   ARG L CZ  1 
ATOM   170  N NH1 . ARG A 1 24  ? 20.024  13.941 73.423 1.00 48.36  ? 24   ARG L NH1 1 
ATOM   171  N NH2 . ARG A 1 24  ? 21.491  12.191 73.194 1.00 48.14  ? 24   ARG L NH2 1 
ATOM   172  N N   . ALA A 1 25  ? 25.491  17.115 69.513 1.00 18.77  ? 25   ALA L N   1 
ATOM   173  C CA  . ALA A 1 25  ? 25.837  16.626 68.185 1.00 18.37  ? 25   ALA L CA  1 
ATOM   174  C C   . ALA A 1 25  ? 25.004  15.400 67.823 1.00 18.26  ? 25   ALA L C   1 
ATOM   175  O O   . ALA A 1 25  ? 24.670  14.601 68.687 1.00 19.18  ? 25   ALA L O   1 
ATOM   176  C CB  . ALA A 1 25  ? 27.319  16.283 68.139 1.00 23.69  ? 25   ALA L CB  1 
ATOM   177  N N   . SER A 1 26  ? 24.674  15.252 66.544 1.00 19.26  ? 26   SER L N   1 
ATOM   178  C CA  . SER A 1 26  ? 23.881  14.114 66.099 1.00 20.06  ? 26   SER L CA  1 
ATOM   179  C C   . SER A 1 26  ? 24.727  12.840 66.060 1.00 20.78  ? 26   SER L C   1 
ATOM   180  O O   . SER A 1 26  ? 24.210  11.753 65.818 1.00 21.52  ? 26   SER L O   1 
ATOM   181  C CB  . SER A 1 26  ? 23.276  14.392 64.716 1.00 20.25  ? 26   SER L CB  1 
ATOM   182  O OG  . SER A 1 26  ? 24.280  14.580 63.737 1.00 18.44  ? 26   SER L OG  1 
ATOM   183  N N   . GLY A 1 27  ? 26.026  12.993 66.316 1.00 21.81  ? 27   GLY L N   1 
ATOM   184  C CA  . GLY A 1 27  ? 26.950  11.870 66.331 1.00 21.26  ? 27   GLY L CA  1 
ATOM   185  C C   . GLY A 1 27  ? 28.169  12.216 67.176 1.00 23.28  ? 27   GLY L C   1 
ATOM   186  O O   . GLY A 1 27  ? 28.505  13.389 67.321 1.00 22.67  ? 27   GLY L O   1 
ATOM   187  N N   . ASN A 1 28  ? 28.837  11.208 67.727 1.00 25.06  ? 28   ASN L N   1 
ATOM   188  C CA  . ASN A 1 28  ? 30.010  11.429 68.578 1.00 26.31  ? 28   ASN L CA  1 
ATOM   189  C C   . ASN A 1 28  ? 31.084  12.279 67.900 1.00 25.78  ? 28   ASN L C   1 
ATOM   190  O O   . ASN A 1 28  ? 31.583  11.910 66.838 1.00 25.77  ? 28   ASN L O   1 
ATOM   191  C CB  . ASN A 1 28  ? 30.632  10.087 68.970 1.00 31.14  ? 28   ASN L CB  1 
ATOM   192  C CG  . ASN A 1 28  ? 31.584  10.203 70.154 1.00 33.60  ? 28   ASN L CG  1 
ATOM   193  O OD1 . ASN A 1 28  ? 32.248  11.224 70.340 1.00 34.25  ? 28   ASN L OD1 1 
ATOM   194  N ND2 . ASN A 1 28  ? 31.663  9.145  70.952 1.00 32.44  ? 28   ASN L ND2 1 
ATOM   195  N N   . ILE A 1 29  ? 31.450  13.409 68.503 1.00 19.17  ? 29   ILE L N   1 
ATOM   196  C CA  . ILE A 1 29  ? 32.493  14.239 67.902 1.00 19.30  ? 29   ILE L CA  1 
ATOM   197  C C   . ILE A 1 29  ? 33.793  14.234 68.706 1.00 18.79  ? 29   ILE L C   1 
ATOM   198  O O   . ILE A 1 29  ? 34.696  15.031 68.456 1.00 16.49  ? 29   ILE L O   1 
ATOM   199  C CB  . ILE A 1 29  ? 32.024  15.700 67.666 1.00 21.19  ? 29   ILE L CB  1 
ATOM   200  C CG1 . ILE A 1 29  ? 31.579  16.346 68.977 1.00 20.92  ? 29   ILE L CG1 1 
ATOM   201  C CG2 . ILE A 1 29  ? 30.901  15.713 66.629 1.00 22.72  ? 29   ILE L CG2 1 
ATOM   202  C CD1 . ILE A 1 29  ? 31.147  17.802 68.821 1.00 19.94  ? 29   ILE L CD1 1 
ATOM   203  N N   . HIS A 1 30  ? 33.869  13.327 69.675 1.00 24.94  ? 30   HIS L N   1 
ATOM   204  C CA  . HIS A 1 30  ? 35.061  13.144 70.503 1.00 24.88  ? 30   HIS L CA  1 
ATOM   205  C C   . HIS A 1 30  ? 35.792  14.408 70.956 1.00 25.45  ? 30   HIS L C   1 
ATOM   206  O O   . HIS A 1 30  ? 37.006  14.507 70.795 1.00 27.15  ? 30   HIS L O   1 
ATOM   207  C CB  . HIS A 1 30  ? 36.044  12.256 69.746 1.00 27.13  ? 30   HIS L CB  1 
ATOM   208  C CG  . HIS A 1 30  ? 35.417  11.028 69.163 1.00 28.85  ? 30   HIS L CG  1 
ATOM   209  N ND1 . HIS A 1 30  ? 35.222  9.872  69.888 1.00 30.14  ? 30   HIS L ND1 1 
ATOM   210  C CD2 . HIS A 1 30  ? 34.916  10.787 67.928 1.00 30.00  ? 30   HIS L CD2 1 
ATOM   211  C CE1 . HIS A 1 30  ? 34.629  8.971  69.125 1.00 29.30  ? 30   HIS L CE1 1 
ATOM   212  N NE2 . HIS A 1 30  ? 34.432  9.501  67.932 1.00 30.39  ? 30   HIS L NE2 1 
ATOM   213  N N   . ASN A 1 31  ? 35.055  15.362 71.519 1.00 23.65  ? 31   ASN L N   1 
ATOM   214  C CA  . ASN A 1 31  ? 35.615  16.620 72.023 1.00 21.15  ? 31   ASN L CA  1 
ATOM   215  C C   . ASN A 1 31  ? 36.100  17.632 70.995 1.00 19.75  ? 31   ASN L C   1 
ATOM   216  O O   . ASN A 1 31  ? 36.697  18.647 71.361 1.00 17.02  ? 31   ASN L O   1 
ATOM   217  C CB  . ASN A 1 31  ? 36.749  16.342 73.011 1.00 20.19  ? 31   ASN L CB  1 
ATOM   218  C CG  . ASN A 1 31  ? 36.324  15.427 74.127 1.00 23.53  ? 31   ASN L CG  1 
ATOM   219  O OD1 . ASN A 1 31  ? 35.218  15.548 74.653 1.00 25.11  ? 31   ASN L OD1 1 
ATOM   220  N ND2 . ASN A 1 31  ? 37.201  14.503 74.504 1.00 26.16  ? 31   ASN L ND2 1 
ATOM   221  N N   . TYR A 1 32  ? 35.851  17.371 69.717 1.00 19.25  ? 32   TYR L N   1 
ATOM   222  C CA  . TYR A 1 32  ? 36.264  18.300 68.666 1.00 18.69  ? 32   TYR L CA  1 
ATOM   223  C C   . TYR A 1 32  ? 35.216  19.402 68.516 1.00 19.53  ? 32   TYR L C   1 
ATOM   224  O O   . TYR A 1 32  ? 34.519  19.488 67.492 1.00 19.04  ? 32   TYR L O   1 
ATOM   225  C CB  . TYR A 1 32  ? 36.432  17.559 67.337 1.00 30.17  ? 32   TYR L CB  1 
ATOM   226  C CG  . TYR A 1 32  ? 37.653  16.673 67.291 1.00 34.96  ? 32   TYR L CG  1 
ATOM   227  C CD1 . TYR A 1 32  ? 37.805  15.616 68.182 1.00 36.39  ? 32   TYR L CD1 1 
ATOM   228  C CD2 . TYR A 1 32  ? 38.675  16.914 66.376 1.00 39.59  ? 32   TYR L CD2 1 
ATOM   229  C CE1 . TYR A 1 32  ? 38.947  14.822 68.170 1.00 38.60  ? 32   TYR L CE1 1 
ATOM   230  C CE2 . TYR A 1 32  ? 39.822  16.125 66.353 1.00 41.23  ? 32   TYR L CE2 1 
ATOM   231  C CZ  . TYR A 1 32  ? 39.951  15.083 67.254 1.00 39.71  ? 32   TYR L CZ  1 
ATOM   232  O OH  . TYR A 1 32  ? 41.089  14.315 67.243 1.00 41.66  ? 32   TYR L OH  1 
ATOM   233  N N   . LEU A 1 33  ? 35.115  20.247 69.539 1.00 17.13  ? 33   LEU L N   1 
ATOM   234  C CA  . LEU A 1 33  ? 34.145  21.331 69.542 1.00 15.72  ? 33   LEU L CA  1 
ATOM   235  C C   . LEU A 1 33  ? 34.754  22.668 69.969 1.00 15.50  ? 33   LEU L C   1 
ATOM   236  O O   . LEU A 1 33  ? 35.572  22.732 70.887 1.00 15.36  ? 33   LEU L O   1 
ATOM   237  C CB  . LEU A 1 33  ? 32.992  20.986 70.485 1.00 18.04  ? 33   LEU L CB  1 
ATOM   238  C CG  . LEU A 1 33  ? 31.791  21.938 70.436 1.00 20.15  ? 33   LEU L CG  1 
ATOM   239  C CD1 . LEU A 1 33  ? 31.024  21.692 69.147 1.00 17.67  ? 33   LEU L CD1 1 
ATOM   240  C CD2 . LEU A 1 33  ? 30.886  21.709 71.629 1.00 19.60  ? 33   LEU L CD2 1 
ATOM   241  N N   . ALA A 1 34  ? 34.352  23.737 69.296 1.00 14.44  ? 34   ALA L N   1 
ATOM   242  C CA  . ALA A 1 34  ? 34.841  25.064 69.627 1.00 14.93  ? 34   ALA L CA  1 
ATOM   243  C C   . ALA A 1 34  ? 33.646  25.940 69.995 1.00 15.67  ? 34   ALA L C   1 
ATOM   244  O O   . ALA A 1 34  ? 32.514  25.678 69.571 1.00 14.71  ? 34   ALA L O   1 
ATOM   245  C CB  . ALA A 1 34  ? 35.583  25.662 68.438 1.00 13.61  ? 34   ALA L CB  1 
ATOM   246  N N   . TRP A 1 35  ? 33.895  26.964 70.803 1.00 14.48  ? 35   TRP L N   1 
ATOM   247  C CA  . TRP A 1 35  ? 32.844  27.891 71.195 1.00 13.19  ? 35   TRP L CA  1 
ATOM   248  C C   . TRP A 1 35  ? 33.297  29.276 70.768 1.00 14.01  ? 35   TRP L C   1 
ATOM   249  O O   . TRP A 1 35  ? 34.433  29.682 71.045 1.00 13.57  ? 35   TRP L O   1 
ATOM   250  C CB  . TRP A 1 35  ? 32.607  27.865 72.713 1.00 11.40  ? 35   TRP L CB  1 
ATOM   251  C CG  . TRP A 1 35  ? 31.883  26.646 73.208 1.00 12.33  ? 35   TRP L CG  1 
ATOM   252  C CD1 . TRP A 1 35  ? 32.433  25.549 73.812 1.00 11.62  ? 35   TRP L CD1 1 
ATOM   253  C CD2 . TRP A 1 35  ? 30.468  26.408 73.155 1.00 10.51  ? 35   TRP L CD2 1 
ATOM   254  N NE1 . TRP A 1 35  ? 31.446  24.646 74.142 1.00 10.65  ? 35   TRP L NE1 1 
ATOM   255  C CE2 . TRP A 1 35  ? 30.233  25.148 73.751 1.00 11.81  ? 35   TRP L CE2 1 
ATOM   256  C CE3 . TRP A 1 35  ? 29.378  27.138 72.664 1.00 10.94  ? 35   TRP L CE3 1 
ATOM   257  C CZ2 . TRP A 1 35  ? 28.948  24.600 73.871 1.00 12.47  ? 35   TRP L CZ2 1 
ATOM   258  C CZ3 . TRP A 1 35  ? 28.096  26.593 72.785 1.00 13.62  ? 35   TRP L CZ3 1 
ATOM   259  C CH2 . TRP A 1 35  ? 27.897  25.335 73.386 1.00 13.10  ? 35   TRP L CH2 1 
ATOM   260  N N   . TYR A 1 36  ? 32.408  29.996 70.093 1.00 11.41  ? 36   TYR L N   1 
ATOM   261  C CA  . TYR A 1 36  ? 32.709  31.338 69.622 1.00 11.46  ? 36   TYR L CA  1 
ATOM   262  C C   . TYR A 1 36  ? 31.762  32.390 70.173 1.00 12.74  ? 36   TYR L C   1 
ATOM   263  O O   . TYR A 1 36  ? 30.607  32.106 70.493 1.00 12.07  ? 36   TYR L O   1 
ATOM   264  C CB  . TYR A 1 36  ? 32.625  31.403 68.098 1.00 13.76  ? 36   TYR L CB  1 
ATOM   265  C CG  . TYR A 1 36  ? 33.790  30.786 67.364 1.00 18.06  ? 36   TYR L CG  1 
ATOM   266  C CD1 . TYR A 1 36  ? 33.702  29.503 66.824 1.00 18.12  ? 36   TYR L CD1 1 
ATOM   267  C CD2 . TYR A 1 36  ? 34.966  31.506 67.166 1.00 17.08  ? 36   TYR L CD2 1 
ATOM   268  C CE1 . TYR A 1 36  ? 34.756  28.957 66.097 1.00 19.10  ? 36   TYR L CE1 1 
ATOM   269  C CE2 . TYR A 1 36  ? 36.023  30.969 66.444 1.00 19.45  ? 36   TYR L CE2 1 
ATOM   270  C CZ  . TYR A 1 36  ? 35.912  29.698 65.911 1.00 19.30  ? 36   TYR L CZ  1 
ATOM   271  O OH  . TYR A 1 36  ? 36.956  29.179 65.186 1.00 18.91  ? 36   TYR L OH  1 
ATOM   272  N N   . GLN A 1 37  ? 32.269  33.611 70.269 1.00 13.27  ? 37   GLN L N   1 
ATOM   273  C CA  . GLN A 1 37  ? 31.487  34.747 70.724 1.00 14.43  ? 37   GLN L CA  1 
ATOM   274  C C   . GLN A 1 37  ? 31.503  35.757 69.587 1.00 16.65  ? 37   GLN L C   1 
ATOM   275  O O   . GLN A 1 37  ? 32.554  36.011 68.990 1.00 17.24  ? 37   GLN L O   1 
ATOM   276  C CB  . GLN A 1 37  ? 32.120  35.387 71.962 1.00 17.74  ? 37   GLN L CB  1 
ATOM   277  C CG  . GLN A 1 37  ? 31.380  36.617 72.474 1.00 15.86  ? 37   GLN L CG  1 
ATOM   278  C CD  . GLN A 1 37  ? 32.197  37.405 73.484 1.00 17.56  ? 37   GLN L CD  1 
ATOM   279  O OE1 . GLN A 1 37  ? 33.063  38.197 73.116 1.00 18.06  ? 37   GLN L OE1 1 
ATOM   280  N NE2 . GLN A 1 37  ? 31.937  37.177 74.765 1.00 16.48  ? 37   GLN L NE2 1 
ATOM   281  N N   . GLN A 1 38  ? 30.343  36.318 69.267 1.00 20.23  ? 38   GLN L N   1 
ATOM   282  C CA  . GLN A 1 38  ? 30.274  37.326 68.219 1.00 19.76  ? 38   GLN L CA  1 
ATOM   283  C C   . GLN A 1 38  ? 29.496  38.545 68.690 1.00 21.33  ? 38   GLN L C   1 
ATOM   284  O O   . GLN A 1 38  ? 28.378  38.436 69.204 1.00 22.00  ? 38   GLN L O   1 
ATOM   285  C CB  . GLN A 1 38  ? 29.636  36.764 66.944 1.00 16.85  ? 38   GLN L CB  1 
ATOM   286  C CG  . GLN A 1 38  ? 29.542  37.795 65.827 1.00 14.75  ? 38   GLN L CG  1 
ATOM   287  C CD  . GLN A 1 38  ? 29.075  37.208 64.510 1.00 15.87  ? 38   GLN L CD  1 
ATOM   288  O OE1 . GLN A 1 38  ? 28.136  36.416 64.471 1.00 15.32  ? 38   GLN L OE1 1 
ATOM   289  N NE2 . GLN A 1 38  ? 29.721  37.610 63.417 1.00 14.98  ? 38   GLN L NE2 1 
ATOM   290  N N   . LYS A 1 39  ? 30.117  39.705 68.525 1.00 17.07  ? 39   LYS L N   1 
ATOM   291  C CA  . LYS A 1 39  ? 29.524  40.978 68.900 1.00 20.65  ? 39   LYS L CA  1 
ATOM   292  C C   . LYS A 1 39  ? 29.012  41.635 67.628 1.00 22.45  ? 39   LYS L C   1 
ATOM   293  O O   . LYS A 1 39  ? 29.658  41.555 66.587 1.00 22.77  ? 39   LYS L O   1 
ATOM   294  C CB  . LYS A 1 39  ? 30.577  41.890 69.521 1.00 30.67  ? 39   LYS L CB  1 
ATOM   295  C CG  . LYS A 1 39  ? 31.250  41.337 70.747 1.00 34.86  ? 39   LYS L CG  1 
ATOM   296  C CD  . LYS A 1 39  ? 30.262  41.175 71.872 1.00 35.89  ? 39   LYS L CD  1 
ATOM   297  C CE  . LYS A 1 39  ? 30.985  41.066 73.191 1.00 38.06  ? 39   LYS L CE  1 
ATOM   298  N NZ  . LYS A 1 39  ? 31.739  42.314 73.492 1.00 38.81  ? 39   LYS L NZ  1 
ATOM   299  N N   . GLN A 1 40  ? 27.850  42.269 67.722 1.00 28.87  ? 40   GLN L N   1 
ATOM   300  C CA  . GLN A 1 40  ? 27.226  42.977 66.607 1.00 32.33  ? 40   GLN L CA  1 
ATOM   301  C C   . GLN A 1 40  ? 27.875  42.813 65.226 1.00 33.20  ? 40   GLN L C   1 
ATOM   302  O O   . GLN A 1 40  ? 28.516  43.736 64.724 1.00 32.79  ? 40   GLN L O   1 
ATOM   303  C CB  . GLN A 1 40  ? 27.157  44.458 66.953 1.00 64.65  ? 40   GLN L CB  1 
ATOM   304  C CG  . GLN A 1 40  ? 28.513  45.026 67.322 1.00 70.58  ? 40   GLN L CG  1 
ATOM   305  C CD  . GLN A 1 40  ? 28.424  46.399 67.944 1.00 74.20  ? 40   GLN L CD  1 
ATOM   306  O OE1 . GLN A 1 40  ? 29.443  47.025 68.230 1.00 78.72  ? 40   GLN L OE1 1 
ATOM   307  N NE2 . GLN A 1 40  ? 27.204  46.877 68.163 1.00 76.04  ? 40   GLN L NE2 1 
ATOM   308  N N   . GLY A 1 41  ? 27.714  41.631 64.628 1.00 35.85  ? 41   GLY L N   1 
ATOM   309  C CA  . GLY A 1 41  ? 28.242  41.366 63.297 1.00 34.47  ? 41   GLY L CA  1 
ATOM   310  C C   . GLY A 1 41  ? 29.742  41.229 63.079 1.00 35.01  ? 41   GLY L C   1 
ATOM   311  O O   . GLY A 1 41  ? 30.165  40.684 62.052 1.00 34.66  ? 41   GLY L O   1 
ATOM   312  N N   . LYS A 1 42  ? 30.540  41.719 64.027 1.00 29.33  ? 42   LYS L N   1 
ATOM   313  C CA  . LYS A 1 42  ? 32.002  41.669 63.943 1.00 27.33  ? 42   LYS L CA  1 
ATOM   314  C C   . LYS A 1 42  ? 32.537  40.249 63.818 1.00 25.03  ? 42   LYS L C   1 
ATOM   315  O O   . LYS A 1 42  ? 31.792  39.281 63.936 1.00 23.74  ? 42   LYS L O   1 
ATOM   316  C CB  . LYS A 1 42  ? 32.610  42.315 65.186 1.00 46.61  ? 42   LYS L CB  1 
ATOM   317  C CG  . LYS A 1 42  ? 32.010  43.664 65.522 1.00 51.20  ? 42   LYS L CG  1 
ATOM   318  C CD  . LYS A 1 42  ? 32.458  44.729 64.543 1.00 54.93  ? 42   LYS L CD  1 
ATOM   319  C CE  . LYS A 1 42  ? 33.731  45.412 65.021 1.00 57.73  ? 42   LYS L CE  1 
ATOM   320  N NZ  . LYS A 1 42  ? 33.496  46.192 66.272 1.00 58.71  ? 42   LYS L NZ  1 
ATOM   321  N N   . SER A 1 43  ? 33.842  40.131 63.597 1.00 24.61  ? 43   SER L N   1 
ATOM   322  C CA  . SER A 1 43  ? 34.471  38.827 63.472 1.00 22.70  ? 43   SER L CA  1 
ATOM   323  C C   . SER A 1 43  ? 34.282  38.019 64.751 1.00 21.54  ? 43   SER L C   1 
ATOM   324  O O   . SER A 1 43  ? 34.424  38.539 65.863 1.00 20.11  ? 43   SER L O   1 
ATOM   325  C CB  . SER A 1 43  ? 35.966  38.978 63.196 1.00 33.18  ? 43   SER L CB  1 
ATOM   326  O OG  . SER A 1 43  ? 36.192  39.702 62.000 1.00 39.37  ? 43   SER L OG  1 
ATOM   327  N N   . PRO A 1 44  ? 33.925  36.737 64.609 1.00 18.62  ? 44   PRO L N   1 
ATOM   328  C CA  . PRO A 1 44  ? 33.733  35.890 65.785 1.00 17.13  ? 44   PRO L CA  1 
ATOM   329  C C   . PRO A 1 44  ? 35.075  35.733 66.488 1.00 17.32  ? 44   PRO L C   1 
ATOM   330  O O   . PRO A 1 44  ? 36.126  35.830 65.859 1.00 16.81  ? 44   PRO L O   1 
ATOM   331  C CB  . PRO A 1 44  ? 33.241  34.580 65.182 1.00 15.28  ? 44   PRO L CB  1 
ATOM   332  C CG  . PRO A 1 44  ? 32.455  35.043 63.994 1.00 15.22  ? 44   PRO L CG  1 
ATOM   333  C CD  . PRO A 1 44  ? 33.365  36.098 63.404 1.00 16.35  ? 44   PRO L CD  1 
ATOM   334  N N   . GLN A 1 45  ? 35.037  35.495 67.791 1.00 16.39  ? 45   GLN L N   1 
ATOM   335  C CA  . GLN A 1 45  ? 36.254  35.330 68.562 1.00 17.41  ? 45   GLN L CA  1 
ATOM   336  C C   . GLN A 1 45  ? 36.207  34.011 69.326 1.00 17.42  ? 45   GLN L C   1 
ATOM   337  O O   . GLN A 1 45  ? 35.212  33.691 69.977 1.00 15.42  ? 45   GLN L O   1 
ATOM   338  C CB  . GLN A 1 45  ? 36.426  36.524 69.505 1.00 34.48  ? 45   GLN L CB  1 
ATOM   339  C CG  . GLN A 1 45  ? 36.718  37.813 68.741 1.00 43.50  ? 45   GLN L CG  1 
ATOM   340  C CD  . GLN A 1 45  ? 36.999  39.001 69.640 1.00 49.42  ? 45   GLN L CD  1 
ATOM   341  O OE1 . GLN A 1 45  ? 36.103  39.514 70.314 1.00 52.84  ? 45   GLN L OE1 1 
ATOM   342  N NE2 . GLN A 1 45  ? 38.251  39.445 69.656 1.00 51.48  ? 45   GLN L NE2 1 
ATOM   343  N N   . LEU A 1 46  ? 37.287  33.243 69.233 1.00 17.06  ? 46   LEU L N   1 
ATOM   344  C CA  . LEU A 1 46  ? 37.348  31.949 69.890 1.00 18.16  ? 46   LEU L CA  1 
ATOM   345  C C   . LEU A 1 46  ? 37.389  32.044 71.410 1.00 19.30  ? 46   LEU L C   1 
ATOM   346  O O   . LEU A 1 46  ? 38.105  32.868 71.978 1.00 19.72  ? 46   LEU L O   1 
ATOM   347  C CB  . LEU A 1 46  ? 38.565  31.166 69.391 1.00 14.41  ? 46   LEU L CB  1 
ATOM   348  C CG  . LEU A 1 46  ? 38.672  29.727 69.903 1.00 16.86  ? 46   LEU L CG  1 
ATOM   349  C CD1 . LEU A 1 46  ? 37.481  28.914 69.380 1.00 14.60  ? 46   LEU L CD1 1 
ATOM   350  C CD2 . LEU A 1 46  ? 39.993  29.109 69.435 1.00 15.14  ? 46   LEU L CD2 1 
ATOM   351  N N   . LEU A 1 47  ? 36.614  31.188 72.065 1.00 15.68  ? 47   LEU L N   1 
ATOM   352  C CA  . LEU A 1 47  ? 36.574  31.163 73.515 1.00 15.59  ? 47   LEU L CA  1 
ATOM   353  C C   . LEU A 1 47  ? 37.191  29.870 74.010 1.00 15.94  ? 47   LEU L C   1 
ATOM   354  O O   . LEU A 1 47  ? 38.082  29.874 74.852 1.00 16.54  ? 47   LEU L O   1 
ATOM   355  C CB  . LEU A 1 47  ? 35.134  31.232 74.017 1.00 17.21  ? 47   LEU L CB  1 
ATOM   356  C CG  . LEU A 1 47  ? 34.281  32.438 73.623 1.00 18.42  ? 47   LEU L CG  1 
ATOM   357  C CD1 . LEU A 1 47  ? 32.814  32.114 73.873 1.00 17.56  ? 47   LEU L CD1 1 
ATOM   358  C CD2 . LEU A 1 47  ? 34.718  33.662 74.411 1.00 15.54  ? 47   LEU L CD2 1 
ATOM   359  N N   . VAL A 1 48  ? 36.698  28.761 73.476 1.00 19.29  ? 48   VAL L N   1 
ATOM   360  C CA  . VAL A 1 48  ? 37.153  27.443 73.880 1.00 18.73  ? 48   VAL L CA  1 
ATOM   361  C C   . VAL A 1 48  ? 37.214  26.516 72.674 1.00 19.39  ? 48   VAL L C   1 
ATOM   362  O O   . VAL A 1 48  ? 36.383  26.621 71.770 1.00 21.11  ? 48   VAL L O   1 
ATOM   363  C CB  . VAL A 1 48  ? 36.166  26.837 74.911 1.00 14.73  ? 48   VAL L CB  1 
ATOM   364  C CG1 . VAL A 1 48  ? 36.680  25.509 75.411 1.00 13.04  ? 48   VAL L CG1 1 
ATOM   365  C CG2 . VAL A 1 48  ? 35.955  27.812 76.067 1.00 12.60  ? 48   VAL L CG2 1 
ATOM   366  N N   . TYR A 1 49  ? 38.197  25.617 72.655 1.00 17.46  ? 49   TYR L N   1 
ATOM   367  C CA  . TYR A 1 49  ? 38.315  24.648 71.569 1.00 19.57  ? 49   TYR L CA  1 
ATOM   368  C C   . TYR A 1 49  ? 38.690  23.293 72.175 1.00 21.12  ? 49   TYR L C   1 
ATOM   369  O O   . TYR A 1 49  ? 39.235  23.235 73.281 1.00 22.00  ? 49   TYR L O   1 
ATOM   370  C CB  . TYR A 1 49  ? 39.331  25.120 70.515 1.00 21.82  ? 49   TYR L CB  1 
ATOM   371  C CG  . TYR A 1 49  ? 40.773  25.131 70.958 1.00 23.56  ? 49   TYR L CG  1 
ATOM   372  C CD1 . TYR A 1 49  ? 41.602  24.034 70.719 1.00 24.72  ? 49   TYR L CD1 1 
ATOM   373  C CD2 . TYR A 1 49  ? 41.311  26.238 71.615 1.00 24.19  ? 49   TYR L CD2 1 
ATOM   374  C CE1 . TYR A 1 49  ? 42.935  24.038 71.122 1.00 27.25  ? 49   TYR L CE1 1 
ATOM   375  C CE2 . TYR A 1 49  ? 42.640  26.255 72.024 1.00 25.25  ? 49   TYR L CE2 1 
ATOM   376  C CZ  . TYR A 1 49  ? 43.447  25.151 71.775 1.00 27.17  ? 49   TYR L CZ  1 
ATOM   377  O OH  . TYR A 1 49  ? 44.757  25.155 72.181 1.00 29.50  ? 49   TYR L OH  1 
ATOM   378  N N   . ASN A 1 50  ? 38.393  22.212 71.457 1.00 15.99  ? 50   ASN L N   1 
ATOM   379  C CA  . ASN A 1 50  ? 38.630  20.864 71.957 1.00 16.28  ? 50   ASN L CA  1 
ATOM   380  C C   . ASN A 1 50  ? 37.766  20.682 73.201 1.00 16.97  ? 50   ASN L C   1 
ATOM   381  O O   . ASN A 1 50  ? 38.168  20.055 74.185 1.00 17.42  ? 50   ASN L O   1 
ATOM   382  C CB  . ASN A 1 50  ? 40.107  20.619 72.292 1.00 23.36  ? 50   ASN L CB  1 
ATOM   383  C CG  . ASN A 1 50  ? 40.972  20.471 71.047 1.00 25.19  ? 50   ASN L CG  1 
ATOM   384  O OD1 . ASN A 1 50  ? 40.477  20.137 69.973 1.00 24.68  ? 50   ASN L OD1 1 
ATOM   385  N ND2 . ASN A 1 50  ? 42.272  20.702 71.195 1.00 24.89  ? 50   ASN L ND2 1 
ATOM   386  N N   . ALA A 1 51  ? 36.575  21.264 73.144 1.00 16.71  ? 51   ALA L N   1 
ATOM   387  C CA  . ALA A 1 51  ? 35.593  21.168 74.215 1.00 17.60  ? 51   ALA L CA  1 
ATOM   388  C C   . ALA A 1 51  ? 35.898  21.871 75.540 1.00 18.65  ? 51   ALA L C   1 
ATOM   389  O O   . ALA A 1 51  ? 34.983  22.421 76.166 1.00 15.87  ? 51   ALA L O   1 
ATOM   390  C CB  . ALA A 1 51  ? 35.279  19.693 74.486 1.00 17.44  ? 51   ALA L CB  1 
ATOM   391  N N   . LYS A 1 52  ? 37.161  21.866 75.968 1.00 20.65  ? 52   LYS L N   1 
ATOM   392  C CA  . LYS A 1 52  ? 37.500  22.466 77.262 1.00 23.33  ? 52   LYS L CA  1 
ATOM   393  C C   . LYS A 1 52  ? 38.759  23.327 77.382 1.00 21.76  ? 52   LYS L C   1 
ATOM   394  O O   . LYS A 1 52  ? 39.081  23.788 78.474 1.00 21.54  ? 52   LYS L O   1 
ATOM   395  C CB  . LYS A 1 52  ? 37.574  21.361 78.321 1.00 40.98  ? 52   LYS L CB  1 
ATOM   396  C CG  . LYS A 1 52  ? 38.717  20.378 78.101 1.00 45.12  ? 52   LYS L CG  1 
ATOM   397  C CD  . LYS A 1 52  ? 38.617  19.191 79.047 1.00 49.08  ? 52   LYS L CD  1 
ATOM   398  C CE  . LYS A 1 52  ? 39.678  18.146 78.733 1.00 52.69  ? 52   LYS L CE  1 
ATOM   399  N NZ  . LYS A 1 52  ? 39.432  16.851 79.440 1.00 55.69  ? 52   LYS L NZ  1 
ATOM   400  N N   . THR A 1 53  ? 39.472  23.550 76.288 1.00 19.70  ? 53   THR L N   1 
ATOM   401  C CA  . THR A 1 53  ? 40.680  24.361 76.367 1.00 18.59  ? 53   THR L CA  1 
ATOM   402  C C   . THR A 1 53  ? 40.385  25.828 76.066 1.00 19.34  ? 53   THR L C   1 
ATOM   403  O O   . THR A 1 53  ? 39.863  26.154 74.996 1.00 18.15  ? 53   THR L O   1 
ATOM   404  C CB  . THR A 1 53  ? 41.747  23.857 75.379 1.00 18.79  ? 53   THR L CB  1 
ATOM   405  O OG1 . THR A 1 53  ? 41.961  22.458 75.587 1.00 20.67  ? 53   THR L OG1 1 
ATOM   406  C CG2 . THR A 1 53  ? 43.057  24.595 75.595 1.00 19.04  ? 53   THR L CG2 1 
ATOM   407  N N   . LEU A 1 54  ? 40.710  26.711 77.010 1.00 18.29  ? 54   LEU L N   1 
ATOM   408  C CA  . LEU A 1 54  ? 40.485  28.140 76.816 1.00 18.62  ? 54   LEU L CA  1 
ATOM   409  C C   . LEU A 1 54  ? 41.505  28.722 75.857 1.00 19.60  ? 54   LEU L C   1 
ATOM   410  O O   . LEU A 1 54  ? 42.698  28.441 75.967 1.00 21.28  ? 54   LEU L O   1 
ATOM   411  C CB  . LEU A 1 54  ? 40.588  28.906 78.138 1.00 21.81  ? 54   LEU L CB  1 
ATOM   412  C CG  . LEU A 1 54  ? 39.403  28.895 79.105 1.00 24.71  ? 54   LEU L CG  1 
ATOM   413  C CD1 . LEU A 1 54  ? 39.533  30.070 80.074 1.00 22.29  ? 54   LEU L CD1 1 
ATOM   414  C CD2 . LEU A 1 54  ? 38.110  29.016 78.330 1.00 22.99  ? 54   LEU L CD2 1 
ATOM   415  N N   . ALA A 1 55  ? 41.042  29.544 74.922 1.00 19.97  ? 55   ALA L N   1 
ATOM   416  C CA  . ALA A 1 55  ? 41.948  30.175 73.968 1.00 20.59  ? 55   ALA L CA  1 
ATOM   417  C C   . ALA A 1 55  ? 42.671  31.325 74.663 1.00 21.15  ? 55   ALA L C   1 
ATOM   418  O O   . ALA A 1 55  ? 42.248  31.785 75.728 1.00 20.40  ? 55   ALA L O   1 
ATOM   419  C CB  . ALA A 1 55  ? 41.174  30.695 72.769 1.00 12.93  ? 55   ALA L CB  1 
ATOM   420  N N   . ASP A 1 56  ? 43.760  31.790 74.060 1.00 23.24  ? 56   ASP L N   1 
ATOM   421  C CA  . ASP A 1 56  ? 44.532  32.882 74.639 1.00 23.58  ? 56   ASP L CA  1 
ATOM   422  C C   . ASP A 1 56  ? 43.671  34.098 74.954 1.00 22.61  ? 56   ASP L C   1 
ATOM   423  O O   . ASP A 1 56  ? 42.802  34.479 74.168 1.00 21.20  ? 56   ASP L O   1 
ATOM   424  C CB  . ASP A 1 56  ? 45.659  33.328 73.697 1.00 35.16  ? 56   ASP L CB  1 
ATOM   425  C CG  . ASP A 1 56  ? 46.717  32.261 73.491 1.00 39.41  ? 56   ASP L CG  1 
ATOM   426  O OD1 . ASP A 1 56  ? 46.964  31.464 74.422 1.00 42.46  ? 56   ASP L OD1 1 
ATOM   427  O OD2 . ASP A 1 56  ? 47.316  32.232 72.394 1.00 44.09  ? 56   ASP L OD2 1 
ATOM   428  N N   . GLY A 1 57  ? 43.933  34.697 76.113 1.00 24.76  ? 57   GLY L N   1 
ATOM   429  C CA  . GLY A 1 57  ? 43.226  35.890 76.538 1.00 23.39  ? 57   GLY L CA  1 
ATOM   430  C C   . GLY A 1 57  ? 41.787  35.729 76.978 1.00 23.08  ? 57   GLY L C   1 
ATOM   431  O O   . GLY A 1 57  ? 41.138  36.709 77.336 1.00 24.98  ? 57   GLY L O   1 
ATOM   432  N N   . VAL A 1 58  ? 41.276  34.506 76.958 1.00 16.60  ? 58   VAL L N   1 
ATOM   433  C CA  . VAL A 1 58  ? 39.898  34.283 77.350 1.00 14.01  ? 58   VAL L CA  1 
ATOM   434  C C   . VAL A 1 58  ? 39.739  34.216 78.861 1.00 14.57  ? 58   VAL L C   1 
ATOM   435  O O   . VAL A 1 58  ? 40.308  33.338 79.512 1.00 12.89  ? 58   VAL L O   1 
ATOM   436  C CB  . VAL A 1 58  ? 39.350  32.989 76.721 1.00 13.30  ? 58   VAL L CB  1 
ATOM   437  C CG1 . VAL A 1 58  ? 37.922  32.740 77.208 1.00 12.34  ? 58   VAL L CG1 1 
ATOM   438  C CG2 . VAL A 1 58  ? 39.384  33.112 75.196 1.00 13.35  ? 58   VAL L CG2 1 
ATOM   439  N N   . PRO A 1 59  ? 38.949  35.146 79.437 1.00 17.32  ? 59   PRO L N   1 
ATOM   440  C CA  . PRO A 1 59  ? 38.705  35.202 80.882 1.00 16.97  ? 59   PRO L CA  1 
ATOM   441  C C   . PRO A 1 59  ? 38.319  33.826 81.400 1.00 17.88  ? 59   PRO L C   1 
ATOM   442  O O   . PRO A 1 59  ? 37.576  33.091 80.740 1.00 17.87  ? 59   PRO L O   1 
ATOM   443  C CB  . PRO A 1 59  ? 37.556  36.205 81.004 1.00 13.49  ? 59   PRO L CB  1 
ATOM   444  C CG  . PRO A 1 59  ? 37.771  37.112 79.832 1.00 15.17  ? 59   PRO L CG  1 
ATOM   445  C CD  . PRO A 1 59  ? 38.123  36.143 78.729 1.00 12.88  ? 59   PRO L CD  1 
ATOM   446  N N   . SER A 1 60  ? 38.810  33.484 82.586 1.00 15.91  ? 60   SER L N   1 
ATOM   447  C CA  . SER A 1 60  ? 38.520  32.181 83.170 1.00 17.30  ? 60   SER L CA  1 
ATOM   448  C C   . SER A 1 60  ? 37.071  32.006 83.622 1.00 17.26  ? 60   SER L C   1 
ATOM   449  O O   . SER A 1 60  ? 36.688  30.925 84.067 1.00 18.16  ? 60   SER L O   1 
ATOM   450  C CB  . SER A 1 60  ? 39.463  31.912 84.341 1.00 19.51  ? 60   SER L CB  1 
ATOM   451  O OG  . SER A 1 60  ? 39.282  32.882 85.348 1.00 29.14  ? 60   SER L OG  1 
ATOM   452  N N   . ARG A 1 61  ? 36.255  33.052 83.527 1.00 15.12  ? 61   ARG L N   1 
ATOM   453  C CA  . ARG A 1 61  ? 34.868  32.882 83.928 1.00 15.04  ? 61   ARG L CA  1 
ATOM   454  C C   . ARG A 1 61  ? 34.142  32.105 82.823 1.00 14.72  ? 61   ARG L C   1 
ATOM   455  O O   . ARG A 1 61  ? 32.984  31.723 82.976 1.00 12.53  ? 61   ARG L O   1 
ATOM   456  C CB  . ARG A 1 61  ? 34.193  34.231 84.223 1.00 20.47  ? 61   ARG L CB  1 
ATOM   457  C CG  . ARG A 1 61  ? 34.232  35.237 83.104 1.00 20.42  ? 61   ARG L CG  1 
ATOM   458  C CD  . ARG A 1 61  ? 33.463  36.504 83.455 1.00 19.19  ? 61   ARG L CD  1 
ATOM   459  N NE  . ARG A 1 61  ? 33.458  37.400 82.306 1.00 18.57  ? 61   ARG L NE  1 
ATOM   460  C CZ  . ARG A 1 61  ? 34.482  38.169 81.959 1.00 17.63  ? 61   ARG L CZ  1 
ATOM   461  N NH1 . ARG A 1 61  ? 35.591  38.167 82.686 1.00 14.84  ? 61   ARG L NH1 1 
ATOM   462  N NH2 . ARG A 1 61  ? 34.417  38.896 80.853 1.00 17.35  ? 61   ARG L NH2 1 
ATOM   463  N N   . PHE A 1 62  ? 34.844  31.856 81.715 1.00 15.69  ? 62   PHE L N   1 
ATOM   464  C CA  . PHE A 1 62  ? 34.295  31.069 80.608 1.00 16.45  ? 62   PHE L CA  1 
ATOM   465  C C   . PHE A 1 62  ? 34.832  29.654 80.768 1.00 17.77  ? 62   PHE L C   1 
ATOM   466  O O   . PHE A 1 62  ? 36.018  29.474 81.048 1.00 18.39  ? 62   PHE L O   1 
ATOM   467  C CB  . PHE A 1 62  ? 34.778  31.582 79.244 1.00 13.54  ? 62   PHE L CB  1 
ATOM   468  C CG  . PHE A 1 62  ? 34.132  32.858 78.801 1.00 13.55  ? 62   PHE L CG  1 
ATOM   469  C CD1 . PHE A 1 62  ? 32.889  32.846 78.169 1.00 14.68  ? 62   PHE L CD1 1 
ATOM   470  C CD2 . PHE A 1 62  ? 34.767  34.075 79.008 1.00 14.48  ? 62   PHE L CD2 1 
ATOM   471  C CE1 . PHE A 1 62  ? 32.288  34.036 77.749 1.00 13.68  ? 62   PHE L CE1 1 
ATOM   472  C CE2 . PHE A 1 62  ? 34.176  35.275 78.593 1.00 13.30  ? 62   PHE L CE2 1 
ATOM   473  C CZ  . PHE A 1 62  ? 32.938  35.256 77.964 1.00 13.48  ? 62   PHE L CZ  1 
ATOM   474  N N   . SER A 1 63  ? 33.982  28.648 80.594 1.00 17.94  ? 63   SER L N   1 
ATOM   475  C CA  . SER A 1 63  ? 34.463  27.275 80.683 1.00 19.93  ? 63   SER L CA  1 
ATOM   476  C C   . SER A 1 63  ? 33.576  26.330 79.888 1.00 20.08  ? 63   SER L C   1 
ATOM   477  O O   . SER A 1 63  ? 32.346  26.426 79.926 1.00 18.97  ? 63   SER L O   1 
ATOM   478  C CB  . SER A 1 63  ? 34.554  26.813 82.143 1.00 19.36  ? 63   SER L CB  1 
ATOM   479  O OG  . SER A 1 63  ? 33.349  26.210 82.575 1.00 22.00  ? 63   SER L OG  1 
ATOM   480  N N   . GLY A 1 64  ? 34.214  25.424 79.156 1.00 21.07  ? 64   GLY L N   1 
ATOM   481  C CA  . GLY A 1 64  ? 33.478  24.461 78.360 1.00 20.89  ? 64   GLY L CA  1 
ATOM   482  C C   . GLY A 1 64  ? 33.622  23.071 78.942 1.00 21.52  ? 64   GLY L C   1 
ATOM   483  O O   . GLY A 1 64  ? 34.612  22.775 79.607 1.00 21.13  ? 64   GLY L O   1 
ATOM   484  N N   . SER A 1 65  ? 32.633  22.218 78.710 1.00 18.52  ? 65   SER L N   1 
ATOM   485  C CA  . SER A 1 65  ? 32.694  20.856 79.215 1.00 19.51  ? 65   SER L CA  1 
ATOM   486  C C   . SER A 1 65  ? 31.858  19.922 78.343 1.00 20.52  ? 65   SER L C   1 
ATOM   487  O O   . SER A 1 65  ? 31.245  20.361 77.358 1.00 18.06  ? 65   SER L O   1 
ATOM   488  C CB  . SER A 1 65  ? 32.191  20.802 80.658 1.00 28.48  ? 65   SER L CB  1 
ATOM   489  O OG  . SER A 1 65  ? 30.819  21.144 80.731 1.00 30.38  ? 65   SER L OG  1 
ATOM   490  N N   . GLY A 1 66  ? 31.843  18.640 78.713 1.00 18.97  ? 66   GLY L N   1 
ATOM   491  C CA  . GLY A 1 66  ? 31.081  17.649 77.973 1.00 19.81  ? 66   GLY L CA  1 
ATOM   492  C C   . GLY A 1 66  ? 31.927  16.592 77.284 1.00 20.49  ? 66   GLY L C   1 
ATOM   493  O O   . GLY A 1 66  ? 33.154  16.605 77.365 1.00 19.14  ? 66   GLY L O   1 
ATOM   494  N N   . SER A 1 67  ? 31.263  15.660 76.607 1.00 20.35  ? 67   SER L N   1 
ATOM   495  C CA  . SER A 1 67  ? 31.954  14.596 75.887 1.00 20.82  ? 67   SER L CA  1 
ATOM   496  C C   . SER A 1 67  ? 30.949  13.855 75.020 1.00 21.21  ? 67   SER L C   1 
ATOM   497  O O   . SER A 1 67  ? 29.742  14.031 75.169 1.00 18.34  ? 67   SER L O   1 
ATOM   498  C CB  . SER A 1 67  ? 32.606  13.609 76.860 1.00 22.94  ? 67   SER L CB  1 
ATOM   499  O OG  . SER A 1 67  ? 31.619  12.848 77.536 1.00 25.17  ? 67   SER L OG  1 
ATOM   500  N N   . GLY A 1 68  ? 31.453  13.019 74.120 1.00 28.37  ? 68   GLY L N   1 
ATOM   501  C CA  . GLY A 1 68  ? 30.570  12.281 73.243 1.00 27.38  ? 68   GLY L CA  1 
ATOM   502  C C   . GLY A 1 68  ? 29.805  13.231 72.340 1.00 26.89  ? 68   GLY L C   1 
ATOM   503  O O   . GLY A 1 68  ? 30.381  13.829 71.432 1.00 27.26  ? 68   GLY L O   1 
ATOM   504  N N   . THR A 1 69  ? 28.511  13.384 72.608 1.00 18.02  ? 69   THR L N   1 
ATOM   505  C CA  . THR A 1 69  ? 27.647  14.246 71.809 1.00 19.89  ? 69   THR L CA  1 
ATOM   506  C C   . THR A 1 69  ? 27.066  15.433 72.574 1.00 20.17  ? 69   THR L C   1 
ATOM   507  O O   . THR A 1 69  ? 26.364  16.264 71.994 1.00 21.62  ? 69   THR L O   1 
ATOM   508  C CB  . THR A 1 69  ? 26.452  13.456 71.245 1.00 23.91  ? 69   THR L CB  1 
ATOM   509  O OG1 . THR A 1 69  ? 25.726  12.869 72.333 1.00 23.04  ? 69   THR L OG1 1 
ATOM   510  C CG2 . THR A 1 69  ? 26.925  12.356 70.305 1.00 23.54  ? 69   THR L CG2 1 
ATOM   511  N N   . GLN A 1 70  ? 27.330  15.516 73.872 1.00 20.32  ? 70   GLN L N   1 
ATOM   512  C CA  . GLN A 1 70  ? 26.785  16.623 74.644 1.00 21.06  ? 70   GLN L CA  1 
ATOM   513  C C   . GLN A 1 70  ? 27.851  17.494 75.277 1.00 18.87  ? 70   GLN L C   1 
ATOM   514  O O   . GLN A 1 70  ? 28.730  17.027 76.001 1.00 17.40  ? 70   GLN L O   1 
ATOM   515  C CB  . GLN A 1 70  ? 25.806  16.102 75.696 1.00 51.99  ? 70   GLN L CB  1 
ATOM   516  C CG  . GLN A 1 70  ? 24.539  15.547 75.068 1.00 58.78  ? 70   GLN L CG  1 
ATOM   517  C CD  . GLN A 1 70  ? 23.572  14.993 76.084 1.00 64.36  ? 70   GLN L CD  1 
ATOM   518  O OE1 . GLN A 1 70  ? 23.924  14.121 76.879 1.00 67.15  ? 70   GLN L OE1 1 
ATOM   519  N NE2 . GLN A 1 70  ? 22.338  15.488 76.059 1.00 64.72  ? 70   GLN L NE2 1 
ATOM   520  N N   . TYR A 1 71  ? 27.751  18.778 74.979 1.00 18.72  ? 71   TYR L N   1 
ATOM   521  C CA  . TYR A 1 71  ? 28.698  19.754 75.457 1.00 18.34  ? 71   TYR L CA  1 
ATOM   522  C C   . TYR A 1 71  ? 27.972  21.015 75.899 1.00 18.67  ? 71   TYR L C   1 
ATOM   523  O O   . TYR A 1 71  ? 26.793  21.218 75.597 1.00 18.12  ? 71   TYR L O   1 
ATOM   524  C CB  . TYR A 1 71  ? 29.678  20.101 74.332 1.00 18.34  ? 71   TYR L CB  1 
ATOM   525  C CG  . TYR A 1 71  ? 30.402  18.907 73.758 1.00 15.45  ? 71   TYR L CG  1 
ATOM   526  C CD1 . TYR A 1 71  ? 29.795  18.078 72.813 1.00 15.03  ? 71   TYR L CD1 1 
ATOM   527  C CD2 . TYR A 1 71  ? 31.685  18.583 74.194 1.00 17.03  ? 71   TYR L CD2 1 
ATOM   528  C CE1 . TYR A 1 71  ? 30.455  16.947 72.320 1.00 17.31  ? 71   TYR L CE1 1 
ATOM   529  C CE2 . TYR A 1 71  ? 32.354  17.462 73.715 1.00 16.54  ? 71   TYR L CE2 1 
ATOM   530  C CZ  . TYR A 1 71  ? 31.737  16.648 72.780 1.00 18.98  ? 71   TYR L CZ  1 
ATOM   531  O OH  . TYR A 1 71  ? 32.407  15.546 72.306 1.00 19.87  ? 71   TYR L OH  1 
ATOM   532  N N   . SER A 1 72  ? 28.680  21.866 76.622 1.00 16.81  ? 72   SER L N   1 
ATOM   533  C CA  . SER A 1 72  ? 28.080  23.106 77.060 1.00 17.72  ? 72   SER L CA  1 
ATOM   534  C C   . SER A 1 72  ? 29.138  24.115 77.448 1.00 17.53  ? 72   SER L C   1 
ATOM   535  O O   . SER A 1 72  ? 30.252  23.758 77.822 1.00 17.36  ? 72   SER L O   1 
ATOM   536  C CB  . SER A 1 72  ? 27.114  22.854 78.221 1.00 22.28  ? 72   SER L CB  1 
ATOM   537  O OG  . SER A 1 72  ? 27.751  22.183 79.282 1.00 22.24  ? 72   SER L OG  1 
ATOM   538  N N   . LEU A 1 73  ? 28.784  25.384 77.309 1.00 21.23  ? 73   LEU L N   1 
ATOM   539  C CA  . LEU A 1 73  ? 29.669  26.479 77.656 1.00 20.12  ? 73   LEU L CA  1 
ATOM   540  C C   . LEU A 1 73  ? 29.035  27.131 78.866 1.00 19.84  ? 73   LEU L C   1 
ATOM   541  O O   . LEU A 1 73  ? 27.851  27.462 78.847 1.00 20.90  ? 73   LEU L O   1 
ATOM   542  C CB  . LEU A 1 73  ? 29.749  27.492 76.511 1.00 13.90  ? 73   LEU L CB  1 
ATOM   543  C CG  . LEU A 1 73  ? 30.563  28.757 76.798 1.00 13.39  ? 73   LEU L CG  1 
ATOM   544  C CD1 . LEU A 1 73  ? 32.062  28.442 76.762 1.00 12.59  ? 73   LEU L CD1 1 
ATOM   545  C CD2 . LEU A 1 73  ? 30.229  29.817 75.761 1.00 14.41  ? 73   LEU L CD2 1 
ATOM   546  N N   . LYS A 1 74  ? 29.814  27.294 79.925 1.00 17.41  ? 74   LYS L N   1 
ATOM   547  C CA  . LYS A 1 74  ? 29.305  27.923 81.133 1.00 17.19  ? 74   LYS L CA  1 
ATOM   548  C C   . LYS A 1 74  ? 29.964  29.285 81.297 1.00 16.30  ? 74   LYS L C   1 
ATOM   549  O O   . LYS A 1 74  ? 31.176  29.409 81.125 1.00 16.35  ? 74   LYS L O   1 
ATOM   550  C CB  . LYS A 1 74  ? 29.607  27.050 82.353 1.00 25.82  ? 74   LYS L CB  1 
ATOM   551  C CG  . LYS A 1 74  ? 29.038  27.600 83.654 1.00 32.08  ? 74   LYS L CG  1 
ATOM   552  C CD  . LYS A 1 74  ? 29.369  26.706 84.833 1.00 36.41  ? 74   LYS L CD  1 
ATOM   553  C CE  . LYS A 1 74  ? 28.739  27.236 86.108 1.00 40.70  ? 74   LYS L CE  1 
ATOM   554  N NZ  . LYS A 1 74  ? 29.176  26.459 87.301 1.00 43.85  ? 74   LYS L NZ  1 
ATOM   555  N N   . ILE A 1 75  ? 29.160  30.307 81.594 1.00 13.04  ? 75   ILE L N   1 
ATOM   556  C CA  . ILE A 1 75  ? 29.676  31.652 81.814 1.00 13.05  ? 75   ILE L CA  1 
ATOM   557  C C   . ILE A 1 75  ? 29.165  32.126 83.179 1.00 14.26  ? 75   ILE L C   1 
ATOM   558  O O   . ILE A 1 75  ? 27.975  32.390 83.350 1.00 13.49  ? 75   ILE L O   1 
ATOM   559  C CB  . ILE A 1 75  ? 29.192  32.662 80.737 1.00 11.54  ? 75   ILE L CB  1 
ATOM   560  C CG1 . ILE A 1 75  ? 29.378  32.084 79.337 1.00 10.83  ? 75   ILE L CG1 1 
ATOM   561  C CG2 . ILE A 1 75  ? 30.004  33.960 80.846 1.00 12.01  ? 75   ILE L CG2 1 
ATOM   562  C CD1 . ILE A 1 75  ? 28.834  32.973 78.220 1.00 12.16  ? 75   ILE L CD1 1 
ATOM   563  N N   . ASN A 1 76  ? 30.052  32.231 84.159 1.00 18.42  ? 76   ASN L N   1 
ATOM   564  C CA  . ASN A 1 76  ? 29.608  32.679 85.470 1.00 20.78  ? 76   ASN L CA  1 
ATOM   565  C C   . ASN A 1 76  ? 30.020  34.119 85.734 1.00 18.91  ? 76   ASN L C   1 
ATOM   566  O O   . ASN A 1 76  ? 31.003  34.609 85.182 1.00 19.65  ? 76   ASN L O   1 
ATOM   567  C CB  . ASN A 1 76  ? 30.159  31.761 86.562 1.00 26.58  ? 76   ASN L CB  1 
ATOM   568  C CG  . ASN A 1 76  ? 31.649  31.909 86.747 1.00 30.90  ? 76   ASN L CG  1 
ATOM   569  O OD1 . ASN A 1 76  ? 32.130  32.948 87.205 1.00 31.17  ? 76   ASN L OD1 1 
ATOM   570  N ND2 . ASN A 1 76  ? 32.394  30.873 86.387 1.00 32.04  ? 76   ASN L ND2 1 
ATOM   571  N N   . SER A 1 77  ? 29.246  34.790 86.578 1.00 19.92  ? 77   SER L N   1 
ATOM   572  C CA  . SER A 1 77  ? 29.511  36.175 86.943 1.00 19.51  ? 77   SER L CA  1 
ATOM   573  C C   . SER A 1 77  ? 29.687  37.011 85.681 1.00 16.85  ? 77   SER L C   1 
ATOM   574  O O   . SER A 1 77  ? 30.750  37.581 85.443 1.00 15.60  ? 77   SER L O   1 
ATOM   575  C CB  . SER A 1 77  ? 30.773  36.245 87.795 1.00 20.38  ? 77   SER L CB  1 
ATOM   576  O OG  . SER A 1 77  ? 30.811  35.154 88.692 1.00 24.81  ? 77   SER L OG  1 
ATOM   577  N N   . LEU A 1 78  ? 28.632  37.077 84.878 1.00 14.36  ? 78   LEU L N   1 
ATOM   578  C CA  . LEU A 1 78  ? 28.650  37.827 83.632 1.00 12.82  ? 78   LEU L CA  1 
ATOM   579  C C   . LEU A 1 78  ? 29.154  39.262 83.754 1.00 12.79  ? 78   LEU L C   1 
ATOM   580  O O   . LEU A 1 78  ? 28.867  39.970 84.726 1.00 11.17  ? 78   LEU L O   1 
ATOM   581  C CB  . LEU A 1 78  ? 27.252  37.831 83.018 1.00 11.27  ? 78   LEU L CB  1 
ATOM   582  C CG  . LEU A 1 78  ? 26.799  36.500 82.412 1.00 12.00  ? 78   LEU L CG  1 
ATOM   583  C CD1 . LEU A 1 78  ? 25.271  36.473 82.295 1.00 11.65  ? 78   LEU L CD1 1 
ATOM   584  C CD2 . LEU A 1 78  ? 27.451  36.320 81.039 1.00 10.76  ? 78   LEU L CD2 1 
ATOM   585  N N   . GLN A 1 79  ? 29.921  39.672 82.750 1.00 14.85  ? 79   GLN L N   1 
ATOM   586  C CA  . GLN A 1 79  ? 30.467  41.020 82.665 1.00 13.87  ? 79   GLN L CA  1 
ATOM   587  C C   . GLN A 1 79  ? 29.718  41.677 81.494 1.00 14.74  ? 79   GLN L C   1 
ATOM   588  O O   . GLN A 1 79  ? 29.182  40.976 80.624 1.00 13.55  ? 79   GLN L O   1 
ATOM   589  C CB  . GLN A 1 79  ? 31.972  40.966 82.362 1.00 10.95  ? 79   GLN L CB  1 
ATOM   590  C CG  . GLN A 1 79  ? 32.868  40.649 83.551 1.00 12.63  ? 79   GLN L CG  1 
ATOM   591  C CD  . GLN A 1 79  ? 32.942  41.792 84.552 1.00 13.92  ? 79   GLN L CD  1 
ATOM   592  O OE1 . GLN A 1 79  ? 32.993  42.965 84.173 1.00 12.14  ? 79   GLN L OE1 1 
ATOM   593  N NE2 . GLN A 1 79  ? 32.970  41.454 85.837 1.00 14.50  ? 79   GLN L NE2 1 
ATOM   594  N N   . PRO A 1 80  ? 29.661  43.021 81.455 1.00 9.45   ? 80   PRO L N   1 
ATOM   595  C CA  . PRO A 1 80  ? 28.941  43.632 80.334 1.00 11.10  ? 80   PRO L CA  1 
ATOM   596  C C   . PRO A 1 80  ? 29.435  43.254 78.937 1.00 11.30  ? 80   PRO L C   1 
ATOM   597  O O   . PRO A 1 80  ? 28.645  43.221 78.006 1.00 11.70  ? 80   PRO L O   1 
ATOM   598  C CB  . PRO A 1 80  ? 29.021  45.146 80.615 1.00 8.66   ? 80   PRO L CB  1 
ATOM   599  C CG  . PRO A 1 80  ? 30.004  45.300 81.725 1.00 12.37  ? 80   PRO L CG  1 
ATOM   600  C CD  . PRO A 1 80  ? 29.985  44.010 82.497 1.00 11.14  ? 80   PRO L CD  1 
ATOM   601  N N   . GLU A 1 81  ? 30.723  42.951 78.784 1.00 13.17  ? 81   GLU L N   1 
ATOM   602  C CA  . GLU A 1 81  ? 31.230  42.580 77.458 1.00 15.54  ? 81   GLU L CA  1 
ATOM   603  C C   . GLU A 1 81  ? 30.867  41.137 77.075 1.00 14.99  ? 81   GLU L C   1 
ATOM   604  O O   . GLU A 1 81  ? 31.165  40.691 75.975 1.00 14.81  ? 81   GLU L O   1 
ATOM   605  C CB  . GLU A 1 81  ? 32.755  42.755 77.380 1.00 13.89  ? 81   GLU L CB  1 
ATOM   606  C CG  . GLU A 1 81  ? 33.533  41.923 78.398 1.00 19.18  ? 81   GLU L CG  1 
ATOM   607  C CD  . GLU A 1 81  ? 33.710  42.644 79.723 1.00 20.78  ? 81   GLU L CD  1 
ATOM   608  O OE1 . GLU A 1 81  ? 32.837  43.462 80.081 1.00 22.98  ? 81   GLU L OE1 1 
ATOM   609  O OE2 . GLU A 1 81  ? 34.717  42.381 80.413 1.00 23.04  ? 81   GLU L OE2 1 
ATOM   610  N N   . ASP A 1 82  ? 30.223  40.413 77.984 1.00 14.48  ? 82   ASP L N   1 
ATOM   611  C CA  . ASP A 1 82  ? 29.843  39.035 77.714 1.00 15.02  ? 82   ASP L CA  1 
ATOM   612  C C   . ASP A 1 82  ? 28.547  38.927 76.914 1.00 15.98  ? 82   ASP L C   1 
ATOM   613  O O   . ASP A 1 82  ? 28.220  37.858 76.394 1.00 16.87  ? 82   ASP L O   1 
ATOM   614  C CB  . ASP A 1 82  ? 29.689  38.259 79.025 1.00 14.50  ? 82   ASP L CB  1 
ATOM   615  C CG  . ASP A 1 82  ? 30.999  38.120 79.782 1.00 13.83  ? 82   ASP L CG  1 
ATOM   616  O OD1 . ASP A 1 82  ? 30.965  37.708 80.960 1.00 16.27  ? 82   ASP L OD1 1 
ATOM   617  O OD2 . ASP A 1 82  ? 32.059  38.415 79.199 1.00 11.98  ? 82   ASP L OD2 1 
ATOM   618  N N   . PHE A 1 83  ? 27.805  40.020 76.798 1.00 14.71  ? 83   PHE L N   1 
ATOM   619  C CA  . PHE A 1 83  ? 26.561  39.936 76.057 1.00 15.69  ? 83   PHE L CA  1 
ATOM   620  C C   . PHE A 1 83  ? 26.763  40.028 74.555 1.00 16.14  ? 83   PHE L C   1 
ATOM   621  O O   . PHE A 1 83  ? 27.514  40.864 74.046 1.00 16.05  ? 83   PHE L O   1 
ATOM   622  C CB  . PHE A 1 83  ? 25.557  40.973 76.577 1.00 14.44  ? 83   PHE L CB  1 
ATOM   623  C CG  . PHE A 1 83  ? 25.143  40.720 78.005 1.00 14.54  ? 83   PHE L CG  1 
ATOM   624  C CD1 . PHE A 1 83  ? 25.886  41.238 79.061 1.00 15.74  ? 83   PHE L CD1 1 
ATOM   625  C CD2 . PHE A 1 83  ? 24.078  39.880 78.293 1.00 11.73  ? 83   PHE L CD2 1 
ATOM   626  C CE1 . PHE A 1 83  ? 25.578  40.913 80.383 1.00 14.03  ? 83   PHE L CE1 1 
ATOM   627  C CE2 . PHE A 1 83  ? 23.761  39.546 79.616 1.00 12.67  ? 83   PHE L CE2 1 
ATOM   628  C CZ  . PHE A 1 83  ? 24.514  40.062 80.660 1.00 13.71  ? 83   PHE L CZ  1 
ATOM   629  N N   . GLY A 1 84  ? 26.102  39.114 73.858 1.00 15.22  ? 84   GLY L N   1 
ATOM   630  C CA  . GLY A 1 84  ? 26.191  39.039 72.416 1.00 13.94  ? 84   GLY L CA  1 
ATOM   631  C C   . GLY A 1 84  ? 25.698  37.672 71.996 1.00 13.01  ? 84   GLY L C   1 
ATOM   632  O O   . GLY A 1 84  ? 24.865  37.073 72.679 1.00 12.37  ? 84   GLY L O   1 
ATOM   633  N N   . THR A 1 85  ? 26.220  37.163 70.887 1.00 15.01  ? 85   THR L N   1 
ATOM   634  C CA  . THR A 1 85  ? 25.800  35.863 70.391 1.00 16.01  ? 85   THR L CA  1 
ATOM   635  C C   . THR A 1 85  ? 26.914  34.835 70.488 1.00 16.84  ? 85   THR L C   1 
ATOM   636  O O   . THR A 1 85  ? 28.088  35.154 70.275 1.00 18.48  ? 85   THR L O   1 
ATOM   637  C CB  . THR A 1 85  ? 25.326  35.965 68.928 1.00 16.65  ? 85   THR L CB  1 
ATOM   638  O OG1 . THR A 1 85  ? 24.276  36.932 68.846 1.00 18.23  ? 85   THR L OG1 1 
ATOM   639  C CG2 . THR A 1 85  ? 24.811  34.620 68.428 1.00 16.80  ? 85   THR L CG2 1 
ATOM   640  N N   . TYR A 1 86  ? 26.527  33.605 70.818 1.00 13.23  ? 86   TYR L N   1 
ATOM   641  C CA  . TYR A 1 86  ? 27.451  32.490 70.965 1.00 12.75  ? 86   TYR L CA  1 
ATOM   642  C C   . TYR A 1 86  ? 27.141  31.374 69.974 1.00 13.21  ? 86   TYR L C   1 
ATOM   643  O O   . TYR A 1 86  ? 25.980  31.127 69.650 1.00 13.03  ? 86   TYR L O   1 
ATOM   644  C CB  . TYR A 1 86  ? 27.370  31.930 72.392 1.00 16.00  ? 86   TYR L CB  1 
ATOM   645  C CG  . TYR A 1 86  ? 27.920  32.879 73.420 1.00 15.47  ? 86   TYR L CG  1 
ATOM   646  C CD1 . TYR A 1 86  ? 27.145  33.919 73.924 1.00 14.31  ? 86   TYR L CD1 1 
ATOM   647  C CD2 . TYR A 1 86  ? 29.257  32.799 73.812 1.00 15.38  ? 86   TYR L CD2 1 
ATOM   648  C CE1 . TYR A 1 86  ? 27.691  34.866 74.793 1.00 15.68  ? 86   TYR L CE1 1 
ATOM   649  C CE2 . TYR A 1 86  ? 29.814  33.734 74.665 1.00 14.79  ? 86   TYR L CE2 1 
ATOM   650  C CZ  . TYR A 1 86  ? 29.033  34.765 75.151 1.00 14.94  ? 86   TYR L CZ  1 
ATOM   651  O OH  . TYR A 1 86  ? 29.610  35.709 75.957 1.00 12.56  ? 86   TYR L OH  1 
ATOM   652  N N   . TYR A 1 87  ? 28.179  30.701 69.492 1.00 14.54  ? 87   TYR L N   1 
ATOM   653  C CA  . TYR A 1 87  ? 28.001  29.593 68.555 1.00 15.34  ? 87   TYR L CA  1 
ATOM   654  C C   . TYR A 1 87  ? 28.964  28.474 68.878 1.00 16.78  ? 87   TYR L C   1 
ATOM   655  O O   . TYR A 1 87  ? 30.108  28.719 69.229 1.00 17.69  ? 87   TYR L O   1 
ATOM   656  C CB  . TYR A 1 87  ? 28.312  30.009 67.112 1.00 14.62  ? 87   TYR L CB  1 
ATOM   657  C CG  . TYR A 1 87  ? 27.435  31.084 66.520 1.00 13.13  ? 87   TYR L CG  1 
ATOM   658  C CD1 . TYR A 1 87  ? 27.773  32.433 66.643 1.00 10.67  ? 87   TYR L CD1 1 
ATOM   659  C CD2 . TYR A 1 87  ? 26.287  30.749 65.802 1.00 11.20  ? 87   TYR L CD2 1 
ATOM   660  C CE1 . TYR A 1 87  ? 26.982  33.430 66.054 1.00 14.60  ? 87   TYR L CE1 1 
ATOM   661  C CE2 . TYR A 1 87  ? 25.489  31.730 65.213 1.00 13.73  ? 87   TYR L CE2 1 
ATOM   662  C CZ  . TYR A 1 87  ? 25.838  33.067 65.340 1.00 13.48  ? 87   TYR L CZ  1 
ATOM   663  O OH  . TYR A 1 87  ? 25.041  34.028 64.754 1.00 14.57  ? 87   TYR L OH  1 
ATOM   664  N N   . CYS A 1 88  ? 28.506  27.236 68.758 1.00 15.58  ? 88   CYS L N   1 
ATOM   665  C CA  . CYS A 1 88  ? 29.403  26.118 68.949 1.00 16.94  ? 88   CYS L CA  1 
ATOM   666  C C   . CYS A 1 88  ? 29.728  25.688 67.527 1.00 18.71  ? 88   CYS L C   1 
ATOM   667  O O   . CYS A 1 88  ? 28.930  25.937 66.619 1.00 18.69  ? 88   CYS L O   1 
ATOM   668  C CB  . CYS A 1 88  ? 28.747  24.974 69.724 1.00 17.89  ? 88   CYS L CB  1 
ATOM   669  S SG  . CYS A 1 88  ? 27.328  24.181 68.970 1.00 17.71  ? 88   CYS L SG  1 
ATOM   670  N N   . HIS A 1 89  ? 30.866  25.015 67.346 1.00 15.61  ? 89   HIS L N   1 
ATOM   671  C CA  . HIS A 1 89  ? 31.319  24.579 66.028 1.00 15.79  ? 89   HIS L CA  1 
ATOM   672  C C   . HIS A 1 89  ? 32.098  23.268 66.152 1.00 15.06  ? 89   HIS L C   1 
ATOM   673  O O   . HIS A 1 89  ? 33.177  23.290 66.739 1.00 14.27  ? 89   HIS L O   1 
ATOM   674  C CB  . HIS A 1 89  ? 32.247  25.655 65.469 1.00 14.46  ? 89   HIS L CB  1 
ATOM   675  C CG  . HIS A 1 89  ? 32.659  25.430 64.046 1.00 14.98  ? 89   HIS L CG  1 
ATOM   676  N ND1 . HIS A 1 89  ? 33.865  25.866 63.538 1.00 15.69  ? 89   HIS L ND1 1 
ATOM   677  C CD2 . HIS A 1 89  ? 31.994  24.869 63.006 1.00 15.32  ? 89   HIS L CD2 1 
ATOM   678  C CE1 . HIS A 1 89  ? 33.925  25.584 62.246 1.00 15.07  ? 89   HIS L CE1 1 
ATOM   679  N NE2 . HIS A 1 89  ? 32.804  24.981 61.900 1.00 16.71  ? 89   HIS L NE2 1 
ATOM   680  N N   . HIS A 1 90  ? 31.585  22.144 65.634 1.00 15.57  ? 90   HIS L N   1 
ATOM   681  C CA  . HIS A 1 90  ? 32.326  20.883 65.745 1.00 16.46  ? 90   HIS L CA  1 
ATOM   682  C C   . HIS A 1 90  ? 33.259  20.770 64.542 1.00 17.16  ? 90   HIS L C   1 
ATOM   683  O O   . HIS A 1 90  ? 33.033  21.389 63.493 1.00 15.29  ? 90   HIS L O   1 
ATOM   684  C CB  . HIS A 1 90  ? 31.374  19.679 65.800 1.00 22.18  ? 90   HIS L CB  1 
ATOM   685  C CG  . HIS A 1 90  ? 31.189  18.981 64.485 1.00 22.87  ? 90   HIS L CG  1 
ATOM   686  N ND1 . HIS A 1 90  ? 30.124  19.238 63.657 1.00 24.45  ? 90   HIS L ND1 1 
ATOM   687  C CD2 . HIS A 1 90  ? 31.899  17.985 63.895 1.00 24.30  ? 90   HIS L CD2 1 
ATOM   688  C CE1 . HIS A 1 90  ? 30.174  18.424 62.610 1.00 24.38  ? 90   HIS L CE1 1 
ATOM   689  N NE2 . HIS A 1 90  ? 31.236  17.659 62.732 1.00 25.75  ? 90   HIS L NE2 1 
ATOM   690  N N   . PHE A 1 91  ? 34.348  20.036 64.722 1.00 17.97  ? 91   PHE L N   1 
ATOM   691  C CA  . PHE A 1 91  ? 35.289  19.842 63.642 1.00 19.03  ? 91   PHE L CA  1 
ATOM   692  C C   . PHE A 1 91  ? 35.848  18.441 63.654 1.00 19.88  ? 91   PHE L C   1 
ATOM   693  O O   . PHE A 1 91  ? 37.029  18.227 63.404 1.00 19.81  ? 91   PHE L O   1 
ATOM   694  C CB  . PHE A 1 91  ? 36.439  20.877 63.657 1.00 18.75  ? 91   PHE L CB  1 
ATOM   695  C CG  . PHE A 1 91  ? 37.074  21.096 64.996 1.00 19.81  ? 91   PHE L CG  1 
ATOM   696  C CD1 . PHE A 1 91  ? 36.473  21.940 65.927 1.00 18.88  ? 91   PHE L CD1 1 
ATOM   697  C CD2 . PHE A 1 91  ? 38.282  20.485 65.322 1.00 18.97  ? 91   PHE L CD2 1 
ATOM   698  C CE1 . PHE A 1 91  ? 37.061  22.174 67.160 1.00 16.67  ? 91   PHE L CE1 1 
ATOM   699  C CE2 . PHE A 1 91  ? 38.880  20.710 66.558 1.00 19.41  ? 91   PHE L CE2 1 
ATOM   700  C CZ  . PHE A 1 91  ? 38.272  21.555 67.479 1.00 19.14  ? 91   PHE L CZ  1 
ATOM   701  N N   . TRP A 1 92  ? 34.982  17.481 63.946 1.00 24.06  ? 92   TRP L N   1 
ATOM   702  C CA  . TRP A 1 92  ? 35.376  16.077 63.972 1.00 25.93  ? 92   TRP L CA  1 
ATOM   703  C C   . TRP A 1 92  ? 35.417  15.484 62.561 1.00 26.40  ? 92   TRP L C   1 
ATOM   704  O O   . TRP A 1 92  ? 36.319  14.720 62.223 1.00 27.11  ? 92   TRP L O   1 
ATOM   705  C CB  . TRP A 1 92  ? 34.396  15.274 64.820 1.00 28.18  ? 92   TRP L CB  1 
ATOM   706  C CG  . TRP A 1 92  ? 34.482  13.810 64.577 1.00 31.56  ? 92   TRP L CG  1 
ATOM   707  C CD1 . TRP A 1 92  ? 33.573  13.032 63.915 1.00 32.01  ? 92   TRP L CD1 1 
ATOM   708  C CD2 . TRP A 1 92  ? 35.551  12.943 64.958 1.00 33.17  ? 92   TRP L CD2 1 
ATOM   709  N NE1 . TRP A 1 92  ? 34.011  11.730 63.862 1.00 30.12  ? 92   TRP L NE1 1 
ATOM   710  C CE2 . TRP A 1 92  ? 35.224  11.647 64.495 1.00 33.02  ? 92   TRP L CE2 1 
ATOM   711  C CE3 . TRP A 1 92  ? 36.756  13.132 65.647 1.00 33.90  ? 92   TRP L CE3 1 
ATOM   712  C CZ2 . TRP A 1 92  ? 36.061  10.548 64.697 1.00 32.13  ? 92   TRP L CZ2 1 
ATOM   713  C CZ3 . TRP A 1 92  ? 37.590  12.036 65.848 1.00 34.70  ? 92   TRP L CZ3 1 
ATOM   714  C CH2 . TRP A 1 92  ? 37.237  10.761 65.373 1.00 33.87  ? 92   TRP L CH2 1 
ATOM   715  N N   . SER A 1 93  ? 34.429  15.836 61.746 1.00 22.39  ? 93   SER L N   1 
ATOM   716  C CA  . SER A 1 93  ? 34.352  15.333 60.385 1.00 23.39  ? 93   SER L CA  1 
ATOM   717  C C   . SER A 1 93  ? 33.647  16.367 59.529 1.00 22.58  ? 93   SER L C   1 
ATOM   718  O O   . SER A 1 93  ? 32.796  17.109 60.015 1.00 22.26  ? 93   SER L O   1 
ATOM   719  C CB  . SER A 1 93  ? 33.559  14.026 60.349 1.00 22.77  ? 93   SER L CB  1 
ATOM   720  O OG  . SER A 1 93  ? 32.193  14.263 60.660 1.00 23.12  ? 93   SER L OG  1 
ATOM   721  N N   . THR A 1 94  ? 33.996  16.414 58.252 1.00 21.77  ? 94   THR L N   1 
ATOM   722  C CA  . THR A 1 94  ? 33.369  17.367 57.358 1.00 23.00  ? 94   THR L CA  1 
ATOM   723  C C   . THR A 1 94  ? 31.930  16.942 57.123 1.00 21.43  ? 94   THR L C   1 
ATOM   724  O O   . THR A 1 94  ? 31.644  15.760 56.975 1.00 23.04  ? 94   THR L O   1 
ATOM   725  C CB  . THR A 1 94  ? 34.109  17.435 56.015 1.00 39.67  ? 94   THR L CB  1 
ATOM   726  O OG1 . THR A 1 94  ? 35.463  17.850 56.243 1.00 43.70  ? 94   THR L OG1 1 
ATOM   727  C CG2 . THR A 1 94  ? 33.429  18.432 55.081 1.00 39.90  ? 94   THR L CG2 1 
ATOM   728  N N   . PRO A 1 95  ? 31.001  17.907 57.095 1.00 22.11  ? 95   PRO L N   1 
ATOM   729  C CA  . PRO A 1 95  ? 31.290  19.333 57.273 1.00 21.54  ? 95   PRO L CA  1 
ATOM   730  C C   . PRO A 1 95  ? 31.360  19.749 58.742 1.00 21.62  ? 95   PRO L C   1 
ATOM   731  O O   . PRO A 1 95  ? 30.638  19.211 59.584 1.00 20.08  ? 95   PRO L O   1 
ATOM   732  C CB  . PRO A 1 95  ? 30.129  19.997 56.548 1.00 15.81  ? 95   PRO L CB  1 
ATOM   733  C CG  . PRO A 1 95  ? 28.983  19.090 56.914 1.00 14.24  ? 95   PRO L CG  1 
ATOM   734  C CD  . PRO A 1 95  ? 29.587  17.702 56.726 1.00 16.76  ? 95   PRO L CD  1 
ATOM   735  N N   . TRP A 1 96  ? 32.246  20.700 59.036 1.00 22.38  ? 96   TRP L N   1 
ATOM   736  C CA  . TRP A 1 96  ? 32.408  21.231 60.389 1.00 20.01  ? 96   TRP L CA  1 
ATOM   737  C C   . TRP A 1 96  ? 31.236  22.190 60.577 1.00 19.35  ? 96   TRP L C   1 
ATOM   738  O O   . TRP A 1 96  ? 31.353  23.375 60.275 1.00 18.09  ? 96   TRP L O   1 
ATOM   739  C CB  . TRP A 1 96  ? 33.722  22.009 60.505 1.00 20.11  ? 96   TRP L CB  1 
ATOM   740  C CG  . TRP A 1 96  ? 34.943  21.223 60.132 1.00 20.79  ? 96   TRP L CG  1 
ATOM   741  C CD1 . TRP A 1 96  ? 35.016  19.878 59.904 1.00 22.15  ? 96   TRP L CD1 1 
ATOM   742  C CD2 . TRP A 1 96  ? 36.278  21.726 59.989 1.00 21.87  ? 96   TRP L CD2 1 
ATOM   743  N NE1 . TRP A 1 96  ? 36.312  19.511 59.631 1.00 22.76  ? 96   TRP L NE1 1 
ATOM   744  C CE2 . TRP A 1 96  ? 37.109  20.624 59.677 1.00 23.73  ? 96   TRP L CE2 1 
ATOM   745  C CE3 . TRP A 1 96  ? 36.856  23.000 60.098 1.00 21.96  ? 96   TRP L CE3 1 
ATOM   746  C CZ2 . TRP A 1 96  ? 38.490  20.757 59.469 1.00 23.77  ? 96   TRP L CZ2 1 
ATOM   747  C CZ3 . TRP A 1 96  ? 38.232  23.132 59.892 1.00 21.49  ? 96   TRP L CZ3 1 
ATOM   748  C CH2 . TRP A 1 96  ? 39.031  22.014 59.582 1.00 21.75  ? 96   TRP L CH2 1 
ATOM   749  N N   . THR A 1 97  ? 30.117  21.672 61.079 1.00 12.33  ? 97   THR L N   1 
ATOM   750  C CA  . THR A 1 97  ? 28.908  22.471 61.248 1.00 13.09  ? 97   THR L CA  1 
ATOM   751  C C   . THR A 1 97  ? 28.821  23.304 62.521 1.00 14.15  ? 97   THR L C   1 
ATOM   752  O O   . THR A 1 97  ? 29.359  22.937 63.574 1.00 14.65  ? 97   THR L O   1 
ATOM   753  C CB  . THR A 1 97  ? 27.650  21.578 61.184 1.00 21.89  ? 97   THR L CB  1 
ATOM   754  O OG1 . THR A 1 97  ? 27.672  20.647 62.273 1.00 22.42  ? 97   THR L OG1 1 
ATOM   755  C CG2 . THR A 1 97  ? 27.605  20.803 59.866 1.00 20.87  ? 97   THR L CG2 1 
ATOM   756  N N   . PHE A 1 98  ? 28.131  24.434 62.409 1.00 20.79  ? 98   PHE L N   1 
ATOM   757  C CA  . PHE A 1 98  ? 27.934  25.344 63.530 1.00 19.50  ? 98   PHE L CA  1 
ATOM   758  C C   . PHE A 1 98  ? 26.581  25.077 64.175 1.00 20.23  ? 98   PHE L C   1 
ATOM   759  O O   . PHE A 1 98  ? 25.677  24.511 63.545 1.00 18.91  ? 98   PHE L O   1 
ATOM   760  C CB  . PHE A 1 98  ? 27.928  26.804 63.069 1.00 15.72  ? 98   PHE L CB  1 
ATOM   761  C CG  . PHE A 1 98  ? 29.280  27.349 62.694 1.00 19.46  ? 98   PHE L CG  1 
ATOM   762  C CD1 . PHE A 1 98  ? 29.751  27.251 61.386 1.00 18.62  ? 98   PHE L CD1 1 
ATOM   763  C CD2 . PHE A 1 98  ? 30.070  27.999 63.646 1.00 17.86  ? 98   PHE L CD2 1 
ATOM   764  C CE1 . PHE A 1 98  ? 30.984  27.796 61.031 1.00 18.70  ? 98   PHE L CE1 1 
ATOM   765  C CE2 . PHE A 1 98  ? 31.304  28.545 63.300 1.00 18.71  ? 98   PHE L CE2 1 
ATOM   766  C CZ  . PHE A 1 98  ? 31.762  28.445 61.992 1.00 18.94  ? 98   PHE L CZ  1 
ATOM   767  N N   . GLY A 1 99  ? 26.450  25.486 65.434 1.00 14.17  ? 99   GLY L N   1 
ATOM   768  C CA  . GLY A 1 99  ? 25.175  25.356 66.105 1.00 12.44  ? 99   GLY L CA  1 
ATOM   769  C C   . GLY A 1 99  ? 24.410  26.563 65.596 1.00 13.00  ? 99   GLY L C   1 
ATOM   770  O O   . GLY A 1 99  ? 25.022  27.466 65.022 1.00 11.78  ? 99   GLY L O   1 
ATOM   771  N N   . GLY A 1 100 ? 23.094  26.599 65.783 1.00 17.83  ? 100  GLY L N   1 
ATOM   772  C CA  . GLY A 1 100 ? 22.314  27.732 65.299 1.00 15.30  ? 100  GLY L CA  1 
ATOM   773  C C   . GLY A 1 100 ? 22.584  29.031 66.044 1.00 18.16  ? 100  GLY L C   1 
ATOM   774  O O   . GLY A 1 100 ? 22.170  30.104 65.601 1.00 18.59  ? 100  GLY L O   1 
ATOM   775  N N   . GLY A 1 101 ? 23.265  28.937 67.184 1.00 17.58  ? 101  GLY L N   1 
ATOM   776  C CA  . GLY A 1 101 ? 23.586  30.126 67.954 1.00 18.64  ? 101  GLY L CA  1 
ATOM   777  C C   . GLY A 1 101 ? 22.668  30.454 69.120 1.00 18.81  ? 101  GLY L C   1 
ATOM   778  O O   . GLY A 1 101 ? 21.512  30.038 69.154 1.00 20.68  ? 101  GLY L O   1 
ATOM   779  N N   . THR A 1 102 ? 23.199  31.209 70.081 1.00 15.67  ? 102  THR L N   1 
ATOM   780  C CA  . THR A 1 102 ? 22.450  31.633 71.259 1.00 14.35  ? 102  THR L CA  1 
ATOM   781  C C   . THR A 1 102 ? 22.625  33.133 71.434 1.00 16.20  ? 102  THR L C   1 
ATOM   782  O O   . THR A 1 102 ? 23.753  33.632 71.509 1.00 15.65  ? 102  THR L O   1 
ATOM   783  C CB  . THR A 1 102 ? 22.955  30.951 72.548 1.00 15.94  ? 102  THR L CB  1 
ATOM   784  O OG1 . THR A 1 102 ? 22.780  29.533 72.442 1.00 15.71  ? 102  THR L OG1 1 
ATOM   785  C CG2 . THR A 1 102 ? 22.189  31.477 73.766 1.00 11.03  ? 102  THR L CG2 1 
ATOM   786  N N   . LYS A 1 103 ? 21.512  33.856 71.501 1.00 14.97  ? 103  LYS L N   1 
ATOM   787  C CA  . LYS A 1 103 ? 21.574  35.297 71.678 1.00 16.25  ? 103  LYS L CA  1 
ATOM   788  C C   . LYS A 1 103 ? 21.443  35.594 73.171 1.00 15.20  ? 103  LYS L C   1 
ATOM   789  O O   . LYS A 1 103 ? 20.410  35.316 73.773 1.00 15.03  ? 103  LYS L O   1 
ATOM   790  C CB  . LYS A 1 103 ? 20.444  35.973 70.890 1.00 30.56  ? 103  LYS L CB  1 
ATOM   791  C CG  . LYS A 1 103 ? 20.720  37.423 70.516 1.00 37.54  ? 103  LYS L CG  1 
ATOM   792  C CD  . LYS A 1 103 ? 19.550  38.045 69.750 1.00 43.21  ? 103  LYS L CD  1 
ATOM   793  C CE  . LYS A 1 103 ? 19.917  39.431 69.223 1.00 49.82  ? 103  LYS L CE  1 
ATOM   794  N NZ  . LYS A 1 103 ? 18.763  40.165 68.618 1.00 52.01  ? 103  LYS L NZ  1 
ATOM   795  N N   . LEU A 1 104 ? 22.502  36.135 73.768 1.00 14.86  ? 104  LEU L N   1 
ATOM   796  C CA  . LEU A 1 104 ? 22.497  36.467 75.191 1.00 14.83  ? 104  LEU L CA  1 
ATOM   797  C C   . LEU A 1 104 ? 22.342  37.972 75.347 1.00 14.78  ? 104  LEU L C   1 
ATOM   798  O O   . LEU A 1 104 ? 23.241  38.737 74.991 1.00 15.28  ? 104  LEU L O   1 
ATOM   799  C CB  . LEU A 1 104 ? 23.798  36.004 75.859 1.00 14.73  ? 104  LEU L CB  1 
ATOM   800  C CG  . LEU A 1 104 ? 23.980  36.405 77.324 1.00 17.18  ? 104  LEU L CG  1 
ATOM   801  C CD1 . LEU A 1 104 ? 22.912  35.718 78.183 1.00 17.10  ? 104  LEU L CD1 1 
ATOM   802  C CD2 . LEU A 1 104 ? 25.374  36.014 77.794 1.00 19.56  ? 104  LEU L CD2 1 
ATOM   803  N N   . GLU A 1 105 ? 21.208  38.391 75.894 1.00 12.83  ? 105  GLU L N   1 
ATOM   804  C CA  . GLU A 1 105 ? 20.919  39.815 76.059 1.00 14.31  ? 105  GLU L CA  1 
ATOM   805  C C   . GLU A 1 105 ? 20.792  40.257 77.522 1.00 14.35  ? 105  GLU L C   1 
ATOM   806  O O   . GLU A 1 105 ? 20.609  39.431 78.421 1.00 12.69  ? 105  GLU L O   1 
ATOM   807  C CB  . GLU A 1 105 ? 19.657  40.150 75.253 1.00 20.92  ? 105  GLU L CB  1 
ATOM   808  C CG  . GLU A 1 105 ? 19.764  39.581 73.821 1.00 25.97  ? 105  GLU L CG  1 
ATOM   809  C CD  . GLU A 1 105 ? 18.592  39.910 72.908 1.00 27.70  ? 105  GLU L CD  1 
ATOM   810  O OE1 . GLU A 1 105 ? 18.582  41.003 72.310 1.00 26.04  ? 105  GLU L OE1 1 
ATOM   811  O OE2 . GLU A 1 105 ? 17.681  39.061 72.783 1.00 32.39  ? 105  GLU L OE2 1 
ATOM   812  N N   . VAL A 1 106 ? 20.909  41.562 77.750 1.00 15.02  ? 106  VAL L N   1 
ATOM   813  C CA  . VAL A 1 106 ? 20.842  42.116 79.098 1.00 17.80  ? 106  VAL L CA  1 
ATOM   814  C C   . VAL A 1 106 ? 19.432  42.220 79.654 1.00 19.96  ? 106  VAL L C   1 
ATOM   815  O O   . VAL A 1 106 ? 18.519  42.739 78.997 1.00 19.70  ? 106  VAL L O   1 
ATOM   816  C CB  . VAL A 1 106 ? 21.477  43.528 79.170 1.00 15.32  ? 106  VAL L CB  1 
ATOM   817  C CG1 . VAL A 1 106 ? 21.498  44.013 80.614 1.00 12.88  ? 106  VAL L CG1 1 
ATOM   818  C CG2 . VAL A 1 106 ? 22.885  43.506 78.599 1.00 13.28  ? 106  VAL L CG2 1 
ATOM   819  N N   . LYS A 1 107 ? 19.271  41.724 80.876 1.00 20.02  ? 107  LYS L N   1 
ATOM   820  C CA  . LYS A 1 107 ? 17.998  41.763 81.574 1.00 21.97  ? 107  LYS L CA  1 
ATOM   821  C C   . LYS A 1 107 ? 17.998  43.033 82.421 1.00 21.40  ? 107  LYS L C   1 
ATOM   822  O O   . LYS A 1 107 ? 18.927  43.275 83.203 1.00 20.09  ? 107  LYS L O   1 
ATOM   823  C CB  . LYS A 1 107 ? 17.847  40.522 82.461 1.00 34.72  ? 107  LYS L CB  1 
ATOM   824  C CG  . LYS A 1 107 ? 16.670  40.555 83.424 1.00 39.59  ? 107  LYS L CG  1 
ATOM   825  C CD  . LYS A 1 107 ? 16.460  39.190 84.084 1.00 44.25  ? 107  LYS L CD  1 
ATOM   826  C CE  . LYS A 1 107 ? 17.694  38.746 84.868 1.00 47.02  ? 107  LYS L CE  1 
ATOM   827  N NZ  . LYS A 1 107 ? 17.660  37.298 85.224 1.00 49.11  ? 107  LYS L NZ  1 
ATOM   828  N N   . ARG A 1 108 ? 16.964  43.849 82.241 1.00 18.28  ? 108  ARG L N   1 
ATOM   829  C CA  . ARG A 1 108 ? 16.831  45.100 82.978 1.00 16.37  ? 108  ARG L CA  1 
ATOM   830  C C   . ARG A 1 108 ? 15.357  45.362 83.264 1.00 15.97  ? 108  ARG L C   1 
ATOM   831  O O   . ARG A 1 108 ? 14.489  44.606 82.832 1.00 14.60  ? 108  ARG L O   1 
ATOM   832  C CB  . ARG A 1 108 ? 17.400  46.264 82.171 1.00 16.12  ? 108  ARG L CB  1 
ATOM   833  C CG  . ARG A 1 108 ? 16.818  46.395 80.766 1.00 14.85  ? 108  ARG L CG  1 
ATOM   834  C CD  . ARG A 1 108 ? 16.835  47.846 80.335 1.00 16.68  ? 108  ARG L CD  1 
ATOM   835  N NE  . ARG A 1 108 ? 15.944  48.623 81.190 1.00 16.90  ? 108  ARG L NE  1 
ATOM   836  C CZ  . ARG A 1 108 ? 15.982  49.942 81.331 1.00 17.85  ? 108  ARG L CZ  1 
ATOM   837  N NH1 . ARG A 1 108 ? 16.876  50.666 80.672 1.00 16.96  ? 108  ARG L NH1 1 
ATOM   838  N NH2 . ARG A 1 108 ? 15.122  50.536 82.149 1.00 20.66  ? 108  ARG L NH2 1 
ATOM   839  N N   . ALA A 1 109 ? 15.080  46.438 83.987 1.00 14.50  ? 109  ALA L N   1 
ATOM   840  C CA  . ALA A 1 109 ? 13.707  46.779 84.334 1.00 15.82  ? 109  ALA L CA  1 
ATOM   841  C C   . ALA A 1 109 ? 12.917  47.216 83.107 1.00 15.69  ? 109  ALA L C   1 
ATOM   842  O O   . ALA A 1 109 ? 13.472  47.792 82.162 1.00 15.04  ? 109  ALA L O   1 
ATOM   843  C CB  . ALA A 1 109 ? 13.692  47.888 85.400 1.00 12.69  ? 109  ALA L CB  1 
ATOM   844  N N   . ASP A 1 110 ? 11.621  46.921 83.126 1.00 15.80  ? 110  ASP L N   1 
ATOM   845  C CA  . ASP A 1 110 ? 10.735  47.288 82.031 1.00 17.18  ? 110  ASP L CA  1 
ATOM   846  C C   . ASP A 1 110 ? 10.778  48.795 81.802 1.00 17.35  ? 110  ASP L C   1 
ATOM   847  O O   . ASP A 1 110 ? 10.998  49.569 82.736 1.00 15.06  ? 110  ASP L O   1 
ATOM   848  C CB  . ASP A 1 110 ? 9.290   46.877 82.343 1.00 19.91  ? 110  ASP L CB  1 
ATOM   849  C CG  . ASP A 1 110 ? 9.107   45.374 82.429 1.00 22.06  ? 110  ASP L CG  1 
ATOM   850  O OD1 . ASP A 1 110 ? 10.018  44.632 82.017 1.00 22.49  ? 110  ASP L OD1 1 
ATOM   851  O OD2 . ASP A 1 110 ? 8.032   44.934 82.898 1.00 28.24  ? 110  ASP L OD2 1 
ATOM   852  N N   . ALA A 1 111 ? 10.571  49.203 80.555 1.00 15.34  ? 111  ALA L N   1 
ATOM   853  C CA  . ALA A 1 111 ? 10.559  50.613 80.198 1.00 14.63  ? 111  ALA L CA  1 
ATOM   854  C C   . ALA A 1 111 ? 9.591   50.779 79.038 1.00 15.99  ? 111  ALA L C   1 
ATOM   855  O O   . ALA A 1 111 ? 9.694   50.075 78.028 1.00 15.14  ? 111  ALA L O   1 
ATOM   856  C CB  . ALA A 1 111 ? 11.952  51.076 79.787 1.00 13.89  ? 111  ALA L CB  1 
ATOM   857  N N   . ALA A 1 112 ? 8.644   51.698 79.188 1.00 16.26  ? 112  ALA L N   1 
ATOM   858  C CA  . ALA A 1 112 ? 7.664   51.943 78.140 1.00 16.06  ? 112  ALA L CA  1 
ATOM   859  C C   . ALA A 1 112 ? 8.343   52.717 77.025 1.00 16.25  ? 112  ALA L C   1 
ATOM   860  O O   . ALA A 1 112 ? 9.242   53.523 77.273 1.00 18.10  ? 112  ALA L O   1 
ATOM   861  C CB  . ALA A 1 112 ? 6.495   52.750 78.695 1.00 12.72  ? 112  ALA L CB  1 
ATOM   862  N N   . PRO A 1 113 ? 7.934   52.480 75.777 1.00 14.06  ? 113  PRO L N   1 
ATOM   863  C CA  . PRO A 1 113 ? 8.579   53.227 74.695 1.00 13.25  ? 113  PRO L CA  1 
ATOM   864  C C   . PRO A 1 113 ? 8.196   54.705 74.722 1.00 13.10  ? 113  PRO L C   1 
ATOM   865  O O   . PRO A 1 113 ? 7.141   55.076 75.239 1.00 13.53  ? 113  PRO L O   1 
ATOM   866  C CB  . PRO A 1 113 ? 8.060   52.527 73.444 1.00 13.88  ? 113  PRO L CB  1 
ATOM   867  C CG  . PRO A 1 113 ? 6.663   52.087 73.871 1.00 13.31  ? 113  PRO L CG  1 
ATOM   868  C CD  . PRO A 1 113 ? 6.943   51.523 75.250 1.00 12.12  ? 113  PRO L CD  1 
ATOM   869  N N   . THR A 1 114 ? 9.073   55.545 74.189 1.00 11.43  ? 114  THR L N   1 
ATOM   870  C CA  . THR A 1 114 ? 8.802   56.972 74.082 1.00 11.13  ? 114  THR L CA  1 
ATOM   871  C C   . THR A 1 114 ? 8.416   57.107 72.620 1.00 11.78  ? 114  THR L C   1 
ATOM   872  O O   . THR A 1 114 ? 9.230   56.848 71.739 1.00 13.21  ? 114  THR L O   1 
ATOM   873  C CB  . THR A 1 114 ? 10.058  57.812 74.372 1.00 15.44  ? 114  THR L CB  1 
ATOM   874  O OG1 . THR A 1 114 ? 10.425  57.647 75.749 1.00 18.27  ? 114  THR L OG1 1 
ATOM   875  C CG2 . THR A 1 114 ? 9.790   59.297 74.092 1.00 15.89  ? 114  THR L CG2 1 
ATOM   876  N N   . VAL A 1 115 ? 7.170   57.491 72.365 1.00 16.93  ? 115  VAL L N   1 
ATOM   877  C CA  . VAL A 1 115 ? 6.662   57.602 71.001 1.00 16.98  ? 115  VAL L CA  1 
ATOM   878  C C   . VAL A 1 115 ? 6.736   58.990 70.368 1.00 17.67  ? 115  VAL L C   1 
ATOM   879  O O   . VAL A 1 115 ? 6.371   59.995 70.978 1.00 19.27  ? 115  VAL L O   1 
ATOM   880  C CB  . VAL A 1 115 ? 5.204   57.101 70.948 1.00 14.28  ? 115  VAL L CB  1 
ATOM   881  C CG1 . VAL A 1 115 ? 4.681   57.139 69.508 1.00 12.24  ? 115  VAL L CG1 1 
ATOM   882  C CG2 . VAL A 1 115 ? 5.129   55.672 71.520 1.00 11.35  ? 115  VAL L CG2 1 
ATOM   883  N N   . SER A 1 116 ? 7.221   59.031 69.134 1.00 15.60  ? 116  SER L N   1 
ATOM   884  C CA  . SER A 1 116 ? 7.339   60.279 68.378 1.00 17.30  ? 116  SER L CA  1 
ATOM   885  C C   . SER A 1 116 ? 6.798   60.032 66.972 1.00 17.29  ? 116  SER L C   1 
ATOM   886  O O   . SER A 1 116 ? 7.165   59.053 66.324 1.00 17.17  ? 116  SER L O   1 
ATOM   887  C CB  . SER A 1 116 ? 8.804   60.725 68.278 1.00 13.29  ? 116  SER L CB  1 
ATOM   888  O OG  . SER A 1 116 ? 9.336   61.009 69.553 1.00 15.53  ? 116  SER L OG  1 
ATOM   889  N N   . ILE A 1 117 ? 5.918   60.909 66.505 1.00 17.66  ? 117  ILE L N   1 
ATOM   890  C CA  . ILE A 1 117 ? 5.357   60.765 65.167 1.00 17.85  ? 117  ILE L CA  1 
ATOM   891  C C   . ILE A 1 117 ? 5.805   61.962 64.335 1.00 18.30  ? 117  ILE L C   1 
ATOM   892  O O   . ILE A 1 117 ? 5.904   63.081 64.842 1.00 17.78  ? 117  ILE L O   1 
ATOM   893  C CB  . ILE A 1 117 ? 3.807   60.669 65.219 1.00 19.40  ? 117  ILE L CB  1 
ATOM   894  C CG1 . ILE A 1 117 ? 3.264   60.307 63.834 1.00 19.33  ? 117  ILE L CG1 1 
ATOM   895  C CG2 . ILE A 1 117 ? 3.208   61.986 65.739 1.00 17.17  ? 117  ILE L CG2 1 
ATOM   896  C CD1 . ILE A 1 117 ? 1.860   59.711 63.862 1.00 20.44  ? 117  ILE L CD1 1 
ATOM   897  N N   . PHE A 1 118 ? 6.089   61.720 63.060 1.00 22.49  ? 118  PHE L N   1 
ATOM   898  C CA  . PHE A 1 118 ? 6.566   62.772 62.164 1.00 23.24  ? 118  PHE L CA  1 
ATOM   899  C C   . PHE A 1 118 ? 5.822   62.832 60.842 1.00 22.22  ? 118  PHE L C   1 
ATOM   900  O O   . PHE A 1 118 ? 5.805   61.864 60.090 1.00 23.26  ? 118  PHE L O   1 
ATOM   901  C CB  . PHE A 1 118 ? 8.046   62.564 61.850 1.00 21.64  ? 118  PHE L CB  1 
ATOM   902  C CG  . PHE A 1 118 ? 8.928   62.558 63.056 1.00 21.22  ? 118  PHE L CG  1 
ATOM   903  C CD1 . PHE A 1 118 ? 9.373   63.751 63.614 1.00 20.83  ? 118  PHE L CD1 1 
ATOM   904  C CD2 . PHE A 1 118 ? 9.324   61.357 63.628 1.00 21.49  ? 118  PHE L CD2 1 
ATOM   905  C CE1 . PHE A 1 118 ? 10.202  63.750 64.725 1.00 21.42  ? 118  PHE L CE1 1 
ATOM   906  C CE2 . PHE A 1 118 ? 10.156  61.343 64.745 1.00 23.52  ? 118  PHE L CE2 1 
ATOM   907  C CZ  . PHE A 1 118 ? 10.597  62.542 65.294 1.00 20.26  ? 118  PHE L CZ  1 
ATOM   908  N N   . PRO A 1 119 ? 5.225   63.988 60.529 1.00 17.91  ? 119  PRO L N   1 
ATOM   909  C CA  . PRO A 1 119 ? 4.489   64.151 59.271 1.00 17.79  ? 119  PRO L CA  1 
ATOM   910  C C   . PRO A 1 119 ? 5.496   64.182 58.124 1.00 18.58  ? 119  PRO L C   1 
ATOM   911  O O   . PRO A 1 119 ? 6.692   64.365 58.347 1.00 17.32  ? 119  PRO L O   1 
ATOM   912  C CB  . PRO A 1 119 ? 3.799   65.509 59.432 1.00 16.92  ? 119  PRO L CB  1 
ATOM   913  C CG  . PRO A 1 119 ? 3.800   65.756 60.930 1.00 19.30  ? 119  PRO L CG  1 
ATOM   914  C CD  . PRO A 1 119 ? 5.127   65.195 61.364 1.00 17.40  ? 119  PRO L CD  1 
ATOM   915  N N   . PRO A 1 120 ? 5.029   63.990 56.884 1.00 21.62  ? 120  PRO L N   1 
ATOM   916  C CA  . PRO A 1 120 ? 5.952   64.018 55.747 1.00 22.26  ? 120  PRO L CA  1 
ATOM   917  C C   . PRO A 1 120 ? 6.645   65.377 55.678 1.00 23.53  ? 120  PRO L C   1 
ATOM   918  O O   . PRO A 1 120 ? 6.089   66.386 56.110 1.00 23.49  ? 120  PRO L O   1 
ATOM   919  C CB  . PRO A 1 120 ? 5.029   63.789 54.553 1.00 24.45  ? 120  PRO L CB  1 
ATOM   920  C CG  . PRO A 1 120 ? 3.955   62.920 55.122 1.00 23.29  ? 120  PRO L CG  1 
ATOM   921  C CD  . PRO A 1 120 ? 3.682   63.570 56.462 1.00 23.26  ? 120  PRO L CD  1 
ATOM   922  N N   . SER A 1 121 ? 7.862   65.409 55.151 1.00 23.15  ? 121  SER L N   1 
ATOM   923  C CA  . SER A 1 121 ? 8.577   66.669 55.040 1.00 24.18  ? 121  SER L CA  1 
ATOM   924  C C   . SER A 1 121 ? 8.039   67.408 53.814 1.00 24.67  ? 121  SER L C   1 
ATOM   925  O O   . SER A 1 121 ? 7.401   66.807 52.947 1.00 22.53  ? 121  SER L O   1 
ATOM   926  C CB  . SER A 1 121 ? 10.079  66.418 54.885 1.00 25.18  ? 121  SER L CB  1 
ATOM   927  O OG  . SER A 1 121 ? 10.354  65.658 53.715 1.00 24.01  ? 121  SER L OG  1 
ATOM   928  N N   . SER A 1 122 ? 8.286   68.712 53.750 1.00 25.77  ? 122  SER L N   1 
ATOM   929  C CA  . SER A 1 122 ? 7.828   69.503 52.615 1.00 26.64  ? 122  SER L CA  1 
ATOM   930  C C   . SER A 1 122 ? 8.596   69.079 51.374 1.00 25.73  ? 122  SER L C   1 
ATOM   931  O O   . SER A 1 122 ? 8.030   69.004 50.287 1.00 25.95  ? 122  SER L O   1 
ATOM   932  C CB  . SER A 1 122 ? 8.035   70.994 52.887 1.00 27.15  ? 122  SER L CB  1 
ATOM   933  O OG  . SER A 1 122 ? 9.341   71.239 53.382 1.00 31.27  ? 122  SER L OG  1 
ATOM   934  N N   . GLU A 1 123 ? 9.883   68.783 51.539 1.00 24.83  ? 123  GLU L N   1 
ATOM   935  C CA  . GLU A 1 123 ? 10.696  68.363 50.407 1.00 25.50  ? 123  GLU L CA  1 
ATOM   936  C C   . GLU A 1 123 ? 10.090  67.108 49.777 1.00 24.99  ? 123  GLU L C   1 
ATOM   937  O O   . GLU A 1 123 ? 9.843   67.070 48.569 1.00 24.08  ? 123  GLU L O   1 
ATOM   938  C CB  . GLU A 1 123 ? 12.143  68.078 50.829 1.00 30.84  ? 123  GLU L CB  1 
ATOM   939  C CG  . GLU A 1 123 ? 13.121  68.176 49.654 1.00 33.03  ? 123  GLU L CG  1 
ATOM   940  C CD  . GLU A 1 123 ? 14.475  67.523 49.907 1.00 34.99  ? 123  GLU L CD  1 
ATOM   941  O OE1 . GLU A 1 123 ? 15.072  67.733 50.988 1.00 34.79  ? 123  GLU L OE1 1 
ATOM   942  O OE2 . GLU A 1 123 ? 14.950  66.804 49.002 1.00 36.76  ? 123  GLU L OE2 1 
ATOM   943  N N   . GLN A 1 124 ? 9.836   66.079 50.581 1.00 27.52  ? 124  GLN L N   1 
ATOM   944  C CA  . GLN A 1 124 ? 9.261   64.853 50.023 1.00 27.13  ? 124  GLN L CA  1 
ATOM   945  C C   . GLN A 1 124 ? 7.867   65.082 49.438 1.00 27.82  ? 124  GLN L C   1 
ATOM   946  O O   . GLN A 1 124 ? 7.521   64.506 48.406 1.00 27.53  ? 124  GLN L O   1 
ATOM   947  C CB  . GLN A 1 124 ? 9.183   63.744 51.076 1.00 20.77  ? 124  GLN L CB  1 
ATOM   948  C CG  . GLN A 1 124 ? 8.409   62.522 50.579 1.00 19.69  ? 124  GLN L CG  1 
ATOM   949  C CD  . GLN A 1 124 ? 8.377   61.380 51.574 1.00 19.96  ? 124  GLN L CD  1 
ATOM   950  O OE1 . GLN A 1 124 ? 8.102   61.577 52.759 1.00 18.84  ? 124  GLN L OE1 1 
ATOM   951  N NE2 . GLN A 1 124 ? 8.640   60.168 51.090 1.00 19.03  ? 124  GLN L NE2 1 
ATOM   952  N N   . LEU A 1 125 ? 7.067   65.912 50.102 1.00 26.62  ? 125  LEU L N   1 
ATOM   953  C CA  . LEU A 1 125 ? 5.722   66.202 49.629 1.00 27.26  ? 125  LEU L CA  1 
ATOM   954  C C   . LEU A 1 125 ? 5.797   66.841 48.244 1.00 28.79  ? 125  LEU L C   1 
ATOM   955  O O   . LEU A 1 125 ? 5.006   66.520 47.358 1.00 30.04  ? 125  LEU L O   1 
ATOM   956  C CB  . LEU A 1 125 ? 5.008   67.128 50.619 1.00 28.90  ? 125  LEU L CB  1 
ATOM   957  C CG  . LEU A 1 125 ? 3.771   66.557 51.335 1.00 30.44  ? 125  LEU L CG  1 
ATOM   958  C CD1 . LEU A 1 125 ? 3.974   65.089 51.636 1.00 31.06  ? 125  LEU L CD1 1 
ATOM   959  C CD2 . LEU A 1 125 ? 3.506   67.337 52.617 1.00 27.41  ? 125  LEU L CD2 1 
ATOM   960  N N   . THR A 1 126 ? 6.769   67.730 48.062 1.00 34.55  ? 126  THR L N   1 
ATOM   961  C CA  . THR A 1 126 ? 6.967   68.410 46.788 1.00 35.06  ? 126  THR L CA  1 
ATOM   962  C C   . THR A 1 126 ? 7.361   67.416 45.702 1.00 36.55  ? 126  THR L C   1 
ATOM   963  O O   . THR A 1 126 ? 7.082   67.634 44.521 1.00 38.08  ? 126  THR L O   1 
ATOM   964  C CB  . THR A 1 126 ? 8.074   69.471 46.888 1.00 25.11  ? 126  THR L CB  1 
ATOM   965  O OG1 . THR A 1 126 ? 7.707   70.451 47.864 1.00 24.76  ? 126  THR L OG1 1 
ATOM   966  C CG2 . THR A 1 126 ? 8.282   70.155 45.545 1.00 27.09  ? 126  THR L CG2 1 
ATOM   967  N N   . SER A 1 127 ? 8.015   66.327 46.098 1.00 31.29  ? 127  SER L N   1 
ATOM   968  C CA  . SER A 1 127 ? 8.433   65.321 45.129 1.00 30.96  ? 127  SER L CA  1 
ATOM   969  C C   . SER A 1 127 ? 7.314   64.330 44.846 1.00 30.77  ? 127  SER L C   1 
ATOM   970  O O   . SER A 1 127 ? 7.501   63.390 44.081 1.00 33.98  ? 127  SER L O   1 
ATOM   971  C CB  . SER A 1 127 ? 9.670   64.566 45.623 1.00 30.67  ? 127  SER L CB  1 
ATOM   972  O OG  . SER A 1 127 ? 9.337   63.649 46.650 1.00 31.51  ? 127  SER L OG  1 
ATOM   973  N N   . GLY A 1 128 ? 6.157   64.532 45.472 1.00 28.66  ? 128  GLY L N   1 
ATOM   974  C CA  . GLY A 1 128 ? 5.026   63.645 45.235 1.00 27.41  ? 128  GLY L CA  1 
ATOM   975  C C   . GLY A 1 128 ? 4.858   62.478 46.193 1.00 27.26  ? 128  GLY L C   1 
ATOM   976  O O   . GLY A 1 128 ? 3.934   61.673 46.040 1.00 26.24  ? 128  GLY L O   1 
ATOM   977  N N   . GLY A 1 129 ? 5.738   62.378 47.184 1.00 24.12  ? 129  GLY L N   1 
ATOM   978  C CA  . GLY A 1 129 ? 5.641   61.286 48.133 1.00 24.04  ? 129  GLY L CA  1 
ATOM   979  C C   . GLY A 1 129 ? 5.268   61.730 49.531 1.00 24.32  ? 129  GLY L C   1 
ATOM   980  O O   . GLY A 1 129 ? 5.416   62.906 49.876 1.00 24.65  ? 129  GLY L O   1 
ATOM   981  N N   . ALA A 1 130 ? 4.783   60.791 50.340 1.00 26.63  ? 130  ALA L N   1 
ATOM   982  C CA  . ALA A 1 130 ? 4.394   61.096 51.713 1.00 25.90  ? 130  ALA L CA  1 
ATOM   983  C C   . ALA A 1 130 ? 4.666   59.948 52.684 1.00 24.86  ? 130  ALA L C   1 
ATOM   984  O O   . ALA A 1 130 ? 3.877   59.009 52.794 1.00 24.35  ? 130  ALA L O   1 
ATOM   985  C CB  . ALA A 1 130 ? 2.918   61.473 51.768 1.00 21.53  ? 130  ALA L CB  1 
ATOM   986  N N   . SER A 1 131 ? 5.789   60.027 53.387 1.00 20.69  ? 131  SER L N   1 
ATOM   987  C CA  . SER A 1 131 ? 6.133   59.008 54.364 1.00 19.80  ? 131  SER L CA  1 
ATOM   988  C C   . SER A 1 131 ? 5.879   59.554 55.760 1.00 20.41  ? 131  SER L C   1 
ATOM   989  O O   . SER A 1 131 ? 6.389   60.615 56.115 1.00 21.00  ? 131  SER L O   1 
ATOM   990  C CB  . SER A 1 131 ? 7.604   58.611 54.235 1.00 20.45  ? 131  SER L CB  1 
ATOM   991  O OG  . SER A 1 131 ? 7.852   57.923 53.022 1.00 22.59  ? 131  SER L OG  1 
ATOM   992  N N   . VAL A 1 132 ? 5.070   58.848 56.541 1.00 22.27  ? 132  VAL L N   1 
ATOM   993  C CA  . VAL A 1 132 ? 4.805   59.271 57.906 1.00 22.03  ? 132  VAL L CA  1 
ATOM   994  C C   . VAL A 1 132 ? 5.670   58.353 58.759 1.00 22.97  ? 132  VAL L C   1 
ATOM   995  O O   . VAL A 1 132 ? 5.577   57.131 58.650 1.00 23.43  ? 132  VAL L O   1 
ATOM   996  C CB  . VAL A 1 132 ? 3.326   59.092 58.300 1.00 20.08  ? 132  VAL L CB  1 
ATOM   997  C CG1 . VAL A 1 132 ? 3.052   59.824 59.610 1.00 18.90  ? 132  VAL L CG1 1 
ATOM   998  C CG2 . VAL A 1 132 ? 2.425   59.625 57.201 1.00 19.43  ? 132  VAL L CG2 1 
ATOM   999  N N   . VAL A 1 133 ? 6.517   58.942 59.596 1.00 25.13  ? 133  VAL L N   1 
ATOM   1000 C CA  . VAL A 1 133 ? 7.419   58.159 60.428 1.00 24.29  ? 133  VAL L CA  1 
ATOM   1001 C C   . VAL A 1 133 ? 7.071   58.158 61.913 1.00 26.19  ? 133  VAL L C   1 
ATOM   1002 O O   . VAL A 1 133 ? 6.663   59.178 62.473 1.00 27.76  ? 133  VAL L O   1 
ATOM   1003 C CB  . VAL A 1 133 ? 8.879   58.649 60.250 1.00 14.34  ? 133  VAL L CB  1 
ATOM   1004 C CG1 . VAL A 1 133 ? 9.792   57.957 61.247 1.00 11.56  ? 133  VAL L CG1 1 
ATOM   1005 C CG2 . VAL A 1 133 ? 9.347   58.371 58.821 1.00 11.92  ? 133  VAL L CG2 1 
ATOM   1006 N N   . CYS A 1 134 ? 7.237   56.999 62.542 1.00 17.74  ? 134  CYS L N   1 
ATOM   1007 C CA  . CYS A 1 134 ? 6.969   56.851 63.963 1.00 16.61  ? 134  CYS L CA  1 
ATOM   1008 C C   . CYS A 1 134 ? 8.143   56.149 64.633 1.00 16.38  ? 134  CYS L C   1 
ATOM   1009 O O   . CYS A 1 134 ? 8.594   55.094 64.167 1.00 15.31  ? 134  CYS L O   1 
ATOM   1010 C CB  . CYS A 1 134 ? 5.708   56.021 64.197 1.00 18.04  ? 134  CYS L CB  1 
ATOM   1011 S SG  . CYS A 1 134 ? 5.246   55.846 65.960 1.00 24.83  ? 134  CYS L SG  1 
ATOM   1012 N N   . PHE A 1 135 ? 8.648   56.744 65.709 1.00 12.10  ? 135  PHE L N   1 
ATOM   1013 C CA  . PHE A 1 135 ? 9.742   56.147 66.462 1.00 12.48  ? 135  PHE L CA  1 
ATOM   1014 C C   . PHE A 1 135 ? 9.183   55.649 67.793 1.00 12.57  ? 135  PHE L C   1 
ATOM   1015 O O   . PHE A 1 135 ? 8.407   56.349 68.447 1.00 12.34  ? 135  PHE L O   1 
ATOM   1016 C CB  . PHE A 1 135 ? 10.846  57.162 66.793 1.00 12.08  ? 135  PHE L CB  1 
ATOM   1017 C CG  . PHE A 1 135 ? 11.693  57.585 65.621 1.00 17.18  ? 135  PHE L CG  1 
ATOM   1018 C CD1 . PHE A 1 135 ? 11.773  56.820 64.462 1.00 16.12  ? 135  PHE L CD1 1 
ATOM   1019 C CD2 . PHE A 1 135 ? 12.449  58.754 65.701 1.00 15.99  ? 135  PHE L CD2 1 
ATOM   1020 C CE1 . PHE A 1 135 ? 12.599  57.221 63.398 1.00 19.15  ? 135  PHE L CE1 1 
ATOM   1021 C CE2 . PHE A 1 135 ? 13.271  59.158 64.647 1.00 16.96  ? 135  PHE L CE2 1 
ATOM   1022 C CZ  . PHE A 1 135 ? 13.346  58.394 63.497 1.00 15.47  ? 135  PHE L CZ  1 
ATOM   1023 N N   . LEU A 1 136 ? 9.560   54.438 68.177 1.00 11.32  ? 136  LEU L N   1 
ATOM   1024 C CA  . LEU A 1 136 ? 9.165   53.877 69.473 1.00 13.72  ? 136  LEU L CA  1 
ATOM   1025 C C   . LEU A 1 136 ? 10.539  53.602 70.063 1.00 13.33  ? 136  LEU L C   1 
ATOM   1026 O O   . LEU A 1 136 ? 11.122  52.544 69.830 1.00 12.30  ? 136  LEU L O   1 
ATOM   1027 C CB  . LEU A 1 136 ? 8.382   52.572 69.317 1.00 23.90  ? 136  LEU L CB  1 
ATOM   1028 C CG  . LEU A 1 136 ? 6.996   52.673 68.680 1.00 27.16  ? 136  LEU L CG  1 
ATOM   1029 C CD1 . LEU A 1 136 ? 7.104   53.193 67.256 1.00 30.35  ? 136  LEU L CD1 1 
ATOM   1030 C CD2 . LEU A 1 136 ? 6.359   51.305 68.689 1.00 30.44  ? 136  LEU L CD2 1 
ATOM   1031 N N   . ASN A 1 137 ? 11.049  54.587 70.800 1.00 16.35  ? 137  ASN L N   1 
ATOM   1032 C CA  . ASN A 1 137 ? 12.381  54.541 71.388 1.00 15.20  ? 137  ASN L CA  1 
ATOM   1033 C C   . ASN A 1 137 ? 12.556  54.140 72.830 1.00 14.87  ? 137  ASN L C   1 
ATOM   1034 O O   . ASN A 1 137 ? 11.711  54.402 73.684 1.00 15.34  ? 137  ASN L O   1 
ATOM   1035 C CB  . ASN A 1 137 ? 13.070  55.896 71.244 1.00 16.40  ? 137  ASN L CB  1 
ATOM   1036 C CG  . ASN A 1 137 ? 13.407  56.237 69.816 1.00 19.81  ? 137  ASN L CG  1 
ATOM   1037 O OD1 . ASN A 1 137 ? 13.384  55.378 68.935 1.00 22.15  ? 137  ASN L OD1 1 
ATOM   1038 N ND2 . ASN A 1 137 ? 13.747  57.499 69.580 1.00 20.03  ? 137  ASN L ND2 1 
ATOM   1039 N N   . ASN A 1 138 ? 13.712  53.529 73.076 1.00 15.38  ? 138  ASN L N   1 
ATOM   1040 C CA  . ASN A 1 138 ? 14.155  53.103 74.397 1.00 13.64  ? 138  ASN L CA  1 
ATOM   1041 C C   . ASN A 1 138 ? 13.157  52.396 75.306 1.00 12.93  ? 138  ASN L C   1 
ATOM   1042 O O   . ASN A 1 138 ? 12.809  52.895 76.383 1.00 12.59  ? 138  ASN L O   1 
ATOM   1043 C CB  . ASN A 1 138 ? 14.759  54.318 75.116 1.00 16.15  ? 138  ASN L CB  1 
ATOM   1044 C CG  . ASN A 1 138 ? 15.706  55.110 74.216 1.00 18.04  ? 138  ASN L CG  1 
ATOM   1045 O OD1 . ASN A 1 138 ? 15.269  55.858 73.338 1.00 19.38  ? 138  ASN L OD1 1 
ATOM   1046 N ND2 . ASN A 1 138 ? 17.007  54.932 74.418 1.00 18.65  ? 138  ASN L ND2 1 
ATOM   1047 N N   . PHE A 1 139 ? 12.714  51.222 74.874 1.00 10.95  ? 139  PHE L N   1 
ATOM   1048 C CA  . PHE A 1 139 ? 11.791  50.424 75.654 1.00 12.18  ? 139  PHE L CA  1 
ATOM   1049 C C   . PHE A 1 139 ? 12.421  49.069 75.996 1.00 13.42  ? 139  PHE L C   1 
ATOM   1050 O O   . PHE A 1 139 ? 13.465  48.695 75.449 1.00 12.23  ? 139  PHE L O   1 
ATOM   1051 C CB  . PHE A 1 139 ? 10.462  50.213 74.902 1.00 13.28  ? 139  PHE L CB  1 
ATOM   1052 C CG  . PHE A 1 139 ? 10.604  49.560 73.543 1.00 15.97  ? 139  PHE L CG  1 
ATOM   1053 C CD1 . PHE A 1 139 ? 10.711  50.337 72.382 1.00 15.83  ? 139  PHE L CD1 1 
ATOM   1054 C CD2 . PHE A 1 139 ? 10.574  48.173 73.414 1.00 13.42  ? 139  PHE L CD2 1 
ATOM   1055 C CE1 . PHE A 1 139 ? 10.777  49.740 71.111 1.00 12.32  ? 139  PHE L CE1 1 
ATOM   1056 C CE2 . PHE A 1 139 ? 10.640  47.565 72.149 1.00 14.96  ? 139  PHE L CE2 1 
ATOM   1057 C CZ  . PHE A 1 139 ? 10.739  48.349 70.998 1.00 13.54  ? 139  PHE L CZ  1 
ATOM   1058 N N   . TYR A 1 140 ? 11.783  48.350 76.917 1.00 14.93  ? 140  TYR L N   1 
ATOM   1059 C CA  . TYR A 1 140 ? 12.235  47.028 77.345 1.00 16.32  ? 140  TYR L CA  1 
ATOM   1060 C C   . TYR A 1 140 ? 11.079  46.390 78.102 1.00 17.76  ? 140  TYR L C   1 
ATOM   1061 O O   . TYR A 1 140 ? 10.450  47.050 78.935 1.00 17.13  ? 140  TYR L O   1 
ATOM   1062 C CB  . TYR A 1 140 ? 13.436  47.133 78.290 1.00 18.68  ? 140  TYR L CB  1 
ATOM   1063 C CG  . TYR A 1 140 ? 14.008  45.781 78.650 1.00 20.48  ? 140  TYR L CG  1 
ATOM   1064 C CD1 . TYR A 1 140 ? 15.071  45.241 77.926 1.00 19.95  ? 140  TYR L CD1 1 
ATOM   1065 C CD2 . TYR A 1 140 ? 13.432  45.004 79.661 1.00 18.45  ? 140  TYR L CD2 1 
ATOM   1066 C CE1 . TYR A 1 140 ? 15.547  43.961 78.192 1.00 21.25  ? 140  TYR L CE1 1 
ATOM   1067 C CE2 . TYR A 1 140 ? 13.899  43.719 79.932 1.00 19.51  ? 140  TYR L CE2 1 
ATOM   1068 C CZ  . TYR A 1 140 ? 14.955  43.205 79.191 1.00 19.96  ? 140  TYR L CZ  1 
ATOM   1069 O OH  . TYR A 1 140 ? 15.413  41.933 79.431 1.00 22.34  ? 140  TYR L OH  1 
ATOM   1070 N N   . PRO A 1 141 ? 10.787  45.100 77.845 1.00 18.29  ? 141  PRO L N   1 
ATOM   1071 C CA  . PRO A 1 141 ? 11.431  44.146 76.935 1.00 19.96  ? 141  PRO L CA  1 
ATOM   1072 C C   . PRO A 1 141 ? 11.226  44.430 75.443 1.00 20.68  ? 141  PRO L C   1 
ATOM   1073 O O   . PRO A 1 141 ? 10.439  45.295 75.064 1.00 20.79  ? 141  PRO L O   1 
ATOM   1074 C CB  . PRO A 1 141 ? 10.828  42.813 77.360 1.00 21.97  ? 141  PRO L CB  1 
ATOM   1075 C CG  . PRO A 1 141 ? 9.446   43.197 77.734 1.00 21.73  ? 141  PRO L CG  1 
ATOM   1076 C CD  . PRO A 1 141 ? 9.667   44.453 78.552 1.00 21.17  ? 141  PRO L CD  1 
ATOM   1077 N N   . LYS A 1 142 ? 11.931  43.668 74.609 1.00 18.67  ? 142  LYS L N   1 
ATOM   1078 C CA  . LYS A 1 142 ? 11.896  43.848 73.161 1.00 19.85  ? 142  LYS L CA  1 
ATOM   1079 C C   . LYS A 1 142 ? 10.576  43.608 72.430 1.00 19.00  ? 142  LYS L C   1 
ATOM   1080 O O   . LYS A 1 142 ? 10.362  44.162 71.349 1.00 18.73  ? 142  LYS L O   1 
ATOM   1081 C CB  . LYS A 1 142 ? 12.996  43.000 72.500 1.00 35.45  ? 142  LYS L CB  1 
ATOM   1082 C CG  . LYS A 1 142 ? 12.744  41.495 72.510 1.00 40.70  ? 142  LYS L CG  1 
ATOM   1083 C CD  . LYS A 1 142 ? 13.839  40.740 71.752 1.00 45.03  ? 142  LYS L CD  1 
ATOM   1084 C CE  . LYS A 1 142 ? 13.584  39.236 71.759 1.00 47.56  ? 142  LYS L CE  1 
ATOM   1085 N NZ  . LYS A 1 142 ? 14.628  38.466 71.021 1.00 51.45  ? 142  LYS L NZ  1 
ATOM   1086 N N   . ASP A 1 143 ? 9.691   42.792 72.987 1.00 17.16  ? 143  ASP L N   1 
ATOM   1087 C CA  . ASP A 1 143 ? 8.425   42.532 72.302 1.00 20.13  ? 143  ASP L CA  1 
ATOM   1088 C C   . ASP A 1 143 ? 7.551   43.773 72.260 1.00 19.52  ? 143  ASP L C   1 
ATOM   1089 O O   . ASP A 1 143 ? 7.299   44.401 73.287 1.00 18.79  ? 143  ASP L O   1 
ATOM   1090 C CB  . ASP A 1 143 ? 7.645   41.409 72.984 1.00 42.87  ? 143  ASP L CB  1 
ATOM   1091 C CG  . ASP A 1 143 ? 8.371   40.087 72.944 1.00 48.12  ? 143  ASP L CG  1 
ATOM   1092 O OD1 . ASP A 1 143 ? 8.843   39.695 71.856 1.00 50.81  ? 143  ASP L OD1 1 
ATOM   1093 O OD2 . ASP A 1 143 ? 8.461   39.433 74.001 1.00 52.95  ? 143  ASP L OD2 1 
ATOM   1094 N N   . ILE A 1 144 ? 7.084   44.121 71.070 1.00 22.01  ? 144  ILE L N   1 
ATOM   1095 C CA  . ILE A 1 144 ? 6.233   45.286 70.914 1.00 22.40  ? 144  ILE L CA  1 
ATOM   1096 C C   . ILE A 1 144 ? 5.477   45.220 69.596 1.00 22.46  ? 144  ILE L C   1 
ATOM   1097 O O   . ILE A 1 144 ? 5.906   44.555 68.657 1.00 22.00  ? 144  ILE L O   1 
ATOM   1098 C CB  . ILE A 1 144 ? 7.062   46.586 70.940 1.00 19.06  ? 144  ILE L CB  1 
ATOM   1099 C CG1 . ILE A 1 144 ? 6.131   47.803 70.963 1.00 18.20  ? 144  ILE L CG1 1 
ATOM   1100 C CG2 . ILE A 1 144 ? 7.962   46.651 69.707 1.00 16.79  ? 144  ILE L CG2 1 
ATOM   1101 C CD1 . ILE A 1 144 ? 6.846   49.113 71.200 1.00 15.12  ? 144  ILE L CD1 1 
ATOM   1102 N N   . ASN A 1 145 ? 4.345   45.911 69.540 1.00 20.49  ? 145  ASN L N   1 
ATOM   1103 C CA  . ASN A 1 145 ? 3.539   45.961 68.330 1.00 23.24  ? 145  ASN L CA  1 
ATOM   1104 C C   . ASN A 1 145 ? 3.167   47.403 68.015 1.00 23.50  ? 145  ASN L C   1 
ATOM   1105 O O   . ASN A 1 145 ? 2.969   48.213 68.922 1.00 22.09  ? 145  ASN L O   1 
ATOM   1106 C CB  . ASN A 1 145 ? 2.270   45.123 68.496 1.00 37.41  ? 145  ASN L CB  1 
ATOM   1107 C CG  . ASN A 1 145 ? 2.471   43.683 68.084 1.00 41.06  ? 145  ASN L CG  1 
ATOM   1108 O OD1 . ASN A 1 145 ? 2.366   43.342 66.904 1.00 44.26  ? 145  ASN L OD1 1 
ATOM   1109 N ND2 . ASN A 1 145 ? 2.780   42.829 69.051 1.00 42.44  ? 145  ASN L ND2 1 
ATOM   1110 N N   . VAL A 1 146 ? 3.095   47.713 66.725 1.00 25.46  ? 146  VAL L N   1 
ATOM   1111 C CA  . VAL A 1 146 ? 2.726   49.046 66.258 1.00 26.92  ? 146  VAL L CA  1 
ATOM   1112 C C   . VAL A 1 146 ? 1.470   48.944 65.405 1.00 27.28  ? 146  VAL L C   1 
ATOM   1113 O O   . VAL A 1 146 ? 1.331   48.034 64.588 1.00 26.69  ? 146  VAL L O   1 
ATOM   1114 C CB  . VAL A 1 146 ? 3.823   49.678 65.385 1.00 27.24  ? 146  VAL L CB  1 
ATOM   1115 C CG1 . VAL A 1 146 ? 3.371   51.046 64.908 1.00 26.81  ? 146  VAL L CG1 1 
ATOM   1116 C CG2 . VAL A 1 146 ? 5.099   49.799 66.169 1.00 29.42  ? 146  VAL L CG2 1 
ATOM   1117 N N   . LYS A 1 147 ? 0.562   49.891 65.589 1.00 27.62  ? 147  LYS L N   1 
ATOM   1118 C CA  . LYS A 1 147 ? -0.682  49.912 64.835 1.00 28.24  ? 147  LYS L CA  1 
ATOM   1119 C C   . LYS A 1 147 ? -0.927  51.335 64.352 1.00 28.11  ? 147  LYS L C   1 
ATOM   1120 O O   . LYS A 1 147 ? -0.879  52.281 65.148 1.00 26.84  ? 147  LYS L O   1 
ATOM   1121 C CB  . LYS A 1 147 ? -1.825  49.441 65.735 1.00 46.63  ? 147  LYS L CB  1 
ATOM   1122 C CG  . LYS A 1 147 ? -3.208  49.463 65.115 1.00 51.51  ? 147  LYS L CG  1 
ATOM   1123 C CD  . LYS A 1 147 ? -4.216  48.916 66.116 1.00 54.25  ? 147  LYS L CD  1 
ATOM   1124 C CE  . LYS A 1 147 ? -5.649  49.146 65.676 1.00 57.48  ? 147  LYS L CE  1 
ATOM   1125 N NZ  . LYS A 1 147 ? -6.605  48.751 66.752 1.00 57.89  ? 147  LYS L NZ  1 
ATOM   1126 N N   . TRP A 1 148 ? -1.155  51.488 63.048 1.00 25.64  ? 148  TRP L N   1 
ATOM   1127 C CA  . TRP A 1 148 ? -1.417  52.798 62.468 1.00 25.61  ? 148  TRP L CA  1 
ATOM   1128 C C   . TRP A 1 148 ? -2.902  53.019 62.288 1.00 27.30  ? 148  TRP L C   1 
ATOM   1129 O O   . TRP A 1 148 ? -3.656  52.084 62.009 1.00 27.40  ? 148  TRP L O   1 
ATOM   1130 C CB  . TRP A 1 148 ? -0.768  52.948 61.094 1.00 27.19  ? 148  TRP L CB  1 
ATOM   1131 C CG  . TRP A 1 148 ? 0.699   53.124 61.107 1.00 25.72  ? 148  TRP L CG  1 
ATOM   1132 C CD1 . TRP A 1 148 ? 1.642   52.142 61.068 1.00 25.77  ? 148  TRP L CD1 1 
ATOM   1133 C CD2 . TRP A 1 148 ? 1.408   54.364 61.158 1.00 24.56  ? 148  TRP L CD2 1 
ATOM   1134 N NE1 . TRP A 1 148 ? 2.897   52.692 61.087 1.00 25.41  ? 148  TRP L NE1 1 
ATOM   1135 C CE2 . TRP A 1 148 ? 2.783   54.057 61.143 1.00 25.78  ? 148  TRP L CE2 1 
ATOM   1136 C CE3 . TRP A 1 148 ? 1.015   55.707 61.214 1.00 24.11  ? 148  TRP L CE3 1 
ATOM   1137 C CZ2 . TRP A 1 148 ? 3.772   55.045 61.182 1.00 25.65  ? 148  TRP L CZ2 1 
ATOM   1138 C CZ3 . TRP A 1 148 ? 1.998   56.690 61.252 1.00 24.43  ? 148  TRP L CZ3 1 
ATOM   1139 C CH2 . TRP A 1 148 ? 3.361   56.352 61.236 1.00 24.88  ? 148  TRP L CH2 1 
ATOM   1140 N N   . LYS A 1 149 ? -3.312  54.271 62.433 1.00 27.93  ? 149  LYS L N   1 
ATOM   1141 C CA  . LYS A 1 149 ? -4.700  54.645 62.255 1.00 29.45  ? 149  LYS L CA  1 
ATOM   1142 C C   . LYS A 1 149 ? -4.752  55.959 61.501 1.00 29.97  ? 149  LYS L C   1 
ATOM   1143 O O   . LYS A 1 149 ? -4.011  56.897 61.805 1.00 27.39  ? 149  LYS L O   1 
ATOM   1144 C CB  . LYS A 1 149 ? -5.413  54.809 63.598 1.00 44.69  ? 149  LYS L CB  1 
ATOM   1145 C CG  . LYS A 1 149 ? -5.760  53.511 64.303 1.00 48.13  ? 149  LYS L CG  1 
ATOM   1146 C CD  . LYS A 1 149 ? -6.650  53.792 65.507 1.00 49.99  ? 149  LYS L CD  1 
ATOM   1147 C CE  . LYS A 1 149 ? -7.048  52.518 66.236 1.00 51.19  ? 149  LYS L CE  1 
ATOM   1148 N NZ  . LYS A 1 149 ? -7.846  52.825 67.459 1.00 51.29  ? 149  LYS L NZ  1 
ATOM   1149 N N   . ILE A 1 150 ? -5.626  56.004 60.503 1.00 33.28  ? 150  ILE L N   1 
ATOM   1150 C CA  . ILE A 1 150 ? -5.828  57.192 59.691 1.00 34.21  ? 150  ILE L CA  1 
ATOM   1151 C C   . ILE A 1 150 ? -7.325  57.481 59.794 1.00 34.33  ? 150  ILE L C   1 
ATOM   1152 O O   . ILE A 1 150 ? -8.151  56.628 59.470 1.00 34.40  ? 150  ILE L O   1 
ATOM   1153 C CB  . ILE A 1 150 ? -5.417  56.927 58.223 1.00 35.08  ? 150  ILE L CB  1 
ATOM   1154 C CG1 . ILE A 1 150 ? -4.000  56.348 58.186 1.00 35.31  ? 150  ILE L CG1 1 
ATOM   1155 C CG2 . ILE A 1 150 ? -5.468  58.221 57.425 1.00 34.47  ? 150  ILE L CG2 1 
ATOM   1156 C CD1 . ILE A 1 150 ? -3.483  56.049 56.794 1.00 36.32  ? 150  ILE L CD1 1 
ATOM   1157 N N   . ASP A 1 151 ? -7.669  58.676 60.259 1.00 37.97  ? 151  ASP L N   1 
ATOM   1158 C CA  . ASP A 1 151 ? -9.066  59.050 60.440 1.00 39.17  ? 151  ASP L CA  1 
ATOM   1159 C C   . ASP A 1 151 ? -9.808  57.967 61.224 1.00 40.82  ? 151  ASP L C   1 
ATOM   1160 O O   . ASP A 1 151 ? -10.921 57.572 60.869 1.00 40.67  ? 151  ASP L O   1 
ATOM   1161 C CB  . ASP A 1 151 ? -9.760  59.289 59.094 1.00 33.62  ? 151  ASP L CB  1 
ATOM   1162 C CG  . ASP A 1 151 ? -9.291  60.563 58.410 1.00 34.25  ? 151  ASP L CG  1 
ATOM   1163 O OD1 . ASP A 1 151 ? -8.930  61.530 59.116 1.00 33.20  ? 151  ASP L OD1 1 
ATOM   1164 O OD2 . ASP A 1 151 ? -9.299  60.601 57.161 1.00 35.60  ? 151  ASP L OD2 1 
ATOM   1165 N N   . GLY A 1 152 ? -9.169  57.484 62.287 1.00 46.32  ? 152  GLY L N   1 
ATOM   1166 C CA  . GLY A 1 152 ? -9.772  56.473 63.138 1.00 45.52  ? 152  GLY L CA  1 
ATOM   1167 C C   . GLY A 1 152 ? -9.797  55.049 62.621 1.00 45.64  ? 152  GLY L C   1 
ATOM   1168 O O   . GLY A 1 152 ? -10.167 54.134 63.352 1.00 47.23  ? 152  GLY L O   1 
ATOM   1169 N N   . SER A 1 153 ? -9.403  54.844 61.372 1.00 37.59  ? 153  SER L N   1 
ATOM   1170 C CA  . SER A 1 153 ? -9.413  53.501 60.807 1.00 38.34  ? 153  SER L CA  1 
ATOM   1171 C C   . SER A 1 153 ? -8.006  52.931 60.707 1.00 38.52  ? 153  SER L C   1 
ATOM   1172 O O   . SER A 1 153 ? -7.072  53.628 60.314 1.00 38.41  ? 153  SER L O   1 
ATOM   1173 C CB  . SER A 1 153 ? -10.062 53.521 59.423 1.00 41.86  ? 153  SER L CB  1 
ATOM   1174 O OG  . SER A 1 153 ? -11.351 54.107 59.477 1.00 44.28  ? 153  SER L OG  1 
ATOM   1175 N N   . GLU A 1 154 ? -7.856  51.660 61.060 1.00 41.97  ? 154  GLU L N   1 
ATOM   1176 C CA  . GLU A 1 154 ? -6.553  51.017 61.004 1.00 43.20  ? 154  GLU L CA  1 
ATOM   1177 C C   . GLU A 1 154 ? -6.059  50.848 59.572 1.00 44.12  ? 154  GLU L C   1 
ATOM   1178 O O   . GLU A 1 154 ? -6.808  50.423 58.693 1.00 45.14  ? 154  GLU L O   1 
ATOM   1179 C CB  . GLU A 1 154 ? -6.603  49.646 61.671 1.00 37.41  ? 154  GLU L CB  1 
ATOM   1180 C CG  . GLU A 1 154 ? -5.224  49.069 61.924 1.00 38.28  ? 154  GLU L CG  1 
ATOM   1181 C CD  . GLU A 1 154 ? -5.266  47.645 62.423 1.00 39.85  ? 154  GLU L CD  1 
ATOM   1182 O OE1 . GLU A 1 154 ? -6.256  47.275 63.090 1.00 39.34  ? 154  GLU L OE1 1 
ATOM   1183 O OE2 . GLU A 1 154 ? -4.297  46.898 62.162 1.00 41.68  ? 154  GLU L OE2 1 
ATOM   1184 N N   . ARG A 1 155 ? -4.794  51.187 59.344 1.00 41.65  ? 155  ARG L N   1 
ATOM   1185 C CA  . ARG A 1 155 ? -4.185  51.056 58.024 1.00 41.11  ? 155  ARG L CA  1 
ATOM   1186 C C   . ARG A 1 155 ? -3.114  49.980 58.144 1.00 41.77  ? 155  ARG L C   1 
ATOM   1187 O O   . ARG A 1 155 ? -2.300  50.011 59.065 1.00 42.30  ? 155  ARG L O   1 
ATOM   1188 C CB  . ARG A 1 155 ? -3.550  52.381 57.593 1.00 40.04  ? 155  ARG L CB  1 
ATOM   1189 C CG  . ARG A 1 155 ? -2.967  52.366 56.184 1.00 43.05  ? 155  ARG L CG  1 
ATOM   1190 C CD  . ARG A 1 155 ? -4.043  52.041 55.152 1.00 44.87  ? 155  ARG L CD  1 
ATOM   1191 N NE  . ARG A 1 155 ? -5.059  53.089 55.050 1.00 46.86  ? 155  ARG L NE  1 
ATOM   1192 C CZ  . ARG A 1 155 ? -4.929  54.192 54.318 1.00 47.51  ? 155  ARG L CZ  1 
ATOM   1193 N NH1 . ARG A 1 155 ? -3.822  54.397 53.612 1.00 47.56  ? 155  ARG L NH1 1 
ATOM   1194 N NH2 . ARG A 1 155 ? -5.904  55.091 54.288 1.00 47.38  ? 155  ARG L NH2 1 
ATOM   1195 N N   . GLN A 1 156 ? -3.101  49.030 57.217 1.00 48.08  ? 156  GLN L N   1 
ATOM   1196 C CA  . GLN A 1 156 ? -2.122  47.956 57.298 1.00 47.61  ? 156  GLN L CA  1 
ATOM   1197 C C   . GLN A 1 156 ? -1.113  47.917 56.156 1.00 46.50  ? 156  GLN L C   1 
ATOM   1198 O O   . GLN A 1 156 ? 0.042   47.544 56.362 1.00 46.91  ? 156  GLN L O   1 
ATOM   1199 C CB  . GLN A 1 156 ? -2.854  46.613 57.419 1.00 53.11  ? 156  GLN L CB  1 
ATOM   1200 C CG  . GLN A 1 156 ? -4.038  46.676 58.383 1.00 54.88  ? 156  GLN L CG  1 
ATOM   1201 C CD  . GLN A 1 156 ? -4.334  45.354 59.059 1.00 57.06  ? 156  GLN L CD  1 
ATOM   1202 O OE1 . GLN A 1 156 ? -3.499  44.819 59.789 1.00 58.43  ? 156  GLN L OE1 1 
ATOM   1203 N NE2 . GLN A 1 156 ? -5.529  44.823 58.827 1.00 58.00  ? 156  GLN L NE2 1 
ATOM   1204 N N   . ASN A 1 157 ? -1.531  48.312 54.958 1.00 36.73  ? 157  ASN L N   1 
ATOM   1205 C CA  . ASN A 1 157 ? -0.623  48.297 53.814 1.00 34.66  ? 157  ASN L CA  1 
ATOM   1206 C C   . ASN A 1 157 ? 0.256   49.551 53.750 1.00 31.11  ? 157  ASN L C   1 
ATOM   1207 O O   . ASN A 1 157 ? -0.157  50.640 54.155 1.00 29.75  ? 157  ASN L O   1 
ATOM   1208 C CB  . ASN A 1 157 ? -1.411  48.155 52.503 1.00 70.38  ? 157  ASN L CB  1 
ATOM   1209 C CG  . ASN A 1 157 ? -2.370  46.975 52.518 1.00 73.92  ? 157  ASN L CG  1 
ATOM   1210 O OD1 . ASN A 1 157 ? -2.036  45.890 52.998 1.00 74.47  ? 157  ASN L OD1 1 
ATOM   1211 N ND2 . ASN A 1 157 ? -3.566  47.181 51.977 1.00 75.78  ? 157  ASN L ND2 1 
ATOM   1212 N N   . GLY A 1 158 ? 1.470   49.384 53.237 1.00 23.74  ? 158  GLY L N   1 
ATOM   1213 C CA  . GLY A 1 158 ? 2.391   50.501 53.120 1.00 22.58  ? 158  GLY L CA  1 
ATOM   1214 C C   . GLY A 1 158 ? 3.252   50.733 54.352 1.00 21.69  ? 158  GLY L C   1 
ATOM   1215 O O   . GLY A 1 158 ? 4.011   51.703 54.405 1.00 20.85  ? 158  GLY L O   1 
ATOM   1216 N N   . VAL A 1 159 ? 3.136   49.844 55.336 1.00 26.94  ? 159  VAL L N   1 
ATOM   1217 C CA  . VAL A 1 159 ? 3.889   49.950 56.582 1.00 26.79  ? 159  VAL L CA  1 
ATOM   1218 C C   . VAL A 1 159 ? 5.107   49.029 56.648 1.00 28.88  ? 159  VAL L C   1 
ATOM   1219 O O   . VAL A 1 159 ? 4.983   47.806 56.535 1.00 28.60  ? 159  VAL L O   1 
ATOM   1220 C CB  . VAL A 1 159 ? 3.001   49.622 57.797 1.00 25.44  ? 159  VAL L CB  1 
ATOM   1221 C CG1 . VAL A 1 159 ? 3.812   49.751 59.087 1.00 25.86  ? 159  VAL L CG1 1 
ATOM   1222 C CG2 . VAL A 1 159 ? 1.794   50.542 57.828 1.00 24.85  ? 159  VAL L CG2 1 
ATOM   1223 N N   . LEU A 1 160 ? 6.281   49.625 56.835 1.00 30.04  ? 160  LEU L N   1 
ATOM   1224 C CA  . LEU A 1 160 ? 7.528   48.873 56.960 1.00 30.28  ? 160  LEU L CA  1 
ATOM   1225 C C   . LEU A 1 160 ? 8.116   49.180 58.335 1.00 29.35  ? 160  LEU L C   1 
ATOM   1226 O O   . LEU A 1 160 ? 8.102   50.332 58.777 1.00 27.47  ? 160  LEU L O   1 
ATOM   1227 C CB  . LEU A 1 160 ? 8.522   49.273 55.864 1.00 40.99  ? 160  LEU L CB  1 
ATOM   1228 C CG  . LEU A 1 160 ? 8.219   48.788 54.440 1.00 43.15  ? 160  LEU L CG  1 
ATOM   1229 C CD1 . LEU A 1 160 ? 9.344   49.213 53.513 1.00 44.60  ? 160  LEU L CD1 1 
ATOM   1230 C CD2 . LEU A 1 160 ? 8.068   47.275 54.426 1.00 42.09  ? 160  LEU L CD2 1 
ATOM   1231 N N   . ASN A 1 161 ? 8.618   48.152 59.014 1.00 25.52  ? 161  ASN L N   1 
ATOM   1232 C CA  . ASN A 1 161 ? 9.188   48.330 60.347 1.00 23.74  ? 161  ASN L CA  1 
ATOM   1233 C C   . ASN A 1 161 ? 10.625  47.843 60.453 1.00 24.13  ? 161  ASN L C   1 
ATOM   1234 O O   . ASN A 1 161 ? 11.048  46.948 59.717 1.00 24.26  ? 161  ASN L O   1 
ATOM   1235 C CB  . ASN A 1 161 ? 8.348   47.586 61.382 1.00 23.23  ? 161  ASN L CB  1 
ATOM   1236 C CG  . ASN A 1 161 ? 6.913   48.038 61.401 1.00 24.52  ? 161  ASN L CG  1 
ATOM   1237 O OD1 . ASN A 1 161 ? 6.630   49.237 61.419 1.00 24.14  ? 161  ASN L OD1 1 
ATOM   1238 N ND2 . ASN A 1 161 ? 5.991   47.082 61.412 1.00 21.31  ? 161  ASN L ND2 1 
ATOM   1239 N N   . SER A 1 162 ? 11.365  48.436 61.386 1.00 25.86  ? 162  SER L N   1 
ATOM   1240 C CA  . SER A 1 162 ? 12.757  48.071 61.638 1.00 26.45  ? 162  SER L CA  1 
ATOM   1241 C C   . SER A 1 162 ? 12.985  48.117 63.156 1.00 26.27  ? 162  SER L C   1 
ATOM   1242 O O   . SER A 1 162 ? 12.386  48.941 63.855 1.00 25.36  ? 162  SER L O   1 
ATOM   1243 C CB  . SER A 1 162 ? 13.700  49.046 60.922 1.00 26.86  ? 162  SER L CB  1 
ATOM   1244 O OG  . SER A 1 162 ? 15.054  48.684 61.115 1.00 29.08  ? 162  SER L OG  1 
ATOM   1245 N N   . TRP A 1 163 ? 13.847  47.236 63.659 1.00 20.25  ? 163  TRP L N   1 
ATOM   1246 C CA  . TRP A 1 163 ? 14.132  47.160 65.097 1.00 19.80  ? 163  TRP L CA  1 
ATOM   1247 C C   . TRP A 1 163 ? 15.643  47.160 65.355 1.00 19.07  ? 163  TRP L C   1 
ATOM   1248 O O   . TRP A 1 163 ? 16.384  46.417 64.707 1.00 16.31  ? 163  TRP L O   1 
ATOM   1249 C CB  . TRP A 1 163 ? 13.556  45.862 65.675 1.00 25.47  ? 163  TRP L CB  1 
ATOM   1250 C CG  . TRP A 1 163 ? 12.093  45.641 65.440 1.00 25.85  ? 163  TRP L CG  1 
ATOM   1251 C CD1 . TRP A 1 163 ? 11.076  45.869 66.324 1.00 27.10  ? 163  TRP L CD1 1 
ATOM   1252 C CD2 . TRP A 1 163 ? 11.484  45.125 64.250 1.00 26.56  ? 163  TRP L CD2 1 
ATOM   1253 N NE1 . TRP A 1 163 ? 9.868   45.524 65.757 1.00 27.11  ? 163  TRP L NE1 1 
ATOM   1254 C CE2 . TRP A 1 163 ? 10.090  45.067 64.485 1.00 25.75  ? 163  TRP L CE2 1 
ATOM   1255 C CE3 . TRP A 1 163 ? 11.980  44.705 63.007 1.00 25.54  ? 163  TRP L CE3 1 
ATOM   1256 C CZ2 . TRP A 1 163 ? 9.184   44.605 63.521 1.00 26.99  ? 163  TRP L CZ2 1 
ATOM   1257 C CZ3 . TRP A 1 163 ? 11.078  44.244 62.048 1.00 27.55  ? 163  TRP L CZ3 1 
ATOM   1258 C CH2 . TRP A 1 163 ? 9.695   44.199 62.312 1.00 27.52  ? 163  TRP L CH2 1 
ATOM   1259 N N   . THR A 1 164 ? 16.105  47.970 66.301 1.00 17.28  ? 164  THR L N   1 
ATOM   1260 C CA  . THR A 1 164 ? 17.535  48.003 66.615 1.00 17.77  ? 164  THR L CA  1 
ATOM   1261 C C   . THR A 1 164 ? 17.870  46.826 67.526 1.00 18.23  ? 164  THR L C   1 
ATOM   1262 O O   . THR A 1 164 ? 16.978  46.175 68.062 1.00 16.69  ? 164  THR L O   1 
ATOM   1263 C CB  . THR A 1 164 ? 17.929  49.289 67.369 1.00 17.76  ? 164  THR L CB  1 
ATOM   1264 O OG1 . THR A 1 164 ? 17.134  49.402 68.556 1.00 17.02  ? 164  THR L OG1 1 
ATOM   1265 C CG2 . THR A 1 164 ? 17.714  50.517 66.500 1.00 19.73  ? 164  THR L CG2 1 
ATOM   1266 N N   . ASP A 1 165 ? 19.155  46.536 67.689 1.00 22.99  ? 165  ASP L N   1 
ATOM   1267 C CA  . ASP A 1 165 ? 19.552  45.466 68.596 1.00 23.52  ? 165  ASP L CA  1 
ATOM   1268 C C   . ASP A 1 165 ? 19.618  46.168 69.954 1.00 22.46  ? 165  ASP L C   1 
ATOM   1269 O O   . ASP A 1 165 ? 19.577  47.402 70.011 1.00 19.81  ? 165  ASP L O   1 
ATOM   1270 C CB  . ASP A 1 165 ? 20.925  44.911 68.225 1.00 43.03  ? 165  ASP L CB  1 
ATOM   1271 C CG  . ASP A 1 165 ? 20.950  44.300 66.843 1.00 48.63  ? 165  ASP L CG  1 
ATOM   1272 O OD1 . ASP A 1 165 ? 20.144  43.382 66.575 1.00 52.00  ? 165  ASP L OD1 1 
ATOM   1273 O OD2 . ASP A 1 165 ? 21.780  44.739 66.021 1.00 53.42  ? 165  ASP L OD2 1 
ATOM   1274 N N   . GLN A 1 166 ? 19.715  45.406 71.039 1.00 16.57  ? 166  GLN L N   1 
ATOM   1275 C CA  . GLN A 1 166 ? 19.773  46.006 72.365 1.00 17.55  ? 166  GLN L CA  1 
ATOM   1276 C C   . GLN A 1 166 ? 20.867  47.073 72.440 1.00 18.35  ? 166  GLN L C   1 
ATOM   1277 O O   . GLN A 1 166 ? 21.988  46.864 71.970 1.00 17.93  ? 166  GLN L O   1 
ATOM   1278 C CB  . GLN A 1 166 ? 20.014  44.925 73.417 1.00 18.47  ? 166  GLN L CB  1 
ATOM   1279 C CG  . GLN A 1 166 ? 19.923  45.421 74.851 1.00 16.51  ? 166  GLN L CG  1 
ATOM   1280 C CD  . GLN A 1 166 ? 19.780  44.277 75.836 1.00 17.89  ? 166  GLN L CD  1 
ATOM   1281 O OE1 . GLN A 1 166 ? 20.550  43.313 75.802 1.00 17.50  ? 166  GLN L OE1 1 
ATOM   1282 N NE2 . GLN A 1 166 ? 18.798  44.376 76.722 1.00 14.72  ? 166  GLN L NE2 1 
ATOM   1283 N N   . ASP A 1 167 ? 20.542  48.216 73.037 1.00 19.18  ? 167  ASP L N   1 
ATOM   1284 C CA  . ASP A 1 167 ? 21.506  49.303 73.137 1.00 20.46  ? 167  ASP L CA  1 
ATOM   1285 C C   . ASP A 1 167 ? 22.606  49.015 74.143 1.00 20.61  ? 167  ASP L C   1 
ATOM   1286 O O   . ASP A 1 167 ? 22.338  48.672 75.291 1.00 19.77  ? 167  ASP L O   1 
ATOM   1287 C CB  . ASP A 1 167 ? 20.801  50.609 73.499 1.00 22.56  ? 167  ASP L CB  1 
ATOM   1288 C CG  . ASP A 1 167 ? 21.731  51.792 73.449 1.00 22.33  ? 167  ASP L CG  1 
ATOM   1289 O OD1 . ASP A 1 167 ? 22.354  52.103 74.483 1.00 22.18  ? 167  ASP L OD1 1 
ATOM   1290 O OD2 . ASP A 1 167 ? 21.856  52.400 72.363 1.00 27.37  ? 167  ASP L OD2 1 
ATOM   1291 N N   . SER A 1 168 ? 23.850  49.170 73.709 1.00 21.90  ? 168  SER L N   1 
ATOM   1292 C CA  . SER A 1 168 ? 24.987  48.898 74.579 1.00 24.08  ? 168  SER L CA  1 
ATOM   1293 C C   . SER A 1 168 ? 25.096  49.848 75.770 1.00 23.43  ? 168  SER L C   1 
ATOM   1294 O O   . SER A 1 168 ? 25.816  49.566 76.721 1.00 24.51  ? 168  SER L O   1 
ATOM   1295 C CB  . SER A 1 168 ? 26.283  48.941 73.769 1.00 26.51  ? 168  SER L CB  1 
ATOM   1296 O OG  . SER A 1 168 ? 26.494  50.230 73.222 1.00 30.94  ? 168  SER L OG  1 
ATOM   1297 N N   . LYS A 1 169 ? 24.369  50.960 75.727 1.00 23.50  ? 169  LYS L N   1 
ATOM   1298 C CA  . LYS A 1 169 ? 24.415  51.944 76.805 1.00 23.16  ? 169  LYS L CA  1 
ATOM   1299 C C   . LYS A 1 169 ? 23.323  51.823 77.862 1.00 21.26  ? 169  LYS L C   1 
ATOM   1300 O O   . LYS A 1 169 ? 23.617  51.875 79.054 1.00 20.32  ? 169  LYS L O   1 
ATOM   1301 C CB  . LYS A 1 169 ? 24.391  53.356 76.221 1.00 58.38  ? 169  LYS L CB  1 
ATOM   1302 C CG  . LYS A 1 169 ? 25.640  53.726 75.445 1.00 63.30  ? 169  LYS L CG  1 
ATOM   1303 C CD  . LYS A 1 169 ? 25.448  55.043 74.718 1.00 67.23  ? 169  LYS L CD  1 
ATOM   1304 C CE  . LYS A 1 169 ? 26.771  55.619 74.255 1.00 71.05  ? 169  LYS L CE  1 
ATOM   1305 N NZ  . LYS A 1 169 ? 27.632  55.986 75.414 1.00 72.78  ? 169  LYS L NZ  1 
ATOM   1306 N N   . ASP A 1 170 ? 22.066  51.677 77.444 1.00 18.49  ? 170  ASP L N   1 
ATOM   1307 C CA  . ASP A 1 170 ? 20.976  51.565 78.419 1.00 15.02  ? 170  ASP L CA  1 
ATOM   1308 C C   . ASP A 1 170 ? 20.239  50.237 78.371 1.00 12.64  ? 170  ASP L C   1 
ATOM   1309 O O   . ASP A 1 170 ? 19.266  50.036 79.096 1.00 16.51  ? 170  ASP L O   1 
ATOM   1310 C CB  . ASP A 1 170 ? 19.968  52.713 78.247 1.00 20.70  ? 170  ASP L CB  1 
ATOM   1311 C CG  . ASP A 1 170 ? 19.307  52.725 76.870 1.00 22.20  ? 170  ASP L CG  1 
ATOM   1312 O OD1 . ASP A 1 170 ? 19.242  51.666 76.205 1.00 18.48  ? 170  ASP L OD1 1 
ATOM   1313 O OD2 . ASP A 1 170 ? 18.834  53.806 76.465 1.00 24.27  ? 170  ASP L OD2 1 
ATOM   1314 N N   . SER A 1 171 ? 20.699  49.334 77.514 1.00 12.31  ? 171  SER L N   1 
ATOM   1315 C CA  . SER A 1 171 ? 20.087  48.019 77.375 1.00 12.21  ? 171  SER L CA  1 
ATOM   1316 C C   . SER A 1 171 ? 18.628  48.028 76.915 1.00 12.18  ? 171  SER L C   1 
ATOM   1317 O O   . SER A 1 171 ? 17.904  47.053 77.142 1.00 12.47  ? 171  SER L O   1 
ATOM   1318 C CB  . SER A 1 171 ? 20.190  47.249 78.696 1.00 17.36  ? 171  SER L CB  1 
ATOM   1319 O OG  . SER A 1 171 ? 21.539  46.950 79.011 1.00 20.66  ? 171  SER L OG  1 
ATOM   1320 N N   . THR A 1 172 ? 18.184  49.114 76.282 1.00 15.31  ? 172  THR L N   1 
ATOM   1321 C CA  . THR A 1 172 ? 16.806  49.178 75.788 1.00 16.95  ? 172  THR L CA  1 
ATOM   1322 C C   . THR A 1 172 ? 16.766  48.827 74.307 1.00 18.80  ? 172  THR L C   1 
ATOM   1323 O O   . THR A 1 172 ? 17.799  48.622 73.676 1.00 19.98  ? 172  THR L O   1 
ATOM   1324 C CB  . THR A 1 172 ? 16.178  50.591 75.935 1.00 16.16  ? 172  THR L CB  1 
ATOM   1325 O OG1 . THR A 1 172 ? 16.872  51.523 75.093 1.00 14.56  ? 172  THR L OG1 1 
ATOM   1326 C CG2 . THR A 1 172 ? 16.234  51.056 77.378 1.00 14.99  ? 172  THR L CG2 1 
ATOM   1327 N N   . TYR A 1 173 ? 15.558  48.776 73.761 1.00 21.52  ? 173  TYR L N   1 
ATOM   1328 C CA  . TYR A 1 173 ? 15.342  48.477 72.351 1.00 21.74  ? 173  TYR L CA  1 
ATOM   1329 C C   . TYR A 1 173 ? 14.635  49.681 71.733 1.00 20.79  ? 173  TYR L C   1 
ATOM   1330 O O   . TYR A 1 173 ? 14.124  50.528 72.453 1.00 20.98  ? 173  TYR L O   1 
ATOM   1331 C CB  . TYR A 1 173 ? 14.474  47.219 72.218 1.00 17.95  ? 173  TYR L CB  1 
ATOM   1332 C CG  . TYR A 1 173 ? 15.206  45.959 72.622 1.00 21.48  ? 173  TYR L CG  1 
ATOM   1333 C CD1 . TYR A 1 173 ? 16.009  45.276 71.706 1.00 21.06  ? 173  TYR L CD1 1 
ATOM   1334 C CD2 . TYR A 1 173 ? 15.164  45.495 73.939 1.00 20.98  ? 173  TYR L CD2 1 
ATOM   1335 C CE1 . TYR A 1 173 ? 16.754  44.169 72.089 1.00 20.37  ? 173  TYR L CE1 1 
ATOM   1336 C CE2 . TYR A 1 173 ? 15.910  44.389 74.337 1.00 20.97  ? 173  TYR L CE2 1 
ATOM   1337 C CZ  . TYR A 1 173 ? 16.705  43.732 73.406 1.00 23.07  ? 173  TYR L CZ  1 
ATOM   1338 O OH  . TYR A 1 173 ? 17.469  42.657 73.795 1.00 19.24  ? 173  TYR L OH  1 
ATOM   1339 N N   . SER A 1 174 ? 14.628  49.761 70.408 1.00 19.73  ? 174  SER L N   1 
ATOM   1340 C CA  . SER A 1 174 ? 13.961  50.850 69.696 1.00 19.79  ? 174  SER L CA  1 
ATOM   1341 C C   . SER A 1 174 ? 13.379  50.307 68.405 1.00 21.20  ? 174  SER L C   1 
ATOM   1342 O O   . SER A 1 174 ? 13.895  49.347 67.836 1.00 22.30  ? 174  SER L O   1 
ATOM   1343 C CB  . SER A 1 174 ? 14.938  51.985 69.361 1.00 20.52  ? 174  SER L CB  1 
ATOM   1344 O OG  . SER A 1 174 ? 15.224  52.791 70.491 1.00 19.38  ? 174  SER L OG  1 
ATOM   1345 N N   . MET A 1 175 ? 12.308  50.927 67.936 1.00 21.22  ? 175  MET L N   1 
ATOM   1346 C CA  . MET A 1 175 ? 11.672  50.487 66.709 1.00 22.60  ? 175  MET L CA  1 
ATOM   1347 C C   . MET A 1 175 ? 11.208  51.681 65.892 1.00 22.68  ? 175  MET L C   1 
ATOM   1348 O O   . MET A 1 175 ? 10.778  52.697 66.451 1.00 23.72  ? 175  MET L O   1 
ATOM   1349 C CB  . MET A 1 175 ? 10.469  49.597 67.035 1.00 22.36  ? 175  MET L CB  1 
ATOM   1350 C CG  . MET A 1 175 ? 9.564   49.330 65.847 1.00 24.15  ? 175  MET L CG  1 
ATOM   1351 S SD  . MET A 1 175 ? 8.104   48.389 66.297 1.00 27.79  ? 175  MET L SD  1 
ATOM   1352 C CE  . MET A 1 175 ? 7.548   47.816 64.710 1.00 26.24  ? 175  MET L CE  1 
ATOM   1353 N N   . SER A 1 176 ? 11.313  51.572 64.572 1.00 17.39  ? 176  SER L N   1 
ATOM   1354 C CA  . SER A 1 176 ? 10.854  52.646 63.699 1.00 19.30  ? 176  SER L CA  1 
ATOM   1355 C C   . SER A 1 176 ? 9.770   52.060 62.812 1.00 20.64  ? 176  SER L C   1 
ATOM   1356 O O   . SER A 1 176 ? 9.898   50.929 62.335 1.00 22.60  ? 176  SER L O   1 
ATOM   1357 C CB  . SER A 1 176 ? 11.983  53.167 62.819 1.00 17.67  ? 176  SER L CB  1 
ATOM   1358 O OG  . SER A 1 176 ? 12.233  52.261 61.762 1.00 22.86  ? 176  SER L OG  1 
ATOM   1359 N N   . SER A 1 177 ? 8.700   52.818 62.600 1.00 20.40  ? 177  SER L N   1 
ATOM   1360 C CA  . SER A 1 177 ? 7.612   52.354 61.755 1.00 19.58  ? 177  SER L CA  1 
ATOM   1361 C C   . SER A 1 177 ? 7.292   53.427 60.726 1.00 21.12  ? 177  SER L C   1 
ATOM   1362 O O   . SER A 1 177 ? 6.968   54.567 61.076 1.00 20.61  ? 177  SER L O   1 
ATOM   1363 C CB  . SER A 1 177 ? 6.380   52.047 62.600 1.00 22.64  ? 177  SER L CB  1 
ATOM   1364 O OG  . SER A 1 177 ? 5.383   51.424 61.814 1.00 20.64  ? 177  SER L OG  1 
ATOM   1365 N N   . THR A 1 178 ? 7.374   53.058 59.454 1.00 20.55  ? 178  THR L N   1 
ATOM   1366 C CA  . THR A 1 178 ? 7.127   54.004 58.376 1.00 21.47  ? 178  THR L CA  1 
ATOM   1367 C C   . THR A 1 178 ? 5.961   53.625 57.473 1.00 21.23  ? 178  THR L C   1 
ATOM   1368 O O   . THR A 1 178 ? 5.928   52.532 56.904 1.00 21.31  ? 178  THR L O   1 
ATOM   1369 C CB  . THR A 1 178 ? 8.378   54.148 57.494 1.00 26.79  ? 178  THR L CB  1 
ATOM   1370 O OG1 . THR A 1 178 ? 9.525   54.356 58.327 1.00 27.04  ? 178  THR L OG1 1 
ATOM   1371 C CG2 . THR A 1 178 ? 8.227   55.324 56.536 1.00 25.53  ? 178  THR L CG2 1 
ATOM   1372 N N   . LEU A 1 179 ? 5.008   54.540 57.347 1.00 19.89  ? 179  LEU L N   1 
ATOM   1373 C CA  . LEU A 1 179 ? 3.849   54.342 56.487 1.00 21.04  ? 179  LEU L CA  1 
ATOM   1374 C C   . LEU A 1 179 ? 4.093   55.219 55.259 1.00 23.02  ? 179  LEU L C   1 
ATOM   1375 O O   . LEU A 1 179 ? 4.151   56.446 55.372 1.00 21.62  ? 179  LEU L O   1 
ATOM   1376 C CB  . LEU A 1 179 ? 2.570   54.793 57.197 1.00 23.94  ? 179  LEU L CB  1 
ATOM   1377 C CG  . LEU A 1 179 ? 1.307   54.904 56.332 1.00 23.73  ? 179  LEU L CG  1 
ATOM   1378 C CD1 . LEU A 1 179 ? 0.913   53.534 55.806 1.00 23.46  ? 179  LEU L CD1 1 
ATOM   1379 C CD2 . LEU A 1 179 ? 0.178   55.511 57.157 1.00 23.04  ? 179  LEU L CD2 1 
ATOM   1380 N N   . THR A 1 180 ? 4.266   54.595 54.097 1.00 31.13  ? 180  THR L N   1 
ATOM   1381 C CA  . THR A 1 180 ? 4.508   55.351 52.876 1.00 34.44  ? 180  THR L CA  1 
ATOM   1382 C C   . THR A 1 180 ? 3.237   55.481 52.052 1.00 35.44  ? 180  THR L C   1 
ATOM   1383 O O   . THR A 1 180 ? 2.571   54.494 51.747 1.00 36.90  ? 180  THR L O   1 
ATOM   1384 C CB  . THR A 1 180 ? 5.604   54.699 52.003 1.00 36.61  ? 180  THR L CB  1 
ATOM   1385 O OG1 . THR A 1 180 ? 6.858   54.742 52.695 1.00 37.26  ? 180  THR L OG1 1 
ATOM   1386 C CG2 . THR A 1 180 ? 5.743   55.446 50.676 1.00 36.83  ? 180  THR L CG2 1 
ATOM   1387 N N   . LEU A 1 181 ? 2.911   56.717 51.704 1.00 27.84  ? 181  LEU L N   1 
ATOM   1388 C CA  . LEU A 1 181 ? 1.728   57.011 50.917 1.00 27.86  ? 181  LEU L CA  1 
ATOM   1389 C C   . LEU A 1 181 ? 2.103   57.952 49.790 1.00 28.95  ? 181  LEU L C   1 
ATOM   1390 O O   . LEU A 1 181 ? 3.198   58.529 49.784 1.00 27.17  ? 181  LEU L O   1 
ATOM   1391 C CB  . LEU A 1 181 ? 0.674   57.702 51.781 1.00 36.64  ? 181  LEU L CB  1 
ATOM   1392 C CG  . LEU A 1 181 ? 0.158   56.969 53.013 1.00 38.50  ? 181  LEU L CG  1 
ATOM   1393 C CD1 . LEU A 1 181 ? -0.812  57.867 53.761 1.00 37.76  ? 181  LEU L CD1 1 
ATOM   1394 C CD2 . LEU A 1 181 ? -0.516  55.673 52.589 1.00 39.72  ? 181  LEU L CD2 1 
ATOM   1395 N N   . THR A 1 182 ? 1.189   58.098 48.835 1.00 32.18  ? 182  THR L N   1 
ATOM   1396 C CA  . THR A 1 182 ? 1.396   59.018 47.730 1.00 33.23  ? 182  THR L CA  1 
ATOM   1397 C C   . THR A 1 182 ? 0.948   60.349 48.317 1.00 33.30  ? 182  THR L C   1 
ATOM   1398 O O   . THR A 1 182 ? 0.297   60.379 49.361 1.00 30.70  ? 182  THR L O   1 
ATOM   1399 C CB  . THR A 1 182 ? 0.484   58.697 46.531 1.00 35.17  ? 182  THR L CB  1 
ATOM   1400 O OG1 . THR A 1 182 ? -0.887  58.835 46.926 1.00 35.90  ? 182  THR L OG1 1 
ATOM   1401 C CG2 . THR A 1 182 ? 0.725   57.283 46.041 1.00 34.98  ? 182  THR L CG2 1 
ATOM   1402 N N   . LYS A 1 183 ? 1.288   61.444 47.650 1.00 30.88  ? 183  LYS L N   1 
ATOM   1403 C CA  . LYS A 1 183 ? 0.902   62.762 48.126 1.00 30.59  ? 183  LYS L CA  1 
ATOM   1404 C C   . LYS A 1 183 ? -0.618  62.904 48.130 1.00 30.56  ? 183  LYS L C   1 
ATOM   1405 O O   . LYS A 1 183 ? -1.190  63.465 49.063 1.00 28.99  ? 183  LYS L O   1 
ATOM   1406 C CB  . LYS A 1 183 ? 1.527   63.836 47.234 1.00 43.80  ? 183  LYS L CB  1 
ATOM   1407 C CG  . LYS A 1 183 ? 1.271   65.269 47.672 1.00 44.98  ? 183  LYS L CG  1 
ATOM   1408 C CD  . LYS A 1 183 ? 1.759   66.234 46.604 1.00 46.63  ? 183  LYS L CD  1 
ATOM   1409 C CE  . LYS A 1 183 ? 1.549   67.680 47.004 1.00 49.00  ? 183  LYS L CE  1 
ATOM   1410 N NZ  . LYS A 1 183 ? 2.400   68.058 48.164 1.00 52.34  ? 183  LYS L NZ  1 
ATOM   1411 N N   . ASP A 1 184 ? -1.270  62.397 47.084 1.00 36.11  ? 184  ASP L N   1 
ATOM   1412 C CA  . ASP A 1 184 ? -2.726  62.483 46.981 1.00 36.53  ? 184  ASP L CA  1 
ATOM   1413 C C   . ASP A 1 184 ? -3.372  61.669 48.081 1.00 36.94  ? 184  ASP L C   1 
ATOM   1414 O O   . ASP A 1 184 ? -4.300  62.130 48.749 1.00 36.87  ? 184  ASP L O   1 
ATOM   1415 C CB  . ASP A 1 184 ? -3.227  61.949 45.634 1.00 41.16  ? 184  ASP L CB  1 
ATOM   1416 C CG  . ASP A 1 184 ? -2.687  62.725 44.451 1.00 42.06  ? 184  ASP L CG  1 
ATOM   1417 O OD1 . ASP A 1 184 ? -2.565  63.963 44.552 1.00 40.70  ? 184  ASP L OD1 1 
ATOM   1418 O OD2 . ASP A 1 184 ? -2.402  62.090 43.411 1.00 43.05  ? 184  ASP L OD2 1 
ATOM   1419 N N   . GLU A 1 185 ? -2.886  60.445 48.249 1.00 34.43  ? 185  GLU L N   1 
ATOM   1420 C CA  . GLU A 1 185 ? -3.405  59.546 49.269 1.00 35.93  ? 185  GLU L CA  1 
ATOM   1421 C C   . GLU A 1 185 ? -3.303  60.199 50.644 1.00 33.98  ? 185  GLU L C   1 
ATOM   1422 O O   . GLU A 1 185 ? -4.282  60.244 51.386 1.00 35.25  ? 185  GLU L O   1 
ATOM   1423 C CB  . GLU A 1 185 ? -2.624  58.228 49.240 1.00 92.42  ? 185  GLU L CB  1 
ATOM   1424 C CG  . GLU A 1 185 ? -2.869  57.304 50.424 1.00 100.12 ? 185  GLU L CG  1 
ATOM   1425 C CD  . GLU A 1 185 ? -4.322  56.904 50.578 1.00 103.75 ? 185  GLU L CD  1 
ATOM   1426 O OE1 . GLU A 1 185 ? -4.904  56.365 49.613 1.00 107.34 ? 185  GLU L OE1 1 
ATOM   1427 O OE2 . GLU A 1 185 ? -4.882  57.122 51.673 1.00 105.41 ? 185  GLU L OE2 1 
ATOM   1428 N N   . TYR A 1 186 ? -2.125  60.726 50.964 1.00 31.95  ? 186  TYR L N   1 
ATOM   1429 C CA  . TYR A 1 186 ? -1.880  61.373 52.253 1.00 30.59  ? 186  TYR L CA  1 
ATOM   1430 C C   . TYR A 1 186 ? -2.776  62.577 52.510 1.00 31.02  ? 186  TYR L C   1 
ATOM   1431 O O   . TYR A 1 186 ? -3.194  62.820 53.644 1.00 30.58  ? 186  TYR L O   1 
ATOM   1432 C CB  . TYR A 1 186 ? -0.408  61.806 52.359 1.00 26.68  ? 186  TYR L CB  1 
ATOM   1433 C CG  . TYR A 1 186 ? -0.089  62.678 53.563 1.00 24.31  ? 186  TYR L CG  1 
ATOM   1434 C CD1 . TYR A 1 186 ? 0.259   64.018 53.407 1.00 22.49  ? 186  TYR L CD1 1 
ATOM   1435 C CD2 . TYR A 1 186 ? -0.147  62.164 54.861 1.00 26.10  ? 186  TYR L CD2 1 
ATOM   1436 C CE1 . TYR A 1 186 ? 0.544   64.829 54.509 1.00 21.64  ? 186  TYR L CE1 1 
ATOM   1437 C CE2 . TYR A 1 186 ? 0.131   62.968 55.976 1.00 22.69  ? 186  TYR L CE2 1 
ATOM   1438 C CZ  . TYR A 1 186 ? 0.476   64.297 55.792 1.00 23.74  ? 186  TYR L CZ  1 
ATOM   1439 O OH  . TYR A 1 186 ? 0.750   65.095 56.887 1.00 21.01  ? 186  TYR L OH  1 
ATOM   1440 N N   . GLU A 1 187 ? -3.067  63.337 51.462 1.00 31.41  ? 187  GLU L N   1 
ATOM   1441 C CA  . GLU A 1 187 ? -3.898  64.522 51.614 1.00 33.51  ? 187  GLU L CA  1 
ATOM   1442 C C   . GLU A 1 187 ? -5.401  64.249 51.606 1.00 34.17  ? 187  GLU L C   1 
ATOM   1443 O O   . GLU A 1 187 ? -6.200  65.169 51.757 1.00 35.40  ? 187  GLU L O   1 
ATOM   1444 C CB  . GLU A 1 187 ? -3.514  65.552 50.546 1.00 38.73  ? 187  GLU L CB  1 
ATOM   1445 C CG  . GLU A 1 187 ? -2.172  66.217 50.847 1.00 41.04  ? 187  GLU L CG  1 
ATOM   1446 C CD  . GLU A 1 187 ? -1.598  66.996 49.677 1.00 42.45  ? 187  GLU L CD  1 
ATOM   1447 O OE1 . GLU A 1 187 ? -0.621  67.749 49.892 1.00 41.70  ? 187  GLU L OE1 1 
ATOM   1448 O OE2 . GLU A 1 187 ? -2.111  66.851 48.546 1.00 42.49  ? 187  GLU L OE2 1 
ATOM   1449 N N   . ARG A 1 188 ? -5.781  62.985 51.441 1.00 40.88  ? 188  ARG L N   1 
ATOM   1450 C CA  . ARG A 1 188 ? -7.190  62.599 51.448 1.00 41.91  ? 188  ARG L CA  1 
ATOM   1451 C C   . ARG A 1 188 ? -7.651  62.376 52.880 1.00 42.38  ? 188  ARG L C   1 
ATOM   1452 O O   . ARG A 1 188 ? -8.841  62.186 53.131 1.00 43.20  ? 188  ARG L O   1 
ATOM   1453 C CB  . ARG A 1 188 ? -7.409  61.294 50.679 1.00 51.13  ? 188  ARG L CB  1 
ATOM   1454 C CG  . ARG A 1 188 ? -7.293  61.396 49.177 1.00 54.65  ? 188  ARG L CG  1 
ATOM   1455 C CD  . ARG A 1 188 ? -7.223  60.014 48.562 1.00 55.31  ? 188  ARG L CD  1 
ATOM   1456 N NE  . ARG A 1 188 ? -6.797  60.075 47.168 1.00 59.51  ? 188  ARG L NE  1 
ATOM   1457 C CZ  . ARG A 1 188 ? -6.353  59.032 46.475 1.00 60.10  ? 188  ARG L CZ  1 
ATOM   1458 N NH1 . ARG A 1 188 ? -6.276  57.837 47.047 1.00 59.70  ? 188  ARG L NH1 1 
ATOM   1459 N NH2 . ARG A 1 188 ? -5.979  59.186 45.212 1.00 60.74  ? 188  ARG L NH2 1 
ATOM   1460 N N   . HIS A 1 189 ? -6.709  62.392 53.817 1.00 40.00  ? 189  HIS L N   1 
ATOM   1461 C CA  . HIS A 1 189 ? -7.036  62.159 55.220 1.00 38.40  ? 189  HIS L CA  1 
ATOM   1462 C C   . HIS A 1 189 ? -6.502  63.230 56.167 1.00 37.25  ? 189  HIS L C   1 
ATOM   1463 O O   . HIS A 1 189 ? -5.574  63.969 55.832 1.00 36.73  ? 189  HIS L O   1 
ATOM   1464 C CB  . HIS A 1 189 ? -6.533  60.777 55.620 1.00 41.76  ? 189  HIS L CB  1 
ATOM   1465 C CG  . HIS A 1 189 ? -7.133  59.669 54.809 1.00 44.10  ? 189  HIS L CG  1 
ATOM   1466 N ND1 . HIS A 1 189 ? -8.444  59.268 54.952 1.00 44.93  ? 189  HIS L ND1 1 
ATOM   1467 C CD2 . HIS A 1 189 ? -6.612  58.905 53.820 1.00 44.49  ? 189  HIS L CD2 1 
ATOM   1468 C CE1 . HIS A 1 189 ? -8.705  58.305 54.086 1.00 45.27  ? 189  HIS L CE1 1 
ATOM   1469 N NE2 . HIS A 1 189 ? -7.611  58.066 53.387 1.00 45.37  ? 189  HIS L NE2 1 
ATOM   1470 N N   . ASN A 1 190 ? -7.088  63.300 57.358 1.00 33.26  ? 190  ASN L N   1 
ATOM   1471 C CA  . ASN A 1 190 ? -6.711  64.310 58.336 1.00 33.62  ? 190  ASN L CA  1 
ATOM   1472 C C   . ASN A 1 190 ? -5.849  63.856 59.519 1.00 31.94  ? 190  ASN L C   1 
ATOM   1473 O O   . ASN A 1 190 ? -4.741  64.361 59.717 1.00 29.65  ? 190  ASN L O   1 
ATOM   1474 C CB  . ASN A 1 190 ? -7.975  64.978 58.881 1.00 52.63  ? 190  ASN L CB  1 
ATOM   1475 C CG  . ASN A 1 190 ? -7.672  66.200 59.725 1.00 55.80  ? 190  ASN L CG  1 
ATOM   1476 O OD1 . ASN A 1 190 ? -8.507  66.645 60.513 1.00 58.79  ? 190  ASN L OD1 1 
ATOM   1477 N ND2 . ASN A 1 190 ? -6.478  66.762 59.554 1.00 56.52  ? 190  ASN L ND2 1 
ATOM   1478 N N   . SER A 1 191 ? -6.365  62.920 60.311 1.00 29.84  ? 191  SER L N   1 
ATOM   1479 C CA  . SER A 1 191 ? -5.651  62.447 61.491 1.00 28.90  ? 191  SER L CA  1 
ATOM   1480 C C   . SER A 1 191 ? -4.816  61.194 61.280 1.00 26.30  ? 191  SER L C   1 
ATOM   1481 O O   . SER A 1 191 ? -5.308  60.181 60.784 1.00 25.39  ? 191  SER L O   1 
ATOM   1482 C CB  . SER A 1 191 ? -6.638  62.183 62.627 1.00 37.57  ? 191  SER L CB  1 
ATOM   1483 O OG  . SER A 1 191 ? -7.452  61.061 62.323 1.00 40.12  ? 191  SER L OG  1 
ATOM   1484 N N   . TYR A 1 192 ? -3.551  61.275 61.679 1.00 25.57  ? 192  TYR L N   1 
ATOM   1485 C CA  . TYR A 1 192 ? -2.631  60.151 61.574 1.00 23.00  ? 192  TYR L CA  1 
ATOM   1486 C C   . TYR A 1 192 ? -2.180  59.777 62.980 1.00 21.74  ? 192  TYR L C   1 
ATOM   1487 O O   . TYR A 1 192 ? -1.688  60.624 63.730 1.00 16.98  ? 192  TYR L O   1 
ATOM   1488 C CB  . TYR A 1 192 ? -1.436  60.523 60.697 1.00 20.90  ? 192  TYR L CB  1 
ATOM   1489 C CG  . TYR A 1 192 ? -1.811  60.649 59.241 1.00 21.40  ? 192  TYR L CG  1 
ATOM   1490 C CD1 . TYR A 1 192 ? -2.428  61.800 58.753 1.00 22.75  ? 192  TYR L CD1 1 
ATOM   1491 C CD2 . TYR A 1 192 ? -1.611  59.588 58.364 1.00 21.94  ? 192  TYR L CD2 1 
ATOM   1492 C CE1 . TYR A 1 192 ? -2.842  61.883 57.421 1.00 23.94  ? 192  TYR L CE1 1 
ATOM   1493 C CE2 . TYR A 1 192 ? -2.016  59.659 57.038 1.00 24.46  ? 192  TYR L CE2 1 
ATOM   1494 C CZ  . TYR A 1 192 ? -2.633  60.806 56.574 1.00 24.65  ? 192  TYR L CZ  1 
ATOM   1495 O OH  . TYR A 1 192 ? -3.046  60.854 55.264 1.00 28.55  ? 192  TYR L OH  1 
ATOM   1496 N N   . THR A 1 193 ? -2.353  58.505 63.328 1.00 22.93  ? 193  THR L N   1 
ATOM   1497 C CA  . THR A 1 193 ? -2.009  58.021 64.656 1.00 21.96  ? 193  THR L CA  1 
ATOM   1498 C C   . THR A 1 193 ? -1.150  56.759 64.692 1.00 23.02  ? 193  THR L C   1 
ATOM   1499 O O   . THR A 1 193 ? -1.411  55.791 63.976 1.00 24.80  ? 193  THR L O   1 
ATOM   1500 C CB  . THR A 1 193 ? -3.290  57.739 65.460 1.00 18.61  ? 193  THR L CB  1 
ATOM   1501 O OG1 . THR A 1 193 ? -4.079  58.932 65.528 1.00 19.22  ? 193  THR L OG1 1 
ATOM   1502 C CG2 . THR A 1 193 ? -2.949  57.272 66.870 1.00 17.95  ? 193  THR L CG2 1 
ATOM   1503 N N   . CYS A 1 194 ? -0.136  56.787 65.554 1.00 19.39  ? 194  CYS L N   1 
ATOM   1504 C CA  . CYS A 1 194 ? 0.777   55.670 65.762 1.00 19.11  ? 194  CYS L CA  1 
ATOM   1505 C C   . CYS A 1 194 ? 0.495   55.127 67.161 1.00 19.47  ? 194  CYS L C   1 
ATOM   1506 O O   . CYS A 1 194 ? 0.565   55.875 68.141 1.00 20.34  ? 194  CYS L O   1 
ATOM   1507 C CB  . CYS A 1 194 ? 2.227   56.159 65.694 1.00 27.48  ? 194  CYS L CB  1 
ATOM   1508 S SG  . CYS A 1 194 ? 3.480   54.849 65.883 1.00 29.42  ? 194  CYS L SG  1 
ATOM   1509 N N   . GLU A 1 195 ? 0.176   53.840 67.267 1.00 21.63  ? 195  GLU L N   1 
ATOM   1510 C CA  . GLU A 1 195 ? -0.104  53.247 68.576 1.00 22.10  ? 195  GLU L CA  1 
ATOM   1511 C C   . GLU A 1 195 ? 0.783   52.049 68.876 1.00 20.55  ? 195  GLU L C   1 
ATOM   1512 O O   . GLU A 1 195 ? 0.839   51.099 68.096 1.00 21.08  ? 195  GLU L O   1 
ATOM   1513 C CB  . GLU A 1 195 ? -1.555  52.772 68.674 1.00 22.95  ? 195  GLU L CB  1 
ATOM   1514 C CG  . GLU A 1 195 ? -2.613  53.789 68.334 1.00 25.09  ? 195  GLU L CG  1 
ATOM   1515 C CD  . GLU A 1 195 ? -4.005  53.259 68.620 1.00 25.73  ? 195  GLU L CD  1 
ATOM   1516 O OE1 . GLU A 1 195 ? -4.181  52.022 68.602 1.00 26.09  ? 195  GLU L OE1 1 
ATOM   1517 O OE2 . GLU A 1 195 ? -4.922  54.072 68.852 1.00 27.90  ? 195  GLU L OE2 1 
ATOM   1518 N N   . ALA A 1 196 ? 1.464   52.082 70.014 1.00 20.43  ? 196  ALA L N   1 
ATOM   1519 C CA  . ALA A 1 196 ? 2.306   50.958 70.400 1.00 18.82  ? 196  ALA L CA  1 
ATOM   1520 C C   . ALA A 1 196 ? 1.598   50.135 71.468 1.00 18.97  ? 196  ALA L C   1 
ATOM   1521 O O   . ALA A 1 196 ? 0.865   50.660 72.311 1.00 20.07  ? 196  ALA L O   1 
ATOM   1522 C CB  . ALA A 1 196 ? 3.647   51.444 70.931 1.00 14.63  ? 196  ALA L CB  1 
ATOM   1523 N N   . THR A 1 197 ? 1.815   48.831 71.415 1.00 15.99  ? 197  THR L N   1 
ATOM   1524 C CA  . THR A 1 197 ? 1.246   47.917 72.387 1.00 16.76  ? 197  THR L CA  1 
ATOM   1525 C C   . THR A 1 197 ? 2.483   47.306 73.012 1.00 17.02  ? 197  THR L C   1 
ATOM   1526 O O   . THR A 1 197 ? 3.277   46.659 72.322 1.00 16.52  ? 197  THR L O   1 
ATOM   1527 C CB  . THR A 1 197 ? 0.377   46.826 71.706 1.00 26.09  ? 197  THR L CB  1 
ATOM   1528 O OG1 . THR A 1 197 ? -0.798  47.444 71.168 1.00 25.89  ? 197  THR L OG1 1 
ATOM   1529 C CG2 . THR A 1 197 ? -0.044  45.740 72.709 1.00 24.01  ? 197  THR L CG2 1 
ATOM   1530 N N   . HIS A 1 198 ? 2.650   47.527 74.312 1.00 20.03  ? 198  HIS L N   1 
ATOM   1531 C CA  . HIS A 1 198 ? 3.802   47.035 75.039 1.00 19.23  ? 198  HIS L CA  1 
ATOM   1532 C C   . HIS A 1 198 ? 3.325   46.527 76.409 1.00 19.27  ? 198  HIS L C   1 
ATOM   1533 O O   . HIS A 1 198 ? 2.264   46.923 76.875 1.00 21.53  ? 198  HIS L O   1 
ATOM   1534 C CB  . HIS A 1 198 ? 4.789   48.182 75.189 1.00 17.87  ? 198  HIS L CB  1 
ATOM   1535 C CG  . HIS A 1 198 ? 6.132   47.767 75.712 1.00 16.14  ? 198  HIS L CG  1 
ATOM   1536 N ND1 . HIS A 1 198 ? 6.556   48.064 76.988 1.00 15.48  ? 198  HIS L ND1 1 
ATOM   1537 C CD2 . HIS A 1 198 ? 7.145   47.074 75.132 1.00 13.55  ? 198  HIS L CD2 1 
ATOM   1538 C CE1 . HIS A 1 198 ? 7.773   47.575 77.175 1.00 14.54  ? 198  HIS L CE1 1 
ATOM   1539 N NE2 . HIS A 1 198 ? 8.153   46.970 76.066 1.00 16.93  ? 198  HIS L NE2 1 
ATOM   1540 N N   . LYS A 1 199 ? 4.098   45.663 77.057 1.00 14.69  ? 199  LYS L N   1 
ATOM   1541 C CA  . LYS A 1 199 ? 3.679   45.118 78.346 1.00 17.27  ? 199  LYS L CA  1 
ATOM   1542 C C   . LYS A 1 199 ? 3.628   46.164 79.457 1.00 15.84  ? 199  LYS L C   1 
ATOM   1543 O O   . LYS A 1 199 ? 3.014   45.932 80.499 1.00 13.47  ? 199  LYS L O   1 
ATOM   1544 C CB  . LYS A 1 199 ? 4.596   43.959 78.773 1.00 24.84  ? 199  LYS L CB  1 
ATOM   1545 C CG  . LYS A 1 199 ? 5.906   44.371 79.431 1.00 28.63  ? 199  LYS L CG  1 
ATOM   1546 C CD  . LYS A 1 199 ? 6.792   43.154 79.712 1.00 31.61  ? 199  LYS L CD  1 
ATOM   1547 C CE  . LYS A 1 199 ? 6.246   42.259 80.818 1.00 34.23  ? 199  LYS L CE  1 
ATOM   1548 N NZ  . LYS A 1 199 ? 6.344   42.905 82.158 1.00 37.36  ? 199  LYS L NZ  1 
ATOM   1549 N N   . THR A 1 200 ? 4.261   47.313 79.236 1.00 15.27  ? 200  THR L N   1 
ATOM   1550 C CA  . THR A 1 200 ? 4.265   48.362 80.246 1.00 13.91  ? 200  THR L CA  1 
ATOM   1551 C C   . THR A 1 200 ? 2.916   49.078 80.380 1.00 13.99  ? 200  THR L C   1 
ATOM   1552 O O   . THR A 1 200 ? 2.755   49.947 81.235 1.00 13.63  ? 200  THR L O   1 
ATOM   1553 C CB  . THR A 1 200 ? 5.360   49.396 79.951 1.00 17.25  ? 200  THR L CB  1 
ATOM   1554 O OG1 . THR A 1 200 ? 5.289   49.795 78.573 1.00 12.47  ? 200  THR L OG1 1 
ATOM   1555 C CG2 . THR A 1 200 ? 6.722   48.811 80.243 1.00 14.42  ? 200  THR L CG2 1 
ATOM   1556 N N   . SER A 1 201 ? 1.943   48.710 79.552 1.00 14.69  ? 201  SER L N   1 
ATOM   1557 C CA  . SER A 1 201 ? 0.622   49.335 79.631 1.00 18.00  ? 201  SER L CA  1 
ATOM   1558 C C   . SER A 1 201 ? -0.457  48.462 79.007 1.00 19.52  ? 201  SER L C   1 
ATOM   1559 O O   . SER A 1 201 ? -0.224  47.829 77.981 1.00 21.23  ? 201  SER L O   1 
ATOM   1560 C CB  . SER A 1 201 ? 0.627   50.696 78.922 1.00 19.06  ? 201  SER L CB  1 
ATOM   1561 O OG  . SER A 1 201 ? -0.641  51.326 79.034 1.00 19.34  ? 201  SER L OG  1 
ATOM   1562 N N   . THR A 1 202 ? -1.636  48.426 79.619 1.00 26.97  ? 202  THR L N   1 
ATOM   1563 C CA  . THR A 1 202 ? -2.729  47.640 79.061 1.00 26.87  ? 202  THR L CA  1 
ATOM   1564 C C   . THR A 1 202 ? -3.474  48.500 78.053 1.00 27.35  ? 202  THR L C   1 
ATOM   1565 O O   . THR A 1 202 ? -4.440  48.055 77.436 1.00 27.75  ? 202  THR L O   1 
ATOM   1566 C CB  . THR A 1 202 ? -3.727  47.151 80.140 1.00 22.62  ? 202  THR L CB  1 
ATOM   1567 O OG1 . THR A 1 202 ? -4.058  48.234 81.020 1.00 24.60  ? 202  THR L OG1 1 
ATOM   1568 C CG2 . THR A 1 202 ? -3.132  45.984 80.930 1.00 20.57  ? 202  THR L CG2 1 
ATOM   1569 N N   . SER A 1 203 ? -3.020  49.739 77.894 1.00 20.90  ? 203  SER L N   1 
ATOM   1570 C CA  . SER A 1 203 ? -3.627  50.647 76.933 1.00 19.64  ? 203  SER L CA  1 
ATOM   1571 C C   . SER A 1 203 ? -2.605  50.981 75.871 1.00 20.04  ? 203  SER L C   1 
ATOM   1572 O O   . SER A 1 203 ? -1.404  50.827 76.077 1.00 20.75  ? 203  SER L O   1 
ATOM   1573 C CB  . SER A 1 203 ? -4.074  51.947 77.598 1.00 14.50  ? 203  SER L CB  1 
ATOM   1574 O OG  . SER A 1 203 ? -5.039  51.700 78.597 1.00 15.70  ? 203  SER L OG  1 
ATOM   1575 N N   . PRO A 1 204 ? -3.071  51.419 74.700 1.00 18.29  ? 204  PRO L N   1 
ATOM   1576 C CA  . PRO A 1 204 ? -2.114  51.762 73.652 1.00 17.01  ? 204  PRO L CA  1 
ATOM   1577 C C   . PRO A 1 204 ? -1.348  53.000 74.108 1.00 16.79  ? 204  PRO L C   1 
ATOM   1578 O O   . PRO A 1 204 ? -1.886  53.838 74.840 1.00 12.88  ? 204  PRO L O   1 
ATOM   1579 C CB  . PRO A 1 204 ? -3.007  52.057 72.452 1.00 18.79  ? 204  PRO L CB  1 
ATOM   1580 C CG  . PRO A 1 204 ? -4.201  51.174 72.695 1.00 20.42  ? 204  PRO L CG  1 
ATOM   1581 C CD  . PRO A 1 204 ? -4.445  51.368 74.171 1.00 17.88  ? 204  PRO L CD  1 
ATOM   1582 N N   . ILE A 1 205 ? -0.087  53.090 73.698 1.00 18.96  ? 205  ILE L N   1 
ATOM   1583 C CA  . ILE A 1 205 ? 0.763   54.234 74.015 1.00 19.07  ? 205  ILE L CA  1 
ATOM   1584 C C   . ILE A 1 205 ? 0.788   54.937 72.661 1.00 20.35  ? 205  ILE L C   1 
ATOM   1585 O O   . ILE A 1 205 ? 1.362   54.432 71.700 1.00 21.73  ? 205  ILE L O   1 
ATOM   1586 C CB  . ILE A 1 205 ? 2.164   53.759 74.436 1.00 17.18  ? 205  ILE L CB  1 
ATOM   1587 C CG1 . ILE A 1 205 ? 2.029   52.707 75.543 1.00 16.53  ? 205  ILE L CG1 1 
ATOM   1588 C CG2 . ILE A 1 205 ? 2.982   54.921 74.971 1.00 15.40  ? 205  ILE L CG2 1 
ATOM   1589 C CD1 . ILE A 1 205 ? 3.326   52.003 75.885 1.00 17.00  ? 205  ILE L CD1 1 
ATOM   1590 N N   . VAL A 1 206 ? 0.156   56.101 72.581 1.00 19.91  ? 206  VAL L N   1 
ATOM   1591 C CA  . VAL A 1 206 ? 0.040   56.769 71.300 1.00 20.69  ? 206  VAL L CA  1 
ATOM   1592 C C   . VAL A 1 206 ? 0.616   58.154 71.084 1.00 20.27  ? 206  VAL L C   1 
ATOM   1593 O O   . VAL A 1 206 ? 0.977   58.876 72.009 1.00 16.92  ? 206  VAL L O   1 
ATOM   1594 C CB  . VAL A 1 206 ? -1.447  56.842 70.876 1.00 27.74  ? 206  VAL L CB  1 
ATOM   1595 C CG1 . VAL A 1 206 ? -2.167  55.566 71.285 1.00 28.01  ? 206  VAL L CG1 1 
ATOM   1596 C CG2 . VAL A 1 206 ? -2.112  58.056 71.504 1.00 26.21  ? 206  VAL L CG2 1 
ATOM   1597 N N   . LYS A 1 207 ? 0.670   58.502 69.807 1.00 23.62  ? 207  LYS L N   1 
ATOM   1598 C CA  . LYS A 1 207 ? 1.140   59.794 69.359 1.00 24.33  ? 207  LYS L CA  1 
ATOM   1599 C C   . LYS A 1 207 ? 0.496   59.995 67.999 1.00 25.92  ? 207  LYS L C   1 
ATOM   1600 O O   . LYS A 1 207 ? 0.504   59.096 67.152 1.00 25.75  ? 207  LYS L O   1 
ATOM   1601 C CB  . LYS A 1 207 ? 2.662   59.809 69.251 1.00 21.38  ? 207  LYS L CB  1 
ATOM   1602 C CG  . LYS A 1 207 ? 3.302   60.991 69.970 1.00 21.33  ? 207  LYS L CG  1 
ATOM   1603 C CD  . LYS A 1 207 ? 2.922   61.000 71.445 1.00 23.59  ? 207  LYS L CD  1 
ATOM   1604 C CE  . LYS A 1 207 ? 3.554   62.160 72.181 1.00 23.95  ? 207  LYS L CE  1 
ATOM   1605 N NZ  . LYS A 1 207 ? 5.030   62.132 72.012 1.00 23.73  ? 207  LYS L NZ  1 
ATOM   1606 N N   . SER A 1 208 ? -0.095  61.162 67.797 1.00 24.94  ? 208  SER L N   1 
ATOM   1607 C CA  . SER A 1 208 ? -0.742  61.441 66.531 1.00 27.06  ? 208  SER L CA  1 
ATOM   1608 C C   . SER A 1 208 ? -0.631  62.912 66.166 1.00 27.34  ? 208  SER L C   1 
ATOM   1609 O O   . SER A 1 208 ? -0.069  63.712 66.914 1.00 26.92  ? 208  SER L O   1 
ATOM   1610 C CB  . SER A 1 208 ? -2.215  61.032 66.597 1.00 29.98  ? 208  SER L CB  1 
ATOM   1611 O OG  . SER A 1 208 ? -2.918  61.833 67.522 1.00 33.45  ? 208  SER L OG  1 
ATOM   1612 N N   . PHE A 1 209 ? -1.165  63.257 65.001 1.00 22.79  ? 209  PHE L N   1 
ATOM   1613 C CA  . PHE A 1 209 ? -1.152  64.634 64.533 1.00 24.53  ? 209  PHE L CA  1 
ATOM   1614 C C   . PHE A 1 209 ? -2.203  64.761 63.449 1.00 26.51  ? 209  PHE L C   1 
ATOM   1615 O O   . PHE A 1 209 ? -2.588  63.771 62.823 1.00 26.54  ? 209  PHE L O   1 
ATOM   1616 C CB  . PHE A 1 209 ? 0.242   65.012 63.984 1.00 24.08  ? 209  PHE L CB  1 
ATOM   1617 C CG  . PHE A 1 209 ? 0.574   64.395 62.641 1.00 23.98  ? 209  PHE L CG  1 
ATOM   1618 C CD1 . PHE A 1 209 ? 0.125   64.979 61.455 1.00 23.37  ? 209  PHE L CD1 1 
ATOM   1619 C CD2 . PHE A 1 209 ? 1.343   63.234 62.560 1.00 23.91  ? 209  PHE L CD2 1 
ATOM   1620 C CE1 . PHE A 1 209 ? 0.440   64.411 60.208 1.00 21.62  ? 209  PHE L CE1 1 
ATOM   1621 C CE2 . PHE A 1 209 ? 1.661   62.663 61.321 1.00 21.32  ? 209  PHE L CE2 1 
ATOM   1622 C CZ  . PHE A 1 209 ? 1.206   63.255 60.144 1.00 21.38  ? 209  PHE L CZ  1 
ATOM   1623 N N   . ASN A 1 210 ? -2.686  65.976 63.241 1.00 34.87  ? 210  ASN L N   1 
ATOM   1624 C CA  . ASN A 1 210 ? -3.669  66.215 62.198 1.00 37.70  ? 210  ASN L CA  1 
ATOM   1625 C C   . ASN A 1 210 ? -2.949  66.973 61.096 1.00 39.11  ? 210  ASN L C   1 
ATOM   1626 O O   . ASN A 1 210 ? -2.243  67.950 61.364 1.00 37.81  ? 210  ASN L O   1 
ATOM   1627 C CB  . ASN A 1 210 ? -4.841  67.037 62.734 1.00 53.25  ? 210  ASN L CB  1 
ATOM   1628 C CG  . ASN A 1 210 ? -5.663  66.273 63.748 1.00 56.33  ? 210  ASN L CG  1 
ATOM   1629 O OD1 . ASN A 1 210 ? -6.124  65.163 63.479 1.00 58.53  ? 210  ASN L OD1 1 
ATOM   1630 N ND2 . ASN A 1 210 ? -5.855  66.864 64.920 1.00 58.84  ? 210  ASN L ND2 1 
ATOM   1631 N N   . ARG A 1 211 ? -3.110  66.506 59.862 1.00 38.46  ? 211  ARG L N   1 
ATOM   1632 C CA  . ARG A 1 211 ? -2.464  67.140 58.723 1.00 40.43  ? 211  ARG L CA  1 
ATOM   1633 C C   . ARG A 1 211 ? -2.821  68.621 58.721 1.00 43.80  ? 211  ARG L C   1 
ATOM   1634 O O   . ARG A 1 211 ? -2.113  69.447 58.142 1.00 43.46  ? 211  ARG L O   1 
ATOM   1635 C CB  . ARG A 1 211 ? -2.924  66.473 57.427 1.00 38.36  ? 211  ARG L CB  1 
ATOM   1636 C CG  . ARG A 1 211 ? -2.121  66.875 56.212 1.00 36.53  ? 211  ARG L CG  1 
ATOM   1637 C CD  . ARG A 1 211 ? -2.464  65.993 55.036 1.00 36.06  ? 211  ARG L CD  1 
ATOM   1638 N NE  . ARG A 1 211 ? -3.881  66.052 54.707 1.00 36.06  ? 211  ARG L NE  1 
ATOM   1639 C CZ  . ARG A 1 211 ? -4.462  67.072 54.087 1.00 36.07  ? 211  ARG L CZ  1 
ATOM   1640 N NH1 . ARG A 1 211 ? -3.744  68.127 53.720 1.00 34.25  ? 211  ARG L NH1 1 
ATOM   1641 N NH2 . ARG A 1 211 ? -5.763  67.035 53.832 1.00 36.55  ? 211  ARG L NH2 1 
ATOM   1642 N N   . ASN A 1 212 ? -3.920  68.938 59.399 1.00 59.75  ? 212  ASN L N   1 
ATOM   1643 C CA  . ASN A 1 212 ? -4.419  70.300 59.527 1.00 63.64  ? 212  ASN L CA  1 
ATOM   1644 C C   . ASN A 1 212 ? -4.094  70.876 60.907 1.00 64.95  ? 212  ASN L C   1 
ATOM   1645 O O   . ASN A 1 212 ? -4.885  70.743 61.841 1.00 65.30  ? 212  ASN L O   1 
ATOM   1646 C CB  . ASN A 1 212 ? -5.935  70.311 59.306 1.00 100.29 ? 212  ASN L CB  1 
ATOM   1647 C CG  . ASN A 1 212 ? -6.630  71.415 60.079 1.00 103.16 ? 212  ASN L CG  1 
ATOM   1648 O OD1 . ASN A 1 212 ? -6.350  72.598 59.888 1.00 105.06 ? 212  ASN L OD1 1 
ATOM   1649 N ND2 . ASN A 1 212 ? -7.539  71.029 60.967 1.00 105.16 ? 212  ASN L ND2 1 
ATOM   1650 N N   . GLU A 1 213 ? -2.929  71.510 61.028 1.00 59.58  ? 213  GLU L N   1 
ATOM   1651 C CA  . GLU A 1 213 ? -2.499  72.115 62.288 1.00 61.04  ? 213  GLU L CA  1 
ATOM   1652 C C   . GLU A 1 213 ? -1.043  72.572 62.257 1.00 61.70  ? 213  GLU L C   1 
ATOM   1653 O O   . GLU A 1 213 ? -0.210  71.953 62.954 1.00 62.03  ? 213  GLU L O   1 
ATOM   1654 C CB  . GLU A 1 213 ? -2.711  71.144 63.452 1.00 70.76  ? 213  GLU L CB  1 
ATOM   1655 C CG  . GLU A 1 213 ? -3.879  71.526 64.346 1.00 72.46  ? 213  GLU L CG  1 
ATOM   1656 C CD  . GLU A 1 213 ? -4.255  70.431 65.320 1.00 73.27  ? 213  GLU L CD  1 
ATOM   1657 O OE1 . GLU A 1 213 ? -4.800  69.400 64.875 1.00 74.11  ? 213  GLU L OE1 1 
ATOM   1658 O OE2 . GLU A 1 213 ? -4.002  70.602 66.531 1.00 74.88  ? 213  GLU L OE2 1 
ATOM   1659 N N   . GLN B 2 1   ? 51.538  39.691 66.116 1.00 70.29  ? 1    GLN H N   1 
ATOM   1660 C CA  . GLN B 2 1   ? 50.387  38.749 66.219 1.00 70.25  ? 1    GLN H CA  1 
ATOM   1661 C C   . GLN B 2 1   ? 49.836  38.406 64.839 1.00 69.00  ? 1    GLN H C   1 
ATOM   1662 O O   . GLN B 2 1   ? 49.823  39.246 63.939 1.00 68.83  ? 1    GLN H O   1 
ATOM   1663 C CB  . GLN B 2 1   ? 49.280  39.366 67.081 1.00 90.05  ? 1    GLN H CB  1 
ATOM   1664 C CG  . GLN B 2 1   ? 48.832  40.746 66.622 1.00 92.03  ? 1    GLN H CG  1 
ATOM   1665 C CD  . GLN B 2 1   ? 47.777  41.352 67.530 1.00 93.51  ? 1    GLN H CD  1 
ATOM   1666 O OE1 . GLN B 2 1   ? 47.983  41.487 68.738 1.00 94.56  ? 1    GLN H OE1 1 
ATOM   1667 N NE2 . GLN B 2 1   ? 46.642  41.727 66.952 1.00 93.83  ? 1    GLN H NE2 1 
ATOM   1668 N N   . ILE B 2 2   ? 49.387  37.166 64.678 1.00 69.55  ? 2    ILE H N   1 
ATOM   1669 C CA  . ILE B 2 2   ? 48.835  36.715 63.407 1.00 67.75  ? 2    ILE H CA  1 
ATOM   1670 C C   . ILE B 2 2   ? 47.569  37.490 63.070 1.00 66.46  ? 2    ILE H C   1 
ATOM   1671 O O   . ILE B 2 2   ? 46.601  37.476 63.831 1.00 66.81  ? 2    ILE H O   1 
ATOM   1672 C CB  . ILE B 2 2   ? 48.494  35.213 63.449 1.00 55.41  ? 2    ILE H CB  1 
ATOM   1673 C CG1 . ILE B 2 2   ? 49.762  34.401 63.727 1.00 55.74  ? 2    ILE H CG1 1 
ATOM   1674 C CG2 . ILE B 2 2   ? 47.860  34.786 62.132 1.00 54.45  ? 2    ILE H CG2 1 
ATOM   1675 C CD1 . ILE B 2 2   ? 49.522  32.911 63.873 1.00 56.21  ? 2    ILE H CD1 1 
ATOM   1676 N N   . GLN B 2 3   ? 47.579  38.169 61.928 1.00 59.81  ? 3    GLN H N   1 
ATOM   1677 C CA  . GLN B 2 3   ? 46.420  38.941 61.500 1.00 57.34  ? 3    GLN H CA  1 
ATOM   1678 C C   . GLN B 2 3   ? 46.013  38.609 60.071 1.00 53.90  ? 3    GLN H C   1 
ATOM   1679 O O   . GLN B 2 3   ? 46.854  38.542 59.171 1.00 53.78  ? 3    GLN H O   1 
ATOM   1680 C CB  . GLN B 2 3   ? 46.704  40.442 61.609 1.00 89.08  ? 3    GLN H CB  1 
ATOM   1681 C CG  . GLN B 2 3   ? 46.949  40.930 63.027 1.00 92.98  ? 3    GLN H CG  1 
ATOM   1682 C CD  . GLN B 2 3   ? 47.036  42.442 63.114 1.00 95.57  ? 3    GLN H CD  1 
ATOM   1683 O OE1 . GLN B 2 3   ? 46.092  43.152 62.764 1.00 96.01  ? 3    GLN H OE1 1 
ATOM   1684 N NE2 . GLN B 2 3   ? 48.173  42.943 63.583 1.00 96.97  ? 3    GLN H NE2 1 
ATOM   1685 N N   . LEU B 2 4   ? 44.716  38.392 59.874 1.00 38.69  ? 4    LEU H N   1 
ATOM   1686 C CA  . LEU B 2 4   ? 44.181  38.086 58.555 1.00 33.21  ? 4    LEU H CA  1 
ATOM   1687 C C   . LEU B 2 4   ? 43.402  39.291 58.066 1.00 29.78  ? 4    LEU H C   1 
ATOM   1688 O O   . LEU B 2 4   ? 42.442  39.724 58.698 1.00 29.11  ? 4    LEU H O   1 
ATOM   1689 C CB  . LEU B 2 4   ? 43.254  36.870 58.611 1.00 37.22  ? 4    LEU H CB  1 
ATOM   1690 C CG  . LEU B 2 4   ? 43.899  35.522 58.934 1.00 36.93  ? 4    LEU H CG  1 
ATOM   1691 C CD1 . LEU B 2 4   ? 42.830  34.444 58.993 1.00 38.83  ? 4    LEU H CD1 1 
ATOM   1692 C CD2 . LEU B 2 4   ? 44.926  35.185 57.869 1.00 37.05  ? 4    LEU H CD2 1 
ATOM   1693 N N   . VAL B 2 5   ? 43.822  39.837 56.936 1.00 35.27  ? 5    VAL H N   1 
ATOM   1694 C CA  . VAL B 2 5   ? 43.152  40.990 56.372 1.00 31.78  ? 5    VAL H CA  1 
ATOM   1695 C C   . VAL B 2 5   ? 42.457  40.540 55.098 1.00 31.85  ? 5    VAL H C   1 
ATOM   1696 O O   . VAL B 2 5   ? 43.052  39.844 54.276 1.00 32.71  ? 5    VAL H O   1 
ATOM   1697 C CB  . VAL B 2 5   ? 44.171  42.113 56.063 1.00 26.15  ? 5    VAL H CB  1 
ATOM   1698 C CG1 . VAL B 2 5   ? 43.455  43.332 55.503 1.00 25.27  ? 5    VAL H CG1 1 
ATOM   1699 C CG2 . VAL B 2 5   ? 44.933  42.483 57.337 1.00 22.42  ? 5    VAL H CG2 1 
ATOM   1700 N N   . GLN B 2 6   ? 41.190  40.915 54.947 1.00 26.09  ? 6    GLN H N   1 
ATOM   1701 C CA  . GLN B 2 6   ? 40.431  40.543 53.764 1.00 23.62  ? 6    GLN H CA  1 
ATOM   1702 C C   . GLN B 2 6   ? 40.211  41.764 52.876 1.00 24.35  ? 6    GLN H C   1 
ATOM   1703 O O   . GLN B 2 6   ? 40.301  42.903 53.342 1.00 22.59  ? 6    GLN H O   1 
ATOM   1704 C CB  . GLN B 2 6   ? 39.079  39.937 54.162 1.00 20.85  ? 6    GLN H CB  1 
ATOM   1705 C CG  . GLN B 2 6   ? 39.181  38.772 55.142 1.00 18.53  ? 6    GLN H CG  1 
ATOM   1706 C CD  . GLN B 2 6   ? 37.851  38.070 55.403 1.00 17.69  ? 6    GLN H CD  1 
ATOM   1707 O OE1 . GLN B 2 6   ? 37.701  37.370 56.403 1.00 20.61  ? 6    GLN H OE1 1 
ATOM   1708 N NE2 . GLN B 2 6   ? 36.890  38.241 54.500 1.00 15.40  ? 6    GLN H NE2 1 
ATOM   1709 N N   . SER B 2 7   ? 39.932  41.512 51.599 1.00 22.65  ? 7    SER H N   1 
ATOM   1710 C CA  . SER B 2 7   ? 39.687  42.567 50.623 1.00 22.74  ? 7    SER H CA  1 
ATOM   1711 C C   . SER B 2 7   ? 38.366  43.274 50.919 1.00 22.27  ? 7    SER H C   1 
ATOM   1712 O O   . SER B 2 7   ? 37.514  42.736 51.620 1.00 23.00  ? 7    SER H O   1 
ATOM   1713 C CB  . SER B 2 7   ? 39.675  41.976 49.208 1.00 24.34  ? 7    SER H CB  1 
ATOM   1714 O OG  . SER B 2 7   ? 38.943  40.756 49.169 1.00 25.61  ? 7    SER H OG  1 
ATOM   1715 N N   . GLY B 2 8   ? 38.205  44.471 50.368 1.00 24.38  ? 8    GLY H N   1 
ATOM   1716 C CA  . GLY B 2 8   ? 37.015  45.274 50.604 1.00 24.60  ? 8    GLY H CA  1 
ATOM   1717 C C   . GLY B 2 8   ? 35.666  44.785 50.115 1.00 24.47  ? 8    GLY H C   1 
ATOM   1718 O O   . GLY B 2 8   ? 35.564  43.755 49.451 1.00 25.24  ? 8    GLY H O   1 
ATOM   1719 N N   . PRO B 2 9   ? 34.595  45.530 50.432 1.00 27.87  ? 9    PRO H N   1 
ATOM   1720 C CA  . PRO B 2 9   ? 33.229  45.177 50.028 1.00 27.80  ? 9    PRO H CA  1 
ATOM   1721 C C   . PRO B 2 9   ? 33.088  44.905 48.533 1.00 29.25  ? 9    PRO H C   1 
ATOM   1722 O O   . PRO B 2 9   ? 33.772  45.516 47.708 1.00 28.21  ? 9    PRO H O   1 
ATOM   1723 C CB  . PRO B 2 9   ? 32.407  46.381 50.490 1.00 25.08  ? 9    PRO H CB  1 
ATOM   1724 C CG  . PRO B 2 9   ? 33.411  47.510 50.485 1.00 26.92  ? 9    PRO H CG  1 
ATOM   1725 C CD  . PRO B 2 9   ? 34.626  46.854 51.075 1.00 25.19  ? 9    PRO H CD  1 
ATOM   1726 N N   . GLU B 2 10  ? 32.195  43.983 48.193 1.00 23.53  ? 10   GLU H N   1 
ATOM   1727 C CA  . GLU B 2 10  ? 31.972  43.621 46.801 1.00 23.21  ? 10   GLU H CA  1 
ATOM   1728 C C   . GLU B 2 10  ? 30.517  43.795 46.393 1.00 22.43  ? 10   GLU H C   1 
ATOM   1729 O O   . GLU B 2 10  ? 29.606  43.511 47.173 1.00 22.92  ? 10   GLU H O   1 
ATOM   1730 C CB  . GLU B 2 10  ? 32.381  42.166 46.565 1.00 20.42  ? 10   GLU H CB  1 
ATOM   1731 C CG  . GLU B 2 10  ? 33.859  41.880 46.737 1.00 21.68  ? 10   GLU H CG  1 
ATOM   1732 C CD  . GLU B 2 10  ? 34.688  42.391 45.576 1.00 23.22  ? 10   GLU H CD  1 
ATOM   1733 O OE1 . GLU B 2 10  ? 34.103  42.699 44.515 1.00 23.51  ? 10   GLU H OE1 1 
ATOM   1734 O OE2 . GLU B 2 10  ? 35.928  42.469 45.718 1.00 25.40  ? 10   GLU H OE2 1 
ATOM   1735 N N   . LEU B 2 11  ? 30.313  44.257 45.163 1.00 19.12  ? 11   LEU H N   1 
ATOM   1736 C CA  . LEU B 2 11  ? 28.981  44.453 44.605 1.00 20.46  ? 11   LEU H CA  1 
ATOM   1737 C C   . LEU B 2 11  ? 28.968  43.794 43.224 1.00 21.81  ? 11   LEU H C   1 
ATOM   1738 O O   . LEU B 2 11  ? 29.702  44.212 42.325 1.00 21.12  ? 11   LEU H O   1 
ATOM   1739 C CB  . LEU B 2 11  ? 28.661  45.943 44.474 1.00 20.01  ? 11   LEU H CB  1 
ATOM   1740 C CG  . LEU B 2 11  ? 27.330  46.233 43.775 1.00 22.65  ? 11   LEU H CG  1 
ATOM   1741 C CD1 . LEU B 2 11  ? 26.199  45.556 44.537 1.00 19.00  ? 11   LEU H CD1 1 
ATOM   1742 C CD2 . LEU B 2 11  ? 27.100  47.740 43.679 1.00 22.64  ? 11   LEU H CD2 1 
ATOM   1743 N N   . LYS B 2 12  ? 28.140  42.764 43.063 1.00 22.63  ? 12   LYS H N   1 
ATOM   1744 C CA  . LYS B 2 12  ? 28.066  42.033 41.804 1.00 23.78  ? 12   LYS H CA  1 
ATOM   1745 C C   . LYS B 2 12  ? 26.641  41.770 41.344 1.00 24.58  ? 12   LYS H C   1 
ATOM   1746 O O   . LYS B 2 12  ? 25.685  41.909 42.111 1.00 26.03  ? 12   LYS H O   1 
ATOM   1747 C CB  . LYS B 2 12  ? 28.787  40.691 41.946 1.00 22.20  ? 12   LYS H CB  1 
ATOM   1748 C CG  . LYS B 2 12  ? 30.245  40.787 42.341 1.00 21.57  ? 12   LYS H CG  1 
ATOM   1749 C CD  . LYS B 2 12  ? 31.110  41.239 41.180 1.00 21.82  ? 12   LYS H CD  1 
ATOM   1750 C CE  . LYS B 2 12  ? 32.559  41.364 41.619 1.00 24.34  ? 12   LYS H CE  1 
ATOM   1751 N NZ  . LYS B 2 12  ? 33.459  41.762 40.498 1.00 25.85  ? 12   LYS H NZ  1 
ATOM   1752 N N   . LYS B 2 13  ? 26.509  41.370 40.086 1.00 26.19  ? 13   LYS H N   1 
ATOM   1753 C CA  . LYS B 2 13  ? 25.204  41.064 39.511 1.00 28.21  ? 13   LYS H CA  1 
ATOM   1754 C C   . LYS B 2 13  ? 25.026  39.554 39.392 1.00 27.81  ? 13   LYS H C   1 
ATOM   1755 O O   . LYS B 2 13  ? 26.001  38.817 39.238 1.00 26.90  ? 13   LYS H O   1 
ATOM   1756 C CB  . LYS B 2 13  ? 25.073  41.698 38.125 1.00 37.31  ? 13   LYS H CB  1 
ATOM   1757 C CG  . LYS B 2 13  ? 24.952  43.208 38.140 1.00 41.00  ? 13   LYS H CG  1 
ATOM   1758 C CD  . LYS B 2 13  ? 24.802  43.757 36.729 1.00 45.72  ? 13   LYS H CD  1 
ATOM   1759 C CE  . LYS B 2 13  ? 24.107  45.116 36.731 1.00 49.03  ? 13   LYS H CE  1 
ATOM   1760 N NZ  . LYS B 2 13  ? 24.771  46.114 37.613 1.00 50.25  ? 13   LYS H NZ  1 
ATOM   1761 N N   . PRO B 2 14  ? 23.776  39.073 39.483 1.00 30.16  ? 14   PRO H N   1 
ATOM   1762 C CA  . PRO B 2 14  ? 23.490  37.640 39.373 1.00 30.62  ? 14   PRO H CA  1 
ATOM   1763 C C   . PRO B 2 14  ? 24.235  37.046 38.180 1.00 31.31  ? 14   PRO H C   1 
ATOM   1764 O O   . PRO B 2 14  ? 24.203  37.609 37.086 1.00 32.53  ? 14   PRO H O   1 
ATOM   1765 C CB  . PRO B 2 14  ? 21.982  37.614 39.169 1.00 25.84  ? 14   PRO H CB  1 
ATOM   1766 C CG  . PRO B 2 14  ? 21.527  38.745 40.034 1.00 28.04  ? 14   PRO H CG  1 
ATOM   1767 C CD  . PRO B 2 14  ? 22.544  39.839 39.751 1.00 27.74  ? 14   PRO H CD  1 
ATOM   1768 N N   . GLY B 2 15  ? 24.923  35.928 38.395 1.00 27.93  ? 15   GLY H N   1 
ATOM   1769 C CA  . GLY B 2 15  ? 25.648  35.291 37.308 1.00 26.10  ? 15   GLY H CA  1 
ATOM   1770 C C   . GLY B 2 15  ? 27.126  35.616 37.191 1.00 25.97  ? 15   GLY H C   1 
ATOM   1771 O O   . GLY B 2 15  ? 27.860  34.921 36.489 1.00 24.25  ? 15   GLY H O   1 
ATOM   1772 N N   . GLU B 2 16  ? 27.578  36.658 37.876 1.00 27.93  ? 16   GLU H N   1 
ATOM   1773 C CA  . GLU B 2 16  ? 28.985  37.041 37.803 1.00 26.29  ? 16   GLU H CA  1 
ATOM   1774 C C   . GLU B 2 16  ? 29.886  36.242 38.737 1.00 25.40  ? 16   GLU H C   1 
ATOM   1775 O O   . GLU B 2 16  ? 29.426  35.331 39.427 1.00 22.04  ? 16   GLU H O   1 
ATOM   1776 C CB  . GLU B 2 16  ? 29.129  38.535 38.083 1.00 24.50  ? 16   GLU H CB  1 
ATOM   1777 C CG  . GLU B 2 16  ? 28.457  39.386 37.031 1.00 26.63  ? 16   GLU H CG  1 
ATOM   1778 C CD  . GLU B 2 16  ? 28.714  40.861 37.219 1.00 30.56  ? 16   GLU H CD  1 
ATOM   1779 O OE1 . GLU B 2 16  ? 28.501  41.619 36.246 1.00 31.94  ? 16   GLU H OE1 1 
ATOM   1780 O OE2 . GLU B 2 16  ? 29.119  41.267 38.333 1.00 29.87  ? 16   GLU H OE2 1 
ATOM   1781 N N   . THR B 2 17  ? 31.169  36.601 38.745 1.00 23.33  ? 17   THR H N   1 
ATOM   1782 C CA  . THR B 2 17  ? 32.185  35.937 39.558 1.00 24.39  ? 17   THR H CA  1 
ATOM   1783 C C   . THR B 2 17  ? 32.872  36.938 40.492 1.00 25.39  ? 17   THR H C   1 
ATOM   1784 O O   . THR B 2 17  ? 33.078  38.094 40.128 1.00 26.17  ? 17   THR H O   1 
ATOM   1785 C CB  . THR B 2 17  ? 33.279  35.300 38.651 1.00 26.70  ? 17   THR H CB  1 
ATOM   1786 O OG1 . THR B 2 17  ? 32.673  34.377 37.735 1.00 25.30  ? 17   THR H OG1 1 
ATOM   1787 C CG2 . THR B 2 17  ? 34.324  34.572 39.487 1.00 26.18  ? 17   THR H CG2 1 
ATOM   1788 N N   . VAL B 2 18  ? 33.233  36.493 41.691 1.00 22.40  ? 18   VAL H N   1 
ATOM   1789 C CA  . VAL B 2 18  ? 33.915  37.368 42.639 1.00 20.64  ? 18   VAL H CA  1 
ATOM   1790 C C   . VAL B 2 18  ? 35.043  36.617 43.342 1.00 20.69  ? 18   VAL H C   1 
ATOM   1791 O O   . VAL B 2 18  ? 34.936  35.416 43.608 1.00 18.83  ? 18   VAL H O   1 
ATOM   1792 C CB  . VAL B 2 18  ? 32.933  37.941 43.702 1.00 24.03  ? 18   VAL H CB  1 
ATOM   1793 C CG1 . VAL B 2 18  ? 32.376  36.819 44.574 1.00 22.04  ? 18   VAL H CG1 1 
ATOM   1794 C CG2 . VAL B 2 18  ? 33.644  38.991 44.557 1.00 21.06  ? 18   VAL H CG2 1 
ATOM   1795 N N   . ARG B 2 19  ? 36.136  37.324 43.613 1.00 22.68  ? 19   ARG H N   1 
ATOM   1796 C CA  . ARG B 2 19  ? 37.281  36.735 44.293 1.00 25.44  ? 19   ARG H CA  1 
ATOM   1797 C C   . ARG B 2 19  ? 37.566  37.541 45.548 1.00 26.20  ? 19   ARG H C   1 
ATOM   1798 O O   . ARG B 2 19  ? 37.754  38.760 45.487 1.00 25.07  ? 19   ARG H O   1 
ATOM   1799 C CB  . ARG B 2 19  ? 38.521  36.749 43.395 1.00 35.58  ? 19   ARG H CB  1 
ATOM   1800 C CG  . ARG B 2 19  ? 38.477  35.763 42.239 1.00 41.44  ? 19   ARG H CG  1 
ATOM   1801 C CD  . ARG B 2 19  ? 39.561  36.074 41.213 1.00 43.58  ? 19   ARG H CD  1 
ATOM   1802 N NE  . ARG B 2 19  ? 40.907  36.018 41.779 1.00 47.09  ? 19   ARG H NE  1 
ATOM   1803 C CZ  . ARG B 2 19  ? 41.572  34.893 42.022 1.00 48.21  ? 19   ARG H CZ  1 
ATOM   1804 N NH1 . ARG B 2 19  ? 41.019  33.719 41.746 1.00 48.41  ? 19   ARG H NH1 1 
ATOM   1805 N NH2 . ARG B 2 19  ? 42.793  34.944 42.539 1.00 47.62  ? 19   ARG H NH2 1 
ATOM   1806 N N   . ILE B 2 20  ? 37.592  36.857 46.686 1.00 24.42  ? 20   ILE H N   1 
ATOM   1807 C CA  . ILE B 2 20  ? 37.866  37.511 47.956 1.00 24.04  ? 20   ILE H CA  1 
ATOM   1808 C C   . ILE B 2 20  ? 39.196  37.006 48.483 1.00 25.85  ? 20   ILE H C   1 
ATOM   1809 O O   . ILE B 2 20  ? 39.394  35.796 48.650 1.00 26.89  ? 20   ILE H O   1 
ATOM   1810 C CB  . ILE B 2 20  ? 36.781  37.201 48.979 1.00 25.11  ? 20   ILE H CB  1 
ATOM   1811 C CG1 . ILE B 2 20  ? 35.422  37.638 48.429 1.00 24.26  ? 20   ILE H CG1 1 
ATOM   1812 C CG2 . ILE B 2 20  ? 37.091  37.907 50.286 1.00 23.45  ? 20   ILE H CG2 1 
ATOM   1813 C CD1 . ILE B 2 20  ? 34.240  37.189 49.282 1.00 25.67  ? 20   ILE H CD1 1 
ATOM   1814 N N   . SER B 2 21  ? 40.113  37.932 48.739 1.00 24.22  ? 21   SER H N   1 
ATOM   1815 C CA  . SER B 2 21  ? 41.426  37.563 49.237 1.00 24.64  ? 21   SER H CA  1 
ATOM   1816 C C   . SER B 2 21  ? 41.508  37.678 50.753 1.00 26.04  ? 21   SER H C   1 
ATOM   1817 O O   . SER B 2 21  ? 40.776  38.447 51.382 1.00 25.81  ? 21   SER H O   1 
ATOM   1818 C CB  . SER B 2 21  ? 42.501  38.437 48.589 1.00 26.57  ? 21   SER H CB  1 
ATOM   1819 O OG  . SER B 2 21  ? 42.257  39.808 48.840 1.00 27.90  ? 21   SER H OG  1 
ATOM   1820 N N   . CYS B 2 22  ? 42.417  36.894 51.320 1.00 26.06  ? 22   CYS H N   1 
ATOM   1821 C CA  . CYS B 2 22  ? 42.656  36.835 52.753 1.00 28.59  ? 22   CYS H CA  1 
ATOM   1822 C C   . CYS B 2 22  ? 44.172  36.785 52.890 1.00 31.07  ? 22   CYS H C   1 
ATOM   1823 O O   . CYS B 2 22  ? 44.786  35.759 52.606 1.00 31.17  ? 22   CYS H O   1 
ATOM   1824 C CB  . CYS B 2 22  ? 42.020  35.555 53.298 1.00 27.55  ? 22   CYS H CB  1 
ATOM   1825 S SG  . CYS B 2 22  ? 42.206  35.176 55.068 1.00 26.78  ? 22   CYS H SG  1 
ATOM   1826 N N   . LYS B 2 23  ? 44.776  37.895 53.308 1.00 30.45  ? 23   LYS H N   1 
ATOM   1827 C CA  . LYS B 2 23  ? 46.229  37.956 53.449 1.00 34.16  ? 23   LYS H CA  1 
ATOM   1828 C C   . LYS B 2 23  ? 46.686  37.922 54.892 1.00 35.64  ? 23   LYS H C   1 
ATOM   1829 O O   . LYS B 2 23  ? 46.302  38.765 55.699 1.00 35.30  ? 23   LYS H O   1 
ATOM   1830 C CB  . LYS B 2 23  ? 46.782  39.214 52.775 1.00 66.56  ? 23   LYS H CB  1 
ATOM   1831 C CG  . LYS B 2 23  ? 48.300  39.326 52.852 1.00 70.55  ? 23   LYS H CG  1 
ATOM   1832 C CD  . LYS B 2 23  ? 48.821  40.501 52.034 1.00 74.40  ? 23   LYS H CD  1 
ATOM   1833 C CE  . LYS B 2 23  ? 50.344  40.568 52.068 1.00 76.34  ? 23   LYS H CE  1 
ATOM   1834 N NZ  . LYS B 2 23  ? 50.886  41.662 51.211 1.00 77.56  ? 23   LYS H NZ  1 
ATOM   1835 N N   . ALA B 2 24  ? 47.525  36.947 55.210 1.00 44.70  ? 24   ALA H N   1 
ATOM   1836 C CA  . ALA B 2 24  ? 48.028  36.805 56.563 1.00 50.11  ? 24   ALA H CA  1 
ATOM   1837 C C   . ALA B 2 24  ? 49.334  37.560 56.762 1.00 53.50  ? 24   ALA H C   1 
ATOM   1838 O O   . ALA B 2 24  ? 50.192  37.589 55.879 1.00 54.22  ? 24   ALA H O   1 
ATOM   1839 C CB  . ALA B 2 24  ? 48.222  35.330 56.892 1.00 62.24  ? 24   ALA H CB  1 
ATOM   1840 N N   . SER B 2 25  ? 49.469  38.179 57.929 1.00 69.64  ? 25   SER H N   1 
ATOM   1841 C CA  . SER B 2 25  ? 50.677  38.915 58.268 1.00 73.42  ? 25   SER H CA  1 
ATOM   1842 C C   . SER B 2 25  ? 51.868  37.967 58.124 1.00 76.37  ? 25   SER H C   1 
ATOM   1843 O O   . SER B 2 25  ? 52.904  38.333 57.566 1.00 76.82  ? 25   SER H O   1 
ATOM   1844 C CB  . SER B 2 25  ? 50.575  39.444 59.702 1.00 60.45  ? 25   SER H CB  1 
ATOM   1845 O OG  . SER B 2 25  ? 50.145  38.430 60.598 1.00 58.57  ? 25   SER H OG  1 
ATOM   1846 N N   . ASP B 2 26  ? 51.706  36.744 58.627 1.00 70.67  ? 26   ASP H N   1 
ATOM   1847 C CA  . ASP B 2 26  ? 52.744  35.721 58.536 1.00 73.34  ? 26   ASP H CA  1 
ATOM   1848 C C   . ASP B 2 26  ? 52.215  34.616 57.631 1.00 74.19  ? 26   ASP H C   1 
ATOM   1849 O O   . ASP B 2 26  ? 51.468  34.880 56.691 1.00 74.04  ? 26   ASP H O   1 
ATOM   1850 C CB  . ASP B 2 26  ? 53.056  35.114 59.910 1.00 101.57 ? 26   ASP H CB  1 
ATOM   1851 C CG  . ASP B 2 26  ? 53.228  36.156 60.993 1.00 103.38 ? 26   ASP H CG  1 
ATOM   1852 O OD1 . ASP B 2 26  ? 53.603  37.303 60.671 1.00 104.74 ? 26   ASP H OD1 1 
ATOM   1853 O OD2 . ASP B 2 26  ? 53.001  35.819 62.174 1.00 104.82 ? 26   ASP H OD2 1 
ATOM   1854 N N   . TYR B 2 27  ? 52.607  33.382 57.935 1.00 84.46  ? 27   TYR H N   1 
ATOM   1855 C CA  . TYR B 2 27  ? 52.185  32.192 57.196 1.00 85.92  ? 27   TYR H CA  1 
ATOM   1856 C C   . TYR B 2 27  ? 53.187  31.067 57.405 1.00 85.87  ? 27   TYR H C   1 
ATOM   1857 O O   . TYR B 2 27  ? 53.847  31.003 58.441 1.00 87.19  ? 27   TYR H O   1 
ATOM   1858 C CB  . TYR B 2 27  ? 52.035  32.487 55.697 1.00 105.34 ? 27   TYR H CB  1 
ATOM   1859 C CG  . TYR B 2 27  ? 53.316  32.831 54.968 1.00 107.62 ? 27   TYR H CG  1 
ATOM   1860 C CD1 . TYR B 2 27  ? 54.275  31.854 54.697 1.00 108.09 ? 27   TYR H CD1 1 
ATOM   1861 C CD2 . TYR B 2 27  ? 53.553  34.129 54.515 1.00 108.25 ? 27   TYR H CD2 1 
ATOM   1862 C CE1 . TYR B 2 27  ? 55.436  32.160 53.989 1.00 108.76 ? 27   TYR H CE1 1 
ATOM   1863 C CE2 . TYR B 2 27  ? 54.711  34.445 53.807 1.00 108.50 ? 27   TYR H CE2 1 
ATOM   1864 C CZ  . TYR B 2 27  ? 55.645  33.456 53.546 1.00 108.77 ? 27   TYR H CZ  1 
ATOM   1865 O OH  . TYR B 2 27  ? 56.780  33.760 52.832 1.00 109.05 ? 27   TYR H OH  1 
ATOM   1866 N N   . MET B 2 30  ? 49.760  27.985 55.016 1.00 66.13  ? 30   MET H N   1 
ATOM   1867 C CA  . MET B 2 30  ? 50.616  26.806 54.917 1.00 66.14  ? 30   MET H CA  1 
ATOM   1868 C C   . MET B 2 30  ? 50.944  26.231 56.288 1.00 64.51  ? 30   MET H C   1 
ATOM   1869 O O   . MET B 2 30  ? 51.173  25.030 56.438 1.00 63.68  ? 30   MET H O   1 
ATOM   1870 C CB  . MET B 2 30  ? 51.922  27.155 54.197 1.00 90.56  ? 30   MET H CB  1 
ATOM   1871 C CG  . MET B 2 30  ? 51.871  26.996 52.688 1.00 92.87  ? 30   MET H CG  1 
ATOM   1872 S SD  . MET B 2 30  ? 51.698  25.272 52.175 1.00 96.01  ? 30   MET H SD  1 
ATOM   1873 C CE  . MET B 2 30  ? 53.425  24.790 51.985 1.00 95.78  ? 30   MET H CE  1 
ATOM   1874 N N   . THR B 2 31  ? 50.951  27.097 57.289 1.00 61.75  ? 31   THR H N   1 
ATOM   1875 C CA  . THR B 2 31  ? 51.276  26.684 58.640 1.00 60.34  ? 31   THR H CA  1 
ATOM   1876 C C   . THR B 2 31  ? 50.324  25.665 59.255 1.00 58.76  ? 31   THR H C   1 
ATOM   1877 O O   . THR B 2 31  ? 50.759  24.807 60.022 1.00 58.33  ? 31   THR H O   1 
ATOM   1878 C CB  . THR B 2 31  ? 51.350  27.904 59.575 1.00 72.76  ? 31   THR H CB  1 
ATOM   1879 O OG1 . THR B 2 31  ? 52.194  28.903 58.989 1.00 73.27  ? 31   THR H OG1 1 
ATOM   1880 C CG2 . THR B 2 31  ? 51.920  27.501 60.925 1.00 71.78  ? 31   THR H CG2 1 
ATOM   1881 N N   . SER B 2 32  ? 49.036  25.734 58.921 1.00 58.06  ? 32   SER H N   1 
ATOM   1882 C CA  . SER B 2 32  ? 48.092  24.805 59.534 1.00 55.77  ? 32   SER H CA  1 
ATOM   1883 C C   . SER B 2 32  ? 46.749  24.589 58.844 1.00 53.26  ? 32   SER H C   1 
ATOM   1884 O O   . SER B 2 32  ? 45.939  23.785 59.304 1.00 54.21  ? 32   SER H O   1 
ATOM   1885 C CB  . SER B 2 32  ? 47.826  25.256 60.968 1.00 67.68  ? 32   SER H CB  1 
ATOM   1886 O OG  . SER B 2 32  ? 47.362  26.595 60.981 1.00 69.65  ? 32   SER H OG  1 
ATOM   1887 N N   . GLY B 2 33  ? 46.496  25.297 57.755 1.00 41.71  ? 33   GLY H N   1 
ATOM   1888 C CA  . GLY B 2 33  ? 45.223  25.128 57.083 1.00 37.05  ? 33   GLY H CA  1 
ATOM   1889 C C   . GLY B 2 33  ? 44.273  26.241 57.473 1.00 34.27  ? 33   GLY H C   1 
ATOM   1890 O O   . GLY B 2 33  ? 44.454  26.899 58.499 1.00 33.14  ? 33   GLY H O   1 
ATOM   1891 N N   . MET B 2 34  ? 43.252  26.455 56.656 1.00 39.87  ? 34   MET H N   1 
ATOM   1892 C CA  . MET B 2 34  ? 42.295  27.510 56.925 1.00 36.54  ? 34   MET H CA  1 
ATOM   1893 C C   . MET B 2 34  ? 40.889  27.128 56.484 1.00 34.41  ? 34   MET H C   1 
ATOM   1894 O O   . MET B 2 34  ? 40.682  26.103 55.831 1.00 35.64  ? 34   MET H O   1 
ATOM   1895 C CB  . MET B 2 34  ? 42.741  28.771 56.212 1.00 36.35  ? 34   MET H CB  1 
ATOM   1896 C CG  . MET B 2 34  ? 42.967  28.551 54.740 1.00 40.24  ? 34   MET H CG  1 
ATOM   1897 S SD  . MET B 2 34  ? 42.020  29.727 53.808 1.00 50.26  ? 34   MET H SD  1 
ATOM   1898 C CE  . MET B 2 34  ? 40.416  29.202 54.204 1.00 47.63  ? 34   MET H CE  1 
ATOM   1899 N N   . GLN B 2 35  ? 39.924  27.969 56.832 1.00 25.39  ? 35   GLN H N   1 
ATOM   1900 C CA  . GLN B 2 35  ? 38.535  27.711 56.493 1.00 22.17  ? 35   GLN H CA  1 
ATOM   1901 C C   . GLN B 2 35  ? 37.834  29.007 56.116 1.00 19.15  ? 35   GLN H C   1 
ATOM   1902 O O   . GLN B 2 35  ? 38.317  30.093 56.427 1.00 18.80  ? 35   GLN H O   1 
ATOM   1903 C CB  . GLN B 2 35  ? 37.826  27.087 57.698 1.00 24.06  ? 35   GLN H CB  1 
ATOM   1904 C CG  . GLN B 2 35  ? 37.717  28.032 58.893 1.00 23.42  ? 35   GLN H CG  1 
ATOM   1905 C CD  . GLN B 2 35  ? 37.174  27.357 60.143 1.00 25.76  ? 35   GLN H CD  1 
ATOM   1906 O OE1 . GLN B 2 35  ? 36.517  26.322 60.066 1.00 25.79  ? 35   GLN H OE1 1 
ATOM   1907 N NE2 . GLN B 2 35  ? 37.437  27.952 61.304 1.00 24.52  ? 35   GLN H NE2 1 
ATOM   1908 N N   . TRP B 2 36  ? 36.708  28.887 55.425 1.00 16.92  ? 36   TRP H N   1 
ATOM   1909 C CA  . TRP B 2 36  ? 35.913  30.049 55.054 1.00 17.80  ? 36   TRP H CA  1 
ATOM   1910 C C   . TRP B 2 36  ? 34.537  29.835 55.641 1.00 18.07  ? 36   TRP H C   1 
ATOM   1911 O O   . TRP B 2 36  ? 34.042  28.709 55.685 1.00 17.60  ? 36   TRP H O   1 
ATOM   1912 C CB  . TRP B 2 36  ? 35.785  30.209 53.544 1.00 18.07  ? 36   TRP H CB  1 
ATOM   1913 C CG  . TRP B 2 36  ? 37.033  30.656 52.898 1.00 19.98  ? 36   TRP H CG  1 
ATOM   1914 C CD1 . TRP B 2 36  ? 38.028  29.868 52.424 1.00 20.16  ? 36   TRP H CD1 1 
ATOM   1915 C CD2 . TRP B 2 36  ? 37.427  32.006 52.640 1.00 21.64  ? 36   TRP H CD2 1 
ATOM   1916 N NE1 . TRP B 2 36  ? 39.023  30.635 51.879 1.00 21.23  ? 36   TRP H NE1 1 
ATOM   1917 C CE2 . TRP B 2 36  ? 38.681  31.955 51.996 1.00 22.03  ? 36   TRP H CE2 1 
ATOM   1918 C CE3 . TRP B 2 36  ? 36.841  33.255 52.889 1.00 21.22  ? 36   TRP H CE3 1 
ATOM   1919 C CZ2 . TRP B 2 36  ? 39.366  33.106 51.589 1.00 20.18  ? 36   TRP H CZ2 1 
ATOM   1920 C CZ3 . TRP B 2 36  ? 37.523  34.404 52.484 1.00 21.58  ? 36   TRP H CZ3 1 
ATOM   1921 C CH2 . TRP B 2 36  ? 38.774  34.316 51.841 1.00 19.72  ? 36   TRP H CH2 1 
ATOM   1922 N N   . VAL B 2 37  ? 33.921  30.922 56.082 1.00 16.23  ? 37   VAL H N   1 
ATOM   1923 C CA  . VAL B 2 37  ? 32.614  30.845 56.696 1.00 16.12  ? 37   VAL H CA  1 
ATOM   1924 C C   . VAL B 2 37  ? 31.725  31.927 56.120 1.00 16.21  ? 37   VAL H C   1 
ATOM   1925 O O   . VAL B 2 37  ? 32.189  33.035 55.843 1.00 13.82  ? 37   VAL H O   1 
ATOM   1926 C CB  . VAL B 2 37  ? 32.751  31.011 58.224 1.00 17.89  ? 37   VAL H CB  1 
ATOM   1927 C CG1 . VAL B 2 37  ? 31.382  31.118 58.873 1.00 16.09  ? 37   VAL H CG1 1 
ATOM   1928 C CG2 . VAL B 2 37  ? 33.533  29.820 58.810 1.00 15.11  ? 37   VAL H CG2 1 
ATOM   1929 N N   . GLN B 2 38  ? 30.449  31.593 55.936 1.00 14.40  ? 38   GLN H N   1 
ATOM   1930 C CA  . GLN B 2 38  ? 29.460  32.523 55.391 1.00 15.03  ? 38   GLN H CA  1 
ATOM   1931 C C   . GLN B 2 38  ? 28.475  32.946 56.475 1.00 16.21  ? 38   GLN H C   1 
ATOM   1932 O O   . GLN B 2 38  ? 28.115  32.152 57.351 1.00 16.98  ? 38   GLN H O   1 
ATOM   1933 C CB  . GLN B 2 38  ? 28.679  31.870 54.233 1.00 20.61  ? 38   GLN H CB  1 
ATOM   1934 C CG  . GLN B 2 38  ? 27.356  32.566 53.874 1.00 19.76  ? 38   GLN H CG  1 
ATOM   1935 C CD  . GLN B 2 38  ? 26.531  31.771 52.850 1.00 23.71  ? 38   GLN H CD  1 
ATOM   1936 O OE1 . GLN B 2 38  ? 25.793  30.835 53.193 1.00 28.14  ? 38   GLN H OE1 1 
ATOM   1937 N NE2 . GLN B 2 38  ? 26.681  32.139 51.591 1.00 21.32  ? 38   GLN H NE2 1 
ATOM   1938 N N   . GLN B 2 39  ? 28.054  34.206 56.429 1.00 16.33  ? 39   GLN H N   1 
ATOM   1939 C CA  . GLN B 2 39  ? 27.073  34.715 57.380 1.00 16.97  ? 39   GLN H CA  1 
ATOM   1940 C C   . GLN B 2 39  ? 26.104  35.635 56.639 1.00 19.11  ? 39   GLN H C   1 
ATOM   1941 O O   . GLN B 2 39  ? 26.437  36.770 56.291 1.00 16.12  ? 39   GLN H O   1 
ATOM   1942 C CB  . GLN B 2 39  ? 27.746  35.470 58.535 1.00 16.55  ? 39   GLN H CB  1 
ATOM   1943 C CG  . GLN B 2 39  ? 26.746  35.993 59.537 1.00 18.34  ? 39   GLN H CG  1 
ATOM   1944 C CD  . GLN B 2 39  ? 27.351  36.216 60.905 1.00 17.55  ? 39   GLN H CD  1 
ATOM   1945 O OE1 . GLN B 2 39  ? 28.289  36.996 61.072 1.00 15.31  ? 39   GLN H OE1 1 
ATOM   1946 N NE2 . GLN B 2 39  ? 26.793  35.541 61.894 1.00 16.64  ? 39   GLN H NE2 1 
ATOM   1947 N N   . MET B 2 40  ? 24.905  35.128 56.385 1.00 22.34  ? 40   MET H N   1 
ATOM   1948 C CA  . MET B 2 40  ? 23.902  35.916 55.702 1.00 27.09  ? 40   MET H CA  1 
ATOM   1949 C C   . MET B 2 40  ? 23.345  36.964 56.662 1.00 27.21  ? 40   MET H C   1 
ATOM   1950 O O   . MET B 2 40  ? 23.312  36.760 57.876 1.00 25.86  ? 40   MET H O   1 
ATOM   1951 C CB  . MET B 2 40  ? 22.800  35.003 55.153 1.00 33.64  ? 40   MET H CB  1 
ATOM   1952 C CG  . MET B 2 40  ? 23.321  34.089 54.050 1.00 38.55  ? 40   MET H CG  1 
ATOM   1953 S SD  . MET B 2 40  ? 22.113  32.971 53.325 1.00 45.40  ? 40   MET H SD  1 
ATOM   1954 C CE  . MET B 2 40  ? 22.729  31.364 53.896 1.00 46.41  ? 40   MET H CE  1 
ATOM   1955 N N   . PRO B 2 41  ? 22.912  38.112 56.124 1.00 28.83  ? 41   PRO H N   1 
ATOM   1956 C CA  . PRO B 2 41  ? 22.366  39.184 56.961 1.00 29.17  ? 41   PRO H CA  1 
ATOM   1957 C C   . PRO B 2 41  ? 21.402  38.676 58.032 1.00 28.96  ? 41   PRO H C   1 
ATOM   1958 O O   . PRO B 2 41  ? 20.403  38.015 57.730 1.00 28.72  ? 41   PRO H O   1 
ATOM   1959 C CB  . PRO B 2 41  ? 21.707  40.119 55.941 1.00 37.59  ? 41   PRO H CB  1 
ATOM   1960 C CG  . PRO B 2 41  ? 21.419  39.220 54.766 1.00 39.24  ? 41   PRO H CG  1 
ATOM   1961 C CD  . PRO B 2 41  ? 22.649  38.371 54.700 1.00 37.11  ? 41   PRO H CD  1 
ATOM   1962 N N   . GLY B 2 42  ? 21.740  38.966 59.285 1.00 26.25  ? 42   GLY H N   1 
ATOM   1963 C CA  . GLY B 2 42  ? 20.918  38.555 60.412 1.00 24.16  ? 42   GLY H CA  1 
ATOM   1964 C C   . GLY B 2 42  ? 20.881  37.064 60.719 1.00 24.58  ? 42   GLY H C   1 
ATOM   1965 O O   . GLY B 2 42  ? 20.182  36.648 61.639 1.00 25.19  ? 42   GLY H O   1 
ATOM   1966 N N   . LYS B 2 43  ? 21.632  36.260 59.967 1.00 25.54  ? 43   LYS H N   1 
ATOM   1967 C CA  . LYS B 2 43  ? 21.650  34.809 60.171 1.00 23.81  ? 43   LYS H CA  1 
ATOM   1968 C C   . LYS B 2 43  ? 22.873  34.308 60.923 1.00 21.22  ? 43   LYS H C   1 
ATOM   1969 O O   . LYS B 2 43  ? 23.783  35.068 61.234 1.00 21.75  ? 43   LYS H O   1 
ATOM   1970 C CB  . LYS B 2 43  ? 21.587  34.087 58.826 1.00 30.13  ? 43   LYS H CB  1 
ATOM   1971 C CG  . LYS B 2 43  ? 20.400  34.457 57.976 1.00 34.91  ? 43   LYS H CG  1 
ATOM   1972 C CD  . LYS B 2 43  ? 19.098  34.195 58.708 1.00 38.44  ? 43   LYS H CD  1 
ATOM   1973 C CE  . LYS B 2 43  ? 17.908  34.370 57.780 1.00 39.30  ? 43   LYS H CE  1 
ATOM   1974 N NZ  . LYS B 2 43  ? 16.628  34.185 58.517 1.00 41.68  ? 43   LYS H NZ  1 
ATOM   1975 N N   . GLY B 2 44  ? 22.899  33.008 61.183 1.00 20.23  ? 44   GLY H N   1 
ATOM   1976 C CA  . GLY B 2 44  ? 24.016  32.420 61.899 1.00 19.80  ? 44   GLY H CA  1 
ATOM   1977 C C   . GLY B 2 44  ? 25.218  32.140 61.013 1.00 19.35  ? 44   GLY H C   1 
ATOM   1978 O O   . GLY B 2 44  ? 25.200  32.406 59.805 1.00 18.44  ? 44   GLY H O   1 
ATOM   1979 N N   . LEU B 2 45  ? 26.272  31.611 61.624 1.00 18.42  ? 45   LEU H N   1 
ATOM   1980 C CA  . LEU B 2 45  ? 27.492  31.276 60.903 1.00 17.73  ? 45   LEU H CA  1 
ATOM   1981 C C   . LEU B 2 45  ? 27.245  29.968 60.161 1.00 16.42  ? 45   LEU H C   1 
ATOM   1982 O O   . LEU B 2 45  ? 26.587  29.062 60.679 1.00 16.59  ? 45   LEU H O   1 
ATOM   1983 C CB  . LEU B 2 45  ? 28.658  31.109 61.883 1.00 10.06  ? 45   LEU H CB  1 
ATOM   1984 C CG  . LEU B 2 45  ? 28.975  32.307 62.785 1.00 11.62  ? 45   LEU H CG  1 
ATOM   1985 C CD1 . LEU B 2 45  ? 30.043  31.899 63.812 1.00 10.83  ? 45   LEU H CD1 1 
ATOM   1986 C CD2 . LEU B 2 45  ? 29.450  33.491 61.942 1.00 6.38   ? 45   LEU H CD2 1 
ATOM   1987 N N   . LYS B 2 46  ? 27.767  29.874 58.948 1.00 14.38  ? 46   LYS H N   1 
ATOM   1988 C CA  . LYS B 2 46  ? 27.596  28.672 58.142 1.00 16.07  ? 46   LYS H CA  1 
ATOM   1989 C C   . LYS B 2 46  ? 28.943  28.358 57.518 1.00 17.16  ? 46   LYS H C   1 
ATOM   1990 O O   . LYS B 2 46  ? 29.520  29.188 56.820 1.00 18.32  ? 46   LYS H O   1 
ATOM   1991 C CB  . LYS B 2 46  ? 26.535  28.913 57.059 1.00 17.12  ? 46   LYS H CB  1 
ATOM   1992 C CG  . LYS B 2 46  ? 26.150  27.671 56.270 1.00 23.53  ? 46   LYS H CG  1 
ATOM   1993 C CD  . LYS B 2 46  ? 24.985  27.936 55.309 1.00 22.61  ? 46   LYS H CD  1 
ATOM   1994 C CE  . LYS B 2 46  ? 24.596  26.663 54.566 1.00 24.44  ? 46   LYS H CE  1 
ATOM   1995 N NZ  . LYS B 2 46  ? 23.500  26.876 53.571 1.00 27.30  ? 46   LYS H NZ  1 
ATOM   1996 N N   . TRP B 2 47  ? 29.444  27.162 57.797 1.00 19.15  ? 47   TRP H N   1 
ATOM   1997 C CA  . TRP B 2 47  ? 30.735  26.710 57.301 1.00 19.30  ? 47   TRP H CA  1 
ATOM   1998 C C   . TRP B 2 47  ? 30.664  26.399 55.812 1.00 19.28  ? 47   TRP H C   1 
ATOM   1999 O O   . TRP B 2 47  ? 29.829  25.610 55.379 1.00 19.36  ? 47   TRP H O   1 
ATOM   2000 C CB  . TRP B 2 47  ? 31.149  25.455 58.066 1.00 19.81  ? 47   TRP H CB  1 
ATOM   2001 C CG  . TRP B 2 47  ? 32.567  25.024 57.884 1.00 18.41  ? 47   TRP H CG  1 
ATOM   2002 C CD1 . TRP B 2 47  ? 33.678  25.587 58.450 1.00 19.14  ? 47   TRP H CD1 1 
ATOM   2003 C CD2 . TRP B 2 47  ? 33.023  23.868 57.173 1.00 18.76  ? 47   TRP H CD2 1 
ATOM   2004 N NE1 . TRP B 2 47  ? 34.795  24.846 58.145 1.00 17.00  ? 47   TRP H NE1 1 
ATOM   2005 C CE2 . TRP B 2 47  ? 34.421  23.784 57.363 1.00 19.18  ? 47   TRP H CE2 1 
ATOM   2006 C CE3 . TRP B 2 47  ? 32.384  22.891 56.398 1.00 19.06  ? 47   TRP H CE3 1 
ATOM   2007 C CZ2 . TRP B 2 47  ? 35.195  22.753 56.807 1.00 19.57  ? 47   TRP H CZ2 1 
ATOM   2008 C CZ3 . TRP B 2 47  ? 33.152  21.865 55.843 1.00 19.77  ? 47   TRP H CZ3 1 
ATOM   2009 C CH2 . TRP B 2 47  ? 34.544  21.805 56.053 1.00 19.09  ? 47   TRP H CH2 1 
ATOM   2010 N N   . ILE B 2 48  ? 31.548  27.022 55.039 1.00 17.01  ? 48   ILE H N   1 
ATOM   2011 C CA  . ILE B 2 48  ? 31.605  26.811 53.597 1.00 18.75  ? 48   ILE H CA  1 
ATOM   2012 C C   . ILE B 2 48  ? 32.494  25.603 53.305 1.00 20.53  ? 48   ILE H C   1 
ATOM   2013 O O   . ILE B 2 48  ? 32.157  24.747 52.486 1.00 21.51  ? 48   ILE H O   1 
ATOM   2014 C CB  . ILE B 2 48  ? 32.185  28.056 52.881 1.00 16.88  ? 48   ILE H CB  1 
ATOM   2015 C CG1 . ILE B 2 48  ? 31.305  29.276 53.185 1.00 15.18  ? 48   ILE H CG1 1 
ATOM   2016 C CG2 . ILE B 2 48  ? 32.251  27.810 51.366 1.00 13.02  ? 48   ILE H CG2 1 
ATOM   2017 C CD1 . ILE B 2 48  ? 31.872  30.590 52.694 1.00 15.60  ? 48   ILE H CD1 1 
ATOM   2018 N N   . GLY B 2 49  ? 33.631  25.548 53.989 1.00 19.39  ? 49   GLY H N   1 
ATOM   2019 C CA  . GLY B 2 49  ? 34.567  24.452 53.821 1.00 19.47  ? 49   GLY H CA  1 
ATOM   2020 C C   . GLY B 2 49  ? 35.932  24.844 54.352 1.00 21.00  ? 49   GLY H C   1 
ATOM   2021 O O   . GLY B 2 49  ? 36.109  25.941 54.893 1.00 18.42  ? 49   GLY H O   1 
ATOM   2022 N N   . TRP B 2 50  ? 36.905  23.953 54.231 1.00 21.73  ? 50   TRP H N   1 
ATOM   2023 C CA  . TRP B 2 50  ? 38.238  24.290 54.694 1.00 25.33  ? 50   TRP H CA  1 
ATOM   2024 C C   . TRP B 2 50  ? 39.257  23.798 53.679 1.00 27.61  ? 50   TRP H C   1 
ATOM   2025 O O   . TRP B 2 50  ? 38.960  22.930 52.856 1.00 27.23  ? 50   TRP H O   1 
ATOM   2026 C CB  . TRP B 2 50  ? 38.504  23.696 56.085 1.00 25.86  ? 50   TRP H CB  1 
ATOM   2027 C CG  . TRP B 2 50  ? 38.962  22.274 56.105 1.00 27.20  ? 50   TRP H CG  1 
ATOM   2028 C CD1 . TRP B 2 50  ? 38.211  21.158 55.872 1.00 27.46  ? 50   TRP H CD1 1 
ATOM   2029 C CD2 . TRP B 2 50  ? 40.280  21.815 56.411 1.00 27.22  ? 50   TRP H CD2 1 
ATOM   2030 N NE1 . TRP B 2 50  ? 38.980  20.029 56.019 1.00 28.28  ? 50   TRP H NE1 1 
ATOM   2031 C CE2 . TRP B 2 50  ? 40.256  20.405 56.349 1.00 28.65  ? 50   TRP H CE2 1 
ATOM   2032 C CE3 . TRP B 2 50  ? 41.482  22.461 56.733 1.00 29.19  ? 50   TRP H CE3 1 
ATOM   2033 C CZ2 . TRP B 2 50  ? 41.391  19.624 56.598 1.00 30.86  ? 50   TRP H CZ2 1 
ATOM   2034 C CZ3 . TRP B 2 50  ? 42.609  21.690 56.981 1.00 30.99  ? 50   TRP H CZ3 1 
ATOM   2035 C CH2 . TRP B 2 50  ? 42.555  20.282 56.912 1.00 32.74  ? 50   TRP H CH2 1 
ATOM   2036 N N   . LEU B 2 51  ? 40.451  24.372 53.724 1.00 28.23  ? 51   LEU H N   1 
ATOM   2037 C CA  . LEU B 2 51  ? 41.503  24.006 52.795 1.00 30.27  ? 51   LEU H CA  1 
ATOM   2038 C C   . LEU B 2 51  ? 42.735  23.511 53.527 1.00 33.16  ? 51   LEU H C   1 
ATOM   2039 O O   . LEU B 2 51  ? 43.341  24.247 54.304 1.00 33.32  ? 51   LEU H O   1 
ATOM   2040 C CB  . LEU B 2 51  ? 41.875  25.209 51.927 1.00 32.13  ? 51   LEU H CB  1 
ATOM   2041 C CG  . LEU B 2 51  ? 43.149  25.076 51.090 1.00 32.02  ? 51   LEU H CG  1 
ATOM   2042 C CD1 . LEU B 2 51  ? 43.064  23.848 50.190 1.00 32.76  ? 51   LEU H CD1 1 
ATOM   2043 C CD2 . LEU B 2 51  ? 43.335  26.330 50.263 1.00 31.91  ? 51   LEU H CD2 1 
ATOM   2044 N N   . ASN B 2 52  ? 43.101  22.260 53.273 1.00 43.19  ? 52   ASN H N   1 
ATOM   2045 C CA  . ASN B 2 52  ? 44.279  21.656 53.888 1.00 45.98  ? 52   ASN H CA  1 
ATOM   2046 C C   . ASN B 2 52  ? 45.514  22.206 53.179 1.00 47.54  ? 52   ASN H C   1 
ATOM   2047 O O   . ASN B 2 52  ? 46.009  21.597 52.236 1.00 47.87  ? 52   ASN H O   1 
ATOM   2048 C CB  . ASN B 2 52  ? 44.226  20.138 53.720 1.00 40.70  ? 52   ASN H CB  1 
ATOM   2049 C CG  . ASN B 2 52  ? 45.393  19.438 54.377 1.00 41.00  ? 52   ASN H CG  1 
ATOM   2050 O OD1 . ASN B 2 52  ? 46.544  19.851 54.229 1.00 39.61  ? 52   ASN H OD1 1 
ATOM   2051 N ND2 . ASN B 2 52  ? 45.104  18.362 55.104 1.00 40.04  ? 52   ASN H ND2 1 
ATOM   2052 N N   . THR B 2 53  A 46.004  23.355 53.636 1.00 51.10  ? 52   THR H N   1 
ATOM   2053 C CA  . THR B 2 53  A 47.166  24.008 53.031 1.00 52.84  ? 52   THR H CA  1 
ATOM   2054 C C   . THR B 2 53  A 48.376  23.103 52.815 1.00 54.80  ? 52   THR H C   1 
ATOM   2055 O O   . THR B 2 53  A 49.260  23.420 52.016 1.00 55.32  ? 52   THR H O   1 
ATOM   2056 C CB  . THR B 2 53  A 47.626  25.210 53.873 1.00 46.68  ? 52   THR H CB  1 
ATOM   2057 O OG1 . THR B 2 53  A 48.001  24.760 55.182 1.00 46.96  ? 52   THR H OG1 1 
ATOM   2058 C CG2 . THR B 2 53  A 46.512  26.235 53.986 1.00 45.63  ? 52   THR H CG2 1 
ATOM   2059 N N   . GLN B 2 54  ? 48.416  21.985 53.532 1.00 67.39  ? 53   GLN H N   1 
ATOM   2060 C CA  . GLN B 2 54  ? 49.516  21.036 53.421 1.00 68.35  ? 53   GLN H CA  1 
ATOM   2061 C C   . GLN B 2 54  ? 49.375  20.159 52.172 1.00 68.31  ? 53   GLN H C   1 
ATOM   2062 O O   . GLN B 2 54  ? 50.270  20.131 51.325 1.00 68.41  ? 53   GLN H O   1 
ATOM   2063 C CB  . GLN B 2 54  ? 49.572  20.178 54.692 1.00 74.02  ? 53   GLN H CB  1 
ATOM   2064 C CG  . GLN B 2 54  ? 50.466  18.950 54.629 1.00 76.71  ? 53   GLN H CG  1 
ATOM   2065 C CD  . GLN B 2 54  ? 49.667  17.660 54.541 1.00 79.48  ? 53   GLN H CD  1 
ATOM   2066 O OE1 . GLN B 2 54  ? 48.982  17.407 53.551 1.00 80.51  ? 53   GLN H OE1 1 
ATOM   2067 N NE2 . GLN B 2 54  ? 49.746  16.841 55.584 1.00 80.57  ? 53   GLN H NE2 1 
ATOM   2068 N N   . SER B 2 55  ? 48.247  19.461 52.052 1.00 48.66  ? 54   SER H N   1 
ATOM   2069 C CA  . SER B 2 55  ? 48.004  18.586 50.909 1.00 47.07  ? 54   SER H CA  1 
ATOM   2070 C C   . SER B 2 55  ? 47.408  19.347 49.733 1.00 46.07  ? 54   SER H C   1 
ATOM   2071 O O   . SER B 2 55  ? 47.290  18.809 48.632 1.00 46.70  ? 54   SER H O   1 
ATOM   2072 C CB  . SER B 2 55  ? 47.046  17.461 51.298 1.00 51.83  ? 54   SER H CB  1 
ATOM   2073 O OG  . SER B 2 55  ? 45.732  17.959 51.490 1.00 52.45  ? 54   SER H OG  1 
ATOM   2074 N N   . GLY B 2 56  ? 47.028  20.597 49.973 1.00 43.05  ? 55   GLY H N   1 
ATOM   2075 C CA  . GLY B 2 56  ? 46.431  21.404 48.924 1.00 39.19  ? 55   GLY H CA  1 
ATOM   2076 C C   . GLY B 2 56  ? 45.001  20.983 48.638 1.00 38.09  ? 55   GLY H C   1 
ATOM   2077 O O   . GLY B 2 56  ? 44.343  21.556 47.771 1.00 37.27  ? 55   GLY H O   1 
ATOM   2078 N N   . VAL B 2 57  ? 44.511  19.988 49.372 1.00 35.55  ? 56   VAL H N   1 
ATOM   2079 C CA  . VAL B 2 57  ? 43.155  19.487 49.169 1.00 36.15  ? 56   VAL H CA  1 
ATOM   2080 C C   . VAL B 2 57  ? 42.085  20.251 49.944 1.00 35.78  ? 56   VAL H C   1 
ATOM   2081 O O   . VAL B 2 57  ? 42.214  20.479 51.146 1.00 37.31  ? 56   VAL H O   1 
ATOM   2082 C CB  . VAL B 2 57  ? 43.044  18.001 49.565 1.00 34.19  ? 56   VAL H CB  1 
ATOM   2083 C CG1 . VAL B 2 57  ? 41.641  17.487 49.271 1.00 33.41  ? 56   VAL H CG1 1 
ATOM   2084 C CG2 . VAL B 2 57  ? 44.076  17.186 48.811 1.00 35.56  ? 56   VAL H CG2 1 
ATOM   2085 N N   . PRO B 2 58  ? 41.016  20.670 49.254 1.00 36.25  ? 57   PRO H N   1 
ATOM   2086 C CA  . PRO B 2 58  ? 39.935  21.404 49.912 1.00 35.49  ? 57   PRO H CA  1 
ATOM   2087 C C   . PRO B 2 58  ? 38.730  20.503 50.185 1.00 35.30  ? 57   PRO H C   1 
ATOM   2088 O O   . PRO B 2 58  ? 38.563  19.467 49.544 1.00 35.43  ? 57   PRO H O   1 
ATOM   2089 C CB  . PRO B 2 58  ? 39.611  22.492 48.902 1.00 32.51  ? 57   PRO H CB  1 
ATOM   2090 C CG  . PRO B 2 58  ? 39.726  21.743 47.606 1.00 33.15  ? 57   PRO H CG  1 
ATOM   2091 C CD  . PRO B 2 58  ? 40.991  20.906 47.796 1.00 32.64  ? 57   PRO H CD  1 
ATOM   2092 N N   . GLU B 2 59  ? 37.903  20.896 51.145 1.00 31.95  ? 58   GLU H N   1 
ATOM   2093 C CA  . GLU B 2 59  ? 36.693  20.149 51.473 1.00 32.08  ? 58   GLU H CA  1 
ATOM   2094 C C   . GLU B 2 59  ? 35.568  21.154 51.593 1.00 29.76  ? 58   GLU H C   1 
ATOM   2095 O O   . GLU B 2 59  ? 35.665  22.121 52.350 1.00 28.67  ? 58   GLU H O   1 
ATOM   2096 C CB  . GLU B 2 59  ? 36.828  19.396 52.795 1.00 50.77  ? 58   GLU H CB  1 
ATOM   2097 C CG  . GLU B 2 59  ? 37.807  18.252 52.785 1.00 56.00  ? 58   GLU H CG  1 
ATOM   2098 C CD  . GLU B 2 59  ? 37.616  17.349 53.982 1.00 61.40  ? 58   GLU H CD  1 
ATOM   2099 O OE1 . GLU B 2 59  ? 36.640  16.568 53.986 1.00 64.46  ? 58   GLU H OE1 1 
ATOM   2100 O OE2 . GLU B 2 59  ? 38.429  17.428 54.928 1.00 65.23  ? 58   GLU H OE2 1 
ATOM   2101 N N   . TYR B 2 60  ? 34.491  20.917 50.861 1.00 25.70  ? 59   TYR H N   1 
ATOM   2102 C CA  . TYR B 2 60  ? 33.366  21.834 50.872 1.00 24.73  ? 59   TYR H CA  1 
ATOM   2103 C C   . TYR B 2 60  ? 32.107  21.248 51.483 1.00 24.97  ? 59   TYR H C   1 
ATOM   2104 O O   . TYR B 2 60  ? 31.883  20.040 51.436 1.00 25.68  ? 59   TYR H O   1 
ATOM   2105 C CB  . TYR B 2 60  ? 33.053  22.261 49.442 1.00 24.10  ? 59   TYR H CB  1 
ATOM   2106 C CG  . TYR B 2 60  ? 34.221  22.885 48.734 1.00 24.05  ? 59   TYR H CG  1 
ATOM   2107 C CD1 . TYR B 2 60  ? 34.634  24.176 49.047 1.00 22.47  ? 59   TYR H CD1 1 
ATOM   2108 C CD2 . TYR B 2 60  ? 34.925  22.183 47.759 1.00 22.26  ? 59   TYR H CD2 1 
ATOM   2109 C CE1 . TYR B 2 60  ? 35.719  24.755 48.408 1.00 23.96  ? 59   TYR H CE1 1 
ATOM   2110 C CE2 . TYR B 2 60  ? 36.011  22.752 47.113 1.00 23.13  ? 59   TYR H CE2 1 
ATOM   2111 C CZ  . TYR B 2 60  ? 36.404  24.041 47.442 1.00 23.49  ? 59   TYR H CZ  1 
ATOM   2112 O OH  . TYR B 2 60  ? 37.473  24.628 46.804 1.00 23.19  ? 59   TYR H OH  1 
ATOM   2113 N N   . ALA B 2 61  ? 31.290  22.120 52.058 1.00 25.24  ? 60   ALA H N   1 
ATOM   2114 C CA  . ALA B 2 61  ? 30.021  21.706 52.625 1.00 26.30  ? 60   ALA H CA  1 
ATOM   2115 C C   . ALA B 2 61  ? 29.065  21.587 51.429 1.00 27.76  ? 60   ALA H C   1 
ATOM   2116 O O   . ALA B 2 61  ? 29.142  22.375 50.479 1.00 25.28  ? 60   ALA H O   1 
ATOM   2117 C CB  . ALA B 2 61  ? 29.514  22.752 53.611 1.00 24.25  ? 60   ALA H CB  1 
ATOM   2118 N N   . GLU B 2 62  ? 28.174  20.603 51.490 1.00 30.09  ? 61   GLU H N   1 
ATOM   2119 C CA  . GLU B 2 62  ? 27.203  20.325 50.431 1.00 31.12  ? 61   GLU H CA  1 
ATOM   2120 C C   . GLU B 2 62  ? 26.658  21.521 49.641 1.00 29.93  ? 61   GLU H C   1 
ATOM   2121 O O   . GLU B 2 62  ? 26.745  21.546 48.413 1.00 30.30  ? 61   GLU H O   1 
ATOM   2122 C CB  . GLU B 2 62  ? 26.036  19.531 51.023 1.00 43.04  ? 61   GLU H CB  1 
ATOM   2123 C CG  . GLU B 2 62  ? 25.036  18.999 50.005 1.00 47.69  ? 61   GLU H CG  1 
ATOM   2124 C CD  . GLU B 2 62  ? 25.697  18.191 48.904 1.00 49.11  ? 61   GLU H CD  1 
ATOM   2125 O OE1 . GLU B 2 62  ? 26.682  17.481 49.197 1.00 52.71  ? 61   GLU H OE1 1 
ATOM   2126 O OE2 . GLU B 2 62  ? 25.224  18.258 47.748 1.00 51.98  ? 61   GLU H OE2 1 
ATOM   2127 N N   . ASP B 2 63  ? 26.099  22.503 50.341 1.00 26.49  ? 62   ASP H N   1 
ATOM   2128 C CA  . ASP B 2 63  ? 25.514  23.684 49.700 1.00 26.52  ? 62   ASP H CA  1 
ATOM   2129 C C   . ASP B 2 63  ? 26.486  24.608 48.974 1.00 24.75  ? 62   ASP H C   1 
ATOM   2130 O O   . ASP B 2 63  ? 26.062  25.536 48.291 1.00 25.36  ? 62   ASP H O   1 
ATOM   2131 C CB  . ASP B 2 63  ? 24.754  24.515 50.733 1.00 32.68  ? 62   ASP H CB  1 
ATOM   2132 C CG  . ASP B 2 63  ? 23.598  23.765 51.345 1.00 36.87  ? 62   ASP H CG  1 
ATOM   2133 O OD1 . ASP B 2 63  ? 23.023  24.273 52.337 1.00 36.96  ? 62   ASP H OD1 1 
ATOM   2134 O OD2 . ASP B 2 63  ? 23.262  22.672 50.833 1.00 36.67  ? 62   ASP H OD2 1 
ATOM   2135 N N   . PHE B 2 64  ? 27.781  24.368 49.110 1.00 25.73  ? 63   PHE H N   1 
ATOM   2136 C CA  . PHE B 2 64  ? 28.752  25.239 48.465 1.00 24.78  ? 63   PHE H CA  1 
ATOM   2137 C C   . PHE B 2 64  ? 29.544  24.574 47.362 1.00 25.29  ? 63   PHE H C   1 
ATOM   2138 O O   . PHE B 2 64  ? 30.267  25.245 46.629 1.00 26.98  ? 63   PHE H O   1 
ATOM   2139 C CB  . PHE B 2 64  ? 29.702  25.808 49.518 1.00 19.87  ? 63   PHE H CB  1 
ATOM   2140 C CG  . PHE B 2 64  ? 29.005  26.617 50.567 1.00 19.15  ? 63   PHE H CG  1 
ATOM   2141 C CD1 . PHE B 2 64  ? 28.612  27.925 50.305 1.00 15.32  ? 63   PHE H CD1 1 
ATOM   2142 C CD2 . PHE B 2 64  ? 28.693  26.054 51.799 1.00 16.76  ? 63   PHE H CD2 1 
ATOM   2143 C CE1 . PHE B 2 64  ? 27.918  28.659 51.252 1.00 17.31  ? 63   PHE H CE1 1 
ATOM   2144 C CE2 . PHE B 2 64  ? 27.997  26.781 52.754 1.00 17.87  ? 63   PHE H CE2 1 
ATOM   2145 C CZ  . PHE B 2 64  ? 27.606  28.089 52.482 1.00 15.63  ? 63   PHE H CZ  1 
ATOM   2146 N N   . LYS B 2 65  ? 29.411  23.260 47.243 1.00 24.73  ? 64   LYS H N   1 
ATOM   2147 C CA  . LYS B 2 65  ? 30.136  22.522 46.212 1.00 26.84  ? 64   LYS H CA  1 
ATOM   2148 C C   . LYS B 2 65  ? 29.692  22.981 44.829 1.00 24.90  ? 64   LYS H C   1 
ATOM   2149 O O   . LYS B 2 65  ? 28.498  23.115 44.568 1.00 24.21  ? 64   LYS H O   1 
ATOM   2150 C CB  . LYS B 2 65  ? 29.888  21.018 46.365 1.00 43.85  ? 64   LYS H CB  1 
ATOM   2151 C CG  . LYS B 2 65  ? 30.409  20.442 47.672 1.00 49.90  ? 64   LYS H CG  1 
ATOM   2152 C CD  . LYS B 2 65  ? 29.910  19.021 47.908 1.00 54.28  ? 64   LYS H CD  1 
ATOM   2153 C CE  . LYS B 2 65  ? 30.368  18.498 49.267 1.00 54.84  ? 64   LYS H CE  1 
ATOM   2154 N NZ  . LYS B 2 65  ? 29.831  17.143 49.570 1.00 55.53  ? 64   LYS H NZ  1 
ATOM   2155 N N   . GLY B 2 66  ? 30.659  23.235 43.953 1.00 28.43  ? 65   GLY H N   1 
ATOM   2156 C CA  . GLY B 2 66  ? 30.333  23.663 42.605 1.00 30.18  ? 65   GLY H CA  1 
ATOM   2157 C C   . GLY B 2 66  ? 30.589  25.125 42.276 1.00 31.04  ? 65   GLY H C   1 
ATOM   2158 O O   . GLY B 2 66  ? 31.275  25.425 41.298 1.00 31.45  ? 65   GLY H O   1 
ATOM   2159 N N   . ARG B 2 67  ? 30.049  26.035 43.082 1.00 26.86  ? 66   ARG H N   1 
ATOM   2160 C CA  . ARG B 2 67  ? 30.219  27.469 42.834 1.00 26.02  ? 66   ARG H CA  1 
ATOM   2161 C C   . ARG B 2 67  ? 31.236  28.171 43.729 1.00 25.76  ? 66   ARG H C   1 
ATOM   2162 O O   . ARG B 2 67  ? 31.568  29.334 43.495 1.00 26.43  ? 66   ARG H O   1 
ATOM   2163 C CB  . ARG B 2 67  ? 28.872  28.171 42.970 1.00 25.87  ? 66   ARG H CB  1 
ATOM   2164 C CG  . ARG B 2 67  ? 27.919  27.930 41.815 1.00 26.65  ? 66   ARG H CG  1 
ATOM   2165 C CD  . ARG B 2 67  ? 26.491  28.173 42.248 1.00 29.71  ? 66   ARG H CD  1 
ATOM   2166 N NE  . ARG B 2 67  ? 26.414  29.150 43.332 1.00 35.06  ? 66   ARG H NE  1 
ATOM   2167 C CZ  . ARG B 2 67  ? 25.347  29.311 44.105 1.00 35.95  ? 66   ARG H CZ  1 
ATOM   2168 N NH1 . ARG B 2 67  ? 24.268  28.562 43.905 1.00 39.55  ? 66   ARG H NH1 1 
ATOM   2169 N NH2 . ARG B 2 67  ? 25.361  30.197 45.086 1.00 32.95  ? 66   ARG H NH2 1 
ATOM   2170 N N   . PHE B 2 68  ? 31.727  27.476 44.751 1.00 27.06  ? 67   PHE H N   1 
ATOM   2171 C CA  . PHE B 2 68  ? 32.699  28.065 45.670 1.00 25.96  ? 67   PHE H CA  1 
ATOM   2172 C C   . PHE B 2 68  ? 34.015  27.310 45.612 1.00 26.34  ? 67   PHE H C   1 
ATOM   2173 O O   . PHE B 2 68  ? 34.032  26.090 45.717 1.00 27.85  ? 67   PHE H O   1 
ATOM   2174 C CB  . PHE B 2 68  ? 32.165  28.030 47.105 1.00 20.99  ? 67   PHE H CB  1 
ATOM   2175 C CG  . PHE B 2 68  ? 30.924  28.845 47.310 1.00 18.93  ? 67   PHE H CG  1 
ATOM   2176 C CD1 . PHE B 2 68  ? 29.719  28.460 46.736 1.00 16.52  ? 67   PHE H CD1 1 
ATOM   2177 C CD2 . PHE B 2 68  ? 30.965  30.008 48.071 1.00 17.74  ? 67   PHE H CD2 1 
ATOM   2178 C CE1 . PHE B 2 68  ? 28.564  29.227 46.915 1.00 18.63  ? 67   PHE H CE1 1 
ATOM   2179 C CE2 . PHE B 2 68  ? 29.820  30.783 48.259 1.00 17.91  ? 67   PHE H CE2 1 
ATOM   2180 C CZ  . PHE B 2 68  ? 28.617  30.392 47.679 1.00 19.43  ? 67   PHE H CZ  1 
ATOM   2181 N N   . ALA B 2 69  ? 35.119  28.032 45.464 1.00 23.48  ? 68   ALA H N   1 
ATOM   2182 C CA  . ALA B 2 69  ? 36.415  27.380 45.391 1.00 23.11  ? 68   ALA H CA  1 
ATOM   2183 C C   . ALA B 2 69  ? 37.486  28.101 46.200 1.00 23.90  ? 68   ALA H C   1 
ATOM   2184 O O   . ALA B 2 69  ? 37.554  29.334 46.199 1.00 24.66  ? 68   ALA H O   1 
ATOM   2185 C CB  . ALA B 2 69  ? 36.850  27.261 43.928 1.00 13.29  ? 68   ALA H CB  1 
ATOM   2186 N N   . PHE B 2 70  ? 38.318  27.322 46.890 1.00 23.12  ? 69   PHE H N   1 
ATOM   2187 C CA  . PHE B 2 70  ? 39.411  27.869 47.689 1.00 25.41  ? 69   PHE H CA  1 
ATOM   2188 C C   . PHE B 2 70  ? 40.713  27.742 46.910 1.00 28.12  ? 69   PHE H C   1 
ATOM   2189 O O   . PHE B 2 70  ? 40.930  26.761 46.203 1.00 29.28  ? 69   PHE H O   1 
ATOM   2190 C CB  . PHE B 2 70  ? 39.592  27.105 49.007 1.00 22.18  ? 69   PHE H CB  1 
ATOM   2191 C CG  . PHE B 2 70  ? 38.326  26.899 49.783 1.00 21.01  ? 69   PHE H CG  1 
ATOM   2192 C CD1 . PHE B 2 70  ? 37.332  27.869 49.802 1.00 21.12  ? 69   PHE H CD1 1 
ATOM   2193 C CD2 . PHE B 2 70  ? 38.141  25.738 50.521 1.00 20.34  ? 69   PHE H CD2 1 
ATOM   2194 C CE1 . PHE B 2 70  ? 36.170  27.685 50.547 1.00 22.80  ? 69   PHE H CE1 1 
ATOM   2195 C CE2 . PHE B 2 70  ? 36.986  25.543 51.271 1.00 22.08  ? 69   PHE H CE2 1 
ATOM   2196 C CZ  . PHE B 2 70  ? 35.997  26.522 51.282 1.00 21.92  ? 69   PHE H CZ  1 
ATOM   2197 N N   . SER B 2 71  ? 41.580  28.735 47.047 1.00 31.02  ? 70   SER H N   1 
ATOM   2198 C CA  . SER B 2 71  ? 42.877  28.714 46.387 1.00 32.37  ? 70   SER H CA  1 
ATOM   2199 C C   . SER B 2 71  ? 43.867  29.404 47.314 1.00 34.45  ? 70   SER H C   1 
ATOM   2200 O O   . SER B 2 71  ? 43.476  29.982 48.325 1.00 34.10  ? 70   SER H O   1 
ATOM   2201 C CB  . SER B 2 71  ? 42.815  29.417 45.023 1.00 24.38  ? 70   SER H CB  1 
ATOM   2202 O OG  . SER B 2 71  ? 42.238  30.703 45.131 1.00 25.20  ? 70   SER H OG  1 
ATOM   2203 N N   . LEU B 2 72  ? 45.147  29.338 46.974 1.00 41.42  ? 71   LEU H N   1 
ATOM   2204 C CA  . LEU B 2 72  ? 46.181  29.935 47.801 1.00 44.66  ? 71   LEU H CA  1 
ATOM   2205 C C   . LEU B 2 72  ? 47.376  30.367 46.965 1.00 48.57  ? 71   LEU H C   1 
ATOM   2206 O O   . LEU B 2 72  ? 47.900  29.580 46.181 1.00 50.19  ? 71   LEU H O   1 
ATOM   2207 C CB  . LEU B 2 72  ? 46.623  28.921 48.852 1.00 30.60  ? 71   LEU H CB  1 
ATOM   2208 C CG  . LEU B 2 72  ? 47.896  29.216 49.638 1.00 31.36  ? 71   LEU H CG  1 
ATOM   2209 C CD1 . LEU B 2 72  ? 47.795  30.573 50.323 1.00 31.30  ? 71   LEU H CD1 1 
ATOM   2210 C CD2 . LEU B 2 72  ? 48.118  28.101 50.654 1.00 30.79  ? 71   LEU H CD2 1 
ATOM   2211 N N   . GLU B 2 73  ? 47.807  31.614 47.136 1.00 68.47  ? 72   GLU H N   1 
ATOM   2212 C CA  . GLU B 2 73  ? 48.950  32.131 46.389 1.00 72.79  ? 72   GLU H CA  1 
ATOM   2213 C C   . GLU B 2 73  ? 49.982  32.761 47.319 1.00 73.85  ? 72   GLU H C   1 
ATOM   2214 O O   . GLU B 2 73  ? 50.760  33.622 46.905 1.00 76.38  ? 72   GLU H O   1 
ATOM   2215 C CB  . GLU B 2 73  ? 48.490  33.169 45.363 1.00 84.19  ? 72   GLU H CB  1 
ATOM   2216 C CG  . GLU B 2 73  ? 47.248  32.759 44.594 1.00 88.92  ? 72   GLU H CG  1 
ATOM   2217 C CD  . GLU B 2 73  ? 46.958  33.677 43.425 1.00 92.40  ? 72   GLU H CD  1 
ATOM   2218 O OE1 . GLU B 2 73  ? 47.076  34.910 43.587 1.00 94.19  ? 72   GLU H OE1 1 
ATOM   2219 O OE2 . GLU B 2 73  ? 46.600  33.163 42.344 1.00 94.51  ? 72   GLU H OE2 1 
ATOM   2220 N N   . THR B 2 77  ? 51.671  35.257 51.963 1.00 62.61  ? 76   THR H N   1 
ATOM   2221 C CA  . THR B 2 77  ? 50.875  34.457 51.041 1.00 61.98  ? 76   THR H CA  1 
ATOM   2222 C C   . THR B 2 77  ? 49.421  34.856 51.200 1.00 60.57  ? 76   THR H C   1 
ATOM   2223 O O   . THR B 2 77  ? 48.983  35.237 52.287 1.00 61.27  ? 76   THR H O   1 
ATOM   2224 C CB  . THR B 2 77  ? 50.982  32.963 51.351 1.00 64.25  ? 76   THR H CB  1 
ATOM   2225 O OG1 . THR B 2 77  ? 50.443  32.709 52.654 1.00 64.65  ? 76   THR H OG1 1 
ATOM   2226 C CG2 . THR B 2 77  ? 52.424  32.517 51.312 1.00 65.77  ? 76   THR H CG2 1 
ATOM   2227 N N   . THR B 2 78  ? 48.667  34.758 50.117 1.00 46.87  ? 77   THR H N   1 
ATOM   2228 C CA  . THR B 2 78  ? 47.276  35.131 50.168 1.00 43.02  ? 77   THR H CA  1 
ATOM   2229 C C   . THR B 2 78  ? 46.351  33.971 49.844 1.00 41.08  ? 77   THR H C   1 
ATOM   2230 O O   . THR B 2 78  ? 46.647  33.153 48.980 1.00 40.15  ? 77   THR H O   1 
ATOM   2231 C CB  . THR B 2 78  ? 47.028  36.296 49.212 1.00 42.48  ? 77   THR H CB  1 
ATOM   2232 O OG1 . THR B 2 78  ? 47.795  37.421 49.651 1.00 44.33  ? 77   THR H OG1 1 
ATOM   2233 C CG2 . THR B 2 78  ? 45.563  36.679 49.188 1.00 42.46  ? 77   THR H CG2 1 
ATOM   2234 N N   . ALA B 2 79  ? 45.246  33.889 50.577 1.00 30.71  ? 78   ALA H N   1 
ATOM   2235 C CA  . ALA B 2 79  ? 44.258  32.845 50.354 1.00 29.21  ? 78   ALA H CA  1 
ATOM   2236 C C   . ALA B 2 79  ? 43.094  33.481 49.619 1.00 28.20  ? 78   ALA H C   1 
ATOM   2237 O O   . ALA B 2 79  ? 42.787  34.656 49.834 1.00 29.12  ? 78   ALA H O   1 
ATOM   2238 C CB  . ALA B 2 79  ? 43.790  32.261 51.678 1.00 32.84  ? 78   ALA H CB  1 
ATOM   2239 N N   . TYR B 2 80  ? 42.446  32.709 48.755 1.00 28.79  ? 79   TYR H N   1 
ATOM   2240 C CA  . TYR B 2 80  ? 41.324  33.219 47.979 1.00 28.75  ? 79   TYR H CA  1 
ATOM   2241 C C   . TYR B 2 80  ? 40.069  32.364 48.095 1.00 28.24  ? 79   TYR H C   1 
ATOM   2242 O O   . TYR B 2 80  ? 40.138  31.160 48.356 1.00 27.41  ? 79   TYR H O   1 
ATOM   2243 C CB  . TYR B 2 80  ? 41.698  33.303 46.499 1.00 33.71  ? 79   TYR H CB  1 
ATOM   2244 C CG  . TYR B 2 80  ? 42.708  34.370 46.171 1.00 36.45  ? 79   TYR H CG  1 
ATOM   2245 C CD1 . TYR B 2 80  ? 42.303  35.666 45.852 1.00 36.50  ? 79   TYR H CD1 1 
ATOM   2246 C CD2 . TYR B 2 80  ? 44.072  34.085 46.180 1.00 38.36  ? 79   TYR H CD2 1 
ATOM   2247 C CE1 . TYR B 2 80  ? 43.234  36.653 45.547 1.00 39.47  ? 79   TYR H CE1 1 
ATOM   2248 C CE2 . TYR B 2 80  ? 45.012  35.063 45.878 1.00 41.09  ? 79   TYR H CE2 1 
ATOM   2249 C CZ  . TYR B 2 80  ? 44.588  36.344 45.562 1.00 41.34  ? 79   TYR H CZ  1 
ATOM   2250 O OH  . TYR B 2 80  ? 45.519  37.314 45.259 1.00 43.60  ? 79   TYR H OH  1 
ATOM   2251 N N   . LEU B 2 81  ? 38.926  33.016 47.903 1.00 23.34  ? 80   LEU H N   1 
ATOM   2252 C CA  . LEU B 2 81  ? 37.634  32.360 47.913 1.00 22.73  ? 80   LEU H CA  1 
ATOM   2253 C C   . LEU B 2 81  ? 36.994  32.868 46.634 1.00 22.66  ? 80   LEU H C   1 
ATOM   2254 O O   . LEU B 2 81  ? 36.692  34.052 46.525 1.00 22.09  ? 80   LEU H O   1 
ATOM   2255 C CB  . LEU B 2 81  ? 36.781  32.788 49.110 1.00 30.13  ? 80   LEU H CB  1 
ATOM   2256 C CG  . LEU B 2 81  ? 35.601  31.880 49.500 1.00 31.45  ? 80   LEU H CG  1 
ATOM   2257 C CD1 . LEU B 2 81  ? 34.395  32.743 49.848 1.00 30.26  ? 80   LEU H CD1 1 
ATOM   2258 C CD2 . LEU B 2 81  ? 35.239  30.934 48.370 1.00 28.84  ? 80   LEU H CD2 1 
ATOM   2259 N N   . GLN B 2 82  ? 36.797  31.978 45.665 1.00 19.74  ? 81   GLN H N   1 
ATOM   2260 C CA  . GLN B 2 82  ? 36.210  32.370 44.392 1.00 20.29  ? 81   GLN H CA  1 
ATOM   2261 C C   . GLN B 2 82  ? 34.801  31.796 44.274 1.00 20.05  ? 81   GLN H C   1 
ATOM   2262 O O   . GLN B 2 82  ? 34.577  30.610 44.514 1.00 19.53  ? 81   GLN H O   1 
ATOM   2263 C CB  . GLN B 2 82  ? 37.100  31.904 43.222 1.00 30.98  ? 81   GLN H CB  1 
ATOM   2264 C CG  . GLN B 2 82  ? 36.714  32.522 41.873 1.00 35.96  ? 81   GLN H CG  1 
ATOM   2265 C CD  . GLN B 2 82  ? 37.728  32.212 40.779 1.00 39.42  ? 81   GLN H CD  1 
ATOM   2266 O OE1 . GLN B 2 82  ? 38.579  33.037 40.412 1.00 42.45  ? 81   GLN H OE1 1 
ATOM   2267 N NE2 . GLN B 2 82  ? 37.640  31.005 40.271 1.00 38.15  ? 81   GLN H NE2 1 
ATOM   2268 N N   . ILE B 2 83  ? 33.852  32.658 43.923 1.00 22.49  ? 82   ILE H N   1 
ATOM   2269 C CA  . ILE B 2 83  ? 32.461  32.261 43.777 1.00 23.75  ? 82   ILE H CA  1 
ATOM   2270 C C   . ILE B 2 83  ? 31.984  32.593 42.368 1.00 24.68  ? 82   ILE H C   1 
ATOM   2271 O O   . ILE B 2 83  ? 32.047  33.748 41.955 1.00 23.52  ? 82   ILE H O   1 
ATOM   2272 C CB  . ILE B 2 83  ? 31.562  33.025 44.767 1.00 22.85  ? 82   ILE H CB  1 
ATOM   2273 C CG1 . ILE B 2 83  ? 32.227  33.094 46.141 1.00 24.40  ? 82   ILE H CG1 1 
ATOM   2274 C CG2 . ILE B 2 83  ? 30.217  32.324 44.905 1.00 21.98  ? 82   ILE H CG2 1 
ATOM   2275 C CD1 . ILE B 2 83  ? 31.398  33.846 47.198 1.00 25.75  ? 82   ILE H CD1 1 
ATOM   2276 N N   . ASN B 2 84  A 31.514  31.592 41.629 1.00 27.16  ? 82   ASN H N   1 
ATOM   2277 C CA  . ASN B 2 84  A 31.021  31.850 40.277 1.00 28.24  ? 82   ASN H CA  1 
ATOM   2278 C C   . ASN B 2 84  A 29.523  31.580 40.193 1.00 27.48  ? 82   ASN H C   1 
ATOM   2279 O O   . ASN B 2 84  A 28.952  30.943 41.081 1.00 27.28  ? 82   ASN H O   1 
ATOM   2280 C CB  . ASN B 2 84  A 31.783  31.011 39.246 1.00 44.19  ? 82   ASN H CB  1 
ATOM   2281 C CG  . ASN B 2 84  A 31.721  29.530 39.536 1.00 48.75  ? 82   ASN H CG  1 
ATOM   2282 O OD1 . ASN B 2 84  A 30.654  28.917 39.486 1.00 51.95  ? 82   ASN H OD1 1 
ATOM   2283 N ND2 . ASN B 2 84  A 32.869  28.943 39.840 1.00 50.44  ? 82   ASN H ND2 1 
ATOM   2284 N N   . ASN B 2 85  B 28.892  32.073 39.128 1.00 21.15  ? 82   ASN H N   1 
ATOM   2285 C CA  . ASN B 2 85  B 27.454  31.920 38.938 1.00 21.50  ? 82   ASN H CA  1 
ATOM   2286 C C   . ASN B 2 85  B 26.702  32.458 40.159 1.00 22.84  ? 82   ASN H C   1 
ATOM   2287 O O   . ASN B 2 85  B 25.755  31.841 40.656 1.00 22.29  ? 82   ASN H O   1 
ATOM   2288 C CB  . ASN B 2 85  B 27.085  30.452 38.689 1.00 26.95  ? 82   ASN H CB  1 
ATOM   2289 C CG  . ASN B 2 85  B 27.350  30.016 37.253 1.00 26.86  ? 82   ASN H CG  1 
ATOM   2290 O OD1 . ASN B 2 85  B 28.428  29.514 36.924 1.00 26.89  ? 82   ASN H OD1 1 
ATOM   2291 N ND2 . ASN B 2 85  B 26.364  30.226 36.386 1.00 25.42  ? 82   ASN H ND2 1 
ATOM   2292 N N   . LEU B 2 86  C 27.131  33.629 40.622 1.00 24.48  ? 82   LEU H N   1 
ATOM   2293 C CA  . LEU B 2 86  C 26.540  34.281 41.781 1.00 23.66  ? 82   LEU H CA  1 
ATOM   2294 C C   . LEU B 2 86  C 25.011  34.382 41.744 1.00 25.21  ? 82   LEU H C   1 
ATOM   2295 O O   . LEU B 2 86  C 24.408  34.670 40.708 1.00 25.25  ? 82   LEU H O   1 
ATOM   2296 C CB  . LEU B 2 86  C 27.150  35.681 41.943 1.00 21.30  ? 82   LEU H CB  1 
ATOM   2297 C CG  . LEU B 2 86  C 28.620  35.728 42.387 1.00 20.86  ? 82   LEU H CG  1 
ATOM   2298 C CD1 . LEU B 2 86  C 29.211  37.110 42.118 1.00 20.51  ? 82   LEU H CD1 1 
ATOM   2299 C CD2 . LEU B 2 86  C 28.720  35.366 43.869 1.00 17.58  ? 82   LEU H CD2 1 
ATOM   2300 N N   . LYS B 2 87  ? 24.392  34.116 42.886 1.00 25.05  ? 83   LYS H N   1 
ATOM   2301 C CA  . LYS B 2 87  ? 22.945  34.210 43.016 1.00 26.46  ? 83   LYS H CA  1 
ATOM   2302 C C   . LYS B 2 87  ? 22.699  35.255 44.081 1.00 25.99  ? 83   LYS H C   1 
ATOM   2303 O O   . LYS B 2 87  ? 23.585  35.549 44.884 1.00 23.89  ? 83   LYS H O   1 
ATOM   2304 C CB  . LYS B 2 87  ? 22.329  32.890 43.482 1.00 36.03  ? 83   LYS H CB  1 
ATOM   2305 C CG  . LYS B 2 87  ? 22.401  31.750 42.483 1.00 38.80  ? 83   LYS H CG  1 
ATOM   2306 C CD  . LYS B 2 87  ? 21.743  30.507 43.068 1.00 38.98  ? 83   LYS H CD  1 
ATOM   2307 C CE  . LYS B 2 87  ? 21.810  29.339 42.108 1.00 41.49  ? 83   LYS H CE  1 
ATOM   2308 N NZ  . LYS B 2 87  ? 21.249  28.098 42.711 1.00 44.14  ? 83   LYS H NZ  1 
ATOM   2309 N N   . ASN B 2 88  ? 21.503  35.821 44.084 1.00 23.80  ? 84   ASN H N   1 
ATOM   2310 C CA  . ASN B 2 88  ? 21.167  36.816 45.081 1.00 26.10  ? 84   ASN H CA  1 
ATOM   2311 C C   . ASN B 2 88  ? 21.438  36.251 46.476 1.00 26.35  ? 84   ASN H C   1 
ATOM   2312 O O   . ASN B 2 88  ? 21.945  36.957 47.347 1.00 26.40  ? 84   ASN H O   1 
ATOM   2313 C CB  . ASN B 2 88  ? 19.695  37.219 44.947 1.00 37.87  ? 84   ASN H CB  1 
ATOM   2314 C CG  . ASN B 2 88  ? 19.454  38.177 43.791 1.00 40.97  ? 84   ASN H CG  1 
ATOM   2315 O OD1 . ASN B 2 88  ? 19.799  37.890 42.647 1.00 40.23  ? 84   ASN H OD1 1 
ATOM   2316 N ND2 . ASN B 2 88  ? 18.857  39.327 44.092 1.00 43.24  ? 84   ASN H ND2 1 
ATOM   2317 N N   . GLU B 2 89  ? 21.116  34.973 46.674 1.00 34.44  ? 85   GLU H N   1 
ATOM   2318 C CA  . GLU B 2 89  ? 21.305  34.313 47.969 1.00 34.97  ? 85   GLU H CA  1 
ATOM   2319 C C   . GLU B 2 89  ? 22.749  34.249 48.472 1.00 33.36  ? 85   GLU H C   1 
ATOM   2320 O O   . GLU B 2 89  ? 22.993  33.819 49.601 1.00 33.10  ? 85   GLU H O   1 
ATOM   2321 C CB  . GLU B 2 89  ? 20.744  32.889 47.934 1.00 44.07  ? 85   GLU H CB  1 
ATOM   2322 C CG  . GLU B 2 89  ? 19.261  32.787 47.635 1.00 50.42  ? 85   GLU H CG  1 
ATOM   2323 C CD  . GLU B 2 89  ? 18.935  33.103 46.189 1.00 55.06  ? 85   GLU H CD  1 
ATOM   2324 O OE1 . GLU B 2 89  ? 19.582  32.522 45.293 1.00 57.02  ? 85   GLU H OE1 1 
ATOM   2325 O OE2 . GLU B 2 89  ? 18.027  33.926 45.950 1.00 58.44  ? 85   GLU H OE2 1 
ATOM   2326 N N   . ASP B 2 90  ? 23.709  34.651 47.646 1.00 25.24  ? 86   ASP H N   1 
ATOM   2327 C CA  . ASP B 2 90  ? 25.102  34.620 48.080 1.00 23.43  ? 86   ASP H CA  1 
ATOM   2328 C C   . ASP B 2 90  ? 25.406  35.907 48.828 1.00 21.93  ? 86   ASP H C   1 
ATOM   2329 O O   . ASP B 2 90  ? 26.504  36.093 49.356 1.00 20.42  ? 86   ASP H O   1 
ATOM   2330 C CB  . ASP B 2 90  ? 26.046  34.482 46.886 1.00 24.33  ? 86   ASP H CB  1 
ATOM   2331 C CG  . ASP B 2 90  ? 25.840  33.187 46.135 1.00 25.14  ? 86   ASP H CG  1 
ATOM   2332 O OD1 . ASP B 2 90  ? 25.695  32.136 46.793 1.00 24.66  ? 86   ASP H OD1 1 
ATOM   2333 O OD2 . ASP B 2 90  ? 25.828  33.219 44.891 1.00 23.64  ? 86   ASP H OD2 1 
ATOM   2334 N N   . THR B 2 91  ? 24.423  36.798 48.855 1.00 20.21  ? 87   THR H N   1 
ATOM   2335 C CA  . THR B 2 91  ? 24.570  38.065 49.546 1.00 18.48  ? 87   THR H CA  1 
ATOM   2336 C C   . THR B 2 91  ? 24.801  37.747 51.014 1.00 18.04  ? 87   THR H C   1 
ATOM   2337 O O   . THR B 2 91  ? 23.929  37.201 51.691 1.00 18.73  ? 87   THR H O   1 
ATOM   2338 C CB  . THR B 2 91  ? 23.309  38.924 49.373 1.00 22.85  ? 87   THR H CB  1 
ATOM   2339 O OG1 . THR B 2 91  ? 23.206  39.335 48.003 1.00 22.41  ? 87   THR H OG1 1 
ATOM   2340 C CG2 . THR B 2 91  ? 23.365  40.153 50.273 1.00 22.25  ? 87   THR H CG2 1 
ATOM   2341 N N   . ALA B 2 92  ? 25.992  38.074 51.496 1.00 20.65  ? 88   ALA H N   1 
ATOM   2342 C CA  . ALA B 2 92  ? 26.344  37.802 52.877 1.00 22.22  ? 88   ALA H CA  1 
ATOM   2343 C C   . ALA B 2 92  ? 27.730  38.341 53.144 1.00 21.58  ? 88   ALA H C   1 
ATOM   2344 O O   . ALA B 2 92  ? 28.340  38.978 52.282 1.00 23.23  ? 88   ALA H O   1 
ATOM   2345 C CB  . ALA B 2 92  ? 26.328  36.290 53.131 1.00 13.78  ? 88   ALA H CB  1 
ATOM   2346 N N   . THR B 2 93  ? 28.214  38.082 54.350 1.00 14.79  ? 89   THR H N   1 
ATOM   2347 C CA  . THR B 2 93  ? 29.553  38.487 54.741 1.00 16.24  ? 89   THR H CA  1 
ATOM   2348 C C   . THR B 2 93  ? 30.343  37.188 54.774 1.00 14.90  ? 89   THR H C   1 
ATOM   2349 O O   . THR B 2 93  ? 29.847  36.164 55.253 1.00 15.98  ? 89   THR H O   1 
ATOM   2350 C CB  . THR B 2 93  ? 29.575  39.148 56.144 1.00 19.29  ? 89   THR H CB  1 
ATOM   2351 O OG1 . THR B 2 93  ? 28.957  40.436 56.071 1.00 19.81  ? 89   THR H OG1 1 
ATOM   2352 C CG2 . THR B 2 93  ? 31.002  39.309 56.639 1.00 18.29  ? 89   THR H CG2 1 
ATOM   2353 N N   . TYR B 2 94  ? 31.558  37.223 54.243 1.00 14.22  ? 90   TYR H N   1 
ATOM   2354 C CA  . TYR B 2 94  ? 32.399  36.041 54.205 1.00 14.72  ? 90   TYR H CA  1 
ATOM   2355 C C   . TYR B 2 94  ? 33.632  36.228 55.066 1.00 14.15  ? 90   TYR H C   1 
ATOM   2356 O O   . TYR B 2 94  ? 34.285  37.275 55.023 1.00 15.37  ? 90   TYR H O   1 
ATOM   2357 C CB  . TYR B 2 94  ? 32.790  35.721 52.754 1.00 16.84  ? 90   TYR H CB  1 
ATOM   2358 C CG  . TYR B 2 94  ? 31.599  35.332 51.907 1.00 16.38  ? 90   TYR H CG  1 
ATOM   2359 C CD1 . TYR B 2 94  ? 30.772  36.302 51.344 1.00 15.72  ? 90   TYR H CD1 1 
ATOM   2360 C CD2 . TYR B 2 94  ? 31.246  33.992 51.746 1.00 15.95  ? 90   TYR H CD2 1 
ATOM   2361 C CE1 . TYR B 2 94  ? 29.614  35.947 50.645 1.00 17.75  ? 90   TYR H CE1 1 
ATOM   2362 C CE2 . TYR B 2 94  ? 30.091  33.621 51.055 1.00 14.99  ? 90   TYR H CE2 1 
ATOM   2363 C CZ  . TYR B 2 94  ? 29.280  34.602 50.510 1.00 17.24  ? 90   TYR H CZ  1 
ATOM   2364 O OH  . TYR B 2 94  ? 28.129  34.242 49.859 1.00 15.36  ? 90   TYR H OH  1 
ATOM   2365 N N   . PHE B 2 95  ? 33.939  35.209 55.858 1.00 14.94  ? 91   PHE H N   1 
ATOM   2366 C CA  . PHE B 2 95  ? 35.089  35.252 56.748 1.00 15.61  ? 91   PHE H CA  1 
ATOM   2367 C C   . PHE B 2 95  ? 36.078  34.148 56.424 1.00 17.39  ? 91   PHE H C   1 
ATOM   2368 O O   . PHE B 2 95  ? 35.678  33.044 56.057 1.00 19.93  ? 91   PHE H O   1 
ATOM   2369 C CB  . PHE B 2 95  ? 34.665  35.029 58.195 1.00 13.91  ? 91   PHE H CB  1 
ATOM   2370 C CG  . PHE B 2 95  ? 33.740  36.072 58.747 1.00 15.24  ? 91   PHE H CG  1 
ATOM   2371 C CD1 . PHE B 2 95  ? 34.243  37.259 59.268 1.00 15.09  ? 91   PHE H CD1 1 
ATOM   2372 C CD2 . PHE B 2 95  ? 32.371  35.835 58.811 1.00 14.93  ? 91   PHE H CD2 1 
ATOM   2373 C CE1 . PHE B 2 95  ? 33.390  38.198 59.859 1.00 18.81  ? 91   PHE H CE1 1 
ATOM   2374 C CE2 . PHE B 2 95  ? 31.511  36.763 59.398 1.00 17.39  ? 91   PHE H CE2 1 
ATOM   2375 C CZ  . PHE B 2 95  ? 32.020  37.946 59.925 1.00 18.61  ? 91   PHE H CZ  1 
ATOM   2376 N N   . CYS B 2 96  ? 37.366  34.448 56.557 1.00 17.58  ? 92   CYS H N   1 
ATOM   2377 C CA  . CYS B 2 96  ? 38.390  33.429 56.386 1.00 19.23  ? 92   CYS H CA  1 
ATOM   2378 C C   . CYS B 2 96  ? 38.947  33.285 57.791 1.00 19.73  ? 92   CYS H C   1 
ATOM   2379 O O   . CYS B 2 96  ? 38.929  34.240 58.574 1.00 21.32  ? 92   CYS H O   1 
ATOM   2380 C CB  . CYS B 2 96  ? 39.496  33.863 55.420 1.00 21.85  ? 92   CYS H CB  1 
ATOM   2381 S SG  . CYS B 2 96  ? 40.319  35.438 55.789 1.00 25.33  ? 92   CYS H SG  1 
ATOM   2382 N N   . ALA B 2 97  ? 39.419  32.094 58.124 1.00 16.87  ? 93   ALA H N   1 
ATOM   2383 C CA  . ALA B 2 97  ? 39.962  31.860 59.443 1.00 18.15  ? 93   ALA H CA  1 
ATOM   2384 C C   . ALA B 2 97  ? 41.013  30.763 59.423 1.00 19.74  ? 93   ALA H C   1 
ATOM   2385 O O   . ALA B 2 97  ? 40.971  29.843 58.595 1.00 17.53  ? 93   ALA H O   1 
ATOM   2386 C CB  . ALA B 2 97  ? 38.845  31.481 60.402 1.00 20.88  ? 93   ALA H CB  1 
ATOM   2387 N N   . THR B 2 98  ? 41.966  30.877 60.334 1.00 18.44  ? 94   THR H N   1 
ATOM   2388 C CA  . THR B 2 98  ? 43.006  29.876 60.451 1.00 21.17  ? 94   THR H CA  1 
ATOM   2389 C C   . THR B 2 98  ? 43.233  29.667 61.943 1.00 21.31  ? 94   THR H C   1 
ATOM   2390 O O   . THR B 2 98  ? 42.550  30.273 62.764 1.00 21.19  ? 94   THR H O   1 
ATOM   2391 C CB  . THR B 2 98  ? 44.303  30.319 59.763 1.00 28.83  ? 94   THR H CB  1 
ATOM   2392 O OG1 . THR B 2 98  ? 45.266  29.269 59.869 1.00 29.38  ? 94   THR H OG1 1 
ATOM   2393 C CG2 . THR B 2 98  ? 44.848  31.586 60.402 1.00 30.04  ? 94   THR H CG2 1 
ATOM   2394 N N   . TRP B 2 99  ? 44.180  28.813 62.301 1.00 24.74  ? 95   TRP H N   1 
ATOM   2395 C CA  . TRP B 2 99  ? 44.420  28.533 63.706 1.00 26.16  ? 95   TRP H CA  1 
ATOM   2396 C C   . TRP B 2 99  ? 45.853  28.080 63.959 1.00 28.49  ? 95   TRP H C   1 
ATOM   2397 O O   . TRP B 2 99  ? 46.604  27.806 63.026 1.00 29.80  ? 95   TRP H O   1 
ATOM   2398 C CB  . TRP B 2 99  ? 43.428  27.463 64.171 1.00 24.17  ? 95   TRP H CB  1 
ATOM   2399 C CG  . TRP B 2 99  ? 43.410  26.240 63.269 1.00 24.91  ? 95   TRP H CG  1 
ATOM   2400 C CD1 . TRP B 2 99  ? 44.162  25.111 63.406 1.00 24.29  ? 95   TRP H CD1 1 
ATOM   2401 C CD2 . TRP B 2 99  ? 42.639  26.061 62.073 1.00 23.16  ? 95   TRP H CD2 1 
ATOM   2402 N NE1 . TRP B 2 99  ? 43.913  24.240 62.377 1.00 22.93  ? 95   TRP H NE1 1 
ATOM   2403 C CE2 . TRP B 2 99  ? 42.983  24.797 61.540 1.00 25.39  ? 95   TRP H CE2 1 
ATOM   2404 C CE3 . TRP B 2 99  ? 41.696  26.847 61.396 1.00 23.19  ? 95   TRP H CE3 1 
ATOM   2405 C CZ2 . TRP B 2 99  ? 42.416  24.298 60.360 1.00 21.94  ? 95   TRP H CZ2 1 
ATOM   2406 C CZ3 . TRP B 2 99  ? 41.131  26.353 60.219 1.00 23.28  ? 95   TRP H CZ3 1 
ATOM   2407 C CH2 . TRP B 2 99  ? 41.495  25.089 59.715 1.00 25.54  ? 95   TRP H CH2 1 
ATOM   2408 N N   . GLY B 2 100 ? 46.225  28.007 65.230 1.00 27.60  ? 96   GLY H N   1 
ATOM   2409 C CA  . GLY B 2 100 ? 47.567  27.593 65.588 1.00 26.73  ? 96   GLY H CA  1 
ATOM   2410 C C   . GLY B 2 100 ? 47.818  27.971 67.027 1.00 26.47  ? 96   GLY H C   1 
ATOM   2411 O O   . GLY B 2 100 ? 47.038  28.717 67.613 1.00 26.09  ? 96   GLY H O   1 
ATOM   2412 N N   . GLY B 2 101 ? 48.901  27.471 67.607 1.00 26.46  ? 97   GLY H N   1 
ATOM   2413 C CA  . GLY B 2 101 ? 49.180  27.803 68.991 1.00 27.28  ? 97   GLY H CA  1 
ATOM   2414 C C   . GLY B 2 101 ? 47.957  27.517 69.846 1.00 26.23  ? 97   GLY H C   1 
ATOM   2415 O O   . GLY B 2 101 ? 47.372  26.439 69.766 1.00 24.95  ? 97   GLY H O   1 
ATOM   2416 N N   . ASN B 2 102 ? 47.546  28.483 70.653 1.00 27.10  ? 98   ASN H N   1 
ATOM   2417 C CA  . ASN B 2 102 ? 46.392  28.270 71.511 1.00 27.80  ? 98   ASN H CA  1 
ATOM   2418 C C   . ASN B 2 102 ? 45.208  29.158 71.133 1.00 28.05  ? 98   ASN H C   1 
ATOM   2419 O O   . ASN B 2 102 ? 44.557  29.736 72.005 1.00 27.73  ? 98   ASN H O   1 
ATOM   2420 C CB  . ASN B 2 102 ? 46.795  28.504 72.971 1.00 34.04  ? 98   ASN H CB  1 
ATOM   2421 C CG  . ASN B 2 102 ? 45.717  28.088 73.945 1.00 36.32  ? 98   ASN H CG  1 
ATOM   2422 O OD1 . ASN B 2 102 ? 45.155  26.996 73.838 1.00 35.59  ? 98   ASN H OD1 1 
ATOM   2423 N ND2 . ASN B 2 102 ? 45.428  28.952 74.911 1.00 35.30  ? 98   ASN H ND2 1 
ATOM   2424 N N   . SER B 2 103 ? 44.928  29.268 69.834 1.00 23.47  ? 99   SER H N   1 
ATOM   2425 C CA  . SER B 2 103 ? 43.807  30.086 69.387 1.00 24.21  ? 99   SER H CA  1 
ATOM   2426 C C   . SER B 2 103 ? 43.498  30.035 67.893 1.00 22.85  ? 99   SER H C   1 
ATOM   2427 O O   . SER B 2 103 ? 44.108  29.279 67.135 1.00 21.96  ? 99   SER H O   1 
ATOM   2428 C CB  . SER B 2 103 ? 44.015  31.540 69.819 1.00 44.94  ? 99   SER H CB  1 
ATOM   2429 O OG  . SER B 2 103 ? 45.316  31.996 69.497 1.00 49.73  ? 99   SER H OG  1 
ATOM   2430 N N   . ALA B 2 104 ? 42.525  30.840 67.481 1.00 22.70  ? 101  ALA H N   1 
ATOM   2431 C CA  . ALA B 2 104 ? 42.113  30.901 66.087 1.00 23.11  ? 101  ALA H CA  1 
ATOM   2432 C C   . ALA B 2 104 ? 42.187  32.345 65.634 1.00 22.25  ? 101  ALA H C   1 
ATOM   2433 O O   . ALA B 2 104 ? 42.075  33.258 66.445 1.00 20.98  ? 101  ALA H O   1 
ATOM   2434 C CB  . ALA B 2 104 ? 40.692  30.380 65.935 1.00 18.64  ? 101  ALA H CB  1 
ATOM   2435 N N   . TYR B 2 105 ? 42.376  32.552 64.338 1.00 24.44  ? 102  TYR H N   1 
ATOM   2436 C CA  . TYR B 2 105 ? 42.466  33.904 63.808 1.00 26.12  ? 102  TYR H CA  1 
ATOM   2437 C C   . TYR B 2 105 ? 41.516  34.084 62.639 1.00 24.97  ? 102  TYR H C   1 
ATOM   2438 O O   . TYR B 2 105 ? 41.645  33.422 61.609 1.00 27.14  ? 102  TYR H O   1 
ATOM   2439 C CB  . TYR B 2 105 ? 43.902  34.197 63.377 1.00 28.98  ? 102  TYR H CB  1 
ATOM   2440 C CG  . TYR B 2 105 ? 44.914  33.739 64.397 1.00 31.01  ? 102  TYR H CG  1 
ATOM   2441 C CD1 . TYR B 2 105 ? 45.399  32.430 64.388 1.00 32.40  ? 102  TYR H CD1 1 
ATOM   2442 C CD2 . TYR B 2 105 ? 45.354  34.597 65.399 1.00 32.02  ? 102  TYR H CD2 1 
ATOM   2443 C CE1 . TYR B 2 105 ? 46.297  31.989 65.351 1.00 33.53  ? 102  TYR H CE1 1 
ATOM   2444 C CE2 . TYR B 2 105 ? 46.248  34.168 66.370 1.00 34.37  ? 102  TYR H CE2 1 
ATOM   2445 C CZ  . TYR B 2 105 ? 46.717  32.865 66.341 1.00 36.41  ? 102  TYR H CZ  1 
ATOM   2446 O OH  . TYR B 2 105 ? 47.611  32.443 67.300 1.00 38.75  ? 102  TYR H OH  1 
ATOM   2447 N N   . TRP B 2 106 ? 40.559  34.985 62.811 1.00 22.58  ? 103  TRP H N   1 
ATOM   2448 C CA  . TRP B 2 106 ? 39.566  35.260 61.787 1.00 21.45  ? 103  TRP H CA  1 
ATOM   2449 C C   . TRP B 2 106 ? 39.804  36.617 61.140 1.00 23.00  ? 103  TRP H C   1 
ATOM   2450 O O   . TRP B 2 106 ? 40.289  37.546 61.787 1.00 20.65  ? 103  TRP H O   1 
ATOM   2451 C CB  . TRP B 2 106 ? 38.172  35.244 62.406 1.00 19.90  ? 103  TRP H CB  1 
ATOM   2452 C CG  . TRP B 2 106 ? 37.634  33.879 62.710 1.00 16.27  ? 103  TRP H CG  1 
ATOM   2453 C CD1 . TRP B 2 106 ? 38.237  32.893 63.437 1.00 15.54  ? 103  TRP H CD1 1 
ATOM   2454 C CD2 . TRP B 2 106 ? 36.355  33.369 62.322 1.00 15.65  ? 103  TRP H CD2 1 
ATOM   2455 N NE1 . TRP B 2 106 ? 37.406  31.796 63.528 1.00 15.05  ? 103  TRP H NE1 1 
ATOM   2456 C CE2 . TRP B 2 106 ? 36.245  32.064 62.854 1.00 14.28  ? 103  TRP H CE2 1 
ATOM   2457 C CE3 . TRP B 2 106 ? 35.286  33.893 61.578 1.00 16.65  ? 103  TRP H CE3 1 
ATOM   2458 C CZ2 . TRP B 2 106 ? 35.107  31.275 62.668 1.00 14.27  ? 103  TRP H CZ2 1 
ATOM   2459 C CZ3 . TRP B 2 106 ? 34.153  33.106 61.392 1.00 16.47  ? 103  TRP H CZ3 1 
ATOM   2460 C CH2 . TRP B 2 106 ? 34.074  31.813 61.937 1.00 15.38  ? 103  TRP H CH2 1 
ATOM   2461 N N   . GLY B 2 107 ? 39.469  36.722 59.858 1.00 20.55  ? 104  GLY H N   1 
ATOM   2462 C CA  . GLY B 2 107 ? 39.627  37.981 59.154 1.00 20.42  ? 104  GLY H CA  1 
ATOM   2463 C C   . GLY B 2 107 ? 38.502  38.897 59.590 1.00 19.89  ? 104  GLY H C   1 
ATOM   2464 O O   . GLY B 2 107 ? 37.613  38.459 60.316 1.00 19.48  ? 104  GLY H O   1 
ATOM   2465 N N   . GLN B 2 108 ? 38.522  40.154 59.153 1.00 23.10  ? 105  GLN H N   1 
ATOM   2466 C CA  . GLN B 2 108 ? 37.485  41.106 59.546 1.00 22.02  ? 105  GLN H CA  1 
ATOM   2467 C C   . GLN B 2 108 ? 36.175  40.867 58.793 1.00 21.77  ? 105  GLN H C   1 
ATOM   2468 O O   . GLN B 2 108 ? 35.143  41.454 59.124 1.00 19.05  ? 105  GLN H O   1 
ATOM   2469 C CB  . GLN B 2 108 ? 37.956  42.546 59.303 1.00 19.05  ? 105  GLN H CB  1 
ATOM   2470 C CG  . GLN B 2 108 ? 37.749  43.044 57.874 1.00 18.10  ? 105  GLN H CG  1 
ATOM   2471 C CD  . GLN B 2 108 ? 38.918  42.748 56.951 1.00 19.69  ? 105  GLN H CD  1 
ATOM   2472 O OE1 . GLN B 2 108 ? 39.668  41.789 57.152 1.00 21.25  ? 105  GLN H OE1 1 
ATOM   2473 N NE2 . GLN B 2 108 ? 39.068  43.568 55.919 1.00 18.53  ? 105  GLN H NE2 1 
ATOM   2474 N N   . GLY B 2 109 ? 36.230  40.007 57.779 1.00 19.40  ? 106  GLY H N   1 
ATOM   2475 C CA  . GLY B 2 109 ? 35.051  39.712 56.994 1.00 18.81  ? 106  GLY H CA  1 
ATOM   2476 C C   . GLY B 2 109 ? 34.957  40.584 55.754 1.00 21.19  ? 106  GLY H C   1 
ATOM   2477 O O   . GLY B 2 109 ? 35.506  41.684 55.717 1.00 21.52  ? 106  GLY H O   1 
ATOM   2478 N N   . THR B 2 110 ? 34.266  40.082 54.734 1.00 22.56  ? 107  THR H N   1 
ATOM   2479 C CA  . THR B 2 110 ? 34.067  40.805 53.482 1.00 20.96  ? 107  THR H CA  1 
ATOM   2480 C C   . THR B 2 110 ? 32.596  40.704 53.114 1.00 21.19  ? 107  THR H C   1 
ATOM   2481 O O   . THR B 2 110 ? 32.051  39.606 53.028 1.00 21.60  ? 107  THR H O   1 
ATOM   2482 C CB  . THR B 2 110 ? 34.904  40.187 52.336 1.00 19.97  ? 107  THR H CB  1 
ATOM   2483 O OG1 . THR B 2 110 ? 36.298  40.301 52.648 1.00 18.30  ? 107  THR H OG1 1 
ATOM   2484 C CG2 . THR B 2 110 ? 34.616  40.902 51.008 1.00 17.16  ? 107  THR H CG2 1 
ATOM   2485 N N   . THR B 2 111 ? 31.944  41.840 52.904 1.00 19.00  ? 108  THR H N   1 
ATOM   2486 C CA  . THR B 2 111 ? 30.534  41.804 52.543 1.00 20.49  ? 108  THR H CA  1 
ATOM   2487 C C   . THR B 2 111 ? 30.367  41.719 51.037 1.00 21.10  ? 108  THR H C   1 
ATOM   2488 O O   . THR B 2 111 ? 31.069  42.387 50.277 1.00 20.29  ? 108  THR H O   1 
ATOM   2489 C CB  . THR B 2 111 ? 29.775  43.053 53.016 1.00 23.40  ? 108  THR H CB  1 
ATOM   2490 O OG1 . THR B 2 111 ? 30.119  44.164 52.178 1.00 26.28  ? 108  THR H OG1 1 
ATOM   2491 C CG2 . THR B 2 111 ? 30.129  43.375 54.459 1.00 22.92  ? 108  THR H CG2 1 
ATOM   2492 N N   . LEU B 2 112 ? 29.431  40.882 50.613 1.00 20.99  ? 109  LEU H N   1 
ATOM   2493 C CA  . LEU B 2 112 ? 29.140  40.714 49.207 1.00 21.02  ? 109  LEU H CA  1 
ATOM   2494 C C   . LEU B 2 112 ? 27.667  40.955 49.000 1.00 20.74  ? 109  LEU H C   1 
ATOM   2495 O O   . LEU B 2 112 ? 26.834  40.473 49.763 1.00 21.50  ? 109  LEU H O   1 
ATOM   2496 C CB  . LEU B 2 112 ? 29.484  39.294 48.738 1.00 20.20  ? 109  LEU H CB  1 
ATOM   2497 C CG  . LEU B 2 112 ? 28.970  38.893 47.350 1.00 18.56  ? 109  LEU H CG  1 
ATOM   2498 C CD1 . LEU B 2 112 ? 29.611  39.754 46.268 1.00 19.02  ? 109  LEU H CD1 1 
ATOM   2499 C CD2 . LEU B 2 112 ? 29.291  37.426 47.103 1.00 19.90  ? 109  LEU H CD2 1 
ATOM   2500 N N   . THR B 2 113 ? 27.344  41.721 47.972 1.00 20.44  ? 110  THR H N   1 
ATOM   2501 C CA  . THR B 2 113 ? 25.957  41.971 47.652 1.00 21.75  ? 110  THR H CA  1 
ATOM   2502 C C   . THR B 2 113 ? 25.797  41.564 46.204 1.00 22.82  ? 110  THR H C   1 
ATOM   2503 O O   . THR B 2 113 ? 26.557  42.007 45.342 1.00 24.08  ? 110  THR H O   1 
ATOM   2504 C CB  . THR B 2 113 ? 25.582  43.455 47.828 1.00 26.03  ? 110  THR H CB  1 
ATOM   2505 O OG1 . THR B 2 113 ? 25.674  43.810 49.215 1.00 28.96  ? 110  THR H OG1 1 
ATOM   2506 C CG2 . THR B 2 113 ? 24.165  43.704 47.342 1.00 25.65  ? 110  THR H CG2 1 
ATOM   2507 N N   . VAL B 2 114 ? 24.834  40.684 45.952 1.00 26.26  ? 111  VAL H N   1 
ATOM   2508 C CA  . VAL B 2 114 ? 24.551  40.207 44.607 1.00 26.66  ? 111  VAL H CA  1 
ATOM   2509 C C   . VAL B 2 114 ? 23.130  40.623 44.269 1.00 26.13  ? 111  VAL H C   1 
ATOM   2510 O O   . VAL B 2 114 ? 22.171  40.135 44.868 1.00 25.67  ? 111  VAL H O   1 
ATOM   2511 C CB  . VAL B 2 114 ? 24.657  38.666 44.509 1.00 22.37  ? 111  VAL H CB  1 
ATOM   2512 C CG1 . VAL B 2 114 ? 24.230  38.207 43.122 1.00 23.99  ? 111  VAL H CG1 1 
ATOM   2513 C CG2 . VAL B 2 114 ? 26.086  38.219 44.792 1.00 22.04  ? 111  VAL H CG2 1 
ATOM   2514 N N   . SER B 2 115 ? 22.996  41.533 43.312 1.00 22.74  ? 112  SER H N   1 
ATOM   2515 C CA  . SER B 2 115 ? 21.675  42.017 42.923 1.00 22.52  ? 112  SER H CA  1 
ATOM   2516 C C   . SER B 2 115 ? 21.674  42.618 41.527 1.00 23.04  ? 112  SER H C   1 
ATOM   2517 O O   . SER B 2 115 ? 22.726  42.953 40.980 1.00 21.62  ? 112  SER H O   1 
ATOM   2518 C CB  . SER B 2 115 ? 21.184  43.069 43.923 1.00 22.89  ? 112  SER H CB  1 
ATOM   2519 O OG  . SER B 2 115 ? 19.965  43.648 43.493 1.00 20.23  ? 112  SER H OG  1 
ATOM   2520 N N   . SER B 2 116 ? 20.476  42.757 40.969 1.00 26.97  ? 113  SER H N   1 
ATOM   2521 C CA  . SER B 2 116 ? 20.287  43.321 39.639 1.00 28.25  ? 113  SER H CA  1 
ATOM   2522 C C   . SER B 2 116 ? 20.180  44.836 39.742 1.00 27.18  ? 113  SER H C   1 
ATOM   2523 O O   . SER B 2 116 ? 20.378  45.555 38.761 1.00 25.84  ? 113  SER H O   1 
ATOM   2524 C CB  . SER B 2 116 ? 19.002  42.766 39.023 1.00 46.53  ? 113  SER H CB  1 
ATOM   2525 O OG  . SER B 2 116 ? 18.985  41.349 39.078 1.00 55.31  ? 113  SER H OG  1 
ATOM   2526 N N   . ALA B 2 117 ? 19.858  45.302 40.945 1.00 21.58  ? 114  ALA H N   1 
ATOM   2527 C CA  . ALA B 2 117 ? 19.684  46.719 41.243 1.00 22.84  ? 114  ALA H CA  1 
ATOM   2528 C C   . ALA B 2 117 ? 20.854  47.608 40.840 1.00 23.87  ? 114  ALA H C   1 
ATOM   2529 O O   . ALA B 2 117 ? 22.012  47.205 40.919 1.00 23.32  ? 114  ALA H O   1 
ATOM   2530 C CB  . ALA B 2 117 ? 19.406  46.889 42.730 1.00 32.83  ? 114  ALA H CB  1 
ATOM   2531 N N   . LYS B 2 118 ? 20.544  48.828 40.416 1.00 25.71  ? 115  LYS H N   1 
ATOM   2532 C CA  . LYS B 2 118 ? 21.579  49.774 40.028 1.00 27.84  ? 115  LYS H CA  1 
ATOM   2533 C C   . LYS B 2 118 ? 21.941  50.644 41.224 1.00 25.98  ? 115  LYS H C   1 
ATOM   2534 O O   . LYS B 2 118 ? 21.066  51.062 41.978 1.00 25.68  ? 115  LYS H O   1 
ATOM   2535 C CB  . LYS B 2 118 ? 21.094  50.677 38.895 1.00 51.96  ? 115  LYS H CB  1 
ATOM   2536 C CG  . LYS B 2 118 ? 22.098  51.758 38.538 1.00 57.10  ? 115  LYS H CG  1 
ATOM   2537 C CD  . LYS B 2 118 ? 21.532  52.759 37.556 1.00 61.93  ? 115  LYS H CD  1 
ATOM   2538 C CE  . LYS B 2 118 ? 22.587  53.780 37.185 1.00 64.25  ? 115  LYS H CE  1 
ATOM   2539 N NZ  . LYS B 2 118 ? 23.809  53.101 36.673 1.00 67.14  ? 115  LYS H NZ  1 
ATOM   2540 N N   . THR B 2 119 ? 23.228  50.913 41.400 1.00 27.74  ? 116  THR H N   1 
ATOM   2541 C CA  . THR B 2 119 ? 23.658  51.755 42.502 1.00 28.31  ? 116  THR H CA  1 
ATOM   2542 C C   . THR B 2 119 ? 22.841  53.048 42.447 1.00 27.96  ? 116  THR H C   1 
ATOM   2543 O O   . THR B 2 119 ? 22.842  53.755 41.439 1.00 28.79  ? 116  THR H O   1 
ATOM   2544 C CB  . THR B 2 119 ? 25.156  52.054 42.396 1.00 27.98  ? 116  THR H CB  1 
ATOM   2545 O OG1 . THR B 2 119 ? 25.888  50.834 42.576 1.00 28.43  ? 116  THR H OG1 1 
ATOM   2546 C CG2 . THR B 2 119 ? 25.584  53.058 43.453 1.00 29.35  ? 116  THR H CG2 1 
ATOM   2547 N N   . THR B 2 120 ? 22.130  53.339 43.531 1.00 24.28  ? 117  THR H N   1 
ATOM   2548 C CA  . THR B 2 120 ? 21.281  54.521 43.592 1.00 23.34  ? 117  THR H CA  1 
ATOM   2549 C C   . THR B 2 120 ? 21.471  55.294 44.892 1.00 22.29  ? 117  THR H C   1 
ATOM   2550 O O   . THR B 2 120 ? 21.341  54.732 45.981 1.00 21.89  ? 117  THR H O   1 
ATOM   2551 C CB  . THR B 2 120 ? 19.802  54.120 43.486 1.00 25.91  ? 117  THR H CB  1 
ATOM   2552 O OG1 . THR B 2 120 ? 19.606  53.348 42.296 1.00 30.97  ? 117  THR H OG1 1 
ATOM   2553 C CG2 . THR B 2 120 ? 18.910  55.350 43.448 1.00 25.63  ? 117  THR H CG2 1 
ATOM   2554 N N   . PRO B 2 121 ? 21.774  56.598 44.792 1.00 21.00  ? 118  PRO H N   1 
ATOM   2555 C CA  . PRO B 2 121 ? 21.974  57.426 45.984 1.00 19.86  ? 118  PRO H CA  1 
ATOM   2556 C C   . PRO B 2 121 ? 20.664  57.618 46.753 1.00 18.86  ? 118  PRO H C   1 
ATOM   2557 O O   . PRO B 2 121 ? 19.577  57.492 46.189 1.00 16.76  ? 118  PRO H O   1 
ATOM   2558 C CB  . PRO B 2 121 ? 22.536  58.728 45.409 1.00 19.74  ? 118  PRO H CB  1 
ATOM   2559 C CG  . PRO B 2 121 ? 21.880  58.805 44.053 1.00 19.60  ? 118  PRO H CG  1 
ATOM   2560 C CD  . PRO B 2 121 ? 21.969  57.383 43.557 1.00 19.78  ? 118  PRO H CD  1 
ATOM   2561 N N   . PRO B 2 122 ? 20.754  57.906 48.060 1.00 17.79  ? 119  PRO H N   1 
ATOM   2562 C CA  . PRO B 2 122 ? 19.542  58.099 48.861 1.00 16.48  ? 119  PRO H CA  1 
ATOM   2563 C C   . PRO B 2 122 ? 18.939  59.496 48.810 1.00 17.28  ? 119  PRO H C   1 
ATOM   2564 O O   . PRO B 2 122 ? 19.627  60.475 48.515 1.00 16.74  ? 119  PRO H O   1 
ATOM   2565 C CB  . PRO B 2 122 ? 20.013  57.750 50.266 1.00 18.28  ? 119  PRO H CB  1 
ATOM   2566 C CG  . PRO B 2 122 ? 21.405  58.301 50.272 1.00 17.84  ? 119  PRO H CG  1 
ATOM   2567 C CD  . PRO B 2 122 ? 21.950  57.844 48.922 1.00 16.71  ? 119  PRO H CD  1 
ATOM   2568 N N   . SER B 2 123 ? 17.639  59.569 49.081 1.00 15.21  ? 120  SER H N   1 
ATOM   2569 C CA  . SER B 2 123 ? 16.930  60.839 49.157 1.00 16.37  ? 120  SER H CA  1 
ATOM   2570 C C   . SER B 2 123 ? 16.803  61.022 50.670 1.00 16.60  ? 120  SER H C   1 
ATOM   2571 O O   . SER B 2 123 ? 16.216  60.186 51.352 1.00 18.81  ? 120  SER H O   1 
ATOM   2572 C CB  . SER B 2 123 ? 15.535  60.735 48.534 1.00 21.00  ? 120  SER H CB  1 
ATOM   2573 O OG  . SER B 2 123 ? 15.597  60.486 47.139 1.00 24.37  ? 120  SER H OG  1 
ATOM   2574 N N   . VAL B 2 124 ? 17.370  62.093 51.200 1.00 18.35  ? 121  VAL H N   1 
ATOM   2575 C CA  . VAL B 2 124 ? 17.326  62.335 52.636 1.00 16.53  ? 121  VAL H CA  1 
ATOM   2576 C C   . VAL B 2 124 ? 16.280  63.389 52.991 1.00 18.30  ? 121  VAL H C   1 
ATOM   2577 O O   . VAL B 2 124 ? 16.261  64.473 52.408 1.00 16.78  ? 121  VAL H O   1 
ATOM   2578 C CB  . VAL B 2 124 ? 18.709  62.785 53.136 1.00 15.47  ? 121  VAL H CB  1 
ATOM   2579 C CG1 . VAL B 2 124 ? 18.698  62.952 54.649 1.00 16.06  ? 121  VAL H CG1 1 
ATOM   2580 C CG2 . VAL B 2 124 ? 19.769  61.772 52.697 1.00 11.51  ? 121  VAL H CG2 1 
ATOM   2581 N N   . TYR B 2 125 ? 15.408  63.057 53.941 1.00 14.60  ? 122  TYR H N   1 
ATOM   2582 C CA  . TYR B 2 125 ? 14.345  63.962 54.370 1.00 15.97  ? 122  TYR H CA  1 
ATOM   2583 C C   . TYR B 2 125 ? 14.403  64.255 55.862 1.00 16.18  ? 122  TYR H C   1 
ATOM   2584 O O   . TYR B 2 125 ? 14.640  63.359 56.674 1.00 14.71  ? 122  TYR H O   1 
ATOM   2585 C CB  . TYR B 2 125 ? 12.977  63.363 54.046 1.00 18.22  ? 122  TYR H CB  1 
ATOM   2586 C CG  . TYR B 2 125 ? 12.768  63.070 52.583 1.00 20.67  ? 122  TYR H CG  1 
ATOM   2587 C CD1 . TYR B 2 125 ? 12.457  61.780 52.152 1.00 22.01  ? 122  TYR H CD1 1 
ATOM   2588 C CD2 . TYR B 2 125 ? 12.883  64.079 51.624 1.00 20.50  ? 122  TYR H CD2 1 
ATOM   2589 C CE1 . TYR B 2 125 ? 12.264  61.495 50.806 1.00 22.75  ? 122  TYR H CE1 1 
ATOM   2590 C CE2 . TYR B 2 125 ? 12.694  63.804 50.267 1.00 21.80  ? 122  TYR H CE2 1 
ATOM   2591 C CZ  . TYR B 2 125 ? 12.384  62.508 49.869 1.00 22.75  ? 122  TYR H CZ  1 
ATOM   2592 O OH  . TYR B 2 125 ? 12.195  62.213 48.539 1.00 24.76  ? 122  TYR H OH  1 
ATOM   2593 N N   . PRO B 2 126 ? 14.163  65.515 56.245 1.00 25.03  ? 123  PRO H N   1 
ATOM   2594 C CA  . PRO B 2 126 ? 14.197  65.894 57.659 1.00 26.11  ? 123  PRO H CA  1 
ATOM   2595 C C   . PRO B 2 126 ? 12.937  65.457 58.410 1.00 25.78  ? 123  PRO H C   1 
ATOM   2596 O O   . PRO B 2 126 ? 11.836  65.512 57.870 1.00 28.26  ? 123  PRO H O   1 
ATOM   2597 C CB  . PRO B 2 126 ? 14.336  67.412 57.595 1.00 22.00  ? 123  PRO H CB  1 
ATOM   2598 C CG  . PRO B 2 126 ? 13.478  67.755 56.406 1.00 21.45  ? 123  PRO H CG  1 
ATOM   2599 C CD  . PRO B 2 126 ? 13.856  66.681 55.390 1.00 21.57  ? 123  PRO H CD  1 
ATOM   2600 N N   . LEU B 2 127 ? 13.116  65.009 59.648 1.00 20.22  ? 124  LEU H N   1 
ATOM   2601 C CA  . LEU B 2 127 ? 12.004  64.582 60.495 1.00 20.14  ? 124  LEU H CA  1 
ATOM   2602 C C   . LEU B 2 127 ? 11.909  65.539 61.679 1.00 21.26  ? 124  LEU H C   1 
ATOM   2603 O O   . LEU B 2 127 ? 12.671  65.431 62.641 1.00 19.97  ? 124  LEU H O   1 
ATOM   2604 C CB  . LEU B 2 127 ? 12.229  63.157 61.013 1.00 16.01  ? 124  LEU H CB  1 
ATOM   2605 C CG  . LEU B 2 127 ? 12.306  62.060 59.948 1.00 18.66  ? 124  LEU H CG  1 
ATOM   2606 C CD1 . LEU B 2 127 ? 12.626  60.711 60.590 1.00 17.22  ? 124  LEU H CD1 1 
ATOM   2607 C CD2 . LEU B 2 127 ? 10.982  61.997 59.208 1.00 18.47  ? 124  LEU H CD2 1 
ATOM   2608 N N   . ALA B 2 128 ? 10.982  66.485 61.596 1.00 19.95  ? 125  ALA H N   1 
ATOM   2609 C CA  . ALA B 2 128 ? 10.793  67.460 62.658 1.00 21.43  ? 125  ALA H CA  1 
ATOM   2610 C C   . ALA B 2 128 ? 9.405   67.299 63.262 1.00 23.58  ? 125  ALA H C   1 
ATOM   2611 O O   . ALA B 2 128 ? 8.478   66.844 62.591 1.00 23.88  ? 125  ALA H O   1 
ATOM   2612 C CB  . ALA B 2 128 ? 10.965  68.868 62.109 1.00 18.69  ? 125  ALA H CB  1 
ATOM   2613 N N   . PRO B 2 129 ? 9.250   67.660 64.547 1.00 32.19  ? 126  PRO H N   1 
ATOM   2614 C CA  . PRO B 2 129 ? 7.984   67.575 65.287 1.00 35.00  ? 126  PRO H CA  1 
ATOM   2615 C C   . PRO B 2 129 ? 6.821   68.253 64.556 1.00 38.08  ? 126  PRO H C   1 
ATOM   2616 O O   . PRO B 2 129 ? 7.013   69.246 63.856 1.00 38.38  ? 126  PRO H O   1 
ATOM   2617 C CB  . PRO B 2 129 ? 8.314   68.270 66.601 1.00 27.36  ? 126  PRO H CB  1 
ATOM   2618 C CG  . PRO B 2 129 ? 9.748   67.903 66.813 1.00 27.02  ? 126  PRO H CG  1 
ATOM   2619 C CD  . PRO B 2 129 ? 10.342  68.107 65.432 1.00 26.11  ? 126  PRO H CD  1 
ATOM   2620 N N   . GLY B 2 130 ? 5.619   67.712 64.728 1.00 56.86  ? 127  GLY H N   1 
ATOM   2621 C CA  . GLY B 2 130 ? 4.448   68.277 64.076 1.00 59.32  ? 127  GLY H CA  1 
ATOM   2622 C C   . GLY B 2 130 ? 4.291   69.771 64.292 1.00 60.91  ? 127  GLY H C   1 
ATOM   2623 O O   . GLY B 2 130 ? 3.995   70.224 65.400 1.00 63.30  ? 127  GLY H O   1 
ATOM   2624 N N   . ASN B 2 136 ? 8.377   70.248 75.913 1.00 33.48  ? 133  ASN H N   1 
ATOM   2625 C CA  . ASN B 2 136 ? 9.104   69.378 76.837 1.00 33.90  ? 133  ASN H CA  1 
ATOM   2626 C C   . ASN B 2 136 ? 10.555  69.822 76.919 1.00 32.78  ? 133  ASN H C   1 
ATOM   2627 O O   . ASN B 2 136 ? 11.006  70.624 76.109 1.00 34.30  ? 133  ASN H O   1 
ATOM   2628 C CB  . ASN B 2 136 ? 9.047   67.931 76.350 1.00 41.54  ? 133  ASN H CB  1 
ATOM   2629 C CG  . ASN B 2 136 ? 7.628   67.425 76.188 1.00 43.60  ? 133  ASN H CG  1 
ATOM   2630 O OD1 . ASN B 2 136 ? 7.354   66.588 75.329 1.00 43.36  ? 133  ASN H OD1 1 
ATOM   2631 N ND2 . ASN B 2 136 ? 6.718   67.921 77.024 1.00 43.99  ? 133  ASN H ND2 1 
ATOM   2632 N N   . SER B 2 137 ? 11.292  69.296 77.891 1.00 33.26  ? 134  SER H N   1 
ATOM   2633 C CA  . SER B 2 137 ? 12.694  69.661 78.039 1.00 31.16  ? 134  SER H CA  1 
ATOM   2634 C C   . SER B 2 137 ? 13.547  68.950 76.982 1.00 29.54  ? 134  SER H C   1 
ATOM   2635 O O   . SER B 2 137 ? 14.648  69.395 76.652 1.00 29.06  ? 134  SER H O   1 
ATOM   2636 C CB  . SER B 2 137 ? 13.198  69.311 79.446 1.00 23.25  ? 134  SER H CB  1 
ATOM   2637 O OG  . SER B 2 137 ? 13.417  67.917 79.593 1.00 23.30  ? 134  SER H OG  1 
ATOM   2638 N N   . MET B 2 138 ? 13.039  67.841 76.456 1.00 26.67  ? 135  MET H N   1 
ATOM   2639 C CA  . MET B 2 138 ? 13.765  67.096 75.433 1.00 25.33  ? 135  MET H CA  1 
ATOM   2640 C C   . MET B 2 138 ? 12.937  67.011 74.157 1.00 24.05  ? 135  MET H C   1 
ATOM   2641 O O   . MET B 2 138 ? 11.707  67.049 74.197 1.00 24.66  ? 135  MET H O   1 
ATOM   2642 C CB  . MET B 2 138 ? 14.093  65.686 75.931 1.00 24.59  ? 135  MET H CB  1 
ATOM   2643 C CG  . MET B 2 138 ? 14.960  65.654 77.184 1.00 23.34  ? 135  MET H CG  1 
ATOM   2644 S SD  . MET B 2 138 ? 16.540  66.519 76.968 1.00 25.55  ? 135  MET H SD  1 
ATOM   2645 C CE  . MET B 2 138 ? 17.529  65.256 76.214 1.00 22.01  ? 135  MET H CE  1 
ATOM   2646 N N   . VAL B 2 139 ? 13.611  66.913 73.020 1.00 19.81  ? 136  VAL H N   1 
ATOM   2647 C CA  . VAL B 2 139 ? 12.916  66.808 71.747 1.00 18.39  ? 136  VAL H CA  1 
ATOM   2648 C C   . VAL B 2 139 ? 13.646  65.802 70.879 1.00 16.96  ? 136  VAL H C   1 
ATOM   2649 O O   . VAL B 2 139 ? 14.874  65.806 70.819 1.00 17.89  ? 136  VAL H O   1 
ATOM   2650 C CB  . VAL B 2 139 ? 12.866  68.166 71.016 1.00 18.61  ? 136  VAL H CB  1 
ATOM   2651 C CG1 . VAL B 2 139 ? 14.277  68.701 70.804 1.00 16.19  ? 136  VAL H CG1 1 
ATOM   2652 C CG2 . VAL B 2 139 ? 12.153  68.002 69.681 1.00 19.45  ? 136  VAL H CG2 1 
ATOM   2653 N N   . THR B 2 140 ? 12.893  64.928 70.221 1.00 17.23  ? 137  THR H N   1 
ATOM   2654 C CA  . THR B 2 140 ? 13.491  63.918 69.358 1.00 15.83  ? 137  THR H CA  1 
ATOM   2655 C C   . THR B 2 140 ? 13.317  64.293 67.886 1.00 17.04  ? 137  THR H C   1 
ATOM   2656 O O   . THR B 2 140 ? 12.209  64.572 67.424 1.00 16.52  ? 137  THR H O   1 
ATOM   2657 C CB  . THR B 2 140 ? 12.870  62.530 69.637 1.00 18.21  ? 137  THR H CB  1 
ATOM   2658 O OG1 . THR B 2 140 ? 13.262  62.095 70.945 1.00 19.54  ? 137  THR H OG1 1 
ATOM   2659 C CG2 . THR B 2 140 ? 13.344  61.505 68.627 1.00 14.90  ? 137  THR H CG2 1 
ATOM   2660 N N   . LEU B 2 141 ? 14.426  64.323 67.154 1.00 19.32  ? 138  LEU H N   1 
ATOM   2661 C CA  . LEU B 2 141 ? 14.385  64.672 65.739 1.00 19.75  ? 138  LEU H CA  1 
ATOM   2662 C C   . LEU B 2 141 ? 14.875  63.474 64.945 1.00 19.09  ? 138  LEU H C   1 
ATOM   2663 O O   . LEU B 2 141 ? 15.243  62.451 65.523 1.00 18.00  ? 138  LEU H O   1 
ATOM   2664 C CB  . LEU B 2 141 ? 15.283  65.884 65.470 1.00 17.95  ? 138  LEU H CB  1 
ATOM   2665 C CG  . LEU B 2 141 ? 15.057  67.117 66.357 1.00 20.78  ? 138  LEU H CG  1 
ATOM   2666 C CD1 . LEU B 2 141 ? 16.206  68.100 66.150 1.00 21.38  ? 138  LEU H CD1 1 
ATOM   2667 C CD2 . LEU B 2 141 ? 13.719  67.770 66.036 1.00 16.06  ? 138  LEU H CD2 1 
ATOM   2668 N N   . GLY B 2 142 ? 14.885  63.589 63.623 1.00 19.57  ? 139  GLY H N   1 
ATOM   2669 C CA  . GLY B 2 142 ? 15.358  62.472 62.832 1.00 19.22  ? 139  GLY H CA  1 
ATOM   2670 C C   . GLY B 2 142 ? 15.568  62.761 61.364 1.00 20.07  ? 139  GLY H C   1 
ATOM   2671 O O   . GLY B 2 142 ? 15.326  63.872 60.884 1.00 18.59  ? 139  GLY H O   1 
ATOM   2672 N N   . CYS B 2 143 ? 16.031  61.740 60.652 1.00 15.47  ? 140  CYS H N   1 
ATOM   2673 C CA  . CYS B 2 143 ? 16.260  61.836 59.226 1.00 16.57  ? 140  CYS H CA  1 
ATOM   2674 C C   . CYS B 2 143 ? 15.853  60.533 58.564 1.00 17.34  ? 140  CYS H C   1 
ATOM   2675 O O   . CYS B 2 143 ? 16.191  59.443 59.033 1.00 16.71  ? 140  CYS H O   1 
ATOM   2676 C CB  . CYS B 2 143 ? 17.729  62.135 58.925 1.00 25.08  ? 140  CYS H CB  1 
ATOM   2677 S SG  . CYS B 2 143 ? 18.117  63.913 58.870 1.00 29.47  ? 140  CYS H SG  1 
ATOM   2678 N N   . LEU B 2 144 ? 15.095  60.662 57.483 1.00 18.86  ? 141  LEU H N   1 
ATOM   2679 C CA  . LEU B 2 144 ? 14.637  59.517 56.720 1.00 18.18  ? 141  LEU H CA  1 
ATOM   2680 C C   . LEU B 2 144 ? 15.592  59.408 55.544 1.00 17.21  ? 141  LEU H C   1 
ATOM   2681 O O   . LEU B 2 144 ? 15.797  60.378 54.815 1.00 16.34  ? 141  LEU H O   1 
ATOM   2682 C CB  . LEU B 2 144 ? 13.210  59.757 56.223 1.00 14.87  ? 141  LEU H CB  1 
ATOM   2683 C CG  . LEU B 2 144 ? 12.531  58.711 55.334 1.00 17.37  ? 141  LEU H CG  1 
ATOM   2684 C CD1 . LEU B 2 144 ? 12.403  57.374 56.056 1.00 15.74  ? 141  LEU H CD1 1 
ATOM   2685 C CD2 . LEU B 2 144 ? 11.149  59.233 54.951 1.00 16.70  ? 141  LEU H CD2 1 
ATOM   2686 N N   . VAL B 2 145 ? 16.201  58.239 55.389 1.00 14.47  ? 142  VAL H N   1 
ATOM   2687 C CA  . VAL B 2 145 ? 17.133  57.996 54.298 1.00 14.51  ? 142  VAL H CA  1 
ATOM   2688 C C   . VAL B 2 145 ? 16.448  56.961 53.421 1.00 15.41  ? 142  VAL H C   1 
ATOM   2689 O O   . VAL B 2 145 ? 16.454  55.767 53.721 1.00 12.73  ? 142  VAL H O   1 
ATOM   2690 C CB  . VAL B 2 145 ? 18.459  57.453 54.828 1.00 12.55  ? 142  VAL H CB  1 
ATOM   2691 C CG1 . VAL B 2 145 ? 19.461  57.328 53.684 1.00 11.37  ? 142  VAL H CG1 1 
ATOM   2692 C CG2 . VAL B 2 145 ? 18.984  58.387 55.922 1.00 12.13  ? 142  VAL H CG2 1 
ATOM   2693 N N   . LYS B 2 146 ? 15.880  57.431 52.316 1.00 15.82  ? 143  LYS H N   1 
ATOM   2694 C CA  . LYS B 2 146 ? 15.107  56.566 51.443 1.00 17.29  ? 143  LYS H CA  1 
ATOM   2695 C C   . LYS B 2 146 ? 15.585  56.284 50.023 1.00 16.16  ? 143  LYS H C   1 
ATOM   2696 O O   . LYS B 2 146 ? 16.218  57.115 49.373 1.00 16.67  ? 143  LYS H O   1 
ATOM   2697 C CB  . LYS B 2 146 ? 13.677  57.110 51.404 1.00 24.25  ? 143  LYS H CB  1 
ATOM   2698 C CG  . LYS B 2 146 ? 12.764  56.442 50.421 1.00 30.91  ? 143  LYS H CG  1 
ATOM   2699 C CD  . LYS B 2 146 ? 11.338  56.922 50.599 1.00 34.46  ? 143  LYS H CD  1 
ATOM   2700 C CE  . LYS B 2 146 ? 10.441  56.275 49.568 1.00 37.44  ? 143  LYS H CE  1 
ATOM   2701 N NZ  . LYS B 2 146 ? 9.018   56.622 49.781 1.00 41.10  ? 143  LYS H NZ  1 
ATOM   2702 N N   . GLY B 2 147 ? 15.267  55.073 49.575 1.00 19.80  ? 144  GLY H N   1 
ATOM   2703 C CA  . GLY B 2 147 ? 15.568  54.620 48.226 1.00 19.85  ? 144  GLY H CA  1 
ATOM   2704 C C   . GLY B 2 147 ? 16.995  54.511 47.740 1.00 21.06  ? 144  GLY H C   1 
ATOM   2705 O O   . GLY B 2 147 ? 17.294  54.930 46.624 1.00 21.83  ? 144  GLY H O   1 
ATOM   2706 N N   . TYR B 2 148 ? 17.881  53.935 48.536 1.00 17.16  ? 145  TYR H N   1 
ATOM   2707 C CA  . TYR B 2 148 ? 19.255  53.818 48.088 1.00 20.61  ? 145  TYR H CA  1 
ATOM   2708 C C   . TYR B 2 148 ? 19.655  52.366 47.889 1.00 21.88  ? 145  TYR H C   1 
ATOM   2709 O O   . TYR B 2 148 ? 18.990  51.453 48.374 1.00 22.39  ? 145  TYR H O   1 
ATOM   2710 C CB  . TYR B 2 148 ? 20.193  54.478 49.092 1.00 21.49  ? 145  TYR H CB  1 
ATOM   2711 C CG  . TYR B 2 148 ? 20.193  53.800 50.437 1.00 21.71  ? 145  TYR H CG  1 
ATOM   2712 C CD1 . TYR B 2 148 ? 21.108  52.792 50.730 1.00 20.30  ? 145  TYR H CD1 1 
ATOM   2713 C CD2 . TYR B 2 148 ? 19.272  54.166 51.419 1.00 21.38  ? 145  TYR H CD2 1 
ATOM   2714 C CE1 . TYR B 2 148 ? 21.113  52.164 51.978 1.00 22.19  ? 145  TYR H CE1 1 
ATOM   2715 C CE2 . TYR B 2 148 ? 19.264  53.548 52.664 1.00 21.99  ? 145  TYR H CE2 1 
ATOM   2716 C CZ  . TYR B 2 148 ? 20.188  52.552 52.939 1.00 20.69  ? 145  TYR H CZ  1 
ATOM   2717 O OH  . TYR B 2 148 ? 20.196  51.969 54.179 1.00 20.88  ? 145  TYR H OH  1 
ATOM   2718 N N   . PHE B 2 149 ? 20.741  52.169 47.151 1.00 22.93  ? 146  PHE H N   1 
ATOM   2719 C CA  . PHE B 2 149 ? 21.285  50.844 46.893 1.00 24.08  ? 146  PHE H CA  1 
ATOM   2720 C C   . PHE B 2 149 ? 22.715  51.024 46.432 1.00 23.30  ? 146  PHE H C   1 
ATOM   2721 O O   . PHE B 2 149 ? 23.008  51.919 45.648 1.00 25.79  ? 146  PHE H O   1 
ATOM   2722 C CB  . PHE B 2 149 ? 20.507  50.108 45.801 1.00 30.42  ? 146  PHE H CB  1 
ATOM   2723 C CG  . PHE B 2 149 ? 21.057  48.737 45.498 1.00 32.69  ? 146  PHE H CG  1 
ATOM   2724 C CD1 . PHE B 2 149 ? 20.645  47.627 46.230 1.00 33.03  ? 146  PHE H CD1 1 
ATOM   2725 C CD2 . PHE B 2 149 ? 22.036  48.567 44.522 1.00 33.09  ? 146  PHE H CD2 1 
ATOM   2726 C CE1 . PHE B 2 149 ? 21.199  46.369 45.996 1.00 33.15  ? 146  PHE H CE1 1 
ATOM   2727 C CE2 . PHE B 2 149 ? 22.599  47.314 44.280 1.00 36.06  ? 146  PHE H CE2 1 
ATOM   2728 C CZ  . PHE B 2 149 ? 22.178  46.211 45.021 1.00 34.01  ? 146  PHE H CZ  1 
ATOM   2729 N N   . PRO B 2 150 ? 23.632  50.184 46.919 1.00 25.99  ? 147  PRO H N   1 
ATOM   2730 C CA  . PRO B 2 150 ? 23.444  49.079 47.860 1.00 25.77  ? 147  PRO H CA  1 
ATOM   2731 C C   . PRO B 2 150 ? 23.725  49.578 49.274 1.00 26.29  ? 147  PRO H C   1 
ATOM   2732 O O   . PRO B 2 150 ? 23.842  50.778 49.504 1.00 26.12  ? 147  PRO H O   1 
ATOM   2733 C CB  . PRO B 2 150 ? 24.507  48.102 47.418 1.00 21.73  ? 147  PRO H CB  1 
ATOM   2734 C CG  . PRO B 2 150 ? 25.663  49.040 47.196 1.00 21.49  ? 147  PRO H CG  1 
ATOM   2735 C CD  . PRO B 2 150 ? 25.019  50.199 46.424 1.00 21.68  ? 147  PRO H CD  1 
ATOM   2736 N N   . GLU B 2 151 ? 23.839  48.648 50.215 1.00 28.18  ? 148  GLU H N   1 
ATOM   2737 C CA  . GLU B 2 151 ? 24.159  49.003 51.592 1.00 28.93  ? 148  GLU H CA  1 
ATOM   2738 C C   . GLU B 2 151 ? 25.667  49.191 51.647 1.00 28.56  ? 148  GLU H C   1 
ATOM   2739 O O   . GLU B 2 151 ? 26.399  48.631 50.831 1.00 30.11  ? 148  GLU H O   1 
ATOM   2740 C CB  . GLU B 2 151 ? 23.754  47.884 52.552 1.00 33.25  ? 148  GLU H CB  1 
ATOM   2741 C CG  . GLU B 2 151 ? 22.316  47.941 53.028 1.00 37.79  ? 148  GLU H CG  1 
ATOM   2742 C CD  . GLU B 2 151 ? 22.187  48.538 54.423 1.00 42.85  ? 148  GLU H CD  1 
ATOM   2743 O OE1 . GLU B 2 151 ? 22.514  49.735 54.607 1.00 43.33  ? 148  GLU H OE1 1 
ATOM   2744 O OE2 . GLU B 2 151 ? 21.758  47.802 55.339 1.00 41.43  ? 148  GLU H OE2 1 
ATOM   2745 N N   . PRO B 2 152 ? 26.151  49.993 52.601 1.00 28.14  ? 149  PRO H N   1 
ATOM   2746 C CA  . PRO B 2 152 ? 25.293  50.679 53.565 1.00 28.36  ? 149  PRO H CA  1 
ATOM   2747 C C   . PRO B 2 152 ? 25.450  52.190 53.432 1.00 28.58  ? 149  PRO H C   1 
ATOM   2748 O O   . PRO B 2 152 ? 26.055  52.698 52.479 1.00 28.78  ? 149  PRO H O   1 
ATOM   2749 C CB  . PRO B 2 152 ? 25.854  50.195 54.884 1.00 25.96  ? 149  PRO H CB  1 
ATOM   2750 C CG  . PRO B 2 152 ? 27.340  50.346 54.614 1.00 26.23  ? 149  PRO H CG  1 
ATOM   2751 C CD  . PRO B 2 152 ? 27.509  49.838 53.159 1.00 24.88  ? 149  PRO H CD  1 
ATOM   2752 N N   . VAL B 2 153 ? 24.892  52.900 54.403 1.00 24.59  ? 150  VAL H N   1 
ATOM   2753 C CA  . VAL B 2 153 ? 25.008  54.342 54.463 1.00 23.66  ? 150  VAL H CA  1 
ATOM   2754 C C   . VAL B 2 153 ? 25.439  54.595 55.888 1.00 23.91  ? 150  VAL H C   1 
ATOM   2755 O O   . VAL B 2 153 ? 25.140  53.798 56.779 1.00 24.45  ? 150  VAL H O   1 
ATOM   2756 C CB  . VAL B 2 153 ? 23.660  55.069 54.231 1.00 23.36  ? 150  VAL H CB  1 
ATOM   2757 C CG1 . VAL B 2 153 ? 23.214  54.902 52.789 1.00 20.20  ? 150  VAL H CG1 1 
ATOM   2758 C CG2 . VAL B 2 153 ? 22.607  54.537 55.198 1.00 21.15  ? 150  VAL H CG2 1 
ATOM   2759 N N   . THR B 2 154 ? 26.168  55.678 56.103 1.00 25.28  ? 151  THR H N   1 
ATOM   2760 C CA  . THR B 2 154 ? 26.597  56.025 57.444 1.00 26.33  ? 151  THR H CA  1 
ATOM   2761 C C   . THR B 2 154 ? 25.887  57.325 57.742 1.00 25.76  ? 151  THR H C   1 
ATOM   2762 O O   . THR B 2 154 ? 25.810  58.208 56.879 1.00 24.62  ? 151  THR H O   1 
ATOM   2763 C CB  . THR B 2 154 ? 28.113  56.241 57.530 1.00 34.03  ? 151  THR H CB  1 
ATOM   2764 O OG1 . THR B 2 154 ? 28.510  57.222 56.569 1.00 38.94  ? 151  THR H OG1 1 
ATOM   2765 C CG2 . THR B 2 154 ? 28.847  54.941 57.264 1.00 36.90  ? 151  THR H CG2 1 
ATOM   2766 N N   . VAL B 2 155 ? 25.353  57.431 58.951 1.00 21.08  ? 152  VAL H N   1 
ATOM   2767 C CA  . VAL B 2 155 ? 24.636  58.628 59.358 1.00 20.35  ? 152  VAL H CA  1 
ATOM   2768 C C   . VAL B 2 155 ? 25.262  59.211 60.613 1.00 19.71  ? 152  VAL H C   1 
ATOM   2769 O O   . VAL B 2 155 ? 25.554  58.490 61.553 1.00 20.09  ? 152  VAL H O   1 
ATOM   2770 C CB  . VAL B 2 155 ? 23.158  58.306 59.670 1.00 20.58  ? 152  VAL H CB  1 
ATOM   2771 C CG1 . VAL B 2 155 ? 22.430  59.570 60.114 1.00 17.33  ? 152  VAL H CG1 1 
ATOM   2772 C CG2 . VAL B 2 155 ? 22.488  57.689 58.452 1.00 17.47  ? 152  VAL H CG2 1 
ATOM   2773 N N   . THR B 2 156 ? 25.478  60.517 60.619 1.00 19.64  ? 153  THR H N   1 
ATOM   2774 C CA  . THR B 2 156 ? 26.024  61.185 61.790 1.00 18.58  ? 153  THR H CA  1 
ATOM   2775 C C   . THR B 2 156 ? 25.180  62.429 61.992 1.00 18.57  ? 153  THR H C   1 
ATOM   2776 O O   . THR B 2 156 ? 24.390  62.800 61.121 1.00 16.48  ? 153  THR H O   1 
ATOM   2777 C CB  . THR B 2 156 ? 27.506  61.615 61.602 1.00 25.25  ? 153  THR H CB  1 
ATOM   2778 O OG1 . THR B 2 156 ? 27.610  62.556 60.523 1.00 22.48  ? 153  THR H OG1 1 
ATOM   2779 C CG2 . THR B 2 156 ? 28.379  60.408 61.311 1.00 25.42  ? 153  THR H CG2 1 
ATOM   2780 N N   . TRP B 2 157 ? 25.326  63.061 63.147 1.00 21.09  ? 154  TRP H N   1 
ATOM   2781 C CA  . TRP B 2 157 ? 24.585  64.276 63.428 1.00 21.98  ? 154  TRP H CA  1 
ATOM   2782 C C   . TRP B 2 157 ? 25.583  65.352 63.788 1.00 23.53  ? 154  TRP H C   1 
ATOM   2783 O O   . TRP B 2 157 ? 26.465  65.141 64.624 1.00 24.89  ? 154  TRP H O   1 
ATOM   2784 C CB  . TRP B 2 157 ? 23.596  64.053 64.566 1.00 21.02  ? 154  TRP H CB  1 
ATOM   2785 C CG  . TRP B 2 157 ? 22.464  63.171 64.169 1.00 21.43  ? 154  TRP H CG  1 
ATOM   2786 C CD1 . TRP B 2 157 ? 22.416  61.810 64.246 1.00 18.31  ? 154  TRP H CD1 1 
ATOM   2787 C CD2 . TRP B 2 157 ? 21.213  63.590 63.613 1.00 18.85  ? 154  TRP H CD2 1 
ATOM   2788 N NE1 . TRP B 2 157 ? 21.207  61.353 63.776 1.00 20.37  ? 154  TRP H NE1 1 
ATOM   2789 C CE2 . TRP B 2 157 ? 20.450  62.426 63.381 1.00 18.89  ? 154  TRP H CE2 1 
ATOM   2790 C CE3 . TRP B 2 157 ? 20.665  64.838 63.286 1.00 19.99  ? 154  TRP H CE3 1 
ATOM   2791 C CZ2 . TRP B 2 157 ? 19.160  62.471 62.841 1.00 18.54  ? 154  TRP H CZ2 1 
ATOM   2792 C CZ3 . TRP B 2 157 ? 19.380  64.885 62.745 1.00 18.22  ? 154  TRP H CZ3 1 
ATOM   2793 C CH2 . TRP B 2 157 ? 18.643  63.707 62.529 1.00 18.87  ? 154  TRP H CH2 1 
ATOM   2794 N N   . ASN B 2 158 ? 25.445  66.506 63.149 1.00 23.65  ? 155  ASN H N   1 
ATOM   2795 C CA  . ASN B 2 158 ? 26.367  67.602 63.383 1.00 26.48  ? 155  ASN H CA  1 
ATOM   2796 C C   . ASN B 2 158 ? 27.790  67.078 63.279 1.00 28.28  ? 155  ASN H C   1 
ATOM   2797 O O   . ASN B 2 158 ? 28.596  67.240 64.193 1.00 28.82  ? 155  ASN H O   1 
ATOM   2798 C CB  . ASN B 2 158 ? 26.120  68.231 64.753 1.00 20.04  ? 155  ASN H CB  1 
ATOM   2799 C CG  . ASN B 2 158 ? 24.923  69.149 64.745 1.00 19.02  ? 155  ASN H CG  1 
ATOM   2800 O OD1 . ASN B 2 158 ? 24.233  69.267 63.729 1.00 17.75  ? 155  ASN H OD1 1 
ATOM   2801 N ND2 . ASN B 2 158 ? 24.663  69.806 65.869 1.00 17.98  ? 155  ASN H ND2 1 
ATOM   2802 N N   . SER B 2 159 ? 28.066  66.424 62.153 1.00 37.88  ? 156  SER H N   1 
ATOM   2803 C CA  . SER B 2 159 ? 29.380  65.871 61.854 1.00 39.69  ? 156  SER H CA  1 
ATOM   2804 C C   . SER B 2 159 ? 29.970  65.053 62.992 1.00 42.40  ? 156  SER H C   1 
ATOM   2805 O O   . SER B 2 159 ? 31.186  65.029 63.172 1.00 44.57  ? 156  SER H O   1 
ATOM   2806 C CB  . SER B 2 159 ? 30.341  67.003 61.502 1.00 24.54  ? 156  SER H CB  1 
ATOM   2807 O OG  . SER B 2 159 ? 29.760  67.866 60.541 1.00 23.52  ? 156  SER H OG  1 
ATOM   2808 N N   . GLY B 2 160 ? 29.115  64.388 63.761 1.00 34.89  ? 157  GLY H N   1 
ATOM   2809 C CA  . GLY B 2 160 ? 29.609  63.581 64.858 1.00 35.94  ? 157  GLY H CA  1 
ATOM   2810 C C   . GLY B 2 160 ? 29.667  64.288 66.199 1.00 36.28  ? 157  GLY H C   1 
ATOM   2811 O O   . GLY B 2 160 ? 29.832  63.633 67.225 1.00 36.92  ? 157  GLY H O   1 
ATOM   2812 N N   . SER B 2 161 ? 29.538  65.613 66.207 1.00 33.85  ? 158  SER H N   1 
ATOM   2813 C CA  . SER B 2 161 ? 29.573  66.369 67.461 1.00 35.11  ? 158  SER H CA  1 
ATOM   2814 C C   . SER B 2 161 ? 28.421  65.952 68.367 1.00 35.14  ? 158  SER H C   1 
ATOM   2815 O O   . SER B 2 161 ? 28.513  66.036 69.593 1.00 34.37  ? 158  SER H O   1 
ATOM   2816 C CB  . SER B 2 161 ? 29.468  67.871 67.193 1.00 45.81  ? 158  SER H CB  1 
ATOM   2817 O OG  . SER B 2 161 ? 30.590  68.346 66.474 1.00 51.47  ? 158  SER H OG  1 
ATOM   2818 N N   . LEU B 2 162 ? 27.334  65.509 67.745 1.00 38.81  ? 159  LEU H N   1 
ATOM   2819 C CA  . LEU B 2 162 ? 26.138  65.076 68.456 1.00 38.61  ? 159  LEU H CA  1 
ATOM   2820 C C   . LEU B 2 162 ? 26.122  63.557 68.380 1.00 39.82  ? 159  LEU H C   1 
ATOM   2821 O O   . LEU B 2 162 ? 25.670  62.984 67.390 1.00 41.21  ? 159  LEU H O   1 
ATOM   2822 C CB  . LEU B 2 162 ? 24.913  65.649 67.755 1.00 27.57  ? 159  LEU H CB  1 
ATOM   2823 C CG  . LEU B 2 162 ? 23.659  66.010 68.538 1.00 27.50  ? 159  LEU H CG  1 
ATOM   2824 C CD1 . LEU B 2 162 ? 24.012  66.886 69.742 1.00 24.37  ? 159  LEU H CD1 1 
ATOM   2825 C CD2 . LEU B 2 162 ? 22.713  66.749 67.597 1.00 23.60  ? 159  LEU H CD2 1 
ATOM   2826 N N   . SER B 2 163 ? 26.617  62.902 69.422 1.00 45.29  ? 160  SER H N   1 
ATOM   2827 C CA  . SER B 2 163 ? 26.685  61.451 69.417 1.00 45.62  ? 160  SER H CA  1 
ATOM   2828 C C   . SER B 2 163 ? 25.808  60.781 70.461 1.00 44.98  ? 160  SER H C   1 
ATOM   2829 O O   . SER B 2 163 ? 25.379  59.642 70.278 1.00 46.10  ? 160  SER H O   1 
ATOM   2830 C CB  . SER B 2 163 ? 28.136  61.008 69.606 1.00 50.02  ? 160  SER H CB  1 
ATOM   2831 O OG  . SER B 2 163 ? 28.681  61.572 70.788 1.00 50.38  ? 160  SER H OG  1 
ATOM   2832 N N   . SER B 2 164 ? 25.542  61.475 71.557 1.00 30.95  ? 161  SER H N   1 
ATOM   2833 C CA  . SER B 2 164 ? 24.712  60.896 72.599 1.00 29.56  ? 161  SER H CA  1 
ATOM   2834 C C   . SER B 2 164 ? 23.233  61.049 72.231 1.00 26.27  ? 161  SER H C   1 
ATOM   2835 O O   . SER B 2 164 ? 22.857  61.988 71.524 1.00 25.73  ? 161  SER H O   1 
ATOM   2836 C CB  . SER B 2 164 ? 25.006  61.575 73.937 1.00 42.06  ? 161  SER H CB  1 
ATOM   2837 O OG  . SER B 2 164 ? 24.384  60.878 74.999 1.00 45.09  ? 161  SER H OG  1 
ATOM   2838 N N   . GLY B 2 165 ? 22.407  60.117 72.702 1.00 21.84  ? 162  GLY H N   1 
ATOM   2839 C CA  . GLY B 2 165 ? 20.978  60.157 72.417 1.00 20.03  ? 162  GLY H CA  1 
ATOM   2840 C C   . GLY B 2 165 ? 20.687  59.883 70.950 1.00 19.04  ? 162  GLY H C   1 
ATOM   2841 O O   . GLY B 2 165 ? 19.717  60.391 70.388 1.00 15.49  ? 162  GLY H O   1 
ATOM   2842 N N   . VAL B 2 166 ? 21.527  59.050 70.345 1.00 23.06  ? 163  VAL H N   1 
ATOM   2843 C CA  . VAL B 2 166 ? 21.414  58.706 68.938 1.00 22.56  ? 163  VAL H CA  1 
ATOM   2844 C C   . VAL B 2 166 ? 21.411  57.216 68.627 1.00 23.19  ? 163  VAL H C   1 
ATOM   2845 O O   . VAL B 2 166 ? 22.133  56.433 69.241 1.00 24.02  ? 163  VAL H O   1 
ATOM   2846 C CB  . VAL B 2 166 ? 22.586  59.312 68.139 1.00 21.50  ? 163  VAL H CB  1 
ATOM   2847 C CG1 . VAL B 2 166 ? 22.565  58.798 66.701 1.00 21.81  ? 163  VAL H CG1 1 
ATOM   2848 C CG2 . VAL B 2 166 ? 22.521  60.829 68.182 1.00 20.12  ? 163  VAL H CG2 1 
ATOM   2849 N N   . HIS B 2 167 ? 20.582  56.831 67.663 1.00 21.90  ? 164  HIS H N   1 
ATOM   2850 C CA  . HIS B 2 167 ? 20.547  55.456 67.193 1.00 21.22  ? 164  HIS H CA  1 
ATOM   2851 C C   . HIS B 2 167 ? 19.937  55.440 65.804 1.00 19.24  ? 164  HIS H C   1 
ATOM   2852 O O   . HIS B 2 167 ? 18.968  56.142 65.515 1.00 16.65  ? 164  HIS H O   1 
ATOM   2853 C CB  . HIS B 2 167 ? 19.796  54.509 68.151 1.00 22.25  ? 164  HIS H CB  1 
ATOM   2854 C CG  . HIS B 2 167 ? 18.362  54.868 68.384 1.00 23.06  ? 164  HIS H CG  1 
ATOM   2855 N ND1 . HIS B 2 167 ? 17.908  55.362 69.589 1.00 23.97  ? 164  HIS H ND1 1 
ATOM   2856 C CD2 . HIS B 2 167 ? 17.275  54.775 67.583 1.00 22.10  ? 164  HIS H CD2 1 
ATOM   2857 C CE1 . HIS B 2 167 ? 16.604  55.557 69.520 1.00 23.88  ? 164  HIS H CE1 1 
ATOM   2858 N NE2 . HIS B 2 167 ? 16.195  55.209 68.312 1.00 24.55  ? 164  HIS H NE2 1 
ATOM   2859 N N   . THR B 2 168 ? 20.553  54.660 64.934 1.00 17.12  ? 165  THR H N   1 
ATOM   2860 C CA  . THR B 2 168 ? 20.113  54.544 63.562 1.00 17.79  ? 165  THR H CA  1 
ATOM   2861 C C   . THR B 2 168 ? 19.565  53.145 63.347 1.00 18.18  ? 165  THR H C   1 
ATOM   2862 O O   . THR B 2 168 ? 20.228  52.152 63.651 1.00 17.75  ? 165  THR H O   1 
ATOM   2863 C CB  . THR B 2 168 ? 21.287  54.832 62.623 1.00 17.01  ? 165  THR H CB  1 
ATOM   2864 O OG1 . THR B 2 168 ? 21.654  56.212 62.761 1.00 19.45  ? 165  THR H OG1 1 
ATOM   2865 C CG2 . THR B 2 168 ? 20.919  54.535 61.179 1.00 17.07  ? 165  THR H CG2 1 
ATOM   2866 N N   . PHE B 2 169 ? 18.340  53.076 62.843 1.00 18.38  ? 166  PHE H N   1 
ATOM   2867 C CA  . PHE B 2 169 ? 17.673  51.803 62.611 1.00 18.41  ? 166  PHE H CA  1 
ATOM   2868 C C   . PHE B 2 169 ? 18.188  51.065 61.391 1.00 20.46  ? 166  PHE H C   1 
ATOM   2869 O O   . PHE B 2 169 ? 18.610  51.676 60.409 1.00 20.56  ? 166  PHE H O   1 
ATOM   2870 C CB  . PHE B 2 169 ? 16.176  52.025 62.437 1.00 20.61  ? 166  PHE H CB  1 
ATOM   2871 C CG  . PHE B 2 169 ? 15.519  52.665 63.610 1.00 21.93  ? 166  PHE H CG  1 
ATOM   2872 C CD1 . PHE B 2 169 ? 15.086  51.899 64.689 1.00 21.20  ? 166  PHE H CD1 1 
ATOM   2873 C CD2 . PHE B 2 169 ? 15.341  54.043 63.649 1.00 23.88  ? 166  PHE H CD2 1 
ATOM   2874 C CE1 . PHE B 2 169 ? 14.485  52.495 65.789 1.00 20.98  ? 166  PHE H CE1 1 
ATOM   2875 C CE2 . PHE B 2 169 ? 14.740  54.655 64.748 1.00 25.13  ? 166  PHE H CE2 1 
ATOM   2876 C CZ  . PHE B 2 169 ? 14.311  53.878 65.822 1.00 21.59  ? 166  PHE H CZ  1 
ATOM   2877 N N   . PRO B 2 170 ? 18.149  49.728 61.435 1.00 21.11  ? 167  PRO H N   1 
ATOM   2878 C CA  . PRO B 2 170 ? 18.613  48.920 60.304 1.00 21.57  ? 167  PRO H CA  1 
ATOM   2879 C C   . PRO B 2 170 ? 17.730  49.222 59.092 1.00 21.16  ? 167  PRO H C   1 
ATOM   2880 O O   . PRO B 2 170 ? 16.529  49.464 59.232 1.00 16.33  ? 167  PRO H O   1 
ATOM   2881 C CB  . PRO B 2 170 ? 18.423  47.486 60.797 1.00 25.33  ? 167  PRO H CB  1 
ATOM   2882 C CG  . PRO B 2 170 ? 18.564  47.616 62.295 1.00 27.88  ? 167  PRO H CG  1 
ATOM   2883 C CD  . PRO B 2 170 ? 17.792  48.879 62.586 1.00 25.90  ? 167  PRO H CD  1 
ATOM   2884 N N   . ALA B 2 171 ? 18.321  49.211 57.904 1.00 23.39  ? 168  ALA H N   1 
ATOM   2885 C CA  . ALA B 2 171 ? 17.551  49.478 56.696 1.00 26.06  ? 168  ALA H CA  1 
ATOM   2886 C C   . ALA B 2 171 ? 16.672  48.285 56.345 1.00 27.66  ? 168  ALA H C   1 
ATOM   2887 O O   . ALA B 2 171 ? 17.003  47.144 56.666 1.00 26.72  ? 168  ALA H O   1 
ATOM   2888 C CB  . ALA B 2 171 ? 18.487  49.779 55.537 1.00 31.97  ? 168  ALA H CB  1 
ATOM   2889 N N   . VAL B 2 172 ? 15.539  48.558 55.711 1.00 25.25  ? 169  VAL H N   1 
ATOM   2890 C CA  . VAL B 2 172 ? 14.654  47.501 55.263 1.00 28.30  ? 169  VAL H CA  1 
ATOM   2891 C C   . VAL B 2 172 ? 14.684  47.593 53.742 1.00 31.25  ? 169  VAL H C   1 
ATOM   2892 O O   . VAL B 2 172 ? 14.854  48.680 53.180 1.00 30.81  ? 169  VAL H O   1 
ATOM   2893 C CB  . VAL B 2 172 ? 13.206  47.681 55.770 1.00 38.44  ? 169  VAL H CB  1 
ATOM   2894 C CG1 . VAL B 2 172 ? 13.150  47.442 57.267 1.00 38.16  ? 169  VAL H CG1 1 
ATOM   2895 C CG2 . VAL B 2 172 ? 12.690  49.067 55.422 1.00 37.24  ? 169  VAL H CG2 1 
ATOM   2896 N N   . LEU B 2 173 ? 14.535  46.453 53.081 1.00 40.65  ? 170  LEU H N   1 
ATOM   2897 C CA  . LEU B 2 173 ? 14.574  46.394 51.628 1.00 43.16  ? 170  LEU H CA  1 
ATOM   2898 C C   . LEU B 2 173 ? 13.188  46.400 51.004 1.00 45.74  ? 170  LEU H C   1 
ATOM   2899 O O   . LEU B 2 173 ? 12.422  45.452 51.171 1.00 46.79  ? 170  LEU H O   1 
ATOM   2900 C CB  . LEU B 2 173 ? 15.321  45.137 51.190 1.00 42.09  ? 170  LEU H CB  1 
ATOM   2901 C CG  . LEU B 2 173 ? 15.374  44.868 49.688 1.00 42.60  ? 170  LEU H CG  1 
ATOM   2902 C CD1 . LEU B 2 173 ? 16.154  45.981 49.001 1.00 41.66  ? 170  LEU H CD1 1 
ATOM   2903 C CD2 . LEU B 2 173 ? 16.026  43.512 49.437 1.00 43.07  ? 170  LEU H CD2 1 
ATOM   2904 N N   . GLN B 2 174 ? 12.871  47.466 50.276 1.00 50.19  ? 171  GLN H N   1 
ATOM   2905 C CA  . GLN B 2 174 ? 11.571  47.579 49.626 1.00 52.11  ? 171  GLN H CA  1 
ATOM   2906 C C   . GLN B 2 174 ? 11.724  47.752 48.116 1.00 51.34  ? 171  GLN H C   1 
ATOM   2907 O O   . GLN B 2 174 ? 12.007  48.848 47.629 1.00 50.58  ? 171  GLN H O   1 
ATOM   2908 C CB  . GLN B 2 174 ? 10.785  48.755 50.216 1.00 92.17  ? 171  GLN H CB  1 
ATOM   2909 C CG  . GLN B 2 174 ? 9.384   48.928 49.639 1.00 96.79  ? 171  GLN H CG  1 
ATOM   2910 C CD  . GLN B 2 174 ? 8.538   49.908 50.435 1.00 99.19  ? 171  GLN H CD  1 
ATOM   2911 O OE1 . GLN B 2 174 ? 8.907   51.070 50.608 1.00 101.00 ? 171  GLN H OE1 1 
ATOM   2912 N NE2 . GLN B 2 174 ? 7.395   49.439 50.923 1.00 100.21 ? 171  GLN H NE2 1 
ATOM   2913 N N   . SER B 2 175 ? 11.543  46.655 47.386 1.00 45.22  ? 172  SER H N   1 
ATOM   2914 C CA  . SER B 2 175 ? 11.645  46.662 45.932 1.00 44.13  ? 172  SER H CA  1 
ATOM   2915 C C   . SER B 2 175 ? 13.030  47.054 45.435 1.00 42.13  ? 172  SER H C   1 
ATOM   2916 O O   . SER B 2 175 ? 13.201  48.089 44.792 1.00 41.87  ? 172  SER H O   1 
ATOM   2917 C CB  . SER B 2 175 ? 10.600  47.611 45.335 1.00 57.49  ? 172  SER H CB  1 
ATOM   2918 O OG  . SER B 2 175 ? 9.284   47.146 45.586 1.00 59.24  ? 172  SER H OG  1 
ATOM   2919 N N   . ASP B 2 176 ? 14.015  46.220 45.739 1.00 41.36  ? 173  ASP H N   1 
ATOM   2920 C CA  . ASP B 2 176 ? 15.390  46.454 45.312 1.00 39.90  ? 173  ASP H CA  1 
ATOM   2921 C C   . ASP B 2 176 ? 16.054  47.669 45.949 1.00 37.46  ? 173  ASP H C   1 
ATOM   2922 O O   . ASP B 2 176 ? 17.252  47.885 45.766 1.00 37.56  ? 173  ASP H O   1 
ATOM   2923 C CB  . ASP B 2 176 ? 15.454  46.585 43.788 1.00 56.09  ? 173  ASP H CB  1 
ATOM   2924 C CG  . ASP B 2 176 ? 15.114  45.291 43.075 1.00 57.47  ? 173  ASP H CG  1 
ATOM   2925 O OD1 . ASP B 2 176 ? 15.120  45.284 41.825 1.00 59.98  ? 173  ASP H OD1 1 
ATOM   2926 O OD2 . ASP B 2 176 ? 14.845  44.281 43.761 1.00 58.59  ? 173  ASP H OD2 1 
ATOM   2927 N N   . LEU B 2 177 ? 15.295  48.462 46.698 1.00 29.92  ? 174  LEU H N   1 
ATOM   2928 C CA  . LEU B 2 177 ? 15.881  49.635 47.330 1.00 27.55  ? 174  LEU H CA  1 
ATOM   2929 C C   . LEU B 2 177 ? 15.779  49.614 48.856 1.00 26.88  ? 174  LEU H C   1 
ATOM   2930 O O   . LEU B 2 177 ? 14.833  49.051 49.420 1.00 25.16  ? 174  LEU H O   1 
ATOM   2931 C CB  . LEU B 2 177 ? 15.241  50.903 46.762 1.00 27.23  ? 174  LEU H CB  1 
ATOM   2932 C CG  . LEU B 2 177 ? 15.473  51.103 45.258 1.00 26.59  ? 174  LEU H CG  1 
ATOM   2933 C CD1 . LEU B 2 177 ? 14.863  52.426 44.823 1.00 25.58  ? 174  LEU H CD1 1 
ATOM   2934 C CD2 . LEU B 2 177 ? 16.967  51.079 44.946 1.00 21.76  ? 174  LEU H CD2 1 
ATOM   2935 N N   . TYR B 2 178 ? 16.767  50.224 49.511 1.00 24.53  ? 175  TYR H N   1 
ATOM   2936 C CA  . TYR B 2 178 ? 16.818  50.271 50.970 1.00 26.05  ? 175  TYR H CA  1 
ATOM   2937 C C   . TYR B 2 178 ? 16.377  51.604 51.571 1.00 24.35  ? 175  TYR H C   1 
ATOM   2938 O O   . TYR B 2 178 ? 16.583  52.671 50.986 1.00 21.64  ? 175  TYR H O   1 
ATOM   2939 C CB  . TYR B 2 178 ? 18.232  49.959 51.472 1.00 34.23  ? 175  TYR H CB  1 
ATOM   2940 C CG  . TYR B 2 178 ? 18.737  48.562 51.164 1.00 37.45  ? 175  TYR H CG  1 
ATOM   2941 C CD1 . TYR B 2 178 ? 19.431  48.289 49.984 1.00 37.77  ? 175  TYR H CD1 1 
ATOM   2942 C CD2 . TYR B 2 178 ? 18.553  47.520 52.072 1.00 38.79  ? 175  TYR H CD2 1 
ATOM   2943 C CE1 . TYR B 2 178 ? 19.938  47.016 49.721 1.00 38.67  ? 175  TYR H CE1 1 
ATOM   2944 C CE2 . TYR B 2 178 ? 19.053  46.242 51.816 1.00 38.41  ? 175  TYR H CE2 1 
ATOM   2945 C CZ  . TYR B 2 178 ? 19.746  46.000 50.644 1.00 38.91  ? 175  TYR H CZ  1 
ATOM   2946 O OH  . TYR B 2 178 ? 20.273  44.751 50.408 1.00 40.81  ? 175  TYR H OH  1 
ATOM   2947 N N   . THR B 2 179 ? 15.763  51.524 52.746 1.00 23.36  ? 176  THR H N   1 
ATOM   2948 C CA  . THR B 2 179 ? 15.305  52.701 53.463 1.00 22.80  ? 176  THR H CA  1 
ATOM   2949 C C   . THR B 2 179 ? 15.603  52.517 54.938 1.00 22.18  ? 176  THR H C   1 
ATOM   2950 O O   . THR B 2 179 ? 15.523  51.408 55.471 1.00 21.61  ? 176  THR H O   1 
ATOM   2951 C CB  . THR B 2 179 ? 13.791  52.941 53.291 1.00 27.31  ? 176  THR H CB  1 
ATOM   2952 O OG1 . THR B 2 179 ? 13.522  53.354 51.946 1.00 30.55  ? 176  THR H OG1 1 
ATOM   2953 C CG2 . THR B 2 179 ? 13.312  54.033 54.244 1.00 27.55  ? 176  THR H CG2 1 
ATOM   2954 N N   . LEU B 2 180 ? 15.953  53.616 55.590 1.00 19.83  ? 177  LEU H N   1 
ATOM   2955 C CA  . LEU B 2 180 ? 16.274  53.596 57.001 1.00 19.74  ? 177  LEU H CA  1 
ATOM   2956 C C   . LEU B 2 180 ? 16.035  54.995 57.551 1.00 20.40  ? 177  LEU H C   1 
ATOM   2957 O O   . LEU B 2 180 ? 15.844  55.951 56.796 1.00 19.76  ? 177  LEU H O   1 
ATOM   2958 C CB  . LEU B 2 180 ? 17.736  53.161 57.172 1.00 19.45  ? 177  LEU H CB  1 
ATOM   2959 C CG  . LEU B 2 180 ? 18.826  53.925 57.935 1.00 19.21  ? 177  LEU H CG  1 
ATOM   2960 C CD1 . LEU B 2 180 ? 20.159  53.291 57.528 1.00 17.71  ? 177  LEU H CD1 1 
ATOM   2961 C CD2 . LEU B 2 180 ? 18.855  55.411 57.607 1.00 19.60  ? 177  LEU H CD2 1 
ATOM   2962 N N   . SER B 2 181 ? 16.035  55.108 58.869 1.00 24.13  ? 178  SER H N   1 
ATOM   2963 C CA  . SER B 2 181 ? 15.833  56.391 59.513 1.00 24.91  ? 178  SER H CA  1 
ATOM   2964 C C   . SER B 2 181 ? 16.768  56.465 60.706 1.00 23.79  ? 178  SER H C   1 
ATOM   2965 O O   . SER B 2 181 ? 17.186  55.435 61.237 1.00 22.76  ? 178  SER H O   1 
ATOM   2966 C CB  . SER B 2 181 ? 14.381  56.527 59.970 1.00 31.89  ? 178  SER H CB  1 
ATOM   2967 O OG  . SER B 2 181 ? 14.020  55.447 60.817 1.00 36.11  ? 178  SER H OG  1 
ATOM   2968 N N   . SER B 2 182 ? 17.112  57.684 61.106 1.00 24.24  ? 179  SER H N   1 
ATOM   2969 C CA  . SER B 2 182 ? 17.990  57.893 62.251 1.00 21.79  ? 179  SER H CA  1 
ATOM   2970 C C   . SER B 2 182 ? 17.310  58.839 63.233 1.00 21.71  ? 179  SER H C   1 
ATOM   2971 O O   . SER B 2 182 ? 16.708  59.835 62.839 1.00 18.63  ? 179  SER H O   1 
ATOM   2972 C CB  . SER B 2 182 ? 19.330  58.480 61.814 1.00 20.56  ? 179  SER H CB  1 
ATOM   2973 O OG  . SER B 2 182 ? 20.187  58.624 62.929 1.00 21.21  ? 179  SER H OG  1 
ATOM   2974 N N   . SER B 2 183 ? 17.430  58.516 64.515 1.00 16.57  ? 180  SER H N   1 
ATOM   2975 C CA  . SER B 2 183 ? 16.819  59.282 65.583 1.00 17.32  ? 180  SER H CA  1 
ATOM   2976 C C   . SER B 2 183 ? 17.843  59.967 66.493 1.00 17.65  ? 180  SER H C   1 
ATOM   2977 O O   . SER B 2 183 ? 18.864  59.370 66.859 1.00 17.57  ? 180  SER H O   1 
ATOM   2978 C CB  . SER B 2 183 ? 15.935  58.334 66.410 1.00 24.36  ? 180  SER H CB  1 
ATOM   2979 O OG  . SER B 2 183 ? 15.654  58.840 67.698 1.00 24.79  ? 180  SER H OG  1 
ATOM   2980 N N   . VAL B 2 184 ? 17.575  61.220 66.854 1.00 17.66  ? 181  VAL H N   1 
ATOM   2981 C CA  . VAL B 2 184 ? 18.456  61.951 67.760 1.00 17.60  ? 181  VAL H CA  1 
ATOM   2982 C C   . VAL B 2 184 ? 17.618  62.745 68.758 1.00 17.66  ? 181  VAL H C   1 
ATOM   2983 O O   . VAL B 2 184 ? 16.665  63.422 68.377 1.00 17.02  ? 181  VAL H O   1 
ATOM   2984 C CB  . VAL B 2 184 ? 19.398  62.921 67.011 1.00 18.58  ? 181  VAL H CB  1 
ATOM   2985 C CG1 . VAL B 2 184 ? 18.593  63.913 66.181 1.00 18.33  ? 181  VAL H CG1 1 
ATOM   2986 C CG2 . VAL B 2 184 ? 20.283  63.661 68.025 1.00 17.58  ? 181  VAL H CG2 1 
ATOM   2987 N N   . THR B 2 185 ? 17.972  62.655 70.037 1.00 15.43  ? 182  THR H N   1 
ATOM   2988 C CA  . THR B 2 185 ? 17.241  63.366 71.079 1.00 15.96  ? 182  THR H CA  1 
ATOM   2989 C C   . THR B 2 185 ? 18.116  64.442 71.733 1.00 14.76  ? 182  THR H C   1 
ATOM   2990 O O   . THR B 2 185 ? 19.171  64.147 72.280 1.00 14.66  ? 182  THR H O   1 
ATOM   2991 C CB  . THR B 2 185 ? 16.717  62.368 72.140 1.00 17.08  ? 182  THR H CB  1 
ATOM   2992 O OG1 . THR B 2 185 ? 15.758  61.493 71.525 1.00 18.45  ? 182  THR H OG1 1 
ATOM   2993 C CG2 . THR B 2 185 ? 16.042  63.100 73.306 1.00 15.82  ? 182  THR H CG2 1 
ATOM   2994 N N   . VAL B 2 186 ? 17.672  65.691 71.659 1.00 14.00  ? 183  VAL H N   1 
ATOM   2995 C CA  . VAL B 2 186 ? 18.429  66.802 72.236 1.00 16.96  ? 183  VAL H CA  1 
ATOM   2996 C C   . VAL B 2 186 ? 17.552  67.697 73.101 1.00 17.62  ? 183  VAL H C   1 
ATOM   2997 O O   . VAL B 2 186 ? 16.331  67.678 72.989 1.00 19.03  ? 183  VAL H O   1 
ATOM   2998 C CB  . VAL B 2 186 ? 19.058  67.694 71.141 1.00 11.03  ? 183  VAL H CB  1 
ATOM   2999 C CG1 . VAL B 2 186 ? 19.824  66.839 70.152 1.00 13.71  ? 183  VAL H CG1 1 
ATOM   3000 C CG2 . VAL B 2 186 ? 17.969  68.491 70.432 1.00 12.17  ? 183  VAL H CG2 1 
ATOM   3001 N N   . PRO B 2 187 ? 18.173  68.492 73.981 1.00 19.18  ? 184  PRO H N   1 
ATOM   3002 C CA  . PRO B 2 187 ? 17.420  69.397 74.856 1.00 19.93  ? 184  PRO H CA  1 
ATOM   3003 C C   . PRO B 2 187 ? 16.664  70.413 74.010 1.00 21.52  ? 184  PRO H C   1 
ATOM   3004 O O   . PRO B 2 187 ? 17.171  70.866 72.983 1.00 20.70  ? 184  PRO H O   1 
ATOM   3005 C CB  . PRO B 2 187 ? 18.516  70.066 75.688 1.00 24.80  ? 184  PRO H CB  1 
ATOM   3006 C CG  . PRO B 2 187 ? 19.584  69.021 75.750 1.00 25.46  ? 184  PRO H CG  1 
ATOM   3007 C CD  . PRO B 2 187 ? 19.606  68.499 74.329 1.00 25.11  ? 184  PRO H CD  1 
ATOM   3008 N N   . SER B 2 188 ? 15.457  70.771 74.430 1.00 25.03  ? 185  SER H N   1 
ATOM   3009 C CA  . SER B 2 188 ? 14.684  71.753 73.686 1.00 27.40  ? 185  SER H CA  1 
ATOM   3010 C C   . SER B 2 188 ? 15.359  73.118 73.756 1.00 29.31  ? 185  SER H C   1 
ATOM   3011 O O   . SER B 2 188 ? 15.028  74.021 72.988 1.00 29.92  ? 185  SER H O   1 
ATOM   3012 C CB  . SER B 2 188 ? 13.268  71.866 74.242 1.00 27.94  ? 185  SER H CB  1 
ATOM   3013 O OG  . SER B 2 188 ? 12.491  70.750 73.858 1.00 32.21  ? 185  SER H OG  1 
ATOM   3014 N N   . SER B 2 189 ? 16.305  73.271 74.678 1.00 35.55  ? 186  SER H N   1 
ATOM   3015 C CA  . SER B 2 189 ? 16.998  74.542 74.821 1.00 36.32  ? 186  SER H CA  1 
ATOM   3016 C C   . SER B 2 189 ? 18.144  74.632 73.826 1.00 37.21  ? 186  SER H C   1 
ATOM   3017 O O   . SER B 2 189 ? 18.787  75.676 73.695 1.00 37.12  ? 186  SER H O   1 
ATOM   3018 C CB  . SER B 2 189 ? 17.524  74.711 76.251 1.00 25.48  ? 186  SER H CB  1 
ATOM   3019 O OG  . SER B 2 189 ? 18.526  73.755 76.554 1.00 25.84  ? 186  SER H OG  1 
ATOM   3020 N N   . THR B 2 190 ? 18.388  73.529 73.124 1.00 34.90  ? 187  THR H N   1 
ATOM   3021 C CA  . THR B 2 190 ? 19.448  73.466 72.126 1.00 33.78  ? 187  THR H CA  1 
ATOM   3022 C C   . THR B 2 190 ? 18.865  73.667 70.729 1.00 32.01  ? 187  THR H C   1 
ATOM   3023 O O   . THR B 2 190 ? 19.429  74.384 69.909 1.00 33.00  ? 187  THR H O   1 
ATOM   3024 C CB  . THR B 2 190 ? 20.173  72.104 72.177 1.00 38.83  ? 187  THR H CB  1 
ATOM   3025 O OG1 . THR B 2 190 ? 20.839  71.968 73.438 1.00 42.02  ? 187  THR H OG1 1 
ATOM   3026 C CG2 . THR B 2 190 ? 21.200  71.991 71.052 1.00 42.14  ? 187  THR H CG2 1 
ATOM   3027 N N   . TRP B 2 191 ? 17.725  73.041 70.470 1.00 22.80  ? 188  TRP H N   1 
ATOM   3028 C CA  . TRP B 2 191 ? 17.081  73.145 69.168 1.00 22.47  ? 188  TRP H CA  1 
ATOM   3029 C C   . TRP B 2 191 ? 15.701  73.775 69.309 1.00 21.75  ? 188  TRP H C   1 
ATOM   3030 O O   . TRP B 2 191 ? 14.986  73.491 70.262 1.00 22.84  ? 188  TRP H O   1 
ATOM   3031 C CB  . TRP B 2 191 ? 16.949  71.747 68.555 1.00 21.78  ? 188  TRP H CB  1 
ATOM   3032 C CG  . TRP B 2 191 ? 16.386  71.741 67.186 1.00 20.24  ? 188  TRP H CG  1 
ATOM   3033 C CD1 . TRP B 2 191 ? 17.078  71.837 66.015 1.00 19.72  ? 188  TRP H CD1 1 
ATOM   3034 C CD2 . TRP B 2 191 ? 15.003  71.634 66.832 1.00 18.85  ? 188  TRP H CD2 1 
ATOM   3035 N NE1 . TRP B 2 191 ? 16.211  71.792 64.950 1.00 19.50  ? 188  TRP H NE1 1 
ATOM   3036 C CE2 . TRP B 2 191 ? 14.930  71.668 65.423 1.00 19.44  ? 188  TRP H CE2 1 
ATOM   3037 C CE3 . TRP B 2 191 ? 13.819  71.514 67.570 1.00 18.91  ? 188  TRP H CE3 1 
ATOM   3038 C CZ2 . TRP B 2 191 ? 13.713  71.584 64.730 1.00 17.98  ? 188  TRP H CZ2 1 
ATOM   3039 C CZ3 . TRP B 2 191 ? 12.608  71.432 66.883 1.00 19.99  ? 188  TRP H CZ3 1 
ATOM   3040 C CH2 . TRP B 2 191 ? 12.568  71.468 65.474 1.00 17.87  ? 188  TRP H CH2 1 
ATOM   3041 N N   . PRO B 2 192 ? 15.301  74.633 68.356 1.00 22.68  ? 189  PRO H N   1 
ATOM   3042 C CA  . PRO B 2 192 ? 15.999  75.054 67.138 1.00 23.24  ? 189  PRO H CA  1 
ATOM   3043 C C   . PRO B 2 192 ? 16.995  76.209 67.289 1.00 24.31  ? 189  PRO H C   1 
ATOM   3044 O O   . PRO B 2 192 ? 17.479  76.735 66.290 1.00 24.58  ? 189  PRO H O   1 
ATOM   3045 C CB  . PRO B 2 192 ? 14.855  75.419 66.206 1.00 28.70  ? 189  PRO H CB  1 
ATOM   3046 C CG  . PRO B 2 192 ? 13.882  76.048 67.146 1.00 27.84  ? 189  PRO H CG  1 
ATOM   3047 C CD  . PRO B 2 192 ? 13.901  75.104 68.334 1.00 27.69  ? 189  PRO H CD  1 
ATOM   3048 N N   . SER B 2 193 ? 17.304  76.609 68.518 1.00 27.18  ? 190  SER H N   1 
ATOM   3049 C CA  . SER B 2 193 ? 18.248  77.706 68.723 1.00 27.54  ? 190  SER H CA  1 
ATOM   3050 C C   . SER B 2 193 ? 19.572  77.396 68.039 1.00 26.98  ? 190  SER H C   1 
ATOM   3051 O O   . SER B 2 193 ? 20.136  78.238 67.345 1.00 27.95  ? 190  SER H O   1 
ATOM   3052 C CB  . SER B 2 193 ? 18.480  77.948 70.218 1.00 36.17  ? 190  SER H CB  1 
ATOM   3053 O OG  . SER B 2 193 ? 17.326  78.512 70.817 1.00 38.63  ? 190  SER H OG  1 
ATOM   3054 N N   . GLU B 2 194 ? 20.068  76.185 68.262 1.00 24.04  ? 191  GLU H N   1 
ATOM   3055 C CA  . GLU B 2 194 ? 21.306  75.723 67.658 1.00 22.90  ? 191  GLU H CA  1 
ATOM   3056 C C   . GLU B 2 194 ? 20.908  74.753 66.546 1.00 23.76  ? 191  GLU H C   1 
ATOM   3057 O O   . GLU B 2 194 ? 19.990  73.940 66.722 1.00 23.08  ? 191  GLU H O   1 
ATOM   3058 C CB  . GLU B 2 194 ? 22.170  75.017 68.704 1.00 28.85  ? 191  GLU H CB  1 
ATOM   3059 C CG  . GLU B 2 194 ? 22.669  75.940 69.815 1.00 30.96  ? 191  GLU H CG  1 
ATOM   3060 C CD  . GLU B 2 194 ? 23.523  75.217 70.839 1.00 32.67  ? 191  GLU H CD  1 
ATOM   3061 O OE1 . GLU B 2 194 ? 24.229  74.255 70.466 1.00 30.45  ? 191  GLU H OE1 1 
ATOM   3062 O OE2 . GLU B 2 194 ? 23.504  75.619 72.019 1.00 35.22  ? 191  GLU H OE2 1 
ATOM   3063 N N   . THR B 2 195 ? 21.581  74.838 65.402 1.00 18.96  ? 192  THR H N   1 
ATOM   3064 C CA  . THR B 2 195 ? 21.250  73.973 64.276 1.00 19.15  ? 192  THR H CA  1 
ATOM   3065 C C   . THR B 2 195 ? 21.566  72.495 64.503 1.00 17.79  ? 192  THR H C   1 
ATOM   3066 O O   . THR B 2 195 ? 22.578  72.147 65.117 1.00 17.10  ? 192  THR H O   1 
ATOM   3067 C CB  . THR B 2 195 ? 21.980  74.417 62.988 1.00 27.94  ? 192  THR H CB  1 
ATOM   3068 O OG1 . THR B 2 195 ? 23.390  74.249 63.160 1.00 32.12  ? 192  THR H OG1 1 
ATOM   3069 C CG2 . THR B 2 195 ? 21.684  75.873 62.677 1.00 28.50  ? 192  THR H CG2 1 
ATOM   3070 N N   . VAL B 2 196 ? 20.677  71.634 64.016 1.00 16.69  ? 193  VAL H N   1 
ATOM   3071 C CA  . VAL B 2 196 ? 20.853  70.187 64.107 1.00 15.27  ? 193  VAL H CA  1 
ATOM   3072 C C   . VAL B 2 196 ? 20.772  69.668 62.680 1.00 15.57  ? 193  VAL H C   1 
ATOM   3073 O O   . VAL B 2 196 ? 19.762  69.862 61.994 1.00 15.93  ? 193  VAL H O   1 
ATOM   3074 C CB  . VAL B 2 196 ? 19.746  69.514 64.954 1.00 17.26  ? 193  VAL H CB  1 
ATOM   3075 C CG1 . VAL B 2 196 ? 19.861  67.988 64.849 1.00 17.26  ? 193  VAL H CG1 1 
ATOM   3076 C CG2 . VAL B 2 196 ? 19.874  69.942 66.414 1.00 16.86  ? 193  VAL H CG2 1 
ATOM   3077 N N   . THR B 2 197 ? 21.837  69.013 62.233 1.00 13.80  ? 194  THR H N   1 
ATOM   3078 C CA  . THR B 2 197 ? 21.901  68.491 60.871 1.00 14.53  ? 194  THR H CA  1 
ATOM   3079 C C   . THR B 2 197 ? 22.339  67.035 60.822 1.00 14.92  ? 194  THR H C   1 
ATOM   3080 O O   . THR B 2 197 ? 23.245  66.629 61.548 1.00 13.79  ? 194  THR H O   1 
ATOM   3081 C CB  . THR B 2 197 ? 22.929  69.271 60.038 1.00 19.01  ? 194  THR H CB  1 
ATOM   3082 O OG1 . THR B 2 197 ? 22.697  70.674 60.183 1.00 20.52  ? 194  THR H OG1 1 
ATOM   3083 C CG2 . THR B 2 197 ? 22.832  68.879 58.564 1.00 19.38  ? 194  THR H CG2 1 
ATOM   3084 N N   . CYS B 2 198 ? 21.709  66.236 59.969 1.00 22.99  ? 195  CYS H N   1 
ATOM   3085 C CA  . CYS B 2 198 ? 22.162  64.862 59.855 1.00 24.38  ? 195  CYS H CA  1 
ATOM   3086 C C   . CYS B 2 198 ? 23.022  64.799 58.606 1.00 24.19  ? 195  CYS H C   1 
ATOM   3087 O O   . CYS B 2 198 ? 22.751  65.479 57.613 1.00 24.75  ? 195  CYS H O   1 
ATOM   3088 C CB  . CYS B 2 198 ? 21.000  63.879 59.750 1.00 22.43  ? 195  CYS H CB  1 
ATOM   3089 S SG  . CYS B 2 198 ? 20.043  63.961 58.216 1.00 26.44  ? 195  CYS H SG  1 
ATOM   3090 N N   . ASN B 2 199 ? 24.085  64.012 58.677 1.00 22.28  ? 196  ASN H N   1 
ATOM   3091 C CA  . ASN B 2 199 ? 24.992  63.851 57.553 1.00 22.88  ? 196  ASN H CA  1 
ATOM   3092 C C   . ASN B 2 199 ? 24.874  62.406 57.109 1.00 21.89  ? 196  ASN H C   1 
ATOM   3093 O O   . ASN B 2 199 ? 25.069  61.488 57.903 1.00 22.07  ? 196  ASN H O   1 
ATOM   3094 C CB  . ASN B 2 199 ? 26.431  64.153 57.979 1.00 21.67  ? 196  ASN H CB  1 
ATOM   3095 C CG  . ASN B 2 199 ? 26.509  65.237 59.034 1.00 22.92  ? 196  ASN H CG  1 
ATOM   3096 O OD1 . ASN B 2 199 ? 26.549  64.952 60.233 1.00 22.74  ? 196  ASN H OD1 1 
ATOM   3097 N ND2 . ASN B 2 199 ? 26.516  66.492 58.596 1.00 24.66  ? 196  ASN H ND2 1 
ATOM   3098 N N   . VAL B 2 200 ? 24.538  62.210 55.843 1.00 22.56  ? 197  VAL H N   1 
ATOM   3099 C CA  . VAL B 2 200 ? 24.382  60.873 55.296 1.00 21.72  ? 197  VAL H CA  1 
ATOM   3100 C C   . VAL B 2 200 ? 25.417  60.633 54.210 1.00 22.40  ? 197  VAL H C   1 
ATOM   3101 O O   . VAL B 2 200 ? 25.573  61.439 53.292 1.00 23.26  ? 197  VAL H O   1 
ATOM   3102 C CB  . VAL B 2 200 ? 22.983  60.685 54.671 1.00 22.23  ? 197  VAL H CB  1 
ATOM   3103 C CG1 . VAL B 2 200 ? 22.829  59.265 54.149 1.00 21.61  ? 197  VAL H CG1 1 
ATOM   3104 C CG2 . VAL B 2 200 ? 21.906  61.003 55.702 1.00 22.85  ? 197  VAL H CG2 1 
ATOM   3105 N N   . ALA B 2 201 ? 26.129  59.524 54.318 1.00 23.70  ? 198  ALA H N   1 
ATOM   3106 C CA  . ALA B 2 201 ? 27.124  59.183 53.322 1.00 24.25  ? 198  ALA H CA  1 
ATOM   3107 C C   . ALA B 2 201 ? 26.752  57.836 52.730 1.00 24.66  ? 198  ALA H C   1 
ATOM   3108 O O   . ALA B 2 201 ? 26.332  56.932 53.450 1.00 25.15  ? 198  ALA H O   1 
ATOM   3109 C CB  . ALA B 2 201 ? 28.508  59.117 53.957 1.00 34.96  ? 198  ALA H CB  1 
ATOM   3110 N N   . HIS B 2 202 ? 26.869  57.724 51.413 1.00 21.90  ? 199  HIS H N   1 
ATOM   3111 C CA  . HIS B 2 202 ? 26.588  56.477 50.711 1.00 23.64  ? 199  HIS H CA  1 
ATOM   3112 C C   . HIS B 2 202 ? 27.832  56.245 49.863 1.00 25.07  ? 199  HIS H C   1 
ATOM   3113 O O   . HIS B 2 202 ? 27.913  56.702 48.724 1.00 24.60  ? 199  HIS H O   1 
ATOM   3114 C CB  . HIS B 2 202 ? 25.362  56.615 49.808 1.00 24.52  ? 199  HIS H CB  1 
ATOM   3115 C CG  . HIS B 2 202 ? 24.957  55.334 49.142 1.00 24.15  ? 199  HIS H CG  1 
ATOM   3116 N ND1 . HIS B 2 202 ? 24.763  55.231 47.783 1.00 24.15  ? 199  HIS H ND1 1 
ATOM   3117 C CD2 . HIS B 2 202 ? 24.675  54.112 49.654 1.00 24.29  ? 199  HIS H CD2 1 
ATOM   3118 C CE1 . HIS B 2 202 ? 24.378  54.002 47.485 1.00 24.01  ? 199  HIS H CE1 1 
ATOM   3119 N NE2 . HIS B 2 202 ? 24.315  53.303 48.603 1.00 24.16  ? 199  HIS H NE2 1 
ATOM   3120 N N   . PRO B 2 203 ? 28.828  55.547 50.424 1.00 33.49  ? 200  PRO H N   1 
ATOM   3121 C CA  . PRO B 2 203 ? 30.096  55.240 49.755 1.00 34.71  ? 200  PRO H CA  1 
ATOM   3122 C C   . PRO B 2 203 ? 29.961  54.646 48.354 1.00 34.66  ? 200  PRO H C   1 
ATOM   3123 O O   . PRO B 2 203 ? 30.708  55.014 47.447 1.00 34.74  ? 200  PRO H O   1 
ATOM   3124 C CB  . PRO B 2 203 ? 30.768  54.269 50.725 1.00 42.11  ? 200  PRO H CB  1 
ATOM   3125 C CG  . PRO B 2 203 ? 30.242  54.700 52.050 1.00 42.86  ? 200  PRO H CG  1 
ATOM   3126 C CD  . PRO B 2 203 ? 28.782  54.919 51.757 1.00 41.73  ? 200  PRO H CD  1 
ATOM   3127 N N   . ALA B 2 204 ? 29.013  53.730 48.182 1.00 38.29  ? 201  ALA H N   1 
ATOM   3128 C CA  . ALA B 2 204 ? 28.808  53.073 46.891 1.00 39.11  ? 201  ALA H CA  1 
ATOM   3129 C C   . ALA B 2 204 ? 28.609  54.046 45.738 1.00 39.88  ? 201  ALA H C   1 
ATOM   3130 O O   . ALA B 2 204 ? 29.043  53.779 44.615 1.00 40.32  ? 201  ALA H O   1 
ATOM   3131 C CB  . ALA B 2 204 ? 27.630  52.115 46.968 1.00 31.13  ? 201  ALA H CB  1 
ATOM   3132 N N   . SER B 2 205 ? 27.951  55.170 45.999 1.00 29.97  ? 202  SER H N   1 
ATOM   3133 C CA  . SER B 2 205 ? 27.734  56.147 44.937 1.00 30.47  ? 202  SER H CA  1 
ATOM   3134 C C   . SER B 2 205 ? 28.564  57.386 45.219 1.00 30.41  ? 202  SER H C   1 
ATOM   3135 O O   . SER B 2 205 ? 28.399  58.415 44.566 1.00 29.29  ? 202  SER H O   1 
ATOM   3136 C CB  . SER B 2 205 ? 26.251  56.523 44.836 1.00 30.78  ? 202  SER H CB  1 
ATOM   3137 O OG  . SER B 2 205 ? 25.820  57.218 45.990 1.00 28.31  ? 202  SER H OG  1 
ATOM   3138 N N   . SER B 2 206 ? 29.459  57.274 46.195 1.00 39.26  ? 203  SER H N   1 
ATOM   3139 C CA  . SER B 2 206 ? 30.317  58.388 46.572 1.00 41.87  ? 203  SER H CA  1 
ATOM   3140 C C   . SER B 2 206 ? 29.445  59.620 46.785 1.00 41.30  ? 203  SER H C   1 
ATOM   3141 O O   . SER B 2 206 ? 29.677  60.679 46.201 1.00 41.69  ? 203  SER H O   1 
ATOM   3142 C CB  . SER B 2 206 ? 31.344  58.651 45.469 1.00 60.46  ? 203  SER H CB  1 
ATOM   3143 O OG  . SER B 2 206 ? 32.127  57.493 45.235 1.00 64.14  ? 203  SER H OG  1 
ATOM   3144 N N   . THR B 2 207 ? 28.438  59.468 47.634 1.00 33.93  ? 204  THR H N   1 
ATOM   3145 C CA  . THR B 2 207 ? 27.513  60.551 47.910 1.00 32.84  ? 204  THR H CA  1 
ATOM   3146 C C   . THR B 2 207 ? 27.512  60.979 49.365 1.00 31.86  ? 204  THR H C   1 
ATOM   3147 O O   . THR B 2 207 ? 27.657  60.155 50.269 1.00 33.00  ? 204  THR H O   1 
ATOM   3148 C CB  . THR B 2 207 ? 26.080  60.139 47.539 1.00 33.58  ? 204  THR H CB  1 
ATOM   3149 O OG1 . THR B 2 207 ? 26.073  59.618 46.207 1.00 34.00  ? 204  THR H OG1 1 
ATOM   3150 C CG2 . THR B 2 207 ? 25.140  61.333 47.619 1.00 33.70  ? 204  THR H CG2 1 
ATOM   3151 N N   . LYS B 2 208 ? 27.352  62.278 49.577 1.00 31.37  ? 205  LYS H N   1 
ATOM   3152 C CA  . LYS B 2 208 ? 27.276  62.851 50.913 1.00 32.44  ? 205  LYS H CA  1 
ATOM   3153 C C   . LYS B 2 208 ? 26.191  63.915 50.870 1.00 31.54  ? 205  LYS H C   1 
ATOM   3154 O O   . LYS B 2 208 ? 26.204  64.794 50.009 1.00 32.27  ? 205  LYS H O   1 
ATOM   3155 C CB  . LYS B 2 208 ? 28.614  63.461 51.333 1.00 42.25  ? 205  LYS H CB  1 
ATOM   3156 C CG  . LYS B 2 208 ? 29.667  62.416 51.665 1.00 46.32  ? 205  LYS H CG  1 
ATOM   3157 C CD  . LYS B 2 208 ? 30.955  63.046 52.167 1.00 48.94  ? 205  LYS H CD  1 
ATOM   3158 C CE  . LYS B 2 208 ? 32.029  61.989 52.388 1.00 49.81  ? 205  LYS H CE  1 
ATOM   3159 N NZ  . LYS B 2 208 ? 33.302  62.593 52.864 1.00 51.60  ? 205  LYS H NZ  1 
ATOM   3160 N N   . VAL B 2 209 ? 25.236  63.808 51.788 1.00 28.93  ? 206  VAL H N   1 
ATOM   3161 C CA  . VAL B 2 209 ? 24.120  64.742 51.858 1.00 26.09  ? 206  VAL H CA  1 
ATOM   3162 C C   . VAL B 2 209 ? 23.919  65.236 53.286 1.00 24.94  ? 206  VAL H C   1 
ATOM   3163 O O   . VAL B 2 209 ? 24.025  64.464 54.234 1.00 24.43  ? 206  VAL H O   1 
ATOM   3164 C CB  . VAL B 2 209 ? 22.805  64.060 51.382 1.00 22.58  ? 206  VAL H CB  1 
ATOM   3165 C CG1 . VAL B 2 209 ? 21.608  64.966 51.647 1.00 19.39  ? 206  VAL H CG1 1 
ATOM   3166 C CG2 . VAL B 2 209 ? 22.896  63.731 49.911 1.00 20.76  ? 206  VAL H CG2 1 
ATOM   3167 N N   . ASP B 2 210 ? 23.637  66.527 53.427 1.00 26.96  ? 207  ASP H N   1 
ATOM   3168 C CA  . ASP B 2 210 ? 23.382  67.135 54.728 1.00 27.06  ? 207  ASP H CA  1 
ATOM   3169 C C   . ASP B 2 210 ? 21.946  67.647 54.727 1.00 26.80  ? 207  ASP H C   1 
ATOM   3170 O O   . ASP B 2 210 ? 21.504  68.241 53.745 1.00 28.36  ? 207  ASP H O   1 
ATOM   3171 C CB  . ASP B 2 210 ? 24.321  68.317 54.965 1.00 27.40  ? 207  ASP H CB  1 
ATOM   3172 C CG  . ASP B 2 210 ? 25.729  67.893 55.343 1.00 30.16  ? 207  ASP H CG  1 
ATOM   3173 O OD1 . ASP B 2 210 ? 26.643  68.739 55.229 1.00 35.10  ? 207  ASP H OD1 1 
ATOM   3174 O OD2 . ASP B 2 210 ? 25.929  66.734 55.763 1.00 29.16  ? 207  ASP H OD2 1 
ATOM   3175 N N   . LYS B 2 211 ? 21.210  67.403 55.807 1.00 18.90  ? 208  LYS H N   1 
ATOM   3176 C CA  . LYS B 2 211 ? 19.834  67.891 55.902 1.00 18.22  ? 208  LYS H CA  1 
ATOM   3177 C C   . LYS B 2 211 ? 19.631  68.537 57.252 1.00 17.15  ? 208  LYS H C   1 
ATOM   3178 O O   . LYS B 2 211 ? 19.691  67.879 58.295 1.00 14.10  ? 208  LYS H O   1 
ATOM   3179 C CB  . LYS B 2 211 ? 18.805  66.768 55.711 1.00 22.00  ? 208  LYS H CB  1 
ATOM   3180 C CG  . LYS B 2 211 ? 18.530  66.432 54.255 1.00 27.89  ? 208  LYS H CG  1 
ATOM   3181 C CD  . LYS B 2 211 ? 18.046  67.653 53.481 1.00 27.66  ? 208  LYS H CD  1 
ATOM   3182 C CE  . LYS B 2 211 ? 18.054  67.389 51.984 1.00 30.80  ? 208  LYS H CE  1 
ATOM   3183 N NZ  . LYS B 2 211 ? 17.730  68.610 51.189 1.00 30.89  ? 208  LYS H NZ  1 
ATOM   3184 N N   . LYS B 2 212 ? 19.403  69.841 57.229 1.00 21.03  ? 209  LYS H N   1 
ATOM   3185 C CA  . LYS B 2 212 ? 19.201  70.584 58.458 1.00 22.13  ? 209  LYS H CA  1 
ATOM   3186 C C   . LYS B 2 212 ? 17.795  70.294 58.938 1.00 21.18  ? 209  LYS H C   1 
ATOM   3187 O O   . LYS B 2 212 ? 16.870  70.203 58.135 1.00 21.50  ? 209  LYS H O   1 
ATOM   3188 C CB  . LYS B 2 212 ? 19.357  72.080 58.188 1.00 26.20  ? 209  LYS H CB  1 
ATOM   3189 C CG  . LYS B 2 212 ? 19.424  72.936 59.438 1.00 30.07  ? 209  LYS H CG  1 
ATOM   3190 C CD  . LYS B 2 212 ? 19.306  74.404 59.080 1.00 33.93  ? 209  LYS H CD  1 
ATOM   3191 C CE  . LYS B 2 212 ? 20.326  74.807 58.028 1.00 37.85  ? 209  LYS H CE  1 
ATOM   3192 N NZ  . LYS B 2 212 ? 20.035  76.157 57.466 1.00 41.55  ? 209  LYS H NZ  1 
ATOM   3193 N N   . ILE B 2 213 ? 17.625  70.135 60.241 1.00 20.85  ? 210  ILE H N   1 
ATOM   3194 C CA  . ILE B 2 213 ? 16.290  69.885 60.759 1.00 22.23  ? 210  ILE H CA  1 
ATOM   3195 C C   . ILE B 2 213 ? 15.681  71.235 61.107 1.00 23.30  ? 210  ILE H C   1 
ATOM   3196 O O   . ILE B 2 213 ? 16.079  71.865 62.079 1.00 25.73  ? 210  ILE H O   1 
ATOM   3197 C CB  . ILE B 2 213 ? 16.317  69.008 62.016 1.00 18.45  ? 210  ILE H CB  1 
ATOM   3198 C CG1 . ILE B 2 213 ? 17.119  67.727 61.750 1.00 17.92  ? 210  ILE H CG1 1 
ATOM   3199 C CG2 . ILE B 2 213 ? 14.890  68.675 62.430 1.00 17.17  ? 210  ILE H CG2 1 
ATOM   3200 C CD1 . ILE B 2 213 ? 16.623  66.900 60.560 1.00 14.58  ? 210  ILE H CD1 1 
ATOM   3201 N N   . VAL B 2 214 ? 14.718  71.671 60.304 1.00 23.28  ? 211  VAL H N   1 
ATOM   3202 C CA  . VAL B 2 214 ? 14.062  72.955 60.506 1.00 25.97  ? 211  VAL H CA  1 
ATOM   3203 C C   . VAL B 2 214 ? 12.664  72.794 61.086 1.00 28.18  ? 211  VAL H C   1 
ATOM   3204 O O   . VAL B 2 214 ? 11.861  72.006 60.585 1.00 27.34  ? 211  VAL H O   1 
ATOM   3205 C CB  . VAL B 2 214 ? 13.938  73.725 59.177 1.00 32.91  ? 211  VAL H CB  1 
ATOM   3206 C CG1 . VAL B 2 214 ? 13.282  75.077 59.417 1.00 32.55  ? 211  VAL H CG1 1 
ATOM   3207 C CG2 . VAL B 2 214 ? 15.312  73.900 58.548 1.00 33.67  ? 211  VAL H CG2 1 
ATOM   3208 N N   . PRO B 2 215 ? 12.347  73.556 62.144 1.00 32.27  ? 212  PRO H N   1 
ATOM   3209 C CA  . PRO B 2 215 ? 11.021  73.468 62.766 1.00 34.43  ? 212  PRO H CA  1 
ATOM   3210 C C   . PRO B 2 215 ? 9.888   73.790 61.794 1.00 37.25  ? 212  PRO H C   1 
ATOM   3211 O O   . PRO B 2 215 ? 10.030  74.647 60.920 1.00 37.26  ? 212  PRO H O   1 
ATOM   3212 C CB  . PRO B 2 215 ? 11.112  74.468 63.917 1.00 32.98  ? 212  PRO H CB  1 
ATOM   3213 C CG  . PRO B 2 215 ? 12.124  75.462 63.431 1.00 33.63  ? 212  PRO H CG  1 
ATOM   3214 C CD  . PRO B 2 215 ? 13.172  74.578 62.809 1.00 33.29  ? 212  PRO H CD  1 
ATOM   3215 N N   . ARG B 2 216 ? 8.768   73.093 61.950 1.00 52.61  ? 213  ARG H N   1 
ATOM   3216 C CA  . ARG B 2 216 ? 7.608   73.299 61.092 1.00 56.78  ? 213  ARG H CA  1 
ATOM   3217 C C   . ARG B 2 216 ? 7.210   74.772 61.080 1.00 58.40  ? 213  ARG H C   1 
ATOM   3218 O O   . ARG B 2 216 ? 7.673   75.508 61.977 1.00 60.10  ? 213  ARG H O   1 
ATOM   3219 C CB  . ARG B 2 216 ? 6.431   72.466 61.596 1.00 68.34  ? 213  ARG H CB  1 
ATOM   3220 C CG  . ARG B 2 216 ? 6.690   70.974 61.651 1.00 71.34  ? 213  ARG H CG  1 
ATOM   3221 C CD  . ARG B 2 216 ? 6.957   70.419 60.273 1.00 74.06  ? 213  ARG H CD  1 
ATOM   3222 N NE  . ARG B 2 216 ? 6.734   68.981 60.214 1.00 77.21  ? 213  ARG H NE  1 
ATOM   3223 C CZ  . ARG B 2 216 ? 6.824   68.264 59.100 1.00 79.52  ? 213  ARG H CZ  1 
ATOM   3224 N NH1 . ARG B 2 216 ? 7.137   68.855 57.953 1.00 79.91  ? 213  ARG H NH1 1 
ATOM   3225 N NH2 . ARG B 2 216 ? 6.593   66.959 59.126 1.00 81.36  ? 213  ARG H NH2 1 
HETATM 3226 C C1  . EST C 3 .   ? 43.148  25.815 67.976 1.00 26.88  ? 911  EST L C1  1 
HETATM 3227 C C2  . EST C 3 .   ? 44.547  25.724 68.282 1.00 27.18  ? 911  EST L C2  1 
HETATM 3228 C C3  . EST C 3 .   ? 45.340  24.672 67.700 1.00 27.40  ? 911  EST L C3  1 
HETATM 3229 O O3  . EST C 3 .   ? 46.679  24.593 68.003 1.00 29.15  ? 911  EST L O3  1 
HETATM 3230 C C4  . EST C 3 .   ? 44.749  23.711 66.809 1.00 27.93  ? 911  EST L C4  1 
HETATM 3231 C C5  . EST C 3 .   ? 43.338  23.784 66.479 1.00 28.38  ? 911  EST L C5  1 
HETATM 3232 C C6  . EST C 3 .   ? 42.736  22.745 65.504 1.00 27.88  ? 911  EST L C6  1 
HETATM 3233 C C7  . EST C 3 .   ? 41.214  22.912 65.179 1.00 25.76  ? 911  EST L C7  1 
HETATM 3234 C C8  . EST C 3 .   ? 40.713  24.381 65.247 1.00 24.38  ? 911  EST L C8  1 
HETATM 3235 C C9  . EST C 3 .   ? 40.972  24.941 66.722 1.00 26.80  ? 911  EST L C9  1 
HETATM 3236 C C10 . EST C 3 .   ? 42.500  24.861 67.077 1.00 28.25  ? 911  EST L C10 1 
HETATM 3237 C C11 . EST C 3 .   ? 40.419  26.405 66.795 1.00 25.78  ? 911  EST L C11 1 
HETATM 3238 C C12 . EST C 3 .   ? 38.907  26.528 66.427 1.00 23.02  ? 911  EST L C12 1 
HETATM 3239 C C13 . EST C 3 .   ? 38.658  26.023 64.975 1.00 23.12  ? 911  EST L C13 1 
HETATM 3240 C C14 . EST C 3 .   ? 39.161  24.500 64.904 1.00 24.46  ? 911  EST L C14 1 
HETATM 3241 C C15 . EST C 3 .   ? 38.604  24.073 63.535 1.00 24.43  ? 911  EST L C15 1 
HETATM 3242 C C16 . EST C 3 .   ? 37.111  24.591 63.624 1.00 24.61  ? 911  EST L C16 1 
HETATM 3243 C C17 . EST C 3 .   ? 37.159  25.840 64.577 1.00 22.69  ? 911  EST L C17 1 
HETATM 3244 O O17 . EST C 3 .   ? 36.533  26.973 63.917 1.00 22.79  ? 911  EST L O17 1 
HETATM 3245 C C18 . EST C 3 .   ? 39.354  27.006 63.925 1.00 20.96  ? 911  EST L C18 1 
HETATM 3246 O O   . HOH D 4 .   ? 10.612  58.781 70.185 1.00 15.27  ? 912  HOH L O   1 
HETATM 3247 O O   . HOH D 4 .   ? 11.224  55.273 76.813 1.00 15.38  ? 913  HOH L O   1 
HETATM 3248 O O   . HOH D 4 .   ? 33.563  38.606 76.807 1.00 17.62  ? 914  HOH L O   1 
HETATM 3249 O O   . HOH D 4 .   ? 21.434  29.306 81.767 1.00 15.42  ? 915  HOH L O   1 
HETATM 3250 O O   . HOH D 4 .   ? 13.828  41.668 75.827 1.00 26.53  ? 916  HOH L O   1 
HETATM 3251 O O   . HOH D 4 .   ? 30.377  39.589 88.674 1.00 21.16  ? 917  HOH L O   1 
HETATM 3252 O O   . HOH D 4 .   ? 13.650  52.805 59.545 1.00 18.64  ? 918  HOH L O   1 
HETATM 3253 O O   . HOH D 4 .   ? 32.299  29.158 83.922 1.00 17.73  ? 919  HOH L O   1 
HETATM 3254 O O   . HOH D 4 .   ? 22.962  43.601 84.078 1.00 18.08  ? 920  HOH L O   1 
HETATM 3255 O O   . HOH D 4 .   ? 20.318  27.788 68.073 1.00 26.02  ? 921  HOH L O   1 
HETATM 3256 O O   . HOH D 4 .   ? 25.752  36.452 65.446 1.00 18.18  ? 922  HOH L O   1 
HETATM 3257 O O   . HOH D 4 .   ? 32.647  38.727 86.838 1.00 23.25  ? 923  HOH L O   1 
HETATM 3258 O O   . HOH D 4 .   ? 12.690  51.441 83.328 1.00 26.54  ? 924  HOH L O   1 
HETATM 3259 O O   . HOH D 4 .   ? 37.480  39.495 77.414 1.00 16.24  ? 925  HOH L O   1 
HETATM 3260 O O   . HOH D 4 .   ? 33.584  38.886 70.606 1.00 20.12  ? 926  HOH L O   1 
HETATM 3261 O O   . HOH D 4 .   ? 37.773  39.869 82.151 1.00 22.30  ? 927  HOH L O   1 
HETATM 3262 O O   . HOH D 4 .   ? 35.277  43.240 82.709 1.00 20.92  ? 928  HOH L O   1 
HETATM 3263 O O   . HOH D 4 .   ? -0.993  53.640 77.599 1.00 21.11  ? 929  HOH L O   1 
HETATM 3264 O O   . HOH D 4 .   ? 42.099  25.859 79.390 1.00 20.88  ? 930  HOH L O   1 
HETATM 3265 O O   . HOH D 4 .   ? 33.001  39.615 67.950 1.00 24.98  ? 931  HOH L O   1 
HETATM 3266 O O   . HOH D 4 .   ? 27.754  30.178 89.395 1.00 43.79  ? 932  HOH L O   1 
HETATM 3267 O O   . HOH D 4 .   ? 35.983  37.653 76.573 1.00 18.26  ? 933  HOH L O   1 
HETATM 3268 O O   . HOH D 4 .   ? -4.160  55.179 74.986 1.00 31.12  ? 934  HOH L O   1 
HETATM 3269 O O   . HOH D 4 .   ? 18.691  50.044 70.697 1.00 23.97  ? 935  HOH L O   1 
HETATM 3270 O O   . HOH D 4 .   ? -0.456  48.713 68.855 1.00 26.18  ? 936  HOH L O   1 
HETATM 3271 O O   . HOH D 4 .   ? 19.203  32.677 68.337 1.00 24.01  ? 937  HOH L O   1 
HETATM 3272 O O   . HOH D 4 .   ? 34.051  12.934 73.771 1.00 34.85  ? 938  HOH L O   1 
HETATM 3273 O O   . HOH D 4 .   ? 0.454   50.969 82.650 1.00 20.39  ? 939  HOH L O   1 
HETATM 3274 O O   . HOH D 4 .   ? 14.428  46.913 68.937 1.00 23.53  ? 940  HOH L O   1 
HETATM 3275 O O   . HOH D 4 .   ? 21.405  24.587 66.518 1.00 24.58  ? 941  HOH L O   1 
HETATM 3276 O O   . HOH D 4 .   ? 20.897  21.434 72.476 1.00 32.54  ? 942  HOH L O   1 
HETATM 3277 O O   . HOH D 4 .   ? 17.212  51.866 72.444 1.00 20.08  ? 943  HOH L O   1 
HETATM 3278 O O   . HOH D 4 .   ? 5.512   63.176 68.586 1.00 30.41  ? 944  HOH L O   1 
HETATM 3279 O O   . HOH D 4 .   ? 23.815  39.390 89.869 1.00 17.01  ? 945  HOH L O   1 
HETATM 3280 O O   . HOH D 4 .   ? 35.908  37.951 85.602 1.00 14.58  ? 946  HOH L O   1 
HETATM 3281 O O   . HOH D 4 .   ? 5.636   70.832 50.747 1.00 30.81  ? 947  HOH L O   1 
HETATM 3282 O O   . HOH D 4 .   ? 0.486   48.699 75.459 1.00 23.79  ? 948  HOH L O   1 
HETATM 3283 O O   . HOH D 4 .   ? 27.212  34.026 88.925 1.00 21.69  ? 949  HOH L O   1 
HETATM 3284 O O   . HOH D 4 .   ? 30.164  16.434 60.008 1.00 24.24  ? 950  HOH L O   1 
HETATM 3285 O O   . HOH D 4 .   ? 32.453  22.163 75.305 1.00 21.95  ? 951  HOH L O   1 
HETATM 3286 O O   . HOH D 4 .   ? 22.043  17.778 66.478 1.00 19.19  ? 952  HOH L O   1 
HETATM 3287 O O   . HOH D 4 .   ? 15.405  30.059 73.341 1.00 36.59  ? 953  HOH L O   1 
HETATM 3288 O O   . HOH D 4 .   ? 16.852  57.952 72.464 1.00 28.39  ? 954  HOH L O   1 
HETATM 3289 O O   . HOH D 4 .   ? 1.715   43.431 75.721 1.00 28.69  ? 955  HOH L O   1 
HETATM 3290 O O   . HOH D 4 .   ? 13.770  58.189 74.112 1.00 26.69  ? 956  HOH L O   1 
HETATM 3291 O O   . HOH D 4 .   ? 2.180   47.852 83.975 1.00 42.71  ? 957  HOH L O   1 
HETATM 3292 O O   . HOH D 4 .   ? 24.716  44.695 75.797 1.00 19.57  ? 958  HOH L O   1 
HETATM 3293 O O   . HOH D 4 .   ? 36.853  24.853 80.073 1.00 23.60  ? 959  HOH L O   1 
HETATM 3294 O O   . HOH D 4 .   ? 40.163  36.065 84.143 1.00 29.31  ? 960  HOH L O   1 
HETATM 3295 O O   . HOH D 4 .   ? 21.992  34.230 65.116 1.00 39.72  ? 961  HOH L O   1 
HETATM 3296 O O   . HOH D 4 .   ? 17.356  48.159 85.174 1.00 24.06  ? 962  HOH L O   1 
HETATM 3297 O O   . HOH D 4 .   ? 37.225  41.859 83.957 1.00 23.72  ? 963  HOH L O   1 
HETATM 3298 O O   . HOH D 4 .   ? 34.181  40.713 75.062 1.00 33.49  ? 964  HOH L O   1 
HETATM 3299 O O   . HOH D 4 .   ? 5.971   44.058 75.719 1.00 24.10  ? 965  HOH L O   1 
HETATM 3300 O O   . HOH D 4 .   ? 12.210  43.535 83.202 1.00 22.15  ? 966  HOH L O   1 
HETATM 3301 O O   . HOH D 4 .   ? 22.963  46.176 76.820 1.00 25.03  ? 967  HOH L O   1 
HETATM 3302 O O   . HOH D 4 .   ? 23.044  32.990 88.461 1.00 25.06  ? 968  HOH L O   1 
HETATM 3303 O O   . HOH D 4 .   ? 15.686  53.648 81.897 1.00 33.37  ? 969  HOH L O   1 
HETATM 3304 O O   . HOH D 4 .   ? 37.935  28.343 82.831 1.00 29.63  ? 970  HOH L O   1 
HETATM 3305 O O   . HOH D 4 .   ? 19.118  17.147 69.808 1.00 40.63  ? 971  HOH L O   1 
HETATM 3306 O O   . HOH D 4 .   ? 0.701   62.647 74.754 1.00 32.53  ? 972  HOH L O   1 
HETATM 3307 O O   . HOH D 4 .   ? 6.875   52.464 54.309 1.00 39.70  ? 973  HOH L O   1 
HETATM 3308 O O   . HOH D 4 .   ? 27.468  11.774 74.724 1.00 36.05  ? 974  HOH L O   1 
HETATM 3309 O O   . HOH D 4 .   ? 36.607  40.618 79.579 1.00 22.16  ? 975  HOH L O   1 
HETATM 3310 O O   . HOH D 4 .   ? 37.318  35.686 84.809 1.00 25.80  ? 976  HOH L O   1 
HETATM 3311 O O   . HOH D 4 .   ? 37.246  16.776 77.074 1.00 45.79  ? 977  HOH L O   1 
HETATM 3312 O O   . HOH D 4 .   ? 19.710  27.892 80.228 1.00 47.84  ? 978  HOH L O   1 
HETATM 3313 O O   . HOH D 4 .   ? 29.693  38.107 90.949 1.00 17.12  ? 979  HOH L O   1 
HETATM 3314 O O   . HOH D 4 .   ? 18.926  54.179 72.289 1.00 51.96  ? 980  HOH L O   1 
HETATM 3315 O O   . HOH D 4 .   ? 27.023  37.963 91.122 1.00 21.51  ? 981  HOH L O   1 
HETATM 3316 O O   . HOH D 4 .   ? 19.491  34.817 85.013 1.00 46.00  ? 982  HOH L O   1 
HETATM 3317 O O   . HOH D 4 .   ? 43.448  30.249 81.053 1.00 39.98  ? 983  HOH L O   1 
HETATM 3318 O O   . HOH D 4 .   ? 8.214   42.257 68.883 1.00 44.30  ? 984  HOH L O   1 
HETATM 3319 O O   . HOH D 4 .   ? 26.053  53.316 80.142 1.00 39.05  ? 985  HOH L O   1 
HETATM 3320 O O   . HOH D 4 .   ? 47.521  32.209 76.856 1.00 51.62  ? 986  HOH L O   1 
HETATM 3321 O O   . HOH D 4 .   ? 16.947  64.792 49.369 1.00 46.95  ? 987  HOH L O   1 
HETATM 3322 O O   . HOH D 4 .   ? 15.679  27.377 72.043 1.00 30.95  ? 988  HOH L O   1 
HETATM 3323 O O   . HOH D 4 .   ? 23.272  44.402 71.124 1.00 49.71  ? 989  HOH L O   1 
HETATM 3324 O O   . HOH D 4 .   ? 10.389  59.772 77.744 1.00 36.72  ? 990  HOH L O   1 
HETATM 3325 O O   . HOH D 4 .   ? 39.998  34.853 71.237 1.00 39.68  ? 991  HOH L O   1 
HETATM 3326 O O   . HOH D 4 .   ? 4.360   45.272 58.361 1.00 43.75  ? 992  HOH L O   1 
HETATM 3327 O O   . HOH D 4 .   ? 45.354  33.166 78.105 1.00 43.95  ? 993  HOH L O   1 
HETATM 3328 O O   . HOH D 4 .   ? 17.758  36.724 74.070 1.00 32.53  ? 994  HOH L O   1 
HETATM 3329 O O   . HOH D 4 .   ? -2.826  49.602 69.082 1.00 30.18  ? 995  HOH L O   1 
HETATM 3330 O O   . HOH D 4 .   ? 30.983  23.903 81.403 1.00 38.05  ? 996  HOH L O   1 
HETATM 3331 O O   . HOH D 4 .   ? 21.072  38.986 89.595 1.00 23.14  ? 997  HOH L O   1 
HETATM 3332 O O   . HOH D 4 .   ? 24.583  49.518 71.115 1.00 38.35  ? 998  HOH L O   1 
HETATM 3333 O O   . HOH D 4 .   ? 17.024  54.649 78.808 1.00 30.97  ? 999  HOH L O   1 
HETATM 3334 O O   . HOH D 4 .   ? 33.410  17.610 80.948 1.00 52.81  ? 1000 HOH L O   1 
HETATM 3335 O O   . HOH D 4 .   ? 42.825  32.071 78.589 1.00 26.47  ? 1001 HOH L O   1 
HETATM 3336 O O   . HOH D 4 .   ? 24.534  22.067 62.758 1.00 22.90  ? 1002 HOH L O   1 
HETATM 3337 O O   . HOH D 4 .   ? -1.938  58.683 44.101 1.00 55.29  ? 1003 HOH L O   1 
HETATM 3338 O O   . HOH D 4 .   ? -0.053  45.075 76.860 1.00 28.88  ? 1004 HOH L O   1 
HETATM 3339 O O   . HOH D 4 .   ? -0.251  63.163 70.098 1.00 36.01  ? 1005 HOH L O   1 
HETATM 3340 O O   . HOH D 4 .   ? 35.380  30.953 87.149 1.00 24.72  ? 1006 HOH L O   1 
HETATM 3341 O O   . HOH D 4 .   ? -3.630  51.535 80.863 1.00 30.01  ? 1007 HOH L O   1 
HETATM 3342 O O   . HOH D 4 .   ? 31.051  35.546 91.506 1.00 25.89  ? 1008 HOH L O   1 
HETATM 3343 O O   . HOH D 4 .   ? 36.347  37.584 74.153 1.00 44.17  ? 1009 HOH L O   1 
HETATM 3344 O O   . HOH D 4 .   ? 11.670  69.362 53.758 1.00 28.45  ? 1010 HOH L O   1 
HETATM 3345 O O   . HOH D 4 .   ? 9.549   63.336 54.404 1.00 28.06  ? 1011 HOH L O   1 
HETATM 3346 O O   . HOH D 4 .   ? 21.291  16.253 68.590 1.00 25.96  ? 1012 HOH L O   1 
HETATM 3347 O O   . HOH D 4 .   ? 23.097  42.877 74.364 1.00 25.99  ? 1013 HOH L O   1 
HETATM 3348 O O   . HOH D 4 .   ? 21.328  32.553 66.823 1.00 35.79  ? 1014 HOH L O   1 
HETATM 3349 O O   . HOH D 4 .   ? 23.652  22.735 59.163 1.00 43.60  ? 1015 HOH L O   1 
HETATM 3350 O O   . HOH D 4 .   ? 0.525   61.808 44.865 1.00 42.30  ? 1016 HOH L O   1 
HETATM 3351 O O   . HOH D 4 .   ? 25.070  11.956 62.612 1.00 26.95  ? 1017 HOH L O   1 
HETATM 3352 O O   . HOH D 4 .   ? 9.474   41.975 81.788 1.00 35.45  ? 1018 HOH L O   1 
HETATM 3353 O O   . HOH D 4 .   ? -6.204  58.471 63.082 1.00 26.33  ? 1019 HOH L O   1 
HETATM 3354 O O   . HOH D 4 .   ? 10.502  52.248 59.475 1.00 27.32  ? 1020 HOH L O   1 
HETATM 3355 O O   . HOH D 4 .   ? 36.890  40.385 86.451 1.00 34.28  ? 1021 HOH L O   1 
HETATM 3356 O O   . HOH D 4 .   ? 43.351  21.370 73.694 1.00 26.33  ? 1022 HOH L O   1 
HETATM 3357 O O   . HOH D 4 .   ? 36.737  33.793 86.981 1.00 28.73  ? 1023 HOH L O   1 
HETATM 3358 O O   . HOH D 4 .   ? 19.843  21.370 65.223 1.00 34.14  ? 1024 HOH L O   1 
HETATM 3359 O O   . HOH D 4 .   ? -1.267  49.247 61.345 1.00 24.49  ? 1025 HOH L O   1 
HETATM 3360 O O   . HOH D 4 .   ? 20.705  51.496 69.939 1.00 33.83  ? 1026 HOH L O   1 
HETATM 3361 O O   . HOH D 4 .   ? -7.170  50.225 78.231 1.00 27.05  ? 1027 HOH L O   1 
HETATM 3362 O O   . HOH D 4 .   ? 27.619  52.424 82.056 1.00 44.30  ? 1028 HOH L O   1 
HETATM 3363 O O   . HOH D 4 .   ? -0.140  60.025 74.101 1.00 38.25  ? 1029 HOH L O   1 
HETATM 3364 O O   . HOH D 4 .   ? 16.596  50.740 85.590 1.00 32.22  ? 1030 HOH L O   1 
HETATM 3365 O O   . HOH D 4 .   ? 31.516  44.982 74.987 1.00 38.61  ? 1031 HOH L O   1 
HETATM 3366 O O   . HOH D 4 .   ? 39.171  35.665 65.687 1.00 37.86  ? 1032 HOH L O   1 
HETATM 3367 O O   . HOH D 4 .   ? 14.070  69.301 53.322 1.00 30.11  ? 1033 HOH L O   1 
HETATM 3368 O O   . HOH D 4 .   ? 8.909   61.289 46.160 1.00 34.06  ? 1034 HOH L O   1 
HETATM 3369 O O   . HOH D 4 .   ? 25.904  41.742 69.428 1.00 36.10  ? 1035 HOH L O   1 
HETATM 3370 O O   . HOH D 4 .   ? 7.308   64.239 66.864 1.00 40.23  ? 1036 HOH L O   1 
HETATM 3371 O O   . HOH D 4 .   ? 46.188  22.923 72.199 1.00 34.61  ? 1037 HOH L O   1 
HETATM 3372 O O   . HOH D 4 .   ? 43.887  27.459 78.295 1.00 46.03  ? 1038 HOH L O   1 
HETATM 3373 O O   . HOH D 4 .   ? 26.763  42.541 71.943 1.00 36.41  ? 1039 HOH L O   1 
HETATM 3374 O O   . HOH D 4 .   ? 20.705  42.846 70.222 1.00 39.47  ? 1040 HOH L O   1 
HETATM 3375 O O   . HOH D 4 .   ? 40.483  38.288 82.857 1.00 33.15  ? 1041 HOH L O   1 
HETATM 3376 O O   . HOH D 4 .   ? 37.385  12.200 61.619 1.00 44.89  ? 1042 HOH L O   1 
HETATM 3377 O O   . HOH D 4 .   ? 14.276  52.221 85.775 1.00 41.36  ? 1043 HOH L O   1 
HETATM 3378 O O   . HOH D 4 .   ? 20.323  16.955 64.689 1.00 38.63  ? 1044 HOH L O   1 
HETATM 3379 O O   . HOH D 4 .   ? 3.151   67.628 56.266 1.00 37.29  ? 1045 HOH L O   1 
HETATM 3380 O O   . HOH D 4 .   ? 44.766  20.490 69.308 1.00 34.83  ? 1046 HOH L O   1 
HETATM 3381 O O   . HOH D 4 .   ? 20.596  30.091 63.339 1.00 40.70  ? 1047 HOH L O   1 
HETATM 3382 O O   . HOH D 4 .   ? -1.989  52.515 53.030 1.00 49.11  ? 1048 HOH L O   1 
HETATM 3383 O O   . HOH D 4 .   ? 26.904  27.880 88.908 1.00 39.52  ? 1049 HOH L O   1 
HETATM 3384 O O   . HOH D 4 .   ? 17.245  59.573 74.332 1.00 29.91  ? 1050 HOH L O   1 
HETATM 3385 O O   . HOH D 4 .   ? 26.153  45.301 72.983 1.00 37.51  ? 1051 HOH L O   1 
HETATM 3386 O O   . HOH D 4 .   ? 17.893  26.997 78.641 1.00 47.87  ? 1052 HOH L O   1 
HETATM 3387 O O   . HOH D 4 .   ? 12.564  45.320 69.116 1.00 37.06  ? 1053 HOH L O   1 
HETATM 3388 O O   . HOH D 4 .   ? 26.313  44.738 78.053 1.00 32.41  ? 1054 HOH L O   1 
HETATM 3389 O O   . HOH D 4 .   ? 21.931  48.802 81.031 1.00 33.27  ? 1055 HOH L O   1 
HETATM 3390 O O   . HOH D 4 .   ? 35.851  14.428 57.314 1.00 40.85  ? 1056 HOH L O   1 
HETATM 3391 O O   . HOH D 4 .   ? 8.405   62.121 71.784 1.00 38.59  ? 1057 HOH L O   1 
HETATM 3392 O O   . HOH D 4 .   ? 31.970  24.832 87.108 1.00 47.32  ? 1058 HOH L O   1 
HETATM 3393 O O   . HOH D 4 .   ? -9.499  60.180 64.081 1.00 52.81  ? 1059 HOH L O   1 
HETATM 3394 O O   . HOH D 4 .   ? 35.347  14.706 77.573 1.00 49.36  ? 1060 HOH L O   1 
HETATM 3395 O O   . HOH D 4 .   ? 21.176  54.696 74.210 1.00 45.64  ? 1061 HOH L O   1 
HETATM 3396 O O   . HOH D 4 .   ? 5.938   41.323 76.593 1.00 25.33  ? 1062 HOH L O   1 
HETATM 3397 O O   . HOH D 4 .   ? 20.900  36.480 90.966 1.00 41.77  ? 1063 HOH L O   1 
HETATM 3398 O O   . HOH D 4 .   ? 22.209  36.619 67.281 1.00 41.05  ? 1064 HOH L O   1 
HETATM 3399 O O   . HOH D 4 .   ? 9.668   69.753 55.931 1.00 50.22  ? 1065 HOH L O   1 
HETATM 3400 O O   . HOH D 4 .   ? 8.972   50.889 84.302 1.00 37.93  ? 1066 HOH L O   1 
HETATM 3401 O O   . HOH D 4 .   ? 35.337  18.470 78.330 1.00 36.75  ? 1067 HOH L O   1 
HETATM 3402 O O   . HOH D 4 .   ? 36.041  40.482 66.326 1.00 56.43  ? 1068 HOH L O   1 
HETATM 3403 O O   . HOH D 4 .   ? 23.665  28.050 84.403 1.00 40.81  ? 1069 HOH L O   1 
HETATM 3404 O O   . HOH D 4 .   ? 16.330  68.852 47.851 1.00 41.31  ? 1070 HOH L O   1 
HETATM 3405 O O   . HOH D 4 .   ? 41.225  36.516 73.383 1.00 44.04  ? 1071 HOH L O   1 
HETATM 3406 O O   . HOH D 4 .   ? 4.132   45.584 64.961 1.00 31.38  ? 1072 HOH L O   1 
HETATM 3407 O O   . HOH D 4 .   ? -1.203  68.060 64.565 1.00 36.40  ? 1073 HOH L O   1 
HETATM 3408 O O   . HOH D 4 .   ? -5.715  45.773 77.412 1.00 32.45  ? 1074 HOH L O   1 
HETATM 3409 O O   . HOH D 4 .   ? 26.753  24.605 83.870 1.00 43.85  ? 1075 HOH L O   1 
HETATM 3410 O O   . HOH D 4 .   ? 4.424   65.162 65.295 1.00 34.58  ? 1076 HOH L O   1 
HETATM 3411 O O   . HOH D 4 .   ? 1.780   49.889 85.191 1.00 42.15  ? 1077 HOH L O   1 
HETATM 3412 O O   . HOH D 4 .   ? 3.949   51.743 50.675 1.00 47.68  ? 1078 HOH L O   1 
HETATM 3413 O O   . HOH D 4 .   ? 33.758  34.448 88.453 1.00 29.04  ? 1079 HOH L O   1 
HETATM 3414 O O   . HOH D 4 .   ? 19.935  24.268 76.841 1.00 25.02  ? 1080 HOH L O   1 
HETATM 3415 O O   . HOH D 4 .   ? 0.683   63.922 72.661 1.00 54.04  ? 1081 HOH L O   1 
HETATM 3416 O O   . HOH D 4 .   ? 39.596  36.559 69.600 1.00 38.18  ? 1082 HOH L O   1 
HETATM 3417 O O   . HOH D 4 .   ? 3.428   43.186 74.012 1.00 30.66  ? 1083 HOH L O   1 
HETATM 3418 O O   . HOH D 4 .   ? 8.207   45.563 58.174 1.00 45.37  ? 1084 HOH L O   1 
HETATM 3419 O O   . HOH D 4 .   ? 11.641  52.864 56.912 1.00 45.86  ? 1085 HOH L O   1 
HETATM 3420 O O   . HOH D 4 .   ? 28.809  43.165 75.007 1.00 35.92  ? 1086 HOH L O   1 
HETATM 3421 O O   . HOH D 4 .   ? 17.080  40.423 77.445 1.00 28.73  ? 1087 HOH L O   1 
HETATM 3422 O O   . HOH D 4 .   ? 10.395  40.565 74.975 1.00 31.43  ? 1088 HOH L O   1 
HETATM 3423 O O   . HOH D 4 .   ? 23.015  40.468 72.922 1.00 40.08  ? 1089 HOH L O   1 
HETATM 3424 O O   . HOH D 4 .   ? -2.082  49.822 81.942 1.00 29.19  ? 1090 HOH L O   1 
HETATM 3425 O O   . HOH D 4 .   ? 14.921  45.366 61.373 1.00 34.60  ? 1091 HOH L O   1 
HETATM 3426 O O   . HOH D 4 .   ? 27.443  46.958 77.138 1.00 39.18  ? 1092 HOH L O   1 
HETATM 3427 O O   . HOH D 4 .   ? 19.829  33.418 64.052 1.00 47.20  ? 1093 HOH L O   1 
HETATM 3428 O O   . HOH D 4 .   ? 8.564   61.879 57.511 1.00 31.16  ? 1094 HOH L O   1 
HETATM 3429 O O   . HOH D 4 .   ? -1.106  67.995 53.051 1.00 48.51  ? 1095 HOH L O   1 
HETATM 3430 O O   . HOH D 4 .   ? 21.727  25.385 78.599 1.00 32.25  ? 1096 HOH L O   1 
HETATM 3431 O O   . HOH D 4 .   ? -4.520  47.221 83.351 1.00 48.49  ? 1097 HOH L O   1 
HETATM 3432 O O   . HOH D 4 .   ? 35.326  10.377 73.003 1.00 54.68  ? 1098 HOH L O   1 
HETATM 3433 O O   . HOH D 4 .   ? -6.153  55.100 72.458 1.00 43.39  ? 1099 HOH L O   1 
HETATM 3434 O O   . HOH D 4 .   ? 17.111  37.774 87.646 1.00 48.75  ? 1100 HOH L O   1 
HETATM 3435 O O   . HOH D 4 .   ? -11.470 59.265 55.809 1.00 53.76  ? 1101 HOH L O   1 
HETATM 3436 O O   . HOH D 4 .   ? 26.803  10.088 62.863 1.00 30.66  ? 1102 HOH L O   1 
HETATM 3437 O O   . HOH D 4 .   ? 33.238  13.514 56.390 1.00 43.57  ? 1103 HOH L O   1 
HETATM 3438 O O   . HOH D 4 .   ? 12.132  54.599 58.598 1.00 35.35  ? 1104 HOH L O   1 
HETATM 3439 O O   . HOH D 4 .   ? 18.561  61.686 75.663 1.00 39.50  ? 1105 HOH L O   1 
HETATM 3440 O O   . HOH D 4 .   ? 7.332   48.743 85.453 1.00 32.81  ? 1106 HOH L O   1 
HETATM 3441 O O   . HOH D 4 .   ? 17.247  34.805 68.780 1.00 34.10  ? 1107 HOH L O   1 
HETATM 3442 O O   . HOH D 4 .   ? -0.301  66.233 67.734 1.00 46.51  ? 1108 HOH L O   1 
HETATM 3443 O O   . HOH D 4 .   ? 34.722  42.258 61.880 1.00 39.98  ? 1109 HOH L O   1 
HETATM 3444 O O   . HOH D 4 .   ? 19.217  33.630 82.694 1.00 36.35  ? 1110 HOH L O   1 
HETATM 3445 O O   . HOH D 4 .   ? 9.935   71.721 49.046 1.00 44.23  ? 1111 HOH L O   1 
HETATM 3446 O O   . HOH D 4 .   ? 13.404  66.108 46.949 1.00 31.82  ? 1112 HOH L O   1 
HETATM 3447 O O   . HOH D 4 .   ? 4.831   57.677 47.925 1.00 47.43  ? 1113 HOH L O   1 
HETATM 3448 O O   . HOH D 4 .   ? 35.986  42.312 63.977 1.00 36.96  ? 1114 HOH L O   1 
HETATM 3449 O O   . HOH D 4 .   ? 16.366  36.635 76.050 1.00 32.90  ? 1115 HOH L O   1 
HETATM 3450 O O   . HOH D 4 .   ? 36.410  41.694 75.948 1.00 42.64  ? 1116 HOH L O   1 
HETATM 3451 O O   . HOH D 4 .   ? 41.570  37.370 80.381 1.00 44.05  ? 1117 HOH L O   1 
HETATM 3452 O O   . HOH D 4 .   ? 30.798  10.117 65.154 1.00 35.27  ? 1118 HOH L O   1 
HETATM 3453 O O   . HOH D 4 .   ? 9.633   39.736 79.916 1.00 48.02  ? 1119 HOH L O   1 
HETATM 3454 O O   . HOH D 4 .   ? 21.460  22.118 63.508 1.00 34.41  ? 1120 HOH L O   1 
HETATM 3455 O O   . HOH D 4 .   ? 23.846  50.676 81.458 1.00 36.70  ? 1121 HOH L O   1 
HETATM 3456 O O   . HOH D 4 .   ? 6.990   60.856 44.306 1.00 57.33  ? 1122 HOH L O   1 
HETATM 3457 O O   . HOH D 4 .   ? 1.466   48.039 61.414 1.00 50.58  ? 1123 HOH L O   1 
HETATM 3458 O O   . HOH D 4 .   ? 23.303  26.101 61.853 1.00 40.09  ? 1124 HOH L O   1 
HETATM 3459 O O   . HOH D 4 .   ? 11.401  67.734 46.541 1.00 35.66  ? 1125 HOH L O   1 
HETATM 3460 O O   . HOH D 4 .   ? 14.850  38.491 74.783 1.00 42.28  ? 1126 HOH L O   1 
HETATM 3461 O O   . HOH D 4 .   ? 6.568   50.197 88.096 1.00 37.29  ? 1127 HOH L O   1 
HETATM 3462 O O   . HOH D 4 .   ? 34.301  41.731 68.691 1.00 38.74  ? 1128 HOH L O   1 
HETATM 3463 O O   . HOH D 4 .   ? 18.457  41.126 87.510 1.00 49.94  ? 1129 HOH L O   1 
HETATM 3464 O O   . HOH D 4 .   ? 21.206  48.703 66.364 1.00 40.45  ? 1130 HOH L O   1 
HETATM 3465 O O   . HOH D 4 .   ? 38.211  36.796 72.926 1.00 40.24  ? 1131 HOH L O   1 
HETATM 3466 O O   . HOH D 4 .   ? 32.584  44.496 68.864 1.00 46.77  ? 1132 HOH L O   1 
HETATM 3467 O O   . HOH D 4 .   ? 3.771   71.123 52.458 1.00 45.80  ? 1133 HOH L O   1 
HETATM 3468 O O   . HOH D 4 .   ? 39.770  17.840 75.232 1.00 42.81  ? 1134 HOH L O   1 
HETATM 3469 O O   . HOH D 4 .   ? 43.086  33.701 71.347 1.00 51.29  ? 1135 HOH L O   1 
HETATM 3470 O O   . HOH E 4 .   ? 17.242  59.188 69.837 1.00 21.03  ? 216  HOH H O   1 
HETATM 3471 O O   . HOH E 4 .   ? 35.415  42.651 42.126 1.00 27.75  ? 217  HOH H O   1 
HETATM 3472 O O   . HOH E 4 .   ? 12.919  59.393 71.703 1.00 20.36  ? 218  HOH H O   1 
HETATM 3473 O O   . HOH E 4 .   ? 24.794  29.173 62.773 1.00 16.01  ? 219  HOH H O   1 
HETATM 3474 O O   . HOH E 4 .   ? 24.260  32.630 57.360 1.00 25.25  ? 220  HOH H O   1 
HETATM 3475 O O   . HOH E 4 .   ? 20.804  48.360 57.774 1.00 32.56  ? 221  HOH H O   1 
HETATM 3476 O O   . HOH E 4 .   ? 29.585  44.542 38.506 1.00 38.12  ? 222  HOH H O   1 
HETATM 3477 O O   . HOH E 4 .   ? 25.400  22.563 53.218 1.00 31.21  ? 223  HOH H O   1 
HETATM 3478 O O   . HOH E 4 .   ? 27.468  60.046 57.828 1.00 34.52  ? 224  HOH H O   1 
HETATM 3479 O O   . HOH E 4 .   ? 28.613  39.028 59.441 1.00 21.36  ? 225  HOH H O   1 
HETATM 3480 O O   . HOH E 4 .   ? 27.781  25.104 59.373 1.00 19.36  ? 226  HOH H O   1 
HETATM 3481 O O   . HOH E 4 .   ? 17.739  75.489 63.677 1.00 26.27  ? 227  HOH H O   1 
HETATM 3482 O O   . HOH E 4 .   ? 18.316  73.012 62.935 1.00 25.69  ? 228  HOH H O   1 
HETATM 3483 O O   . HOH E 4 .   ? 24.730  73.536 65.804 1.00 27.22  ? 229  HOH H O   1 
HETATM 3484 O O   . HOH E 4 .   ? 39.646  45.451 47.987 1.00 35.71  ? 230  HOH H O   1 
HETATM 3485 O O   . HOH E 4 .   ? 32.901  45.002 43.518 1.00 32.70  ? 231  HOH H O   1 
HETATM 3486 O O   . HOH E 4 .   ? 28.009  24.030 56.837 1.00 33.47  ? 232  HOH H O   1 
HETATM 3487 O O   . HOH E 4 .   ? 26.686  61.707 64.997 1.00 33.20  ? 233  HOH H O   1 
HETATM 3488 O O   . HOH E 4 .   ? 26.912  68.818 60.429 1.00 23.37  ? 234  HOH H O   1 
HETATM 3489 O O   . HOH E 4 .   ? 21.829  69.823 48.321 1.00 36.77  ? 235  HOH H O   1 
HETATM 3490 O O   . HOH E 4 .   ? 25.028  30.815 49.354 1.00 28.37  ? 236  HOH H O   1 
HETATM 3491 O O   . HOH E 4 .   ? 24.089  71.667 62.526 1.00 30.56  ? 237  HOH H O   1 
HETATM 3492 O O   . HOH E 4 .   ? 19.265  71.524 54.698 1.00 28.76  ? 238  HOH H O   1 
HETATM 3493 O O   . HOH E 4 .   ? 31.698  44.152 39.859 1.00 60.10  ? 239  HOH H O   1 
HETATM 3494 O O   . HOH E 4 .   ? 33.934  44.753 57.859 1.00 39.11  ? 240  HOH H O   1 
HETATM 3495 O O   . HOH E 4 .   ? 20.929  31.237 60.979 1.00 33.26  ? 241  HOH H O   1 
HETATM 3496 O O   . HOH E 4 .   ? 37.256  45.978 55.345 1.00 40.92  ? 242  HOH H O   1 
HETATM 3497 O O   . HOH E 4 .   ? 23.482  45.830 50.072 1.00 30.04  ? 243  HOH H O   1 
HETATM 3498 O O   . HOH E 4 .   ? 23.262  39.811 35.774 1.00 39.51  ? 244  HOH H O   1 
HETATM 3499 O O   . HOH E 4 .   ? 30.404  70.007 64.006 1.00 40.93  ? 245  HOH H O   1 
HETATM 3500 O O   . HOH E 4 .   ? 35.976  43.725 54.019 1.00 25.79  ? 246  HOH H O   1 
HETATM 3501 O O   . HOH E 4 .   ? 22.539  30.103 49.655 1.00 45.65  ? 247  HOH H O   1 
HETATM 3502 O O   . HOH E 4 .   ? 22.837  21.072 52.946 1.00 32.93  ? 248  HOH H O   1 
HETATM 3503 O O   . HOH E 4 .   ? 32.733  42.470 58.211 1.00 40.16  ? 249  HOH H O   1 
HETATM 3504 O O   . HOH E 4 .   ? 26.615  70.150 67.793 1.00 40.04  ? 250  HOH H O   1 
HETATM 3505 O O   . HOH E 4 .   ? 14.508  51.009 58.152 1.00 28.44  ? 251  HOH H O   1 
HETATM 3506 O O   . HOH E 4 .   ? 27.476  52.402 49.893 1.00 27.00  ? 252  HOH H O   1 
HETATM 3507 O O   . HOH E 4 .   ? 15.721  56.457 44.664 1.00 37.10  ? 253  HOH H O   1 
HETATM 3508 O O   . HOH E 4 .   ? 30.300  33.473 36.987 1.00 27.82  ? 254  HOH H O   1 
HETATM 3509 O O   . HOH E 4 .   ? 26.598  40.794 55.052 1.00 28.39  ? 255  HOH H O   1 
HETATM 3510 O O   . HOH E 4 .   ? 41.327  29.596 50.473 1.00 25.88  ? 256  HOH H O   1 
HETATM 3511 O O   . HOH E 4 .   ? 9.533   64.236 68.259 1.00 25.69  ? 257  HOH H O   1 
HETATM 3512 O O   . HOH E 4 .   ? 36.666  41.511 48.313 1.00 28.59  ? 258  HOH H O   1 
HETATM 3513 O O   . HOH E 4 .   ? 32.701  40.522 38.105 1.00 48.98  ? 259  HOH H O   1 
HETATM 3514 O O   . HOH E 4 .   ? 21.473  36.065 51.497 1.00 23.90  ? 260  HOH H O   1 
HETATM 3515 O O   . HOH E 4 .   ? 39.824  30.076 44.788 1.00 30.66  ? 261  HOH H O   1 
HETATM 3516 O O   . HOH E 4 .   ? 20.522  36.020 64.070 1.00 42.36  ? 262  HOH H O   1 
HETATM 3517 O O   . HOH E 4 .   ? 13.248  63.589 46.444 1.00 27.72  ? 263  HOH H O   1 
HETATM 3518 O O   . HOH E 4 .   ? 21.871  64.244 71.850 1.00 38.15  ? 264  HOH H O   1 
HETATM 3519 O O   . HOH E 4 .   ? 22.391  28.979 61.690 1.00 26.55  ? 265  HOH H O   1 
HETATM 3520 O O   . HOH E 4 .   ? 26.641  23.777 42.624 1.00 29.60  ? 266  HOH H O   1 
HETATM 3521 O O   . HOH E 4 .   ? 11.785  63.231 73.440 1.00 41.31  ? 267  HOH H O   1 
HETATM 3522 O O   . HOH E 4 .   ? 16.051  71.766 77.590 1.00 30.88  ? 268  HOH H O   1 
HETATM 3523 O O   . HOH E 4 .   ? 28.528  50.945 42.687 1.00 34.63  ? 269  HOH H O   1 
HETATM 3524 O O   . HOH E 4 .   ? 28.365  19.030 53.609 1.00 36.97  ? 270  HOH H O   1 
HETATM 3525 O O   . HOH E 4 .   ? 30.349  63.202 59.760 1.00 41.75  ? 271  HOH H O   1 
HETATM 3526 O O   . HOH E 4 .   ? 12.211  69.846 58.904 1.00 28.44  ? 272  HOH H O   1 
HETATM 3527 O O   . HOH E 4 .   ? 46.117  26.899 45.519 1.00 40.77  ? 273  HOH H O   1 
HETATM 3528 O O   . HOH E 4 .   ? 35.985  46.789 47.566 1.00 31.45  ? 274  HOH H O   1 
HETATM 3529 O O   . HOH E 4 .   ? 33.603  44.292 53.384 1.00 28.33  ? 275  HOH H O   1 
HETATM 3530 O O   . HOH E 4 .   ? 25.222  55.182 60.619 1.00 57.62  ? 276  HOH H O   1 
HETATM 3531 O O   . HOH E 4 .   ? 41.036  45.682 53.103 1.00 44.08  ? 277  HOH H O   1 
HETATM 3532 O O   . HOH E 4 .   ? 38.413  22.977 44.433 1.00 35.05  ? 278  HOH H O   1 
HETATM 3533 O O   . HOH E 4 .   ? 26.482  52.259 58.721 1.00 50.44  ? 279  HOH H O   1 
HETATM 3534 O O   . HOH E 4 .   ? 37.078  28.686 40.516 1.00 44.13  ? 280  HOH H O   1 
HETATM 3535 O O   . HOH E 4 .   ? 25.460  73.172 68.405 1.00 34.81  ? 281  HOH H O   1 
HETATM 3536 O O   . HOH E 4 .   ? 21.544  51.088 59.996 1.00 34.83  ? 282  HOH H O   1 
HETATM 3537 O O   . HOH E 4 .   ? 22.460  52.877 66.230 1.00 33.30  ? 283  HOH H O   1 
HETATM 3538 O O   . HOH E 4 .   ? 36.440  39.872 42.591 1.00 43.70  ? 284  HOH H O   1 
HETATM 3539 O O   . HOH E 4 .   ? 8.809   71.342 64.155 1.00 34.30  ? 285  HOH H O   1 
HETATM 3540 O O   . HOH E 4 .   ? 34.156  29.411 41.994 1.00 32.04  ? 286  HOH H O   1 
HETATM 3541 O O   . HOH E 4 .   ? 24.630  39.944 60.551 1.00 53.01  ? 287  HOH H O   1 
HETATM 3542 O O   . HOH E 4 .   ? 26.254  52.599 38.557 1.00 42.55  ? 288  HOH H O   1 
HETATM 3543 O O   . HOH E 4 .   ? 37.494  35.107 38.922 1.00 35.47  ? 289  HOH H O   1 
HETATM 3544 O O   . HOH E 4 .   ? 19.238  76.982 60.213 1.00 34.61  ? 290  HOH H O   1 
HETATM 3545 O O   . HOH E 4 .   ? 28.365  44.799 49.889 1.00 31.43  ? 291  HOH H O   1 
HETATM 3546 O O   . HOH E 4 .   ? 12.368  73.253 70.835 1.00 37.19  ? 292  HOH H O   1 
HETATM 3547 O O   . HOH E 4 .   ? 37.516  44.860 45.443 1.00 46.18  ? 293  HOH H O   1 
HETATM 3548 O O   . HOH E 4 .   ? 26.002  39.282 57.587 1.00 39.20  ? 294  HOH H O   1 
HETATM 3549 O O   . HOH E 4 .   ? 24.455  29.149 51.640 1.00 36.10  ? 295  HOH H O   1 
HETATM 3550 O O   . HOH E 4 .   ? 22.636  26.736 40.676 1.00 44.53  ? 296  HOH H O   1 
HETATM 3551 O O   . HOH E 4 .   ? 24.402  28.302 49.107 1.00 45.79  ? 297  HOH H O   1 
HETATM 3552 O O   . HOH E 4 .   ? 20.098  34.739 41.232 1.00 30.58  ? 298  HOH H O   1 
HETATM 3553 O O   . HOH E 4 .   ? 21.693  30.958 56.779 1.00 42.54  ? 299  HOH H O   1 
HETATM 3554 O O   . HOH E 4 .   ? 32.350  38.380 36.644 1.00 34.52  ? 300  HOH H O   1 
HETATM 3555 O O   . HOH E 4 .   ? 33.462  23.790 44.678 1.00 32.00  ? 301  HOH H O   1 
HETATM 3556 O O   . HOH E 4 .   ? 17.071  52.795 41.098 1.00 27.31  ? 302  HOH H O   1 
HETATM 3557 O O   . HOH E 4 .   ? 36.016  28.742 37.721 1.00 40.36  ? 303  HOH H O   1 
HETATM 3558 O O   . HOH E 4 .   ? 19.139  63.599 49.084 1.00 37.42  ? 304  HOH H O   1 
HETATM 3559 O O   . HOH E 4 .   ? 42.878  37.544 62.370 1.00 32.88  ? 305  HOH H O   1 
HETATM 3560 O O   . HOH E 4 .   ? 26.154  41.093 52.601 1.00 43.14  ? 306  HOH H O   1 
HETATM 3561 O O   . HOH E 4 .   ? 10.242  68.138 58.208 1.00 30.16  ? 307  HOH H O   1 
HETATM 3562 O O   . HOH E 4 .   ? 41.760  42.296 60.037 1.00 42.06  ? 308  HOH H O   1 
HETATM 3563 O O   . HOH E 4 .   ? 46.407  25.438 75.666 1.00 44.64  ? 309  HOH H O   1 
HETATM 3564 O O   . HOH E 4 .   ? 30.021  65.546 58.095 1.00 44.21  ? 310  HOH H O   1 
HETATM 3565 O O   . HOH E 4 .   ? 27.013  71.007 62.064 1.00 44.10  ? 311  HOH H O   1 
HETATM 3566 O O   . HOH E 4 .   ? 25.692  49.249 39.989 1.00 40.55  ? 312  HOH H O   1 
HETATM 3567 O O   . HOH E 4 .   ? 26.510  59.352 65.663 1.00 49.29  ? 313  HOH H O   1 
HETATM 3568 O O   . HOH E 4 .   ? 34.203  18.740 49.265 1.00 40.40  ? 314  HOH H O   1 
HETATM 3569 O O   . HOH E 4 .   ? 23.486  72.256 57.896 1.00 34.59  ? 315  HOH H O   1 
HETATM 3570 O O   . HOH E 4 .   ? 26.623  63.849 72.244 1.00 53.37  ? 316  HOH H O   1 
HETATM 3571 O O   . HOH E 4 .   ? 21.931  33.605 39.449 1.00 37.63  ? 317  HOH H O   1 
HETATM 3572 O O   . HOH E 4 .   ? 24.041  68.139 51.012 1.00 46.65  ? 318  HOH H O   1 
HETATM 3573 O O   . HOH E 4 .   ? 20.637  69.609 51.509 1.00 50.12  ? 319  HOH H O   1 
HETATM 3574 O O   . HOH E 4 .   ? 28.094  46.107 40.132 1.00 40.42  ? 320  HOH H O   1 
HETATM 3575 O O   . HOH E 4 .   ? 11.904  59.538 48.277 1.00 34.30  ? 321  HOH H O   1 
HETATM 3576 O O   . HOH E 4 .   ? 22.027  77.000 59.258 1.00 40.75  ? 322  HOH H O   1 
HETATM 3577 O O   . HOH E 4 .   ? 19.166  37.372 55.184 1.00 45.62  ? 323  HOH H O   1 
HETATM 3578 O O   . HOH E 4 .   ? 24.941  43.502 52.471 1.00 47.69  ? 324  HOH H O   1 
HETATM 3579 O O   . HOH E 4 .   ? 25.562  46.623 40.026 1.00 40.89  ? 325  HOH H O   1 
HETATM 3580 O O   . HOH E 4 .   ? 9.105   65.959 59.228 1.00 46.02  ? 326  HOH H O   1 
HETATM 3581 O O   . HOH E 4 .   ? 18.578  44.529 46.048 1.00 56.05  ? 327  HOH H O   1 
HETATM 3582 O O   . HOH E 4 .   ? 24.532  25.861 42.887 1.00 44.50  ? 328  HOH H O   1 
HETATM 3583 O O   . HOH E 4 .   ? 25.758  58.173 67.839 1.00 42.15  ? 329  HOH H O   1 
HETATM 3584 O O   . HOH E 4 .   ? 20.147  43.921 47.743 1.00 48.45  ? 330  HOH H O   1 
HETATM 3585 O O   . HOH E 4 .   ? 1.466   68.603 65.092 1.00 49.30  ? 331  HOH H O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   1   ASP ASP L . n 
A 1 2   ILE 2   2   2   ILE ILE L . n 
A 1 3   GLN 3   3   3   GLN GLN L . n 
A 1 4   MET 4   4   4   MET MET L . n 
A 1 5   THR 5   5   5   THR THR L . n 
A 1 6   GLN 6   6   6   GLN GLN L . n 
A 1 7   SER 7   7   7   SER SER L . n 
A 1 8   PRO 8   8   8   PRO PRO L . n 
A 1 9   ALA 9   9   9   ALA ALA L . n 
A 1 10  SER 10  10  10  SER SER L . n 
A 1 11  LEU 11  11  11  LEU LEU L . n 
A 1 12  SER 12  12  12  SER SER L . n 
A 1 13  ALA 13  13  13  ALA ALA L . n 
A 1 14  SER 14  14  14  SER SER L . n 
A 1 15  VAL 15  15  15  VAL VAL L . n 
A 1 16  GLY 16  16  16  GLY GLY L . n 
A 1 17  GLU 17  17  17  GLU GLU L . n 
A 1 18  THR 18  18  18  THR THR L . n 
A 1 19  VAL 19  19  19  VAL VAL L . n 
A 1 20  THR 20  20  20  THR THR L . n 
A 1 21  ILE 21  21  21  ILE ILE L . n 
A 1 22  THR 22  22  22  THR THR L . n 
A 1 23  CYS 23  23  23  CYS CYS L . n 
A 1 24  ARG 24  24  24  ARG ARG L . n 
A 1 25  ALA 25  25  25  ALA ALA L . n 
A 1 26  SER 26  26  26  SER SER L . n 
A 1 27  GLY 27  27  27  GLY GLY L . n 
A 1 28  ASN 28  28  28  ASN ASN L . n 
A 1 29  ILE 29  29  29  ILE ILE L . n 
A 1 30  HIS 30  30  30  HIS HIS L . n 
A 1 31  ASN 31  31  31  ASN ASN L . n 
A 1 32  TYR 32  32  32  TYR TYR L . n 
A 1 33  LEU 33  33  33  LEU LEU L . n 
A 1 34  ALA 34  34  34  ALA ALA L . n 
A 1 35  TRP 35  35  35  TRP TRP L . n 
A 1 36  TYR 36  36  36  TYR TYR L . n 
A 1 37  GLN 37  37  37  GLN GLN L . n 
A 1 38  GLN 38  38  38  GLN GLN L . n 
A 1 39  LYS 39  39  39  LYS LYS L . n 
A 1 40  GLN 40  40  40  GLN GLN L . n 
A 1 41  GLY 41  41  41  GLY GLY L . n 
A 1 42  LYS 42  42  42  LYS LYS L . n 
A 1 43  SER 43  43  43  SER SER L . n 
A 1 44  PRO 44  44  44  PRO PRO L . n 
A 1 45  GLN 45  45  45  GLN GLN L . n 
A 1 46  LEU 46  46  46  LEU LEU L . n 
A 1 47  LEU 47  47  47  LEU LEU L . n 
A 1 48  VAL 48  48  48  VAL VAL L . n 
A 1 49  TYR 49  49  49  TYR TYR L . n 
A 1 50  ASN 50  50  50  ASN ASN L . n 
A 1 51  ALA 51  51  51  ALA ALA L . n 
A 1 52  LYS 52  52  52  LYS LYS L . n 
A 1 53  THR 53  53  53  THR THR L . n 
A 1 54  LEU 54  54  54  LEU LEU L . n 
A 1 55  ALA 55  55  55  ALA ALA L . n 
A 1 56  ASP 56  56  56  ASP ASP L . n 
A 1 57  GLY 57  57  57  GLY GLY L . n 
A 1 58  VAL 58  58  58  VAL VAL L . n 
A 1 59  PRO 59  59  59  PRO PRO L . n 
A 1 60  SER 60  60  60  SER SER L . n 
A 1 61  ARG 61  61  61  ARG ARG L . n 
A 1 62  PHE 62  62  62  PHE PHE L . n 
A 1 63  SER 63  63  63  SER SER L . n 
A 1 64  GLY 64  64  64  GLY GLY L . n 
A 1 65  SER 65  65  65  SER SER L . n 
A 1 66  GLY 66  66  66  GLY GLY L . n 
A 1 67  SER 67  67  67  SER SER L . n 
A 1 68  GLY 68  68  68  GLY GLY L . n 
A 1 69  THR 69  69  69  THR THR L . n 
A 1 70  GLN 70  70  70  GLN GLN L . n 
A 1 71  TYR 71  71  71  TYR TYR L . n 
A 1 72  SER 72  72  72  SER SER L . n 
A 1 73  LEU 73  73  73  LEU LEU L . n 
A 1 74  LYS 74  74  74  LYS LYS L . n 
A 1 75  ILE 75  75  75  ILE ILE L . n 
A 1 76  ASN 76  76  76  ASN ASN L . n 
A 1 77  SER 77  77  77  SER SER L . n 
A 1 78  LEU 78  78  78  LEU LEU L . n 
A 1 79  GLN 79  79  79  GLN GLN L . n 
A 1 80  PRO 80  80  80  PRO PRO L . n 
A 1 81  GLU 81  81  81  GLU GLU L . n 
A 1 82  ASP 82  82  82  ASP ASP L . n 
A 1 83  PHE 83  83  83  PHE PHE L . n 
A 1 84  GLY 84  84  84  GLY GLY L . n 
A 1 85  THR 85  85  85  THR THR L . n 
A 1 86  TYR 86  86  86  TYR TYR L . n 
A 1 87  TYR 87  87  87  TYR TYR L . n 
A 1 88  CYS 88  88  88  CYS CYS L . n 
A 1 89  HIS 89  89  89  HIS HIS L . n 
A 1 90  HIS 90  90  90  HIS HIS L . n 
A 1 91  PHE 91  91  91  PHE PHE L . n 
A 1 92  TRP 92  92  92  TRP TRP L . n 
A 1 93  SER 93  93  93  SER SER L . n 
A 1 94  THR 94  94  94  THR THR L . n 
A 1 95  PRO 95  95  95  PRO PRO L . n 
A 1 96  TRP 96  96  96  TRP TRP L . n 
A 1 97  THR 97  97  97  THR THR L . n 
A 1 98  PHE 98  98  98  PHE PHE L . n 
A 1 99  GLY 99  99  99  GLY GLY L . n 
A 1 100 GLY 100 100 100 GLY GLY L . n 
A 1 101 GLY 101 101 101 GLY GLY L . n 
A 1 102 THR 102 102 102 THR THR L . n 
A 1 103 LYS 103 103 103 LYS LYS L . n 
A 1 104 LEU 104 104 104 LEU LEU L . n 
A 1 105 GLU 105 105 105 GLU GLU L . n 
A 1 106 VAL 106 106 106 VAL VAL L . n 
A 1 107 LYS 107 107 107 LYS LYS L . n 
A 1 108 ARG 108 108 108 ARG ARG L . n 
A 1 109 ALA 109 109 109 ALA ALA L . n 
A 1 110 ASP 110 110 110 ASP ASP L . n 
A 1 111 ALA 111 111 111 ALA ALA L . n 
A 1 112 ALA 112 112 112 ALA ALA L . n 
A 1 113 PRO 113 113 113 PRO PRO L . n 
A 1 114 THR 114 114 114 THR THR L . n 
A 1 115 VAL 115 115 115 VAL VAL L . n 
A 1 116 SER 116 116 116 SER SER L . n 
A 1 117 ILE 117 117 117 ILE ILE L . n 
A 1 118 PHE 118 118 118 PHE PHE L . n 
A 1 119 PRO 119 119 119 PRO PRO L . n 
A 1 120 PRO 120 120 120 PRO PRO L . n 
A 1 121 SER 121 121 121 SER SER L . n 
A 1 122 SER 122 122 122 SER SER L . n 
A 1 123 GLU 123 123 123 GLU GLU L . n 
A 1 124 GLN 124 124 124 GLN GLN L . n 
A 1 125 LEU 125 125 125 LEU LEU L . n 
A 1 126 THR 126 126 126 THR THR L . n 
A 1 127 SER 127 127 127 SER SER L . n 
A 1 128 GLY 128 128 128 GLY GLY L . n 
A 1 129 GLY 129 129 129 GLY GLY L . n 
A 1 130 ALA 130 130 130 ALA ALA L . n 
A 1 131 SER 131 131 131 SER SER L . n 
A 1 132 VAL 132 132 132 VAL VAL L . n 
A 1 133 VAL 133 133 133 VAL VAL L . n 
A 1 134 CYS 134 134 134 CYS CYS L . n 
A 1 135 PHE 135 135 135 PHE PHE L . n 
A 1 136 LEU 136 136 136 LEU LEU L . n 
A 1 137 ASN 137 137 137 ASN ASN L . n 
A 1 138 ASN 138 138 138 ASN ASN L . n 
A 1 139 PHE 139 139 139 PHE PHE L . n 
A 1 140 TYR 140 140 140 TYR TYR L . n 
A 1 141 PRO 141 141 141 PRO PRO L . n 
A 1 142 LYS 142 142 142 LYS LYS L . n 
A 1 143 ASP 143 143 143 ASP ASP L . n 
A 1 144 ILE 144 144 144 ILE ILE L . n 
A 1 145 ASN 145 145 145 ASN ASN L . n 
A 1 146 VAL 146 146 146 VAL VAL L . n 
A 1 147 LYS 147 147 147 LYS LYS L . n 
A 1 148 TRP 148 148 148 TRP TRP L . n 
A 1 149 LYS 149 149 149 LYS LYS L . n 
A 1 150 ILE 150 150 150 ILE ILE L . n 
A 1 151 ASP 151 151 151 ASP ASP L . n 
A 1 152 GLY 152 152 152 GLY GLY L . n 
A 1 153 SER 153 153 153 SER SER L . n 
A 1 154 GLU 154 154 154 GLU GLU L . n 
A 1 155 ARG 155 155 155 ARG ARG L . n 
A 1 156 GLN 156 156 156 GLN GLN L . n 
A 1 157 ASN 157 157 157 ASN ASN L . n 
A 1 158 GLY 158 158 158 GLY GLY L . n 
A 1 159 VAL 159 159 159 VAL VAL L . n 
A 1 160 LEU 160 160 160 LEU LEU L . n 
A 1 161 ASN 161 161 161 ASN ASN L . n 
A 1 162 SER 162 162 162 SER SER L . n 
A 1 163 TRP 163 163 163 TRP TRP L . n 
A 1 164 THR 164 164 164 THR THR L . n 
A 1 165 ASP 165 165 165 ASP ASP L . n 
A 1 166 GLN 166 166 166 GLN GLN L . n 
A 1 167 ASP 167 167 167 ASP ASP L . n 
A 1 168 SER 168 168 168 SER SER L . n 
A 1 169 LYS 169 169 169 LYS LYS L . n 
A 1 170 ASP 170 170 170 ASP ASP L . n 
A 1 171 SER 171 171 171 SER SER L . n 
A 1 172 THR 172 172 172 THR THR L . n 
A 1 173 TYR 173 173 173 TYR TYR L . n 
A 1 174 SER 174 174 174 SER SER L . n 
A 1 175 MET 175 175 175 MET MET L . n 
A 1 176 SER 176 176 176 SER SER L . n 
A 1 177 SER 177 177 177 SER SER L . n 
A 1 178 THR 178 178 178 THR THR L . n 
A 1 179 LEU 179 179 179 LEU LEU L . n 
A 1 180 THR 180 180 180 THR THR L . n 
A 1 181 LEU 181 181 181 LEU LEU L . n 
A 1 182 THR 182 182 182 THR THR L . n 
A 1 183 LYS 183 183 183 LYS LYS L . n 
A 1 184 ASP 184 184 184 ASP ASP L . n 
A 1 185 GLU 185 185 185 GLU GLU L . n 
A 1 186 TYR 186 186 186 TYR TYR L . n 
A 1 187 GLU 187 187 187 GLU GLU L . n 
A 1 188 ARG 188 188 188 ARG ARG L . n 
A 1 189 HIS 189 189 189 HIS HIS L . n 
A 1 190 ASN 190 190 190 ASN ASN L . n 
A 1 191 SER 191 191 191 SER SER L . n 
A 1 192 TYR 192 192 192 TYR TYR L . n 
A 1 193 THR 193 193 193 THR THR L . n 
A 1 194 CYS 194 194 194 CYS CYS L . n 
A 1 195 GLU 195 195 195 GLU GLU L . n 
A 1 196 ALA 196 196 196 ALA ALA L . n 
A 1 197 THR 197 197 197 THR THR L . n 
A 1 198 HIS 198 198 198 HIS HIS L . n 
A 1 199 LYS 199 199 199 LYS LYS L . n 
A 1 200 THR 200 200 200 THR THR L . n 
A 1 201 SER 201 201 201 SER SER L . n 
A 1 202 THR 202 202 202 THR THR L . n 
A 1 203 SER 203 203 203 SER SER L . n 
A 1 204 PRO 204 204 204 PRO PRO L . n 
A 1 205 ILE 205 205 205 ILE ILE L . n 
A 1 206 VAL 206 206 206 VAL VAL L . n 
A 1 207 LYS 207 207 207 LYS LYS L . n 
A 1 208 SER 208 208 208 SER SER L . n 
A 1 209 PHE 209 209 209 PHE PHE L . n 
A 1 210 ASN 210 210 210 ASN ASN L . n 
A 1 211 ARG 211 211 211 ARG ARG L . n 
A 1 212 ASN 212 212 212 ASN ASN L . n 
A 1 213 GLU 213 213 213 GLU GLU L . n 
A 1 214 CYS 214 214 ?   ?   ?   L . n 
B 2 1   GLN 1   1   1   GLN GLN H . n 
B 2 2   ILE 2   2   2   ILE ILE H . n 
B 2 3   GLN 3   3   3   GLN GLN H . n 
B 2 4   LEU 4   4   4   LEU LEU H . n 
B 2 5   VAL 5   5   5   VAL VAL H . n 
B 2 6   GLN 6   6   6   GLN GLN H . n 
B 2 7   SER 7   7   7   SER SER H . n 
B 2 8   GLY 8   8   8   GLY GLY H . n 
B 2 9   PRO 9   9   9   PRO PRO H . n 
B 2 10  GLU 10  10  10  GLU GLU H . n 
B 2 11  LEU 11  11  11  LEU LEU H . n 
B 2 12  LYS 12  12  12  LYS LYS H . n 
B 2 13  LYS 13  13  13  LYS LYS H . n 
B 2 14  PRO 14  14  14  PRO PRO H . n 
B 2 15  GLY 15  15  15  GLY GLY H . n 
B 2 16  GLU 16  16  16  GLU GLU H . n 
B 2 17  THR 17  17  17  THR THR H . n 
B 2 18  VAL 18  18  18  VAL VAL H . n 
B 2 19  ARG 19  19  19  ARG ARG H . n 
B 2 20  ILE 20  20  20  ILE ILE H . n 
B 2 21  SER 21  21  21  SER SER H . n 
B 2 22  CYS 22  22  22  CYS CYS H . n 
B 2 23  LYS 23  23  23  LYS LYS H . n 
B 2 24  ALA 24  24  24  ALA ALA H . n 
B 2 25  SER 25  25  25  SER SER H . n 
B 2 26  ASP 26  26  26  ASP ASP H . n 
B 2 27  TYR 27  27  27  TYR TYR H . n 
B 2 28  SER 28  28  ?   ?   ?   H . n 
B 2 29  PHE 29  29  ?   ?   ?   H . n 
B 2 30  MET 30  30  30  MET MET H . n 
B 2 31  THR 31  31  31  THR THR H . n 
B 2 32  SER 32  32  32  SER SER H . n 
B 2 33  GLY 33  33  33  GLY GLY H . n 
B 2 34  MET 34  34  34  MET MET H . n 
B 2 35  GLN 35  35  35  GLN GLN H . n 
B 2 36  TRP 36  36  36  TRP TRP H . n 
B 2 37  VAL 37  37  37  VAL VAL H . n 
B 2 38  GLN 38  38  38  GLN GLN H . n 
B 2 39  GLN 39  39  39  GLN GLN H . n 
B 2 40  MET 40  40  40  MET MET H . n 
B 2 41  PRO 41  41  41  PRO PRO H . n 
B 2 42  GLY 42  42  42  GLY GLY H . n 
B 2 43  LYS 43  43  43  LYS LYS H . n 
B 2 44  GLY 44  44  44  GLY GLY H . n 
B 2 45  LEU 45  45  45  LEU LEU H . n 
B 2 46  LYS 46  46  46  LYS LYS H . n 
B 2 47  TRP 47  47  47  TRP TRP H . n 
B 2 48  ILE 48  48  48  ILE ILE H . n 
B 2 49  GLY 49  49  49  GLY GLY H . n 
B 2 50  TRP 50  50  50  TRP TRP H . n 
B 2 51  LEU 51  51  51  LEU LEU H . n 
B 2 52  ASN 52  52  52  ASN ASN H . n 
B 2 53  THR 53  52  52  THR THR H A n 
B 2 54  GLN 54  53  53  GLN GLN H . n 
B 2 55  SER 55  54  54  SER SER H . n 
B 2 56  GLY 56  55  55  GLY GLY H . n 
B 2 57  VAL 57  56  56  VAL VAL H . n 
B 2 58  PRO 58  57  57  PRO PRO H . n 
B 2 59  GLU 59  58  58  GLU GLU H . n 
B 2 60  TYR 60  59  59  TYR TYR H . n 
B 2 61  ALA 61  60  60  ALA ALA H . n 
B 2 62  GLU 62  61  61  GLU GLU H . n 
B 2 63  ASP 63  62  62  ASP ASP H . n 
B 2 64  PHE 64  63  63  PHE PHE H . n 
B 2 65  LYS 65  64  64  LYS LYS H . n 
B 2 66  GLY 66  65  65  GLY GLY H . n 
B 2 67  ARG 67  66  66  ARG ARG H . n 
B 2 68  PHE 68  67  67  PHE PHE H . n 
B 2 69  ALA 69  68  68  ALA ALA H . n 
B 2 70  PHE 70  69  69  PHE PHE H . n 
B 2 71  SER 71  70  70  SER SER H . n 
B 2 72  LEU 72  71  71  LEU LEU H . n 
B 2 73  GLU 73  72  72  GLU GLU H . n 
B 2 74  THR 74  73  ?   ?   ?   H . n 
B 2 75  SER 75  74  ?   ?   ?   H . n 
B 2 76  ALA 76  75  ?   ?   ?   H . n 
B 2 77  THR 77  76  76  THR THR H . n 
B 2 78  THR 78  77  77  THR THR H . n 
B 2 79  ALA 79  78  78  ALA ALA H . n 
B 2 80  TYR 80  79  79  TYR TYR H . n 
B 2 81  LEU 81  80  80  LEU LEU H . n 
B 2 82  GLN 82  81  81  GLN GLN H . n 
B 2 83  ILE 83  82  82  ILE ILE H . n 
B 2 84  ASN 84  82  82  ASN ASN H A n 
B 2 85  ASN 85  82  82  ASN ASN H B n 
B 2 86  LEU 86  82  82  LEU LEU H C n 
B 2 87  LYS 87  83  83  LYS LYS H . n 
B 2 88  ASN 88  84  84  ASN ASN H . n 
B 2 89  GLU 89  85  85  GLU GLU H . n 
B 2 90  ASP 90  86  86  ASP ASP H . n 
B 2 91  THR 91  87  87  THR THR H . n 
B 2 92  ALA 92  88  88  ALA ALA H . n 
B 2 93  THR 93  89  89  THR THR H . n 
B 2 94  TYR 94  90  90  TYR TYR H . n 
B 2 95  PHE 95  91  91  PHE PHE H . n 
B 2 96  CYS 96  92  92  CYS CYS H . n 
B 2 97  ALA 97  93  93  ALA ALA H . n 
B 2 98  THR 98  94  94  THR THR H . n 
B 2 99  TRP 99  95  95  TRP TRP H . n 
B 2 100 GLY 100 96  96  GLY GLY H . n 
B 2 101 GLY 101 97  97  GLY GLY H . n 
B 2 102 ASN 102 98  98  ASN ASN H . n 
B 2 103 SER 103 99  99  SER SER H . n 
B 2 104 ALA 104 101 101 ALA ALA H . n 
B 2 105 TYR 105 102 102 TYR TYR H . n 
B 2 106 TRP 106 103 103 TRP TRP H . n 
B 2 107 GLY 107 104 104 GLY GLY H . n 
B 2 108 GLN 108 105 105 GLN GLN H . n 
B 2 109 GLY 109 106 106 GLY GLY H . n 
B 2 110 THR 110 107 107 THR THR H . n 
B 2 111 THR 111 108 108 THR THR H . n 
B 2 112 LEU 112 109 109 LEU LEU H . n 
B 2 113 THR 113 110 110 THR THR H . n 
B 2 114 VAL 114 111 111 VAL VAL H . n 
B 2 115 SER 115 112 112 SER SER H . n 
B 2 116 SER 116 113 113 SER SER H . n 
B 2 117 ALA 117 114 114 ALA ALA H . n 
B 2 118 LYS 118 115 115 LYS LYS H . n 
B 2 119 THR 119 116 116 THR THR H . n 
B 2 120 THR 120 117 117 THR THR H . n 
B 2 121 PRO 121 118 118 PRO PRO H . n 
B 2 122 PRO 122 119 119 PRO PRO H . n 
B 2 123 SER 123 120 120 SER SER H . n 
B 2 124 VAL 124 121 121 VAL VAL H . n 
B 2 125 TYR 125 122 122 TYR TYR H . n 
B 2 126 PRO 126 123 123 PRO PRO H . n 
B 2 127 LEU 127 124 124 LEU LEU H . n 
B 2 128 ALA 128 125 125 ALA ALA H . n 
B 2 129 PRO 129 126 126 PRO PRO H . n 
B 2 130 GLY 130 127 127 GLY GLY H . n 
B 2 131 SER 131 128 ?   ?   ?   H . n 
B 2 132 ALA 132 129 ?   ?   ?   H . n 
B 2 133 ALA 133 130 ?   ?   ?   H . n 
B 2 134 GLN 134 131 ?   ?   ?   H . n 
B 2 135 THR 135 132 ?   ?   ?   H . n 
B 2 136 ASN 136 133 133 ASN ASN H . n 
B 2 137 SER 137 134 134 SER SER H . n 
B 2 138 MET 138 135 135 MET MET H . n 
B 2 139 VAL 139 136 136 VAL VAL H . n 
B 2 140 THR 140 137 137 THR THR H . n 
B 2 141 LEU 141 138 138 LEU LEU H . n 
B 2 142 GLY 142 139 139 GLY GLY H . n 
B 2 143 CYS 143 140 140 CYS CYS H . n 
B 2 144 LEU 144 141 141 LEU LEU H . n 
B 2 145 VAL 145 142 142 VAL VAL H . n 
B 2 146 LYS 146 143 143 LYS LYS H . n 
B 2 147 GLY 147 144 144 GLY GLY H . n 
B 2 148 TYR 148 145 145 TYR TYR H . n 
B 2 149 PHE 149 146 146 PHE PHE H . n 
B 2 150 PRO 150 147 147 PRO PRO H . n 
B 2 151 GLU 151 148 148 GLU GLU H . n 
B 2 152 PRO 152 149 149 PRO PRO H . n 
B 2 153 VAL 153 150 150 VAL VAL H . n 
B 2 154 THR 154 151 151 THR THR H . n 
B 2 155 VAL 155 152 152 VAL VAL H . n 
B 2 156 THR 156 153 153 THR THR H . n 
B 2 157 TRP 157 154 154 TRP TRP H . n 
B 2 158 ASN 158 155 155 ASN ASN H . n 
B 2 159 SER 159 156 156 SER SER H . n 
B 2 160 GLY 160 157 157 GLY GLY H . n 
B 2 161 SER 161 158 158 SER SER H . n 
B 2 162 LEU 162 159 159 LEU LEU H . n 
B 2 163 SER 163 160 160 SER SER H . n 
B 2 164 SER 164 161 161 SER SER H . n 
B 2 165 GLY 165 162 162 GLY GLY H . n 
B 2 166 VAL 166 163 163 VAL VAL H . n 
B 2 167 HIS 167 164 164 HIS HIS H . n 
B 2 168 THR 168 165 165 THR THR H . n 
B 2 169 PHE 169 166 166 PHE PHE H . n 
B 2 170 PRO 170 167 167 PRO PRO H . n 
B 2 171 ALA 171 168 168 ALA ALA H . n 
B 2 172 VAL 172 169 169 VAL VAL H . n 
B 2 173 LEU 173 170 170 LEU LEU H . n 
B 2 174 GLN 174 171 171 GLN GLN H . n 
B 2 175 SER 175 172 172 SER SER H . n 
B 2 176 ASP 176 173 173 ASP ASP H . n 
B 2 177 LEU 177 174 174 LEU LEU H . n 
B 2 178 TYR 178 175 175 TYR TYR H . n 
B 2 179 THR 179 176 176 THR THR H . n 
B 2 180 LEU 180 177 177 LEU LEU H . n 
B 2 181 SER 181 178 178 SER SER H . n 
B 2 182 SER 182 179 179 SER SER H . n 
B 2 183 SER 183 180 180 SER SER H . n 
B 2 184 VAL 184 181 181 VAL VAL H . n 
B 2 185 THR 185 182 182 THR THR H . n 
B 2 186 VAL 186 183 183 VAL VAL H . n 
B 2 187 PRO 187 184 184 PRO PRO H . n 
B 2 188 SER 188 185 185 SER SER H . n 
B 2 189 SER 189 186 186 SER SER H . n 
B 2 190 THR 190 187 187 THR THR H . n 
B 2 191 TRP 191 188 188 TRP TRP H . n 
B 2 192 PRO 192 189 189 PRO PRO H . n 
B 2 193 SER 193 190 190 SER SER H . n 
B 2 194 GLU 194 191 191 GLU GLU H . n 
B 2 195 THR 195 192 192 THR THR H . n 
B 2 196 VAL 196 193 193 VAL VAL H . n 
B 2 197 THR 197 194 194 THR THR H . n 
B 2 198 CYS 198 195 195 CYS CYS H . n 
B 2 199 ASN 199 196 196 ASN ASN H . n 
B 2 200 VAL 200 197 197 VAL VAL H . n 
B 2 201 ALA 201 198 198 ALA ALA H . n 
B 2 202 HIS 202 199 199 HIS HIS H . n 
B 2 203 PRO 203 200 200 PRO PRO H . n 
B 2 204 ALA 204 201 201 ALA ALA H . n 
B 2 205 SER 205 202 202 SER SER H . n 
B 2 206 SER 206 203 203 SER SER H . n 
B 2 207 THR 207 204 204 THR THR H . n 
B 2 208 LYS 208 205 205 LYS LYS H . n 
B 2 209 VAL 209 206 206 VAL VAL H . n 
B 2 210 ASP 210 207 207 ASP ASP H . n 
B 2 211 LYS 211 208 208 LYS LYS H . n 
B 2 212 LYS 212 209 209 LYS LYS H . n 
B 2 213 ILE 213 210 210 ILE ILE H . n 
B 2 214 VAL 214 211 211 VAL VAL H . n 
B 2 215 PRO 215 212 212 PRO PRO H . n 
B 2 216 ARG 216 213 213 ARG ARG H . n 
B 2 217 ASP 217 214 ?   ?   ?   H . n 
B 2 218 CYS 218 215 ?   ?   ?   H . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4100  ? 
1 MORE         -22   ? 
1 'SSA (A^2)'  19460 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-10-10 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN L 40  ? ? 8.06    72.56   
2  1 LYS L 42  ? ? -58.72  173.23  
3  1 ALA L 51  ? ? 68.43   -37.20  
4  1 PHE L 91  ? ? -142.43 39.59   
5  1 ASN L 190 ? ? -104.35 -60.14  
6  1 ASP H 26  ? ? -113.72 -146.36 
7  1 SER H 32  ? ? -160.87 -2.57   
8  1 THR H 52  A ? -49.62  -19.67  
9  1 ALA H 88  ? ? -177.45 -175.77 
10 1 SER H 99  ? ? -174.44 -176.33 
11 1 PRO H 149 ? ? -118.94 -169.14 
12 1 SER H 172 ? ? 62.00   64.88   
13 1 ASP H 173 ? ? 66.78   -7.03   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 L CYS 214 ? A CYS 214 
2  1 Y 1 H SER 28  ? B SER 28  
3  1 Y 1 H PHE 29  ? B PHE 29  
4  1 Y 1 H THR 73  ? B THR 74  
5  1 Y 1 H SER 74  ? B SER 75  
6  1 Y 1 H ALA 75  ? B ALA 76  
7  1 Y 1 H SER 128 ? B SER 131 
8  1 Y 1 H ALA 129 ? B ALA 132 
9  1 Y 1 H ALA 130 ? B ALA 133 
10 1 Y 1 H GLN 131 ? B GLN 134 
11 1 Y 1 H THR 132 ? B THR 135 
12 1 Y 1 H ASP 214 ? B ASP 217 
13 1 Y 1 H CYS 215 ? B CYS 218 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 ESTRADIOL EST 
4 water     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 EST 1   911  911 EST EST L . 
D 4 HOH 1   912  1   HOH TIP L . 
D 4 HOH 2   913  2   HOH TIP L . 
D 4 HOH 3   914  3   HOH TIP L . 
D 4 HOH 4   915  5   HOH TIP L . 
D 4 HOH 5   916  6   HOH TIP L . 
D 4 HOH 6   917  7   HOH TIP L . 
D 4 HOH 7   918  9   HOH TIP L . 
D 4 HOH 8   919  10  HOH TIP L . 
D 4 HOH 9   920  12  HOH TIP L . 
D 4 HOH 10  921  13  HOH TIP L . 
D 4 HOH 11  922  15  HOH TIP L . 
D 4 HOH 12  923  16  HOH TIP L . 
D 4 HOH 13  924  17  HOH TIP L . 
D 4 HOH 14  925  18  HOH TIP L . 
D 4 HOH 15  926  19  HOH TIP L . 
D 4 HOH 16  927  20  HOH TIP L . 
D 4 HOH 17  928  21  HOH TIP L . 
D 4 HOH 18  929  22  HOH TIP L . 
D 4 HOH 19  930  23  HOH TIP L . 
D 4 HOH 20  931  24  HOH TIP L . 
D 4 HOH 21  932  25  HOH TIP L . 
D 4 HOH 22  933  26  HOH TIP L . 
D 4 HOH 23  934  29  HOH TIP L . 
D 4 HOH 24  935  30  HOH TIP L . 
D 4 HOH 25  936  31  HOH TIP L . 
D 4 HOH 26  937  33  HOH TIP L . 
D 4 HOH 27  938  34  HOH TIP L . 
D 4 HOH 28  939  35  HOH TIP L . 
D 4 HOH 29  940  36  HOH TIP L . 
D 4 HOH 30  941  37  HOH TIP L . 
D 4 HOH 31  942  40  HOH TIP L . 
D 4 HOH 32  943  41  HOH TIP L . 
D 4 HOH 33  944  42  HOH TIP L . 
D 4 HOH 34  945  45  HOH TIP L . 
D 4 HOH 35  946  48  HOH TIP L . 
D 4 HOH 36  947  50  HOH TIP L . 
D 4 HOH 37  948  51  HOH TIP L . 
D 4 HOH 38  949  52  HOH TIP L . 
D 4 HOH 39  950  53  HOH TIP L . 
D 4 HOH 40  951  55  HOH TIP L . 
D 4 HOH 41  952  56  HOH TIP L . 
D 4 HOH 42  953  58  HOH TIP L . 
D 4 HOH 43  954  59  HOH TIP L . 
D 4 HOH 44  955  61  HOH TIP L . 
D 4 HOH 45  956  62  HOH TIP L . 
D 4 HOH 46  957  63  HOH TIP L . 
D 4 HOH 47  958  65  HOH TIP L . 
D 4 HOH 48  959  66  HOH TIP L . 
D 4 HOH 49  960  68  HOH TIP L . 
D 4 HOH 50  961  71  HOH TIP L . 
D 4 HOH 51  962  72  HOH TIP L . 
D 4 HOH 52  963  73  HOH TIP L . 
D 4 HOH 53  964  74  HOH TIP L . 
D 4 HOH 54  965  75  HOH TIP L . 
D 4 HOH 55  966  76  HOH TIP L . 
D 4 HOH 56  967  77  HOH TIP L . 
D 4 HOH 57  968  78  HOH TIP L . 
D 4 HOH 58  969  80  HOH TIP L . 
D 4 HOH 59  970  81  HOH TIP L . 
D 4 HOH 60  971  82  HOH TIP L . 
D 4 HOH 61  972  83  HOH TIP L . 
D 4 HOH 62  973  84  HOH TIP L . 
D 4 HOH 63  974  85  HOH TIP L . 
D 4 HOH 64  975  86  HOH TIP L . 
D 4 HOH 65  976  88  HOH TIP L . 
D 4 HOH 66  977  90  HOH TIP L . 
D 4 HOH 67  978  91  HOH TIP L . 
D 4 HOH 68  979  92  HOH TIP L . 
D 4 HOH 69  980  95  HOH TIP L . 
D 4 HOH 70  981  98  HOH TIP L . 
D 4 HOH 71  982  102 HOH TIP L . 
D 4 HOH 72  983  103 HOH TIP L . 
D 4 HOH 73  984  104 HOH TIP L . 
D 4 HOH 74  985  106 HOH TIP L . 
D 4 HOH 75  986  107 HOH TIP L . 
D 4 HOH 76  987  108 HOH TIP L . 
D 4 HOH 77  988  109 HOH TIP L . 
D 4 HOH 78  989  110 HOH TIP L . 
D 4 HOH 79  990  111 HOH TIP L . 
D 4 HOH 80  991  112 HOH TIP L . 
D 4 HOH 81  992  114 HOH TIP L . 
D 4 HOH 82  993  115 HOH TIP L . 
D 4 HOH 83  994  116 HOH TIP L . 
D 4 HOH 84  995  117 HOH TIP L . 
D 4 HOH 85  996  119 HOH TIP L . 
D 4 HOH 86  997  121 HOH TIP L . 
D 4 HOH 87  998  122 HOH TIP L . 
D 4 HOH 88  999  123 HOH TIP L . 
D 4 HOH 89  1000 124 HOH TIP L . 
D 4 HOH 90  1001 127 HOH TIP L . 
D 4 HOH 91  1002 130 HOH TIP L . 
D 4 HOH 92  1003 131 HOH TIP L . 
D 4 HOH 93  1004 132 HOH TIP L . 
D 4 HOH 94  1005 133 HOH TIP L . 
D 4 HOH 95  1006 134 HOH TIP L . 
D 4 HOH 96  1007 136 HOH TIP L . 
D 4 HOH 97  1008 137 HOH TIP L . 
D 4 HOH 98  1009 138 HOH TIP L . 
D 4 HOH 99  1010 140 HOH TIP L . 
D 4 HOH 100 1011 141 HOH TIP L . 
D 4 HOH 101 1012 142 HOH TIP L . 
D 4 HOH 102 1013 144 HOH TIP L . 
D 4 HOH 103 1014 147 HOH TIP L . 
D 4 HOH 104 1015 148 HOH TIP L . 
D 4 HOH 105 1016 149 HOH TIP L . 
D 4 HOH 106 1017 150 HOH TIP L . 
D 4 HOH 107 1018 151 HOH TIP L . 
D 4 HOH 108 1019 154 HOH TIP L . 
D 4 HOH 109 1020 155 HOH TIP L . 
D 4 HOH 110 1021 156 HOH TIP L . 
D 4 HOH 111 1022 157 HOH TIP L . 
D 4 HOH 112 1023 161 HOH TIP L . 
D 4 HOH 113 1024 162 HOH TIP L . 
D 4 HOH 114 1025 165 HOH TIP L . 
D 4 HOH 115 1026 166 HOH TIP L . 
D 4 HOH 116 1027 168 HOH TIP L . 
D 4 HOH 117 1028 175 HOH TIP L . 
D 4 HOH 118 1029 176 HOH TIP L . 
D 4 HOH 119 1030 179 HOH TIP L . 
D 4 HOH 120 1031 181 HOH TIP L . 
D 4 HOH 121 1032 182 HOH TIP L . 
D 4 HOH 122 1033 183 HOH TIP L . 
D 4 HOH 123 1034 184 HOH TIP L . 
D 4 HOH 124 1035 185 HOH TIP L . 
D 4 HOH 125 1036 186 HOH TIP L . 
D 4 HOH 126 1037 191 HOH TIP L . 
D 4 HOH 127 1038 192 HOH TIP L . 
D 4 HOH 128 1039 193 HOH TIP L . 
D 4 HOH 129 1040 194 HOH TIP L . 
D 4 HOH 130 1041 195 HOH TIP L . 
D 4 HOH 131 1042 196 HOH TIP L . 
D 4 HOH 132 1043 197 HOH TIP L . 
D 4 HOH 133 1044 201 HOH TIP L . 
D 4 HOH 134 1045 202 HOH TIP L . 
D 4 HOH 135 1046 203 HOH TIP L . 
D 4 HOH 136 1047 204 HOH TIP L . 
D 4 HOH 137 1048 207 HOH TIP L . 
D 4 HOH 138 1049 210 HOH TIP L . 
D 4 HOH 139 1050 211 HOH TIP L . 
D 4 HOH 140 1051 212 HOH TIP L . 
D 4 HOH 141 1052 214 HOH TIP L . 
D 4 HOH 142 1053 215 HOH TIP L . 
D 4 HOH 143 1054 217 HOH TIP L . 
D 4 HOH 144 1055 219 HOH TIP L . 
D 4 HOH 145 1056 220 HOH TIP L . 
D 4 HOH 146 1057 222 HOH TIP L . 
D 4 HOH 147 1058 225 HOH TIP L . 
D 4 HOH 148 1059 226 HOH TIP L . 
D 4 HOH 149 1060 228 HOH TIP L . 
D 4 HOH 150 1061 229 HOH TIP L . 
D 4 HOH 151 1062 233 HOH TIP L . 
D 4 HOH 152 1063 234 HOH TIP L . 
D 4 HOH 153 1064 235 HOH TIP L . 
D 4 HOH 154 1065 236 HOH TIP L . 
D 4 HOH 155 1066 237 HOH TIP L . 
D 4 HOH 156 1067 238 HOH TIP L . 
D 4 HOH 157 1068 239 HOH TIP L . 
D 4 HOH 158 1069 240 HOH TIP L . 
D 4 HOH 159 1070 241 HOH TIP L . 
D 4 HOH 160 1071 243 HOH TIP L . 
D 4 HOH 161 1072 244 HOH TIP L . 
D 4 HOH 162 1073 245 HOH TIP L . 
D 4 HOH 163 1074 246 HOH TIP L . 
D 4 HOH 164 1075 247 HOH TIP L . 
D 4 HOH 165 1076 248 HOH TIP L . 
D 4 HOH 166 1077 249 HOH TIP L . 
D 4 HOH 167 1078 252 HOH TIP L . 
D 4 HOH 168 1079 253 HOH TIP L . 
D 4 HOH 169 1080 256 HOH TIP L . 
D 4 HOH 170 1081 257 HOH TIP L . 
D 4 HOH 171 1082 258 HOH TIP L . 
D 4 HOH 172 1083 260 HOH TIP L . 
D 4 HOH 173 1084 262 HOH TIP L . 
D 4 HOH 174 1085 263 HOH TIP L . 
D 4 HOH 175 1086 264 HOH TIP L . 
D 4 HOH 176 1087 265 HOH TIP L . 
D 4 HOH 177 1088 266 HOH TIP L . 
D 4 HOH 178 1089 267 HOH TIP L . 
D 4 HOH 179 1090 268 HOH TIP L . 
D 4 HOH 180 1091 270 HOH TIP L . 
D 4 HOH 181 1092 273 HOH TIP L . 
D 4 HOH 182 1093 275 HOH TIP L . 
D 4 HOH 183 1094 276 HOH TIP L . 
D 4 HOH 184 1095 278 HOH TIP L . 
D 4 HOH 185 1096 279 HOH TIP L . 
D 4 HOH 186 1097 282 HOH TIP L . 
D 4 HOH 187 1098 284 HOH TIP L . 
D 4 HOH 188 1099 285 HOH TIP L . 
D 4 HOH 189 1100 287 HOH TIP L . 
D 4 HOH 190 1101 289 HOH TIP L . 
D 4 HOH 191 1102 290 HOH TIP L . 
D 4 HOH 192 1103 291 HOH TIP L . 
D 4 HOH 193 1104 292 HOH TIP L . 
D 4 HOH 194 1105 293 HOH TIP L . 
D 4 HOH 195 1106 294 HOH TIP L . 
D 4 HOH 196 1107 297 HOH TIP L . 
D 4 HOH 197 1108 298 HOH TIP L . 
D 4 HOH 198 1109 299 HOH TIP L . 
D 4 HOH 199 1110 300 HOH TIP L . 
D 4 HOH 200 1111 301 HOH TIP L . 
D 4 HOH 201 1112 302 HOH TIP L . 
D 4 HOH 202 1113 303 HOH TIP L . 
D 4 HOH 203 1114 304 HOH TIP L . 
D 4 HOH 204 1115 305 HOH TIP L . 
D 4 HOH 205 1116 307 HOH TIP L . 
D 4 HOH 206 1117 312 HOH TIP L . 
D 4 HOH 207 1118 315 HOH TIP L . 
D 4 HOH 208 1119 316 HOH TIP L . 
D 4 HOH 209 1120 319 HOH TIP L . 
D 4 HOH 210 1121 320 HOH TIP L . 
D 4 HOH 211 1122 322 HOH TIP L . 
D 4 HOH 212 1123 323 HOH TIP L . 
D 4 HOH 213 1124 324 HOH TIP L . 
D 4 HOH 214 1125 325 HOH TIP L . 
D 4 HOH 215 1126 326 HOH TIP L . 
D 4 HOH 216 1127 327 HOH TIP L . 
D 4 HOH 217 1128 331 HOH TIP L . 
D 4 HOH 218 1129 334 HOH TIP L . 
D 4 HOH 219 1130 339 HOH TIP L . 
D 4 HOH 220 1131 341 HOH TIP L . 
D 4 HOH 221 1132 346 HOH TIP L . 
D 4 HOH 222 1133 350 HOH TIP L . 
D 4 HOH 223 1134 352 HOH TIP L . 
D 4 HOH 224 1135 354 HOH TIP L . 
E 4 HOH 1   216  4   HOH TIP H . 
E 4 HOH 2   217  8   HOH TIP H . 
E 4 HOH 3   218  11  HOH TIP H . 
E 4 HOH 4   219  14  HOH TIP H . 
E 4 HOH 5   220  27  HOH TIP H . 
E 4 HOH 6   221  28  HOH TIP H . 
E 4 HOH 7   222  32  HOH TIP H . 
E 4 HOH 8   223  38  HOH TIP H . 
E 4 HOH 9   224  39  HOH TIP H . 
E 4 HOH 10  225  43  HOH TIP H . 
E 4 HOH 11  226  44  HOH TIP H . 
E 4 HOH 12  227  46  HOH TIP H . 
E 4 HOH 13  228  47  HOH TIP H . 
E 4 HOH 14  229  49  HOH TIP H . 
E 4 HOH 15  230  54  HOH TIP H . 
E 4 HOH 16  231  57  HOH TIP H . 
E 4 HOH 17  232  60  HOH TIP H . 
E 4 HOH 18  233  64  HOH TIP H . 
E 4 HOH 19  234  67  HOH TIP H . 
E 4 HOH 20  235  69  HOH TIP H . 
E 4 HOH 21  236  70  HOH TIP H . 
E 4 HOH 22  237  79  HOH TIP H . 
E 4 HOH 23  238  87  HOH TIP H . 
E 4 HOH 24  239  89  HOH TIP H . 
E 4 HOH 25  240  93  HOH TIP H . 
E 4 HOH 26  241  94  HOH TIP H . 
E 4 HOH 27  242  96  HOH TIP H . 
E 4 HOH 28  243  97  HOH TIP H . 
E 4 HOH 29  244  99  HOH TIP H . 
E 4 HOH 30  245  100 HOH TIP H . 
E 4 HOH 31  246  101 HOH TIP H . 
E 4 HOH 32  247  113 HOH TIP H . 
E 4 HOH 33  248  118 HOH TIP H . 
E 4 HOH 34  249  120 HOH TIP H . 
E 4 HOH 35  250  125 HOH TIP H . 
E 4 HOH 36  251  126 HOH TIP H . 
E 4 HOH 37  252  128 HOH TIP H . 
E 4 HOH 38  253  129 HOH TIP H . 
E 4 HOH 39  254  135 HOH TIP H . 
E 4 HOH 40  255  139 HOH TIP H . 
E 4 HOH 41  256  143 HOH TIP H . 
E 4 HOH 42  257  145 HOH TIP H . 
E 4 HOH 43  258  146 HOH TIP H . 
E 4 HOH 44  259  152 HOH TIP H . 
E 4 HOH 45  260  153 HOH TIP H . 
E 4 HOH 46  261  158 HOH TIP H . 
E 4 HOH 47  262  159 HOH TIP H . 
E 4 HOH 48  263  160 HOH TIP H . 
E 4 HOH 49  264  163 HOH TIP H . 
E 4 HOH 50  265  164 HOH TIP H . 
E 4 HOH 51  266  167 HOH TIP H . 
E 4 HOH 52  267  169 HOH TIP H . 
E 4 HOH 53  268  170 HOH TIP H . 
E 4 HOH 54  269  171 HOH TIP H . 
E 4 HOH 55  270  172 HOH TIP H . 
E 4 HOH 56  271  173 HOH TIP H . 
E 4 HOH 57  272  174 HOH TIP H . 
E 4 HOH 58  273  177 HOH TIP H . 
E 4 HOH 59  274  178 HOH TIP H . 
E 4 HOH 60  275  180 HOH TIP H . 
E 4 HOH 61  276  188 HOH TIP H . 
E 4 HOH 62  277  189 HOH TIP H . 
E 4 HOH 63  278  190 HOH TIP H . 
E 4 HOH 64  279  199 HOH TIP H . 
E 4 HOH 65  280  200 HOH TIP H . 
E 4 HOH 66  281  205 HOH TIP H . 
E 4 HOH 67  282  206 HOH TIP H . 
E 4 HOH 68  283  208 HOH TIP H . 
E 4 HOH 69  284  213 HOH TIP H . 
E 4 HOH 70  285  216 HOH TIP H . 
E 4 HOH 71  286  218 HOH TIP H . 
E 4 HOH 72  287  221 HOH TIP H . 
E 4 HOH 73  288  223 HOH TIP H . 
E 4 HOH 74  289  227 HOH TIP H . 
E 4 HOH 75  290  230 HOH TIP H . 
E 4 HOH 76  291  231 HOH TIP H . 
E 4 HOH 77  292  232 HOH TIP H . 
E 4 HOH 78  293  242 HOH TIP H . 
E 4 HOH 79  294  250 HOH TIP H . 
E 4 HOH 80  295  251 HOH TIP H . 
E 4 HOH 81  296  255 HOH TIP H . 
E 4 HOH 82  297  259 HOH TIP H . 
E 4 HOH 83  298  261 HOH TIP H . 
E 4 HOH 84  299  269 HOH TIP H . 
E 4 HOH 85  300  271 HOH TIP H . 
E 4 HOH 86  301  272 HOH TIP H . 
E 4 HOH 87  302  274 HOH TIP H . 
E 4 HOH 88  303  277 HOH TIP H . 
E 4 HOH 89  304  280 HOH TIP H . 
E 4 HOH 90  305  281 HOH TIP H . 
E 4 HOH 91  306  283 HOH TIP H . 
E 4 HOH 92  307  286 HOH TIP H . 
E 4 HOH 93  308  288 HOH TIP H . 
E 4 HOH 94  309  295 HOH TIP H . 
E 4 HOH 95  310  296 HOH TIP H . 
E 4 HOH 96  311  306 HOH TIP H . 
E 4 HOH 97  312  308 HOH TIP H . 
E 4 HOH 98  313  309 HOH TIP H . 
E 4 HOH 99  314  310 HOH TIP H . 
E 4 HOH 100 315  311 HOH TIP H . 
E 4 HOH 101 316  314 HOH TIP H . 
E 4 HOH 102 317  318 HOH TIP H . 
E 4 HOH 103 318  329 HOH TIP H . 
E 4 HOH 104 319  332 HOH TIP H . 
E 4 HOH 105 320  333 HOH TIP H . 
E 4 HOH 106 321  335 HOH TIP H . 
E 4 HOH 107 322  337 HOH TIP H . 
E 4 HOH 108 323  338 HOH TIP H . 
E 4 HOH 109 324  340 HOH TIP H . 
E 4 HOH 110 325  342 HOH TIP H . 
E 4 HOH 111 326  343 HOH TIP H . 
E 4 HOH 112 327  344 HOH TIP H . 
E 4 HOH 113 328  347 HOH TIP H . 
E 4 HOH 114 329  348 HOH TIP H . 
E 4 HOH 115 330  349 HOH TIP H . 
E 4 HOH 116 331  353 HOH TIP H . 
#