data_1JH9
# 
_entry.id   1JH9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1JH9         pdb_00001jh9 10.2210/pdb1jh9/pdb 
NDB   PD0226       ?            ?                   
RCSB  RCSB013770   ?            ?                   
WWPDB D_1000013770 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1PNR 'Purine Repressor-Hypoxanthine-Purf-Operator Complex'                unspecified 
PDB 1QPZ 'Purine Repressor-Hypoxanthine-Palindromic Operator Complex'         unspecified 
PDB 1JFS 'PURINE REPRESSOR MUTANT-HYPOXANTHINE-PURF OPERATOR COMPLEX (W147F)' unspecified 
PDB 1JFT 'PURINE REPRESSOR MUTANT-HYPOXANTHINE-PURF OPERATOR COMPLEX (W147A)' unspecified 
PDB 1JHZ 'PURINE REPRESSOR MUTANT COREPRESSOR BINDING DOMAIN STRUCTURE'       unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JH9 
_pdbx_database_status.recvd_initial_deposition_date   2001-06-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Huffman, J.L.' 1 
'Lu, F.'        2 
'Zalkin, H.'    3 
'Brennan, R.G.' 4 
# 
_citation.id                        primary 
_citation.title                     'Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            41 
_citation.page_first                511 
_citation.page_last                 520 
_citation.year                      2002 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11781089 
_citation.pdbx_database_id_DOI      10.1021/bi0156660 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Huffman, J.L.' 1 ? 
primary 'Lu, F.'        2 ? 
primary 'Zalkin, H.'    3 ? 
primary 'Brennan, R.G.' 4 ? 
# 
_cell.entry_id           1JH9 
_cell.length_a           175.380 
_cell.length_b           92.610 
_cell.length_c           80.640 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JH9 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*AP*AP*CP*GP*AP*AP*AP*AP*CP*GP*TP*TP*TP*TP*CP*GP*T)-3'" 5210.410  1   ? ?     ? ? 
2 polymer     man 'PURINE NUCLEOTIDE SYNTHESIS REPRESSOR'                       38062.578 1   ? W147R ? ? 
3 non-polymer syn 'PHOSPHATE ION'                                               94.971    2   ? ?     ? ? 
4 non-polymer syn HYPOXANTHINE                                                  136.111   1   ? ?     ? ? 
5 water       nat water                                                         18.015    116 ? ?     ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DA)(DA)(DC)(DG)(DA)(DA)(DA)(DA)(DC)(DG)(DT)(DT)(DT)(DT)(DC)(DG)(DT)' AACGAAAACGTTTTCGT B ? 
2 'polypeptide(L)'        no no 
;ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAV
EKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDRGEAKADFTDAVIDN
AFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPT
AVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEV
HPRLIERRSVADGPFRDYRR
;
;ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAV
EKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDRGEAKADFTDAVIDN
AFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPT
AVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEV
HPRLIERRSVADGPFRDYRR
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DA  n 
1 3   DC  n 
1 4   DG  n 
1 5   DA  n 
1 6   DA  n 
1 7   DA  n 
1 8   DA  n 
1 9   DC  n 
1 10  DG  n 
1 11  DT  n 
1 12  DT  n 
1 13  DT  n 
1 14  DT  n 
1 15  DC  n 
1 16  DG  n 
1 17  DT  n 
2 1   ALA n 
2 2   THR n 
2 3   ILE n 
2 4   LYS n 
2 5   ASP n 
2 6   VAL n 
2 7   ALA n 
2 8   LYS n 
2 9   ARG n 
2 10  ALA n 
2 11  ASN n 
2 12  VAL n 
2 13  SER n 
2 14  THR n 
2 15  THR n 
2 16  THR n 
2 17  VAL n 
2 18  SER n 
2 19  HIS n 
2 20  VAL n 
2 21  ILE n 
2 22  ASN n 
2 23  LYS n 
2 24  THR n 
2 25  ARG n 
2 26  PHE n 
2 27  VAL n 
2 28  ALA n 
2 29  GLU n 
2 30  GLU n 
2 31  THR n 
2 32  ARG n 
2 33  ASN n 
2 34  ALA n 
2 35  VAL n 
2 36  TRP n 
2 37  ALA n 
2 38  ALA n 
2 39  ILE n 
2 40  LYS n 
2 41  GLU n 
2 42  LEU n 
2 43  HIS n 
2 44  TYR n 
2 45  SER n 
2 46  PRO n 
2 47  SER n 
2 48  ALA n 
2 49  VAL n 
2 50  ALA n 
2 51  ARG n 
2 52  SER n 
2 53  LEU n 
2 54  LYS n 
2 55  VAL n 
2 56  ASN n 
2 57  HIS n 
2 58  THR n 
2 59  LYS n 
2 60  SER n 
2 61  ILE n 
2 62  GLY n 
2 63  LEU n 
2 64  LEU n 
2 65  ALA n 
2 66  THR n 
2 67  SER n 
2 68  SER n 
2 69  GLU n 
2 70  ALA n 
2 71  ALA n 
2 72  TYR n 
2 73  PHE n 
2 74  ALA n 
2 75  GLU n 
2 76  ILE n 
2 77  ILE n 
2 78  GLU n 
2 79  ALA n 
2 80  VAL n 
2 81  GLU n 
2 82  LYS n 
2 83  ASN n 
2 84  CYS n 
2 85  PHE n 
2 86  GLN n 
2 87  LYS n 
2 88  GLY n 
2 89  TYR n 
2 90  THR n 
2 91  LEU n 
2 92  ILE n 
2 93  LEU n 
2 94  GLY n 
2 95  ASN n 
2 96  ALA n 
2 97  TRP n 
2 98  ASN n 
2 99  ASN n 
2 100 LEU n 
2 101 GLU n 
2 102 LYS n 
2 103 GLN n 
2 104 ARG n 
2 105 ALA n 
2 106 TYR n 
2 107 LEU n 
2 108 SER n 
2 109 MET n 
2 110 MET n 
2 111 ALA n 
2 112 GLN n 
2 113 LYS n 
2 114 ARG n 
2 115 VAL n 
2 116 ASP n 
2 117 GLY n 
2 118 LEU n 
2 119 LEU n 
2 120 VAL n 
2 121 MET n 
2 122 CYS n 
2 123 SER n 
2 124 GLU n 
2 125 TYR n 
2 126 PRO n 
2 127 GLU n 
2 128 PRO n 
2 129 LEU n 
2 130 LEU n 
2 131 ALA n 
2 132 MET n 
2 133 LEU n 
2 134 GLU n 
2 135 GLU n 
2 136 TYR n 
2 137 ARG n 
2 138 HIS n 
2 139 ILE n 
2 140 PRO n 
2 141 MET n 
2 142 VAL n 
2 143 VAL n 
2 144 MET n 
2 145 ASP n 
2 146 ARG n 
2 147 GLY n 
2 148 GLU n 
2 149 ALA n 
2 150 LYS n 
2 151 ALA n 
2 152 ASP n 
2 153 PHE n 
2 154 THR n 
2 155 ASP n 
2 156 ALA n 
2 157 VAL n 
2 158 ILE n 
2 159 ASP n 
2 160 ASN n 
2 161 ALA n 
2 162 PHE n 
2 163 GLU n 
2 164 GLY n 
2 165 GLY n 
2 166 TYR n 
2 167 MET n 
2 168 ALA n 
2 169 GLY n 
2 170 ARG n 
2 171 TYR n 
2 172 LEU n 
2 173 ILE n 
2 174 GLU n 
2 175 ARG n 
2 176 GLY n 
2 177 HIS n 
2 178 ARG n 
2 179 GLU n 
2 180 ILE n 
2 181 GLY n 
2 182 VAL n 
2 183 ILE n 
2 184 PRO n 
2 185 GLY n 
2 186 PRO n 
2 187 LEU n 
2 188 GLU n 
2 189 ARG n 
2 190 ASN n 
2 191 THR n 
2 192 GLY n 
2 193 ALA n 
2 194 GLY n 
2 195 ARG n 
2 196 LEU n 
2 197 ALA n 
2 198 GLY n 
2 199 PHE n 
2 200 MET n 
2 201 LYS n 
2 202 ALA n 
2 203 MET n 
2 204 GLU n 
2 205 GLU n 
2 206 ALA n 
2 207 MET n 
2 208 ILE n 
2 209 LYS n 
2 210 VAL n 
2 211 PRO n 
2 212 GLU n 
2 213 SER n 
2 214 TRP n 
2 215 ILE n 
2 216 VAL n 
2 217 GLN n 
2 218 GLY n 
2 219 ASP n 
2 220 PHE n 
2 221 GLU n 
2 222 PRO n 
2 223 GLU n 
2 224 SER n 
2 225 GLY n 
2 226 TYR n 
2 227 ARG n 
2 228 ALA n 
2 229 MET n 
2 230 GLN n 
2 231 GLN n 
2 232 ILE n 
2 233 LEU n 
2 234 SER n 
2 235 GLN n 
2 236 PRO n 
2 237 HIS n 
2 238 ARG n 
2 239 PRO n 
2 240 THR n 
2 241 ALA n 
2 242 VAL n 
2 243 PHE n 
2 244 CYS n 
2 245 GLY n 
2 246 GLY n 
2 247 ASP n 
2 248 ILE n 
2 249 MET n 
2 250 ALA n 
2 251 MET n 
2 252 GLY n 
2 253 ALA n 
2 254 LEU n 
2 255 CYS n 
2 256 ALA n 
2 257 ALA n 
2 258 ASP n 
2 259 GLU n 
2 260 MET n 
2 261 GLY n 
2 262 LEU n 
2 263 ARG n 
2 264 VAL n 
2 265 PRO n 
2 266 GLN n 
2 267 ASP n 
2 268 VAL n 
2 269 SER n 
2 270 LEU n 
2 271 ILE n 
2 272 GLY n 
2 273 TYR n 
2 274 ASP n 
2 275 ASN n 
2 276 VAL n 
2 277 ARG n 
2 278 ASN n 
2 279 ALA n 
2 280 ARG n 
2 281 TYR n 
2 282 PHE n 
2 283 THR n 
2 284 PRO n 
2 285 ALA n 
2 286 LEU n 
2 287 THR n 
2 288 THR n 
2 289 ILE n 
2 290 HIS n 
2 291 GLN n 
2 292 PRO n 
2 293 LYS n 
2 294 ASP n 
2 295 SER n 
2 296 LEU n 
2 297 GLY n 
2 298 GLU n 
2 299 THR n 
2 300 ALA n 
2 301 PHE n 
2 302 ASN n 
2 303 MET n 
2 304 LEU n 
2 305 LEU n 
2 306 ASP n 
2 307 ARG n 
2 308 ILE n 
2 309 VAL n 
2 310 ASN n 
2 311 LYS n 
2 312 ARG n 
2 313 GLU n 
2 314 GLU n 
2 315 PRO n 
2 316 GLN n 
2 317 SER n 
2 318 ILE n 
2 319 GLU n 
2 320 VAL n 
2 321 HIS n 
2 322 PRO n 
2 323 ARG n 
2 324 LEU n 
2 325 ILE n 
2 326 GLU n 
2 327 ARG n 
2 328 ARG n 
2 329 SER n 
2 330 VAL n 
2 331 ALA n 
2 332 ASP n 
2 333 GLY n 
2 334 PRO n 
2 335 PHE n 
2 336 ARG n 
2 337 ASP n 
2 338 TYR n 
2 339 ARG n 
2 340 ARG n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 PURR 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 LAMBDA DE3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET24a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP PURR_ECOLI 2 P0ACP7 1 
;ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAV
EKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDN
AFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPT
AVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEV
HPRLIERRSVADGPFRDYRR
;
? 
2 PDB 1JH9       1 1JH9   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JH9 A 1 ? 340 ? P0ACP7 1   ? 340 ? 2   341 
2 2 1JH9 B 1 ? 17  ? 1JH9   699 ? 715 ? 699 715 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1JH9 
_struct_ref_seq_dif.mon_id                       ARG 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      146 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P0ACP7 
_struct_ref_seq_dif.db_mon_id                    TRP 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          146 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            147 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
HPA non-polymer         . HYPOXANTHINE                         ? 'C5 H4 N4 O'      136.111 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                      ? 'O4 P -3'         94.971  
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1JH9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.77 
_exptl_crystal.density_percent_sol   67.33 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'PEG 4000, ammonium sulfate, ammonium phosphate, cobalt hexammine, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 4000' ? ? ? 
1 2 1 NH4SO4     ? ? ? 
1 3 1 NH4PO4     ? ? ? 
1 4 1 'Co(NH3)6' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1998-07-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'HORIZONTAL FOCUS SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.08 
# 
_reflns.entry_id                     1JH9 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            2.55 
_reflns.number_obs                   22093 
_reflns.number_all                   22093 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.1120000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        4.89 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.55 
_reflns_shell.d_res_low              2.61 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.5240000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.4 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1612 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1JH9 
_refine.ls_number_reflns_obs                     78925 
_refine.ls_number_reflns_all                     78925 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             10.00 
_refine.ls_d_res_high                            2.55 
_refine.ls_percent_reflns_obs                    96.0 
_refine.ls_R_factor_obs                          0.2190000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               4.6 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1PNR 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2654 
_refine_hist.pdbx_number_atoms_nucleic_acid   346 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             116 
_refine_hist.number_atoms_total               3136 
_refine_hist.d_res_high                       2.55 
_refine_hist.d_res_low                        10.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.016  ? 2.600 3109 'X-RAY DIFFRACTION' ? 
t_angle_deg        1.655  ? 3.500 4262 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d 20.700 ? 0.000 1758 'X-RAY DIFFRACTION' ? 
t_trig_c_planes    0.006  ? 12.50 67   'X-RAY DIFFRACTION' ? 
t_gen_planes       0.006  ? 12.40 415  'X-RAY DIFFRACTION' ? 
t_it               4.604  ? 7.500 3090 'X-RAY DIFFRACTION' ? 
t_nbd              0.039  ? 37.00 357  'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1JH9 
_struct.title                     'PURINE REPRESSOR MUTANT-HYPOXANTHINE-PURF OPERATOR COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JH9 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
;TRANSCRIPTION REGULATION, DNA-BINDING, REPRESSOR, PURINE BIOSYNTHESIS, COMPLEX (DNA-BINDING PROTEIN-DNA), ALLOSTERIC REGULATION, TRANSCRIPTION-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR B 2   ? ASN B 11  ? THR A 3   ASN A 12  1 ? 10 
HELX_P HELX_P2  2  SER B 13  ? ASN B 22  ? SER A 14  ASN A 23  1 ? 10 
HELX_P HELX_P3  3  ALA B 28  ? HIS B 43  ? ALA A 29  HIS A 44  1 ? 16 
HELX_P HELX_P4  4  SER B 47  ? ASN B 56  ? SER A 48  ASN A 57  1 ? 10 
HELX_P HELX_P5  5  ALA B 70  ? LYS B 87  ? ALA A 71  LYS A 88  1 ? 18 
HELX_P HELX_P6  6  ASN B 99  ? LYS B 113 ? ASN A 100 LYS A 114 1 ? 15 
HELX_P HELX_P7  7  PRO B 126 ? TYR B 136 ? PRO A 127 TYR A 137 1 ? 11 
HELX_P HELX_P8  8  ARG B 137 ? ILE B 139 ? ARG A 138 ILE A 140 5 ? 3  
HELX_P HELX_P9  9  ALA B 161 ? ARG B 175 ? ALA A 162 ARG A 176 1 ? 15 
HELX_P HELX_P10 10 ARG B 189 ? ALA B 206 ? ARG A 190 ALA A 207 1 ? 18 
HELX_P HELX_P11 11 PRO B 211 ? TRP B 214 ? PRO A 212 TRP A 215 5 ? 4  
HELX_P HELX_P12 12 GLU B 221 ? LEU B 233 ? GLU A 222 LEU A 234 1 ? 13 
HELX_P HELX_P13 13 GLY B 246 ? MET B 260 ? GLY A 247 MET A 261 1 ? 15 
HELX_P HELX_P14 14 ASN B 278 ? PHE B 282 ? ASN A 279 PHE A 283 5 ? 5  
HELX_P HELX_P15 15 LYS B 293 ? ASN B 310 ? LYS A 294 ASN A 311 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? A DA 2  N1 ? ? ? 1_555 A DT 17 N3 ? ? B DA 700 B DT 715 4_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? ? 
hydrog2  hydrog ? ? A DC 3  N3 ? ? ? 1_555 A DG 16 N1 ? ? B DC 701 B DG 714 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog3  hydrog ? ? A DC 3  N4 ? ? ? 1_555 A DG 16 O6 ? ? B DC 701 B DG 714 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog4  hydrog ? ? A DC 3  O2 ? ? ? 1_555 A DG 16 N2 ? ? B DC 701 B DG 714 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog5  hydrog ? ? A DG 4  N1 ? ? ? 1_555 A DC 15 N3 ? ? B DG 702 B DC 713 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog6  hydrog ? ? A DG 4  N2 ? ? ? 1_555 A DC 15 O2 ? ? B DG 702 B DC 713 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog7  hydrog ? ? A DG 4  O6 ? ? ? 1_555 A DC 15 N4 ? ? B DG 702 B DC 713 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog8  hydrog ? ? A DA 5  N1 ? ? ? 1_555 A DT 14 N3 ? ? B DA 703 B DT 712 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog9  hydrog ? ? A DA 5  N6 ? ? ? 1_555 A DT 14 O4 ? ? B DA 703 B DT 712 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog10 hydrog ? ? A DA 6  N1 ? ? ? 1_555 A DT 13 N3 ? ? B DA 704 B DT 711 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog11 hydrog ? ? A DA 6  N6 ? ? ? 1_555 A DT 13 O4 ? ? B DA 704 B DT 711 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog12 hydrog ? ? A DA 7  N1 ? ? ? 1_555 A DT 12 N3 ? ? B DA 705 B DT 710 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog13 hydrog ? ? A DA 7  N6 ? ? ? 1_555 A DT 12 O4 ? ? B DA 705 B DT 710 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog14 hydrog ? ? A DA 8  N1 ? ? ? 1_555 A DT 11 N3 ? ? B DA 706 B DT 709 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog15 hydrog ? ? A DA 8  N6 ? ? ? 1_555 A DT 11 O4 ? ? B DA 706 B DT 709 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog16 hydrog ? ? A DC 9  N3 ? ? ? 1_555 A DG 10 N1 ? ? B DC 707 B DG 708 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog17 hydrog ? ? A DC 9  N4 ? ? ? 1_555 A DG 10 O6 ? ? B DC 707 B DG 708 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog18 hydrog ? ? A DC 9  O2 ? ? ? 1_555 A DG 10 N2 ? ? B DC 707 B DG 708 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog19 hydrog ? ? A DG 10 N1 ? ? ? 1_555 A DC 9  N3 ? ? B DG 708 B DC 707 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog20 hydrog ? ? A DG 10 N2 ? ? ? 1_555 A DC 9  O2 ? ? B DG 708 B DC 707 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog21 hydrog ? ? A DG 10 O6 ? ? ? 1_555 A DC 9  N4 ? ? B DG 708 B DC 707 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog22 hydrog ? ? A DT 11 N3 ? ? ? 1_555 A DA 8  N1 ? ? B DT 709 B DA 706 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog23 hydrog ? ? A DT 11 O4 ? ? ? 1_555 A DA 8  N6 ? ? B DT 709 B DA 706 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog24 hydrog ? ? A DT 12 N3 ? ? ? 1_555 A DA 7  N1 ? ? B DT 710 B DA 705 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog25 hydrog ? ? A DT 12 O4 ? ? ? 1_555 A DA 7  N6 ? ? B DT 710 B DA 705 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog26 hydrog ? ? A DT 13 N3 ? ? ? 1_555 A DA 6  N1 ? ? B DT 711 B DA 704 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog27 hydrog ? ? A DT 13 O4 ? ? ? 1_555 A DA 6  N6 ? ? B DT 711 B DA 704 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog28 hydrog ? ? A DT 14 N3 ? ? ? 1_555 A DA 5  N1 ? ? B DT 712 B DA 703 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog29 hydrog ? ? A DT 14 O4 ? ? ? 1_555 A DA 5  N6 ? ? B DT 712 B DA 703 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog30 hydrog ? ? A DC 15 N3 ? ? ? 1_555 A DG 4  N1 ? ? B DC 713 B DG 702 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog31 hydrog ? ? A DC 15 N4 ? ? ? 1_555 A DG 4  O6 ? ? B DC 713 B DG 702 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog32 hydrog ? ? A DC 15 O2 ? ? ? 1_555 A DG 4  N2 ? ? B DC 713 B DG 702 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog33 hydrog ? ? A DG 16 N1 ? ? ? 1_555 A DC 3  N3 ? ? B DG 714 B DC 701 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog34 hydrog ? ? A DG 16 N2 ? ? ? 1_555 A DC 3  O2 ? ? B DG 714 B DC 701 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog35 hydrog ? ? A DG 16 O6 ? ? ? 1_555 A DC 3  N4 ? ? B DG 714 B DC 701 4_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog36 hydrog ? ? A DT 17 N3 ? ? ? 1_555 A DA 2  N1 ? ? B DT 715 B DA 700 4_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 264 B . ? VAL 265 A PRO 265 B ? PRO 266 A 1 1.99 
2 THR 283 B . ? THR 284 A PRO 284 B ? PRO 285 A 1 0.73 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR B 90  ? LEU B 93  ? THR A 91  LEU A 94  
A 2 SER B 60  ? LEU B 64  ? SER A 61  LEU A 65  
A 3 GLY B 117 ? VAL B 120 ? GLY A 118 VAL A 121 
A 4 MET B 141 ? VAL B 143 ? MET A 142 VAL A 144 
A 5 ASP B 155 ? ILE B 158 ? ASP A 156 ILE A 159 
A 6 SER B 317 ? GLU B 319 ? SER A 318 GLU A 320 
B 1 ILE B 180 ? ILE B 183 ? ILE A 181 ILE A 184 
B 2 ALA B 241 ? CYS B 244 ? ALA A 242 CYS A 245 
B 3 SER B 269 ? ASP B 274 ? SER A 270 ASP A 275 
B 4 THR B 287 ? HIS B 290 ? THR A 288 HIS A 291 
B 5 ARG B 323 ? ILE B 325 ? ARG A 324 ILE A 326 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR B 90  ? O THR A 91  N ILE B 61  ? N ILE A 62  
A 2 3 N GLY B 62  ? N GLY A 63  O GLY B 117 ? O GLY A 118 
A 3 4 N VAL B 120 ? N VAL A 121 O VAL B 142 ? O VAL A 143 
A 4 5 N VAL B 143 ? N VAL A 144 O ASP B 155 ? O ASP A 156 
A 5 6 N ILE B 158 ? N ILE A 159 O ILE B 318 ? O ILE A 319 
B 1 2 N GLY B 181 ? N GLY A 182 O ALA B 241 ? O ALA A 242 
B 2 3 N VAL B 242 ? N VAL A 243 O SER B 269 ? O SER A 270 
B 3 4 N GLY B 272 ? N GLY A 273 O THR B 287 ? O THR A 288 
B 4 5 N HIS B 290 ? N HIS A 291 O ARG B 323 ? O ARG A 324 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PO4 799 ? 6 'BINDING SITE FOR RESIDUE PO4 A 799' 
AC2 Software A PO4 800 ? 4 'BINDING SITE FOR RESIDUE PO4 A 800' 
AC3 Software A HPA 599 ? 9 'BINDING SITE FOR RESIDUE HPA A 599' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 HIS B 290 ? HIS A 291 . ? 1_555 ? 
2  AC1 6 GLN B 291 ? GLN A 292 . ? 1_555 ? 
3  AC1 6 PRO B 292 ? PRO A 293 . ? 1_555 ? 
4  AC1 6 LYS B 293 ? LYS A 294 . ? 1_555 ? 
5  AC1 6 ASP B 294 ? ASP A 295 . ? 1_555 ? 
6  AC1 6 SER B 295 ? SER A 296 . ? 1_555 ? 
7  AC2 4 ARG B 51  ? ARG A 52  . ? 1_555 ? 
8  AC2 4 HIS B 57  ? HIS A 58  . ? 1_555 ? 
9  AC2 4 LYS B 59  ? LYS A 60  . ? 1_555 ? 
10 AC2 4 HOH G .   ? HOH A 880 . ? 1_555 ? 
11 AC3 9 TYR B 72  ? TYR A 73  . ? 1_555 ? 
12 AC3 9 PHE B 73  ? PHE A 74  . ? 1_555 ? 
13 AC3 9 ARG B 189 ? ARG A 190 . ? 1_555 ? 
14 AC3 9 THR B 191 ? THR A 192 . ? 1_555 ? 
15 AC3 9 ARG B 195 ? ARG A 196 . ? 1_555 ? 
16 AC3 9 PHE B 220 ? PHE A 221 . ? 1_555 ? 
17 AC3 9 ASP B 274 ? ASP A 275 . ? 1_555 ? 
18 AC3 9 HOH G .   ? HOH A 808 . ? 1_555 ? 
19 AC3 9 HOH G .   ? HOH A 832 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1JH9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JH9 
_atom_sites.fract_transf_matrix[1][1]   0.005702 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010798 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012401 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DA  A 1 1   ? 168.003 26.542  -19.684 1.00 40.33  ? 699 DA  B "O5'" 1 
ATOM   2    C "C5'" . DA  A 1 1   ? 168.809 25.377  -19.852 1.00 46.82  ? 699 DA  B "C5'" 1 
ATOM   3    C "C4'" . DA  A 1 1   ? 168.231 24.448  -20.907 1.00 45.82  ? 699 DA  B "C4'" 1 
ATOM   4    O "O4'" . DA  A 1 1   ? 169.005 23.236  -20.921 1.00 46.03  ? 699 DA  B "O4'" 1 
ATOM   5    C "C3'" . DA  A 1 1   ? 166.840 23.954  -20.582 1.00 45.43  ? 699 DA  B "C3'" 1 
ATOM   6    O "O3'" . DA  A 1 1   ? 166.308 23.246  -21.692 1.00 46.98  ? 699 DA  B "O3'" 1 
ATOM   7    C "C2'" . DA  A 1 1   ? 167.139 22.946  -19.495 1.00 48.28  ? 699 DA  B "C2'" 1 
ATOM   8    C "C1'" . DA  A 1 1   ? 168.449 22.329  -19.990 1.00 49.63  ? 699 DA  B "C1'" 1 
ATOM   9    N N9    . DA  A 1 1   ? 169.429 22.138  -18.937 1.00 51.50  ? 699 DA  B N9    1 
ATOM   10   C C8    . DA  A 1 1   ? 169.574 22.850  -17.765 1.00 53.74  ? 699 DA  B C8    1 
ATOM   11   N N7    . DA  A 1 1   ? 170.560 22.423  -17.006 1.00 51.10  ? 699 DA  B N7    1 
ATOM   12   C C5    . DA  A 1 1   ? 171.091 21.365  -17.735 1.00 48.08  ? 699 DA  B C5    1 
ATOM   13   C C6    . DA  A 1 1   ? 172.152 20.496  -17.482 1.00 50.32  ? 699 DA  B C6    1 
ATOM   14   N N6    . DA  A 1 1   ? 172.910 20.555  -16.378 1.00 51.79  ? 699 DA  B N6    1 
ATOM   15   N N1    . DA  A 1 1   ? 172.415 19.548  -18.413 1.00 51.96  ? 699 DA  B N1    1 
ATOM   16   C C2    . DA  A 1 1   ? 171.649 19.495  -19.520 1.00 50.79  ? 699 DA  B C2    1 
ATOM   17   N N3    . DA  A 1 1   ? 170.620 20.261  -19.872 1.00 44.81  ? 699 DA  B N3    1 
ATOM   18   C C4    . DA  A 1 1   ? 170.396 21.183  -18.925 1.00 46.77  ? 699 DA  B C4    1 
ATOM   19   P P     . DA  A 1 2   ? 165.072 22.256  -21.448 1.00 49.35  ? 700 DA  B P     1 
ATOM   20   O OP1   . DA  A 1 2   ? 164.264 22.134  -22.669 1.00 43.78  ? 700 DA  B OP1   1 
ATOM   21   O OP2   . DA  A 1 2   ? 164.415 22.618  -20.167 1.00 50.36  ? 700 DA  B OP2   1 
ATOM   22   O "O5'" . DA  A 1 2   ? 165.760 20.872  -21.158 1.00 46.65  ? 700 DA  B "O5'" 1 
ATOM   23   C "C5'" . DA  A 1 2   ? 165.955 19.913  -22.181 1.00 54.64  ? 700 DA  B "C5'" 1 
ATOM   24   C "C4'" . DA  A 1 2   ? 166.383 18.616  -21.546 1.00 54.30  ? 700 DA  B "C4'" 1 
ATOM   25   O "O4'" . DA  A 1 2   ? 167.285 18.934  -20.473 1.00 52.26  ? 700 DA  B "O4'" 1 
ATOM   26   C "C3'" . DA  A 1 2   ? 165.220 17.873  -20.896 1.00 54.85  ? 700 DA  B "C3'" 1 
ATOM   27   O "O3'" . DA  A 1 2   ? 164.817 16.780  -21.729 1.00 60.36  ? 700 DA  B "O3'" 1 
ATOM   28   C "C2'" . DA  A 1 2   ? 165.753 17.368  -19.561 1.00 52.35  ? 700 DA  B "C2'" 1 
ATOM   29   C "C1'" . DA  A 1 2   ? 167.120 18.024  -19.409 1.00 50.53  ? 700 DA  B "C1'" 1 
ATOM   30   N N9    . DA  A 1 2   ? 167.278 18.776  -18.185 1.00 47.00  ? 700 DA  B N9    1 
ATOM   31   C C8    . DA  A 1 2   ? 166.475 19.774  -17.708 1.00 46.79  ? 700 DA  B C8    1 
ATOM   32   N N7    . DA  A 1 2   ? 166.884 20.270  -16.560 1.00 47.25  ? 700 DA  B N7    1 
ATOM   33   C C5    . DA  A 1 2   ? 168.032 19.549  -16.272 1.00 43.53  ? 700 DA  B C5    1 
ATOM   34   C C6    . DA  A 1 2   ? 168.934 19.601  -15.205 1.00 43.32  ? 700 DA  B C6    1 
ATOM   35   N N6    . DA  A 1 2   ? 168.813 20.442  -14.173 1.00 48.03  ? 700 DA  B N6    1 
ATOM   36   N N1    . DA  A 1 2   ? 169.980 18.749  -15.227 1.00 39.47  ? 700 DA  B N1    1 
ATOM   37   C C2    . DA  A 1 2   ? 170.103 17.905  -16.259 1.00 36.04  ? 700 DA  B C2    1 
ATOM   38   N N3    . DA  A 1 2   ? 169.322 17.760  -17.322 1.00 39.74  ? 700 DA  B N3    1 
ATOM   39   C C4    . DA  A 1 2   ? 168.290 18.625  -17.267 1.00 45.22  ? 700 DA  B C4    1 
ATOM   40   P P     . DC  A 1 3   ? 164.530 15.351  -21.079 1.00 60.73  ? 701 DC  B P     1 
ATOM   41   O OP1   . DC  A 1 3   ? 164.098 14.439  -22.154 1.00 53.76  ? 701 DC  B OP1   1 
ATOM   42   O OP2   . DC  A 1 3   ? 163.691 15.508  -19.855 1.00 57.65  ? 701 DC  B OP2   1 
ATOM   43   O "O5'" . DC  A 1 3   ? 165.983 14.871  -20.697 1.00 51.64  ? 701 DC  B "O5'" 1 
ATOM   44   C "C5'" . DC  A 1 3   ? 166.193 13.555  -20.267 1.00 52.80  ? 701 DC  B "C5'" 1 
ATOM   45   C "C4'" . DC  A 1 3   ? 167.125 13.520  -19.097 1.00 43.47  ? 701 DC  B "C4'" 1 
ATOM   46   O "O4'" . DC  A 1 3   ? 167.062 14.705  -18.307 1.00 38.92  ? 701 DC  B "O4'" 1 
ATOM   47   C "C3'" . DC  A 1 3   ? 166.802 12.429  -18.122 1.00 43.40  ? 701 DC  B "C3'" 1 
ATOM   48   O "O3'" . DC  A 1 3   ? 167.512 11.285  -18.544 1.00 52.51  ? 701 DC  B "O3'" 1 
ATOM   49   C "C2'" . DC  A 1 3   ? 167.352 12.954  -16.787 1.00 40.88  ? 701 DC  B "C2'" 1 
ATOM   50   C "C1'" . DC  A 1 3   ? 167.742 14.393  -17.110 1.00 37.66  ? 701 DC  B "C1'" 1 
ATOM   51   N N1    . DC  A 1 3   ? 167.404 15.391  -16.098 1.00 39.83  ? 701 DC  B N1    1 
ATOM   52   C C2    . DC  A 1 3   ? 168.206 15.485  -14.954 1.00 48.83  ? 701 DC  B C2    1 
ATOM   53   O O2    . DC  A 1 3   ? 169.170 14.710  -14.837 1.00 52.64  ? 701 DC  B O2    1 
ATOM   54   N N3    . DC  A 1 3   ? 167.908 16.412  -14.009 1.00 47.97  ? 701 DC  B N3    1 
ATOM   55   C C4    . DC  A 1 3   ? 166.858 17.226  -14.194 1.00 48.80  ? 701 DC  B C4    1 
ATOM   56   N N4    . DC  A 1 3   ? 166.589 18.129  -13.253 1.00 53.01  ? 701 DC  B N4    1 
ATOM   57   C C5    . DC  A 1 3   ? 166.036 17.153  -15.354 1.00 43.64  ? 701 DC  B C5    1 
ATOM   58   C C6    . DC  A 1 3   ? 166.348 16.230  -16.273 1.00 41.91  ? 701 DC  B C6    1 
ATOM   59   P P     . DG  A 1 4   ? 167.262 9.917   -17.808 1.00 63.79  ? 702 DG  B P     1 
ATOM   60   O OP1   . DG  A 1 4   ? 167.450 8.896   -18.879 1.00 63.69  ? 702 DG  B OP1   1 
ATOM   61   O OP2   . DG  A 1 4   ? 165.980 10.003  -17.057 1.00 65.03  ? 702 DG  B OP2   1 
ATOM   62   O "O5'" . DG  A 1 4   ? 168.387 9.902   -16.688 1.00 57.03  ? 702 DG  B "O5'" 1 
ATOM   63   C "C5'" . DG  A 1 4   ? 169.728 9.575   -17.003 1.00 61.14  ? 702 DG  B "C5'" 1 
ATOM   64   C "C4'" . DG  A 1 4   ? 170.595 9.674   -15.775 1.00 57.27  ? 702 DG  B "C4'" 1 
ATOM   65   O "O4'" . DG  A 1 4   ? 170.283 10.883  -15.055 1.00 53.37  ? 702 DG  B "O4'" 1 
ATOM   66   C "C3'" . DG  A 1 4   ? 170.408 8.527   -14.784 1.00 60.60  ? 702 DG  B "C3'" 1 
ATOM   67   O "O3'" . DG  A 1 4   ? 171.687 8.088   -14.331 1.00 70.64  ? 702 DG  B "O3'" 1 
ATOM   68   C "C2'" . DG  A 1 4   ? 169.650 9.151   -13.616 1.00 55.87  ? 702 DG  B "C2'" 1 
ATOM   69   C "C1'" . DG  A 1 4   ? 170.076 10.603  -13.673 1.00 50.67  ? 702 DG  B "C1'" 1 
ATOM   70   N N9    . DG  A 1 4   ? 169.061 11.534  -13.225 1.00 46.64  ? 702 DG  B N9    1 
ATOM   71   C C8    . DG  A 1 4   ? 167.876 11.810  -13.872 1.00 45.28  ? 702 DG  B C8    1 
ATOM   72   N N7    . DG  A 1 4   ? 167.158 12.703  -13.253 1.00 43.15  ? 702 DG  B N7    1 
ATOM   73   C C5    . DG  A 1 4   ? 167.909 13.043  -12.137 1.00 37.94  ? 702 DG  B C5    1 
ATOM   74   C C6    . DG  A 1 4   ? 167.629 13.965  -11.109 1.00 39.99  ? 702 DG  B C6    1 
ATOM   75   O O6    . DG  A 1 4   ? 166.636 14.674  -10.976 1.00 46.05  ? 702 DG  B O6    1 
ATOM   76   N N1    . DG  A 1 4   ? 168.648 14.018  -10.174 1.00 37.04  ? 702 DG  B N1    1 
ATOM   77   C C2    . DG  A 1 4   ? 169.798 13.265  -10.221 1.00 34.92  ? 702 DG  B C2    1 
ATOM   78   N N2    . DG  A 1 4   ? 170.657 13.455  -9.214  1.00 32.41  ? 702 DG  B N2    1 
ATOM   79   N N3    . DG  A 1 4   ? 170.080 12.389  -11.185 1.00 33.80  ? 702 DG  B N3    1 
ATOM   80   C C4    . DG  A 1 4   ? 169.094 12.334  -12.104 1.00 39.39  ? 702 DG  B C4    1 
ATOM   81   P P     . DA  A 1 5   ? 171.806 6.680   -13.595 1.00 77.03  ? 703 DA  B P     1 
ATOM   82   O OP1   . DA  A 1 5   ? 172.709 5.876   -14.459 1.00 80.64  ? 703 DA  B OP1   1 
ATOM   83   O OP2   . DA  A 1 5   ? 170.432 6.182   -13.312 1.00 81.78  ? 703 DA  B OP2   1 
ATOM   84   O "O5'" . DA  A 1 5   ? 172.480 7.053   -12.207 1.00 53.78  ? 703 DA  B "O5'" 1 
ATOM   85   C "C5'" . DA  A 1 5   ? 172.993 8.343   -11.979 1.00 56.65  ? 703 DA  B "C5'" 1 
ATOM   86   C "C4'" . DA  A 1 5   ? 173.686 8.371   -10.652 1.00 61.51  ? 703 DA  B "C4'" 1 
ATOM   87   O "O4'" . DA  A 1 5   ? 172.915 9.175   -9.736  1.00 64.43  ? 703 DA  B "O4'" 1 
ATOM   88   C "C3'" . DA  A 1 5   ? 173.736 7.008   -9.985  1.00 64.45  ? 703 DA  B "C3'" 1 
ATOM   89   O "O3'" . DA  A 1 5   ? 174.660 7.052   -8.889  1.00 72.45  ? 703 DA  B "O3'" 1 
ATOM   90   C "C2'" . DA  A 1 5   ? 172.324 6.904   -9.441  1.00 65.73  ? 703 DA  B "C2'" 1 
ATOM   91   C "C1'" . DA  A 1 5   ? 172.048 8.334   -8.979  1.00 64.31  ? 703 DA  B "C1'" 1 
ATOM   92   N N9    . DA  A 1 5   ? 170.689 8.787   -9.232  1.00 61.58  ? 703 DA  B N9    1 
ATOM   93   C C8    . DA  A 1 5   ? 169.825 8.350   -10.204 1.00 63.00  ? 703 DA  B C8    1 
ATOM   94   N N7    . DA  A 1 5   ? 168.665 8.958   -10.189 1.00 63.32  ? 703 DA  B N7    1 
ATOM   95   C C5    . DA  A 1 5   ? 168.778 9.857   -9.139  1.00 60.99  ? 703 DA  B C5    1 
ATOM   96   C C6    . DA  A 1 5   ? 167.889 10.797  -8.605  1.00 61.58  ? 703 DA  B C6    1 
ATOM   97   N N6    . DA  A 1 5   ? 166.655 10.999  -9.079  1.00 60.98  ? 703 DA  B N6    1 
ATOM   98   N N1    . DA  A 1 5   ? 168.316 11.536  -7.556  1.00 62.42  ? 703 DA  B N1    1 
ATOM   99   C C2    . DA  A 1 5   ? 169.553 11.332  -7.085  1.00 61.68  ? 703 DA  B C2    1 
ATOM   100  N N3    . DA  A 1 5   ? 170.478 10.473  -7.504  1.00 60.81  ? 703 DA  B N3    1 
ATOM   101  C C4    . DA  A 1 5   ? 170.023 9.761   -8.544  1.00 59.59  ? 703 DA  B C4    1 
ATOM   102  P P     . DA  A 1 6   ? 174.807 5.791   -7.908  1.00 79.90  ? 704 DA  B P     1 
ATOM   103  O OP1   . DA  A 1 6   ? 176.134 5.898   -7.260  1.00 85.17  ? 704 DA  B OP1   1 
ATOM   104  O OP2   . DA  A 1 6   ? 174.415 4.542   -8.627  1.00 75.49  ? 704 DA  B OP2   1 
ATOM   105  O "O5'" . DA  A 1 6   ? 173.808 6.103   -6.727  1.00 70.26  ? 704 DA  B "O5'" 1 
ATOM   106  C "C5'" . DA  A 1 6   ? 174.071 7.159   -5.826  1.00 80.07  ? 704 DA  B "C5'" 1 
ATOM   107  C "C4'" . DA  A 1 6   ? 172.996 7.198   -4.773  1.00 85.92  ? 704 DA  B "C4'" 1 
ATOM   108  O "O4'" . DA  A 1 6   ? 171.749 7.647   -5.384  1.00 88.58  ? 704 DA  B "O4'" 1 
ATOM   109  C "C3'" . DA  A 1 6   ? 172.659 5.814   -4.191  1.00 86.69  ? 704 DA  B "C3'" 1 
ATOM   110  O "O3'" . DA  A 1 6   ? 171.980 6.017   -2.948  1.00 93.62  ? 704 DA  B "O3'" 1 
ATOM   111  C "C2'" . DA  A 1 6   ? 171.612 5.344   -5.179  1.00 86.47  ? 704 DA  B "C2'" 1 
ATOM   112  C "C1'" . DA  A 1 6   ? 170.786 6.615   -5.197  1.00 85.06  ? 704 DA  B "C1'" 1 
ATOM   113  N N9    . DA  A 1 6   ? 169.705 6.702   -6.183  1.00 75.50  ? 704 DA  B N9    1 
ATOM   114  C C8    . DA  A 1 6   ? 169.531 5.960   -7.324  1.00 72.42  ? 704 DA  B C8    1 
ATOM   115  N N7    . DA  A 1 6   ? 168.444 6.269   -7.994  1.00 70.49  ? 704 DA  B N7    1 
ATOM   116  C C5    . DA  A 1 6   ? 167.860 7.280   -7.235  1.00 69.84  ? 704 DA  B C5    1 
ATOM   117  C C6    . DA  A 1 6   ? 166.679 8.039   -7.405  1.00 67.13  ? 704 DA  B C6    1 
ATOM   118  N N6    . DA  A 1 6   ? 165.840 7.888   -8.438  1.00 67.15  ? 704 DA  B N6    1 
ATOM   119  N N1    . DA  A 1 6   ? 166.388 8.968   -6.465  1.00 63.53  ? 704 DA  B N1    1 
ATOM   120  C C2    . DA  A 1 6   ? 167.230 9.116   -5.431  1.00 65.64  ? 704 DA  B C2    1 
ATOM   121  N N3    . DA  A 1 6   ? 168.365 8.466   -5.162  1.00 67.08  ? 704 DA  B N3    1 
ATOM   122  C C4    . DA  A 1 6   ? 168.626 7.551   -6.115  1.00 69.59  ? 704 DA  B C4    1 
ATOM   123  P P     . DA  A 1 7   ? 172.626 5.572   -1.554  1.00 98.94  ? 705 DA  B P     1 
ATOM   124  O OP1   . DA  A 1 7   ? 174.059 5.961   -1.597  1.00 100.00 ? 705 DA  B OP1   1 
ATOM   125  O OP2   . DA  A 1 7   ? 172.242 4.159   -1.282  1.00 98.85  ? 705 DA  B OP2   1 
ATOM   126  O "O5'" . DA  A 1 7   ? 171.898 6.529   -0.512  1.00 82.75  ? 705 DA  B "O5'" 1 
ATOM   127  C "C5'" . DA  A 1 7   ? 171.518 7.836   -0.910  1.00 83.14  ? 705 DA  B "C5'" 1 
ATOM   128  C "C4'" . DA  A 1 7   ? 170.361 8.365   -0.095  1.00 74.90  ? 705 DA  B "C4'" 1 
ATOM   129  O "O4'" . DA  A 1 7   ? 169.164 8.371   -0.897  1.00 72.37  ? 705 DA  B "O4'" 1 
ATOM   130  C "C3'" . DA  A 1 7   ? 170.015 7.551   1.137   1.00 69.03  ? 705 DA  B "C3'" 1 
ATOM   131  O "O3'" . DA  A 1 7   ? 169.367 8.416   2.067   1.00 79.22  ? 705 DA  B "O3'" 1 
ATOM   132  C "C2'" . DA  A 1 7   ? 169.020 6.538   0.596   1.00 64.40  ? 705 DA  B "C2'" 1 
ATOM   133  C "C1'" . DA  A 1 7   ? 168.284 7.334   -0.477  1.00 64.65  ? 705 DA  B "C1'" 1 
ATOM   134  N N9    . DA  A 1 7   ? 167.918 6.576   -1.668  1.00 58.33  ? 705 DA  B N9    1 
ATOM   135  C C8    . DA  A 1 7   ? 168.564 5.499   -2.217  1.00 57.83  ? 705 DA  B C8    1 
ATOM   136  N N7    . DA  A 1 7   ? 167.991 5.034   -3.307  1.00 55.47  ? 705 DA  B N7    1 
ATOM   137  C C5    . DA  A 1 7   ? 166.895 5.864   -3.486  1.00 52.53  ? 705 DA  B C5    1 
ATOM   138  C C6    . DA  A 1 7   ? 165.881 5.895   -4.462  1.00 49.31  ? 705 DA  B C6    1 
ATOM   139  N N6    . DA  A 1 7   ? 165.806 5.037   -5.487  1.00 47.73  ? 705 DA  B N6    1 
ATOM   140  N N1    . DA  A 1 7   ? 164.938 6.850   -4.352  1.00 49.01  ? 705 DA  B N1    1 
ATOM   141  C C2    . DA  A 1 7   ? 165.015 7.712   -3.322  1.00 53.87  ? 705 DA  B C2    1 
ATOM   142  N N3    . DA  A 1 7   ? 165.916 7.787   -2.337  1.00 55.27  ? 705 DA  B N3    1 
ATOM   143  C C4    . DA  A 1 7   ? 166.841 6.822   -2.482  1.00 55.26  ? 705 DA  B C4    1 
ATOM   144  P P     . DA  A 1 8   ? 168.979 7.875   3.525   1.00 93.37  ? 706 DA  B P     1 
ATOM   145  O OP1   . DA  A 1 8   ? 169.151 8.983   4.508   1.00 92.20  ? 706 DA  B OP1   1 
ATOM   146  O OP2   . DA  A 1 8   ? 169.657 6.567   3.743   1.00 92.73  ? 706 DA  B OP2   1 
ATOM   147  O "O5'" . DA  A 1 8   ? 167.416 7.601   3.407   1.00 85.88  ? 706 DA  B "O5'" 1 
ATOM   148  C "C5'" . DA  A 1 8   ? 166.516 8.653   3.080   1.00 86.64  ? 706 DA  B "C5'" 1 
ATOM   149  C "C4'" . DA  A 1 8   ? 165.197 8.104   2.583   1.00 77.85  ? 706 DA  B "C4'" 1 
ATOM   150  O "O4'" . DA  A 1 8   ? 165.387 7.429   1.332   1.00 72.61  ? 706 DA  B "O4'" 1 
ATOM   151  C "C3'" . DA  A 1 8   ? 164.566 7.061   3.499   1.00 71.92  ? 706 DA  B "C3'" 1 
ATOM   152  O "O3'" . DA  A 1 8   ? 163.562 7.679   4.303   1.00 78.18  ? 706 DA  B "O3'" 1 
ATOM   153  C "C2'" . DA  A 1 8   ? 163.921 6.054   2.549   1.00 67.36  ? 706 DA  B "C2'" 1 
ATOM   154  C "C1'" . DA  A 1 8   ? 164.313 6.537   1.154   1.00 65.65  ? 706 DA  B "C1'" 1 
ATOM   155  N N9    . DA  A 1 8   ? 164.758 5.478   0.263   1.00 60.55  ? 706 DA  B N9    1 
ATOM   156  C C8    . DA  A 1 8   ? 165.825 4.630   0.428   1.00 60.27  ? 706 DA  B C8    1 
ATOM   157  N N7    . DA  A 1 8   ? 165.974 3.768   -0.553  1.00 58.85  ? 706 DA  B N7    1 
ATOM   158  C C5    . DA  A 1 8   ? 164.933 4.072   -1.418  1.00 57.00  ? 706 DA  B C5    1 
ATOM   159  C C6    . DA  A 1 8   ? 164.536 3.524   -2.641  1.00 57.39  ? 706 DA  B C6    1 
ATOM   160  N N6    . DA  A 1 8   ? 165.161 2.507   -3.240  1.00 62.10  ? 706 DA  B N6    1 
ATOM   161  N N1    . DA  A 1 8   ? 163.461 4.060   -3.241  1.00 51.86  ? 706 DA  B N1    1 
ATOM   162  C C2    . DA  A 1 8   ? 162.823 5.072   -2.650  1.00 48.62  ? 706 DA  B C2    1 
ATOM   163  N N3    . DA  A 1 8   ? 163.099 5.680   -1.501  1.00 48.38  ? 706 DA  B N3    1 
ATOM   164  C C4    . DA  A 1 8   ? 164.177 5.126   -0.928  1.00 55.04  ? 706 DA  B C4    1 
ATOM   165  P P     . DC  A 1 9   ? 163.182 7.022   5.712   1.00 85.82  ? 707 DC  B P     1 
ATOM   166  O OP1   . DC  A 1 9   ? 163.286 8.065   6.768   1.00 87.00  ? 707 DC  B OP1   1 
ATOM   167  O OP2   . DC  A 1 9   ? 163.911 5.737   5.865   1.00 84.41  ? 707 DC  B OP2   1 
ATOM   168  O "O5'" . DC  A 1 9   ? 161.657 6.606   5.534   1.00 75.30  ? 707 DC  B "O5'" 1 
ATOM   169  C "C5'" . DC  A 1 9   ? 160.728 7.451   4.876   1.00 70.92  ? 707 DC  B "C5'" 1 
ATOM   170  C "C4'" . DC  A 1 9   ? 159.635 6.617   4.264   1.00 55.43  ? 707 DC  B "C4'" 1 
ATOM   171  O "O4'" . DC  A 1 9   ? 160.114 6.081   3.033   1.00 50.45  ? 707 DC  B "O4'" 1 
ATOM   172  C "C3'" . DC  A 1 9   ? 159.289 5.391   5.083   1.00 45.43  ? 707 DC  B "C3'" 1 
ATOM   173  O "O3'" . DC  A 1 9   ? 158.204 5.681   5.957   1.00 49.27  ? 707 DC  B "O3'" 1 
ATOM   174  C "C2'" . DC  A 1 9   ? 158.871 4.360   4.050   1.00 43.39  ? 707 DC  B "C2'" 1 
ATOM   175  C "C1'" . DC  A 1 9   ? 159.369 4.931   2.725   1.00 44.95  ? 707 DC  B "C1'" 1 
ATOM   176  N N1    . DC  A 1 9   ? 160.250 4.050   1.970   1.00 42.75  ? 707 DC  B N1    1 
ATOM   177  C C2    . DC  A 1 9   ? 159.936 3.781   0.647   1.00 47.02  ? 707 DC  B C2    1 
ATOM   178  O O2    . DC  A 1 9   ? 158.920 4.294   0.168   1.00 55.35  ? 707 DC  B O2    1 
ATOM   179  N N3    . DC  A 1 9   ? 160.738 2.973   -0.076  1.00 45.63  ? 707 DC  B N3    1 
ATOM   180  C C4    . DC  A 1 9   ? 161.821 2.449   0.490   1.00 46.86  ? 707 DC  B C4    1 
ATOM   181  N N4    . DC  A 1 9   ? 162.592 1.661   -0.248  1.00 48.03  ? 707 DC  B N4    1 
ATOM   182  C C5    . DC  A 1 9   ? 162.167 2.716   1.844   1.00 46.01  ? 707 DC  B C5    1 
ATOM   183  C C6    . DC  A 1 9   ? 161.357 3.517   2.542   1.00 44.71  ? 707 DC  B C6    1 
ATOM   184  P P     . DG  A 1 10  ? 158.313 5.235   7.495   1.00 61.27  ? 708 DG  B P     1 
ATOM   185  O OP1   . DG  A 1 10  ? 157.473 6.112   8.347   1.00 63.91  ? 708 DG  B OP1   1 
ATOM   186  O OP2   . DG  A 1 10  ? 159.740 5.027   7.847   1.00 62.31  ? 708 DG  B OP2   1 
ATOM   187  O "O5'" . DG  A 1 10  ? 157.640 3.798   7.509   1.00 58.12  ? 708 DG  B "O5'" 1 
ATOM   188  C "C5'" . DG  A 1 10  ? 156.753 3.404   6.482   1.00 61.59  ? 708 DG  B "C5'" 1 
ATOM   189  C "C4'" . DG  A 1 10  ? 156.400 1.952   6.632   1.00 57.60  ? 708 DG  B "C4'" 1 
ATOM   190  O "O4'" . DG  A 1 10  ? 157.138 1.192   5.655   1.00 58.68  ? 708 DG  B "O4'" 1 
ATOM   191  C "C3'" . DG  A 1 10  ? 156.767 1.351   7.987   1.00 53.59  ? 708 DG  B "C3'" 1 
ATOM   192  O "O3'" . DG  A 1 10  ? 155.883 0.255   8.255   1.00 59.82  ? 708 DG  B "O3'" 1 
ATOM   193  C "C2'" . DG  A 1 10  ? 158.158 0.815   7.726   1.00 51.87  ? 708 DG  B "C2'" 1 
ATOM   194  C "C1'" . DG  A 1 10  ? 158.030 0.300   6.301   1.00 53.97  ? 708 DG  B "C1'" 1 
ATOM   195  N N9    . DG  A 1 10  ? 159.275 0.326   5.552   1.00 51.45  ? 708 DG  B N9    1 
ATOM   196  C C8    . DG  A 1 10  ? 160.393 1.062   5.857   1.00 52.60  ? 708 DG  B C8    1 
ATOM   197  N N7    . DG  A 1 10  ? 161.365 0.896   5.002   1.00 51.25  ? 708 DG  B N7    1 
ATOM   198  C C5    . DG  A 1 10  ? 160.861 -0.002  4.077   1.00 48.13  ? 708 DG  B C5    1 
ATOM   199  C C6    . DG  A 1 10  ? 161.469 -0.545  2.932   1.00 49.81  ? 708 DG  B C6    1 
ATOM   200  O O6    . DG  A 1 10  ? 162.604 -0.334  2.510   1.00 58.34  ? 708 DG  B O6    1 
ATOM   201  N N1    . DG  A 1 10  ? 160.625 -1.414  2.261   1.00 46.33  ? 708 DG  B N1    1 
ATOM   202  C C2    . DG  A 1 10  ? 159.344 -1.723  2.652   1.00 43.65  ? 708 DG  B C2    1 
ATOM   203  N N2    . DG  A 1 10  ? 158.692 -2.586  1.868   1.00 38.36  ? 708 DG  B N2    1 
ATOM   204  N N3    . DG  A 1 10  ? 158.752 -1.221  3.734   1.00 43.76  ? 708 DG  B N3    1 
ATOM   205  C C4    . DG  A 1 10  ? 159.569 -0.369  4.394   1.00 48.46  ? 708 DG  B C4    1 
ATOM   206  P P     . DT  A 1 11  ? 156.035 -0.634  9.584   1.00 64.47  ? 709 DT  B P     1 
ATOM   207  O OP1   . DT  A 1 11  ? 155.170 -0.073  10.656  1.00 57.86  ? 709 DT  B OP1   1 
ATOM   208  O OP2   . DT  A 1 11  ? 157.481 -0.852  9.868   1.00 68.27  ? 709 DT  B OP2   1 
ATOM   209  O "O5'" . DT  A 1 11  ? 155.440 -2.032  9.116   1.00 51.40  ? 709 DT  B "O5'" 1 
ATOM   210  C "C5'" . DT  A 1 11  ? 156.241 -3.202  9.133   1.00 54.34  ? 709 DT  B "C5'" 1 
ATOM   211  C "C4'" . DT  A 1 11  ? 156.429 -3.730  7.744   1.00 51.36  ? 709 DT  B "C4'" 1 
ATOM   212  O "O4'" . DT  A 1 11  ? 157.480 -3.012  7.101   1.00 53.19  ? 709 DT  B "O4'" 1 
ATOM   213  C "C3'" . DT  A 1 11  ? 156.876 -5.180  7.686   1.00 53.64  ? 709 DT  B "C3'" 1 
ATOM   214  O "O3'" . DT  A 1 11  ? 155.733 -6.029  7.626   1.00 56.93  ? 709 DT  B "O3'" 1 
ATOM   215  C "C2'" . DT  A 1 11  ? 157.634 -5.268  6.362   1.00 55.49  ? 709 DT  B "C2'" 1 
ATOM   216  C "C1'" . DT  A 1 11  ? 158.020 -3.821  6.060   1.00 53.94  ? 709 DT  B "C1'" 1 
ATOM   217  N N1    . DT  A 1 11  ? 159.469 -3.559  5.966   1.00 52.57  ? 709 DT  B N1    1 
ATOM   218  C C2    . DT  A 1 11  ? 160.161 -4.076  4.898   1.00 53.26  ? 709 DT  B C2    1 
ATOM   219  O O2    . DT  A 1 11  ? 159.652 -4.753  4.026   1.00 55.63  ? 709 DT  B O2    1 
ATOM   220  N N3    . DT  A 1 11  ? 161.485 -3.772  4.889   1.00 53.18  ? 709 DT  B N3    1 
ATOM   221  C C4    . DT  A 1 11  ? 162.182 -3.016  5.807   1.00 52.93  ? 709 DT  B C4    1 
ATOM   222  O O4    . DT  A 1 11  ? 163.383 -2.824  5.659   1.00 58.36  ? 709 DT  B O4    1 
ATOM   223  C C5    . DT  A 1 11  ? 161.406 -2.505  6.893   1.00 47.02  ? 709 DT  B C5    1 
ATOM   224  C C7    . DT  A 1 11  ? 162.086 -1.679  7.930   1.00 46.68  ? 709 DT  B C7    1 
ATOM   225  C C6    . DT  A 1 11  ? 160.103 -2.796  6.923   1.00 49.53  ? 709 DT  B C6    1 
ATOM   226  P P     . DT  A 1 12  ? 155.899 -7.558  8.018   1.00 53.77  ? 710 DT  B P     1 
ATOM   227  O OP1   . DT  A 1 12  ? 154.620 -8.288  7.837   1.00 59.07  ? 710 DT  B OP1   1 
ATOM   228  O OP2   . DT  A 1 12  ? 156.536 -7.529  9.358   1.00 45.33  ? 710 DT  B OP2   1 
ATOM   229  O "O5'" . DT  A 1 12  ? 156.817 -8.108  6.858   1.00 37.04  ? 710 DT  B "O5'" 1 
ATOM   230  C "C5'" . DT  A 1 12  ? 156.363 -8.056  5.528   1.00 40.90  ? 710 DT  B "C5'" 1 
ATOM   231  C "C4'" . DT  A 1 12  ? 157.031 -9.109  4.676   1.00 46.26  ? 710 DT  B "C4'" 1 
ATOM   232  O "O4'" . DT  A 1 12  ? 158.384 -8.725  4.343   1.00 53.84  ? 710 DT  B "O4'" 1 
ATOM   233  C "C3'" . DT  A 1 12  ? 157.176 -10.492 5.275   1.00 42.61  ? 710 DT  B "C3'" 1 
ATOM   234  O "O3'" . DT  A 1 12  ? 157.324 -11.354 4.149   1.00 50.65  ? 710 DT  B "O3'" 1 
ATOM   235  C "C2'" . DT  A 1 12  ? 158.519 -10.386 5.990   1.00 42.72  ? 710 DT  B "C2'" 1 
ATOM   236  C "C1'" . DT  A 1 12  ? 159.330 -9.600  4.968   1.00 47.35  ? 710 DT  B "C1'" 1 
ATOM   237  N N1    . DT  A 1 12  ? 160.389 -8.716  5.498   1.00 44.79  ? 710 DT  B N1    1 
ATOM   238  C C2    . DT  A 1 12  ? 161.542 -8.546  4.748   1.00 46.77  ? 710 DT  B C2    1 
ATOM   239  O O2    . DT  A 1 12  ? 161.745 -9.124  3.687   1.00 51.90  ? 710 DT  B O2    1 
ATOM   240  N N3    . DT  A 1 12  ? 162.460 -7.682  5.296   1.00 40.77  ? 710 DT  B N3    1 
ATOM   241  C C4    . DT  A 1 12  ? 162.342 -6.984  6.478   1.00 43.25  ? 710 DT  B C4    1 
ATOM   242  O O4    . DT  A 1 12  ? 163.250 -6.243  6.845   1.00 50.25  ? 710 DT  B O4    1 
ATOM   243  C C5    . DT  A 1 12  ? 161.107 -7.196  7.201   1.00 39.79  ? 710 DT  B C5    1 
ATOM   244  C C7    . DT  A 1 12  ? 160.890 -6.476  8.496   1.00 36.72  ? 710 DT  B C7    1 
ATOM   245  C C6    . DT  A 1 12  ? 160.203 -8.035  6.677   1.00 40.56  ? 710 DT  B C6    1 
ATOM   246  P P     . DT  A 1 13  ? 157.335 -12.932 4.318   1.00 63.33  ? 711 DT  B P     1 
ATOM   247  O OP1   . DT  A 1 13  ? 156.681 -13.534 3.128   1.00 62.91  ? 711 DT  B OP1   1 
ATOM   248  O OP2   . DT  A 1 13  ? 156.850 -13.241 5.683   1.00 62.30  ? 711 DT  B OP2   1 
ATOM   249  O "O5'" . DT  A 1 13  ? 158.853 -13.295 4.095   1.00 61.75  ? 711 DT  B "O5'" 1 
ATOM   250  C "C5'" . DT  A 1 13  ? 159.397 -13.186 2.793   1.00 68.60  ? 711 DT  B "C5'" 1 
ATOM   251  C "C4'" . DT  A 1 13  ? 160.875 -13.481 2.786   1.00 65.49  ? 711 DT  B "C4'" 1 
ATOM   252  O "O4'" . DT  A 1 13  ? 161.593 -12.488 3.549   1.00 64.36  ? 711 DT  B "O4'" 1 
ATOM   253  C "C3'" . DT  A 1 13  ? 161.262 -14.824 3.387   1.00 60.56  ? 711 DT  B "C3'" 1 
ATOM   254  O "O3'" . DT  A 1 13  ? 162.333 -15.325 2.608   1.00 69.85  ? 711 DT  B "O3'" 1 
ATOM   255  C "C2'" . DT  A 1 13  ? 161.777 -14.447 4.772   1.00 56.71  ? 711 DT  B "C2'" 1 
ATOM   256  C "C1'" . DT  A 1 13  ? 162.465 -13.139 4.459   1.00 56.39  ? 711 DT  B "C1'" 1 
ATOM   257  N N1    . DT  A 1 13  ? 162.652 -12.212 5.570   1.00 49.13  ? 711 DT  B N1    1 
ATOM   258  C C2    . DT  A 1 13  ? 163.746 -11.392 5.511   1.00 49.72  ? 711 DT  B C2    1 
ATOM   259  O O2    . DT  A 1 13  ? 164.556 -11.445 4.592   1.00 55.90  ? 711 DT  B O2    1 
ATOM   260  N N3    . DT  A 1 13  ? 163.865 -10.518 6.561   1.00 42.84  ? 711 DT  B N3    1 
ATOM   261  C C4    . DT  A 1 13  ? 163.005 -10.393 7.634   1.00 44.56  ? 711 DT  B C4    1 
ATOM   262  O O4    . DT  A 1 13  ? 163.233 -9.562  8.521   1.00 45.40  ? 711 DT  B O4    1 
ATOM   263  C C5    . DT  A 1 13  ? 161.871 -11.288 7.617   1.00 43.69  ? 711 DT  B C5    1 
ATOM   264  C C7    . DT  A 1 13  ? 160.887 -11.222 8.738   1.00 45.25  ? 711 DT  B C7    1 
ATOM   265  C C6    . DT  A 1 13  ? 161.750 -12.138 6.595   1.00 44.02  ? 711 DT  B C6    1 
ATOM   266  P P     . DT  A 1 14  ? 162.570 -16.892 2.516   1.00 79.93  ? 712 DT  B P     1 
ATOM   267  O OP1   . DT  A 1 14  ? 161.418 -17.471 1.783   1.00 78.49  ? 712 DT  B OP1   1 
ATOM   268  O OP2   . DT  A 1 14  ? 162.862 -17.330 3.906   1.00 81.16  ? 712 DT  B OP2   1 
ATOM   269  O "O5'" . DT  A 1 14  ? 163.896 -17.012 1.628   1.00 73.32  ? 712 DT  B "O5'" 1 
ATOM   270  C "C5'" . DT  A 1 14  ? 164.424 -15.881 0.945   1.00 77.40  ? 712 DT  B "C5'" 1 
ATOM   271  C "C4'" . DT  A 1 14  ? 165.876 -15.639 1.309   1.00 73.22  ? 712 DT  B "C4'" 1 
ATOM   272  O "O4'" . DT  A 1 14  ? 165.952 -14.744 2.450   1.00 68.87  ? 712 DT  B "O4'" 1 
ATOM   273  C "C3'" . DT  A 1 14  ? 166.660 -16.900 1.704   1.00 76.11  ? 712 DT  B "C3'" 1 
ATOM   274  O "O3'" . DT  A 1 14  ? 168.031 -16.767 1.262   1.00 92.74  ? 712 DT  B "O3'" 1 
ATOM   275  C "C2'" . DT  A 1 14  ? 166.625 -16.823 3.224   1.00 70.16  ? 712 DT  B "C2'" 1 
ATOM   276  C "C1'" . DT  A 1 14  ? 166.786 -15.329 3.435   1.00 64.91  ? 712 DT  B "C1'" 1 
ATOM   277  N N1    . DT  A 1 14  ? 166.397 -14.827 4.773   1.00 56.53  ? 712 DT  B N1    1 
ATOM   278  C C2    . DT  A 1 14  ? 167.102 -13.757 5.293   1.00 50.26  ? 712 DT  B C2    1 
ATOM   279  O O2    . DT  A 1 14  ? 168.018 -13.213 4.699   1.00 52.86  ? 712 DT  B O2    1 
ATOM   280  N N3    . DT  A 1 14  ? 166.696 -13.340 6.532   1.00 42.04  ? 712 DT  B N3    1 
ATOM   281  C C4    . DT  A 1 14  ? 165.688 -13.869 7.298   1.00 47.41  ? 712 DT  B C4    1 
ATOM   282  O O4    . DT  A 1 14  ? 165.442 -13.385 8.410   1.00 43.75  ? 712 DT  B O4    1 
ATOM   283  C C5    . DT  A 1 14  ? 164.987 -14.996 6.699   1.00 53.51  ? 712 DT  B C5    1 
ATOM   284  C C7    . DT  A 1 14  ? 163.872 -15.639 7.464   1.00 56.30  ? 712 DT  B C7    1 
ATOM   285  C C6    . DT  A 1 14  ? 165.373 -15.415 5.480   1.00 51.96  ? 712 DT  B C6    1 
ATOM   286  P P     . DC  A 1 15  ? 168.753 -17.892 0.335   1.00 100.00 ? 713 DC  B P     1 
ATOM   287  O OP1   . DC  A 1 15  ? 169.920 -17.200 -0.277  1.00 100.00 ? 713 DC  B OP1   1 
ATOM   288  O OP2   . DC  A 1 15  ? 167.778 -18.603 -0.535  1.00 100.00 ? 713 DC  B OP2   1 
ATOM   289  O "O5'" . DC  A 1 15  ? 169.295 -18.971 1.371   1.00 87.00  ? 713 DC  B "O5'" 1 
ATOM   290  C "C5'" . DC  A 1 15  ? 169.518 -18.617 2.724   1.00 91.83  ? 713 DC  B "C5'" 1 
ATOM   291  C "C4'" . DC  A 1 15  ? 170.609 -17.580 2.828   1.00 88.00  ? 713 DC  B "C4'" 1 
ATOM   292  O "O4'" . DC  A 1 15  ? 170.106 -16.420 3.528   1.00 83.47  ? 713 DC  B "O4'" 1 
ATOM   293  C "C3'" . DC  A 1 15  ? 171.836 -18.077 3.583   1.00 90.05  ? 713 DC  B "C3'" 1 
ATOM   294  O "O3'" . DC  A 1 15  ? 173.027 -17.849 2.822   1.00 98.97  ? 713 DC  B "O3'" 1 
ATOM   295  C "C2'" . DC  A 1 15  ? 171.897 -17.265 4.865   1.00 86.63  ? 713 DC  B "C2'" 1 
ATOM   296  C "C1'" . DC  A 1 15  ? 170.805 -16.209 4.747   1.00 79.69  ? 713 DC  B "C1'" 1 
ATOM   297  N N1    . DC  A 1 15  ? 169.857 -16.247 5.871   1.00 69.77  ? 713 DC  B N1    1 
ATOM   298  C C2    . DC  A 1 15  ? 170.074 -15.385 6.949   1.00 65.73  ? 713 DC  B C2    1 
ATOM   299  O O2    . DC  A 1 15  ? 171.044 -14.610 6.903   1.00 64.86  ? 713 DC  B O2    1 
ATOM   300  N N3    . DC  A 1 15  ? 169.222 -15.411 8.002   1.00 64.17  ? 713 DC  B N3    1 
ATOM   301  C C4    . DC  A 1 15  ? 168.186 -16.264 7.997   1.00 63.39  ? 713 DC  B C4    1 
ATOM   302  N N4    . DC  A 1 15  ? 167.370 -16.263 9.046   1.00 58.89  ? 713 DC  B N4    1 
ATOM   303  C C5    . DC  A 1 15  ? 167.947 -17.161 6.912   1.00 64.00  ? 713 DC  B C5    1 
ATOM   304  C C6    . DC  A 1 15  ? 168.804 -17.121 5.880   1.00 66.99  ? 713 DC  B C6    1 
ATOM   305  P P     . DG  A 1 16  ? 174.421 -18.450 3.357   1.00 100.00 ? 714 DG  B P     1 
ATOM   306  O OP1   . DG  A 1 16  ? 175.401 -18.283 2.254   1.00 100.00 ? 714 DG  B OP1   1 
ATOM   307  O OP2   . DG  A 1 16  ? 174.149 -19.809 3.902   1.00 100.00 ? 714 DG  B OP2   1 
ATOM   308  O "O5'" . DG  A 1 16  ? 174.820 -17.483 4.562   1.00 82.75  ? 714 DG  B "O5'" 1 
ATOM   309  C "C5'" . DG  A 1 16  ? 175.015 -17.988 5.877   1.00 87.09  ? 714 DG  B "C5'" 1 
ATOM   310  C "C4'" . DG  A 1 16  ? 174.908 -16.873 6.897   1.00 86.45  ? 714 DG  B "C4'" 1 
ATOM   311  O "O4'" . DG  A 1 16  ? 173.520 -16.617 7.155   1.00 84.34  ? 714 DG  B "O4'" 1 
ATOM   312  C "C3'" . DG  A 1 16  ? 175.511 -17.203 8.259   1.00 87.80  ? 714 DG  B "C3'" 1 
ATOM   313  O "O3'" . DG  A 1 16  ? 176.849 -16.697 8.337   1.00 96.25  ? 714 DG  B "O3'" 1 
ATOM   314  C "C2'" . DG  A 1 16  ? 174.639 -16.438 9.247   1.00 82.86  ? 714 DG  B "C2'" 1 
ATOM   315  C "C1'" . DG  A 1 16  ? 173.322 -16.256 8.515   1.00 77.00  ? 714 DG  B "C1'" 1 
ATOM   316  N N9    . DG  A 1 16  ? 172.206 -17.033 9.041   1.00 63.07  ? 714 DG  B N9    1 
ATOM   317  C C8    . DG  A 1 16  ? 171.640 -18.172 8.499   1.00 58.00  ? 714 DG  B C8    1 
ATOM   318  N N7    . DG  A 1 16  ? 170.643 -18.627 9.208   1.00 54.20  ? 714 DG  B N7    1 
ATOM   319  C C5    . DG  A 1 16  ? 170.546 -17.727 10.271  1.00 54.32  ? 714 DG  B C5    1 
ATOM   320  C C6    . DG  A 1 16  ? 169.646 -17.687 11.371  1.00 60.76  ? 714 DG  B C6    1 
ATOM   321  O O6    . DG  A 1 16  ? 168.723 -18.467 11.641  1.00 64.51  ? 714 DG  B O6    1 
ATOM   322  N N1    . DG  A 1 16  ? 169.904 -16.606 12.211  1.00 61.62  ? 714 DG  B N1    1 
ATOM   323  C C2    . DG  A 1 16  ? 170.898 -15.683 12.013  1.00 62.04  ? 714 DG  B C2    1 
ATOM   324  N N2    . DG  A 1 16  ? 170.993 -14.713 12.930  1.00 63.97  ? 714 DG  B N2    1 
ATOM   325  N N3    . DG  A 1 16  ? 171.738 -15.707 10.989  1.00 56.89  ? 714 DG  B N3    1 
ATOM   326  C C4    . DG  A 1 16  ? 171.503 -16.745 10.170  1.00 55.25  ? 714 DG  B C4    1 
ATOM   327  P P     . DT  A 1 17  ? 177.780 -17.112 9.583   1.00 100.00 ? 715 DT  B P     1 
ATOM   328  O OP1   . DT  A 1 17  ? 179.080 -16.414 9.402   1.00 100.00 ? 715 DT  B OP1   1 
ATOM   329  O OP2   . DT  A 1 17  ? 177.770 -18.595 9.748   1.00 100.00 ? 715 DT  B OP2   1 
ATOM   330  O "O5'" . DT  A 1 17  ? 177.056 -16.462 10.842  1.00 90.22  ? 715 DT  B "O5'" 1 
ATOM   331  C "C5'" . DT  A 1 17  ? 177.454 -15.177 11.301  1.00 96.84  ? 715 DT  B "C5'" 1 
ATOM   332  C "C4'" . DT  A 1 17  ? 176.813 -14.867 12.639  1.00 93.26  ? 715 DT  B "C4'" 1 
ATOM   333  O "O4'" . DT  A 1 17  ? 175.457 -15.388 12.647  1.00 89.97  ? 715 DT  B "O4'" 1 
ATOM   334  C "C3'" . DT  A 1 17  ? 177.533 -15.492 13.823  1.00 91.87  ? 715 DT  B "C3'" 1 
ATOM   335  O "O3'" . DT  A 1 17  ? 177.572 -14.567 14.905  1.00 100.00 ? 715 DT  B "O3'" 1 
ATOM   336  C "C2'" . DT  A 1 17  ? 176.663 -16.697 14.186  1.00 90.36  ? 715 DT  B "C2'" 1 
ATOM   337  C "C1'" . DT  A 1 17  ? 175.268 -16.277 13.726  1.00 84.41  ? 715 DT  B "C1'" 1 
ATOM   338  N N1    . DT  A 1 17  ? 174.416 -17.385 13.253  1.00 72.09  ? 715 DT  B N1    1 
ATOM   339  C C2    . DT  A 1 17  ? 173.279 -17.680 13.973  1.00 67.47  ? 715 DT  B C2    1 
ATOM   340  O O2    . DT  A 1 17  ? 172.950 -17.068 14.976  1.00 68.54  ? 715 DT  B O2    1 
ATOM   341  N N3    . DT  A 1 17  ? 172.536 -18.720 13.473  1.00 62.40  ? 715 DT  B N3    1 
ATOM   342  C C4    . DT  A 1 17  ? 172.810 -19.477 12.350  1.00 64.09  ? 715 DT  B C4    1 
ATOM   343  O O4    . DT  A 1 17  ? 172.044 -20.389 12.018  1.00 63.90  ? 715 DT  B O4    1 
ATOM   344  C C5    . DT  A 1 17  ? 174.020 -19.111 11.642  1.00 65.23  ? 715 DT  B C5    1 
ATOM   345  C C7    . DT  A 1 17  ? 174.395 -19.875 10.411  1.00 66.41  ? 715 DT  B C7    1 
ATOM   346  C C6    . DT  A 1 17  ? 174.753 -18.097 12.123  1.00 65.70  ? 715 DT  B C6    1 
ATOM   347  N N     . ALA B 2 1   ? 155.471 -3.923  -15.709 1.00 62.71  ? 2   ALA A N     1 
ATOM   348  C CA    . ALA B 2 1   ? 155.011 -4.247  -14.369 1.00 68.78  ? 2   ALA A CA    1 
ATOM   349  C C     . ALA B 2 1   ? 155.556 -3.275  -13.343 1.00 79.70  ? 2   ALA A C     1 
ATOM   350  O O     . ALA B 2 1   ? 154.871 -2.900  -12.345 1.00 88.00  ? 2   ALA A O     1 
ATOM   351  C CB    . ALA B 2 1   ? 155.409 -5.677  -13.992 1.00 71.04  ? 2   ALA A CB    1 
ATOM   352  N N     . THR B 2 2   ? 156.793 -2.866  -13.586 1.00 65.15  ? 3   THR A N     1 
ATOM   353  C CA    . THR B 2 2   ? 157.468 -1.950  -12.704 1.00 59.15  ? 3   THR A CA    1 
ATOM   354  C C     . THR B 2 2   ? 157.884 -0.674  -13.408 1.00 55.20  ? 3   THR A C     1 
ATOM   355  O O     . THR B 2 2   ? 158.036 -0.641  -14.647 1.00 49.49  ? 3   THR A O     1 
ATOM   356  C CB    . THR B 2 2   ? 158.640 -2.664  -12.008 1.00 56.51  ? 3   THR A CB    1 
ATOM   357  O OG1   . THR B 2 2   ? 158.213 -3.103  -10.719 1.00 73.34  ? 3   THR A OG1   1 
ATOM   358  C CG2   . THR B 2 2   ? 159.806 -1.748  -11.796 1.00 68.71  ? 3   THR A CG2   1 
ATOM   359  N N     . ILE B 2 3   ? 158.061 0.387   -12.629 1.00 51.56  ? 4   ILE A N     1 
ATOM   360  C CA    . ILE B 2 3   ? 158.484 1.633   -13.229 1.00 53.41  ? 4   ILE A CA    1 
ATOM   361  C C     . ILE B 2 3   ? 159.830 1.404   -14.009 1.00 62.98  ? 4   ILE A C     1 
ATOM   362  O O     . ILE B 2 3   ? 160.125 2.072   -15.016 1.00 58.75  ? 4   ILE A O     1 
ATOM   363  C CB    . ILE B 2 3   ? 158.608 2.699   -12.199 1.00 55.11  ? 4   ILE A CB    1 
ATOM   364  C CG1   . ILE B 2 3   ? 158.230 4.045   -12.815 1.00 55.08  ? 4   ILE A CG1   1 
ATOM   365  C CG2   . ILE B 2 3   ? 159.993 2.700   -11.616 1.00 55.07  ? 4   ILE A CG2   1 
ATOM   366  C CD1   . ILE B 2 3   ? 157.449 4.935   -11.881 1.00 87.57  ? 4   ILE A CD1   1 
ATOM   367  N N     . LYS B 2 4   ? 160.613 0.430   -13.520 1.00 64.61  ? 5   LYS A N     1 
ATOM   368  C CA    . LYS B 2 4   ? 161.915 -0.003  -14.085 1.00 59.56  ? 5   LYS A CA    1 
ATOM   369  C C     . LYS B 2 4   ? 161.761 -0.553  -15.495 1.00 60.38  ? 5   LYS A C     1 
ATOM   370  O O     . LYS B 2 4   ? 162.391 -0.094  -16.417 1.00 63.38  ? 5   LYS A O     1 
ATOM   371  C CB    . LYS B 2 4   ? 162.476 -1.134  -13.243 1.00 54.17  ? 5   LYS A CB    1 
ATOM   372  C CG    . LYS B 2 4   ? 163.961 -1.095  -13.077 1.00 86.54  ? 5   LYS A CG    1 
ATOM   373  C CD    . LYS B 2 4   ? 164.307 -0.538  -11.710 1.00 100.00 ? 5   LYS A CD    1 
ATOM   374  C CE    . LYS B 2 4   ? 163.607 -1.306  -10.600 1.00 100.00 ? 5   LYS A CE    1 
ATOM   375  N NZ    . LYS B 2 4   ? 164.366 -1.228  -9.312  1.00 100.00 ? 5   LYS A NZ    1 
ATOM   376  N N     . ASP B 2 5   ? 160.917 -1.552  -15.641 1.00 56.27  ? 6   ASP A N     1 
ATOM   377  C CA    . ASP B 2 5   ? 160.696 -2.164  -16.928 1.00 58.64  ? 6   ASP A CA    1 
ATOM   378  C C     . ASP B 2 5   ? 160.262 -1.147  -17.868 1.00 64.94  ? 6   ASP A C     1 
ATOM   379  O O     . ASP B 2 5   ? 160.552 -1.231  -19.052 1.00 70.18  ? 6   ASP A O     1 
ATOM   380  C CB    . ASP B 2 5   ? 159.666 -3.275  -16.807 1.00 64.44  ? 6   ASP A CB    1 
ATOM   381  C CG    . ASP B 2 5   ? 159.840 -4.060  -15.516 1.00 82.37  ? 6   ASP A CG    1 
ATOM   382  O OD1   . ASP B 2 5   ? 160.886 -4.723  -15.344 1.00 85.53  ? 6   ASP A OD1   1 
ATOM   383  O OD2   . ASP B 2 5   ? 158.993 -3.933  -14.628 1.00 80.63  ? 6   ASP A OD2   1 
ATOM   384  N N     . VAL B 2 6   ? 159.568 -0.153  -17.349 1.00 65.46  ? 7   VAL A N     1 
ATOM   385  C CA    . VAL B 2 6   ? 159.096 0.916   -18.216 1.00 67.35  ? 7   VAL A CA    1 
ATOM   386  C C     . VAL B 2 6   ? 160.257 1.827   -18.593 1.00 73.25  ? 7   VAL A C     1 
ATOM   387  O O     . VAL B 2 6   ? 160.526 2.031   -19.777 1.00 69.93  ? 7   VAL A O     1 
ATOM   388  C CB    . VAL B 2 6   ? 157.973 1.758   -17.560 1.00 67.79  ? 7   VAL A CB    1 
ATOM   389  C CG1   . VAL B 2 6   ? 157.203 2.568   -18.611 1.00 63.45  ? 7   VAL A CG1   1 
ATOM   390  C CG2   . VAL B 2 6   ? 157.051 0.850   -16.785 1.00 68.39  ? 7   VAL A CG2   1 
ATOM   391  N N     . ALA B 2 7   ? 160.929 2.373   -17.573 1.00 68.30  ? 8   ALA A N     1 
ATOM   392  C CA    . ALA B 2 7   ? 162.062 3.281   -17.766 1.00 64.47  ? 8   ALA A CA    1 
ATOM   393  C C     . ALA B 2 7   ? 163.034 2.683   -18.789 1.00 70.35  ? 8   ALA A C     1 
ATOM   394  O O     . ALA B 2 7   ? 163.442 3.340   -19.778 1.00 63.16  ? 8   ALA A O     1 
ATOM   395  C CB    . ALA B 2 7   ? 162.743 3.573   -16.416 1.00 61.75  ? 8   ALA A CB    1 
ATOM   396  N N     . LYS B 2 8   ? 163.364 1.416   -18.539 1.00 76.07  ? 9   LYS A N     1 
ATOM   397  C CA    . LYS B 2 8   ? 164.266 0.641   -19.377 1.00 78.09  ? 9   LYS A CA    1 
ATOM   398  C C     . LYS B 2 8   ? 163.733 0.674   -20.781 1.00 80.47  ? 9   LYS A C     1 
ATOM   399  O O     . LYS B 2 8   ? 164.387 1.124   -21.704 1.00 87.75  ? 9   LYS A O     1 
ATOM   400  C CB    . LYS B 2 8   ? 164.329 -0.826  -18.901 1.00 80.65  ? 9   LYS A CB    1 
ATOM   401  C CG    . LYS B 2 8   ? 164.872 -1.027  -17.473 1.00 100.00 ? 9   LYS A CG    1 
ATOM   402  C CD    . LYS B 2 8   ? 164.930 -2.522  -17.043 1.00 100.00 ? 9   LYS A CD    1 
ATOM   403  C CE    . LYS B 2 8   ? 164.120 -2.825  -15.751 1.00 100.00 ? 9   LYS A CE    1 
ATOM   404  N NZ    . LYS B 2 8   ? 164.617 -3.944  -14.873 1.00 92.09  ? 9   LYS A NZ    1 
ATOM   405  N N     . ARG B 2 9   ? 162.529 0.178   -20.929 1.00 70.50  ? 10  ARG A N     1 
ATOM   406  C CA    . ARG B 2 9   ? 161.856 0.130   -22.209 1.00 71.44  ? 10  ARG A CA    1 
ATOM   407  C C     . ARG B 2 9   ? 161.918 1.496   -22.951 1.00 75.86  ? 10  ARG A C     1 
ATOM   408  O O     . ARG B 2 9   ? 162.048 1.556   -24.173 1.00 69.96  ? 10  ARG A O     1 
ATOM   409  C CB    . ARG B 2 9   ? 160.382 -0.251  -21.915 1.00 79.14  ? 10  ARG A CB    1 
ATOM   410  C CG    . ARG B 2 9   ? 159.476 -0.428  -23.126 1.00 89.85  ? 10  ARG A CG    1 
ATOM   411  C CD    . ARG B 2 9   ? 159.306 -1.902  -23.428 1.00 100.00 ? 10  ARG A CD    1 
ATOM   412  N NE    . ARG B 2 9   ? 158.347 -2.183  -24.492 1.00 100.00 ? 10  ARG A NE    1 
ATOM   413  C CZ    . ARG B 2 9   ? 158.256 -1.504  -25.634 1.00 100.00 ? 10  ARG A CZ    1 
ATOM   414  N NH1   . ARG B 2 9   ? 159.068 -0.481  -25.881 1.00 73.03  ? 10  ARG A NH1   1 
ATOM   415  N NH2   . ARG B 2 9   ? 157.342 -1.862  -26.536 1.00 100.00 ? 10  ARG A NH2   1 
ATOM   416  N N     . ALA B 2 10  ? 161.829 2.588   -22.198 1.00 78.94  ? 11  ALA A N     1 
ATOM   417  C CA    . ALA B 2 10  ? 161.857 3.924   -22.772 1.00 77.33  ? 11  ALA A CA    1 
ATOM   418  C C     . ALA B 2 10  ? 163.232 4.516   -22.906 1.00 72.96  ? 11  ALA A C     1 
ATOM   419  O O     . ALA B 2 10  ? 163.400 5.608   -23.434 1.00 74.97  ? 11  ALA A O     1 
ATOM   420  C CB    . ALA B 2 10  ? 160.982 4.841   -21.945 1.00 78.94  ? 11  ALA A CB    1 
ATOM   421  N N     . ASN B 2 11  ? 164.221 3.803   -22.423 1.00 68.04  ? 12  ASN A N     1 
ATOM   422  C CA    . ASN B 2 11  ? 165.575 4.299   -22.513 1.00 68.33  ? 12  ASN A CA    1 
ATOM   423  C C     . ASN B 2 11  ? 165.645 5.556   -21.694 1.00 71.70  ? 12  ASN A C     1 
ATOM   424  O O     . ASN B 2 11  ? 166.168 6.571   -22.172 1.00 83.87  ? 12  ASN A O     1 
ATOM   425  C CB    . ASN B 2 11  ? 165.975 4.642   -23.968 1.00 60.63  ? 12  ASN A CB    1 
ATOM   426  C CG    . ASN B 2 11  ? 166.115 3.409   -24.861 1.00 100.00 ? 12  ASN A CG    1 
ATOM   427  O OD1   . ASN B 2 11  ? 166.355 2.285   -24.385 1.00 100.00 ? 12  ASN A OD1   1 
ATOM   428  N ND2   . ASN B 2 11  ? 165.952 3.615   -26.171 1.00 100.00 ? 12  ASN A ND2   1 
ATOM   429  N N     . VAL B 2 12  ? 165.127 5.515   -20.470 1.00 47.06  ? 13  VAL A N     1 
ATOM   430  C CA    . VAL B 2 12  ? 165.187 6.700   -19.639 1.00 42.10  ? 13  VAL A CA    1 
ATOM   431  C C     . VAL B 2 12  ? 165.278 6.161   -18.306 1.00 43.53  ? 13  VAL A C     1 
ATOM   432  O O     . VAL B 2 12  ? 165.181 4.985   -18.120 1.00 46.83  ? 13  VAL A O     1 
ATOM   433  C CB    . VAL B 2 12  ? 163.868 7.414   -19.644 1.00 50.38  ? 13  VAL A CB    1 
ATOM   434  C CG1   . VAL B 2 12  ? 163.794 8.365   -20.828 1.00 51.69  ? 13  VAL A CG1   1 
ATOM   435  C CG2   . VAL B 2 12  ? 162.783 6.373   -19.743 1.00 52.47  ? 13  VAL A CG2   1 
ATOM   436  N N     . SER B 2 13  ? 165.451 7.043   -17.357 1.00 39.60  ? 14  SER A N     1 
ATOM   437  C CA    . SER B 2 13  ? 165.553 6.684   -15.968 1.00 36.96  ? 14  SER A CA    1 
ATOM   438  C C     . SER B 2 13  ? 164.130 6.420   -15.379 1.00 60.37  ? 14  SER A C     1 
ATOM   439  O O     . SER B 2 13  ? 163.115 6.651   -16.021 1.00 70.94  ? 14  SER A O     1 
ATOM   440  C CB    . SER B 2 13  ? 166.201 7.875   -15.254 1.00 35.98  ? 14  SER A CB    1 
ATOM   441  O OG    . SER B 2 13  ? 165.652 8.114   -13.982 1.00 64.29  ? 14  SER A OG    1 
ATOM   442  N N     . THR B 2 14  ? 164.073 5.936   -14.158 1.00 55.41  ? 15  THR A N     1 
ATOM   443  C CA    . THR B 2 14  ? 162.818 5.678   -13.531 1.00 54.04  ? 15  THR A CA    1 
ATOM   444  C C     . THR B 2 14  ? 162.388 7.050   -13.028 1.00 59.10  ? 15  THR A C     1 
ATOM   445  O O     . THR B 2 14  ? 161.198 7.395   -13.005 1.00 58.25  ? 15  THR A O     1 
ATOM   446  C CB    . THR B 2 14  ? 162.999 4.778   -12.301 1.00 55.05  ? 15  THR A CB    1 
ATOM   447  O OG1   . THR B 2 14  ? 164.052 5.275   -11.473 1.00 60.03  ? 15  THR A OG1   1 
ATOM   448  C CG2   . THR B 2 14  ? 163.276 3.370   -12.702 1.00 50.67  ? 15  THR A CG2   1 
ATOM   449  N N     . THR B 2 15  ? 163.379 7.824   -12.609 1.00 54.12  ? 16  THR A N     1 
ATOM   450  C CA    . THR B 2 15  ? 163.122 9.160   -12.124 1.00 55.31  ? 16  THR A CA    1 
ATOM   451  C C     . THR B 2 15  ? 162.452 9.878   -13.304 1.00 53.24  ? 16  THR A C     1 
ATOM   452  O O     . THR B 2 15  ? 161.554 10.651  -13.146 1.00 54.78  ? 16  THR A O     1 
ATOM   453  C CB    . THR B 2 15  ? 164.423 9.916   -11.821 1.00 54.04  ? 16  THR A CB    1 
ATOM   454  O OG1   . THR B 2 15  ? 165.229 9.172   -10.900 1.00 59.90  ? 16  THR A OG1   1 
ATOM   455  C CG2   . THR B 2 15  ? 164.103 11.283  -11.249 1.00 42.85  ? 16  THR A CG2   1 
ATOM   456  N N     . THR B 2 16  ? 162.885 9.626   -14.506 1.00 41.52  ? 17  THR A N     1 
ATOM   457  C CA    . THR B 2 16  ? 162.212 10.321  -15.539 1.00 38.23  ? 17  THR A CA    1 
ATOM   458  C C     . THR B 2 16  ? 160.770 9.812   -15.695 1.00 50.59  ? 17  THR A C     1 
ATOM   459  O O     . THR B 2 16  ? 159.846 10.602  -15.808 1.00 56.98  ? 17  THR A O     1 
ATOM   460  C CB    . THR B 2 16  ? 163.001 10.366  -16.825 1.00 41.71  ? 17  THR A CB    1 
ATOM   461  O OG1   . THR B 2 16  ? 163.553 11.671  -16.976 1.00 52.49  ? 17  THR A OG1   1 
ATOM   462  C CG2   . THR B 2 16  ? 162.112 10.126  -18.023 1.00 46.45  ? 17  THR A CG2   1 
ATOM   463  N N     . VAL B 2 17  ? 160.574 8.501   -15.685 1.00 48.73  ? 18  VAL A N     1 
ATOM   464  C CA    . VAL B 2 17  ? 159.240 7.944   -15.830 1.00 45.98  ? 18  VAL A CA    1 
ATOM   465  C C     . VAL B 2 17  ? 158.340 8.533   -14.752 1.00 49.52  ? 18  VAL A C     1 
ATOM   466  O O     . VAL B 2 17  ? 157.258 9.040   -15.023 1.00 52.70  ? 18  VAL A O     1 
ATOM   467  C CB    . VAL B 2 17  ? 159.257 6.412   -15.700 1.00 49.78  ? 18  VAL A CB    1 
ATOM   468  C CG1   . VAL B 2 17  ? 157.854 5.867   -15.427 1.00 50.56  ? 18  VAL A CG1   1 
ATOM   469  C CG2   . VAL B 2 17  ? 159.788 5.796   -16.968 1.00 47.69  ? 18  VAL A CG2   1 
ATOM   470  N N     . SER B 2 18  ? 158.798 8.491   -13.528 1.00 40.60  ? 19  SER A N     1 
ATOM   471  C CA    . SER B 2 18  ? 157.993 9.035   -12.456 1.00 40.40  ? 19  SER A CA    1 
ATOM   472  C C     . SER B 2 18  ? 157.612 10.481  -12.661 1.00 51.52  ? 19  SER A C     1 
ATOM   473  O O     . SER B 2 18  ? 156.630 10.961  -12.123 1.00 53.58  ? 19  SER A O     1 
ATOM   474  C CB    . SER B 2 18  ? 158.736 8.918   -11.133 1.00 39.14  ? 19  SER A CB    1 
ATOM   475  O OG    . SER B 2 18  ? 158.314 9.891   -10.181 1.00 40.51  ? 19  SER A OG    1 
ATOM   476  N N     . HIS B 2 19  ? 158.405 11.195  -13.432 1.00 53.50  ? 20  HIS A N     1 
ATOM   477  C CA    . HIS B 2 19  ? 158.131 12.597  -13.662 1.00 49.06  ? 20  HIS A CA    1 
ATOM   478  C C     . HIS B 2 19  ? 157.084 12.783  -14.709 1.00 47.74  ? 20  HIS A C     1 
ATOM   479  O O     . HIS B 2 19  ? 156.280 13.678  -14.592 1.00 48.24  ? 20  HIS A O     1 
ATOM   480  C CB    . HIS B 2 19  ? 159.430 13.355  -13.987 1.00 50.58  ? 20  HIS A CB    1 
ATOM   481  C CG    . HIS B 2 19  ? 160.222 13.713  -12.767 1.00 52.35  ? 20  HIS A CG    1 
ATOM   482  N ND1   . HIS B 2 19  ? 159.732 14.535  -11.780 1.00 54.75  ? 20  HIS A ND1   1 
ATOM   483  C CD2   . HIS B 2 19  ? 161.455 13.353  -12.367 1.00 51.30  ? 20  HIS A CD2   1 
ATOM   484  C CE1   . HIS B 2 19  ? 160.622 14.674  -10.822 1.00 50.33  ? 20  HIS A CE1   1 
ATOM   485  N NE2   . HIS B 2 19  ? 161.678 13.961  -11.151 1.00 52.23  ? 20  HIS A NE2   1 
ATOM   486  N N     . VAL B 2 20  ? 157.085 11.934  -15.736 1.00 44.64  ? 21  VAL A N     1 
ATOM   487  C CA    . VAL B 2 20  ? 156.075 12.067  -16.778 1.00 47.77  ? 21  VAL A CA    1 
ATOM   488  C C     . VAL B 2 20  ? 154.754 11.570  -16.225 1.00 53.55  ? 21  VAL A C     1 
ATOM   489  O O     . VAL B 2 20  ? 153.714 12.178  -16.402 1.00 56.09  ? 21  VAL A O     1 
ATOM   490  C CB    . VAL B 2 20  ? 156.412 11.321  -18.090 1.00 49.21  ? 21  VAL A CB    1 
ATOM   491  C CG1   . VAL B 2 20  ? 157.897 11.280  -18.336 1.00 50.24  ? 21  VAL A CG1   1 
ATOM   492  C CG2   . VAL B 2 20  ? 155.861 9.949   -18.064 1.00 48.95  ? 21  VAL A CG2   1 
ATOM   493  N N     . ILE B 2 21  ? 154.832 10.454  -15.540 1.00 51.40  ? 22  ILE A N     1 
ATOM   494  C CA    . ILE B 2 21  ? 153.686 9.834   -14.943 1.00 48.12  ? 22  ILE A CA    1 
ATOM   495  C C     . ILE B 2 21  ? 153.024 10.849  -14.062 1.00 49.87  ? 22  ILE A C     1 
ATOM   496  O O     . ILE B 2 21  ? 151.882 11.143  -14.278 1.00 54.73  ? 22  ILE A O     1 
ATOM   497  C CB    . ILE B 2 21  ? 154.077 8.475   -14.237 1.00 48.28  ? 22  ILE A CB    1 
ATOM   498  C CG1   . ILE B 2 21  ? 154.051 7.348   -15.268 1.00 47.86  ? 22  ILE A CG1   1 
ATOM   499  C CG2   . ILE B 2 21  ? 153.164 8.117   -13.108 1.00 34.74  ? 22  ILE A CG2   1 
ATOM   500  C CD1   . ILE B 2 21  ? 153.992 5.981   -14.655 1.00 56.75  ? 22  ILE A CD1   1 
ATOM   501  N N     . ASN B 2 22  ? 153.729 11.416  -13.094 1.00 45.21  ? 23  ASN A N     1 
ATOM   502  C CA    . ASN B 2 22  ? 153.116 12.425  -12.212 1.00 40.12  ? 23  ASN A CA    1 
ATOM   503  C C     . ASN B 2 22  ? 153.184 13.876  -12.646 1.00 48.98  ? 23  ASN A C     1 
ATOM   504  O O     . ASN B 2 22  ? 152.895 14.731  -11.805 1.00 50.55  ? 23  ASN A O     1 
ATOM   505  C CB    . ASN B 2 22  ? 153.731 12.408  -10.811 1.00 29.01  ? 23  ASN A CB    1 
ATOM   506  C CG    . ASN B 2 22  ? 153.637 11.058  -10.137 1.00 76.38  ? 23  ASN A CG    1 
ATOM   507  O OD1   . ASN B 2 22  ? 152.834 10.870  -9.237  1.00 87.74  ? 23  ASN A OD1   1 
ATOM   508  N ND2   . ASN B 2 22  ? 154.471 10.114  -10.562 1.00 59.70  ? 23  ASN A ND2   1 
ATOM   509  N N     . LYS B 2 23  ? 153.576 14.159  -13.904 1.00 51.51  ? 24  LYS A N     1 
ATOM   510  C CA    . LYS B 2 23  ? 153.702 15.552  -14.433 1.00 49.63  ? 24  LYS A CA    1 
ATOM   511  C C     . LYS B 2 23  ? 154.376 16.429  -13.362 1.00 49.29  ? 24  LYS A C     1 
ATOM   512  O O     . LYS B 2 23  ? 153.944 17.524  -13.064 1.00 54.51  ? 24  LYS A O     1 
ATOM   513  C CB    . LYS B 2 23  ? 152.307 16.071  -14.749 1.00 51.49  ? 24  LYS A CB    1 
ATOM   514  C CG    . LYS B 2 23  ? 151.684 15.417  -15.976 1.00 82.66  ? 24  LYS A CG    1 
ATOM   515  C CD    . LYS B 2 23  ? 150.161 15.317  -15.867 1.00 100.00 ? 24  LYS A CD    1 
ATOM   516  C CE    . LYS B 2 23  ? 149.515 15.083  -17.240 1.00 100.00 ? 24  LYS A CE    1 
ATOM   517  N NZ    . LYS B 2 23  ? 150.282 15.646  -18.407 1.00 99.91  ? 24  LYS A NZ    1 
ATOM   518  N N     . THR B 2 24  ? 155.432 15.902  -12.760 1.00 39.54  ? 25  THR A N     1 
ATOM   519  C CA    . THR B 2 24  ? 156.095 16.587  -11.687 1.00 35.32  ? 25  THR A CA    1 
ATOM   520  C C     . THR B 2 24  ? 157.266 17.490  -12.011 1.00 40.97  ? 25  THR A C     1 
ATOM   521  O O     . THR B 2 24  ? 157.739 18.313  -11.195 1.00 34.64  ? 25  THR A O     1 
ATOM   522  C CB    . THR B 2 24  ? 156.219 15.619  -10.510 1.00 30.03  ? 25  THR A CB    1 
ATOM   523  O OG1   . THR B 2 24  ? 156.580 16.266  -9.302  1.00 60.51  ? 25  THR A OG1   1 
ATOM   524  C CG2   . THR B 2 24  ? 157.144 14.537  -10.848 1.00 27.47  ? 25  THR A CG2   1 
ATOM   525  N N     . ARG B 2 25  ? 157.732 17.375  -13.229 1.00 37.52  ? 26  ARG A N     1 
ATOM   526  C CA    . ARG B 2 25  ? 158.811 18.223  -13.603 1.00 43.77  ? 26  ARG A CA    1 
ATOM   527  C C     . ARG B 2 25  ? 158.867 18.208  -15.134 1.00 51.95  ? 26  ARG A C     1 
ATOM   528  O O     . ARG B 2 25  ? 158.391 17.222  -15.763 1.00 55.26  ? 26  ARG A O     1 
ATOM   529  C CB    . ARG B 2 25  ? 160.113 17.849  -12.852 1.00 55.31  ? 26  ARG A CB    1 
ATOM   530  C CG    . ARG B 2 25  ? 161.044 16.983  -13.632 1.00 55.30  ? 26  ARG A CG    1 
ATOM   531  C CD    . ARG B 2 25  ? 162.467 17.216  -13.262 1.00 61.27  ? 26  ARG A CD    1 
ATOM   532  N NE    . ARG B 2 25  ? 163.254 16.038  -13.624 1.00 53.16  ? 26  ARG A NE    1 
ATOM   533  C CZ    . ARG B 2 25  ? 164.193 15.507  -12.855 1.00 58.08  ? 26  ARG A CZ    1 
ATOM   534  N NH1   . ARG B 2 25  ? 164.478 16.054  -11.661 1.00 42.46  ? 26  ARG A NH1   1 
ATOM   535  N NH2   . ARG B 2 25  ? 164.835 14.433  -13.276 1.00 33.17  ? 26  ARG A NH2   1 
ATOM   536  N N     . PHE B 2 26  ? 159.401 19.280  -15.743 1.00 37.98  ? 27  PHE A N     1 
ATOM   537  C CA    . PHE B 2 26  ? 159.433 19.303  -17.189 1.00 36.28  ? 27  PHE A CA    1 
ATOM   538  C C     . PHE B 2 26  ? 160.045 18.080  -17.825 1.00 38.12  ? 27  PHE A C     1 
ATOM   539  O O     . PHE B 2 26  ? 160.968 17.523  -17.283 1.00 46.37  ? 27  PHE A O     1 
ATOM   540  C CB    . PHE B 2 26  ? 159.946 20.614  -17.799 1.00 39.74  ? 27  PHE A CB    1 
ATOM   541  C CG    . PHE B 2 26  ? 160.063 20.521  -19.266 1.00 39.53  ? 27  PHE A CG    1 
ATOM   542  C CD1   . PHE B 2 26  ? 161.204 20.015  -19.850 1.00 42.03  ? 27  PHE A CD1   1 
ATOM   543  C CD2   . PHE B 2 26  ? 159.025 20.863  -20.050 1.00 41.53  ? 27  PHE A CD2   1 
ATOM   544  C CE1   . PHE B 2 26  ? 161.308 19.868  -21.212 1.00 45.23  ? 27  PHE A CE1   1 
ATOM   545  C CE2   . PHE B 2 26  ? 159.114 20.731  -21.426 1.00 49.60  ? 27  PHE A CE2   1 
ATOM   546  C CZ    . PHE B 2 26  ? 160.262 20.231  -22.006 1.00 48.22  ? 27  PHE A CZ    1 
ATOM   547  N N     . VAL B 2 27  ? 159.548 17.643  -18.978 1.00 29.75  ? 28  VAL A N     1 
ATOM   548  C CA    . VAL B 2 27  ? 160.138 16.465  -19.605 1.00 27.79  ? 28  VAL A CA    1 
ATOM   549  C C     . VAL B 2 27  ? 159.970 16.549  -21.053 1.00 43.11  ? 28  VAL A C     1 
ATOM   550  O O     . VAL B 2 27  ? 158.922 16.821  -21.506 1.00 44.33  ? 28  VAL A O     1 
ATOM   551  C CB    . VAL B 2 27  ? 159.517 15.172  -19.143 1.00 29.36  ? 28  VAL A CB    1 
ATOM   552  C CG1   . VAL B 2 27  ? 160.066 13.960  -19.918 1.00 24.88  ? 28  VAL A CG1   1 
ATOM   553  C CG2   . VAL B 2 27  ? 159.637 15.039  -17.636 1.00 28.49  ? 28  VAL A CG2   1 
ATOM   554  N N     . ALA B 2 28  ? 161.035 16.318  -21.789 1.00 59.08  ? 29  ALA A N     1 
ATOM   555  C CA    . ALA B 2 28  ? 160.966 16.394  -23.231 1.00 65.79  ? 29  ALA A CA    1 
ATOM   556  C C     . ALA B 2 28  ? 159.851 15.555  -23.773 1.00 72.21  ? 29  ALA A C     1 
ATOM   557  O O     . ALA B 2 28  ? 159.671 14.418  -23.352 1.00 71.84  ? 29  ALA A O     1 
ATOM   558  C CB    . ALA B 2 28  ? 162.286 15.978  -23.849 1.00 68.27  ? 29  ALA A CB    1 
ATOM   559  N N     . GLU B 2 29  ? 159.109 16.153  -24.702 1.00 73.83  ? 30  GLU A N     1 
ATOM   560  C CA    . GLU B 2 29  ? 157.966 15.529  -25.372 1.00 76.57  ? 30  GLU A CA    1 
ATOM   561  C C     . GLU B 2 29  ? 158.314 14.132  -25.761 1.00 68.69  ? 30  GLU A C     1 
ATOM   562  O O     . GLU B 2 29  ? 157.733 13.195  -25.266 1.00 66.13  ? 30  GLU A O     1 
ATOM   563  C CB    . GLU B 2 29  ? 157.549 16.321  -26.642 1.00 81.37  ? 30  GLU A CB    1 
ATOM   564  C CG    . GLU B 2 29  ? 156.425 17.385  -26.454 1.00 100.00 ? 30  GLU A CG    1 
ATOM   565  C CD    . GLU B 2 29  ? 156.002 18.128  -27.792 1.00 100.00 ? 30  GLU A CD    1 
ATOM   566  O OE1   . GLU B 2 29  ? 156.007 19.402  -27.823 1.00 100.00 ? 30  GLU A OE1   1 
ATOM   567  O OE2   . GLU B 2 29  ? 155.659 17.430  -28.794 1.00 100.00 ? 30  GLU A OE2   1 
ATOM   568  N N     . GLU B 2 30  ? 159.279 14.013  -26.650 1.00 65.71  ? 31  GLU A N     1 
ATOM   569  C CA    . GLU B 2 30  ? 159.749 12.714  -27.137 1.00 69.57  ? 31  GLU A CA    1 
ATOM   570  C C     . GLU B 2 30  ? 159.975 11.738  -25.989 1.00 72.56  ? 31  GLU A C     1 
ATOM   571  O O     . GLU B 2 30  ? 159.740 10.530  -26.096 1.00 77.14  ? 31  GLU A O     1 
ATOM   572  C CB    . GLU B 2 30  ? 161.079 12.925  -27.828 1.00 72.55  ? 31  GLU A CB    1 
ATOM   573  C CG    . GLU B 2 30  ? 161.143 12.435  -29.261 1.00 95.01  ? 31  GLU A CG    1 
ATOM   574  C CD    . GLU B 2 30  ? 162.579 12.435  -29.787 1.00 100.00 ? 31  GLU A CD    1 
ATOM   575  O OE1   . GLU B 2 30  ? 163.517 12.440  -28.929 1.00 100.00 ? 31  GLU A OE1   1 
ATOM   576  O OE2   . GLU B 2 30  ? 162.767 12.476  -31.043 1.00 100.00 ? 31  GLU A OE2   1 
ATOM   577  N N     . THR B 2 31  ? 160.426 12.287  -24.883 1.00 59.94  ? 32  THR A N     1 
ATOM   578  C CA    . THR B 2 31  ? 160.685 11.503  -23.716 1.00 58.24  ? 32  THR A CA    1 
ATOM   579  C C     . THR B 2 31  ? 159.367 11.049  -23.171 1.00 59.58  ? 32  THR A C     1 
ATOM   580  O O     . THR B 2 31  ? 159.139 9.852   -22.988 1.00 56.10  ? 32  THR A O     1 
ATOM   581  C CB    . THR B 2 31  ? 161.454 12.343  -22.740 1.00 76.83  ? 32  THR A CB    1 
ATOM   582  O OG1   . THR B 2 31  ? 162.749 12.539  -23.296 1.00 52.41  ? 32  THR A OG1   1 
ATOM   583  C CG2   . THR B 2 31  ? 161.595 11.641  -21.410 1.00 87.95  ? 32  THR A CG2   1 
ATOM   584  N N     . ARG B 2 32  ? 158.504 12.035  -22.938 1.00 57.02  ? 33  ARG A N     1 
ATOM   585  C CA    . ARG B 2 32  ? 157.151 11.882  -22.445 1.00 54.24  ? 33  ARG A CA    1 
ATOM   586  C C     . ARG B 2 32  ? 156.500 10.746  -23.255 1.00 59.93  ? 33  ARG A C     1 
ATOM   587  O O     . ARG B 2 32  ? 156.037 9.718   -22.718 1.00 58.66  ? 33  ARG A O     1 
ATOM   588  C CB    . ARG B 2 32  ? 156.446 13.180  -22.802 1.00 50.67  ? 33  ARG A CB    1 
ATOM   589  C CG    . ARG B 2 32  ? 155.268 13.568  -21.952 1.00 91.59  ? 33  ARG A CG    1 
ATOM   590  C CD    . ARG B 2 32  ? 155.612 14.667  -20.903 1.00 100.00 ? 33  ARG A CD    1 
ATOM   591  N NE    . ARG B 2 32  ? 156.232 15.865  -21.473 1.00 100.00 ? 33  ARG A NE    1 
ATOM   592  C CZ    . ARG B 2 32  ? 155.838 16.466  -22.601 1.00 100.00 ? 33  ARG A CZ    1 
ATOM   593  N NH1   . ARG B 2 32  ? 154.802 15.968  -23.294 1.00 100.00 ? 33  ARG A NH1   1 
ATOM   594  N NH2   . ARG B 2 32  ? 156.488 17.566  -23.042 1.00 91.73  ? 33  ARG A NH2   1 
ATOM   595  N N     . ASN B 2 33  ? 156.483 10.958  -24.560 1.00 56.70  ? 34  ASN A N     1 
ATOM   596  C CA    . ASN B 2 33  ? 155.936 10.038  -25.529 1.00 58.76  ? 34  ASN A CA    1 
ATOM   597  C C     . ASN B 2 33  ? 156.448 8.697   -25.278 1.00 70.46  ? 34  ASN A C     1 
ATOM   598  O O     . ASN B 2 33  ? 155.703 7.775   -24.964 1.00 79.71  ? 34  ASN A O     1 
ATOM   599  C CB    . ASN B 2 33  ? 156.482 10.393  -26.887 1.00 67.39  ? 34  ASN A CB    1 
ATOM   600  C CG    . ASN B 2 33  ? 156.077 11.764  -27.323 1.00 100.00 ? 34  ASN A CG    1 
ATOM   601  O OD1   . ASN B 2 33  ? 156.699 12.356  -28.222 1.00 100.00 ? 34  ASN A OD1   1 
ATOM   602  N ND2   . ASN B 2 33  ? 155.011 12.293  -26.702 1.00 100.00 ? 34  ASN A ND2   1 
ATOM   603  N N     . ALA B 2 34  ? 157.751 8.603   -25.452 1.00 67.33  ? 35  ALA A N     1 
ATOM   604  C CA    . ALA B 2 34  ? 158.496 7.386   -25.260 1.00 69.72  ? 35  ALA A CA    1 
ATOM   605  C C     . ALA B 2 34  ? 158.023 6.683   -23.995 1.00 67.98  ? 35  ALA A C     1 
ATOM   606  O O     . ALA B 2 34  ? 157.736 5.499   -24.011 1.00 68.85  ? 35  ALA A O     1 
ATOM   607  C CB    . ALA B 2 34  ? 159.955 7.736   -25.153 1.00 72.87  ? 35  ALA A CB    1 
ATOM   608  N N     . VAL B 2 35  ? 157.915 7.441   -22.910 1.00 60.26  ? 36  VAL A N     1 
ATOM   609  C CA    . VAL B 2 35  ? 157.454 6.883   -21.665 1.00 58.41  ? 36  VAL A CA    1 
ATOM   610  C C     . VAL B 2 35  ? 156.066 6.294   -21.782 1.00 65.17  ? 36  VAL A C     1 
ATOM   611  O O     . VAL B 2 35  ? 155.852 5.125   -21.471 1.00 69.70  ? 36  VAL A O     1 
ATOM   612  C CB    . VAL B 2 35  ? 157.379 7.924   -20.585 1.00 59.21  ? 36  VAL A CB    1 
ATOM   613  C CG1   . VAL B 2 35  ? 156.717 7.317   -19.388 1.00 56.06  ? 36  VAL A CG1   1 
ATOM   614  C CG2   . VAL B 2 35  ? 158.771 8.333   -20.223 1.00 60.49  ? 36  VAL A CG2   1 
ATOM   615  N N     . TRP B 2 36  ? 155.121 7.110   -22.212 1.00 60.19  ? 37  TRP A N     1 
ATOM   616  C CA    . TRP B 2 36  ? 153.757 6.646   -22.371 1.00 59.96  ? 37  TRP A CA    1 
ATOM   617  C C     . TRP B 2 36  ? 153.719 5.386   -23.187 1.00 72.71  ? 37  TRP A C     1 
ATOM   618  O O     . TRP B 2 36  ? 153.158 4.382   -22.765 1.00 71.08  ? 37  TRP A O     1 
ATOM   619  C CB    . TRP B 2 36  ? 152.934 7.690   -23.070 1.00 55.40  ? 37  TRP A CB    1 
ATOM   620  C CG    . TRP B 2 36  ? 152.645 8.773   -22.106 1.00 59.48  ? 37  TRP A CG    1 
ATOM   621  C CD1   . TRP B 2 36  ? 152.748 10.082  -22.322 1.00 64.81  ? 37  TRP A CD1   1 
ATOM   622  C CD2   . TRP B 2 36  ? 152.226 8.601   -20.754 1.00 63.17  ? 37  TRP A CD2   1 
ATOM   623  N NE1   . TRP B 2 36  ? 152.406 10.784  -21.176 1.00 68.99  ? 37  TRP A NE1   1 
ATOM   624  C CE2   . TRP B 2 36  ? 152.081 9.883   -20.196 1.00 73.09  ? 37  TRP A CE2   1 
ATOM   625  C CE3   . TRP B 2 36  ? 151.950 7.486   -19.955 1.00 67.71  ? 37  TRP A CE3   1 
ATOM   626  C CZ2   . TRP B 2 36  ? 151.667 10.084  -18.858 1.00 76.52  ? 37  TRP A CZ2   1 
ATOM   627  C CZ3   . TRP B 2 36  ? 151.555 7.677   -18.637 1.00 72.09  ? 37  TRP A CZ3   1 
ATOM   628  C CH2   . TRP B 2 36  ? 151.411 8.959   -18.097 1.00 74.16  ? 37  TRP A CH2   1 
ATOM   629  N N     . ALA B 2 37  ? 154.336 5.453   -24.355 1.00 71.12  ? 38  ALA A N     1 
ATOM   630  C CA    . ALA B 2 37  ? 154.387 4.327   -25.246 1.00 72.51  ? 38  ALA A CA    1 
ATOM   631  C C     . ALA B 2 37  ? 154.835 3.067   -24.502 1.00 76.59  ? 38  ALA A C     1 
ATOM   632  O O     . ALA B 2 37  ? 154.198 2.030   -24.591 1.00 76.49  ? 38  ALA A O     1 
ATOM   633  C CB    . ALA B 2 37  ? 155.326 4.635   -26.376 1.00 73.36  ? 38  ALA A CB    1 
ATOM   634  N N     . ALA B 2 38  ? 155.921 3.169   -23.753 1.00 69.72  ? 39  ALA A N     1 
ATOM   635  C CA    . ALA B 2 38  ? 156.391 2.019   -23.026 1.00 67.88  ? 39  ALA A CA    1 
ATOM   636  C C     . ALA B 2 38  ? 155.302 1.627   -22.063 1.00 70.50  ? 39  ALA A C     1 
ATOM   637  O O     . ALA B 2 38  ? 155.048 0.453   -21.868 1.00 67.98  ? 39  ALA A O     1 
ATOM   638  C CB    . ALA B 2 38  ? 157.671 2.333   -22.277 1.00 67.38  ? 39  ALA A CB    1 
ATOM   639  N N     . ILE B 2 39  ? 154.654 2.619   -21.463 1.00 69.10  ? 40  ILE A N     1 
ATOM   640  C CA    . ILE B 2 39  ? 153.582 2.342   -20.501 1.00 67.02  ? 40  ILE A CA    1 
ATOM   641  C C     . ILE B 2 39  ? 152.463 1.596   -21.147 1.00 72.86  ? 40  ILE A C     1 
ATOM   642  O O     . ILE B 2 39  ? 151.788 0.793   -20.521 1.00 70.99  ? 40  ILE A O     1 
ATOM   643  C CB    . ILE B 2 39  ? 152.944 3.594   -19.852 1.00 65.67  ? 40  ILE A CB    1 
ATOM   644  C CG1   . ILE B 2 39  ? 153.975 4.658   -19.448 1.00 62.69  ? 40  ILE A CG1   1 
ATOM   645  C CG2   . ILE B 2 39  ? 152.217 3.168   -18.602 1.00 65.63  ? 40  ILE A CG2   1 
ATOM   646  C CD1   . ILE B 2 39  ? 153.778 5.167   -18.016 1.00 45.88  ? 40  ILE A CD1   1 
ATOM   647  N N     . LYS B 2 40  ? 152.254 1.872   -22.414 1.00 77.04  ? 41  LYS A N     1 
ATOM   648  C CA    . LYS B 2 40  ? 151.182 1.213   -23.132 1.00 82.96  ? 41  LYS A CA    1 
ATOM   649  C C     . LYS B 2 40  ? 151.489 -0.241  -23.417 1.00 93.08  ? 41  LYS A C     1 
ATOM   650  O O     . LYS B 2 40  ? 150.782 -1.130  -22.954 1.00 93.00  ? 41  LYS A O     1 
ATOM   651  C CB    . LYS B 2 40  ? 150.816 1.979   -24.416 1.00 87.94  ? 41  LYS A CB    1 
ATOM   652  C CG    . LYS B 2 40  ? 150.827 3.512   -24.260 1.00 100.00 ? 41  LYS A CG    1 
ATOM   653  C CD    . LYS B 2 40  ? 150.391 4.012   -22.868 1.00 100.00 ? 41  LYS A CD    1 
ATOM   654  C CE    . LYS B 2 40  ? 150.092 5.516   -22.866 1.00 81.27  ? 41  LYS A CE    1 
ATOM   655  N NZ    . LYS B 2 40  ? 150.076 6.112   -21.496 1.00 82.14  ? 41  LYS A NZ    1 
ATOM   656  N N     . GLU B 2 41  ? 152.546 -0.470  -24.190 1.00 92.36  ? 42  GLU A N     1 
ATOM   657  C CA    . GLU B 2 41  ? 152.956 -1.812  -24.537 1.00 90.21  ? 42  GLU A CA    1 
ATOM   658  C C     . GLU B 2 41  ? 153.103 -2.605  -23.242 1.00 91.65  ? 42  GLU A C     1 
ATOM   659  O O     . GLU B 2 41  ? 152.499 -3.662  -23.084 1.00 95.55  ? 42  GLU A O     1 
ATOM   660  C CB    . GLU B 2 41  ? 154.283 -1.785  -25.325 1.00 90.25  ? 42  GLU A CB    1 
ATOM   661  C CG    . GLU B 2 41  ? 155.142 -0.557  -25.077 1.00 100.00 ? 42  GLU A CG    1 
ATOM   662  C CD    . GLU B 2 41  ? 155.491 0.207   -26.361 1.00 100.00 ? 42  GLU A CD    1 
ATOM   663  O OE1   . GLU B 2 41  ? 154.981 -0.167  -27.454 1.00 100.00 ? 42  GLU A OE1   1 
ATOM   664  O OE2   . GLU B 2 41  ? 156.309 1.160   -26.272 1.00 100.00 ? 42  GLU A OE2   1 
ATOM   665  N N     . LEU B 2 42  ? 153.886 -2.075  -22.315 1.00 80.80  ? 43  LEU A N     1 
ATOM   666  C CA    . LEU B 2 42  ? 154.094 -2.743  -21.056 1.00 79.33  ? 43  LEU A CA    1 
ATOM   667  C C     . LEU B 2 42  ? 152.797 -3.022  -20.393 1.00 85.02  ? 43  LEU A C     1 
ATOM   668  O O     . LEU B 2 42  ? 152.716 -3.955  -19.603 1.00 85.75  ? 43  LEU A O     1 
ATOM   669  C CB    . LEU B 2 42  ? 154.919 -1.892  -20.119 1.00 79.74  ? 43  LEU A CB    1 
ATOM   670  C CG    . LEU B 2 42  ? 156.368 -1.753  -20.527 1.00 89.61  ? 43  LEU A CG    1 
ATOM   671  C CD1   . LEU B 2 42  ? 157.290 -2.191  -19.375 1.00 92.70  ? 43  LEU A CD1   1 
ATOM   672  C CD2   . LEU B 2 42  ? 156.589 -2.580  -21.792 1.00 96.40  ? 43  LEU A CD2   1 
ATOM   673  N N     . HIS B 2 43  ? 151.789 -2.208  -20.709 1.00 84.31  ? 44  HIS A N     1 
ATOM   674  C CA    . HIS B 2 43  ? 150.456 -2.352  -20.126 1.00 86.78  ? 44  HIS A CA    1 
ATOM   675  C C     . HIS B 2 43  ? 150.639 -1.995  -18.651 1.00 89.30  ? 44  HIS A C     1 
ATOM   676  O O     . HIS B 2 43  ? 150.061 -2.637  -17.777 1.00 93.40  ? 44  HIS A O     1 
ATOM   677  C CB    . HIS B 2 43  ? 150.034 -3.835  -20.216 1.00 91.00  ? 44  HIS A CB    1 
ATOM   678  C CG    . HIS B 2 43  ? 148.757 -4.073  -20.947 1.00 97.63  ? 44  HIS A CG    1 
ATOM   679  N ND1   . HIS B 2 43  ? 147.523 -3.703  -20.437 1.00 100.00 ? 44  HIS A ND1   1 
ATOM   680  C CD2   . HIS B 2 43  ? 148.512 -4.661  -22.145 1.00 100.00 ? 44  HIS A CD2   1 
ATOM   681  C CE1   . HIS B 2 43  ? 146.573 -4.045  -21.294 1.00 100.00 ? 44  HIS A CE1   1 
ATOM   682  N NE2   . HIS B 2 43  ? 147.145 -4.628  -22.338 1.00 100.00 ? 44  HIS A NE2   1 
ATOM   683  N N     . TYR B 2 44  ? 151.462 -0.982  -18.381 1.00 77.06  ? 45  TYR A N     1 
ATOM   684  C CA    . TYR B 2 44  ? 151.764 -0.546  -17.014 1.00 69.51  ? 45  TYR A CA    1 
ATOM   685  C C     . TYR B 2 44  ? 150.702 0.173   -16.161 1.00 70.30  ? 45  TYR A C     1 
ATOM   686  O O     . TYR B 2 44  ? 149.905 0.961   -16.652 1.00 71.23  ? 45  TYR A O     1 
ATOM   687  C CB    . TYR B 2 44  ? 153.103 0.227   -16.983 1.00 63.94  ? 45  TYR A CB    1 
ATOM   688  C CG    . TYR B 2 44  ? 153.499 0.812   -15.621 1.00 52.50  ? 45  TYR A CG    1 
ATOM   689  C CD1   . TYR B 2 44  ? 153.966 -0.012  -14.589 1.00 51.87  ? 45  TYR A CD1   1 
ATOM   690  C CD2   . TYR B 2 44  ? 153.397 2.175   -15.369 1.00 47.74  ? 45  TYR A CD2   1 
ATOM   691  C CE1   . TYR B 2 44  ? 154.319 0.505   -13.343 1.00 41.23  ? 45  TYR A CE1   1 
ATOM   692  C CE2   . TYR B 2 44  ? 153.753 2.687   -14.138 1.00 47.13  ? 45  TYR A CE2   1 
ATOM   693  C CZ    . TYR B 2 44  ? 154.211 1.838   -13.128 1.00 54.33  ? 45  TYR A CZ    1 
ATOM   694  O OH    . TYR B 2 44  ? 154.557 2.349   -11.897 1.00 65.75  ? 45  TYR A OH    1 
ATOM   695  N N     . SER B 2 45  ? 150.730 -0.112  -14.865 1.00 59.96  ? 46  SER A N     1 
ATOM   696  C CA    . SER B 2 45  ? 149.835 0.494   -13.916 1.00 58.49  ? 46  SER A CA    1 
ATOM   697  C C     . SER B 2 45  ? 150.690 0.820   -12.672 1.00 59.16  ? 46  SER A C     1 
ATOM   698  O O     . SER B 2 45  ? 151.279 -0.042  -12.046 1.00 57.24  ? 46  SER A O     1 
ATOM   699  C CB    . SER B 2 45  ? 148.720 -0.465  -13.562 1.00 70.62  ? 46  SER A CB    1 
ATOM   700  O OG    . SER B 2 45  ? 147.735 0.199   -12.802 1.00 88.07  ? 46  SER A OG    1 
ATOM   701  N N     . PRO B 2 46  ? 150.771 2.079   -12.330 1.00 54.09  ? 47  PRO A N     1 
ATOM   702  C CA    . PRO B 2 46  ? 151.561 2.485   -11.197 1.00 52.59  ? 47  PRO A CA    1 
ATOM   703  C C     . PRO B 2 46  ? 151.002 1.894   -9.964  1.00 58.47  ? 47  PRO A C     1 
ATOM   704  O O     . PRO B 2 46  ? 149.821 1.945   -9.744  1.00 64.49  ? 47  PRO A O     1 
ATOM   705  C CB    . PRO B 2 46  ? 151.362 3.997   -11.158 1.00 55.99  ? 47  PRO A CB    1 
ATOM   706  C CG    . PRO B 2 46  ? 150.900 4.382   -12.545 1.00 64.12  ? 47  PRO A CG    1 
ATOM   707  C CD    . PRO B 2 46  ? 150.705 3.122   -13.359 1.00 57.44  ? 47  PRO A CD    1 
ATOM   708  N N     . SER B 2 47  ? 151.849 1.333   -9.129  1.00 51.25  ? 48  SER A N     1 
ATOM   709  C CA    . SER B 2 47  ? 151.346 0.755   -7.920  1.00 45.90  ? 48  SER A CA    1 
ATOM   710  C C     . SER B 2 47  ? 151.115 1.850   -6.958  1.00 51.43  ? 48  SER A C     1 
ATOM   711  O O     . SER B 2 47  ? 152.014 2.598   -6.632  1.00 55.63  ? 48  SER A O     1 
ATOM   712  C CB    . SER B 2 47  ? 152.310 -0.239  -7.298  1.00 46.93  ? 48  SER A CB    1 
ATOM   713  O OG    . SER B 2 47  ? 152.101 -0.268  -5.885  1.00 64.33  ? 48  SER A OG    1 
ATOM   714  N N     . ALA B 2 48  ? 149.895 1.964   -6.481  1.00 47.67  ? 49  ALA A N     1 
ATOM   715  C CA    . ALA B 2 48  ? 149.637 3.005   -5.537  1.00 41.67  ? 49  ALA A CA    1 
ATOM   716  C C     . ALA B 2 48  ? 150.128 2.542   -4.165  1.00 45.33  ? 49  ALA A C     1 
ATOM   717  O O     . ALA B 2 48  ? 150.161 3.325   -3.220  1.00 50.01  ? 49  ALA A O     1 
ATOM   718  C CB    . ALA B 2 48  ? 148.182 3.376   -5.533  1.00 40.87  ? 49  ALA A CB    1 
ATOM   719  N N     . VAL B 2 49  ? 150.528 1.287   -4.002  1.00 42.55  ? 50  VAL A N     1 
ATOM   720  C CA    . VAL B 2 49  ? 150.981 0.981   -2.639  1.00 48.62  ? 50  VAL A CA    1 
ATOM   721  C C     . VAL B 2 49  ? 152.411 1.463   -2.501  1.00 51.37  ? 50  VAL A C     1 
ATOM   722  O O     . VAL B 2 49  ? 152.837 1.923   -1.431  1.00 51.73  ? 50  VAL A O     1 
ATOM   723  C CB    . VAL B 2 49  ? 150.735 -0.480  -2.133  1.00 53.93  ? 50  VAL A CB    1 
ATOM   724  C CG1   . VAL B 2 49  ? 150.487 -1.444  -3.283  1.00 51.59  ? 50  VAL A CG1   1 
ATOM   725  C CG2   . VAL B 2 49  ? 151.824 -0.940  -1.122  1.00 53.14  ? 50  VAL A CG2   1 
ATOM   726  N N     . ALA B 2 50  ? 153.129 1.361   -3.617  1.00 42.28  ? 51  ALA A N     1 
ATOM   727  C CA    . ALA B 2 50  ? 154.505 1.785   -3.697  1.00 39.87  ? 51  ALA A CA    1 
ATOM   728  C C     . ALA B 2 50  ? 154.432 3.286   -3.425  1.00 46.51  ? 51  ALA A C     1 
ATOM   729  O O     . ALA B 2 50  ? 154.985 3.773   -2.409  1.00 50.18  ? 51  ALA A O     1 
ATOM   730  C CB    . ALA B 2 50  ? 155.099 1.490   -5.101  1.00 38.91  ? 51  ALA A CB    1 
ATOM   731  N N     . ARG B 2 51  ? 153.739 4.032   -4.291  1.00 32.93  ? 52  ARG A N     1 
ATOM   732  C CA    . ARG B 2 51  ? 153.651 5.469   -4.042  1.00 30.41  ? 52  ARG A CA    1 
ATOM   733  C C     . ARG B 2 51  ? 153.129 5.889   -2.697  1.00 40.25  ? 52  ARG A C     1 
ATOM   734  O O     . ARG B 2 51  ? 153.465 6.946   -2.168  1.00 48.76  ? 52  ARG A O     1 
ATOM   735  C CB    . ARG B 2 51  ? 152.913 6.223   -5.149  1.00 41.09  ? 52  ARG A CB    1 
ATOM   736  C CG    . ARG B 2 51  ? 152.379 7.637   -4.657  1.00 47.76  ? 52  ARG A CG    1 
ATOM   737  C CD    . ARG B 2 51  ? 151.538 8.384   -5.742  1.00 42.10  ? 52  ARG A CD    1 
ATOM   738  N NE    . ARG B 2 51  ? 152.350 9.395   -6.411  1.00 55.17  ? 52  ARG A NE    1 
ATOM   739  C CZ    . ARG B 2 51  ? 152.487 10.639  -5.992  1.00 61.91  ? 52  ARG A CZ    1 
ATOM   740  N NH1   . ARG B 2 51  ? 151.857 11.065  -4.903  1.00 59.82  ? 52  ARG A NH1   1 
ATOM   741  N NH2   . ARG B 2 51  ? 153.257 11.465  -6.668  1.00 95.94  ? 52  ARG A NH2   1 
ATOM   742  N N     . SER B 2 52  ? 152.292 5.068   -2.125  1.00 44.72  ? 53  SER A N     1 
ATOM   743  C CA    . SER B 2 52  ? 151.737 5.412   -0.842  1.00 46.71  ? 53  SER A CA    1 
ATOM   744  C C     . SER B 2 52  ? 152.749 5.276   0.204   1.00 45.92  ? 53  SER A C     1 
ATOM   745  O O     . SER B 2 52  ? 152.767 6.043   1.179   1.00 44.88  ? 53  SER A O     1 
ATOM   746  C CB    . SER B 2 52  ? 150.557 4.528   -0.550  1.00 59.90  ? 53  SER A CB    1 
ATOM   747  O OG    . SER B 2 52  ? 149.430 5.017   -1.269  1.00 98.30  ? 53  SER A OG    1 
ATOM   748  N N     . LEU B 2 53  ? 153.601 4.276   0.002   1.00 48.29  ? 54  LEU A N     1 
ATOM   749  C CA    . LEU B 2 53  ? 154.686 3.980   0.928   1.00 46.51  ? 54  LEU A CA    1 
ATOM   750  C C     . LEU B 2 53  ? 155.568 5.220   0.991   1.00 51.40  ? 54  LEU A C     1 
ATOM   751  O O     . LEU B 2 53  ? 155.917 5.712   2.078   1.00 50.08  ? 54  LEU A O     1 
ATOM   752  C CB    . LEU B 2 53  ? 155.469 2.748   0.477   1.00 45.46  ? 54  LEU A CB    1 
ATOM   753  C CG    . LEU B 2 53  ? 156.408 2.181   1.598   1.00 52.87  ? 54  LEU A CG    1 
ATOM   754  C CD1   . LEU B 2 53  ? 155.914 2.304   3.051   1.00 45.33  ? 54  LEU A CD1   1 
ATOM   755  C CD2   . LEU B 2 53  ? 157.018 0.793   1.322   1.00 55.72  ? 54  LEU A CD2   1 
ATOM   756  N N     . LYS B 2 54  ? 155.900 5.750   -0.183  1.00 47.24  ? 55  LYS A N     1 
ATOM   757  C CA    . LYS B 2 54  ? 156.717 6.921   -0.214  1.00 45.19  ? 55  LYS A CA    1 
ATOM   758  C C     . LYS B 2 54  ? 155.982 8.146   0.237   1.00 55.75  ? 55  LYS A C     1 
ATOM   759  O O     . LYS B 2 54  ? 156.377 8.768   1.238   1.00 61.99  ? 55  LYS A O     1 
ATOM   760  C CB    . LYS B 2 54  ? 157.368 7.140   -1.583  1.00 51.88  ? 55  LYS A CB    1 
ATOM   761  C CG    . LYS B 2 54  ? 158.910 6.954   -1.606  1.00 64.07  ? 55  LYS A CG    1 
ATOM   762  C CD    . LYS B 2 54  ? 159.677 8.252   -1.327  1.00 82.88  ? 55  LYS A CD    1 
ATOM   763  C CE    . LYS B 2 54  ? 161.087 8.012   -0.775  1.00 93.08  ? 55  LYS A CE    1 
ATOM   764  N NZ    . LYS B 2 54  ? 161.355 8.765   0.498   1.00 92.97  ? 55  LYS A NZ    1 
ATOM   765  N N     . VAL B 2 55  ? 154.904 8.513   -0.468  1.00 49.08  ? 56  VAL A N     1 
ATOM   766  C CA    . VAL B 2 55  ? 154.147 9.737   -0.095  1.00 40.20  ? 56  VAL A CA    1 
ATOM   767  C C     . VAL B 2 55  ? 153.398 9.911   1.184   1.00 42.92  ? 56  VAL A C     1 
ATOM   768  O O     . VAL B 2 55  ? 153.019 11.039  1.490   1.00 43.60  ? 56  VAL A O     1 
ATOM   769  C CB    . VAL B 2 55  ? 153.261 10.194  -1.154  1.00 43.61  ? 56  VAL A CB    1 
ATOM   770  C CG1   . VAL B 2 55  ? 153.903 9.927   -2.531  1.00 45.71  ? 56  VAL A CG1   1 
ATOM   771  C CG2   . VAL B 2 55  ? 151.984 9.435   -0.949  1.00 45.40  ? 56  VAL A CG2   1 
ATOM   772  N N     . ASN B 2 56  ? 153.175 8.831   1.944   1.00 42.06  ? 57  ASN A N     1 
ATOM   773  C CA    . ASN B 2 56  ? 152.458 8.908   3.235   1.00 40.71  ? 57  ASN A CA    1 
ATOM   774  C C     . ASN B 2 56  ? 150.980 9.309   3.289   1.00 54.35  ? 57  ASN A C     1 
ATOM   775  O O     . ASN B 2 56  ? 150.565 10.228  4.029   1.00 54.51  ? 57  ASN A O     1 
ATOM   776  C CB    . ASN B 2 56  ? 153.206 9.702   4.281   1.00 30.43  ? 57  ASN A CB    1 
ATOM   777  C CG    . ASN B 2 56  ? 152.777 9.344   5.673   1.00 65.32  ? 57  ASN A CG    1 
ATOM   778  O OD1   . ASN B 2 56  ? 152.195 8.276   5.886   1.00 97.25  ? 57  ASN A OD1   1 
ATOM   779  N ND2   . ASN B 2 56  ? 153.041 10.234  6.641   1.00 46.33  ? 57  ASN A ND2   1 
ATOM   780  N N     . HIS B 2 57  ? 150.180 8.606   2.523   1.00 50.75  ? 58  HIS A N     1 
ATOM   781  C CA    . HIS B 2 57  ? 148.770 8.851   2.515   1.00 51.77  ? 58  HIS A CA    1 
ATOM   782  C C     . HIS B 2 57  ? 148.301 7.841   1.524   1.00 57.28  ? 58  HIS A C     1 
ATOM   783  O O     . HIS B 2 57  ? 149.089 7.409   0.652   1.00 48.24  ? 58  HIS A O     1 
ATOM   784  C CB    . HIS B 2 57  ? 148.381 10.326  2.283   1.00 51.04  ? 58  HIS A CB    1 
ATOM   785  C CG    . HIS B 2 57  ? 148.769 10.866  0.943   1.00 51.98  ? 58  HIS A CG    1 
ATOM   786  N ND1   . HIS B 2 57  ? 149.633 11.932  0.796   1.00 49.26  ? 58  HIS A ND1   1 
ATOM   787  C CD2   . HIS B 2 57  ? 148.396 10.502  -0.311  1.00 52.29  ? 58  HIS A CD2   1 
ATOM   788  C CE1   . HIS B 2 57  ? 149.783 12.188  -0.493  1.00 49.90  ? 58  HIS A CE1   1 
ATOM   789  N NE2   . HIS B 2 57  ? 149.046 11.334  -1.187  1.00 49.65  ? 58  HIS A NE2   1 
ATOM   790  N N     . THR B 2 58  ? 147.055 7.413   1.664   1.00 49.21  ? 59  THR A N     1 
ATOM   791  C CA    . THR B 2 58  ? 146.571 6.404   0.773   1.00 43.00  ? 59  THR A CA    1 
ATOM   792  C C     . THR B 2 58  ? 145.551 6.859   -0.174  1.00 47.92  ? 59  THR A C     1 
ATOM   793  O O     . THR B 2 58  ? 145.212 6.122   -1.108  1.00 49.26  ? 59  THR A O     1 
ATOM   794  C CB    . THR B 2 58  ? 146.036 5.303   1.593   1.00 43.32  ? 59  THR A CB    1 
ATOM   795  O OG1   . THR B 2 58  ? 145.021 5.819   2.454   1.00 57.03  ? 59  THR A OG1   1 
ATOM   796  C CG2   . THR B 2 58  ? 147.125 4.825   2.513   1.00 45.48  ? 59  THR A CG2   1 
ATOM   797  N N     . LYS B 2 59  ? 145.059 8.079   0.063   1.00 44.82  ? 60  LYS A N     1 
ATOM   798  C CA    . LYS B 2 59  ? 144.009 8.713   -0.760  1.00 44.75  ? 60  LYS A CA    1 
ATOM   799  C C     . LYS B 2 59  ? 142.806 7.711   -0.724  1.00 49.22  ? 60  LYS A C     1 
ATOM   800  O O     . LYS B 2 59  ? 142.299 7.208   -1.739  1.00 49.75  ? 60  LYS A O     1 
ATOM   801  C CB    . LYS B 2 59  ? 144.513 8.993   -2.186  1.00 45.93  ? 60  LYS A CB    1 
ATOM   802  C CG    . LYS B 2 59  ? 144.026 10.303  -2.791  1.00 55.34  ? 60  LYS A CG    1 
ATOM   803  C CD    . LYS B 2 59  ? 144.058 11.429  -1.763  1.00 88.99  ? 60  LYS A CD    1 
ATOM   804  C CE    . LYS B 2 59  ? 145.116 12.479  -2.104  1.00 100.00 ? 60  LYS A CE    1 
ATOM   805  N NZ    . LYS B 2 59  ? 144.688 13.464  -3.147  1.00 100.00 ? 60  LYS A NZ    1 
ATOM   806  N N     . SER B 2 60  ? 142.381 7.425   0.487   1.00 44.75  ? 61  SER A N     1 
ATOM   807  C CA    . SER B 2 60  ? 141.316 6.519   0.687   1.00 48.22  ? 61  SER A CA    1 
ATOM   808  C C     . SER B 2 60  ? 140.636 6.749   2.031   1.00 58.28  ? 61  SER A C     1 
ATOM   809  O O     . SER B 2 60  ? 141.296 7.059   3.066   1.00 48.91  ? 61  SER A O     1 
ATOM   810  C CB    . SER B 2 60  ? 141.884 5.128   0.705   1.00 55.53  ? 61  SER A CB    1 
ATOM   811  O OG    . SER B 2 60  ? 142.271 4.794   2.038   1.00 66.10  ? 61  SER A OG    1 
ATOM   812  N N     . ILE B 2 61  ? 139.303 6.585   1.999   1.00 57.46  ? 62  ILE A N     1 
ATOM   813  C CA    . ILE B 2 61  ? 138.473 6.724   3.169   1.00 52.29  ? 62  ILE A CA    1 
ATOM   814  C C     . ILE B 2 61  ? 137.831 5.463   3.747   1.00 45.61  ? 62  ILE A C     1 
ATOM   815  O O     . ILE B 2 61  ? 137.330 4.572   3.025   1.00 40.03  ? 62  ILE A O     1 
ATOM   816  C CB    . ILE B 2 61  ? 137.874 8.142   3.435   1.00 53.68  ? 62  ILE A CB    1 
ATOM   817  C CG1   . ILE B 2 61  ? 136.459 8.064   3.982   1.00 53.65  ? 62  ILE A CG1   1 
ATOM   818  C CG2   . ILE B 2 61  ? 138.068 9.063   2.234   1.00 46.52  ? 62  ILE A CG2   1 
ATOM   819  C CD1   . ILE B 2 61  ? 136.381 8.193   5.496   1.00 77.94  ? 62  ILE A CD1   1 
ATOM   820  N N     . GLY B 2 62  ? 137.889 5.365   5.057   1.00 43.12  ? 63  GLY A N     1 
ATOM   821  C CA    . GLY B 2 62  ? 137.332 4.199   5.732   1.00 43.11  ? 63  GLY A CA    1 
ATOM   822  C C     . GLY B 2 62  ? 135.996 4.527   6.316   1.00 49.11  ? 63  GLY A C     1 
ATOM   823  O O     . GLY B 2 62  ? 135.867 5.457   7.116   1.00 45.81  ? 63  GLY A O     1 
ATOM   824  N N     . LEU B 2 63  ? 134.993 3.763   5.912   1.00 47.78  ? 64  LEU A N     1 
ATOM   825  C CA    . LEU B 2 63  ? 133.642 3.980   6.398   1.00 49.40  ? 64  LEU A CA    1 
ATOM   826  C C     . LEU B 2 63  ? 133.214 2.934   7.372   1.00 49.60  ? 64  LEU A C     1 
ATOM   827  O O     . LEU B 2 63  ? 132.818 1.840   6.976   1.00 50.74  ? 64  LEU A O     1 
ATOM   828  C CB    . LEU B 2 63  ? 132.636 4.008   5.245   1.00 49.82  ? 64  LEU A CB    1 
ATOM   829  C CG    . LEU B 2 63  ? 131.230 4.461   5.664   1.00 48.89  ? 64  LEU A CG    1 
ATOM   830  C CD1   . LEU B 2 63  ? 131.332 5.756   6.428   1.00 49.29  ? 64  LEU A CD1   1 
ATOM   831  C CD2   . LEU B 2 63  ? 130.386 4.674   4.452   1.00 42.13  ? 64  LEU A CD2   1 
ATOM   832  N N     . LEU B 2 64  ? 133.280 3.266   8.653   1.00 42.33  ? 65  LEU A N     1 
ATOM   833  C CA    . LEU B 2 64  ? 132.874 2.311   9.667   1.00 43.69  ? 65  LEU A CA    1 
ATOM   834  C C     . LEU B 2 64  ? 131.346 2.322   9.910   1.00 49.29  ? 65  LEU A C     1 
ATOM   835  O O     . LEU B 2 64  ? 130.868 2.850   10.928  1.00 41.64  ? 65  LEU A O     1 
ATOM   836  C CB    . LEU B 2 64  ? 133.574 2.609   10.976  1.00 43.45  ? 65  LEU A CB    1 
ATOM   837  C CG    . LEU B 2 64  ? 133.494 1.486   12.000  1.00 45.34  ? 65  LEU A CG    1 
ATOM   838  C CD1   . LEU B 2 64  ? 133.848 0.222   11.278  1.00 43.57  ? 65  LEU A CD1   1 
ATOM   839  C CD2   . LEU B 2 64  ? 134.451 1.768   13.159  1.00 48.83  ? 65  LEU A CD2   1 
ATOM   840  N N     . ALA B 2 65  ? 130.608 1.723   8.978   1.00 43.98  ? 66  ALA A N     1 
ATOM   841  C CA    . ALA B 2 65  ? 129.157 1.628   9.046   1.00 44.61  ? 66  ALA A CA    1 
ATOM   842  C C     . ALA B 2 65  ? 128.596 0.713   10.143  1.00 51.87  ? 66  ALA A C     1 
ATOM   843  O O     . ALA B 2 65  ? 129.266 0.281   11.064  1.00 50.23  ? 66  ALA A O     1 
ATOM   844  C CB    . ALA B 2 65  ? 128.612 1.182   7.687   1.00 45.75  ? 66  ALA A CB    1 
ATOM   845  N N     . THR B 2 66  ? 127.319 0.438   9.990   1.00 56.43  ? 67  THR A N     1 
ATOM   846  C CA    . THR B 2 66  ? 126.559 -0.408  10.873  1.00 51.23  ? 67  THR A CA    1 
ATOM   847  C C     . THR B 2 66  ? 126.051 -1.484  9.938   1.00 48.93  ? 67  THR A C     1 
ATOM   848  O O     . THR B 2 66  ? 126.299 -2.666  10.127  1.00 49.02  ? 67  THR A O     1 
ATOM   849  C CB    . THR B 2 66  ? 125.362 0.329   11.356  1.00 42.65  ? 67  THR A CB    1 
ATOM   850  O OG1   . THR B 2 66  ? 125.746 1.260   12.379  1.00 58.62  ? 67  THR A OG1   1 
ATOM   851  C CG2   . THR B 2 66  ? 124.391 -0.644  11.920  1.00 38.40  ? 67  THR A CG2   1 
ATOM   852  N N     . SER B 2 67  ? 125.351 -1.039  8.907   1.00 33.21  ? 68  SER A N     1 
ATOM   853  C CA    . SER B 2 67  ? 124.819 -1.931  7.914   1.00 32.98  ? 68  SER A CA    1 
ATOM   854  C C     . SER B 2 67  ? 124.693 -1.008  6.703   1.00 34.59  ? 68  SER A C     1 
ATOM   855  O O     . SER B 2 67  ? 124.750 0.189   6.855   1.00 33.81  ? 68  SER A O     1 
ATOM   856  C CB    . SER B 2 67  ? 123.435 -2.471  8.396   1.00 46.56  ? 68  SER A CB    1 
ATOM   857  O OG    . SER B 2 67  ? 122.384 -2.419  7.414   1.00 57.73  ? 68  SER A OG    1 
ATOM   858  N N     . SER B 2 68  ? 124.514 -1.573  5.515   1.00 34.71  ? 69  SER A N     1 
ATOM   859  C CA    . SER B 2 68  ? 124.383 -0.821  4.272   1.00 33.92  ? 69  SER A CA    1 
ATOM   860  C C     . SER B 2 68  ? 123.132 -1.234  3.442   1.00 44.30  ? 69  SER A C     1 
ATOM   861  O O     . SER B 2 68  ? 122.950 -0.730  2.342   1.00 43.67  ? 69  SER A O     1 
ATOM   862  C CB    . SER B 2 68  ? 125.631 -1.102  3.407   1.00 37.50  ? 69  SER A CB    1 
ATOM   863  O OG    . SER B 2 68  ? 125.819 -2.513  3.134   1.00 33.50  ? 69  SER A OG    1 
ATOM   864  N N     . GLU B 2 69  ? 122.286 -2.153  3.941   1.00 50.25  ? 70  GLU A N     1 
ATOM   865  C CA    . GLU B 2 69  ? 121.070 -2.571  3.169   1.00 49.93  ? 70  GLU A CA    1 
ATOM   866  C C     . GLU B 2 69  ? 119.969 -1.579  3.488   1.00 46.57  ? 70  GLU A C     1 
ATOM   867  O O     . GLU B 2 69  ? 119.288 -1.087  2.600   1.00 48.14  ? 70  GLU A O     1 
ATOM   868  C CB    . GLU B 2 69  ? 120.625 -4.007  3.483   1.00 51.53  ? 70  GLU A CB    1 
ATOM   869  C CG    . GLU B 2 69  ? 119.405 -4.466  2.696   1.00 49.49  ? 70  GLU A CG    1 
ATOM   870  C CD    . GLU B 2 69  ? 118.088 -4.160  3.450   1.00 90.90  ? 70  GLU A CD    1 
ATOM   871  O OE1   . GLU B 2 69  ? 118.099 -4.101  4.704   1.00 74.21  ? 70  GLU A OE1   1 
ATOM   872  O OE2   . GLU B 2 69  ? 117.041 -3.977  2.793   1.00 88.47  ? 70  GLU A OE2   1 
ATOM   873  N N     . ALA B 2 70  ? 119.826 -1.278  4.773   1.00 38.99  ? 71  ALA A N     1 
ATOM   874  C CA    . ALA B 2 70  ? 118.840 -0.311  5.238   1.00 37.98  ? 71  ALA A CA    1 
ATOM   875  C C     . ALA B 2 70  ? 118.858 0.979   4.403   1.00 47.33  ? 71  ALA A C     1 
ATOM   876  O O     . ALA B 2 70  ? 119.812 1.750   4.445   1.00 52.95  ? 71  ALA A O     1 
ATOM   877  C CB    . ALA B 2 70  ? 119.122 0.040   6.698   1.00 36.98  ? 71  ALA A CB    1 
ATOM   878  N N     . ALA B 2 71  ? 117.785 1.181   3.671   1.00 46.47  ? 72  ALA A N     1 
ATOM   879  C CA    . ALA B 2 71  ? 117.596 2.335   2.809   1.00 46.05  ? 72  ALA A CA    1 
ATOM   880  C C     . ALA B 2 71  ? 118.221 3.578   3.287   1.00 40.15  ? 72  ALA A C     1 
ATOM   881  O O     . ALA B 2 71  ? 118.928 4.215   2.547   1.00 42.38  ? 72  ALA A O     1 
ATOM   882  C CB    . ALA B 2 71  ? 116.126 2.581   2.618   1.00 47.08  ? 72  ALA A CB    1 
ATOM   883  N N     . TYR B 2 72  ? 117.945 3.902   4.543   1.00 33.83  ? 73  TYR A N     1 
ATOM   884  C CA    . TYR B 2 72  ? 118.475 5.114   5.178   1.00 38.70  ? 73  TYR A CA    1 
ATOM   885  C C     . TYR B 2 72  ? 119.945 5.140   4.898   1.00 44.60  ? 73  TYR A C     1 
ATOM   886  O O     . TYR B 2 72  ? 120.449 5.930   4.113   1.00 42.59  ? 73  TYR A O     1 
ATOM   887  C CB    . TYR B 2 72  ? 118.272 5.006   6.669   1.00 42.11  ? 73  TYR A CB    1 
ATOM   888  C CG    . TYR B 2 72  ? 118.702 6.207   7.441   1.00 49.09  ? 73  TYR A CG    1 
ATOM   889  C CD1   . TYR B 2 72  ? 118.126 7.418   7.237   1.00 46.51  ? 73  TYR A CD1   1 
ATOM   890  C CD2   . TYR B 2 72  ? 119.687 6.115   8.401   1.00 54.71  ? 73  TYR A CD2   1 
ATOM   891  C CE1   . TYR B 2 72  ? 118.520 8.515   7.962   1.00 50.89  ? 73  TYR A CE1   1 
ATOM   892  C CE2   . TYR B 2 72  ? 120.080 7.216   9.138   1.00 55.26  ? 73  TYR A CE2   1 
ATOM   893  C CZ    . TYR B 2 72  ? 119.496 8.407   8.906   1.00 54.88  ? 73  TYR A CZ    1 
ATOM   894  O OH    . TYR B 2 72  ? 119.887 9.503   9.623   1.00 56.23  ? 73  TYR A OH    1 
ATOM   895  N N     . PHE B 2 73  ? 120.607 4.214   5.531   1.00 37.24  ? 74  PHE A N     1 
ATOM   896  C CA    . PHE B 2 73  ? 122.013 4.018   5.408   1.00 31.98  ? 74  PHE A CA    1 
ATOM   897  C C     . PHE B 2 73  ? 122.464 3.936   3.979   1.00 38.49  ? 74  PHE A C     1 
ATOM   898  O O     . PHE B 2 73  ? 123.397 4.629   3.545   1.00 45.24  ? 74  PHE A O     1 
ATOM   899  C CB    . PHE B 2 73  ? 122.293 2.661   5.987   1.00 32.23  ? 74  PHE A CB    1 
ATOM   900  C CG    . PHE B 2 73  ? 122.127 2.609   7.469   1.00 31.68  ? 74  PHE A CG    1 
ATOM   901  C CD1   . PHE B 2 73  ? 122.340 3.735   8.225   1.00 32.11  ? 74  PHE A CD1   1 
ATOM   902  C CD2   . PHE B 2 73  ? 121.757 1.434   8.094   1.00 31.25  ? 74  PHE A CD2   1 
ATOM   903  C CE1   . PHE B 2 73  ? 122.202 3.676   9.588   1.00 35.12  ? 74  PHE A CE1   1 
ATOM   904  C CE2   . PHE B 2 73  ? 121.601 1.369   9.455   1.00 32.72  ? 74  PHE A CE2   1 
ATOM   905  C CZ    . PHE B 2 73  ? 121.827 2.491   10.208  1.00 30.67  ? 74  PHE A CZ    1 
ATOM   906  N N     . ALA B 2 74  ? 121.827 3.060   3.243   1.00 25.82  ? 75  ALA A N     1 
ATOM   907  C CA    . ALA B 2 74  ? 122.188 2.874   1.859   1.00 28.64  ? 75  ALA A CA    1 
ATOM   908  C C     . ALA B 2 74  ? 122.246 4.184   1.099   1.00 44.94  ? 75  ALA A C     1 
ATOM   909  O O     . ALA B 2 74  ? 123.012 4.421   0.151   1.00 47.24  ? 75  ALA A O     1 
ATOM   910  C CB    . ALA B 2 74  ? 121.197 1.977   1.241   1.00 30.35  ? 75  ALA A CB    1 
ATOM   911  N N     . GLU B 2 75  ? 121.416 5.057   1.551   1.00 50.23  ? 76  GLU A N     1 
ATOM   912  C CA    . GLU B 2 75  ? 121.352 6.295   0.921   1.00 54.00  ? 76  GLU A CA    1 
ATOM   913  C C     . GLU B 2 75  ? 122.543 7.214   1.265   1.00 58.00  ? 76  GLU A C     1 
ATOM   914  O O     . GLU B 2 75  ? 123.058 7.965   0.410   1.00 56.38  ? 76  GLU A O     1 
ATOM   915  C CB    . GLU B 2 75  ? 119.973 6.902   1.225   1.00 54.99  ? 76  GLU A CB    1 
ATOM   916  C CG    . GLU B 2 75  ? 119.046 6.879   0.020   1.00 69.06  ? 76  GLU A CG    1 
ATOM   917  C CD    . GLU B 2 75  ? 117.686 7.534   0.297   1.00 97.86  ? 76  GLU A CD    1 
ATOM   918  O OE1   . GLU B 2 75  ? 117.561 8.801   0.188   1.00 76.86  ? 76  GLU A OE1   1 
ATOM   919  O OE2   . GLU B 2 75  ? 116.739 6.759   0.597   1.00 39.13  ? 76  GLU A OE2   1 
ATOM   920  N N     . ILE B 2 76  ? 122.975 7.156   2.512   1.00 48.87  ? 77  ILE A N     1 
ATOM   921  C CA    . ILE B 2 76  ? 124.061 7.989   2.944   1.00 44.64  ? 77  ILE A CA    1 
ATOM   922  C C     . ILE B 2 76  ? 125.366 7.548   2.320   1.00 48.71  ? 77  ILE A C     1 
ATOM   923  O O     . ILE B 2 76  ? 126.157 8.345   1.818   1.00 48.50  ? 77  ILE A O     1 
ATOM   924  C CB    . ILE B 2 76  ? 124.104 7.995   4.426   1.00 43.95  ? 77  ILE A CB    1 
ATOM   925  C CG1   . ILE B 2 76  ? 122.859 8.702   4.914   1.00 36.93  ? 77  ILE A CG1   1 
ATOM   926  C CG2   . ILE B 2 76  ? 125.303 8.772   4.886   1.00 54.99  ? 77  ILE A CG2   1 
ATOM   927  C CD1   . ILE B 2 76  ? 122.693 8.719   6.412   1.00 40.59  ? 77  ILE A CD1   1 
ATOM   928  N N     . ILE B 2 77  ? 125.558 6.251   2.354   1.00 38.50  ? 78  ILE A N     1 
ATOM   929  C CA    . ILE B 2 77  ? 126.719 5.606   1.830   1.00 32.31  ? 78  ILE A CA    1 
ATOM   930  C C     . ILE B 2 77  ? 126.882 5.991   0.395   1.00 39.98  ? 78  ILE A C     1 
ATOM   931  O O     . ILE B 2 77  ? 127.927 6.516   0.012   1.00 51.68  ? 78  ILE A O     1 
ATOM   932  C CB    . ILE B 2 77  ? 126.628 4.118   2.124   1.00 33.27  ? 78  ILE A CB    1 
ATOM   933  C CG1   . ILE B 2 77  ? 126.904 3.886   3.605   1.00 23.54  ? 78  ILE A CG1   1 
ATOM   934  C CG2   . ILE B 2 77  ? 127.469 3.279   1.239   1.00 37.53  ? 78  ILE A CG2   1 
ATOM   935  C CD1   . ILE B 2 77  ? 126.508 2.501   4.008   1.00 30.27  ? 78  ILE A CD1   1 
ATOM   936  N N     . GLU B 2 78  ? 125.873 5.767   -0.409  1.00 33.57  ? 79  GLU A N     1 
ATOM   937  C CA    . GLU B 2 78  ? 125.993 6.150   -1.810  1.00 33.77  ? 79  GLU A CA    1 
ATOM   938  C C     . GLU B 2 78  ? 126.342 7.606   -1.926  1.00 34.67  ? 79  GLU A C     1 
ATOM   939  O O     . GLU B 2 78  ? 126.922 8.025   -2.884  1.00 35.78  ? 79  GLU A O     1 
ATOM   940  C CB    . GLU B 2 78  ? 124.697 5.942   -2.531  1.00 33.85  ? 79  GLU A CB    1 
ATOM   941  C CG    . GLU B 2 78  ? 124.912 5.592   -3.959  1.00 51.22  ? 79  GLU A CG    1 
ATOM   942  C CD    . GLU B 2 78  ? 123.659 5.580   -4.748  1.00 54.19  ? 79  GLU A CD    1 
ATOM   943  O OE1   . GLU B 2 78  ? 123.072 6.668   -4.909  1.00 59.02  ? 79  GLU A OE1   1 
ATOM   944  O OE2   . GLU B 2 78  ? 123.285 4.491   -5.236  1.00 47.50  ? 79  GLU A OE2   1 
ATOM   945  N N     . ALA B 2 79  ? 125.990 8.370   -0.913  1.00 33.02  ? 80  ALA A N     1 
ATOM   946  C CA    . ALA B 2 79  ? 126.283 9.804   -0.918  1.00 36.75  ? 80  ALA A CA    1 
ATOM   947  C C     . ALA B 2 79  ? 127.807 9.926   -0.701  1.00 50.13  ? 80  ALA A C     1 
ATOM   948  O O     . ALA B 2 79  ? 128.504 10.471  -1.539  1.00 49.12  ? 80  ALA A O     1 
ATOM   949  C CB    . ALA B 2 79  ? 125.527 10.528  0.233   1.00 34.55  ? 80  ALA A CB    1 
ATOM   950  N N     . VAL B 2 80  ? 128.274 9.398   0.438   1.00 40.82  ? 81  VAL A N     1 
ATOM   951  C CA    . VAL B 2 80  ? 129.659 9.399   0.814   1.00 38.29  ? 81  VAL A CA    1 
ATOM   952  C C     . VAL B 2 80  ? 130.488 8.973   -0.358  1.00 45.21  ? 81  VAL A C     1 
ATOM   953  O O     . VAL B 2 80  ? 131.320 9.738   -0.821  1.00 54.07  ? 81  VAL A O     1 
ATOM   954  C CB    . VAL B 2 80  ? 129.934 8.383   1.913   1.00 42.15  ? 81  VAL A CB    1 
ATOM   955  C CG1   . VAL B 2 80  ? 131.390 8.012   1.878   1.00 39.29  ? 81  VAL A CG1   1 
ATOM   956  C CG2   . VAL B 2 80  ? 129.585 8.960   3.283   1.00 42.63  ? 81  VAL A CG2   1 
ATOM   957  N N     . GLU B 2 81  ? 130.246 7.775   -0.861  1.00 34.51  ? 82  GLU A N     1 
ATOM   958  C CA    . GLU B 2 81  ? 131.007 7.333   -1.984  1.00 34.00  ? 82  GLU A CA    1 
ATOM   959  C C     . GLU B 2 81  ? 131.023 8.261   -3.121  1.00 40.77  ? 82  GLU A C     1 
ATOM   960  O O     . GLU B 2 81  ? 131.945 8.235   -3.898  1.00 50.87  ? 82  GLU A O     1 
ATOM   961  C CB    . GLU B 2 81  ? 130.581 5.975   -2.512  1.00 37.09  ? 82  GLU A CB    1 
ATOM   962  C CG    . GLU B 2 81  ? 129.939 6.063   -3.902  1.00 64.23  ? 82  GLU A CG    1 
ATOM   963  C CD    . GLU B 2 81  ? 130.918 5.901   -5.084  1.00 87.93  ? 82  GLU A CD    1 
ATOM   964  O OE1   . GLU B 2 81  ? 131.967 5.262   -4.900  1.00 57.08  ? 82  GLU A OE1   1 
ATOM   965  O OE2   . GLU B 2 81  ? 130.613 6.441   -6.186  1.00 90.46  ? 82  GLU A OE2   1 
ATOM   966  N N     . LYS B 2 82  ? 130.021 9.085   -3.278  1.00 45.28  ? 83  LYS A N     1 
ATOM   967  C CA    . LYS B 2 82  ? 130.096 9.964   -4.447  1.00 49.93  ? 83  LYS A CA    1 
ATOM   968  C C     . LYS B 2 82  ? 131.117 11.100  -4.289  1.00 55.55  ? 83  LYS A C     1 
ATOM   969  O O     . LYS B 2 82  ? 131.801 11.469  -5.250  1.00 54.00  ? 83  LYS A O     1 
ATOM   970  C CB    . LYS B 2 82  ? 128.719 10.456  -4.880  1.00 53.16  ? 83  LYS A CB    1 
ATOM   971  C CG    . LYS B 2 82  ? 127.986 9.499   -5.816  1.00 78.84  ? 83  LYS A CG    1 
ATOM   972  C CD    . LYS B 2 82  ? 126.479 9.763   -5.857  1.00 100.00 ? 83  LYS A CD    1 
ATOM   973  C CE    . LYS B 2 82  ? 125.973 9.955   -7.297  1.00 100.00 ? 83  LYS A CE    1 
ATOM   974  N NZ    . LYS B 2 82  ? 124.536 10.390  -7.443  1.00 100.00 ? 83  LYS A NZ    1 
ATOM   975  N N     . ASN B 2 83  ? 131.206 11.632  -3.066  1.00 47.42  ? 84  ASN A N     1 
ATOM   976  C CA    . ASN B 2 83  ? 132.108 12.698  -2.733  1.00 48.00  ? 84  ASN A CA    1 
ATOM   977  C C     . ASN B 2 83  ? 133.530 12.127  -2.669  1.00 59.18  ? 84  ASN A C     1 
ATOM   978  O O     . ASN B 2 83  ? 134.505 12.838  -2.808  1.00 62.61  ? 84  ASN A O     1 
ATOM   979  C CB    . ASN B 2 83  ? 131.700 13.276  -1.376  1.00 56.29  ? 84  ASN A CB    1 
ATOM   980  C CG    . ASN B 2 83  ? 130.339 14.025  -1.413  1.00 66.18  ? 84  ASN A CG    1 
ATOM   981  O OD1   . ASN B 2 83  ? 130.288 15.257  -1.534  1.00 65.03  ? 84  ASN A OD1   1 
ATOM   982  N ND2   . ASN B 2 83  ? 129.254 13.285  -1.237  1.00 66.44  ? 84  ASN A ND2   1 
ATOM   983  N N     . CYS B 2 84  ? 133.645 10.824  -2.443  1.00 51.46  ? 85  CYS A N     1 
ATOM   984  C CA    . CYS B 2 84  ? 134.966 10.225  -2.394  1.00 45.49  ? 85  CYS A CA    1 
ATOM   985  C C     . CYS B 2 84  ? 135.482 10.269  -3.823  1.00 52.18  ? 85  CYS A C     1 
ATOM   986  O O     . CYS B 2 84  ? 136.568 10.729  -4.084  1.00 55.42  ? 85  CYS A O     1 
ATOM   987  C CB    . CYS B 2 84  ? 134.895 8.777   -1.925  1.00 39.84  ? 85  CYS A CB    1 
ATOM   988  S SG    . CYS B 2 84  ? 134.658 8.693   -0.114  1.00 42.41  ? 85  CYS A SG    1 
ATOM   989  N N     . PHE B 2 85  ? 134.669 9.798   -4.751  1.00 47.93  ? 86  PHE A N     1 
ATOM   990  C CA    . PHE B 2 85  ? 135.028 9.764   -6.176  1.00 43.44  ? 86  PHE A CA    1 
ATOM   991  C C     . PHE B 2 85  ? 135.241 11.131  -6.752  1.00 62.44  ? 86  PHE A C     1 
ATOM   992  O O     . PHE B 2 85  ? 136.102 11.304  -7.600  1.00 64.16  ? 86  PHE A O     1 
ATOM   993  C CB    . PHE B 2 85  ? 133.956 9.017   -6.962  1.00 38.15  ? 86  PHE A CB    1 
ATOM   994  C CG    . PHE B 2 85  ? 134.240 8.887   -8.412  1.00 39.53  ? 86  PHE A CG    1 
ATOM   995  C CD1   . PHE B 2 85  ? 134.892 7.747   -8.917  1.00 47.02  ? 86  PHE A CD1   1 
ATOM   996  C CD2   . PHE B 2 85  ? 133.855 9.878   -9.307  1.00 44.64  ? 86  PHE A CD2   1 
ATOM   997  C CE1   . PHE B 2 85  ? 135.166 7.595   -10.292 1.00 47.28  ? 86  PHE A CE1   1 
ATOM   998  C CE2   . PHE B 2 85  ? 134.112 9.735   -10.676 1.00 49.49  ? 86  PHE A CE2   1 
ATOM   999  C CZ    . PHE B 2 85  ? 134.771 8.591   -11.171 1.00 48.32  ? 86  PHE A CZ    1 
ATOM   1000 N N     . GLN B 2 86  ? 134.449 12.100  -6.292  1.00 70.14  ? 87  GLN A N     1 
ATOM   1001 C CA    . GLN B 2 86  ? 134.560 13.467  -6.783  1.00 72.80  ? 87  GLN A CA    1 
ATOM   1002 C C     . GLN B 2 86  ? 135.956 13.937  -6.452  1.00 65.74  ? 87  GLN A C     1 
ATOM   1003 O O     . GLN B 2 86  ? 136.629 14.522  -7.275  1.00 66.70  ? 87  GLN A O     1 
ATOM   1004 C CB    . GLN B 2 86  ? 133.527 14.413  -6.097  1.00 78.83  ? 87  GLN A CB    1 
ATOM   1005 C CG    . GLN B 2 86  ? 133.896 14.824  -4.606  1.00 99.57  ? 87  GLN A CG    1 
ATOM   1006 C CD    . GLN B 2 86  ? 133.545 16.295  -4.153  1.00 100.00 ? 87  GLN A CD    1 
ATOM   1007 O OE1   . GLN B 2 86  ? 133.162 16.534  -2.980  1.00 83.99  ? 87  GLN A OE1   1 
ATOM   1008 N NE2   . GLN B 2 86  ? 133.724 17.266  -5.054  1.00 96.76  ? 87  GLN A NE2   1 
ATOM   1009 N N     . LYS B 2 87  ? 136.372 13.667  -5.225  1.00 54.51  ? 88  LYS A N     1 
ATOM   1010 C CA    . LYS B 2 87  ? 137.680 14.053  -4.719  1.00 48.03  ? 88  LYS A CA    1 
ATOM   1011 C C     . LYS B 2 87  ? 138.793 12.980  -4.771  1.00 50.94  ? 88  LYS A C     1 
ATOM   1012 O O     . LYS B 2 87  ? 139.625 12.925  -3.884  1.00 56.21  ? 88  LYS A O     1 
ATOM   1013 C CB    . LYS B 2 87  ? 137.530 14.534  -3.277  1.00 43.90  ? 88  LYS A CB    1 
ATOM   1014 C CG    . LYS B 2 87  ? 136.571 15.674  -3.159  1.00 56.94  ? 88  LYS A CG    1 
ATOM   1015 C CD    . LYS B 2 87  ? 137.278 16.972  -2.827  1.00 74.76  ? 88  LYS A CD    1 
ATOM   1016 C CE    . LYS B 2 87  ? 136.756 18.109  -3.686  1.00 93.87  ? 88  LYS A CE    1 
ATOM   1017 N NZ    . LYS B 2 87  ? 137.069 17.878  -5.125  1.00 100.00 ? 88  LYS A NZ    1 
ATOM   1018 N N     . GLY B 2 88  ? 138.825 12.131  -5.787  1.00 38.37  ? 89  GLY A N     1 
ATOM   1019 C CA    . GLY B 2 88  ? 139.877 11.128  -5.833  1.00 36.73  ? 89  GLY A CA    1 
ATOM   1020 C C     . GLY B 2 88  ? 139.869 10.015  -4.779  1.00 48.14  ? 89  GLY A C     1 
ATOM   1021 O O     . GLY B 2 88  ? 140.376 8.937   -5.058  1.00 61.76  ? 89  GLY A O     1 
ATOM   1022 N N     . TYR B 2 89  ? 139.300 10.227  -3.594  1.00 36.61  ? 90  TYR A N     1 
ATOM   1023 C CA    . TYR B 2 89  ? 139.271 9.134   -2.595  1.00 32.93  ? 90  TYR A CA    1 
ATOM   1024 C C     . TYR B 2 89  ? 138.695 7.779   -2.990  1.00 43.83  ? 90  TYR A C     1 
ATOM   1025 O O     . TYR B 2 89  ? 137.836 7.641   -3.845  1.00 47.23  ? 90  TYR A O     1 
ATOM   1026 C CB    . TYR B 2 89  ? 138.847 9.594   -1.225  1.00 34.18  ? 90  TYR A CB    1 
ATOM   1027 C CG    . TYR B 2 89  ? 139.833 10.612  -0.720  1.00 44.08  ? 90  TYR A CG    1 
ATOM   1028 C CD1   . TYR B 2 89  ? 140.108 11.750  -1.449  1.00 41.10  ? 90  TYR A CD1   1 
ATOM   1029 C CD2   . TYR B 2 89  ? 140.530 10.415  0.460   1.00 51.22  ? 90  TYR A CD2   1 
ATOM   1030 C CE1   . TYR B 2 89  ? 141.018 12.677  -1.026  1.00 43.99  ? 90  TYR A CE1   1 
ATOM   1031 C CE2   . TYR B 2 89  ? 141.453 11.348  0.897   1.00 52.52  ? 90  TYR A CE2   1 
ATOM   1032 C CZ    . TYR B 2 89  ? 141.687 12.476  0.146   1.00 54.31  ? 90  TYR A CZ    1 
ATOM   1033 O OH    . TYR B 2 89  ? 142.600 13.405  0.575   1.00 53.54  ? 90  TYR A OH    1 
ATOM   1034 N N     . THR B 2 90  ? 139.214 6.755   -2.367  1.00 48.62  ? 91  THR A N     1 
ATOM   1035 C CA    . THR B 2 90  ? 138.774 5.411   -2.643  1.00 45.18  ? 91  THR A CA    1 
ATOM   1036 C C     . THR B 2 90  ? 137.954 5.159   -1.362  1.00 50.38  ? 91  THR A C     1 
ATOM   1037 O O     . THR B 2 90  ? 138.305 5.734   -0.317  1.00 43.66  ? 91  THR A O     1 
ATOM   1038 C CB    . THR B 2 90  ? 140.014 4.468   -2.728  1.00 24.97  ? 91  THR A CB    1 
ATOM   1039 O OG1   . THR B 2 90  ? 139.984 3.734   -3.951  1.00 39.84  ? 91  THR A OG1   1 
ATOM   1040 C CG2   . THR B 2 90  ? 139.995 3.441   -1.607  1.00 30.94  ? 91  THR A CG2   1 
ATOM   1041 N N     . LEU B 2 91  ? 136.873 4.341   -1.426  1.00 49.69  ? 92  LEU A N     1 
ATOM   1042 C CA    . LEU B 2 91  ? 136.038 4.059   -0.221  1.00 42.98  ? 92  LEU A CA    1 
ATOM   1043 C C     . LEU B 2 91  ? 136.075 2.647   0.179   1.00 41.38  ? 92  LEU A C     1 
ATOM   1044 O O     . LEU B 2 91  ? 135.982 1.731   -0.663  1.00 36.15  ? 92  LEU A O     1 
ATOM   1045 C CB    . LEU B 2 91  ? 134.563 4.449   -0.385  1.00 42.49  ? 92  LEU A CB    1 
ATOM   1046 C CG    . LEU B 2 91  ? 133.704 4.815   0.851   1.00 46.76  ? 92  LEU A CG    1 
ATOM   1047 C CD1   . LEU B 2 91  ? 132.386 4.141   0.622   1.00 44.63  ? 92  LEU A CD1   1 
ATOM   1048 C CD2   . LEU B 2 91  ? 134.244 4.437   2.239   1.00 44.07  ? 92  LEU A CD2   1 
ATOM   1049 N N     . ILE B 2 92  ? 136.212 2.470   1.486   1.00 43.42  ? 93  ILE A N     1 
ATOM   1050 C CA    . ILE B 2 92  ? 136.252 1.162   2.065   1.00 44.82  ? 93  ILE A CA    1 
ATOM   1051 C C     . ILE B 2 92  ? 135.097 1.178   3.009   1.00 51.79  ? 93  ILE A C     1 
ATOM   1052 O O     . ILE B 2 92  ? 135.067 1.971   3.953   1.00 45.82  ? 93  ILE A O     1 
ATOM   1053 C CB    . ILE B 2 92  ? 137.540 0.944   2.834   1.00 48.12  ? 93  ILE A CB    1 
ATOM   1054 C CG1   . ILE B 2 92  ? 138.709 0.717   1.852   1.00 48.80  ? 93  ILE A CG1   1 
ATOM   1055 C CG2   . ILE B 2 92  ? 137.358 -0.203  3.810   1.00 48.20  ? 93  ILE A CG2   1 
ATOM   1056 C CD1   . ILE B 2 92  ? 140.058 0.408   2.481   1.00 75.66  ? 93  ILE A CD1   1 
ATOM   1057 N N     . LEU B 2 93  ? 134.137 0.302   2.735   1.00 53.24  ? 94  LEU A N     1 
ATOM   1058 C CA    . LEU B 2 93  ? 132.926 0.191   3.527   1.00 55.70  ? 94  LEU A CA    1 
ATOM   1059 C C     . LEU B 2 93  ? 132.986 -0.874  4.552   1.00 48.71  ? 94  LEU A C     1 
ATOM   1060 O O     . LEU B 2 93  ? 133.220 -2.005  4.226   1.00 49.87  ? 94  LEU A O     1 
ATOM   1061 C CB    . LEU B 2 93  ? 131.762 -0.178  2.572   1.00 60.44  ? 94  LEU A CB    1 
ATOM   1062 C CG    . LEU B 2 93  ? 130.277 -0.348  3.025   1.00 64.35  ? 94  LEU A CG    1 
ATOM   1063 C CD1   . LEU B 2 93  ? 129.843 0.603   4.150   1.00 59.58  ? 94  LEU A CD1   1 
ATOM   1064 C CD2   . LEU B 2 93  ? 129.352 -0.248  1.828   1.00 63.65  ? 94  LEU A CD2   1 
ATOM   1065 N N     . GLY B 2 94  ? 132.729 -0.538  5.799   1.00 48.27  ? 95  GLY A N     1 
ATOM   1066 C CA    . GLY B 2 94  ? 132.752 -1.547  6.864   1.00 47.71  ? 95  GLY A CA    1 
ATOM   1067 C C     . GLY B 2 94  ? 131.454 -1.660  7.707   1.00 51.86  ? 95  GLY A C     1 
ATOM   1068 O O     . GLY B 2 94  ? 131.215 -0.874  8.621   1.00 51.26  ? 95  GLY A O     1 
ATOM   1069 N N     . ASN B 2 95  ? 130.624 -2.651  7.419   1.00 48.14  ? 96  ASN A N     1 
ATOM   1070 C CA    . ASN B 2 95  ? 129.399 -2.793  8.198   1.00 46.54  ? 96  ASN A CA    1 
ATOM   1071 C C     . ASN B 2 95  ? 129.753 -3.560  9.418   1.00 45.40  ? 96  ASN A C     1 
ATOM   1072 O O     . ASN B 2 95  ? 129.954 -4.756  9.319   1.00 47.81  ? 96  ASN A O     1 
ATOM   1073 C CB    . ASN B 2 95  ? 128.349 -3.597  7.433   1.00 30.46  ? 96  ASN A CB    1 
ATOM   1074 C CG    . ASN B 2 95  ? 128.046 -3.025  6.103   1.00 47.96  ? 96  ASN A CG    1 
ATOM   1075 O OD1   . ASN B 2 95  ? 127.886 -3.758  5.151   1.00 38.64  ? 96  ASN A OD1   1 
ATOM   1076 N ND2   . ASN B 2 95  ? 127.952 -1.708  6.018   1.00 49.42  ? 96  ASN A ND2   1 
ATOM   1077 N N     . ALA B 2 96  ? 129.829 -2.893  10.563  1.00 43.37  ? 97  ALA A N     1 
ATOM   1078 C CA    . ALA B 2 96  ? 130.166 -3.577  11.821  1.00 44.05  ? 97  ALA A CA    1 
ATOM   1079 C C     . ALA B 2 96  ? 128.968 -4.151  12.572  1.00 58.73  ? 97  ALA A C     1 
ATOM   1080 O O     . ALA B 2 96  ? 129.136 -4.775  13.636  1.00 60.22  ? 97  ALA A O     1 
ATOM   1081 C CB    . ALA B 2 96  ? 130.969 -2.677  12.738  1.00 45.26  ? 97  ALA A CB    1 
ATOM   1082 N N     . TRP B 2 97  ? 127.771 -3.930  12.015  1.00 57.06  ? 98  TRP A N     1 
ATOM   1083 C CA    . TRP B 2 97  ? 126.527 -4.424  12.572  1.00 52.53  ? 98  TRP A CA    1 
ATOM   1084 C C     . TRP B 2 97  ? 126.390 -4.188  14.021  1.00 53.44  ? 98  TRP A C     1 
ATOM   1085 O O     . TRP B 2 97  ? 125.848 -5.004  14.725  1.00 60.41  ? 98  TRP A O     1 
ATOM   1086 C CB    . TRP B 2 97  ? 126.469 -5.920  12.335  1.00 56.13  ? 98  TRP A CB    1 
ATOM   1087 C CG    . TRP B 2 97  ? 126.210 -6.218  10.892  1.00 66.18  ? 98  TRP A CG    1 
ATOM   1088 C CD1   . TRP B 2 97  ? 127.120 -6.617  9.950   1.00 70.05  ? 98  TRP A CD1   1 
ATOM   1089 C CD2   . TRP B 2 97  ? 124.950 -6.099  10.211  1.00 71.88  ? 98  TRP A CD2   1 
ATOM   1090 N NE1   . TRP B 2 97  ? 126.503 -6.759  8.722   1.00 72.14  ? 98  TRP A NE1   1 
ATOM   1091 C CE2   . TRP B 2 97  ? 125.174 -6.448  8.855   1.00 77.36  ? 98  TRP A CE2   1 
ATOM   1092 C CE3   . TRP B 2 97  ? 123.642 -5.735  10.621  1.00 77.82  ? 98  TRP A CE3   1 
ATOM   1093 C CZ2   . TRP B 2 97  ? 124.142 -6.450  7.901   1.00 81.25  ? 98  TRP A CZ2   1 
ATOM   1094 C CZ3   . TRP B 2 97  ? 122.614 -5.739  9.676   1.00 83.29  ? 98  TRP A CZ3   1 
ATOM   1095 C CH2   . TRP B 2 97  ? 122.869 -6.097  8.327   1.00 85.33  ? 98  TRP A CH2   1 
ATOM   1096 N N     . ASN B 2 98  ? 126.873 -3.076  14.504  1.00 48.66  ? 99  ASN A N     1 
ATOM   1097 C CA    . ASN B 2 98  ? 126.763 -2.838  15.930  1.00 51.57  ? 99  ASN A CA    1 
ATOM   1098 C C     . ASN B 2 98  ? 127.483 -3.881  16.809  1.00 63.32  ? 99  ASN A C     1 
ATOM   1099 O O     . ASN B 2 98  ? 127.128 -4.094  17.993  1.00 57.23  ? 99  ASN A O     1 
ATOM   1100 C CB    . ASN B 2 98  ? 125.344 -2.665  16.369  1.00 42.21  ? 99  ASN A CB    1 
ATOM   1101 C CG    . ASN B 2 98  ? 125.232 -1.601  17.378  1.00 74.64  ? 99  ASN A CG    1 
ATOM   1102 O OD1   . ASN B 2 98  ? 124.828 -0.486  17.074  1.00 100.00 ? 99  ASN A OD1   1 
ATOM   1103 N ND2   . ASN B 2 98  ? 125.705 -1.886  18.575  1.00 95.08  ? 99  ASN A ND2   1 
ATOM   1104 N N     . ASN B 2 99  ? 128.499 -4.510  16.210  1.00 64.70  ? 100 ASN A N     1 
ATOM   1105 C CA    . ASN B 2 99  ? 129.310 -5.519  16.856  1.00 64.06  ? 100 ASN A CA    1 
ATOM   1106 C C     . ASN B 2 99  ? 130.643 -4.917  17.217  1.00 64.70  ? 100 ASN A C     1 
ATOM   1107 O O     . ASN B 2 99  ? 131.444 -4.588  16.344  1.00 64.51  ? 100 ASN A O     1 
ATOM   1108 C CB    . ASN B 2 99  ? 129.557 -6.688  15.928  1.00 69.03  ? 100 ASN A CB    1 
ATOM   1109 C CG    . ASN B 2 99  ? 130.539 -7.677  16.520  1.00 100.00 ? 100 ASN A CG    1 
ATOM   1110 O OD1   . ASN B 2 99  ? 131.312 -8.338  15.806  1.00 100.00 ? 100 ASN A OD1   1 
ATOM   1111 N ND2   . ASN B 2 99  ? 130.534 -7.772  17.842  1.00 99.08  ? 100 ASN A ND2   1 
ATOM   1112 N N     . LEU B 2 100 ? 130.875 -4.788  18.517  1.00 58.32  ? 101 LEU A N     1 
ATOM   1113 C CA    . LEU B 2 100 ? 132.112 -4.226  19.026  1.00 54.17  ? 101 LEU A CA    1 
ATOM   1114 C C     . LEU B 2 100 ? 133.316 -4.858  18.400  1.00 55.43  ? 101 LEU A C     1 
ATOM   1115 O O     . LEU B 2 100 ? 134.141 -4.173  17.808  1.00 55.00  ? 101 LEU A O     1 
ATOM   1116 C CB    . LEU B 2 100 ? 132.206 -4.392  20.514  1.00 51.83  ? 101 LEU A CB    1 
ATOM   1117 C CG    . LEU B 2 100 ? 133.359 -3.565  21.052  1.00 58.00  ? 101 LEU A CG    1 
ATOM   1118 C CD1   . LEU B 2 100 ? 133.588 -2.341  20.193  1.00 62.64  ? 101 LEU A CD1   1 
ATOM   1119 C CD2   . LEU B 2 100 ? 133.148 -3.135  22.490  1.00 55.70  ? 101 LEU A CD2   1 
ATOM   1120 N N     . GLU B 2 101 ? 133.415 -6.163  18.536  1.00 48.93  ? 102 GLU A N     1 
ATOM   1121 C CA    . GLU B 2 101 ? 134.532 -6.844  17.964  1.00 53.87  ? 102 GLU A CA    1 
ATOM   1122 C C     . GLU B 2 101 ? 134.699 -6.555  16.486  1.00 55.24  ? 102 GLU A C     1 
ATOM   1123 O O     . GLU B 2 101 ? 135.800 -6.280  16.008  1.00 60.39  ? 102 GLU A O     1 
ATOM   1124 C CB    . GLU B 2 101 ? 134.439 -8.345  18.190  1.00 56.81  ? 102 GLU A CB    1 
ATOM   1125 C CG    . GLU B 2 101 ? 135.770 -9.077  17.928  1.00 84.23  ? 102 GLU A CG    1 
ATOM   1126 C CD    . GLU B 2 101 ? 136.107 -9.315  16.400  1.00 100.00 ? 102 GLU A CD    1 
ATOM   1127 O OE1   . GLU B 2 101 ? 137.282 -9.662  16.086  1.00 93.57  ? 102 GLU A OE1   1 
ATOM   1128 O OE2   . GLU B 2 101 ? 135.202 -9.138  15.527  1.00 100.00 ? 102 GLU A OE2   1 
ATOM   1129 N N     . LYS B 2 102 ? 133.618 -6.643  15.757  1.00 45.92  ? 103 LYS A N     1 
ATOM   1130 C CA    . LYS B 2 102 ? 133.675 -6.398  14.349  1.00 42.64  ? 103 LYS A CA    1 
ATOM   1131 C C     . LYS B 2 102 ? 134.164 -4.977  14.181  1.00 50.13  ? 103 LYS A C     1 
ATOM   1132 O O     . LYS B 2 102 ? 134.849 -4.637  13.215  1.00 55.48  ? 103 LYS A O     1 
ATOM   1133 C CB    . LYS B 2 102 ? 132.292 -6.516  13.780  1.00 38.54  ? 103 LYS A CB    1 
ATOM   1134 C CG    . LYS B 2 102 ? 132.339 -6.841  12.324  1.00 56.65  ? 103 LYS A CG    1 
ATOM   1135 C CD    . LYS B 2 102 ? 131.736 -8.196  12.086  1.00 61.43  ? 103 LYS A CD    1 
ATOM   1136 C CE    . LYS B 2 102 ? 130.249 -8.240  12.404  1.00 62.43  ? 103 LYS A CE    1 
ATOM   1137 N NZ    . LYS B 2 102 ? 129.502 -8.866  11.270  1.00 89.23  ? 103 LYS A NZ    1 
ATOM   1138 N N     . GLN B 2 103 ? 133.816 -4.143  15.139  1.00 41.62  ? 104 GLN A N     1 
ATOM   1139 C CA    . GLN B 2 103 ? 134.223 -2.754  15.085  1.00 47.39  ? 104 GLN A CA    1 
ATOM   1140 C C     . GLN B 2 103 ? 135.706 -2.637  15.292  1.00 57.67  ? 104 GLN A C     1 
ATOM   1141 O O     . GLN B 2 103 ? 136.407 -1.843  14.641  1.00 55.51  ? 104 GLN A O     1 
ATOM   1142 C CB    . GLN B 2 103 ? 133.438 -1.944  16.077  1.00 50.34  ? 104 GLN A CB    1 
ATOM   1143 C CG    . GLN B 2 103 ? 132.057 -1.690  15.569  1.00 47.28  ? 104 GLN A CG    1 
ATOM   1144 C CD    . GLN B 2 103 ? 131.073 -1.527  16.670  1.00 62.82  ? 104 GLN A CD    1 
ATOM   1145 O OE1   . GLN B 2 103 ? 129.930 -1.187  16.436  1.00 79.29  ? 104 GLN A OE1   1 
ATOM   1146 N NE2   . GLN B 2 103 ? 131.510 -1.746  17.885  1.00 64.57  ? 104 GLN A NE2   1 
ATOM   1147 N N     . ARG B 2 104 ? 136.176 -3.461  16.203  1.00 57.98  ? 105 ARG A N     1 
ATOM   1148 C CA    . ARG B 2 104 ? 137.565 -3.551  16.530  1.00 56.57  ? 105 ARG A CA    1 
ATOM   1149 C C     . ARG B 2 104 ? 138.266 -4.004  15.254  1.00 51.45  ? 105 ARG A C     1 
ATOM   1150 O O     . ARG B 2 104 ? 139.230 -3.406  14.836  1.00 55.43  ? 105 ARG A O     1 
ATOM   1151 C CB    . ARG B 2 104 ? 137.716 -4.647  17.547  1.00 62.61  ? 105 ARG A CB    1 
ATOM   1152 C CG    . ARG B 2 104 ? 138.633 -4.377  18.711  1.00 84.31  ? 105 ARG A CG    1 
ATOM   1153 C CD    . ARG B 2 104 ? 139.324 -5.695  19.051  1.00 100.00 ? 105 ARG A CD    1 
ATOM   1154 N NE    . ARG B 2 104 ? 139.671 -6.414  17.818  1.00 100.00 ? 105 ARG A NE    1 
ATOM   1155 C CZ    . ARG B 2 104 ? 139.227 -7.623  17.496  1.00 100.00 ? 105 ARG A CZ    1 
ATOM   1156 N NH1   . ARG B 2 104 ? 138.410 -8.281  18.333  1.00 93.76  ? 105 ARG A NH1   1 
ATOM   1157 N NH2   . ARG B 2 104 ? 139.617 -8.170  16.337  1.00 79.73  ? 105 ARG A NH2   1 
ATOM   1158 N N     . ALA B 2 105 ? 137.761 -5.065  14.642  1.00 41.05  ? 106 ALA A N     1 
ATOM   1159 C CA    . ALA B 2 105 ? 138.342 -5.618  13.426  1.00 41.99  ? 106 ALA A CA    1 
ATOM   1160 C C     . ALA B 2 105 ? 138.397 -4.743  12.217  1.00 53.26  ? 106 ALA A C     1 
ATOM   1161 O O     . ALA B 2 105 ? 139.240 -4.904  11.332  1.00 57.88  ? 106 ALA A O     1 
ATOM   1162 C CB    . ALA B 2 105 ? 137.643 -6.902  13.079  1.00 45.00  ? 106 ALA A CB    1 
ATOM   1163 N N     . TYR B 2 106 ? 137.483 -3.817  12.154  1.00 54.64  ? 107 TYR A N     1 
ATOM   1164 C CA    . TYR B 2 106 ? 137.436 -2.952  11.015  1.00 52.72  ? 107 TYR A CA    1 
ATOM   1165 C C     . TYR B 2 106 ? 138.318 -1.764  11.250  1.00 46.83  ? 107 TYR A C     1 
ATOM   1166 O O     . TYR B 2 106 ? 139.039 -1.337  10.386  1.00 49.65  ? 107 TYR A O     1 
ATOM   1167 C CB    . TYR B 2 106 ? 135.971 -2.486  10.799  1.00 52.76  ? 107 TYR A CB    1 
ATOM   1168 C CG    . TYR B 2 106 ? 135.145 -3.373  9.883   1.00 50.45  ? 107 TYR A CG    1 
ATOM   1169 C CD1   . TYR B 2 106 ? 135.427 -3.457  8.518   1.00 51.19  ? 107 TYR A CD1   1 
ATOM   1170 C CD2   . TYR B 2 106 ? 134.077 -4.129  10.380  1.00 48.74  ? 107 TYR A CD2   1 
ATOM   1171 C CE1   . TYR B 2 106 ? 134.678 -4.271  7.674   1.00 47.15  ? 107 TYR A CE1   1 
ATOM   1172 C CE2   . TYR B 2 106 ? 133.310 -4.941  9.540   1.00 44.61  ? 107 TYR A CE2   1 
ATOM   1173 C CZ    . TYR B 2 106 ? 133.620 -5.000  8.192   1.00 61.44  ? 107 TYR A CZ    1 
ATOM   1174 O OH    . TYR B 2 106 ? 132.891 -5.805  7.364   1.00 74.10  ? 107 TYR A OH    1 
ATOM   1175 N N     . LEU B 2 107 ? 138.235 -1.221  12.436  1.00 38.50  ? 108 LEU A N     1 
ATOM   1176 C CA    . LEU B 2 107 ? 139.012 -0.059  12.767  1.00 40.97  ? 108 LEU A CA    1 
ATOM   1177 C C     . LEU B 2 107 ? 140.514 -0.369  12.547  1.00 65.13  ? 108 LEU A C     1 
ATOM   1178 O O     . LEU B 2 107 ? 141.288 0.473   12.069  1.00 67.85  ? 108 LEU A O     1 
ATOM   1179 C CB    . LEU B 2 107 ? 138.741 0.266   14.227  1.00 37.48  ? 108 LEU A CB    1 
ATOM   1180 C CG    . LEU B 2 107 ? 138.274 1.640   14.601  1.00 38.29  ? 108 LEU A CG    1 
ATOM   1181 C CD1   . LEU B 2 107 ? 137.702 2.312   13.422  1.00 39.21  ? 108 LEU A CD1   1 
ATOM   1182 C CD2   . LEU B 2 107 ? 137.294 1.572   15.727  1.00 35.70  ? 108 LEU A CD2   1 
ATOM   1183 N N     . SER B 2 108 ? 140.901 -1.593  12.896  1.00 65.47  ? 109 SER A N     1 
ATOM   1184 C CA    . SER B 2 108 ? 142.274 -2.031  12.765  1.00 61.75  ? 109 SER A CA    1 
ATOM   1185 C C     . SER B 2 108 ? 142.604 -2.262  11.342  1.00 60.03  ? 109 SER A C     1 
ATOM   1186 O O     . SER B 2 108 ? 143.590 -1.752  10.855  1.00 65.85  ? 109 SER A O     1 
ATOM   1187 C CB    . SER B 2 108 ? 142.510 -3.321  13.537  1.00 65.70  ? 109 SER A CB    1 
ATOM   1188 O OG    . SER B 2 108 ? 143.061 -4.323  12.694  1.00 81.78  ? 109 SER A OG    1 
ATOM   1189 N N     . MET B 2 109 ? 141.790 -3.048  10.673  1.00 48.87  ? 110 MET A N     1 
ATOM   1190 C CA    . MET B 2 109 ? 142.034 -3.331  9.280   1.00 49.14  ? 110 MET A CA    1 
ATOM   1191 C C     . MET B 2 109 ? 142.204 -2.001  8.523   1.00 54.12  ? 110 MET A C     1 
ATOM   1192 O O     . MET B 2 109 ? 142.995 -1.863  7.584   1.00 51.74  ? 110 MET A O     1 
ATOM   1193 C CB    . MET B 2 109 ? 140.797 -4.027  8.733   1.00 52.50  ? 110 MET A CB    1 
ATOM   1194 C CG    . MET B 2 109 ? 140.867 -5.523  8.623   1.00 60.62  ? 110 MET A CG    1 
ATOM   1195 S SD    . MET B 2 109 ? 139.195 -6.252  8.607   1.00 70.82  ? 110 MET A SD    1 
ATOM   1196 C CE    . MET B 2 109 ? 138.998 -6.799  6.905   1.00 63.83  ? 110 MET A CE    1 
ATOM   1197 N N     . MET B 2 110 ? 141.444 -1.022  8.970   1.00 52.12  ? 111 MET A N     1 
ATOM   1198 C CA    . MET B 2 110 ? 141.451 0.266   8.360   1.00 51.66  ? 111 MET A CA    1 
ATOM   1199 C C     . MET B 2 110 ? 142.716 0.992   8.610   1.00 53.08  ? 111 MET A C     1 
ATOM   1200 O O     . MET B 2 110 ? 143.359 1.529   7.683   1.00 50.63  ? 111 MET A O     1 
ATOM   1201 C CB    . MET B 2 110 ? 140.246 1.094   8.840   1.00 54.45  ? 111 MET A CB    1 
ATOM   1202 C CG    . MET B 2 110 ? 139.035 1.087   7.885   1.00 57.09  ? 111 MET A CG    1 
ATOM   1203 S SD    . MET B 2 110 ? 137.416 1.280   8.723   1.00 60.33  ? 111 MET A SD    1 
ATOM   1204 C CE    . MET B 2 110 ? 136.373 0.549   7.461   1.00 52.19  ? 111 MET A CE    1 
ATOM   1205 N N     . ALA B 2 111 ? 143.082 1.038   9.868   1.00 50.68  ? 112 ALA A N     1 
ATOM   1206 C CA    . ALA B 2 111 ? 144.300 1.735   10.228  1.00 56.37  ? 112 ALA A CA    1 
ATOM   1207 C C     . ALA B 2 111 ? 145.539 1.122   9.546   1.00 59.90  ? 112 ALA A C     1 
ATOM   1208 O O     . ALA B 2 111 ? 146.429 1.823   9.071   1.00 62.82  ? 112 ALA A O     1 
ATOM   1209 C CB    . ALA B 2 111 ? 144.457 1.797   11.740  1.00 58.23  ? 112 ALA A CB    1 
ATOM   1210 N N     . GLN B 2 112 ? 145.583 -0.185  9.498   1.00 44.25  ? 113 GLN A N     1 
ATOM   1211 C CA    . GLN B 2 112 ? 146.683 -0.812  8.885   1.00 41.49  ? 113 GLN A CA    1 
ATOM   1212 C C     . GLN B 2 112 ? 146.702 -0.453  7.469   1.00 55.61  ? 113 GLN A C     1 
ATOM   1213 O O     . GLN B 2 112 ? 147.739 -0.108  6.949   1.00 63.58  ? 113 GLN A O     1 
ATOM   1214 C CB    . GLN B 2 112 ? 146.610 -2.288  9.107   1.00 41.39  ? 113 GLN A CB    1 
ATOM   1215 C CG    . GLN B 2 112 ? 147.054 -2.550  10.517  1.00 52.69  ? 113 GLN A CG    1 
ATOM   1216 C CD    . GLN B 2 112 ? 146.719 -3.874  11.007  1.00 58.70  ? 113 GLN A CD    1 
ATOM   1217 O OE1   . GLN B 2 112 ? 146.404 -4.049  12.209  1.00 54.92  ? 113 GLN A OE1   1 
ATOM   1218 N NE2   . GLN B 2 112 ? 146.816 -4.869  10.117  1.00 39.98  ? 113 GLN A NE2   1 
ATOM   1219 N N     . LYS B 2 113 ? 145.542 -0.487  6.831   1.00 51.12  ? 114 LYS A N     1 
ATOM   1220 C CA    . LYS B 2 113 ? 145.428 -0.119  5.421   1.00 45.88  ? 114 LYS A CA    1 
ATOM   1221 C C     . LYS B 2 113 ? 145.801 1.360   5.322   1.00 50.05  ? 114 LYS A C     1 
ATOM   1222 O O     . LYS B 2 113 ? 145.934 1.896   4.243   1.00 54.08  ? 114 LYS A O     1 
ATOM   1223 C CB    . LYS B 2 113 ? 144.004 -0.285  4.967   1.00 44.26  ? 114 LYS A CB    1 
ATOM   1224 C CG    . LYS B 2 113 ? 143.704 -1.609  4.355   1.00 28.54  ? 114 LYS A CG    1 
ATOM   1225 C CD    . LYS B 2 113 ? 144.460 -1.770  3.034   1.00 52.86  ? 114 LYS A CD    1 
ATOM   1226 C CE    . LYS B 2 113 ? 143.798 -2.767  2.068   1.00 69.37  ? 114 LYS A CE    1 
ATOM   1227 N NZ    . LYS B 2 113 ? 143.773 -4.213  2.507   1.00 65.79  ? 114 LYS A NZ    1 
ATOM   1228 N N     . ARG B 2 114 ? 145.966 2.005   6.468   1.00 44.31  ? 115 ARG A N     1 
ATOM   1229 C CA    . ARG B 2 114 ? 146.346 3.400   6.554   1.00 49.67  ? 115 ARG A CA    1 
ATOM   1230 C C     . ARG B 2 114 ? 145.454 4.405   5.815   1.00 63.42  ? 115 ARG A C     1 
ATOM   1231 O O     . ARG B 2 114 ? 145.917 5.201   5.003   1.00 65.16  ? 115 ARG A O     1 
ATOM   1232 C CB    . ARG B 2 114 ? 147.792 3.560   6.119   1.00 57.27  ? 115 ARG A CB    1 
ATOM   1233 C CG    . ARG B 2 114 ? 148.726 3.974   7.269   1.00 62.15  ? 115 ARG A CG    1 
ATOM   1234 C CD    . ARG B 2 114 ? 149.570 2.827   7.756   1.00 36.86  ? 115 ARG A CD    1 
ATOM   1235 N NE    . ARG B 2 114 ? 150.153 3.084   9.071   1.00 42.88  ? 115 ARG A NE    1 
ATOM   1236 C CZ    . ARG B 2 114 ? 150.297 2.183   10.043  1.00 77.91  ? 115 ARG A CZ    1 
ATOM   1237 N NH1   . ARG B 2 114 ? 149.879 0.928   9.868   1.00 66.36  ? 115 ARG A NH1   1 
ATOM   1238 N NH2   . ARG B 2 114 ? 150.858 2.555   11.202  1.00 91.36  ? 115 ARG A NH2   1 
ATOM   1239 N N     . VAL B 2 115 ? 144.165 4.355   6.116   1.00 55.75  ? 116 VAL A N     1 
ATOM   1240 C CA    . VAL B 2 115 ? 143.189 5.239   5.518   1.00 46.05  ? 116 VAL A CA    1 
ATOM   1241 C C     . VAL B 2 115 ? 143.501 6.658   5.958   1.00 50.52  ? 116 VAL A C     1 
ATOM   1242 O O     . VAL B 2 115 ? 143.881 6.924   7.102   1.00 41.51  ? 116 VAL A O     1 
ATOM   1243 C CB    . VAL B 2 115 ? 141.790 4.830   5.966   1.00 36.94  ? 116 VAL A CB    1 
ATOM   1244 C CG1   . VAL B 2 115 ? 141.538 3.421   5.498   1.00 33.37  ? 116 VAL A CG1   1 
ATOM   1245 C CG2   . VAL B 2 115 ? 141.727 4.826   7.480   1.00 33.35  ? 116 VAL A CG2   1 
ATOM   1246 N N     . ASP B 2 116 ? 143.343 7.565   5.015   1.00 48.13  ? 117 ASP A N     1 
ATOM   1247 C CA    . ASP B 2 116 ? 143.607 8.946   5.224   1.00 44.97  ? 117 ASP A CA    1 
ATOM   1248 C C     . ASP B 2 116 ? 142.722 9.510   6.305   1.00 52.74  ? 117 ASP A C     1 
ATOM   1249 O O     . ASP B 2 116 ? 143.062 10.509  6.950   1.00 51.83  ? 117 ASP A O     1 
ATOM   1250 C CB    . ASP B 2 116 ? 143.414 9.664   3.902   1.00 47.90  ? 117 ASP A CB    1 
ATOM   1251 C CG    . ASP B 2 116 ? 144.629 9.552   2.989   1.00 59.33  ? 117 ASP A CG    1 
ATOM   1252 O OD1   . ASP B 2 116 ? 145.693 9.050   3.433   1.00 64.36  ? 117 ASP A OD1   1 
ATOM   1253 O OD2   . ASP B 2 116 ? 144.520 9.999   1.828   1.00 60.61  ? 117 ASP A OD2   1 
ATOM   1254 N N     . GLY B 2 117 ? 141.574 8.869   6.512   1.00 53.61  ? 118 GLY A N     1 
ATOM   1255 C CA    . GLY B 2 117 ? 140.624 9.313   7.543   1.00 49.55  ? 118 GLY A CA    1 
ATOM   1256 C C     . GLY B 2 117 ? 139.472 8.316   7.731   1.00 49.88  ? 118 GLY A C     1 
ATOM   1257 O O     . GLY B 2 117 ? 139.257 7.439   6.897   1.00 47.66  ? 118 GLY A O     1 
ATOM   1258 N N     . LEU B 2 118 ? 138.730 8.472   8.830   1.00 52.24  ? 119 LEU A N     1 
ATOM   1259 C CA    . LEU B 2 118 ? 137.586 7.616   9.156   1.00 51.13  ? 119 LEU A CA    1 
ATOM   1260 C C     . LEU B 2 118 ? 136.208 8.334   9.213   1.00 47.05  ? 119 LEU A C     1 
ATOM   1261 O O     . LEU B 2 118 ? 136.060 9.320   9.911   1.00 45.37  ? 119 LEU A O     1 
ATOM   1262 C CB    . LEU B 2 118 ? 137.837 6.985   10.522  1.00 51.35  ? 119 LEU A CB    1 
ATOM   1263 C CG    . LEU B 2 118 ? 138.039 5.463   10.594  1.00 56.91  ? 119 LEU A CG    1 
ATOM   1264 C CD1   . LEU B 2 118 ? 138.248 4.771   9.252   1.00 50.84  ? 119 LEU A CD1   1 
ATOM   1265 C CD2   . LEU B 2 118 ? 139.168 5.152   11.550  1.00 72.81  ? 119 LEU A CD2   1 
ATOM   1266 N N     . LEU B 2 119 ? 135.208 7.816   8.492   1.00 47.34  ? 120 LEU A N     1 
ATOM   1267 C CA    . LEU B 2 119 ? 133.806 8.353   8.475   1.00 39.43  ? 120 LEU A CA    1 
ATOM   1268 C C     . LEU B 2 119 ? 133.089 7.361   9.419   1.00 45.19  ? 120 LEU A C     1 
ATOM   1269 O O     . LEU B 2 119 ? 133.052 6.165   9.137   1.00 46.60  ? 120 LEU A O     1 
ATOM   1270 C CB    . LEU B 2 119 ? 133.244 8.204   7.079   1.00 34.20  ? 120 LEU A CB    1 
ATOM   1271 C CG    . LEU B 2 119 ? 132.945 9.544   6.434   1.00 31.85  ? 120 LEU A CG    1 
ATOM   1272 C CD1   . LEU B 2 119 ? 133.365 10.747  7.218   1.00 27.60  ? 120 LEU A CD1   1 
ATOM   1273 C CD2   . LEU B 2 119 ? 133.276 9.669   4.978   1.00 28.81  ? 120 LEU A CD2   1 
ATOM   1274 N N     . VAL B 2 120 ? 132.555 7.841   10.540  1.00 49.63  ? 121 VAL A N     1 
ATOM   1275 C CA    . VAL B 2 120 ? 131.875 6.959   11.533  1.00 51.71  ? 121 VAL A CA    1 
ATOM   1276 C C     . VAL B 2 120 ? 130.320 6.967   11.669  1.00 56.79  ? 121 VAL A C     1 
ATOM   1277 O O     . VAL B 2 120 ? 129.690 7.959   12.091  1.00 58.75  ? 121 VAL A O     1 
ATOM   1278 C CB    . VAL B 2 120 ? 132.503 7.127   12.954  1.00 59.99  ? 121 VAL A CB    1 
ATOM   1279 C CG1   . VAL B 2 120 ? 131.903 6.150   13.959  1.00 60.77  ? 121 VAL A CG1   1 
ATOM   1280 C CG2   . VAL B 2 120 ? 133.992 6.906   12.908  1.00 62.28  ? 121 VAL A CG2   1 
ATOM   1281 N N     . MET B 2 121 ? 129.723 5.835   11.334  1.00 52.32  ? 122 MET A N     1 
ATOM   1282 C CA    . MET B 2 121 ? 128.275 5.640   11.403  1.00 48.43  ? 122 MET A CA    1 
ATOM   1283 C C     . MET B 2 121 ? 127.932 4.337   12.162  1.00 39.96  ? 122 MET A C     1 
ATOM   1284 O O     . MET B 2 121 ? 127.409 3.388   11.598  1.00 39.22  ? 122 MET A O     1 
ATOM   1285 C CB    . MET B 2 121 ? 127.733 5.587   9.990   1.00 51.23  ? 122 MET A CB    1 
ATOM   1286 C CG    . MET B 2 121 ? 126.282 5.920   9.941   1.00 58.97  ? 122 MET A CG    1 
ATOM   1287 S SD    . MET B 2 121 ? 125.953 6.666   8.386   1.00 68.13  ? 122 MET A SD    1 
ATOM   1288 C CE    . MET B 2 121 ? 126.638 5.494   7.201   1.00 58.28  ? 122 MET A CE    1 
ATOM   1289 N N     . CYS B 2 122 ? 128.244 4.299   13.439  1.00 40.35  ? 123 CYS A N     1 
ATOM   1290 C CA    . CYS B 2 122 ? 127.995 3.113   14.231  1.00 49.33  ? 123 CYS A CA    1 
ATOM   1291 C C     . CYS B 2 122 ? 126.636 2.969   14.878  1.00 58.49  ? 123 CYS A C     1 
ATOM   1292 O O     . CYS B 2 122 ? 126.329 1.924   15.442  1.00 49.55  ? 123 CYS A O     1 
ATOM   1293 C CB    . CYS B 2 122 ? 129.109 2.942   15.264  1.00 55.04  ? 123 CYS A CB    1 
ATOM   1294 S SG    . CYS B 2 122 ? 130.722 2.539   14.496  1.00 59.60  ? 123 CYS A SG    1 
ATOM   1295 N N     . SER B 2 123 ? 125.827 4.024   14.782  1.00 63.00  ? 124 SER A N     1 
ATOM   1296 C CA    . SER B 2 123 ? 124.483 4.034   15.341  1.00 54.59  ? 124 SER A CA    1 
ATOM   1297 C C     . SER B 2 123 ? 124.502 4.108   16.820  1.00 43.45  ? 124 SER A C     1 
ATOM   1298 O O     . SER B 2 123 ? 123.930 4.987   17.391  1.00 37.34  ? 124 SER A O     1 
ATOM   1299 C CB    . SER B 2 123 ? 123.697 2.808   14.871  1.00 50.84  ? 124 SER A CB    1 
ATOM   1300 O OG    . SER B 2 123 ? 123.279 2.998   13.533  1.00 55.39  ? 124 SER A OG    1 
ATOM   1301 N N     . GLU B 2 124 ? 125.180 3.178   17.450  1.00 46.66  ? 125 GLU A N     1 
ATOM   1302 C CA    . GLU B 2 124 ? 125.243 3.172   18.882  1.00 50.53  ? 125 GLU A CA    1 
ATOM   1303 C C     . GLU B 2 124 ? 126.642 3.305   19.398  1.00 57.57  ? 125 GLU A C     1 
ATOM   1304 O O     . GLU B 2 124 ? 127.562 2.671   18.901  1.00 63.36  ? 125 GLU A O     1 
ATOM   1305 C CB    . GLU B 2 124 ? 124.475 2.001   19.440  1.00 51.04  ? 125 GLU A CB    1 
ATOM   1306 C CG    . GLU B 2 124 ? 123.050 2.036   18.950  1.00 49.64  ? 125 GLU A CG    1 
ATOM   1307 C CD    . GLU B 2 124 ? 122.301 0.805   19.309  1.00 82.98  ? 125 GLU A CD    1 
ATOM   1308 O OE1   . GLU B 2 124 ? 122.778 0.082   20.215  1.00 64.13  ? 125 GLU A OE1   1 
ATOM   1309 O OE2   . GLU B 2 124 ? 121.247 0.551   18.680  1.00 89.02  ? 125 GLU A OE2   1 
ATOM   1310 N N     . TYR B 2 125 ? 126.784 4.157   20.403  1.00 51.39  ? 126 TYR A N     1 
ATOM   1311 C CA    . TYR B 2 125 ? 128.066 4.445   20.987  1.00 47.44  ? 126 TYR A CA    1 
ATOM   1312 C C     . TYR B 2 125 ? 128.239 4.255   22.448  1.00 48.25  ? 126 TYR A C     1 
ATOM   1313 O O     . TYR B 2 125 ? 128.348 5.202   23.187  1.00 54.68  ? 126 TYR A O     1 
ATOM   1314 C CB    . TYR B 2 125 ? 128.443 5.867   20.610  1.00 47.38  ? 126 TYR A CB    1 
ATOM   1315 C CG    . TYR B 2 125 ? 128.543 6.034   19.114  1.00 53.12  ? 126 TYR A CG    1 
ATOM   1316 C CD1   . TYR B 2 125 ? 127.428 6.274   18.353  1.00 53.62  ? 126 TYR A CD1   1 
ATOM   1317 C CD2   . TYR B 2 125 ? 129.770 5.927   18.460  1.00 55.42  ? 126 TYR A CD2   1 
ATOM   1318 C CE1   . TYR B 2 125 ? 127.535 6.428   16.982  1.00 59.73  ? 126 TYR A CE1   1 
ATOM   1319 C CE2   . TYR B 2 125 ? 129.873 6.068   17.088  1.00 54.48  ? 126 TYR A CE2   1 
ATOM   1320 C CZ    . TYR B 2 125 ? 128.760 6.315   16.369  1.00 57.08  ? 126 TYR A CZ    1 
ATOM   1321 O OH    . TYR B 2 125 ? 128.869 6.445   15.029  1.00 65.19  ? 126 TYR A OH    1 
ATOM   1322 N N     . PRO B 2 126 ? 128.281 3.022   22.872  1.00 41.99  ? 127 PRO A N     1 
ATOM   1323 C CA    . PRO B 2 126 ? 128.478 2.675   24.288  1.00 48.04  ? 127 PRO A CA    1 
ATOM   1324 C C     . PRO B 2 126 ? 129.934 3.028   24.663  1.00 63.81  ? 127 PRO A C     1 
ATOM   1325 O O     . PRO B 2 126 ? 130.751 3.287   23.777  1.00 67.10  ? 127 PRO A O     1 
ATOM   1326 C CB    . PRO B 2 126 ? 128.342 1.153   24.276  1.00 51.05  ? 127 PRO A CB    1 
ATOM   1327 C CG    . PRO B 2 126 ? 128.666 0.752   22.866  1.00 48.85  ? 127 PRO A CG    1 
ATOM   1328 C CD    . PRO B 2 126 ? 128.155 1.856   22.001  1.00 40.11  ? 127 PRO A CD    1 
ATOM   1329 N N     . GLU B 2 127 ? 130.285 3.031   25.947  1.00 64.75  ? 128 GLU A N     1 
ATOM   1330 C CA    . GLU B 2 127 ? 131.680 3.385   26.290  1.00 67.82  ? 128 GLU A CA    1 
ATOM   1331 C C     . GLU B 2 127 ? 132.793 2.588   25.654  1.00 63.03  ? 128 GLU A C     1 
ATOM   1332 O O     . GLU B 2 127 ? 133.742 3.145   25.191  1.00 63.31  ? 128 GLU A O     1 
ATOM   1333 C CB    . GLU B 2 127 ? 131.944 3.655   27.774  1.00 70.58  ? 128 GLU A CB    1 
ATOM   1334 C CG    . GLU B 2 127 ? 132.407 5.090   28.052  1.00 93.68  ? 128 GLU A CG    1 
ATOM   1335 C CD    . GLU B 2 127 ? 133.933 5.292   27.900  1.00 100.00 ? 128 GLU A CD    1 
ATOM   1336 O OE1   . GLU B 2 127 ? 134.725 4.480   28.497  1.00 100.00 ? 128 GLU A OE1   1 
ATOM   1337 O OE2   . GLU B 2 127 ? 134.332 6.285   27.207  1.00 100.00 ? 128 GLU A OE2   1 
ATOM   1338 N N     . PRO B 2 128 ? 132.676 1.285   25.629  1.00 48.46  ? 129 PRO A N     1 
ATOM   1339 C CA    . PRO B 2 128 ? 133.695 0.526   25.029  1.00 46.62  ? 129 PRO A CA    1 
ATOM   1340 C C     . PRO B 2 128 ? 133.907 0.899   23.568  1.00 57.14  ? 129 PRO A C     1 
ATOM   1341 O O     . PRO B 2 128 ? 134.954 0.623   23.017  1.00 68.06  ? 129 PRO A O     1 
ATOM   1342 C CB    . PRO B 2 128 ? 133.183 -0.893  25.204  1.00 46.84  ? 129 PRO A CB    1 
ATOM   1343 C CG    . PRO B 2 128 ? 132.638 -0.856  26.580  1.00 51.11  ? 129 PRO A CG    1 
ATOM   1344 C CD    . PRO B 2 128 ? 132.013 0.519   26.691  1.00 49.01  ? 129 PRO A CD    1 
ATOM   1345 N N     . LEU B 2 129 ? 132.956 1.542   22.923  1.00 47.77  ? 130 LEU A N     1 
ATOM   1346 C CA    . LEU B 2 129 ? 133.225 1.879   21.529  1.00 45.78  ? 130 LEU A CA    1 
ATOM   1347 C C     . LEU B 2 129 ? 133.804 3.265   21.528  1.00 53.48  ? 130 LEU A C     1 
ATOM   1348 O O     . LEU B 2 129 ? 134.589 3.675   20.654  1.00 52.41  ? 130 LEU A O     1 
ATOM   1349 C CB    . LEU B 2 129 ? 131.950 1.845   20.719  1.00 44.68  ? 130 LEU A CB    1 
ATOM   1350 C CG    . LEU B 2 129 ? 131.971 2.065   19.210  1.00 46.68  ? 130 LEU A CG    1 
ATOM   1351 C CD1   . LEU B 2 129 ? 131.794 3.518   18.983  1.00 50.39  ? 130 LEU A CD1   1 
ATOM   1352 C CD2   . LEU B 2 129 ? 133.229 1.573   18.528  1.00 40.92  ? 130 LEU A CD2   1 
ATOM   1353 N N     . LEU B 2 130 ? 133.409 4.010   22.524  1.00 52.37  ? 131 LEU A N     1 
ATOM   1354 C CA    . LEU B 2 130 ? 133.899 5.330   22.577  1.00 57.29  ? 131 LEU A CA    1 
ATOM   1355 C C     . LEU B 2 130 ? 135.360 5.201   22.842  1.00 71.58  ? 131 LEU A C     1 
ATOM   1356 O O     . LEU B 2 130 ? 136.187 5.841   22.196  1.00 78.35  ? 131 LEU A O     1 
ATOM   1357 C CB    . LEU B 2 130 ? 133.158 6.117   23.632  1.00 59.18  ? 131 LEU A CB    1 
ATOM   1358 C CG    . LEU B 2 130 ? 131.977 6.899   23.020  1.00 67.86  ? 131 LEU A CG    1 
ATOM   1359 C CD1   . LEU B 2 130 ? 132.419 7.868   21.926  1.00 69.36  ? 131 LEU A CD1   1 
ATOM   1360 C CD2   . LEU B 2 130 ? 130.996 5.928   22.430  1.00 81.53  ? 131 LEU A CD2   1 
ATOM   1361 N N     . ALA B 2 131 ? 135.656 4.325   23.785  1.00 70.76  ? 132 ALA A N     1 
ATOM   1362 C CA    . ALA B 2 131 ? 136.998 3.992   24.234  1.00 68.56  ? 132 ALA A CA    1 
ATOM   1363 C C     . ALA B 2 131 ? 137.839 3.609   23.009  1.00 78.93  ? 132 ALA A C     1 
ATOM   1364 O O     . ALA B 2 131 ? 138.854 4.257   22.700  1.00 81.21  ? 132 ALA A O     1 
ATOM   1365 C CB    . ALA B 2 131 ? 136.924 2.818   25.214  1.00 65.98  ? 132 ALA A CB    1 
ATOM   1366 N N     . MET B 2 132 ? 137.398 2.560   22.314  1.00 69.46  ? 133 MET A N     1 
ATOM   1367 C CA    . MET B 2 132 ? 138.076 2.073   21.126  1.00 64.50  ? 133 MET A CA    1 
ATOM   1368 C C     . MET B 2 132 ? 138.298 3.200   20.107  1.00 66.22  ? 133 MET A C     1 
ATOM   1369 O O     . MET B 2 132 ? 139.348 3.301   19.479  1.00 66.86  ? 133 MET A O     1 
ATOM   1370 C CB    . MET B 2 132 ? 137.260 0.933   20.508  1.00 66.82  ? 133 MET A CB    1 
ATOM   1371 C CG    . MET B 2 132 ? 138.076 -0.267  20.062  1.00 71.66  ? 133 MET A CG    1 
ATOM   1372 S SD    . MET B 2 132 ? 137.055 -1.685  19.656  1.00 75.76  ? 133 MET A SD    1 
ATOM   1373 C CE    . MET B 2 132 ? 136.367 -1.176  18.083  1.00 68.19  ? 133 MET A CE    1 
ATOM   1374 N N     . LEU B 2 133 ? 137.294 4.045   19.934  1.00 62.12  ? 134 LEU A N     1 
ATOM   1375 C CA    . LEU B 2 133 ? 137.396 5.143   18.987  1.00 57.78  ? 134 LEU A CA    1 
ATOM   1376 C C     . LEU B 2 133 ? 138.568 6.108   19.277  1.00 65.39  ? 134 LEU A C     1 
ATOM   1377 O O     . LEU B 2 133 ? 139.187 6.651   18.375  1.00 61.04  ? 134 LEU A O     1 
ATOM   1378 C CB    . LEU B 2 133 ? 136.083 5.901   18.986  1.00 54.27  ? 134 LEU A CB    1 
ATOM   1379 C CG    . LEU B 2 133 ? 135.003 5.187   18.204  1.00 53.79  ? 134 LEU A CG    1 
ATOM   1380 C CD1   . LEU B 2 133 ? 133.709 5.974   18.320  1.00 49.46  ? 134 LEU A CD1   1 
ATOM   1381 C CD2   . LEU B 2 133 ? 135.446 5.042   16.747  1.00 46.55  ? 134 LEU A CD2   1 
ATOM   1382 N N     . GLU B 2 134 ? 138.856 6.313   20.544  1.00 69.19  ? 135 GLU A N     1 
ATOM   1383 C CA    . GLU B 2 134 ? 139.921 7.203   20.929  1.00 72.94  ? 135 GLU A CA    1 
ATOM   1384 C C     . GLU B 2 134 ? 141.332 6.737   20.646  1.00 68.99  ? 135 GLU A C     1 
ATOM   1385 O O     . GLU B 2 134 ? 142.223 7.568   20.498  1.00 69.81  ? 135 GLU A O     1 
ATOM   1386 C CB    . GLU B 2 134 ? 139.787 7.593   22.397  1.00 76.93  ? 135 GLU A CB    1 
ATOM   1387 C CG    . GLU B 2 134 ? 138.853 8.786   22.618  1.00 100.00 ? 135 GLU A CG    1 
ATOM   1388 C CD    . GLU B 2 134 ? 139.498 9.949   23.428  1.00 100.00 ? 135 GLU A CD    1 
ATOM   1389 O OE1   . GLU B 2 134 ? 140.521 9.701   24.137  1.00 100.00 ? 135 GLU A OE1   1 
ATOM   1390 O OE2   . GLU B 2 134 ? 138.960 11.102  23.365  1.00 100.00 ? 135 GLU A OE2   1 
ATOM   1391 N N     . GLU B 2 135 ? 141.550 5.432   20.595  1.00 56.33  ? 136 GLU A N     1 
ATOM   1392 C CA    . GLU B 2 135 ? 142.879 4.945   20.328  1.00 58.00  ? 136 GLU A CA    1 
ATOM   1393 C C     . GLU B 2 135 ? 143.170 5.475   18.982  1.00 64.98  ? 136 GLU A C     1 
ATOM   1394 O O     . GLU B 2 135 ? 144.266 5.953   18.684  1.00 70.86  ? 136 GLU A O     1 
ATOM   1395 C CB    . GLU B 2 135 ? 142.904 3.441   20.179  1.00 60.77  ? 136 GLU A CB    1 
ATOM   1396 C CG    . GLU B 2 135 ? 141.926 2.708   21.047  1.00 88.61  ? 136 GLU A CG    1 
ATOM   1397 C CD    . GLU B 2 135 ? 142.409 2.621   22.458  1.00 100.00 ? 136 GLU A CD    1 
ATOM   1398 O OE1   . GLU B 2 135 ? 142.934 3.674   22.962  1.00 100.00 ? 136 GLU A OE1   1 
ATOM   1399 O OE2   . GLU B 2 135 ? 142.275 1.500   23.043  1.00 100.00 ? 136 GLU A OE2   1 
ATOM   1400 N N     . TYR B 2 136 ? 142.169 5.397   18.139  1.00 60.03  ? 137 TYR A N     1 
ATOM   1401 C CA    . TYR B 2 136 ? 142.367 5.887   16.795  1.00 58.91  ? 137 TYR A CA    1 
ATOM   1402 C C     . TYR B 2 136 ? 142.252 7.370   16.696  1.00 59.75  ? 137 TYR A C     1 
ATOM   1403 O O     . TYR B 2 136 ? 142.100 7.926   15.593  1.00 58.85  ? 137 TYR A O     1 
ATOM   1404 C CB    . TYR B 2 136 ? 141.532 5.145   15.794  1.00 56.21  ? 137 TYR A CB    1 
ATOM   1405 C CG    . TYR B 2 136 ? 141.818 3.675   15.866  1.00 60.19  ? 137 TYR A CG    1 
ATOM   1406 C CD1   . TYR B 2 136 ? 141.447 2.933   16.976  1.00 61.02  ? 137 TYR A CD1   1 
ATOM   1407 C CD2   . TYR B 2 136 ? 142.477 3.020   14.825  1.00 65.46  ? 137 TYR A CD2   1 
ATOM   1408 C CE1   . TYR B 2 136 ? 141.711 1.570   17.044  1.00 62.58  ? 137 TYR A CE1   1 
ATOM   1409 C CE2   . TYR B 2 136 ? 142.746 1.658   14.884  1.00 65.65  ? 137 TYR A CE2   1 
ATOM   1410 C CZ    . TYR B 2 136 ? 142.365 0.936   15.991  1.00 63.28  ? 137 TYR A CZ    1 
ATOM   1411 O OH    . TYR B 2 136 ? 142.628 -0.424  16.037  1.00 63.85  ? 137 TYR A OH    1 
ATOM   1412 N N     . ARG B 2 137 ? 142.331 8.021   17.859  1.00 56.43  ? 138 ARG A N     1 
ATOM   1413 C CA    . ARG B 2 137 ? 142.240 9.459   17.876  1.00 58.79  ? 138 ARG A CA    1 
ATOM   1414 C C     . ARG B 2 137 ? 143.274 10.076  16.949  1.00 72.08  ? 138 ARG A C     1 
ATOM   1415 O O     . ARG B 2 137 ? 143.138 11.200  16.516  1.00 72.27  ? 138 ARG A O     1 
ATOM   1416 C CB    . ARG B 2 137 ? 142.121 10.082  19.287  1.00 50.90  ? 138 ARG A CB    1 
ATOM   1417 C CG    . ARG B 2 137 ? 143.323 10.127  20.224  1.00 57.13  ? 138 ARG A CG    1 
ATOM   1418 C CD    . ARG B 2 137 ? 142.940 10.934  21.548  1.00 87.01  ? 138 ARG A CD    1 
ATOM   1419 N NE    . ARG B 2 137 ? 142.211 12.207  21.262  1.00 100.00 ? 138 ARG A NE    1 
ATOM   1420 C CZ    . ARG B 2 137 ? 141.545 12.977  22.153  1.00 100.00 ? 138 ARG A CZ    1 
ATOM   1421 N NH1   . ARG B 2 137 ? 141.467 12.656  23.446  1.00 100.00 ? 138 ARG A NH1   1 
ATOM   1422 N NH2   . ARG B 2 137 ? 140.944 14.095  21.744  1.00 94.80  ? 138 ARG A NH2   1 
ATOM   1423 N N     . HIS B 2 138 ? 144.300 9.310   16.610  1.00 76.81  ? 139 HIS A N     1 
ATOM   1424 C CA    . HIS B 2 138 ? 145.305 9.827   15.722  1.00 79.47  ? 139 HIS A CA    1 
ATOM   1425 C C     . HIS B 2 138 ? 144.844 9.967   14.278  1.00 73.77  ? 139 HIS A C     1 
ATOM   1426 O O     . HIS B 2 138 ? 145.171 10.952  13.627  1.00 76.85  ? 139 HIS A O     1 
ATOM   1427 C CB    . HIS B 2 138 ? 146.636 9.082   15.855  1.00 86.16  ? 139 HIS A CB    1 
ATOM   1428 C CG    . HIS B 2 138 ? 146.587 7.643   15.426  1.00 95.83  ? 139 HIS A CG    1 
ATOM   1429 N ND1   . HIS B 2 138 ? 147.089 7.202   14.209  1.00 100.00 ? 139 HIS A ND1   1 
ATOM   1430 C CD2   . HIS B 2 138 ? 146.114 6.535   16.060  1.00 100.00 ? 139 HIS A CD2   1 
ATOM   1431 C CE1   . HIS B 2 138 ? 146.916 5.890   14.109  1.00 100.00 ? 139 HIS A CE1   1 
ATOM   1432 N NE2   . HIS B 2 138 ? 146.329 5.460   15.217  1.00 100.00 ? 139 HIS A NE2   1 
ATOM   1433 N N     . ILE B 2 139 ? 144.088 9.005   13.759  1.00 59.88  ? 140 ILE A N     1 
ATOM   1434 C CA    . ILE B 2 139 ? 143.645 9.154   12.380  1.00 56.31  ? 140 ILE A CA    1 
ATOM   1435 C C     . ILE B 2 139 ? 142.426 10.100  12.351  1.00 58.41  ? 140 ILE A C     1 
ATOM   1436 O O     . ILE B 2 139 ? 141.574 10.021  13.210  1.00 59.54  ? 140 ILE A O     1 
ATOM   1437 C CB    . ILE B 2 139 ? 143.386 7.830   11.651  1.00 54.99  ? 140 ILE A CB    1 
ATOM   1438 C CG1   . ILE B 2 139 ? 142.016 7.854   11.007  1.00 55.77  ? 140 ILE A CG1   1 
ATOM   1439 C CG2   . ILE B 2 139 ? 143.703 6.583   12.496  1.00 44.08  ? 140 ILE A CG2   1 
ATOM   1440 C CD1   . ILE B 2 139 ? 142.005 7.247   9.625   1.00 80.38  ? 140 ILE A CD1   1 
ATOM   1441 N N     . PRO B 2 140 ? 142.373 11.002  11.373  1.00 55.26  ? 141 PRO A N     1 
ATOM   1442 C CA    . PRO B 2 140 ? 141.294 11.970  11.239  1.00 58.19  ? 141 PRO A CA    1 
ATOM   1443 C C     . PRO B 2 140 ? 139.890 11.361  10.887  1.00 70.65  ? 141 PRO A C     1 
ATOM   1444 O O     . PRO B 2 140 ? 139.697 10.769  9.820   1.00 65.29  ? 141 PRO A O     1 
ATOM   1445 C CB    . PRO B 2 140 ? 141.805 12.871  10.095  1.00 56.75  ? 141 PRO A CB    1 
ATOM   1446 C CG    . PRO B 2 140 ? 142.725 12.008  9.281   1.00 58.43  ? 141 PRO A CG    1 
ATOM   1447 C CD    . PRO B 2 140 ? 142.959 10.717  10.052  1.00 57.19  ? 141 PRO A CD    1 
ATOM   1448 N N     . MET B 2 141 ? 138.930 11.531  11.801  1.00 68.23  ? 142 MET A N     1 
ATOM   1449 C CA    . MET B 2 141 ? 137.590 11.001  11.611  1.00 63.26  ? 142 MET A CA    1 
ATOM   1450 C C     . MET B 2 141 ? 136.395 11.845  12.076  1.00 57.80  ? 142 MET A C     1 
ATOM   1451 O O     . MET B 2 141 ? 136.443 12.585  13.067  1.00 50.15  ? 142 MET A O     1 
ATOM   1452 C CB    . MET B 2 141 ? 137.494 9.630   12.289  1.00 63.55  ? 142 MET A CB    1 
ATOM   1453 C CG    . MET B 2 141 ? 137.045 9.703   13.742  1.00 61.29  ? 142 MET A CG    1 
ATOM   1454 S SD    . MET B 2 141 ? 137.670 8.278   14.641  1.00 64.51  ? 142 MET A SD    1 
ATOM   1455 C CE    . MET B 2 141 ? 137.110 8.720   16.258  1.00 58.90  ? 142 MET A CE    1 
ATOM   1456 N N     . VAL B 2 142 ? 135.299 11.695  11.350  1.00 56.26  ? 143 VAL A N     1 
ATOM   1457 C CA    . VAL B 2 142 ? 134.078 12.409  11.688  1.00 57.55  ? 143 VAL A CA    1 
ATOM   1458 C C     . VAL B 2 142 ? 132.938 11.405  12.014  1.00 53.86  ? 143 VAL A C     1 
ATOM   1459 O O     . VAL B 2 142 ? 132.660 10.479  11.223  1.00 51.05  ? 143 VAL A O     1 
ATOM   1460 C CB    . VAL B 2 142 ? 133.708 13.448  10.600  1.00 60.01  ? 143 VAL A CB    1 
ATOM   1461 C CG1   . VAL B 2 142 ? 134.149 12.955  9.256   1.00 59.39  ? 143 VAL A CG1   1 
ATOM   1462 C CG2   . VAL B 2 142 ? 132.225 13.759  10.586  1.00 58.91  ? 143 VAL A CG2   1 
ATOM   1463 N N     . VAL B 2 143 ? 132.310 11.573  13.185  1.00 47.60  ? 144 VAL A N     1 
ATOM   1464 C CA    . VAL B 2 143 ? 131.201 10.696  13.580  1.00 51.72  ? 144 VAL A CA    1 
ATOM   1465 C C     . VAL B 2 143 ? 129.868 11.356  13.076  1.00 57.22  ? 144 VAL A C     1 
ATOM   1466 O O     . VAL B 2 143 ? 129.381 12.356  13.609  1.00 62.43  ? 144 VAL A O     1 
ATOM   1467 C CB    . VAL B 2 143 ? 131.212 10.315  15.046  1.00 52.46  ? 144 VAL A CB    1 
ATOM   1468 C CG1   . VAL B 2 143 ? 131.671 11.463  15.871  1.00 51.82  ? 144 VAL A CG1   1 
ATOM   1469 C CG2   . VAL B 2 143 ? 129.827 9.869   15.447  1.00 53.75  ? 144 VAL A CG2   1 
ATOM   1470 N N     . MET B 2 144 ? 129.309 10.788  12.016  1.00 41.64  ? 145 MET A N     1 
ATOM   1471 C CA    . MET B 2 144 ? 128.126 11.304  11.381  1.00 36.29  ? 145 MET A CA    1 
ATOM   1472 C C     . MET B 2 144 ? 126.699 11.002  11.883  1.00 52.10  ? 145 MET A C     1 
ATOM   1473 O O     . MET B 2 144 ? 125.716 11.421  11.241  1.00 52.56  ? 145 MET A O     1 
ATOM   1474 C CB    . MET B 2 144 ? 128.242 10.885  9.921   1.00 36.95  ? 145 MET A CB    1 
ATOM   1475 C CG    . MET B 2 144 ? 129.274 9.797   9.706   1.00 41.94  ? 145 MET A CG    1 
ATOM   1476 S SD    . MET B 2 144 ? 129.371 9.303   7.979   1.00 50.89  ? 145 MET A SD    1 
ATOM   1477 C CE    . MET B 2 144 ? 128.321 10.600  7.338   1.00 52.65  ? 145 MET A CE    1 
ATOM   1478 N N     . ASP B 2 145 ? 126.560 10.296  13.004  1.00 48.29  ? 146 ASP A N     1 
ATOM   1479 C CA    . ASP B 2 145 ? 125.241 9.964   13.464  1.00 41.23  ? 146 ASP A CA    1 
ATOM   1480 C C     . ASP B 2 145 ? 124.958 10.043  14.943  1.00 47.17  ? 146 ASP A C     1 
ATOM   1481 O O     . ASP B 2 145 ? 124.188 9.238   15.497  1.00 44.28  ? 146 ASP A O     1 
ATOM   1482 C CB    . ASP B 2 145 ? 124.960 8.542   12.975  1.00 43.16  ? 146 ASP A CB    1 
ATOM   1483 C CG    . ASP B 2 145 ? 125.869 7.499   13.627  1.00 42.82  ? 146 ASP A CG    1 
ATOM   1484 O OD1   . ASP B 2 145 ? 126.634 7.859   14.563  1.00 42.37  ? 146 ASP A OD1   1 
ATOM   1485 O OD2   . ASP B 2 145 ? 125.786 6.313   13.215  1.00 43.42  ? 146 ASP A OD2   1 
ATOM   1486 N N     . ARG B 2 146 ? 125.535 10.993  15.628  1.00 45.86  ? 147 ARG A N     1 
ATOM   1487 C CA    . ARG B 2 146 ? 125.229 11.033  17.030  1.00 45.99  ? 147 ARG A CA    1 
ATOM   1488 C C     . ARG B 2 146 ? 124.497 12.269  17.504  1.00 62.01  ? 147 ARG A C     1 
ATOM   1489 O O     . ARG B 2 146 ? 124.231 13.233  16.732  1.00 53.21  ? 147 ARG A O     1 
ATOM   1490 C CB    . ARG B 2 146 ? 126.448 10.761  17.870  1.00 43.97  ? 147 ARG A CB    1 
ATOM   1491 C CG    . ARG B 2 146 ? 127.227 9.557   17.417  1.00 82.40  ? 147 ARG A CG    1 
ATOM   1492 C CD    . ARG B 2 146 ? 128.324 9.236   18.399  1.00 97.48  ? 147 ARG A CD    1 
ATOM   1493 N NE    . ARG B 2 146 ? 127.776 8.881   19.716  1.00 100.00 ? 147 ARG A NE    1 
ATOM   1494 C CZ    . ARG B 2 146 ? 128.187 9.408   20.878  1.00 100.00 ? 147 ARG A CZ    1 
ATOM   1495 N NH1   . ARG B 2 146 ? 129.166 10.322  20.899  1.00 100.00 ? 147 ARG A NH1   1 
ATOM   1496 N NH2   . ARG B 2 146 ? 127.625 9.023   22.028  1.00 61.23  ? 147 ARG A NH2   1 
ATOM   1497 N N     . GLY B 2 147 ? 124.165 12.214  18.788  1.00 73.35  ? 148 GLY A N     1 
ATOM   1498 C CA    . GLY B 2 147 ? 123.446 13.268  19.449  1.00 78.05  ? 148 GLY A CA    1 
ATOM   1499 C C     . GLY B 2 147 ? 124.126 14.593  19.521  1.00 83.61  ? 148 GLY A C     1 
ATOM   1500 O O     . GLY B 2 147 ? 123.892 15.484  18.720  1.00 86.71  ? 148 GLY A O     1 
ATOM   1501 N N     . GLU B 2 148 ? 124.966 14.710  20.513  1.00 78.77  ? 149 GLU A N     1 
ATOM   1502 C CA    . GLU B 2 148 ? 125.709 15.908  20.778  1.00 80.23  ? 149 GLU A CA    1 
ATOM   1503 C C     . GLU B 2 148 ? 127.134 15.621  20.402  1.00 93.75  ? 149 GLU A C     1 
ATOM   1504 O O     . GLU B 2 148 ? 127.425 15.207  19.252  1.00 91.64  ? 149 GLU A O     1 
ATOM   1505 C CB    . GLU B 2 148 ? 125.616 16.191  22.287  1.00 81.08  ? 149 GLU A CB    1 
ATOM   1506 C CG    . GLU B 2 148 ? 126.081 15.042  23.240  1.00 100.00 ? 149 GLU A CG    1 
ATOM   1507 C CD    . GLU B 2 148 ? 125.423 13.642  23.037  1.00 100.00 ? 149 GLU A CD    1 
ATOM   1508 O OE1   . GLU B 2 148 ? 125.895 12.841  22.190  1.00 100.00 ? 149 GLU A OE1   1 
ATOM   1509 O OE2   . GLU B 2 148 ? 124.473 13.317  23.782  1.00 100.00 ? 149 GLU A OE2   1 
ATOM   1510 N N     . ALA B 2 149 ? 128.000 15.829  21.411  1.00 100.00 ? 150 ALA A N     1 
ATOM   1511 C CA    . ALA B 2 149 ? 129.476 15.633  21.406  1.00 100.00 ? 150 ALA A CA    1 
ATOM   1512 C C     . ALA B 2 149 ? 130.014 14.941  22.706  1.00 100.00 ? 150 ALA A C     1 
ATOM   1513 O O     . ALA B 2 149 ? 130.299 15.623  23.742  1.00 100.00 ? 150 ALA A O     1 
ATOM   1514 C CB    . ALA B 2 149 ? 130.231 16.961  21.160  1.00 100.00 ? 150 ALA A CB    1 
ATOM   1515 N N     . LYS B 2 150 ? 130.151 13.603  22.626  1.00 100.00 ? 151 LYS A N     1 
ATOM   1516 C CA    . LYS B 2 150 ? 130.674 12.752  23.717  1.00 100.00 ? 151 LYS A CA    1 
ATOM   1517 C C     . LYS B 2 150 ? 132.106 12.516  23.215  1.00 100.00 ? 151 LYS A C     1 
ATOM   1518 O O     . LYS B 2 150 ? 132.838 11.623  23.679  1.00 100.00 ? 151 LYS A O     1 
ATOM   1519 C CB    . LYS B 2 150 ? 129.919 11.427  23.810  1.00 100.00 ? 151 LYS A CB    1 
ATOM   1520 C CG    . LYS B 2 150 ? 129.077 11.283  25.092  1.00 100.00 ? 151 LYS A CG    1 
ATOM   1521 C CD    . LYS B 2 150 ? 128.249 9.996   25.077  1.00 100.00 ? 151 LYS A CD    1 
ATOM   1522 C CE    . LYS B 2 150 ? 127.435 9.793   26.370  1.00 100.00 ? 151 LYS A CE    1 
ATOM   1523 N NZ    . LYS B 2 150 ? 126.335 8.762   26.305  1.00 100.00 ? 151 LYS A NZ    1 
ATOM   1524 N N     . ALA B 2 151 ? 132.449 13.360  22.242  1.00 100.00 ? 152 ALA A N     1 
ATOM   1525 C CA    . ALA B 2 151 ? 133.726 13.403  21.570  1.00 99.57  ? 152 ALA A CA    1 
ATOM   1526 C C     . ALA B 2 151 ? 134.403 14.730  21.850  1.00 98.14  ? 152 ALA A C     1 
ATOM   1527 O O     . ALA B 2 151 ? 133.812 15.663  22.402  1.00 94.01  ? 152 ALA A O     1 
ATOM   1528 C CB    . ALA B 2 151 ? 133.545 13.212  20.065  1.00 100.00 ? 152 ALA A CB    1 
ATOM   1529 N N     . ASP B 2 152 ? 135.663 14.802  21.468  1.00 95.99  ? 153 ASP A N     1 
ATOM   1530 C CA    . ASP B 2 152 ? 136.476 16.000  21.667  1.00 97.92  ? 153 ASP A CA    1 
ATOM   1531 C C     . ASP B 2 152 ? 137.729 15.702  20.847  1.00 100.00 ? 153 ASP A C     1 
ATOM   1532 O O     . ASP B 2 152 ? 138.647 16.524  20.679  1.00 100.00 ? 153 ASP A O     1 
ATOM   1533 C CB    . ASP B 2 152 ? 136.842 16.120  23.163  1.00 100.00 ? 153 ASP A CB    1 
ATOM   1534 C CG    . ASP B 2 152 ? 136.733 14.785  23.907  1.00 100.00 ? 153 ASP A CG    1 
ATOM   1535 O OD1   . ASP B 2 152 ? 136.111 14.740  25.000  1.00 100.00 ? 153 ASP A OD1   1 
ATOM   1536 O OD2   . ASP B 2 152 ? 137.236 13.755  23.399  1.00 100.00 ? 153 ASP A OD2   1 
ATOM   1537 N N     . PHE B 2 153 ? 137.723 14.480  20.341  1.00 94.38  ? 154 PHE A N     1 
ATOM   1538 C CA    . PHE B 2 153 ? 138.775 13.931  19.543  1.00 89.47  ? 154 PHE A CA    1 
ATOM   1539 C C     . PHE B 2 153 ? 138.139 13.698  18.198  1.00 99.09  ? 154 PHE A C     1 
ATOM   1540 O O     . PHE B 2 153 ? 138.605 12.853  17.427  1.00 100.00 ? 154 PHE A O     1 
ATOM   1541 C CB    . PHE B 2 153 ? 139.094 12.573  20.144  1.00 88.17  ? 154 PHE A CB    1 
ATOM   1542 C CG    . PHE B 2 153 ? 137.879 11.712  20.306  1.00 86.65  ? 154 PHE A CG    1 
ATOM   1543 C CD1   . PHE B 2 153 ? 136.954 11.983  21.293  1.00 90.28  ? 154 PHE A CD1   1 
ATOM   1544 C CD2   . PHE B 2 153 ? 137.640 10.657  19.452  1.00 89.70  ? 154 PHE A CD2   1 
ATOM   1545 C CE1   . PHE B 2 153 ? 135.828 11.199  21.452  1.00 93.81  ? 154 PHE A CE1   1 
ATOM   1546 C CE2   . PHE B 2 153 ? 136.501 9.874   19.598  1.00 94.23  ? 154 PHE A CE2   1 
ATOM   1547 C CZ    . PHE B 2 153 ? 135.589 10.149  20.598  1.00 91.84  ? 154 PHE A CZ    1 
ATOM   1548 N N     . THR B 2 154 ? 137.058 14.431  17.917  1.00 95.23  ? 155 THR A N     1 
ATOM   1549 C CA    . THR B 2 154 ? 136.355 14.247  16.639  1.00 93.18  ? 155 THR A CA    1 
ATOM   1550 C C     . THR B 2 154 ? 135.577 15.349  15.931  1.00 93.96  ? 155 THR A C     1 
ATOM   1551 O O     . THR B 2 154 ? 135.286 16.418  16.473  1.00 98.23  ? 155 THR A O     1 
ATOM   1552 C CB    . THR B 2 154 ? 135.303 13.122  16.754  1.00 77.56  ? 155 THR A CB    1 
ATOM   1553 O OG1   . THR B 2 154 ? 135.352 12.507  18.048  1.00 94.45  ? 155 THR A OG1   1 
ATOM   1554 C CG2   . THR B 2 154 ? 135.530 12.110  15.667  1.00 65.81  ? 155 THR A CG2   1 
ATOM   1555 N N     . ASP B 2 155 ? 135.209 15.031  14.694  1.00 77.15  ? 156 ASP A N     1 
ATOM   1556 C CA    . ASP B 2 155 ? 134.432 15.927  13.892  1.00 71.06  ? 156 ASP A CA    1 
ATOM   1557 C C     . ASP B 2 155 ? 133.049 15.319  13.851  1.00 67.68  ? 156 ASP A C     1 
ATOM   1558 O O     . ASP B 2 155 ? 132.894 14.110  13.842  1.00 61.08  ? 156 ASP A O     1 
ATOM   1559 C CB    . ASP B 2 155 ? 135.050 16.160  12.552  1.00 71.03  ? 156 ASP A CB    1 
ATOM   1560 C CG    . ASP B 2 155 ? 135.943 17.376  12.576  1.00 76.54  ? 156 ASP A CG    1 
ATOM   1561 O OD1   . ASP B 2 155 ? 136.342 17.770  13.710  1.00 72.63  ? 156 ASP A OD1   1 
ATOM   1562 O OD2   . ASP B 2 155 ? 136.210 17.954  11.497  1.00 65.04  ? 156 ASP A OD2   1 
ATOM   1563 N N     . ALA B 2 156 ? 132.029 16.159  13.878  1.00 64.18  ? 157 ALA A N     1 
ATOM   1564 C CA    . ALA B 2 156 ? 130.679 15.650  13.885  1.00 57.18  ? 157 ALA A CA    1 
ATOM   1565 C C     . ALA B 2 156 ? 129.683 16.425  13.130  1.00 59.23  ? 157 ALA A C     1 
ATOM   1566 O O     . ALA B 2 156 ? 129.797 17.617  12.944  1.00 54.11  ? 157 ALA A O     1 
ATOM   1567 C CB    . ALA B 2 156 ? 130.191 15.579  15.305  1.00 54.56  ? 157 ALA A CB    1 
ATOM   1568 N N     . VAL B 2 157 ? 128.655 15.723  12.712  1.00 60.86  ? 158 VAL A N     1 
ATOM   1569 C CA    . VAL B 2 157 ? 127.594 16.377  12.028  1.00 57.09  ? 158 VAL A CA    1 
ATOM   1570 C C     . VAL B 2 157 ? 126.394 16.049  12.904  1.00 51.80  ? 158 VAL A C     1 
ATOM   1571 O O     . VAL B 2 157 ? 126.272 14.937  13.447  1.00 41.80  ? 158 VAL A O     1 
ATOM   1572 C CB    . VAL B 2 157 ? 127.438 15.938  10.597  1.00 56.34  ? 158 VAL A CB    1 
ATOM   1573 C CG1   . VAL B 2 157 ? 128.737 15.392  10.085  1.00 52.82  ? 158 VAL A CG1   1 
ATOM   1574 C CG2   . VAL B 2 157 ? 126.328 14.954  10.485  1.00 58.90  ? 158 VAL A CG2   1 
ATOM   1575 N N     . ILE B 2 158 ? 125.535 17.029  13.094  1.00 51.98  ? 159 ILE A N     1 
ATOM   1576 C CA    . ILE B 2 158 ? 124.368 16.780  13.910  1.00 52.54  ? 159 ILE A CA    1 
ATOM   1577 C C     . ILE B 2 158 ? 123.148 16.998  13.070  1.00 50.70  ? 159 ILE A C     1 
ATOM   1578 O O     . ILE B 2 158 ? 123.067 17.977  12.316  1.00 47.84  ? 159 ILE A O     1 
ATOM   1579 C CB    . ILE B 2 158 ? 124.336 17.551  15.141  1.00 55.34  ? 159 ILE A CB    1 
ATOM   1580 C CG1   . ILE B 2 158 ? 123.840 18.924  14.864  1.00 59.08  ? 159 ILE A CG1   1 
ATOM   1581 C CG2   . ILE B 2 158 ? 125.686 17.558  15.774  1.00 50.64  ? 159 ILE A CG2   1 
ATOM   1582 C CD1   . ILE B 2 158 ? 123.228 19.553  16.094  1.00 100.00 ? 159 ILE A CD1   1 
ATOM   1583 N N     . ASP B 2 159 ? 122.217 16.047  13.201  1.00 46.86  ? 160 ASP A N     1 
ATOM   1584 C CA    . ASP B 2 159 ? 120.960 16.024  12.450  1.00 41.35  ? 160 ASP A CA    1 
ATOM   1585 C C     . ASP B 2 159 ? 119.709 16.641  13.030  1.00 46.53  ? 160 ASP A C     1 
ATOM   1586 O O     . ASP B 2 159 ? 118.698 16.639  12.384  1.00 58.20  ? 160 ASP A O     1 
ATOM   1587 C CB    . ASP B 2 159 ? 120.647 14.608  12.056  1.00 33.58  ? 160 ASP A CB    1 
ATOM   1588 C CG    . ASP B 2 159 ? 120.328 13.790  13.233  1.00 37.04  ? 160 ASP A CG    1 
ATOM   1589 O OD1   . ASP B 2 159 ? 120.468 14.335  14.334  1.00 42.31  ? 160 ASP A OD1   1 
ATOM   1590 O OD2   . ASP B 2 159 ? 119.988 12.618  13.082  1.00 55.90  ? 160 ASP A OD2   1 
ATOM   1591 N N     . ASN B 2 160 ? 119.767 17.144  14.242  1.00 49.67  ? 161 ASN A N     1 
ATOM   1592 C CA    . ASN B 2 160 ? 118.587 17.768  14.855  1.00 49.52  ? 161 ASN A CA    1 
ATOM   1593 C C     . ASN B 2 160 ? 117.392 16.836  14.796  1.00 54.78  ? 161 ASN A C     1 
ATOM   1594 O O     . ASN B 2 160 ? 116.395 17.163  14.176  1.00 59.63  ? 161 ASN A O     1 
ATOM   1595 C CB    . ASN B 2 160 ? 118.261 19.001  14.053  1.00 45.85  ? 161 ASN A CB    1 
ATOM   1596 C CG    . ASN B 2 160 ? 119.247 20.080  14.267  1.00 54.53  ? 161 ASN A CG    1 
ATOM   1597 O OD1   . ASN B 2 160 ? 119.315 20.663  15.343  1.00 40.39  ? 161 ASN A OD1   1 
ATOM   1598 N ND2   . ASN B 2 160 ? 120.051 20.349  13.258  1.00 55.48  ? 161 ASN A ND2   1 
ATOM   1599 N N     . ALA B 2 161 ? 117.528 15.676  15.421  1.00 48.42  ? 162 ALA A N     1 
ATOM   1600 C CA    . ALA B 2 161 ? 116.512 14.651  15.451  1.00 44.50  ? 162 ALA A CA    1 
ATOM   1601 C C     . ALA B 2 161 ? 115.439 15.038  16.405  1.00 51.91  ? 162 ALA A C     1 
ATOM   1602 O O     . ALA B 2 161 ? 114.298 14.644  16.269  1.00 58.44  ? 162 ALA A O     1 
ATOM   1603 C CB    . ALA B 2 161 ? 117.129 13.323  15.865  1.00 42.28  ? 162 ALA A CB    1 
ATOM   1604 N N     . PHE B 2 162 ? 115.814 15.814  17.391  1.00 48.70  ? 163 PHE A N     1 
ATOM   1605 C CA    . PHE B 2 162 ? 114.858 16.264  18.371  1.00 45.04  ? 163 PHE A CA    1 
ATOM   1606 C C     . PHE B 2 162 ? 113.875 17.136  17.620  1.00 52.82  ? 163 PHE A C     1 
ATOM   1607 O O     . PHE B 2 162 ? 112.709 16.835  17.528  1.00 59.07  ? 163 PHE A O     1 
ATOM   1608 C CB    . PHE B 2 162 ? 115.559 17.125  19.315  1.00 40.22  ? 163 PHE A CB    1 
ATOM   1609 C CG    . PHE B 2 162 ? 114.706 17.598  20.400  1.00 40.99  ? 163 PHE A CG    1 
ATOM   1610 C CD1   . PHE B 2 162 ? 114.186 18.886  20.374  1.00 36.21  ? 163 PHE A CD1   1 
ATOM   1611 C CD2   . PHE B 2 162 ? 114.407 16.756  21.484  1.00 45.38  ? 163 PHE A CD2   1 
ATOM   1612 C CE1   . PHE B 2 162 ? 113.389 19.336  21.428  1.00 32.89  ? 163 PHE A CE1   1 
ATOM   1613 C CE2   . PHE B 2 162 ? 113.601 17.209  22.532  1.00 44.67  ? 163 PHE A CE2   1 
ATOM   1614 C CZ    . PHE B 2 162 ? 113.092 18.492  22.497  1.00 34.50  ? 163 PHE A CZ    1 
ATOM   1615 N N     . GLU B 2 163 ? 114.369 18.217  17.064  1.00 47.54  ? 164 GLU A N     1 
ATOM   1616 C CA    . GLU B 2 163 ? 113.535 19.116  16.294  1.00 50.19  ? 164 GLU A CA    1 
ATOM   1617 C C     . GLU B 2 163 ? 112.727 18.433  15.139  1.00 53.47  ? 164 GLU A C     1 
ATOM   1618 O O     . GLU B 2 163 ? 111.815 19.027  14.557  1.00 57.99  ? 164 GLU A O     1 
ATOM   1619 C CB    . GLU B 2 163 ? 114.380 20.288  15.793  1.00 51.76  ? 164 GLU A CB    1 
ATOM   1620 C CG    . GLU B 2 163 ? 114.224 20.649  14.335  1.00 76.13  ? 164 GLU A CG    1 
ATOM   1621 C CD    . GLU B 2 163 ? 113.312 21.857  14.131  1.00 100.00 ? 164 GLU A CD    1 
ATOM   1622 O OE1   . GLU B 2 163 ? 112.726 22.330  15.151  1.00 100.00 ? 164 GLU A OE1   1 
ATOM   1623 O OE2   . GLU B 2 163 ? 113.177 22.328  12.957  1.00 100.00 ? 164 GLU A OE2   1 
ATOM   1624 N N     . GLY B 2 164 ? 113.052 17.194  14.815  1.00 43.97  ? 165 GLY A N     1 
ATOM   1625 C CA    . GLY B 2 164 ? 112.343 16.487  13.762  1.00 39.73  ? 165 GLY A CA    1 
ATOM   1626 C C     . GLY B 2 164 ? 111.163 15.795  14.461  1.00 51.71  ? 165 GLY A C     1 
ATOM   1627 O O     . GLY B 2 164 ? 110.038 15.833  13.959  1.00 56.37  ? 165 GLY A O     1 
ATOM   1628 N N     . GLY B 2 165 ? 111.435 15.172  15.622  1.00 43.37  ? 166 GLY A N     1 
ATOM   1629 C CA    . GLY B 2 165 ? 110.427 14.464  16.430  1.00 38.29  ? 166 GLY A CA    1 
ATOM   1630 C C     . GLY B 2 165 ? 109.349 15.484  16.660  1.00 45.40  ? 166 GLY A C     1 
ATOM   1631 O O     . GLY B 2 165 ? 108.215 15.312  16.306  1.00 53.10  ? 166 GLY A O     1 
ATOM   1632 N N     . TYR B 2 166 ? 109.742 16.580  17.237  1.00 40.92  ? 167 TYR A N     1 
ATOM   1633 C CA    . TYR B 2 166 ? 108.856 17.663  17.503  1.00 35.28  ? 167 TYR A CA    1 
ATOM   1634 C C     . TYR B 2 166 ? 108.197 18.169  16.256  1.00 39.22  ? 167 TYR A C     1 
ATOM   1635 O O     . TYR B 2 166 ? 107.074 18.512  16.300  1.00 48.57  ? 167 TYR A O     1 
ATOM   1636 C CB    . TYR B 2 166 ? 109.643 18.761  18.119  1.00 34.09  ? 167 TYR A CB    1 
ATOM   1637 C CG    . TYR B 2 166 ? 108.882 19.985  18.516  1.00 32.73  ? 167 TYR A CG    1 
ATOM   1638 C CD1   . TYR B 2 166 ? 108.437 20.183  19.842  1.00 32.49  ? 167 TYR A CD1   1 
ATOM   1639 C CD2   . TYR B 2 166 ? 108.658 20.974  17.596  1.00 30.60  ? 167 TYR A CD2   1 
ATOM   1640 C CE1   . TYR B 2 166 ? 107.770 21.333  20.194  1.00 28.59  ? 167 TYR A CE1   1 
ATOM   1641 C CE2   . TYR B 2 166 ? 108.000 22.122  17.929  1.00 26.74  ? 167 TYR A CE2   1 
ATOM   1642 C CZ    . TYR B 2 166 ? 107.561 22.303  19.211  1.00 41.13  ? 167 TYR A CZ    1 
ATOM   1643 O OH    . TYR B 2 166 ? 106.906 23.488  19.448  1.00 65.98  ? 167 TYR A OH    1 
ATOM   1644 N N     . MET B 2 167 ? 108.862 18.238  15.133  1.00 42.22  ? 168 MET A N     1 
ATOM   1645 C CA    . MET B 2 167 ? 108.149 18.731  13.934  1.00 39.53  ? 168 MET A CA    1 
ATOM   1646 C C     . MET B 2 167 ? 107.002 17.778  13.646  1.00 47.76  ? 168 MET A C     1 
ATOM   1647 O O     . MET B 2 167 ? 105.890 18.187  13.310  1.00 53.27  ? 168 MET A O     1 
ATOM   1648 C CB    . MET B 2 167 ? 109.055 18.788  12.708  1.00 42.57  ? 168 MET A CB    1 
ATOM   1649 C CG    . MET B 2 167 ? 109.564 20.200  12.395  1.00 49.35  ? 168 MET A CG    1 
ATOM   1650 S SD    . MET B 2 167 ? 110.862 20.253  11.152  1.00 55.06  ? 168 MET A SD    1 
ATOM   1651 C CE    . MET B 2 167 ? 109.883 20.332  9.666   1.00 54.85  ? 168 MET A CE    1 
ATOM   1652 N N     . ALA B 2 168 ? 107.278 16.499  13.817  1.00 40.57  ? 169 ALA A N     1 
ATOM   1653 C CA    . ALA B 2 168 ? 106.298 15.470  13.580  1.00 38.76  ? 169 ALA A CA    1 
ATOM   1654 C C     . ALA B 2 168 ? 105.026 15.592  14.479  1.00 46.03  ? 169 ALA A C     1 
ATOM   1655 O O     . ALA B 2 168 ? 103.868 15.659  13.991  1.00 41.49  ? 169 ALA A O     1 
ATOM   1656 C CB    . ALA B 2 168 ? 106.955 14.108  13.694  1.00 36.64  ? 169 ALA A CB    1 
ATOM   1657 N N     . GLY B 2 169 ? 105.240 15.623  15.782  1.00 41.00  ? 170 GLY A N     1 
ATOM   1658 C CA    . GLY B 2 169 ? 104.142 15.750  16.713  1.00 41.82  ? 170 GLY A CA    1 
ATOM   1659 C C     . GLY B 2 169 ? 103.329 16.996  16.382  1.00 52.60  ? 170 GLY A C     1 
ATOM   1660 O O     . GLY B 2 169 ? 102.092 16.944  16.287  1.00 60.95  ? 170 GLY A O     1 
ATOM   1661 N N     . ARG B 2 170 ? 104.019 18.110  16.201  1.00 43.86  ? 171 ARG A N     1 
ATOM   1662 C CA    . ARG B 2 170 ? 103.334 19.351  15.884  1.00 42.34  ? 171 ARG A CA    1 
ATOM   1663 C C     . ARG B 2 170 ? 102.394 19.221  14.753  1.00 39.71  ? 171 ARG A C     1 
ATOM   1664 O O     . ARG B 2 170 ? 101.262 19.574  14.867  1.00 44.33  ? 171 ARG A O     1 
ATOM   1665 C CB    . ARG B 2 170 ? 104.299 20.474  15.625  1.00 30.37  ? 171 ARG A CB    1 
ATOM   1666 C CG    . ARG B 2 170 ? 105.003 20.836  16.866  1.00 53.54  ? 171 ARG A CG    1 
ATOM   1667 C CD    . ARG B 2 170 ? 104.203 21.815  17.673  1.00 40.91  ? 171 ARG A CD    1 
ATOM   1668 N NE    . ARG B 2 170 ? 103.278 22.494  16.798  1.00 41.68  ? 171 ARG A NE    1 
ATOM   1669 C CZ    . ARG B 2 170 ? 102.038 22.798  17.179  1.00 69.62  ? 171 ARG A CZ    1 
ATOM   1670 N NH1   . ARG B 2 170 ? 101.561 22.496  18.415  1.00 25.87  ? 171 ARG A NH1   1 
ATOM   1671 N NH2   . ARG B 2 170 ? 101.265 23.405  16.327  1.00 31.31  ? 171 ARG A NH2   1 
ATOM   1672 N N     . TYR B 2 171 ? 102.868 18.699  13.655  1.00 34.78  ? 172 TYR A N     1 
ATOM   1673 C CA    . TYR B 2 171 ? 102.005 18.537  12.517  1.00 36.09  ? 172 TYR A CA    1 
ATOM   1674 C C     . TYR B 2 171 ? 100.820 17.691  12.875  1.00 45.19  ? 172 TYR A C     1 
ATOM   1675 O O     . TYR B 2 171 ? 99.728  18.006  12.517  1.00 43.95  ? 172 TYR A O     1 
ATOM   1676 C CB    . TYR B 2 171 ? 102.721 17.777  11.499  1.00 33.04  ? 172 TYR A CB    1 
ATOM   1677 C CG    . TYR B 2 171 ? 102.022 17.664  10.202  1.00 30.54  ? 172 TYR A CG    1 
ATOM   1678 C CD1   . TYR B 2 171 ? 101.932 18.741  9.322   1.00 32.06  ? 172 TYR A CD1   1 
ATOM   1679 C CD2   . TYR B 2 171 ? 101.506 16.454  9.807   1.00 30.51  ? 172 TYR A CD2   1 
ATOM   1680 C CE1   . TYR B 2 171 ? 101.313 18.586  8.074   1.00 34.14  ? 172 TYR A CE1   1 
ATOM   1681 C CE2   . TYR B 2 171 ? 100.895 16.295  8.581   1.00 29.01  ? 172 TYR A CE2   1 
ATOM   1682 C CZ    . TYR B 2 171 ? 100.794 17.350  7.726   1.00 30.92  ? 172 TYR A CZ    1 
ATOM   1683 O OH    . TYR B 2 171 ? 100.176 17.096  6.543   1.00 45.20  ? 172 TYR A OH    1 
ATOM   1684 N N     . LEU B 2 172 ? 101.046 16.602  13.581  1.00 39.87  ? 173 LEU A N     1 
ATOM   1685 C CA    . LEU B 2 172 ? 99.950  15.775  13.938  1.00 34.12  ? 173 LEU A CA    1 
ATOM   1686 C C     . LEU B 2 172 ? 98.943  16.592  14.724  1.00 41.61  ? 173 LEU A C     1 
ATOM   1687 O O     . LEU B 2 172 ? 97.759  16.464  14.527  1.00 43.57  ? 173 LEU A O     1 
ATOM   1688 C CB    . LEU B 2 172 ? 100.436 14.653  14.768  1.00 30.87  ? 173 LEU A CB    1 
ATOM   1689 C CG    . LEU B 2 172 ? 101.083 13.550  13.951  1.00 34.49  ? 173 LEU A CG    1 
ATOM   1690 C CD1   . LEU B 2 172 ? 101.242 12.311  14.857  1.00 38.12  ? 173 LEU A CD1   1 
ATOM   1691 C CD2   . LEU B 2 172 ? 100.366 13.212  12.663  1.00 20.47  ? 173 LEU A CD2   1 
ATOM   1692 N N     . ILE B 2 173 ? 99.443  17.446  15.592  1.00 36.26  ? 174 ILE A N     1 
ATOM   1693 C CA    . ILE B 2 173 ? 98.604  18.299  16.412  1.00 35.48  ? 174 ILE A CA    1 
ATOM   1694 C C     . ILE B 2 173 ? 97.874  19.336  15.572  1.00 43.46  ? 174 ILE A C     1 
ATOM   1695 O O     . ILE B 2 173 ? 96.672  19.550  15.691  1.00 47.23  ? 174 ILE A O     1 
ATOM   1696 C CB    . ILE B 2 173 ? 99.433  19.014  17.458  1.00 36.97  ? 174 ILE A CB    1 
ATOM   1697 C CG1   . ILE B 2 173 ? 99.819  18.044  18.529  1.00 38.36  ? 174 ILE A CG1   1 
ATOM   1698 C CG2   . ILE B 2 173 ? 98.666  20.132  18.155  1.00 36.15  ? 174 ILE A CG2   1 
ATOM   1699 C CD1   . ILE B 2 173 ? 100.628 18.711  19.603  1.00 43.69  ? 174 ILE A CD1   1 
ATOM   1700 N N     . GLU B 2 174 ? 98.612  19.985  14.726  1.00 41.58  ? 175 GLU A N     1 
ATOM   1701 C CA    . GLU B 2 174 ? 98.057  20.991  13.866  1.00 44.21  ? 175 GLU A CA    1 
ATOM   1702 C C     . GLU B 2 174 ? 97.019  20.385  12.902  1.00 57.81  ? 175 GLU A C     1 
ATOM   1703 O O     . GLU B 2 174 ? 96.335  21.109  12.188  1.00 62.13  ? 175 GLU A O     1 
ATOM   1704 C CB    . GLU B 2 174 ? 99.194  21.631  13.056  1.00 43.78  ? 175 GLU A CB    1 
ATOM   1705 C CG    . GLU B 2 174 ? 100.269 22.241  13.929  1.00 43.50  ? 175 GLU A CG    1 
ATOM   1706 C CD    . GLU B 2 174 ? 101.142 23.203  13.168  1.00 75.88  ? 175 GLU A CD    1 
ATOM   1707 O OE1   . GLU B 2 174 ? 101.163 23.127  11.905  1.00 59.85  ? 175 GLU A OE1   1 
ATOM   1708 O OE2   . GLU B 2 174 ? 101.778 24.057  13.833  1.00 47.79  ? 175 GLU A OE2   1 
ATOM   1709 N N     . ARG B 2 175 ? 96.914  19.061  12.867  1.00 56.22  ? 176 ARG A N     1 
ATOM   1710 C CA    . ARG B 2 175 ? 95.957  18.408  11.973  1.00 51.41  ? 176 ARG A CA    1 
ATOM   1711 C C     . ARG B 2 175 ? 94.665  17.977  12.698  1.00 46.71  ? 176 ARG A C     1 
ATOM   1712 O O     . ARG B 2 175 ? 93.745  17.553  12.056  1.00 46.07  ? 176 ARG A O     1 
ATOM   1713 C CB    . ARG B 2 175 ? 96.583  17.220  11.248  1.00 48.80  ? 176 ARG A CB    1 
ATOM   1714 C CG    . ARG B 2 175 ? 97.398  17.600  10.067  1.00 41.54  ? 176 ARG A CG    1 
ATOM   1715 C CD    . ARG B 2 175 ? 96.645  18.356  9.065   1.00 35.41  ? 176 ARG A CD    1 
ATOM   1716 N NE    . ARG B 2 175 ? 96.857  17.840  7.705   1.00 57.69  ? 176 ARG A NE    1 
ATOM   1717 C CZ    . ARG B 2 175 ? 96.059  16.960  7.108   1.00 57.34  ? 176 ARG A CZ    1 
ATOM   1718 N NH1   . ARG B 2 175 ? 95.016  16.504  7.743   1.00 41.02  ? 176 ARG A NH1   1 
ATOM   1719 N NH2   . ARG B 2 175 ? 96.304  16.540  5.880   1.00 65.22  ? 176 ARG A NH2   1 
ATOM   1720 N N     . GLY B 2 176 ? 94.624  18.101  14.025  1.00 39.10  ? 177 GLY A N     1 
ATOM   1721 C CA    . GLY B 2 176 ? 93.458  17.757  14.792  1.00 38.06  ? 177 GLY A CA    1 
ATOM   1722 C C     . GLY B 2 176 ? 93.636  16.602  15.723  1.00 47.43  ? 177 GLY A C     1 
ATOM   1723 O O     . GLY B 2 176 ? 92.671  16.222  16.410  1.00 47.58  ? 177 GLY A O     1 
ATOM   1724 N N     . HIS B 2 177 ? 94.852  16.034  15.767  1.00 41.95  ? 178 HIS A N     1 
ATOM   1725 C CA    . HIS B 2 177 ? 95.140  14.863  16.639  1.00 33.24  ? 178 HIS A CA    1 
ATOM   1726 C C     . HIS B 2 177 ? 95.507  15.030  18.119  1.00 36.82  ? 178 HIS A C     1 
ATOM   1727 O O     . HIS B 2 177 ? 96.134  15.992  18.502  1.00 43.10  ? 178 HIS A O     1 
ATOM   1728 C CB    . HIS B 2 177 ? 96.026  13.833  15.932  1.00 28.67  ? 178 HIS A CB    1 
ATOM   1729 C CG    . HIS B 2 177 ? 95.536  13.452  14.571  1.00 28.92  ? 178 HIS A CG    1 
ATOM   1730 N ND1   . HIS B 2 177 ? 94.788  12.309  14.345  1.00 29.54  ? 178 HIS A ND1   1 
ATOM   1731 C CD2   . HIS B 2 177 ? 95.689  14.046  13.364  1.00 31.80  ? 178 HIS A CD2   1 
ATOM   1732 C CE1   . HIS B 2 177 ? 94.497  12.220  13.057  1.00 31.45  ? 178 HIS A CE1   1 
ATOM   1733 N NE2   . HIS B 2 177 ? 95.032  13.260  12.436  1.00 31.12  ? 178 HIS A NE2   1 
ATOM   1734 N N     . ARG B 2 178 ? 95.094  14.094  18.964  1.00 35.57  ? 179 ARG A N     1 
ATOM   1735 C CA    . ARG B 2 178 ? 95.420  14.197  20.389  1.00 35.24  ? 179 ARG A CA    1 
ATOM   1736 C C     . ARG B 2 178 ? 95.554  12.816  21.017  1.00 46.16  ? 179 ARG A C     1 
ATOM   1737 O O     . ARG B 2 178 ? 96.016  12.645  22.160  1.00 49.13  ? 179 ARG A O     1 
ATOM   1738 C CB    . ARG B 2 178 ? 94.432  15.069  21.137  1.00 37.93  ? 179 ARG A CB    1 
ATOM   1739 C CG    . ARG B 2 178 ? 94.404  16.483  20.705  1.00 32.30  ? 179 ARG A CG    1 
ATOM   1740 C CD    . ARG B 2 178 ? 93.652  17.221  21.737  1.00 29.15  ? 179 ARG A CD    1 
ATOM   1741 N NE    . ARG B 2 178 ? 94.529  17.911  22.642  1.00 38.37  ? 179 ARG A NE    1 
ATOM   1742 C CZ    . ARG B 2 178 ? 94.689  17.509  23.875  1.00 71.81  ? 179 ARG A CZ    1 
ATOM   1743 N NH1   . ARG B 2 178 ? 94.017  16.436  24.309  1.00 79.24  ? 179 ARG A NH1   1 
ATOM   1744 N NH2   . ARG B 2 178 ? 95.505  18.167  24.665  1.00 47.19  ? 179 ARG A NH2   1 
ATOM   1745 N N     . GLU B 2 179 ? 95.148  11.819  20.254  1.00 42.99  ? 180 GLU A N     1 
ATOM   1746 C CA    . GLU B 2 179 ? 95.264  10.477  20.727  1.00 43.04  ? 180 GLU A CA    1 
ATOM   1747 C C     . GLU B 2 179 ? 96.264  10.054  19.695  1.00 48.73  ? 180 GLU A C     1 
ATOM   1748 O O     . GLU B 2 179 ? 95.917  9.613   18.594  1.00 40.21  ? 180 GLU A O     1 
ATOM   1749 C CB    . GLU B 2 179 ? 93.972  9.711   20.596  1.00 45.61  ? 180 GLU A CB    1 
ATOM   1750 C CG    . GLU B 2 179 ? 93.035  9.871   21.795  1.00 63.57  ? 180 GLU A CG    1 
ATOM   1751 C CD    . GLU B 2 179 ? 91.624  9.387   21.474  1.00 77.67  ? 180 GLU A CD    1 
ATOM   1752 O OE1   . GLU B 2 179 ? 90.889  10.132  20.793  1.00 100.00 ? 180 GLU A OE1   1 
ATOM   1753 O OE2   . GLU B 2 179 ? 91.272  8.258   21.869  1.00 58.17  ? 180 GLU A OE2   1 
ATOM   1754 N N     . ILE B 2 180 ? 97.527  10.248  20.056  1.00 53.74  ? 181 ILE A N     1 
ATOM   1755 C CA    . ILE B 2 180 ? 98.628  9.912   19.177  1.00 51.08  ? 181 ILE A CA    1 
ATOM   1756 C C     . ILE B 2 180 ? 99.532  8.862   19.761  1.00 44.98  ? 181 ILE A C     1 
ATOM   1757 O O     . ILE B 2 180 ? 99.755  8.805   20.954  1.00 41.91  ? 181 ILE A O     1 
ATOM   1758 C CB    . ILE B 2 180 ? 99.427  11.141  18.834  1.00 51.88  ? 181 ILE A CB    1 
ATOM   1759 C CG1   . ILE B 2 180 ? 98.445  12.190  18.269  1.00 49.95  ? 181 ILE A CG1   1 
ATOM   1760 C CG2   . ILE B 2 180 ? 100.586 10.746  17.889  1.00 46.73  ? 181 ILE A CG2   1 
ATOM   1761 C CD1   . ILE B 2 180 ? 98.891  13.641  18.274  1.00 22.62  ? 181 ILE A CD1   1 
ATOM   1762 N N     . GLY B 2 181 ? 100.049 8.018   18.909  1.00 38.47  ? 182 GLY A N     1 
ATOM   1763 C CA    . GLY B 2 181 ? 100.933 6.974   19.378  1.00 39.42  ? 182 GLY A CA    1 
ATOM   1764 C C     . GLY B 2 181 ? 102.290 7.112   18.711  1.00 38.69  ? 182 GLY A C     1 
ATOM   1765 O O     . GLY B 2 181 ? 102.487 7.933   17.818  1.00 36.49  ? 182 GLY A O     1 
ATOM   1766 N N     . VAL B 2 182 ? 103.240 6.304   19.139  1.00 41.02  ? 183 VAL A N     1 
ATOM   1767 C CA    . VAL B 2 182 ? 104.557 6.412   18.526  1.00 40.70  ? 183 VAL A CA    1 
ATOM   1768 C C     . VAL B 2 182 ? 105.338 5.161   18.592  1.00 41.24  ? 183 VAL A C     1 
ATOM   1769 O O     . VAL B 2 182 ? 105.291 4.432   19.574  1.00 42.55  ? 183 VAL A O     1 
ATOM   1770 C CB    . VAL B 2 182 ? 105.385 7.572   19.183  1.00 42.28  ? 183 VAL A CB    1 
ATOM   1771 C CG1   . VAL B 2 182 ? 105.582 7.332   20.636  1.00 33.13  ? 183 VAL A CG1   1 
ATOM   1772 C CG2   . VAL B 2 182 ? 106.737 7.786   18.517  1.00 44.01  ? 183 VAL A CG2   1 
ATOM   1773 N N     . ILE B 2 183 ? 106.079 4.917   17.534  1.00 42.42  ? 184 ILE A N     1 
ATOM   1774 C CA    . ILE B 2 183 ? 106.957 3.747   17.471  1.00 43.82  ? 184 ILE A CA    1 
ATOM   1775 C C     . ILE B 2 183 ? 108.391 4.308   17.207  1.00 47.68  ? 184 ILE A C     1 
ATOM   1776 O O     . ILE B 2 183 ? 108.720 4.709   16.078  1.00 49.24  ? 184 ILE A O     1 
ATOM   1777 C CB    . ILE B 2 183 ? 106.583 2.910   16.361  1.00 44.11  ? 184 ILE A CB    1 
ATOM   1778 C CG1   . ILE B 2 183 ? 105.090 2.818   16.294  1.00 38.29  ? 184 ILE A CG1   1 
ATOM   1779 C CG2   . ILE B 2 183 ? 107.226 1.571   16.491  1.00 48.24  ? 184 ILE A CG2   1 
ATOM   1780 C CD1   . ILE B 2 183 ? 104.716 1.912   15.174  1.00 32.90  ? 184 ILE A CD1   1 
ATOM   1781 N N     . PRO B 2 184 ? 109.240 4.370   18.223  1.00 42.22  ? 185 PRO A N     1 
ATOM   1782 C CA    . PRO B 2 184 ? 110.596 4.919   17.975  1.00 41.15  ? 185 PRO A CA    1 
ATOM   1783 C C     . PRO B 2 184 ? 111.610 3.870   17.608  1.00 51.84  ? 185 PRO A C     1 
ATOM   1784 O O     . PRO B 2 184 ? 111.443 2.686   17.885  1.00 55.88  ? 185 PRO A O     1 
ATOM   1785 C CB    . PRO B 2 184 ? 110.989 5.504   19.316  1.00 38.00  ? 185 PRO A CB    1 
ATOM   1786 C CG    . PRO B 2 184 ? 110.174 4.733   20.339  1.00 37.94  ? 185 PRO A CG    1 
ATOM   1787 C CD    . PRO B 2 184 ? 109.034 4.025   19.638  1.00 36.79  ? 185 PRO A CD    1 
ATOM   1788 N N     . GLY B 2 185 ? 112.689 4.300   16.997  1.00 46.15  ? 186 GLY A N     1 
ATOM   1789 C CA    . GLY B 2 185 ? 113.714 3.351   16.652  1.00 46.37  ? 186 GLY A CA    1 
ATOM   1790 C C     . GLY B 2 185 ? 114.411 3.114   18.008  1.00 53.46  ? 186 GLY A C     1 
ATOM   1791 O O     . GLY B 2 185 ? 113.983 3.684   19.043  1.00 54.87  ? 186 GLY A O     1 
ATOM   1792 N N     . PRO B 2 186 ? 115.471 2.292   17.998  1.00 47.35  ? 187 PRO A N     1 
ATOM   1793 C CA    . PRO B 2 186 ? 116.271 1.935   19.198  1.00 44.01  ? 187 PRO A CA    1 
ATOM   1794 C C     . PRO B 2 186 ? 116.682 3.156   20.000  1.00 54.06  ? 187 PRO A C     1 
ATOM   1795 O O     . PRO B 2 186 ? 117.262 4.091   19.455  1.00 55.83  ? 187 PRO A O     1 
ATOM   1796 C CB    . PRO B 2 186 ? 117.500 1.326   18.596  1.00 45.48  ? 187 PRO A CB    1 
ATOM   1797 C CG    . PRO B 2 186 ? 117.043 0.787   17.289  1.00 47.57  ? 187 PRO A CG    1 
ATOM   1798 C CD    . PRO B 2 186 ? 116.071 1.767   16.768  1.00 41.94  ? 187 PRO A CD    1 
ATOM   1799 N N     . LEU B 2 187 ? 116.373 3.150   21.295  1.00 52.70  ? 188 LEU A N     1 
ATOM   1800 C CA    . LEU B 2 187 ? 116.689 4.273   22.160  1.00 51.95  ? 188 LEU A CA    1 
ATOM   1801 C C     . LEU B 2 187 ? 118.150 4.529   22.446  1.00 53.42  ? 188 LEU A C     1 
ATOM   1802 O O     . LEU B 2 187 ? 118.495 5.439   23.186  1.00 50.90  ? 188 LEU A O     1 
ATOM   1803 C CB    . LEU B 2 187 ? 115.927 4.141   23.465  1.00 52.49  ? 188 LEU A CB    1 
ATOM   1804 C CG    . LEU B 2 187 ? 114.402 4.040   23.353  1.00 51.13  ? 188 LEU A CG    1 
ATOM   1805 C CD1   . LEU B 2 187 ? 113.844 3.922   24.765  1.00 41.34  ? 188 LEU A CD1   1 
ATOM   1806 C CD2   . LEU B 2 187 ? 113.835 5.239   22.590  1.00 50.59  ? 188 LEU A CD2   1 
ATOM   1807 N N     . GLU B 2 188 ? 119.003 3.717   21.857  1.00 57.11  ? 189 GLU A N     1 
ATOM   1808 C CA    . GLU B 2 188 ? 120.432 3.839   22.044  1.00 60.77  ? 189 GLU A CA    1 
ATOM   1809 C C     . GLU B 2 188 ? 121.023 4.535   20.846  1.00 65.26  ? 189 GLU A C     1 
ATOM   1810 O O     . GLU B 2 188 ? 122.228 4.660   20.699  1.00 67.86  ? 189 GLU A O     1 
ATOM   1811 C CB    . GLU B 2 188 ? 121.021 2.450   22.203  1.00 63.96  ? 189 GLU A CB    1 
ATOM   1812 C CG    . GLU B 2 188 ? 120.166 1.562   23.102  1.00 84.03  ? 189 GLU A CG    1 
ATOM   1813 C CD    . GLU B 2 188 ? 119.209 0.707   22.299  1.00 100.00 ? 189 GLU A CD    1 
ATOM   1814 O OE1   . GLU B 2 188 ? 119.586 -0.447  21.978  1.00 100.00 ? 189 GLU A OE1   1 
ATOM   1815 O OE2   . GLU B 2 188 ? 118.096 1.192   21.971  1.00 92.44  ? 189 GLU A OE2   1 
ATOM   1816 N N     . ARG B 2 189 ? 120.136 4.991   19.990  1.00 58.25  ? 190 ARG A N     1 
ATOM   1817 C CA    . ARG B 2 189 ? 120.500 5.669   18.799  1.00 53.78  ? 190 ARG A CA    1 
ATOM   1818 C C     . ARG B 2 189 ? 119.928 7.040   18.859  1.00 55.18  ? 190 ARG A C     1 
ATOM   1819 O O     . ARG B 2 189 ? 118.936 7.269   19.501  1.00 60.49  ? 190 ARG A O     1 
ATOM   1820 C CB    . ARG B 2 189 ? 119.940 4.930   17.597  1.00 49.86  ? 190 ARG A CB    1 
ATOM   1821 C CG    . ARG B 2 189 ? 120.950 4.122   16.959  1.00 45.83  ? 190 ARG A CG    1 
ATOM   1822 C CD    . ARG B 2 189 ? 120.594 2.686   17.017  1.00 35.24  ? 190 ARG A CD    1 
ATOM   1823 N NE    . ARG B 2 189 ? 120.437 2.284   15.637  1.00 38.76  ? 190 ARG A NE    1 
ATOM   1824 C CZ    . ARG B 2 189 ? 120.535 1.053   15.199  1.00 49.66  ? 190 ARG A CZ    1 
ATOM   1825 N NH1   . ARG B 2 189 ? 120.797 0.078   16.039  1.00 52.02  ? 190 ARG A NH1   1 
ATOM   1826 N NH2   . ARG B 2 189 ? 120.349 0.809   13.917  1.00 49.75  ? 190 ARG A NH2   1 
ATOM   1827 N N     . ASN B 2 190 ? 120.580 7.950   18.171  1.00 47.15  ? 191 ASN A N     1 
ATOM   1828 C CA    . ASN B 2 190 ? 120.174 9.332   18.119  1.00 45.77  ? 191 ASN A CA    1 
ATOM   1829 C C     . ASN B 2 190 ? 118.834 9.390   17.393  1.00 48.95  ? 191 ASN A C     1 
ATOM   1830 O O     . ASN B 2 190 ? 117.854 9.940   17.899  1.00 50.40  ? 191 ASN A O     1 
ATOM   1831 C CB    . ASN B 2 190 ? 121.217 10.127  17.331  1.00 36.15  ? 191 ASN A CB    1 
ATOM   1832 C CG    . ASN B 2 190 ? 120.868 11.554  17.233  1.00 50.71  ? 191 ASN A CG    1 
ATOM   1833 O OD1   . ASN B 2 190 ? 120.614 12.196  18.278  1.00 34.97  ? 191 ASN A OD1   1 
ATOM   1834 N ND2   . ASN B 2 190 ? 120.786 12.093  15.972  1.00 22.55  ? 191 ASN A ND2   1 
ATOM   1835 N N     . THR B 2 191 ? 118.806 8.800   16.208  1.00 40.28  ? 192 THR A N     1 
ATOM   1836 C CA    . THR B 2 191 ? 117.639 8.757   15.390  1.00 38.02  ? 192 THR A CA    1 
ATOM   1837 C C     . THR B 2 191 ? 116.544 7.980   16.126  1.00 49.94  ? 192 THR A C     1 
ATOM   1838 O O     . THR B 2 191 ? 115.437 7.861   15.640  1.00 57.03  ? 192 THR A O     1 
ATOM   1839 C CB    . THR B 2 191 ? 117.939 8.083   14.076  1.00 36.60  ? 192 THR A CB    1 
ATOM   1840 O OG1   . THR B 2 191 ? 118.587 6.864   14.364  1.00 36.56  ? 192 THR A OG1   1 
ATOM   1841 C CG2   . THR B 2 191 ? 118.840 8.951   13.189  1.00 22.84  ? 192 THR A CG2   1 
ATOM   1842 N N     . GLY B 2 192 ? 116.845 7.459   17.304  1.00 48.70  ? 193 GLY A N     1 
ATOM   1843 C CA    . GLY B 2 192 ? 115.837 6.735   18.072  1.00 49.28  ? 193 GLY A CA    1 
ATOM   1844 C C     . GLY B 2 192 ? 115.300 7.709   19.148  1.00 55.95  ? 193 GLY A C     1 
ATOM   1845 O O     . GLY B 2 192 ? 114.325 8.420   18.943  1.00 55.84  ? 193 GLY A O     1 
ATOM   1846 N N     . ALA B 2 193 ? 115.973 7.735   20.288  1.00 55.63  ? 194 ALA A N     1 
ATOM   1847 C CA    . ALA B 2 193 ? 115.618 8.589   21.408  1.00 51.79  ? 194 ALA A CA    1 
ATOM   1848 C C     . ALA B 2 193 ? 115.501 10.063  21.024  1.00 55.23  ? 194 ALA A C     1 
ATOM   1849 O O     . ALA B 2 193 ? 114.675 10.818  21.551  1.00 49.93  ? 194 ALA A O     1 
ATOM   1850 C CB    . ALA B 2 193 ? 116.649 8.420   22.467  1.00 50.56  ? 194 ALA A CB    1 
ATOM   1851 N N     . GLY B 2 194 ? 116.345 10.482  20.087  1.00 48.42  ? 195 GLY A N     1 
ATOM   1852 C CA    . GLY B 2 194 ? 116.321 11.875  19.664  1.00 42.70  ? 195 GLY A CA    1 
ATOM   1853 C C     . GLY B 2 194 ? 114.998 12.293  19.089  1.00 44.71  ? 195 GLY A C     1 
ATOM   1854 O O     . GLY B 2 194 ? 114.406 13.247  19.534  1.00 45.52  ? 195 GLY A O     1 
ATOM   1855 N N     . ARG B 2 195 ? 114.556 11.573  18.074  1.00 39.84  ? 196 ARG A N     1 
ATOM   1856 C CA    . ARG B 2 195 ? 113.298 11.880  17.429  1.00 42.44  ? 196 ARG A CA    1 
ATOM   1857 C C     . ARG B 2 195 ? 112.170 11.798  18.468  1.00 48.55  ? 196 ARG A C     1 
ATOM   1858 O O     . ARG B 2 195 ? 111.336 12.689  18.576  1.00 48.64  ? 196 ARG A O     1 
ATOM   1859 C CB    . ARG B 2 195 ? 113.089 10.907  16.267  1.00 36.99  ? 196 ARG A CB    1 
ATOM   1860 C CG    . ARG B 2 195 ? 114.245 10.988  15.240  1.00 29.40  ? 196 ARG A CG    1 
ATOM   1861 C CD    . ARG B 2 195 ? 114.272 9.876   14.114  1.00 32.97  ? 196 ARG A CD    1 
ATOM   1862 N NE    . ARG B 2 195 ? 115.145 10.319  13.027  1.00 41.06  ? 196 ARG A NE    1 
ATOM   1863 C CZ    . ARG B 2 195 ? 115.352 9.662   11.896  1.00 54.13  ? 196 ARG A CZ    1 
ATOM   1864 N NH1   . ARG B 2 195 ? 114.749 8.515   11.688  1.00 47.14  ? 196 ARG A NH1   1 
ATOM   1865 N NH2   . ARG B 2 195 ? 116.175 10.154  10.974  1.00 43.46  ? 196 ARG A NH2   1 
ATOM   1866 N N     . LEU B 2 196 ? 112.186 10.722  19.235  1.00 39.56  ? 197 LEU A N     1 
ATOM   1867 C CA    . LEU B 2 196 ? 111.212 10.464  20.273  1.00 32.30  ? 197 LEU A CA    1 
ATOM   1868 C C     . LEU B 2 196 ? 111.045 11.656  21.150  1.00 50.27  ? 197 LEU A C     1 
ATOM   1869 O O     . LEU B 2 196 ? 109.984 12.210  21.247  1.00 65.16  ? 197 LEU A O     1 
ATOM   1870 C CB    . LEU B 2 196 ? 111.650 9.276   21.116  1.00 28.94  ? 197 LEU A CB    1 
ATOM   1871 C CG    . LEU B 2 196 ? 110.684 8.960   22.235  1.00 36.94  ? 197 LEU A CG    1 
ATOM   1872 C CD1   . LEU B 2 196 ? 109.394 8.717   21.485  1.00 41.23  ? 197 LEU A CD1   1 
ATOM   1873 C CD2   . LEU B 2 196 ? 111.066 7.687   23.001  1.00 29.03  ? 197 LEU A CD2   1 
ATOM   1874 N N     . ALA B 2 197 ? 112.088 12.084  21.805  1.00 50.46  ? 198 ALA A N     1 
ATOM   1875 C CA    . ALA B 2 197 ? 111.934 13.255  22.661  1.00 49.04  ? 198 ALA A CA    1 
ATOM   1876 C C     . ALA B 2 197 ? 111.456 14.507  21.929  1.00 52.24  ? 198 ALA A C     1 
ATOM   1877 O O     . ALA B 2 197 ? 110.736 15.309  22.523  1.00 54.87  ? 198 ALA A O     1 
ATOM   1878 C CB    . ALA B 2 197 ? 113.207 13.555  23.402  1.00 50.36  ? 198 ALA A CB    1 
ATOM   1879 N N     . GLY B 2 198 ? 111.869 14.687  20.669  1.00 45.56  ? 199 GLY A N     1 
ATOM   1880 C CA    . GLY B 2 198 ? 111.454 15.859  19.899  1.00 48.03  ? 199 GLY A CA    1 
ATOM   1881 C C     . GLY B 2 198 ? 109.918 15.824  19.933  1.00 53.95  ? 199 GLY A C     1 
ATOM   1882 O O     . GLY B 2 198 ? 109.225 16.762  20.392  1.00 45.15  ? 199 GLY A O     1 
ATOM   1883 N N     . PHE B 2 199 ? 109.418 14.695  19.473  1.00 53.16  ? 200 PHE A N     1 
ATOM   1884 C CA    . PHE B 2 199 ? 108.005 14.416  19.434  1.00 50.22  ? 200 PHE A CA    1 
ATOM   1885 C C     . PHE B 2 199 ? 107.359 14.579  20.803  1.00 47.50  ? 200 PHE A C     1 
ATOM   1886 O O     . PHE B 2 199 ? 106.317 15.200  20.945  1.00 52.02  ? 200 PHE A O     1 
ATOM   1887 C CB    . PHE B 2 199 ? 107.813 12.973  19.000  1.00 47.01  ? 200 PHE A CB    1 
ATOM   1888 C CG    . PHE B 2 199 ? 106.442 12.445  19.224  1.00 43.84  ? 200 PHE A CG    1 
ATOM   1889 C CD1   . PHE B 2 199 ? 105.399 12.722  18.326  1.00 46.62  ? 200 PHE A CD1   1 
ATOM   1890 C CD2   . PHE B 2 199 ? 106.183 11.645  20.290  1.00 38.28  ? 200 PHE A CD2   1 
ATOM   1891 C CE1   . PHE B 2 199 ? 104.122 12.205  18.542  1.00 45.16  ? 200 PHE A CE1   1 
ATOM   1892 C CE2   . PHE B 2 199 ? 104.900 11.120  20.510  1.00 42.42  ? 200 PHE A CE2   1 
ATOM   1893 C CZ    . PHE B 2 199 ? 103.870 11.400  19.647  1.00 37.72  ? 200 PHE A CZ    1 
ATOM   1894 N N     . MET B 2 200 ? 107.971 14.021  21.808  1.00 36.96  ? 201 MET A N     1 
ATOM   1895 C CA    . MET B 2 200 ? 107.400 14.104  23.130  1.00 36.42  ? 201 MET A CA    1 
ATOM   1896 C C     . MET B 2 200 ? 107.321 15.499  23.675  1.00 39.52  ? 201 MET A C     1 
ATOM   1897 O O     . MET B 2 200 ? 106.474 15.826  24.495  1.00 39.09  ? 201 MET A O     1 
ATOM   1898 C CB    . MET B 2 200 ? 108.090 13.112  24.058  1.00 39.87  ? 201 MET A CB    1 
ATOM   1899 C CG    . MET B 2 200 ? 107.180 12.510  25.114  1.00 46.38  ? 201 MET A CG    1 
ATOM   1900 S SD    . MET B 2 200 ? 106.101 11.134  24.698  1.00 43.38  ? 201 MET A SD    1 
ATOM   1901 C CE    . MET B 2 200 ? 106.645 10.834  23.095  1.00 36.77  ? 201 MET A CE    1 
ATOM   1902 N N     . LYS B 2 201 ? 108.197 16.347  23.191  1.00 42.52  ? 202 LYS A N     1 
ATOM   1903 C CA    . LYS B 2 201 ? 108.210 17.732  23.635  1.00 42.32  ? 202 LYS A CA    1 
ATOM   1904 C C     . LYS B 2 201 ? 106.874 18.275  23.200  1.00 50.48  ? 202 LYS A C     1 
ATOM   1905 O O     . LYS B 2 201 ? 106.079 18.808  23.974  1.00 49.64  ? 202 LYS A O     1 
ATOM   1906 C CB    . LYS B 2 201 ? 109.289 18.484  22.853  1.00 44.20  ? 202 LYS A CB    1 
ATOM   1907 C CG    . LYS B 2 201 ? 109.305 19.977  23.110  1.00 45.57  ? 202 LYS A CG    1 
ATOM   1908 C CD    . LYS B 2 201 ? 109.205 20.207  24.605  1.00 44.30  ? 202 LYS A CD    1 
ATOM   1909 C CE    . LYS B 2 201 ? 109.972 21.439  25.048  1.00 98.66  ? 202 LYS A CE    1 
ATOM   1910 N NZ    . LYS B 2 201 ? 109.277 22.064  26.214  1.00 100.00 ? 202 LYS A NZ    1 
ATOM   1911 N N     . ALA B 2 202 ? 106.661 18.126  21.910  1.00 50.05  ? 203 ALA A N     1 
ATOM   1912 C CA    . ALA B 2 202 ? 105.457 18.551  21.240  1.00 47.40  ? 203 ALA A CA    1 
ATOM   1913 C C     . ALA B 2 202 ? 104.178 18.184  22.046  1.00 58.36  ? 203 ALA A C     1 
ATOM   1914 O O     . ALA B 2 202 ? 103.303 19.017  22.269  1.00 54.79  ? 203 ALA A O     1 
ATOM   1915 C CB    . ALA B 2 202 ? 105.422 17.894  19.878  1.00 43.03  ? 203 ALA A CB    1 
ATOM   1916 N N     . MET B 2 203 ? 104.092 16.932  22.477  1.00 52.54  ? 204 MET A N     1 
ATOM   1917 C CA    . MET B 2 203 ? 102.952 16.476  23.218  1.00 44.61  ? 204 MET A CA    1 
ATOM   1918 C C     . MET B 2 203 ? 102.804 17.246  24.508  1.00 46.39  ? 204 MET A C     1 
ATOM   1919 O O     . MET B 2 203 ? 101.728 17.746  24.793  1.00 47.16  ? 204 MET A O     1 
ATOM   1920 C CB    . MET B 2 203 ? 103.043 14.968  23.466  1.00 44.97  ? 204 MET A CB    1 
ATOM   1921 C CG    . MET B 2 203 ? 103.269 14.128  22.204  1.00 45.11  ? 204 MET A CG    1 
ATOM   1922 S SD    . MET B 2 203 ? 101.891 14.262  21.045  1.00 46.62  ? 204 MET A SD    1 
ATOM   1923 C CE    . MET B 2 203 ? 102.508 14.915  19.509  1.00 36.36  ? 204 MET A CE    1 
ATOM   1924 N N     . GLU B 2 204 ? 103.869 17.363  25.299  1.00 42.70  ? 205 GLU A N     1 
ATOM   1925 C CA    . GLU B 2 204 ? 103.730 18.101  26.555  1.00 36.78  ? 205 GLU A CA    1 
ATOM   1926 C C     . GLU B 2 204 ? 103.348 19.491  26.389  1.00 42.97  ? 205 GLU A C     1 
ATOM   1927 O O     . GLU B 2 204 ? 102.690 20.065  27.247  1.00 51.75  ? 205 GLU A O     1 
ATOM   1928 C CB    . GLU B 2 204 ? 104.888 17.994  27.497  1.00 40.43  ? 205 GLU A CB    1 
ATOM   1929 C CG    . GLU B 2 204 ? 106.018 17.110  27.019  1.00 97.78  ? 205 GLU A CG    1 
ATOM   1930 C CD    . GLU B 2 204 ? 107.253 17.207  27.945  1.00 100.00 ? 205 GLU A CD    1 
ATOM   1931 O OE1   . GLU B 2 204 ? 108.145 16.306  27.861  1.00 100.00 ? 205 GLU A OE1   1 
ATOM   1932 O OE2   . GLU B 2 204 ? 107.319 18.196  28.745  1.00 100.00 ? 205 GLU A OE2   1 
ATOM   1933 N N     . GLU B 2 205 ? 103.743 20.081  25.287  1.00 44.80  ? 206 GLU A N     1 
ATOM   1934 C CA    . GLU B 2 205 ? 103.347 21.467  25.078  1.00 43.69  ? 206 GLU A CA    1 
ATOM   1935 C C     . GLU B 2 205 ? 101.826 21.408  24.918  1.00 52.81  ? 206 GLU A C     1 
ATOM   1936 O O     . GLU B 2 205 ? 101.101 22.192  25.487  1.00 47.55  ? 206 GLU A O     1 
ATOM   1937 C CB    . GLU B 2 205 ? 103.934 22.005  23.790  1.00 44.24  ? 206 GLU A CB    1 
ATOM   1938 C CG    . GLU B 2 205 ? 105.433 21.934  23.772  1.00 55.78  ? 206 GLU A CG    1 
ATOM   1939 C CD    . GLU B 2 205 ? 105.953 22.901  22.811  1.00 65.84  ? 206 GLU A CD    1 
ATOM   1940 O OE1   . GLU B 2 205 ? 105.544 22.806  21.641  1.00 44.23  ? 206 GLU A OE1   1 
ATOM   1941 O OE2   . GLU B 2 205 ? 106.709 23.793  23.239  1.00 57.03  ? 206 GLU A OE2   1 
ATOM   1942 N N     . ALA B 2 206 ? 101.368 20.438  24.132  1.00 58.60  ? 207 ALA A N     1 
ATOM   1943 C CA    . ALA B 2 206 ? 99.962  20.233  23.849  1.00 54.36  ? 207 ALA A CA    1 
ATOM   1944 C C     . ALA B 2 206 ? 99.246  19.585  24.967  1.00 57.16  ? 207 ALA A C     1 
ATOM   1945 O O     . ALA B 2 206 ? 98.084  19.316  24.863  1.00 62.77  ? 207 ALA A O     1 
ATOM   1946 C CB    . ALA B 2 206 ? 99.808  19.397  22.601  1.00 53.98  ? 207 ALA A CB    1 
ATOM   1947 N N     . MET B 2 207 ? 99.927  19.312  26.049  1.00 56.39  ? 208 MET A N     1 
ATOM   1948 C CA    . MET B 2 207 ? 99.237  18.679  27.149  1.00 59.89  ? 208 MET A CA    1 
ATOM   1949 C C     . MET B 2 207 ? 98.670  17.323  26.732  1.00 59.42  ? 208 MET A C     1 
ATOM   1950 O O     . MET B 2 207 ? 97.780  16.806  27.381  1.00 67.22  ? 208 MET A O     1 
ATOM   1951 C CB    . MET B 2 207 ? 98.107  19.572  27.638  1.00 64.93  ? 208 MET A CB    1 
ATOM   1952 C CG    . MET B 2 207 ? 98.035  19.739  29.146  1.00 76.53  ? 208 MET A CG    1 
ATOM   1953 S SD    . MET B 2 207 ? 97.677  21.443  29.597  1.00 86.61  ? 208 MET A SD    1 
ATOM   1954 C CE    . MET B 2 207 ? 98.895  22.272  28.583  1.00 83.14  ? 208 MET A CE    1 
ATOM   1955 N N     . ILE B 2 208 ? 99.183  16.744  25.655  1.00 42.75  ? 209 ILE A N     1 
ATOM   1956 C CA    . ILE B 2 208 ? 98.699  15.452  25.204  1.00 31.85  ? 209 ILE A CA    1 
ATOM   1957 C C     . ILE B 2 208 ? 99.465  14.405  25.939  1.00 43.79  ? 209 ILE A C     1 
ATOM   1958 O O     . ILE B 2 208 ? 100.655 14.328  25.825  1.00 56.11  ? 209 ILE A O     1 
ATOM   1959 C CB    . ILE B 2 208 ? 98.979  15.286  23.774  1.00 31.40  ? 209 ILE A CB    1 
ATOM   1960 C CG1   . ILE B 2 208 ? 97.936  16.011  22.929  1.00 36.88  ? 209 ILE A CG1   1 
ATOM   1961 C CG2   . ILE B 2 208 ? 98.989  13.868  23.450  1.00 30.55  ? 209 ILE A CG2   1 
ATOM   1962 C CD1   . ILE B 2 208 ? 98.442  16.597  21.624  1.00 32.07  ? 209 ILE A CD1   1 
ATOM   1963 N N     . LYS B 2 209 ? 98.780  13.599  26.718  1.00 47.95  ? 210 LYS A N     1 
ATOM   1964 C CA    . LYS B 2 209 ? 99.397  12.521  27.501  1.00 48.45  ? 210 LYS A CA    1 
ATOM   1965 C C     . LYS B 2 209 ? 99.621  11.371  26.567  1.00 55.15  ? 210 LYS A C     1 
ATOM   1966 O O     . LYS B 2 209 ? 98.789  11.080  25.764  1.00 63.61  ? 210 LYS A O     1 
ATOM   1967 C CB    . LYS B 2 209 ? 98.409  12.056  28.542  1.00 56.03  ? 210 LYS A CB    1 
ATOM   1968 C CG    . LYS B 2 209 ? 97.071  11.518  27.974  1.00 100.00 ? 210 LYS A CG    1 
ATOM   1969 C CD    . LYS B 2 209 ? 96.238  12.534  27.148  1.00 100.00 ? 210 LYS A CD    1 
ATOM   1970 C CE    . LYS B 2 209 ? 95.466  11.853  25.993  1.00 100.00 ? 210 LYS A CE    1 
ATOM   1971 N NZ    . LYS B 2 209 ? 95.171  12.705  24.790  1.00 52.08  ? 210 LYS A NZ    1 
ATOM   1972 N N     . VAL B 2 210 ? 100.736 10.698  26.644  1.00 49.03  ? 211 VAL A N     1 
ATOM   1973 C CA    . VAL B 2 210 ? 100.896 9.620   25.726  1.00 44.12  ? 211 VAL A CA    1 
ATOM   1974 C C     . VAL B 2 210 ? 101.014 8.357   26.477  1.00 60.89  ? 211 VAL A C     1 
ATOM   1975 O O     . VAL B 2 210 ? 102.019 8.062   27.109  1.00 69.17  ? 211 VAL A O     1 
ATOM   1976 C CB    . VAL B 2 210 ? 102.047 9.818   24.762  1.00 46.70  ? 211 VAL A CB    1 
ATOM   1977 C CG1   . VAL B 2 210 ? 102.015 8.732   23.713  1.00 48.96  ? 211 VAL A CG1   1 
ATOM   1978 C CG2   . VAL B 2 210 ? 102.004 11.208  24.126  1.00 46.47  ? 211 VAL A CG2   1 
ATOM   1979 N N     . PRO B 2 211 ? 99.943  7.609   26.409  1.00 59.51  ? 212 PRO A N     1 
ATOM   1980 C CA    . PRO B 2 211 ? 99.809  6.336   27.069  1.00 57.48  ? 212 PRO A CA    1 
ATOM   1981 C C     . PRO B 2 211 ? 100.847 5.330   26.622  1.00 51.42  ? 212 PRO A C     1 
ATOM   1982 O O     . PRO B 2 211 ? 101.089 5.157   25.436  1.00 49.38  ? 212 PRO A O     1 
ATOM   1983 C CB    . PRO B 2 211 ? 98.393  5.878   26.644  1.00 59.40  ? 212 PRO A CB    1 
ATOM   1984 C CG    . PRO B 2 211 ? 97.876  6.921   25.703  1.00 62.97  ? 212 PRO A CG    1 
ATOM   1985 C CD    . PRO B 2 211 ? 99.063  7.704   25.244  1.00 59.95  ? 212 PRO A CD    1 
ATOM   1986 N N     . GLU B 2 212 ? 101.450 4.662   27.586  1.00 43.72  ? 213 GLU A N     1 
ATOM   1987 C CA    . GLU B 2 212 ? 102.453 3.686   27.276  1.00 48.11  ? 213 GLU A CA    1 
ATOM   1988 C C     . GLU B 2 212 ? 101.961 2.539   26.391  1.00 55.73  ? 213 GLU A C     1 
ATOM   1989 O O     . GLU B 2 212 ? 102.770 1.836   25.733  1.00 58.77  ? 213 GLU A O     1 
ATOM   1990 C CB    . GLU B 2 212 ? 103.207 3.216   28.541  1.00 52.19  ? 213 GLU A CB    1 
ATOM   1991 C CG    . GLU B 2 212 ? 104.680 3.674   28.645  1.00 54.49  ? 213 GLU A CG    1 
ATOM   1992 C CD    . GLU B 2 212 ? 104.820 5.117   29.141  1.00 100.00 ? 213 GLU A CD    1 
ATOM   1993 O OE1   . GLU B 2 212 ? 105.626 5.881   28.551  1.00 100.00 ? 213 GLU A OE1   1 
ATOM   1994 O OE2   . GLU B 2 212 ? 104.114 5.492   30.114  1.00 100.00 ? 213 GLU A OE2   1 
ATOM   1995 N N     . SER B 2 213 ? 100.646 2.344   26.361  1.00 52.46  ? 214 SER A N     1 
ATOM   1996 C CA    . SER B 2 213 ? 100.076 1.277   25.539  1.00 49.86  ? 214 SER A CA    1 
ATOM   1997 C C     . SER B 2 213 ? 100.222 1.738   24.119  1.00 53.91  ? 214 SER A C     1 
ATOM   1998 O O     . SER B 2 213 ? 100.021 0.994   23.174  1.00 56.26  ? 214 SER A O     1 
ATOM   1999 C CB    . SER B 2 213 ? 98.582  1.072   25.853  1.00 57.08  ? 214 SER A CB    1 
ATOM   2000 O OG    . SER B 2 213 ? 97.935  2.274   26.246  1.00 81.50  ? 214 SER A OG    1 
ATOM   2001 N N     . TRP B 2 214 ? 100.588 2.990   23.983  1.00 57.69  ? 215 TRP A N     1 
ATOM   2002 C CA    . TRP B 2 214 ? 100.758 3.576   22.693  1.00 61.70  ? 215 TRP A CA    1 
ATOM   2003 C C     . TRP B 2 214 ? 102.191 3.847   22.230  1.00 53.66  ? 215 TRP A C     1 
ATOM   2004 O O     . TRP B 2 214 ? 102.395 4.357   21.133  1.00 44.48  ? 215 TRP A O     1 
ATOM   2005 C CB    . TRP B 2 214 ? 99.892  4.803   22.635  1.00 66.64  ? 215 TRP A CB    1 
ATOM   2006 C CG    . TRP B 2 214 ? 98.417  4.520   22.484  1.00 70.69  ? 215 TRP A CG    1 
ATOM   2007 C CD1   . TRP B 2 214 ? 97.809  3.303   22.304  1.00 73.94  ? 215 TRP A CD1   1 
ATOM   2008 C CD2   . TRP B 2 214 ? 97.357  5.494   22.449  1.00 70.26  ? 215 TRP A CD2   1 
ATOM   2009 N NE1   . TRP B 2 214 ? 96.447  3.469   22.244  1.00 72.91  ? 215 TRP A NE1   1 
ATOM   2010 C CE2   . TRP B 2 214 ? 96.148  4.800   22.282  1.00 74.47  ? 215 TRP A CE2   1 
ATOM   2011 C CE3   . TRP B 2 214 ? 97.325  6.896   22.568  1.00 70.07  ? 215 TRP A CE3   1 
ATOM   2012 C CZ2   . TRP B 2 214 ? 94.918  5.449   22.220  1.00 74.00  ? 215 TRP A CZ2   1 
ATOM   2013 C CZ3   . TRP B 2 214 ? 96.113  7.542   22.499  1.00 70.05  ? 215 TRP A CZ3   1 
ATOM   2014 C CH2   . TRP B 2 214 ? 94.923  6.824   22.307  1.00 71.08  ? 215 TRP A CH2   1 
ATOM   2015 N N     . ILE B 2 215 ? 103.182 3.502   23.054  1.00 54.19  ? 216 ILE A N     1 
ATOM   2016 C CA    . ILE B 2 215 ? 104.578 3.684   22.653  1.00 53.36  ? 216 ILE A CA    1 
ATOM   2017 C C     . ILE B 2 215 ? 105.129 2.299   22.588  1.00 53.58  ? 216 ILE A C     1 
ATOM   2018 O O     . ILE B 2 215 ? 105.182 1.604   23.587  1.00 62.27  ? 216 ILE A O     1 
ATOM   2019 C CB    . ILE B 2 215 ? 105.389 4.565   23.529  1.00 57.16  ? 216 ILE A CB    1 
ATOM   2020 C CG1   . ILE B 2 215 ? 104.788 4.678   24.874  1.00 56.97  ? 216 ILE A CG1   1 
ATOM   2021 C CG2   . ILE B 2 215 ? 105.073 5.992   23.193  1.00 64.95  ? 216 ILE A CG2   1 
ATOM   2022 C CD1   . ILE B 2 215 ? 104.632 6.172   25.213  1.00 34.26  ? 216 ILE A CD1   1 
ATOM   2023 N N     . VAL B 2 216 ? 105.498 1.890   21.391  1.00 44.20  ? 217 VAL A N     1 
ATOM   2024 C CA    . VAL B 2 216 ? 106.030 0.558   21.153  1.00 46.89  ? 217 VAL A CA    1 
ATOM   2025 C C     . VAL B 2 216 ? 107.367 0.657   20.406  1.00 52.48  ? 217 VAL A C     1 
ATOM   2026 O O     . VAL B 2 216 ? 107.435 1.272   19.309  1.00 47.12  ? 217 VAL A O     1 
ATOM   2027 C CB    . VAL B 2 216 ? 105.055 -0.241  20.290  1.00 49.43  ? 217 VAL A CB    1 
ATOM   2028 C CG1   . VAL B 2 216 ? 105.517 -1.668  20.143  1.00 49.56  ? 217 VAL A CG1   1 
ATOM   2029 C CG2   . VAL B 2 216 ? 103.717 -0.230  20.934  1.00 49.21  ? 217 VAL A CG2   1 
ATOM   2030 N N     . GLN B 2 217 ? 108.423 0.062   21.002  1.00 49.86  ? 218 GLN A N     1 
ATOM   2031 C CA    . GLN B 2 217 ? 109.789 0.091   20.412  1.00 47.64  ? 218 GLN A CA    1 
ATOM   2032 C C     . GLN B 2 217 ? 109.921 -0.557  19.087  1.00 55.49  ? 218 GLN A C     1 
ATOM   2033 O O     . GLN B 2 217 ? 109.480 -1.707  18.898  1.00 58.37  ? 218 GLN A O     1 
ATOM   2034 C CB    . GLN B 2 217 ? 110.863 -0.553  21.322  1.00 44.68  ? 218 GLN A CB    1 
ATOM   2035 C CG    . GLN B 2 217 ? 111.966 0.406   21.989  1.00 28.58  ? 218 GLN A CG    1 
ATOM   2036 C CD    . GLN B 2 217 ? 112.464 1.532   21.090  1.00 62.72  ? 218 GLN A CD    1 
ATOM   2037 O OE1   . GLN B 2 217 ? 112.586 2.683   21.526  1.00 81.30  ? 218 GLN A OE1   1 
ATOM   2038 N NE2   . GLN B 2 217 ? 112.772 1.206   19.851  1.00 35.36  ? 218 GLN A NE2   1 
ATOM   2039 N N     . GLY B 2 218 ? 110.561 0.173   18.174  1.00 53.40  ? 219 GLY A N     1 
ATOM   2040 C CA    . GLY B 2 218 ? 110.841 -0.304  16.813  1.00 54.37  ? 219 GLY A CA    1 
ATOM   2041 C C     . GLY B 2 218 ? 112.390 -0.554  16.729  1.00 56.03  ? 219 GLY A C     1 
ATOM   2042 O O     . GLY B 2 218 ? 113.138 -0.321  17.695  1.00 47.65  ? 219 GLY A O     1 
ATOM   2043 N N     . ASP B 2 219 ? 112.868 -1.020  15.588  1.00 46.51  ? 220 ASP A N     1 
ATOM   2044 C CA    . ASP B 2 219 ? 114.283 -1.243  15.459  1.00 39.44  ? 220 ASP A CA    1 
ATOM   2045 C C     . ASP B 2 219 ? 114.715 -0.788  14.074  1.00 48.46  ? 220 ASP A C     1 
ATOM   2046 O O     . ASP B 2 219 ? 115.727 -1.208  13.547  1.00 54.68  ? 220 ASP A O     1 
ATOM   2047 C CB    . ASP B 2 219 ? 114.624 -2.696  15.776  1.00 32.62  ? 220 ASP A CB    1 
ATOM   2048 C CG    . ASP B 2 219 ? 114.221 -3.679  14.674  1.00 47.00  ? 220 ASP A CG    1 
ATOM   2049 O OD1   . ASP B 2 219 ? 113.930 -3.335  13.481  1.00 45.70  ? 220 ASP A OD1   1 
ATOM   2050 O OD2   . ASP B 2 219 ? 114.214 -4.870  15.020  1.00 68.19  ? 220 ASP A OD2   1 
ATOM   2051 N N     . PHE B 2 220 ? 113.899 0.060   13.486  1.00 41.27  ? 221 PHE A N     1 
ATOM   2052 C CA    . PHE B 2 220 ? 114.140 0.593   12.160  1.00 38.45  ? 221 PHE A CA    1 
ATOM   2053 C C     . PHE B 2 220 ? 113.896 -0.395  11.068  1.00 43.85  ? 221 PHE A C     1 
ATOM   2054 O O     . PHE B 2 220 ? 114.147 -0.090  9.896   1.00 43.03  ? 221 PHE A O     1 
ATOM   2055 C CB    . PHE B 2 220 ? 115.496 1.229   12.025  1.00 41.78  ? 221 PHE A CB    1 
ATOM   2056 C CG    . PHE B 2 220 ? 115.604 2.539   12.723  1.00 43.23  ? 221 PHE A CG    1 
ATOM   2057 C CD1   . PHE B 2 220 ? 114.855 3.619   12.295  1.00 42.29  ? 221 PHE A CD1   1 
ATOM   2058 C CD2   . PHE B 2 220 ? 116.444 2.686   13.807  1.00 42.18  ? 221 PHE A CD2   1 
ATOM   2059 C CE1   . PHE B 2 220 ? 114.935 4.839   12.929  1.00 39.17  ? 221 PHE A CE1   1 
ATOM   2060 C CE2   . PHE B 2 220 ? 116.530 3.891   14.452  1.00 46.88  ? 221 PHE A CE2   1 
ATOM   2061 C CZ    . PHE B 2 220 ? 115.764 4.977   14.010  1.00 44.12  ? 221 PHE A CZ    1 
ATOM   2062 N N     . GLU B 2 221 ? 113.391 -1.576  11.429  1.00 39.27  ? 222 GLU A N     1 
ATOM   2063 C CA    . GLU B 2 221 ? 113.103 -2.590  10.421  1.00 44.16  ? 222 GLU A CA    1 
ATOM   2064 C C     . GLU B 2 221 ? 111.590 -2.861  10.248  1.00 50.79  ? 222 GLU A C     1 
ATOM   2065 O O     . GLU B 2 221 ? 110.810 -2.793  11.190  1.00 46.70  ? 222 GLU A O     1 
ATOM   2066 C CB    . GLU B 2 221 ? 113.886 -3.879  10.683  1.00 48.39  ? 222 GLU A CB    1 
ATOM   2067 C CG    . GLU B 2 221 ? 115.383 -3.815  10.317  1.00 52.28  ? 222 GLU A CG    1 
ATOM   2068 C CD    . GLU B 2 221 ? 115.709 -4.112  8.820   1.00 100.00 ? 222 GLU A CD    1 
ATOM   2069 O OE1   . GLU B 2 221 ? 116.039 -3.141  8.068   1.00 100.00 ? 222 GLU A OE1   1 
ATOM   2070 O OE2   . GLU B 2 221 ? 115.676 -5.313  8.401   1.00 100.00 ? 222 GLU A OE2   1 
ATOM   2071 N N     . PRO B 2 222 ? 111.195 -3.169  9.029   1.00 46.05  ? 223 PRO A N     1 
ATOM   2072 C CA    . PRO B 2 222 ? 109.813 -3.435  8.701   1.00 49.19  ? 223 PRO A CA    1 
ATOM   2073 C C     . PRO B 2 222 ? 109.059 -4.303  9.664   1.00 52.28  ? 223 PRO A C     1 
ATOM   2074 O O     . PRO B 2 222 ? 107.957 -4.000  10.052  1.00 51.42  ? 223 PRO A O     1 
ATOM   2075 C CB    . PRO B 2 222 ? 109.919 -4.147  7.354   1.00 51.18  ? 223 PRO A CB    1 
ATOM   2076 C CG    . PRO B 2 222 ? 111.246 -3.750  6.800   1.00 51.68  ? 223 PRO A CG    1 
ATOM   2077 C CD    . PRO B 2 222 ? 111.959 -2.907  7.827   1.00 44.87  ? 223 PRO A CD    1 
ATOM   2078 N N     . GLU B 2 223 ? 109.650 -5.401  10.056  1.00 52.50  ? 224 GLU A N     1 
ATOM   2079 C CA    . GLU B 2 223 ? 108.925 -6.227  10.961  1.00 46.44  ? 224 GLU A CA    1 
ATOM   2080 C C     . GLU B 2 223 ? 108.657 -5.545  12.256  1.00 50.73  ? 224 GLU A C     1 
ATOM   2081 O O     . GLU B 2 223 ? 107.705 -5.880  12.906  1.00 54.74  ? 224 GLU A O     1 
ATOM   2082 C CB    . GLU B 2 223 ? 109.578 -7.567  11.156  1.00 44.80  ? 224 GLU A CB    1 
ATOM   2083 C CG    . GLU B 2 223 ? 108.725 -8.537  11.942  1.00 52.12  ? 224 GLU A CG    1 
ATOM   2084 C CD    . GLU B 2 223 ? 107.974 -9.547  11.056  1.00 100.00 ? 224 GLU A CD    1 
ATOM   2085 O OE1   . GLU B 2 223 ? 108.558 -10.629 10.779  1.00 100.00 ? 224 GLU A OE1   1 
ATOM   2086 O OE2   . GLU B 2 223 ? 106.805 -9.272  10.648  1.00 80.42  ? 224 GLU A OE2   1 
ATOM   2087 N N     . SER B 2 224 ? 109.469 -4.575  12.651  1.00 48.53  ? 225 SER A N     1 
ATOM   2088 C CA    . SER B 2 224 ? 109.171 -3.931  13.926  1.00 47.97  ? 225 SER A CA    1 
ATOM   2089 C C     . SER B 2 224 ? 108.070 -2.937  13.779  1.00 52.71  ? 225 SER A C     1 
ATOM   2090 O O     . SER B 2 224 ? 107.328 -2.701  14.706  1.00 51.77  ? 225 SER A O     1 
ATOM   2091 C CB    . SER B 2 224 ? 110.385 -3.353  14.639  1.00 47.48  ? 225 SER A CB    1 
ATOM   2092 O OG    . SER B 2 224 ? 111.173 -2.586  13.781  1.00 53.12  ? 225 SER A OG    1 
ATOM   2093 N N     . GLY B 2 225 ? 107.957 -2.360  12.594  1.00 49.12  ? 226 GLY A N     1 
ATOM   2094 C CA    . GLY B 2 225 ? 106.906 -1.396  12.332  1.00 45.06  ? 226 GLY A CA    1 
ATOM   2095 C C     . GLY B 2 225 ? 105.625 -2.219  12.446  1.00 51.69  ? 226 GLY A C     1 
ATOM   2096 O O     . GLY B 2 225 ? 104.758 -1.922  13.260  1.00 50.75  ? 226 GLY A O     1 
ATOM   2097 N N     . TYR B 2 226 ? 105.544 -3.264  11.625  1.00 48.83  ? 227 TYR A N     1 
ATOM   2098 C CA    . TYR B 2 226 ? 104.416 -4.159  11.601  1.00 46.68  ? 227 TYR A CA    1 
ATOM   2099 C C     . TYR B 2 226 ? 104.023 -4.543  12.969  1.00 46.94  ? 227 TYR A C     1 
ATOM   2100 O O     . TYR B 2 226 ? 102.946 -4.234  13.417  1.00 57.57  ? 227 TYR A O     1 
ATOM   2101 C CB    . TYR B 2 226 ? 104.735 -5.417  10.832  1.00 54.74  ? 227 TYR A CB    1 
ATOM   2102 C CG    . TYR B 2 226 ? 103.482 -6.185  10.502  1.00 62.63  ? 227 TYR A CG    1 
ATOM   2103 C CD1   . TYR B 2 226 ? 102.875 -6.058  9.235   1.00 64.08  ? 227 TYR A CD1   1 
ATOM   2104 C CD2   . TYR B 2 226 ? 102.884 -7.003  11.438  1.00 64.68  ? 227 TYR A CD2   1 
ATOM   2105 C CE1   . TYR B 2 226 ? 101.720 -6.728  8.915   1.00 53.74  ? 227 TYR A CE1   1 
ATOM   2106 C CE2   . TYR B 2 226 ? 101.723 -7.669  11.130  1.00 68.12  ? 227 TYR A CE2   1 
ATOM   2107 C CZ    . TYR B 2 226 ? 101.150 -7.526  9.860   1.00 78.20  ? 227 TYR A CZ    1 
ATOM   2108 O OH    . TYR B 2 226 ? 99.992  -8.203  9.563   1.00 100.00 ? 227 TYR A OH    1 
ATOM   2109 N N     . ARG B 2 227 ? 104.898 -5.205  13.669  1.00 44.67  ? 228 ARG A N     1 
ATOM   2110 C CA    . ARG B 2 227 ? 104.544 -5.588  15.023  1.00 45.87  ? 228 ARG A CA    1 
ATOM   2111 C C     . ARG B 2 227 ? 104.133 -4.452  15.924  1.00 57.28  ? 228 ARG A C     1 
ATOM   2112 O O     . ARG B 2 227 ? 103.142 -4.554  16.636  1.00 64.26  ? 228 ARG A O     1 
ATOM   2113 C CB    . ARG B 2 227 ? 105.584 -6.490  15.661  1.00 52.85  ? 228 ARG A CB    1 
ATOM   2114 C CG    . ARG B 2 227 ? 105.289 -7.992  15.440  1.00 92.72  ? 228 ARG A CG    1 
ATOM   2115 C CD    . ARG B 2 227 ? 106.287 -8.664  14.488  1.00 98.85  ? 228 ARG A CD    1 
ATOM   2116 N NE    . ARG B 2 227 ? 107.436 -9.195  15.227  1.00 100.00 ? 228 ARG A NE    1 
ATOM   2117 C CZ    . ARG B 2 227 ? 108.226 -10.179 14.804  1.00 100.00 ? 228 ARG A CZ    1 
ATOM   2118 N NH1   . ARG B 2 227 ? 108.015 -10.769 13.628  1.00 100.00 ? 228 ARG A NH1   1 
ATOM   2119 N NH2   . ARG B 2 227 ? 109.231 -10.575 15.565  1.00 100.00 ? 228 ARG A NH2   1 
ATOM   2120 N N     . ALA B 2 228 ? 104.872 -3.351  15.890  1.00 54.25  ? 229 ALA A N     1 
ATOM   2121 C CA    . ALA B 2 228 ? 104.523 -2.214  16.731  1.00 47.95  ? 229 ALA A CA    1 
ATOM   2122 C C     . ALA B 2 228 ? 103.114 -1.707  16.385  1.00 51.82  ? 229 ALA A C     1 
ATOM   2123 O O     . ALA B 2 228 ? 102.301 -1.558  17.275  1.00 55.76  ? 229 ALA A O     1 
ATOM   2124 C CB    . ALA B 2 228 ? 105.537 -1.118  16.593  1.00 44.67  ? 229 ALA A CB    1 
ATOM   2125 N N     . MET B 2 229 ? 102.841 -1.457  15.098  1.00 41.62  ? 230 MET A N     1 
ATOM   2126 C CA    . MET B 2 229 ? 101.534 -0.960  14.654  1.00 39.84  ? 230 MET A CA    1 
ATOM   2127 C C     . MET B 2 229 ? 100.492 -1.847  15.189  1.00 55.49  ? 230 MET A C     1 
ATOM   2128 O O     . MET B 2 229 ? 99.636  -1.415  15.955  1.00 60.45  ? 230 MET A O     1 
ATOM   2129 C CB    . MET B 2 229 ? 101.392 -0.982  13.128  1.00 40.55  ? 230 MET A CB    1 
ATOM   2130 C CG    . MET B 2 229 ? 100.619 0.215   12.510  1.00 41.68  ? 230 MET A CG    1 
ATOM   2131 S SD    . MET B 2 229 ? 100.282 1.697   13.571  1.00 44.52  ? 230 MET A SD    1 
ATOM   2132 C CE    . MET B 2 229 ? 99.631  2.730   12.280  1.00 40.43  ? 230 MET A CE    1 
ATOM   2133 N N     . GLN B 2 230 ? 100.572 -3.098  14.769  1.00 50.91  ? 231 GLN A N     1 
ATOM   2134 C CA    . GLN B 2 230 ? 99.631  -4.110  15.178  1.00 51.70  ? 231 GLN A CA    1 
ATOM   2135 C C     . GLN B 2 230 ? 99.386  -4.070  16.662  1.00 59.80  ? 231 GLN A C     1 
ATOM   2136 O O     . GLN B 2 230 ? 98.296  -4.313  17.146  1.00 71.47  ? 231 GLN A O     1 
ATOM   2137 C CB    . GLN B 2 230 ? 100.135 -5.479  14.765  1.00 55.74  ? 231 GLN A CB    1 
ATOM   2138 C CG    . GLN B 2 230 ? 100.127 -6.522  15.883  1.00 97.21  ? 231 GLN A CG    1 
ATOM   2139 C CD    . GLN B 2 230 ? 100.951 -7.764  15.539  1.00 100.00 ? 231 GLN A CD    1 
ATOM   2140 O OE1   . GLN B 2 230 ? 101.044 -8.182  14.350  1.00 67.88  ? 231 GLN A OE1   1 
ATOM   2141 N NE2   . GLN B 2 230 ? 101.575 -8.356  16.570  1.00 85.13  ? 231 GLN A NE2   1 
ATOM   2142 N N     . GLN B 2 231 ? 100.401 -3.732  17.393  1.00 50.74  ? 232 GLN A N     1 
ATOM   2143 C CA    . GLN B 2 231 ? 100.241 -3.680  18.806  1.00 51.51  ? 232 GLN A CA    1 
ATOM   2144 C C     . GLN B 2 231 ? 99.475  -2.450  19.248  1.00 57.53  ? 232 GLN A C     1 
ATOM   2145 O O     . GLN B 2 231 ? 98.667  -2.509  20.170  1.00 59.15  ? 232 GLN A O     1 
ATOM   2146 C CB    . GLN B 2 231 ? 101.611 -3.711  19.440  1.00 55.02  ? 232 GLN A CB    1 
ATOM   2147 C CG    . GLN B 2 231 ? 101.823 -4.811  20.424  1.00 78.00  ? 232 GLN A CG    1 
ATOM   2148 C CD    . GLN B 2 231 ? 102.640 -4.329  21.593  1.00 99.92  ? 232 GLN A CD    1 
ATOM   2149 O OE1   . GLN B 2 231 ? 102.137 -3.609  22.471  1.00 100.00 ? 232 GLN A OE1   1 
ATOM   2150 N NE2   . GLN B 2 231 ? 103.925 -4.664  21.589  1.00 83.60  ? 232 GLN A NE2   1 
ATOM   2151 N N     . ILE B 2 232 ? 99.722  -1.323  18.609  1.00 56.47  ? 233 ILE A N     1 
ATOM   2152 C CA    . ILE B 2 232 ? 99.006  -0.110  19.007  1.00 61.09  ? 233 ILE A CA    1 
ATOM   2153 C C     . ILE B 2 232 ? 97.563  -0.136  18.477  1.00 66.07  ? 233 ILE A C     1 
ATOM   2154 O O     . ILE B 2 232 ? 96.615  0.263   19.167  1.00 56.64  ? 233 ILE A O     1 
ATOM   2155 C CB    . ILE B 2 232 ? 99.705  1.180   18.490  1.00 62.20  ? 233 ILE A CB    1 
ATOM   2156 C CG1   . ILE B 2 232 ? 101.066 1.357   19.162  1.00 64.33  ? 233 ILE A CG1   1 
ATOM   2157 C CG2   . ILE B 2 232 ? 98.842  2.410   18.753  1.00 57.55  ? 233 ILE A CG2   1 
ATOM   2158 C CD1   . ILE B 2 232 ? 102.095 2.130   18.338  1.00 52.75  ? 233 ILE A CD1   1 
ATOM   2159 N N     . LEU B 2 233 ? 97.410  -0.607  17.248  1.00 59.08  ? 234 LEU A N     1 
ATOM   2160 C CA    . LEU B 2 233 ? 96.112  -0.664  16.640  1.00 58.48  ? 234 LEU A CA    1 
ATOM   2161 C C     . LEU B 2 233 ? 95.201  -1.761  17.180  1.00 71.78  ? 234 LEU A C     1 
ATOM   2162 O O     . LEU B 2 233 ? 94.089  -1.947  16.711  1.00 80.06  ? 234 LEU A O     1 
ATOM   2163 C CB    . LEU B 2 233 ? 96.280  -0.828  15.149  1.00 56.18  ? 234 LEU A CB    1 
ATOM   2164 C CG    . LEU B 2 233 ? 96.722  0.400   14.374  1.00 57.61  ? 234 LEU A CG    1 
ATOM   2165 C CD1   . LEU B 2 233 ? 96.702  0.002   12.910  1.00 56.88  ? 234 LEU A CD1   1 
ATOM   2166 C CD2   . LEU B 2 233 ? 95.823  1.612   14.635  1.00 53.70  ? 234 LEU A CD2   1 
ATOM   2167 N N     . SER B 2 234 ? 95.665  -2.494  18.158  1.00 66.21  ? 235 SER A N     1 
ATOM   2168 C CA    . SER B 2 234 ? 94.853  -3.554  18.693  1.00 66.06  ? 235 SER A CA    1 
ATOM   2169 C C     . SER B 2 234 ? 94.486  -3.292  20.135  1.00 71.41  ? 235 SER A C     1 
ATOM   2170 O O     . SER B 2 234 ? 94.072  -4.180  20.882  1.00 70.03  ? 235 SER A O     1 
ATOM   2171 C CB    . SER B 2 234 ? 95.571  -4.889  18.514  1.00 74.66  ? 235 SER A CB    1 
ATOM   2172 O OG    . SER B 2 234 ? 95.495  -5.286  17.151  1.00 92.90  ? 235 SER A OG    1 
ATOM   2173 N N     . GLN B 2 235 ? 94.645  -2.048  20.534  1.00 72.77  ? 236 GLN A N     1 
ATOM   2174 C CA    . GLN B 2 235 ? 94.312  -1.678  21.889  1.00 73.10  ? 236 GLN A CA    1 
ATOM   2175 C C     . GLN B 2 235 ? 92.797  -1.599  21.808  1.00 73.98  ? 236 GLN A C     1 
ATOM   2176 O O     . GLN B 2 235 ? 92.232  -1.356  20.724  1.00 69.65  ? 236 GLN A O     1 
ATOM   2177 C CB    . GLN B 2 235 ? 94.835  -0.254  22.205  1.00 75.76  ? 236 GLN A CB    1 
ATOM   2178 C CG    . GLN B 2 235 ? 96.285  0.016   21.914  1.00 80.79  ? 236 GLN A CG    1 
ATOM   2179 C CD    . GLN B 2 235 ? 97.172  -0.558  22.955  1.00 96.50  ? 236 GLN A CD    1 
ATOM   2180 O OE1   . GLN B 2 235 ? 96.931  -0.376  24.146  1.00 100.00 ? 236 GLN A OE1   1 
ATOM   2181 N NE2   . GLN B 2 235 ? 98.207  -1.282  22.524  1.00 76.65  ? 236 GLN A NE2   1 
ATOM   2182 N N     . PRO B 2 236 ? 92.130  -1.788  22.929  1.00 74.32  ? 237 PRO A N     1 
ATOM   2183 C CA    . PRO B 2 236 ? 90.686  -1.700  22.923  1.00 75.50  ? 237 PRO A CA    1 
ATOM   2184 C C     . PRO B 2 236 ? 90.437  -0.216  22.507  1.00 80.85  ? 237 PRO A C     1 
ATOM   2185 O O     . PRO B 2 236 ? 89.556  0.091   21.676  1.00 79.13  ? 237 PRO A O     1 
ATOM   2186 C CB    . PRO B 2 236 ? 90.348  -1.923  24.383  1.00 76.84  ? 237 PRO A CB    1 
ATOM   2187 C CG    . PRO B 2 236 ? 91.478  -1.244  25.107  1.00 82.75  ? 237 PRO A CG    1 
ATOM   2188 C CD    . PRO B 2 236 ? 92.698  -1.423  24.241  1.00 77.52  ? 237 PRO A CD    1 
ATOM   2189 N N     . HIS B 2 237 ? 91.257  0.669   23.085  1.00 76.43  ? 238 HIS A N     1 
ATOM   2190 C CA    . HIS B 2 237 ? 91.237  2.108   22.845  1.00 75.39  ? 238 HIS A CA    1 
ATOM   2191 C C     . HIS B 2 237 ? 92.514  2.449   22.015  1.00 63.93  ? 238 HIS A C     1 
ATOM   2192 O O     . HIS B 2 237 ? 93.633  2.292   22.473  1.00 64.74  ? 238 HIS A O     1 
ATOM   2193 C CB    . HIS B 2 237 ? 91.231  2.802   24.204  1.00 81.18  ? 238 HIS A CB    1 
ATOM   2194 C CG    . HIS B 2 237 ? 90.921  4.250   24.129  1.00 92.82  ? 238 HIS A CG    1 
ATOM   2195 N ND1   . HIS B 2 237 ? 90.718  5.025   25.253  1.00 100.00 ? 238 HIS A ND1   1 
ATOM   2196 C CD2   . HIS B 2 237 ? 90.785  5.081   23.065  1.00 100.00 ? 238 HIS A CD2   1 
ATOM   2197 C CE1   . HIS B 2 237 ? 90.468  6.276   24.884  1.00 100.00 ? 238 HIS A CE1   1 
ATOM   2198 N NE2   . HIS B 2 237 ? 90.503  6.335   23.562  1.00 100.00 ? 238 HIS A NE2   1 
ATOM   2199 N N     . ARG B 2 238 ? 92.342  2.880   20.779  1.00 52.31  ? 239 ARG A N     1 
ATOM   2200 C CA    . ARG B 2 238 ? 93.484  3.185   19.939  1.00 46.95  ? 239 ARG A CA    1 
ATOM   2201 C C     . ARG B 2 238 ? 93.631  4.626   19.518  1.00 52.30  ? 239 ARG A C     1 
ATOM   2202 O O     . ARG B 2 238 ? 92.722  5.405   19.608  1.00 51.65  ? 239 ARG A O     1 
ATOM   2203 C CB    . ARG B 2 238 ? 93.481  2.285   18.738  1.00 42.44  ? 239 ARG A CB    1 
ATOM   2204 C CG    . ARG B 2 238 ? 92.810  2.847   17.569  1.00 54.16  ? 239 ARG A CG    1 
ATOM   2205 C CD    . ARG B 2 238 ? 92.576  1.735   16.573  1.00 68.01  ? 239 ARG A CD    1 
ATOM   2206 N NE    . ARG B 2 238 ? 91.985  2.265   15.356  1.00 84.74  ? 239 ARG A NE    1 
ATOM   2207 C CZ    . ARG B 2 238 ? 90.923  1.754   14.738  1.00 100.00 ? 239 ARG A CZ    1 
ATOM   2208 N NH1   . ARG B 2 238 ? 90.309  0.653   15.221  1.00 100.00 ? 239 ARG A NH1   1 
ATOM   2209 N NH2   . ARG B 2 238 ? 90.474  2.346   13.626  1.00 98.98  ? 239 ARG A NH2   1 
ATOM   2210 N N     . PRO B 2 239 ? 94.806  5.004   19.065  1.00 56.19  ? 240 PRO A N     1 
ATOM   2211 C CA    . PRO B 2 239 ? 94.971  6.373   18.690  1.00 50.95  ? 240 PRO A CA    1 
ATOM   2212 C C     . PRO B 2 239 ? 94.432  6.661   17.339  1.00 45.02  ? 240 PRO A C     1 
ATOM   2213 O O     . PRO B 2 239 ? 94.060  5.777   16.562  1.00 41.93  ? 240 PRO A O     1 
ATOM   2214 C CB    . PRO B 2 239 ? 96.485  6.574   18.748  1.00 52.08  ? 240 PRO A CB    1 
ATOM   2215 C CG    . PRO B 2 239 ? 97.072  5.193   18.837  1.00 58.92  ? 240 PRO A CG    1 
ATOM   2216 C CD    . PRO B 2 239 ? 95.972  4.218   18.637  1.00 57.29  ? 240 PRO A CD    1 
ATOM   2217 N N     . THR B 2 240 ? 94.389  7.940   17.073  1.00 42.50  ? 241 THR A N     1 
ATOM   2218 C CA    . THR B 2 240 ? 93.889  8.462   15.838  1.00 43.36  ? 241 THR A CA    1 
ATOM   2219 C C     . THR B 2 240 ? 95.040  8.727   14.839  1.00 50.25  ? 241 THR A C     1 
ATOM   2220 O O     . THR B 2 240 ? 94.862  8.728   13.583  1.00 46.28  ? 241 THR A O     1 
ATOM   2221 C CB    . THR B 2 240 ? 93.041  9.774   16.169  1.00 48.34  ? 241 THR A CB    1 
ATOM   2222 O OG1   . THR B 2 240 ? 92.916  10.577  15.019  1.00 75.76  ? 241 THR A OG1   1 
ATOM   2223 C CG2   . THR B 2 240 ? 93.687  10.635  17.253  1.00 61.22  ? 241 THR A CG2   1 
ATOM   2224 N N     . ALA B 2 241 ? 96.231  8.951   15.411  1.00 44.59  ? 242 ALA A N     1 
ATOM   2225 C CA    . ALA B 2 241 ? 97.422  9.233   14.636  1.00 35.22  ? 242 ALA A CA    1 
ATOM   2226 C C     . ALA B 2 241 ? 98.653  8.630   15.256  1.00 50.23  ? 242 ALA A C     1 
ATOM   2227 O O     . ALA B 2 241 ? 98.809  8.578   16.497  1.00 47.35  ? 242 ALA A O     1 
ATOM   2228 C CB    . ALA B 2 241 ? 97.606  10.731  14.483  1.00 33.36  ? 242 ALA A CB    1 
ATOM   2229 N N     . VAL B 2 242 ? 99.542  8.190   14.362  1.00 53.60  ? 243 VAL A N     1 
ATOM   2230 C CA    . VAL B 2 242 ? 100.801 7.584   14.746  1.00 50.09  ? 243 VAL A CA    1 
ATOM   2231 C C     . VAL B 2 242 ? 102.068 8.212   14.144  1.00 41.73  ? 243 VAL A C     1 
ATOM   2232 O O     . VAL B 2 242 ? 102.152 8.578   12.954  1.00 40.42  ? 243 VAL A O     1 
ATOM   2233 C CB    . VAL B 2 242 ? 100.798 6.060   14.491  1.00 50.93  ? 243 VAL A CB    1 
ATOM   2234 C CG1   . VAL B 2 242 ? 102.025 5.416   15.090  1.00 50.22  ? 243 VAL A CG1   1 
ATOM   2235 C CG2   . VAL B 2 242 ? 99.563  5.422   15.113  1.00 51.03  ? 243 VAL A CG2   1 
ATOM   2236 N N     . PHE B 2 243 ? 103.057 8.338   14.996  1.00 38.02  ? 244 PHE A N     1 
ATOM   2237 C CA    . PHE B 2 243 ? 104.314 8.848   14.564  1.00 41.64  ? 244 PHE A CA    1 
ATOM   2238 C C     . PHE B 2 243 ? 105.269 7.627   14.543  1.00 35.93  ? 244 PHE A C     1 
ATOM   2239 O O     . PHE B 2 243 ? 105.588 7.006   15.616  1.00 29.04  ? 244 PHE A O     1 
ATOM   2240 C CB    . PHE B 2 243 ? 104.879 9.872   15.518  1.00 46.55  ? 244 PHE A CB    1 
ATOM   2241 C CG    . PHE B 2 243 ? 106.308 10.219  15.202  1.00 51.03  ? 244 PHE A CG    1 
ATOM   2242 C CD1   . PHE B 2 243 ? 106.725 10.310  13.873  1.00 52.55  ? 244 PHE A CD1   1 
ATOM   2243 C CD2   . PHE B 2 243 ? 107.234 10.408  16.199  1.00 51.19  ? 244 PHE A CD2   1 
ATOM   2244 C CE1   . PHE B 2 243 ? 108.031 10.616  13.546  1.00 50.09  ? 244 PHE A CE1   1 
ATOM   2245 C CE2   . PHE B 2 243 ? 108.543 10.719  15.875  1.00 49.77  ? 244 PHE A CE2   1 
ATOM   2246 C CZ    . PHE B 2 243 ? 108.940 10.829  14.548  1.00 44.84  ? 244 PHE A CZ    1 
ATOM   2247 N N     . CYS B 2 244 ? 105.709 7.275   13.347  1.00 29.79  ? 245 CYS A N     1 
ATOM   2248 C CA    . CYS B 2 244 ? 106.669 6.116   13.191  1.00 38.47  ? 245 CYS A CA    1 
ATOM   2249 C C     . CYS B 2 244 ? 108.083 6.651   12.918  1.00 42.20  ? 245 CYS A C     1 
ATOM   2250 O O     . CYS B 2 244 ? 108.369 7.158   11.818  1.00 44.35  ? 245 CYS A O     1 
ATOM   2251 C CB    . CYS B 2 244 ? 106.302 5.248   12.019  1.00 40.84  ? 245 CYS A CB    1 
ATOM   2252 S SG    . CYS B 2 244 ? 107.083 3.664   12.183  1.00 45.90  ? 245 CYS A SG    1 
ATOM   2253 N N     . GLY B 2 245 ? 108.941 6.542   13.918  1.00 40.76  ? 246 GLY A N     1 
ATOM   2254 C CA    . GLY B 2 245 ? 110.323 7.029   13.853  1.00 44.03  ? 246 GLY A CA    1 
ATOM   2255 C C     . GLY B 2 245 ? 111.292 6.735   12.700  1.00 51.54  ? 246 GLY A C     1 
ATOM   2256 O O     . GLY B 2 245 ? 112.413 7.173   12.768  1.00 58.32  ? 246 GLY A O     1 
ATOM   2257 N N     . GLY B 2 246 ? 110.867 6.008   11.668  1.00 42.25  ? 247 GLY A N     1 
ATOM   2258 C CA    . GLY B 2 246 ? 111.684 5.665   10.496  1.00 34.39  ? 247 GLY A CA    1 
ATOM   2259 C C     . GLY B 2 246 ? 110.723 5.203   9.381   1.00 41.00  ? 247 GLY A C     1 
ATOM   2260 O O     . GLY B 2 246 ? 109.782 4.464   9.627   1.00 43.92  ? 247 GLY A O     1 
ATOM   2261 N N     . ASP B 2 247 ? 110.952 5.632   8.153   1.00 34.16  ? 248 ASP A N     1 
ATOM   2262 C CA    . ASP B 2 247 ? 110.087 5.238   7.075   1.00 31.49  ? 248 ASP A CA    1 
ATOM   2263 C C     . ASP B 2 247 ? 109.917 3.711   6.832   1.00 45.57  ? 248 ASP A C     1 
ATOM   2264 O O     . ASP B 2 247 ? 108.795 3.203   6.613   1.00 43.12  ? 248 ASP A O     1 
ATOM   2265 C CB    . ASP B 2 247 ? 110.558 5.910   5.804   1.00 30.02  ? 248 ASP A CB    1 
ATOM   2266 C CG    . ASP B 2 247 ? 110.261 7.370   5.788   1.00 29.78  ? 248 ASP A CG    1 
ATOM   2267 O OD1   . ASP B 2 247 ? 109.765 7.848   6.790   1.00 31.40  ? 248 ASP A OD1   1 
ATOM   2268 O OD2   . ASP B 2 247 ? 110.537 8.037   4.779   1.00 46.02  ? 248 ASP A OD2   1 
ATOM   2269 N N     . ILE B 2 248 ? 111.032 2.992   6.845   1.00 42.50  ? 249 ILE A N     1 
ATOM   2270 C CA    . ILE B 2 248 ? 110.999 1.570   6.611   1.00 40.92  ? 249 ILE A CA    1 
ATOM   2271 C C     . ILE B 2 248 ? 110.164 0.886   7.642   1.00 38.23  ? 249 ILE A C     1 
ATOM   2272 O O     . ILE B 2 248 ? 109.426 -0.018  7.359   1.00 39.92  ? 249 ILE A O     1 
ATOM   2273 C CB    . ILE B 2 248 ? 112.398 0.988   6.569   1.00 46.09  ? 249 ILE A CB    1 
ATOM   2274 C CG1   . ILE B 2 248 ? 113.236 1.773   5.573   1.00 43.85  ? 249 ILE A CG1   1 
ATOM   2275 C CG2   . ILE B 2 248 ? 112.351 -0.437  6.052   1.00 40.44  ? 249 ILE A CG2   1 
ATOM   2276 C CD1   . ILE B 2 248 ? 112.820 1.499   4.148   1.00 21.17  ? 249 ILE A CD1   1 
ATOM   2277 N N     . MET B 2 249 ? 110.284 1.319   8.862   1.00 29.08  ? 250 MET A N     1 
ATOM   2278 C CA    . MET B 2 249 ? 109.499 0.727   9.884   1.00 28.95  ? 250 MET A CA    1 
ATOM   2279 C C     . MET B 2 249 ? 107.996 1.116   9.505   1.00 47.93  ? 250 MET A C     1 
ATOM   2280 O O     . MET B 2 249 ? 107.079 0.321   9.578   1.00 41.64  ? 250 MET A O     1 
ATOM   2281 C CB    . MET B 2 249 ? 109.851 1.453   11.178  1.00 30.04  ? 250 MET A CB    1 
ATOM   2282 C CG    . MET B 2 249 ? 110.770 0.702   12.105  1.00 37.44  ? 250 MET A CG    1 
ATOM   2283 S SD    . MET B 2 249 ? 110.681 1.265   13.851  1.00 44.47  ? 250 MET A SD    1 
ATOM   2284 C CE    . MET B 2 249 ? 111.152 3.015   13.716  1.00 39.67  ? 250 MET A CE    1 
ATOM   2285 N N     . ALA B 2 250 ? 107.793 2.371   9.110   1.00 48.51  ? 251 ALA A N     1 
ATOM   2286 C CA    . ALA B 2 250 ? 106.482 2.904   8.756   1.00 38.11  ? 251 ALA A CA    1 
ATOM   2287 C C     . ALA B 2 250 ? 105.823 2.079   7.739   1.00 44.27  ? 251 ALA A C     1 
ATOM   2288 O O     . ALA B 2 250 ? 104.625 1.844   7.771   1.00 46.14  ? 251 ALA A O     1 
ATOM   2289 C CB    . ALA B 2 250 ? 106.618 4.322   8.241   1.00 31.85  ? 251 ALA A CB    1 
ATOM   2290 N N     . MET B 2 251 ? 106.616 1.660   6.803   1.00 42.56  ? 252 MET A N     1 
ATOM   2291 C CA    . MET B 2 251 ? 106.124 0.863   5.739   1.00 38.33  ? 252 MET A CA    1 
ATOM   2292 C C     . MET B 2 251 ? 105.522 -0.356  6.386   1.00 49.67  ? 252 MET A C     1 
ATOM   2293 O O     . MET B 2 251 ? 104.456 -0.766  6.054   1.00 58.67  ? 252 MET A O     1 
ATOM   2294 C CB    . MET B 2 251 ? 107.269 0.495   4.864   1.00 39.47  ? 252 MET A CB    1 
ATOM   2295 C CG    . MET B 2 251 ? 106.902 -0.509  3.837   1.00 47.42  ? 252 MET A CG    1 
ATOM   2296 S SD    . MET B 2 251 ? 108.315 -1.105  2.938   1.00 52.81  ? 252 MET A SD    1 
ATOM   2297 C CE    . MET B 2 251 ? 108.071 -0.300  1.350   1.00 48.68  ? 252 MET A CE    1 
ATOM   2298 N N     . GLY B 2 252 ? 106.184 -0.921  7.358   1.00 49.83  ? 253 GLY A N     1 
ATOM   2299 C CA    . GLY B 2 252 ? 105.627 -2.099  8.021   1.00 48.79  ? 253 GLY A CA    1 
ATOM   2300 C C     . GLY B 2 252 ? 104.451 -1.722  8.911   1.00 55.62  ? 253 GLY A C     1 
ATOM   2301 O O     . GLY B 2 252 ? 103.740 -2.585  9.396   1.00 62.61  ? 253 GLY A O     1 
ATOM   2302 N N     . ALA B 2 253 ? 104.254 -0.429  9.131   1.00 47.68  ? 254 ALA A N     1 
ATOM   2303 C CA    . ALA B 2 253 ? 103.143 0.038   9.969   1.00 48.04  ? 254 ALA A CA    1 
ATOM   2304 C C     . ALA B 2 253 ? 101.876 0.068   9.069   1.00 53.18  ? 254 ALA A C     1 
ATOM   2305 O O     . ALA B 2 253 ? 100.765 -0.236  9.504   1.00 52.81  ? 254 ALA A O     1 
ATOM   2306 C CB    . ALA B 2 253 ? 103.426 1.419   10.561  1.00 45.41  ? 254 ALA A CB    1 
ATOM   2307 N N     . LEU B 2 254 ? 102.074 0.430   7.814   1.00 39.84  ? 255 LEU A N     1 
ATOM   2308 C CA    . LEU B 2 254 ? 101.013 0.479   6.879   1.00 35.74  ? 255 LEU A CA    1 
ATOM   2309 C C     . LEU B 2 254 ? 100.475 -0.942  6.697   1.00 64.19  ? 255 LEU A C     1 
ATOM   2310 O O     . LEU B 2 254 ? 99.252  -1.175  6.790   1.00 67.09  ? 255 LEU A O     1 
ATOM   2311 C CB    . LEU B 2 254 ? 101.568 0.946   5.577   1.00 31.51  ? 255 LEU A CB    1 
ATOM   2312 C CG    . LEU B 2 254 ? 101.449 2.435   5.334   1.00 36.75  ? 255 LEU A CG    1 
ATOM   2313 C CD1   . LEU B 2 254 ? 101.073 3.141   6.611   1.00 38.16  ? 255 LEU A CD1   1 
ATOM   2314 C CD2   . LEU B 2 254 ? 102.765 2.937   4.818   1.00 45.84  ? 255 LEU A CD2   1 
ATOM   2315 N N     . CYS B 2 255 ? 101.403 -1.885  6.448   1.00 69.82  ? 256 CYS A N     1 
ATOM   2316 C CA    . CYS B 2 255 ? 101.086 -3.316  6.236   1.00 65.30  ? 256 CYS A CA    1 
ATOM   2317 C C     . CYS B 2 255 ? 100.175 -3.859  7.288   1.00 54.90  ? 256 CYS A C     1 
ATOM   2318 O O     . CYS B 2 255 ? 99.204  -4.494  6.969   1.00 53.72  ? 256 CYS A O     1 
ATOM   2319 C CB    . CYS B 2 255 ? 102.334 -4.197  6.145   1.00 66.55  ? 256 CYS A CB    1 
ATOM   2320 S SG    . CYS B 2 255 ? 102.126 -5.714  5.112   1.00 73.63  ? 256 CYS A SG    1 
ATOM   2321 N N     . ALA B 2 256 ? 100.485 -3.612  8.549   1.00 49.17  ? 257 ALA A N     1 
ATOM   2322 C CA    . ALA B 2 256 ? 99.620  -4.113  9.628   1.00 49.86  ? 257 ALA A CA    1 
ATOM   2323 C C     . ALA B 2 256 ? 98.184  -3.542  9.520   1.00 61.61  ? 257 ALA A C     1 
ATOM   2324 O O     . ALA B 2 256 ? 97.215  -4.301  9.490   1.00 65.40  ? 257 ALA A O     1 
ATOM   2325 C CB    . ALA B 2 256 ? 100.217 -3.803  11.003  1.00 48.53  ? 257 ALA A CB    1 
ATOM   2326 N N     . ALA B 2 257 ? 98.103  -2.209  9.474   1.00 54.71  ? 258 ALA A N     1 
ATOM   2327 C CA    . ALA B 2 257 ? 96.898  -1.415  9.366   1.00 50.78  ? 258 ALA A CA    1 
ATOM   2328 C C     . ALA B 2 257 ? 95.978  -2.090  8.369   1.00 52.15  ? 258 ALA A C     1 
ATOM   2329 O O     . ALA B 2 257 ? 94.928  -2.618  8.718   1.00 45.02  ? 258 ALA A O     1 
ATOM   2330 C CB    . ALA B 2 257 ? 97.303  -0.029  8.850   1.00 50.63  ? 258 ALA A CB    1 
ATOM   2331 N N     . ASP B 2 258 ? 96.416  -2.078  7.121   1.00 52.85  ? 259 ASP A N     1 
ATOM   2332 C CA    . ASP B 2 258 ? 95.686  -2.669  5.999   1.00 48.81  ? 259 ASP A CA    1 
ATOM   2333 C C     . ASP B 2 258 ? 95.274  -4.051  6.343   1.00 61.35  ? 259 ASP A C     1 
ATOM   2334 O O     . ASP B 2 258 ? 94.110  -4.373  6.302   1.00 67.69  ? 259 ASP A O     1 
ATOM   2335 C CB    . ASP B 2 258 ? 96.572  -2.633  4.767   1.00 46.28  ? 259 ASP A CB    1 
ATOM   2336 C CG    . ASP B 2 258 ? 96.045  -3.439  3.616   1.00 77.05  ? 259 ASP A CG    1 
ATOM   2337 O OD1   . ASP B 2 258 ? 95.736  -2.828  2.558   1.00 77.19  ? 259 ASP A OD1   1 
ATOM   2338 O OD2   . ASP B 2 258 ? 96.038  -4.681  3.727   1.00 100.00 ? 259 ASP A OD2   1 
ATOM   2339 N N     . GLU B 2 259 ? 96.228  -4.876  6.709   1.00 69.02  ? 260 GLU A N     1 
ATOM   2340 C CA    . GLU B 2 259 ? 95.928  -6.262  7.066   1.00 72.24  ? 260 GLU A CA    1 
ATOM   2341 C C     . GLU B 2 259 ? 94.976  -6.413  8.233   1.00 68.51  ? 260 GLU A C     1 
ATOM   2342 O O     . GLU B 2 259 ? 94.399  -7.458  8.406   1.00 73.93  ? 260 GLU A O     1 
ATOM   2343 C CB    . GLU B 2 259 ? 97.213  -7.096  7.234   1.00 74.50  ? 260 GLU A CB    1 
ATOM   2344 C CG    . GLU B 2 259 ? 98.137  -6.970  6.019   1.00 87.72  ? 260 GLU A CG    1 
ATOM   2345 C CD    . GLU B 2 259 ? 99.196  -8.071  5.913   1.00 100.00 ? 260 GLU A CD    1 
ATOM   2346 O OE1   . GLU B 2 259 ? 99.863  -8.379  6.917   1.00 80.85  ? 260 GLU A OE1   1 
ATOM   2347 O OE2   . GLU B 2 259 ? 99.388  -8.605  4.797   1.00 53.23  ? 260 GLU A OE2   1 
ATOM   2348 N N     . MET B 2 260 ? 94.806  -5.360  9.016   1.00 57.51  ? 261 MET A N     1 
ATOM   2349 C CA    . MET B 2 260 ? 93.912  -5.388  10.164  1.00 56.01  ? 261 MET A CA    1 
ATOM   2350 C C     . MET B 2 260 ? 92.631  -4.688  9.769   1.00 64.86  ? 261 MET A C     1 
ATOM   2351 O O     . MET B 2 260 ? 91.757  -4.457  10.597  1.00 71.34  ? 261 MET A O     1 
ATOM   2352 C CB    . MET B 2 260 ? 94.498  -4.599  11.311  1.00 58.94  ? 261 MET A CB    1 
ATOM   2353 C CG    . MET B 2 260 ? 95.617  -5.280  12.058  1.00 66.65  ? 261 MET A CG    1 
ATOM   2354 S SD    . MET B 2 260 ? 95.633  -4.561  13.709  1.00 71.66  ? 261 MET A SD    1 
ATOM   2355 C CE    . MET B 2 260 ? 94.009  -3.811  13.706  1.00 70.31  ? 261 MET A CE    1 
ATOM   2356 N N     . GLY B 2 261 ? 92.515  -4.320  8.505   1.00 56.88  ? 262 GLY A N     1 
ATOM   2357 C CA    . GLY B 2 261 ? 91.305  -3.651  8.054   1.00 54.22  ? 262 GLY A CA    1 
ATOM   2358 C C     . GLY B 2 261 ? 91.264  -2.137  8.006   1.00 59.61  ? 262 GLY A C     1 
ATOM   2359 O O     . GLY B 2 261 ? 90.631  -1.590  7.123   1.00 62.26  ? 262 GLY A O     1 
ATOM   2360 N N     . LEU B 2 262 ? 91.929  -1.479  8.955   1.00 53.22  ? 263 LEU A N     1 
ATOM   2361 C CA    . LEU B 2 262 ? 92.007  -0.019  9.065   1.00 46.64  ? 263 LEU A CA    1 
ATOM   2362 C C     . LEU B 2 262 ? 92.645  0.651   7.835   1.00 58.50  ? 263 LEU A C     1 
ATOM   2363 O O     . LEU B 2 262 ? 93.648  0.179   7.293   1.00 64.93  ? 263 LEU A O     1 
ATOM   2364 C CB    . LEU B 2 262 ? 92.860  0.353   10.250  1.00 44.74  ? 263 LEU A CB    1 
ATOM   2365 C CG    . LEU B 2 262 ? 92.216  0.175   11.588  1.00 53.24  ? 263 LEU A CG    1 
ATOM   2366 C CD1   . LEU B 2 262 ? 91.239  -0.951  11.544  1.00 55.03  ? 263 LEU A CD1   1 
ATOM   2367 C CD2   . LEU B 2 262 ? 93.257  -0.097  12.655  1.00 68.46  ? 263 LEU A CD2   1 
ATOM   2368 N N     . ARG B 2 263 ? 92.055  1.766   7.419   1.00 48.48  ? 264 ARG A N     1 
ATOM   2369 C CA    . ARG B 2 263 ? 92.471  2.563   6.293   1.00 44.73  ? 264 ARG A CA    1 
ATOM   2370 C C     . ARG B 2 263 ? 93.419  3.647   6.775   1.00 51.04  ? 264 ARG A C     1 
ATOM   2371 O O     . ARG B 2 263 ? 93.297  4.112   7.869   1.00 52.93  ? 264 ARG A O     1 
ATOM   2372 C CB    . ARG B 2 263 ? 91.252  3.280   5.783   1.00 41.74  ? 264 ARG A CB    1 
ATOM   2373 C CG    . ARG B 2 263 ? 90.509  2.615   4.704   1.00 45.11  ? 264 ARG A CG    1 
ATOM   2374 C CD    . ARG B 2 263 ? 91.348  2.641   3.403   1.00 98.14  ? 264 ARG A CD    1 
ATOM   2375 N NE    . ARG B 2 263 ? 91.226  3.856   2.570   1.00 100.00 ? 264 ARG A NE    1 
ATOM   2376 C CZ    . ARG B 2 263 ? 91.719  3.967   1.319   1.00 100.00 ? 264 ARG A CZ    1 
ATOM   2377 N NH1   . ARG B 2 263 ? 92.371  2.936   0.757   1.00 100.00 ? 264 ARG A NH1   1 
ATOM   2378 N NH2   . ARG B 2 263 ? 91.573  5.102   0.612   1.00 100.00 ? 264 ARG A NH2   1 
ATOM   2379 N N     . VAL B 2 264 ? 94.372  4.043   5.951   1.00 45.78  ? 265 VAL A N     1 
ATOM   2380 C CA    . VAL B 2 264 ? 95.289  5.094   6.325   1.00 43.70  ? 265 VAL A CA    1 
ATOM   2381 C C     . VAL B 2 264 ? 95.171  5.958   5.091   1.00 42.85  ? 265 VAL A C     1 
ATOM   2382 O O     . VAL B 2 264 ? 95.270  5.472   3.966   1.00 42.84  ? 265 VAL A O     1 
ATOM   2383 C CB    . VAL B 2 264 ? 96.767  4.677   6.418   1.00 48.51  ? 265 VAL A CB    1 
ATOM   2384 C CG1   . VAL B 2 264 ? 97.557  5.857   6.928   1.00 49.11  ? 265 VAL A CG1   1 
ATOM   2385 C CG2   . VAL B 2 264 ? 96.987  3.509   7.346   1.00 47.97  ? 265 VAL A CG2   1 
ATOM   2386 N N     . PRO B 2 265 ? 94.939  7.225   5.299   1.00 32.95  ? 266 PRO A N     1 
ATOM   2387 C CA    . PRO B 2 265 ? 94.843  7.787   6.626   1.00 33.37  ? 266 PRO A CA    1 
ATOM   2388 C C     . PRO B 2 265 ? 93.435  7.872   7.133   1.00 47.58  ? 266 PRO A C     1 
ATOM   2389 O O     . PRO B 2 265 ? 93.184  8.512   8.172   1.00 49.26  ? 266 PRO A O     1 
ATOM   2390 C CB    . PRO B 2 265 ? 95.234  9.224   6.377   1.00 33.14  ? 266 PRO A CB    1 
ATOM   2391 C CG    . PRO B 2 265 ? 94.598  9.514   5.065   1.00 35.78  ? 266 PRO A CG    1 
ATOM   2392 C CD    . PRO B 2 265 ? 94.740  8.234   4.259   1.00 31.98  ? 266 PRO A CD    1 
ATOM   2393 N N     . GLN B 2 266 ? 92.492  7.272   6.432   1.00 40.62  ? 267 GLN A N     1 
ATOM   2394 C CA    . GLN B 2 266 ? 91.127  7.388   6.909   1.00 42.33  ? 267 GLN A CA    1 
ATOM   2395 C C     . GLN B 2 266 ? 90.793  6.876   8.256   1.00 49.33  ? 267 GLN A C     1 
ATOM   2396 O O     . GLN B 2 266 ? 89.977  7.463   8.953   1.00 49.00  ? 267 GLN A O     1 
ATOM   2397 C CB    . GLN B 2 266 ? 90.123  6.963   5.900   1.00 45.68  ? 267 GLN A CB    1 
ATOM   2398 C CG    . GLN B 2 266 ? 90.307  7.654   4.583   1.00 55.55  ? 267 GLN A CG    1 
ATOM   2399 C CD    . GLN B 2 266 ? 91.179  6.855   3.670   1.00 58.96  ? 267 GLN A CD    1 
ATOM   2400 O OE1   . GLN B 2 266 ? 91.975  6.029   4.123   1.00 64.02  ? 267 GLN A OE1   1 
ATOM   2401 N NE2   . GLN B 2 266 ? 91.016  7.062   2.368   1.00 61.68  ? 267 GLN A NE2   1 
ATOM   2402 N N     . ASP B 2 267 ? 91.434  5.785   8.627   1.00 44.37  ? 268 ASP A N     1 
ATOM   2403 C CA    . ASP B 2 267 ? 91.228  5.156   9.914   1.00 42.72  ? 268 ASP A CA    1 
ATOM   2404 C C     . ASP B 2 267 ? 92.275  5.579   10.900  1.00 48.71  ? 268 ASP A C     1 
ATOM   2405 O O     . ASP B 2 267 ? 91.982  5.824   12.074  1.00 41.26  ? 268 ASP A O     1 
ATOM   2406 C CB    . ASP B 2 267 ? 91.130  3.631   9.762   1.00 45.89  ? 268 ASP A CB    1 
ATOM   2407 C CG    . ASP B 2 267 ? 89.768  3.210   9.233   1.00 61.51  ? 268 ASP A CG    1 
ATOM   2408 O OD1   . ASP B 2 267 ? 88.761  3.658   9.809   1.00 69.09  ? 268 ASP A OD1   1 
ATOM   2409 O OD2   . ASP B 2 267 ? 89.675  2.541   8.195   1.00 60.13  ? 268 ASP A OD2   1 
ATOM   2410 N N     . VAL B 2 268 ? 93.508  5.672   10.403  1.00 50.01  ? 269 VAL A N     1 
ATOM   2411 C CA    . VAL B 2 268 ? 94.658  6.087   11.194  1.00 42.56  ? 269 VAL A CA    1 
ATOM   2412 C C     . VAL B 2 268 ? 95.518  6.837   10.265  1.00 50.96  ? 269 VAL A C     1 
ATOM   2413 O O     . VAL B 2 268 ? 95.622  6.512   9.052   1.00 50.01  ? 269 VAL A O     1 
ATOM   2414 C CB    . VAL B 2 268 ? 95.571  4.956   11.658  1.00 43.80  ? 269 VAL A CB    1 
ATOM   2415 C CG1   . VAL B 2 268 ? 95.525  4.770   13.156  1.00 44.07  ? 269 VAL A CG1   1 
ATOM   2416 C CG2   . VAL B 2 268 ? 95.428  3.674   10.833  1.00 42.26  ? 269 VAL A CG2   1 
ATOM   2417 N N     . SER B 2 269 ? 96.152  7.839   10.848  1.00 51.06  ? 270 SER A N     1 
ATOM   2418 C CA    . SER B 2 269 ? 97.063  8.706   10.155  1.00 46.14  ? 270 SER A CA    1 
ATOM   2419 C C     . SER B 2 269 ? 98.477  8.217   10.579  1.00 46.38  ? 270 SER A C     1 
ATOM   2420 O O     . SER B 2 269 ? 98.671  7.661   11.679  1.00 39.53  ? 270 SER A O     1 
ATOM   2421 C CB    . SER B 2 269 ? 96.802  10.126  10.623  1.00 41.17  ? 270 SER A CB    1 
ATOM   2422 O OG    . SER B 2 269 ? 95.889  10.791  9.782   1.00 53.94  ? 270 SER A OG    1 
ATOM   2423 N N     . LEU B 2 270 ? 99.451  8.411   9.704   1.00 45.82  ? 271 LEU A N     1 
ATOM   2424 C CA    . LEU B 2 270 ? 100.831 7.997   9.989   1.00 45.69  ? 271 LEU A CA    1 
ATOM   2425 C C     . LEU B 2 270 ? 101.832 8.978   9.422   1.00 47.20  ? 271 LEU A C     1 
ATOM   2426 O O     . LEU B 2 270 ? 101.801 9.330   8.218   1.00 41.37  ? 271 LEU A O     1 
ATOM   2427 C CB    . LEU B 2 270 ? 101.105 6.652   9.343   1.00 44.75  ? 271 LEU A CB    1 
ATOM   2428 C CG    . LEU B 2 270 ? 102.232 5.810   9.879   1.00 46.87  ? 271 LEU A CG    1 
ATOM   2429 C CD1   . LEU B 2 270 ? 102.077 5.648   11.383  1.00 42.69  ? 271 LEU A CD1   1 
ATOM   2430 C CD2   . LEU B 2 270 ? 102.133 4.471   9.173   1.00 49.48  ? 271 LEU A CD2   1 
ATOM   2431 N N     . ILE B 2 271 ? 102.727 9.421   10.282  1.00 40.24  ? 272 ILE A N     1 
ATOM   2432 C CA    . ILE B 2 271 ? 103.752 10.346  9.853   1.00 32.80  ? 272 ILE A CA    1 
ATOM   2433 C C     . ILE B 2 271 ? 104.990 9.540   10.156  1.00 38.88  ? 272 ILE A C     1 
ATOM   2434 O O     . ILE B 2 271 ? 105.148 8.975   11.292  1.00 31.70  ? 272 ILE A O     1 
ATOM   2435 C CB    . ILE B 2 271 ? 103.681 11.581  10.672  1.00 34.71  ? 272 ILE A CB    1 
ATOM   2436 C CG1   . ILE B 2 271 ? 104.871 12.454  10.430  1.00 41.33  ? 272 ILE A CG1   1 
ATOM   2437 C CG2   . ILE B 2 271 ? 103.578 11.242  12.101  1.00 33.22  ? 272 ILE A CG2   1 
ATOM   2438 C CD1   . ILE B 2 271 ? 104.614 13.552  9.429   1.00 49.11  ? 272 ILE A CD1   1 
ATOM   2439 N N     . GLY B 2 272 ? 105.869 9.439   9.162   1.00 40.31  ? 273 GLY A N     1 
ATOM   2440 C CA    . GLY B 2 272 ? 107.113 8.670   9.364   1.00 40.04  ? 273 GLY A CA    1 
ATOM   2441 C C     . GLY B 2 272 ? 108.342 9.556   9.596   1.00 43.28  ? 273 GLY A C     1 
ATOM   2442 O O     . GLY B 2 272 ? 108.272 10.662  10.146  1.00 41.84  ? 273 GLY A O     1 
ATOM   2443 N N     . TYR B 2 273 ? 109.486 9.073   9.181   1.00 44.21  ? 274 TYR A N     1 
ATOM   2444 C CA    . TYR B 2 273 ? 110.730 9.843   9.345   1.00 39.69  ? 274 TYR A CA    1 
ATOM   2445 C C     . TYR B 2 273 ? 111.850 9.268   8.529   1.00 41.00  ? 274 TYR A C     1 
ATOM   2446 O O     . TYR B 2 273 ? 112.048 8.053   8.556   1.00 40.21  ? 274 TYR A O     1 
ATOM   2447 C CB    . TYR B 2 273 ? 111.149 9.823   10.788  1.00 35.52  ? 274 TYR A CB    1 
ATOM   2448 C CG    . TYR B 2 273 ? 111.956 11.022  11.167  1.00 38.56  ? 274 TYR A CG    1 
ATOM   2449 C CD1   . TYR B 2 273 ? 113.032 11.452  10.378  1.00 42.76  ? 274 TYR A CD1   1 
ATOM   2450 C CD2   . TYR B 2 273 ? 111.680 11.721  12.304  1.00 37.14  ? 274 TYR A CD2   1 
ATOM   2451 C CE1   . TYR B 2 273 ? 113.812 12.550  10.740  1.00 37.20  ? 274 TYR A CE1   1 
ATOM   2452 C CE2   . TYR B 2 273 ? 112.448 12.828  12.663  1.00 43.58  ? 274 TYR A CE2   1 
ATOM   2453 C CZ    . TYR B 2 273 ? 113.519 13.244  11.878  1.00 47.72  ? 274 TYR A CZ    1 
ATOM   2454 O OH    . TYR B 2 273 ? 114.277 14.365  12.243  1.00 48.57  ? 274 TYR A OH    1 
ATOM   2455 N N     . ASP B 2 274 ? 112.561 10.165  7.839   1.00 33.56  ? 275 ASP A N     1 
ATOM   2456 C CA    . ASP B 2 274 ? 113.730 9.915   6.978   1.00 33.87  ? 275 ASP A CA    1 
ATOM   2457 C C     . ASP B 2 274 ? 113.457 10.392  5.602   1.00 45.47  ? 275 ASP A C     1 
ATOM   2458 O O     . ASP B 2 274 ? 114.295 11.011  4.956   1.00 47.91  ? 275 ASP A O     1 
ATOM   2459 C CB    . ASP B 2 274 ? 114.153 8.420   6.844   1.00 34.24  ? 275 ASP A CB    1 
ATOM   2460 C CG    . ASP B 2 274 ? 114.777 7.829   8.120   1.00 43.81  ? 275 ASP A CG    1 
ATOM   2461 O OD1   . ASP B 2 274 ? 115.164 8.598   9.040   1.00 42.31  ? 275 ASP A OD1   1 
ATOM   2462 O OD2   . ASP B 2 274 ? 114.829 6.565   8.220   1.00 37.87  ? 275 ASP A OD2   1 
ATOM   2463 N N     . ASN B 2 275 ? 112.279 10.063  5.132   1.00 41.34  ? 276 ASN A N     1 
ATOM   2464 C CA    . ASN B 2 275 ? 111.894 10.428  3.780   1.00 36.10  ? 276 ASN A CA    1 
ATOM   2465 C C     . ASN B 2 275 ? 112.798 9.653   2.920   1.00 38.45  ? 276 ASN A C     1 
ATOM   2466 O O     . ASN B 2 275 ? 113.558 10.187  2.137   1.00 37.65  ? 276 ASN A O     1 
ATOM   2467 C CB    . ASN B 2 275 ? 112.090 11.894  3.487   1.00 24.80  ? 276 ASN A CB    1 
ATOM   2468 C CG    . ASN B 2 275 ? 111.740 12.259  2.050   1.00 48.57  ? 276 ASN A CG    1 
ATOM   2469 O OD1   . ASN B 2 275 ? 111.172 11.474  1.310   1.00 39.43  ? 276 ASN A OD1   1 
ATOM   2470 N ND2   . ASN B 2 275 ? 112.168 13.409  1.638   1.00 44.53  ? 276 ASN A ND2   1 
ATOM   2471 N N     . VAL B 2 276 ? 112.719 8.350   3.056   1.00 46.03  ? 277 VAL A N     1 
ATOM   2472 C CA    . VAL B 2 276 ? 113.536 7.456   2.255   1.00 44.17  ? 277 VAL A CA    1 
ATOM   2473 C C     . VAL B 2 276 ? 113.240 7.757   0.786   1.00 44.39  ? 277 VAL A C     1 
ATOM   2474 O O     . VAL B 2 276 ? 112.290 8.410   0.500   1.00 52.03  ? 277 VAL A O     1 
ATOM   2475 C CB    . VAL B 2 276 ? 113.265 6.026   2.640   1.00 48.53  ? 277 VAL A CB    1 
ATOM   2476 C CG1   . VAL B 2 276 ? 113.091 5.168   1.403   1.00 54.12  ? 277 VAL A CG1   1 
ATOM   2477 C CG2   . VAL B 2 276 ? 114.367 5.556   3.550   1.00 43.47  ? 277 VAL A CG2   1 
ATOM   2478 N N     . ARG B 2 277 ? 114.063 7.293   -0.138  1.00 44.29  ? 278 ARG A N     1 
ATOM   2479 C CA    . ARG B 2 277 ? 113.878 7.579   -1.551  1.00 45.22  ? 278 ARG A CA    1 
ATOM   2480 C C     . ARG B 2 277 ? 112.595 7.106   -2.193  1.00 59.58  ? 278 ARG A C     1 
ATOM   2481 O O     . ARG B 2 277 ? 112.105 7.657   -3.203  1.00 64.98  ? 278 ARG A O     1 
ATOM   2482 C CB    . ARG B 2 277 ? 115.091 7.086   -2.355  1.00 42.57  ? 278 ARG A CB    1 
ATOM   2483 C CG    . ARG B 2 277 ? 115.495 8.035   -3.470  1.00 42.44  ? 278 ARG A CG    1 
ATOM   2484 C CD    . ARG B 2 277 ? 116.021 7.297   -4.722  1.00 52.32  ? 278 ARG A CD    1 
ATOM   2485 N NE    . ARG B 2 277 ? 117.397 6.816   -4.479  1.00 100.00 ? 278 ARG A NE    1 
ATOM   2486 C CZ    . ARG B 2 277 ? 118.416 7.558   -3.988  1.00 100.00 ? 278 ARG A CZ    1 
ATOM   2487 N NH1   . ARG B 2 277 ? 118.227 8.850   -3.682  1.00 100.00 ? 278 ARG A NH1   1 
ATOM   2488 N NH2   . ARG B 2 277 ? 119.641 7.009   -3.797  1.00 77.97  ? 278 ARG A NH2   1 
ATOM   2489 N N     . ASN B 2 278 ? 112.040 6.077   -1.625  1.00 53.20  ? 279 ASN A N     1 
ATOM   2490 C CA    . ASN B 2 278 ? 110.837 5.545   -2.191  1.00 55.92  ? 279 ASN A CA    1 
ATOM   2491 C C     . ASN B 2 278 ? 109.507 5.593   -1.337  1.00 64.11  ? 279 ASN A C     1 
ATOM   2492 O O     . ASN B 2 278 ? 108.508 4.873   -1.590  1.00 61.39  ? 279 ASN A O     1 
ATOM   2493 C CB    . ASN B 2 278 ? 111.140 4.258   -3.007  1.00 41.93  ? 279 ASN A CB    1 
ATOM   2494 C CG    . ASN B 2 278 ? 112.075 3.268   -2.272  1.00 88.69  ? 279 ASN A CG    1 
ATOM   2495 O OD1   . ASN B 2 278 ? 112.483 2.261   -2.859  1.00 72.51  ? 279 ASN A OD1   1 
ATOM   2496 N ND2   . ASN B 2 278 ? 112.391 3.536   -0.989  1.00 80.67  ? 279 ASN A ND2   1 
ATOM   2497 N N     . ALA B 2 279 ? 109.524 6.482   -0.340  1.00 58.45  ? 280 ALA A N     1 
ATOM   2498 C CA    . ALA B 2 279 ? 108.397 6.705   0.559   1.00 52.31  ? 280 ALA A CA    1 
ATOM   2499 C C     . ALA B 2 279 ? 107.252 7.373   -0.278  1.00 49.54  ? 280 ALA A C     1 
ATOM   2500 O O     . ALA B 2 279 ? 106.090 7.134   -0.041  1.00 45.63  ? 280 ALA A O     1 
ATOM   2501 C CB    . ALA B 2 279 ? 108.841 7.596   1.723   1.00 48.56  ? 280 ALA A CB    1 
ATOM   2502 N N     . ARG B 2 280 ? 107.611 8.193   -1.261  1.00 38.91  ? 281 ARG A N     1 
ATOM   2503 C CA    . ARG B 2 280 ? 106.636 8.838   -2.118  1.00 37.59  ? 281 ARG A CA    1 
ATOM   2504 C C     . ARG B 2 280 ? 105.830 7.739   -2.770  1.00 49.74  ? 281 ARG A C     1 
ATOM   2505 O O     . ARG B 2 280 ? 104.745 7.979   -3.268  1.00 57.28  ? 281 ARG A O     1 
ATOM   2506 C CB    . ARG B 2 280 ? 107.350 9.548   -3.282  1.00 45.18  ? 281 ARG A CB    1 
ATOM   2507 C CG    . ARG B 2 280 ? 106.501 10.659  -3.983  1.00 95.82  ? 281 ARG A CG    1 
ATOM   2508 C CD    . ARG B 2 280 ? 105.928 10.284  -5.367  1.00 100.00 ? 281 ARG A CD    1 
ATOM   2509 N NE    . ARG B 2 280 ? 104.558 9.730   -5.304  1.00 100.00 ? 281 ARG A NE    1 
ATOM   2510 C CZ    . ARG B 2 280 ? 103.683 9.706   -6.324  1.00 100.00 ? 281 ARG A CZ    1 
ATOM   2511 N NH1   . ARG B 2 280 ? 104.000 10.212  -7.517  1.00 97.82  ? 281 ARG A NH1   1 
ATOM   2512 N NH2   . ARG B 2 280 ? 102.481 9.172   -6.151  1.00 88.19  ? 281 ARG A NH2   1 
ATOM   2513 N N     . TYR B 2 281 ? 106.384 6.533   -2.794  1.00 45.38  ? 282 TYR A N     1 
ATOM   2514 C CA    . TYR B 2 281 ? 105.710 5.409   -3.408  1.00 37.50  ? 282 TYR A CA    1 
ATOM   2515 C C     . TYR B 2 281 ? 105.086 4.462   -2.465  1.00 46.86  ? 282 TYR A C     1 
ATOM   2516 O O     . TYR B 2 281 ? 104.529 3.457   -2.858  1.00 54.36  ? 282 TYR A O     1 
ATOM   2517 C CB    . TYR B 2 281 ? 106.547 4.722   -4.445  1.00 32.82  ? 282 TYR A CB    1 
ATOM   2518 C CG    . TYR B 2 281 ? 106.983 5.660   -5.563  1.00 36.78  ? 282 TYR A CG    1 
ATOM   2519 C CD1   . TYR B 2 281 ? 106.248 5.791   -6.719  1.00 37.77  ? 282 TYR A CD1   1 
ATOM   2520 C CD2   . TYR B 2 281 ? 108.137 6.402   -5.457  1.00 39.52  ? 282 TYR A CD2   1 
ATOM   2521 C CE1   . TYR B 2 281 ? 106.642 6.631   -7.735  1.00 34.67  ? 282 TYR A CE1   1 
ATOM   2522 C CE2   . TYR B 2 281 ? 108.544 7.243   -6.476  1.00 39.25  ? 282 TYR A CE2   1 
ATOM   2523 C CZ    . TYR B 2 281 ? 107.790 7.358   -7.604  1.00 53.94  ? 282 TYR A CZ    1 
ATOM   2524 O OH    . TYR B 2 281 ? 108.202 8.214   -8.607  1.00 58.48  ? 282 TYR A OH    1 
ATOM   2525 N N     . PHE B 2 282 ? 105.139 4.771   -1.194  1.00 44.73  ? 283 PHE A N     1 
ATOM   2526 C CA    . PHE B 2 282 ? 104.492 3.902   -0.261  1.00 44.58  ? 283 PHE A CA    1 
ATOM   2527 C C     . PHE B 2 282 ? 103.030 4.118   -0.578  1.00 55.48  ? 283 PHE A C     1 
ATOM   2528 O O     . PHE B 2 282 ? 102.642 5.049   -1.267  1.00 61.80  ? 283 PHE A O     1 
ATOM   2529 C CB    . PHE B 2 282 ? 104.699 4.412   1.125   1.00 48.18  ? 283 PHE A CB    1 
ATOM   2530 C CG    . PHE B 2 282 ? 106.004 4.065   1.675   1.00 50.42  ? 283 PHE A CG    1 
ATOM   2531 C CD1   . PHE B 2 282 ? 107.030 3.777   0.825   1.00 49.53  ? 283 PHE A CD1   1 
ATOM   2532 C CD2   . PHE B 2 282 ? 106.205 4.027   3.039   1.00 49.31  ? 283 PHE A CD2   1 
ATOM   2533 C CE1   . PHE B 2 282 ? 108.239 3.448   1.316   1.00 48.34  ? 283 PHE A CE1   1 
ATOM   2534 C CE2   . PHE B 2 282 ? 107.418 3.709   3.542   1.00 53.53  ? 283 PHE A CE2   1 
ATOM   2535 C CZ    . PHE B 2 282 ? 108.438 3.418   2.672   1.00 51.44  ? 283 PHE A CZ    1 
ATOM   2536 N N     . THR B 2 283 ? 102.199 3.267   -0.047  1.00 58.56  ? 284 THR A N     1 
ATOM   2537 C CA    . THR B 2 283 ? 100.779 3.358   -0.297  1.00 54.09  ? 284 THR A CA    1 
ATOM   2538 C C     . THR B 2 283 ? 100.063 3.459   1.052   1.00 51.16  ? 284 THR A C     1 
ATOM   2539 O O     . THR B 2 283 ? 100.045 2.500   1.824   1.00 54.94  ? 284 THR A O     1 
ATOM   2540 C CB    . THR B 2 283 ? 100.431 2.087   -1.116  1.00 59.47  ? 284 THR A CB    1 
ATOM   2541 O OG1   . THR B 2 283 ? 100.207 2.416   -2.482  1.00 54.86  ? 284 THR A OG1   1 
ATOM   2542 C CG2   . THR B 2 283 ? 99.335  1.265   -0.542  1.00 42.47  ? 284 THR A CG2   1 
ATOM   2543 N N     . PRO B 2 284 ? 99.495  4.630   1.360   1.00 38.14  ? 285 PRO A N     1 
ATOM   2544 C CA    . PRO B 2 284 ? 99.524  5.771   0.469   1.00 37.59  ? 285 PRO A CA    1 
ATOM   2545 C C     . PRO B 2 284 ? 100.844 6.510   0.658   1.00 38.02  ? 285 PRO A C     1 
ATOM   2546 O O     . PRO B 2 284 ? 101.602 6.231   1.591   1.00 36.94  ? 285 PRO A O     1 
ATOM   2547 C CB    . PRO B 2 284 ? 98.403  6.637   1.028   1.00 34.91  ? 285 PRO A CB    1 
ATOM   2548 C CG    . PRO B 2 284 ? 98.530  6.450   2.493   1.00 32.07  ? 285 PRO A CG    1 
ATOM   2549 C CD    . PRO B 2 284 ? 98.961  5.008   2.678   1.00 29.84  ? 285 PRO A CD    1 
ATOM   2550 N N     . ALA B 2 285 ? 101.088 7.447   -0.234  1.00 28.58  ? 286 ALA A N     1 
ATOM   2551 C CA    . ALA B 2 285 ? 102.287 8.227   -0.199  1.00 29.87  ? 286 ALA A CA    1 
ATOM   2552 C C     . ALA B 2 285 ? 102.513 8.744   1.200   1.00 43.17  ? 286 ALA A C     1 
ATOM   2553 O O     . ALA B 2 285 ? 101.678 9.434   1.770   1.00 50.39  ? 286 ALA A O     1 
ATOM   2554 C CB    . ALA B 2 285 ? 102.246 9.339   -1.260  1.00 29.97  ? 286 ALA A CB    1 
ATOM   2555 N N     . LEU B 2 286 ? 103.647 8.331   1.754   1.00 39.95  ? 287 LEU A N     1 
ATOM   2556 C CA    . LEU B 2 286 ? 104.068 8.661   3.107   1.00 36.88  ? 287 LEU A CA    1 
ATOM   2557 C C     . LEU B 2 286 ? 104.351 10.091  3.490   1.00 39.66  ? 287 LEU A C     1 
ATOM   2558 O O     . LEU B 2 286 ? 105.110 10.757  2.892   1.00 44.80  ? 287 LEU A O     1 
ATOM   2559 C CB    . LEU B 2 286 ? 105.252 7.796   3.493   1.00 35.42  ? 287 LEU A CB    1 
ATOM   2560 C CG    . LEU B 2 286 ? 105.738 7.712   4.943   1.00 41.17  ? 287 LEU A CG    1 
ATOM   2561 C CD1   . LEU B 2 286 ? 104.588 7.633   5.895   1.00 46.96  ? 287 LEU A CD1   1 
ATOM   2562 C CD2   . LEU B 2 286 ? 106.587 6.472   5.156   1.00 42.86  ? 287 LEU A CD2   1 
ATOM   2563 N N     . THR B 2 287 ? 103.723 10.562  4.525   1.00 40.87  ? 288 THR A N     1 
ATOM   2564 C CA    . THR B 2 287 ? 103.981 11.902  4.958   1.00 41.08  ? 288 THR A CA    1 
ATOM   2565 C C     . THR B 2 287 ? 105.156 11.671  5.945   1.00 47.84  ? 288 THR A C     1 
ATOM   2566 O O     . THR B 2 287 ? 105.131 10.791  6.849   1.00 51.98  ? 288 THR A O     1 
ATOM   2567 C CB    . THR B 2 287 ? 102.735 12.511  5.633   1.00 26.10  ? 288 THR A CB    1 
ATOM   2568 O OG1   . THR B 2 287 ? 101.817 12.826  4.603   1.00 56.53  ? 288 THR A OG1   1 
ATOM   2569 C CG2   . THR B 2 287 ? 103.077 13.807  6.386   1.00 24.82  ? 288 THR A CG2   1 
ATOM   2570 N N     . THR B 2 288 ? 106.199 12.440  5.796   1.00 43.85  ? 289 THR A N     1 
ATOM   2571 C CA    . THR B 2 288 ? 107.288 12.199  6.696   1.00 47.20  ? 289 THR A CA    1 
ATOM   2572 C C     . THR B 2 288 ? 108.210 13.378  6.940   1.00 46.60  ? 289 THR A C     1 
ATOM   2573 O O     . THR B 2 288 ? 108.096 14.414  6.290   1.00 44.37  ? 289 THR A O     1 
ATOM   2574 C CB    . THR B 2 288 ? 108.123 11.112  6.015   1.00 54.30  ? 289 THR A CB    1 
ATOM   2575 O OG1   . THR B 2 288 ? 108.921 10.396  6.960   1.00 45.94  ? 289 THR A OG1   1 
ATOM   2576 C CG2   . THR B 2 288 ? 108.944 11.728  4.905   1.00 27.75  ? 289 THR A CG2   1 
ATOM   2577 N N     . ILE B 2 289 ? 109.129 13.205  7.891   1.00 47.35  ? 290 ILE A N     1 
ATOM   2578 C CA    . ILE B 2 289 ? 110.102 14.245  8.184   1.00 49.76  ? 290 ILE A CA    1 
ATOM   2579 C C     . ILE B 2 289 ? 111.309 13.825  7.367   1.00 55.98  ? 290 ILE A C     1 
ATOM   2580 O O     . ILE B 2 289 ? 111.760 12.681  7.447   1.00 61.01  ? 290 ILE A O     1 
ATOM   2581 C CB    . ILE B 2 289 ? 110.559 14.320  9.625   1.00 53.09  ? 290 ILE A CB    1 
ATOM   2582 C CG1   . ILE B 2 289 ? 109.471 14.955  10.518  1.00 55.44  ? 290 ILE A CG1   1 
ATOM   2583 C CG2   . ILE B 2 289 ? 111.774 15.226  9.660   1.00 52.43  ? 290 ILE A CG2   1 
ATOM   2584 C CD1   . ILE B 2 289 ? 109.132 16.406  10.180  1.00 60.64  ? 290 ILE A CD1   1 
ATOM   2585 N N     . HIS B 2 290 ? 111.831 14.731  6.564   1.00 47.63  ? 291 HIS A N     1 
ATOM   2586 C CA    . HIS B 2 290 ? 112.977 14.399  5.749   1.00 43.81  ? 291 HIS A CA    1 
ATOM   2587 C C     . HIS B 2 290 ? 114.316 14.771  6.326   1.00 47.28  ? 291 HIS A C     1 
ATOM   2588 O O     . HIS B 2 290 ? 114.505 15.862  6.928   1.00 47.63  ? 291 HIS A O     1 
ATOM   2589 C CB    . HIS B 2 290 ? 112.811 14.987  4.370   1.00 43.34  ? 291 HIS A CB    1 
ATOM   2590 C CG    . HIS B 2 290 ? 114.091 15.235  3.649   1.00 44.48  ? 291 HIS A CG    1 
ATOM   2591 N ND1   . HIS B 2 290 ? 114.988 16.214  4.027   1.00 47.05  ? 291 HIS A ND1   1 
ATOM   2592 C CD2   . HIS B 2 290 ? 114.609 14.653  2.543   1.00 42.60  ? 291 HIS A CD2   1 
ATOM   2593 C CE1   . HIS B 2 290 ? 116.008 16.218  3.186   1.00 43.38  ? 291 HIS A CE1   1 
ATOM   2594 N NE2   . HIS B 2 290 ? 115.801 15.282  2.276   1.00 42.54  ? 291 HIS A NE2   1 
ATOM   2595 N N     . GLN B 2 291 ? 115.245 13.838  6.147   1.00 47.36  ? 292 GLN A N     1 
ATOM   2596 C CA    . GLN B 2 291 ? 116.621 13.987  6.604   1.00 45.43  ? 292 GLN A CA    1 
ATOM   2597 C C     . GLN B 2 291 ? 117.452 14.329  5.373   1.00 38.94  ? 292 GLN A C     1 
ATOM   2598 O O     . GLN B 2 291 ? 117.373 13.674  4.353   1.00 43.11  ? 292 GLN A O     1 
ATOM   2599 C CB    . GLN B 2 291 ? 117.148 12.677  7.203   1.00 46.66  ? 292 GLN A CB    1 
ATOM   2600 C CG    . GLN B 2 291 ? 118.538 12.765  7.897   1.00 33.00  ? 292 GLN A CG    1 
ATOM   2601 C CD    . GLN B 2 291 ? 118.464 13.202  9.370   1.00 69.25  ? 292 GLN A CD    1 
ATOM   2602 O OE1   . GLN B 2 291 ? 117.979 14.320  9.710   1.00 56.10  ? 292 GLN A OE1   1 
ATOM   2603 N NE2   . GLN B 2 291 ? 118.973 12.338  10.256  1.00 53.03  ? 292 GLN A NE2   1 
ATOM   2604 N N     . PRO B 2 292 ? 118.235 15.364  5.457   1.00 34.10  ? 293 PRO A N     1 
ATOM   2605 C CA    . PRO B 2 292 ? 119.063 15.714  4.324   1.00 39.15  ? 293 PRO A CA    1 
ATOM   2606 C C     . PRO B 2 292 ? 120.100 14.628  4.418   1.00 46.46  ? 293 PRO A C     1 
ATOM   2607 O O     . PRO B 2 292 ? 121.000 14.697  5.250   1.00 45.81  ? 293 PRO A O     1 
ATOM   2608 C CB    . PRO B 2 292 ? 119.658 17.066  4.720   1.00 39.64  ? 293 PRO A CB    1 
ATOM   2609 C CG    . PRO B 2 292 ? 119.075 17.397  6.059   1.00 41.01  ? 293 PRO A CG    1 
ATOM   2610 C CD    . PRO B 2 292 ? 118.568 16.147  6.650   1.00 36.30  ? 293 PRO A CD    1 
ATOM   2611 N N     . LYS B 2 293 ? 119.955 13.603  3.595   1.00 41.56  ? 294 LYS A N     1 
ATOM   2612 C CA    . LYS B 2 293 ? 120.886 12.510  3.664   1.00 43.39  ? 294 LYS A CA    1 
ATOM   2613 C C     . LYS B 2 293 ? 122.130 12.723  2.797   1.00 54.13  ? 294 LYS A C     1 
ATOM   2614 O O     . LYS B 2 293 ? 123.269 12.485  3.236   1.00 53.51  ? 294 LYS A O     1 
ATOM   2615 C CB    . LYS B 2 293 ? 120.187 11.196  3.372   1.00 45.29  ? 294 LYS A CB    1 
ATOM   2616 C CG    . LYS B 2 293 ? 119.201 10.723  4.436   1.00 44.85  ? 294 LYS A CG    1 
ATOM   2617 C CD    . LYS B 2 293 ? 118.020 10.011  3.723   1.00 71.03  ? 294 LYS A CD    1 
ATOM   2618 C CE    . LYS B 2 293 ? 116.778 10.893  3.399   1.00 50.36  ? 294 LYS A CE    1 
ATOM   2619 N NZ    . LYS B 2 293 ? 116.672 11.375  1.987   1.00 63.54  ? 294 LYS A NZ    1 
ATOM   2620 N N     . ASP B 2 294 ? 121.912 13.173  1.567   1.00 50.09  ? 295 ASP A N     1 
ATOM   2621 C CA    . ASP B 2 294 ? 123.024 13.442  0.650   1.00 49.23  ? 295 ASP A CA    1 
ATOM   2622 C C     . ASP B 2 294 ? 123.963 14.461  1.338   1.00 58.39  ? 295 ASP A C     1 
ATOM   2623 O O     . ASP B 2 294 ? 125.174 14.335  1.302   1.00 60.59  ? 295 ASP A O     1 
ATOM   2624 C CB    . ASP B 2 294 ? 122.530 14.127  -0.620  1.00 47.06  ? 295 ASP A CB    1 
ATOM   2625 C CG    . ASP B 2 294 ? 121.954 13.168  -1.630  1.00 80.87  ? 295 ASP A CG    1 
ATOM   2626 O OD1   . ASP B 2 294 ? 121.783 11.980  -1.280  1.00 85.48  ? 295 ASP A OD1   1 
ATOM   2627 O OD2   . ASP B 2 294 ? 121.672 13.616  -2.781  1.00 100.00 ? 295 ASP A OD2   1 
ATOM   2628 N N     . SER B 2 295 ? 123.374 15.474  1.952   1.00 52.72  ? 296 SER A N     1 
ATOM   2629 C CA    . SER B 2 295 ? 124.139 16.493  2.607   1.00 50.72  ? 296 SER A CA    1 
ATOM   2630 C C     . SER B 2 295 ? 124.685 16.007  3.894   1.00 54.19  ? 296 SER A C     1 
ATOM   2631 O O     . SER B 2 295 ? 125.624 16.587  4.429   1.00 58.29  ? 296 SER A O     1 
ATOM   2632 C CB    . SER B 2 295 ? 123.296 17.718  2.854   1.00 54.78  ? 296 SER A CB    1 
ATOM   2633 O OG    . SER B 2 295 ? 123.354 18.060  4.225   1.00 68.13  ? 296 SER A OG    1 
ATOM   2634 N N     . LEU B 2 296 ? 124.105 14.952  4.426   1.00 49.03  ? 297 LEU A N     1 
ATOM   2635 C CA    . LEU B 2 296 ? 124.639 14.457  5.678   1.00 46.92  ? 297 LEU A CA    1 
ATOM   2636 C C     . LEU B 2 296 ? 125.969 13.806  5.214   1.00 57.56  ? 297 LEU A C     1 
ATOM   2637 O O     . LEU B 2 296 ? 127.012 14.010  5.808   1.00 58.09  ? 297 LEU A O     1 
ATOM   2638 C CB    . LEU B 2 296 ? 123.715 13.418  6.314   1.00 43.24  ? 297 LEU A CB    1 
ATOM   2639 C CG    . LEU B 2 296 ? 123.806 13.303  7.831   1.00 46.34  ? 297 LEU A CG    1 
ATOM   2640 C CD1   . LEU B 2 296 ? 122.632 12.536  8.278   1.00 44.24  ? 297 LEU A CD1   1 
ATOM   2641 C CD2   . LEU B 2 296 ? 125.039 12.550  8.256   1.00 52.61  ? 297 LEU A CD2   1 
ATOM   2642 N N     . GLY B 2 297 ? 125.925 13.045  4.128   1.00 47.66  ? 298 GLY A N     1 
ATOM   2643 C CA    . GLY B 2 297 ? 127.138 12.409  3.641   1.00 47.86  ? 298 GLY A CA    1 
ATOM   2644 C C     . GLY B 2 297 ? 128.241 13.393  3.223   1.00 51.27  ? 298 GLY A C     1 
ATOM   2645 O O     . GLY B 2 297 ? 129.347 13.342  3.714   1.00 55.73  ? 298 GLY A O     1 
ATOM   2646 N N     . GLU B 2 298 ? 127.933 14.280  2.308   1.00 45.57  ? 299 GLU A N     1 
ATOM   2647 C CA    . GLU B 2 298 ? 128.907 15.229  1.854   1.00 47.40  ? 299 GLU A CA    1 
ATOM   2648 C C     . GLU B 2 298 ? 129.419 16.113  2.948   1.00 48.22  ? 299 GLU A C     1 
ATOM   2649 O O     . GLU B 2 298 ? 130.576 16.435  2.996   1.00 54.90  ? 299 GLU A O     1 
ATOM   2650 C CB    . GLU B 2 298 ? 128.342 16.097  0.743   1.00 49.09  ? 299 GLU A CB    1 
ATOM   2651 C CG    . GLU B 2 298 ? 128.229 17.548  1.133   1.00 64.27  ? 299 GLU A CG    1 
ATOM   2652 C CD    . GLU B 2 298 ? 127.614 18.398  0.036   1.00 100.00 ? 299 GLU A CD    1 
ATOM   2653 O OE1   . GLU B 2 298 ? 127.993 18.198  -1.157  1.00 44.13  ? 299 GLU A OE1   1 
ATOM   2654 O OE2   . GLU B 2 298 ? 126.761 19.267  0.379   1.00 100.00 ? 299 GLU A OE2   1 
ATOM   2655 N N     . THR B 2 299 ? 128.569 16.534  3.831   1.00 45.89  ? 300 THR A N     1 
ATOM   2656 C CA    . THR B 2 299 ? 129.080 17.396  4.869   1.00 47.11  ? 300 THR A CA    1 
ATOM   2657 C C     . THR B 2 299 ? 130.067 16.628  5.707   1.00 47.19  ? 300 THR A C     1 
ATOM   2658 O O     . THR B 2 299 ? 130.903 17.198  6.353   1.00 48.04  ? 300 THR A O     1 
ATOM   2659 C CB    . THR B 2 299 ? 127.939 17.953  5.762   1.00 42.79  ? 300 THR A CB    1 
ATOM   2660 O OG1   . THR B 2 299 ? 127.387 19.105  5.136   1.00 71.46  ? 300 THR A OG1   1 
ATOM   2661 C CG2   . THR B 2 299 ? 128.467 18.358  7.153   1.00 45.72  ? 300 THR A CG2   1 
ATOM   2662 N N     . ALA B 2 300 ? 129.943 15.315  5.683   1.00 42.61  ? 301 ALA A N     1 
ATOM   2663 C CA    . ALA B 2 300 ? 130.835 14.472  6.459   1.00 44.21  ? 301 ALA A CA    1 
ATOM   2664 C C     . ALA B 2 300 ? 132.180 14.364  5.699   1.00 57.26  ? 301 ALA A C     1 
ATOM   2665 O O     . ALA B 2 300 ? 133.263 14.589  6.266   1.00 53.81  ? 301 ALA A O     1 
ATOM   2666 C CB    . ALA B 2 300 ? 130.215 13.074  6.695   1.00 40.68  ? 301 ALA A CB    1 
ATOM   2667 N N     . PHE B 2 301 ? 132.100 14.031  4.417   1.00 53.49  ? 302 PHE A N     1 
ATOM   2668 C CA    . PHE B 2 301 ? 133.299 13.891  3.616   1.00 49.40  ? 302 PHE A CA    1 
ATOM   2669 C C     . PHE B 2 301 ? 134.056 15.149  3.667   1.00 56.62  ? 302 PHE A C     1 
ATOM   2670 O O     . PHE B 2 301 ? 135.195 15.196  4.100   1.00 61.10  ? 302 PHE A O     1 
ATOM   2671 C CB    . PHE B 2 301 ? 132.953 13.657  2.202   1.00 46.17  ? 302 PHE A CB    1 
ATOM   2672 C CG    . PHE B 2 301 ? 134.137 13.521  1.317   1.00 49.92  ? 302 PHE A CG    1 
ATOM   2673 C CD1   . PHE B 2 301 ? 134.955 12.411  1.398   1.00 54.62  ? 302 PHE A CD1   1 
ATOM   2674 C CD2   . PHE B 2 301 ? 134.422 14.482  0.375   1.00 52.14  ? 302 PHE A CD2   1 
ATOM   2675 C CE1   . PHE B 2 301 ? 136.027 12.270  0.549   1.00 54.66  ? 302 PHE A CE1   1 
ATOM   2676 C CE2   . PHE B 2 301 ? 135.497 14.342  -0.478  1.00 55.07  ? 302 PHE A CE2   1 
ATOM   2677 C CZ    . PHE B 2 301 ? 136.300 13.239  -0.393  1.00 53.98  ? 302 PHE A CZ    1 
ATOM   2678 N N     . ASN B 2 302 ? 133.404 16.184  3.210   1.00 53.51  ? 303 ASN A N     1 
ATOM   2679 C CA    . ASN B 2 302 ? 134.017 17.473  3.189   1.00 53.65  ? 303 ASN A CA    1 
ATOM   2680 C C     . ASN B 2 302 ? 134.541 17.849  4.576   1.00 56.47  ? 303 ASN A C     1 
ATOM   2681 O O     . ASN B 2 302 ? 135.602 18.400  4.721   1.00 59.33  ? 303 ASN A O     1 
ATOM   2682 C CB    . ASN B 2 302 ? 133.070 18.514  2.566   1.00 38.82  ? 303 ASN A CB    1 
ATOM   2683 C CG    . ASN B 2 302 ? 132.862 18.292  1.062   1.00 69.27  ? 303 ASN A CG    1 
ATOM   2684 O OD1   . ASN B 2 302 ? 133.581 17.521  0.420   1.00 83.99  ? 303 ASN A OD1   1 
ATOM   2685 N ND2   . ASN B 2 302 ? 131.874 18.978  0.499   1.00 85.43  ? 303 ASN A ND2   1 
ATOM   2686 N N     . MET B 2 303 ? 133.821 17.522  5.605   1.00 53.64  ? 304 MET A N     1 
ATOM   2687 C CA    . MET B 2 303 ? 134.316 17.875  6.923   1.00 55.32  ? 304 MET A CA    1 
ATOM   2688 C C     . MET B 2 303 ? 135.570 17.087  7.260   1.00 63.09  ? 304 MET A C     1 
ATOM   2689 O O     . MET B 2 303 ? 136.400 17.549  8.034   1.00 69.55  ? 304 MET A O     1 
ATOM   2690 C CB    . MET B 2 303 ? 133.243 17.608  7.982   1.00 57.99  ? 304 MET A CB    1 
ATOM   2691 C CG    . MET B 2 303 ? 133.135 18.616  9.090   1.00 60.96  ? 304 MET A CG    1 
ATOM   2692 S SD    . MET B 2 303 ? 131.989 17.865  10.209  1.00 68.57  ? 304 MET A SD    1 
ATOM   2693 C CE    . MET B 2 303 ? 132.643 18.281  11.827  1.00 63.99  ? 304 MET A CE    1 
ATOM   2694 N N     . LEU B 2 304 ? 135.706 15.891  6.694   1.00 54.97  ? 305 LEU A N     1 
ATOM   2695 C CA    . LEU B 2 304 ? 136.878 15.054  6.962   1.00 49.39  ? 305 LEU A CA    1 
ATOM   2696 C C     . LEU B 2 304 ? 138.040 15.477  6.077   1.00 56.10  ? 305 LEU A C     1 
ATOM   2697 O O     . LEU B 2 304 ? 139.119 15.761  6.578   1.00 59.50  ? 305 LEU A O     1 
ATOM   2698 C CB    . LEU B 2 304 ? 136.552 13.614  6.718   1.00 46.51  ? 305 LEU A CB    1 
ATOM   2699 C CG    . LEU B 2 304 ? 137.593 12.572  7.022   1.00 43.45  ? 305 LEU A CG    1 
ATOM   2700 C CD1   . LEU B 2 304 ? 137.959 12.518  8.498   1.00 39.48  ? 305 LEU A CD1   1 
ATOM   2701 C CD2   . LEU B 2 304 ? 137.045 11.260  6.499   1.00 39.43  ? 305 LEU A CD2   1 
ATOM   2702 N N     . LEU B 2 305 ? 137.816 15.523  4.764   1.00 49.45  ? 306 LEU A N     1 
ATOM   2703 C CA    . LEU B 2 305 ? 138.851 15.930  3.806   1.00 49.00  ? 306 LEU A CA    1 
ATOM   2704 C C     . LEU B 2 305 ? 139.632 17.205  4.245   1.00 61.07  ? 306 LEU A C     1 
ATOM   2705 O O     . LEU B 2 305 ? 140.797 17.414  3.868   1.00 59.53  ? 306 LEU A O     1 
ATOM   2706 C CB    . LEU B 2 305 ? 138.216 16.163  2.468   1.00 46.92  ? 306 LEU A CB    1 
ATOM   2707 C CG    . LEU B 2 305 ? 139.149 16.200  1.265   1.00 56.78  ? 306 LEU A CG    1 
ATOM   2708 C CD1   . LEU B 2 305 ? 139.438 14.788  0.718   1.00 62.97  ? 306 LEU A CD1   1 
ATOM   2709 C CD2   . LEU B 2 305 ? 138.493 17.031  0.175   1.00 60.08  ? 306 LEU A CD2   1 
ATOM   2710 N N     . ASP B 2 306 ? 138.975 18.033  5.053   1.00 58.21  ? 307 ASP A N     1 
ATOM   2711 C CA    . ASP B 2 306 ? 139.547 19.268  5.569   1.00 62.40  ? 307 ASP A CA    1 
ATOM   2712 C C     . ASP B 2 306 ? 140.652 18.958  6.577   1.00 66.76  ? 307 ASP A C     1 
ATOM   2713 O O     . ASP B 2 306 ? 141.796 19.387  6.410   1.00 65.92  ? 307 ASP A O     1 
ATOM   2714 C CB    . ASP B 2 306 ? 138.454 20.054  6.280   1.00 67.50  ? 307 ASP A CB    1 
ATOM   2715 C CG    . ASP B 2 306 ? 138.958 21.334  6.892   1.00 85.61  ? 307 ASP A CG    1 
ATOM   2716 O OD1   . ASP B 2 306 ? 140.082 21.762  6.560   1.00 92.35  ? 307 ASP A OD1   1 
ATOM   2717 O OD2   . ASP B 2 306 ? 138.204 21.929  7.677   1.00 82.42  ? 307 ASP A OD2   1 
ATOM   2718 N N     . ARG B 2 307 ? 140.286 18.221  7.623   1.00 64.28  ? 308 ARG A N     1 
ATOM   2719 C CA    . ARG B 2 307 ? 141.230 17.819  8.670   1.00 66.09  ? 308 ARG A CA    1 
ATOM   2720 C C     . ARG B 2 307 ? 142.443 17.181  7.948   1.00 72.50  ? 308 ARG A C     1 
ATOM   2721 O O     . ARG B 2 307 ? 143.594 17.319  8.355   1.00 72.16  ? 308 ARG A O     1 
ATOM   2722 C CB    . ARG B 2 307 ? 140.613 16.671  9.533   1.00 55.96  ? 308 ARG A CB    1 
ATOM   2723 C CG    . ARG B 2 307 ? 139.820 17.040  10.793  1.00 50.79  ? 308 ARG A CG    1 
ATOM   2724 C CD    . ARG B 2 307 ? 140.571 17.961  11.774  1.00 68.64  ? 308 ARG A CD    1 
ATOM   2725 N NE    . ARG B 2 307 ? 140.018 17.903  13.129  1.00 67.01  ? 308 ARG A NE    1 
ATOM   2726 C CZ    . ARG B 2 307 ? 139.771 16.764  13.779  1.00 100.00 ? 308 ARG A CZ    1 
ATOM   2727 N NH1   . ARG B 2 307 ? 140.033 15.605  13.175  1.00 95.04  ? 308 ARG A NH1   1 
ATOM   2728 N NH2   . ARG B 2 307 ? 139.270 16.774  15.027  1.00 90.69  ? 308 ARG A NH2   1 
ATOM   2729 N N     . ILE B 2 308 ? 142.150 16.468  6.874   1.00 63.09  ? 309 ILE A N     1 
ATOM   2730 C CA    . ILE B 2 308 ? 143.177 15.813  6.147   1.00 60.18  ? 309 ILE A CA    1 
ATOM   2731 C C     . ILE B 2 308 ? 143.973 16.798  5.445   1.00 69.53  ? 309 ILE A C     1 
ATOM   2732 O O     . ILE B 2 308 ? 145.080 17.084  5.854   1.00 76.61  ? 309 ILE A O     1 
ATOM   2733 C CB    . ILE B 2 308 ? 142.633 14.838  5.147   1.00 60.17  ? 309 ILE A CB    1 
ATOM   2734 C CG1   . ILE B 2 308 ? 142.361 13.507  5.819   1.00 57.77  ? 309 ILE A CG1   1 
ATOM   2735 C CG2   . ILE B 2 308 ? 143.618 14.591  4.025   1.00 54.05  ? 309 ILE A CG2   1 
ATOM   2736 C CD1   . ILE B 2 308 ? 141.386 12.682  5.006   1.00 49.22  ? 309 ILE A CD1   1 
ATOM   2737 N N     . VAL B 2 309 ? 143.431 17.336  4.372   1.00 62.61  ? 310 VAL A N     1 
ATOM   2738 C CA    . VAL B 2 309 ? 144.196 18.308  3.635   1.00 63.70  ? 310 VAL A CA    1 
ATOM   2739 C C     . VAL B 2 309 ? 144.672 19.496  4.437   1.00 68.49  ? 310 VAL A C     1 
ATOM   2740 O O     . VAL B 2 309 ? 145.848 19.603  4.714   1.00 75.43  ? 310 VAL A O     1 
ATOM   2741 C CB    . VAL B 2 309 ? 143.648 18.625  2.233   1.00 67.11  ? 310 VAL A CB    1 
ATOM   2742 C CG1   . VAL B 2 309 ? 142.708 17.525  1.778   1.00 68.53  ? 310 VAL A CG1   1 
ATOM   2743 C CG2   . VAL B 2 309 ? 143.003 19.990  2.174   1.00 66.30  ? 310 VAL A CG2   1 
ATOM   2744 N N     . ASN B 2 310 ? 143.774 20.378  4.830   1.00 60.01  ? 311 ASN A N     1 
ATOM   2745 C CA    . ASN B 2 310 ? 144.179 21.531  5.606   1.00 57.49  ? 311 ASN A CA    1 
ATOM   2746 C C     . ASN B 2 310 ? 144.712 21.169  6.982   1.00 61.19  ? 311 ASN A C     1 
ATOM   2747 O O     . ASN B 2 310 ? 144.957 22.036  7.799   1.00 61.31  ? 311 ASN A O     1 
ATOM   2748 C CB    . ASN B 2 310 ? 143.058 22.533  5.677   1.00 48.06  ? 311 ASN A CB    1 
ATOM   2749 C CG    . ASN B 2 310 ? 142.464 22.800  4.314   1.00 100.00 ? 311 ASN A CG    1 
ATOM   2750 O OD1   . ASN B 2 310 ? 143.197 22.867  3.306   1.00 100.00 ? 311 ASN A OD1   1 
ATOM   2751 N ND2   . ASN B 2 310 ? 141.120 22.921  4.250   1.00 100.00 ? 311 ASN A ND2   1 
ATOM   2752 N N     . LYS B 2 311 ? 144.896 19.881  7.208   1.00 62.38  ? 312 LYS A N     1 
ATOM   2753 C CA    . LYS B 2 311 ? 145.417 19.378  8.464   1.00 68.53  ? 312 LYS A CA    1 
ATOM   2754 C C     . LYS B 2 311 ? 144.848 20.033  9.707   1.00 70.24  ? 312 LYS A C     1 
ATOM   2755 O O     . LYS B 2 311 ? 145.516 20.083  10.757  1.00 72.71  ? 312 LYS A O     1 
ATOM   2756 C CB    . LYS B 2 311 ? 146.958 19.393  8.461   1.00 76.56  ? 312 LYS A CB    1 
ATOM   2757 C CG    . LYS B 2 311 ? 147.605 18.013  8.373   1.00 95.86  ? 312 LYS A CG    1 
ATOM   2758 C CD    . LYS B 2 311 ? 149.048 18.028  8.893   1.00 100.00 ? 312 LYS A CD    1 
ATOM   2759 C CE    . LYS B 2 311 ? 149.188 17.481  10.335  1.00 100.00 ? 312 LYS A CE    1 
ATOM   2760 N NZ    . LYS B 2 311 ? 150.525 16.854  10.648  1.00 100.00 ? 312 LYS A NZ    1 
ATOM   2761 N N     . ARG B 2 312 ? 143.627 20.543  9.568   1.00 63.05  ? 313 ARG A N     1 
ATOM   2762 C CA    . ARG B 2 312 ? 142.945 21.208  10.654  1.00 65.30  ? 313 ARG A CA    1 
ATOM   2763 C C     . ARG B 2 312 ? 143.020 20.344  11.899  1.00 78.02  ? 313 ARG A C     1 
ATOM   2764 O O     . ARG B 2 312 ? 143.225 19.124  11.797  1.00 76.44  ? 313 ARG A O     1 
ATOM   2765 C CB    . ARG B 2 312 ? 141.488 21.478  10.295  1.00 72.65  ? 313 ARG A CB    1 
ATOM   2766 C CG    . ARG B 2 312 ? 140.628 21.801  11.527  1.00 100.00 ? 313 ARG A CG    1 
ATOM   2767 C CD    . ARG B 2 312 ? 139.332 22.498  11.159  1.00 94.45  ? 313 ARG A CD    1 
ATOM   2768 N NE    . ARG B 2 312 ? 138.507 21.655  10.310  1.00 64.75  ? 313 ARG A NE    1 
ATOM   2769 C CZ    . ARG B 2 312 ? 137.861 20.567  10.725  1.00 94.70  ? 313 ARG A CZ    1 
ATOM   2770 N NH1   . ARG B 2 312 ? 137.944 20.192  12.010  1.00 69.08  ? 313 ARG A NH1   1 
ATOM   2771 N NH2   . ARG B 2 312 ? 137.123 19.859  9.853   1.00 56.19  ? 313 ARG A NH2   1 
ATOM   2772 N N     . GLU B 2 313 ? 142.882 20.953  13.073  1.00 82.37  ? 314 GLU A N     1 
ATOM   2773 C CA    . GLU B 2 313 ? 142.957 20.154  14.282  1.00 86.79  ? 314 GLU A CA    1 
ATOM   2774 C C     . GLU B 2 313 ? 141.882 20.393  15.332  1.00 98.72  ? 314 GLU A C     1 
ATOM   2775 O O     . GLU B 2 313 ? 141.682 19.562  16.228  1.00 98.65  ? 314 GLU A O     1 
ATOM   2776 C CB    . GLU B 2 313 ? 144.366 20.158  14.874  1.00 89.22  ? 314 GLU A CB    1 
ATOM   2777 C CG    . GLU B 2 313 ? 145.213 18.920  14.514  1.00 100.00 ? 314 GLU A CG    1 
ATOM   2778 C CD    . GLU B 2 313 ? 144.535 17.543  14.864  1.00 100.00 ? 314 GLU A CD    1 
ATOM   2779 O OE1   . GLU B 2 313 ? 144.588 17.121  16.071  1.00 100.00 ? 314 GLU A OE1   1 
ATOM   2780 O OE2   . GLU B 2 313 ? 143.992 16.873  13.915  1.00 100.00 ? 314 GLU A OE2   1 
ATOM   2781 N N     . GLU B 2 314 ? 141.184 21.519  15.227  1.00 99.61  ? 315 GLU A N     1 
ATOM   2782 C CA    . GLU B 2 314 ? 140.128 21.822  16.189  1.00 98.29  ? 315 GLU A CA    1 
ATOM   2783 C C     . GLU B 2 314 ? 138.763 21.218  15.811  1.00 100.00 ? 315 GLU A C     1 
ATOM   2784 O O     . GLU B 2 314 ? 138.181 21.536  14.755  1.00 99.91  ? 315 GLU A O     1 
ATOM   2785 C CB    . GLU B 2 314 ? 140.004 23.320  16.431  1.00 98.63  ? 315 GLU A CB    1 
ATOM   2786 C CG    . GLU B 2 314 ? 141.321 24.004  16.762  1.00 100.00 ? 315 GLU A CG    1 
ATOM   2787 C CD    . GLU B 2 314 ? 141.629 25.180  15.816  1.00 100.00 ? 315 GLU A CD    1 
ATOM   2788 O OE1   . GLU B 2 314 ? 141.966 24.903  14.610  1.00 100.00 ? 315 GLU A OE1   1 
ATOM   2789 O OE2   . GLU B 2 314 ? 141.530 26.371  16.282  1.00 100.00 ? 315 GLU A OE2   1 
ATOM   2790 N N     . PRO B 2 315 ? 138.271 20.345  16.690  1.00 92.33  ? 316 PRO A N     1 
ATOM   2791 C CA    . PRO B 2 315 ? 137.017 19.703  16.505  1.00 88.65  ? 316 PRO A CA    1 
ATOM   2792 C C     . PRO B 2 315 ? 135.891 20.601  16.063  1.00 83.89  ? 316 PRO A C     1 
ATOM   2793 O O     . PRO B 2 315 ? 135.634 21.691  16.619  1.00 79.62  ? 316 PRO A O     1 
ATOM   2794 C CB    . PRO B 2 315 ? 136.771 19.097  17.867  1.00 91.19  ? 316 PRO A CB    1 
ATOM   2795 C CG    . PRO B 2 315 ? 138.128 18.573  18.210  1.00 98.47  ? 316 PRO A CG    1 
ATOM   2796 C CD    . PRO B 2 315 ? 139.132 19.489  17.516  1.00 94.57  ? 316 PRO A CD    1 
ATOM   2797 N N     . GLN B 2 316 ? 135.231 20.104  15.030  1.00 73.73  ? 317 GLN A N     1 
ATOM   2798 C CA    . GLN B 2 316 ? 134.122 20.764  14.416  1.00 65.55  ? 317 GLN A CA    1 
ATOM   2799 C C     . GLN B 2 316 ? 132.870 19.929  14.520  1.00 67.91  ? 317 GLN A C     1 
ATOM   2800 O O     . GLN B 2 316 ? 132.912 18.742  14.825  1.00 66.00  ? 317 GLN A O     1 
ATOM   2801 C CB    . GLN B 2 316 ? 134.433 20.932  12.963  1.00 61.62  ? 317 GLN A CB    1 
ATOM   2802 C CG    . GLN B 2 316 ? 134.229 22.259  12.550  1.00 50.83  ? 317 GLN A CG    1 
ATOM   2803 C CD    . GLN B 2 316 ? 135.058 22.587  11.420  1.00 69.69  ? 317 GLN A CD    1 
ATOM   2804 O OE1   . GLN B 2 316 ? 136.055 23.300  11.550  1.00 82.67  ? 317 GLN A OE1   1 
ATOM   2805 N NE2   . GLN B 2 316 ? 134.693 22.059  10.265  1.00 50.84  ? 317 GLN A NE2   1 
ATOM   2806 N N     . SER B 2 317 ? 131.754 20.582  14.247  1.00 66.49  ? 318 SER A N     1 
ATOM   2807 C CA    . SER B 2 317 ? 130.430 19.974  14.262  1.00 62.99  ? 318 SER A CA    1 
ATOM   2808 C C     . SER B 2 317 ? 129.505 20.868  13.430  1.00 62.88  ? 318 SER A C     1 
ATOM   2809 O O     . SER B 2 317 ? 129.318 22.030  13.743  1.00 60.62  ? 318 SER A O     1 
ATOM   2810 C CB    . SER B 2 317 ? 129.911 19.786  15.675  1.00 63.55  ? 318 SER A CB    1 
ATOM   2811 O OG    . SER B 2 317 ? 128.696 20.472  15.861  1.00 72.38  ? 318 SER A OG    1 
ATOM   2812 N N     . ILE B 2 318 ? 128.958 20.318  12.353  1.00 58.46  ? 319 ILE A N     1 
ATOM   2813 C CA    . ILE B 2 318 ? 128.070 21.056  11.474  1.00 54.36  ? 319 ILE A CA    1 
ATOM   2814 C C     . ILE B 2 318 ? 126.689 20.429  11.576  1.00 58.24  ? 319 ILE A C     1 
ATOM   2815 O O     . ILE B 2 318 ? 126.555 19.200  11.550  1.00 59.55  ? 319 ILE A O     1 
ATOM   2816 C CB    . ILE B 2 318 ? 128.551 20.949  10.050  1.00 54.29  ? 319 ILE A CB    1 
ATOM   2817 C CG1   . ILE B 2 318 ? 129.994 21.417  9.973   1.00 56.34  ? 319 ILE A CG1   1 
ATOM   2818 C CG2   . ILE B 2 318 ? 127.689 21.774  9.129   1.00 51.44  ? 319 ILE A CG2   1 
ATOM   2819 C CD1   . ILE B 2 318 ? 130.695 20.987  8.700   1.00 74.49  ? 319 ILE A CD1   1 
ATOM   2820 N N     . GLU B 2 319 ? 125.668 21.273  11.703  1.00 54.10  ? 320 GLU A N     1 
ATOM   2821 C CA    . GLU B 2 319 ? 124.272 20.809  11.809  1.00 49.55  ? 320 GLU A CA    1 
ATOM   2822 C C     . GLU B 2 319 ? 123.651 20.675  10.449  1.00 51.51  ? 320 GLU A C     1 
ATOM   2823 O O     . GLU B 2 319 ? 124.021 21.357  9.494   1.00 49.46  ? 320 GLU A O     1 
ATOM   2824 C CB    . GLU B 2 319 ? 123.404 21.802  12.575  1.00 48.14  ? 320 GLU A CB    1 
ATOM   2825 C CG    . GLU B 2 319 ? 123.722 21.942  14.056  1.00 44.55  ? 320 GLU A CG    1 
ATOM   2826 C CD    . GLU B 2 319 ? 122.735 22.841  14.782  1.00 65.01  ? 320 GLU A CD    1 
ATOM   2827 O OE1   . GLU B 2 319 ? 122.085 23.658  14.104  1.00 82.81  ? 320 GLU A OE1   1 
ATOM   2828 O OE2   . GLU B 2 319 ? 122.629 22.759  16.031  1.00 91.59  ? 320 GLU A OE2   1 
ATOM   2829 N N     . VAL B 2 320 ? 122.678 19.792  10.367  1.00 53.15  ? 321 VAL A N     1 
ATOM   2830 C CA    . VAL B 2 320 ? 121.969 19.576  9.120   1.00 50.41  ? 321 VAL A CA    1 
ATOM   2831 C C     . VAL B 2 320 ? 120.513 19.724  9.541   1.00 51.05  ? 321 VAL A C     1 
ATOM   2832 O O     . VAL B 2 320 ? 120.215 19.572  10.733  1.00 43.24  ? 321 VAL A O     1 
ATOM   2833 C CB    . VAL B 2 320 ? 122.291 18.232  8.584   1.00 51.16  ? 321 VAL A CB    1 
ATOM   2834 C CG1   . VAL B 2 320 ? 121.359 17.193  9.162   1.00 49.65  ? 321 VAL A CG1   1 
ATOM   2835 C CG2   . VAL B 2 320 ? 122.301 18.296  7.099   1.00 52.50  ? 321 VAL A CG2   1 
ATOM   2836 N N     . HIS B 2 321 ? 119.607 20.051  8.616   1.00 51.98  ? 322 HIS A N     1 
ATOM   2837 C CA    . HIS B 2 321 ? 118.174 20.238  9.005   1.00 54.22  ? 322 HIS A CA    1 
ATOM   2838 C C     . HIS B 2 321 ? 116.984 19.496  8.425   1.00 53.04  ? 322 HIS A C     1 
ATOM   2839 O O     . HIS B 2 321 ? 116.617 19.657  7.256   1.00 57.41  ? 322 HIS A O     1 
ATOM   2840 C CB    . HIS B 2 321 ? 117.838 21.705  9.092   1.00 58.32  ? 322 HIS A CB    1 
ATOM   2841 C CG    . HIS B 2 321 ? 118.610 22.414  10.144  1.00 65.50  ? 322 HIS A CG    1 
ATOM   2842 N ND1   . HIS B 2 321 ? 118.296 22.307  11.484  1.00 69.39  ? 322 HIS A ND1   1 
ATOM   2843 C CD2   . HIS B 2 321 ? 119.689 23.233  10.064  1.00 63.43  ? 322 HIS A CD2   1 
ATOM   2844 C CE1   . HIS B 2 321 ? 119.145 23.041  12.182  1.00 68.10  ? 322 HIS A CE1   1 
ATOM   2845 N NE2   . HIS B 2 321 ? 119.999 23.613  11.344  1.00 65.32  ? 322 HIS A NE2   1 
ATOM   2846 N N     . PRO B 2 322 ? 116.356 18.708  9.282   1.00 41.29  ? 323 PRO A N     1 
ATOM   2847 C CA    . PRO B 2 322 ? 115.191 17.900  8.919   1.00 38.66  ? 323 PRO A CA    1 
ATOM   2848 C C     . PRO B 2 322 ? 114.025 18.781  8.580   1.00 49.72  ? 323 PRO A C     1 
ATOM   2849 O O     . PRO B 2 322 ? 113.804 19.797  9.228   1.00 54.59  ? 323 PRO A O     1 
ATOM   2850 C CB    . PRO B 2 322 ? 114.877 17.189  10.240  1.00 36.21  ? 323 PRO A CB    1 
ATOM   2851 C CG    . PRO B 2 322 ? 115.280 18.178  11.299  1.00 37.92  ? 323 PRO A CG    1 
ATOM   2852 C CD    . PRO B 2 322 ? 116.307 19.128  10.697  1.00 35.45  ? 323 PRO A CD    1 
ATOM   2853 N N     . ARG B 2 323 ? 113.261 18.397  7.580   1.00 36.96  ? 324 ARG A N     1 
ATOM   2854 C CA    . ARG B 2 323 ? 112.124 19.195  7.229   1.00 30.60  ? 324 ARG A CA    1 
ATOM   2855 C C     . ARG B 2 323 ? 110.905 18.309  6.931   1.00 42.67  ? 324 ARG A C     1 
ATOM   2856 O O     . ARG B 2 323 ? 111.028 17.251  6.329   1.00 41.41  ? 324 ARG A O     1 
ATOM   2857 C CB    . ARG B 2 323 ? 112.466 19.987  5.977   1.00 19.74  ? 324 ARG A CB    1 
ATOM   2858 C CG    . ARG B 2 323 ? 112.372 19.120  4.747   1.00 30.24  ? 324 ARG A CG    1 
ATOM   2859 C CD    . ARG B 2 323 ? 112.830 19.829  3.456   1.00 37.21  ? 324 ARG A CD    1 
ATOM   2860 N NE    . ARG B 2 323 ? 112.564 19.018  2.234   1.00 62.19  ? 324 ARG A NE    1 
ATOM   2861 C CZ    . ARG B 2 323 ? 113.491 18.700  1.325   1.00 95.62  ? 324 ARG A CZ    1 
ATOM   2862 N NH1   . ARG B 2 323 ? 114.751 19.114  1.511   1.00 96.52  ? 324 ARG A NH1   1 
ATOM   2863 N NH2   . ARG B 2 323 ? 113.171 17.973  0.232   1.00 51.03  ? 324 ARG A NH2   1 
ATOM   2864 N N     . LEU B 2 324 ? 109.728 18.782  7.338   1.00 47.47  ? 325 LEU A N     1 
ATOM   2865 C CA    . LEU B 2 324 ? 108.451 18.085  7.130   1.00 45.78  ? 325 LEU A CA    1 
ATOM   2866 C C     . LEU B 2 324 ? 108.128 17.997  5.695   1.00 46.84  ? 325 LEU A C     1 
ATOM   2867 O O     . LEU B 2 324 ? 108.302 18.952  4.962   1.00 44.06  ? 325 LEU A O     1 
ATOM   2868 C CB    . LEU B 2 324 ? 107.307 18.889  7.736   1.00 44.48  ? 325 LEU A CB    1 
ATOM   2869 C CG    . LEU B 2 324 ? 105.884 18.322  7.759   1.00 44.50  ? 325 LEU A CG    1 
ATOM   2870 C CD1   . LEU B 2 324 ? 105.183 18.230  6.424   1.00 43.02  ? 325 LEU A CD1   1 
ATOM   2871 C CD2   . LEU B 2 324 ? 105.945 16.974  8.372   1.00 38.31  ? 325 LEU A CD2   1 
ATOM   2872 N N     . ILE B 2 325 ? 107.595 16.858  5.302   1.00 46.14  ? 326 ILE A N     1 
ATOM   2873 C CA    . ILE B 2 325 ? 107.205 16.659  3.925   1.00 47.56  ? 326 ILE A CA    1 
ATOM   2874 C C     . ILE B 2 325 ? 105.839 16.038  3.925   1.00 52.77  ? 326 ILE A C     1 
ATOM   2875 O O     . ILE B 2 325 ? 105.669 14.847  4.226   1.00 45.75  ? 326 ILE A O     1 
ATOM   2876 C CB    . ILE B 2 325 ? 108.060 15.659  3.228   1.00 52.93  ? 326 ILE A CB    1 
ATOM   2877 C CG1   . ILE B 2 325 ? 109.486 16.141  3.157   1.00 56.21  ? 326 ILE A CG1   1 
ATOM   2878 C CG2   . ILE B 2 325 ? 107.508 15.407  1.826   1.00 43.82  ? 326 ILE A CG2   1 
ATOM   2879 C CD1   . ILE B 2 325 ? 110.102 15.803  1.830   1.00 33.65  ? 326 ILE A CD1   1 
ATOM   2880 N N     . GLU B 2 326 ? 104.863 16.848  3.571   1.00 49.21  ? 327 GLU A N     1 
ATOM   2881 C CA    . GLU B 2 326 ? 103.496 16.404  3.521   1.00 41.21  ? 327 GLU A CA    1 
ATOM   2882 C C     . GLU B 2 326 ? 103.146 15.530  2.330   1.00 40.26  ? 327 GLU A C     1 
ATOM   2883 O O     . GLU B 2 326 ? 103.232 15.950  1.198   1.00 39.53  ? 327 GLU A O     1 
ATOM   2884 C CB    . GLU B 2 326 ? 102.606 17.615  3.526   1.00 40.11  ? 327 GLU A CB    1 
ATOM   2885 C CG    . GLU B 2 326 ? 102.432 18.227  4.896   1.00 43.39  ? 327 GLU A CG    1 
ATOM   2886 C CD    . GLU B 2 326 ? 101.565 19.489  4.861   1.00 68.13  ? 327 GLU A CD    1 
ATOM   2887 O OE1   . GLU B 2 326 ? 102.075 20.598  4.517   1.00 48.79  ? 327 GLU A OE1   1 
ATOM   2888 O OE2   . GLU B 2 326 ? 100.367 19.371  5.170   1.00 50.43  ? 327 GLU A OE2   1 
ATOM   2889 N N     . ARG B 2 327 ? 102.743 14.297  2.578   1.00 43.72  ? 328 ARG A N     1 
ATOM   2890 C CA    . ARG B 2 327 ? 102.367 13.432  1.470   1.00 46.39  ? 328 ARG A CA    1 
ATOM   2891 C C     . ARG B 2 327 ? 100.821 13.080  1.543   1.00 55.10  ? 328 ARG A C     1 
ATOM   2892 O O     . ARG B 2 327 ? 99.985  13.971  1.556   1.00 61.38  ? 328 ARG A O     1 
ATOM   2893 C CB    . ARG B 2 327 ? 103.255 12.207  1.399   1.00 54.97  ? 328 ARG A CB    1 
ATOM   2894 C CG    . ARG B 2 327 ? 103.721 11.918  -0.004  1.00 72.75  ? 328 ARG A CG    1 
ATOM   2895 C CD    . ARG B 2 327 ? 105.073 12.531  -0.283  1.00 51.85  ? 328 ARG A CD    1 
ATOM   2896 N NE    . ARG B 2 327 ? 106.046 12.035  0.674   1.00 60.37  ? 328 ARG A NE    1 
ATOM   2897 C CZ    . ARG B 2 327 ? 107.370 12.025  0.506   1.00 62.07  ? 328 ARG A CZ    1 
ATOM   2898 N NH1   . ARG B 2 327 ? 107.916 12.504  -0.598  1.00 45.62  ? 328 ARG A NH1   1 
ATOM   2899 N NH2   . ARG B 2 327 ? 108.156 11.543  1.470   1.00 69.12  ? 328 ARG A NH2   1 
ATOM   2900 N N     . ARG B 2 328 ? 100.444 11.812  1.614   1.00 42.06  ? 329 ARG A N     1 
ATOM   2901 C CA    . ARG B 2 328 ? 99.033  11.463  1.655   1.00 33.06  ? 329 ARG A CA    1 
ATOM   2902 C C     . ARG B 2 328 ? 98.677  10.448  2.720   1.00 36.33  ? 329 ARG A C     1 
ATOM   2903 O O     . ARG B 2 328 ? 97.861  9.589   2.483   1.00 41.94  ? 329 ARG A O     1 
ATOM   2904 C CB    . ARG B 2 328 ? 98.710  10.805  0.332   1.00 28.49  ? 329 ARG A CB    1 
ATOM   2905 C CG    . ARG B 2 328 ? 98.725  11.730  -0.904  1.00 29.53  ? 329 ARG A CG    1 
ATOM   2906 C CD    . ARG B 2 328 ? 98.710  10.843  -2.134  1.00 66.01  ? 329 ARG A CD    1 
ATOM   2907 N NE    . ARG B 2 328 ? 99.161  11.545  -3.341  1.00 100.00 ? 329 ARG A NE    1 
ATOM   2908 C CZ    . ARG B 2 328 ? 100.287 11.272  -4.023  1.00 100.00 ? 329 ARG A CZ    1 
ATOM   2909 N NH1   . ARG B 2 328 ? 101.110 10.305  -3.617  1.00 100.00 ? 329 ARG A NH1   1 
ATOM   2910 N NH2   . ARG B 2 328 ? 100.599 11.981  -5.121  1.00 100.00 ? 329 ARG A NH2   1 
ATOM   2911 N N     . SER B 2 329 ? 99.274  10.520  3.885   1.00 34.91  ? 330 SER A N     1 
ATOM   2912 C CA    . SER B 2 329 ? 98.980  9.531   4.921   1.00 35.90  ? 330 SER A CA    1 
ATOM   2913 C C     . SER B 2 329 ? 98.477  10.117  6.234   1.00 42.15  ? 330 SER A C     1 
ATOM   2914 O O     . SER B 2 329 ? 98.362  9.428   7.284   1.00 41.52  ? 330 SER A O     1 
ATOM   2915 C CB    . SER B 2 329 ? 100.279 8.726   5.199   1.00 45.97  ? 330 SER A CB    1 
ATOM   2916 O OG    . SER B 2 329 ? 101.365 9.563   5.599   1.00 47.77  ? 330 SER A OG    1 
ATOM   2917 N N     . VAL B 2 330 ? 98.189  11.395  6.203   1.00 42.86  ? 331 VAL A N     1 
ATOM   2918 C CA    . VAL B 2 330 ? 97.720  12.030  7.397   1.00 43.94  ? 331 VAL A CA    1 
ATOM   2919 C C     . VAL B 2 330 ? 96.492  12.754  6.932   1.00 54.36  ? 331 VAL A C     1 
ATOM   2920 O O     . VAL B 2 330 ? 96.498  13.356  5.830   1.00 49.64  ? 331 VAL A O     1 
ATOM   2921 C CB    . VAL B 2 330 ? 98.737  13.042  7.880   1.00 48.75  ? 331 VAL A CB    1 
ATOM   2922 C CG1   . VAL B 2 330 ? 98.121  14.048  8.822   1.00 46.83  ? 331 VAL A CG1   1 
ATOM   2923 C CG2   . VAL B 2 330 ? 99.949  12.332  8.488   1.00 51.94  ? 331 VAL A CG2   1 
ATOM   2924 N N     . ALA B 2 331 ? 95.457  12.667  7.785   1.00 46.56  ? 332 ALA A N     1 
ATOM   2925 C CA    . ALA B 2 331 ? 94.152  13.260  7.596   1.00 41.94  ? 332 ALA A CA    1 
ATOM   2926 C C     . ALA B 2 331 ? 93.839  14.091  8.816   1.00 39.64  ? 332 ALA A C     1 
ATOM   2927 O O     . ALA B 2 331 ? 94.397  13.856  9.884   1.00 37.05  ? 332 ALA A O     1 
ATOM   2928 C CB    . ALA B 2 331 ? 93.144  12.154  7.501   1.00 43.57  ? 332 ALA A CB    1 
ATOM   2929 N N     . ASP B 2 332 ? 92.927  15.054  8.679   1.00 40.33  ? 333 ASP A N     1 
ATOM   2930 C CA    . ASP B 2 332 ? 92.584  15.891  9.822   1.00 34.53  ? 333 ASP A CA    1 
ATOM   2931 C C     . ASP B 2 332 ? 92.038  14.993  10.849  1.00 42.30  ? 333 ASP A C     1 
ATOM   2932 O O     . ASP B 2 332 ? 91.462  13.949  10.536  1.00 50.13  ? 333 ASP A O     1 
ATOM   2933 C CB    . ASP B 2 332 ? 91.537  16.913  9.479   1.00 31.38  ? 333 ASP A CB    1 
ATOM   2934 C CG    . ASP B 2 332 ? 91.935  17.790  8.334   1.00 46.81  ? 333 ASP A CG    1 
ATOM   2935 O OD1   . ASP B 2 332 ? 92.898  18.569  8.461   1.00 63.64  ? 333 ASP A OD1   1 
ATOM   2936 O OD2   . ASP B 2 332 ? 91.259  17.740  7.309   1.00 73.75  ? 333 ASP A OD2   1 
ATOM   2937 N N     . GLY B 2 333 ? 92.224  15.393  12.079  1.00 37.13  ? 334 GLY A N     1 
ATOM   2938 C CA    . GLY B 2 333 ? 91.768  14.678  13.226  1.00 35.69  ? 334 GLY A CA    1 
ATOM   2939 C C     . GLY B 2 333 ? 90.635  15.533  13.797  1.00 48.37  ? 334 GLY A C     1 
ATOM   2940 O O     . GLY B 2 333 ? 90.346  16.668  13.373  1.00 53.27  ? 334 GLY A O     1 
ATOM   2941 N N     . PRO B 2 334 ? 90.013  14.952  14.776  1.00 41.30  ? 335 PRO A N     1 
ATOM   2942 C CA    . PRO B 2 334 ? 88.910  15.504  15.513  1.00 39.38  ? 335 PRO A CA    1 
ATOM   2943 C C     . PRO B 2 334 ? 88.973  16.948  15.973  1.00 46.84  ? 335 PRO A C     1 
ATOM   2944 O O     . PRO B 2 334 ? 87.932  17.592  16.077  1.00 49.22  ? 335 PRO A O     1 
ATOM   2945 C CB    . PRO B 2 334 ? 88.912  14.651  16.764  1.00 42.88  ? 335 PRO A CB    1 
ATOM   2946 C CG    . PRO B 2 334 ? 89.513  13.342  16.328  1.00 45.98  ? 335 PRO A CG    1 
ATOM   2947 C CD    . PRO B 2 334 ? 90.561  13.718  15.365  1.00 40.07  ? 335 PRO A CD    1 
ATOM   2948 N N     . PHE B 2 335 ? 90.162  17.470  16.292  1.00 40.01  ? 336 PHE A N     1 
ATOM   2949 C CA    . PHE B 2 335 ? 90.230  18.848  16.758  1.00 29.77  ? 336 PHE A CA    1 
ATOM   2950 C C     . PHE B 2 335 ? 90.602  19.813  15.740  1.00 33.67  ? 336 PHE A C     1 
ATOM   2951 O O     . PHE B 2 335 ? 90.841  20.961  16.067  1.00 33.25  ? 336 PHE A O     1 
ATOM   2952 C CB    . PHE B 2 335 ? 91.092  18.985  17.972  1.00 28.28  ? 336 PHE A CB    1 
ATOM   2953 C CG    . PHE B 2 335 ? 90.689  18.066  19.057  1.00 30.05  ? 336 PHE A CG    1 
ATOM   2954 C CD1   . PHE B 2 335 ? 90.969  16.732  18.962  1.00 30.40  ? 336 PHE A CD1   1 
ATOM   2955 C CD2   . PHE B 2 335 ? 89.972  18.539  20.165  1.00 34.28  ? 336 PHE A CD2   1 
ATOM   2956 C CE1   . PHE B 2 335 ? 90.563  15.878  19.969  1.00 32.36  ? 336 PHE A CE1   1 
ATOM   2957 C CE2   . PHE B 2 335 ? 89.555  17.695  21.171  1.00 35.88  ? 336 PHE A CE2   1 
ATOM   2958 C CZ    . PHE B 2 335 ? 89.853  16.358  21.079  1.00 33.98  ? 336 PHE A CZ    1 
ATOM   2959 N N     . ARG B 2 336 ? 90.657  19.382  14.494  1.00 26.44  ? 337 ARG A N     1 
ATOM   2960 C CA    . ARG B 2 336 ? 91.027  20.341  13.528  1.00 31.35  ? 337 ARG A CA    1 
ATOM   2961 C C     . ARG B 2 336 ? 90.275  21.633  13.497  1.00 49.03  ? 337 ARG A C     1 
ATOM   2962 O O     . ARG B 2 336 ? 90.888  22.684  13.298  1.00 57.06  ? 337 ARG A O     1 
ATOM   2963 C CB    . ARG B 2 336 ? 91.284  19.775  12.160  1.00 34.73  ? 337 ARG A CB    1 
ATOM   2964 C CG    . ARG B 2 336 ? 90.823  20.655  11.045  1.00 71.04  ? 337 ARG A CG    1 
ATOM   2965 C CD    . ARG B 2 336 ? 91.705  21.859  10.662  1.00 82.66  ? 337 ARG A CD    1 
ATOM   2966 N NE    . ARG B 2 336 ? 91.202  22.440  9.371   1.00 100.00 ? 337 ARG A NE    1 
ATOM   2967 C CZ    . ARG B 2 336 ? 90.293  23.438  9.226   1.00 100.00 ? 337 ARG A CZ    1 
ATOM   2968 N NH1   . ARG B 2 336 ? 89.737  24.044  10.290  1.00 100.00 ? 337 ARG A NH1   1 
ATOM   2969 N NH2   . ARG B 2 336 ? 89.939  23.844  7.996   1.00 100.00 ? 337 ARG A NH2   1 
ATOM   2970 N N     . ASP B 2 337 ? 88.967  21.582  13.722  1.00 47.56  ? 338 ASP A N     1 
ATOM   2971 C CA    . ASP B 2 337 ? 88.169  22.817  13.682  1.00 44.56  ? 338 ASP A CA    1 
ATOM   2972 C C     . ASP B 2 337 ? 88.131  23.645  14.929  1.00 42.30  ? 338 ASP A C     1 
ATOM   2973 O O     . ASP B 2 337 ? 87.826  24.823  14.869  1.00 43.46  ? 338 ASP A O     1 
ATOM   2974 C CB    . ASP B 2 337 ? 86.769  22.568  13.168  1.00 45.96  ? 338 ASP A CB    1 
ATOM   2975 C CG    . ASP B 2 337 ? 86.746  21.785  11.867  1.00 61.03  ? 338 ASP A CG    1 
ATOM   2976 O OD1   . ASP B 2 337 ? 87.431  22.197  10.914  1.00 52.57  ? 338 ASP A OD1   1 
ATOM   2977 O OD2   . ASP B 2 337 ? 86.022  20.758  11.795  1.00 82.14  ? 338 ASP A OD2   1 
ATOM   2978 N N     . TYR B 2 338 ? 88.431  23.029  16.058  1.00 34.49  ? 339 TYR A N     1 
ATOM   2979 C CA    . TYR B 2 338 ? 88.432  23.722  17.328  1.00 38.10  ? 339 TYR A CA    1 
ATOM   2980 C C     . TYR B 2 338 ? 89.815  24.298  17.637  1.00 55.55  ? 339 TYR A C     1 
ATOM   2981 O O     . TYR B 2 338 ? 90.423  23.826  18.567  1.00 66.67  ? 339 TYR A O     1 
ATOM   2982 C CB    . TYR B 2 338 ? 88.092  22.708  18.431  1.00 41.16  ? 339 TYR A CB    1 
ATOM   2983 C CG    . TYR B 2 338 ? 86.798  21.979  18.175  1.00 42.21  ? 339 TYR A CG    1 
ATOM   2984 C CD1   . TYR B 2 338 ? 86.687  21.123  17.101  1.00 45.84  ? 339 TYR A CD1   1 
ATOM   2985 C CD2   . TYR B 2 338 ? 85.683  22.164  19.000  1.00 38.75  ? 339 TYR A CD2   1 
ATOM   2986 C CE1   . TYR B 2 338 ? 85.518  20.455  16.842  1.00 50.72  ? 339 TYR A CE1   1 
ATOM   2987 C CE2   . TYR B 2 338 ? 84.505  21.496  18.736  1.00 41.42  ? 339 TYR A CE2   1 
ATOM   2988 C CZ    . TYR B 2 338 ? 84.436  20.641  17.644  1.00 48.60  ? 339 TYR A CZ    1 
ATOM   2989 O OH    . TYR B 2 338 ? 83.294  19.962  17.321  1.00 49.05  ? 339 TYR A OH    1 
ATOM   2990 N N     . ARG B 2 339 ? 90.309  25.308  16.902  1.00 56.10  ? 340 ARG A N     1 
ATOM   2991 C CA    . ARG B 2 339 ? 91.658  25.856  17.159  1.00 95.44  ? 340 ARG A CA    1 
ATOM   2992 C C     . ARG B 2 339 ? 91.873  27.283  16.725  1.00 100.00 ? 340 ARG A C     1 
ATOM   2993 O O     . ARG B 2 339 ? 92.909  27.893  17.050  1.00 100.00 ? 340 ARG A O     1 
ATOM   2994 C CB    . ARG B 2 339 ? 92.722  25.069  16.378  1.00 94.17  ? 340 ARG A CB    1 
ATOM   2995 C CG    . ARG B 2 339 ? 92.976  23.663  16.922  1.00 95.00  ? 340 ARG A CG    1 
ATOM   2996 C CD    . ARG B 2 339 ? 94.102  22.939  16.176  1.00 48.72  ? 340 ARG A CD    1 
ATOM   2997 N NE    . ARG B 2 339 ? 95.419  23.566  16.375  1.00 82.77  ? 340 ARG A NE    1 
ATOM   2998 C CZ    . ARG B 2 339 ? 96.101  24.214  15.417  1.00 90.93  ? 340 ARG A CZ    1 
ATOM   2999 N NH1   . ARG B 2 339 ? 95.607  24.335  14.176  1.00 48.80  ? 340 ARG A NH1   1 
ATOM   3000 N NH2   . ARG B 2 339 ? 97.300  24.784  15.605  1.00 91.71  ? 340 ARG A NH2   1 
HETATM 3001 P P     . PO4 C 3 .   ? 119.474 16.271  1.141   1.00 54.80  ? 799 PO4 A P     1 
HETATM 3002 O O1    . PO4 C 3 .   ? 119.360 16.671  -0.295  1.00 51.81  ? 799 PO4 A O1    1 
HETATM 3003 O O2    . PO4 C 3 .   ? 120.792 16.201  1.703   1.00 100.00 ? 799 PO4 A O2    1 
HETATM 3004 O O3    . PO4 C 3 .   ? 118.803 17.308  1.902   1.00 68.98  ? 799 PO4 A O3    1 
HETATM 3005 O O4    . PO4 C 3 .   ? 118.927 14.838  1.312   1.00 100.00 ? 799 PO4 A O4    1 
HETATM 3006 P P     . PO4 D 3 .   ? 148.220 11.670  -5.039  1.00 75.29  ? 800 PO4 A P     1 
HETATM 3007 O O1    . PO4 D 3 .   ? 148.272 10.666  -6.241  1.00 66.22  ? 800 PO4 A O1    1 
HETATM 3008 O O2    . PO4 D 3 .   ? 146.886 12.228  -4.905  1.00 100.00 ? 800 PO4 A O2    1 
HETATM 3009 O O3    . PO4 D 3 .   ? 149.098 12.842  -5.238  1.00 99.95  ? 800 PO4 A O3    1 
HETATM 3010 O O4    . PO4 D 3 .   ? 148.608 10.947  -3.827  1.00 68.34  ? 800 PO4 A O4    1 
HETATM 3011 N N1    . HPA E 4 .   ? 118.710 2.602   10.683  1.00 40.34  ? 599 HPA A N1    1 
HETATM 3012 C C2    . HPA E 4 .   ? 117.911 2.701   9.566   1.00 35.86  ? 599 HPA A C2    1 
HETATM 3013 N N3    . HPA E 4 .   ? 117.263 3.809   9.219   1.00 53.30  ? 599 HPA A N3    1 
HETATM 3014 C C4    . HPA E 4 .   ? 117.454 4.815   10.110  1.00 45.42  ? 599 HPA A C4    1 
HETATM 3015 C C5    . HPA E 4 .   ? 118.236 4.811   11.246  1.00 65.81  ? 599 HPA A C5    1 
HETATM 3016 C C6    . HPA E 4 .   ? 118.945 3.632   11.593  1.00 51.31  ? 599 HPA A C6    1 
HETATM 3017 O O6    . HPA E 4 .   ? 119.697 3.433   12.561  1.00 53.10  ? 599 HPA A O6    1 
HETATM 3018 N N7    . HPA E 4 .   ? 118.171 6.051   11.876  1.00 43.36  ? 599 HPA A N7    1 
HETATM 3019 C C8    . HPA E 4 .   ? 117.381 6.768   11.126  1.00 55.74  ? 599 HPA A C8    1 
HETATM 3020 N N9    . HPA E 4 .   ? 116.907 6.080   10.033  1.00 42.86  ? 599 HPA A N9    1 
HETATM 3021 O O     . HOH F 5 .   ? 152.238 -6.155  9.097   1.00 71.86  ? 2   HOH B O     1 
HETATM 3022 O O     . HOH F 5 .   ? 167.656 27.728  -22.081 1.00 46.66  ? 7   HOH B O     1 
HETATM 3023 O O     . HOH F 5 .   ? 155.648 -12.023 7.769   1.00 55.52  ? 23  HOH B O     1 
HETATM 3024 O O     . HOH F 5 .   ? 159.022 -14.098 6.999   1.00 48.48  ? 26  HOH B O     1 
HETATM 3025 O O     . HOH F 5 .   ? 166.665 4.233   -7.913  1.00 73.02  ? 42  HOH B O     1 
HETATM 3026 O O     . HOH F 5 .   ? 163.624 19.286  -15.363 1.00 68.48  ? 65  HOH B O     1 
HETATM 3027 O O     . HOH F 5 .   ? 155.341 5.874   10.798  1.00 63.29  ? 70  HOH B O     1 
HETATM 3028 O O     . HOH F 5 .   ? 155.109 -6.588  11.800  1.00 78.76  ? 86  HOH B O     1 
HETATM 3029 O O     . HOH F 5 .   ? 173.351 -19.272 -0.401  1.00 100.00 ? 97  HOH B O     1 
HETATM 3030 O O     . HOH G 5 .   ? 123.766 7.897   17.770  1.00 46.44  ? 801 HOH A O     1 
HETATM 3031 O O     . HOH G 5 .   ? 125.199 -2.390  0.512   1.00 43.07  ? 802 HOH A O     1 
HETATM 3032 O O     . HOH G 5 .   ? 93.052  9.900   10.749  1.00 44.81  ? 803 HOH A O     1 
HETATM 3033 O O     . HOH G 5 .   ? 103.457 -0.128  -1.355  1.00 55.12  ? 804 HOH A O     1 
HETATM 3034 O O     . HOH G 5 .   ? 96.461  8.489   -1.109  1.00 53.16  ? 805 HOH A O     1 
HETATM 3035 O O     . HOH G 5 .   ? 115.548 -0.026  7.500   1.00 46.95  ? 806 HOH A O     1 
HETATM 3036 O O     . HOH G 5 .   ? 120.873 10.230  21.275  1.00 72.89  ? 807 HOH A O     1 
HETATM 3037 O O     . HOH G 5 .   ? 119.439 0.004   11.513  1.00 55.48  ? 808 HOH A O     1 
HETATM 3038 O O     . HOH G 5 .   ? 102.782 22.647  7.545   1.00 50.66  ? 809 HOH A O     1 
HETATM 3039 O O     . HOH G 5 .   ? 116.174 20.415  4.437   1.00 63.03  ? 810 HOH A O     1 
HETATM 3040 O O     . HOH G 5 .   ? 117.617 19.348  17.312  1.00 54.99  ? 811 HOH A O     1 
HETATM 3041 O O     . HOH G 5 .   ? 87.842  4.252   4.652   1.00 49.43  ? 812 HOH A O     1 
HETATM 3042 O O     . HOH G 5 .   ? 107.497 25.792  25.559  1.00 50.20  ? 813 HOH A O     1 
HETATM 3043 O O     . HOH G 5 .   ? 164.495 18.185  -9.934  1.00 57.77  ? 814 HOH A O     1 
HETATM 3044 O O     . HOH G 5 .   ? 121.155 7.162   12.995  1.00 49.34  ? 815 HOH A O     1 
HETATM 3045 O O     . HOH G 5 .   ? 107.790 -1.189  23.426  1.00 51.03  ? 816 HOH A O     1 
HETATM 3046 O O     . HOH G 5 .   ? 117.060 12.225  13.069  1.00 46.76  ? 817 HOH A O     1 
HETATM 3047 O O     . HOH G 5 .   ? 92.534  4.708   14.433  1.00 49.20  ? 818 HOH A O     1 
HETATM 3048 O O     . HOH G 5 .   ? 91.249  15.100  5.842   1.00 53.54  ? 819 HOH A O     1 
HETATM 3049 O O     . HOH G 5 .   ? 147.859 7.498   5.161   1.00 54.11  ? 820 HOH A O     1 
HETATM 3050 O O     . HOH G 5 .   ? 120.038 21.256  6.276   1.00 50.51  ? 821 HOH A O     1 
HETATM 3051 O O     . HOH G 5 .   ? 152.723 14.097  -6.605  1.00 55.38  ? 822 HOH A O     1 
HETATM 3052 O O     . HOH G 5 .   ? 128.301 -0.848  13.306  1.00 57.16  ? 823 HOH A O     1 
HETATM 3053 O O     . HOH G 5 .   ? 150.902 5.412   3.933   1.00 59.14  ? 824 HOH A O     1 
HETATM 3054 O O     . HOH G 5 .   ? 94.338  21.663  8.914   1.00 56.56  ? 825 HOH A O     1 
HETATM 3055 O O     . HOH G 5 .   ? 87.543  19.139  13.871  1.00 47.61  ? 826 HOH A O     1 
HETATM 3056 O O     . HOH G 5 .   ? 127.541 6.395   25.786  1.00 67.38  ? 827 HOH A O     1 
HETATM 3057 O O     . HOH G 5 .   ? 113.776 4.051   7.497   1.00 44.43  ? 828 HOH A O     1 
HETATM 3058 O O     . HOH G 5 .   ? 121.709 10.677  13.803  1.00 55.33  ? 829 HOH A O     1 
HETATM 3059 O O     . HOH G 5 .   ? 98.731  8.906   30.010  1.00 66.67  ? 830 HOH A O     1 
HETATM 3060 O O     . HOH G 5 .   ? 150.931 13.080  2.833   1.00 68.22  ? 831 HOH A O     1 
HETATM 3061 O O     . HOH G 5 .   ? 116.551 2.814   6.763   1.00 58.03  ? 832 HOH A O     1 
HETATM 3062 O O     . HOH G 5 .   ? 104.782 21.440  3.863   1.00 56.11  ? 833 HOH A O     1 
HETATM 3063 O O     . HOH G 5 .   ? 105.303 18.990  2.000   1.00 50.85  ? 834 HOH A O     1 
HETATM 3064 O O     . HOH G 5 .   ? 95.202  6.738   1.626   1.00 76.95  ? 835 HOH A O     1 
HETATM 3065 O O     . HOH G 5 .   ? 163.443 13.994  -15.528 1.00 50.92  ? 836 HOH A O     1 
HETATM 3066 O O     . HOH G 5 .   ? 110.641 9.769   -1.133  1.00 49.63  ? 837 HOH A O     1 
HETATM 3067 O O     . HOH G 5 .   ? 99.381  21.446  9.085   1.00 59.43  ? 838 HOH A O     1 
HETATM 3068 O O     . HOH G 5 .   ? 134.932 1.414   28.515  1.00 90.75  ? 839 HOH A O     1 
HETATM 3069 O O     . HOH G 5 .   ? 135.426 21.392  7.769   1.00 66.95  ? 840 HOH A O     1 
HETATM 3070 O O     . HOH G 5 .   ? 153.450 -7.009  -20.669 1.00 76.86  ? 841 HOH A O     1 
HETATM 3071 O O     . HOH G 5 .   ? 146.385 4.076   10.545  1.00 74.62  ? 842 HOH A O     1 
HETATM 3072 O O     . HOH G 5 .   ? 119.030 7.267   -8.918  1.00 94.48  ? 843 HOH A O     1 
HETATM 3073 O O     . HOH G 5 .   ? 145.867 -1.639  -18.661 1.00 77.79  ? 844 HOH A O     1 
HETATM 3074 O O     . HOH G 5 .   ? 98.194  0.554   4.530   1.00 63.49  ? 845 HOH A O     1 
HETATM 3075 O O     . HOH G 5 .   ? 111.195 10.179  25.384  1.00 59.31  ? 846 HOH A O     1 
HETATM 3076 O O     . HOH G 5 .   ? 112.502 0.924   -0.515  1.00 59.10  ? 847 HOH A O     1 
HETATM 3077 O O     . HOH G 5 .   ? 121.988 9.280   11.509  1.00 49.31  ? 848 HOH A O     1 
HETATM 3078 O O     . HOH G 5 .   ? 87.654  13.746  12.551  1.00 60.48  ? 849 HOH A O     1 
HETATM 3079 O O     . HOH G 5 .   ? 142.839 6.192   -4.893  0.50 41.65  ? 850 HOH A O     1 
HETATM 3080 O O     . HOH G 5 .   ? 109.479 24.299  21.437  1.00 67.01  ? 851 HOH A O     1 
HETATM 3081 O O     . HOH G 5 .   ? 136.619 24.393  8.747   1.00 65.14  ? 852 HOH A O     1 
HETATM 3082 O O     . HOH G 5 .   ? 109.481 20.146  2.854   1.00 59.35  ? 853 HOH A O     1 
HETATM 3083 O O     . HOH G 5 .   ? 148.253 7.548   -3.384  1.00 72.71  ? 854 HOH A O     1 
HETATM 3084 O O     . HOH G 5 .   ? 110.151 -7.154  15.736  1.00 72.07  ? 855 HOH A O     1 
HETATM 3085 O O     . HOH G 5 .   ? 89.376  6.205   17.377  1.00 62.24  ? 856 HOH A O     1 
HETATM 3086 O O     . HOH G 5 .   ? 102.908 12.680  27.371  1.00 72.19  ? 857 HOH A O     1 
HETATM 3087 O O     . HOH G 5 .   ? 116.877 -4.160  0.120   1.00 65.11  ? 858 HOH A O     1 
HETATM 3088 O O     . HOH G 5 .   ? 124.770 5.491   22.319  1.00 58.66  ? 859 HOH A O     1 
HETATM 3089 O O     . HOH G 5 .   ? 114.302 7.474   24.826  1.00 58.29  ? 860 HOH A O     1 
HETATM 3090 O O     . HOH G 5 .   ? 113.706 17.488  25.846  1.00 86.90  ? 861 HOH A O     1 
HETATM 3091 O O     . HOH G 5 .   ? 145.609 6.249   9.039   1.00 78.12  ? 862 HOH A O     1 
HETATM 3092 O O     . HOH G 5 .   ? 139.957 13.015  13.906  1.00 78.31  ? 863 HOH A O     1 
HETATM 3093 O O     . HOH G 5 .   ? 90.738  16.413  24.883  1.00 63.66  ? 864 HOH A O     1 
HETATM 3094 O O     . HOH G 5 .   ? 99.703  14.488  5.091   1.00 74.41  ? 865 HOH A O     1 
HETATM 3095 O O     . HOH G 5 .   ? 162.506 -4.684  -17.630 1.00 84.37  ? 866 HOH A O     1 
HETATM 3096 O O     . HOH G 5 .   ? 87.694  17.201  11.476  1.00 66.94  ? 867 HOH A O     1 
HETATM 3097 O O     . HOH G 5 .   ? 152.470 14.447  -2.388  1.00 63.39  ? 868 HOH A O     1 
HETATM 3098 O O     . HOH G 5 .   ? 92.732  -8.247  12.026  1.00 80.69  ? 869 HOH A O     1 
HETATM 3099 O O     . HOH G 5 .   ? 98.987  7.859   -2.249  1.00 49.34  ? 870 HOH A O     1 
HETATM 3100 O O     . HOH G 5 .   ? 143.101 15.817  -1.325  1.00 90.17  ? 871 HOH A O     1 
HETATM 3101 O O     . HOH G 5 .   ? 108.591 6.154   26.526  1.00 71.73  ? 872 HOH A O     1 
HETATM 3102 O O     . HOH G 5 .   ? 157.272 18.963  -8.655  1.00 65.47  ? 873 HOH A O     1 
HETATM 3103 O O     . HOH G 5 .   ? 149.128 12.586  -8.812  1.00 93.39  ? 874 HOH A O     1 
HETATM 3104 O O     . HOH G 5 .   ? 103.490 21.703  10.608  1.00 75.00  ? 875 HOH A O     1 
HETATM 3105 O O     . HOH G 5 .   ? 89.436  3.276   19.751  1.00 68.85  ? 876 HOH A O     1 
HETATM 3106 O O     . HOH G 5 .   ? 119.692 -3.973  6.998   1.00 76.74  ? 877 HOH A O     1 
HETATM 3107 O O     . HOH G 5 .   ? 123.671 11.124  21.212  1.00 69.65  ? 878 HOH A O     1 
HETATM 3108 O O     . HOH G 5 .   ? 146.165 14.520  8.705   1.00 68.07  ? 879 HOH A O     1 
HETATM 3109 O O     . HOH G 5 .   ? 148.805 14.664  -3.290  1.00 64.87  ? 880 HOH A O     1 
HETATM 3110 O O     . HOH G 5 .   ? 87.698  10.056  15.064  1.00 88.00  ? 881 HOH A O     1 
HETATM 3111 O O     . HOH G 5 .   ? 105.838 20.792  11.755  1.00 57.24  ? 882 HOH A O     1 
HETATM 3112 O O     . HOH G 5 .   ? 121.054 -2.357  11.639  1.00 89.67  ? 883 HOH A O     1 
HETATM 3113 O O     . HOH G 5 .   ? 147.041 14.560  -0.155  1.00 75.07  ? 884 HOH A O     1 
HETATM 3114 O O     . HOH G 5 .   ? 115.421 -1.649  19.867  1.00 90.53  ? 885 HOH A O     1 
HETATM 3115 O O     . HOH G 5 .   ? 111.912 6.087   26.380  1.00 92.86  ? 886 HOH A O     1 
HETATM 3116 O O     . HOH G 5 .   ? 124.116 3.037   23.871  1.00 79.07  ? 887 HOH A O     1 
HETATM 3117 O O     . HOH G 5 .   ? 105.347 14.414  26.769  1.00 67.42  ? 888 HOH A O     1 
HETATM 3118 O O     . HOH G 5 .   ? 134.599 18.222  -7.412  1.00 78.28  ? 889 HOH A O     1 
HETATM 3119 O O     . HOH G 5 .   ? 92.222  8.946   24.984  1.00 84.20  ? 890 HOH A O     1 
HETATM 3120 O O     . HOH G 5 .   ? 156.175 19.270  -19.225 1.00 91.83  ? 891 HOH A O     1 
HETATM 3121 O O     . HOH G 5 .   ? 95.279  -8.135  21.944  1.00 90.14  ? 892 HOH A O     1 
HETATM 3122 O O     . HOH G 5 .   ? 99.357  4.179   30.048  1.00 97.12  ? 893 HOH A O     1 
HETATM 3123 O O     . HOH G 5 .   ? 107.064 14.410  -3.261  1.00 41.87  ? 894 HOH A O     1 
HETATM 3124 O O     . HOH G 5 .   ? 113.058 2.463   9.656   1.00 47.50  ? 895 HOH A O     1 
HETATM 3125 O O     . HOH G 5 .   ? 127.575 6.829   -5.187  1.00 53.19  ? 896 HOH A O     1 
HETATM 3126 O O     . HOH G 5 .   ? 121.386 7.716   15.615  1.00 54.77  ? 897 HOH A O     1 
HETATM 3127 O O     . HOH G 5 .   ? 87.061  4.856   7.108   1.00 64.18  ? 898 HOH A O     1 
HETATM 3128 O O     . HOH G 5 .   ? 124.107 13.272  13.593  1.00 76.76  ? 899 HOH A O     1 
HETATM 3129 O O     . HOH G 5 .   ? 112.676 6.913   16.153  1.00 78.88  ? 900 HOH A O     1 
HETATM 3130 O O     . HOH G 5 .   ? 121.194 8.076   22.828  1.00 44.52  ? 901 HOH A O     1 
HETATM 3131 O O     . HOH G 5 .   ? 124.336 8.730   20.254  1.00 60.65  ? 902 HOH A O     1 
HETATM 3132 O O     . HOH G 5 .   ? 113.907 9.989   23.964  1.00 71.15  ? 903 HOH A O     1 
HETATM 3133 O O     . HOH G 5 .   ? 127.287 13.523  15.647  1.00 78.32  ? 904 HOH A O     1 
HETATM 3134 O O     . HOH G 5 .   ? 130.966 10.056  18.750  1.00 88.64  ? 905 HOH A O     1 
HETATM 3135 O O     . HOH G 5 .   ? 145.400 1.112   1.405   1.00 100.00 ? 906 HOH A O     1 
HETATM 3136 O O     . HOH G 5 .   ? 111.188 15.288  25.623  1.00 79.44  ? 907 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   699 699 DA  A   B . n 
A 1 2   DA  2   700 700 DA  A   B . n 
A 1 3   DC  3   701 701 DC  C   B . n 
A 1 4   DG  4   702 702 DG  G   B . n 
A 1 5   DA  5   703 703 DA  A   B . n 
A 1 6   DA  6   704 704 DA  A   B . n 
A 1 7   DA  7   705 705 DA  A   B . n 
A 1 8   DA  8   706 706 DA  A   B . n 
A 1 9   DC  9   707 707 DC  C   B . n 
A 1 10  DG  10  708 708 DG  G   B . n 
A 1 11  DT  11  709 709 DT  T   B . n 
A 1 12  DT  12  710 710 DT  T   B . n 
A 1 13  DT  13  711 711 DT  T   B . n 
A 1 14  DT  14  712 712 DT  T   B . n 
A 1 15  DC  15  713 713 DC  C   B . n 
A 1 16  DG  16  714 714 DG  G   B . n 
A 1 17  DT  17  715 715 DT  T   B . n 
B 2 1   ALA 1   2   2   ALA ALA A . n 
B 2 2   THR 2   3   3   THR THR A . n 
B 2 3   ILE 3   4   4   ILE ILE A . n 
B 2 4   LYS 4   5   5   LYS LYS A . n 
B 2 5   ASP 5   6   6   ASP ASP A . n 
B 2 6   VAL 6   7   7   VAL VAL A . n 
B 2 7   ALA 7   8   8   ALA ALA A . n 
B 2 8   LYS 8   9   9   LYS LYS A . n 
B 2 9   ARG 9   10  10  ARG ARG A . n 
B 2 10  ALA 10  11  11  ALA ALA A . n 
B 2 11  ASN 11  12  12  ASN ASN A . n 
B 2 12  VAL 12  13  13  VAL VAL A . n 
B 2 13  SER 13  14  14  SER SER A . n 
B 2 14  THR 14  15  15  THR THR A . n 
B 2 15  THR 15  16  16  THR THR A . n 
B 2 16  THR 16  17  17  THR THR A . n 
B 2 17  VAL 17  18  18  VAL VAL A . n 
B 2 18  SER 18  19  19  SER SER A . n 
B 2 19  HIS 19  20  20  HIS HIS A . n 
B 2 20  VAL 20  21  21  VAL VAL A . n 
B 2 21  ILE 21  22  22  ILE ILE A . n 
B 2 22  ASN 22  23  23  ASN ASN A . n 
B 2 23  LYS 23  24  24  LYS LYS A . n 
B 2 24  THR 24  25  25  THR THR A . n 
B 2 25  ARG 25  26  26  ARG ARG A . n 
B 2 26  PHE 26  27  27  PHE PHE A . n 
B 2 27  VAL 27  28  28  VAL VAL A . n 
B 2 28  ALA 28  29  29  ALA ALA A . n 
B 2 29  GLU 29  30  30  GLU GLU A . n 
B 2 30  GLU 30  31  31  GLU GLU A . n 
B 2 31  THR 31  32  32  THR THR A . n 
B 2 32  ARG 32  33  33  ARG ARG A . n 
B 2 33  ASN 33  34  34  ASN ASN A . n 
B 2 34  ALA 34  35  35  ALA ALA A . n 
B 2 35  VAL 35  36  36  VAL VAL A . n 
B 2 36  TRP 36  37  37  TRP TRP A . n 
B 2 37  ALA 37  38  38  ALA ALA A . n 
B 2 38  ALA 38  39  39  ALA ALA A . n 
B 2 39  ILE 39  40  40  ILE ILE A . n 
B 2 40  LYS 40  41  41  LYS LYS A . n 
B 2 41  GLU 41  42  42  GLU GLU A . n 
B 2 42  LEU 42  43  43  LEU LEU A . n 
B 2 43  HIS 43  44  44  HIS HIS A . n 
B 2 44  TYR 44  45  45  TYR TYR A . n 
B 2 45  SER 45  46  46  SER SER A . n 
B 2 46  PRO 46  47  47  PRO PRO A . n 
B 2 47  SER 47  48  48  SER SER A . n 
B 2 48  ALA 48  49  49  ALA ALA A . n 
B 2 49  VAL 49  50  50  VAL VAL A . n 
B 2 50  ALA 50  51  51  ALA ALA A . n 
B 2 51  ARG 51  52  52  ARG ARG A . n 
B 2 52  SER 52  53  53  SER SER A . n 
B 2 53  LEU 53  54  54  LEU LEU A . n 
B 2 54  LYS 54  55  55  LYS LYS A . n 
B 2 55  VAL 55  56  56  VAL VAL A . n 
B 2 56  ASN 56  57  57  ASN ASN A . n 
B 2 57  HIS 57  58  58  HIS HIS A . n 
B 2 58  THR 58  59  59  THR THR A . n 
B 2 59  LYS 59  60  60  LYS LYS A . n 
B 2 60  SER 60  61  61  SER SER A . n 
B 2 61  ILE 61  62  62  ILE ILE A . n 
B 2 62  GLY 62  63  63  GLY GLY A . n 
B 2 63  LEU 63  64  64  LEU LEU A . n 
B 2 64  LEU 64  65  65  LEU LEU A . n 
B 2 65  ALA 65  66  66  ALA ALA A . n 
B 2 66  THR 66  67  67  THR THR A . n 
B 2 67  SER 67  68  68  SER SER A . n 
B 2 68  SER 68  69  69  SER SER A . n 
B 2 69  GLU 69  70  70  GLU GLU A . n 
B 2 70  ALA 70  71  71  ALA ALA A . n 
B 2 71  ALA 71  72  72  ALA ALA A . n 
B 2 72  TYR 72  73  73  TYR TYR A . n 
B 2 73  PHE 73  74  74  PHE PHE A . n 
B 2 74  ALA 74  75  75  ALA ALA A . n 
B 2 75  GLU 75  76  76  GLU GLU A . n 
B 2 76  ILE 76  77  77  ILE ILE A . n 
B 2 77  ILE 77  78  78  ILE ILE A . n 
B 2 78  GLU 78  79  79  GLU GLU A . n 
B 2 79  ALA 79  80  80  ALA ALA A . n 
B 2 80  VAL 80  81  81  VAL VAL A . n 
B 2 81  GLU 81  82  82  GLU GLU A . n 
B 2 82  LYS 82  83  83  LYS LYS A . n 
B 2 83  ASN 83  84  84  ASN ASN A . n 
B 2 84  CYS 84  85  85  CYS CYS A . n 
B 2 85  PHE 85  86  86  PHE PHE A . n 
B 2 86  GLN 86  87  87  GLN GLN A . n 
B 2 87  LYS 87  88  88  LYS LYS A . n 
B 2 88  GLY 88  89  89  GLY GLY A . n 
B 2 89  TYR 89  90  90  TYR TYR A . n 
B 2 90  THR 90  91  91  THR THR A . n 
B 2 91  LEU 91  92  92  LEU LEU A . n 
B 2 92  ILE 92  93  93  ILE ILE A . n 
B 2 93  LEU 93  94  94  LEU LEU A . n 
B 2 94  GLY 94  95  95  GLY GLY A . n 
B 2 95  ASN 95  96  96  ASN ASN A . n 
B 2 96  ALA 96  97  97  ALA ALA A . n 
B 2 97  TRP 97  98  98  TRP TRP A . n 
B 2 98  ASN 98  99  99  ASN ASN A . n 
B 2 99  ASN 99  100 100 ASN ASN A . n 
B 2 100 LEU 100 101 101 LEU LEU A . n 
B 2 101 GLU 101 102 102 GLU GLU A . n 
B 2 102 LYS 102 103 103 LYS LYS A . n 
B 2 103 GLN 103 104 104 GLN GLN A . n 
B 2 104 ARG 104 105 105 ARG ARG A . n 
B 2 105 ALA 105 106 106 ALA ALA A . n 
B 2 106 TYR 106 107 107 TYR TYR A . n 
B 2 107 LEU 107 108 108 LEU LEU A . n 
B 2 108 SER 108 109 109 SER SER A . n 
B 2 109 MET 109 110 110 MET MET A . n 
B 2 110 MET 110 111 111 MET MET A . n 
B 2 111 ALA 111 112 112 ALA ALA A . n 
B 2 112 GLN 112 113 113 GLN GLN A . n 
B 2 113 LYS 113 114 114 LYS LYS A . n 
B 2 114 ARG 114 115 115 ARG ARG A . n 
B 2 115 VAL 115 116 116 VAL VAL A . n 
B 2 116 ASP 116 117 117 ASP ASP A . n 
B 2 117 GLY 117 118 118 GLY GLY A . n 
B 2 118 LEU 118 119 119 LEU LEU A . n 
B 2 119 LEU 119 120 120 LEU LEU A . n 
B 2 120 VAL 120 121 121 VAL VAL A . n 
B 2 121 MET 121 122 122 MET MET A . n 
B 2 122 CYS 122 123 123 CYS CYS A . n 
B 2 123 SER 123 124 124 SER SER A . n 
B 2 124 GLU 124 125 125 GLU GLU A . n 
B 2 125 TYR 125 126 126 TYR TYR A . n 
B 2 126 PRO 126 127 127 PRO PRO A . n 
B 2 127 GLU 127 128 128 GLU GLU A . n 
B 2 128 PRO 128 129 129 PRO PRO A . n 
B 2 129 LEU 129 130 130 LEU LEU A . n 
B 2 130 LEU 130 131 131 LEU LEU A . n 
B 2 131 ALA 131 132 132 ALA ALA A . n 
B 2 132 MET 132 133 133 MET MET A . n 
B 2 133 LEU 133 134 134 LEU LEU A . n 
B 2 134 GLU 134 135 135 GLU GLU A . n 
B 2 135 GLU 135 136 136 GLU GLU A . n 
B 2 136 TYR 136 137 137 TYR TYR A . n 
B 2 137 ARG 137 138 138 ARG ARG A . n 
B 2 138 HIS 138 139 139 HIS HIS A . n 
B 2 139 ILE 139 140 140 ILE ILE A . n 
B 2 140 PRO 140 141 141 PRO PRO A . n 
B 2 141 MET 141 142 142 MET MET A . n 
B 2 142 VAL 142 143 143 VAL VAL A . n 
B 2 143 VAL 143 144 144 VAL VAL A . n 
B 2 144 MET 144 145 145 MET MET A . n 
B 2 145 ASP 145 146 146 ASP ASP A . n 
B 2 146 ARG 146 147 147 ARG ARG A . n 
B 2 147 GLY 147 148 148 GLY GLY A . n 
B 2 148 GLU 148 149 149 GLU GLU A . n 
B 2 149 ALA 149 150 150 ALA ALA A . n 
B 2 150 LYS 150 151 151 LYS LYS A . n 
B 2 151 ALA 151 152 152 ALA ALA A . n 
B 2 152 ASP 152 153 153 ASP ASP A . n 
B 2 153 PHE 153 154 154 PHE PHE A . n 
B 2 154 THR 154 155 155 THR THR A . n 
B 2 155 ASP 155 156 156 ASP ASP A . n 
B 2 156 ALA 156 157 157 ALA ALA A . n 
B 2 157 VAL 157 158 158 VAL VAL A . n 
B 2 158 ILE 158 159 159 ILE ILE A . n 
B 2 159 ASP 159 160 160 ASP ASP A . n 
B 2 160 ASN 160 161 161 ASN ASN A . n 
B 2 161 ALA 161 162 162 ALA ALA A . n 
B 2 162 PHE 162 163 163 PHE PHE A . n 
B 2 163 GLU 163 164 164 GLU GLU A . n 
B 2 164 GLY 164 165 165 GLY GLY A . n 
B 2 165 GLY 165 166 166 GLY GLY A . n 
B 2 166 TYR 166 167 167 TYR TYR A . n 
B 2 167 MET 167 168 168 MET MET A . n 
B 2 168 ALA 168 169 169 ALA ALA A . n 
B 2 169 GLY 169 170 170 GLY GLY A . n 
B 2 170 ARG 170 171 171 ARG ARG A . n 
B 2 171 TYR 171 172 172 TYR TYR A . n 
B 2 172 LEU 172 173 173 LEU LEU A . n 
B 2 173 ILE 173 174 174 ILE ILE A . n 
B 2 174 GLU 174 175 175 GLU GLU A . n 
B 2 175 ARG 175 176 176 ARG ARG A . n 
B 2 176 GLY 176 177 177 GLY GLY A . n 
B 2 177 HIS 177 178 178 HIS HIS A . n 
B 2 178 ARG 178 179 179 ARG ARG A . n 
B 2 179 GLU 179 180 180 GLU GLU A . n 
B 2 180 ILE 180 181 181 ILE ILE A . n 
B 2 181 GLY 181 182 182 GLY GLY A . n 
B 2 182 VAL 182 183 183 VAL VAL A . n 
B 2 183 ILE 183 184 184 ILE ILE A . n 
B 2 184 PRO 184 185 185 PRO PRO A . n 
B 2 185 GLY 185 186 186 GLY GLY A . n 
B 2 186 PRO 186 187 187 PRO PRO A . n 
B 2 187 LEU 187 188 188 LEU LEU A . n 
B 2 188 GLU 188 189 189 GLU GLU A . n 
B 2 189 ARG 189 190 190 ARG ARG A . n 
B 2 190 ASN 190 191 191 ASN ASN A . n 
B 2 191 THR 191 192 192 THR THR A . n 
B 2 192 GLY 192 193 193 GLY GLY A . n 
B 2 193 ALA 193 194 194 ALA ALA A . n 
B 2 194 GLY 194 195 195 GLY GLY A . n 
B 2 195 ARG 195 196 196 ARG ARG A . n 
B 2 196 LEU 196 197 197 LEU LEU A . n 
B 2 197 ALA 197 198 198 ALA ALA A . n 
B 2 198 GLY 198 199 199 GLY GLY A . n 
B 2 199 PHE 199 200 200 PHE PHE A . n 
B 2 200 MET 200 201 201 MET MET A . n 
B 2 201 LYS 201 202 202 LYS LYS A . n 
B 2 202 ALA 202 203 203 ALA ALA A . n 
B 2 203 MET 203 204 204 MET MET A . n 
B 2 204 GLU 204 205 205 GLU GLU A . n 
B 2 205 GLU 205 206 206 GLU GLU A . n 
B 2 206 ALA 206 207 207 ALA ALA A . n 
B 2 207 MET 207 208 208 MET MET A . n 
B 2 208 ILE 208 209 209 ILE ILE A . n 
B 2 209 LYS 209 210 210 LYS LYS A . n 
B 2 210 VAL 210 211 211 VAL VAL A . n 
B 2 211 PRO 211 212 212 PRO PRO A . n 
B 2 212 GLU 212 213 213 GLU GLU A . n 
B 2 213 SER 213 214 214 SER SER A . n 
B 2 214 TRP 214 215 215 TRP TRP A . n 
B 2 215 ILE 215 216 216 ILE ILE A . n 
B 2 216 VAL 216 217 217 VAL VAL A . n 
B 2 217 GLN 217 218 218 GLN GLN A . n 
B 2 218 GLY 218 219 219 GLY GLY A . n 
B 2 219 ASP 219 220 220 ASP ASP A . n 
B 2 220 PHE 220 221 221 PHE PHE A . n 
B 2 221 GLU 221 222 222 GLU GLU A . n 
B 2 222 PRO 222 223 223 PRO PRO A . n 
B 2 223 GLU 223 224 224 GLU GLU A . n 
B 2 224 SER 224 225 225 SER SER A . n 
B 2 225 GLY 225 226 226 GLY GLY A . n 
B 2 226 TYR 226 227 227 TYR TYR A . n 
B 2 227 ARG 227 228 228 ARG ARG A . n 
B 2 228 ALA 228 229 229 ALA ALA A . n 
B 2 229 MET 229 230 230 MET MET A . n 
B 2 230 GLN 230 231 231 GLN GLN A . n 
B 2 231 GLN 231 232 232 GLN GLN A . n 
B 2 232 ILE 232 233 233 ILE ILE A . n 
B 2 233 LEU 233 234 234 LEU LEU A . n 
B 2 234 SER 234 235 235 SER SER A . n 
B 2 235 GLN 235 236 236 GLN GLN A . n 
B 2 236 PRO 236 237 237 PRO PRO A . n 
B 2 237 HIS 237 238 238 HIS HIS A . n 
B 2 238 ARG 238 239 239 ARG ARG A . n 
B 2 239 PRO 239 240 240 PRO PRO A . n 
B 2 240 THR 240 241 241 THR THR A . n 
B 2 241 ALA 241 242 242 ALA ALA A . n 
B 2 242 VAL 242 243 243 VAL VAL A . n 
B 2 243 PHE 243 244 244 PHE PHE A . n 
B 2 244 CYS 244 245 245 CYS CYS A . n 
B 2 245 GLY 245 246 246 GLY GLY A . n 
B 2 246 GLY 246 247 247 GLY GLY A . n 
B 2 247 ASP 247 248 248 ASP ASP A . n 
B 2 248 ILE 248 249 249 ILE ILE A . n 
B 2 249 MET 249 250 250 MET MET A . n 
B 2 250 ALA 250 251 251 ALA ALA A . n 
B 2 251 MET 251 252 252 MET MET A . n 
B 2 252 GLY 252 253 253 GLY GLY A . n 
B 2 253 ALA 253 254 254 ALA ALA A . n 
B 2 254 LEU 254 255 255 LEU LEU A . n 
B 2 255 CYS 255 256 256 CYS CYS A . n 
B 2 256 ALA 256 257 257 ALA ALA A . n 
B 2 257 ALA 257 258 258 ALA ALA A . n 
B 2 258 ASP 258 259 259 ASP ASP A . n 
B 2 259 GLU 259 260 260 GLU GLU A . n 
B 2 260 MET 260 261 261 MET MET A . n 
B 2 261 GLY 261 262 262 GLY GLY A . n 
B 2 262 LEU 262 263 263 LEU LEU A . n 
B 2 263 ARG 263 264 264 ARG ARG A . n 
B 2 264 VAL 264 265 265 VAL VAL A . n 
B 2 265 PRO 265 266 266 PRO PRO A . n 
B 2 266 GLN 266 267 267 GLN GLN A . n 
B 2 267 ASP 267 268 268 ASP ASP A . n 
B 2 268 VAL 268 269 269 VAL VAL A . n 
B 2 269 SER 269 270 270 SER SER A . n 
B 2 270 LEU 270 271 271 LEU LEU A . n 
B 2 271 ILE 271 272 272 ILE ILE A . n 
B 2 272 GLY 272 273 273 GLY GLY A . n 
B 2 273 TYR 273 274 274 TYR TYR A . n 
B 2 274 ASP 274 275 275 ASP ASP A . n 
B 2 275 ASN 275 276 276 ASN ASN A . n 
B 2 276 VAL 276 277 277 VAL VAL A . n 
B 2 277 ARG 277 278 278 ARG ARG A . n 
B 2 278 ASN 278 279 279 ASN ASN A . n 
B 2 279 ALA 279 280 280 ALA ALA A . n 
B 2 280 ARG 280 281 281 ARG ARG A . n 
B 2 281 TYR 281 282 282 TYR TYR A . n 
B 2 282 PHE 282 283 283 PHE PHE A . n 
B 2 283 THR 283 284 284 THR THR A . n 
B 2 284 PRO 284 285 285 PRO PRO A . n 
B 2 285 ALA 285 286 286 ALA ALA A . n 
B 2 286 LEU 286 287 287 LEU LEU A . n 
B 2 287 THR 287 288 288 THR THR A . n 
B 2 288 THR 288 289 289 THR THR A . n 
B 2 289 ILE 289 290 290 ILE ILE A . n 
B 2 290 HIS 290 291 291 HIS HIS A . n 
B 2 291 GLN 291 292 292 GLN GLN A . n 
B 2 292 PRO 292 293 293 PRO PRO A . n 
B 2 293 LYS 293 294 294 LYS LYS A . n 
B 2 294 ASP 294 295 295 ASP ASP A . n 
B 2 295 SER 295 296 296 SER SER A . n 
B 2 296 LEU 296 297 297 LEU LEU A . n 
B 2 297 GLY 297 298 298 GLY GLY A . n 
B 2 298 GLU 298 299 299 GLU GLU A . n 
B 2 299 THR 299 300 300 THR THR A . n 
B 2 300 ALA 300 301 301 ALA ALA A . n 
B 2 301 PHE 301 302 302 PHE PHE A . n 
B 2 302 ASN 302 303 303 ASN ASN A . n 
B 2 303 MET 303 304 304 MET MET A . n 
B 2 304 LEU 304 305 305 LEU LEU A . n 
B 2 305 LEU 305 306 306 LEU LEU A . n 
B 2 306 ASP 306 307 307 ASP ASP A . n 
B 2 307 ARG 307 308 308 ARG ARG A . n 
B 2 308 ILE 308 309 309 ILE ILE A . n 
B 2 309 VAL 309 310 310 VAL VAL A . n 
B 2 310 ASN 310 311 311 ASN ASN A . n 
B 2 311 LYS 311 312 312 LYS LYS A . n 
B 2 312 ARG 312 313 313 ARG ARG A . n 
B 2 313 GLU 313 314 314 GLU GLU A . n 
B 2 314 GLU 314 315 315 GLU GLU A . n 
B 2 315 PRO 315 316 316 PRO PRO A . n 
B 2 316 GLN 316 317 317 GLN GLN A . n 
B 2 317 SER 317 318 318 SER SER A . n 
B 2 318 ILE 318 319 319 ILE ILE A . n 
B 2 319 GLU 319 320 320 GLU GLU A . n 
B 2 320 VAL 320 321 321 VAL VAL A . n 
B 2 321 HIS 321 322 322 HIS HIS A . n 
B 2 322 PRO 322 323 323 PRO PRO A . n 
B 2 323 ARG 323 324 324 ARG ARG A . n 
B 2 324 LEU 324 325 325 LEU LEU A . n 
B 2 325 ILE 325 326 326 ILE ILE A . n 
B 2 326 GLU 326 327 327 GLU GLU A . n 
B 2 327 ARG 327 328 328 ARG ARG A . n 
B 2 328 ARG 328 329 329 ARG ARG A . n 
B 2 329 SER 329 330 330 SER SER A . n 
B 2 330 VAL 330 331 331 VAL VAL A . n 
B 2 331 ALA 331 332 332 ALA ALA A . n 
B 2 332 ASP 332 333 333 ASP ASP A . n 
B 2 333 GLY 333 334 334 GLY GLY A . n 
B 2 334 PRO 334 335 335 PRO PRO A . n 
B 2 335 PHE 335 336 336 PHE PHE A . n 
B 2 336 ARG 336 337 337 ARG ARG A . n 
B 2 337 ASP 337 338 338 ASP ASP A . n 
B 2 338 TYR 338 339 339 TYR TYR A . n 
B 2 339 ARG 339 340 340 ARG ARG A . n 
B 2 340 ARG 340 341 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 PO4 1   799 799 PO4 PO4 A . 
D 3 PO4 1   800 800 PO4 PO4 A . 
E 4 HPA 1   599 599 HPA HPA A . 
F 5 HOH 1   2   2   HOH HOH B . 
F 5 HOH 2   7   7   HOH HOH B . 
F 5 HOH 3   23  23  HOH HOH B . 
F 5 HOH 4   26  26  HOH HOH B . 
F 5 HOH 5   42  42  HOH HOH B . 
F 5 HOH 6   65  65  HOH HOH B . 
F 5 HOH 7   70  70  HOH HOH B . 
F 5 HOH 8   86  86  HOH HOH B . 
F 5 HOH 9   97  97  HOH HOH B . 
G 5 HOH 1   801 1   HOH HOH A . 
G 5 HOH 2   802 4   HOH HOH A . 
G 5 HOH 3   803 5   HOH HOH A . 
G 5 HOH 4   804 6   HOH HOH A . 
G 5 HOH 5   805 8   HOH HOH A . 
G 5 HOH 6   806 9   HOH HOH A . 
G 5 HOH 7   807 10  HOH HOH A . 
G 5 HOH 8   808 11  HOH HOH A . 
G 5 HOH 9   809 12  HOH HOH A . 
G 5 HOH 10  810 13  HOH HOH A . 
G 5 HOH 11  811 14  HOH HOH A . 
G 5 HOH 12  812 15  HOH HOH A . 
G 5 HOH 13  813 16  HOH HOH A . 
G 5 HOH 14  814 17  HOH HOH A . 
G 5 HOH 15  815 18  HOH HOH A . 
G 5 HOH 16  816 19  HOH HOH A . 
G 5 HOH 17  817 20  HOH HOH A . 
G 5 HOH 18  818 21  HOH HOH A . 
G 5 HOH 19  819 22  HOH HOH A . 
G 5 HOH 20  820 24  HOH HOH A . 
G 5 HOH 21  821 25  HOH HOH A . 
G 5 HOH 22  822 27  HOH HOH A . 
G 5 HOH 23  823 28  HOH HOH A . 
G 5 HOH 24  824 29  HOH HOH A . 
G 5 HOH 25  825 30  HOH HOH A . 
G 5 HOH 26  826 31  HOH HOH A . 
G 5 HOH 27  827 32  HOH HOH A . 
G 5 HOH 28  828 33  HOH HOH A . 
G 5 HOH 29  829 34  HOH HOH A . 
G 5 HOH 30  830 35  HOH HOH A . 
G 5 HOH 31  831 36  HOH HOH A . 
G 5 HOH 32  832 37  HOH HOH A . 
G 5 HOH 33  833 38  HOH HOH A . 
G 5 HOH 34  834 39  HOH HOH A . 
G 5 HOH 35  835 40  HOH HOH A . 
G 5 HOH 36  836 41  HOH HOH A . 
G 5 HOH 37  837 43  HOH HOH A . 
G 5 HOH 38  838 44  HOH HOH A . 
G 5 HOH 39  839 45  HOH HOH A . 
G 5 HOH 40  840 48  HOH HOH A . 
G 5 HOH 41  841 49  HOH HOH A . 
G 5 HOH 42  842 50  HOH HOH A . 
G 5 HOH 43  843 51  HOH HOH A . 
G 5 HOH 44  844 52  HOH HOH A . 
G 5 HOH 45  845 53  HOH HOH A . 
G 5 HOH 46  846 54  HOH HOH A . 
G 5 HOH 47  847 55  HOH HOH A . 
G 5 HOH 48  848 56  HOH HOH A . 
G 5 HOH 49  849 57  HOH HOH A . 
G 5 HOH 50  850 58  HOH HOH A . 
G 5 HOH 51  851 59  HOH HOH A . 
G 5 HOH 52  852 60  HOH HOH A . 
G 5 HOH 53  853 61  HOH HOH A . 
G 5 HOH 54  854 62  HOH HOH A . 
G 5 HOH 55  855 63  HOH HOH A . 
G 5 HOH 56  856 64  HOH HOH A . 
G 5 HOH 57  857 66  HOH HOH A . 
G 5 HOH 58  858 67  HOH HOH A . 
G 5 HOH 59  859 68  HOH HOH A . 
G 5 HOH 60  860 69  HOH HOH A . 
G 5 HOH 61  861 71  HOH HOH A . 
G 5 HOH 62  862 72  HOH HOH A . 
G 5 HOH 63  863 73  HOH HOH A . 
G 5 HOH 64  864 74  HOH HOH A . 
G 5 HOH 65  865 75  HOH HOH A . 
G 5 HOH 66  866 76  HOH HOH A . 
G 5 HOH 67  867 77  HOH HOH A . 
G 5 HOH 68  868 79  HOH HOH A . 
G 5 HOH 69  869 80  HOH HOH A . 
G 5 HOH 70  870 81  HOH HOH A . 
G 5 HOH 71  871 82  HOH HOH A . 
G 5 HOH 72  872 83  HOH HOH A . 
G 5 HOH 73  873 84  HOH HOH A . 
G 5 HOH 74  874 87  HOH HOH A . 
G 5 HOH 75  875 88  HOH HOH A . 
G 5 HOH 76  876 89  HOH HOH A . 
G 5 HOH 77  877 90  HOH HOH A . 
G 5 HOH 78  878 91  HOH HOH A . 
G 5 HOH 79  879 92  HOH HOH A . 
G 5 HOH 80  880 94  HOH HOH A . 
G 5 HOH 81  881 95  HOH HOH A . 
G 5 HOH 82  882 96  HOH HOH A . 
G 5 HOH 83  883 98  HOH HOH A . 
G 5 HOH 84  884 99  HOH HOH A . 
G 5 HOH 85  885 100 HOH HOH A . 
G 5 HOH 86  886 101 HOH HOH A . 
G 5 HOH 87  887 102 HOH HOH A . 
G 5 HOH 88  888 103 HOH HOH A . 
G 5 HOH 89  889 104 HOH HOH A . 
G 5 HOH 90  890 105 HOH HOH A . 
G 5 HOH 91  891 106 HOH HOH A . 
G 5 HOH 92  892 107 HOH HOH A . 
G 5 HOH 93  893 108 HOH HOH A . 
G 5 HOH 94  894 109 HOH HOH A . 
G 5 HOH 95  895 110 HOH HOH A . 
G 5 HOH 96  896 112 HOH HOH A . 
G 5 HOH 97  897 113 HOH HOH A . 
G 5 HOH 98  898 114 HOH HOH A . 
G 5 HOH 99  899 115 HOH HOH A . 
G 5 HOH 100 900 116 HOH HOH A . 
G 5 HOH 101 901 117 HOH HOH A . 
G 5 HOH 102 902 118 HOH HOH A . 
G 5 HOH 103 903 119 HOH HOH A . 
G 5 HOH 104 904 120 HOH HOH A . 
G 5 HOH 105 905 121 HOH HOH A . 
G 5 HOH 106 906 122 HOH HOH A . 
G 5 HOH 107 907 123 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-02-08 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_ref_seq_dif 
3 4 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_ref_seq_dif.details'         
4 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
5 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
6 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
TNT    refinement       .         ? 1 
MOSFLM 'data reduction' .         ? 2 
CCP4   'data scaling'   '(SCALA)' ? 3 
TNT    phasing          .         ? 4 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     847 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     847 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_555 
_pdbx_validate_symm_contact.dist              2.12 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "C3'" B DA  704 ? ? "C2'" B DA  704 ? ? "C1'" B DA  704 ? ? 97.14  102.40 -5.26  0.80 N 
2 1 "O4'" B DA  704 ? ? "C1'" B DA  704 ? ? N9    B DA  704 ? ? 111.56 108.30 3.26   0.30 N 
3 1 CG1   A ILE 216 ? ? CB    A ILE 216 ? ? CG2   A ILE 216 ? ? 92.61  111.40 -18.79 2.20 N 
4 1 CB    A ASP 220 ? ? CG    A ASP 220 ? ? OD1   A ASP 220 ? ? 124.08 118.30 5.78   0.90 N 
5 1 NE    A ARG 340 ? ? CZ    A ARG 340 ? ? NH2   A ARG 340 ? ? 124.01 120.30 3.71   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 58  ? ? 179.96  153.06  
2  1 ALA A 66  ? ? -69.00  -166.45 
3  1 THR A 67  ? ? -121.78 -56.67  
4  1 LYS A 88  ? ? -96.78  35.35   
5  1 SER A 124 ? ? 72.11   -55.84  
6  1 GLU A 149 ? ? -107.93 -123.67 
7  1 ASP A 153 ? ? -169.74 -5.00   
8  1 ARG A 179 ? ? -149.42 -10.56  
9  1 LEU A 188 ? ? -68.35  1.26    
10 1 ASP A 275 ? ? 121.49  -44.97  
11 1 ASN A 276 ? ? 66.10   60.14   
12 1 ILE A 309 ? ? -71.18  -75.07  
13 1 VAL A 310 ? ? -56.17  -70.75  
14 1 ASN A 311 ? ? -65.79  8.54    
15 1 LYS A 312 ? ? 42.62   26.40   
16 1 ARG A 313 ? ? -48.91  156.97  
17 1 ARG A 328 ? ? -114.75 -121.82 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     ARG 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      341 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    B 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    ARG 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     340 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1JH9 'double helix'        
1JH9 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 2  1_555 A DT 17 4_555 -0.389 0.275  0.424  -2.838  -3.745  17.506 1  B_DA700:DT715_B B 700 ? B 715 ? ?  1 
1 A DC 3  1_555 A DG 16 4_555 0.417  -0.447 0.553  -3.434  -6.267  -1.957 2  B_DC701:DG714_B B 701 ? B 714 ? 19 1 
1 A DG 4  1_555 A DC 15 4_555 0.895  -0.436 0.339  2.792   -8.104  -3.117 3  B_DG702:DC713_B B 702 ? B 713 ? 19 1 
1 A DA 5  1_555 A DT 14 4_555 -0.129 -0.358 -0.065 -4.526  -20.630 -0.105 4  B_DA703:DT712_B B 703 ? B 712 ? 20 1 
1 A DA 6  1_555 A DT 13 4_555 -0.123 0.001  -0.214 -0.903  -0.782  1.383  5  B_DA704:DT711_B B 704 ? B 711 ? 20 1 
1 A DA 7  1_555 A DT 12 4_555 0.825  -0.151 0.055  6.218   -10.056 6.762  6  B_DA705:DT710_B B 705 ? B 710 ? 20 1 
1 A DA 8  1_555 A DT 11 4_555 1.099  -0.439 0.250  11.441  -22.339 7.155  7  B_DA706:DT709_B B 706 ? B 709 ? 20 1 
1 A DC 9  1_555 A DG 10 4_555 -0.861 -0.373 -0.503 15.803  -9.045  -2.121 8  B_DC707:DG708_B B 707 ? B 708 ? 19 1 
1 A DG 10 1_555 A DC 9  4_555 0.861  -0.373 -0.503 -15.803 -9.045  -2.121 9  B_DG708:DC707_B B 708 ? B 707 ? 19 1 
1 A DT 11 1_555 A DA 8  4_555 -1.099 -0.439 0.250  -11.441 -22.339 7.155  10 B_DT709:DA706_B B 709 ? B 706 ? 20 1 
1 A DT 12 1_555 A DA 7  4_555 -0.825 -0.151 0.055  -6.218  -10.056 6.762  11 B_DT710:DA705_B B 710 ? B 705 ? 20 1 
1 A DT 13 1_555 A DA 6  4_555 0.123  0.001  -0.214 0.903   -0.782  1.383  12 B_DT711:DA704_B B 711 ? B 704 ? 20 1 
1 A DT 14 1_555 A DA 5  4_555 0.129  -0.358 -0.065 4.526   -20.630 -0.105 13 B_DT712:DA703_B B 712 ? B 703 ? 20 1 
1 A DC 15 1_555 A DG 4  4_555 -0.895 -0.436 0.339  -2.792  -8.104  -3.117 14 B_DC713:DG702_B B 713 ? B 702 ? 19 1 
1 A DG 16 1_555 A DC 3  4_555 -0.417 -0.447 0.553  3.434   -6.267  -1.957 15 B_DG714:DC701_B B 714 ? B 701 ? 19 1 
1 A DT 17 1_555 A DA 2  4_555 0.389  0.275  0.424  2.838   -3.745  17.506 16 B_DT715:DA700_B B 715 ? B 700 ? ?  1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 2  1_555 A DT 17 4_555 A DC 3  1_555 A DG 16 4_555 -0.280 -0.710 3.350 -4.243 3.605  34.420 -1.742 -0.189 3.272 6.043   
7.113   34.854 1  BB_DA700DC701:DG714DT715_BB B 700 ? B 715 ? B 701 ? B 714 ? 
1 A DC 3  1_555 A DG 16 4_555 A DG 4  1_555 A DC 15 4_555 -1.393 -0.823 3.131 -1.415 -7.977 36.302 -0.236 1.999  3.283 -12.611 
2.237   37.165 2  BB_DC701DG702:DC713DG714_BB B 701 ? B 714 ? B 702 ? B 713 ? 
1 A DG 4  1_555 A DC 15 4_555 A DA 5  1_555 A DT 14 4_555 -0.939 0.184  3.519 3.393  -0.966 33.848 0.478  2.179  3.405 -1.653  
-5.808  34.026 3  BB_DG702DA703:DT712DC713_BB B 702 ? B 713 ? B 703 ? B 712 ? 
1 A DA 5  1_555 A DT 14 4_555 A DA 6  1_555 A DT 13 4_555 0.951  0.519  3.236 -0.442 1.491  31.041 0.686  -1.859 3.243 2.783   
0.825   31.079 4  BB_DA703DA704:DT711DT712_BB B 703 ? B 712 ? B 704 ? B 711 ? 
1 A DA 6  1_555 A DT 13 4_555 A DA 7  1_555 A DT 12 4_555 -0.511 0.687  3.200 -1.871 -0.579 42.975 0.993  0.516  3.210 -0.790  
2.552   43.017 5  BB_DA704DA705:DT710DT711_BB B 704 ? B 711 ? B 705 ? B 710 ? 
1 A DA 7  1_555 A DT 12 4_555 A DA 8  1_555 A DT 11 4_555 0.677  -0.190 3.223 -3.146 5.551  36.668 -1.016 -1.468 3.096 8.742   
4.955   37.200 6  BB_DA705DA706:DT709DT710_BB B 705 ? B 710 ? B 706 ? B 709 ? 
1 A DA 8  1_555 A DT 11 4_555 A DC 9  1_555 A DG 10 4_555 -0.996 -0.213 3.368 6.212  -0.509 21.785 -0.359 4.766  2.976 -1.313  
-16.019 22.649 7  BB_DA706DC707:DG708DT709_BB B 706 ? B 709 ? B 707 ? B 708 ? 
1 A DC 9  1_555 A DG 10 4_555 A DG 10 1_555 A DC 9  4_555 0.000  1.824  5.052 0.000  53.257 21.662 -4.105 0.000  3.661 69.454  
0.000   57.195 8  BB_DC707DG708:DC707DG708_BB B 707 ? B 708 ? B 708 ? B 707 ? 
1 A DG 10 1_555 A DC 9  4_555 A DT 11 1_555 A DA 8  4_555 0.996  -0.213 3.368 -6.212 -0.509 21.785 -0.359 -4.766 2.976 -1.313  
16.019  22.649 9  BB_DG708DT709:DA706DC707_BB B 708 ? B 707 ? B 709 ? B 706 ? 
1 A DT 11 1_555 A DA 8  4_555 A DT 12 1_555 A DA 7  4_555 -0.677 -0.190 3.223 3.146  5.551  36.668 -1.016 1.468  3.096 8.742   
-4.955  37.200 10 BB_DT709DT710:DA705DA706_BB B 709 ? B 706 ? B 710 ? B 705 ? 
1 A DT 12 1_555 A DA 7  4_555 A DT 13 1_555 A DA 6  4_555 0.511  0.687  3.200 1.871  -0.579 42.975 0.993  -0.516 3.210 -0.790  
-2.552  43.017 11 BB_DT710DT711:DA704DA705_BB B 710 ? B 705 ? B 711 ? B 704 ? 
1 A DT 13 1_555 A DA 6  4_555 A DT 14 1_555 A DA 5  4_555 -0.951 0.519  3.236 0.442  1.491  31.041 0.686  1.859  3.243 2.783   
-0.825  31.079 12 BB_DT711DT712:DA703DA704_BB B 711 ? B 704 ? B 712 ? B 703 ? 
1 A DT 14 1_555 A DA 5  4_555 A DC 15 1_555 A DG 4  4_555 0.939  0.184  3.519 -3.393 -0.966 33.848 0.478  -2.179 3.405 -1.653  
5.808   34.026 13 BB_DT712DC713:DG702DA703_BB B 712 ? B 703 ? B 713 ? B 702 ? 
1 A DC 15 1_555 A DG 4  4_555 A DG 16 1_555 A DC 3  4_555 1.393  -0.823 3.131 1.415  -7.977 36.302 -0.236 -1.999 3.283 -12.611 
-2.237  37.165 14 BB_DC713DG714:DC701DG702_BB B 713 ? B 702 ? B 714 ? B 701 ? 
1 A DG 16 1_555 A DC 3  4_555 A DT 17 1_555 A DA 2  4_555 0.280  -0.710 3.350 4.243  3.605  34.420 -1.742 0.189  3.272 6.043   
-7.113  34.854 15 BB_DG714DT715:DA700DC701_BB B 714 ? B 701 ? B 715 ? B 700 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'PHOSPHATE ION' PO4 
4 HYPOXANTHINE    HPA 
5 water           HOH 
#