data_1JIQ
# 
_entry.id   1JIQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JIQ         
RCSB  RCSB013817   
WWPDB D_1000013817 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JIQ 
_pdbx_database_status.recvd_initial_deposition_date   2001-07-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tanaka, N.'     1 
'Haga, A.'       2 
'Uemura, H.'     3 
'Akiyama, H.'    4 
'Funasaka, T.'   5 
'Nagase, H.'     6 
'Raz, A.'        7 
'Nakamura, K.T.' 8 
# 
_citation.id                        primary 
_citation.title                     
;Inhibition mechanism of cytokine activity of human autocrine motility factor examined by crystal structure analyses and site-directed mutagenesis studies.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            318 
_citation.page_first                985 
_citation.page_last                 997 
_citation.year                      2002 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12054796 
_citation.pdbx_database_id_DOI      '10.1016/S0022-2836(02)00186-9' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tanaka, N.'     1 
primary 'Haga, A.'       2 
primary 'Uemura, H.'     3 
primary 'Akiyama, H.'    4 
primary 'Funasaka, T.'   5 
primary 'Nagase, H.'     6 
primary 'Raz, A.'        7 
primary 'Nakamura, K.T.' 8 
# 
_cell.entry_id           1JIQ 
_cell.length_a           80.77 
_cell.length_b           107.4 
_cell.length_c           270.7 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JIQ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'autocrine motility factor' 63229.949 4    5.3.1.9 ? ? ? 
2 water   nat water                       18.015    1475 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'glucose phosphate isomerase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAA
RERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGS
DLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVA
KHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLL
ALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK
MIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFT
KLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAA
RERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGS
DLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVA
KHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLL
ALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTK
MIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFT
KLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ALA n 
1 4   LEU n 
1 5   THR n 
1 6   ARG n 
1 7   ASP n 
1 8   PRO n 
1 9   GLN n 
1 10  PHE n 
1 11  GLN n 
1 12  LYS n 
1 13  LEU n 
1 14  GLN n 
1 15  GLN n 
1 16  TRP n 
1 17  TYR n 
1 18  ARG n 
1 19  GLU n 
1 20  HIS n 
1 21  ARG n 
1 22  SER n 
1 23  GLU n 
1 24  LEU n 
1 25  ASN n 
1 26  LEU n 
1 27  ARG n 
1 28  ARG n 
1 29  LEU n 
1 30  PHE n 
1 31  ASP n 
1 32  ALA n 
1 33  ASN n 
1 34  LYS n 
1 35  ASP n 
1 36  ARG n 
1 37  PHE n 
1 38  ASN n 
1 39  HIS n 
1 40  PHE n 
1 41  SER n 
1 42  LEU n 
1 43  THR n 
1 44  LEU n 
1 45  ASN n 
1 46  THR n 
1 47  ASN n 
1 48  HIS n 
1 49  GLY n 
1 50  HIS n 
1 51  ILE n 
1 52  LEU n 
1 53  VAL n 
1 54  ASP n 
1 55  TYR n 
1 56  SER n 
1 57  LYS n 
1 58  ASN n 
1 59  LEU n 
1 60  VAL n 
1 61  THR n 
1 62  GLU n 
1 63  ASP n 
1 64  VAL n 
1 65  MET n 
1 66  ARG n 
1 67  MET n 
1 68  LEU n 
1 69  VAL n 
1 70  ASP n 
1 71  LEU n 
1 72  ALA n 
1 73  LYS n 
1 74  SER n 
1 75  ARG n 
1 76  GLY n 
1 77  VAL n 
1 78  GLU n 
1 79  ALA n 
1 80  ALA n 
1 81  ARG n 
1 82  GLU n 
1 83  ARG n 
1 84  MET n 
1 85  PHE n 
1 86  ASN n 
1 87  GLY n 
1 88  GLU n 
1 89  LYS n 
1 90  ILE n 
1 91  ASN n 
1 92  TYR n 
1 93  THR n 
1 94  GLU n 
1 95  GLY n 
1 96  ARG n 
1 97  ALA n 
1 98  VAL n 
1 99  LEU n 
1 100 HIS n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 ARG n 
1 105 ASN n 
1 106 ARG n 
1 107 SER n 
1 108 ASN n 
1 109 THR n 
1 110 PRO n 
1 111 ILE n 
1 112 LEU n 
1 113 VAL n 
1 114 ASP n 
1 115 GLY n 
1 116 LYS n 
1 117 ASP n 
1 118 VAL n 
1 119 MET n 
1 120 PRO n 
1 121 GLU n 
1 122 VAL n 
1 123 ASN n 
1 124 LYS n 
1 125 VAL n 
1 126 LEU n 
1 127 ASP n 
1 128 LYS n 
1 129 MET n 
1 130 LYS n 
1 131 SER n 
1 132 PHE n 
1 133 CYS n 
1 134 GLN n 
1 135 ARG n 
1 136 VAL n 
1 137 ARG n 
1 138 SER n 
1 139 GLY n 
1 140 ASP n 
1 141 TRP n 
1 142 LYS n 
1 143 GLY n 
1 144 TYR n 
1 145 THR n 
1 146 GLY n 
1 147 LYS n 
1 148 THR n 
1 149 ILE n 
1 150 THR n 
1 151 ASP n 
1 152 VAL n 
1 153 ILE n 
1 154 ASN n 
1 155 ILE n 
1 156 GLY n 
1 157 ILE n 
1 158 GLY n 
1 159 GLY n 
1 160 SER n 
1 161 ASP n 
1 162 LEU n 
1 163 GLY n 
1 164 PRO n 
1 165 LEU n 
1 166 MET n 
1 167 VAL n 
1 168 THR n 
1 169 GLU n 
1 170 ALA n 
1 171 LEU n 
1 172 LYS n 
1 173 PRO n 
1 174 TYR n 
1 175 SER n 
1 176 SER n 
1 177 GLY n 
1 178 GLY n 
1 179 PRO n 
1 180 ARG n 
1 181 VAL n 
1 182 TRP n 
1 183 TYR n 
1 184 VAL n 
1 185 SER n 
1 186 ASN n 
1 187 ILE n 
1 188 ASP n 
1 189 GLY n 
1 190 THR n 
1 191 HIS n 
1 192 ILE n 
1 193 ALA n 
1 194 LYS n 
1 195 THR n 
1 196 LEU n 
1 197 ALA n 
1 198 GLN n 
1 199 LEU n 
1 200 ASN n 
1 201 PRO n 
1 202 GLU n 
1 203 SER n 
1 204 SER n 
1 205 LEU n 
1 206 PHE n 
1 207 ILE n 
1 208 ILE n 
1 209 ALA n 
1 210 SER n 
1 211 LYS n 
1 212 THR n 
1 213 PHE n 
1 214 THR n 
1 215 THR n 
1 216 GLN n 
1 217 GLU n 
1 218 THR n 
1 219 ILE n 
1 220 THR n 
1 221 ASN n 
1 222 ALA n 
1 223 GLU n 
1 224 THR n 
1 225 ALA n 
1 226 LYS n 
1 227 GLU n 
1 228 TRP n 
1 229 PHE n 
1 230 LEU n 
1 231 GLN n 
1 232 ALA n 
1 233 ALA n 
1 234 LYS n 
1 235 ASP n 
1 236 PRO n 
1 237 SER n 
1 238 ALA n 
1 239 VAL n 
1 240 ALA n 
1 241 LYS n 
1 242 HIS n 
1 243 PHE n 
1 244 VAL n 
1 245 ALA n 
1 246 LEU n 
1 247 SER n 
1 248 THR n 
1 249 ASN n 
1 250 THR n 
1 251 THR n 
1 252 LYS n 
1 253 VAL n 
1 254 LYS n 
1 255 GLU n 
1 256 PHE n 
1 257 GLY n 
1 258 ILE n 
1 259 ASP n 
1 260 PRO n 
1 261 GLN n 
1 262 ASN n 
1 263 MET n 
1 264 PHE n 
1 265 GLU n 
1 266 PHE n 
1 267 TRP n 
1 268 ASP n 
1 269 TRP n 
1 270 VAL n 
1 271 GLY n 
1 272 GLY n 
1 273 ARG n 
1 274 TYR n 
1 275 SER n 
1 276 LEU n 
1 277 TRP n 
1 278 SER n 
1 279 ALA n 
1 280 ILE n 
1 281 GLY n 
1 282 LEU n 
1 283 SER n 
1 284 ILE n 
1 285 ALA n 
1 286 LEU n 
1 287 HIS n 
1 288 VAL n 
1 289 GLY n 
1 290 PHE n 
1 291 ASP n 
1 292 ASN n 
1 293 PHE n 
1 294 GLU n 
1 295 GLN n 
1 296 LEU n 
1 297 LEU n 
1 298 SER n 
1 299 GLY n 
1 300 ALA n 
1 301 HIS n 
1 302 TRP n 
1 303 MET n 
1 304 ASP n 
1 305 GLN n 
1 306 HIS n 
1 307 PHE n 
1 308 ARG n 
1 309 THR n 
1 310 THR n 
1 311 PRO n 
1 312 LEU n 
1 313 GLU n 
1 314 LYS n 
1 315 ASN n 
1 316 ALA n 
1 317 PRO n 
1 318 VAL n 
1 319 LEU n 
1 320 LEU n 
1 321 ALA n 
1 322 LEU n 
1 323 LEU n 
1 324 GLY n 
1 325 ILE n 
1 326 TRP n 
1 327 TYR n 
1 328 ILE n 
1 329 ASN n 
1 330 CYS n 
1 331 PHE n 
1 332 GLY n 
1 333 CYS n 
1 334 GLU n 
1 335 THR n 
1 336 HIS n 
1 337 ALA n 
1 338 MET n 
1 339 LEU n 
1 340 PRO n 
1 341 TYR n 
1 342 ASP n 
1 343 GLN n 
1 344 TYR n 
1 345 LEU n 
1 346 HIS n 
1 347 ARG n 
1 348 PHE n 
1 349 ALA n 
1 350 ALA n 
1 351 TYR n 
1 352 PHE n 
1 353 GLN n 
1 354 GLN n 
1 355 GLY n 
1 356 ASP n 
1 357 MET n 
1 358 GLU n 
1 359 SER n 
1 360 ASN n 
1 361 GLY n 
1 362 LYS n 
1 363 TYR n 
1 364 ILE n 
1 365 THR n 
1 366 LYS n 
1 367 SER n 
1 368 GLY n 
1 369 THR n 
1 370 ARG n 
1 371 VAL n 
1 372 ASP n 
1 373 HIS n 
1 374 GLN n 
1 375 THR n 
1 376 GLY n 
1 377 PRO n 
1 378 ILE n 
1 379 VAL n 
1 380 TRP n 
1 381 GLY n 
1 382 GLU n 
1 383 PRO n 
1 384 GLY n 
1 385 THR n 
1 386 ASN n 
1 387 GLY n 
1 388 GLN n 
1 389 HIS n 
1 390 ALA n 
1 391 PHE n 
1 392 TYR n 
1 393 GLN n 
1 394 LEU n 
1 395 ILE n 
1 396 HIS n 
1 397 GLN n 
1 398 GLY n 
1 399 THR n 
1 400 LYS n 
1 401 MET n 
1 402 ILE n 
1 403 PRO n 
1 404 CYS n 
1 405 ASP n 
1 406 PHE n 
1 407 LEU n 
1 408 ILE n 
1 409 PRO n 
1 410 VAL n 
1 411 GLN n 
1 412 THR n 
1 413 GLN n 
1 414 HIS n 
1 415 PRO n 
1 416 ILE n 
1 417 ARG n 
1 418 LYS n 
1 419 GLY n 
1 420 LEU n 
1 421 HIS n 
1 422 HIS n 
1 423 LYS n 
1 424 ILE n 
1 425 LEU n 
1 426 LEU n 
1 427 ALA n 
1 428 ASN n 
1 429 PHE n 
1 430 LEU n 
1 431 ALA n 
1 432 GLN n 
1 433 THR n 
1 434 GLU n 
1 435 ALA n 
1 436 LEU n 
1 437 MET n 
1 438 ARG n 
1 439 GLY n 
1 440 LYS n 
1 441 SER n 
1 442 THR n 
1 443 GLU n 
1 444 GLU n 
1 445 ALA n 
1 446 ARG n 
1 447 LYS n 
1 448 GLU n 
1 449 LEU n 
1 450 GLN n 
1 451 ALA n 
1 452 ALA n 
1 453 GLY n 
1 454 LYS n 
1 455 SER n 
1 456 PRO n 
1 457 GLU n 
1 458 ASP n 
1 459 LEU n 
1 460 GLU n 
1 461 ARG n 
1 462 LEU n 
1 463 LEU n 
1 464 PRO n 
1 465 HIS n 
1 466 LYS n 
1 467 VAL n 
1 468 PHE n 
1 469 GLU n 
1 470 GLY n 
1 471 ASN n 
1 472 ARG n 
1 473 PRO n 
1 474 THR n 
1 475 ASN n 
1 476 SER n 
1 477 ILE n 
1 478 VAL n 
1 479 PHE n 
1 480 THR n 
1 481 LYS n 
1 482 LEU n 
1 483 THR n 
1 484 PRO n 
1 485 PHE n 
1 486 MET n 
1 487 LEU n 
1 488 GLY n 
1 489 ALA n 
1 490 LEU n 
1 491 VAL n 
1 492 ALA n 
1 493 MET n 
1 494 TYR n 
1 495 GLU n 
1 496 HIS n 
1 497 LYS n 
1 498 ILE n 
1 499 PHE n 
1 500 VAL n 
1 501 GLN n 
1 502 GLY n 
1 503 ILE n 
1 504 ILE n 
1 505 TRP n 
1 506 ASP n 
1 507 ILE n 
1 508 ASN n 
1 509 SER n 
1 510 PHE n 
1 511 ASP n 
1 512 GLN n 
1 513 TRP n 
1 514 GLY n 
1 515 VAL n 
1 516 GLU n 
1 517 LEU n 
1 518 GLY n 
1 519 LYS n 
1 520 GLN n 
1 521 LEU n 
1 522 ALA n 
1 523 LYS n 
1 524 LYS n 
1 525 ILE n 
1 526 GLU n 
1 527 PRO n 
1 528 GLU n 
1 529 LEU n 
1 530 ASP n 
1 531 GLY n 
1 532 SER n 
1 533 ALA n 
1 534 GLN n 
1 535 VAL n 
1 536 THR n 
1 537 SER n 
1 538 HIS n 
1 539 ASP n 
1 540 ALA n 
1 541 SER n 
1 542 THR n 
1 543 ASN n 
1 544 GLY n 
1 545 LEU n 
1 546 ILE n 
1 547 ASN n 
1 548 PHE n 
1 549 ILE n 
1 550 LYS n 
1 551 GLN n 
1 552 GLN n 
1 553 ARG n 
1 554 GLU n 
1 555 ALA n 
1 556 ARG n 
1 557 VAL n 
1 558 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-6P 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    G6PI_HUMAN 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P06744 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1JIQ A 1 ? 558 ? P06744 1 ? 558 ? 1 558 
2 1 1JIQ B 1 ? 558 ? P06744 1 ? 558 ? 1 558 
3 1 1JIQ C 1 ? 558 ? P06744 1 ? 558 ? 1 558 
4 1 1JIQ D 1 ? 558 ? P06744 1 ? 558 ? 1 558 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1JIQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.32 
_exptl_crystal.density_percent_sol   46.99 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'cacodylate, sodium acetate, PEG8000, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2000-11-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI 111' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-18B' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-18B 
_diffrn_source.pdbx_wavelength             1.00 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1JIQ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.000 
_reflns.d_resolution_high            1.900 
_reflns.number_obs                   183404 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            0.1080000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        4.6000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.400 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              2.00 
_reflns_shell.percent_possible_all   92.1 
_reflns_shell.Rmerge_I_obs           0.3050000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.400 
_reflns_shell.pdbx_redundancy        4.40 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1JIQ 
_refine.ls_number_reflns_obs                     174100 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             36.00 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    98.69 
_refine.ls_R_factor_obs                          0.1690000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1674700 
_refine.ls_R_factor_R_free                       0.1979100 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  9195 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.940 
_refine.B_iso_mean                               15.102 
_refine.aniso_B[1][1]                            0.36 
_refine.aniso_B[2][2]                            0.68 
_refine.aniso_B[3][3]                            -1.04 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1DQR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.145 
_refine.pdbx_overall_ESU_R_Free                  0.128 
_refine.overall_SU_ML                            0.125 
_refine.overall_SU_B                             4.203 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        17780 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             1475 
_refine_hist.number_atoms_total               19255 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        36.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.010  0.021  ? 18216 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.001  0.020  ? 16316 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.321  1.931  ? 24660 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.759  3.000  ? 38000 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   4.131  3.000  ? 2224  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   17.320 15.000 ? 3297  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.086  0.200  ? 2680  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 20268 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.002  0.020  ? 3760  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.228  0.300  ? 4209  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.196  0.300  ? 16429 'X-RAY DIFFRACTION' ? 
r_nbtor_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.137  0.500  ? 1395  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      0.151  0.500  ? 10    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.284  0.300  ? 14    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.174  0.300  ? 37    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.209  0.500  ? 33    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.590  1.500  ? 11064 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.089  2.000  ? 17832 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.747  3.000  ? 7152  'X-RAY DIFFRACTION' ? 
r_scangle_it             2.866  4.500  ? 6828  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.900 
_refine_ls_shell.d_res_low                        1.949 
_refine_ls_shell.number_reflns_R_work             11476 
_refine_ls_shell.R_factor_R_work                  0.2060000 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2440000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             593 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1JIQ 
_struct.title                     'Crystal Structure of Human Autocrine Motility Factor' 
_struct.pdbx_descriptor           'glucose phosphate isomerase (E.C.5.3.1.9)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JIQ 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            'cytokine, Autocrine Motility Factor, ISOMERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 
;The biological assembly is a dimer. 
Two dimers exist in an asymmetric unit.
;
? 
2 ?                                                                              ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ALA A 2   ? ASP A 7   ? ALA A 2   ASP A 7   1 ? 6  
HELX_P HELX_P2   2   ASP A 7   ? ARG A 21  ? ASP A 7   ARG A 21  1 ? 15 
HELX_P HELX_P3   3   SER A 22  ? LEU A 24  ? SER A 22  LEU A 24  5 ? 3  
HELX_P HELX_P4   4   ASN A 25  ? ASN A 33  ? ASN A 25  ASN A 33  1 ? 9  
HELX_P HELX_P5   5   ASP A 35  ? PHE A 40  ? ASP A 35  PHE A 40  1 ? 6  
HELX_P HELX_P6   6   THR A 61  ? ARG A 75  ? THR A 61  ARG A 75  1 ? 15 
HELX_P HELX_P7   7   GLY A 76  ? ASN A 86  ? GLY A 76  ASN A 86  1 ? 11 
HELX_P HELX_P8   8   LEU A 99  ? ARG A 104 ? LEU A 99  ARG A 104 1 ? 6  
HELX_P HELX_P9   9   VAL A 118 ? SER A 138 ? VAL A 118 SER A 138 1 ? 21 
HELX_P HELX_P10  10  ILE A 157 ? SER A 160 ? ILE A 157 SER A 160 5 ? 4  
HELX_P HELX_P11  11  ASP A 161 ? LEU A 171 ? ASP A 161 LEU A 171 1 ? 11 
HELX_P HELX_P12  12  LYS A 172 ? SER A 175 ? LYS A 172 SER A 175 5 ? 4  
HELX_P HELX_P13  13  ASP A 188 ? ALA A 197 ? ASP A 188 ALA A 197 1 ? 10 
HELX_P HELX_P14  14  GLN A 198 ? LEU A 199 ? GLN A 198 LEU A 199 5 ? 2  
HELX_P HELX_P15  15  ASN A 200 ? GLU A 202 ? ASN A 200 GLU A 202 5 ? 3  
HELX_P HELX_P16  16  THR A 215 ? LYS A 234 ? THR A 215 LYS A 234 1 ? 20 
HELX_P HELX_P17  17  ASP A 235 ? SER A 237 ? ASP A 235 SER A 237 5 ? 3  
HELX_P HELX_P18  18  ALA A 238 ? HIS A 242 ? ALA A 238 HIS A 242 1 ? 5  
HELX_P HELX_P19  19  ASN A 249 ? GLY A 257 ? ASN A 249 GLY A 257 1 ? 9  
HELX_P HELX_P20  20  ASP A 259 ? ASN A 262 ? ASP A 259 ASN A 262 5 ? 4  
HELX_P HELX_P21  21  GLY A 271 ? SER A 275 ? GLY A 271 SER A 275 5 ? 5  
HELX_P HELX_P22  22  SER A 278 ? ILE A 280 ? SER A 278 ILE A 280 5 ? 3  
HELX_P HELX_P23  23  GLY A 281 ? GLY A 289 ? GLY A 281 GLY A 289 1 ? 9  
HELX_P HELX_P24  24  GLY A 289 ? THR A 310 ? GLY A 289 THR A 310 1 ? 22 
HELX_P HELX_P25  25  PRO A 311 ? LYS A 314 ? PRO A 311 LYS A 314 5 ? 4  
HELX_P HELX_P26  26  ASN A 315 ? CYS A 330 ? ASN A 315 CYS A 330 1 ? 16 
HELX_P HELX_P27  27  ASP A 342 ? HIS A 346 ? ASP A 342 HIS A 346 5 ? 5  
HELX_P HELX_P28  28  ARG A 347 ? GLY A 361 ? ARG A 347 GLY A 361 1 ? 15 
HELX_P HELX_P29  29  ASN A 386 ? ALA A 390 ? ASN A 386 ALA A 390 5 ? 5  
HELX_P HELX_P30  30  PHE A 391 ? GLY A 398 ? PHE A 391 GLY A 398 1 ? 8  
HELX_P HELX_P31  31  ILE A 416 ? LYS A 418 ? ILE A 416 LYS A 418 5 ? 3  
HELX_P HELX_P32  32  GLY A 419 ? GLY A 439 ? GLY A 419 GLY A 439 1 ? 21 
HELX_P HELX_P33  33  SER A 441 ? ALA A 452 ? SER A 441 ALA A 452 1 ? 12 
HELX_P HELX_P34  34  SER A 455 ? LEU A 463 ? SER A 455 LEU A 463 1 ? 9  
HELX_P HELX_P35  35  PRO A 464 ? VAL A 467 ? PRO A 464 VAL A 467 5 ? 4  
HELX_P HELX_P36  36  THR A 483 ? ASP A 506 ? THR A 483 ASP A 506 1 ? 24 
HELX_P HELX_P37  37  GLN A 512 ? GLY A 514 ? GLN A 512 GLY A 514 5 ? 3  
HELX_P HELX_P38  38  VAL A 515 ? GLU A 526 ? VAL A 515 GLU A 526 1 ? 12 
HELX_P HELX_P39  39  PRO A 527 ? ASP A 530 ? PRO A 527 ASP A 530 5 ? 4  
HELX_P HELX_P40  40  ASP A 539 ? GLU A 554 ? ASP A 539 GLU A 554 1 ? 16 
HELX_P HELX_P41  41  ALA B 2   ? ASP B 7   ? ALA B 2   ASP B 7   1 ? 6  
HELX_P HELX_P42  42  ASP B 7   ? ARG B 21  ? ASP B 7   ARG B 21  1 ? 15 
HELX_P HELX_P43  43  SER B 22  ? LEU B 24  ? SER B 22  LEU B 24  5 ? 3  
HELX_P HELX_P44  44  ASN B 25  ? ASN B 33  ? ASN B 25  ASN B 33  1 ? 9  
HELX_P HELX_P45  45  ASP B 35  ? PHE B 40  ? ASP B 35  PHE B 40  1 ? 6  
HELX_P HELX_P46  46  THR B 61  ? ARG B 75  ? THR B 61  ARG B 75  1 ? 15 
HELX_P HELX_P47  47  GLY B 76  ? GLY B 87  ? GLY B 76  GLY B 87  1 ? 12 
HELX_P HELX_P48  48  LEU B 99  ? ARG B 104 ? LEU B 99  ARG B 104 1 ? 6  
HELX_P HELX_P49  49  VAL B 118 ? SER B 138 ? VAL B 118 SER B 138 1 ? 21 
HELX_P HELX_P50  50  ILE B 157 ? SER B 160 ? ILE B 157 SER B 160 5 ? 4  
HELX_P HELX_P51  51  ASP B 161 ? LEU B 171 ? ASP B 161 LEU B 171 1 ? 11 
HELX_P HELX_P52  52  LYS B 172 ? SER B 175 ? LYS B 172 SER B 175 5 ? 4  
HELX_P HELX_P53  53  ASP B 188 ? ALA B 197 ? ASP B 188 ALA B 197 1 ? 10 
HELX_P HELX_P54  54  GLN B 198 ? LEU B 199 ? GLN B 198 LEU B 199 5 ? 2  
HELX_P HELX_P55  55  ASN B 200 ? GLU B 202 ? ASN B 200 GLU B 202 5 ? 3  
HELX_P HELX_P56  56  THR B 215 ? LYS B 234 ? THR B 215 LYS B 234 1 ? 20 
HELX_P HELX_P57  57  ASP B 235 ? LYS B 241 ? ASP B 235 LYS B 241 5 ? 7  
HELX_P HELX_P58  58  ASN B 249 ? GLY B 257 ? ASN B 249 GLY B 257 1 ? 9  
HELX_P HELX_P59  59  ASP B 259 ? GLN B 261 ? ASP B 259 GLN B 261 5 ? 3  
HELX_P HELX_P60  60  GLY B 271 ? SER B 275 ? GLY B 271 SER B 275 5 ? 5  
HELX_P HELX_P61  61  SER B 278 ? ILE B 280 ? SER B 278 ILE B 280 5 ? 3  
HELX_P HELX_P62  62  GLY B 281 ? GLY B 289 ? GLY B 281 GLY B 289 1 ? 9  
HELX_P HELX_P63  63  GLY B 289 ? THR B 310 ? GLY B 289 THR B 310 1 ? 22 
HELX_P HELX_P64  64  PRO B 311 ? LYS B 314 ? PRO B 311 LYS B 314 5 ? 4  
HELX_P HELX_P65  65  ASN B 315 ? CYS B 330 ? ASN B 315 CYS B 330 1 ? 16 
HELX_P HELX_P66  66  ASP B 342 ? HIS B 346 ? ASP B 342 HIS B 346 5 ? 5  
HELX_P HELX_P67  67  ARG B 347 ? GLY B 361 ? ARG B 347 GLY B 361 1 ? 15 
HELX_P HELX_P68  68  ASN B 386 ? ALA B 390 ? ASN B 386 ALA B 390 5 ? 5  
HELX_P HELX_P69  69  PHE B 391 ? GLY B 398 ? PHE B 391 GLY B 398 1 ? 8  
HELX_P HELX_P70  70  ILE B 416 ? LYS B 418 ? ILE B 416 LYS B 418 5 ? 3  
HELX_P HELX_P71  71  GLY B 419 ? GLY B 439 ? GLY B 419 GLY B 439 1 ? 21 
HELX_P HELX_P72  72  SER B 441 ? ALA B 452 ? SER B 441 ALA B 452 1 ? 12 
HELX_P HELX_P73  73  SER B 455 ? LEU B 463 ? SER B 455 LEU B 463 1 ? 9  
HELX_P HELX_P74  74  PRO B 464 ? VAL B 467 ? PRO B 464 VAL B 467 5 ? 4  
HELX_P HELX_P75  75  THR B 483 ? ASP B 506 ? THR B 483 ASP B 506 1 ? 24 
HELX_P HELX_P76  76  GLN B 512 ? GLY B 514 ? GLN B 512 GLY B 514 5 ? 3  
HELX_P HELX_P77  77  VAL B 515 ? LEU B 529 ? VAL B 515 LEU B 529 1 ? 15 
HELX_P HELX_P78  78  ASP B 539 ? ARG B 553 ? ASP B 539 ARG B 553 1 ? 15 
HELX_P HELX_P79  79  ASP C 7   ? ARG C 21  ? ASP C 7   ARG C 21  1 ? 15 
HELX_P HELX_P80  80  SER C 22  ? LEU C 24  ? SER C 22  LEU C 24  5 ? 3  
HELX_P HELX_P81  81  ASN C 25  ? ASN C 33  ? ASN C 25  ASN C 33  1 ? 9  
HELX_P HELX_P82  82  ASP C 35  ? PHE C 40  ? ASP C 35  PHE C 40  1 ? 6  
HELX_P HELX_P83  83  THR C 61  ? ARG C 75  ? THR C 61  ARG C 75  1 ? 15 
HELX_P HELX_P84  84  GLY C 76  ? ASN C 86  ? GLY C 76  ASN C 86  1 ? 11 
HELX_P HELX_P85  85  LEU C 99  ? ARG C 104 ? LEU C 99  ARG C 104 1 ? 6  
HELX_P HELX_P86  86  VAL C 118 ? SER C 138 ? VAL C 118 SER C 138 1 ? 21 
HELX_P HELX_P87  87  ILE C 157 ? SER C 160 ? ILE C 157 SER C 160 5 ? 4  
HELX_P HELX_P88  88  ASP C 161 ? LEU C 171 ? ASP C 161 LEU C 171 1 ? 11 
HELX_P HELX_P89  89  LYS C 172 ? SER C 176 ? LYS C 172 SER C 176 5 ? 5  
HELX_P HELX_P90  90  ASP C 188 ? ALA C 197 ? ASP C 188 ALA C 197 1 ? 10 
HELX_P HELX_P91  91  GLN C 198 ? LEU C 199 ? GLN C 198 LEU C 199 5 ? 2  
HELX_P HELX_P92  92  ASN C 200 ? GLU C 202 ? ASN C 200 GLU C 202 5 ? 3  
HELX_P HELX_P93  93  THR C 215 ? LYS C 234 ? THR C 215 LYS C 234 1 ? 20 
HELX_P HELX_P94  94  ASP C 235 ? LYS C 241 ? ASP C 235 LYS C 241 5 ? 7  
HELX_P HELX_P95  95  ASN C 249 ? GLY C 257 ? ASN C 249 GLY C 257 1 ? 9  
HELX_P HELX_P96  96  ASP C 259 ? GLN C 261 ? ASP C 259 GLN C 261 5 ? 3  
HELX_P HELX_P97  97  GLY C 271 ? SER C 275 ? GLY C 271 SER C 275 5 ? 5  
HELX_P HELX_P98  98  SER C 278 ? ILE C 280 ? SER C 278 ILE C 280 5 ? 3  
HELX_P HELX_P99  99  GLY C 281 ? GLY C 289 ? GLY C 281 GLY C 289 1 ? 9  
HELX_P HELX_P100 100 GLY C 289 ? THR C 310 ? GLY C 289 THR C 310 1 ? 22 
HELX_P HELX_P101 101 PRO C 311 ? LYS C 314 ? PRO C 311 LYS C 314 5 ? 4  
HELX_P HELX_P102 102 ASN C 315 ? CYS C 330 ? ASN C 315 CYS C 330 1 ? 16 
HELX_P HELX_P103 103 ASP C 342 ? HIS C 346 ? ASP C 342 HIS C 346 5 ? 5  
HELX_P HELX_P104 104 ARG C 347 ? GLY C 361 ? ARG C 347 GLY C 361 1 ? 15 
HELX_P HELX_P105 105 ASN C 386 ? ALA C 390 ? ASN C 386 ALA C 390 5 ? 5  
HELX_P HELX_P106 106 PHE C 391 ? GLY C 398 ? PHE C 391 GLY C 398 1 ? 8  
HELX_P HELX_P107 107 ILE C 416 ? LYS C 418 ? ILE C 416 LYS C 418 5 ? 3  
HELX_P HELX_P108 108 GLY C 419 ? GLY C 439 ? GLY C 419 GLY C 439 1 ? 21 
HELX_P HELX_P109 109 SER C 441 ? GLY C 453 ? SER C 441 GLY C 453 1 ? 13 
HELX_P HELX_P110 110 SER C 455 ? LEU C 463 ? SER C 455 LEU C 463 1 ? 9  
HELX_P HELX_P111 111 PRO C 464 ? VAL C 467 ? PRO C 464 VAL C 467 5 ? 4  
HELX_P HELX_P112 112 THR C 483 ? ASP C 506 ? THR C 483 ASP C 506 1 ? 24 
HELX_P HELX_P113 113 GLN C 512 ? GLY C 514 ? GLN C 512 GLY C 514 5 ? 3  
HELX_P HELX_P114 114 VAL C 515 ? LEU C 529 ? VAL C 515 LEU C 529 1 ? 15 
HELX_P HELX_P115 115 ASP C 539 ? GLU C 554 ? ASP C 539 GLU C 554 1 ? 16 
HELX_P HELX_P116 116 ASP D 7   ? ARG D 21  ? ASP D 7   ARG D 21  1 ? 15 
HELX_P HELX_P117 117 SER D 22  ? LEU D 24  ? SER D 22  LEU D 24  5 ? 3  
HELX_P HELX_P118 118 ASN D 25  ? ASN D 33  ? ASN D 25  ASN D 33  1 ? 9  
HELX_P HELX_P119 119 ASP D 35  ? PHE D 40  ? ASP D 35  PHE D 40  1 ? 6  
HELX_P HELX_P120 120 THR D 61  ? ARG D 75  ? THR D 61  ARG D 75  1 ? 15 
HELX_P HELX_P121 121 GLY D 76  ? GLY D 87  ? GLY D 76  GLY D 87  1 ? 12 
HELX_P HELX_P122 122 LEU D 99  ? ARG D 104 ? LEU D 99  ARG D 104 1 ? 6  
HELX_P HELX_P123 123 VAL D 118 ? SER D 138 ? VAL D 118 SER D 138 1 ? 21 
HELX_P HELX_P124 124 ILE D 157 ? SER D 160 ? ILE D 157 SER D 160 5 ? 4  
HELX_P HELX_P125 125 ASP D 161 ? LEU D 171 ? ASP D 161 LEU D 171 1 ? 11 
HELX_P HELX_P126 126 LYS D 172 ? SER D 175 ? LYS D 172 SER D 175 5 ? 4  
HELX_P HELX_P127 127 ASP D 188 ? ALA D 197 ? ASP D 188 ALA D 197 1 ? 10 
HELX_P HELX_P128 128 THR D 215 ? GLN D 231 ? THR D 215 GLN D 231 1 ? 17 
HELX_P HELX_P129 129 SER D 237 ? LYS D 241 ? SER D 237 LYS D 241 5 ? 5  
HELX_P HELX_P130 130 ASN D 249 ? GLY D 257 ? ASN D 249 GLY D 257 1 ? 9  
HELX_P HELX_P131 131 ASP D 259 ? GLN D 261 ? ASP D 259 GLN D 261 5 ? 3  
HELX_P HELX_P132 132 GLY D 271 ? SER D 275 ? GLY D 271 SER D 275 5 ? 5  
HELX_P HELX_P133 133 SER D 278 ? ILE D 280 ? SER D 278 ILE D 280 5 ? 3  
HELX_P HELX_P134 134 GLY D 281 ? GLY D 289 ? GLY D 281 GLY D 289 1 ? 9  
HELX_P HELX_P135 135 GLY D 289 ? THR D 310 ? GLY D 289 THR D 310 1 ? 22 
HELX_P HELX_P136 136 PRO D 311 ? LYS D 314 ? PRO D 311 LYS D 314 5 ? 4  
HELX_P HELX_P137 137 ASN D 315 ? CYS D 330 ? ASN D 315 CYS D 330 1 ? 16 
HELX_P HELX_P138 138 ASP D 342 ? HIS D 346 ? ASP D 342 HIS D 346 5 ? 5  
HELX_P HELX_P139 139 ARG D 347 ? ASP D 356 ? ARG D 347 ASP D 356 1 ? 10 
HELX_P HELX_P140 140 ASP D 356 ? GLY D 361 ? ASP D 356 GLY D 361 1 ? 6  
HELX_P HELX_P141 141 ASN D 386 ? ALA D 390 ? ASN D 386 ALA D 390 5 ? 5  
HELX_P HELX_P142 142 PHE D 391 ? GLY D 398 ? PHE D 391 GLY D 398 1 ? 8  
HELX_P HELX_P143 143 PRO D 415 ? LYS D 418 ? PRO D 415 LYS D 418 5 ? 4  
HELX_P HELX_P144 144 GLY D 419 ? GLY D 439 ? GLY D 419 GLY D 439 1 ? 21 
HELX_P HELX_P145 145 SER D 441 ? GLY D 453 ? SER D 441 GLY D 453 1 ? 13 
HELX_P HELX_P146 146 SER D 455 ? LEU D 463 ? SER D 455 LEU D 463 1 ? 9  
HELX_P HELX_P147 147 PRO D 464 ? VAL D 467 ? PRO D 464 VAL D 467 5 ? 4  
HELX_P HELX_P148 148 THR D 483 ? ASP D 506 ? THR D 483 ASP D 506 1 ? 24 
HELX_P HELX_P149 149 GLN D 512 ? GLY D 514 ? GLN D 512 GLY D 514 5 ? 3  
HELX_P HELX_P150 150 VAL D 515 ? LEU D 529 ? VAL D 515 LEU D 529 1 ? 15 
HELX_P HELX_P151 151 ASP D 539 ? GLU D 554 ? ASP D 539 GLU D 554 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 384 A . ? GLY 384 A THR 385 A ? THR 385 A 1 0.19 
2 GLY 384 B . ? GLY 384 B THR 385 B ? THR 385 B 1 2.66 
3 GLY 384 C . ? GLY 384 C THR 385 C ? THR 385 C 1 3.68 
4 GLY 384 D . ? GLY 384 D THR 385 D ? THR 385 D 1 2.08 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 4 ? 
D ? 6 ? 
E ? 2 ? 
F ? 5 ? 
G ? 6 ? 
H ? 2 ? 
I ? 5 ? 
J ? 6 ? 
K ? 2 ? 
L ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
H 1 2 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? parallel      
J 4 5 ? parallel      
J 5 6 ? parallel      
K 1 2 ? anti-parallel 
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 41  ? ASN A 45  ? SER A 41  ASN A 45  
A 2 HIS A 50  ? ASP A 54  ? HIS A 50  ASP A 54  
A 3 THR A 474 ? LYS A 481 ? THR A 474 LYS A 481 
A 4 CYS A 404 ? GLN A 411 ? CYS A 404 GLN A 411 
A 5 THR A 335 ? PRO A 340 ? THR A 335 PRO A 340 
A 6 ILE A 378 ? TRP A 380 ? ILE A 378 TRP A 380 
B 1 LEU A 112 ? VAL A 113 ? LEU A 112 VAL A 113 
B 2 LYS A 116 ? ASP A 117 ? LYS A 116 ASP A 117 
C 1 ARG A 180 ? VAL A 184 ? ARG A 180 VAL A 184 
C 2 ASP A 151 ? ILE A 155 ? ASP A 151 ILE A 155 
C 3 SER A 204 ? ALA A 209 ? SER A 204 ALA A 209 
C 4 PHE A 243 ? LEU A 246 ? PHE A 243 LEU A 246 
D 1 SER B 41  ? ASN B 45  ? SER B 41  ASN B 45  
D 2 HIS B 50  ? ASP B 54  ? HIS B 50  ASP B 54  
D 3 THR B 474 ? LYS B 481 ? THR B 474 LYS B 481 
D 4 CYS B 404 ? GLN B 411 ? CYS B 404 GLN B 411 
D 5 THR B 335 ? PRO B 340 ? THR B 335 PRO B 340 
D 6 ILE B 378 ? TRP B 380 ? ILE B 378 TRP B 380 
E 1 LEU B 112 ? VAL B 113 ? LEU B 112 VAL B 113 
E 2 LYS B 116 ? ASP B 117 ? LYS B 116 ASP B 117 
F 1 ARG B 180 ? VAL B 184 ? ARG B 180 VAL B 184 
F 2 ASP B 151 ? ILE B 155 ? ASP B 151 ILE B 155 
F 3 SER B 204 ? ALA B 209 ? SER B 204 ALA B 209 
F 4 PHE B 243 ? LEU B 246 ? PHE B 243 LEU B 246 
F 5 MET B 263 ? PHE B 264 ? MET B 263 PHE B 264 
G 1 SER C 41  ? ASN C 45  ? SER C 41  ASN C 45  
G 2 HIS C 50  ? ASP C 54  ? HIS C 50  ASP C 54  
G 3 THR C 474 ? LYS C 481 ? THR C 474 LYS C 481 
G 4 CYS C 404 ? GLN C 411 ? CYS C 404 GLN C 411 
G 5 THR C 335 ? PRO C 340 ? THR C 335 PRO C 340 
G 6 ILE C 378 ? TRP C 380 ? ILE C 378 TRP C 380 
H 1 LEU C 112 ? VAL C 113 ? LEU C 112 VAL C 113 
H 2 LYS C 116 ? ASP C 117 ? LYS C 116 ASP C 117 
I 1 ARG C 180 ? VAL C 184 ? ARG C 180 VAL C 184 
I 2 ASP C 151 ? ILE C 155 ? ASP C 151 ILE C 155 
I 3 SER C 204 ? ALA C 209 ? SER C 204 ALA C 209 
I 4 PHE C 243 ? LEU C 246 ? PHE C 243 LEU C 246 
I 5 MET C 263 ? PHE C 264 ? MET C 263 PHE C 264 
J 1 SER D 41  ? ASN D 45  ? SER D 41  ASN D 45  
J 2 HIS D 50  ? LYS D 57  ? HIS D 50  LYS D 57  
J 3 THR D 474 ? LYS D 481 ? THR D 474 LYS D 481 
J 4 CYS D 404 ? GLN D 411 ? CYS D 404 GLN D 411 
J 5 THR D 335 ? PRO D 340 ? THR D 335 PRO D 340 
J 6 ILE D 378 ? TRP D 380 ? ILE D 378 TRP D 380 
K 1 LEU D 112 ? VAL D 113 ? LEU D 112 VAL D 113 
K 2 LYS D 116 ? ASP D 117 ? LYS D 116 ASP D 117 
L 1 ARG D 180 ? VAL D 184 ? ARG D 180 VAL D 184 
L 2 ASP D 151 ? ILE D 155 ? ASP D 151 ILE D 155 
L 3 SER D 204 ? ALA D 209 ? SER D 204 ALA D 209 
L 4 PHE D 243 ? LEU D 246 ? PHE D 243 LEU D 246 
L 5 MET D 263 ? PHE D 264 ? MET D 263 PHE D 264 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 44  ? N LEU A 44  O ILE A 51  ? O ILE A 51  
A 2 3 O ASP A 54  ? O ASP A 54  N SER A 476 ? N SER A 476 
A 3 4 N ASN A 475 ? N ASN A 475 O CYS A 404 ? O CYS A 404 
A 4 5 N ASP A 405 ? N ASP A 405 O ALA A 337 ? O ALA A 337 
A 5 6 N HIS A 336 ? N HIS A 336 O ILE A 378 ? O ILE A 378 
B 1 2 O VAL A 113 ? O VAL A 113 N LYS A 116 ? N LYS A 116 
C 1 2 N TRP A 182 ? N TRP A 182 O VAL A 152 ? O VAL A 152 
C 2 3 O ASP A 151 ? O ASP A 151 N LEU A 205 ? N LEU A 205 
C 3 4 N ILE A 208 ? N ILE A 208 O VAL A 244 ? O VAL A 244 
D 1 2 N LEU B 44  ? N LEU B 44  O ILE B 51  ? O ILE B 51  
D 2 3 N ASP B 54  ? N ASP B 54  O SER B 476 ? O SER B 476 
D 3 4 N ASN B 475 ? N ASN B 475 O CYS B 404 ? O CYS B 404 
D 4 5 N ASP B 405 ? N ASP B 405 O ALA B 337 ? O ALA B 337 
D 5 6 N HIS B 336 ? N HIS B 336 O ILE B 378 ? O ILE B 378 
E 1 2 N VAL B 113 ? N VAL B 113 O LYS B 116 ? O LYS B 116 
F 1 2 O ARG B 180 ? O ARG B 180 N VAL B 152 ? N VAL B 152 
F 2 3 N ILE B 153 ? N ILE B 153 O LEU B 205 ? O LEU B 205 
F 3 4 N ILE B 208 ? N ILE B 208 O VAL B 244 ? O VAL B 244 
F 4 5 O ALA B 245 ? O ALA B 245 N PHE B 264 ? N PHE B 264 
G 1 2 N LEU C 44  ? N LEU C 44  O ILE C 51  ? O ILE C 51  
G 2 3 N ASP C 54  ? N ASP C 54  O SER C 476 ? O SER C 476 
G 3 4 N ASN C 475 ? N ASN C 475 O CYS C 404 ? O CYS C 404 
G 4 5 N ASP C 405 ? N ASP C 405 O ALA C 337 ? O ALA C 337 
G 5 6 N HIS C 336 ? N HIS C 336 O ILE C 378 ? O ILE C 378 
H 1 2 N VAL C 113 ? N VAL C 113 O LYS C 116 ? O LYS C 116 
I 1 2 O ARG C 180 ? O ARG C 180 N VAL C 152 ? N VAL C 152 
I 2 3 N ILE C 153 ? N ILE C 153 O LEU C 205 ? O LEU C 205 
I 3 4 N ILE C 208 ? N ILE C 208 O VAL C 244 ? O VAL C 244 
I 4 5 O ALA C 245 ? O ALA C 245 N PHE C 264 ? N PHE C 264 
J 1 2 N LEU D 44  ? N LEU D 44  O ILE D 51  ? O ILE D 51  
J 2 3 O LYS D 57  ? O LYS D 57  N THR D 474 ? N THR D 474 
J 3 4 N ASN D 475 ? N ASN D 475 O CYS D 404 ? O CYS D 404 
J 4 5 N ASP D 405 ? N ASP D 405 O ALA D 337 ? O ALA D 337 
J 5 6 N HIS D 336 ? N HIS D 336 O ILE D 378 ? O ILE D 378 
K 1 2 N VAL D 113 ? N VAL D 113 O LYS D 116 ? O LYS D 116 
L 1 2 O ARG D 180 ? O ARG D 180 N VAL D 152 ? N VAL D 152 
L 2 3 O ASP D 151 ? O ASP D 151 N LEU D 205 ? N LEU D 205 
L 3 4 N ILE D 208 ? N ILE D 208 O VAL D 244 ? O VAL D 244 
L 4 5 O ALA D 245 ? O ALA D 245 N PHE D 264 ? N PHE D 264 
# 
_database_PDB_matrix.entry_id          1JIQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JIQ 
_atom_sites.fract_transf_matrix[1][1]   0.01238 
_atom_sites.fract_transf_matrix[1][2]   0.00000 
_atom_sites.fract_transf_matrix[1][3]   0.00000 
_atom_sites.fract_transf_matrix[2][1]   0.00000 
_atom_sites.fract_transf_matrix[2][2]   0.00931 
_atom_sites.fract_transf_matrix[2][3]   0.00000 
_atom_sites.fract_transf_matrix[3][1]   0.00000 
_atom_sites.fract_transf_matrix[3][2]   0.00000 
_atom_sites.fract_transf_matrix[3][3]   0.00369 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . MET A 1 1   ? -12.563 -2.554  74.075  1.00 32.91 ? 1   MET A N   1 
ATOM   2     C CA  . MET A 1 1   ? -11.610 -2.782  72.955  1.00 32.60 ? 1   MET A CA  1 
ATOM   3     C C   . MET A 1 1   ? -11.119 -1.449  72.371  1.00 31.55 ? 1   MET A C   1 
ATOM   4     O O   . MET A 1 1   ? -11.908 -0.548  72.065  1.00 31.90 ? 1   MET A O   1 
ATOM   5     C CB  . MET A 1 1   ? -12.266 -3.602  71.841  1.00 33.34 ? 1   MET A CB  1 
ATOM   6     C CG  . MET A 1 1   ? -13.021 -4.817  72.291  1.00 35.04 ? 1   MET A CG  1 
ATOM   7     S SD  . MET A 1 1   ? -12.354 -6.331  71.611  1.00 40.47 ? 1   MET A SD  1 
ATOM   8     C CE  . MET A 1 1   ? -12.776 -7.485  72.894  1.00 40.19 ? 1   MET A CE  1 
ATOM   9     N N   . ALA A 1 2   ? -9.806  -1.315  72.266  1.00 29.77 ? 2   ALA A N   1 
ATOM   10    C CA  . ALA A 1 2   ? -9.194  -0.165  71.617  1.00 28.46 ? 2   ALA A CA  1 
ATOM   11    C C   . ALA A 1 2   ? -8.968  -0.395  70.120  1.00 26.95 ? 2   ALA A C   1 
ATOM   12    O O   . ALA A 1 2   ? -9.218  -1.475  69.593  1.00 26.91 ? 2   ALA A O   1 
ATOM   13    C CB  . ALA A 1 2   ? -7.867  0.176   72.319  1.00 27.90 ? 2   ALA A CB  1 
ATOM   14    N N   . ALA A 1 3   ? -8.492  0.644   69.445  1.00 25.72 ? 3   ALA A N   1 
ATOM   15    C CA  . ALA A 1 3   ? -8.245  0.579   68.009  1.00 24.48 ? 3   ALA A CA  1 
ATOM   16    C C   . ALA A 1 3   ? -7.373  -0.599  67.673  1.00 23.22 ? 3   ALA A C   1 
ATOM   17    O O   . ALA A 1 3   ? -7.755  -1.457  66.867  1.00 23.34 ? 3   ALA A O   1 
ATOM   18    C CB  . ALA A 1 3   ? -7.580  1.826   67.538  1.00 24.92 ? 3   ALA A CB  1 
ATOM   19    N N   . LEU A 1 4   ? -6.210  -0.675  68.308  1.00 21.63 ? 4   LEU A N   1 
ATOM   20    C CA  . LEU A 1 4   ? -5.270  -1.736  67.984  1.00 20.55 ? 4   LEU A CA  1 
ATOM   21    C C   . LEU A 1 4   ? -5.859  -3.137  68.114  1.00 20.23 ? 4   LEU A C   1 
ATOM   22    O O   . LEU A 1 4   ? -5.653  -3.989  67.261  1.00 19.14 ? 4   LEU A O   1 
ATOM   23    C CB  . LEU A 1 4   ? -4.024  -1.643  68.869  1.00 20.12 ? 4   LEU A CB  1 
ATOM   24    C CG  . LEU A 1 4   ? -2.994  -2.726  68.543  1.00 18.65 ? 4   LEU A CG  1 
ATOM   25    C CD1 . LEU A 1 4   ? -2.614  -2.726  67.067  1.00 18.61 ? 4   LEU A CD1 1 
ATOM   26    C CD2 . LEU A 1 4   ? -1.762  -2.570  69.414  1.00 19.28 ? 4   LEU A CD2 1 
ATOM   27    N N   . THR A 1 5   ? -6.568  -3.385  69.202  1.00 20.45 ? 5   THR A N   1 
ATOM   28    C CA  . THR A 1 5   ? -7.075  -4.723  69.442  1.00 21.01 ? 5   THR A CA  1 
ATOM   29    C C   . THR A 1 5   ? -8.210  -5.078  68.479  1.00 20.77 ? 5   THR A C   1 
ATOM   30    O O   . THR A 1 5   ? -8.421  -6.251  68.203  1.00 20.63 ? 5   THR A O   1 
ATOM   31    C CB  . THR A 1 5   ? -7.501  -4.883  70.903  1.00 21.52 ? 5   THR A CB  1 
ATOM   32    O OG1 . THR A 1 5   ? -8.163  -3.700  71.348  1.00 22.77 ? 5   THR A OG1 1 
ATOM   33    C CG2 . THR A 1 5   ? -6.280  -4.976  71.812  1.00 21.98 ? 5   THR A CG2 1 
ATOM   34    N N   . ARG A 1 6   ? -8.897  -4.066  67.948  1.00 20.74 ? 6   ARG A N   1 
ATOM   35    C CA  . ARG A 1 6   ? -9.978  -4.268  66.977  1.00 21.27 ? 6   ARG A CA  1 
ATOM   36    C C   . ARG A 1 6   ? -9.433  -4.464  65.556  1.00 20.21 ? 6   ARG A C   1 
ATOM   37    O O   . ARG A 1 6   ? -10.126 -4.948  64.656  1.00 20.21 ? 6   ARG A O   1 
ATOM   38    C CB  . ARG A 1 6   ? -10.915 -3.052  66.970  1.00 21.99 ? 6   ARG A CB  1 
ATOM   39    C CG  . ARG A 1 6   ? -11.872 -2.957  68.152  1.00 25.53 ? 6   ARG A CG  1 
ATOM   40    C CD  . ARG A 1 6   ? -12.509 -1.570  68.296  1.00 30.31 ? 6   ARG A CD  1 
ATOM   41    N NE  . ARG A 1 6   ? -13.451 -1.498  69.410  1.00 34.78 ? 6   ARG A NE  1 
ATOM   42    C CZ  . ARG A 1 6   ? -14.395 -0.570  69.555  1.00 37.62 ? 6   ARG A CZ  1 
ATOM   43    N NH1 . ARG A 1 6   ? -15.194 -0.603  70.615  1.00 38.80 ? 6   ARG A NH1 1 
ATOM   44    N NH2 . ARG A 1 6   ? -14.550 0.390   68.649  1.00 39.32 ? 6   ARG A NH2 1 
ATOM   45    N N   . ASP A 1 7   ? -8.181  -4.086  65.351  1.00 19.33 ? 7   ASP A N   1 
ATOM   46    C CA  . ASP A 1 7   ? -7.578  -4.161  64.030  1.00 18.31 ? 7   ASP A CA  1 
ATOM   47    C C   . ASP A 1 7   ? -7.405  -5.603  63.513  1.00 18.18 ? 7   ASP A C   1 
ATOM   48    O O   . ASP A 1 7   ? -6.798  -6.443  64.169  1.00 17.70 ? 7   ASP A O   1 
ATOM   49    C CB  . ASP A 1 7   ? -6.251  -3.419  64.049  1.00 18.27 ? 7   ASP A CB  1 
ATOM   50    C CG  . ASP A 1 7   ? -5.640  -3.331  62.699  1.00 17.18 ? 7   ASP A CG  1 
ATOM   51    O OD1 . ASP A 1 7   ? -5.800  -2.267  62.044  1.00 15.52 ? 7   ASP A OD1 1 
ATOM   52    O OD2 . ASP A 1 7   ? -5.006  -4.293  62.220  1.00 13.70 ? 7   ASP A OD2 1 
ATOM   53    N N   . PRO A 1 8   ? -7.966  -5.898  62.337  1.00 18.55 ? 8   PRO A N   1 
ATOM   54    C CA  . PRO A 1 8   ? -7.881  -7.247  61.766  1.00 18.38 ? 8   PRO A CA  1 
ATOM   55    C C   . PRO A 1 8   ? -6.445  -7.748  61.558  1.00 17.73 ? 8   PRO A C   1 
ATOM   56    O O   . PRO A 1 8   ? -6.176  -8.944  61.718  1.00 16.96 ? 8   PRO A O   1 
ATOM   57    C CB  . PRO A 1 8   ? -8.607  -7.106  60.420  1.00 18.33 ? 8   PRO A CB  1 
ATOM   58    C CG  . PRO A 1 8   ? -9.457  -5.943  60.574  1.00 19.78 ? 8   PRO A CG  1 
ATOM   59    C CD  . PRO A 1 8   ? -8.739  -4.991  61.475  1.00 18.85 ? 8   PRO A CD  1 
ATOM   60    N N   . GLN A 1 9   ? -5.529  -6.849  61.214  1.00 17.60 ? 9   GLN A N   1 
ATOM   61    C CA  . GLN A 1 9   ? -4.147  -7.258  60.979  1.00 17.57 ? 9   GLN A CA  1 
ATOM   62    C C   . GLN A 1 9   ? -3.487  -7.611  62.287  1.00 17.01 ? 9   GLN A C   1 
ATOM   63    O O   . GLN A 1 9   ? -2.681  -8.540  62.361  1.00 15.96 ? 9   GLN A O   1 
ATOM   64    C CB  . GLN A 1 9   ? -3.365  -6.160  60.247  1.00 18.31 ? 9   GLN A CB  1 
ATOM   65    C CG  . GLN A 1 9   ? -3.894  -5.877  58.854  1.00 20.09 ? 9   GLN A CG  1 
ATOM   66    C CD  . GLN A 1 9   ? -4.029  -7.140  58.037  1.00 24.54 ? 9   GLN A CD  1 
ATOM   67    O OE1 . GLN A 1 9   ? -5.103  -7.424  57.502  1.00 29.37 ? 9   GLN A OE1 1 
ATOM   68    N NE2 . GLN A 1 9   ? -2.958  -7.911  57.951  1.00 24.93 ? 9   GLN A NE2 1 
ATOM   69    N N   . PHE A 1 10  ? -3.842  -6.874  63.335  1.00 16.76 ? 10  PHE A N   1 
ATOM   70    C CA  . PHE A 1 10  ? -3.289  -7.162  64.645  1.00 16.84 ? 10  PHE A CA  1 
ATOM   71    C C   . PHE A 1 10  ? -3.792  -8.511  65.118  1.00 16.90 ? 10  PHE A C   1 
ATOM   72    O O   . PHE A 1 10  ? -3.049  -9.285  65.721  1.00 15.92 ? 10  PHE A O   1 
ATOM   73    C CB  . PHE A 1 10  ? -3.654  -6.097  65.662  1.00 17.06 ? 10  PHE A CB  1 
ATOM   74    C CG  . PHE A 1 10  ? -3.065  -6.358  66.998  1.00 17.77 ? 10  PHE A CG  1 
ATOM   75    C CD1 . PHE A 1 10  ? -1.687  -6.352  67.163  1.00 18.56 ? 10  PHE A CD1 1 
ATOM   76    C CD2 . PHE A 1 10  ? -3.873  -6.677  68.075  1.00 18.18 ? 10  PHE A CD2 1 
ATOM   77    C CE1 . PHE A 1 10  ? -1.125  -6.621  68.384  1.00 19.23 ? 10  PHE A CE1 1 
ATOM   78    C CE2 . PHE A 1 10  ? -3.323  -6.951  69.307  1.00 18.21 ? 10  PHE A CE2 1 
ATOM   79    C CZ  . PHE A 1 10  ? -1.944  -6.927  69.467  1.00 19.72 ? 10  PHE A CZ  1 
ATOM   80    N N   . GLN A 1 11  ? -5.073  -8.782  64.855  1.00 17.27 ? 11  GLN A N   1 
ATOM   81    C CA  . GLN A 1 11  ? -5.663  -10.059 65.250  1.00 17.48 ? 11  GLN A CA  1 
ATOM   82    C C   . GLN A 1 11  ? -4.995  -11.156 64.462  1.00 17.07 ? 11  GLN A C   1 
ATOM   83    O O   . GLN A 1 11  ? -4.732  -12.220 64.989  1.00 16.79 ? 11  GLN A O   1 
ATOM   84    C CB  . GLN A 1 11  ? -7.187  -10.073 65.042  1.00 17.84 ? 11  GLN A CB  1 
ATOM   85    C CG  . GLN A 1 11  ? -7.939  -9.191  66.032  1.00 19.11 ? 11  GLN A CG  1 
ATOM   86    C CD  . GLN A 1 11  ? -9.404  -8.944  65.677  1.00 22.54 ? 11  GLN A CD  1 
ATOM   87    O OE1 . GLN A 1 11  ? -9.993  -9.638  64.856  1.00 23.52 ? 11  GLN A OE1 1 
ATOM   88    N NE2 . GLN A 1 11  ? -9.992  -7.942  66.311  1.00 21.86 ? 11  GLN A NE2 1 
ATOM   89    N N   . LYS A 1 12  ? -4.705  -10.891 63.196  1.00 17.45 ? 12  LYS A N   1 
ATOM   90    C CA  . LYS A 1 12  ? -4.018  -11.883 62.370  1.00 18.48 ? 12  LYS A CA  1 
ATOM   91    C C   . LYS A 1 12  ? -2.638  -12.190 62.960  1.00 18.30 ? 12  LYS A C   1 
ATOM   92    O O   . LYS A 1 12  ? -2.235  -13.348 63.059  1.00 17.51 ? 12  LYS A O   1 
ATOM   93    C CB  . LYS A 1 12  ? -3.899  -11.381 60.936  1.00 18.95 ? 12  LYS A CB  1 
ATOM   94    C CG  . LYS A 1 12  ? -3.187  -12.344 59.995  1.00 21.63 ? 12  LYS A CG  1 
ATOM   95    C CD  . LYS A 1 12  ? -3.359  -11.883 58.551  1.00 24.89 ? 12  LYS A CD  1 
ATOM   96    C CE  . LYS A 1 12  ? -2.397  -12.625 57.609  1.00 26.79 ? 12  LYS A CE  1 
ATOM   97    N NZ  . LYS A 1 12  ? -2.277  -11.965 56.273  1.00 27.97 ? 12  LYS A NZ  1 
ATOM   98    N N   . LEU A 1 13  ? -1.923  -11.133 63.333  1.00 17.91 ? 13  LEU A N   1 
ATOM   99    C CA  . LEU A 1 13  ? -0.620  -11.242 63.984  1.00 18.67 ? 13  LEU A CA  1 
ATOM   100   C C   . LEU A 1 13  ? -0.705  -12.118 65.225  1.00 18.51 ? 13  LEU A C   1 
ATOM   101   O O   . LEU A 1 13  ? 0.116   -13.009 65.431  1.00 17.79 ? 13  LEU A O   1 
ATOM   102   C CB  . LEU A 1 13  ? -0.151  -9.855  64.438  1.00 19.20 ? 13  LEU A CB  1 
ATOM   103   C CG  . LEU A 1 13  ? 1.082   -9.166  63.865  1.00 21.92 ? 13  LEU A CG  1 
ATOM   104   C CD1 . LEU A 1 13  ? 1.456   -8.026  64.845  1.00 22.98 ? 13  LEU A CD1 1 
ATOM   105   C CD2 . LEU A 1 13  ? 2.271   -10.093 63.645  1.00 21.07 ? 13  LEU A CD2 1 
ATOM   106   N N   . GLN A 1 14  ? -1.703  -11.831 66.057  1.00 18.86 ? 14  GLN A N   1 
ATOM   107   C CA  . GLN A 1 14  ? -1.926  -12.587 67.288  1.00 19.63 ? 14  GLN A CA  1 
ATOM   108   C C   . GLN A 1 14  ? -2.199  -14.063 67.030  1.00 19.73 ? 14  GLN A C   1 
ATOM   109   O O   . GLN A 1 14  ? -1.679  -14.906 67.745  1.00 20.18 ? 14  GLN A O   1 
ATOM   110   C CB  . GLN A 1 14  ? -3.097  -11.992 68.064  1.00 20.26 ? 14  GLN A CB  1 
ATOM   111   C CG  . GLN A 1 14  ? -2.837  -10.649 68.673  1.00 20.92 ? 14  GLN A CG  1 
ATOM   112   C CD  . GLN A 1 14  ? -4.006  -10.226 69.549  1.00 24.01 ? 14  GLN A CD  1 
ATOM   113   O OE1 . GLN A 1 14  ? -3.849  -9.998  70.761  1.00 22.97 ? 14  GLN A OE1 1 
ATOM   114   N NE2 . GLN A 1 14  ? -5.196  -10.157 68.945  1.00 25.32 ? 14  GLN A NE2 1 
ATOM   115   N N   . GLN A 1 15  ? -3.025  -14.362 66.023  1.00 20.53 ? 15  GLN A N   1 
ATOM   116   C CA  . GLN A 1 15  ? -3.340  -15.754 65.654  1.00 20.03 ? 15  GLN A CA  1 
ATOM   117   C C   . GLN A 1 15  ? -2.066  -16.459 65.259  1.00 19.30 ? 15  GLN A C   1 
ATOM   118   O O   . GLN A 1 15  ? -1.811  -17.575 65.706  1.00 18.84 ? 15  GLN A O   1 
ATOM   119   C CB  . GLN A 1 15  ? -4.333  -15.791 64.485  1.00 20.39 ? 15  GLN A CB  1 
ATOM   120   C CG  . GLN A 1 15  ? -4.670  -17.209 63.928  1.00 21.99 ? 15  GLN A CG  1 
ATOM   121   C CD  . GLN A 1 15  ? -5.687  -17.200 62.754  1.00 24.10 ? 15  GLN A CD  1 
ATOM   122   O OE1 . GLN A 1 15  ? -6.795  -17.742 62.871  1.00 25.55 ? 15  GLN A OE1 1 
ATOM   123   N NE2 . GLN A 1 15  ? -5.299  -16.600 61.625  1.00 24.24 ? 15  GLN A NE2 1 
ATOM   124   N N   . TRP A 1 16  ? -1.263  -15.821 64.416  1.00 18.55 ? 16  TRP A N   1 
ATOM   125   C CA  . TRP A 1 16  ? -0.034  -16.439 63.968  1.00 18.44 ? 16  TRP A CA  1 
ATOM   126   C C   . TRP A 1 16  ? 0.847   -16.764 65.174  1.00 18.49 ? 16  TRP A C   1 
ATOM   127   O O   . TRP A 1 16  ? 1.339   -17.878 65.309  1.00 17.86 ? 16  TRP A O   1 
ATOM   128   C CB  . TRP A 1 16  ? 0.694   -15.528 62.969  1.00 18.02 ? 16  TRP A CB  1 
ATOM   129   C CG  . TRP A 1 16  ? 1.782   -16.232 62.227  1.00 18.03 ? 16  TRP A CG  1 
ATOM   130   C CD1 . TRP A 1 16  ? 1.706   -16.758 60.975  1.00 18.36 ? 16  TRP A CD1 1 
ATOM   131   C CD2 . TRP A 1 16  ? 3.110   -16.505 62.694  1.00 17.60 ? 16  TRP A CD2 1 
ATOM   132   N NE1 . TRP A 1 16  ? 2.901   -17.332 60.626  1.00 19.32 ? 16  TRP A NE1 1 
ATOM   133   C CE2 . TRP A 1 16  ? 3.783   -17.190 61.663  1.00 18.94 ? 16  TRP A CE2 1 
ATOM   134   C CE3 . TRP A 1 16  ? 3.805   -16.218 63.868  1.00 18.49 ? 16  TRP A CE3 1 
ATOM   135   C CZ2 . TRP A 1 16  ? 5.103   -17.609 61.777  1.00 18.11 ? 16  TRP A CZ2 1 
ATOM   136   C CZ3 . TRP A 1 16  ? 5.124   -16.646 63.984  1.00 18.13 ? 16  TRP A CZ3 1 
ATOM   137   C CH2 . TRP A 1 16  ? 5.755   -17.327 62.943  1.00 19.28 ? 16  TRP A CH2 1 
ATOM   138   N N   . TYR A 1 17  ? 1.056   -15.781 66.043  1.00 19.08 ? 17  TYR A N   1 
ATOM   139   C CA  . TYR A 1 17  ? 1.862   -15.970 67.249  1.00 20.03 ? 17  TYR A CA  1 
ATOM   140   C C   . TYR A 1 17  ? 1.326   -17.121 68.096  1.00 21.18 ? 17  TYR A C   1 
ATOM   141   O O   . TYR A 1 17  ? 2.093   -17.948 68.598  1.00 20.67 ? 17  TYR A O   1 
ATOM   142   C CB  . TYR A 1 17  ? 1.879   -14.670 68.063  1.00 19.89 ? 17  TYR A CB  1 
ATOM   143   C CG  . TYR A 1 17  ? 2.538   -14.767 69.423  1.00 19.86 ? 17  TYR A CG  1 
ATOM   144   C CD1 . TYR A 1 17  ? 3.907   -14.554 69.574  1.00 19.24 ? 17  TYR A CD1 1 
ATOM   145   C CD2 . TYR A 1 17  ? 1.783   -15.027 70.573  1.00 21.06 ? 17  TYR A CD2 1 
ATOM   146   C CE1 . TYR A 1 17  ? 4.524   -14.625 70.838  1.00 19.29 ? 17  TYR A CE1 1 
ATOM   147   C CE2 . TYR A 1 17  ? 2.398   -15.090 71.847  1.00 20.37 ? 17  TYR A CE2 1 
ATOM   148   C CZ  . TYR A 1 17  ? 3.767   -14.894 71.959  1.00 19.93 ? 17  TYR A CZ  1 
ATOM   149   O OH  . TYR A 1 17  ? 4.368   -14.961 73.202  1.00 20.35 ? 17  TYR A OH  1 
ATOM   150   N N   . ARG A 1 18  ? 0.010   -17.178 68.255  1.00 23.20 ? 18  ARG A N   1 
ATOM   151   C CA  . ARG A 1 18  ? -0.602  -18.267 69.010  1.00 25.09 ? 18  ARG A CA  1 
ATOM   152   C C   . ARG A 1 18  ? -0.275  -19.617 68.376  1.00 26.14 ? 18  ARG A C   1 
ATOM   153   O O   . ARG A 1 18  ? 0.050   -20.587 69.075  1.00 26.23 ? 18  ARG A O   1 
ATOM   154   C CB  . ARG A 1 18  ? -2.120  -18.097 69.065  1.00 25.36 ? 18  ARG A CB  1 
ATOM   155   C CG  . ARG A 1 18  ? -2.611  -17.154 70.138  1.00 26.83 ? 18  ARG A CG  1 
ATOM   156   C CD  . ARG A 1 18  ? -4.095  -17.308 70.414  1.00 29.22 ? 18  ARG A CD  1 
ATOM   157   N NE  . ARG A 1 18  ? -4.874  -17.355 69.174  1.00 30.13 ? 18  ARG A NE  1 
ATOM   158   C CZ  . ARG A 1 18  ? -5.412  -16.292 68.579  1.00 31.58 ? 18  ARG A CZ  1 
ATOM   159   N NH1 . ARG A 1 18  ? -6.108  -16.444 67.455  1.00 31.58 ? 18  ARG A NH1 1 
ATOM   160   N NH2 . ARG A 1 18  ? -5.268  -15.075 69.109  1.00 30.81 ? 18  ARG A NH2 1 
ATOM   161   N N   . GLU A 1 19  ? -0.368  -19.675 67.052  1.00 27.41 ? 19  GLU A N   1 
ATOM   162   C CA  . GLU A 1 19  ? -0.148  -20.918 66.313  1.00 28.80 ? 19  GLU A CA  1 
ATOM   163   C C   . GLU A 1 19  ? 1.323   -21.322 66.192  1.00 29.66 ? 19  GLU A C   1 
ATOM   164   O O   . GLU A 1 19  ? 1.657   -22.496 66.366  1.00 29.80 ? 19  GLU A O   1 
ATOM   165   C CB  . GLU A 1 19  ? -0.737  -20.801 64.902  1.00 29.04 ? 19  GLU A CB  1 
ATOM   166   C CG  . GLU A 1 19  ? -2.257  -20.748 64.834  1.00 30.49 ? 19  GLU A CG  1 
ATOM   167   C CD  . GLU A 1 19  ? -2.778  -20.220 63.501  1.00 33.28 ? 19  GLU A CD  1 
ATOM   168   O OE1 . GLU A 1 19  ? -1.980  -19.689 62.690  1.00 36.86 ? 19  GLU A OE1 1 
ATOM   169   O OE2 . GLU A 1 19  ? -3.999  -20.308 63.267  1.00 34.23 ? 19  GLU A OE2 1 
ATOM   170   N N   . HIS A 1 20  ? 2.199   -20.360 65.909  1.00 30.15 ? 20  HIS A N   1 
ATOM   171   C CA  . HIS A 1 20  ? 3.595   -20.677 65.602  1.00 31.03 ? 20  HIS A CA  1 
ATOM   172   C C   . HIS A 1 20  ? 4.688   -20.179 66.559  1.00 32.00 ? 20  HIS A C   1 
ATOM   173   O O   . HIS A 1 20  ? 5.869   -20.342 66.257  1.00 32.01 ? 20  HIS A O   1 
ATOM   174   C CB  . HIS A 1 20  ? 3.914   -20.144 64.204  1.00 31.00 ? 20  HIS A CB  1 
ATOM   175   C CG  . HIS A 1 20  ? 2.922   -20.555 63.161  1.00 30.70 ? 20  HIS A CG  1 
ATOM   176   N ND1 . HIS A 1 20  ? 2.964   -21.783 62.537  1.00 31.85 ? 20  HIS A ND1 1 
ATOM   177   C CD2 . HIS A 1 20  ? 1.866   -19.899 62.626  1.00 31.04 ? 20  HIS A CD2 1 
ATOM   178   C CE1 . HIS A 1 20  ? 1.973   -21.868 61.667  1.00 31.69 ? 20  HIS A CE1 1 
ATOM   179   N NE2 . HIS A 1 20  ? 1.289   -20.740 61.704  1.00 30.99 ? 20  HIS A NE2 1 
ATOM   180   N N   . ARG A 1 21  ? 4.334   -19.607 67.703  1.00 33.10 ? 21  ARG A N   1 
ATOM   181   C CA  . ARG A 1 21  ? 5.365   -19.079 68.604  1.00 34.60 ? 21  ARG A CA  1 
ATOM   182   C C   . ARG A 1 21  ? 6.534   -20.056 68.771  1.00 35.42 ? 21  ARG A C   1 
ATOM   183   O O   . ARG A 1 21  ? 7.698   -19.697 68.580  1.00 35.32 ? 21  ARG A O   1 
ATOM   184   C CB  . ARG A 1 21  ? 4.788   -18.742 69.978  1.00 34.93 ? 21  ARG A CB  1 
ATOM   185   C CG  . ARG A 1 21  ? 5.714   -17.876 70.810  1.00 37.38 ? 21  ARG A CG  1 
ATOM   186   C CD  . ARG A 1 21  ? 5.465   -17.938 72.304  1.00 40.25 ? 21  ARG A CD  1 
ATOM   187   N NE  . ARG A 1 21  ? 6.445   -17.134 73.035  1.00 42.50 ? 21  ARG A NE  1 
ATOM   188   C CZ  . ARG A 1 21  ? 6.819   -17.351 74.294  1.00 44.99 ? 21  ARG A CZ  1 
ATOM   189   N NH1 . ARG A 1 21  ? 6.305   -18.365 74.985  1.00 46.19 ? 21  ARG A NH1 1 
ATOM   190   N NH2 . ARG A 1 21  ? 7.725   -16.560 74.865  1.00 45.61 ? 21  ARG A NH2 1 
ATOM   191   N N   . SER A 1 22  ? 6.219   -21.306 69.095  1.00 36.31 ? 22  SER A N   1 
ATOM   192   C CA  . SER A 1 22  ? 7.252   -22.312 69.333  1.00 37.01 ? 22  SER A CA  1 
ATOM   193   C C   . SER A 1 22  ? 8.016   -22.714 68.083  1.00 36.82 ? 22  SER A C   1 
ATOM   194   O O   . SER A 1 22  ? 8.922   -23.539 68.156  1.00 37.91 ? 22  SER A O   1 
ATOM   195   C CB  . SER A 1 22  ? 6.656   -23.543 70.018  1.00 37.40 ? 22  SER A CB  1 
ATOM   196   O OG  . SER A 1 22  ? 6.114   -23.189 71.285  1.00 38.58 ? 22  SER A OG  1 
ATOM   197   N N   . GLU A 1 23  ? 7.686   -22.113 66.947  1.00 36.37 ? 23  GLU A N   1 
ATOM   198   C CA  . GLU A 1 23  ? 8.408   -22.382 65.704  1.00 35.58 ? 23  GLU A CA  1 
ATOM   199   C C   . GLU A 1 23  ? 9.525   -21.336 65.525  1.00 34.14 ? 23  GLU A C   1 
ATOM   200   O O   . GLU A 1 23  ? 10.297  -21.370 64.566  1.00 34.70 ? 23  GLU A O   1 
ATOM   201   C CB  . GLU A 1 23  ? 7.404   -22.419 64.540  1.00 36.07 ? 23  GLU A CB  1 
ATOM   202   C CG  . GLU A 1 23  ? 7.879   -21.957 63.170  1.00 37.71 ? 23  GLU A CG  1 
ATOM   203   C CD  . GLU A 1 23  ? 6.716   -21.885 62.191  1.00 39.71 ? 23  GLU A CD  1 
ATOM   204   O OE1 . GLU A 1 23  ? 5.700   -22.573 62.440  1.00 41.64 ? 23  GLU A OE1 1 
ATOM   205   O OE2 . GLU A 1 23  ? 6.804   -21.138 61.191  1.00 41.75 ? 23  GLU A OE2 1 
ATOM   206   N N   . LEU A 1 24  ? 9.654   -20.444 66.503  1.00 31.59 ? 24  LEU A N   1 
ATOM   207   C CA  . LEU A 1 24  ? 10.634  -19.361 66.427  1.00 29.47 ? 24  LEU A CA  1 
ATOM   208   C C   . LEU A 1 24  ? 11.897  -19.599 67.255  1.00 27.84 ? 24  LEU A C   1 
ATOM   209   O O   . LEU A 1 24  ? 11.936  -19.277 68.448  1.00 28.08 ? 24  LEU A O   1 
ATOM   210   C CB  . LEU A 1 24  ? 9.979   -18.054 66.871  1.00 29.10 ? 24  LEU A CB  1 
ATOM   211   C CG  . LEU A 1 24  ? 8.803   -17.625 65.996  1.00 28.61 ? 24  LEU A CG  1 
ATOM   212   C CD1 . LEU A 1 24  ? 8.016   -16.505 66.667  1.00 27.55 ? 24  LEU A CD1 1 
ATOM   213   C CD2 . LEU A 1 24  ? 9.296   -17.184 64.627  1.00 28.91 ? 24  LEU A CD2 1 
ATOM   214   N N   . ASN A 1 25  ? 12.912  -20.187 66.619  1.00 24.94 ? 25  ASN A N   1 
ATOM   215   C CA  . ASN A 1 25  ? 14.214  -20.436 67.245  1.00 22.98 ? 25  ASN A CA  1 
ATOM   216   C C   . ASN A 1 25  ? 15.296  -19.910 66.320  1.00 21.55 ? 25  ASN A C   1 
ATOM   217   O O   . ASN A 1 25  ? 15.477  -20.410 65.205  1.00 19.72 ? 25  ASN A O   1 
ATOM   218   C CB  . ASN A 1 25  ? 14.454  -21.927 67.521  1.00 22.86 ? 25  ASN A CB  1 
ATOM   219   C CG  . ASN A 1 25  ? 15.806  -22.186 68.167  1.00 22.41 ? 25  ASN A CG  1 
ATOM   220   O OD1 . ASN A 1 25  ? 16.799  -22.400 67.478  1.00 20.44 ? 25  ASN A OD1 1 
ATOM   221   N ND2 . ASN A 1 25  ? 15.850  -22.159 69.505  1.00 23.13 ? 25  ASN A ND2 1 
ATOM   222   N N   . LEU A 1 26  ? 16.004  -18.886 66.787  1.00 20.13 ? 26  LEU A N   1 
ATOM   223   C CA  . LEU A 1 26  ? 17.025  -18.222 65.984  1.00 19.66 ? 26  LEU A CA  1 
ATOM   224   C C   . LEU A 1 26  ? 18.099  -19.154 65.458  1.00 19.76 ? 26  LEU A C   1 
ATOM   225   O O   . LEU A 1 26  ? 18.476  -19.076 64.300  1.00 19.68 ? 26  LEU A O   1 
ATOM   226   C CB  . LEU A 1 26  ? 17.688  -17.104 66.789  1.00 19.31 ? 26  LEU A CB  1 
ATOM   227   C CG  . LEU A 1 26  ? 16.743  -15.983 67.237  1.00 18.98 ? 26  LEU A CG  1 
ATOM   228   C CD1 . LEU A 1 26  ? 17.423  -14.940 68.139  1.00 18.29 ? 26  LEU A CD1 1 
ATOM   229   C CD2 . LEU A 1 26  ? 16.134  -15.281 66.033  1.00 19.89 ? 26  LEU A CD2 1 
ATOM   230   N N   . ARG A 1 27  ? 18.608  -20.036 66.299  1.00 20.25 ? 27  ARG A N   1 
ATOM   231   C CA  . ARG A 1 27  ? 19.654  -20.926 65.844  1.00 20.76 ? 27  ARG A CA  1 
ATOM   232   C C   . ARG A 1 27  ? 19.167  -21.718 64.628  1.00 20.68 ? 27  ARG A C   1 
ATOM   233   O O   . ARG A 1 27  ? 19.863  -21.837 63.612  1.00 19.81 ? 27  ARG A O   1 
ATOM   234   C CB  . ARG A 1 27  ? 20.061  -21.880 66.957  1.00 21.33 ? 27  ARG A CB  1 
ATOM   235   C CG  . ARG A 1 27  ? 21.523  -22.145 66.959  1.00 21.63 ? 27  ARG A CG  1 
ATOM   236   C CD  . ARG A 1 27  ? 21.904  -23.346 67.765  1.00 21.93 ? 27  ARG A CD  1 
ATOM   237   N NE  . ARG A 1 27  ? 22.696  -22.985 68.928  1.00 23.03 ? 27  ARG A NE  1 
ATOM   238   C CZ  . ARG A 1 27  ? 23.627  -23.769 69.466  1.00 22.32 ? 27  ARG A CZ  1 
ATOM   239   N NH1 . ARG A 1 27  ? 23.879  -24.962 68.946  1.00 23.52 ? 27  ARG A NH1 1 
ATOM   240   N NH2 . ARG A 1 27  ? 24.312  -23.366 70.520  1.00 21.83 ? 27  ARG A NH2 1 
ATOM   241   N N   . ARG A 1 28  ? 17.954  -22.244 64.717  1.00 20.84 ? 28  ARG A N   1 
ATOM   242   C CA  . ARG A 1 28  ? 17.394  -22.998 63.609  1.00 22.03 ? 28  ARG A CA  1 
ATOM   243   C C   . ARG A 1 28  ? 17.095  -22.127 62.387  1.00 21.69 ? 28  ARG A C   1 
ATOM   244   O O   . ARG A 1 28  ? 17.349  -22.534 61.254  1.00 21.62 ? 28  ARG A O   1 
ATOM   245   C CB  . ARG A 1 28  ? 16.157  -23.759 64.071  1.00 23.02 ? 28  ARG A CB  1 
ATOM   246   C CG  . ARG A 1 28  ? 16.556  -24.866 65.049  1.00 25.83 ? 28  ARG A CG  1 
ATOM   247   C CD  . ARG A 1 28  ? 15.543  -25.967 65.236  1.00 29.82 ? 28  ARG A CD  1 
ATOM   248   N NE  . ARG A 1 28  ? 14.506  -25.584 66.182  1.00 33.48 ? 28  ARG A NE  1 
ATOM   249   C CZ  . ARG A 1 28  ? 14.639  -25.632 67.503  1.00 36.04 ? 28  ARG A CZ  1 
ATOM   250   N NH1 . ARG A 1 28  ? 15.771  -26.070 68.062  1.00 37.14 ? 28  ARG A NH1 1 
ATOM   251   N NH2 . ARG A 1 28  ? 13.629  -25.254 68.278  1.00 37.35 ? 28  ARG A NH2 1 
ATOM   252   N N   . LEU A 1 29  ? 16.562  -20.930 62.623  1.00 21.03 ? 29  LEU A N   1 
ATOM   253   C CA  . LEU A 1 29  ? 16.238  -19.995 61.543  1.00 20.71 ? 29  LEU A CA  1 
ATOM   254   C C   . LEU A 1 29  ? 17.480  -19.683 60.710  1.00 20.11 ? 29  LEU A C   1 
ATOM   255   O O   . LEU A 1 29  ? 17.437  -19.726 59.476  1.00 19.66 ? 29  LEU A O   1 
ATOM   256   C CB  . LEU A 1 29  ? 15.610  -18.709 62.109  1.00 20.69 ? 29  LEU A CB  1 
ATOM   257   C CG  . LEU A 1 29  ? 14.138  -18.809 62.531  1.00 21.55 ? 29  LEU A CG  1 
ATOM   258   C CD1 . LEU A 1 29  ? 13.690  -17.627 63.367  1.00 21.37 ? 29  LEU A CD1 1 
ATOM   259   C CD2 . LEU A 1 29  ? 13.216  -18.947 61.330  1.00 22.50 ? 29  LEU A CD2 1 
ATOM   260   N N   . PHE A 1 30  ? 18.593  -19.406 61.384  1.00 19.63 ? 30  PHE A N   1 
ATOM   261   C CA  . PHE A 1 30  ? 19.836  -19.132 60.687  1.00 19.63 ? 30  PHE A CA  1 
ATOM   262   C C   . PHE A 1 30  ? 20.408  -20.388 60.001  1.00 20.41 ? 30  PHE A C   1 
ATOM   263   O O   . PHE A 1 30  ? 20.986  -20.290 58.938  1.00 20.05 ? 30  PHE A O   1 
ATOM   264   C CB  . PHE A 1 30  ? 20.868  -18.502 61.619  1.00 18.95 ? 30  PHE A CB  1 
ATOM   265   C CG  . PHE A 1 30  ? 20.700  -17.011 61.777  1.00 17.27 ? 30  PHE A CG  1 
ATOM   266   C CD1 . PHE A 1 30  ? 19.999  -16.495 62.845  1.00 15.64 ? 30  PHE A CD1 1 
ATOM   267   C CD2 . PHE A 1 30  ? 21.225  -16.142 60.840  1.00 15.82 ? 30  PHE A CD2 1 
ATOM   268   C CE1 . PHE A 1 30  ? 19.831  -15.137 62.999  1.00 15.39 ? 30  PHE A CE1 1 
ATOM   269   C CE2 . PHE A 1 30  ? 21.056  -14.762 60.977  1.00 16.09 ? 30  PHE A CE2 1 
ATOM   270   C CZ  . PHE A 1 30  ? 20.359  -14.262 62.063  1.00 14.53 ? 30  PHE A CZ  1 
ATOM   271   N N   . ASP A 1 31  ? 20.258  -21.557 60.603  1.00 21.54 ? 31  ASP A N   1 
ATOM   272   C CA  . ASP A 1 31  ? 20.785  -22.777 59.974  1.00 23.01 ? 31  ASP A CA  1 
ATOM   273   C C   . ASP A 1 31  ? 20.032  -23.103 58.695  1.00 23.74 ? 31  ASP A C   1 
ATOM   274   O O   . ASP A 1 31  ? 20.620  -23.602 57.740  1.00 24.44 ? 31  ASP A O   1 
ATOM   275   C CB  . ASP A 1 31  ? 20.715  -23.962 60.927  1.00 23.26 ? 31  ASP A CB  1 
ATOM   276   C CG  . ASP A 1 31  ? 21.838  -23.963 61.936  1.00 24.91 ? 31  ASP A CG  1 
ATOM   277   O OD1 . ASP A 1 31  ? 21.747  -24.716 62.925  1.00 26.85 ? 31  ASP A OD1 1 
ATOM   278   O OD2 . ASP A 1 31  ? 22.851  -23.239 61.837  1.00 27.86 ? 31  ASP A OD2 1 
ATOM   279   N N   . ALA A 1 32  ? 18.734  -22.808 58.685  1.00 24.70 ? 32  ALA A N   1 
ATOM   280   C CA  . ALA A 1 32  ? 17.872  -23.075 57.535  1.00 25.12 ? 32  ALA A CA  1 
ATOM   281   C C   . ALA A 1 32  ? 17.955  -22.046 56.395  1.00 25.63 ? 32  ALA A C   1 
ATOM   282   O O   . ALA A 1 32  ? 17.597  -22.368 55.268  1.00 25.68 ? 32  ALA A O   1 
ATOM   283   C CB  . ALA A 1 32  ? 16.423  -23.192 58.005  1.00 24.93 ? 32  ALA A CB  1 
ATOM   284   N N   . ASN A 1 33  ? 18.401  -20.821 56.684  1.00 26.18 ? 33  ASN A N   1 
ATOM   285   C CA  . ASN A 1 33  ? 18.452  -19.743 55.688  1.00 26.63 ? 33  ASN A CA  1 
ATOM   286   C C   . ASN A 1 33  ? 19.801  -19.020 55.719  1.00 26.59 ? 33  ASN A C   1 
ATOM   287   O O   . ASN A 1 33  ? 20.017  -18.099 56.517  1.00 26.14 ? 33  ASN A O   1 
ATOM   288   C CB  . ASN A 1 33  ? 17.315  -18.733 55.940  1.00 27.07 ? 33  ASN A CB  1 
ATOM   289   C CG  . ASN A 1 33  ? 17.264  -17.575 54.894  1.00 28.21 ? 33  ASN A CG  1 
ATOM   290   O OD1 . ASN A 1 33  ? 17.970  -17.579 53.874  1.00 28.62 ? 33  ASN A OD1 1 
ATOM   291   N ND2 . ASN A 1 33  ? 16.406  -16.582 55.166  1.00 29.28 ? 33  ASN A ND2 1 
ATOM   292   N N   . LYS A 1 34  ? 20.707  -19.455 54.854  1.00 26.26 ? 34  LYS A N   1 
ATOM   293   C CA  . LYS A 1 34  ? 22.020  -18.820 54.691  1.00 26.70 ? 34  LYS A CA  1 
ATOM   294   C C   . LYS A 1 34  ? 21.885  -17.351 54.284  1.00 25.52 ? 34  LYS A C   1 
ATOM   295   O O   . LYS A 1 34  ? 22.798  -16.550 54.469  1.00 25.50 ? 34  LYS A O   1 
ATOM   296   C CB  . LYS A 1 34  ? 22.824  -19.604 53.641  1.00 27.66 ? 34  LYS A CB  1 
ATOM   297   C CG  . LYS A 1 34  ? 23.414  -18.793 52.467  1.00 31.13 ? 34  LYS A CG  1 
ATOM   298   C CD  . LYS A 1 34  ? 24.945  -18.596 52.611  1.00 34.37 ? 34  LYS A CD  1 
ATOM   299   C CE  . LYS A 1 34  ? 25.480  -17.494 51.692  1.00 36.28 ? 34  LYS A CE  1 
ATOM   300   N NZ  . LYS A 1 34  ? 25.348  -16.109 52.284  1.00 38.10 ? 34  LYS A NZ  1 
ATOM   301   N N   . ASP A 1 35  ? 20.740  -16.996 53.719  1.00 24.46 ? 35  ASP A N   1 
ATOM   302   C CA  . ASP A 1 35  ? 20.506  -15.625 53.290  1.00 24.03 ? 35  ASP A CA  1 
ATOM   303   C C   . ASP A 1 35  ? 19.707  -14.792 54.275  1.00 21.90 ? 35  ASP A C   1 
ATOM   304   O O   . ASP A 1 35  ? 19.201  -13.711 53.941  1.00 21.12 ? 35  ASP A O   1 
ATOM   305   C CB  . ASP A 1 35  ? 19.828  -15.643 51.946  1.00 24.50 ? 35  ASP A CB  1 
ATOM   306   C CG  . ASP A 1 35  ? 20.814  -15.870 50.858  1.00 28.67 ? 35  ASP A CG  1 
ATOM   307   O OD1 . ASP A 1 35  ? 21.063  -17.043 50.518  1.00 34.33 ? 35  ASP A OD1 1 
ATOM   308   O OD2 . ASP A 1 35  ? 21.459  -14.927 50.351  1.00 33.72 ? 35  ASP A OD2 1 
ATOM   309   N N   . ARG A 1 36  ? 19.635  -15.268 55.507  1.00 19.78 ? 36  ARG A N   1 
ATOM   310   C CA  . ARG A 1 36  ? 18.841  -14.569 56.504  1.00 18.48 ? 36  ARG A CA  1 
ATOM   311   C C   . ARG A 1 36  ? 19.315  -13.128 56.762  1.00 17.20 ? 36  ARG A C   1 
ATOM   312   O O   . ARG A 1 36  ? 18.474  -12.233 56.842  1.00 17.13 ? 36  ARG A O   1 
ATOM   313   C CB  . ARG A 1 36  ? 18.757  -15.383 57.801  1.00 18.40 ? 36  ARG A CB  1 
ATOM   314   C CG  . ARG A 1 36  ? 17.714  -14.832 58.770  1.00 17.37 ? 36  ARG A CG  1 
ATOM   315   C CD  . ARG A 1 36  ? 17.534  -15.647 60.034  1.00 15.69 ? 36  ARG A CD  1 
ATOM   316   N NE  . ARG A 1 36  ? 16.780  -14.892 61.024  1.00 15.71 ? 36  ARG A NE  1 
ATOM   317   C CZ  . ARG A 1 36  ? 15.455  -14.821 61.078  1.00 15.78 ? 36  ARG A CZ  1 
ATOM   318   N NH1 . ARG A 1 36  ? 14.693  -15.464 60.202  1.00 15.98 ? 36  ARG A NH1 1 
ATOM   319   N NH2 . ARG A 1 36  ? 14.882  -14.097 62.023  1.00 15.37 ? 36  ARG A NH2 1 
ATOM   320   N N   . PHE A 1 37  ? 20.625  -12.891 56.882  1.00 15.80 ? 37  PHE A N   1 
ATOM   321   C CA  . PHE A 1 37  ? 21.136  -11.535 57.112  1.00 15.61 ? 37  PHE A CA  1 
ATOM   322   C C   . PHE A 1 37  ? 20.725  -10.634 55.974  1.00 15.52 ? 37  PHE A C   1 
ATOM   323   O O   . PHE A 1 37  ? 20.252  -9.523  56.193  1.00 14.81 ? 37  PHE A O   1 
ATOM   324   C CB  . PHE A 1 37  ? 22.665  -11.527 57.268  1.00 14.80 ? 37  PHE A CB  1 
ATOM   325   C CG  . PHE A 1 37  ? 23.300  -10.152 57.190  1.00 14.97 ? 37  PHE A CG  1 
ATOM   326   C CD1 . PHE A 1 37  ? 23.387  -9.341  58.316  1.00 15.07 ? 37  PHE A CD1 1 
ATOM   327   C CD2 . PHE A 1 37  ? 23.859  -9.691  56.010  1.00 13.25 ? 37  PHE A CD2 1 
ATOM   328   C CE1 . PHE A 1 37  ? 23.993  -8.093  58.252  1.00 14.26 ? 37  PHE A CE1 1 
ATOM   329   C CE2 . PHE A 1 37  ? 24.450  -8.438  55.948  1.00 12.90 ? 37  PHE A CE2 1 
ATOM   330   C CZ  . PHE A 1 37  ? 24.523  -7.653  57.079  1.00 14.59 ? 37  PHE A CZ  1 
ATOM   331   N N   . ASN A 1 38  ? 20.905  -11.115 54.748  1.00 16.28 ? 38  ASN A N   1 
ATOM   332   C CA  . ASN A 1 38  ? 20.526  -10.339 53.587  1.00 17.52 ? 38  ASN A CA  1 
ATOM   333   C C   . ASN A 1 38  ? 19.033  -10.000 53.570  1.00 17.36 ? 38  ASN A C   1 
ATOM   334   O O   . ASN A 1 38  ? 18.661  -8.890  53.202  1.00 17.73 ? 38  ASN A O   1 
ATOM   335   C CB  . ASN A 1 38  ? 20.929  -11.053 52.287  1.00 18.48 ? 38  ASN A CB  1 
ATOM   336   C CG  . ASN A 1 38  ? 22.452  -11.222 52.147  1.00 21.88 ? 38  ASN A CG  1 
ATOM   337   O OD1 . ASN A 1 38  ? 23.239  -10.341 52.534  1.00 26.41 ? 38  ASN A OD1 1 
ATOM   338   N ND2 . ASN A 1 38  ? 22.870  -12.360 51.602  1.00 26.16 ? 38  ASN A ND2 1 
ATOM   339   N N   . HIS A 1 39  ? 18.170  -10.918 54.000  1.00 17.14 ? 39  HIS A N   1 
ATOM   340   C CA  . HIS A 1 39  ? 16.720  -10.667 53.936  1.00 17.13 ? 39  HIS A CA  1 
ATOM   341   C C   . HIS A 1 39  ? 16.187  -9.791  55.096  1.00 15.97 ? 39  HIS A C   1 
ATOM   342   O O   . HIS A 1 39  ? 15.116  -9.207  54.985  1.00 15.47 ? 39  HIS A O   1 
ATOM   343   C CB  . HIS A 1 39  ? 15.946  -11.988 53.902  1.00 17.86 ? 39  HIS A CB  1 
ATOM   344   C CG  . HIS A 1 39  ? 16.214  -12.819 52.680  1.00 21.10 ? 39  HIS A CG  1 
ATOM   345   N ND1 . HIS A 1 39  ? 15.493  -13.955 52.378  1.00 26.34 ? 39  HIS A ND1 1 
ATOM   346   C CD2 . HIS A 1 39  ? 17.131  -12.684 51.691  1.00 24.86 ? 39  HIS A CD2 1 
ATOM   347   C CE1 . HIS A 1 39  ? 15.953  -14.483 51.257  1.00 25.23 ? 39  HIS A CE1 1 
ATOM   348   N NE2 . HIS A 1 39  ? 16.944  -13.729 50.817  1.00 26.10 ? 39  HIS A NE2 1 
ATOM   349   N N   . PHE A 1 40  ? 16.932  -9.703  56.191  1.00 14.27 ? 40  PHE A N   1 
ATOM   350   C CA  . PHE A 1 40  ? 16.451  -8.976  57.371  1.00 14.02 ? 40  PHE A CA  1 
ATOM   351   C C   . PHE A 1 40  ? 17.472  -7.918  57.826  1.00 12.78 ? 40  PHE A C   1 
ATOM   352   O O   . PHE A 1 40  ? 17.840  -7.838  58.996  1.00 11.66 ? 40  PHE A O   1 
ATOM   353   C CB  . PHE A 1 40  ? 16.118  -9.956  58.521  1.00 14.16 ? 40  PHE A CB  1 
ATOM   354   C CG  . PHE A 1 40  ? 15.043  -10.978 58.191  1.00 16.00 ? 40  PHE A CG  1 
ATOM   355   C CD1 . PHE A 1 40  ? 15.382  -12.255 57.791  1.00 18.78 ? 40  PHE A CD1 1 
ATOM   356   C CD2 . PHE A 1 40  ? 13.699  -10.668 58.314  1.00 20.70 ? 40  PHE A CD2 1 
ATOM   357   C CE1 . PHE A 1 40  ? 14.406  -13.200 57.483  1.00 20.45 ? 40  PHE A CE1 1 
ATOM   358   C CE2 . PHE A 1 40  ? 12.705  -11.617 58.010  1.00 21.13 ? 40  PHE A CE2 1 
ATOM   359   C CZ  . PHE A 1 40  ? 13.067  -12.880 57.591  1.00 19.21 ? 40  PHE A CZ  1 
ATOM   360   N N   . SER A 1 41  ? 17.948  -7.124  56.879  1.00 12.62 ? 41  SER A N   1 
ATOM   361   C CA  . SER A 1 41  ? 18.855  -6.033  57.198  1.00 12.57 ? 41  SER A CA  1 
ATOM   362   C C   . SER A 1 41  ? 18.664  -4.908  56.195  1.00 12.79 ? 41  SER A C   1 
ATOM   363   O O   . SER A 1 41  ? 18.167  -5.112  55.074  1.00 12.32 ? 41  SER A O   1 
ATOM   364   C CB  . SER A 1 41  ? 20.322  -6.499  57.241  1.00 12.31 ? 41  SER A CB  1 
ATOM   365   O OG  . SER A 1 41  ? 20.812  -6.853  55.958  1.00 11.86 ? 41  SER A OG  1 
ATOM   366   N N   . LEU A 1 42  ? 19.013  -3.705  56.625  1.00 13.54 ? 42  LEU A N   1 
ATOM   367   C CA  . LEU A 1 42  ? 18.932  -2.528  55.784  1.00 14.11 ? 42  LEU A CA  1 
ATOM   368   C C   . LEU A 1 42  ? 20.293  -1.878  55.740  1.00 14.28 ? 42  LEU A C   1 
ATOM   369   O O   . LEU A 1 42  ? 20.965  -1.759  56.765  1.00 12.52 ? 42  LEU A O   1 
ATOM   370   C CB  . LEU A 1 42  ? 17.975  -1.494  56.379  1.00 14.87 ? 42  LEU A CB  1 
ATOM   371   C CG  . LEU A 1 42  ? 16.531  -1.802  56.731  1.00 16.52 ? 42  LEU A CG  1 
ATOM   372   C CD1 . LEU A 1 42  ? 15.927  -0.580  57.442  1.00 18.25 ? 42  LEU A CD1 1 
ATOM   373   C CD2 . LEU A 1 42  ? 15.749  -2.129  55.457  1.00 19.38 ? 42  LEU A CD2 1 
ATOM   374   N N   . THR A 1 43  ? 20.705  -1.443  54.556  1.00 14.33 ? 43  THR A N   1 
ATOM   375   C CA  . THR A 1 43  ? 21.906  -0.641  54.439  1.00 15.79 ? 43  THR A CA  1 
ATOM   376   C C   . THR A 1 43  ? 21.538  0.722   53.891  1.00 14.88 ? 43  THR A C   1 
ATOM   377   O O   . THR A 1 43  ? 20.960  0.833   52.812  1.00 14.71 ? 43  THR A O   1 
ATOM   378   C CB  . THR A 1 43  ? 22.915  -1.324  53.516  1.00 16.59 ? 43  THR A CB  1 
ATOM   379   O OG1 . THR A 1 43  ? 23.287  -2.573  54.096  1.00 19.49 ? 43  THR A OG1 1 
ATOM   380   C CG2 . THR A 1 43  ? 24.198  -0.551  53.492  1.00 19.24 ? 43  THR A CG2 1 
ATOM   381   N N   . LEU A 1 44  ? 21.838  1.756   54.657  1.00 14.19 ? 44  LEU A N   1 
ATOM   382   C CA  . LEU A 1 44  ? 21.520  3.115   54.281  1.00 13.73 ? 44  LEU A CA  1 
ATOM   383   C C   . LEU A 1 44  ? 22.811  3.906   54.024  1.00 13.16 ? 44  LEU A C   1 
ATOM   384   O O   . LEU A 1 44  ? 23.703  3.963   54.906  1.00 11.97 ? 44  LEU A O   1 
ATOM   385   C CB  . LEU A 1 44  ? 20.759  3.792   55.416  1.00 14.17 ? 44  LEU A CB  1 
ATOM   386   C CG  . LEU A 1 44  ? 19.482  3.114   55.920  1.00 16.45 ? 44  LEU A CG  1 
ATOM   387   C CD1 . LEU A 1 44  ? 18.829  4.010   56.933  1.00 16.54 ? 44  LEU A CD1 1 
ATOM   388   C CD2 . LEU A 1 44  ? 18.558  2.877   54.756  1.00 18.17 ? 44  LEU A CD2 1 
ATOM   389   N N   . ASN A 1 45  ? 22.927  4.486   52.824  1.00 11.57 ? 45  ASN A N   1 
ATOM   390   C CA  . ASN A 1 45  ? 24.046  5.356   52.493  1.00 10.83 ? 45  ASN A CA  1 
ATOM   391   C C   . ASN A 1 45  ? 23.574  6.790   52.601  1.00 10.44 ? 45  ASN A C   1 
ATOM   392   O O   . ASN A 1 45  ? 22.752  7.214   51.801  1.00 10.72 ? 45  ASN A O   1 
ATOM   393   C CB  . ASN A 1 45  ? 24.575  5.126   51.071  1.00 10.90 ? 45  ASN A CB  1 
ATOM   394   C CG  . ASN A 1 45  ? 25.770  6.003   50.756  1.00 11.26 ? 45  ASN A CG  1 
ATOM   395   O OD1 . ASN A 1 45  ? 26.207  6.803   51.600  1.00 11.23 ? 45  ASN A OD1 1 
ATOM   396   N ND2 . ASN A 1 45  ? 26.319  5.865   49.536  1.00 11.24 ? 45  ASN A ND2 1 
ATOM   397   N N   . THR A 1 46  ? 24.083  7.543   53.577  1.00 9.75  ? 46  THR A N   1 
ATOM   398   C CA  . THR A 1 46  ? 23.654  8.934   53.756  1.00 9.45  ? 46  THR A CA  1 
ATOM   399   C C   . THR A 1 46  ? 24.482  9.944   52.984  1.00 9.29  ? 46  THR A C   1 
ATOM   400   O O   . THR A 1 46  ? 24.189  11.158  53.028  1.00 9.30  ? 46  THR A O   1 
ATOM   401   C CB  . THR A 1 46  ? 23.739  9.353   55.231  1.00 9.59  ? 46  THR A CB  1 
ATOM   402   O OG1 . THR A 1 46  ? 25.106  9.387   55.645  1.00 8.69  ? 46  THR A OG1 1 
ATOM   403   C CG2 . THR A 1 46  ? 23.073  8.340   56.178  1.00 9.43  ? 46  THR A CG2 1 
ATOM   404   N N   . ASN A 1 47  ? 25.514  9.451   52.310  1.00 9.46  ? 47  ASN A N   1 
ATOM   405   C CA  . ASN A 1 47  ? 26.527  10.262  51.653  1.00 10.01 ? 47  ASN A CA  1 
ATOM   406   C C   . ASN A 1 47  ? 27.547  10.821  52.652  1.00 10.16 ? 47  ASN A C   1 
ATOM   407   O O   . ASN A 1 47  ? 28.554  11.406  52.252  1.00 10.52 ? 47  ASN A O   1 
ATOM   408   C CB  . ASN A 1 47  ? 25.914  11.344  50.775  1.00 10.95 ? 47  ASN A CB  1 
ATOM   409   C CG  . ASN A 1 47  ? 25.306  10.759  49.533  1.00 12.47 ? 47  ASN A CG  1 
ATOM   410   O OD1 . ASN A 1 47  ? 25.782  9.727   49.033  1.00 14.05 ? 47  ASN A OD1 1 
ATOM   411   N ND2 . ASN A 1 47  ? 24.237  11.370  49.042  1.00 14.24 ? 47  ASN A ND2 1 
ATOM   412   N N   . HIS A 1 48  ? 27.291  10.624  53.940  1.00 9.80  ? 48  HIS A N   1 
ATOM   413   C CA  . HIS A 1 48  ? 28.223  11.053  54.993  1.00 10.56 ? 48  HIS A CA  1 
ATOM   414   C C   . HIS A 1 48  ? 28.401  9.915   55.993  1.00 10.46 ? 48  HIS A C   1 
ATOM   415   O O   . HIS A 1 48  ? 28.532  10.132  57.196  1.00 9.63  ? 48  HIS A O   1 
ATOM   416   C CB  . HIS A 1 48  ? 27.716  12.295  55.696  1.00 10.70 ? 48  HIS A CB  1 
ATOM   417   C CG  . HIS A 1 48  ? 27.374  13.396  54.754  1.00 14.09 ? 48  HIS A CG  1 
ATOM   418   N ND1 . HIS A 1 48  ? 28.337  14.106  54.065  1.00 17.48 ? 48  HIS A ND1 1 
ATOM   419   C CD2 . HIS A 1 48  ? 26.178  13.869  54.332  1.00 15.40 ? 48  HIS A CD2 1 
ATOM   420   C CE1 . HIS A 1 48  ? 27.744  14.990  53.281  1.00 18.13 ? 48  HIS A CE1 1 
ATOM   421   N NE2 . HIS A 1 48  ? 26.436  14.867  53.427  1.00 16.70 ? 48  HIS A NE2 1 
ATOM   422   N N   . GLY A 1 49  ? 28.455  8.698   55.467  1.00 10.69 ? 49  GLY A N   1 
ATOM   423   C CA  . GLY A 1 49  ? 28.524  7.514   56.294  1.00 10.66 ? 49  GLY A CA  1 
ATOM   424   C C   . GLY A 1 49  ? 27.360  6.572   56.019  1.00 10.75 ? 49  GLY A C   1 
ATOM   425   O O   . GLY A 1 49  ? 26.274  6.991   55.628  1.00 10.92 ? 49  GLY A O   1 
ATOM   426   N N   . HIS A 1 50  ? 27.600  5.282   56.229  1.00 10.07 ? 50  HIS A N   1 
ATOM   427   C CA  . HIS A 1 50  ? 26.568  4.272   56.071  1.00 10.11 ? 50  HIS A CA  1 
ATOM   428   C C   . HIS A 1 50  ? 25.990  3.857   57.419  1.00 9.66  ? 50  HIS A C   1 
ATOM   429   O O   . HIS A 1 50  ? 26.668  3.938   58.449  1.00 9.45  ? 50  HIS A O   1 
ATOM   430   C CB  . HIS A 1 50  ? 27.152  3.018   55.382  1.00 10.09 ? 50  HIS A CB  1 
ATOM   431   C CG  . HIS A 1 50  ? 27.333  3.167   53.900  1.00 11.19 ? 50  HIS A CG  1 
ATOM   432   N ND1 . HIS A 1 50  ? 28.205  4.080   53.347  1.00 12.20 ? 50  HIS A ND1 1 
ATOM   433   C CD2 . HIS A 1 50  ? 26.783  2.493   52.857  1.00 11.35 ? 50  HIS A CD2 1 
ATOM   434   C CE1 . HIS A 1 50  ? 28.162  3.986   52.026  1.00 11.81 ? 50  HIS A CE1 1 
ATOM   435   N NE2 . HIS A 1 50  ? 27.305  3.031   51.702  1.00 10.50 ? 50  HIS A NE2 1 
ATOM   436   N N   . ILE A 1 51  ? 24.742  3.407   57.394  1.00 9.25  ? 51  ILE A N   1 
ATOM   437   C CA  . ILE A 1 51  ? 24.116  2.782   58.546  1.00 9.85  ? 51  ILE A CA  1 
ATOM   438   C C   . ILE A 1 51  ? 23.600  1.391   58.168  1.00 10.17 ? 51  ILE A C   1 
ATOM   439   O O   . ILE A 1 51  ? 22.805  1.242   57.233  1.00 11.06 ? 51  ILE A O   1 
ATOM   440   C CB  . ILE A 1 51  ? 22.935  3.558   59.046  1.00 9.72  ? 51  ILE A CB  1 
ATOM   441   C CG1 . ILE A 1 51  ? 23.289  5.028   59.260  1.00 9.50  ? 51  ILE A CG1 1 
ATOM   442   C CG2 . ILE A 1 51  ? 22.421  2.886   60.338  1.00 10.07 ? 51  ILE A CG2 1 
ATOM   443   C CD1 . ILE A 1 51  ? 22.085  5.928   59.481  1.00 10.63 ? 51  ILE A CD1 1 
ATOM   444   N N   . LEU A 1 52  ? 24.043  0.388   58.905  1.00 10.15 ? 52  LEU A N   1 
ATOM   445   C CA  . LEU A 1 52  ? 23.532  -0.975  58.736  1.00 10.20 ? 52  LEU A CA  1 
ATOM   446   C C   . LEU A 1 52  ? 22.572  -1.265  59.878  1.00 10.43 ? 52  LEU A C   1 
ATOM   447   O O   . LEU A 1 52  ? 22.973  -1.219  61.037  1.00 10.93 ? 52  LEU A O   1 
ATOM   448   C CB  . LEU A 1 52  ? 24.675  -1.978  58.751  1.00 10.13 ? 52  LEU A CB  1 
ATOM   449   C CG  . LEU A 1 52  ? 24.308  -3.455  58.971  1.00 12.19 ? 52  LEU A CG  1 
ATOM   450   C CD1 . LEU A 1 52  ? 23.334  -3.918  57.878  1.00 11.30 ? 52  LEU A CD1 1 
ATOM   451   C CD2 . LEU A 1 52  ? 25.585  -4.302  58.986  1.00 13.35 ? 52  LEU A CD2 1 
ATOM   452   N N   . VAL A 1 53  ? 21.300  -1.492  59.563  1.00 9.95  ? 53  VAL A N   1 
ATOM   453   C CA  . VAL A 1 53  ? 20.324  -1.853  60.589  1.00 9.57  ? 53  VAL A CA  1 
ATOM   454   C C   . VAL A 1 53  ? 20.080  -3.333  60.371  1.00 8.97  ? 53  VAL A C   1 
ATOM   455   O O   . VAL A 1 53  ? 19.348  -3.734  59.452  1.00 9.17  ? 53  VAL A O   1 
ATOM   456   C CB  . VAL A 1 53  ? 18.992  -1.072  60.487  1.00 9.43  ? 53  VAL A CB  1 
ATOM   457   C CG1 . VAL A 1 53  ? 18.070  -1.431  61.640  1.00 9.28  ? 53  VAL A CG1 1 
ATOM   458   C CG2 . VAL A 1 53  ? 19.225  0.445   60.451  1.00 9.94  ? 53  VAL A CG2 1 
ATOM   459   N N   . ASP A 1 54  ? 20.743  -4.140  61.181  1.00 9.74  ? 54  ASP A N   1 
ATOM   460   C CA  . ASP A 1 54  ? 20.652  -5.590  61.088  1.00 9.87  ? 54  ASP A CA  1 
ATOM   461   C C   . ASP A 1 54  ? 19.654  -6.083  62.107  1.00 10.36 ? 54  ASP A C   1 
ATOM   462   O O   . ASP A 1 54  ? 19.951  -6.137  63.315  1.00 10.03 ? 54  ASP A O   1 
ATOM   463   C CB  . ASP A 1 54  ? 22.011  -6.209  61.370  1.00 9.86  ? 54  ASP A CB  1 
ATOM   464   C CG  . ASP A 1 54  ? 21.980  -7.722  61.356  1.00 9.80  ? 54  ASP A CG  1 
ATOM   465   O OD1 . ASP A 1 54  ? 20.893  -8.325  61.136  1.00 8.59  ? 54  ASP A OD1 1 
ATOM   466   O OD2 . ASP A 1 54  ? 23.023  -8.373  61.563  1.00 9.27  ? 54  ASP A OD2 1 
ATOM   467   N N   . TYR A 1 55  ? 18.470  -6.424  61.624  1.00 9.83  ? 55  TYR A N   1 
ATOM   468   C CA  . TYR A 1 55  ? 17.409  -6.888  62.499  1.00 10.74 ? 55  TYR A CA  1 
ATOM   469   C C   . TYR A 1 55  ? 17.180  -8.395  62.293  1.00 10.80 ? 55  TYR A C   1 
ATOM   470   O O   . TYR A 1 55  ? 16.117  -8.909  62.601  1.00 11.92 ? 55  TYR A O   1 
ATOM   471   C CB  . TYR A 1 55  ? 16.128  -6.073  62.277  1.00 10.37 ? 55  TYR A CB  1 
ATOM   472   C CG  . TYR A 1 55  ? 15.568  -6.103  60.861  1.00 10.19 ? 55  TYR A CG  1 
ATOM   473   C CD1 . TYR A 1 55  ? 14.588  -7.025  60.501  1.00 12.42 ? 55  TYR A CD1 1 
ATOM   474   C CD2 . TYR A 1 55  ? 16.007  -5.207  59.898  1.00 10.78 ? 55  TYR A CD2 1 
ATOM   475   C CE1 . TYR A 1 55  ? 14.072  -7.053  59.213  1.00 12.07 ? 55  TYR A CE1 1 
ATOM   476   C CE2 . TYR A 1 55  ? 15.499  -5.230  58.600  1.00 12.08 ? 55  TYR A CE2 1 
ATOM   477   C CZ  . TYR A 1 55  ? 14.542  -6.153  58.268  1.00 12.61 ? 55  TYR A CZ  1 
ATOM   478   O OH  . TYR A 1 55  ? 14.029  -6.159  56.997  1.00 13.76 ? 55  TYR A OH  1 
ATOM   479   N N   . SER A 1 56  ? 18.205  -9.096  61.817  1.00 10.96 ? 56  SER A N   1 
ATOM   480   C CA  . SER A 1 56  ? 18.075  -10.530 61.530  1.00 10.52 ? 56  SER A CA  1 
ATOM   481   C C   . SER A 1 56  ? 18.084  -11.451 62.756  1.00 10.36 ? 56  SER A C   1 
ATOM   482   O O   . SER A 1 56  ? 17.520  -12.550 62.686  1.00 9.99  ? 56  SER A O   1 
ATOM   483   C CB  . SER A 1 56  ? 19.150  -10.987 60.528  1.00 10.08 ? 56  SER A CB  1 
ATOM   484   O OG  . SER A 1 56  ? 20.470  -10.859 61.044  1.00 10.33 ? 56  SER A OG  1 
ATOM   485   N N   . LYS A 1 57  ? 18.691  -11.020 63.870  1.00 10.02 ? 57  LYS A N   1 
ATOM   486   C CA  . LYS A 1 57  ? 18.710  -11.835 65.090  1.00 10.52 ? 57  LYS A CA  1 
ATOM   487   C C   . LYS A 1 57  ? 17.470  -11.584 65.946  1.00 10.69 ? 57  LYS A C   1 
ATOM   488   O O   . LYS A 1 57  ? 17.521  -11.564 67.178  1.00 10.72 ? 57  LYS A O   1 
ATOM   489   C CB  . LYS A 1 57  ? 19.982  -11.603 65.913  1.00 10.18 ? 57  LYS A CB  1 
ATOM   490   C CG  . LYS A 1 57  ? 21.266  -11.708 65.112  1.00 10.89 ? 57  LYS A CG  1 
ATOM   491   C CD  . LYS A 1 57  ? 22.471  -12.002 65.983  1.00 14.72 ? 57  LYS A CD  1 
ATOM   492   C CE  . LYS A 1 57  ? 23.717  -11.271 65.497  1.00 15.59 ? 57  LYS A CE  1 
ATOM   493   N NZ  . LYS A 1 57  ? 24.913  -11.662 66.291  1.00 26.72 ? 57  LYS A NZ  1 
ATOM   494   N N   . ASN A 1 58  ? 16.354  -11.411 65.257  1.00 10.90 ? 58  ASN A N   1 
ATOM   495   C CA  . ASN A 1 58  ? 15.045  -11.235 65.866  1.00 11.34 ? 58  ASN A CA  1 
ATOM   496   C C   . ASN A 1 58  ? 14.151  -12.422 65.600  1.00 11.92 ? 58  ASN A C   1 
ATOM   497   O O   . ASN A 1 58  ? 14.337  -13.142 64.616  1.00 12.10 ? 58  ASN A O   1 
ATOM   498   C CB  . ASN A 1 58  ? 14.382  -9.979  65.316  1.00 10.58 ? 58  ASN A CB  1 
ATOM   499   C CG  . ASN A 1 58  ? 14.962  -8.722  65.917  1.00 11.05 ? 58  ASN A CG  1 
ATOM   500   O OD1 . ASN A 1 58  ? 15.618  -7.932  65.237  1.00 11.82 ? 58  ASN A OD1 1 
ATOM   501   N ND2 . ASN A 1 58  ? 14.748  -8.545  67.215  1.00 7.46  ? 58  ASN A ND2 1 
ATOM   502   N N   . LEU A 1 59  ? 13.170  -12.623 66.474  1.00 12.21 ? 59  LEU A N   1 
ATOM   503   C CA  . LEU A 1 59  ? 12.280  -13.779 66.381  1.00 13.22 ? 59  LEU A CA  1 
ATOM   504   C C   . LEU A 1 59  ? 11.181  -13.550 65.353  1.00 13.66 ? 59  LEU A C   1 
ATOM   505   O O   . LEU A 1 59  ? 10.003  -13.468 65.698  1.00 13.47 ? 59  LEU A O   1 
ATOM   506   C CB  . LEU A 1 59  ? 11.663  -14.085 67.752  1.00 13.94 ? 59  LEU A CB  1 
ATOM   507   C CG  . LEU A 1 59  ? 12.663  -14.291 68.894  1.00 15.84 ? 59  LEU A CG  1 
ATOM   508   C CD1 . LEU A 1 59  ? 11.965  -14.641 70.187  1.00 17.72 ? 59  LEU A CD1 1 
ATOM   509   C CD2 . LEU A 1 59  ? 13.629  -15.344 68.585  1.00 19.40 ? 59  LEU A CD2 1 
ATOM   510   N N   . VAL A 1 60  ? 11.573  -13.453 64.089  1.00 13.04 ? 60  VAL A N   1 
ATOM   511   C CA  . VAL A 1 60  ? 10.648  -13.174 63.010  1.00 14.14 ? 60  VAL A CA  1 
ATOM   512   C C   . VAL A 1 60  ? 10.986  -13.992 61.769  1.00 14.52 ? 60  VAL A C   1 
ATOM   513   O O   . VAL A 1 60  ? 12.138  -14.429 61.595  1.00 13.35 ? 60  VAL A O   1 
ATOM   514   C CB  . VAL A 1 60  ? 10.748  -11.672 62.590  1.00 14.38 ? 60  VAL A CB  1 
ATOM   515   C CG1 . VAL A 1 60  ? 10.357  -10.755 63.738  1.00 15.85 ? 60  VAL A CG1 1 
ATOM   516   C CG2 . VAL A 1 60  ? 12.145  -11.335 62.120  1.00 14.71 ? 60  VAL A CG2 1 
ATOM   517   N N   . THR A 1 61  ? 9.982   -14.150 60.903  1.00 15.18 ? 61  THR A N   1 
ATOM   518   C CA  . THR A 1 61  ? 10.151  -14.758 59.580  1.00 15.85 ? 61  THR A CA  1 
ATOM   519   C C   . THR A 1 61  ? 9.633   -13.762 58.556  1.00 15.90 ? 61  THR A C   1 
ATOM   520   O O   . THR A 1 61  ? 9.087   -12.714 58.907  1.00 15.64 ? 61  THR A O   1 
ATOM   521   C CB  . THR A 1 61  ? 9.309   -16.041 59.409  1.00 15.88 ? 61  THR A CB  1 
ATOM   522   O OG1 . THR A 1 61  ? 7.917   -15.725 59.577  1.00 15.04 ? 61  THR A OG1 1 
ATOM   523   C CG2 . THR A 1 61  ? 9.622   -17.092 60.458  1.00 16.89 ? 61  THR A CG2 1 
ATOM   524   N N   . GLU A 1 62  ? 9.754   -14.103 57.283  1.00 16.38 ? 62  GLU A N   1 
ATOM   525   C CA  . GLU A 1 62  ? 9.230   -13.228 56.249  1.00 16.97 ? 62  GLU A CA  1 
ATOM   526   C C   . GLU A 1 62  ? 7.724   -13.007 56.441  1.00 16.40 ? 62  GLU A C   1 
ATOM   527   O O   . GLU A 1 62  ? 7.239   -11.891 56.240  1.00 16.08 ? 62  GLU A O   1 
ATOM   528   C CB  . GLU A 1 62  ? 9.559   -13.745 54.841  1.00 17.66 ? 62  GLU A CB  1 
ATOM   529   C CG  . GLU A 1 62  ? 11.046  -13.635 54.474  1.00 22.14 ? 62  GLU A CG  1 
ATOM   530   C CD  . GLU A 1 62  ? 11.520  -12.223 54.107  1.00 26.71 ? 62  GLU A CD  1 
ATOM   531   O OE1 . GLU A 1 62  ? 10.826  -11.225 54.419  1.00 31.36 ? 62  GLU A OE1 1 
ATOM   532   O OE2 . GLU A 1 62  ? 12.615  -12.094 53.502  1.00 30.55 ? 62  GLU A OE2 1 
ATOM   533   N N   . ASP A 1 63  ? 6.985   -14.043 56.844  1.00 15.47 ? 63  ASP A N   1 
ATOM   534   C CA  . ASP A 1 63  ? 5.541   -13.881 57.018  1.00 15.61 ? 63  ASP A CA  1 
ATOM   535   C C   . ASP A 1 63  ? 5.252   -12.911 58.147  1.00 14.64 ? 63  ASP A C   1 
ATOM   536   O O   . ASP A 1 63  ? 4.370   -12.063 58.038  1.00 14.44 ? 63  ASP A O   1 
ATOM   537   C CB  . ASP A 1 63  ? 4.843   -15.217 57.276  1.00 15.64 ? 63  ASP A CB  1 
ATOM   538   C CG  . ASP A 1 63  ? 4.702   -16.055 56.016  1.00 18.00 ? 63  ASP A CG  1 
ATOM   539   O OD1 . ASP A 1 63  ? 4.369   -17.246 56.134  1.00 22.08 ? 63  ASP A OD1 1 
ATOM   540   O OD2 . ASP A 1 63  ? 4.917   -15.622 54.871  1.00 20.23 ? 63  ASP A OD2 1 
ATOM   541   N N   . VAL A 1 64  ? 6.002   -13.028 59.236  1.00 14.22 ? 64  VAL A N   1 
ATOM   542   C CA  . VAL A 1 64  ? 5.806   -12.143 60.370  1.00 13.58 ? 64  VAL A CA  1 
ATOM   543   C C   . VAL A 1 64  ? 6.037   -10.702 59.961  1.00 13.40 ? 64  VAL A C   1 
ATOM   544   O O   . VAL A 1 64  ? 5.213   -9.845  60.237  1.00 12.91 ? 64  VAL A O   1 
ATOM   545   C CB  . VAL A 1 64  ? 6.696   -12.533 61.548  1.00 13.80 ? 64  VAL A CB  1 
ATOM   546   C CG1 . VAL A 1 64  ? 6.696   -11.420 62.602  1.00 13.68 ? 64  VAL A CG1 1 
ATOM   547   C CG2 . VAL A 1 64  ? 6.194   -13.852 62.134  1.00 15.32 ? 64  VAL A CG2 1 
ATOM   548   N N   . MET A 1 65  ? 7.118   -10.444 59.230  1.00 13.35 ? 65  MET A N   1 
ATOM   549   C CA  . MET A 1 65  ? 7.422   -9.083  58.804  1.00 13.57 ? 65  MET A CA  1 
ATOM   550   C C   . MET A 1 65  ? 6.339   -8.538  57.896  1.00 13.84 ? 65  MET A C   1 
ATOM   551   O O   . MET A 1 65  ? 5.944   -7.368  58.007  1.00 13.79 ? 65  MET A O   1 
ATOM   552   C CB  . MET A 1 65  ? 8.783   -9.019  58.117  1.00 13.54 ? 65  MET A CB  1 
ATOM   553   C CG  . MET A 1 65  ? 9.977   -9.336  59.012  1.00 13.53 ? 65  MET A CG  1 
ATOM   554   S SD  . MET A 1 65  ? 10.018  -8.443  60.582  1.00 14.72 ? 65  MET A SD  1 
ATOM   555   C CE  . MET A 1 65  ? 10.130  -6.757  59.947  1.00 14.64 ? 65  MET A CE  1 
ATOM   556   N N   . ARG A 1 66  ? 5.856   -9.382  56.985  1.00 14.15 ? 66  ARG A N   1 
ATOM   557   C CA  . ARG A 1 66  ? 4.772   -9.006  56.088  1.00 14.99 ? 66  ARG A CA  1 
ATOM   558   C C   . ARG A 1 66  ? 3.559   -8.586  56.892  1.00 13.73 ? 66  ARG A C   1 
ATOM   559   O O   . ARG A 1 66  ? 2.951   -7.557  56.642  1.00 14.09 ? 66  ARG A O   1 
ATOM   560   C CB  . ARG A 1 66  ? 4.406   -10.204 55.192  1.00 15.77 ? 66  ARG A CB  1 
ATOM   561   C CG  . ARG A 1 66  ? 3.237   -9.967  54.234  1.00 20.14 ? 66  ARG A CG  1 
ATOM   562   C CD  . ARG A 1 66  ? 2.928   -11.191 53.335  1.00 25.40 ? 66  ARG A CD  1 
ATOM   563   N NE  . ARG A 1 66  ? 2.741   -12.419 54.122  1.00 30.26 ? 66  ARG A NE  1 
ATOM   564   C CZ  . ARG A 1 66  ? 1.682   -12.681 54.887  1.00 33.44 ? 66  ARG A CZ  1 
ATOM   565   N NH1 . ARG A 1 66  ? 1.620   -13.820 55.568  1.00 35.72 ? 66  ARG A NH1 1 
ATOM   566   N NH2 . ARG A 1 66  ? 0.682   -11.813 54.981  1.00 34.40 ? 66  ARG A NH2 1 
ATOM   567   N N   . MET A 1 67  ? 3.217   -9.391  57.884  1.00 13.66 ? 67  MET A N   1 
ATOM   568   C CA  . MET A 1 67  ? 2.066   -9.100  58.722  1.00 13.23 ? 67  MET A CA  1 
ATOM   569   C C   . MET A 1 67  ? 2.263   -7.810  59.494  1.00 12.87 ? 67  MET A C   1 
ATOM   570   O O   . MET A 1 67  ? 1.328   -7.015  59.638  1.00 12.91 ? 67  MET A O   1 
ATOM   571   C CB  . MET A 1 67  ? 1.775   -10.273 59.654  1.00 13.34 ? 67  MET A CB  1 
ATOM   572   C CG  . MET A 1 67  ? 1.138   -11.458 58.930  1.00 15.97 ? 67  MET A CG  1 
ATOM   573   S SD  . MET A 1 67  ? 0.587   -12.730 60.098  1.00 18.59 ? 67  MET A SD  1 
ATOM   574   C CE  . MET A 1 67  ? 2.146   -13.363 60.623  1.00 18.76 ? 67  MET A CE  1 
ATOM   575   N N   . LEU A 1 68  ? 3.488   -7.568  59.957  1.00 13.04 ? 68  LEU A N   1 
ATOM   576   C CA  . LEU A 1 68  ? 3.765   -6.332  60.685  1.00 12.30 ? 68  LEU A CA  1 
ATOM   577   C C   . LEU A 1 68  ? 3.585   -5.115  59.798  1.00 11.95 ? 68  LEU A C   1 
ATOM   578   O O   . LEU A 1 68  ? 2.947   -4.147  60.196  1.00 12.28 ? 68  LEU A O   1 
ATOM   579   C CB  . LEU A 1 68  ? 5.159   -6.361  61.314  1.00 11.62 ? 68  LEU A CB  1 
ATOM   580   C CG  . LEU A 1 68  ? 5.294   -7.318  62.490  1.00 13.26 ? 68  LEU A CG  1 
ATOM   581   C CD1 . LEU A 1 68  ? 6.728   -7.553  62.916  1.00 12.53 ? 68  LEU A CD1 1 
ATOM   582   C CD2 . LEU A 1 68  ? 4.487   -6.816  63.669  1.00 12.19 ? 68  LEU A CD2 1 
ATOM   583   N N   . VAL A 1 69  ? 4.158   -5.157  58.602  1.00 12.18 ? 69  VAL A N   1 
ATOM   584   C CA  . VAL A 1 69  ? 4.021   -4.091  57.639  1.00 12.39 ? 69  VAL A CA  1 
ATOM   585   C C   . VAL A 1 69  ? 2.525   -3.841  57.324  1.00 12.68 ? 69  VAL A C   1 
ATOM   586   O O   . VAL A 1 69  ? 2.076   -2.692  57.244  1.00 11.59 ? 69  VAL A O   1 
ATOM   587   C CB  . VAL A 1 69  ? 4.786   -4.410  56.349  1.00 12.28 ? 69  VAL A CB  1 
ATOM   588   C CG1 . VAL A 1 69  ? 4.375   -3.463  55.236  1.00 13.84 ? 69  VAL A CG1 1 
ATOM   589   C CG2 . VAL A 1 69  ? 6.318   -4.345  56.578  1.00 12.90 ? 69  VAL A CG2 1 
ATOM   590   N N   . ASP A 1 70  ? 1.760   -4.920  57.185  1.00 13.16 ? 70  ASP A N   1 
ATOM   591   C CA  . ASP A 1 70  ? 0.329   -4.808  56.911  1.00 14.24 ? 70  ASP A CA  1 
ATOM   592   C C   . ASP A 1 70  ? -0.371  -4.134  58.092  1.00 13.85 ? 70  ASP A C   1 
ATOM   593   O O   . ASP A 1 70  ? -1.317  -3.363  57.913  1.00 14.29 ? 70  ASP A O   1 
ATOM   594   C CB  . ASP A 1 70  ? -0.295  -6.180  56.671  1.00 14.42 ? 70  ASP A CB  1 
ATOM   595   C CG  . ASP A 1 70  ? 0.030   -6.760  55.299  1.00 16.92 ? 70  ASP A CG  1 
ATOM   596   O OD1 . ASP A 1 70  ? 0.534   -6.050  54.406  1.00 15.95 ? 70  ASP A OD1 1 
ATOM   597   O OD2 . ASP A 1 70  ? -0.193  -7.956  55.045  1.00 20.22 ? 70  ASP A OD2 1 
ATOM   598   N N   . LEU A 1 71  ? 0.132   -4.380  59.299  1.00 13.89 ? 71  LEU A N   1 
ATOM   599   C CA  . LEU A 1 71  ? -0.434  -3.748  60.491  1.00 13.61 ? 71  LEU A CA  1 
ATOM   600   C C   . LEU A 1 71  ? -0.198  -2.234  60.427  1.00 13.33 ? 71  LEU A C   1 
ATOM   601   O O   . LEU A 1 71  ? -1.100  -1.445  60.725  1.00 13.39 ? 71  LEU A O   1 
ATOM   602   C CB  . LEU A 1 71  ? 0.155   -4.352  61.767  1.00 13.75 ? 71  LEU A CB  1 
ATOM   603   C CG  . LEU A 1 71  ? -0.199  -3.630  63.072  1.00 13.78 ? 71  LEU A CG  1 
ATOM   604   C CD1 . LEU A 1 71  ? -1.680  -3.766  63.419  1.00 14.86 ? 71  LEU A CD1 1 
ATOM   605   C CD2 . LEU A 1 71  ? 0.662   -4.152  64.202  1.00 15.05 ? 71  LEU A CD2 1 
ATOM   606   N N   . ALA A 1 72  ? 0.999   -1.828  60.006  1.00 12.70 ? 72  ALA A N   1 
ATOM   607   C CA  . ALA A 1 72  ? 1.329   -0.405  59.872  1.00 13.02 ? 72  ALA A CA  1 
ATOM   608   C C   . ALA A 1 72  ? 0.413   0.258   58.841  1.00 13.19 ? 72  ALA A C   1 
ATOM   609   O O   . ALA A 1 72  ? -0.065  1.365   59.054  1.00 13.68 ? 72  ALA A O   1 
ATOM   610   C CB  . ALA A 1 72  ? 2.811   -0.232  59.494  1.00 12.89 ? 72  ALA A CB  1 
ATOM   611   N N   . LYS A 1 73  ? 0.160   -0.427  57.732  1.00 14.10 ? 73  LYS A N   1 
ATOM   612   C CA  . LYS A 1 73  ? -0.794  0.058   56.723  1.00 15.21 ? 73  LYS A CA  1 
ATOM   613   C C   . LYS A 1 73  ? -2.200  0.220   57.294  1.00 15.12 ? 73  LYS A C   1 
ATOM   614   O O   . LYS A 1 73  ? -2.808  1.287   57.176  1.00 14.89 ? 73  LYS A O   1 
ATOM   615   C CB  . LYS A 1 73  ? -0.815  -0.896  55.534  1.00 16.09 ? 73  LYS A CB  1 
ATOM   616   C CG  . LYS A 1 73  ? 0.460   -0.793  54.721  1.00 18.95 ? 73  LYS A CG  1 
ATOM   617   C CD  . LYS A 1 73  ? 0.553   -1.854  53.652  1.00 24.07 ? 73  LYS A CD  1 
ATOM   618   C CE  . LYS A 1 73  ? 1.661   -1.538  52.654  1.00 27.00 ? 73  LYS A CE  1 
ATOM   619   N NZ  . LYS A 1 73  ? 3.002   -1.326  53.286  1.00 30.08 ? 73  LYS A NZ  1 
ATOM   620   N N   . SER A 1 74  ? -2.686  -0.825  57.959  1.00 15.11 ? 74  SER A N   1 
ATOM   621   C CA  . SER A 1 74  ? -4.028  -0.834  58.551  1.00 15.58 ? 74  SER A CA  1 
ATOM   622   C C   . SER A 1 74  ? -4.226  0.281   59.588  1.00 15.45 ? 74  SER A C   1 
ATOM   623   O O   . SER A 1 74  ? -5.299  0.895   59.661  1.00 15.40 ? 74  SER A O   1 
ATOM   624   C CB  . SER A 1 74  ? -4.304  -2.201  59.178  1.00 15.80 ? 74  SER A CB  1 
ATOM   625   O OG  . SER A 1 74  ? -5.674  -2.355  59.526  1.00 17.19 ? 74  SER A OG  1 
ATOM   626   N N   . ARG A 1 75  ? -3.184  0.559   60.374  1.00 14.58 ? 75  ARG A N   1 
ATOM   627   C CA  . ARG A 1 75  ? -3.228  1.594   61.401  1.00 13.87 ? 75  ARG A CA  1 
ATOM   628   C C   . ARG A 1 75  ? -2.968  3.007   60.858  1.00 13.94 ? 75  ARG A C   1 
ATOM   629   O O   . ARG A 1 75  ? -2.933  3.976   61.624  1.00 13.98 ? 75  ARG A O   1 
ATOM   630   C CB  . ARG A 1 75  ? -2.229  1.245   62.513  1.00 13.62 ? 75  ARG A CB  1 
ATOM   631   C CG  . ARG A 1 75  ? -2.574  -0.022  63.298  1.00 13.51 ? 75  ARG A CG  1 
ATOM   632   C CD  . ARG A 1 75  ? -3.902  0.025   64.062  1.00 15.59 ? 75  ARG A CD  1 
ATOM   633   N NE  . ARG A 1 75  ? -3.941  1.105   65.051  1.00 16.37 ? 75  ARG A NE  1 
ATOM   634   C CZ  . ARG A 1 75  ? -4.735  2.171   64.985  1.00 20.12 ? 75  ARG A CZ  1 
ATOM   635   N NH1 . ARG A 1 75  ? -5.619  2.289   64.012  1.00 20.85 ? 75  ARG A NH1 1 
ATOM   636   N NH2 . ARG A 1 75  ? -4.674  3.119   65.916  1.00 21.67 ? 75  ARG A NH2 1 
ATOM   637   N N   . GLY A 1 76  ? -2.780  3.121   59.543  1.00 13.68 ? 76  GLY A N   1 
ATOM   638   C CA  . GLY A 1 76  ? -2.631  4.409   58.893  1.00 13.98 ? 76  GLY A CA  1 
ATOM   639   C C   . GLY A 1 76  ? -1.346  5.173   59.197  1.00 13.87 ? 76  GLY A C   1 
ATOM   640   O O   . GLY A 1 76  ? -1.339  6.413   59.295  1.00 13.27 ? 76  GLY A O   1 
ATOM   641   N N   . VAL A 1 77  ? -0.252  4.439   59.333  1.00 13.64 ? 77  VAL A N   1 
ATOM   642   C CA  . VAL A 1 77  ? 1.028   5.046   59.647  1.00 13.94 ? 77  VAL A CA  1 
ATOM   643   C C   . VAL A 1 77  ? 1.436   6.096   58.623  1.00 13.47 ? 77  VAL A C   1 
ATOM   644   O O   . VAL A 1 77  ? 1.859   7.187   58.981  1.00 13.58 ? 77  VAL A O   1 
ATOM   645   C CB  . VAL A 1 77  ? 2.128   3.962   59.778  1.00 13.59 ? 77  VAL A CB  1 
ATOM   646   C CG1 . VAL A 1 77  ? 3.509   4.586   59.801  1.00 13.61 ? 77  VAL A CG1 1 
ATOM   647   C CG2 . VAL A 1 77  ? 1.910   3.166   61.025  1.00 13.88 ? 77  VAL A CG2 1 
ATOM   648   N N   . GLU A 1 78  ? 1.298   5.785   57.341  1.00 14.04 ? 78  GLU A N   1 
ATOM   649   C CA  . GLU A 1 78  ? 1.724   6.729   56.315  1.00 14.31 ? 78  GLU A CA  1 
ATOM   650   C C   . GLU A 1 78  ? 0.912   8.029   56.358  1.00 14.10 ? 78  GLU A C   1 
ATOM   651   O O   . GLU A 1 78  ? 1.478   9.114   56.323  1.00 14.53 ? 78  GLU A O   1 
ATOM   652   C CB  . GLU A 1 78  ? 1.692   6.072   54.926  1.00 14.86 ? 78  GLU A CB  1 
ATOM   653   C CG  . GLU A 1 78  ? 2.813   5.067   54.743  1.00 17.10 ? 78  GLU A CG  1 
ATOM   654   C CD  . GLU A 1 78  ? 2.662   4.215   53.496  1.00 21.99 ? 78  GLU A CD  1 
ATOM   655   O OE1 . GLU A 1 78  ? 3.547   4.283   52.618  1.00 26.14 ? 78  GLU A OE1 1 
ATOM   656   O OE2 . GLU A 1 78  ? 1.676   3.455   53.409  1.00 25.17 ? 78  GLU A OE2 1 
ATOM   657   N N   . ALA A 1 79  ? -0.409  7.929   56.452  1.00 14.20 ? 79  ALA A N   1 
ATOM   658   C CA  . ALA A 1 79  ? -1.247  9.126   56.513  1.00 13.98 ? 79  ALA A CA  1 
ATOM   659   C C   . ALA A 1 79  ? -0.900  9.945   57.741  1.00 13.20 ? 79  ALA A C   1 
ATOM   660   O O   . ALA A 1 79  ? -0.831  11.165  57.665  1.00 12.77 ? 79  ALA A O   1 
ATOM   661   C CB  . ALA A 1 79  ? -2.734  8.778   56.532  1.00 14.12 ? 79  ALA A CB  1 
ATOM   662   N N   . ALA A 1 80  ? -0.680  9.293   58.880  1.00 13.16 ? 80  ALA A N   1 
ATOM   663   C CA  . ALA A 1 80  ? -0.324  10.056  60.094  1.00 12.46 ? 80  ALA A CA  1 
ATOM   664   C C   . ALA A 1 80  ? 1.012   10.790  59.894  1.00 12.18 ? 80  ALA A C   1 
ATOM   665   O O   . ALA A 1 80  ? 1.181   11.936  60.320  1.00 12.48 ? 80  ALA A O   1 
ATOM   666   C CB  . ALA A 1 80  ? -0.258  9.138   61.311  1.00 12.82 ? 80  ALA A CB  1 
ATOM   667   N N   . ARG A 1 81  ? 1.967   10.126  59.246  1.00 11.90 ? 81  ARG A N   1 
ATOM   668   C CA  . ARG A 1 81  ? 3.255   10.734  58.962  1.00 11.74 ? 81  ARG A CA  1 
ATOM   669   C C   . ARG A 1 81  ? 3.065   12.016  58.157  1.00 11.87 ? 81  ARG A C   1 
ATOM   670   O O   . ARG A 1 81  ? 3.616   13.056  58.495  1.00 11.21 ? 81  ARG A O   1 
ATOM   671   C CB  . ARG A 1 81  ? 4.177   9.759   58.224  1.00 11.41 ? 81  ARG A CB  1 
ATOM   672   C CG  . ARG A 1 81  ? 5.498   10.361  57.766  1.00 12.75 ? 81  ARG A CG  1 
ATOM   673   C CD  . ARG A 1 81  ? 6.249   9.516   56.761  1.00 13.22 ? 81  ARG A CD  1 
ATOM   674   N NE  . ARG A 1 81  ? 5.433   9.322   55.566  1.00 13.03 ? 81  ARG A NE  1 
ATOM   675   C CZ  . ARG A 1 81  ? 5.434   8.232   54.802  1.00 15.17 ? 81  ARG A CZ  1 
ATOM   676   N NH1 . ARG A 1 81  ? 6.234   7.208   55.047  1.00 13.60 ? 81  ARG A NH1 1 
ATOM   677   N NH2 . ARG A 1 81  ? 4.610   8.166   53.770  1.00 14.99 ? 81  ARG A NH2 1 
ATOM   678   N N   . GLU A 1 82  ? 2.268   11.943  57.099  1.00 12.37 ? 82  GLU A N   1 
ATOM   679   C CA  . GLU A 1 82  ? 2.040   13.115  56.259  1.00 13.45 ? 82  GLU A CA  1 
ATOM   680   C C   . GLU A 1 82  ? 1.389   14.254  57.055  1.00 12.93 ? 82  GLU A C   1 
ATOM   681   O O   . GLU A 1 82  ? 1.730   15.418  56.868  1.00 13.29 ? 82  GLU A O   1 
ATOM   682   C CB  . GLU A 1 82  ? 1.205   12.747  55.031  1.00 13.47 ? 82  GLU A CB  1 
ATOM   683   C CG  . GLU A 1 82  ? 1.900   11.810  54.057  1.00 17.43 ? 82  GLU A CG  1 
ATOM   684   C CD  . GLU A 1 82  ? 3.333   12.190  53.797  1.00 20.59 ? 82  GLU A CD  1 
ATOM   685   O OE1 . GLU A 1 82  ? 3.549   13.263  53.194  1.00 24.99 ? 82  GLU A OE1 1 
ATOM   686   O OE2 . GLU A 1 82  ? 4.243   11.432  54.209  1.00 19.58 ? 82  GLU A OE2 1 
ATOM   687   N N   . ARG A 1 83  ? 0.476   13.921  57.958  1.00 13.11 ? 83  ARG A N   1 
ATOM   688   C CA  . ARG A 1 83  ? -0.142  14.927  58.822  1.00 13.68 ? 83  ARG A CA  1 
ATOM   689   C C   . ARG A 1 83  ? 0.915   15.642  59.675  1.00 13.33 ? 83  ARG A C   1 
ATOM   690   O O   . ARG A 1 83  ? 0.888   16.865  59.845  1.00 12.75 ? 83  ARG A O   1 
ATOM   691   C CB  . ARG A 1 83  ? -1.207  14.289  59.725  1.00 14.75 ? 83  ARG A CB  1 
ATOM   692   C CG  . ARG A 1 83  ? -2.511  13.920  58.985  1.00 15.78 ? 83  ARG A CG  1 
ATOM   693   C CD  . ARG A 1 83  ? -3.703  13.610  59.888  1.00 19.58 ? 83  ARG A CD  1 
ATOM   694   N NE  . ARG A 1 83  ? -3.428  12.584  60.904  1.00 24.41 ? 83  ARG A NE  1 
ATOM   695   C CZ  . ARG A 1 83  ? -3.571  11.261  60.742  1.00 26.23 ? 83  ARG A CZ  1 
ATOM   696   N NH1 . ARG A 1 83  ? -3.297  10.449  61.752  1.00 27.49 ? 83  ARG A NH1 1 
ATOM   697   N NH2 . ARG A 1 83  ? -3.970  10.736  59.592  1.00 25.88 ? 83  ARG A NH2 1 
ATOM   698   N N   . MET A 1 84  ? 1.855   14.878  60.207  1.00 13.23 ? 84  MET A N   1 
ATOM   699   C CA  . MET A 1 84  ? 2.919   15.474  60.986  1.00 13.50 ? 84  MET A CA  1 
ATOM   700   C C   . MET A 1 84  ? 3.709   16.458  60.140  1.00 13.50 ? 84  MET A C   1 
ATOM   701   O O   . MET A 1 84  ? 3.859   17.628  60.510  1.00 13.58 ? 84  MET A O   1 
ATOM   702   C CB  . MET A 1 84  ? 3.887   14.426  61.521  1.00 13.57 ? 84  MET A CB  1 
ATOM   703   C CG  . MET A 1 84  ? 5.079   15.084  62.163  1.00 15.32 ? 84  MET A CG  1 
ATOM   704   S SD  . MET A 1 84  ? 6.268   13.918  62.867  1.00 19.91 ? 84  MET A SD  1 
ATOM   705   C CE  . MET A 1 84  ? 5.576   13.576  64.157  1.00 13.90 ? 84  MET A CE  1 
ATOM   706   N N   . PHE A 1 85  ? 4.196   15.982  59.002  1.00 14.43 ? 85  PHE A N   1 
ATOM   707   C CA  . PHE A 1 85  ? 5.051   16.788  58.127  1.00 15.28 ? 85  PHE A CA  1 
ATOM   708   C C   . PHE A 1 85  ? 4.308   17.972  57.495  1.00 16.18 ? 85  PHE A C   1 
ATOM   709   O O   . PHE A 1 85  ? 4.923   18.971  57.138  1.00 16.53 ? 85  PHE A O   1 
ATOM   710   C CB  . PHE A 1 85  ? 5.673   15.920  57.021  1.00 15.57 ? 85  PHE A CB  1 
ATOM   711   C CG  . PHE A 1 85  ? 6.922   15.157  57.437  1.00 15.48 ? 85  PHE A CG  1 
ATOM   712   C CD1 . PHE A 1 85  ? 6.827   13.945  58.091  1.00 17.65 ? 85  PHE A CD1 1 
ATOM   713   C CD2 . PHE A 1 85  ? 8.190   15.634  57.117  1.00 16.53 ? 85  PHE A CD2 1 
ATOM   714   C CE1 . PHE A 1 85  ? 7.990   13.228  58.459  1.00 17.91 ? 85  PHE A CE1 1 
ATOM   715   C CE2 . PHE A 1 85  ? 9.334   14.936  57.470  1.00 15.22 ? 85  PHE A CE2 1 
ATOM   716   C CZ  . PHE A 1 85  ? 9.235   13.725  58.138  1.00 16.57 ? 85  PHE A CZ  1 
ATOM   717   N N   . ASN A 1 86  ? 2.992   17.854  57.356  1.00 16.91 ? 86  ASN A N   1 
ATOM   718   C CA  . ASN A 1 86  ? 2.194   18.919  56.752  1.00 17.88 ? 86  ASN A CA  1 
ATOM   719   C C   . ASN A 1 86  ? 1.750   19.986  57.756  1.00 17.46 ? 86  ASN A C   1 
ATOM   720   O O   . ASN A 1 86  ? 1.006   20.900  57.404  1.00 17.38 ? 86  ASN A O   1 
ATOM   721   C CB  . ASN A 1 86  ? 0.991   18.325  56.011  1.00 18.09 ? 86  ASN A CB  1 
ATOM   722   C CG  . ASN A 1 86  ? 1.393   17.679  54.687  1.00 21.89 ? 86  ASN A CG  1 
ATOM   723   O OD1 . ASN A 1 86  ? 2.306   18.166  53.996  1.00 26.13 ? 86  ASN A OD1 1 
ATOM   724   N ND2 . ASN A 1 86  ? 0.726   16.581  54.324  1.00 26.87 ? 86  ASN A ND2 1 
ATOM   725   N N   . GLY A 1 87  ? 2.187   19.854  59.009  1.00 16.76 ? 87  GLY A N   1 
ATOM   726   C CA  . GLY A 1 87  ? 1.853   20.812  60.049  1.00 16.42 ? 87  GLY A CA  1 
ATOM   727   C C   . GLY A 1 87  ? 0.445   20.746  60.630  1.00 16.49 ? 87  GLY A C   1 
ATOM   728   O O   . GLY A 1 87  ? -0.008  21.693  61.273  1.00 15.83 ? 87  GLY A O   1 
ATOM   729   N N   . GLU A 1 88  ? -0.253  19.638  60.414  1.00 16.70 ? 88  GLU A N   1 
ATOM   730   C CA  . GLU A 1 88  ? -1.582  19.465  60.982  1.00 17.16 ? 88  GLU A CA  1 
ATOM   731   C C   . GLU A 1 88  ? -1.457  19.248  62.492  1.00 16.93 ? 88  GLU A C   1 
ATOM   732   O O   . GLU A 1 88  ? -0.396  18.871  62.980  1.00 16.34 ? 88  GLU A O   1 
ATOM   733   C CB  . GLU A 1 88  ? -2.312  18.303  60.309  1.00 17.44 ? 88  GLU A CB  1 
ATOM   734   C CG  . GLU A 1 88  ? -2.542  18.545  58.831  1.00 18.59 ? 88  GLU A CG  1 
ATOM   735   C CD  . GLU A 1 88  ? -3.182  17.362  58.142  1.00 19.16 ? 88  GLU A CD  1 
ATOM   736   O OE1 . GLU A 1 88  ? -4.147  16.808  58.693  1.00 19.14 ? 88  GLU A OE1 1 
ATOM   737   O OE2 . GLU A 1 88  ? -2.708  16.998  57.052  1.00 21.30 ? 88  GLU A OE2 1 
ATOM   738   N N   . LYS A 1 89  ? -2.542  19.491  63.224  1.00 16.96 ? 89  LYS A N   1 
ATOM   739   C CA  . LYS A 1 89  ? -2.498  19.487  64.681  1.00 17.19 ? 89  LYS A CA  1 
ATOM   740   C C   . LYS A 1 89  ? -2.667  18.088  65.234  1.00 16.72 ? 89  LYS A C   1 
ATOM   741   O O   . LYS A 1 89  ? -3.683  17.799  65.860  1.00 16.76 ? 89  LYS A O   1 
ATOM   742   C CB  . LYS A 1 89  ? -3.595  20.401  65.251  1.00 17.92 ? 89  LYS A CB  1 
ATOM   743   C CG  . LYS A 1 89  ? -3.776  21.699  64.483  1.00 21.16 ? 89  LYS A CG  1 
ATOM   744   C CD  . LYS A 1 89  ? -3.062  22.864  65.114  1.00 24.38 ? 89  LYS A CD  1 
ATOM   745   C CE  . LYS A 1 89  ? -3.737  24.176  64.697  1.00 26.01 ? 89  LYS A CE  1 
ATOM   746   N NZ  . LYS A 1 89  ? -3.239  25.371  65.406  1.00 28.43 ? 89  LYS A NZ  1 
ATOM   747   N N   . ILE A 1 90  ? -1.661  17.234  65.039  1.00 15.55 ? 90  ILE A N   1 
ATOM   748   C CA  . ILE A 1 90  ? -1.756  15.841  65.472  1.00 15.93 ? 90  ILE A CA  1 
ATOM   749   C C   . ILE A 1 90  ? -1.586  15.653  66.986  1.00 15.79 ? 90  ILE A C   1 
ATOM   750   O O   . ILE A 1 90  ? -1.813  14.563  67.519  1.00 15.71 ? 90  ILE A O   1 
ATOM   751   C CB  . ILE A 1 90  ? -0.730  14.976  64.735  1.00 15.59 ? 90  ILE A CB  1 
ATOM   752   C CG1 . ILE A 1 90  ? 0.694   15.416  65.093  1.00 15.84 ? 90  ILE A CG1 1 
ATOM   753   C CG2 . ILE A 1 90  ? -0.966  15.059  63.231  1.00 16.78 ? 90  ILE A CG2 1 
ATOM   754   C CD1 . ILE A 1 90  ? 1.739   14.398  64.750  1.00 15.86 ? 90  ILE A CD1 1 
ATOM   755   N N   . ASN A 1 91  ? -1.147  16.701  67.678  1.00 15.18 ? 91  ASN A N   1 
ATOM   756   C CA  . ASN A 1 91  ? -1.114  16.652  69.125  1.00 15.63 ? 91  ASN A CA  1 
ATOM   757   C C   . ASN A 1 91  ? -2.526  17.062  69.496  1.00 15.72 ? 91  ASN A C   1 
ATOM   758   O O   . ASN A 1 91  ? -2.792  18.228  69.809  1.00 15.75 ? 91  ASN A O   1 
ATOM   759   C CB  . ASN A 1 91  ? -0.068  17.599  69.696  1.00 15.13 ? 91  ASN A CB  1 
ATOM   760   C CG  . ASN A 1 91  ? -0.137  17.704  71.207  1.00 15.23 ? 91  ASN A CG  1 
ATOM   761   O OD1 . ASN A 1 91  ? -1.040  17.144  71.845  1.00 14.88 ? 91  ASN A OD1 1 
ATOM   762   N ND2 . ASN A 1 91  ? 0.803   18.455  71.791  1.00 11.55 ? 91  ASN A ND2 1 
ATOM   763   N N   . TYR A 1 92  ? -3.430  16.093  69.425  1.00 16.21 ? 92  TYR A N   1 
ATOM   764   C CA  . TYR A 1 92  ? -4.865  16.369  69.513  1.00 16.56 ? 92  TYR A CA  1 
ATOM   765   C C   . TYR A 1 92  ? -5.394  16.767  70.884  1.00 16.72 ? 92  TYR A C   1 
ATOM   766   O O   . TYR A 1 92  ? -6.383  17.484  70.956  1.00 16.93 ? 92  TYR A O   1 
ATOM   767   C CB  . TYR A 1 92  ? -5.694  15.213  68.918  1.00 17.25 ? 92  TYR A CB  1 
ATOM   768   C CG  . TYR A 1 92  ? -5.320  13.836  69.416  1.00 17.68 ? 92  TYR A CG  1 
ATOM   769   C CD1 . TYR A 1 92  ? -5.811  13.349  70.621  1.00 18.29 ? 92  TYR A CD1 1 
ATOM   770   C CD2 . TYR A 1 92  ? -4.499  13.013  68.661  1.00 18.85 ? 92  TYR A CD2 1 
ATOM   771   C CE1 . TYR A 1 92  ? -5.466  12.070  71.072  1.00 17.71 ? 92  TYR A CE1 1 
ATOM   772   C CE2 . TYR A 1 92  ? -4.145  11.739  69.097  1.00 18.77 ? 92  TYR A CE2 1 
ATOM   773   C CZ  . TYR A 1 92  ? -4.632  11.270  70.297  1.00 18.80 ? 92  TYR A CZ  1 
ATOM   774   O OH  . TYR A 1 92  ? -4.283  10.001  70.721  1.00 16.93 ? 92  TYR A OH  1 
ATOM   775   N N   . THR A 1 93  ? -4.736  16.365  71.973  1.00 16.05 ? 93  THR A N   1 
ATOM   776   C CA  . THR A 1 93  ? -5.248  16.759  73.271  1.00 15.99 ? 93  THR A CA  1 
ATOM   777   C C   . THR A 1 93  ? -4.905  18.203  73.584  1.00 15.99 ? 93  THR A C   1 
ATOM   778   O O   . THR A 1 93  ? -5.611  18.833  74.361  1.00 16.15 ? 93  THR A O   1 
ATOM   779   C CB  . THR A 1 93  ? -4.754  15.845  74.407  1.00 15.90 ? 93  THR A CB  1 
ATOM   780   O OG1 . THR A 1 93  ? -3.333  15.951  74.538  1.00 15.09 ? 93  THR A OG1 1 
ATOM   781   C CG2 . THR A 1 93  ? -5.031  14.376  74.091  1.00 15.76 ? 93  THR A CG2 1 
ATOM   782   N N   . GLU A 1 94  ? -3.820  18.718  73.013  1.00 15.75 ? 94  GLU A N   1 
ATOM   783   C CA  . GLU A 1 94  ? -3.435  20.112  73.232  1.00 16.03 ? 94  GLU A CA  1 
ATOM   784   C C   . GLU A 1 94  ? -3.743  20.990  72.013  1.00 16.04 ? 94  GLU A C   1 
ATOM   785   O O   . GLU A 1 94  ? -3.599  22.214  72.074  1.00 16.26 ? 94  GLU A O   1 
ATOM   786   C CB  . GLU A 1 94  ? -1.958  20.232  73.632  1.00 16.05 ? 94  GLU A CB  1 
ATOM   787   C CG  . GLU A 1 94  ? -1.624  19.472  74.914  1.00 15.60 ? 94  GLU A CG  1 
ATOM   788   C CD  . GLU A 1 94  ? -0.162  19.557  75.309  1.00 16.25 ? 94  GLU A CD  1 
ATOM   789   O OE1 . GLU A 1 94  ? 0.710   19.262  74.476  1.00 18.89 ? 94  GLU A OE1 1 
ATOM   790   O OE2 . GLU A 1 94  ? 0.114   19.903  76.467  1.00 18.86 ? 94  GLU A OE2 1 
ATOM   791   N N   . GLY A 1 95  ? -4.177  20.372  70.923  1.00 15.50 ? 95  GLY A N   1 
ATOM   792   C CA  . GLY A 1 95  ? -4.521  21.108  69.713  1.00 15.59 ? 95  GLY A CA  1 
ATOM   793   C C   . GLY A 1 95  ? -3.333  21.800  69.066  1.00 15.55 ? 95  GLY A C   1 
ATOM   794   O O   . GLY A 1 95  ? -3.447  22.941  68.605  1.00 14.26 ? 95  GLY A O   1 
ATOM   795   N N   . ARG A 1 96  ? -2.198  21.101  69.019  1.00 14.44 ? 96  ARG A N   1 
ATOM   796   C CA  . ARG A 1 96  ? -0.962  21.660  68.466  1.00 14.71 ? 96  ARG A CA  1 
ATOM   797   C C   . ARG A 1 96  ? -0.383  20.817  67.360  1.00 13.75 ? 96  ARG A C   1 
ATOM   798   O O   . ARG A 1 96  ? -0.641  19.609  67.270  1.00 13.44 ? 96  ARG A O   1 
ATOM   799   C CB  . ARG A 1 96  ? 0.128   21.748  69.540  1.00 15.00 ? 96  ARG A CB  1 
ATOM   800   C CG  . ARG A 1 96  ? -0.142  22.683  70.667  1.00 16.21 ? 96  ARG A CG  1 
ATOM   801   C CD  . ARG A 1 96  ? 0.746   22.461  71.874  1.00 16.17 ? 96  ARG A CD  1 
ATOM   802   N NE  . ARG A 1 96  ? 0.405   23.420  72.917  1.00 19.66 ? 96  ARG A NE  1 
ATOM   803   C CZ  . ARG A 1 96  ? 0.966   23.461  74.115  1.00 21.96 ? 96  ARG A CZ  1 
ATOM   804   N NH1 . ARG A 1 96  ? 1.898   22.580  74.449  1.00 23.39 ? 96  ARG A NH1 1 
ATOM   805   N NH2 . ARG A 1 96  ? 0.582   24.383  74.988  1.00 24.10 ? 96  ARG A NH2 1 
ATOM   806   N N   . ALA A 1 97  ? 0.435   21.456  66.534  1.00 13.50 ? 97  ALA A N   1 
ATOM   807   C CA  . ALA A 1 97  ? 1.179   20.750  65.512  1.00 12.91 ? 97  ALA A CA  1 
ATOM   808   C C   . ALA A 1 97  ? 2.406   20.128  66.207  1.00 12.66 ? 97  ALA A C   1 
ATOM   809   O O   . ALA A 1 97  ? 2.693   20.449  67.362  1.00 12.27 ? 97  ALA A O   1 
ATOM   810   C CB  . ALA A 1 97  ? 1.587   21.711  64.396  1.00 13.01 ? 97  ALA A CB  1 
ATOM   811   N N   . VAL A 1 98  ? 3.100   19.225  65.523  1.00 12.85 ? 98  VAL A N   1 
ATOM   812   C CA  . VAL A 1 98  ? 4.301   18.580  66.041  1.00 12.80 ? 98  VAL A CA  1 
ATOM   813   C C   . VAL A 1 98  ? 5.317   18.699  64.926  1.00 11.96 ? 98  VAL A C   1 
ATOM   814   O O   . VAL A 1 98  ? 5.313   17.926  63.969  1.00 11.75 ? 98  VAL A O   1 
ATOM   815   C CB  . VAL A 1 98  ? 4.069   17.092  66.417  1.00 12.89 ? 98  VAL A CB  1 
ATOM   816   C CG1 . VAL A 1 98  ? 5.380   16.455  66.817  1.00 12.34 ? 98  VAL A CG1 1 
ATOM   817   C CG2 . VAL A 1 98  ? 3.062   17.017  67.545  1.00 13.73 ? 98  VAL A CG2 1 
ATOM   818   N N   . LEU A 1 99  ? 6.178   19.696  65.051  1.00 11.88 ? 99  LEU A N   1 
ATOM   819   C CA  . LEU A 1 99  ? 7.066   20.059  63.965  1.00 11.91 ? 99  LEU A CA  1 
ATOM   820   C C   . LEU A 1 99  ? 8.536   20.136  64.326  1.00 11.69 ? 99  LEU A C   1 
ATOM   821   O O   . LEU A 1 99  ? 9.255   21.030  63.859  1.00 11.41 ? 99  LEU A O   1 
ATOM   822   C CB  . LEU A 1 99  ? 6.591   21.369  63.336  1.00 11.93 ? 99  LEU A CB  1 
ATOM   823   C CG  . LEU A 1 99  ? 5.349   21.166  62.467  1.00 13.06 ? 99  LEU A CG  1 
ATOM   824   C CD1 . LEU A 1 99  ? 4.809   22.507  62.023  1.00 14.34 ? 99  LEU A CD1 1 
ATOM   825   C CD2 . LEU A 1 99  ? 5.671   20.292  61.280  1.00 14.40 ? 99  LEU A CD2 1 
ATOM   826   N N   . HIS A 1 100 ? 9.019   19.180  65.118  1.00 11.02 ? 100 HIS A N   1 
ATOM   827   C CA  . HIS A 1 100 ? 10.461  19.113  65.279  1.00 10.78 ? 100 HIS A CA  1 
ATOM   828   C C   . HIS A 1 100 ? 11.116  18.923  63.903  1.00 10.66 ? 100 HIS A C   1 
ATOM   829   O O   . HIS A 1 100 ? 12.266  19.345  63.702  1.00 10.12 ? 100 HIS A O   1 
ATOM   830   C CB  . HIS A 1 100 ? 10.909  18.016  66.265  1.00 11.39 ? 100 HIS A CB  1 
ATOM   831   C CG  . HIS A 1 100 ? 10.156  16.730  66.159  1.00 11.09 ? 100 HIS A CG  1 
ATOM   832   N ND1 . HIS A 1 100 ? 8.912   16.546  66.725  1.00 10.88 ? 100 HIS A ND1 1 
ATOM   833   C CD2 . HIS A 1 100 ? 10.502  15.534  65.620  1.00 11.31 ? 100 HIS A CD2 1 
ATOM   834   C CE1 . HIS A 1 100 ? 8.508   15.307  66.506  1.00 11.65 ? 100 HIS A CE1 1 
ATOM   835   N NE2 . HIS A 1 100 ? 9.456   14.669  65.843  1.00 10.25 ? 100 HIS A NE2 1 
ATOM   836   N N   . VAL A 1 101 ? 10.400  18.324  62.941  1.00 10.18 ? 101 VAL A N   1 
ATOM   837   C CA  . VAL A 1 101 ? 10.984  18.147  61.604  1.00 10.63 ? 101 VAL A CA  1 
ATOM   838   C C   . VAL A 1 101 ? 11.207  19.481  60.906  1.00 10.11 ? 101 VAL A C   1 
ATOM   839   O O   . VAL A 1 101 ? 12.050  19.584  60.047  1.00 11.59 ? 101 VAL A O   1 
ATOM   840   C CB  . VAL A 1 101 ? 10.157  17.214  60.656  1.00 10.34 ? 101 VAL A CB  1 
ATOM   841   C CG1 . VAL A 1 101 ? 10.161  15.753  61.174  1.00 11.63 ? 101 VAL A CG1 1 
ATOM   842   C CG2 . VAL A 1 101 ? 8.735   17.738  60.466  1.00 11.31 ? 101 VAL A CG2 1 
ATOM   843   N N   . ALA A 1 102 ? 10.435  20.502  61.251  1.00 10.92 ? 102 ALA A N   1 
ATOM   844   C CA  . ALA A 1 102 ? 10.643  21.841  60.671  1.00 10.40 ? 102 ALA A CA  1 
ATOM   845   C C   . ALA A 1 102 ? 11.943  22.489  61.151  1.00 10.35 ? 102 ALA A C   1 
ATOM   846   O O   . ALA A 1 102 ? 12.594  23.246  60.416  1.00 10.10 ? 102 ALA A O   1 
ATOM   847   C CB  . ALA A 1 102 ? 9.485   22.721  61.015  1.00 10.72 ? 102 ALA A CB  1 
ATOM   848   N N   . LEU A 1 103 ? 12.333  22.180  62.384  1.00 9.44  ? 103 LEU A N   1 
ATOM   849   C CA  . LEU A 1 103 ? 13.538  22.748  62.968  1.00 10.17 ? 103 LEU A CA  1 
ATOM   850   C C   . LEU A 1 103 ? 14.796  22.418  62.181  1.00 9.81  ? 103 LEU A C   1 
ATOM   851   O O   . LEU A 1 103 ? 15.732  23.208  62.139  1.00 10.18 ? 103 LEU A O   1 
ATOM   852   C CB  . LEU A 1 103 ? 13.686  22.289  64.429  1.00 10.04 ? 103 LEU A CB  1 
ATOM   853   C CG  . LEU A 1 103 ? 12.468  22.703  65.254  1.00 10.81 ? 103 LEU A CG  1 
ATOM   854   C CD1 . LEU A 1 103 ? 12.374  21.913  66.529  1.00 11.73 ? 103 LEU A CD1 1 
ATOM   855   C CD2 . LEU A 1 103 ? 12.462  24.198  65.580  1.00 10.92 ? 103 LEU A CD2 1 
ATOM   856   N N   . ARG A 1 104 ? 14.809  21.257  61.546  1.00 10.21 ? 104 ARG A N   1 
ATOM   857   C CA  . ARG A 1 104 ? 15.954  20.800  60.778  1.00 10.32 ? 104 ARG A CA  1 
ATOM   858   C C   . ARG A 1 104 ? 15.636  20.660  59.289  1.00 11.18 ? 104 ARG A C   1 
ATOM   859   O O   . ARG A 1 104 ? 16.307  19.920  58.573  1.00 11.29 ? 104 ARG A O   1 
ATOM   860   C CB  . ARG A 1 104 ? 16.463  19.455  61.321  1.00 9.63  ? 104 ARG A CB  1 
ATOM   861   C CG  . ARG A 1 104 ? 15.501  18.283  61.206  1.00 10.03 ? 104 ARG A CG  1 
ATOM   862   C CD  . ARG A 1 104 ? 14.991  17.755  62.559  1.00 9.25  ? 104 ARG A CD  1 
ATOM   863   N NE  . ARG A 1 104 ? 14.312  16.459  62.435  1.00 10.55 ? 104 ARG A NE  1 
ATOM   864   C CZ  . ARG A 1 104 ? 13.980  15.670  63.457  1.00 10.23 ? 104 ARG A CZ  1 
ATOM   865   N NH1 . ARG A 1 104 ? 14.216  16.061  64.706  1.00 10.41 ? 104 ARG A NH1 1 
ATOM   866   N NH2 . ARG A 1 104 ? 13.394  14.486  63.226  1.00 8.48  ? 104 ARG A NH2 1 
ATOM   867   N N   . ASN A 1 105 ? 14.609  21.362  58.826  1.00 12.50 ? 105 ASN A N   1 
ATOM   868   C CA  . ASN A 1 105 ? 14.219  21.308  57.424  1.00 13.00 ? 105 ASN A CA  1 
ATOM   869   C C   . ASN A 1 105 ? 15.199  22.135  56.593  1.00 13.43 ? 105 ASN A C   1 
ATOM   870   O O   . ASN A 1 105 ? 14.935  23.283  56.245  1.00 13.40 ? 105 ASN A O   1 
ATOM   871   C CB  . ASN A 1 105 ? 12.797  21.806  57.270  1.00 13.45 ? 105 ASN A CB  1 
ATOM   872   C CG  . ASN A 1 105 ? 12.330  21.838  55.820  1.00 13.57 ? 105 ASN A CG  1 
ATOM   873   O OD1 . ASN A 1 105 ? 12.824  21.088  54.973  1.00 12.85 ? 105 ASN A OD1 1 
ATOM   874   N ND2 . ASN A 1 105 ? 11.362  22.698  55.541  1.00 15.25 ? 105 ASN A ND2 1 
ATOM   875   N N   . ARG A 1 106 ? 16.346  21.547  56.308  1.00 14.02 ? 106 ARG A N   1 
ATOM   876   C CA  . ARG A 1 106 ? 17.399  22.248  55.595  1.00 15.08 ? 106 ARG A CA  1 
ATOM   877   C C   . ARG A 1 106 ? 16.960  22.663  54.186  1.00 15.97 ? 106 ARG A C   1 
ATOM   878   O O   . ARG A 1 106 ? 17.525  23.582  53.623  1.00 15.15 ? 106 ARG A O   1 
ATOM   879   C CB  . ARG A 1 106 ? 18.663  21.400  55.506  1.00 14.86 ? 106 ARG A CB  1 
ATOM   880   C CG  . ARG A 1 106 ? 19.173  20.868  56.825  1.00 14.89 ? 106 ARG A CG  1 
ATOM   881   C CD  . ARG A 1 106 ? 19.364  21.901  57.863  1.00 15.83 ? 106 ARG A CD  1 
ATOM   882   N NE  . ARG A 1 106 ? 20.463  22.776  57.502  1.00 16.51 ? 106 ARG A NE  1 
ATOM   883   C CZ  . ARG A 1 106 ? 20.707  23.960  58.047  1.00 17.79 ? 106 ARG A CZ  1 
ATOM   884   N NH1 . ARG A 1 106 ? 19.930  24.453  58.999  1.00 15.95 ? 106 ARG A NH1 1 
ATOM   885   N NH2 . ARG A 1 106 ? 21.751  24.662  57.632  1.00 17.27 ? 106 ARG A NH2 1 
ATOM   886   N N   . SER A 1 107 ? 15.970  21.972  53.629  1.00 17.14 ? 107 SER A N   1 
ATOM   887   C CA  . SER A 1 107 ? 15.457  22.285  52.293  1.00 18.85 ? 107 SER A CA  1 
ATOM   888   C C   . SER A 1 107 ? 14.723  23.597  52.226  1.00 18.53 ? 107 SER A C   1 
ATOM   889   O O   . SER A 1 107 ? 14.588  24.178  51.147  1.00 18.87 ? 107 SER A O   1 
ATOM   890   C CB  . SER A 1 107 ? 14.484  21.195  51.844  1.00 18.92 ? 107 SER A CB  1 
ATOM   891   O OG  . SER A 1 107 ? 15.226  20.042  51.518  1.00 23.46 ? 107 SER A OG  1 
ATOM   892   N N   . ASN A 1 108 ? 14.215  24.035  53.372  1.00 18.15 ? 108 ASN A N   1 
ATOM   893   C CA  . ASN A 1 108 ? 13.441  25.266  53.473  1.00 18.78 ? 108 ASN A CA  1 
ATOM   894   C C   . ASN A 1 108 ? 12.136  25.236  52.670  1.00 19.03 ? 108 ASN A C   1 
ATOM   895   O O   . ASN A 1 108 ? 11.526  26.270  52.412  1.00 19.33 ? 108 ASN A O   1 
ATOM   896   C CB  . ASN A 1 108 ? 14.310  26.486  53.153  1.00 18.88 ? 108 ASN A CB  1 
ATOM   897   C CG  . ASN A 1 108 ? 15.306  26.780  54.260  1.00 19.18 ? 108 ASN A CG  1 
ATOM   898   O OD1 . ASN A 1 108 ? 14.976  26.636  55.426  1.00 17.87 ? 108 ASN A OD1 1 
ATOM   899   N ND2 . ASN A 1 108 ? 16.524  27.165  53.901  1.00 17.35 ? 108 ASN A ND2 1 
ATOM   900   N N   . THR A 1 109 ? 11.695  24.038  52.314  1.00 19.41 ? 109 THR A N   1 
ATOM   901   C CA  . THR A 1 109 ? 10.407  23.859  51.676  1.00 20.09 ? 109 THR A CA  1 
ATOM   902   C C   . THR A 1 109 ? 9.372   24.311  52.692  1.00 19.42 ? 109 THR A C   1 
ATOM   903   O O   . THR A 1 109 ? 9.439   23.900  53.842  1.00 18.66 ? 109 THR A O   1 
ATOM   904   C CB  . THR A 1 109 ? 10.186  22.376  51.378  1.00 20.59 ? 109 THR A CB  1 
ATOM   905   O OG1 . THR A 1 109 ? 11.120  21.935  50.381  1.00 23.14 ? 109 THR A OG1 1 
ATOM   906   C CG2 . THR A 1 109 ? 8.834   22.138  50.747  1.00 22.42 ? 109 THR A CG2 1 
ATOM   907   N N   . PRO A 1 110 ? 8.409   25.138  52.291  1.00 19.31 ? 110 PRO A N   1 
ATOM   908   C CA  . PRO A 1 110 ? 7.411   25.647  53.237  1.00 18.78 ? 110 PRO A CA  1 
ATOM   909   C C   . PRO A 1 110 ? 6.658   24.587  54.026  1.00 18.43 ? 110 PRO A C   1 
ATOM   910   O O   . PRO A 1 110 ? 6.259   23.584  53.448  1.00 17.91 ? 110 PRO A O   1 
ATOM   911   C CB  . PRO A 1 110 ? 6.418   26.384  52.329  1.00 19.44 ? 110 PRO A CB  1 
ATOM   912   C CG  . PRO A 1 110 ? 7.219   26.800  51.169  1.00 19.90 ? 110 PRO A CG  1 
ATOM   913   C CD  . PRO A 1 110 ? 8.197   25.675  50.934  1.00 19.62 ? 110 PRO A CD  1 
ATOM   914   N N   . ILE A 1 111 ? 6.473   24.826  55.324  1.00 17.86 ? 111 ILE A N   1 
ATOM   915   C CA  . ILE A 1 111 ? 5.636   23.983  56.179  1.00 18.14 ? 111 ILE A CA  1 
ATOM   916   C C   . ILE A 1 111 ? 4.703   24.948  56.874  1.00 18.58 ? 111 ILE A C   1 
ATOM   917   O O   . ILE A 1 111 ? 5.154   25.812  57.629  1.00 17.67 ? 111 ILE A O   1 
ATOM   918   C CB  . ILE A 1 111 ? 6.454   23.220  57.245  1.00 18.12 ? 111 ILE A CB  1 
ATOM   919   C CG1 . ILE A 1 111 ? 7.406   22.216  56.583  1.00 18.12 ? 111 ILE A CG1 1 
ATOM   920   C CG2 . ILE A 1 111 ? 5.489   22.538  58.209  1.00 18.31 ? 111 ILE A CG2 1 
ATOM   921   C CD1 . ILE A 1 111 ? 8.438   21.593  57.545  1.00 17.97 ? 111 ILE A CD1 1 
ATOM   922   N N   . LEU A 1 112 ? 3.407   24.797  56.626  1.00 19.23 ? 112 LEU A N   1 
ATOM   923   C CA  . LEU A 1 112 ? 2.421   25.745  57.113  1.00 20.59 ? 112 LEU A CA  1 
ATOM   924   C C   . LEU A 1 112 ? 1.678   25.272  58.327  1.00 21.26 ? 112 LEU A C   1 
ATOM   925   O O   . LEU A 1 112 ? 1.279   24.114  58.391  1.00 20.97 ? 112 LEU A O   1 
ATOM   926   C CB  . LEU A 1 112 ? 1.343   25.987  56.041  1.00 20.68 ? 112 LEU A CB  1 
ATOM   927   C CG  . LEU A 1 112 ? 1.776   26.297  54.613  1.00 23.01 ? 112 LEU A CG  1 
ATOM   928   C CD1 . LEU A 1 112 ? 0.559   26.635  53.741  1.00 24.59 ? 112 LEU A CD1 1 
ATOM   929   C CD2 . LEU A 1 112 ? 2.767   27.433  54.612  1.00 24.42 ? 112 LEU A CD2 1 
ATOM   930   N N   . VAL A 1 113 ? 1.483   26.171  59.289  1.00 22.26 ? 113 VAL A N   1 
ATOM   931   C CA  . VAL A 1 113 ? 0.529   25.902  60.354  1.00 23.29 ? 113 VAL A CA  1 
ATOM   932   C C   . VAL A 1 113 ? -0.439  27.090  60.321  1.00 24.10 ? 113 VAL A C   1 
ATOM   933   O O   . VAL A 1 113 ? -0.021  28.256  60.312  1.00 23.69 ? 113 VAL A O   1 
ATOM   934   C CB  . VAL A 1 113 ? 1.149   25.621  61.767  1.00 23.89 ? 113 VAL A CB  1 
ATOM   935   C CG1 . VAL A 1 113 ? 2.593   25.179  61.666  1.00 22.83 ? 113 VAL A CG1 1 
ATOM   936   C CG2 . VAL A 1 113 ? 0.990   26.780  62.694  1.00 24.25 ? 113 VAL A CG2 1 
ATOM   937   N N   . ASP A 1 114 ? -1.729  26.772  60.250  1.00 24.93 ? 114 ASP A N   1 
ATOM   938   C CA  . ASP A 1 114 ? -2.780  27.780  60.118  1.00 25.56 ? 114 ASP A CA  1 
ATOM   939   C C   . ASP A 1 114 ? -2.477  28.721  58.971  1.00 25.19 ? 114 ASP A C   1 
ATOM   940   O O   . ASP A 1 114 ? -2.598  29.928  59.109  1.00 25.82 ? 114 ASP A O   1 
ATOM   941   C CB  . ASP A 1 114 ? -2.943  28.548  61.417  1.00 25.73 ? 114 ASP A CB  1 
ATOM   942   C CG  . ASP A 1 114 ? -3.480  27.673  62.531  1.00 28.17 ? 114 ASP A CG  1 
ATOM   943   O OD1 . ASP A 1 114 ? -2.978  27.771  63.677  1.00 29.22 ? 114 ASP A OD1 1 
ATOM   944   O OD2 . ASP A 1 114 ? -4.397  26.841  62.337  1.00 29.94 ? 114 ASP A OD2 1 
ATOM   945   N N   . GLY A 1 115 ? -2.045  28.152  57.850  1.00 25.03 ? 115 GLY A N   1 
ATOM   946   C CA  . GLY A 1 115 ? -1.764  28.912  56.645  1.00 24.58 ? 115 GLY A CA  1 
ATOM   947   C C   . GLY A 1 115 ? -0.486  29.741  56.580  1.00 24.39 ? 115 GLY A C   1 
ATOM   948   O O   . GLY A 1 115 ? -0.260  30.430  55.582  1.00 24.36 ? 115 GLY A O   1 
ATOM   949   N N   . LYS A 1 116 ? 0.366   29.672  57.603  1.00 23.30 ? 116 LYS A N   1 
ATOM   950   C CA  . LYS A 1 116 ? 1.578   30.480  57.623  1.00 22.67 ? 116 LYS A CA  1 
ATOM   951   C C   . LYS A 1 116 ? 2.859   29.639  57.724  1.00 21.52 ? 116 LYS A C   1 
ATOM   952   O O   . LYS A 1 116 ? 2.990   28.815  58.612  1.00 20.77 ? 116 LYS A O   1 
ATOM   953   C CB  . LYS A 1 116 ? 1.509   31.457  58.790  1.00 23.14 ? 116 LYS A CB  1 
ATOM   954   C CG  . LYS A 1 116 ? 2.625   32.473  58.798  1.00 24.98 ? 116 LYS A CG  1 
ATOM   955   C CD  . LYS A 1 116 ? 2.554   33.337  60.043  1.00 27.61 ? 116 LYS A CD  1 
ATOM   956   C CE  . LYS A 1 116 ? 3.712   34.333  60.112  1.00 28.43 ? 116 LYS A CE  1 
ATOM   957   N NZ  . LYS A 1 116 ? 3.760   35.210  58.915  1.00 31.77 ? 116 LYS A NZ  1 
ATOM   958   N N   . ASP A 1 117 ? 3.800   29.872  56.808  1.00 20.21 ? 117 ASP A N   1 
ATOM   959   C CA  . ASP A 1 117 ? 5.066   29.136  56.772  1.00 19.15 ? 117 ASP A CA  1 
ATOM   960   C C   . ASP A 1 117 ? 5.875   29.375  58.047  1.00 18.32 ? 117 ASP A C   1 
ATOM   961   O O   . ASP A 1 117 ? 6.086   30.517  58.443  1.00 17.75 ? 117 ASP A O   1 
ATOM   962   C CB  . ASP A 1 117 ? 5.871   29.576  55.557  1.00 19.02 ? 117 ASP A CB  1 
ATOM   963   C CG  . ASP A 1 117 ? 7.128   28.743  55.327  1.00 18.58 ? 117 ASP A CG  1 
ATOM   964   O OD1 . ASP A 1 117 ? 7.362   27.722  56.018  1.00 17.26 ? 117 ASP A OD1 1 
ATOM   965   O OD2 . ASP A 1 117 ? 7.929   29.025  54.422  1.00 14.53 ? 117 ASP A OD2 1 
ATOM   966   N N   . VAL A 1 118 ? 6.295   28.293  58.704  1.00 16.93 ? 118 VAL A N   1 
ATOM   967   C CA  . VAL A 1 118 ? 7.111   28.402  59.911  1.00 16.59 ? 118 VAL A CA  1 
ATOM   968   C C   . VAL A 1 118 ? 8.618   28.554  59.641  1.00 16.02 ? 118 VAL A C   1 
ATOM   969   O O   . VAL A 1 118 ? 9.391   28.925  60.554  1.00 15.91 ? 118 VAL A O   1 
ATOM   970   C CB  . VAL A 1 118 ? 6.911   27.180  60.843  1.00 16.45 ? 118 VAL A CB  1 
ATOM   971   C CG1 . VAL A 1 118 ? 5.458   27.013  61.199  1.00 17.45 ? 118 VAL A CG1 1 
ATOM   972   C CG2 . VAL A 1 118 ? 7.438   25.918  60.198  1.00 16.69 ? 118 VAL A CG2 1 
ATOM   973   N N   . MET A 1 119 ? 9.055   28.299  58.413  1.00 15.03 ? 119 MET A N   1 
ATOM   974   C CA  . MET A 1 119 ? 10.493  28.295  58.151  1.00 15.50 ? 119 MET A CA  1 
ATOM   975   C C   . MET A 1 119 ? 11.188  29.640  58.382  1.00 15.89 ? 119 MET A C   1 
ATOM   976   O O   . MET A 1 119 ? 12.287  29.680  58.947  1.00 16.14 ? 119 MET A O   1 
ATOM   977   C CB  . MET A 1 119 ? 10.825  27.705  56.782  1.00 15.38 ? 119 MET A CB  1 
ATOM   978   C CG  . MET A 1 119 ? 10.462  26.235  56.641  1.00 15.69 ? 119 MET A CG  1 
ATOM   979   S SD  . MET A 1 119 ? 11.036  25.164  58.016  1.00 13.98 ? 119 MET A SD  1 
ATOM   980   C CE  . MET A 1 119 ? 12.785  25.502  58.034  1.00 16.86 ? 119 MET A CE  1 
ATOM   981   N N   . PRO A 1 120 ? 10.581  30.749  57.987  1.00 16.29 ? 120 PRO A N   1 
ATOM   982   C CA  . PRO A 1 120 ? 11.214  32.036  58.270  1.00 16.58 ? 120 PRO A CA  1 
ATOM   983   C C   . PRO A 1 120 ? 11.520  32.215  59.759  1.00 16.47 ? 120 PRO A C   1 
ATOM   984   O O   . PRO A 1 120 ? 12.648  32.610  60.084  1.00 16.33 ? 120 PRO A O   1 
ATOM   985   C CB  . PRO A 1 120 ? 10.202  33.062  57.740  1.00 16.68 ? 120 PRO A CB  1 
ATOM   986   C CG  . PRO A 1 120 ? 9.493   32.319  56.624  1.00 16.92 ? 120 PRO A CG  1 
ATOM   987   C CD  . PRO A 1 120 ? 9.369   30.893  57.163  1.00 16.47 ? 120 PRO A CD  1 
ATOM   988   N N   . GLU A 1 121 ? 10.571  31.923  60.639  1.00 16.34 ? 121 GLU A N   1 
ATOM   989   C CA  . GLU A 1 121 ? 10.816  32.058  62.073  1.00 17.60 ? 121 GLU A CA  1 
ATOM   990   C C   . GLU A 1 121 ? 11.903  31.084  62.580  1.00 16.55 ? 121 GLU A C   1 
ATOM   991   O O   . GLU A 1 121 ? 12.759  31.455  63.398  1.00 16.00 ? 121 GLU A O   1 
ATOM   992   C CB  . GLU A 1 121 ? 9.518   31.887  62.864  1.00 18.91 ? 121 GLU A CB  1 
ATOM   993   C CG  . GLU A 1 121 ? 8.536   33.059  62.745  1.00 24.22 ? 121 GLU A CG  1 
ATOM   994   C CD  . GLU A 1 121 ? 9.106   34.407  63.147  1.00 31.23 ? 121 GLU A CD  1 
ATOM   995   O OE1 . GLU A 1 121 ? 10.112  34.480  63.886  1.00 36.00 ? 121 GLU A OE1 1 
ATOM   996   O OE2 . GLU A 1 121 ? 8.533   35.427  62.706  1.00 38.59 ? 121 GLU A OE2 1 
ATOM   997   N N   . VAL A 1 122 ? 11.856  29.850  62.098  1.00 15.46 ? 122 VAL A N   1 
ATOM   998   C CA  . VAL A 1 122 ? 12.886  28.873  62.391  1.00 14.75 ? 122 VAL A CA  1 
ATOM   999   C C   . VAL A 1 122 ? 14.254  29.418  62.033  1.00 14.63 ? 122 VAL A C   1 
ATOM   1000  O O   . VAL A 1 122 ? 15.195  29.399  62.847  1.00 12.96 ? 122 VAL A O   1 
ATOM   1001  C CB  . VAL A 1 122 ? 12.662  27.592  61.577  1.00 14.90 ? 122 VAL A CB  1 
ATOM   1002  C CG1 . VAL A 1 122 ? 13.933  26.724  61.535  1.00 15.61 ? 122 VAL A CG1 1 
ATOM   1003  C CG2 . VAL A 1 122 ? 11.461  26.799  62.133  1.00 14.73 ? 122 VAL A CG2 1 
ATOM   1004  N N   . ASN A 1 123 ? 14.357  29.913  60.803  1.00 14.33 ? 123 ASN A N   1 
ATOM   1005  C CA  . ASN A 1 123 ? 15.631  30.367  60.280  1.00 15.04 ? 123 ASN A CA  1 
ATOM   1006  C C   . ASN A 1 123 ? 16.123  31.634  60.956  1.00 14.80 ? 123 ASN A C   1 
ATOM   1007  O O   . ASN A 1 123 ? 17.324  31.823  61.122  1.00 14.94 ? 123 ASN A O   1 
ATOM   1008  C CB  . ASN A 1 123 ? 15.558  30.520  58.744  1.00 14.96 ? 123 ASN A CB  1 
ATOM   1009  C CG  . ASN A 1 123 ? 15.566  29.188  58.039  1.00 15.50 ? 123 ASN A CG  1 
ATOM   1010  O OD1 . ASN A 1 123 ? 16.225  28.256  58.492  1.00 15.74 ? 123 ASN A OD1 1 
ATOM   1011  N ND2 . ASN A 1 123 ? 14.811  29.073  56.936  1.00 14.62 ? 123 ASN A ND2 1 
ATOM   1012  N N   . LYS A 1 124 ? 15.198  32.499  61.345  1.00 15.34 ? 124 LYS A N   1 
ATOM   1013  C CA  . LYS A 1 124 ? 15.554  33.716  62.053  1.00 15.33 ? 124 LYS A CA  1 
ATOM   1014  C C   . LYS A 1 124 ? 16.240  33.358  63.364  1.00 14.57 ? 124 LYS A C   1 
ATOM   1015  O O   . LYS A 1 124 ? 17.263  33.935  63.713  1.00 13.54 ? 124 LYS A O   1 
ATOM   1016  C CB  . LYS A 1 124 ? 14.315  34.549  62.367  1.00 15.78 ? 124 LYS A CB  1 
ATOM   1017  C CG  . LYS A 1 124 ? 14.645  35.865  63.072  1.00 19.61 ? 124 LYS A CG  1 
ATOM   1018  C CD  . LYS A 1 124 ? 13.408  36.745  63.279  1.00 23.93 ? 124 LYS A CD  1 
ATOM   1019  C CE  . LYS A 1 124 ? 13.795  38.208  63.484  1.00 26.84 ? 124 LYS A CE  1 
ATOM   1020  N NZ  . LYS A 1 124 ? 13.768  38.564  64.929  1.00 29.64 ? 124 LYS A NZ  1 
ATOM   1021  N N   . VAL A 1 125 ? 15.667  32.404  64.099  1.00 13.30 ? 125 VAL A N   1 
ATOM   1022  C CA  . VAL A 1 125 ? 16.284  31.994  65.348  1.00 13.14 ? 125 VAL A CA  1 
ATOM   1023  C C   . VAL A 1 125 ? 17.651  31.340  65.101  1.00 12.78 ? 125 VAL A C   1 
ATOM   1024  O O   . VAL A 1 125 ? 18.606  31.590  65.823  1.00 12.46 ? 125 VAL A O   1 
ATOM   1025  C CB  . VAL A 1 125 ? 15.382  31.055  66.150  1.00 12.84 ? 125 VAL A CB  1 
ATOM   1026  C CG1 . VAL A 1 125 ? 16.126  30.537  67.359  1.00 12.38 ? 125 VAL A CG1 1 
ATOM   1027  C CG2 . VAL A 1 125 ? 14.107  31.764  66.579  1.00 14.64 ? 125 VAL A CG2 1 
ATOM   1028  N N   . LEU A 1 126 ? 17.747  30.482  64.093  1.00 13.15 ? 126 LEU A N   1 
ATOM   1029  C CA  . LEU A 1 126 ? 19.023  29.850  63.763  1.00 12.92 ? 126 LEU A CA  1 
ATOM   1030  C C   . LEU A 1 126 ? 20.116  30.894  63.433  1.00 13.67 ? 126 LEU A C   1 
ATOM   1031  O O   . LEU A 1 126 ? 21.271  30.758  63.836  1.00 12.80 ? 126 LEU A O   1 
ATOM   1032  C CB  . LEU A 1 126 ? 18.833  28.860  62.596  1.00 13.61 ? 126 LEU A CB  1 
ATOM   1033  C CG  . LEU A 1 126 ? 18.198  27.493  62.921  1.00 12.22 ? 126 LEU A CG  1 
ATOM   1034  C CD1 . LEU A 1 126 ? 17.808  26.734  61.648  1.00 11.51 ? 126 LEU A CD1 1 
ATOM   1035  C CD2 . LEU A 1 126 ? 19.128  26.647  63.765  1.00 13.81 ? 126 LEU A CD2 1 
ATOM   1036  N N   . ASP A 1 127 ? 19.753  31.932  62.687  1.00 14.60 ? 127 ASP A N   1 
ATOM   1037  C CA  . ASP A 1 127 ? 20.720  32.974  62.354  1.00 15.50 ? 127 ASP A CA  1 
ATOM   1038  C C   . ASP A 1 127 ? 21.182  33.664  63.616  1.00 15.24 ? 127 ASP A C   1 
ATOM   1039  O O   . ASP A 1 127 ? 22.357  34.002  63.746  1.00 15.18 ? 127 ASP A O   1 
ATOM   1040  C CB  . ASP A 1 127 ? 20.126  34.009  61.403  1.00 16.25 ? 127 ASP A CB  1 
ATOM   1041  C CG  . ASP A 1 127 ? 19.921  33.483  60.017  1.00 17.80 ? 127 ASP A CG  1 
ATOM   1042  O OD1 . ASP A 1 127 ? 20.501  32.446  59.642  1.00 22.30 ? 127 ASP A OD1 1 
ATOM   1043  O OD2 . ASP A 1 127 ? 19.172  34.058  59.219  1.00 23.37 ? 127 ASP A OD2 1 
ATOM   1044  N N   . LYS A 1 128 ? 20.252  33.875  64.543  1.00 15.18 ? 128 LYS A N   1 
ATOM   1045  C CA  . LYS A 1 128 ? 20.552  34.518  65.814  1.00 15.66 ? 128 LYS A CA  1 
ATOM   1046  C C   . LYS A 1 128 ? 21.565  33.662  66.552  1.00 14.65 ? 128 LYS A C   1 
ATOM   1047  O O   . LYS A 1 128 ? 22.575  34.158  67.055  1.00 14.30 ? 128 LYS A O   1 
ATOM   1048  C CB  . LYS A 1 128 ? 19.268  34.650  66.650  1.00 16.68 ? 128 LYS A CB  1 
ATOM   1049  C CG  . LYS A 1 128 ? 19.233  35.780  67.650  1.00 20.70 ? 128 LYS A CG  1 
ATOM   1050  C CD  . LYS A 1 128 ? 17.774  36.165  68.009  1.00 24.22 ? 128 LYS A CD  1 
ATOM   1051  C CE  . LYS A 1 128 ? 17.696  37.248  69.078  1.00 26.06 ? 128 LYS A CE  1 
ATOM   1052  N NZ  . LYS A 1 128 ? 18.009  38.617  68.609  1.00 27.49 ? 128 LYS A NZ  1 
ATOM   1053  N N   . MET A 1 129 ? 21.286  32.364  66.607  1.00 13.39 ? 129 MET A N   1 
ATOM   1054  C CA  . MET A 1 129 ? 22.171  31.429  67.270  1.00 13.06 ? 129 MET A CA  1 
ATOM   1055  C C   . MET A 1 129 ? 23.573  31.468  66.679  1.00 13.14 ? 129 MET A C   1 
ATOM   1056  O O   . MET A 1 129 ? 24.562  31.463  67.411  1.00 13.39 ? 129 MET A O   1 
ATOM   1057  C CB  . MET A 1 129 ? 21.618  29.991  67.155  1.00 13.24 ? 129 MET A CB  1 
ATOM   1058  C CG  . MET A 1 129 ? 20.349  29.745  67.961  1.00 12.80 ? 129 MET A CG  1 
ATOM   1059  S SD  . MET A 1 129 ? 19.524  28.166  67.592  1.00 12.82 ? 129 MET A SD  1 
ATOM   1060  C CE  . MET A 1 129 ? 20.451  27.009  68.688  1.00 12.83 ? 129 MET A CE  1 
ATOM   1061  N N   . LYS A 1 130 ? 23.653  31.471  65.351  1.00 13.90 ? 130 LYS A N   1 
ATOM   1062  C CA  . LYS A 1 130 ? 24.933  31.457  64.660  1.00 14.56 ? 130 LYS A CA  1 
ATOM   1063  C C   . LYS A 1 130 ? 25.787  32.668  65.078  1.00 14.09 ? 130 LYS A C   1 
ATOM   1064  O O   . LYS A 1 130 ? 26.974  32.545  65.406  1.00 14.13 ? 130 LYS A O   1 
ATOM   1065  C CB  . LYS A 1 130 ? 24.689  31.440  63.138  1.00 14.52 ? 130 LYS A CB  1 
ATOM   1066  C CG  . LYS A 1 130 ? 25.970  31.356  62.310  1.00 16.29 ? 130 LYS A CG  1 
ATOM   1067  C CD  . LYS A 1 130 ? 25.702  31.316  60.798  1.00 18.88 ? 130 LYS A CD  1 
ATOM   1068  C CE  . LYS A 1 130 ? 26.976  30.931  60.052  1.00 20.62 ? 130 LYS A CE  1 
ATOM   1069  N NZ  . LYS A 1 130 ? 26.789  30.648  58.598  1.00 22.14 ? 130 LYS A NZ  1 
ATOM   1070  N N   . SER A 1 131 ? 25.169  33.838  65.069  1.00 14.64 ? 131 SER A N   1 
ATOM   1071  C CA  . SER A 1 131 ? 25.868  35.072  65.425  1.00 14.77 ? 131 SER A CA  1 
ATOM   1072  C C   . SER A 1 131 ? 26.369  35.054  66.861  1.00 13.74 ? 131 SER A C   1 
ATOM   1073  O O   . SER A 1 131 ? 27.530  35.358  67.127  1.00 13.15 ? 131 SER A O   1 
ATOM   1074  C CB  . SER A 1 131 ? 24.958  36.279  65.203  1.00 15.73 ? 131 SER A CB  1 
ATOM   1075  O OG  . SER A 1 131 ? 25.484  37.415  65.854  1.00 18.08 ? 131 SER A OG  1 
ATOM   1076  N N   . PHE A 1 132 ? 25.491  34.671  67.780  1.00 13.40 ? 132 PHE A N   1 
ATOM   1077  C CA  . PHE A 1 132 ? 25.846  34.590  69.188  1.00 13.08 ? 132 PHE A CA  1 
ATOM   1078  C C   . PHE A 1 132 ? 27.011  33.613  69.426  1.00 12.74 ? 132 PHE A C   1 
ATOM   1079  O O   . PHE A 1 132 ? 27.964  33.904  70.184  1.00 12.48 ? 132 PHE A O   1 
ATOM   1080  C CB  . PHE A 1 132 ? 24.614  34.209  70.014  1.00 13.26 ? 132 PHE A CB  1 
ATOM   1081  C CG  . PHE A 1 132 ? 24.878  34.154  71.494  1.00 13.63 ? 132 PHE A CG  1 
ATOM   1082  C CD1 . PHE A 1 132 ? 25.051  35.309  72.223  1.00 13.41 ? 132 PHE A CD1 1 
ATOM   1083  C CD2 . PHE A 1 132 ? 24.947  32.937  72.154  1.00 13.20 ? 132 PHE A CD2 1 
ATOM   1084  C CE1 . PHE A 1 132 ? 25.304  35.258  73.594  1.00 13.48 ? 132 PHE A CE1 1 
ATOM   1085  C CE2 . PHE A 1 132 ? 25.189  32.890  73.505  1.00 11.94 ? 132 PHE A CE2 1 
ATOM   1086  C CZ  . PHE A 1 132 ? 25.359  34.052  74.225  1.00 12.60 ? 132 PHE A CZ  1 
ATOM   1087  N N   . CYS A 1 133 ? 26.935  32.451  68.781  1.00 12.80 ? 133 CYS A N   1 
ATOM   1088  C CA  . CYS A 1 133 ? 27.989  31.458  68.884  1.00 13.30 ? 133 CYS A CA  1 
ATOM   1089  C C   . CYS A 1 133 ? 29.329  32.011  68.395  1.00 13.74 ? 133 CYS A C   1 
ATOM   1090  O O   . CYS A 1 133 ? 30.344  31.824  69.048  1.00 13.09 ? 133 CYS A O   1 
ATOM   1091  C CB  . CYS A 1 133 ? 27.621  30.191  68.104  1.00 12.71 ? 133 CYS A CB  1 
ATOM   1092  S SG  . CYS A 1 133 ? 26.390  29.167  68.955  1.00 14.81 ? 133 CYS A SG  1 
ATOM   1093  N N   . GLN A 1 134 ? 29.324  32.692  67.256  1.00 14.81 ? 134 GLN A N   1 
ATOM   1094  C CA  . GLN A 1 134 ? 30.558  33.240  66.721  1.00 16.22 ? 134 GLN A CA  1 
ATOM   1095  C C   . GLN A 1 134 ? 31.144  34.257  67.685  1.00 15.76 ? 134 GLN A C   1 
ATOM   1096  O O   . GLN A 1 134 ? 32.356  34.276  67.897  1.00 16.71 ? 134 GLN A O   1 
ATOM   1097  C CB  . GLN A 1 134 ? 30.326  33.919  65.379  1.00 17.00 ? 134 GLN A CB  1 
ATOM   1098  C CG  . GLN A 1 134 ? 31.643  34.228  64.631  1.00 20.11 ? 134 GLN A CG  1 
ATOM   1099  C CD  . GLN A 1 134 ? 32.276  35.571  64.964  1.00 24.52 ? 134 GLN A CD  1 
ATOM   1100  O OE1 . GLN A 1 134 ? 33.466  35.772  64.677  1.00 28.97 ? 134 GLN A OE1 1 
ATOM   1101  N NE2 . GLN A 1 134 ? 31.499  36.496  65.543  1.00 24.92 ? 134 GLN A NE2 1 
ATOM   1102  N N   . ARG A 1 135 ? 30.275  35.063  68.285  1.00 15.52 ? 135 ARG A N   1 
ATOM   1103  C CA  . ARG A 1 135 ? 30.715  36.097  69.224  1.00 15.20 ? 135 ARG A CA  1 
ATOM   1104  C C   . ARG A 1 135 ? 31.325  35.481  70.473  1.00 14.40 ? 135 ARG A C   1 
ATOM   1105  O O   . ARG A 1 135 ? 32.371  35.905  70.942  1.00 13.33 ? 135 ARG A O   1 
ATOM   1106  C CB  . ARG A 1 135 ? 29.551  36.991  69.610  1.00 15.59 ? 135 ARG A CB  1 
ATOM   1107  C CG  . ARG A 1 135 ? 29.100  37.934  68.502  1.00 17.60 ? 135 ARG A CG  1 
ATOM   1108  C CD  . ARG A 1 135 ? 27.858  38.684  68.825  1.00 21.09 ? 135 ARG A CD  1 
ATOM   1109  N NE  . ARG A 1 135 ? 28.076  39.698  69.853  1.00 25.49 ? 135 ARG A NE  1 
ATOM   1110  C CZ  . ARG A 1 135 ? 27.105  40.294  70.533  1.00 27.79 ? 135 ARG A CZ  1 
ATOM   1111  N NH1 . ARG A 1 135 ? 27.409  41.213  71.440  1.00 28.24 ? 135 ARG A NH1 1 
ATOM   1112  N NH2 . ARG A 1 135 ? 25.825  39.976  70.312  1.00 29.40 ? 135 ARG A NH2 1 
ATOM   1113  N N   . VAL A 1 136 ? 30.667  34.465  71.029  1.00 14.35 ? 136 VAL A N   1 
ATOM   1114  C CA  . VAL A 1 136 ? 31.195  33.854  72.241  1.00 13.66 ? 136 VAL A CA  1 
ATOM   1115  C C   . VAL A 1 136 ? 32.484  33.099  71.953  1.00 14.11 ? 136 VAL A C   1 
ATOM   1116  O O   . VAL A 1 136 ? 33.480  33.248  72.667  1.00 14.85 ? 136 VAL A O   1 
ATOM   1117  C CB  . VAL A 1 136 ? 30.156  32.940  72.920  1.00 13.44 ? 136 VAL A CB  1 
ATOM   1118  C CG1 . VAL A 1 136 ? 30.770  32.253  74.131  1.00 13.01 ? 136 VAL A CG1 1 
ATOM   1119  C CG2 . VAL A 1 136 ? 28.956  33.750  73.349  1.00 12.39 ? 136 VAL A CG2 1 
ATOM   1120  N N   . ARG A 1 137 ? 32.474  32.295  70.897  1.00 14.31 ? 137 ARG A N   1 
ATOM   1121  C CA  . ARG A 1 137 ? 33.608  31.431  70.601  1.00 14.63 ? 137 ARG A CA  1 
ATOM   1122  C C   . ARG A 1 137 ? 34.846  32.221  70.221  1.00 15.50 ? 137 ARG A C   1 
ATOM   1123  O O   . ARG A 1 137 ? 35.930  31.855  70.636  1.00 15.47 ? 137 ARG A O   1 
ATOM   1124  C CB  . ARG A 1 137 ? 33.260  30.422  69.506  1.00 14.20 ? 137 ARG A CB  1 
ATOM   1125  C CG  . ARG A 1 137 ? 32.379  29.271  70.001  1.00 13.55 ? 137 ARG A CG  1 
ATOM   1126  C CD  . ARG A 1 137 ? 31.690  28.493  68.876  1.00 13.30 ? 137 ARG A CD  1 
ATOM   1127  N NE  . ARG A 1 137 ? 32.657  27.793  68.053  1.00 11.72 ? 137 ARG A NE  1 
ATOM   1128  C CZ  . ARG A 1 137 ? 33.197  26.628  68.345  1.00 12.10 ? 137 ARG A CZ  1 
ATOM   1129  N NH1 . ARG A 1 137 ? 32.855  25.971  69.453  1.00 14.48 ? 137 ARG A NH1 1 
ATOM   1130  N NH2 . ARG A 1 137 ? 34.086  26.111  67.516  1.00 13.86 ? 137 ARG A NH2 1 
ATOM   1131  N N   . SER A 1 138 ? 34.670  33.319  69.483  1.00 16.25 ? 138 SER A N   1 
ATOM   1132  C CA  . SER A 1 138 ? 35.798  34.150  69.039  1.00 16.96 ? 138 SER A CA  1 
ATOM   1133  C C   . SER A 1 138 ? 36.419  35.022  70.138  1.00 17.69 ? 138 SER A C   1 
ATOM   1134  O O   . SER A 1 138 ? 37.504  35.590  69.952  1.00 17.91 ? 138 SER A O   1 
ATOM   1135  C CB  . SER A 1 138 ? 35.340  35.099  67.946  1.00 16.74 ? 138 SER A CB  1 
ATOM   1136  O OG  . SER A 1 138 ? 34.477  36.065  68.488  1.00 16.63 ? 138 SER A OG  1 
ATOM   1137  N N   . GLY A 1 139 ? 35.722  35.170  71.256  1.00 17.96 ? 139 GLY A N   1 
ATOM   1138  C CA  . GLY A 1 139 ? 36.201  36.020  72.330  1.00 18.05 ? 139 GLY A CA  1 
ATOM   1139  C C   . GLY A 1 139 ? 35.652  37.436  72.245  1.00 18.08 ? 139 GLY A C   1 
ATOM   1140  O O   . GLY A 1 139 ? 35.993  38.271  73.085  1.00 18.77 ? 139 GLY A O   1 
ATOM   1141  N N   . ASP A 1 140 ? 34.803  37.707  71.256  1.00 18.35 ? 140 ASP A N   1 
ATOM   1142  C CA  . ASP A 1 140 ? 34.187  39.032  71.097  1.00 18.61 ? 140 ASP A CA  1 
ATOM   1143  C C   . ASP A 1 140 ? 33.252  39.331  72.273  1.00 18.16 ? 140 ASP A C   1 
ATOM   1144  O O   . ASP A 1 140 ? 33.196  40.457  72.776  1.00 18.64 ? 140 ASP A O   1 
ATOM   1145  C CB  . ASP A 1 140 ? 33.395  39.113  69.798  1.00 19.39 ? 140 ASP A CB  1 
ATOM   1146  C CG  . ASP A 1 140 ? 32.717  40.464  69.614  1.00 22.90 ? 140 ASP A CG  1 
ATOM   1147  O OD1 . ASP A 1 140 ? 33.442  41.483  69.559  1.00 27.53 ? 140 ASP A OD1 1 
ATOM   1148  O OD2 . ASP A 1 140 ? 31.477  40.614  69.528  1.00 28.63 ? 140 ASP A OD2 1 
ATOM   1149  N N   . TRP A 1 141 ? 32.511  38.316  72.707  1.00 15.95 ? 141 TRP A N   1 
ATOM   1150  C CA  . TRP A 1 141 ? 31.622  38.471  73.843  1.00 14.93 ? 141 TRP A CA  1 
ATOM   1151  C C   . TRP A 1 141 ? 32.423  38.430  75.128  1.00 14.17 ? 141 TRP A C   1 
ATOM   1152  O O   . TRP A 1 141 ? 33.032  37.414  75.438  1.00 14.58 ? 141 TRP A O   1 
ATOM   1153  C CB  . TRP A 1 141 ? 30.575  37.347  73.854  1.00 14.50 ? 141 TRP A CB  1 
ATOM   1154  C CG  . TRP A 1 141 ? 29.554  37.505  74.938  1.00 13.38 ? 141 TRP A CG  1 
ATOM   1155  C CD1 . TRP A 1 141 ? 29.728  37.247  76.254  1.00 12.64 ? 141 TRP A CD1 1 
ATOM   1156  C CD2 . TRP A 1 141 ? 28.196  37.936  74.792  1.00 14.69 ? 141 TRP A CD2 1 
ATOM   1157  N NE1 . TRP A 1 141 ? 28.572  37.500  76.951  1.00 13.06 ? 141 TRP A NE1 1 
ATOM   1158  C CE2 . TRP A 1 141 ? 27.615  37.932  76.074  1.00 13.44 ? 141 TRP A CE2 1 
ATOM   1159  C CE3 . TRP A 1 141 ? 27.412  38.335  73.708  1.00 16.79 ? 141 TRP A CE3 1 
ATOM   1160  C CZ2 . TRP A 1 141 ? 26.302  38.308  76.301  1.00 14.71 ? 141 TRP A CZ2 1 
ATOM   1161  C CZ3 . TRP A 1 141 ? 26.113  38.708  73.936  1.00 17.87 ? 141 TRP A CZ3 1 
ATOM   1162  C CH2 . TRP A 1 141 ? 25.564  38.687  75.218  1.00 17.11 ? 141 TRP A CH2 1 
ATOM   1163  N N   . LYS A 1 142 ? 32.398  39.510  75.903  1.00 13.80 ? 142 LYS A N   1 
ATOM   1164  C CA  . LYS A 1 142 ? 33.152  39.547  77.150  1.00 13.43 ? 142 LYS A CA  1 
ATOM   1165  C C   . LYS A 1 142 ? 32.289  39.738  78.396  1.00 12.90 ? 142 LYS A C   1 
ATOM   1166  O O   . LYS A 1 142 ? 31.230  40.364  78.360  1.00 12.31 ? 142 LYS A O   1 
ATOM   1167  C CB  . LYS A 1 142 ? 34.227  40.631  77.072  1.00 14.27 ? 142 LYS A CB  1 
ATOM   1168  C CG  . LYS A 1 142 ? 35.334  40.246  76.089  1.00 14.23 ? 142 LYS A CG  1 
ATOM   1169  C CD  . LYS A 1 142 ? 36.386  41.310  75.971  1.00 17.45 ? 142 LYS A CD  1 
ATOM   1170  C CE  . LYS A 1 142 ? 37.525  40.818  75.088  1.00 15.64 ? 142 LYS A CE  1 
ATOM   1171  N NZ  . LYS A 1 142 ? 37.033  40.515  73.727  1.00 16.26 ? 142 LYS A NZ  1 
ATOM   1172  N N   . GLY A 1 143 ? 32.779  39.192  79.499  1.00 12.89 ? 143 GLY A N   1 
ATOM   1173  C CA  . GLY A 1 143 ? 32.122  39.295  80.789  1.00 12.68 ? 143 GLY A CA  1 
ATOM   1174  C C   . GLY A 1 143 ? 32.326  40.672  81.394  1.00 13.15 ? 143 GLY A C   1 
ATOM   1175  O O   . GLY A 1 143 ? 32.939  41.555  80.764  1.00 13.16 ? 143 GLY A O   1 
ATOM   1176  N N   . TYR A 1 144 ? 31.853  40.828  82.626  1.00 12.84 ? 144 TYR A N   1 
ATOM   1177  C CA  . TYR A 1 144 ? 31.822  42.123  83.291  1.00 13.58 ? 144 TYR A CA  1 
ATOM   1178  C C   . TYR A 1 144 ? 33.207  42.703  83.640  1.00 13.68 ? 144 TYR A C   1 
ATOM   1179  O O   . TYR A 1 144 ? 33.296  43.899  83.878  1.00 13.89 ? 144 TYR A O   1 
ATOM   1180  C CB  . TYR A 1 144 ? 30.871  42.087  84.505  1.00 13.51 ? 144 TYR A CB  1 
ATOM   1181  C CG  . TYR A 1 144 ? 31.457  41.481  85.736  1.00 14.64 ? 144 TYR A CG  1 
ATOM   1182  C CD1 . TYR A 1 144 ? 31.904  42.283  86.776  1.00 14.62 ? 144 TYR A CD1 1 
ATOM   1183  C CD2 . TYR A 1 144 ? 31.553  40.106  85.874  1.00 14.64 ? 144 TYR A CD2 1 
ATOM   1184  C CE1 . TYR A 1 144 ? 32.448  41.727  87.906  1.00 16.85 ? 144 TYR A CE1 1 
ATOM   1185  C CE2 . TYR A 1 144 ? 32.091  39.552  86.983  1.00 15.07 ? 144 TYR A CE2 1 
ATOM   1186  C CZ  . TYR A 1 144 ? 32.542  40.364  88.002  1.00 17.31 ? 144 TYR A CZ  1 
ATOM   1187  O OH  . TYR A 1 144 ? 33.070  39.797  89.127  1.00 17.99 ? 144 TYR A OH  1 
ATOM   1188  N N   . THR A 1 145 ? 34.269  41.885  83.622  1.00 13.47 ? 145 THR A N   1 
ATOM   1189  C CA  . THR A 1 145 ? 35.641  42.371  83.828  1.00 13.80 ? 145 THR A CA  1 
ATOM   1190  C C   . THR A 1 145 ? 36.492  42.259  82.555  1.00 13.80 ? 145 THR A C   1 
ATOM   1191  O O   . THR A 1 145 ? 37.719  42.267  82.611  1.00 14.32 ? 145 THR A O   1 
ATOM   1192  C CB  . THR A 1 145 ? 36.339  41.627  84.965  1.00 14.08 ? 145 THR A CB  1 
ATOM   1193  O OG1 . THR A 1 145 ? 36.536  40.249  84.599  1.00 12.39 ? 145 THR A OG1 1 
ATOM   1194  C CG2 . THR A 1 145 ? 35.470  41.622  86.224  1.00 13.08 ? 145 THR A CG2 1 
ATOM   1195  N N   . GLY A 1 146 ? 35.825  42.116  81.419  1.00 13.98 ? 146 GLY A N   1 
ATOM   1196  C CA  . GLY A 1 146 ? 36.491  42.046  80.135  1.00 13.89 ? 146 GLY A CA  1 
ATOM   1197  C C   . GLY A 1 146 ? 37.093  40.713  79.734  1.00 13.49 ? 146 GLY A C   1 
ATOM   1198  O O   . GLY A 1 146 ? 37.860  40.671  78.780  1.00 12.97 ? 146 GLY A O   1 
ATOM   1199  N N   . LYS A 1 147 ? 36.759  39.623  80.426  1.00 13.91 ? 147 LYS A N   1 
ATOM   1200  C CA  . LYS A 1 147 ? 37.353  38.324  80.093  1.00 13.86 ? 147 LYS A CA  1 
ATOM   1201  C C   . LYS A 1 147 ? 36.478  37.535  79.126  1.00 13.77 ? 147 LYS A C   1 
ATOM   1202  O O   . LYS A 1 147 ? 35.264  37.756  79.056  1.00 13.75 ? 147 LYS A O   1 
ATOM   1203  C CB  . LYS A 1 147 ? 37.616  37.505  81.359  1.00 14.26 ? 147 LYS A CB  1 
ATOM   1204  C CG  . LYS A 1 147 ? 38.583  38.200  82.323  1.00 15.65 ? 147 LYS A CG  1 
ATOM   1205  C CD  . LYS A 1 147 ? 39.147  37.284  83.376  1.00 17.92 ? 147 LYS A CD  1 
ATOM   1206  C CE  . LYS A 1 147 ? 40.087  38.059  84.277  1.00 20.12 ? 147 LYS A CE  1 
ATOM   1207  N NZ  . LYS A 1 147 ? 40.470  37.339  85.496  1.00 20.58 ? 147 LYS A NZ  1 
ATOM   1208  N N   . THR A 1 148 ? 37.093  36.643  78.353  1.00 12.81 ? 148 THR A N   1 
ATOM   1209  C CA  . THR A 1 148 ? 36.325  35.815  77.445  1.00 12.77 ? 148 THR A CA  1 
ATOM   1210  C C   . THR A 1 148 ? 35.639  34.707  78.248  1.00 12.56 ? 148 THR A C   1 
ATOM   1211  O O   . THR A 1 148 ? 36.013  34.425  79.381  1.00 11.74 ? 148 THR A O   1 
ATOM   1212  C CB  . THR A 1 148 ? 37.199  35.209  76.342  1.00 12.91 ? 148 THR A CB  1 
ATOM   1213  O OG1 . THR A 1 148 ? 38.286  34.488  76.928  1.00 12.50 ? 148 THR A OG1 1 
ATOM   1214  C CG2 . THR A 1 148 ? 37.849  36.293  75.519  1.00 14.21 ? 148 THR A CG2 1 
ATOM   1215  N N   . ILE A 1 149 ? 34.661  34.063  77.621  1.00 12.71 ? 149 ILE A N   1 
ATOM   1216  C CA  . ILE A 1 149 ? 33.832  33.059  78.283  1.00 12.81 ? 149 ILE A CA  1 
ATOM   1217  C C   . ILE A 1 149 ? 34.524  31.712  78.114  1.00 12.56 ? 149 ILE A C   1 
ATOM   1218  O O   . ILE A 1 149 ? 34.829  31.292  76.982  1.00 12.34 ? 149 ILE A O   1 
ATOM   1219  C CB  . ILE A 1 149 ? 32.411  33.075  77.678  1.00 13.21 ? 149 ILE A CB  1 
ATOM   1220  C CG1 . ILE A 1 149 ? 31.727  34.409  78.010  1.00 14.02 ? 149 ILE A CG1 1 
ATOM   1221  C CG2 . ILE A 1 149 ? 31.566  31.914  78.200  1.00 13.46 ? 149 ILE A CG2 1 
ATOM   1222  C CD1 . ILE A 1 149 ? 31.674  34.727  79.466  1.00 13.85 ? 149 ILE A CD1 1 
ATOM   1223  N N   . THR A 1 150 ? 34.826  31.083  79.242  1.00 11.78 ? 150 THR A N   1 
ATOM   1224  C CA  . THR A 1 150 ? 35.489  29.800  79.269  1.00 11.86 ? 150 THR A CA  1 
ATOM   1225  C C   . THR A 1 150 ? 34.509  28.662  79.605  1.00 11.62 ? 150 THR A C   1 
ATOM   1226  O O   . THR A 1 150 ? 34.773  27.502  79.301  1.00 10.71 ? 150 THR A O   1 
ATOM   1227  C CB  . THR A 1 150 ? 36.633  29.827  80.311  1.00 12.06 ? 150 THR A CB  1 
ATOM   1228  O OG1 . THR A 1 150 ? 36.122  30.149  81.611  1.00 12.53 ? 150 THR A OG1 1 
ATOM   1229  C CG2 . THR A 1 150 ? 37.634  30.947  80.021  1.00 14.52 ? 150 THR A CG2 1 
ATOM   1230  N N   . ASP A 1 151 ? 33.389  29.023  80.232  1.00 11.02 ? 151 ASP A N   1 
ATOM   1231  C CA  . ASP A 1 151 ? 32.384  28.055  80.678  1.00 11.37 ? 151 ASP A CA  1 
ATOM   1232  C C   . ASP A 1 151 ? 30.957  28.517  80.377  1.00 10.54 ? 151 ASP A C   1 
ATOM   1233  O O   . ASP A 1 151 ? 30.597  29.677  80.589  1.00 10.06 ? 151 ASP A O   1 
ATOM   1234  C CB  . ASP A 1 151 ? 32.510  27.804  82.178  1.00 10.75 ? 151 ASP A CB  1 
ATOM   1235  C CG  . ASP A 1 151 ? 33.867  27.223  82.567  1.00 12.96 ? 151 ASP A CG  1 
ATOM   1236  O OD1 . ASP A 1 151 ? 34.806  28.027  82.832  1.00 9.71  ? 151 ASP A OD1 1 
ATOM   1237  O OD2 . ASP A 1 151 ? 34.082  25.980  82.621  1.00 10.29 ? 151 ASP A OD2 1 
ATOM   1238  N N   . VAL A 1 152 ? 30.170  27.586  79.861  1.00 9.96  ? 152 VAL A N   1 
ATOM   1239  C CA  . VAL A 1 152 ? 28.766  27.780  79.568  1.00 9.99  ? 152 VAL A CA  1 
ATOM   1240  C C   . VAL A 1 152 ? 27.985  26.802  80.443  1.00 9.70  ? 152 VAL A C   1 
ATOM   1241  O O   . VAL A 1 152 ? 28.265  25.606  80.426  1.00 8.51  ? 152 VAL A O   1 
ATOM   1242  C CB  . VAL A 1 152 ? 28.506  27.527  78.088  1.00 10.29 ? 152 VAL A CB  1 
ATOM   1243  C CG1 . VAL A 1 152 ? 27.012  27.453  77.763  1.00 11.91 ? 152 VAL A CG1 1 
ATOM   1244  C CG2 . VAL A 1 152 ? 29.199  28.638  77.247  1.00 11.62 ? 152 VAL A CG2 1 
ATOM   1245  N N   . ILE A 1 153 ? 27.038  27.321  81.221  1.00 9.21  ? 153 ILE A N   1 
ATOM   1246  C CA  . ILE A 1 153 ? 26.227  26.498  82.123  1.00 9.50  ? 153 ILE A CA  1 
ATOM   1247  C C   . ILE A 1 153 ? 24.742  26.496  81.687  1.00 8.53  ? 153 ILE A C   1 
ATOM   1248  O O   . ILE A 1 153 ? 24.073  27.513  81.728  1.00 7.10  ? 153 ILE A O   1 
ATOM   1249  C CB  . ILE A 1 153 ? 26.366  27.025  83.556  1.00 9.48  ? 153 ILE A CB  1 
ATOM   1250  C CG1 . ILE A 1 153 ? 27.846  27.092  83.967  1.00 11.90 ? 153 ILE A CG1 1 
ATOM   1251  C CG2 . ILE A 1 153 ? 25.558  26.157  84.512  1.00 9.85  ? 153 ILE A CG2 1 
ATOM   1252  C CD1 . ILE A 1 153 ? 28.516  28.444  83.689  1.00 12.57 ? 153 ILE A CD1 1 
ATOM   1253  N N   . ASN A 1 154 ? 24.241  25.359  81.222  1.00 9.22  ? 154 ASN A N   1 
ATOM   1254  C CA  . ASN A 1 154 ? 22.848  25.259  80.795  1.00 9.08  ? 154 ASN A CA  1 
ATOM   1255  C C   . ASN A 1 154 ? 21.999  24.840  81.985  1.00 9.32  ? 154 ASN A C   1 
ATOM   1256  O O   . ASN A 1 154 ? 22.278  23.827  82.638  1.00 8.77  ? 154 ASN A O   1 
ATOM   1257  C CB  . ASN A 1 154 ? 22.701  24.225  79.684  1.00 9.79  ? 154 ASN A CB  1 
ATOM   1258  C CG  . ASN A 1 154 ? 21.355  24.281  78.994  1.00 10.82 ? 154 ASN A CG  1 
ATOM   1259  O OD1 . ASN A 1 154 ? 21.151  25.114  78.120  1.00 14.18 ? 154 ASN A OD1 1 
ATOM   1260  N ND2 . ASN A 1 154 ? 20.431  23.372  79.366  1.00 12.42 ? 154 ASN A ND2 1 
ATOM   1261  N N   . ILE A 1 155 ? 20.987  25.639  82.278  1.00 9.21  ? 155 ILE A N   1 
ATOM   1262  C CA  . ILE A 1 155 ? 20.089  25.373  83.387  1.00 9.35  ? 155 ILE A CA  1 
ATOM   1263  C C   . ILE A 1 155 ? 18.716  25.099  82.804  1.00 10.10 ? 155 ILE A C   1 
ATOM   1264  O O   . ILE A 1 155 ? 18.138  25.945  82.123  1.00 10.84 ? 155 ILE A O   1 
ATOM   1265  C CB  . ILE A 1 155 ? 20.070  26.557  84.375  1.00 9.00  ? 155 ILE A CB  1 
ATOM   1266  C CG1 . ILE A 1 155 ? 21.462  26.755  84.987  1.00 10.75 ? 155 ILE A CG1 1 
ATOM   1267  C CG2 . ILE A 1 155 ? 19.057  26.300  85.479  1.00 9.78  ? 155 ILE A CG2 1 
ATOM   1268  C CD1 . ILE A 1 155 ? 21.594  27.897  85.923  1.00 10.86 ? 155 ILE A CD1 1 
ATOM   1269  N N   . GLY A 1 156 ? 18.220  23.887  83.039  1.00 10.42 ? 156 GLY A N   1 
ATOM   1270  C CA  . GLY A 1 156 ? 16.931  23.463  82.542  1.00 11.05 ? 156 GLY A CA  1 
ATOM   1271  C C   . GLY A 1 156 ? 16.620  22.066  83.046  1.00 11.43 ? 156 GLY A C   1 
ATOM   1272  O O   . GLY A 1 156 ? 17.506  21.392  83.560  1.00 11.88 ? 156 GLY A O   1 
ATOM   1273  N N   . ILE A 1 157 ? 15.370  21.642  82.921  1.00 12.59 ? 157 ILE A N   1 
ATOM   1274  C CA  . ILE A 1 157 ? 14.972  20.286  83.305  1.00 13.02 ? 157 ILE A CA  1 
ATOM   1275  C C   . ILE A 1 157 ? 14.410  19.528  82.122  1.00 13.46 ? 157 ILE A C   1 
ATOM   1276  O O   . ILE A 1 157 ? 14.058  20.106  81.073  1.00 14.35 ? 157 ILE A O   1 
ATOM   1277  C CB  . ILE A 1 157 ? 13.874  20.309  84.424  1.00 13.41 ? 157 ILE A CB  1 
ATOM   1278  C CG1 . ILE A 1 157 ? 12.626  21.042  83.921  1.00 14.72 ? 157 ILE A CG1 1 
ATOM   1279  C CG2 . ILE A 1 157 ? 14.417  20.932  85.682  1.00 13.82 ? 157 ILE A CG2 1 
ATOM   1280  C CD1 . ILE A 1 157 ? 11.400  20.979  84.866  1.00 14.43 ? 157 ILE A CD1 1 
ATOM   1281  N N   . GLY A 1 158 ? 14.299  18.217  82.286  1.00 13.36 ? 158 GLY A N   1 
ATOM   1282  C CA  . GLY A 1 158 ? 13.710  17.397  81.261  1.00 13.30 ? 158 GLY A CA  1 
ATOM   1283  C C   . GLY A 1 158 ? 14.327  17.613  79.890  1.00 13.39 ? 158 GLY A C   1 
ATOM   1284  O O   . GLY A 1 158 ? 15.542  17.481  79.705  1.00 12.72 ? 158 GLY A O   1 
ATOM   1285  N N   . GLY A 1 159 ? 13.484  17.976  78.928  1.00 13.41 ? 159 GLY A N   1 
ATOM   1286  C CA  . GLY A 1 159 ? 13.920  18.161  77.555  1.00 13.90 ? 159 GLY A CA  1 
ATOM   1287  C C   . GLY A 1 159 ? 14.847  19.349  77.323  1.00 13.96 ? 159 GLY A C   1 
ATOM   1288  O O   . GLY A 1 159 ? 15.518  19.433  76.306  1.00 14.34 ? 159 GLY A O   1 
ATOM   1289  N N   . SER A 1 160 ? 14.862  20.278  78.267  1.00 14.10 ? 160 SER A N   1 
ATOM   1290  C CA  . SER A 1 160 ? 15.735  21.417  78.172  1.00 14.35 ? 160 SER A CA  1 
ATOM   1291  C C   . SER A 1 160 ? 17.161  21.053  78.609  1.00 14.42 ? 160 SER A C   1 
ATOM   1292  O O   . SER A 1 160 ? 18.072  21.875  78.491  1.00 14.96 ? 160 SER A O   1 
ATOM   1293  C CB  . SER A 1 160 ? 15.177  22.543  79.041  1.00 14.72 ? 160 SER A CB  1 
ATOM   1294  O OG  . SER A 1 160 ? 14.017  23.087  78.442  1.00 15.82 ? 160 SER A OG  1 
ATOM   1295  N N   . ASP A 1 161 ? 17.347  19.828  79.094  1.00 12.89 ? 161 ASP A N   1 
ATOM   1296  C CA  . ASP A 1 161 ? 18.625  19.387  79.634  1.00 12.58 ? 161 ASP A CA  1 
ATOM   1297  C C   . ASP A 1 161 ? 19.209  18.149  78.954  1.00 11.93 ? 161 ASP A C   1 
ATOM   1298  O O   . ASP A 1 161 ? 20.351  18.164  78.487  1.00 12.15 ? 161 ASP A O   1 
ATOM   1299  C CB  . ASP A 1 161 ? 18.448  19.074  81.125  1.00 12.39 ? 161 ASP A CB  1 
ATOM   1300  C CG  . ASP A 1 161 ? 19.579  18.247  81.687  1.00 12.92 ? 161 ASP A CG  1 
ATOM   1301  O OD1 . ASP A 1 161 ? 20.637  18.841  81.971  1.00 13.27 ? 161 ASP A OD1 1 
ATOM   1302  O OD2 . ASP A 1 161 ? 19.508  17.001  81.896  1.00 11.90 ? 161 ASP A OD2 1 
ATOM   1303  N N   . LEU A 1 162 ? 18.406  17.088  78.891  1.00 11.84 ? 162 LEU A N   1 
ATOM   1304  C CA  . LEU A 1 162 ? 18.871  15.766  78.487  1.00 11.96 ? 162 LEU A CA  1 
ATOM   1305  C C   . LEU A 1 162 ? 19.471  15.729  77.080  1.00 10.70 ? 162 LEU A C   1 
ATOM   1306  O O   . LEU A 1 162 ? 20.515  15.136  76.887  1.00 8.81  ? 162 LEU A O   1 
ATOM   1307  C CB  . LEU A 1 162 ? 17.712  14.763  78.603  1.00 12.97 ? 162 LEU A CB  1 
ATOM   1308  C CG  . LEU A 1 162 ? 17.779  13.436  79.377  1.00 18.00 ? 162 LEU A CG  1 
ATOM   1309  C CD1 . LEU A 1 162 ? 18.449  13.532  80.724  1.00 20.51 ? 162 LEU A CD1 1 
ATOM   1310  C CD2 . LEU A 1 162 ? 16.325  12.925  79.580  1.00 19.35 ? 162 LEU A CD2 1 
ATOM   1311  N N   . GLY A 1 163 ? 18.796  16.341  76.102  1.00 9.44  ? 163 GLY A N   1 
ATOM   1312  C CA  . GLY A 1 163 ? 19.281  16.359  74.735  1.00 9.54  ? 163 GLY A CA  1 
ATOM   1313  C C   . GLY A 1 163 ? 20.615  17.091  74.579  1.00 9.36  ? 163 GLY A C   1 
ATOM   1314  O O   . GLY A 1 163 ? 21.601  16.540  74.092  1.00 8.49  ? 163 GLY A O   1 
ATOM   1315  N N   . PRO A 1 164 ? 20.655  18.355  74.955  1.00 8.59  ? 164 PRO A N   1 
ATOM   1316  C CA  . PRO A 1 164 ? 21.924  19.093  74.905  1.00 9.29  ? 164 PRO A CA  1 
ATOM   1317  C C   . PRO A 1 164 ? 23.075  18.394  75.660  1.00 8.72  ? 164 PRO A C   1 
ATOM   1318  O O   . PRO A 1 164 ? 24.207  18.335  75.164  1.00 8.46  ? 164 PRO A O   1 
ATOM   1319  C CB  . PRO A 1 164 ? 21.562  20.444  75.529  1.00 9.77  ? 164 PRO A CB  1 
ATOM   1320  C CG  . PRO A 1 164 ? 20.095  20.596  75.257  1.00 9.72  ? 164 PRO A CG  1 
ATOM   1321  C CD  . PRO A 1 164 ? 19.524  19.195  75.374  1.00 9.25  ? 164 PRO A CD  1 
ATOM   1322  N N   . LEU A 1 165 ? 22.786  17.817  76.824  1.00 9.23  ? 165 LEU A N   1 
ATOM   1323  C CA  . LEU A 1 165 ? 23.802  17.076  77.561  1.00 9.10  ? 165 LEU A CA  1 
ATOM   1324  C C   . LEU A 1 165 ? 24.244  15.848  76.756  1.00 9.08  ? 165 LEU A C   1 
ATOM   1325  O O   . LEU A 1 165 ? 25.439  15.612  76.569  1.00 8.67  ? 165 LEU A O   1 
ATOM   1326  C CB  . LEU A 1 165 ? 23.267  16.657  78.941  1.00 9.64  ? 165 LEU A CB  1 
ATOM   1327  C CG  . LEU A 1 165 ? 24.211  15.908  79.873  1.00 13.37 ? 165 LEU A CG  1 
ATOM   1328  C CD1 . LEU A 1 165 ? 23.752  16.035  81.330  1.00 15.31 ? 165 LEU A CD1 1 
ATOM   1329  C CD2 . LEU A 1 165 ? 24.262  14.457  79.489  1.00 15.66 ? 165 LEU A CD2 1 
ATOM   1330  N N   . MET A 1 166 ? 23.281  15.065  76.280  1.00 8.04  ? 166 MET A N   1 
ATOM   1331  C CA  . MET A 1 166 ? 23.627  13.831  75.566  1.00 8.51  ? 166 MET A CA  1 
ATOM   1332  C C   . MET A 1 166 ? 24.462  14.113  74.329  1.00 8.00  ? 166 MET A C   1 
ATOM   1333  O O   . MET A 1 166 ? 25.439  13.415  74.052  1.00 7.80  ? 166 MET A O   1 
ATOM   1334  C CB  . MET A 1 166 ? 22.362  13.070  75.182  1.00 8.52  ? 166 MET A CB  1 
ATOM   1335  C CG  . MET A 1 166 ? 22.626  11.755  74.437  1.00 9.16  ? 166 MET A CG  1 
ATOM   1336  S SD  . MET A 1 166 ? 22.796  12.000  72.669  1.00 10.52 ? 166 MET A SD  1 
ATOM   1337  C CE  . MET A 1 166 ? 21.167  12.295  72.236  1.00 10.30 ? 166 MET A CE  1 
ATOM   1338  N N   . VAL A 1 167 ? 24.077  15.153  73.589  1.00 8.08  ? 167 VAL A N   1 
ATOM   1339  C CA  . VAL A 1 167 ? 24.751  15.472  72.340  1.00 7.86  ? 167 VAL A CA  1 
ATOM   1340  C C   . VAL A 1 167 ? 26.125  16.081  72.567  1.00 7.81  ? 167 VAL A C   1 
ATOM   1341  O O   . VAL A 1 167 ? 27.085  15.734  71.854  1.00 7.48  ? 167 VAL A O   1 
ATOM   1342  C CB  . VAL A 1 167 ? 23.891  16.405  71.459  1.00 7.51  ? 167 VAL A CB  1 
ATOM   1343  C CG1 . VAL A 1 167 ? 24.681  16.879  70.235  1.00 7.98  ? 167 VAL A CG1 1 
ATOM   1344  C CG2 . VAL A 1 167 ? 22.625  15.714  71.041  1.00 7.45  ? 167 VAL A CG2 1 
ATOM   1345  N N   . THR A 1 168 ? 26.255  17.017  73.515  1.00 8.28  ? 168 THR A N   1 
ATOM   1346  C CA  . THR A 1 168 ? 27.600  17.547  73.777  1.00 8.53  ? 168 THR A CA  1 
ATOM   1347  C C   . THR A 1 168 ? 28.506  16.440  74.315  1.00 8.44  ? 168 THR A C   1 
ATOM   1348  O O   . THR A 1 168 ? 29.699  16.459  74.063  1.00 9.34  ? 168 THR A O   1 
ATOM   1349  C CB  . THR A 1 168 ? 27.626  18.765  74.723  1.00 9.04  ? 168 THR A CB  1 
ATOM   1350  O OG1 . THR A 1 168 ? 26.904  18.471  75.925  1.00 7.78  ? 168 THR A OG1 1 
ATOM   1351  C CG2 . THR A 1 168 ? 26.968  19.952  74.096  1.00 9.08  ? 168 THR A CG2 1 
ATOM   1352  N N   . GLU A 1 169 ? 27.966  15.491  75.069  1.00 8.41  ? 169 GLU A N   1 
ATOM   1353  C CA  . GLU A 1 169 ? 28.799  14.383  75.510  1.00 8.35  ? 169 GLU A CA  1 
ATOM   1354  C C   . GLU A 1 169 ? 29.233  13.539  74.330  1.00 7.98  ? 169 GLU A C   1 
ATOM   1355  O O   . GLU A 1 169 ? 30.383  13.101  74.269  1.00 8.70  ? 169 GLU A O   1 
ATOM   1356  C CB  . GLU A 1 169 ? 28.087  13.487  76.521  1.00 8.06  ? 169 GLU A CB  1 
ATOM   1357  C CG  . GLU A 1 169 ? 27.969  14.101  77.899  1.00 8.55  ? 169 GLU A CG  1 
ATOM   1358  C CD  . GLU A 1 169 ? 29.318  14.315  78.570  1.00 11.28 ? 169 GLU A CD  1 
ATOM   1359  O OE1 . GLU A 1 169 ? 29.644  15.490  78.872  1.00 9.58  ? 169 GLU A OE1 1 
ATOM   1360  O OE2 . GLU A 1 169 ? 30.039  13.304  78.805  1.00 10.68 ? 169 GLU A OE2 1 
ATOM   1361  N N   . ALA A 1 170 ? 28.302  13.284  73.416  1.00 7.80  ? 170 ALA A N   1 
ATOM   1362  C CA  . ALA A 1 170 ? 28.569  12.410  72.284  1.00 8.16  ? 170 ALA A CA  1 
ATOM   1363  C C   . ALA A 1 170 ? 29.510  13.058  71.278  1.00 8.50  ? 170 ALA A C   1 
ATOM   1364  O O   . ALA A 1 170 ? 30.235  12.357  70.578  1.00 8.02  ? 170 ALA A O   1 
ATOM   1365  C CB  . ALA A 1 170 ? 27.257  12.014  71.602  1.00 8.95  ? 170 ALA A CB  1 
ATOM   1366  N N   . LEU A 1 171 ? 29.483  14.392  71.202  1.00 8.63  ? 171 LEU A N   1 
ATOM   1367  C CA  . LEU A 1 171 ? 30.281  15.116  70.217  1.00 9.29  ? 171 LEU A CA  1 
ATOM   1368  C C   . LEU A 1 171 ? 31.494  15.860  70.804  1.00 9.66  ? 171 LEU A C   1 
ATOM   1369  O O   . LEU A 1 171 ? 32.044  16.760  70.163  1.00 9.61  ? 171 LEU A O   1 
ATOM   1370  C CB  . LEU A 1 171 ? 29.375  16.066  69.425  1.00 9.39  ? 171 LEU A CB  1 
ATOM   1371  C CG  . LEU A 1 171 ? 28.232  15.399  68.631  1.00 8.91  ? 171 LEU A CG  1 
ATOM   1372  C CD1 . LEU A 1 171 ? 27.394  16.433  67.925  1.00 9.10  ? 171 LEU A CD1 1 
ATOM   1373  C CD2 . LEU A 1 171 ? 28.778  14.411  67.604  1.00 10.39 ? 171 LEU A CD2 1 
ATOM   1374  N N   . LYS A 1 172 ? 31.941  15.420  71.976  1.00 10.64 ? 172 LYS A N   1 
ATOM   1375  C CA  . LYS A 1 172 ? 33.054  16.030  72.684  1.00 12.01 ? 172 LYS A CA  1 
ATOM   1376  C C   . LYS A 1 172 ? 34.306  16.271  71.793  1.00 12.40 ? 172 LYS A C   1 
ATOM   1377  O O   . LYS A 1 172 ? 34.918  17.336  71.876  1.00 13.71 ? 172 LYS A O   1 
ATOM   1378  C CB  . LYS A 1 172 ? 33.378  15.169  73.910  1.00 12.05 ? 172 LYS A CB  1 
ATOM   1379  C CG  . LYS A 1 172 ? 34.225  15.833  74.997  1.00 13.99 ? 172 LYS A CG  1 
ATOM   1380  C CD  . LYS A 1 172 ? 33.596  17.094  75.583  1.00 14.54 ? 172 LYS A CD  1 
ATOM   1381  C CE  . LYS A 1 172 ? 32.289  16.835  76.364  1.00 14.50 ? 172 LYS A CE  1 
ATOM   1382  N NZ  . LYS A 1 172 ? 31.787  18.106  77.008  1.00 14.11 ? 172 LYS A NZ  1 
ATOM   1383  N N   . PRO A 1 173 ? 34.692  15.312  70.951  1.00 12.97 ? 173 PRO A N   1 
ATOM   1384  C CA  . PRO A 1 173 ? 35.843  15.496  70.053  1.00 13.55 ? 173 PRO A CA  1 
ATOM   1385  C C   . PRO A 1 173 ? 35.741  16.702  69.115  1.00 13.68 ? 173 PRO A C   1 
ATOM   1386  O O   . PRO A 1 173 ? 36.764  17.152  68.602  1.00 15.09 ? 173 PRO A O   1 
ATOM   1387  C CB  . PRO A 1 173 ? 35.849  14.199  69.208  1.00 13.91 ? 173 PRO A CB  1 
ATOM   1388  C CG  . PRO A 1 173 ? 35.191  13.219  70.049  1.00 13.25 ? 173 PRO A CG  1 
ATOM   1389  C CD  . PRO A 1 173 ? 34.124  13.958  70.820  1.00 12.76 ? 173 PRO A CD  1 
ATOM   1390  N N   . TYR A 1 174 ? 34.539  17.207  68.878  1.00 13.50 ? 174 TYR A N   1 
ATOM   1391  C CA  . TYR A 1 174 ? 34.341  18.309  67.958  1.00 12.93 ? 174 TYR A CA  1 
ATOM   1392  C C   . TYR A 1 174 ? 34.246  19.668  68.657  1.00 12.90 ? 174 TYR A C   1 
ATOM   1393  O O   . TYR A 1 174 ? 33.856  20.652  68.038  1.00 12.86 ? 174 TYR A O   1 
ATOM   1394  C CB  . TYR A 1 174 ? 33.083  18.037  67.131  1.00 12.68 ? 174 TYR A CB  1 
ATOM   1395  C CG  . TYR A 1 174 ? 33.178  16.780  66.325  1.00 12.59 ? 174 TYR A CG  1 
ATOM   1396  C CD1 . TYR A 1 174 ? 32.926  15.548  66.904  1.00 11.81 ? 174 TYR A CD1 1 
ATOM   1397  C CD2 . TYR A 1 174 ? 33.529  16.812  64.987  1.00 10.87 ? 174 TYR A CD2 1 
ATOM   1398  C CE1 . TYR A 1 174 ? 33.021  14.404  66.177  1.00 9.88  ? 174 TYR A CE1 1 
ATOM   1399  C CE2 . TYR A 1 174 ? 33.637  15.661  64.259  1.00 10.53 ? 174 TYR A CE2 1 
ATOM   1400  C CZ  . TYR A 1 174 ? 33.388  14.463  64.855  1.00 8.72  ? 174 TYR A CZ  1 
ATOM   1401  O OH  . TYR A 1 174 ? 33.454  13.303  64.149  1.00 10.64 ? 174 TYR A OH  1 
ATOM   1402  N N   . SER A 1 175 ? 34.649  19.723  69.920  1.00 13.17 ? 175 SER A N   1 
ATOM   1403  C CA  . SER A 1 175 ? 34.515  20.927  70.733  1.00 13.64 ? 175 SER A CA  1 
ATOM   1404  C C   . SER A 1 175 ? 35.789  21.751  70.899  1.00 14.71 ? 175 SER A C   1 
ATOM   1405  O O   . SER A 1 175 ? 35.860  22.593  71.779  1.00 14.48 ? 175 SER A O   1 
ATOM   1406  C CB  . SER A 1 175 ? 33.974  20.569  72.132  1.00 13.70 ? 175 SER A CB  1 
ATOM   1407  O OG  . SER A 1 175 ? 34.905  19.813  72.888  1.00 12.43 ? 175 SER A OG  1 
ATOM   1408  N N   . SER A 1 176 ? 36.799  21.509  70.068  1.00 16.14 ? 176 SER A N   1 
ATOM   1409  C CA  . SER A 1 176 ? 38.028  22.286  70.141  1.00 17.51 ? 176 SER A CA  1 
ATOM   1410  C C   . SER A 1 176 ? 37.709  23.751  69.860  1.00 17.39 ? 176 SER A C   1 
ATOM   1411  O O   . SER A 1 176 ? 37.023  24.068  68.910  1.00 18.03 ? 176 SER A O   1 
ATOM   1412  C CB  . SER A 1 176 ? 39.067  21.768  69.131  1.00 17.88 ? 176 SER A CB  1 
ATOM   1413  O OG  . SER A 1 176 ? 40.220  22.593  69.149  1.00 21.80 ? 176 SER A OG  1 
ATOM   1414  N N   . GLY A 1 177 ? 38.196  24.658  70.694  1.00 18.40 ? 177 GLY A N   1 
ATOM   1415  C CA  . GLY A 1 177 ? 37.905  26.066  70.478  1.00 18.35 ? 177 GLY A CA  1 
ATOM   1416  C C   . GLY A 1 177 ? 36.538  26.494  70.999  1.00 18.67 ? 177 GLY A C   1 
ATOM   1417  O O   . GLY A 1 177 ? 36.067  27.612  70.740  1.00 19.20 ? 177 GLY A O   1 
ATOM   1418  N N   . GLY A 1 178 ? 35.870  25.598  71.712  1.00 17.29 ? 178 GLY A N   1 
ATOM   1419  C CA  . GLY A 1 178 ? 34.580  25.933  72.294  1.00 16.38 ? 178 GLY A CA  1 
ATOM   1420  C C   . GLY A 1 178 ? 34.741  26.003  73.796  1.00 15.39 ? 178 GLY A C   1 
ATOM   1421  O O   . GLY A 1 178 ? 35.679  25.437  74.338  1.00 14.66 ? 178 GLY A O   1 
ATOM   1422  N N   . PRO A 1 179 ? 33.852  26.708  74.479  1.00 13.93 ? 179 PRO A N   1 
ATOM   1423  C CA  . PRO A 1 179 ? 33.920  26.761  75.940  1.00 13.87 ? 179 PRO A CA  1 
ATOM   1424  C C   . PRO A 1 179 ? 33.480  25.410  76.528  1.00 13.26 ? 179 PRO A C   1 
ATOM   1425  O O   . PRO A 1 179 ? 32.797  24.649  75.854  1.00 11.97 ? 179 PRO A O   1 
ATOM   1426  C CB  . PRO A 1 179 ? 32.921  27.867  76.291  1.00 13.36 ? 179 PRO A CB  1 
ATOM   1427  C CG  . PRO A 1 179 ? 31.952  27.848  75.135  1.00 14.07 ? 179 PRO A CG  1 
ATOM   1428  C CD  . PRO A 1 179 ? 32.781  27.565  73.943  1.00 13.81 ? 179 PRO A CD  1 
ATOM   1429  N N   . ARG A 1 180 ? 33.904  25.115  77.747  1.00 12.67 ? 180 ARG A N   1 
ATOM   1430  C CA  . ARG A 1 180 ? 33.422  23.926  78.432  1.00 13.11 ? 180 ARG A CA  1 
ATOM   1431  C C   . ARG A 1 180 ? 31.923  24.122  78.660  1.00 11.86 ? 180 ARG A C   1 
ATOM   1432  O O   . ARG A 1 180 ? 31.453  25.254  78.793  1.00 11.21 ? 180 ARG A O   1 
ATOM   1433  C CB  . ARG A 1 180 ? 34.098  23.764  79.783  1.00 13.21 ? 180 ARG A CB  1 
ATOM   1434  C CG  . ARG A 1 180 ? 35.544  23.400  79.769  1.00 16.64 ? 180 ARG A CG  1 
ATOM   1435  C CD  . ARG A 1 180 ? 36.141  23.375  81.169  1.00 18.09 ? 180 ARG A CD  1 
ATOM   1436  N NE  . ARG A 1 180 ? 36.237  24.714  81.758  1.00 20.43 ? 180 ARG A NE  1 
ATOM   1437  C CZ  . ARG A 1 180 ? 37.341  25.456  81.768  1.00 21.76 ? 180 ARG A CZ  1 
ATOM   1438  N NH1 . ARG A 1 180 ? 38.464  25.006  81.215  1.00 22.22 ? 180 ARG A NH1 1 
ATOM   1439  N NH2 . ARG A 1 180 ? 37.331  26.648  82.337  1.00 22.04 ? 180 ARG A NH2 1 
ATOM   1440  N N   . VAL A 1 181 ? 31.167  23.032  78.674  1.00 11.65 ? 181 VAL A N   1 
ATOM   1441  C CA  . VAL A 1 181 ? 29.729  23.116  78.941  1.00 11.03 ? 181 VAL A CA  1 
ATOM   1442  C C   . VAL A 1 181 ? 29.407  22.335  80.210  1.00 10.52 ? 181 VAL A C   1 
ATOM   1443  O O   . VAL A 1 181 ? 30.008  21.291  80.470  1.00 9.76  ? 181 VAL A O   1 
ATOM   1444  C CB  . VAL A 1 181 ? 28.830  22.598  77.771  1.00 11.31 ? 181 VAL A CB  1 
ATOM   1445  C CG1 . VAL A 1 181 ? 28.693  23.628  76.691  1.00 13.02 ? 181 VAL A CG1 1 
ATOM   1446  C CG2 . VAL A 1 181 ? 29.346  21.258  77.204  1.00 11.77 ? 181 VAL A CG2 1 
ATOM   1447  N N   . TRP A 1 182 ? 28.487  22.878  80.997  1.00 9.38  ? 182 TRP A N   1 
ATOM   1448  C CA  . TRP A 1 182 ? 27.996  22.254  82.227  1.00 9.05  ? 182 TRP A CA  1 
ATOM   1449  C C   . TRP A 1 182 ? 26.470  22.218  82.145  1.00 9.05  ? 182 TRP A C   1 
ATOM   1450  O O   . TRP A 1 182 ? 25.876  23.121  81.564  1.00 8.53  ? 182 TRP A O   1 
ATOM   1451  C CB  . TRP A 1 182 ? 28.388  23.063  83.462  1.00 9.38  ? 182 TRP A CB  1 
ATOM   1452  C CG  . TRP A 1 182 ? 29.829  23.343  83.599  1.00 9.39  ? 182 TRP A CG  1 
ATOM   1453  C CD1 . TRP A 1 182 ? 30.560  24.225  82.855  1.00 11.14 ? 182 TRP A CD1 1 
ATOM   1454  C CD2 . TRP A 1 182 ? 30.734  22.786  84.556  1.00 12.68 ? 182 TRP A CD2 1 
ATOM   1455  N NE1 . TRP A 1 182 ? 31.863  24.244  83.286  1.00 11.27 ? 182 TRP A NE1 1 
ATOM   1456  C CE2 . TRP A 1 182 ? 32.003  23.372  84.327  1.00 13.14 ? 182 TRP A CE2 1 
ATOM   1457  C CE3 . TRP A 1 182 ? 30.605  21.860  85.602  1.00 15.46 ? 182 TRP A CE3 1 
ATOM   1458  C CZ2 . TRP A 1 182 ? 33.144  23.033  85.078  1.00 15.55 ? 182 TRP A CZ2 1 
ATOM   1459  C CZ3 . TRP A 1 182 ? 31.741  21.533  86.354  1.00 16.75 ? 182 TRP A CZ3 1 
ATOM   1460  C CH2 . TRP A 1 182 ? 32.989  22.125  86.086  1.00 16.05 ? 182 TRP A CH2 1 
ATOM   1461  N N   . TYR A 1 183 ? 25.844  21.195  82.740  1.00 8.62  ? 183 TYR A N   1 
ATOM   1462  C CA  . TYR A 1 183 ? 24.393  21.045  82.740  1.00 9.02  ? 183 TYR A CA  1 
ATOM   1463  C C   . TYR A 1 183 ? 23.891  20.964  84.170  1.00 9.35  ? 183 TYR A C   1 
ATOM   1464  O O   . TYR A 1 183 ? 24.369  20.140  84.950  1.00 10.62 ? 183 TYR A O   1 
ATOM   1465  C CB  . TYR A 1 183 ? 23.981  19.805  81.907  1.00 8.76  ? 183 TYR A CB  1 
ATOM   1466  C CG  . TYR A 1 183 ? 24.280  20.099  80.486  1.00 8.00  ? 183 TYR A CG  1 
ATOM   1467  C CD1 . TYR A 1 183 ? 25.549  19.826  79.957  1.00 8.97  ? 183 TYR A CD1 1 
ATOM   1468  C CD2 . TYR A 1 183 ? 23.369  20.759  79.705  1.00 6.25  ? 183 TYR A CD2 1 
ATOM   1469  C CE1 . TYR A 1 183 ? 25.868  20.166  78.666  1.00 8.75  ? 183 TYR A CE1 1 
ATOM   1470  C CE2 . TYR A 1 183 ? 23.675  21.103  78.402  1.00 8.31  ? 183 TYR A CE2 1 
ATOM   1471  C CZ  . TYR A 1 183 ? 24.915  20.813  77.892  1.00 8.97  ? 183 TYR A CZ  1 
ATOM   1472  O OH  . TYR A 1 183 ? 25.227  21.171  76.593  1.00 8.66  ? 183 TYR A OH  1 
ATOM   1473  N N   . VAL A 1 184 ? 23.006  21.879  84.545  1.00 9.15  ? 184 VAL A N   1 
ATOM   1474  C CA  . VAL A 1 184 ? 22.415  21.875  85.879  1.00 9.65  ? 184 VAL A CA  1 
ATOM   1475  C C   . VAL A 1 184 ? 20.937  21.619  85.691  1.00 9.80  ? 184 VAL A C   1 
ATOM   1476  O O   . VAL A 1 184 ? 20.268  22.389  85.029  1.00 11.52 ? 184 VAL A O   1 
ATOM   1477  C CB  . VAL A 1 184 ? 22.645  23.209  86.625  1.00 9.40  ? 184 VAL A CB  1 
ATOM   1478  C CG1 . VAL A 1 184 ? 21.920  23.211  87.969  1.00 10.17 ? 184 VAL A CG1 1 
ATOM   1479  C CG2 . VAL A 1 184 ? 24.149  23.468  86.824  1.00 10.64 ? 184 VAL A CG2 1 
ATOM   1480  N N   . SER A 1 185 ? 20.420  20.514  86.221  1.00 10.28 ? 185 SER A N   1 
ATOM   1481  C CA  . SER A 1 185 ? 19.000  20.185  86.028  1.00 9.39  ? 185 SER A CA  1 
ATOM   1482  C C   . SER A 1 185 ? 18.259  19.910  87.340  1.00 8.98  ? 185 SER A C   1 
ATOM   1483  O O   . SER A 1 185 ? 17.091  20.287  87.511  1.00 8.91  ? 185 SER A O   1 
ATOM   1484  C CB  . SER A 1 185 ? 18.893  18.947  85.156  1.00 9.87  ? 185 SER A CB  1 
ATOM   1485  O OG  . SER A 1 185 ? 19.706  17.933  85.702  1.00 9.39  ? 185 SER A OG  1 
ATOM   1486  N N   . ASN A 1 186 ? 18.929  19.242  88.265  1.00 8.35  ? 186 ASN A N   1 
ATOM   1487  C CA  . ASN A 1 186 ? 18.291  18.845  89.508  1.00 8.51  ? 186 ASN A CA  1 
ATOM   1488  C C   . ASN A 1 186 ? 17.947  20.062  90.362  1.00 8.56  ? 186 ASN A C   1 
ATOM   1489  O O   . ASN A 1 186 ? 18.737  21.013  90.439  1.00 9.05  ? 186 ASN A O   1 
ATOM   1490  C CB  . ASN A 1 186 ? 19.185  17.859  90.288  1.00 7.55  ? 186 ASN A CB  1 
ATOM   1491  C CG  . ASN A 1 186 ? 18.363  16.865  91.156  1.00 8.22  ? 186 ASN A CG  1 
ATOM   1492  O OD1 . ASN A 1 186 ? 17.305  17.207  91.676  1.00 5.93  ? 186 ASN A OD1 1 
ATOM   1493  N ND2 . ASN A 1 186 ? 18.865  15.646  91.297  1.00 6.64  ? 186 ASN A ND2 1 
ATOM   1494  N N   . ILE A 1 187 ? 16.776  20.044  90.989  1.00 8.10  ? 187 ILE A N   1 
ATOM   1495  C CA  . ILE A 1 187 ? 16.443  21.093  91.953  1.00 8.16  ? 187 ILE A CA  1 
ATOM   1496  C C   . ILE A 1 187 ? 17.291  20.903  93.203  1.00 7.90  ? 187 ILE A C   1 
ATOM   1497  O O   . ILE A 1 187 ? 17.581  21.855  93.926  1.00 7.62  ? 187 ILE A O   1 
ATOM   1498  C CB  . ILE A 1 187 ? 14.930  21.134  92.303  1.00 8.06  ? 187 ILE A CB  1 
ATOM   1499  C CG1 . ILE A 1 187 ? 14.629  22.333  93.200  1.00 9.14  ? 187 ILE A CG1 1 
ATOM   1500  C CG2 . ILE A 1 187 ? 14.479  19.860  93.007  1.00 7.56  ? 187 ILE A CG2 1 
ATOM   1501  C CD1 . ILE A 1 187 ? 15.059  23.639  92.649  1.00 8.36  ? 187 ILE A CD1 1 
ATOM   1502  N N   . ASP A 1 188 ? 17.703  19.660  93.449  1.00 7.87  ? 188 ASP A N   1 
ATOM   1503  C CA  . ASP A 1 188 ? 18.615  19.347  94.549  1.00 7.65  ? 188 ASP A CA  1 
ATOM   1504  C C   . ASP A 1 188 ? 19.753  20.363  94.528  1.00 7.90  ? 188 ASP A C   1 
ATOM   1505  O O   . ASP A 1 188 ? 20.482  20.448  93.538  1.00 7.73  ? 188 ASP A O   1 
ATOM   1506  C CB  . ASP A 1 188 ? 19.192  17.942  94.358  1.00 6.95  ? 188 ASP A CB  1 
ATOM   1507  C CG  . ASP A 1 188 ? 20.172  17.555  95.439  1.00 8.52  ? 188 ASP A CG  1 
ATOM   1508  O OD1 . ASP A 1 188 ? 20.637  16.379  95.415  1.00 9.20  ? 188 ASP A OD1 1 
ATOM   1509  O OD2 . ASP A 1 188 ? 20.511  18.327  96.370  1.00 6.98  ? 188 ASP A OD2 1 
ATOM   1510  N N   . GLY A 1 189 ? 19.947  21.100  95.620  1.00 7.98  ? 189 GLY A N   1 
ATOM   1511  C CA  . GLY A 1 189 ? 20.944  22.165  95.640  1.00 8.15  ? 189 GLY A CA  1 
ATOM   1512  C C   . GLY A 1 189 ? 22.385  21.760  95.406  1.00 8.64  ? 189 GLY A C   1 
ATOM   1513  O O   . GLY A 1 189 ? 23.236  22.570  95.051  1.00 7.68  ? 189 GLY A O   1 
ATOM   1514  N N   . THR A 1 190 ? 22.651  20.472  95.585  1.00 8.36  ? 190 THR A N   1 
ATOM   1515  C CA  . THR A 1 190 ? 23.952  19.925  95.315  1.00 8.54  ? 190 THR A CA  1 
ATOM   1516  C C   . THR A 1 190 ? 24.332  20.211  93.872  1.00 8.20  ? 190 THR A C   1 
ATOM   1517  O O   . THR A 1 190 ? 25.482  20.496  93.584  1.00 7.76  ? 190 THR A O   1 
ATOM   1518  C CB  . THR A 1 190 ? 23.882  18.393  95.506  1.00 9.05  ? 190 THR A CB  1 
ATOM   1519  O OG1 . THR A 1 190 ? 23.850  18.078  96.897  1.00 7.41  ? 190 THR A OG1 1 
ATOM   1520  C CG2 . THR A 1 190 ? 25.105  17.706  94.961  1.00 9.89  ? 190 THR A CG2 1 
ATOM   1521  N N   . HIS A 1 191 ? 23.369  20.141  92.954  1.00 8.71  ? 191 HIS A N   1 
ATOM   1522  C CA  . HIS A 1 191 ? 23.719  20.225  91.546  1.00 8.60  ? 191 HIS A CA  1 
ATOM   1523  C C   . HIS A 1 191 ? 24.279  21.608  91.211  1.00 8.72  ? 191 HIS A C   1 
ATOM   1524  O O   . HIS A 1 191 ? 25.382  21.723  90.667  1.00 9.09  ? 191 HIS A O   1 
ATOM   1525  C CB  . HIS A 1 191 ? 22.546  19.854  90.628  1.00 8.83  ? 191 HIS A CB  1 
ATOM   1526  C CG  . HIS A 1 191 ? 22.980  19.220  89.338  1.00 8.01  ? 191 HIS A CG  1 
ATOM   1527  N ND1 . HIS A 1 191 ? 22.088  18.791  88.385  1.00 8.39  ? 191 HIS A ND1 1 
ATOM   1528  C CD2 . HIS A 1 191 ? 24.215  18.950  88.843  1.00 7.93  ? 191 HIS A CD2 1 
ATOM   1529  C CE1 . HIS A 1 191 ? 22.749  18.255  87.373  1.00 10.72 ? 191 HIS A CE1 1 
ATOM   1530  N NE2 . HIS A 1 191 ? 24.042  18.332  87.629  1.00 9.47  ? 191 HIS A NE2 1 
ATOM   1531  N N   . ILE A 1 192 ? 23.553  22.646  91.568  1.00 8.63  ? 192 ILE A N   1 
ATOM   1532  C CA  . ILE A 1 192 ? 24.033  24.002  91.270  1.00 9.22  ? 192 ILE A CA  1 
ATOM   1533  C C   . ILE A 1 192 ? 25.253  24.333  92.139  1.00 9.37  ? 192 ILE A C   1 
ATOM   1534  O O   . ILE A 1 192 ? 26.211  24.909  91.655  1.00 9.83  ? 192 ILE A O   1 
ATOM   1535  C CB  . ILE A 1 192 ? 22.923  25.063  91.401  1.00 9.02  ? 192 ILE A CB  1 
ATOM   1536  C CG1 . ILE A 1 192 ? 23.415  26.433  90.903  1.00 11.05 ? 192 ILE A CG1 1 
ATOM   1537  C CG2 . ILE A 1 192 ? 22.445  25.239  92.845  1.00 9.33  ? 192 ILE A CG2 1 
ATOM   1538  C CD1 . ILE A 1 192 ? 23.708  26.475  89.488  1.00 11.80 ? 192 ILE A CD1 1 
ATOM   1539  N N   . ALA A 1 193 ? 25.233  23.934  93.404  1.00 9.41  ? 193 ALA A N   1 
ATOM   1540  C CA  . ALA A 1 193 ? 26.320  24.313  94.317  1.00 9.82  ? 193 ALA A CA  1 
ATOM   1541  C C   . ALA A 1 193 ? 27.663  23.742  93.914  1.00 10.37 ? 193 ALA A C   1 
ATOM   1542  O O   . ALA A 1 193 ? 28.655  24.476  93.900  1.00 9.88  ? 193 ALA A O   1 
ATOM   1543  C CB  . ALA A 1 193 ? 25.997  23.928  95.748  1.00 9.56  ? 193 ALA A CB  1 
ATOM   1544  N N   . LYS A 1 194 ? 27.708  22.453  93.580  1.00 10.37 ? 194 LYS A N   1 
ATOM   1545  C CA  . LYS A 1 194 ? 28.976  21.831  93.216  1.00 11.16 ? 194 LYS A CA  1 
ATOM   1546  C C   . LYS A 1 194 ? 29.444  22.323  91.875  1.00 10.86 ? 194 LYS A C   1 
ATOM   1547  O O   . LYS A 1 194 ? 30.620  22.279  91.588  1.00 11.42 ? 194 LYS A O   1 
ATOM   1548  C CB  . LYS A 1 194 ? 28.912  20.297  93.250  1.00 12.32 ? 194 LYS A CB  1 
ATOM   1549  C CG  . LYS A 1 194 ? 28.129  19.619  92.143  1.00 13.24 ? 194 LYS A CG  1 
ATOM   1550  C CD  . LYS A 1 194 ? 28.058  18.102  92.422  1.00 16.00 ? 194 LYS A CD  1 
ATOM   1551  C CE  . LYS A 1 194 ? 27.309  17.356  91.330  1.00 16.70 ? 194 LYS A CE  1 
ATOM   1552  N NZ  . LYS A 1 194 ? 28.097  17.339  90.057  1.00 14.31 ? 194 LYS A NZ  1 
ATOM   1553  N N   . THR A 1 195 ? 28.516  22.762  91.035  1.00 10.47 ? 195 THR A N   1 
ATOM   1554  C CA  . THR A 1 195 ? 28.875  23.363  89.757  1.00 10.25 ? 195 THR A CA  1 
ATOM   1555  C C   . THR A 1 195 ? 29.517  24.767  89.962  1.00 10.64 ? 195 THR A C   1 
ATOM   1556  O O   . THR A 1 195 ? 30.641  25.030  89.482  1.00 10.43 ? 195 THR A O   1 
ATOM   1557  C CB  . THR A 1 195 ? 27.634  23.441  88.887  1.00 10.18 ? 195 THR A CB  1 
ATOM   1558  O OG1 . THR A 1 195 ? 27.122  22.111  88.664  1.00 8.65  ? 195 THR A OG1 1 
ATOM   1559  C CG2 . THR A 1 195 ? 27.960  23.926  87.491  1.00 9.92  ? 195 THR A CG2 1 
ATOM   1560  N N   . LEU A 1 196 ? 28.819  25.638  90.684  1.00 10.63 ? 196 LEU A N   1 
ATOM   1561  C CA  . LEU A 1 196 ? 29.276  27.012  90.939  1.00 11.29 ? 196 LEU A CA  1 
ATOM   1562  C C   . LEU A 1 196 ? 30.625  27.029  91.677  1.00 12.26 ? 196 LEU A C   1 
ATOM   1563  O O   . LEU A 1 196 ? 31.455  27.916  91.454  1.00 13.19 ? 196 LEU A O   1 
ATOM   1564  C CB  . LEU A 1 196 ? 28.210  27.788  91.731  1.00 11.34 ? 196 LEU A CB  1 
ATOM   1565  C CG  . LEU A 1 196 ? 26.867  28.017  91.037  1.00 11.52 ? 196 LEU A CG  1 
ATOM   1566  C CD1 . LEU A 1 196 ? 25.930  28.800  91.944  1.00 14.01 ? 196 LEU A CD1 1 
ATOM   1567  C CD2 . LEU A 1 196 ? 27.041  28.722  89.711  1.00 12.57 ? 196 LEU A CD2 1 
ATOM   1568  N N   . ALA A 1 197 ? 30.862  26.042  92.541  1.00 13.11 ? 197 ALA A N   1 
ATOM   1569  C CA  . ALA A 1 197 ? 32.140  25.960  93.259  1.00 13.42 ? 197 ALA A CA  1 
ATOM   1570  C C   . ALA A 1 197 ? 33.365  25.833  92.331  1.00 13.99 ? 197 ALA A C   1 
ATOM   1571  O O   . ALA A 1 197 ? 34.504  26.112  92.742  1.00 14.12 ? 197 ALA A O   1 
ATOM   1572  C CB  . ALA A 1 197 ? 32.119  24.801  94.235  1.00 13.64 ? 197 ALA A CB  1 
ATOM   1573  N N   . GLN A 1 198 ? 33.143  25.399  91.100  1.00 13.77 ? 198 GLN A N   1 
ATOM   1574  C CA  . GLN A 1 198 ? 34.230  25.167  90.163  1.00 14.24 ? 198 GLN A CA  1 
ATOM   1575  C C   . GLN A 1 198 ? 34.349  26.246  89.086  1.00 13.97 ? 198 GLN A C   1 
ATOM   1576  O O   . GLN A 1 198 ? 35.147  26.109  88.153  1.00 13.76 ? 198 GLN A O   1 
ATOM   1577  C CB  . GLN A 1 198 ? 34.029  23.813  89.470  1.00 14.72 ? 198 GLN A CB  1 
ATOM   1578  C CG  . GLN A 1 198 ? 33.838  22.636  90.438  1.00 16.08 ? 198 GLN A CG  1 
ATOM   1579  C CD  . GLN A 1 198 ? 33.536  21.356  89.708  1.00 17.87 ? 198 GLN A CD  1 
ATOM   1580  O OE1 . GLN A 1 198 ? 34.407  20.793  89.052  1.00 19.03 ? 198 GLN A OE1 1 
ATOM   1581  N NE2 . GLN A 1 198 ? 32.293  20.904  89.791  1.00 19.27 ? 198 GLN A NE2 1 
ATOM   1582  N N   . LEU A 1 199 ? 33.549  27.300  89.208  1.00 13.01 ? 199 LEU A N   1 
ATOM   1583  C CA  . LEU A 1 199 ? 33.479  28.328  88.185  1.00 13.22 ? 199 LEU A CA  1 
ATOM   1584  C C   . LEU A 1 199 ? 33.967  29.699  88.641  1.00 12.41 ? 199 LEU A C   1 
ATOM   1585  O O   . LEU A 1 199 ? 33.935  30.001  89.812  1.00 11.06 ? 199 LEU A O   1 
ATOM   1586  C CB  . LEU A 1 199 ? 32.031  28.471  87.718  1.00 12.86 ? 199 LEU A CB  1 
ATOM   1587  C CG  . LEU A 1 199 ? 31.419  27.227  87.071  1.00 14.50 ? 199 LEU A CG  1 
ATOM   1588  C CD1 . LEU A 1 199 ? 29.931  27.431  86.857  1.00 15.29 ? 199 LEU A CD1 1 
ATOM   1589  C CD2 . LEU A 1 199 ? 32.100  26.913  85.751  1.00 16.45 ? 199 LEU A CD2 1 
ATOM   1590  N N   . ASN A 1 200 ? 34.418  30.499  87.678  1.00 12.42 ? 200 ASN A N   1 
ATOM   1591  C CA  . ASN A 1 200 ? 34.782  31.907  87.893  1.00 13.14 ? 200 ASN A CA  1 
ATOM   1592  C C   . ASN A 1 200 ? 33.652  32.738  87.307  1.00 12.39 ? 200 ASN A C   1 
ATOM   1593  O O   . ASN A 1 200 ? 33.370  32.650  86.115  1.00 12.37 ? 200 ASN A O   1 
ATOM   1594  C CB  . ASN A 1 200 ? 36.105  32.234  87.168  1.00 13.07 ? 200 ASN A CB  1 
ATOM   1595  C CG  . ASN A 1 200 ? 36.566  33.692  87.352  1.00 15.24 ? 200 ASN A CG  1 
ATOM   1596  O OD1 . ASN A 1 200 ? 35.811  34.582  87.757  1.00 15.18 ? 200 ASN A OD1 1 
ATOM   1597  N ND2 . ASN A 1 200 ? 37.829  33.938  87.006  1.00 17.98 ? 200 ASN A ND2 1 
ATOM   1598  N N   . PRO A 1 201 ? 32.986  33.544  88.121  1.00 13.23 ? 201 PRO A N   1 
ATOM   1599  C CA  . PRO A 1 201 ? 31.857  34.357  87.629  1.00 13.10 ? 201 PRO A CA  1 
ATOM   1600  C C   . PRO A 1 201 ? 32.233  35.283  86.462  1.00 12.78 ? 201 PRO A C   1 
ATOM   1601  O O   . PRO A 1 201 ? 31.384  35.607  85.623  1.00 11.60 ? 201 PRO A O   1 
ATOM   1602  C CB  . PRO A 1 201 ? 31.472  35.216  88.819  1.00 13.46 ? 201 PRO A CB  1 
ATOM   1603  C CG  . PRO A 1 201 ? 32.343  34.834  89.939  1.00 13.95 ? 201 PRO A CG  1 
ATOM   1604  C CD  . PRO A 1 201 ? 33.267  33.756  89.547  1.00 13.57 ? 201 PRO A CD  1 
ATOM   1605  N N   . GLU A 1 202 ? 33.488  35.706  86.430  1.00 12.48 ? 202 GLU A N   1 
ATOM   1606  C CA  . GLU A 1 202 ? 33.982  36.616  85.382  1.00 12.91 ? 202 GLU A CA  1 
ATOM   1607  C C   . GLU A 1 202 ? 33.994  36.005  83.981  1.00 12.40 ? 202 GLU A C   1 
ATOM   1608  O O   . GLU A 1 202 ? 33.954  36.728  82.972  1.00 11.97 ? 202 GLU A O   1 
ATOM   1609  C CB  . GLU A 1 202 ? 35.401  37.075  85.745  1.00 13.26 ? 202 GLU A CB  1 
ATOM   1610  C CG  . GLU A 1 202 ? 35.449  37.930  87.011  1.00 15.51 ? 202 GLU A CG  1 
ATOM   1611  C CD  . GLU A 1 202 ? 36.862  38.400  87.365  1.00 18.31 ? 202 GLU A CD  1 
ATOM   1612  O OE1 . GLU A 1 202 ? 37.647  38.692  86.445  1.00 16.44 ? 202 GLU A OE1 1 
ATOM   1613  O OE2 . GLU A 1 202 ? 37.186  38.472  88.567  1.00 22.26 ? 202 GLU A OE2 1 
ATOM   1614  N N   . SER A 1 203 ? 34.026  34.678  83.907  1.00 11.66 ? 203 SER A N   1 
ATOM   1615  C CA  . SER A 1 203 ? 34.167  34.005  82.612  1.00 11.93 ? 203 SER A CA  1 
ATOM   1616  C C   . SER A 1 203 ? 33.109  32.917  82.384  1.00 11.49 ? 203 SER A C   1 
ATOM   1617  O O   . SER A 1 203 ? 33.280  32.036  81.537  1.00 11.77 ? 203 SER A O   1 
ATOM   1618  C CB  . SER A 1 203 ? 35.577  33.417  82.520  1.00 12.12 ? 203 SER A CB  1 
ATOM   1619  O OG  . SER A 1 203 ? 35.787  32.494  83.582  1.00 12.92 ? 203 SER A OG  1 
ATOM   1620  N N   . SER A 1 204 ? 32.014  33.012  83.122  1.00 11.68 ? 204 SER A N   1 
ATOM   1621  C CA  . SER A 1 204 ? 30.899  32.057  83.049  1.00 12.03 ? 204 SER A CA  1 
ATOM   1622  C C   . SER A 1 204 ? 29.654  32.676  82.431  1.00 11.17 ? 204 SER A C   1 
ATOM   1623  O O   . SER A 1 204 ? 29.240  33.761  82.822  1.00 10.86 ? 204 SER A O   1 
ATOM   1624  C CB  . SER A 1 204 ? 30.538  31.563  84.457  1.00 12.06 ? 204 SER A CB  1 
ATOM   1625  O OG  . SER A 1 204 ? 31.540  30.713  84.985  1.00 12.96 ? 204 SER A OG  1 
ATOM   1626  N N   . LEU A 1 205 ? 29.057  31.959  81.478  1.00 10.64 ? 205 LEU A N   1 
ATOM   1627  C CA  . LEU A 1 205 ? 27.845  32.371  80.788  1.00 10.88 ? 205 LEU A CA  1 
ATOM   1628  C C   . LEU A 1 205 ? 26.755  31.347  81.077  1.00 10.78 ? 205 LEU A C   1 
ATOM   1629  O O   . LEU A 1 205 ? 26.933  30.161  80.789  1.00 10.81 ? 205 LEU A O   1 
ATOM   1630  C CB  . LEU A 1 205 ? 28.092  32.376  79.290  1.00 11.58 ? 205 LEU A CB  1 
ATOM   1631  C CG  . LEU A 1 205 ? 26.911  32.635  78.377  1.00 12.78 ? 205 LEU A CG  1 
ATOM   1632  C CD1 . LEU A 1 205 ? 26.477  34.067  78.536  1.00 13.92 ? 205 LEU A CD1 1 
ATOM   1633  C CD2 . LEU A 1 205 ? 27.351  32.373  76.923  1.00 14.45 ? 205 LEU A CD2 1 
ATOM   1634  N N   . PHE A 1 206 ? 25.652  31.793  81.649  1.00 9.95  ? 206 PHE A N   1 
ATOM   1635  C CA  . PHE A 1 206 ? 24.556  30.907  82.000  1.00 10.07 ? 206 PHE A CA  1 
ATOM   1636  C C   . PHE A 1 206 ? 23.461  30.995  80.967  1.00 10.30 ? 206 PHE A C   1 
ATOM   1637  O O   . PHE A 1 206 ? 23.120  32.098  80.517  1.00 9.68  ? 206 PHE A O   1 
ATOM   1638  C CB  . PHE A 1 206 ? 23.989  31.296  83.361  1.00 10.21 ? 206 PHE A CB  1 
ATOM   1639  C CG  . PHE A 1 206 ? 24.938  31.087  84.481  1.00 9.94  ? 206 PHE A CG  1 
ATOM   1640  C CD1 . PHE A 1 206 ? 25.793  32.088  84.868  1.00 9.27  ? 206 PHE A CD1 1 
ATOM   1641  C CD2 . PHE A 1 206 ? 24.971  29.881  85.159  1.00 9.07  ? 206 PHE A CD2 1 
ATOM   1642  C CE1 . PHE A 1 206 ? 26.689  31.888  85.896  1.00 10.67 ? 206 PHE A CE1 1 
ATOM   1643  C CE2 . PHE A 1 206 ? 25.856  29.673  86.170  1.00 9.64  ? 206 PHE A CE2 1 
ATOM   1644  C CZ  . PHE A 1 206 ? 26.719  30.683  86.550  1.00 10.80 ? 206 PHE A CZ  1 
ATOM   1645  N N   . ILE A 1 207 ? 22.958  29.834  80.556  1.00 9.82  ? 207 ILE A N   1 
ATOM   1646  C CA  . ILE A 1 207 ? 21.853  29.749  79.617  1.00 10.79 ? 207 ILE A CA  1 
ATOM   1647  C C   . ILE A 1 207 ? 20.641  29.213  80.382  1.00 10.90 ? 207 ILE A C   1 
ATOM   1648  O O   . ILE A 1 207 ? 20.677  28.093  80.882  1.00 11.73 ? 207 ILE A O   1 
ATOM   1649  C CB  . ILE A 1 207 ? 22.174  28.801  78.466  1.00 11.12 ? 207 ILE A CB  1 
ATOM   1650  C CG1 . ILE A 1 207 ? 23.393  29.289  77.666  1.00 12.77 ? 207 ILE A CG1 1 
ATOM   1651  C CG2 . ILE A 1 207 ? 20.974  28.668  77.575  1.00 10.10 ? 207 ILE A CG2 1 
ATOM   1652  C CD1 . ILE A 1 207 ? 23.900  28.267  76.725  1.00 14.05 ? 207 ILE A CD1 1 
ATOM   1653  N N   . ILE A 1 208 ? 19.591  30.019  80.474  1.00 10.82 ? 208 ILE A N   1 
ATOM   1654  C CA  . ILE A 1 208 ? 18.385  29.634  81.185  1.00 10.92 ? 208 ILE A CA  1 
ATOM   1655  C C   . ILE A 1 208 ? 17.354  29.151  80.165  1.00 10.93 ? 208 ILE A C   1 
ATOM   1656  O O   . ILE A 1 208 ? 16.816  29.936  79.371  1.00 10.26 ? 208 ILE A O   1 
ATOM   1657  C CB  . ILE A 1 208 ? 17.860  30.809  82.035  1.00 10.97 ? 208 ILE A CB  1 
ATOM   1658  C CG1 . ILE A 1 208 ? 19.018  31.504  82.771  1.00 12.53 ? 208 ILE A CG1 1 
ATOM   1659  C CG2 . ILE A 1 208 ? 16.842  30.331  83.070  1.00 12.16 ? 208 ILE A CG2 1 
ATOM   1660  C CD1 . ILE A 1 208 ? 19.844  30.577  83.652  1.00 12.69 ? 208 ILE A CD1 1 
ATOM   1661  N N   . ALA A 1 209 ? 17.081  27.843  80.206  1.00 10.84 ? 209 ALA A N   1 
ATOM   1662  C CA  . ALA A 1 209 ? 16.208  27.185  79.243  1.00 11.27 ? 209 ALA A CA  1 
ATOM   1663  C C   . ALA A 1 209 ? 14.804  26.924  79.776  1.00 12.20 ? 209 ALA A C   1 
ATOM   1664  O O   . ALA A 1 209 ? 14.593  25.980  80.521  1.00 12.26 ? 209 ALA A O   1 
ATOM   1665  C CB  . ALA A 1 209 ? 16.844  25.861  78.798  1.00 11.65 ? 209 ALA A CB  1 
ATOM   1666  N N   . SER A 1 210 ? 13.839  27.744  79.367  1.00 12.24 ? 210 SER A N   1 
ATOM   1667  C CA  . SER A 1 210 ? 12.462  27.578  79.813  1.00 13.18 ? 210 SER A CA  1 
ATOM   1668  C C   . SER A 1 210 ? 11.527  28.429  78.967  1.00 13.75 ? 210 SER A C   1 
ATOM   1669  O O   . SER A 1 210 ? 11.623  29.651  78.954  1.00 13.52 ? 210 SER A O   1 
ATOM   1670  C CB  . SER A 1 210 ? 12.330  27.981  81.286  1.00 13.25 ? 210 SER A CB  1 
ATOM   1671  O OG  . SER A 1 210 ? 10.980  28.214  81.635  1.00 12.99 ? 210 SER A OG  1 
ATOM   1672  N N   . LYS A 1 211 ? 10.616  27.768  78.266  1.00 14.44 ? 211 LYS A N   1 
ATOM   1673  C CA  . LYS A 1 211 ? 9.676   28.428  77.372  1.00 15.27 ? 211 LYS A CA  1 
ATOM   1674  C C   . LYS A 1 211 ? 8.909   29.541  78.078  1.00 15.27 ? 211 LYS A C   1 
ATOM   1675  O O   . LYS A 1 211 ? 8.859   30.690  77.599  1.00 15.51 ? 211 LYS A O   1 
ATOM   1676  C CB  . LYS A 1 211 ? 8.731   27.365  76.790  1.00 15.49 ? 211 LYS A CB  1 
ATOM   1677  C CG  . LYS A 1 211 ? 7.591   27.871  75.904  1.00 18.56 ? 211 LYS A CG  1 
ATOM   1678  C CD  . LYS A 1 211 ? 8.007   28.123  74.480  1.00 20.07 ? 211 LYS A CD  1 
ATOM   1679  C CE  . LYS A 1 211 ? 6.786   28.229  73.549  1.00 19.63 ? 211 LYS A CE  1 
ATOM   1680  N NZ  . LYS A 1 211 ? 6.003   29.480  73.825  1.00 18.44 ? 211 LYS A NZ  1 
ATOM   1681  N N   . THR A 1 212 ? 8.323   29.204  79.223  1.00 15.35 ? 212 THR A N   1 
ATOM   1682  C CA  . THR A 1 212 ? 7.529   30.150  80.004  1.00 15.53 ? 212 THR A CA  1 
ATOM   1683  C C   . THR A 1 212 ? 8.362   31.084  80.849  1.00 15.17 ? 212 THR A C   1 
ATOM   1684  O O   . THR A 1 212 ? 7.899   32.144  81.236  1.00 15.54 ? 212 THR A O   1 
ATOM   1685  C CB  . THR A 1 212 ? 6.616   29.391  80.975  1.00 15.96 ? 212 THR A CB  1 
ATOM   1686  O OG1 . THR A 1 212 ? 7.405   28.560  81.841  1.00 16.74 ? 212 THR A OG1 1 
ATOM   1687  C CG2 . THR A 1 212 ? 5.679   28.427  80.244  1.00 17.07 ? 212 THR A CG2 1 
ATOM   1688  N N   . PHE A 1 213 ? 9.582   30.668  81.157  1.00 14.50 ? 213 PHE A N   1 
ATOM   1689  C CA  . PHE A 1 213 ? 10.447  31.376  82.089  1.00 14.49 ? 213 PHE A CA  1 
ATOM   1690  C C   . PHE A 1 213 ? 9.840   31.470  83.503  1.00 14.63 ? 213 PHE A C   1 
ATOM   1691  O O   . PHE A 1 213 ? 10.232  32.336  84.294  1.00 14.45 ? 213 PHE A O   1 
ATOM   1692  C CB  . PHE A 1 213 ? 10.890  32.746  81.560  1.00 14.49 ? 213 PHE A CB  1 
ATOM   1693  C CG  . PHE A 1 213 ? 12.362  33.006  81.753  1.00 13.93 ? 213 PHE A CG  1 
ATOM   1694  C CD1 . PHE A 1 213 ? 13.297  32.267  81.047  1.00 11.36 ? 213 PHE A CD1 1 
ATOM   1695  C CD2 . PHE A 1 213 ? 12.809  33.954  82.654  1.00 14.04 ? 213 PHE A CD2 1 
ATOM   1696  C CE1 . PHE A 1 213 ? 14.640  32.475  81.208  1.00 12.33 ? 213 PHE A CE1 1 
ATOM   1697  C CE2 . PHE A 1 213 ? 14.171  34.171  82.821  1.00 12.80 ? 213 PHE A CE2 1 
ATOM   1698  C CZ  . PHE A 1 213 ? 15.089  33.420  82.091  1.00 12.28 ? 213 PHE A CZ  1 
ATOM   1699  N N   . THR A 1 214 ? 8.935   30.540  83.826  1.00 14.14 ? 214 THR A N   1 
ATOM   1700  C CA  . THR A 1 214 ? 8.372   30.411  85.176  1.00 15.17 ? 214 THR A CA  1 
ATOM   1701  C C   . THR A 1 214 ? 8.533   28.970  85.724  1.00 14.78 ? 214 THR A C   1 
ATOM   1702  O O   . THR A 1 214 ? 8.050   28.657  86.819  1.00 15.07 ? 214 THR A O   1 
ATOM   1703  C CB  . THR A 1 214 ? 6.867   30.809  85.230  1.00 14.67 ? 214 THR A CB  1 
ATOM   1704  O OG1 . THR A 1 214 ? 6.130   30.016  84.307  1.00 15.49 ? 214 THR A OG1 1 
ATOM   1705  C CG2 . THR A 1 214 ? 6.641   32.246  84.758  1.00 16.67 ? 214 THR A CG2 1 
ATOM   1706  N N   . THR A 1 215 ? 9.222   28.106  84.988  1.00 14.33 ? 215 THR A N   1 
ATOM   1707  C CA  . THR A 1 215 ? 9.463   26.731  85.440  1.00 13.54 ? 215 THR A CA  1 
ATOM   1708  C C   . THR A 1 215 ? 10.101  26.769  86.827  1.00 13.09 ? 215 THR A C   1 
ATOM   1709  O O   . THR A 1 215 ? 11.181  27.323  87.011  1.00 13.03 ? 215 THR A O   1 
ATOM   1710  C CB  . THR A 1 215 ? 10.381  26.021  84.446  1.00 13.69 ? 215 THR A CB  1 
ATOM   1711  O OG1 . THR A 1 215 ? 9.921   26.260  83.110  1.00 13.01 ? 215 THR A OG1 1 
ATOM   1712  C CG2 . THR A 1 215 ? 10.346  24.480  84.630  1.00 13.47 ? 215 THR A CG2 1 
ATOM   1713  N N   . GLN A 1 216 ? 9.446   26.176  87.815  1.00 13.08 ? 216 GLN A N   1 
ATOM   1714  C CA  . GLN A 1 216 ? 9.896   26.343  89.199  1.00 12.54 ? 216 GLN A CA  1 
ATOM   1715  C C   . GLN A 1 216 ? 11.344  25.918  89.438  1.00 11.74 ? 216 GLN A C   1 
ATOM   1716  O O   . GLN A 1 216 ? 12.128  26.676  90.014  1.00 10.19 ? 216 GLN A O   1 
ATOM   1717  C CB  . GLN A 1 216 ? 8.991   25.594  90.173  1.00 13.03 ? 216 GLN A CB  1 
ATOM   1718  C CG  . GLN A 1 216 ? 9.461   25.700  91.610  1.00 13.82 ? 216 GLN A CG  1 
ATOM   1719  C CD  . GLN A 1 216 ? 8.721   24.764  92.553  1.00 16.52 ? 216 GLN A CD  1 
ATOM   1720  O OE1 . GLN A 1 216 ? 8.339   23.667  92.164  1.00 15.26 ? 216 GLN A OE1 1 
ATOM   1721  N NE2 . GLN A 1 216 ? 8.507   25.206  93.791  1.00 14.43 ? 216 GLN A NE2 1 
ATOM   1722  N N   . GLU A 1 217 ? 11.696  24.712  89.000  1.00 10.56 ? 217 GLU A N   1 
ATOM   1723  C CA  . GLU A 1 217 ? 13.025  24.179  89.274  1.00 10.81 ? 217 GLU A CA  1 
ATOM   1724  C C   . GLU A 1 217 ? 14.107  24.945  88.532  1.00 10.12 ? 217 GLU A C   1 
ATOM   1725  O O   . GLU A 1 217 ? 15.095  25.346  89.119  1.00 8.88  ? 217 GLU A O   1 
ATOM   1726  C CB  . GLU A 1 217 ? 13.093  22.672  88.964  1.00 10.46 ? 217 GLU A CB  1 
ATOM   1727  C CG  . GLU A 1 217 ? 12.153  21.870  89.863  1.00 11.85 ? 217 GLU A CG  1 
ATOM   1728  C CD  . GLU A 1 217 ? 12.293  20.363  89.707  1.00 14.41 ? 217 GLU A CD  1 
ATOM   1729  O OE1 . GLU A 1 217 ? 11.269  19.649  89.784  1.00 15.98 ? 217 GLU A OE1 1 
ATOM   1730  O OE2 . GLU A 1 217 ? 13.425  19.893  89.529  1.00 14.39 ? 217 GLU A OE2 1 
ATOM   1731  N N   . THR A 1 218 ? 13.863  25.182  87.256  1.00 10.17 ? 218 THR A N   1 
ATOM   1732  C CA  . THR A 1 218 ? 14.798  25.869  86.408  1.00 9.72  ? 218 THR A CA  1 
ATOM   1733  C C   . THR A 1 218 ? 15.036  27.279  86.893  1.00 9.47  ? 218 THR A C   1 
ATOM   1734  O O   . THR A 1 218 ? 16.177  27.711  86.985  1.00 9.79  ? 218 THR A O   1 
ATOM   1735  C CB  . THR A 1 218 ? 14.254  25.873  84.989  1.00 9.62  ? 218 THR A CB  1 
ATOM   1736  O OG1 . THR A 1 218 ? 14.220  24.530  84.515  1.00 10.33 ? 218 THR A OG1 1 
ATOM   1737  C CG2 . THR A 1 218 ? 15.199  26.566  84.004  1.00 11.15 ? 218 THR A CG2 1 
ATOM   1738  N N   . ILE A 1 219 ? 13.963  27.987  87.197  1.00 10.01 ? 219 ILE A N   1 
ATOM   1739  C CA  . ILE A 1 219 ? 14.075  29.379  87.613  1.00 10.70 ? 219 ILE A CA  1 
ATOM   1740  C C   . ILE A 1 219 ? 14.688  29.467  89.015  1.00 10.40 ? 219 ILE A C   1 
ATOM   1741  O O   . ILE A 1 219 ? 15.423  30.411  89.305  1.00 10.07 ? 219 ILE A O   1 
ATOM   1742  C CB  . ILE A 1 219 ? 12.714  30.097  87.526  1.00 11.79 ? 219 ILE A CB  1 
ATOM   1743  C CG1 . ILE A 1 219 ? 12.195  30.114  86.081  1.00 12.96 ? 219 ILE A CG1 1 
ATOM   1744  C CG2 . ILE A 1 219 ? 12.805  31.529  88.073  1.00 11.93 ? 219 ILE A CG2 1 
ATOM   1745  C CD1 . ILE A 1 219 ? 13.053  30.883  85.079  1.00 14.94 ? 219 ILE A CD1 1 
ATOM   1746  N N   . THR A 1 220 ? 14.388  28.502  89.891  1.00 10.28 ? 220 THR A N   1 
ATOM   1747  C CA  . THR A 1 220 ? 15.022  28.493  91.206  1.00 10.21 ? 220 THR A CA  1 
ATOM   1748  C C   . THR A 1 220 ? 16.533  28.376  91.039  1.00 9.77  ? 220 THR A C   1 
ATOM   1749  O O   . THR A 1 220 ? 17.298  29.171  91.593  1.00 10.46 ? 220 THR A O   1 
ATOM   1750  C CB  . THR A 1 220 ? 14.494  27.353  92.095  1.00 10.68 ? 220 THR A CB  1 
ATOM   1751  O OG1 . THR A 1 220 ? 13.087  27.504  92.307  1.00 10.09 ? 220 THR A OG1 1 
ATOM   1752  C CG2 . THR A 1 220 ? 15.074  27.481  93.502  1.00 10.93 ? 220 THR A CG2 1 
ATOM   1753  N N   . ASN A 1 221 ? 16.955  27.424  90.211  1.00 8.83  ? 221 ASN A N   1 
ATOM   1754  C CA  . ASN A 1 221 ? 18.369  27.258  89.920  1.00 9.13  ? 221 ASN A CA  1 
ATOM   1755  C C   . ASN A 1 221 ? 18.964  28.535  89.312  1.00 9.21  ? 221 ASN A C   1 
ATOM   1756  O O   . ASN A 1 221 ? 20.076  28.946  89.681  1.00 9.19  ? 221 ASN A O   1 
ATOM   1757  C CB  . ASN A 1 221 ? 18.594  26.059  88.980  1.00 7.98  ? 221 ASN A CB  1 
ATOM   1758  C CG  . ASN A 1 221 ? 18.687  24.748  89.729  1.00 8.42  ? 221 ASN A CG  1 
ATOM   1759  O OD1 . ASN A 1 221 ? 19.297  24.692  90.790  1.00 9.57  ? 221 ASN A OD1 1 
ATOM   1760  N ND2 . ASN A 1 221 ? 18.119  23.664  89.158  1.00 7.02  ? 221 ASN A ND2 1 
ATOM   1761  N N   . ALA A 1 222 ? 18.217  29.151  88.398  1.00 9.35  ? 222 ALA A N   1 
ATOM   1762  C CA  . ALA A 1 222 ? 18.686  30.353  87.707  1.00 9.25  ? 222 ALA A CA  1 
ATOM   1763  C C   . ALA A 1 222 ? 18.905  31.512  88.678  1.00 10.21 ? 222 ALA A C   1 
ATOM   1764  O O   . ALA A 1 222 ? 19.876  32.269  88.566  1.00 10.76 ? 222 ALA A O   1 
ATOM   1765  C CB  . ALA A 1 222 ? 17.713  30.737  86.605  1.00 9.01  ? 222 ALA A CB  1 
ATOM   1766  N N   . GLU A 1 223 ? 18.004  31.635  89.642  1.00 10.88 ? 223 GLU A N   1 
ATOM   1767  C CA  . GLU A 1 223 ? 18.067  32.700  90.612  1.00 10.85 ? 223 GLU A CA  1 
ATOM   1768  C C   . GLU A 1 223 ? 19.202  32.449  91.587  1.00 10.23 ? 223 GLU A C   1 
ATOM   1769  O O   . GLU A 1 223 ? 19.829  33.373  92.058  1.00 9.36  ? 223 GLU A O   1 
ATOM   1770  C CB  . GLU A 1 223 ? 16.711  32.828  91.327  1.00 11.99 ? 223 GLU A CB  1 
ATOM   1771  C CG  . GLU A 1 223 ? 15.671  33.423  90.386  1.00 13.80 ? 223 GLU A CG  1 
ATOM   1772  C CD  . GLU A 1 223 ? 14.324  33.709  91.021  1.00 18.64 ? 223 GLU A CD  1 
ATOM   1773  O OE1 . GLU A 1 223 ? 14.008  33.160  92.095  1.00 20.71 ? 223 GLU A OE1 1 
ATOM   1774  O OE2 . GLU A 1 223 ? 13.565  34.492  90.404  1.00 22.58 ? 223 GLU A OE2 1 
ATOM   1775  N N   . THR A 1 224 ? 19.483  31.186  91.861  1.00 9.44  ? 224 THR A N   1 
ATOM   1776  C CA  . THR A 1 224 ? 20.608  30.851  92.717  1.00 9.53  ? 224 THR A CA  1 
ATOM   1777  C C   . THR A 1 224 ? 21.919  31.221  92.005  1.00 9.86  ? 224 THR A C   1 
ATOM   1778  O O   . THR A 1 224 ? 22.823  31.797  92.611  1.00 10.15 ? 224 THR A O   1 
ATOM   1779  C CB  . THR A 1 224 ? 20.557  29.366  93.070  1.00 9.11  ? 224 THR A CB  1 
ATOM   1780  O OG1 . THR A 1 224 ? 19.462  29.141  93.970  1.00 8.65  ? 224 THR A OG1 1 
ATOM   1781  C CG2 . THR A 1 224 ? 21.788  28.947  93.831  1.00 8.92  ? 224 THR A CG2 1 
ATOM   1782  N N   . ALA A 1 225 ? 21.991  30.921  90.715  1.00 9.54  ? 225 ALA A N   1 
ATOM   1783  C CA  . ALA A 1 225 ? 23.163  31.259  89.906  1.00 10.14 ? 225 ALA A CA  1 
ATOM   1784  C C   . ALA A 1 225 ? 23.336  32.781  89.887  1.00 10.54 ? 225 ALA A C   1 
ATOM   1785  O O   . ALA A 1 225 ? 24.437  33.285  90.079  1.00 10.44 ? 225 ALA A O   1 
ATOM   1786  C CB  . ALA A 1 225 ? 23.019  30.731  88.491  1.00 9.98  ? 225 ALA A CB  1 
ATOM   1787  N N   . LYS A 1 226 ? 22.248  33.503  89.663  1.00 11.21 ? 226 LYS A N   1 
ATOM   1788  C CA  . LYS A 1 226 ? 22.317  34.971  89.633  1.00 11.98 ? 226 LYS A CA  1 
ATOM   1789  C C   . LYS A 1 226 ? 22.773  35.590  90.959  1.00 12.50 ? 226 LYS A C   1 
ATOM   1790  O O   . LYS A 1 226 ? 23.563  36.558  90.986  1.00 12.70 ? 226 LYS A O   1 
ATOM   1791  C CB  . LYS A 1 226 ? 20.986  35.567  89.201  1.00 12.32 ? 226 LYS A CB  1 
ATOM   1792  C CG  . LYS A 1 226 ? 20.914  37.090  89.397  1.00 13.95 ? 226 LYS A CG  1 
ATOM   1793  C CD  . LYS A 1 226 ? 19.755  37.746  88.654  1.00 14.11 ? 226 LYS A CD  1 
ATOM   1794  C CE  . LYS A 1 226 ? 18.386  37.366  89.171  1.00 15.04 ? 226 LYS A CE  1 
ATOM   1795  N NZ  . LYS A 1 226 ? 17.342  38.362  88.719  1.00 15.16 ? 226 LYS A NZ  1 
ATOM   1796  N N   . GLU A 1 227 ? 22.303  35.035  92.065  1.00 13.60 ? 227 GLU A N   1 
ATOM   1797  C CA  . GLU A 1 227 ? 22.700  35.533  93.383  1.00 13.79 ? 227 GLU A CA  1 
ATOM   1798  C C   . GLU A 1 227 ? 24.202  35.313  93.585  1.00 13.66 ? 227 GLU A C   1 
ATOM   1799  O O   . GLU A 1 227 ? 24.923  36.196  94.080  1.00 12.75 ? 227 GLU A O   1 
ATOM   1800  C CB  . GLU A 1 227 ? 21.881  34.834  94.471  1.00 14.84 ? 227 GLU A CB  1 
ATOM   1801  C CG  . GLU A 1 227 ? 22.321  35.143  95.893  1.00 16.48 ? 227 GLU A CG  1 
ATOM   1802  C CD  . GLU A 1 227 ? 21.495  34.405  96.934  1.00 20.81 ? 227 GLU A CD  1 
ATOM   1803  O OE1 . GLU A 1 227 ? 21.680  33.179  97.106  1.00 21.19 ? 227 GLU A OE1 1 
ATOM   1804  O OE2 . GLU A 1 227 ? 20.665  35.062  97.582  1.00 24.95 ? 227 GLU A OE2 1 
ATOM   1805  N N   . TRP A 1 228 ? 24.682  34.137  93.190  1.00 13.04 ? 228 TRP A N   1 
ATOM   1806  C CA  . TRP A 1 228 ? 26.110  33.844  93.259  1.00 13.28 ? 228 TRP A CA  1 
ATOM   1807  C C   . TRP A 1 228 ? 26.875  34.812  92.358  1.00 13.10 ? 228 TRP A C   1 
ATOM   1808  O O   . TRP A 1 228 ? 27.910  35.357  92.742  1.00 13.45 ? 228 TRP A O   1 
ATOM   1809  C CB  . TRP A 1 228 ? 26.350  32.401  92.816  1.00 12.77 ? 228 TRP A CB  1 
ATOM   1810  C CG  . TRP A 1 228 ? 27.776  31.987  92.529  1.00 12.24 ? 228 TRP A CG  1 
ATOM   1811  C CD1 . TRP A 1 228 ? 28.686  31.481  93.419  1.00 10.61 ? 228 TRP A CD1 1 
ATOM   1812  C CD2 . TRP A 1 228 ? 28.426  31.954  91.239  1.00 10.78 ? 228 TRP A CD2 1 
ATOM   1813  N NE1 . TRP A 1 228 ? 29.849  31.151  92.769  1.00 11.54 ? 228 TRP A NE1 1 
ATOM   1814  C CE2 . TRP A 1 228 ? 29.724  31.441  91.436  1.00 11.88 ? 228 TRP A CE2 1 
ATOM   1815  C CE3 . TRP A 1 228 ? 28.047  32.331  89.953  1.00 10.12 ? 228 TRP A CE3 1 
ATOM   1816  C CZ2 . TRP A 1 228 ? 30.642  31.294  90.392  1.00 10.15 ? 228 TRP A CZ2 1 
ATOM   1817  C CZ3 . TRP A 1 228 ? 28.953  32.194  88.924  1.00 10.67 ? 228 TRP A CZ3 1 
ATOM   1818  C CH2 . TRP A 1 228 ? 30.228  31.671  89.142  1.00 11.82 ? 228 TRP A CH2 1 
ATOM   1819  N N   . PHE A 1 229 ? 26.349  35.039  91.162  1.00 13.15 ? 229 PHE A N   1 
ATOM   1820  C CA  . PHE A 1 229 ? 27.008  35.933  90.216  1.00 13.67 ? 229 PHE A CA  1 
ATOM   1821  C C   . PHE A 1 229 ? 27.138  37.348  90.786  1.00 14.07 ? 229 PHE A C   1 
ATOM   1822  O O   . PHE A 1 229 ? 28.230  37.928  90.821  1.00 13.72 ? 229 PHE A O   1 
ATOM   1823  C CB  . PHE A 1 229 ? 26.246  35.989  88.893  1.00 13.60 ? 229 PHE A CB  1 
ATOM   1824  C CG  . PHE A 1 229 ? 26.808  36.992  87.950  1.00 13.02 ? 229 PHE A CG  1 
ATOM   1825  C CD1 . PHE A 1 229 ? 28.031  36.753  87.330  1.00 12.69 ? 229 PHE A CD1 1 
ATOM   1826  C CD2 . PHE A 1 229 ? 26.174  38.202  87.742  1.00 13.23 ? 229 PHE A CD2 1 
ATOM   1827  C CE1 . PHE A 1 229 ? 28.597  37.697  86.476  1.00 14.14 ? 229 PHE A CE1 1 
ATOM   1828  C CE2 . PHE A 1 229 ? 26.731  39.152  86.911  1.00 14.30 ? 229 PHE A CE2 1 
ATOM   1829  C CZ  . PHE A 1 229 ? 27.954  38.901  86.273  1.00 13.48 ? 229 PHE A CZ  1 
ATOM   1830  N N   . LEU A 1 230 ? 26.021  37.863  91.276  1.00 15.08 ? 230 LEU A N   1 
ATOM   1831  C CA  . LEU A 1 230 ? 25.950  39.206  91.834  1.00 15.70 ? 230 LEU A CA  1 
ATOM   1832  C C   . LEU A 1 230 ? 26.749  39.356  93.132  1.00 15.92 ? 230 LEU A C   1 
ATOM   1833  O O   . LEU A 1 230 ? 27.203  40.464  93.449  1.00 15.82 ? 230 LEU A O   1 
ATOM   1834  C CB  . LEU A 1 230 ? 24.496  39.646  92.012  1.00 15.93 ? 230 LEU A CB  1 
ATOM   1835  C CG  . LEU A 1 230 ? 23.721  39.934  90.727  1.00 17.49 ? 230 LEU A CG  1 
ATOM   1836  C CD1 . LEU A 1 230 ? 22.232  40.239  91.014  1.00 18.61 ? 230 LEU A CD1 1 
ATOM   1837  C CD2 . LEU A 1 230 ? 24.358  41.077  89.956  1.00 18.26 ? 230 LEU A CD2 1 
ATOM   1838  N N   . GLN A 1 231 ? 26.946  38.272  93.878  1.00 16.24 ? 231 GLN A N   1 
ATOM   1839  C CA  . GLN A 1 231 ? 27.786  38.344  95.082  1.00 16.98 ? 231 GLN A CA  1 
ATOM   1840  C C   . GLN A 1 231 ? 29.196  38.786  94.679  1.00 16.48 ? 231 GLN A C   1 
ATOM   1841  O O   . GLN A 1 231 ? 29.871  39.496  95.427  1.00 16.44 ? 231 GLN A O   1 
ATOM   1842  C CB  . GLN A 1 231 ? 27.828  37.014  95.849  1.00 17.62 ? 231 GLN A CB  1 
ATOM   1843  C CG  . GLN A 1 231 ? 28.714  37.014  97.114  1.00 21.04 ? 231 GLN A CG  1 
ATOM   1844  C CD  . GLN A 1 231 ? 28.323  38.085  98.148  1.00 25.83 ? 231 GLN A CD  1 
ATOM   1845  O OE1 . GLN A 1 231 ? 27.137  38.357  98.364  1.00 30.77 ? 231 GLN A OE1 1 
ATOM   1846  N NE2 . GLN A 1 231 ? 29.326  38.677  98.794  1.00 27.13 ? 231 GLN A NE2 1 
ATOM   1847  N N   . ALA A 1 232 ? 29.618  38.376  93.487  1.00 15.89 ? 232 ALA A N   1 
ATOM   1848  C CA  . ALA A 1 232 ? 30.905  38.760  92.935  1.00 15.91 ? 232 ALA A CA  1 
ATOM   1849  C C   . ALA A 1 232 ? 30.839  40.071  92.157  1.00 16.31 ? 232 ALA A C   1 
ATOM   1850  O O   . ALA A 1 232 ? 31.654  40.959  92.368  1.00 16.80 ? 232 ALA A O   1 
ATOM   1851  C CB  . ALA A 1 232 ? 31.408  37.660  92.014  1.00 15.82 ? 232 ALA A CB  1 
ATOM   1852  N N   . ALA A 1 233 ? 29.854  40.201  91.272  1.00 16.38 ? 233 ALA A N   1 
ATOM   1853  C CA  . ALA A 1 233 ? 29.801  41.333  90.350  1.00 16.77 ? 233 ALA A CA  1 
ATOM   1854  C C   . ALA A 1 233 ? 29.167  42.580  90.932  1.00 17.16 ? 233 ALA A C   1 
ATOM   1855  O O   . ALA A 1 233 ? 29.530  43.697  90.537  1.00 16.85 ? 233 ALA A O   1 
ATOM   1856  C CB  . ALA A 1 233 ? 29.073  40.934  89.082  1.00 16.61 ? 233 ALA A CB  1 
ATOM   1857  N N   . LYS A 1 234 ? 28.195  42.375  91.820  1.00 17.79 ? 234 LYS A N   1 
ATOM   1858  C CA  . LYS A 1 234 ? 27.454  43.436  92.508  1.00 19.14 ? 234 LYS A CA  1 
ATOM   1859  C C   . LYS A 1 234 ? 26.445  44.189  91.655  1.00 19.32 ? 234 LYS A C   1 
ATOM   1860  O O   . LYS A 1 234 ? 25.275  44.361  92.049  1.00 20.36 ? 234 LYS A O   1 
ATOM   1861  C CB  . LYS A 1 234 ? 28.393  44.456  93.164  1.00 19.53 ? 234 LYS A CB  1 
ATOM   1862  C CG  . LYS A 1 234 ? 29.362  43.890  94.181  1.00 20.42 ? 234 LYS A CG  1 
ATOM   1863  C CD  . LYS A 1 234 ? 28.706  42.992  95.214  1.00 21.33 ? 234 LYS A CD  1 
ATOM   1864  C CE  . LYS A 1 234 ? 29.736  42.512  96.233  1.00 22.67 ? 234 LYS A CE  1 
ATOM   1865  N NZ  . LYS A 1 234 ? 29.180  41.512  97.192  1.00 22.17 ? 234 LYS A NZ  1 
ATOM   1866  N N   . ASP A 1 235 ? 26.920  44.656  90.516  1.00 19.39 ? 235 ASP A N   1 
ATOM   1867  C CA  . ASP A 1 235 ? 26.175  45.472  89.576  1.00 19.91 ? 235 ASP A CA  1 
ATOM   1868  C C   . ASP A 1 235 ? 25.112  44.685  88.817  1.00 19.00 ? 235 ASP A C   1 
ATOM   1869  O O   . ASP A 1 235 ? 25.459  43.804  88.050  1.00 17.76 ? 235 ASP A O   1 
ATOM   1870  C CB  . ASP A 1 235 ? 27.199  46.011  88.579  1.00 20.43 ? 235 ASP A CB  1 
ATOM   1871  C CG  . ASP A 1 235 ? 26.597  46.916  87.541  1.00 23.07 ? 235 ASP A CG  1 
ATOM   1872  O OD1 . ASP A 1 235 ? 27.368  47.321  86.637  1.00 27.84 ? 235 ASP A OD1 1 
ATOM   1873  O OD2 . ASP A 1 235 ? 25.402  47.269  87.535  1.00 25.58 ? 235 ASP A OD2 1 
ATOM   1874  N N   . PRO A 1 236 ? 23.833  45.006  89.013  1.00 19.10 ? 236 PRO A N   1 
ATOM   1875  C CA  . PRO A 1 236 ? 22.737  44.290  88.331  1.00 18.72 ? 236 PRO A CA  1 
ATOM   1876  C C   . PRO A 1 236 ? 22.831  44.343  86.819  1.00 18.24 ? 236 PRO A C   1 
ATOM   1877  O O   . PRO A 1 236 ? 22.420  43.400  86.138  1.00 17.93 ? 236 PRO A O   1 
ATOM   1878  C CB  . PRO A 1 236 ? 21.472  45.011  88.804  1.00 19.25 ? 236 PRO A CB  1 
ATOM   1879  C CG  . PRO A 1 236 ? 21.882  45.778  90.033  1.00 20.09 ? 236 PRO A CG  1 
ATOM   1880  C CD  . PRO A 1 236 ? 23.336  46.065  89.906  1.00 19.77 ? 236 PRO A CD  1 
ATOM   1881  N N   . SER A 1 237 ? 23.399  45.421  86.283  1.00 17.35 ? 237 SER A N   1 
ATOM   1882  C CA  . SER A 1 237 ? 23.525  45.547  84.838  1.00 17.05 ? 237 SER A CA  1 
ATOM   1883  C C   . SER A 1 237 ? 24.509  44.507  84.264  1.00 15.70 ? 237 SER A C   1 
ATOM   1884  O O   . SER A 1 237 ? 24.532  44.247  83.063  1.00 15.20 ? 237 SER A O   1 
ATOM   1885  C CB  . SER A 1 237 ? 23.980  46.962  84.467  1.00 17.40 ? 237 SER A CB  1 
ATOM   1886  O OG  . SER A 1 237 ? 25.356  47.141  84.793  1.00 20.73 ? 237 SER A OG  1 
ATOM   1887  N N   . ALA A 1 238 ? 25.331  43.910  85.113  1.00 14.55 ? 238 ALA A N   1 
ATOM   1888  C CA  . ALA A 1 238 ? 26.291  42.922  84.613  1.00 14.18 ? 238 ALA A CA  1 
ATOM   1889  C C   . ALA A 1 238 ? 25.612  41.568  84.321  1.00 13.69 ? 238 ALA A C   1 
ATOM   1890  O O   . ALA A 1 238 ? 26.166  40.733  83.645  1.00 12.71 ? 238 ALA A O   1 
ATOM   1891  C CB  . ALA A 1 238 ? 27.420  42.762  85.572  1.00 14.11 ? 238 ALA A CB  1 
ATOM   1892  N N   . VAL A 1 239 ? 24.385  41.385  84.794  1.00 13.50 ? 239 VAL A N   1 
ATOM   1893  C CA  . VAL A 1 239 ? 23.677  40.124  84.570  1.00 13.40 ? 239 VAL A CA  1 
ATOM   1894  C C   . VAL A 1 239 ? 23.519  39.893  83.065  1.00 13.03 ? 239 VAL A C   1 
ATOM   1895  O O   . VAL A 1 239 ? 23.642  38.761  82.592  1.00 12.70 ? 239 VAL A O   1 
ATOM   1896  C CB  . VAL A 1 239 ? 22.323  40.120  85.310  1.00 13.25 ? 239 VAL A CB  1 
ATOM   1897  C CG1 . VAL A 1 239 ? 21.450  38.966  84.870  1.00 13.22 ? 239 VAL A CG1 1 
ATOM   1898  C CG2 . VAL A 1 239 ? 22.556  40.073  86.796  1.00 14.13 ? 239 VAL A CG2 1 
ATOM   1899  N N   . ALA A 1 240 ? 23.309  40.972  82.311  1.00 13.31 ? 240 ALA A N   1 
ATOM   1900  C CA  . ALA A 1 240 ? 23.102  40.895  80.859  1.00 13.24 ? 240 ALA A CA  1 
ATOM   1901  C C   . ALA A 1 240 ? 24.314  40.403  80.065  1.00 13.28 ? 240 ALA A C   1 
ATOM   1902  O O   . ALA A 1 240 ? 24.169  39.999  78.917  1.00 13.48 ? 240 ALA A O   1 
ATOM   1903  C CB  . ALA A 1 240 ? 22.625  42.252  80.289  1.00 13.80 ? 240 ALA A CB  1 
ATOM   1904  N N   . LYS A 1 241 ? 25.500  40.413  80.659  1.00 12.97 ? 241 LYS A N   1 
ATOM   1905  C CA  . LYS A 1 241 ? 26.650  39.851  79.966  1.00 13.82 ? 241 LYS A CA  1 
ATOM   1906  C C   . LYS A 1 241 ? 26.895  38.420  80.342  1.00 12.40 ? 241 LYS A C   1 
ATOM   1907  O O   . LYS A 1 241 ? 27.741  37.787  79.738  1.00 12.01 ? 241 LYS A O   1 
ATOM   1908  C CB  . LYS A 1 241 ? 27.946  40.540  80.307  1.00 14.69 ? 241 LYS A CB  1 
ATOM   1909  C CG  . LYS A 1 241 ? 27.798  41.791  81.016  1.00 19.60 ? 241 LYS A CG  1 
ATOM   1910  C CD  . LYS A 1 241 ? 27.989  42.892  80.088  1.00 21.39 ? 241 LYS A CD  1 
ATOM   1911  C CE  . LYS A 1 241 ? 29.341  43.506  80.321  1.00 22.28 ? 241 LYS A CE  1 
ATOM   1912  N NZ  . LYS A 1 241 ? 29.386  44.856  79.685  1.00 23.36 ? 241 LYS A NZ  1 
ATOM   1913  N N   . HIS A 1 242 ? 26.168  37.915  81.330  1.00 11.38 ? 242 HIS A N   1 
ATOM   1914  C CA  . HIS A 1 242 ? 26.442  36.569  81.824  1.00 11.18 ? 242 HIS A CA  1 
ATOM   1915  C C   . HIS A 1 242 ? 25.274  35.594  81.802  1.00 11.28 ? 242 HIS A C   1 
ATOM   1916  O O   . HIS A 1 242 ? 25.465  34.409  82.105  1.00 10.98 ? 242 HIS A O   1 
ATOM   1917  C CB  . HIS A 1 242 ? 27.036  36.662  83.224  1.00 10.32 ? 242 HIS A CB  1 
ATOM   1918  C CG  . HIS A 1 242 ? 28.427  37.210  83.211  1.00 11.96 ? 242 HIS A CG  1 
ATOM   1919  N ND1 . HIS A 1 242 ? 29.534  36.414  82.990  1.00 11.35 ? 242 HIS A ND1 1 
ATOM   1920  C CD2 . HIS A 1 242 ? 28.883  38.489  83.271  1.00 11.99 ? 242 HIS A CD2 1 
ATOM   1921  C CE1 . HIS A 1 242 ? 30.617  37.177  82.970  1.00 14.02 ? 242 HIS A CE1 1 
ATOM   1922  N NE2 . HIS A 1 242 ? 30.249  38.439  83.137  1.00 13.85 ? 242 HIS A NE2 1 
ATOM   1923  N N   . PHE A 1 243 ? 24.101  36.087  81.423  1.00 10.61 ? 243 PHE A N   1 
ATOM   1924  C CA  . PHE A 1 243 ? 22.881  35.286  81.359  1.00 10.75 ? 243 PHE A CA  1 
ATOM   1925  C C   . PHE A 1 243 ? 22.112  35.539  80.063  1.00 10.62 ? 243 PHE A C   1 
ATOM   1926  O O   . PHE A 1 243 ? 21.914  36.693  79.639  1.00 10.67 ? 243 PHE A O   1 
ATOM   1927  C CB  . PHE A 1 243 ? 21.966  35.603  82.557  1.00 10.41 ? 243 PHE A CB  1 
ATOM   1928  C CG  . PHE A 1 243 ? 22.504  35.136  83.868  1.00 11.01 ? 243 PHE A CG  1 
ATOM   1929  C CD1 . PHE A 1 243 ? 23.527  35.834  84.505  1.00 11.19 ? 243 PHE A CD1 1 
ATOM   1930  C CD2 . PHE A 1 243 ? 21.986  34.008  84.491  1.00 11.67 ? 243 PHE A CD2 1 
ATOM   1931  C CE1 . PHE A 1 243 ? 24.025  35.408  85.699  1.00 10.03 ? 243 PHE A CE1 1 
ATOM   1932  C CE2 . PHE A 1 243 ? 22.485  33.586  85.690  1.00 10.45 ? 243 PHE A CE2 1 
ATOM   1933  C CZ  . PHE A 1 243 ? 23.511  34.287  86.301  1.00 11.27 ? 243 PHE A CZ  1 
ATOM   1934  N N   . VAL A 1 244 ? 21.710  34.462  79.409  1.00 10.43 ? 244 VAL A N   1 
ATOM   1935  C CA  . VAL A 1 244 ? 20.829  34.544  78.249  1.00 10.77 ? 244 VAL A CA  1 
ATOM   1936  C C   . VAL A 1 244 ? 19.701  33.558  78.460  1.00 11.36 ? 244 VAL A C   1 
ATOM   1937  O O   . VAL A 1 244 ? 19.776  32.686  79.343  1.00 11.65 ? 244 VAL A O   1 
ATOM   1938  C CB  . VAL A 1 244 ? 21.537  34.270  76.921  1.00 10.82 ? 244 VAL A CB  1 
ATOM   1939  C CG1 . VAL A 1 244 ? 22.688  35.290  76.703  1.00 11.95 ? 244 VAL A CG1 1 
ATOM   1940  C CG2 . VAL A 1 244 ? 22.051  32.841  76.865  1.00 10.88 ? 244 VAL A CG2 1 
ATOM   1941  N N   . ALA A 1 245 ? 18.668  33.672  77.631  1.00 11.06 ? 245 ALA A N   1 
ATOM   1942  C CA  . ALA A 1 245 ? 17.473  32.875  77.805  1.00 11.19 ? 245 ALA A CA  1 
ATOM   1943  C C   . ALA A 1 245 ? 17.035  32.121  76.554  1.00 11.11 ? 245 ALA A C   1 
ATOM   1944  O O   . ALA A 1 245 ? 17.111  32.648  75.440  1.00 11.27 ? 245 ALA A O   1 
ATOM   1945  C CB  . ALA A 1 245 ? 16.347  33.756  78.259  1.00 11.13 ? 245 ALA A CB  1 
ATOM   1946  N N   . LEU A 1 246 ? 16.583  30.884  76.749  1.00 10.95 ? 246 LEU A N   1 
ATOM   1947  C CA  . LEU A 1 246 ? 15.897  30.133  75.678  1.00 11.68 ? 246 LEU A CA  1 
ATOM   1948  C C   . LEU A 1 246 ? 14.422  30.108  76.090  1.00 12.01 ? 246 LEU A C   1 
ATOM   1949  O O   . LEU A 1 246 ? 14.005  29.298  76.919  1.00 11.77 ? 246 LEU A O   1 
ATOM   1950  C CB  . LEU A 1 246 ? 16.472  28.726  75.490  1.00 12.02 ? 246 LEU A CB  1 
ATOM   1951  C CG  . LEU A 1 246 ? 17.999  28.626  75.605  1.00 11.45 ? 246 LEU A CG  1 
ATOM   1952  C CD1 . LEU A 1 246 ? 18.467  27.188  75.545  1.00 10.44 ? 246 LEU A CD1 1 
ATOM   1953  C CD2 . LEU A 1 246 ? 18.724  29.446  74.528  1.00 10.92 ? 246 LEU A CD2 1 
ATOM   1954  N N   . SER A 1 247 ? 13.642  31.039  75.542  1.00 12.16 ? 247 SER A N   1 
ATOM   1955  C CA  . SER A 1 247 ? 12.278  31.289  76.013  1.00 12.41 ? 247 SER A CA  1 
ATOM   1956  C C   . SER A 1 247 ? 11.507  32.164  75.032  1.00 12.94 ? 247 SER A C   1 
ATOM   1957  O O   . SER A 1 247 ? 12.082  32.693  74.069  1.00 13.08 ? 247 SER A O   1 
ATOM   1958  C CB  . SER A 1 247 ? 12.382  32.064  77.333  1.00 12.48 ? 247 SER A CB  1 
ATOM   1959  O OG  . SER A 1 247 ? 11.170  32.167  78.037  1.00 10.82 ? 247 SER A OG  1 
ATOM   1960  N N   . THR A 1 248 ? 10.214  32.340  75.293  1.00 13.15 ? 248 THR A N   1 
ATOM   1961  C CA  . THR A 1 248 ? 9.432   33.323  74.565  1.00 13.69 ? 248 THR A CA  1 
ATOM   1962  C C   . THR A 1 248 ? 8.862   34.379  75.508  1.00 14.19 ? 248 THR A C   1 
ATOM   1963  O O   . THR A 1 248 ? 8.197   35.309  75.043  1.00 14.08 ? 248 THR A O   1 
ATOM   1964  C CB  . THR A 1 248 ? 8.276   32.666  73.782  1.00 13.33 ? 248 THR A CB  1 
ATOM   1965  O OG1 . THR A 1 248 ? 7.453   31.904  74.677  1.00 12.61 ? 248 THR A OG1 1 
ATOM   1966  C CG2 . THR A 1 248 ? 8.798   31.659  72.749  1.00 13.64 ? 248 THR A CG2 1 
ATOM   1967  N N   . ASN A 1 249 ? 9.109   34.270  76.822  1.00 14.47 ? 249 ASN A N   1 
ATOM   1968  C CA  . ASN A 1 249 ? 8.498   35.215  77.757  1.00 14.95 ? 249 ASN A CA  1 
ATOM   1969  C C   . ASN A 1 249 ? 9.367   36.456  77.934  1.00 15.12 ? 249 ASN A C   1 
ATOM   1970  O O   . ASN A 1 249 ? 10.127  36.581  78.900  1.00 14.42 ? 249 ASN A O   1 
ATOM   1971  C CB  . ASN A 1 249 ? 8.190   34.553  79.102  1.00 15.19 ? 249 ASN A CB  1 
ATOM   1972  C CG  . ASN A 1 249 ? 7.255   35.392  79.962  1.00 16.51 ? 249 ASN A CG  1 
ATOM   1973  O OD1 . ASN A 1 249 ? 7.247   36.614  79.849  1.00 18.45 ? 249 ASN A OD1 1 
ATOM   1974  N ND2 . ASN A 1 249 ? 6.468   34.733  80.838  1.00 15.74 ? 249 ASN A ND2 1 
ATOM   1975  N N   . THR A 1 250 ? 9.264   37.364  76.971  1.00 14.89 ? 250 THR A N   1 
ATOM   1976  C CA  . THR A 1 250 ? 10.099  38.559  76.981  1.00 15.35 ? 250 THR A CA  1 
ATOM   1977  C C   . THR A 1 250 ? 10.019  39.289  78.307  1.00 15.06 ? 250 THR A C   1 
ATOM   1978  O O   . THR A 1 250 ? 11.030  39.758  78.828  1.00 15.96 ? 250 THR A O   1 
ATOM   1979  C CB  . THR A 1 250 ? 9.665   39.517  75.882  1.00 15.00 ? 250 THR A CB  1 
ATOM   1980  O OG1 . THR A 1 250 ? 9.527   38.808  74.659  1.00 15.20 ? 250 THR A OG1 1 
ATOM   1981  C CG2 . THR A 1 250 ? 10.739  40.561  75.595  1.00 16.71 ? 250 THR A CG2 1 
ATOM   1982  N N   . THR A 1 251 ? 8.813   39.431  78.832  1.00 15.86 ? 251 THR A N   1 
ATOM   1983  C CA  . THR A 1 251 ? 8.616   40.200  80.048  1.00 16.51 ? 251 THR A CA  1 
ATOM   1984  C C   . THR A 1 251 ? 9.409   39.626  81.215  1.00 16.57 ? 251 THR A C   1 
ATOM   1985  O O   . THR A 1 251 ? 10.111  40.354  81.897  1.00 16.84 ? 251 THR A O   1 
ATOM   1986  C CB  . THR A 1 251 ? 7.112   40.258  80.398  1.00 16.95 ? 251 THR A CB  1 
ATOM   1987  O OG1 . THR A 1 251 ? 6.422   41.073  79.433  1.00 18.30 ? 251 THR A OG1 1 
ATOM   1988  C CG2 . THR A 1 251 ? 6.888   40.950  81.724  1.00 17.89 ? 251 THR A CG2 1 
ATOM   1989  N N   . LYS A 1 252 ? 9.304   38.317  81.443  1.00 16.44 ? 252 LYS A N   1 
ATOM   1990  C CA  . LYS A 1 252 ? 10.000  37.677  82.573  1.00 16.78 ? 252 LYS A CA  1 
ATOM   1991  C C   . LYS A 1 252 ? 11.511  37.637  82.358  1.00 15.83 ? 252 LYS A C   1 
ATOM   1992  O O   . LYS A 1 252 ? 12.281  37.687  83.305  1.00 16.00 ? 252 LYS A O   1 
ATOM   1993  C CB  . LYS A 1 252 ? 9.483   36.243  82.778  1.00 16.85 ? 252 LYS A CB  1 
ATOM   1994  C CG  . LYS A 1 252 ? 8.106   36.168  83.415  1.00 20.18 ? 252 LYS A CG  1 
ATOM   1995  C CD  . LYS A 1 252 ? 8.222   36.364  84.937  1.00 24.23 ? 252 LYS A CD  1 
ATOM   1996  C CE  . LYS A 1 252 ? 6.899   36.706  85.576  1.00 26.29 ? 252 LYS A CE  1 
ATOM   1997  N NZ  . LYS A 1 252 ? 5.857   35.750  85.186  1.00 27.90 ? 252 LYS A NZ  1 
ATOM   1998  N N   . VAL A 1 253 ? 11.925  37.546  81.105  1.00 15.62 ? 253 VAL A N   1 
ATOM   1999  C CA  . VAL A 1 253 ? 13.339  37.481  80.783  1.00 15.37 ? 253 VAL A CA  1 
ATOM   2000  C C   . VAL A 1 253 ? 13.976  38.827  81.117  1.00 15.92 ? 253 VAL A C   1 
ATOM   2001  O O   . VAL A 1 253 ? 15.029  38.892  81.771  1.00 14.48 ? 253 VAL A O   1 
ATOM   2002  C CB  . VAL A 1 253 ? 13.537  37.066  79.324  1.00 15.86 ? 253 VAL A CB  1 
ATOM   2003  C CG1 . VAL A 1 253 ? 14.951  37.327  78.858  1.00 15.84 ? 253 VAL A CG1 1 
ATOM   2004  C CG2 . VAL A 1 253 ? 13.149  35.573  79.144  1.00 15.00 ? 253 VAL A CG2 1 
ATOM   2005  N N   . LYS A 1 254 ? 13.309  39.902  80.709  1.00 15.91 ? 254 LYS A N   1 
ATOM   2006  C CA  . LYS A 1 254 ? 13.788  41.250  81.016  1.00 16.66 ? 254 LYS A CA  1 
ATOM   2007  C C   . LYS A 1 254 ? 13.829  41.480  82.515  1.00 15.93 ? 254 LYS A C   1 
ATOM   2008  O O   . LYS A 1 254 ? 14.783  42.056  83.046  1.00 15.95 ? 254 LYS A O   1 
ATOM   2009  C CB  . LYS A 1 254 ? 12.872  42.297  80.373  1.00 16.88 ? 254 LYS A CB  1 
ATOM   2010  C CG  . LYS A 1 254 ? 12.991  42.347  78.898  1.00 21.29 ? 254 LYS A CG  1 
ATOM   2011  C CD  . LYS A 1 254 ? 11.759  42.964  78.238  1.00 25.54 ? 254 LYS A CD  1 
ATOM   2012  C CE  . LYS A 1 254 ? 11.907  44.453  78.026  1.00 28.35 ? 254 LYS A CE  1 
ATOM   2013  N NZ  . LYS A 1 254 ? 11.201  44.848  76.782  1.00 30.41 ? 254 LYS A NZ  1 
ATOM   2014  N N   . GLU A 1 255 ? 12.787  41.042  83.210  1.00 16.12 ? 255 GLU A N   1 
ATOM   2015  C CA  . GLU A 1 255 ? 12.716  41.239  84.656  1.00 16.92 ? 255 GLU A CA  1 
ATOM   2016  C C   . GLU A 1 255 ? 13.868  40.529  85.385  1.00 16.36 ? 255 GLU A C   1 
ATOM   2017  O O   . GLU A 1 255 ? 14.386  41.017  86.405  1.00 15.77 ? 255 GLU A O   1 
ATOM   2018  C CB  . GLU A 1 255 ? 11.350  40.786  85.178  1.00 17.69 ? 255 GLU A CB  1 
ATOM   2019  C CG  . GLU A 1 255 ? 10.237  41.676  84.623  1.00 20.93 ? 255 GLU A CG  1 
ATOM   2020  C CD  . GLU A 1 255 ? 8.851   41.343  85.132  1.00 23.37 ? 255 GLU A CD  1 
ATOM   2021  O OE1 . GLU A 1 255 ? 8.646   40.247  85.705  1.00 25.80 ? 255 GLU A OE1 1 
ATOM   2022  O OE2 . GLU A 1 255 ? 7.968   42.211  84.955  1.00 25.80 ? 255 GLU A OE2 1 
ATOM   2023  N N   . PHE A 1 256 ? 14.267  39.380  84.844  1.00 15.57 ? 256 PHE A N   1 
ATOM   2024  C CA  . PHE A 1 256 ? 15.355  38.601  85.417  1.00 15.16 ? 256 PHE A CA  1 
ATOM   2025  C C   . PHE A 1 256 ? 16.669  39.366  85.312  1.00 14.77 ? 256 PHE A C   1 
ATOM   2026  O O   . PHE A 1 256 ? 17.549  39.197  86.149  1.00 14.67 ? 256 PHE A O   1 
ATOM   2027  C CB  . PHE A 1 256 ? 15.463  37.245  84.699  1.00 15.31 ? 256 PHE A CB  1 
ATOM   2028  C CG  . PHE A 1 256 ? 16.479  36.317  85.305  1.00 14.79 ? 256 PHE A CG  1 
ATOM   2029  C CD1 . PHE A 1 256 ? 16.111  35.403  86.274  1.00 15.45 ? 256 PHE A CD1 1 
ATOM   2030  C CD2 . PHE A 1 256 ? 17.807  36.371  84.908  1.00 14.76 ? 256 PHE A CD2 1 
ATOM   2031  C CE1 . PHE A 1 256 ? 17.045  34.563  86.839  1.00 14.98 ? 256 PHE A CE1 1 
ATOM   2032  C CE2 . PHE A 1 256 ? 18.746  35.516  85.449  1.00 14.57 ? 256 PHE A CE2 1 
ATOM   2033  C CZ  . PHE A 1 256 ? 18.368  34.615  86.431  1.00 14.43 ? 256 PHE A CZ  1 
ATOM   2034  N N   . GLY A 1 257 ? 16.789  40.227  84.300  1.00 14.79 ? 257 GLY A N   1 
ATOM   2035  C CA  . GLY A 1 257 ? 18.008  41.011  84.080  1.00 14.68 ? 257 GLY A CA  1 
ATOM   2036  C C   . GLY A 1 257 ? 18.742  40.666  82.794  1.00 14.87 ? 257 GLY A C   1 
ATOM   2037  O O   . GLY A 1 257 ? 19.879  41.121  82.554  1.00 13.61 ? 257 GLY A O   1 
ATOM   2038  N N   . ILE A 1 258 ? 18.100  39.827  81.975  1.00 15.05 ? 258 ILE A N   1 
ATOM   2039  C CA  . ILE A 1 258 ? 18.622  39.417  80.687  1.00 15.05 ? 258 ILE A CA  1 
ATOM   2040  C C   . ILE A 1 258 ? 18.168  40.403  79.622  1.00 16.02 ? 258 ILE A C   1 
ATOM   2041  O O   . ILE A 1 258 ? 17.017  40.873  79.650  1.00 16.65 ? 258 ILE A O   1 
ATOM   2042  C CB  . ILE A 1 258 ? 18.107  38.012  80.334  1.00 14.70 ? 258 ILE A CB  1 
ATOM   2043  C CG1 . ILE A 1 258 ? 18.731  36.982  81.282  1.00 14.59 ? 258 ILE A CG1 1 
ATOM   2044  C CG2 . ILE A 1 258 ? 18.417  37.682  78.899  1.00 14.15 ? 258 ILE A CG2 1 
ATOM   2045  C CD1 . ILE A 1 258 ? 18.013  35.647  81.306  1.00 14.08 ? 258 ILE A CD1 1 
ATOM   2046  N N   . ASP A 1 259 ? 19.076  40.709  78.700  1.00 16.85 ? 259 ASP A N   1 
ATOM   2047  C CA  . ASP A 1 259 ? 18.798  41.589  77.568  1.00 17.99 ? 259 ASP A CA  1 
ATOM   2048  C C   . ASP A 1 259 ? 17.930  40.806  76.612  1.00 18.90 ? 259 ASP A C   1 
ATOM   2049  O O   . ASP A 1 259 ? 18.318  39.723  76.165  1.00 18.85 ? 259 ASP A O   1 
ATOM   2050  C CB  . ASP A 1 259 ? 20.102  41.992  76.883  1.00 17.60 ? 259 ASP A CB  1 
ATOM   2051  C CG  . ASP A 1 259 ? 19.887  42.902  75.695  1.00 19.93 ? 259 ASP A CG  1 
ATOM   2052  O OD1 . ASP A 1 259 ? 20.848  43.631  75.349  1.00 21.62 ? 259 ASP A OD1 1 
ATOM   2053  O OD2 . ASP A 1 259 ? 18.819  42.933  75.039  1.00 19.84 ? 259 ASP A OD2 1 
ATOM   2054  N N   . PRO A 1 260 ? 16.751  41.339  76.303  1.00 20.07 ? 260 PRO A N   1 
ATOM   2055  C CA  . PRO A 1 260 ? 15.808  40.655  75.413  1.00 20.27 ? 260 PRO A CA  1 
ATOM   2056  C C   . PRO A 1 260 ? 16.372  40.295  74.043  1.00 20.32 ? 260 PRO A C   1 
ATOM   2057  O O   . PRO A 1 260 ? 15.846  39.361  73.435  1.00 20.42 ? 260 PRO A O   1 
ATOM   2058  C CB  . PRO A 1 260 ? 14.648  41.647  75.312  1.00 21.02 ? 260 PRO A CB  1 
ATOM   2059  C CG  . PRO A 1 260 ? 15.242  42.954  75.707  1.00 21.23 ? 260 PRO A CG  1 
ATOM   2060  C CD  . PRO A 1 260 ? 16.199  42.610  76.808  1.00 20.54 ? 260 PRO A CD  1 
ATOM   2061  N N   . GLN A 1 261 ? 17.430  40.971  73.583  1.00 20.06 ? 261 GLN A N   1 
ATOM   2062  C CA  . GLN A 1 261 ? 18.068  40.624  72.317  1.00 20.33 ? 261 GLN A CA  1 
ATOM   2063  C C   . GLN A 1 261 ? 18.668  39.220  72.418  1.00 19.30 ? 261 GLN A C   1 
ATOM   2064  O O   . GLN A 1 261 ? 18.915  38.565  71.403  1.00 19.24 ? 261 GLN A O   1 
ATOM   2065  C CB  . GLN A 1 261 ? 19.200  41.607  71.965  1.00 21.12 ? 261 GLN A CB  1 
ATOM   2066  C CG  . GLN A 1 261 ? 18.804  43.093  71.874  1.00 25.16 ? 261 GLN A CG  1 
ATOM   2067  C CD  . GLN A 1 261 ? 19.998  44.030  71.580  1.00 30.20 ? 261 GLN A CD  1 
ATOM   2068  O OE1 . GLN A 1 261 ? 19.909  44.902  70.701  1.00 34.16 ? 261 GLN A OE1 1 
ATOM   2069  N NE2 . GLN A 1 261 ? 21.094  43.869  72.331  1.00 33.10 ? 261 GLN A NE2 1 
ATOM   2070  N N   . ASN A 1 262 ? 18.930  38.777  73.646  1.00 17.66 ? 262 ASN A N   1 
ATOM   2071  C CA  . ASN A 1 262 ? 19.517  37.471  73.872  1.00 16.81 ? 262 ASN A CA  1 
ATOM   2072  C C   . ASN A 1 262 ? 18.480  36.463  74.394  1.00 16.11 ? 262 ASN A C   1 
ATOM   2073  O O   . ASN A 1 262 ? 18.742  35.654  75.291  1.00 15.79 ? 262 ASN A O   1 
ATOM   2074  C CB  . ASN A 1 262 ? 20.702  37.604  74.815  1.00 17.01 ? 262 ASN A CB  1 
ATOM   2075  C CG  . ASN A 1 262 ? 21.725  38.620  74.315  1.00 16.77 ? 262 ASN A CG  1 
ATOM   2076  O OD1 . ASN A 1 262 ? 22.094  38.619  73.133  1.00 16.57 ? 262 ASN A OD1 1 
ATOM   2077  N ND2 . ASN A 1 262 ? 22.170  39.490  75.203  1.00 16.70 ? 262 ASN A ND2 1 
ATOM   2078  N N   . MET A 1 263 ? 17.279  36.561  73.843  1.00 15.06 ? 263 MET A N   1 
ATOM   2079  C CA  . MET A 1 263 ? 16.227  35.600  74.108  1.00 14.49 ? 263 MET A CA  1 
ATOM   2080  C C   . MET A 1 263 ? 16.033  34.829  72.812  1.00 14.26 ? 263 MET A C   1 
ATOM   2081  O O   . MET A 1 263 ? 15.661  35.418  71.788  1.00 13.46 ? 263 MET A O   1 
ATOM   2082  C CB  . MET A 1 263 ? 14.921  36.262  74.496  1.00 14.59 ? 263 MET A CB  1 
ATOM   2083  C CG  . MET A 1 263 ? 13.893  35.239  75.014  1.00 15.18 ? 263 MET A CG  1 
ATOM   2084  S SD  . MET A 1 263 ? 12.282  35.924  75.466  1.00 16.32 ? 263 MET A SD  1 
ATOM   2085  C CE  . MET A 1 263 ? 11.616  36.182  73.891  1.00 17.96 ? 263 MET A CE  1 
ATOM   2086  N N   . PHE A 1 264 ? 16.317  33.533  72.870  1.00 13.25 ? 264 PHE A N   1 
ATOM   2087  C CA  . PHE A 1 264 ? 16.252  32.638  71.726  1.00 13.05 ? 264 PHE A CA  1 
ATOM   2088  C C   . PHE A 1 264 ? 14.943  31.845  71.753  1.00 13.16 ? 264 PHE A C   1 
ATOM   2089  O O   . PHE A 1 264 ? 14.729  30.976  72.599  1.00 12.00 ? 264 PHE A O   1 
ATOM   2090  C CB  . PHE A 1 264 ? 17.473  31.723  71.745  1.00 12.77 ? 264 PHE A CB  1 
ATOM   2091  C CG  . PHE A 1 264 ? 18.770  32.472  71.675  1.00 13.35 ? 264 PHE A CG  1 
ATOM   2092  C CD1 . PHE A 1 264 ? 19.351  32.983  72.828  1.00 12.65 ? 264 PHE A CD1 1 
ATOM   2093  C CD2 . PHE A 1 264 ? 19.384  32.714  70.453  1.00 13.45 ? 264 PHE A CD2 1 
ATOM   2094  C CE1 . PHE A 1 264 ? 20.542  33.684  72.774  1.00 14.24 ? 264 PHE A CE1 1 
ATOM   2095  C CE2 . PHE A 1 264 ? 20.578  33.416  70.388  1.00 14.37 ? 264 PHE A CE2 1 
ATOM   2096  C CZ  . PHE A 1 264 ? 21.159  33.904  71.537  1.00 13.47 ? 264 PHE A CZ  1 
ATOM   2097  N N   . GLU A 1 265 ? 14.070  32.163  70.806  1.00 13.37 ? 265 GLU A N   1 
ATOM   2098  C CA  . GLU A 1 265 ? 12.713  31.646  70.810  1.00 13.87 ? 265 GLU A CA  1 
ATOM   2099  C C   . GLU A 1 265 ? 12.544  30.271  70.183  1.00 13.50 ? 265 GLU A C   1 
ATOM   2100  O O   . GLU A 1 265 ? 13.363  29.836  69.397  1.00 12.80 ? 265 GLU A O   1 
ATOM   2101  C CB  . GLU A 1 265 ? 11.806  32.630  70.069  1.00 14.66 ? 265 GLU A CB  1 
ATOM   2102  C CG  . GLU A 1 265 ? 11.879  34.038  70.624  1.00 17.94 ? 265 GLU A CG  1 
ATOM   2103  C CD  . GLU A 1 265 ? 10.749  34.909  70.139  1.00 23.97 ? 265 GLU A CD  1 
ATOM   2104  O OE1 . GLU A 1 265 ? 10.464  34.883  68.928  1.00 27.97 ? 265 GLU A OE1 1 
ATOM   2105  O OE2 . GLU A 1 265 ? 10.141  35.597  70.974  1.00 30.38 ? 265 GLU A OE2 1 
ATOM   2106  N N   . PHE A 1 266 ? 11.458  29.613  70.564  1.00 13.79 ? 266 PHE A N   1 
ATOM   2107  C CA  . PHE A 1 266 ? 11.013  28.370  69.952  1.00 14.25 ? 266 PHE A CA  1 
ATOM   2108  C C   . PHE A 1 266 ? 9.479   28.339  70.103  1.00 14.88 ? 266 PHE A C   1 
ATOM   2109  O O   . PHE A 1 266 ? 8.900   29.293  70.648  1.00 15.52 ? 266 PHE A O   1 
ATOM   2110  C CB  . PHE A 1 266 ? 11.759  27.139  70.487  1.00 13.82 ? 266 PHE A CB  1 
ATOM   2111  C CG  . PHE A 1 266 ? 11.688  26.950  71.986  1.00 13.72 ? 266 PHE A CG  1 
ATOM   2112  C CD1 . PHE A 1 266 ? 10.832  26.008  72.529  1.00 15.69 ? 266 PHE A CD1 1 
ATOM   2113  C CD2 . PHE A 1 266 ? 12.496  27.681  72.842  1.00 14.48 ? 266 PHE A CD2 1 
ATOM   2114  C CE1 . PHE A 1 266 ? 10.780  25.801  73.913  1.00 16.95 ? 266 PHE A CE1 1 
ATOM   2115  C CE2 . PHE A 1 266 ? 12.437  27.491  74.211  1.00 14.75 ? 266 PHE A CE2 1 
ATOM   2116  C CZ  . PHE A 1 266 ? 11.577  26.547  74.751  1.00 14.77 ? 266 PHE A CZ  1 
ATOM   2117  N N   . TRP A 1 267 ? 8.819   27.286  69.624  1.00 14.50 ? 267 TRP A N   1 
ATOM   2118  C CA  . TRP A 1 267 ? 7.353   27.303  69.474  1.00 14.95 ? 267 TRP A CA  1 
ATOM   2119  C C   . TRP A 1 267 ? 6.576   26.170  70.137  1.00 15.17 ? 267 TRP A C   1 
ATOM   2120  O O   . TRP A 1 267 ? 7.154   25.187  70.584  1.00 14.30 ? 267 TRP A O   1 
ATOM   2121  C CB  . TRP A 1 267 ? 7.040   27.364  67.984  1.00 15.06 ? 267 TRP A CB  1 
ATOM   2122  C CG  . TRP A 1 267 ? 7.808   28.481  67.377  1.00 15.84 ? 267 TRP A CG  1 
ATOM   2123  C CD1 . TRP A 1 267 ? 7.416   29.773  67.289  1.00 18.63 ? 267 TRP A CD1 1 
ATOM   2124  C CD2 . TRP A 1 267 ? 9.137   28.425  66.846  1.00 17.38 ? 267 TRP A CD2 1 
ATOM   2125  N NE1 . TRP A 1 267 ? 8.404   30.542  66.716  1.00 18.30 ? 267 TRP A NE1 1 
ATOM   2126  C CE2 . TRP A 1 267 ? 9.477   29.737  66.431  1.00 18.05 ? 267 TRP A CE2 1 
ATOM   2127  C CE3 . TRP A 1 267 ? 10.075  27.398  66.666  1.00 16.79 ? 267 TRP A CE3 1 
ATOM   2128  C CZ2 . TRP A 1 267 ? 10.710  30.042  65.844  1.00 18.05 ? 267 TRP A CZ2 1 
ATOM   2129  C CZ3 . TRP A 1 267 ? 11.298  27.702  66.084  1.00 16.55 ? 267 TRP A CZ3 1 
ATOM   2130  C CH2 . TRP A 1 267 ? 11.614  29.016  65.695  1.00 17.01 ? 267 TRP A CH2 1 
ATOM   2131  N N   . ASP A 1 268 ? 5.252   26.320  70.219  1.00 15.72 ? 268 ASP A N   1 
ATOM   2132  C CA  . ASP A 1 268 ? 4.451   25.317  70.920  1.00 16.17 ? 268 ASP A CA  1 
ATOM   2133  C C   . ASP A 1 268 ? 4.419   23.978  70.204  1.00 15.05 ? 268 ASP A C   1 
ATOM   2134  O O   . ASP A 1 268 ? 4.068   22.964  70.814  1.00 15.54 ? 268 ASP A O   1 
ATOM   2135  C CB  . ASP A 1 268 ? 3.051   25.835  71.309  1.00 16.83 ? 268 ASP A CB  1 
ATOM   2136  C CG  . ASP A 1 268 ? 2.067   25.894  70.146  1.00 20.56 ? 268 ASP A CG  1 
ATOM   2137  O OD1 . ASP A 1 268 ? 2.436   25.691  68.966  1.00 23.22 ? 268 ASP A OD1 1 
ATOM   2138  O OD2 . ASP A 1 268 ? 0.858   26.165  70.343  1.00 27.00 ? 268 ASP A OD2 1 
ATOM   2139  N N   . TRP A 1 269 ? 4.849   23.953  68.946  1.00 13.92 ? 269 TRP A N   1 
ATOM   2140  C CA  . TRP A 1 269 ? 4.929   22.702  68.208  1.00 13.00 ? 269 TRP A CA  1 
ATOM   2141  C C   . TRP A 1 269 ? 6.303   22.019  68.364  1.00 12.26 ? 269 TRP A C   1 
ATOM   2142  O O   . TRP A 1 269 ? 6.579   21.022  67.702  1.00 11.06 ? 269 TRP A O   1 
ATOM   2143  C CB  . TRP A 1 269 ? 4.537   22.860  66.724  1.00 13.01 ? 269 TRP A CB  1 
ATOM   2144  C CG  . TRP A 1 269 ? 4.966   24.134  66.046  1.00 14.23 ? 269 TRP A CG  1 
ATOM   2145  C CD1 . TRP A 1 269 ? 4.179   25.227  65.757  1.00 17.17 ? 269 TRP A CD1 1 
ATOM   2146  C CD2 . TRP A 1 269 ? 6.271   24.450  65.550  1.00 14.52 ? 269 TRP A CD2 1 
ATOM   2147  N NE1 . TRP A 1 269 ? 4.920   26.195  65.118  1.00 14.12 ? 269 TRP A NE1 1 
ATOM   2148  C CE2 . TRP A 1 269 ? 6.206   25.743  64.977  1.00 15.37 ? 269 TRP A CE2 1 
ATOM   2149  C CE3 . TRP A 1 269 ? 7.490   23.770  65.524  1.00 14.53 ? 269 TRP A CE3 1 
ATOM   2150  C CZ2 . TRP A 1 269 ? 7.310   26.362  64.414  1.00 14.52 ? 269 TRP A CZ2 1 
ATOM   2151  C CZ3 . TRP A 1 269 ? 8.585   24.381  64.948  1.00 14.72 ? 269 TRP A CZ3 1 
ATOM   2152  C CH2 . TRP A 1 269 ? 8.488   25.658  64.392  1.00 15.33 ? 269 TRP A CH2 1 
ATOM   2153  N N   . VAL A 1 270 ? 7.143   22.558  69.249  1.00 11.93 ? 270 VAL A N   1 
ATOM   2154  C CA  . VAL A 1 270 ? 8.417   21.949  69.595  1.00 11.30 ? 270 VAL A CA  1 
ATOM   2155  C C   . VAL A 1 270 ? 8.219   21.315  70.971  1.00 11.15 ? 270 VAL A C   1 
ATOM   2156  O O   . VAL A 1 270 ? 8.129   22.018  71.971  1.00 10.53 ? 270 VAL A O   1 
ATOM   2157  C CB  . VAL A 1 270 ? 9.568   22.978  69.720  1.00 12.47 ? 270 VAL A CB  1 
ATOM   2158  C CG1 . VAL A 1 270 ? 10.840  22.275  70.173  1.00 13.31 ? 270 VAL A CG1 1 
ATOM   2159  C CG2 . VAL A 1 270 ? 9.799   23.733  68.391  1.00 11.67 ? 270 VAL A CG2 1 
ATOM   2160  N N   . GLY A 1 271 ? 8.105   20.000  71.027  1.00 10.29 ? 271 GLY A N   1 
ATOM   2161  C CA  . GLY A 1 271 ? 7.997   19.323  72.308  1.00 10.51 ? 271 GLY A CA  1 
ATOM   2162  C C   . GLY A 1 271 ? 9.352   19.344  72.981  1.00 10.03 ? 271 GLY A C   1 
ATOM   2163  O O   . GLY A 1 271 ? 10.390  19.224  72.322  1.00 9.23  ? 271 GLY A O   1 
ATOM   2164  N N   . GLY A 1 272 ? 9.351   19.464  74.293  1.00 10.31 ? 272 GLY A N   1 
ATOM   2165  C CA  . GLY A 1 272 ? 10.593  19.528  75.033  1.00 11.30 ? 272 GLY A CA  1 
ATOM   2166  C C   . GLY A 1 272 ? 11.491  18.335  74.739  1.00 10.98 ? 272 GLY A C   1 
ATOM   2167  O O   . GLY A 1 272 ? 12.701  18.458  74.559  1.00 11.58 ? 272 GLY A O   1 
ATOM   2168  N N   . ARG A 1 273 ? 10.886  17.165  74.669  1.00 11.04 ? 273 ARG A N   1 
ATOM   2169  C CA  . ARG A 1 273 ? 11.664  15.955  74.445  1.00 10.65 ? 273 ARG A CA  1 
ATOM   2170  C C   . ARG A 1 273 ? 12.048  15.762  72.970  1.00 10.16 ? 273 ARG A C   1 
ATOM   2171  O O   . ARG A 1 273 ? 12.634  14.743  72.611  1.00 9.72  ? 273 ARG A O   1 
ATOM   2172  C CB  . ARG A 1 273 ? 10.962  14.745  75.043  1.00 11.18 ? 273 ARG A CB  1 
ATOM   2173  C CG  . ARG A 1 273 ? 9.620   14.404  74.451  1.00 12.75 ? 273 ARG A CG  1 
ATOM   2174  C CD  . ARG A 1 273 ? 8.826   13.402  75.265  1.00 13.65 ? 273 ARG A CD  1 
ATOM   2175  N NE  . ARG A 1 273 ? 7.464   13.305  74.753  1.00 11.13 ? 273 ARG A NE  1 
ATOM   2176  C CZ  . ARG A 1 273 ? 6.424   13.940  75.267  1.00 11.14 ? 273 ARG A CZ  1 
ATOM   2177  N NH1 . ARG A 1 273 ? 6.564   14.711  76.347  1.00 12.06 ? 273 ARG A NH1 1 
ATOM   2178  N NH2 . ARG A 1 273 ? 5.233   13.801  74.690  1.00 11.28 ? 273 ARG A NH2 1 
ATOM   2179  N N   . TYR A 1 274 ? 11.726  16.768  72.148  1.00 9.77  ? 274 TYR A N   1 
ATOM   2180  C CA  . TYR A 1 274 ? 12.056  16.836  70.723  1.00 10.05 ? 274 TYR A CA  1 
ATOM   2181  C C   . TYR A 1 274 ? 12.681  18.215  70.403  1.00 10.14 ? 274 TYR A C   1 
ATOM   2182  O O   . TYR A 1 274 ? 12.660  18.684  69.244  1.00 10.32 ? 274 TYR A O   1 
ATOM   2183  C CB  . TYR A 1 274 ? 10.775  16.689  69.884  1.00 9.55  ? 274 TYR A CB  1 
ATOM   2184  C CG  . TYR A 1 274 ? 10.100  15.352  70.062  1.00 10.75 ? 274 TYR A CG  1 
ATOM   2185  C CD1 . TYR A 1 274 ? 8.963   15.214  70.861  1.00 11.66 ? 274 TYR A CD1 1 
ATOM   2186  C CD2 . TYR A 1 274 ? 10.618  14.222  69.465  1.00 9.04  ? 274 TYR A CD2 1 
ATOM   2187  C CE1 . TYR A 1 274 ? 8.353   13.962  71.023  1.00 11.06 ? 274 TYR A CE1 1 
ATOM   2188  C CE2 . TYR A 1 274 ? 10.017  12.987  69.606  1.00 11.16 ? 274 TYR A CE2 1 
ATOM   2189  C CZ  . TYR A 1 274 ? 8.887   12.858  70.384  1.00 11.11 ? 274 TYR A CZ  1 
ATOM   2190  O OH  . TYR A 1 274 ? 8.307   11.602  70.527  1.00 10.82 ? 274 TYR A OH  1 
ATOM   2191  N N   . SER A 1 275 ? 13.253  18.854  71.414  1.00 9.67  ? 275 SER A N   1 
ATOM   2192  C CA  . SER A 1 275 ? 13.659  20.243  71.278  1.00 9.37  ? 275 SER A CA  1 
ATOM   2193  C C   . SER A 1 275 ? 15.138  20.552  71.042  1.00 9.69  ? 275 SER A C   1 
ATOM   2194  O O   . SER A 1 275 ? 15.453  21.702  70.770  1.00 9.53  ? 275 SER A O   1 
ATOM   2195  C CB  . SER A 1 275 ? 13.172  21.029  72.511  1.00 9.39  ? 275 SER A CB  1 
ATOM   2196  O OG  . SER A 1 275 ? 13.983  20.802  73.639  1.00 9.41  ? 275 SER A OG  1 
ATOM   2197  N N   . LEU A 1 276 ? 16.043  19.571  71.111  1.00 9.77  ? 276 LEU A N   1 
ATOM   2198  C CA  . LEU A 1 276 ? 17.466  19.897  70.992  1.00 9.86  ? 276 LEU A CA  1 
ATOM   2199  C C   . LEU A 1 276 ? 17.788  20.529  69.646  1.00 9.56  ? 276 LEU A C   1 
ATOM   2200  O O   . LEU A 1 276 ? 18.815  21.172  69.504  1.00 8.87  ? 276 LEU A O   1 
ATOM   2201  C CB  . LEU A 1 276 ? 18.364  18.680  71.210  1.00 9.59  ? 276 LEU A CB  1 
ATOM   2202  C CG  . LEU A 1 276 ? 18.292  17.518  70.220  1.00 9.42  ? 276 LEU A CG  1 
ATOM   2203  C CD1 . LEU A 1 276 ? 19.193  17.758  69.022  1.00 8.48  ? 276 LEU A CD1 1 
ATOM   2204  C CD2 . LEU A 1 276 ? 18.721  16.258  70.941  1.00 10.20 ? 276 LEU A CD2 1 
ATOM   2205  N N   . TRP A 1 277 ? 16.896  20.330  68.676  1.00 9.89  ? 277 TRP A N   1 
ATOM   2206  C CA  . TRP A 1 277 ? 17.074  20.848  67.323  1.00 9.87  ? 277 TRP A CA  1 
ATOM   2207  C C   . TRP A 1 277 ? 16.738  22.323  67.221  1.00 10.42 ? 277 TRP A C   1 
ATOM   2208  O O   . TRP A 1 277 ? 17.027  22.935  66.202  1.00 11.15 ? 277 TRP A O   1 
ATOM   2209  C CB  . TRP A 1 277 ? 16.180  20.102  66.333  1.00 9.78  ? 277 TRP A CB  1 
ATOM   2210  C CG  . TRP A 1 277 ? 16.113  18.635  66.573  1.00 9.34  ? 277 TRP A CG  1 
ATOM   2211  C CD1 . TRP A 1 277 ? 15.129  17.962  67.226  1.00 7.94  ? 277 TRP A CD1 1 
ATOM   2212  C CD2 . TRP A 1 277 ? 17.076  17.665  66.180  1.00 7.55  ? 277 TRP A CD2 1 
ATOM   2213  N NE1 . TRP A 1 277 ? 15.412  16.613  67.257  1.00 8.19  ? 277 TRP A NE1 1 
ATOM   2214  C CE2 . TRP A 1 277 ? 16.607  16.404  66.619  1.00 7.91  ? 277 TRP A CE2 1 
ATOM   2215  C CE3 . TRP A 1 277 ? 18.288  17.717  65.487  1.00 9.55  ? 277 TRP A CE3 1 
ATOM   2216  C CZ2 . TRP A 1 277 ? 17.309  15.217  66.394  1.00 8.72  ? 277 TRP A CZ2 1 
ATOM   2217  C CZ3 . TRP A 1 277 ? 18.989  16.528  65.264  1.00 8.43  ? 277 TRP A CZ3 1 
ATOM   2218  C CH2 . TRP A 1 277 ? 18.496  15.305  65.728  1.00 10.12 ? 277 TRP A CH2 1 
ATOM   2219  N N   . SER A 1 278 ? 16.100  22.871  68.253  1.00 9.96  ? 278 SER A N   1 
ATOM   2220  C CA  . SER A 1 278 ? 15.710  24.281  68.267  1.00 10.22 ? 278 SER A CA  1 
ATOM   2221  C C   . SER A 1 278 ? 16.702  25.122  69.044  1.00 10.01 ? 278 SER A C   1 
ATOM   2222  O O   . SER A 1 278 ? 17.820  24.695  69.281  1.00 10.90 ? 278 SER A O   1 
ATOM   2223  C CB  . SER A 1 278 ? 14.365  24.395  68.957  1.00 10.02 ? 278 SER A CB  1 
ATOM   2224  O OG  . SER A 1 278 ? 14.528  24.175  70.343  1.00 8.34  ? 278 SER A OG  1 
ATOM   2225  N N   . ALA A 1 279 ? 16.278  26.323  69.441  1.00 10.17 ? 279 ALA A N   1 
ATOM   2226  C CA  . ALA A 1 279 ? 17.072  27.189  70.298  1.00 10.23 ? 279 ALA A CA  1 
ATOM   2227  C C   . ALA A 1 279 ? 17.562  26.455  71.540  1.00 10.11 ? 279 ALA A C   1 
ATOM   2228  O O   . ALA A 1 279 ? 18.596  26.812  72.102  1.00 9.41  ? 279 ALA A O   1 
ATOM   2229  C CB  . ALA A 1 279 ? 16.274  28.416  70.702  1.00 11.04 ? 279 ALA A CB  1 
ATOM   2230  N N   . ILE A 1 280 ? 16.805  25.449  71.981  1.00 9.99  ? 280 ILE A N   1 
ATOM   2231  C CA  . ILE A 1 280 ? 17.195  24.657  73.153  1.00 9.93  ? 280 ILE A CA  1 
ATOM   2232  C C   . ILE A 1 280 ? 18.591  24.057  72.978  1.00 9.66  ? 280 ILE A C   1 
ATOM   2233  O O   . ILE A 1 280 ? 19.298  23.805  73.956  1.00 9.95  ? 280 ILE A O   1 
ATOM   2234  C CB  . ILE A 1 280 ? 16.126  23.570  73.458  1.00 9.88  ? 280 ILE A CB  1 
ATOM   2235  C CG1 . ILE A 1 280 ? 14.852  24.201  74.044  1.00 11.50 ? 280 ILE A CG1 1 
ATOM   2236  C CG2 . ILE A 1 280 ? 16.691  22.482  74.381  1.00 10.39 ? 280 ILE A CG2 1 
ATOM   2237  C CD1 . ILE A 1 280 ? 15.001  24.895  75.384  1.00 10.90 ? 280 ILE A CD1 1 
ATOM   2238  N N   . GLY A 1 281 ? 19.003  23.859  71.726  1.00 9.52  ? 281 GLY A N   1 
ATOM   2239  C CA  . GLY A 1 281 ? 20.317  23.336  71.417  1.00 9.32  ? 281 GLY A CA  1 
ATOM   2240  C C   . GLY A 1 281 ? 21.446  24.349  71.435  1.00 9.17  ? 281 GLY A C   1 
ATOM   2241  O O   . GLY A 1 281 ? 22.542  24.022  71.040  1.00 9.48  ? 281 GLY A O   1 
ATOM   2242  N N   . LEU A 1 282 ? 21.194  25.563  71.907  1.00 9.43  ? 282 LEU A N   1 
ATOM   2243  C CA  . LEU A 1 282 ? 22.222  26.600  71.906  1.00 9.54  ? 282 LEU A CA  1 
ATOM   2244  C C   . LEU A 1 282 ? 23.528  26.122  72.523  1.00 9.42  ? 282 LEU A C   1 
ATOM   2245  O O   . LEU A 1 282 ? 24.578  26.384  71.973  1.00 8.42  ? 282 LEU A O   1 
ATOM   2246  C CB  . LEU A 1 282 ? 21.744  27.872  72.618  1.00 9.40  ? 282 LEU A CB  1 
ATOM   2247  C CG  . LEU A 1 282 ? 22.656  29.088  72.459  1.00 10.42 ? 282 LEU A CG  1 
ATOM   2248  C CD1 . LEU A 1 282 ? 22.837  29.459  70.990  1.00 11.35 ? 282 LEU A CD1 1 
ATOM   2249  C CD2 . LEU A 1 282 ? 22.108  30.279  73.201  1.00 12.88 ? 282 LEU A CD2 1 
ATOM   2250  N N   . SER A 1 283 ? 23.481  25.417  73.647  1.00 9.01  ? 283 SER A N   1 
ATOM   2251  C CA  . SER A 1 283 ? 24.735  24.964  74.256  1.00 9.27  ? 283 SER A CA  1 
ATOM   2252  C C   . SER A 1 283 ? 25.509  24.019  73.344  1.00 9.26  ? 283 SER A C   1 
ATOM   2253  O O   . SER A 1 283 ? 26.731  24.013  73.366  1.00 9.32  ? 283 SER A O   1 
ATOM   2254  C CB  . SER A 1 283 ? 24.502  24.334  75.623  1.00 10.09 ? 283 SER A CB  1 
ATOM   2255  O OG  . SER A 1 283 ? 23.684  23.196  75.568  1.00 9.44  ? 283 SER A OG  1 
ATOM   2256  N N   . ILE A 1 284 ? 24.802  23.235  72.530  1.00 8.65  ? 284 ILE A N   1 
ATOM   2257  C CA  . ILE A 1 284 ? 25.470  22.336  71.603  1.00 8.79  ? 284 ILE A CA  1 
ATOM   2258  C C   . ILE A 1 284 ? 26.287  23.185  70.628  1.00 9.30  ? 284 ILE A C   1 
ATOM   2259  O O   . ILE A 1 284 ? 27.491  22.960  70.441  1.00 9.65  ? 284 ILE A O   1 
ATOM   2260  C CB  . ILE A 1 284 ? 24.455  21.490  70.817  1.00 8.33  ? 284 ILE A CB  1 
ATOM   2261  C CG1 . ILE A 1 284 ? 23.683  20.539  71.740  1.00 8.61  ? 284 ILE A CG1 1 
ATOM   2262  C CG2 . ILE A 1 284 ? 25.170  20.667  69.754  1.00 8.59  ? 284 ILE A CG2 1 
ATOM   2263  C CD1 . ILE A 1 284 ? 22.489  19.858  71.017  1.00 9.60  ? 284 ILE A CD1 1 
ATOM   2264  N N   . ALA A 1 285 ? 25.606  24.133  69.987  1.00 9.58  ? 285 ALA A N   1 
ATOM   2265  C CA  . ALA A 1 285 ? 26.242  24.994  68.990  1.00 10.55 ? 285 ALA A CA  1 
ATOM   2266  C C   . ALA A 1 285 ? 27.428  25.780  69.570  1.00 10.92 ? 285 ALA A C   1 
ATOM   2267  O O   . ALA A 1 285 ? 28.455  25.949  68.913  1.00 11.12 ? 285 ALA A O   1 
ATOM   2268  C CB  . ALA A 1 285 ? 25.194  25.941  68.365  1.00 10.78 ? 285 ALA A CB  1 
ATOM   2269  N N   . LEU A 1 286 ? 27.293  26.243  70.806  1.00 11.58 ? 286 LEU A N   1 
ATOM   2270  C CA  . LEU A 1 286 ? 28.376  26.943  71.477  1.00 11.21 ? 286 LEU A CA  1 
ATOM   2271  C C   . LEU A 1 286 ? 29.582  26.039  71.678  1.00 11.61 ? 286 LEU A C   1 
ATOM   2272  O O   . LEU A 1 286 ? 30.728  26.441  71.441  1.00 11.37 ? 286 LEU A O   1 
ATOM   2273  C CB  . LEU A 1 286 ? 27.896  27.480  72.829  1.00 12.02 ? 286 LEU A CB  1 
ATOM   2274  C CG  . LEU A 1 286 ? 27.123  28.804  72.781  1.00 12.24 ? 286 LEU A CG  1 
ATOM   2275  C CD1 . LEU A 1 286 ? 26.322  29.040  74.043  1.00 12.32 ? 286 LEU A CD1 1 
ATOM   2276  C CD2 . LEU A 1 286 ? 28.093  29.950  72.549  1.00 12.72 ? 286 LEU A CD2 1 
ATOM   2277  N N   . HIS A 1 287 ? 29.332  24.801  72.098  1.00 11.24 ? 287 HIS A N   1 
ATOM   2278  C CA  . HIS A 1 287 ? 30.414  23.860  72.389  1.00 11.47 ? 287 HIS A CA  1 
ATOM   2279  C C   . HIS A 1 287 ? 31.174  23.366  71.155  1.00 11.38 ? 287 HIS A C   1 
ATOM   2280  O O   . HIS A 1 287 ? 32.424  23.349  71.145  1.00 11.51 ? 287 HIS A O   1 
ATOM   2281  C CB  . HIS A 1 287 ? 29.853  22.659  73.170  1.00 11.60 ? 287 HIS A CB  1 
ATOM   2282  C CG  . HIS A 1 287 ? 30.878  21.860  73.910  1.00 12.47 ? 287 HIS A CG  1 
ATOM   2283  N ND1 . HIS A 1 287 ? 30.908  20.484  73.880  1.00 13.51 ? 287 HIS A ND1 1 
ATOM   2284  C CD2 . HIS A 1 287 ? 31.872  22.237  74.743  1.00 10.39 ? 287 HIS A CD2 1 
ATOM   2285  C CE1 . HIS A 1 287 ? 31.896  20.052  74.639  1.00 13.20 ? 287 HIS A CE1 1 
ATOM   2286  N NE2 . HIS A 1 287 ? 32.496  21.097  75.176  1.00 14.32 ? 287 HIS A NE2 1 
ATOM   2287  N N   . VAL A 1 288 ? 30.432  22.923  70.148  1.00 11.84 ? 288 VAL A N   1 
ATOM   2288  C CA  . VAL A 1 288 ? 31.006  22.326  68.940  1.00 12.13 ? 288 VAL A CA  1 
ATOM   2289  C C   . VAL A 1 288 ? 30.903  23.210  67.700  1.00 12.61 ? 288 VAL A C   1 
ATOM   2290  O O   . VAL A 1 288 ? 31.305  22.803  66.609  1.00 12.75 ? 288 VAL A O   1 
ATOM   2291  C CB  . VAL A 1 288 ? 30.368  20.946  68.601  1.00 12.05 ? 288 VAL A CB  1 
ATOM   2292  C CG1 . VAL A 1 288 ? 30.554  19.979  69.733  1.00 13.20 ? 288 VAL A CG1 1 
ATOM   2293  C CG2 . VAL A 1 288 ? 28.903  21.090  68.258  1.00 11.57 ? 288 VAL A CG2 1 
ATOM   2294  N N   . GLY A 1 289 ? 30.360  24.407  67.869  1.00 13.19 ? 289 GLY A N   1 
ATOM   2295  C CA  . GLY A 1 289 ? 30.264  25.394  66.799  1.00 13.71 ? 289 GLY A CA  1 
ATOM   2296  C C   . GLY A 1 289 ? 28.978  25.270  66.003  1.00 14.07 ? 289 GLY A C   1 
ATOM   2297  O O   . GLY A 1 289 ? 28.404  24.176  65.868  1.00 13.97 ? 289 GLY A O   1 
ATOM   2298  N N   . PHE A 1 290 ? 28.512  26.389  65.460  1.00 14.20 ? 290 PHE A N   1 
ATOM   2299  C CA  . PHE A 1 290 ? 27.278  26.347  64.690  1.00 14.45 ? 290 PHE A CA  1 
ATOM   2300  C C   . PHE A 1 290 ? 27.355  25.448  63.451  1.00 14.66 ? 290 PHE A C   1 
ATOM   2301  O O   . PHE A 1 290 ? 26.350  24.833  63.064  1.00 14.85 ? 290 PHE A O   1 
ATOM   2302  C CB  . PHE A 1 290 ? 26.834  27.751  64.296  1.00 14.77 ? 290 PHE A CB  1 
ATOM   2303  C CG  . PHE A 1 290 ? 25.430  27.805  63.834  1.00 13.20 ? 290 PHE A CG  1 
ATOM   2304  C CD1 . PHE A 1 290 ? 24.394  27.761  64.735  1.00 13.81 ? 290 PHE A CD1 1 
ATOM   2305  C CD2 . PHE A 1 290 ? 25.138  27.838  62.491  1.00 15.11 ? 290 PHE A CD2 1 
ATOM   2306  C CE1 . PHE A 1 290 ? 23.078  27.776  64.305  1.00 13.42 ? 290 PHE A CE1 1 
ATOM   2307  C CE2 . PHE A 1 290 ? 23.842  27.860  62.066  1.00 15.32 ? 290 PHE A CE2 1 
ATOM   2308  C CZ  . PHE A 1 290 ? 22.810  27.821  62.977  1.00 14.55 ? 290 PHE A CZ  1 
ATOM   2309  N N   . ASP A 1 291 ? 28.511  25.404  62.796  1.00 14.64 ? 291 ASP A N   1 
ATOM   2310  C CA  . ASP A 1 291 ? 28.670  24.539  61.614  1.00 14.88 ? 291 ASP A CA  1 
ATOM   2311  C C   . ASP A 1 291 ? 28.376  23.072  61.982  1.00 14.29 ? 291 ASP A C   1 
ATOM   2312  O O   . ASP A 1 291 ? 27.654  22.371  61.260  1.00 13.55 ? 291 ASP A O   1 
ATOM   2313  C CB  . ASP A 1 291 ? 30.083  24.627  61.051  1.00 15.53 ? 291 ASP A CB  1 
ATOM   2314  C CG  . ASP A 1 291 ? 30.294  25.854  60.208  1.00 19.91 ? 291 ASP A CG  1 
ATOM   2315  O OD1 . ASP A 1 291 ? 29.329  26.628  60.017  1.00 25.81 ? 291 ASP A OD1 1 
ATOM   2316  O OD2 . ASP A 1 291 ? 31.396  26.122  59.682  1.00 25.90 ? 291 ASP A OD2 1 
ATOM   2317  N N   . ASN A 1 292 ? 28.949  22.617  63.090  1.00 12.21 ? 292 ASN A N   1 
ATOM   2318  C CA  . ASN A 1 292 ? 28.682  21.259  63.551  1.00 12.47 ? 292 ASN A CA  1 
ATOM   2319  C C   . ASN A 1 292 ? 27.209  21.080  63.966  1.00 11.97 ? 292 ASN A C   1 
ATOM   2320  O O   . ASN A 1 292 ? 26.667  20.013  63.778  1.00 12.18 ? 292 ASN A O   1 
ATOM   2321  C CB  . ASN A 1 292 ? 29.636  20.824  64.675  1.00 11.47 ? 292 ASN A CB  1 
ATOM   2322  C CG  . ASN A 1 292 ? 31.023  20.459  64.165  1.00 12.75 ? 292 ASN A CG  1 
ATOM   2323  O OD1 . ASN A 1 292 ? 32.060  20.667  64.859  1.00 12.22 ? 292 ASN A OD1 1 
ATOM   2324  N ND2 . ASN A 1 292 ? 31.064  19.897  62.950  1.00 8.83  ? 292 ASN A ND2 1 
ATOM   2325  N N   . PHE A 1 293 ? 26.584  22.113  64.533  1.00 11.50 ? 293 PHE A N   1 
ATOM   2326  C CA  . PHE A 1 293 ? 25.153  22.077  64.840  1.00 11.69 ? 293 PHE A CA  1 
ATOM   2327  C C   . PHE A 1 293 ? 24.328  21.892  63.573  1.00 11.15 ? 293 PHE A C   1 
ATOM   2328  O O   . PHE A 1 293 ? 23.368  21.127  63.557  1.00 10.35 ? 293 PHE A O   1 
ATOM   2329  C CB  . PHE A 1 293 ? 24.709  23.369  65.547  1.00 11.41 ? 293 PHE A CB  1 
ATOM   2330  C CG  . PHE A 1 293 ? 23.303  23.319  66.093  1.00 11.78 ? 293 PHE A CG  1 
ATOM   2331  C CD1 . PHE A 1 293 ? 22.978  22.480  67.141  1.00 11.17 ? 293 PHE A CD1 1 
ATOM   2332  C CD2 . PHE A 1 293 ? 22.311  24.137  65.570  1.00 11.79 ? 293 PHE A CD2 1 
ATOM   2333  C CE1 . PHE A 1 293 ? 21.690  22.452  67.652  1.00 9.10  ? 293 PHE A CE1 1 
ATOM   2334  C CE2 . PHE A 1 293 ? 21.028  24.106  66.075  1.00 11.58 ? 293 PHE A CE2 1 
ATOM   2335  C CZ  . PHE A 1 293 ? 20.716  23.242  67.109  1.00 10.22 ? 293 PHE A CZ  1 
ATOM   2336  N N   . GLU A 1 294 ? 24.685  22.605  62.508  1.00 11.71 ? 294 GLU A N   1 
ATOM   2337  C CA  . GLU A 1 294 ? 23.973  22.475  61.237  1.00 12.00 ? 294 GLU A CA  1 
ATOM   2338  C C   . GLU A 1 294 ? 24.115  21.038  60.680  1.00 12.09 ? 294 GLU A C   1 
ATOM   2339  O O   . GLU A 1 294 ? 23.177  20.497  60.100  1.00 11.89 ? 294 GLU A O   1 
ATOM   2340  C CB  . GLU A 1 294 ? 24.485  23.492  60.208  1.00 12.44 ? 294 GLU A CB  1 
ATOM   2341  C CG  . GLU A 1 294 ? 23.989  24.904  60.447  1.00 13.53 ? 294 GLU A CG  1 
ATOM   2342  C CD  . GLU A 1 294 ? 24.465  25.878  59.385  1.00 16.23 ? 294 GLU A CD  1 
ATOM   2343  O OE1 . GLU A 1 294 ? 25.629  25.782  58.974  1.00 15.56 ? 294 GLU A OE1 1 
ATOM   2344  O OE2 . GLU A 1 294 ? 23.665  26.738  58.987  1.00 16.89 ? 294 GLU A OE2 1 
ATOM   2345  N N   . GLN A 1 295 ? 25.277  20.432  60.887  1.00 11.52 ? 295 GLN A N   1 
ATOM   2346  C CA  . GLN A 1 295 ? 25.505  19.066  60.431  1.00 11.81 ? 295 GLN A CA  1 
ATOM   2347  C C   . GLN A 1 295 ? 24.607  18.103  61.185  1.00 11.03 ? 295 GLN A C   1 
ATOM   2348  O O   . GLN A 1 295 ? 24.035  17.199  60.592  1.00 10.06 ? 295 GLN A O   1 
ATOM   2349  C CB  . GLN A 1 295 ? 26.956  18.675  60.595  1.00 12.51 ? 295 GLN A CB  1 
ATOM   2350  C CG  . GLN A 1 295 ? 27.903  19.372  59.595  1.00 15.28 ? 295 GLN A CG  1 
ATOM   2351  C CD  . GLN A 1 295 ? 27.640  18.948  58.170  1.00 19.96 ? 295 GLN A CD  1 
ATOM   2352  O OE1 . GLN A 1 295 ? 27.157  17.836  57.920  1.00 21.29 ? 295 GLN A OE1 1 
ATOM   2353  N NE2 . GLN A 1 295 ? 27.939  19.832  57.225  1.00 23.13 ? 295 GLN A NE2 1 
ATOM   2354  N N   . LEU A 1 296 ? 24.478  18.323  62.489  1.00 10.84 ? 296 LEU A N   1 
ATOM   2355  C CA  . LEU A 1 296 ? 23.550  17.563  63.328  1.00 10.83 ? 296 LEU A CA  1 
ATOM   2356  C C   . LEU A 1 296 ? 22.113  17.692  62.773  1.00 11.09 ? 296 LEU A C   1 
ATOM   2357  O O   . LEU A 1 296 ? 21.410  16.689  62.614  1.00 10.53 ? 296 LEU A O   1 
ATOM   2358  C CB  . LEU A 1 296 ? 23.627  18.074  64.774  1.00 10.92 ? 296 LEU A CB  1 
ATOM   2359  C CG  . LEU A 1 296 ? 22.724  17.419  65.827  1.00 10.92 ? 296 LEU A CG  1 
ATOM   2360  C CD1 . LEU A 1 296 ? 23.338  16.085  66.271  1.00 10.41 ? 296 LEU A CD1 1 
ATOM   2361  C CD2 . LEU A 1 296 ? 22.540  18.355  67.009  1.00 13.22 ? 296 LEU A CD2 1 
ATOM   2362  N N   . LEU A 1 297 ? 21.691  18.921  62.453  1.00 10.70 ? 297 LEU A N   1 
ATOM   2363  C CA  . LEU A 1 297 ? 20.373  19.154  61.892  1.00 11.20 ? 297 LEU A CA  1 
ATOM   2364  C C   . LEU A 1 297 ? 20.268  18.448  60.552  1.00 10.81 ? 297 LEU A C   1 
ATOM   2365  O O   . LEU A 1 297 ? 19.265  17.824  60.254  1.00 10.31 ? 297 LEU A O   1 
ATOM   2366  C CB  . LEU A 1 297 ? 20.075  20.656  61.713  1.00 11.68 ? 297 LEU A CB  1 
ATOM   2367  C CG  . LEU A 1 297 ? 20.084  21.568  62.946  1.00 14.90 ? 297 LEU A CG  1 
ATOM   2368  C CD1 . LEU A 1 297 ? 19.705  23.015  62.604  1.00 16.21 ? 297 LEU A CD1 1 
ATOM   2369  C CD2 . LEU A 1 297 ? 19.159  21.088  64.016  1.00 16.21 ? 297 LEU A CD2 1 
ATOM   2370  N N   . SER A 1 298 ? 21.328  18.530  59.763  1.00 10.92 ? 298 SER A N   1 
ATOM   2371  C CA  . SER A 1 298 ? 21.311  17.958  58.426  1.00 11.56 ? 298 SER A CA  1 
ATOM   2372  C C   . SER A 1 298 ? 21.131  16.431  58.456  1.00 10.85 ? 298 SER A C   1 
ATOM   2373  O O   . SER A 1 298 ? 20.420  15.864  57.607  1.00 9.77  ? 298 SER A O   1 
ATOM   2374  C CB  . SER A 1 298 ? 22.569  18.386  57.646  1.00 11.81 ? 298 SER A CB  1 
ATOM   2375  O OG  . SER A 1 298 ? 22.534  17.811  56.344  1.00 16.59 ? 298 SER A OG  1 
ATOM   2376  N N   . GLY A 1 299 ? 21.751  15.779  59.443  1.00 10.55 ? 299 GLY A N   1 
ATOM   2377  C CA  . GLY A 1 299 ? 21.632  14.336  59.611  1.00 10.14 ? 299 GLY A CA  1 
ATOM   2378  C C   . GLY A 1 299 ? 20.206  13.926  59.938  1.00 9.91  ? 299 GLY A C   1 
ATOM   2379  O O   . GLY A 1 299 ? 19.681  12.946  59.407  1.00 10.34 ? 299 GLY A O   1 
ATOM   2380  N N   . ALA A 1 300 ? 19.573  14.661  60.847  1.00 10.05 ? 300 ALA A N   1 
ATOM   2381  C CA  . ALA A 1 300 ? 18.180  14.400  61.182  1.00 9.91  ? 300 ALA A CA  1 
ATOM   2382  C C   . ALA A 1 300 ? 17.300  14.601  59.939  1.00 9.96  ? 300 ALA A C   1 
ATOM   2383  O O   . ALA A 1 300 ? 16.406  13.810  59.671  1.00 8.95  ? 300 ALA A O   1 
ATOM   2384  C CB  . ALA A 1 300 ? 17.721  15.313  62.299  1.00 9.63  ? 300 ALA A CB  1 
ATOM   2385  N N   . HIS A 1 301 ? 17.590  15.655  59.178  1.00 10.49 ? 301 HIS A N   1 
ATOM   2386  C CA  . HIS A 1 301 ? 16.829  15.960  57.961  1.00 10.22 ? 301 HIS A CA  1 
ATOM   2387  C C   . HIS A 1 301 ? 16.941  14.800  56.981  1.00 10.40 ? 301 HIS A C   1 
ATOM   2388  O O   . HIS A 1 301 ? 15.948  14.407  56.345  1.00 10.62 ? 301 HIS A O   1 
ATOM   2389  C CB  . HIS A 1 301 ? 17.337  17.251  57.336  1.00 10.64 ? 301 HIS A CB  1 
ATOM   2390  C CG  . HIS A 1 301 ? 16.518  17.731  56.175  1.00 9.99  ? 301 HIS A CG  1 
ATOM   2391  N ND1 . HIS A 1 301 ? 15.156  17.912  56.253  1.00 10.24 ? 301 HIS A ND1 1 
ATOM   2392  C CD2 . HIS A 1 301 ? 16.872  18.089  54.916  1.00 12.69 ? 301 HIS A CD2 1 
ATOM   2393  C CE1 . HIS A 1 301 ? 14.702  18.341  55.088  1.00 13.52 ? 301 HIS A CE1 1 
ATOM   2394  N NE2 . HIS A 1 301 ? 15.723  18.462  54.261  1.00 11.79 ? 301 HIS A NE2 1 
ATOM   2395  N N   . TRP A 1 302 ? 18.138  14.232  56.878  1.00 10.57 ? 302 TRP A N   1 
ATOM   2396  C CA  . TRP A 1 302 ? 18.365  13.086  56.013  1.00 10.16 ? 302 TRP A CA  1 
ATOM   2397  C C   . TRP A 1 302 ? 17.433  11.934  56.432  1.00 10.02 ? 302 TRP A C   1 
ATOM   2398  O O   . TRP A 1 302 ? 16.750  11.313  55.600  1.00 9.01  ? 302 TRP A O   1 
ATOM   2399  C CB  . TRP A 1 302 ? 19.848  12.654  56.001  1.00 10.07 ? 302 TRP A CB  1 
ATOM   2400  C CG  . TRP A 1 302 ? 20.100  11.571  54.996  1.00 11.57 ? 302 TRP A CG  1 
ATOM   2401  C CD1 . TRP A 1 302 ? 20.592  11.721  53.734  1.00 11.18 ? 302 TRP A CD1 1 
ATOM   2402  C CD2 . TRP A 1 302 ? 19.844  10.167  55.157  1.00 12.05 ? 302 TRP A CD2 1 
ATOM   2403  N NE1 . TRP A 1 302 ? 20.650  10.505  53.095  1.00 10.16 ? 302 TRP A NE1 1 
ATOM   2404  C CE2 . TRP A 1 302 ? 20.184  9.534   53.937  1.00 12.91 ? 302 TRP A CE2 1 
ATOM   2405  C CE3 . TRP A 1 302 ? 19.343  9.381   56.199  1.00 11.71 ? 302 TRP A CE3 1 
ATOM   2406  C CZ2 . TRP A 1 302 ? 20.049  8.157   53.733  1.00 10.85 ? 302 TRP A CZ2 1 
ATOM   2407  C CZ3 . TRP A 1 302 ? 19.189  8.020   55.993  1.00 11.12 ? 302 TRP A CZ3 1 
ATOM   2408  C CH2 . TRP A 1 302 ? 19.546  7.417   54.762  1.00 12.80 ? 302 TRP A CH2 1 
ATOM   2409  N N   . MET A 1 303 ? 17.380  11.663  57.731  1.00 9.91  ? 303 MET A N   1 
ATOM   2410  C CA  . MET A 1 303 ? 16.583  10.559  58.222  1.00 9.58  ? 303 MET A CA  1 
ATOM   2411  C C   . MET A 1 303 ? 15.079  10.854  58.067  1.00 9.60  ? 303 MET A C   1 
ATOM   2412  O O   . MET A 1 303 ? 14.287  9.950   57.803  1.00 8.82  ? 303 MET A O   1 
ATOM   2413  C CB  . MET A 1 303 ? 16.990  10.245  59.673  1.00 9.70  ? 303 MET A CB  1 
ATOM   2414  C CG  . MET A 1 303 ? 16.222  9.077   60.264  1.00 9.03  ? 303 MET A CG  1 
ATOM   2415  S SD  . MET A 1 303 ? 16.465  7.515   59.432  1.00 10.79 ? 303 MET A SD  1 
ATOM   2416  C CE  . MET A 1 303 ? 18.191  7.273   59.659  1.00 11.38 ? 303 MET A CE  1 
ATOM   2417  N N   . ASP A 1 304 ? 14.693  12.128  58.186  1.00 9.62  ? 304 ASP A N   1 
ATOM   2418  C CA  . ASP A 1 304 ? 13.302  12.530  57.961  1.00 9.92  ? 304 ASP A CA  1 
ATOM   2419  C C   . ASP A 1 304 ? 12.899  12.157  56.549  1.00 9.70  ? 304 ASP A C   1 
ATOM   2420  O O   . ASP A 1 304 ? 11.775  11.673  56.331  1.00 10.07 ? 304 ASP A O   1 
ATOM   2421  C CB  . ASP A 1 304 ? 13.087  14.049  58.134  1.00 9.98  ? 304 ASP A CB  1 
ATOM   2422  C CG  . ASP A 1 304 ? 13.351  14.531  59.546  1.00 9.89  ? 304 ASP A CG  1 
ATOM   2423  O OD1 . ASP A 1 304 ? 13.272  13.706  60.495  1.00 9.43  ? 304 ASP A OD1 1 
ATOM   2424  O OD2 . ASP A 1 304 ? 13.600  15.740  59.803  1.00 9.21  ? 304 ASP A OD2 1 
ATOM   2425  N N   . GLN A 1 305 ? 13.788  12.385  55.583  1.00 9.83  ? 305 GLN A N   1 
ATOM   2426  C CA  . GLN A 1 305 ? 13.455  12.042  54.197  1.00 10.88 ? 305 GLN A CA  1 
ATOM   2427  C C   . GLN A 1 305 ? 13.367  10.539  54.014  1.00 10.30 ? 305 GLN A C   1 
ATOM   2428  O O   . GLN A 1 305 ? 12.498  10.056  53.306  1.00 10.18 ? 305 GLN A O   1 
ATOM   2429  C CB  . GLN A 1 305 ? 14.446  12.634  53.183  1.00 11.31 ? 305 GLN A CB  1 
ATOM   2430  C CG  . GLN A 1 305 ? 14.645  14.146  53.259  1.00 14.23 ? 305 GLN A CG  1 
ATOM   2431  C CD  . GLN A 1 305 ? 13.375  14.888  53.600  1.00 17.02 ? 305 GLN A CD  1 
ATOM   2432  O OE1 . GLN A 1 305 ? 12.389  14.860  52.839  1.00 17.79 ? 305 GLN A OE1 1 
ATOM   2433  N NE2 . GLN A 1 305 ? 13.382  15.550  54.759  1.00 20.14 ? 305 GLN A NE2 1 
ATOM   2434  N N   . HIS A 1 306 ? 14.309  9.796   54.588  1.00 9.71  ? 306 HIS A N   1 
ATOM   2435  C CA  . HIS A 1 306 ? 14.260  8.338   54.501  1.00 9.48  ? 306 HIS A CA  1 
ATOM   2436  C C   . HIS A 1 306 ? 12.894  7.825   55.018  1.00 9.33  ? 306 HIS A C   1 
ATOM   2437  O O   . HIS A 1 306 ? 12.228  6.986   54.386  1.00 9.62  ? 306 HIS A O   1 
ATOM   2438  C CB  . HIS A 1 306 ? 15.386  7.739   55.325  1.00 9.23  ? 306 HIS A CB  1 
ATOM   2439  C CG  . HIS A 1 306 ? 15.328  6.251   55.427  1.00 9.57  ? 306 HIS A CG  1 
ATOM   2440  N ND1 . HIS A 1 306 ? 14.704  5.591   56.467  1.00 12.36 ? 306 HIS A ND1 1 
ATOM   2441  C CD2 . HIS A 1 306 ? 15.828  5.293   54.616  1.00 9.16  ? 306 HIS A CD2 1 
ATOM   2442  C CE1 . HIS A 1 306 ? 14.822  4.285   56.279  1.00 9.89  ? 306 HIS A CE1 1 
ATOM   2443  N NE2 . HIS A 1 306 ? 15.499  4.080   55.166  1.00 12.18 ? 306 HIS A NE2 1 
ATOM   2444  N N   . PHE A 1 307 ? 12.494  8.334   56.172  1.00 8.92  ? 307 PHE A N   1 
ATOM   2445  C CA  . PHE A 1 307 ? 11.227  7.974   56.788  1.00 9.74  ? 307 PHE A CA  1 
ATOM   2446  C C   . PHE A 1 307 ? 10.083  8.361   55.849  1.00 10.61 ? 307 PHE A C   1 
ATOM   2447  O O   . PHE A 1 307 ? 9.094   7.655   55.740  1.00 10.83 ? 307 PHE A O   1 
ATOM   2448  C CB  . PHE A 1 307 ? 11.085  8.710   58.126  1.00 9.69  ? 307 PHE A CB  1 
ATOM   2449  C CG  . PHE A 1 307 ? 9.773   8.468   58.843  1.00 9.78  ? 307 PHE A CG  1 
ATOM   2450  C CD1 . PHE A 1 307 ? 9.192   7.210   58.882  1.00 10.29 ? 307 PHE A CD1 1 
ATOM   2451  C CD2 . PHE A 1 307 ? 9.152   9.506   59.523  1.00 11.93 ? 307 PHE A CD2 1 
ATOM   2452  C CE1 . PHE A 1 307 ? 7.986   6.996   59.577  1.00 10.39 ? 307 PHE A CE1 1 
ATOM   2453  C CE2 . PHE A 1 307 ? 7.952   9.304   60.190  1.00 11.33 ? 307 PHE A CE2 1 
ATOM   2454  C CZ  . PHE A 1 307 ? 7.372   8.034   60.221  1.00 11.37 ? 307 PHE A CZ  1 
ATOM   2455  N N   . ARG A 1 308 ? 10.231  9.481   55.160  1.00 10.73 ? 308 ARG A N   1 
ATOM   2456  C CA  . ARG A 1 308 ? 9.162   9.941   54.288  1.00 12.38 ? 308 ARG A CA  1 
ATOM   2457  C C   . ARG A 1 308 ? 8.987   9.173   52.966  1.00 12.06 ? 308 ARG A C   1 
ATOM   2458  O O   . ARG A 1 308 ? 7.849   8.941   52.545  1.00 11.84 ? 308 ARG A O   1 
ATOM   2459  C CB  . ARG A 1 308 ? 9.323   11.432  54.006  1.00 12.68 ? 308 ARG A CB  1 
ATOM   2460  C CG  . ARG A 1 308 ? 7.990   12.074  53.781  1.00 17.64 ? 308 ARG A CG  1 
ATOM   2461  C CD  . ARG A 1 308 ? 7.959   13.570  53.891  1.00 20.88 ? 308 ARG A CD  1 
ATOM   2462  N NE  . ARG A 1 308 ? 6.569   14.002  53.825  1.00 22.89 ? 308 ARG A NE  1 
ATOM   2463  C CZ  . ARG A 1 308 ? 6.183   15.244  53.664  1.00 25.12 ? 308 ARG A CZ  1 
ATOM   2464  N NH1 . ARG A 1 308 ? 7.073   16.220  53.587  1.00 26.01 ? 308 ARG A NH1 1 
ATOM   2465  N NH2 . ARG A 1 308 ? 4.897   15.521  53.615  1.00 27.23 ? 308 ARG A NH2 1 
ATOM   2466  N N   . THR A 1 309 ? 10.093  8.762   52.342  1.00 11.26 ? 309 THR A N   1 
ATOM   2467  C CA  . THR A 1 309 ? 10.035  8.227   50.974  1.00 11.38 ? 309 THR A CA  1 
ATOM   2468  C C   . THR A 1 309 ? 10.220  6.727   50.826  1.00 10.92 ? 309 THR A C   1 
ATOM   2469  O O   . THR A 1 309 ? 10.081  6.201   49.738  1.00 10.89 ? 309 THR A O   1 
ATOM   2470  C CB  . THR A 1 309 ? 11.107  8.918   50.104  1.00 11.22 ? 309 THR A CB  1 
ATOM   2471  O OG1 . THR A 1 309 ? 12.425  8.563   50.545  1.00 11.51 ? 309 THR A OG1 1 
ATOM   2472  C CG2 . THR A 1 309 ? 11.051  10.433  50.248  1.00 12.17 ? 309 THR A CG2 1 
ATOM   2473  N N   . THR A 1 310 ? 10.576  6.041   51.903  1.00 10.66 ? 310 THR A N   1 
ATOM   2474  C CA  . THR A 1 310 ? 10.898  4.629   51.829  1.00 10.65 ? 310 THR A CA  1 
ATOM   2475  C C   . THR A 1 310 ? 9.693   3.749   52.098  1.00 11.01 ? 310 THR A C   1 
ATOM   2476  O O   . THR A 1 310 ? 9.006   3.920   53.117  1.00 10.97 ? 310 THR A O   1 
ATOM   2477  C CB  . THR A 1 310 ? 11.993  4.305   52.883  1.00 10.76 ? 310 THR A CB  1 
ATOM   2478  O OG1 . THR A 1 310 ? 13.129  5.167   52.677  1.00 10.66 ? 310 THR A OG1 1 
ATOM   2479  C CG2 . THR A 1 310 ? 12.537  2.893   52.729  1.00 11.19 ? 310 THR A CG2 1 
ATOM   2480  N N   . PRO A 1 311 ? 9.448   2.789   51.208  1.00 11.48 ? 311 PRO A N   1 
ATOM   2481  C CA  . PRO A 1 311 ? 8.378   1.818   51.425  1.00 11.42 ? 311 PRO A CA  1 
ATOM   2482  C C   . PRO A 1 311 ? 8.492   1.261   52.833  1.00 11.12 ? 311 PRO A C   1 
ATOM   2483  O O   . PRO A 1 311 ? 9.585   0.938   53.292  1.00 11.05 ? 311 PRO A O   1 
ATOM   2484  C CB  . PRO A 1 311 ? 8.660   0.715   50.394  1.00 11.78 ? 311 PRO A CB  1 
ATOM   2485  C CG  . PRO A 1 311 ? 9.450   1.389   49.319  1.00 12.16 ? 311 PRO A CG  1 
ATOM   2486  C CD  . PRO A 1 311 ? 10.194  2.533   49.963  1.00 11.77 ? 311 PRO A CD  1 
ATOM   2487  N N   . LEU A 1 312 ? 7.356   1.144   53.498  1.00 11.45 ? 312 LEU A N   1 
ATOM   2488  C CA  . LEU A 1 312 ? 7.318   0.695   54.882  1.00 12.10 ? 312 LEU A CA  1 
ATOM   2489  C C   . LEU A 1 312 ? 8.173   -0.526  55.131  1.00 11.46 ? 312 LEU A C   1 
ATOM   2490  O O   . LEU A 1 312 ? 8.869   -0.594  56.142  1.00 11.38 ? 312 LEU A O   1 
ATOM   2491  C CB  . LEU A 1 312 ? 5.875   0.375   55.283  1.00 12.45 ? 312 LEU A CB  1 
ATOM   2492  C CG  . LEU A 1 312 ? 4.930   1.568   55.374  1.00 14.12 ? 312 LEU A CG  1 
ATOM   2493  C CD1 . LEU A 1 312 ? 3.554   1.038   55.710  1.00 17.02 ? 312 LEU A CD1 1 
ATOM   2494  C CD2 . LEU A 1 312 ? 5.361   2.576   56.419  1.00 15.88 ? 312 LEU A CD2 1 
ATOM   2495  N N   . GLU A 1 313 ? 8.112   -1.490  54.214  1.00 12.13 ? 313 GLU A N   1 
ATOM   2496  C CA  . GLU A 1 313 ? 8.826   -2.750  54.382  1.00 12.65 ? 313 GLU A CA  1 
ATOM   2497  C C   . GLU A 1 313 ? 10.344  -2.628  54.443  1.00 12.50 ? 313 GLU A C   1 
ATOM   2498  O O   . GLU A 1 313 ? 11.008  -3.582  54.868  1.00 12.01 ? 313 GLU A O   1 
ATOM   2499  C CB  . GLU A 1 313 ? 8.429   -3.765  53.306  1.00 13.55 ? 313 GLU A CB  1 
ATOM   2500  C CG  . GLU A 1 313 ? 8.640   -3.257  51.898  1.00 15.71 ? 313 GLU A CG  1 
ATOM   2501  C CD  . GLU A 1 313 ? 7.375   -2.676  51.284  1.00 19.89 ? 313 GLU A CD  1 
ATOM   2502  O OE1 . GLU A 1 313 ? 7.113   -3.020  50.110  1.00 24.02 ? 313 GLU A OE1 1 
ATOM   2503  O OE2 . GLU A 1 313 ? 6.649   -1.879  51.940  1.00 19.38 ? 313 GLU A OE2 1 
ATOM   2504  N N   . LYS A 1 314 ? 10.886  -1.470  54.051  1.00 12.77 ? 314 LYS A N   1 
ATOM   2505  C CA  . LYS A 1 314 ? 12.331  -1.207  54.114  1.00 13.24 ? 314 LYS A CA  1 
ATOM   2506  C C   . LYS A 1 314 ? 12.671  0.101   54.853  1.00 12.14 ? 314 LYS A C   1 
ATOM   2507  O O   . LYS A 1 314 ? 13.784  0.633   54.743  1.00 11.22 ? 314 LYS A O   1 
ATOM   2508  C CB  . LYS A 1 314 ? 12.940  -1.173  52.704  1.00 13.92 ? 314 LYS A CB  1 
ATOM   2509  C CG  . LYS A 1 314 ? 13.047  -2.559  52.001  1.00 16.68 ? 314 LYS A CG  1 
ATOM   2510  C CD  . LYS A 1 314 ? 14.051  -3.476  52.695  1.00 21.45 ? 314 LYS A CD  1 
ATOM   2511  C CE  . LYS A 1 314 ? 14.200  -4.840  52.009  1.00 24.21 ? 314 LYS A CE  1 
ATOM   2512  N NZ  . LYS A 1 314 ? 13.523  -5.931  52.788  1.00 26.95 ? 314 LYS A NZ  1 
ATOM   2513  N N   . ASN A 1 315 ? 11.715  0.592   55.626  1.00 12.23 ? 315 ASN A N   1 
ATOM   2514  C CA  . ASN A 1 315 ? 11.800  1.894   56.291  1.00 11.75 ? 315 ASN A CA  1 
ATOM   2515  C C   . ASN A 1 315 ? 12.321  1.672   57.722  1.00 11.86 ? 315 ASN A C   1 
ATOM   2516  O O   . ASN A 1 315 ? 11.625  1.102   58.568  1.00 10.84 ? 315 ASN A O   1 
ATOM   2517  C CB  . ASN A 1 315 ? 10.391  2.493   56.244  1.00 11.65 ? 315 ASN A CB  1 
ATOM   2518  C CG  . ASN A 1 315 ? 10.346  3.966   56.559  1.00 12.14 ? 315 ASN A CG  1 
ATOM   2519  O OD1 . ASN A 1 315 ? 9.697   4.769   55.836  1.00 11.56 ? 315 ASN A OD1 1 
ATOM   2520  N ND2 . ASN A 1 315 ? 10.959  4.337   57.663  1.00 6.86  ? 315 ASN A ND2 1 
ATOM   2521  N N   . ALA A 1 316 ? 13.558  2.100   57.968  1.00 11.56 ? 316 ALA A N   1 
ATOM   2522  C CA  . ALA A 1 316 ? 14.239  1.845   59.248  1.00 11.59 ? 316 ALA A CA  1 
ATOM   2523  C C   . ALA A 1 316 ? 13.428  2.142   60.513  1.00 10.66 ? 316 ALA A C   1 
ATOM   2524  O O   . ALA A 1 316 ? 13.207  1.243   61.320  1.00 10.23 ? 316 ALA A O   1 
ATOM   2525  C CB  . ALA A 1 316 ? 15.618  2.523   59.282  1.00 11.87 ? 316 ALA A CB  1 
ATOM   2526  N N   . PRO A 1 317 ? 12.983  3.371   60.722  1.00 10.53 ? 317 PRO A N   1 
ATOM   2527  C CA  . PRO A 1 317 ? 12.218  3.674   61.936  1.00 10.00 ? 317 PRO A CA  1 
ATOM   2528  C C   . PRO A 1 317 ? 10.950  2.820   62.045  1.00 10.10 ? 317 PRO A C   1 
ATOM   2529  O O   . PRO A 1 317 ? 10.560  2.380   63.123  1.00 9.45  ? 317 PRO A O   1 
ATOM   2530  C CB  . PRO A 1 317 ? 11.836  5.143   61.782  1.00 10.48 ? 317 PRO A CB  1 
ATOM   2531  C CG  . PRO A 1 317 ? 12.413  5.612   60.517  1.00 11.03 ? 317 PRO A CG  1 
ATOM   2532  C CD  . PRO A 1 317 ? 13.171  4.543   59.864  1.00 10.72 ? 317 PRO A CD  1 
ATOM   2533  N N   . VAL A 1 318 ? 10.306  2.595   60.911  1.00 9.74  ? 318 VAL A N   1 
ATOM   2534  C CA  . VAL A 1 318 ? 9.105   1.785   60.885  1.00 9.99  ? 318 VAL A CA  1 
ATOM   2535  C C   . VAL A 1 318 ? 9.411   0.361   61.314  1.00 9.20  ? 318 VAL A C   1 
ATOM   2536  O O   . VAL A 1 318 ? 8.685   -0.202  62.136  1.00 9.48  ? 318 VAL A O   1 
ATOM   2537  C CB  . VAL A 1 318 ? 8.464   1.777   59.476  1.00 10.24 ? 318 VAL A CB  1 
ATOM   2538  C CG1 . VAL A 1 318 ? 7.228   0.875   59.463  1.00 10.96 ? 318 VAL A CG1 1 
ATOM   2539  C CG2 . VAL A 1 318 ? 8.089   3.181   59.068  1.00 11.51 ? 318 VAL A CG2 1 
ATOM   2540  N N   . LEU A 1 319 ? 10.468  -0.230  60.763  1.00 9.19  ? 319 LEU A N   1 
ATOM   2541  C CA  . LEU A 1 319 ? 10.798  -1.625  61.104  1.00 9.83  ? 319 LEU A CA  1 
ATOM   2542  C C   . LEU A 1 319 ? 11.177  -1.725  62.583  1.00 9.57  ? 319 LEU A C   1 
ATOM   2543  O O   . LEU A 1 319 ? 10.770  -2.657  63.288  1.00 9.56  ? 319 LEU A O   1 
ATOM   2544  C CB  . LEU A 1 319 ? 11.909  -2.198  60.205  1.00 9.34  ? 319 LEU A CB  1 
ATOM   2545  C CG  . LEU A 1 319 ? 11.561  -2.381  58.707  1.00 10.96 ? 319 LEU A CG  1 
ATOM   2546  C CD1 . LEU A 1 319 ? 12.624  -3.195  57.996  1.00 12.82 ? 319 LEU A CD1 1 
ATOM   2547  C CD2 . LEU A 1 319 ? 10.235  -3.068  58.522  1.00 11.92 ? 319 LEU A CD2 1 
ATOM   2548  N N   . LEU A 1 320 ? 11.950  -0.761  63.072  1.00 9.54  ? 320 LEU A N   1 
ATOM   2549  C CA  . LEU A 1 320 ? 12.304  -0.790  64.482  1.00 8.73  ? 320 LEU A CA  1 
ATOM   2550  C C   . LEU A 1 320 ? 11.030  -0.725  65.316  1.00 8.49  ? 320 LEU A C   1 
ATOM   2551  O O   . LEU A 1 320 ? 10.908  -1.446  66.304  1.00 8.08  ? 320 LEU A O   1 
ATOM   2552  C CB  . LEU A 1 320 ? 13.265  0.347   64.861  1.00 9.14  ? 320 LEU A CB  1 
ATOM   2553  C CG  . LEU A 1 320 ? 14.663  0.276   64.236  1.00 9.78  ? 320 LEU A CG  1 
ATOM   2554  C CD1 . LEU A 1 320 ? 15.447  1.555   64.560  1.00 11.13 ? 320 LEU A CD1 1 
ATOM   2555  C CD2 . LEU A 1 320 ? 15.407  -0.964  64.704  1.00 10.06 ? 320 LEU A CD2 1 
ATOM   2556  N N   . ALA A 1 321 ? 10.083  0.137   64.948  1.00 8.23  ? 321 ALA A N   1 
ATOM   2557  C CA  . ALA A 1 321 ? 8.820   0.228   65.691  1.00 8.72  ? 321 ALA A CA  1 
ATOM   2558  C C   . ALA A 1 321 ? 8.060   -1.093  65.657  1.00 9.11  ? 321 ALA A C   1 
ATOM   2559  O O   . ALA A 1 321 ? 7.583   -1.561  66.687  1.00 8.43  ? 321 ALA A O   1 
ATOM   2560  C CB  . ALA A 1 321 ? 7.931   1.316   65.139  1.00 9.42  ? 321 ALA A CB  1 
ATOM   2561  N N   . LEU A 1 322 ? 7.925   -1.663  64.463  1.00 9.14  ? 322 LEU A N   1 
ATOM   2562  C CA  . LEU A 1 322 ? 7.178   -2.886  64.288  1.00 9.69  ? 322 LEU A CA  1 
ATOM   2563  C C   . LEU A 1 322 ? 7.767   -4.048  65.068  1.00 9.70  ? 322 LEU A C   1 
ATOM   2564  O O   . LEU A 1 322 ? 7.018   -4.827  65.645  1.00 10.58 ? 322 LEU A O   1 
ATOM   2565  C CB  . LEU A 1 322 ? 7.041   -3.231  62.809  1.00 10.24 ? 322 LEU A CB  1 
ATOM   2566  C CG  . LEU A 1 322 ? 6.062   -2.318  62.075  1.00 9.93  ? 322 LEU A CG  1 
ATOM   2567  C CD1 . LEU A 1 322 ? 6.160   -2.562  60.578  1.00 9.96  ? 322 LEU A CD1 1 
ATOM   2568  C CD2 . LEU A 1 322 ? 4.653   -2.512  62.582  1.00 11.36 ? 322 LEU A CD2 1 
ATOM   2569  N N   . LEU A 1 323 ? 9.088   -4.171  65.100  1.00 9.93  ? 323 LEU A N   1 
ATOM   2570  C CA  . LEU A 1 323 ? 9.704   -5.211  65.921  1.00 10.05 ? 323 LEU A CA  1 
ATOM   2571  C C   . LEU A 1 323 ? 9.339   -5.018  67.406  1.00 10.01 ? 323 LEU A C   1 
ATOM   2572  O O   . LEU A 1 323 ? 9.089   -5.972  68.145  1.00 9.89  ? 323 LEU A O   1 
ATOM   2573  C CB  . LEU A 1 323 ? 11.222  -5.229  65.717  1.00 10.43 ? 323 LEU A CB  1 
ATOM   2574  C CG  . LEU A 1 323 ? 11.639  -5.735  64.329  1.00 11.28 ? 323 LEU A CG  1 
ATOM   2575  C CD1 . LEU A 1 323 ? 12.971  -5.182  63.891  1.00 11.75 ? 323 LEU A CD1 1 
ATOM   2576  C CD2 . LEU A 1 323 ? 11.676  -7.238  64.282  1.00 12.16 ? 323 LEU A CD2 1 
ATOM   2577  N N   . GLY A 1 324 ? 9.321   -3.763  67.841  1.00 9.65  ? 324 GLY A N   1 
ATOM   2578  C CA  . GLY A 1 324 ? 8.951   -3.455  69.203  1.00 10.00 ? 324 GLY A CA  1 
ATOM   2579  C C   . GLY A 1 324 ? 7.507   -3.825  69.512  1.00 9.64  ? 324 GLY A C   1 
ATOM   2580  O O   . GLY A 1 324 ? 7.223   -4.352  70.577  1.00 9.84  ? 324 GLY A O   1 
ATOM   2581  N N   . ILE A 1 325 ? 6.596   -3.547  68.591  1.00 9.52  ? 325 ILE A N   1 
ATOM   2582  C CA  . ILE A 1 325 ? 5.183   -3.913  68.760  1.00 10.29 ? 325 ILE A CA  1 
ATOM   2583  C C   . ILE A 1 325 ? 5.048   -5.424  68.938  1.00 9.93  ? 325 ILE A C   1 
ATOM   2584  O O   . ILE A 1 325 ? 4.317   -5.902  69.811  1.00 9.85  ? 325 ILE A O   1 
ATOM   2585  C CB  . ILE A 1 325 ? 4.376   -3.475  67.516  1.00 10.06 ? 325 ILE A CB  1 
ATOM   2586  C CG1 . ILE A 1 325 ? 4.212   -1.936  67.475  1.00 12.16 ? 325 ILE A CG1 1 
ATOM   2587  C CG2 . ILE A 1 325 ? 3.039   -4.160  67.472  1.00 10.88 ? 325 ILE A CG2 1 
ATOM   2588  C CD1 . ILE A 1 325 ? 3.633   -1.375  68.719  1.00 13.30 ? 325 ILE A CD1 1 
ATOM   2589  N N   . TRP A 1 326 ? 5.761   -6.163  68.099  1.00 9.87  ? 326 TRP A N   1 
ATOM   2590  C CA  . TRP A 1 326 ? 5.835   -7.638  68.155  1.00 10.63 ? 326 TRP A CA  1 
ATOM   2591  C C   . TRP A 1 326 ? 6.230   -8.107  69.566  1.00 10.53 ? 326 TRP A C   1 
ATOM   2592  O O   . TRP A 1 326 ? 5.520   -8.885  70.204  1.00 11.08 ? 326 TRP A O   1 
ATOM   2593  C CB  . TRP A 1 326 ? 6.845   -8.067  67.075  1.00 10.66 ? 326 TRP A CB  1 
ATOM   2594  C CG  . TRP A 1 326 ? 7.242   -9.554  66.829  1.00 14.99 ? 326 TRP A CG  1 
ATOM   2595  C CD1 . TRP A 1 326 ? 8.518   -10.043 66.841  1.00 16.75 ? 326 TRP A CD1 1 
ATOM   2596  C CD2 . TRP A 1 326 ? 6.409   -10.645 66.392  1.00 18.51 ? 326 TRP A CD2 1 
ATOM   2597  N NE1 . TRP A 1 326 ? 8.527   -11.372 66.502  1.00 19.17 ? 326 TRP A NE1 1 
ATOM   2598  C CE2 . TRP A 1 326 ? 7.248   -11.763 66.221  1.00 18.34 ? 326 TRP A CE2 1 
ATOM   2599  C CE3 . TRP A 1 326 ? 5.037   -10.799 66.156  1.00 20.37 ? 326 TRP A CE3 1 
ATOM   2600  C CZ2 . TRP A 1 326 ? 6.773   -13.009 65.843  1.00 20.61 ? 326 TRP A CZ2 1 
ATOM   2601  C CZ3 . TRP A 1 326 ? 4.563   -12.091 65.779  1.00 21.28 ? 326 TRP A CZ3 1 
ATOM   2602  C CH2 . TRP A 1 326 ? 5.437   -13.146 65.622  1.00 19.61 ? 326 TRP A CH2 1 
ATOM   2603  N N   . TYR A 1 327 ? 7.332   -7.582  70.082  1.00 10.56 ? 327 TYR A N   1 
ATOM   2604  C CA  . TYR A 1 327 ? 7.792   -7.950  71.416  1.00 10.66 ? 327 TYR A CA  1 
ATOM   2605  C C   . TYR A 1 327 ? 6.885   -7.441  72.538  1.00 10.38 ? 327 TYR A C   1 
ATOM   2606  O O   . TYR A 1 327 ? 6.686   -8.143  73.525  1.00 11.59 ? 327 TYR A O   1 
ATOM   2607  C CB  . TYR A 1 327 ? 9.243   -7.496  71.640  1.00 10.11 ? 327 TYR A CB  1 
ATOM   2608  C CG  . TYR A 1 327 ? 10.216  -8.203  70.726  1.00 10.31 ? 327 TYR A CG  1 
ATOM   2609  C CD1 . TYR A 1 327 ? 10.238  -9.584  70.657  1.00 9.34  ? 327 TYR A CD1 1 
ATOM   2610  C CD2 . TYR A 1 327 ? 11.115  -7.491  69.936  1.00 10.78 ? 327 TYR A CD2 1 
ATOM   2611  C CE1 . TYR A 1 327 ? 11.123  -10.248 69.806  1.00 10.65 ? 327 TYR A CE1 1 
ATOM   2612  C CE2 . TYR A 1 327 ? 11.995  -8.146  69.087  1.00 10.99 ? 327 TYR A CE2 1 
ATOM   2613  C CZ  . TYR A 1 327 ? 11.993  -9.531  69.030  1.00 11.16 ? 327 TYR A CZ  1 
ATOM   2614  O OH  . TYR A 1 327 ? 12.852  -10.203 68.189  1.00 11.47 ? 327 TYR A OH  1 
ATOM   2615  N N   . ILE A 1 328 ? 6.341   -6.240  72.398  1.00 10.08 ? 328 ILE A N   1 
ATOM   2616  C CA  . ILE A 1 328 ? 5.502   -5.677  73.443  1.00 10.51 ? 328 ILE A CA  1 
ATOM   2617  C C   . ILE A 1 328 ? 4.099   -6.281  73.454  1.00 10.99 ? 328 ILE A C   1 
ATOM   2618  O O   . ILE A 1 328 ? 3.647   -6.781  74.491  1.00 11.79 ? 328 ILE A O   1 
ATOM   2619  C CB  . ILE A 1 328 ? 5.419   -4.149  73.297  1.00 9.84  ? 328 ILE A CB  1 
ATOM   2620  C CG1 . ILE A 1 328 ? 6.790   -3.528  73.572  1.00 11.20 ? 328 ILE A CG1 1 
ATOM   2621  C CG2 . ILE A 1 328 ? 4.343   -3.573  74.215  1.00 10.42 ? 328 ILE A CG2 1 
ATOM   2622  C CD1 . ILE A 1 328 ? 6.915   -2.101  73.120  1.00 11.35 ? 328 ILE A CD1 1 
ATOM   2623  N N   . ASN A 1 329 ? 3.426   -6.246  72.315  1.00 11.53 ? 329 ASN A N   1 
ATOM   2624  C CA  . ASN A 1 329 ? 2.033   -6.670  72.245  1.00 12.52 ? 329 ASN A CA  1 
ATOM   2625  C C   . ASN A 1 329 ? 1.796   -8.163  71.984  1.00 12.77 ? 329 ASN A C   1 
ATOM   2626  O O   . ASN A 1 329 ? 0.706   -8.675  72.256  1.00 14.14 ? 329 ASN A O   1 
ATOM   2627  C CB  . ASN A 1 329 ? 1.301   -5.828  71.219  1.00 13.07 ? 329 ASN A CB  1 
ATOM   2628  C CG  . ASN A 1 329 ? 1.297   -4.358  71.566  1.00 11.84 ? 329 ASN A CG  1 
ATOM   2629  O OD1 . ASN A 1 329 ? 1.865   -3.562  70.841  1.00 11.06 ? 329 ASN A OD1 1 
ATOM   2630  N ND2 . ASN A 1 329 ? 0.641   -3.990  72.668  1.00 11.03 ? 329 ASN A ND2 1 
ATOM   2631  N N   . CYS A 1 330 ? 2.803   -8.877  71.497  1.00 12.83 ? 330 CYS A N   1 
ATOM   2632  C CA  . CYS A 1 330 ? 2.671   -10.314 71.355  1.00 13.06 ? 330 CYS A CA  1 
ATOM   2633  C C   . CYS A 1 330 ? 3.485   -11.068 72.416  1.00 12.89 ? 330 CYS A C   1 
ATOM   2634  O O   . CYS A 1 330 ? 2.937   -11.927 73.109  1.00 12.93 ? 330 CYS A O   1 
ATOM   2635  C CB  . CYS A 1 330 ? 3.008   -10.769 69.936  1.00 13.07 ? 330 CYS A CB  1 
ATOM   2636  S SG  . CYS A 1 330 ? 1.782   -10.152 68.750  1.00 15.85 ? 330 CYS A SG  1 
ATOM   2637  N N   . PHE A 1 331 ? 4.768   -10.760 72.561  1.00 12.00 ? 331 PHE A N   1 
ATOM   2638  C CA  . PHE A 1 331 ? 5.578   -11.496 73.524  1.00 12.64 ? 331 PHE A CA  1 
ATOM   2639  C C   . PHE A 1 331 ? 5.433   -10.959 74.954  1.00 12.15 ? 331 PHE A C   1 
ATOM   2640  O O   . PHE A 1 331 ? 5.840   -11.638 75.885  1.00 13.45 ? 331 PHE A O   1 
ATOM   2641  C CB  . PHE A 1 331 ? 7.057   -11.505 73.150  1.00 13.29 ? 331 PHE A CB  1 
ATOM   2642  C CG  . PHE A 1 331 ? 7.434   -12.528 72.111  1.00 14.18 ? 331 PHE A CG  1 
ATOM   2643  C CD1 . PHE A 1 331 ? 7.375   -12.223 70.760  1.00 13.77 ? 331 PHE A CD1 1 
ATOM   2644  C CD2 . PHE A 1 331 ? 7.897   -13.770 72.485  1.00 15.91 ? 331 PHE A CD2 1 
ATOM   2645  C CE1 . PHE A 1 331 ? 7.755   -13.158 69.795  1.00 13.95 ? 331 PHE A CE1 1 
ATOM   2646  C CE2 . PHE A 1 331 ? 8.280   -14.700 71.519  1.00 14.88 ? 331 PHE A CE2 1 
ATOM   2647  C CZ  . PHE A 1 331 ? 8.203   -14.389 70.185  1.00 14.99 ? 331 PHE A CZ  1 
ATOM   2648  N N   . GLY A 1 332 ? 4.889   -9.749  75.120  1.00 11.28 ? 332 GLY A N   1 
ATOM   2649  C CA  . GLY A 1 332 ? 4.674   -9.156  76.430  1.00 10.65 ? 332 GLY A CA  1 
ATOM   2650  C C   . GLY A 1 332 ? 5.925   -8.633  77.139  1.00 10.66 ? 332 GLY A C   1 
ATOM   2651  O O   . GLY A 1 332 ? 5.929   -8.510  78.376  1.00 10.66 ? 332 GLY A O   1 
ATOM   2652  N N   . CYS A 1 333 ? 6.973   -8.301  76.388  1.00 9.03  ? 333 CYS A N   1 
ATOM   2653  C CA  . CYS A 1 333 ? 8.199   -7.797  77.014  1.00 9.07  ? 333 CYS A CA  1 
ATOM   2654  C C   . CYS A 1 333 ? 7.972   -6.389  77.560  1.00 8.77  ? 333 CYS A C   1 
ATOM   2655  O O   . CYS A 1 333 ? 7.561   -5.512  76.815  1.00 7.95  ? 333 CYS A O   1 
ATOM   2656  C CB  . CYS A 1 333 ? 9.349   -7.772  76.023  1.00 9.45  ? 333 CYS A CB  1 
ATOM   2657  S SG  . CYS A 1 333 ? 9.693   -9.380  75.290  1.00 11.53 ? 333 CYS A SG  1 
ATOM   2658  N N   . GLU A 1 334 ? 8.243   -6.172  78.844  1.00 8.43  ? 334 GLU A N   1 
ATOM   2659  C CA  . GLU A 1 334 ? 8.055   -4.843  79.437  1.00 9.14  ? 334 GLU A CA  1 
ATOM   2660  C C   . GLU A 1 334 ? 9.126   -3.825  79.039  1.00 9.39  ? 334 GLU A C   1 
ATOM   2661  O O   . GLU A 1 334 ? 8.859   -2.614  79.062  1.00 10.07 ? 334 GLU A O   1 
ATOM   2662  C CB  . GLU A 1 334 ? 8.085   -4.906  80.956  1.00 9.24  ? 334 GLU A CB  1 
ATOM   2663  C CG  . GLU A 1 334 ? 6.885   -5.525  81.632  1.00 10.35 ? 334 GLU A CG  1 
ATOM   2664  C CD  . GLU A 1 334 ? 6.912   -5.303  83.135  1.00 11.08 ? 334 GLU A CD  1 
ATOM   2665  O OE1 . GLU A 1 334 ? 7.490   -4.277  83.570  1.00 12.21 ? 334 GLU A OE1 1 
ATOM   2666  O OE2 . GLU A 1 334 ? 6.366   -6.148  83.899  1.00 11.30 ? 334 GLU A OE2 1 
ATOM   2667  N N   . THR A 1 335 ? 10.327  -4.296  78.705  1.00 9.14  ? 335 THR A N   1 
ATOM   2668  C CA  . THR A 1 335 ? 11.446  -3.391  78.503  1.00 8.35  ? 335 THR A CA  1 
ATOM   2669  C C   . THR A 1 335 ? 12.126  -3.474  77.150  1.00 8.69  ? 335 THR A C   1 
ATOM   2670  O O   . THR A 1 335 ? 11.928  -4.400  76.365  1.00 8.64  ? 335 THR A O   1 
ATOM   2671  C CB  . THR A 1 335 ? 12.532  -3.562  79.618  1.00 7.89  ? 335 THR A CB  1 
ATOM   2672  O OG1 . THR A 1 335 ? 13.437  -4.642  79.315  1.00 6.13  ? 335 THR A OG1 1 
ATOM   2673  C CG2 . THR A 1 335 ? 11.923  -3.891  80.951  1.00 7.46  ? 335 THR A CG2 1 
ATOM   2674  N N   . HIS A 1 336 ? 12.926  -2.449  76.916  1.00 8.55  ? 336 HIS A N   1 
ATOM   2675  C CA  . HIS A 1 336 ? 13.716  -2.295  75.728  1.00 8.57  ? 336 HIS A CA  1 
ATOM   2676  C C   . HIS A 1 336 ? 15.070  -1.715  76.144  1.00 8.80  ? 336 HIS A C   1 
ATOM   2677  O O   . HIS A 1 336 ? 15.147  -0.593  76.673  1.00 9.14  ? 336 HIS A O   1 
ATOM   2678  C CB  . HIS A 1 336 ? 12.993  -1.389  74.729  1.00 8.73  ? 336 HIS A CB  1 
ATOM   2679  C CG  . HIS A 1 336 ? 13.734  -1.233  73.441  1.00 9.49  ? 336 HIS A CG  1 
ATOM   2680  N ND1 . HIS A 1 336 ? 13.723  -2.202  72.464  1.00 9.30  ? 336 HIS A ND1 1 
ATOM   2681  C CD2 . HIS A 1 336 ? 14.566  -0.260  73.003  1.00 9.63  ? 336 HIS A CD2 1 
ATOM   2682  C CE1 . HIS A 1 336 ? 14.505  -1.823  71.469  1.00 10.90 ? 336 HIS A CE1 1 
ATOM   2683  N NE2 . HIS A 1 336 ? 15.029  -0.648  71.766  1.00 9.27  ? 336 HIS A NE2 1 
ATOM   2684  N N   . ALA A 1 337 ? 16.137  -2.488  75.936  1.00 8.51  ? 337 ALA A N   1 
ATOM   2685  C CA  . ALA A 1 337 ? 17.485  -2.058  76.303  1.00 7.98  ? 337 ALA A CA  1 
ATOM   2686  C C   . ALA A 1 337 ? 18.217  -1.408  75.134  1.00 8.29  ? 337 ALA A C   1 
ATOM   2687  O O   . ALA A 1 337 ? 18.219  -1.948  74.040  1.00 8.92  ? 337 ALA A O   1 
ATOM   2688  C CB  . ALA A 1 337 ? 18.286  -3.234  76.794  1.00 7.72  ? 337 ALA A CB  1 
ATOM   2689  N N   . MET A 1 338 ? 18.854  -0.271  75.383  1.00 7.99  ? 338 MET A N   1 
ATOM   2690  C CA  . MET A 1 338 ? 19.644  0.428   74.366  1.00 8.19  ? 338 MET A CA  1 
ATOM   2691  C C   . MET A 1 338 ? 21.082  0.408   74.853  1.00 7.91  ? 338 MET A C   1 
ATOM   2692  O O   . MET A 1 338 ? 21.394  0.934   75.940  1.00 8.40  ? 338 MET A O   1 
ATOM   2693  C CB  . MET A 1 338 ? 19.087  1.846   74.162  1.00 8.14  ? 338 MET A CB  1 
ATOM   2694  C CG  . MET A 1 338 ? 17.704  1.773   73.528  1.00 11.24 ? 338 MET A CG  1 
ATOM   2695  S SD  . MET A 1 338 ? 16.819  3.295   73.239  1.00 14.48 ? 338 MET A SD  1 
ATOM   2696  C CE  . MET A 1 338 ? 17.843  3.980   71.902  1.00 14.84 ? 338 MET A CE  1 
ATOM   2697  N N   . LEU A 1 339 ? 21.954  -0.215  74.054  1.00 8.09  ? 339 LEU A N   1 
ATOM   2698  C CA  . LEU A 1 339 ? 23.303  -0.537  74.464  1.00 7.59  ? 339 LEU A CA  1 
ATOM   2699  C C   . LEU A 1 339 ? 24.346  -0.111  73.424  1.00 7.22  ? 339 LEU A C   1 
ATOM   2700  O O   . LEU A 1 339 ? 24.826  -0.926  72.649  1.00 7.00  ? 339 LEU A O   1 
ATOM   2701  C CB  . LEU A 1 339 ? 23.414  -2.065  74.725  1.00 7.60  ? 339 LEU A CB  1 
ATOM   2702  C CG  . LEU A 1 339 ? 22.368  -2.669  75.663  1.00 9.07  ? 339 LEU A CG  1 
ATOM   2703  C CD1 . LEU A 1 339 ? 22.398  -4.194  75.634  1.00 8.62  ? 339 LEU A CD1 1 
ATOM   2704  C CD2 . LEU A 1 339 ? 22.579  -2.111  77.081  1.00 8.99  ? 339 LEU A CD2 1 
ATOM   2705  N N   . PRO A 1 340 ? 24.696  1.166   73.420  1.00 7.38  ? 340 PRO A N   1 
ATOM   2706  C CA  . PRO A 1 340 ? 25.731  1.675   72.517  1.00 7.90  ? 340 PRO A CA  1 
ATOM   2707  C C   . PRO A 1 340 ? 27.129  1.321   73.002  1.00 7.83  ? 340 PRO A C   1 
ATOM   2708  O O   . PRO A 1 340 ? 27.465  1.606   74.157  1.00 9.02  ? 340 PRO A O   1 
ATOM   2709  C CB  . PRO A 1 340 ? 25.541  3.192   72.580  1.00 7.82  ? 340 PRO A CB  1 
ATOM   2710  C CG  . PRO A 1 340 ? 24.951  3.443   73.925  1.00 8.19  ? 340 PRO A CG  1 
ATOM   2711  C CD  . PRO A 1 340 ? 24.131  2.222   74.274  1.00 7.60  ? 340 PRO A CD  1 
ATOM   2712  N N   . TYR A 1 341 ? 27.939  0.728   72.132  1.00 7.71  ? 341 TYR A N   1 
ATOM   2713  C CA  . TYR A 1 341 ? 29.310  0.362   72.484  1.00 8.25  ? 341 TYR A CA  1 
ATOM   2714  C C   . TYR A 1 341 ? 30.181  1.558   72.159  1.00 7.83  ? 341 TYR A C   1 
ATOM   2715  O O   . TYR A 1 341 ? 30.947  1.573   71.213  1.00 8.79  ? 341 TYR A O   1 
ATOM   2716  C CB  . TYR A 1 341 ? 29.746  -0.910  71.754  1.00 8.37  ? 341 TYR A CB  1 
ATOM   2717  C CG  . TYR A 1 341 ? 29.340  -2.145  72.522  1.00 9.44  ? 341 TYR A CG  1 
ATOM   2718  C CD1 . TYR A 1 341 ? 28.013  -2.356  72.877  1.00 8.84  ? 341 TYR A CD1 1 
ATOM   2719  C CD2 . TYR A 1 341 ? 30.290  -3.060  72.956  1.00 9.90  ? 341 TYR A CD2 1 
ATOM   2720  C CE1 . TYR A 1 341 ? 27.639  -3.449  73.597  1.00 10.12 ? 341 TYR A CE1 1 
ATOM   2721  C CE2 . TYR A 1 341 ? 29.916  -4.171  73.694  1.00 9.36  ? 341 TYR A CE2 1 
ATOM   2722  C CZ  . TYR A 1 341 ? 28.595  -4.354  74.015  1.00 9.59  ? 341 TYR A CZ  1 
ATOM   2723  O OH  . TYR A 1 341 ? 28.199  -5.429  74.770  1.00 8.68  ? 341 TYR A OH  1 
ATOM   2724  N N   . ASP A 1 342 ? 29.999  2.596   72.954  1.00 8.51  ? 342 ASP A N   1 
ATOM   2725  C CA  . ASP A 1 342 ? 30.574  3.898   72.702  1.00 7.32  ? 342 ASP A CA  1 
ATOM   2726  C C   . ASP A 1 342 ? 30.389  4.734   73.952  1.00 7.72  ? 342 ASP A C   1 
ATOM   2727  O O   . ASP A 1 342 ? 29.260  5.048   74.372  1.00 7.32  ? 342 ASP A O   1 
ATOM   2728  C CB  . ASP A 1 342 ? 29.857  4.549   71.512  1.00 8.12  ? 342 ASP A CB  1 
ATOM   2729  C CG  . ASP A 1 342 ? 30.490  5.854   71.118  1.00 8.72  ? 342 ASP A CG  1 
ATOM   2730  O OD1 . ASP A 1 342 ? 31.406  5.839   70.264  1.00 8.45  ? 342 ASP A OD1 1 
ATOM   2731  O OD2 . ASP A 1 342 ? 30.141  6.935   71.646  1.00 10.31 ? 342 ASP A OD2 1 
ATOM   2732  N N   . GLN A 1 343 ? 31.510  5.069   74.571  1.00 8.18  ? 343 GLN A N   1 
ATOM   2733  C CA  . GLN A 1 343 ? 31.543  5.850   75.803  1.00 8.53  ? 343 GLN A CA  1 
ATOM   2734  C C   . GLN A 1 343 ? 31.039  7.283   75.606  1.00 8.72  ? 343 GLN A C   1 
ATOM   2735  O O   . GLN A 1 343 ? 30.404  7.863   76.499  1.00 7.94  ? 343 GLN A O   1 
ATOM   2736  C CB  . GLN A 1 343 ? 32.979  5.831   76.325  1.00 8.67  ? 343 GLN A CB  1 
ATOM   2737  C CG  . GLN A 1 343 ? 33.161  6.434   77.673  1.00 10.46 ? 343 GLN A CG  1 
ATOM   2738  C CD  . GLN A 1 343 ? 32.408  5.697   78.731  1.00 12.48 ? 343 GLN A CD  1 
ATOM   2739  O OE1 . GLN A 1 343 ? 32.221  4.456   78.648  1.00 9.70  ? 343 GLN A OE1 1 
ATOM   2740  N NE2 . GLN A 1 343 ? 31.960  6.444   79.748  1.00 13.67 ? 343 GLN A NE2 1 
ATOM   2741  N N   . TYR A 1 344 ? 31.313  7.860   74.443  1.00 8.23  ? 344 TYR A N   1 
ATOM   2742  C CA  . TYR A 1 344 ? 30.783  9.173   74.153  1.00 8.82  ? 344 TYR A CA  1 
ATOM   2743  C C   . TYR A 1 344 ? 29.250  9.152   74.203  1.00 8.34  ? 344 TYR A C   1 
ATOM   2744  O O   . TYR A 1 344 ? 28.639  10.140  74.630  1.00 9.25  ? 344 TYR A O   1 
ATOM   2745  C CB  . TYR A 1 344 ? 31.295  9.707   72.811  1.00 9.35  ? 344 TYR A CB  1 
ATOM   2746  C CG  . TYR A 1 344 ? 32.688  10.301  72.879  1.00 8.72  ? 344 TYR A CG  1 
ATOM   2747  C CD1 . TYR A 1 344 ? 33.623  10.042  71.893  1.00 10.32 ? 344 TYR A CD1 1 
ATOM   2748  C CD2 . TYR A 1 344 ? 33.060  11.136  73.934  1.00 10.25 ? 344 TYR A CD2 1 
ATOM   2749  C CE1 . TYR A 1 344 ? 34.897  10.596  71.955  1.00 10.07 ? 344 TYR A CE1 1 
ATOM   2750  C CE2 . TYR A 1 344 ? 34.314  11.691  74.003  1.00 10.63 ? 344 TYR A CE2 1 
ATOM   2751  C CZ  . TYR A 1 344 ? 35.229  11.425  73.017  1.00 9.90  ? 344 TYR A CZ  1 
ATOM   2752  O OH  . TYR A 1 344 ? 36.478  11.969  73.111  1.00 10.04 ? 344 TYR A OH  1 
ATOM   2753  N N   . LEU A 1 345 ? 28.641  8.019   73.831  1.00 8.90  ? 345 LEU A N   1 
ATOM   2754  C CA  . LEU A 1 345 ? 27.171  7.850   73.835  1.00 8.61  ? 345 LEU A CA  1 
ATOM   2755  C C   . LEU A 1 345 ? 26.651  7.365   75.182  1.00 8.97  ? 345 LEU A C   1 
ATOM   2756  O O   . LEU A 1 345 ? 25.585  6.754   75.273  1.00 9.05  ? 345 LEU A O   1 
ATOM   2757  C CB  . LEU A 1 345 ? 26.735  6.850   72.750  1.00 8.73  ? 345 LEU A CB  1 
ATOM   2758  C CG  . LEU A 1 345 ? 26.658  7.442   71.336  1.00 8.77  ? 345 LEU A CG  1 
ATOM   2759  C CD1 . LEU A 1 345 ? 26.424  6.356   70.309  1.00 11.26 ? 345 LEU A CD1 1 
ATOM   2760  C CD2 . LEU A 1 345 ? 25.569  8.524   71.229  1.00 9.31  ? 345 LEU A CD2 1 
ATOM   2761  N N   . HIS A 1 346 ? 27.395  7.645   76.239  1.00 9.48  ? 346 HIS A N   1 
ATOM   2762  C CA  . HIS A 1 346 ? 27.023  7.122   77.536  1.00 9.14  ? 346 HIS A CA  1 
ATOM   2763  C C   . HIS A 1 346 ? 25.681  7.642   78.057  1.00 9.12  ? 346 HIS A C   1 
ATOM   2764  O O   . HIS A 1 346 ? 25.132  7.055   78.963  1.00 9.12  ? 346 HIS A O   1 
ATOM   2765  C CB  . HIS A 1 346 ? 28.149  7.317   78.564  1.00 8.93  ? 346 HIS A CB  1 
ATOM   2766  C CG  . HIS A 1 346 ? 28.348  8.725   79.010  1.00 8.45  ? 346 HIS A CG  1 
ATOM   2767  N ND1 . HIS A 1 346 ? 28.140  9.125   80.315  1.00 7.63  ? 346 HIS A ND1 1 
ATOM   2768  C CD2 . HIS A 1 346 ? 28.816  9.810   78.351  1.00 8.43  ? 346 HIS A CD2 1 
ATOM   2769  C CE1 . HIS A 1 346 ? 28.431  10.408  80.430  1.00 8.46  ? 346 HIS A CE1 1 
ATOM   2770  N NE2 . HIS A 1 346 ? 28.842  10.847  79.254  1.00 9.00  ? 346 HIS A NE2 1 
ATOM   2771  N N   . ARG A 1 347 ? 25.161  8.732   77.495  1.00 8.32  ? 347 ARG A N   1 
ATOM   2772  C CA  . ARG A 1 347 ? 23.875  9.257   77.939  1.00 8.55  ? 347 ARG A CA  1 
ATOM   2773  C C   . ARG A 1 347 ? 22.746  9.117   76.904  1.00 8.98  ? 347 ARG A C   1 
ATOM   2774  O O   . ARG A 1 347 ? 21.678  9.724   77.045  1.00 9.63  ? 347 ARG A O   1 
ATOM   2775  C CB  . ARG A 1 347 ? 24.028  10.715  78.388  1.00 8.44  ? 347 ARG A CB  1 
ATOM   2776  C CG  . ARG A 1 347 ? 25.032  10.902  79.530  1.00 8.45  ? 347 ARG A CG  1 
ATOM   2777  C CD  . ARG A 1 347 ? 24.778  9.981   80.729  1.00 10.24 ? 347 ARG A CD  1 
ATOM   2778  N NE  . ARG A 1 347 ? 23.530  10.331  81.404  1.00 8.69  ? 347 ARG A NE  1 
ATOM   2779  C CZ  . ARG A 1 347 ? 22.872  9.548   82.243  1.00 10.20 ? 347 ARG A CZ  1 
ATOM   2780  N NH1 . ARG A 1 347 ? 21.766  9.985   82.831  1.00 9.59  ? 347 ARG A NH1 1 
ATOM   2781  N NH2 . ARG A 1 347 ? 23.313  8.332   82.512  1.00 11.34 ? 347 ARG A NH2 1 
ATOM   2782  N N   . PHE A 1 348 ? 22.973  8.266   75.916  1.00 9.39  ? 348 PHE A N   1 
ATOM   2783  C CA  . PHE A 1 348 ? 22.046  8.043   74.814  1.00 9.61  ? 348 PHE A CA  1 
ATOM   2784  C C   . PHE A 1 348 ? 20.795  7.298   75.290  1.00 9.60  ? 348 PHE A C   1 
ATOM   2785  O O   . PHE A 1 348 ? 19.677  7.683   74.977  1.00 8.35  ? 348 PHE A O   1 
ATOM   2786  C CB  . PHE A 1 348 ? 22.782  7.280   73.721  1.00 9.57  ? 348 PHE A CB  1 
ATOM   2787  C CG  . PHE A 1 348 ? 22.032  7.145   72.407  1.00 10.50 ? 348 PHE A CG  1 
ATOM   2788  C CD1 . PHE A 1 348 ? 21.935  8.203   71.516  1.00 11.36 ? 348 PHE A CD1 1 
ATOM   2789  C CD2 . PHE A 1 348 ? 21.495  5.914   72.036  1.00 12.43 ? 348 PHE A CD2 1 
ATOM   2790  C CE1 . PHE A 1 348 ? 21.290  8.045   70.294  1.00 11.61 ? 348 PHE A CE1 1 
ATOM   2791  C CE2 . PHE A 1 348 ? 20.844  5.762   70.826  1.00 12.13 ? 348 PHE A CE2 1 
ATOM   2792  C CZ  . PHE A 1 348 ? 20.739  6.822   69.957  1.00 11.90 ? 348 PHE A CZ  1 
ATOM   2793  N N   . ALA A 1 349 ? 20.997  6.239   76.057  1.00 9.71  ? 349 ALA A N   1 
ATOM   2794  C CA  . ALA A 1 349 ? 19.872  5.489   76.597  1.00 10.05 ? 349 ALA A CA  1 
ATOM   2795  C C   . ALA A 1 349 ? 19.039  6.364   77.532  1.00 9.03  ? 349 ALA A C   1 
ATOM   2796  O O   . ALA A 1 349 ? 17.809  6.356   77.458  1.00 7.86  ? 349 ALA A O   1 
ATOM   2797  C CB  . ALA A 1 349 ? 20.373  4.220   77.310  1.00 10.51 ? 349 ALA A CB  1 
ATOM   2798  N N   . ALA A 1 350 ? 19.702  7.156   78.376  1.00 8.87  ? 350 ALA A N   1 
ATOM   2799  C CA  . ALA A 1 350 ? 18.994  8.046   79.288  1.00 9.19  ? 350 ALA A CA  1 
ATOM   2800  C C   . ALA A 1 350 ? 18.132  9.054   78.534  1.00 9.28  ? 350 ALA A C   1 
ATOM   2801  O O   . ALA A 1 350 ? 16.999  9.364   78.936  1.00 9.02  ? 350 ALA A O   1 
ATOM   2802  C CB  . ALA A 1 350 ? 19.965  8.769   80.213  1.00 9.34  ? 350 ALA A CB  1 
ATOM   2803  N N   . TYR A 1 351 ? 18.654  9.545   77.424  1.00 9.57  ? 351 TYR A N   1 
ATOM   2804  C CA  . TYR A 1 351 ? 17.911  10.490  76.620  1.00 10.07 ? 351 TYR A CA  1 
ATOM   2805  C C   . TYR A 1 351 ? 16.625  9.850   76.126  1.00 10.69 ? 351 TYR A C   1 
ATOM   2806  O O   . TYR A 1 351 ? 15.552  10.434  76.220  1.00 10.03 ? 351 TYR A O   1 
ATOM   2807  C CB  . TYR A 1 351 ? 18.741  10.958  75.438  1.00 10.42 ? 351 TYR A CB  1 
ATOM   2808  C CG  . TYR A 1 351 ? 17.991  11.867  74.498  1.00 10.23 ? 351 TYR A CG  1 
ATOM   2809  C CD1 . TYR A 1 351 ? 17.813  13.214  74.789  1.00 11.17 ? 351 TYR A CD1 1 
ATOM   2810  C CD2 . TYR A 1 351 ? 17.445  11.374  73.333  1.00 10.21 ? 351 TYR A CD2 1 
ATOM   2811  C CE1 . TYR A 1 351 ? 17.140  14.041  73.929  1.00 11.25 ? 351 TYR A CE1 1 
ATOM   2812  C CE2 . TYR A 1 351 ? 16.767  12.203  72.455  1.00 11.47 ? 351 TYR A CE2 1 
ATOM   2813  C CZ  . TYR A 1 351 ? 16.622  13.535  72.752  1.00 11.38 ? 351 TYR A CZ  1 
ATOM   2814  O OH  . TYR A 1 351 ? 15.922  14.339  71.863  1.00 11.68 ? 351 TYR A OH  1 
ATOM   2815  N N   . PHE A 1 352 ? 16.725  8.640   75.604  1.00 11.10 ? 352 PHE A N   1 
ATOM   2816  C CA  . PHE A 1 352 ? 15.535  7.980   75.077  1.00 12.04 ? 352 PHE A CA  1 
ATOM   2817  C C   . PHE A 1 352 ? 14.542  7.464   76.128  1.00 12.99 ? 352 PHE A C   1 
ATOM   2818  O O   . PHE A 1 352 ? 13.385  7.155   75.798  1.00 11.82 ? 352 PHE A O   1 
ATOM   2819  C CB  . PHE A 1 352 ? 15.931  6.975   74.001  1.00 12.41 ? 352 PHE A CB  1 
ATOM   2820  C CG  . PHE A 1 352 ? 16.155  7.644   72.696  1.00 11.43 ? 352 PHE A CG  1 
ATOM   2821  C CD1 . PHE A 1 352 ? 17.416  7.783   72.162  1.00 13.41 ? 352 PHE A CD1 1 
ATOM   2822  C CD2 . PHE A 1 352 ? 15.084  8.246   72.055  1.00 12.32 ? 352 PHE A CD2 1 
ATOM   2823  C CE1 . PHE A 1 352 ? 17.589  8.450   70.990  1.00 11.94 ? 352 PHE A CE1 1 
ATOM   2824  C CE2 . PHE A 1 352 ? 15.255  8.926   70.873  1.00 13.36 ? 352 PHE A CE2 1 
ATOM   2825  C CZ  . PHE A 1 352 ? 16.506  9.018   70.339  1.00 12.65 ? 352 PHE A CZ  1 
ATOM   2826  N N   . GLN A 1 353 ? 14.970  7.442   77.392  1.00 13.83 ? 353 GLN A N   1 
ATOM   2827  C CA  . GLN A 1 353 ? 14.058  7.189   78.493  1.00 14.44 ? 353 GLN A CA  1 
ATOM   2828  C C   . GLN A 1 353 ? 12.998  8.259   78.523  1.00 14.63 ? 353 GLN A C   1 
ATOM   2829  O O   . GLN A 1 353 ? 11.839  7.931   78.786  1.00 16.00 ? 353 GLN A O   1 
ATOM   2830  C CB  . GLN A 1 353 ? 14.759  7.140   79.864  1.00 14.57 ? 353 GLN A CB  1 
ATOM   2831  C CG  . GLN A 1 353 ? 15.303  5.826   80.198  1.00 13.32 ? 353 GLN A CG  1 
ATOM   2832  C CD  . GLN A 1 353 ? 15.793  5.728   81.640  1.00 11.99 ? 353 GLN A CD  1 
ATOM   2833  O OE1 . GLN A 1 353 ? 16.154  6.730   82.259  1.00 10.64 ? 353 GLN A OE1 1 
ATOM   2834  N NE2 . GLN A 1 353 ? 15.834  4.514   82.152  1.00 7.33  ? 353 GLN A NE2 1 
ATOM   2835  N N   . GLN A 1 354 ? 13.361  9.532   78.289  1.00 13.70 ? 354 GLN A N   1 
ATOM   2836  C CA  . GLN A 1 354 ? 12.346  10.568  78.176  1.00 13.49 ? 354 GLN A CA  1 
ATOM   2837  C C   . GLN A 1 354 ? 11.675  10.498  76.823  1.00 12.82 ? 354 GLN A C   1 
ATOM   2838  O O   . GLN A 1 354 ? 10.449  10.489  76.720  1.00 13.46 ? 354 GLN A O   1 
ATOM   2839  C CB  . GLN A 1 354 ? 12.876  12.019  78.379  1.00 13.46 ? 354 GLN A CB  1 
ATOM   2840  C CG  . GLN A 1 354 ? 11.687  13.000  78.388  1.00 13.95 ? 354 GLN A CG  1 
ATOM   2841  C CD  . GLN A 1 354 ? 12.032  14.478  78.544  1.00 15.20 ? 354 GLN A CD  1 
ATOM   2842  O OE1 . GLN A 1 354 ? 11.122  15.300  78.683  1.00 17.67 ? 354 GLN A OE1 1 
ATOM   2843  N NE2 . GLN A 1 354 ? 13.314  14.814  78.519  1.00 13.34 ? 354 GLN A NE2 1 
ATOM   2844  N N   . GLY A 1 355 ? 12.485  10.464  75.771  1.00 11.90 ? 355 GLY A N   1 
ATOM   2845  C CA  . GLY A 1 355 ? 11.953  10.510  74.424  1.00 11.05 ? 355 GLY A CA  1 
ATOM   2846  C C   . GLY A 1 355 ? 10.923  9.432   74.185  1.00 10.69 ? 355 GLY A C   1 
ATOM   2847  O O   . GLY A 1 355 ? 9.877   9.701   73.614  1.00 10.20 ? 355 GLY A O   1 
ATOM   2848  N N   . ASP A 1 356 ? 11.243  8.211   74.604  1.00 8.97  ? 356 ASP A N   1 
ATOM   2849  C CA  . ASP A 1 356 ? 10.363  7.068   74.389  1.00 9.18  ? 356 ASP A CA  1 
ATOM   2850  C C   . ASP A 1 356 ? 9.278   7.031   75.480  1.00 8.49  ? 356 ASP A C   1 
ATOM   2851  O O   . ASP A 1 356 ? 8.100   7.183   75.189  1.00 7.52  ? 356 ASP A O   1 
ATOM   2852  C CB  . ASP A 1 356 ? 11.218  5.796   74.372  1.00 8.92  ? 356 ASP A CB  1 
ATOM   2853  C CG  . ASP A 1 356 ? 10.502  4.586   73.813  1.00 10.21 ? 356 ASP A CG  1 
ATOM   2854  O OD1 . ASP A 1 356 ? 9.264   4.460   74.001  1.00 8.63  ? 356 ASP A OD1 1 
ATOM   2855  O OD2 . ASP A 1 356 ? 11.136  3.716   73.172  1.00 8.89  ? 356 ASP A OD2 1 
ATOM   2856  N N   . MET A 1 357 ? 9.696   6.948   76.740  1.00 8.03  ? 357 MET A N   1 
ATOM   2857  C CA  . MET A 1 357 ? 8.747   6.739   77.839  1.00 8.69  ? 357 MET A CA  1 
ATOM   2858  C C   . MET A 1 357 ? 7.768   7.874   78.092  1.00 8.86  ? 357 MET A C   1 
ATOM   2859  O O   . MET A 1 357 ? 6.576   7.614   78.364  1.00 9.91  ? 357 MET A O   1 
ATOM   2860  C CB  . MET A 1 357 ? 9.484   6.369   79.129  1.00 8.90  ? 357 MET A CB  1 
ATOM   2861  C CG  . MET A 1 357 ? 10.351  5.102   78.971  1.00 8.50  ? 357 MET A CG  1 
ATOM   2862  S SD  . MET A 1 357 ? 11.350  4.705   80.403  1.00 9.60  ? 357 MET A SD  1 
ATOM   2863  C CE  . MET A 1 357 ? 10.111  4.228   81.508  1.00 8.37  ? 357 MET A CE  1 
ATOM   2864  N N   . GLU A 1 358 ? 8.227   9.121   77.994  1.00 8.82  ? 358 GLU A N   1 
ATOM   2865  C CA  . GLU A 1 358 ? 7.310   10.242  78.205  1.00 9.64  ? 358 GLU A CA  1 
ATOM   2866  C C   . GLU A 1 358 ? 6.383   10.431  77.006  1.00 9.48  ? 358 GLU A C   1 
ATOM   2867  O O   . GLU A 1 358 ? 5.312   11.032  77.124  1.00 9.66  ? 358 GLU A O   1 
ATOM   2868  C CB  . GLU A 1 358 ? 8.038   11.542  78.527  1.00 9.92  ? 358 GLU A CB  1 
ATOM   2869  C CG  . GLU A 1 358 ? 7.086   12.621  79.033  1.00 11.16 ? 358 GLU A CG  1 
ATOM   2870  C CD  . GLU A 1 358 ? 7.801   13.885  79.462  1.00 14.21 ? 358 GLU A CD  1 
ATOM   2871  O OE1 . GLU A 1 358 ? 8.327   14.586  78.583  1.00 13.53 ? 358 GLU A OE1 1 
ATOM   2872  O OE2 . GLU A 1 358 ? 7.830   14.155  80.683  1.00 16.62 ? 358 GLU A OE2 1 
ATOM   2873  N N   . SER A 1 359 ? 6.787   9.909   75.856  1.00 9.50  ? 359 SER A N   1 
ATOM   2874  C CA  . SER A 1 359 ? 5.938   9.972   74.667  1.00 10.03 ? 359 SER A CA  1 
ATOM   2875  C C   . SER A 1 359 ? 4.836   8.916   74.681  1.00 9.83  ? 359 SER A C   1 
ATOM   2876  O O   . SER A 1 359 ? 3.655   9.226   74.499  1.00 10.61 ? 359 SER A O   1 
ATOM   2877  C CB  . SER A 1 359 ? 6.774   9.768   73.404  1.00 9.48  ? 359 SER A CB  1 
ATOM   2878  O OG  . SER A 1 359 ? 7.536   10.924  73.100  1.00 11.72 ? 359 SER A OG  1 
ATOM   2879  N N   . ASN A 1 360 ? 5.240   7.669   74.900  1.00 9.97  ? 360 ASN A N   1 
ATOM   2880  C CA  . ASN A 1 360 ? 4.352   6.523   74.742  1.00 9.71  ? 360 ASN A CA  1 
ATOM   2881  C C   . ASN A 1 360 ? 3.919   5.805   76.009  1.00 9.95  ? 360 ASN A C   1 
ATOM   2882  O O   . ASN A 1 360 ? 3.225   4.798   75.925  1.00 9.66  ? 360 ASN A O   1 
ATOM   2883  C CB  . ASN A 1 360 ? 4.994   5.560   73.759  1.00 10.09 ? 360 ASN A CB  1 
ATOM   2884  C CG  . ASN A 1 360 ? 5.054   6.152   72.371  1.00 8.93  ? 360 ASN A CG  1 
ATOM   2885  O OD1 . ASN A 1 360 ? 4.471   7.209   72.144  1.00 11.45 ? 360 ASN A OD1 1 
ATOM   2886  N ND2 . ASN A 1 360 ? 5.719   5.478   71.434  1.00 8.75  ? 360 ASN A ND2 1 
ATOM   2887  N N   . GLY A 1 361 ? 4.320   6.327   77.168  1.00 9.60  ? 361 GLY A N   1 
ATOM   2888  C CA  . GLY A 1 361 ? 3.835   5.828   78.450  1.00 9.78  ? 361 GLY A CA  1 
ATOM   2889  C C   . GLY A 1 361 ? 2.459   6.429   78.691  1.00 10.18 ? 361 GLY A C   1 
ATOM   2890  O O   . GLY A 1 361 ? 2.285   7.339   79.500  1.00 10.15 ? 361 GLY A O   1 
ATOM   2891  N N   . LYS A 1 362 ? 1.481   5.918   77.946  1.00 10.61 ? 362 LYS A N   1 
ATOM   2892  C CA  . LYS A 1 362 ? 0.147   6.494   77.844  1.00 11.28 ? 362 LYS A CA  1 
ATOM   2893  C C   . LYS A 1 362 ? -0.892  5.395   77.936  1.00 11.32 ? 362 LYS A C   1 
ATOM   2894  O O   . LYS A 1 362 ? -0.565  4.226   77.743  1.00 10.55 ? 362 LYS A O   1 
ATOM   2895  C CB  . LYS A 1 362 ? -0.013  7.185   76.474  1.00 11.04 ? 362 LYS A CB  1 
ATOM   2896  C CG  . LYS A 1 362 ? 0.997   8.305   76.212  1.00 12.52 ? 362 LYS A CG  1 
ATOM   2897  C CD  . LYS A 1 362 ? 0.641   9.564   76.977  1.00 9.87  ? 362 LYS A CD  1 
ATOM   2898  C CE  . LYS A 1 362 ? 1.806   10.526  77.073  1.00 10.59 ? 362 LYS A CE  1 
ATOM   2899  N NZ  . LYS A 1 362 ? 2.146   11.184  75.764  1.00 7.69  ? 362 LYS A NZ  1 
ATOM   2900  N N   . TYR A 1 363 ? -2.143  5.756   78.220  1.00 12.21 ? 363 TYR A N   1 
ATOM   2901  C CA  . TYR A 1 363 ? -3.175  4.735   78.337  1.00 12.61 ? 363 TYR A CA  1 
ATOM   2902  C C   . TYR A 1 363 ? -4.547  5.129   77.800  1.00 13.69 ? 363 TYR A C   1 
ATOM   2903  O O   . TYR A 1 363 ? -5.461  4.303   77.829  1.00 14.10 ? 363 TYR A O   1 
ATOM   2904  C CB  . TYR A 1 363 ? -3.256  4.215   79.780  1.00 13.01 ? 363 TYR A CB  1 
ATOM   2905  C CG  . TYR A 1 363 ? -4.072  5.042   80.734  1.00 12.97 ? 363 TYR A CG  1 
ATOM   2906  C CD1 . TYR A 1 363 ? -5.196  4.499   81.351  1.00 14.26 ? 363 TYR A CD1 1 
ATOM   2907  C CD2 . TYR A 1 363 ? -3.712  6.340   81.053  1.00 13.11 ? 363 TYR A CD2 1 
ATOM   2908  C CE1 . TYR A 1 363 ? -5.951  5.230   82.223  1.00 15.46 ? 363 TYR A CE1 1 
ATOM   2909  C CE2 . TYR A 1 363 ? -4.465  7.087   81.943  1.00 14.79 ? 363 TYR A CE2 1 
ATOM   2910  C CZ  . TYR A 1 363 ? -5.596  6.520   82.515  1.00 16.19 ? 363 TYR A CZ  1 
ATOM   2911  O OH  . TYR A 1 363 ? -6.371  7.222   83.401  1.00 16.67 ? 363 TYR A OH  1 
ATOM   2912  N N   . ILE A 1 364 ? -4.673  6.358   77.289  1.00 13.71 ? 364 ILE A N   1 
ATOM   2913  C CA  . ILE A 1 364 ? -5.907  6.844   76.679  1.00 13.83 ? 364 ILE A CA  1 
ATOM   2914  C C   . ILE A 1 364 ? -5.730  7.036   75.170  1.00 13.98 ? 364 ILE A C   1 
ATOM   2915  O O   . ILE A 1 364 ? -4.786  7.695   74.721  1.00 14.10 ? 364 ILE A O   1 
ATOM   2916  C CB  . ILE A 1 364 ? -6.369  8.157   77.342  1.00 14.08 ? 364 ILE A CB  1 
ATOM   2917  C CG1 . ILE A 1 364 ? -6.523  7.991   78.856  1.00 13.88 ? 364 ILE A CG1 1 
ATOM   2918  C CG2 . ILE A 1 364 ? -7.692  8.617   76.753  1.00 13.90 ? 364 ILE A CG2 1 
ATOM   2919  C CD1 . ILE A 1 364 ? -7.480  6.869   79.288  1.00 13.88 ? 364 ILE A CD1 1 
ATOM   2920  N N   . THR A 1 365 ? -6.635  6.456   74.380  1.00 14.24 ? 365 THR A N   1 
ATOM   2921  C CA  . THR A 1 365 ? -6.564  6.555   72.923  1.00 14.61 ? 365 THR A CA  1 
ATOM   2922  C C   . THR A 1 365 ? -7.212  7.817   72.379  1.00 15.19 ? 365 THR A C   1 
ATOM   2923  O O   . THR A 1 365 ? -7.858  8.573   73.095  1.00 14.68 ? 365 THR A O   1 
ATOM   2924  C CB  . THR A 1 365 ? -7.191  5.329   72.223  1.00 14.72 ? 365 THR A CB  1 
ATOM   2925  O OG1 . THR A 1 365 ? -8.589  5.216   72.532  1.00 14.28 ? 365 THR A OG1 1 
ATOM   2926  C CG2 . THR A 1 365 ? -6.590  4.058   72.752  1.00 14.87 ? 365 THR A CG2 1 
ATOM   2927  N N   . LYS A 1 366 ? -7.016  8.024   71.092  1.00 16.42 ? 366 LYS A N   1 
ATOM   2928  C CA  . LYS A 1 366 ? -7.520  9.202   70.405  1.00 18.47 ? 366 LYS A CA  1 
ATOM   2929  C C   . LYS A 1 366 ? -9.010  9.426   70.651  1.00 18.63 ? 366 LYS A C   1 
ATOM   2930  O O   . LYS A 1 366 ? -9.460  10.564  70.773  1.00 18.90 ? 366 LYS A O   1 
ATOM   2931  C CB  . LYS A 1 366 ? -7.262  9.080   68.913  1.00 18.73 ? 366 LYS A CB  1 
ATOM   2932  C CG  . LYS A 1 366 ? -7.515  10.370  68.164  1.00 21.90 ? 366 LYS A CG  1 
ATOM   2933  C CD  . LYS A 1 366 ? -6.954  10.338  66.748  1.00 24.82 ? 366 LYS A CD  1 
ATOM   2934  C CE  . LYS A 1 366 ? -7.191  11.682  66.070  1.00 26.48 ? 366 LYS A CE  1 
ATOM   2935  N NZ  . LYS A 1 366 ? -6.589  11.817  64.712  1.00 29.71 ? 366 LYS A NZ  1 
ATOM   2936  N N   . SER A 1 367 ? -9.764  8.345   70.736  1.00 18.80 ? 367 SER A N   1 
ATOM   2937  C CA  . SER A 1 367 ? -11.201 8.441   70.915  1.00 19.81 ? 367 SER A CA  1 
ATOM   2938  C C   . SER A 1 367 ? -11.610 8.627   72.391  1.00 19.73 ? 367 SER A C   1 
ATOM   2939  O O   . SER A 1 367 ? -12.790 8.800   72.703  1.00 19.90 ? 367 SER A O   1 
ATOM   2940  C CB  . SER A 1 367 ? -11.849 7.196   70.338  1.00 19.96 ? 367 SER A CB  1 
ATOM   2941  O OG  . SER A 1 367 ? -11.492 6.086   71.129  1.00 22.49 ? 367 SER A OG  1 
ATOM   2942  N N   . GLY A 1 368 ? -10.642 8.627   73.304  1.00 19.18 ? 368 GLY A N   1 
ATOM   2943  C CA  . GLY A 1 368 ? -10.964 8.832   74.704  1.00 19.11 ? 368 GLY A CA  1 
ATOM   2944  C C   . GLY A 1 368 ? -11.145 7.534   75.455  1.00 19.24 ? 368 GLY A C   1 
ATOM   2945  O O   . GLY A 1 368 ? -11.376 7.555   76.658  1.00 19.31 ? 368 GLY A O   1 
ATOM   2946  N N   . THR A 1 369 ? -11.038 6.429   74.717  1.00 19.62 ? 369 THR A N   1 
ATOM   2947  C CA  . THR A 1 369 ? -11.130 5.055   75.207  1.00 20.65 ? 369 THR A CA  1 
ATOM   2948  C C   . THR A 1 369 ? -9.818  4.581   75.820  1.00 19.99 ? 369 THR A C   1 
ATOM   2949  O O   . THR A 1 369 ? -8.751  4.817   75.254  1.00 18.64 ? 369 THR A O   1 
ATOM   2950  C CB  . THR A 1 369 ? -11.410 4.129   74.004  1.00 20.61 ? 369 THR A CB  1 
ATOM   2951  O OG1 . THR A 1 369 ? -12.714 4.382   73.481  1.00 23.88 ? 369 THR A OG1 1 
ATOM   2952  C CG2 . THR A 1 369 ? -11.472 2.699   74.426  1.00 22.79 ? 369 THR A CG2 1 
ATOM   2953  N N   . ARG A 1 370 ? -9.902  3.907   76.963  1.00 19.41 ? 370 ARG A N   1 
ATOM   2954  C CA  . ARG A 1 370 ? -8.716  3.356   77.594  1.00 19.42 ? 370 ARG A CA  1 
ATOM   2955  C C   . ARG A 1 370 ? -8.158  2.236   76.724  1.00 18.78 ? 370 ARG A C   1 
ATOM   2956  O O   . ARG A 1 370 ? -8.922  1.477   76.110  1.00 18.12 ? 370 ARG A O   1 
ATOM   2957  C CB  . ARG A 1 370 ? -9.038  2.824   78.994  1.00 20.00 ? 370 ARG A CB  1 
ATOM   2958  C CG  . ARG A 1 370 ? -7.809  2.476   79.827  1.00 21.90 ? 370 ARG A CG  1 
ATOM   2959  C CD  . ARG A 1 370 ? -8.112  1.658   81.080  1.00 24.99 ? 370 ARG A CD  1 
ATOM   2960  N NE  . ARG A 1 370 ? -6.979  1.535   82.004  1.00 26.72 ? 370 ARG A NE  1 
ATOM   2961  C CZ  . ARG A 1 370 ? -5.847  0.877   81.760  1.00 27.81 ? 370 ARG A CZ  1 
ATOM   2962  N NH1 . ARG A 1 370 ? -5.637  0.273   80.591  1.00 28.16 ? 370 ARG A NH1 1 
ATOM   2963  N NH2 . ARG A 1 370 ? -4.910  0.833   82.694  1.00 27.21 ? 370 ARG A NH2 1 
ATOM   2964  N N   . VAL A 1 371 ? -6.830  2.156   76.627  1.00 16.87 ? 371 VAL A N   1 
ATOM   2965  C CA  . VAL A 1 371 ? -6.218  1.042   75.926  1.00 16.08 ? 371 VAL A CA  1 
ATOM   2966  C C   . VAL A 1 371 ? -6.532  -0.259  76.669  1.00 15.79 ? 371 VAL A C   1 
ATOM   2967  O O   . VAL A 1 371 ? -6.741  -0.247  77.895  1.00 15.54 ? 371 VAL A O   1 
ATOM   2968  C CB  . VAL A 1 371 ? -4.677  1.163   75.825  1.00 16.25 ? 371 VAL A CB  1 
ATOM   2969  C CG1 . VAL A 1 371 ? -4.274  2.399   75.019  1.00 15.85 ? 371 VAL A CG1 1 
ATOM   2970  C CG2 . VAL A 1 371 ? -4.036  1.157   77.213  1.00 14.93 ? 371 VAL A CG2 1 
ATOM   2971  N N   . ASP A 1 372 ? -6.579  -1.367  75.934  1.00 15.24 ? 372 ASP A N   1 
ATOM   2972  C CA  . ASP A 1 372 ? -6.699  -2.700  76.541  1.00 15.44 ? 372 ASP A CA  1 
ATOM   2973  C C   . ASP A 1 372 ? -5.555  -3.600  76.058  1.00 15.11 ? 372 ASP A C   1 
ATOM   2974  O O   . ASP A 1 372 ? -5.716  -4.807  75.831  1.00 13.57 ? 372 ASP A O   1 
ATOM   2975  C CB  . ASP A 1 372 ? -8.055  -3.332  76.247  1.00 16.83 ? 372 ASP A CB  1 
ATOM   2976  C CG  . ASP A 1 372 ? -8.266  -3.606  74.779  1.00 17.82 ? 372 ASP A CG  1 
ATOM   2977  O OD1 . ASP A 1 372 ? -7.626  -2.924  73.934  1.00 17.60 ? 372 ASP A OD1 1 
ATOM   2978  O OD2 . ASP A 1 372 ? -9.060  -4.488  74.394  1.00 19.07 ? 372 ASP A OD2 1 
ATOM   2979  N N   . HIS A 1 373 ? -4.381  -2.977  75.932  1.00 13.94 ? 373 HIS A N   1 
ATOM   2980  C CA  . HIS A 1 373 ? -3.160  -3.625  75.482  1.00 13.01 ? 373 HIS A CA  1 
ATOM   2981  C C   . HIS A 1 373 ? -2.011  -2.810  76.062  1.00 12.33 ? 373 HIS A C   1 
ATOM   2982  O O   . HIS A 1 373 ? -2.236  -1.730  76.587  1.00 12.17 ? 373 HIS A O   1 
ATOM   2983  C CB  . HIS A 1 373 ? -3.068  -3.623  73.958  1.00 13.16 ? 373 HIS A CB  1 
ATOM   2984  C CG  . HIS A 1 373 ? -3.305  -2.277  73.338  1.00 13.84 ? 373 HIS A CG  1 
ATOM   2985  N ND1 . HIS A 1 373 ? -2.311  -1.332  73.207  1.00 12.06 ? 373 HIS A ND1 1 
ATOM   2986  C CD2 . HIS A 1 373 ? -4.421  -1.726  72.797  1.00 14.16 ? 373 HIS A CD2 1 
ATOM   2987  C CE1 . HIS A 1 373 ? -2.806  -0.249  72.634  1.00 13.10 ? 373 HIS A CE1 1 
ATOM   2988  N NE2 . HIS A 1 373 ? -4.087  -0.459  72.374  1.00 13.70 ? 373 HIS A NE2 1 
ATOM   2989  N N   . GLN A 1 374 ? -0.792  -3.317  75.960  1.00 11.74 ? 374 GLN A N   1 
ATOM   2990  C CA  . GLN A 1 374 ? 0.379   -2.575  76.442  1.00 11.12 ? 374 GLN A CA  1 
ATOM   2991  C C   . GLN A 1 374 ? 0.705   -1.402  75.513  1.00 10.93 ? 374 GLN A C   1 
ATOM   2992  O O   . GLN A 1 374 ? 0.358   -1.411  74.320  1.00 10.39 ? 374 GLN A O   1 
ATOM   2993  C CB  . GLN A 1 374 ? 1.591   -3.505  76.522  1.00 10.97 ? 374 GLN A CB  1 
ATOM   2994  C CG  . GLN A 1 374 ? 1.564   -4.512  77.686  1.00 12.11 ? 374 GLN A CG  1 
ATOM   2995  C CD  . GLN A 1 374 ? 1.611   -3.832  79.022  1.00 13.37 ? 374 GLN A CD  1 
ATOM   2996  O OE1 . GLN A 1 374 ? 2.358   -2.878  79.193  1.00 12.72 ? 374 GLN A OE1 1 
ATOM   2997  N NE2 . GLN A 1 374 ? 0.818   -4.313  79.982  1.00 15.30 ? 374 GLN A NE2 1 
ATOM   2998  N N   . THR A 1 375 ? 1.349   -0.385  76.076  1.00 11.03 ? 375 THR A N   1 
ATOM   2999  C CA  . THR A 1 375 ? 1.890   0.707   75.291  1.00 10.62 ? 375 THR A CA  1 
ATOM   3000  C C   . THR A 1 375 ? 3.405   0.725   75.536  1.00 10.62 ? 375 THR A C   1 
ATOM   3001  O O   . THR A 1 375 ? 4.030   -0.328  75.597  1.00 8.29  ? 375 THR A O   1 
ATOM   3002  C CB  . THR A 1 375 ? 1.221   2.052   75.602  1.00 11.42 ? 375 THR A CB  1 
ATOM   3003  O OG1 . THR A 1 375 ? 1.266   2.319   77.018  1.00 10.35 ? 375 THR A OG1 1 
ATOM   3004  C CG2 . THR A 1 375 ? -0.274  1.981   75.217  1.00 11.16 ? 375 THR A CG2 1 
ATOM   3005  N N   . GLY A 1 376 ? 3.982   1.912   75.679  1.00 9.91  ? 376 GLY A N   1 
ATOM   3006  C CA  . GLY A 1 376 ? 5.422   2.056   75.689  1.00 9.94  ? 376 GLY A CA  1 
ATOM   3007  C C   . GLY A 1 376 ? 6.139   1.189   76.693  1.00 9.33  ? 376 GLY A C   1 
ATOM   3008  O O   . GLY A 1 376 ? 5.623   0.930   77.779  1.00 8.93  ? 376 GLY A O   1 
ATOM   3009  N N   . PRO A 1 377 ? 7.337   0.747   76.333  1.00 8.59  ? 377 PRO A N   1 
ATOM   3010  C CA  . PRO A 1 377 ? 8.155   -0.061  77.234  1.00 8.56  ? 377 PRO A CA  1 
ATOM   3011  C C   . PRO A 1 377 ? 9.050   0.785   78.123  1.00 8.76  ? 377 PRO A C   1 
ATOM   3012  O O   . PRO A 1 377 ? 9.201   1.992   77.909  1.00 8.89  ? 377 PRO A O   1 
ATOM   3013  C CB  . PRO A 1 377 ? 9.044   -0.817  76.257  1.00 8.53  ? 377 PRO A CB  1 
ATOM   3014  C CG  . PRO A 1 377 ? 9.384   0.292   75.274  1.00 7.70  ? 377 PRO A CG  1 
ATOM   3015  C CD  . PRO A 1 377 ? 8.028   0.943   75.040  1.00 8.57  ? 377 PRO A CD  1 
ATOM   3016  N N   . ILE A 1 378 ? 9.605   0.130   79.133  1.00 8.81  ? 378 ILE A N   1 
ATOM   3017  C CA  . ILE A 1 378 ? 10.601  0.731   80.001  1.00 9.31  ? 378 ILE A CA  1 
ATOM   3018  C C   . ILE A 1 378 ? 11.946  0.639   79.279  1.00 8.76  ? 378 ILE A C   1 
ATOM   3019  O O   . ILE A 1 378 ? 12.427  -0.455  78.991  1.00 8.42  ? 378 ILE A O   1 
ATOM   3020  C CB  . ILE A 1 378 ? 10.624  0.002   81.327  1.00 9.10  ? 378 ILE A CB  1 
ATOM   3021  C CG1 . ILE A 1 378 ? 9.322   0.291   82.091  1.00 9.95  ? 378 ILE A CG1 1 
ATOM   3022  C CG2 . ILE A 1 378 ? 11.834  0.397   82.148  1.00 9.44  ? 378 ILE A CG2 1 
ATOM   3023  C CD1 . ILE A 1 378 ? 9.012   -0.723  83.094  1.00 11.64 ? 378 ILE A CD1 1 
ATOM   3024  N N   . VAL A 1 379 ? 12.499  1.802   78.931  1.00 8.36  ? 379 VAL A N   1 
ATOM   3025  C CA  . VAL A 1 379 ? 13.772  1.887   78.229  1.00 8.43  ? 379 VAL A CA  1 
ATOM   3026  C C   . VAL A 1 379 ? 14.888  2.067   79.256  1.00 8.07  ? 379 VAL A C   1 
ATOM   3027  O O   . VAL A 1 379 ? 14.761  2.854   80.223  1.00 8.25  ? 379 VAL A O   1 
ATOM   3028  C CB  . VAL A 1 379 ? 13.773  3.055   77.199  1.00 8.41  ? 379 VAL A CB  1 
ATOM   3029  C CG1 . VAL A 1 379 ? 15.141  3.264   76.545  1.00 8.59  ? 379 VAL A CG1 1 
ATOM   3030  C CG2 . VAL A 1 379 ? 12.719  2.825   76.141  1.00 7.82  ? 379 VAL A CG2 1 
ATOM   3031  N N   . TRP A 1 380 ? 15.973  1.340   79.037  1.00 8.24  ? 380 TRP A N   1 
ATOM   3032  C CA  . TRP A 1 380 ? 17.118  1.345   79.936  1.00 7.93  ? 380 TRP A CA  1 
ATOM   3033  C C   . TRP A 1 380 ? 18.382  0.869   79.216  1.00 8.57  ? 380 TRP A C   1 
ATOM   3034  O O   . TRP A 1 380 ? 18.306  0.372   78.094  1.00 9.25  ? 380 TRP A O   1 
ATOM   3035  C CB  . TRP A 1 380 ? 16.842  0.447   81.156  1.00 8.35  ? 380 TRP A CB  1 
ATOM   3036  C CG  . TRP A 1 380 ? 16.692  -1.029  80.815  1.00 7.32  ? 380 TRP A CG  1 
ATOM   3037  C CD1 . TRP A 1 380 ? 15.635  -1.636  80.208  1.00 6.09  ? 380 TRP A CD1 1 
ATOM   3038  C CD2 . TRP A 1 380 ? 17.642  -2.063  81.081  1.00 8.09  ? 380 TRP A CD2 1 
ATOM   3039  N NE1 . TRP A 1 380 ? 15.877  -2.985  80.060  1.00 6.13  ? 380 TRP A NE1 1 
ATOM   3040  C CE2 . TRP A 1 380 ? 17.105  -3.270  80.596  1.00 7.21  ? 380 TRP A CE2 1 
ATOM   3041  C CE3 . TRP A 1 380 ? 18.895  -2.094  81.705  1.00 10.06 ? 380 TRP A CE3 1 
ATOM   3042  C CZ2 . TRP A 1 380 ? 17.782  -4.466  80.685  1.00 7.41  ? 380 TRP A CZ2 1 
ATOM   3043  C CZ3 . TRP A 1 380 ? 19.563  -3.278  81.788  1.00 10.34 ? 380 TRP A CZ3 1 
ATOM   3044  C CH2 . TRP A 1 380 ? 19.011  -4.454  81.290  1.00 8.02  ? 380 TRP A CH2 1 
ATOM   3045  N N   . GLY A 1 381 ? 19.536  1.029   79.876  1.00 8.21  ? 381 GLY A N   1 
ATOM   3046  C CA  . GLY A 1 381 ? 20.807  0.575   79.362  1.00 9.13  ? 381 GLY A CA  1 
ATOM   3047  C C   . GLY A 1 381 ? 22.003  1.385   79.847  1.00 8.90  ? 381 GLY A C   1 
ATOM   3048  O O   . GLY A 1 381 ? 21.840  2.446   80.428  1.00 8.82  ? 381 GLY A O   1 
ATOM   3049  N N   . GLU A 1 382 ? 23.200  0.861   79.588  1.00 9.52  ? 382 GLU A N   1 
ATOM   3050  C CA  . GLU A 1 382 ? 24.468  1.558   79.805  1.00 9.65  ? 382 GLU A CA  1 
ATOM   3051  C C   . GLU A 1 382 ? 25.323  1.224   78.587  1.00 10.06 ? 382 GLU A C   1 
ATOM   3052  O O   . GLU A 1 382 ? 25.077  0.220   77.922  1.00 9.19  ? 382 GLU A O   1 
ATOM   3053  C CB  . GLU A 1 382 ? 25.197  1.081   81.065  1.00 9.56  ? 382 GLU A CB  1 
ATOM   3054  C CG  . GLU A 1 382 ? 24.625  1.547   82.392  1.00 9.55  ? 382 GLU A CG  1 
ATOM   3055  C CD  . GLU A 1 382 ? 24.779  3.033   82.626  1.00 10.66 ? 382 GLU A CD  1 
ATOM   3056  O OE1 . GLU A 1 382 ? 24.035  3.597   83.460  1.00 13.00 ? 382 GLU A OE1 1 
ATOM   3057  O OE2 . GLU A 1 382 ? 25.636  3.638   81.979  1.00 11.34 ? 382 GLU A OE2 1 
ATOM   3058  N N   . PRO A 1 383 ? 26.312  2.046   78.263  1.00 10.34 ? 383 PRO A N   1 
ATOM   3059  C CA  . PRO A 1 383 ? 27.178  1.721   77.123  1.00 10.63 ? 383 PRO A CA  1 
ATOM   3060  C C   . PRO A 1 383 ? 28.036  0.489   77.352  1.00 9.84  ? 383 PRO A C   1 
ATOM   3061  O O   . PRO A 1 383 ? 28.420  0.175   78.482  1.00 9.74  ? 383 PRO A O   1 
ATOM   3062  C CB  . PRO A 1 383 ? 28.091  2.946   77.004  1.00 10.44 ? 383 PRO A CB  1 
ATOM   3063  C CG  . PRO A 1 383 ? 28.092  3.554   78.385  1.00 11.47 ? 383 PRO A CG  1 
ATOM   3064  C CD  . PRO A 1 383 ? 26.718  3.293   78.936  1.00 10.60 ? 383 PRO A CD  1 
ATOM   3065  N N   . GLY A 1 384 ? 28.320  -0.227  76.275  1.00 10.38 ? 384 GLY A N   1 
ATOM   3066  C CA  . GLY A 1 384 ? 29.241  -1.347  76.332  1.00 10.07 ? 384 GLY A CA  1 
ATOM   3067  C C   . GLY A 1 384 ? 30.657  -0.788  76.268  1.00 10.07 ? 384 GLY A C   1 
ATOM   3068  O O   . GLY A 1 384 ? 30.863  0.244   75.645  1.00 9.43  ? 384 GLY A O   1 
ATOM   3069  N N   . THR A 1 385 ? 31.630  -1.443  76.896  1.00 10.75 ? 385 THR A N   1 
ATOM   3070  C CA  . THR A 1 385 ? 31.418  -2.679  77.646  1.00 11.20 ? 385 THR A CA  1 
ATOM   3071  C C   . THR A 1 385 ? 30.994  -2.498  79.111  1.00 11.54 ? 385 THR A C   1 
ATOM   3072  O O   . THR A 1 385 ? 30.868  -3.488  79.820  1.00 11.02 ? 385 THR A O   1 
ATOM   3073  C CB  . THR A 1 385 ? 32.696  -3.562  77.629  1.00 11.60 ? 385 THR A CB  1 
ATOM   3074  O OG1 . THR A 1 385 ? 33.850  -2.808  78.064  1.00 11.69 ? 385 THR A OG1 1 
ATOM   3075  C CG2 . THR A 1 385 ? 33.019  -4.032  76.240  1.00 11.09 ? 385 THR A CG2 1 
ATOM   3076  N N   . ASN A 1 386 ? 30.782  -1.263  79.572  1.00 12.60 ? 386 ASN A N   1 
ATOM   3077  C CA  . ASN A 1 386 ? 30.371  -1.038  80.955  1.00 12.99 ? 386 ASN A CA  1 
ATOM   3078  C C   . ASN A 1 386 ? 29.135  -1.868  81.359  1.00 13.34 ? 386 ASN A C   1 
ATOM   3079  O O   . ASN A 1 386 ? 29.180  -2.618  82.339  1.00 12.97 ? 386 ASN A O   1 
ATOM   3080  C CB  . ASN A 1 386 ? 30.094  0.460   81.237  1.00 13.93 ? 386 ASN A CB  1 
ATOM   3081  C CG  . ASN A 1 386 ? 31.280  1.364   80.901  1.00 15.93 ? 386 ASN A CG  1 
ATOM   3082  O OD1 . ASN A 1 386 ? 32.407  0.890   80.744  1.00 19.58 ? 386 ASN A OD1 1 
ATOM   3083  N ND2 . ASN A 1 386 ? 31.022  2.687   80.767  1.00 16.29 ? 386 ASN A ND2 1 
ATOM   3084  N N   . GLY A 1 387 ? 28.040  -1.765  80.603  1.00 13.00 ? 387 GLY A N   1 
ATOM   3085  C CA  . GLY A 1 387 ? 26.835  -2.500  80.968  1.00 13.01 ? 387 GLY A CA  1 
ATOM   3086  C C   . GLY A 1 387 ? 27.044  -3.997  80.867  1.00 12.75 ? 387 GLY A C   1 
ATOM   3087  O O   . GLY A 1 387 ? 26.477  -4.785  81.617  1.00 12.64 ? 387 GLY A O   1 
ATOM   3088  N N   . GLN A 1 388 ? 27.879  -4.379  79.910  1.00 13.00 ? 388 GLN A N   1 
ATOM   3089  C CA  . GLN A 1 388 ? 28.228  -5.765  79.676  1.00 12.40 ? 388 GLN A CA  1 
ATOM   3090  C C   . GLN A 1 388 ? 28.803  -6.411  80.936  1.00 12.67 ? 388 GLN A C   1 
ATOM   3091  O O   . GLN A 1 388 ? 28.503  -7.573  81.233  1.00 12.99 ? 388 GLN A O   1 
ATOM   3092  C CB  . GLN A 1 388 ? 29.205  -5.847  78.485  1.00 12.87 ? 388 GLN A CB  1 
ATOM   3093  C CG  . GLN A 1 388 ? 29.621  -7.259  78.068  1.00 11.79 ? 388 GLN A CG  1 
ATOM   3094  C CD  . GLN A 1 388 ? 30.604  -7.246  76.915  1.00 11.09 ? 388 GLN A CD  1 
ATOM   3095  O OE1 . GLN A 1 388 ? 30.393  -6.544  75.930  1.00 12.36 ? 388 GLN A OE1 1 
ATOM   3096  N NE2 . GLN A 1 388 ? 31.699  -7.992  77.049  1.00 10.97 ? 388 GLN A NE2 1 
ATOM   3097  N N   . HIS A 1 389 ? 29.603  -5.666  81.693  1.00 11.31 ? 389 HIS A N   1 
ATOM   3098  C CA  . HIS A 1 389 ? 30.182  -6.178  82.938  1.00 11.82 ? 389 HIS A CA  1 
ATOM   3099  C C   . HIS A 1 389 ? 29.331  -5.876  84.186  1.00 11.26 ? 389 HIS A C   1 
ATOM   3100  O O   . HIS A 1 389 ? 29.746  -6.118  85.317  1.00 12.39 ? 389 HIS A O   1 
ATOM   3101  C CB  . HIS A 1 389 ? 31.573  -5.603  83.084  1.00 11.63 ? 389 HIS A CB  1 
ATOM   3102  C CG  . HIS A 1 389 ? 32.482  -6.002  81.968  1.00 12.48 ? 389 HIS A CG  1 
ATOM   3103  N ND1 . HIS A 1 389 ? 32.706  -7.321  81.641  1.00 12.95 ? 389 HIS A ND1 1 
ATOM   3104  C CD2 . HIS A 1 389 ? 33.190  -5.267  81.081  1.00 14.53 ? 389 HIS A CD2 1 
ATOM   3105  C CE1 . HIS A 1 389 ? 33.540  -7.383  80.617  1.00 12.81 ? 389 HIS A CE1 1 
ATOM   3106  N NE2 . HIS A 1 389 ? 33.841  -6.150  80.251  1.00 13.33 ? 389 HIS A NE2 1 
ATOM   3107  N N   . ALA A 1 390 ? 28.155  -5.322  83.962  1.00 11.10 ? 390 ALA A N   1 
ATOM   3108  C CA  . ALA A 1 390 ? 27.214  -5.058  85.046  1.00 10.82 ? 390 ALA A CA  1 
ATOM   3109  C C   . ALA A 1 390 ? 26.061  -6.046  85.086  1.00 10.93 ? 390 ALA A C   1 
ATOM   3110  O O   . ALA A 1 390 ? 25.897  -6.783  86.050  1.00 11.49 ? 390 ALA A O   1 
ATOM   3111  C CB  . ALA A 1 390 ? 26.655  -3.646  84.906  1.00 11.11 ? 390 ALA A CB  1 
ATOM   3112  N N   . PHE A 1 391 ? 25.243  -6.046  84.038  1.00 10.25 ? 391 PHE A N   1 
ATOM   3113  C CA  . PHE A 1 391 ? 23.962  -6.739  84.081  1.00 10.48 ? 391 PHE A CA  1 
ATOM   3114  C C   . PHE A 1 391 ? 23.704  -7.783  83.003  1.00 9.72  ? 391 PHE A C   1 
ATOM   3115  O O   . PHE A 1 391 ? 22.611  -8.345  82.928  1.00 9.54  ? 391 PHE A O   1 
ATOM   3116  C CB  . PHE A 1 391 ? 22.814  -5.704  84.033  1.00 10.03 ? 391 PHE A CB  1 
ATOM   3117  C CG  . PHE A 1 391 ? 22.941  -4.682  82.926  1.00 10.23 ? 391 PHE A CG  1 
ATOM   3118  C CD1 . PHE A 1 391 ? 22.599  -5.003  81.629  1.00 9.85  ? 391 PHE A CD1 1 
ATOM   3119  C CD2 . PHE A 1 391 ? 23.368  -3.384  83.196  1.00 11.15 ? 391 PHE A CD2 1 
ATOM   3120  C CE1 . PHE A 1 391 ? 22.699  -4.071  80.614  1.00 11.34 ? 391 PHE A CE1 1 
ATOM   3121  C CE2 . PHE A 1 391 ? 23.466  -2.451  82.178  1.00 10.18 ? 391 PHE A CE2 1 
ATOM   3122  C CZ  . PHE A 1 391 ? 23.148  -2.788  80.892  1.00 9.05  ? 391 PHE A CZ  1 
ATOM   3123  N N   . TYR A 1 392 ? 24.678  -8.058  82.153  1.00 9.84  ? 392 TYR A N   1 
ATOM   3124  C CA  . TYR A 1 392 ? 24.412  -9.013  81.092  1.00 9.09  ? 392 TYR A CA  1 
ATOM   3125  C C   . TYR A 1 392 ? 24.146  -10.427 81.596  1.00 8.63  ? 392 TYR A C   1 
ATOM   3126  O O   . TYR A 1 392 ? 23.494  -11.203 80.909  1.00 8.58  ? 392 TYR A O   1 
ATOM   3127  C CB  . TYR A 1 392 ? 25.530  -9.030  80.065  1.00 8.88  ? 392 TYR A CB  1 
ATOM   3128  C CG  . TYR A 1 392 ? 25.525  -7.901  79.045  1.00 10.03 ? 392 TYR A CG  1 
ATOM   3129  C CD1 . TYR A 1 392 ? 25.067  -6.630  79.355  1.00 10.66 ? 392 TYR A CD1 1 
ATOM   3130  C CD2 . TYR A 1 392 ? 26.070  -8.104  77.785  1.00 10.64 ? 392 TYR A CD2 1 
ATOM   3131  C CE1 . TYR A 1 392 ? 25.117  -5.606  78.420  1.00 9.46  ? 392 TYR A CE1 1 
ATOM   3132  C CE2 . TYR A 1 392 ? 26.152  -7.094  76.865  1.00 10.19 ? 392 TYR A CE2 1 
ATOM   3133  C CZ  . TYR A 1 392 ? 25.685  -5.840  77.183  1.00 10.70 ? 392 TYR A CZ  1 
ATOM   3134  O OH  . TYR A 1 392 ? 25.773  -4.841  76.243  1.00 10.07 ? 392 TYR A OH  1 
ATOM   3135  N N   . GLN A 1 393 ? 24.646  -10.767 82.784  1.00 8.75  ? 393 GLN A N   1 
ATOM   3136  C CA  . GLN A 1 393 ? 24.340  -12.071 83.387  1.00 9.17  ? 393 GLN A CA  1 
ATOM   3137  C C   . GLN A 1 393 ? 22.826  -12.348 83.306  1.00 9.06  ? 393 GLN A C   1 
ATOM   3138  O O   . GLN A 1 393 ? 22.378  -13.438 82.909  1.00 9.11  ? 393 GLN A O   1 
ATOM   3139  C CB  . GLN A 1 393 ? 24.825  -12.109 84.847  1.00 9.04  ? 393 GLN A CB  1 
ATOM   3140  C CG  . GLN A 1 393 ? 24.206  -13.203 85.710  1.00 8.41  ? 393 GLN A CG  1 
ATOM   3141  C CD  . GLN A 1 393 ? 24.662  -14.603 85.309  1.00 8.77  ? 393 GLN A CD  1 
ATOM   3142  O OE1 . GLN A 1 393 ? 23.837  -15.518 85.146  1.00 13.46 ? 393 GLN A OE1 1 
ATOM   3143  N NE2 . GLN A 1 393 ? 25.947  -14.766 85.138  1.00 7.29  ? 393 GLN A NE2 1 
ATOM   3144  N N   . LEU A 1 394 ? 22.033  -11.344 83.662  1.00 9.37  ? 394 LEU A N   1 
ATOM   3145  C CA  . LEU A 1 394 ? 20.600  -11.505 83.718  1.00 8.97  ? 394 LEU A CA  1 
ATOM   3146  C C   . LEU A 1 394 ? 20.040  -11.598 82.303  1.00 9.32  ? 394 LEU A C   1 
ATOM   3147  O O   . LEU A 1 394 ? 19.073  -12.327 82.082  1.00 9.36  ? 394 LEU A O   1 
ATOM   3148  C CB  . LEU A 1 394 ? 19.935  -10.338 84.469  1.00 9.14  ? 394 LEU A CB  1 
ATOM   3149  C CG  . LEU A 1 394 ? 18.417  -10.441 84.651  1.00 8.40  ? 394 LEU A CG  1 
ATOM   3150  C CD1 . LEU A 1 394 ? 17.990  -9.917  86.051  1.00 6.81  ? 394 LEU A CD1 1 
ATOM   3151  C CD2 . LEU A 1 394 ? 17.628  -9.740  83.543  1.00 8.35  ? 394 LEU A CD2 1 
ATOM   3152  N N   . ILE A 1 395 ? 20.622  -10.864 81.350  1.00 8.50  ? 395 ILE A N   1 
ATOM   3153  C CA  . ILE A 1 395 ? 20.100  -10.917 79.980  1.00 8.99  ? 395 ILE A CA  1 
ATOM   3154  C C   . ILE A 1 395 ? 20.327  -12.325 79.381  1.00 9.21  ? 395 ILE A C   1 
ATOM   3155  O O   . ILE A 1 395 ? 19.482  -12.860 78.652  1.00 9.75  ? 395 ILE A O   1 
ATOM   3156  C CB  . ILE A 1 395 ? 20.726  -9.806  79.086  1.00 8.66  ? 395 ILE A CB  1 
ATOM   3157  C CG1 . ILE A 1 395 ? 20.420  -8.413  79.656  1.00 8.09  ? 395 ILE A CG1 1 
ATOM   3158  C CG2 . ILE A 1 395 ? 20.226  -9.927  77.668  1.00 9.93  ? 395 ILE A CG2 1 
ATOM   3159  C CD1 . ILE A 1 395 ? 21.087  -7.278  78.851  1.00 8.67  ? 395 ILE A CD1 1 
ATOM   3160  N N   . HIS A 1 396 ? 21.468  -12.911 79.704  1.00 9.86  ? 396 HIS A N   1 
ATOM   3161  C CA  . HIS A 1 396 ? 21.828  -14.247 79.211  1.00 10.33 ? 396 HIS A CA  1 
ATOM   3162  C C   . HIS A 1 396 ? 21.162  -15.402 79.937  1.00 10.94 ? 396 HIS A C   1 
ATOM   3163  O O   . HIS A 1 396 ? 20.771  -16.392 79.302  1.00 10.91 ? 396 HIS A O   1 
ATOM   3164  C CB  . HIS A 1 396 ? 23.330  -14.488 79.303  1.00 10.06 ? 396 HIS A CB  1 
ATOM   3165  C CG  . HIS A 1 396 ? 24.127  -13.750 78.279  1.00 10.51 ? 396 HIS A CG  1 
ATOM   3166  N ND1 . HIS A 1 396 ? 24.264  -14.195 76.980  1.00 9.43  ? 396 HIS A ND1 1 
ATOM   3167  C CD2 . HIS A 1 396 ? 24.823  -12.594 78.357  1.00 9.43  ? 396 HIS A CD2 1 
ATOM   3168  C CE1 . HIS A 1 396 ? 25.022  -13.348 76.306  1.00 9.67  ? 396 HIS A CE1 1 
ATOM   3169  N NE2 . HIS A 1 396 ? 25.370  -12.362 77.119  1.00 9.21  ? 396 HIS A NE2 1 
ATOM   3170  N N   . GLN A 1 397 ? 21.046  -15.293 81.255  1.00 11.36 ? 397 GLN A N   1 
ATOM   3171  C CA  . GLN A 1 397 ? 20.608  -16.422 82.072  1.00 11.32 ? 397 GLN A CA  1 
ATOM   3172  C C   . GLN A 1 397 ? 19.516  -16.135 83.107  1.00 11.30 ? 397 GLN A C   1 
ATOM   3173  O O   . GLN A 1 397 ? 19.311  -16.924 84.043  1.00 11.43 ? 397 GLN A O   1 
ATOM   3174  C CB  . GLN A 1 397 ? 21.836  -17.025 82.766  1.00 11.91 ? 397 GLN A CB  1 
ATOM   3175  C CG  . GLN A 1 397 ? 22.745  -17.876 81.852  1.00 11.86 ? 397 GLN A CG  1 
ATOM   3176  C CD  . GLN A 1 397 ? 23.750  -18.712 82.623  1.00 12.94 ? 397 GLN A CD  1 
ATOM   3177  O OE1 . GLN A 1 397 ? 24.051  -19.881 82.261  1.00 13.35 ? 397 GLN A OE1 1 
ATOM   3178  N NE2 . GLN A 1 397 ? 24.252  -18.152 83.690  1.00 10.62 ? 397 GLN A NE2 1 
ATOM   3179  N N   . GLY A 1 398 ? 18.818  -15.014 82.954  1.00 11.19 ? 398 GLY A N   1 
ATOM   3180  C CA  . GLY A 1 398 ? 17.706  -14.692 83.819  1.00 11.00 ? 398 GLY A CA  1 
ATOM   3181  C C   . GLY A 1 398 ? 16.422  -15.243 83.253  1.00 11.68 ? 398 GLY A C   1 
ATOM   3182  O O   . GLY A 1 398 ? 16.459  -16.079 82.340  1.00 12.50 ? 398 GLY A O   1 
ATOM   3183  N N   . THR A 1 399 ? 15.286  -14.758 83.756  1.00 11.72 ? 399 THR A N   1 
ATOM   3184  C CA  . THR A 1 399 ? 13.987  -15.272 83.331  1.00 12.22 ? 399 THR A CA  1 
ATOM   3185  C C   . THR A 1 399 ? 13.144  -14.270 82.565  1.00 12.96 ? 399 THR A C   1 
ATOM   3186  O O   . THR A 1 399 ? 11.913  -14.444 82.480  1.00 13.67 ? 399 THR A O   1 
ATOM   3187  C CB  . THR A 1 399 ? 13.177  -15.760 84.548  1.00 12.12 ? 399 THR A CB  1 
ATOM   3188  O OG1 . THR A 1 399 ? 13.062  -14.702 85.512  1.00 12.78 ? 399 THR A OG1 1 
ATOM   3189  C CG2 . THR A 1 399 ? 13.915  -16.854 85.279  1.00 11.11 ? 399 THR A CG2 1 
ATOM   3190  N N   . LYS A 1 400 ? 13.790  -13.227 82.035  1.00 12.73 ? 400 LYS A N   1 
ATOM   3191  C CA  . LYS A 1 400 ? 13.114  -12.171 81.296  1.00 13.23 ? 400 LYS A CA  1 
ATOM   3192  C C   . LYS A 1 400 ? 13.554  -12.158 79.833  1.00 12.21 ? 400 LYS A C   1 
ATOM   3193  O O   . LYS A 1 400 ? 14.724  -12.344 79.561  1.00 11.76 ? 400 LYS A O   1 
ATOM   3194  C CB  . LYS A 1 400 ? 13.494  -10.792 81.885  1.00 13.81 ? 400 LYS A CB  1 
ATOM   3195  C CG  . LYS A 1 400 ? 12.628  -10.294 83.062  1.00 14.84 ? 400 LYS A CG  1 
ATOM   3196  C CD  . LYS A 1 400 ? 13.150  -10.780 84.385  1.00 15.64 ? 400 LYS A CD  1 
ATOM   3197  C CE  . LYS A 1 400 ? 12.136  -10.528 85.460  1.00 16.46 ? 400 LYS A CE  1 
ATOM   3198  N NZ  . LYS A 1 400 ? 12.383  -11.295 86.715  1.00 15.08 ? 400 LYS A NZ  1 
ATOM   3199  N N   . MET A 1 401 ? 12.621  -11.939 78.911  1.00 11.46 ? 401 MET A N   1 
ATOM   3200  C CA  . MET A 1 401 ? 12.966  -11.655 77.508  1.00 11.26 ? 401 MET A CA  1 
ATOM   3201  C C   . MET A 1 401 ? 13.128  -10.127 77.397  1.00 10.84 ? 401 MET A C   1 
ATOM   3202  O O   . MET A 1 401 ? 12.231  -9.352  77.811  1.00 10.94 ? 401 MET A O   1 
ATOM   3203  C CB  . MET A 1 401 ? 11.878  -12.153 76.562  1.00 11.31 ? 401 MET A CB  1 
ATOM   3204  C CG  . MET A 1 401 ? 12.232  -12.031 75.098  1.00 13.90 ? 401 MET A CG  1 
ATOM   3205  S SD  . MET A 1 401 ? 10.831  -12.473 74.026  1.00 17.02 ? 401 MET A SD  1 
ATOM   3206  C CE  . MET A 1 401 ? 10.561  -14.035 74.577  1.00 20.10 ? 401 MET A CE  1 
ATOM   3207  N N   . ILE A 1 402 ? 14.260  -9.712  76.838  1.00 10.44 ? 402 ILE A N   1 
ATOM   3208  C CA  . ILE A 1 402 ? 14.667  -8.307  76.776  1.00 9.96  ? 402 ILE A CA  1 
ATOM   3209  C C   . ILE A 1 402 ? 15.238  -7.967  75.406  1.00 9.05  ? 402 ILE A C   1 
ATOM   3210  O O   . ILE A 1 402 ? 16.393  -8.227  75.125  1.00 8.06  ? 402 ILE A O   1 
ATOM   3211  C CB  . ILE A 1 402 ? 15.742  -8.013  77.850  1.00 10.05 ? 402 ILE A CB  1 
ATOM   3212  C CG1 . ILE A 1 402 ? 15.241  -8.403  79.239  1.00 10.34 ? 402 ILE A CG1 1 
ATOM   3213  C CG2 . ILE A 1 402 ? 16.147  -6.519  77.842  1.00 11.29 ? 402 ILE A CG2 1 
ATOM   3214  C CD1 . ILE A 1 402 ? 16.341  -8.564  80.248  1.00 11.47 ? 402 ILE A CD1 1 
ATOM   3215  N N   . PRO A 1 403 ? 14.410  -7.417  74.535  1.00 9.07  ? 403 PRO A N   1 
ATOM   3216  C CA  . PRO A 1 403 ? 14.891  -6.932  73.241  1.00 8.74  ? 403 PRO A CA  1 
ATOM   3217  C C   . PRO A 1 403 ? 15.981  -5.896  73.473  1.00 8.55  ? 403 PRO A C   1 
ATOM   3218  O O   . PRO A 1 403 ? 15.825  -5.035  74.333  1.00 7.96  ? 403 PRO A O   1 
ATOM   3219  C CB  . PRO A 1 403 ? 13.646  -6.322  72.610  1.00 9.33  ? 403 PRO A CB  1 
ATOM   3220  C CG  . PRO A 1 403 ? 12.474  -7.045  73.292  1.00 9.83  ? 403 PRO A CG  1 
ATOM   3221  C CD  . PRO A 1 403 ? 12.959  -7.282  74.694  1.00 9.46  ? 403 PRO A CD  1 
ATOM   3222  N N   . CYS A 1 404 ? 17.083  -6.017  72.743  1.00 8.13  ? 404 CYS A N   1 
ATOM   3223  C CA  . CYS A 1 404 ? 18.229  -5.146  72.917  1.00 8.83  ? 404 CYS A CA  1 
ATOM   3224  C C   . CYS A 1 404 ? 18.657  -4.601  71.587  1.00 8.88  ? 404 CYS A C   1 
ATOM   3225  O O   . CYS A 1 404 ? 18.738  -5.355  70.586  1.00 9.53  ? 404 CYS A O   1 
ATOM   3226  C CB  . CYS A 1 404 ? 19.441  -5.900  73.499  1.00 8.21  ? 404 CYS A CB  1 
ATOM   3227  S SG  . CYS A 1 404 ? 19.301  -6.524  75.187  1.00 7.56  ? 404 CYS A SG  1 
ATOM   3228  N N   . ASP A 1 405 ? 18.916  -3.294  71.580  1.00 7.93  ? 405 ASP A N   1 
ATOM   3229  C CA  . ASP A 1 405 ? 19.523  -2.611  70.457  1.00 8.22  ? 405 ASP A CA  1 
ATOM   3230  C C   . ASP A 1 405 ? 20.981  -2.396  70.810  1.00 8.68  ? 405 ASP A C   1 
ATOM   3231  O O   . ASP A 1 405 ? 21.312  -1.673  71.765  1.00 9.52  ? 405 ASP A O   1 
ATOM   3232  C CB  . ASP A 1 405 ? 18.928  -1.232  70.204  1.00 7.44  ? 405 ASP A CB  1 
ATOM   3233  C CG  . ASP A 1 405 ? 17.532  -1.281  69.625  1.00 8.90  ? 405 ASP A CG  1 
ATOM   3234  O OD1 . ASP A 1 405 ? 17.036  -2.374  69.224  1.00 7.87  ? 405 ASP A OD1 1 
ATOM   3235  O OD2 . ASP A 1 405 ? 16.857  -0.223  69.560  1.00 8.93  ? 405 ASP A OD2 1 
ATOM   3236  N N   . PHE A 1 406 ? 21.852  -3.013  70.030  1.00 8.81  ? 406 PHE A N   1 
ATOM   3237  C CA  . PHE A 1 406 ? 23.285  -2.835  70.181  1.00 8.90  ? 406 PHE A CA  1 
ATOM   3238  C C   . PHE A 1 406 ? 23.731  -1.870  69.078  1.00 9.08  ? 406 PHE A C   1 
ATOM   3239  O O   . PHE A 1 406 ? 23.436  -2.113  67.899  1.00 9.34  ? 406 PHE A O   1 
ATOM   3240  C CB  . PHE A 1 406 ? 24.008  -4.157  69.970  1.00 8.97  ? 406 PHE A CB  1 
ATOM   3241  C CG  . PHE A 1 406 ? 24.050  -5.067  71.177  1.00 7.32  ? 406 PHE A CG  1 
ATOM   3242  C CD1 . PHE A 1 406 ? 22.919  -5.739  71.613  1.00 8.23  ? 406 PHE A CD1 1 
ATOM   3243  C CD2 . PHE A 1 406 ? 25.248  -5.325  71.800  1.00 7.82  ? 406 PHE A CD2 1 
ATOM   3244  C CE1 . PHE A 1 406 ? 22.983  -6.606  72.688  1.00 7.83  ? 406 PHE A CE1 1 
ATOM   3245  C CE2 . PHE A 1 406 ? 25.314  -6.197  72.869  1.00 7.89  ? 406 PHE A CE2 1 
ATOM   3246  C CZ  . PHE A 1 406 ? 24.173  -6.832  73.310  1.00 6.36  ? 406 PHE A CZ  1 
ATOM   3247  N N   . LEU A 1 407 ? 24.434  -0.796  69.442  1.00 9.05  ? 407 LEU A N   1 
ATOM   3248  C CA  . LEU A 1 407 ? 24.917  0.190   68.471  1.00 9.17  ? 407 LEU A CA  1 
ATOM   3249  C C   . LEU A 1 407 ? 26.424  0.426   68.586  1.00 8.68  ? 407 LEU A C   1 
ATOM   3250  O O   . LEU A 1 407 ? 26.998  0.339   69.664  1.00 7.48  ? 407 LEU A O   1 
ATOM   3251  C CB  . LEU A 1 407 ? 24.211  1.544   68.648  1.00 9.75  ? 407 LEU A CB  1 
ATOM   3252  C CG  . LEU A 1 407 ? 22.690  1.573   68.752  1.00 10.87 ? 407 LEU A CG  1 
ATOM   3253  C CD1 . LEU A 1 407 ? 22.302  1.387   70.207  1.00 13.28 ? 407 LEU A CD1 1 
ATOM   3254  C CD2 . LEU A 1 407 ? 22.119  2.898   68.218  1.00 13.81 ? 407 LEU A CD2 1 
ATOM   3255  N N   . ILE A 1 408 ? 27.069  0.768   67.475  1.00 9.16  ? 408 ILE A N   1 
ATOM   3256  C CA  . ILE A 1 408 ? 28.498  1.063   67.506  1.00 8.87  ? 408 ILE A CA  1 
ATOM   3257  C C   . ILE A 1 408 ? 28.950  1.731   66.202  1.00 9.35  ? 408 ILE A C   1 
ATOM   3258  O O   . ILE A 1 408 ? 28.397  1.435   65.124  1.00 8.96  ? 408 ILE A O   1 
ATOM   3259  C CB  . ILE A 1 408 ? 29.320  -0.245  67.728  1.00 9.26  ? 408 ILE A CB  1 
ATOM   3260  C CG1 . ILE A 1 408 ? 30.753  0.100   68.160  1.00 9.13  ? 408 ILE A CG1 1 
ATOM   3261  C CG2 . ILE A 1 408 ? 29.317  -1.073  66.479  1.00 9.47  ? 408 ILE A CG2 1 
ATOM   3262  C CD1 . ILE A 1 408 ? 31.603  -1.096  68.565  1.00 9.16  ? 408 ILE A CD1 1 
ATOM   3263  N N   . PRO A 1 409 ? 29.893  2.675   66.293  1.00 9.18  ? 409 PRO A N   1 
ATOM   3264  C CA  . PRO A 1 409 ? 30.548  3.177   65.087  1.00 9.78  ? 409 PRO A CA  1 
ATOM   3265  C C   . PRO A 1 409 ? 31.693  2.278   64.637  1.00 10.07 ? 409 PRO A C   1 
ATOM   3266  O O   . PRO A 1 409 ? 32.437  1.735   65.461  1.00 10.34 ? 409 PRO A O   1 
ATOM   3267  C CB  . PRO A 1 409 ? 31.095  4.538   65.524  1.00 9.81  ? 409 PRO A CB  1 
ATOM   3268  C CG  . PRO A 1 409 ? 31.366  4.376   66.975  1.00 10.58 ? 409 PRO A CG  1 
ATOM   3269  C CD  . PRO A 1 409 ? 30.348  3.397   67.500  1.00 9.47  ? 409 PRO A CD  1 
ATOM   3270  N N   . VAL A 1 410 ? 31.847  2.137   63.325  1.00 9.98  ? 410 VAL A N   1 
ATOM   3271  C CA  . VAL A 1 410 ? 32.949  1.361   62.784  1.00 9.62  ? 410 VAL A CA  1 
ATOM   3272  C C   . VAL A 1 410 ? 34.275  2.043   63.112  1.00 9.73  ? 410 VAL A C   1 
ATOM   3273  O O   . VAL A 1 410 ? 35.232  1.389   63.554  1.00 9.63  ? 410 VAL A O   1 
ATOM   3274  C CB  . VAL A 1 410 ? 32.800  1.172   61.286  1.00 9.53  ? 410 VAL A CB  1 
ATOM   3275  C CG1 . VAL A 1 410 ? 34.038  0.494   60.702  1.00 9.17  ? 410 VAL A CG1 1 
ATOM   3276  C CG2 . VAL A 1 410 ? 31.566  0.378   60.987  1.00 9.74  ? 410 VAL A CG2 1 
ATOM   3277  N N   . GLN A 1 411 ? 34.302  3.367   62.950  1.00 10.14 ? 411 GLN A N   1 
ATOM   3278  C CA  . GLN A 1 411 ? 35.498  4.171   63.163  1.00 10.39 ? 411 GLN A CA  1 
ATOM   3279  C C   . GLN A 1 411 ? 35.459  4.911   64.490  1.00 10.99 ? 411 GLN A C   1 
ATOM   3280  O O   . GLN A 1 411 ? 34.510  5.624   64.785  1.00 11.52 ? 411 GLN A O   1 
ATOM   3281  C CB  . GLN A 1 411 ? 35.663  5.175   62.011  1.00 10.72 ? 411 GLN A CB  1 
ATOM   3282  C CG  . GLN A 1 411 ? 35.943  4.510   60.655  1.00 10.66 ? 411 GLN A CG  1 
ATOM   3283  C CD  . GLN A 1 411 ? 36.055  5.506   59.498  1.00 12.56 ? 411 GLN A CD  1 
ATOM   3284  O OE1 . GLN A 1 411 ? 36.317  6.689   59.715  1.00 15.27 ? 411 GLN A OE1 1 
ATOM   3285  N NE2 . GLN A 1 411 ? 35.839  5.031   58.272  1.00 10.80 ? 411 GLN A NE2 1 
ATOM   3286  N N   . THR A 1 412 ? 36.488  4.726   65.298  1.00 11.28 ? 412 THR A N   1 
ATOM   3287  C CA  . THR A 1 412 ? 36.575  5.404   66.592  1.00 10.86 ? 412 THR A CA  1 
ATOM   3288  C C   . THR A 1 412 ? 37.215  6.780   66.456  1.00 11.40 ? 412 THR A C   1 
ATOM   3289  O O   . THR A 1 412 ? 38.009  7.020   65.544  1.00 10.15 ? 412 THR A O   1 
ATOM   3290  C CB  . THR A 1 412 ? 37.389  4.555   67.597  1.00 11.05 ? 412 THR A CB  1 
ATOM   3291  O OG1 . THR A 1 412 ? 37.576  5.287   68.820  1.00 10.30 ? 412 THR A OG1 1 
ATOM   3292  C CG2 . THR A 1 412 ? 38.817  4.316   67.095  1.00 11.39 ? 412 THR A CG2 1 
ATOM   3293  N N   . GLN A 1 413 ? 36.860  7.687   67.365  1.00 11.90 ? 413 GLN A N   1 
ATOM   3294  C CA  . GLN A 1 413 ? 37.439  9.006   67.399  1.00 12.74 ? 413 GLN A CA  1 
ATOM   3295  C C   . GLN A 1 413 ? 38.831  8.949   68.015  1.00 13.04 ? 413 GLN A C   1 
ATOM   3296  O O   . GLN A 1 413 ? 39.587  9.906   67.923  1.00 12.98 ? 413 GLN A O   1 
ATOM   3297  C CB  . GLN A 1 413 ? 36.564  9.926   68.240  1.00 12.80 ? 413 GLN A CB  1 
ATOM   3298  C CG  . GLN A 1 413 ? 35.103  9.993   67.819  1.00 12.57 ? 413 GLN A CG  1 
ATOM   3299  C CD  . GLN A 1 413 ? 34.865  10.984  66.703  1.00 15.22 ? 413 GLN A CD  1 
ATOM   3300  O OE1 . GLN A 1 413 ? 35.686  11.883  66.479  1.00 13.94 ? 413 GLN A OE1 1 
ATOM   3301  N NE2 . GLN A 1 413 ? 33.722  10.877  66.037  1.00 16.42 ? 413 GLN A NE2 1 
ATOM   3302  N N   . HIS A 1 414 ? 39.167  7.810   68.616  1.00 12.78 ? 414 HIS A N   1 
ATOM   3303  C CA  . HIS A 1 414 ? 40.432  7.636   69.321  1.00 13.09 ? 414 HIS A CA  1 
ATOM   3304  C C   . HIS A 1 414 ? 41.088  6.289   69.003  1.00 13.22 ? 414 HIS A C   1 
ATOM   3305  O O   . HIS A 1 414 ? 41.081  5.371   69.823  1.00 13.13 ? 414 HIS A O   1 
ATOM   3306  C CB  . HIS A 1 414 ? 40.182  7.750   70.820  1.00 13.39 ? 414 HIS A CB  1 
ATOM   3307  C CG  . HIS A 1 414 ? 39.746  9.115   71.240  1.00 13.55 ? 414 HIS A CG  1 
ATOM   3308  N ND1 . HIS A 1 414 ? 40.616  10.180  71.298  1.00 13.92 ? 414 HIS A ND1 1 
ATOM   3309  C CD2 . HIS A 1 414 ? 38.537  9.594   71.617  1.00 13.61 ? 414 HIS A CD2 1 
ATOM   3310  C CE1 . HIS A 1 414 ? 39.959  11.262  71.683  1.00 15.28 ? 414 HIS A CE1 1 
ATOM   3311  N NE2 . HIS A 1 414 ? 38.698  10.931  71.892  1.00 13.68 ? 414 HIS A NE2 1 
ATOM   3312  N N   . PRO A 1 415 ? 41.682  6.176   67.818  1.00 13.49 ? 415 PRO A N   1 
ATOM   3313  C CA  . PRO A 1 415 ? 42.262  4.900   67.360  1.00 13.63 ? 415 PRO A CA  1 
ATOM   3314  C C   . PRO A 1 415 ? 43.627  4.642   67.956  1.00 13.76 ? 415 PRO A C   1 
ATOM   3315  O O   . PRO A 1 415 ? 44.592  4.377   67.234  1.00 13.27 ? 415 PRO A O   1 
ATOM   3316  C CB  . PRO A 1 415 ? 42.415  5.095   65.850  1.00 14.06 ? 415 PRO A CB  1 
ATOM   3317  C CG  . PRO A 1 415 ? 42.108  6.495   65.578  1.00 15.19 ? 415 PRO A CG  1 
ATOM   3318  C CD  . PRO A 1 415 ? 41.875  7.241   66.831  1.00 13.64 ? 415 PRO A CD  1 
ATOM   3319  N N   . ILE A 1 416 ? 43.690  4.679   69.274  1.00 13.55 ? 416 ILE A N   1 
ATOM   3320  C CA  . ILE A 1 416 ? 44.934  4.483   70.004  1.00 14.01 ? 416 ILE A CA  1 
ATOM   3321  C C   . ILE A 1 416 ? 45.416  3.042   69.918  1.00 14.35 ? 416 ILE A C   1 
ATOM   3322  O O   . ILE A 1 416 ? 44.661  2.141   69.554  1.00 13.49 ? 416 ILE A O   1 
ATOM   3323  C CB  . ILE A 1 416 ? 44.718  4.841   71.472  1.00 13.52 ? 416 ILE A CB  1 
ATOM   3324  C CG1 . ILE A 1 416 ? 43.596  3.966   72.057  1.00 13.28 ? 416 ILE A CG1 1 
ATOM   3325  C CG2 . ILE A 1 416 ? 44.415  6.334   71.597  1.00 14.94 ? 416 ILE A CG2 1 
ATOM   3326  C CD1 . ILE A 1 416 ? 43.408  4.088   73.565  1.00 13.90 ? 416 ILE A CD1 1 
ATOM   3327  N N   . ARG A 1 417 ? 46.683  2.842   70.256  1.00 14.87 ? 417 ARG A N   1 
ATOM   3328  C CA  . ARG A 1 417 ? 47.278  1.518   70.243  1.00 15.54 ? 417 ARG A CA  1 
ATOM   3329  C C   . ARG A 1 417 ? 47.056  0.875   68.888  1.00 15.98 ? 417 ARG A C   1 
ATOM   3330  O O   . ARG A 1 417 ? 46.761  -0.301  68.809  1.00 15.95 ? 417 ARG A O   1 
ATOM   3331  C CB  . ARG A 1 417 ? 46.662  0.636   71.340  1.00 15.57 ? 417 ARG A CB  1 
ATOM   3332  C CG  . ARG A 1 417 ? 46.844  1.110   72.778  1.00 15.74 ? 417 ARG A CG  1 
ATOM   3333  C CD  . ARG A 1 417 ? 48.277  1.099   73.278  1.00 16.45 ? 417 ARG A CD  1 
ATOM   3334  N NE  . ARG A 1 417 ? 48.904  -0.222  73.243  1.00 15.16 ? 417 ARG A NE  1 
ATOM   3335  C CZ  . ARG A 1 417 ? 48.650  -1.221  74.074  1.00 15.88 ? 417 ARG A CZ  1 
ATOM   3336  N NH1 . ARG A 1 417 ? 47.747  -1.108  75.051  1.00 14.00 ? 417 ARG A NH1 1 
ATOM   3337  N NH2 . ARG A 1 417 ? 49.310  -2.360  73.923  1.00 17.63 ? 417 ARG A NH2 1 
ATOM   3338  N N   . LYS A 1 418 ? 47.163  1.660   67.824  1.00 17.45 ? 418 LYS A N   1 
ATOM   3339  C CA  . LYS A 1 418 ? 46.973  1.142   66.469  1.00 18.24 ? 418 LYS A CA  1 
ATOM   3340  C C   . LYS A 1 418 ? 45.640  0.393   66.295  1.00 17.66 ? 418 LYS A C   1 
ATOM   3341  O O   . LYS A 1 418 ? 45.580  -0.621  65.598  1.00 17.14 ? 418 LYS A O   1 
ATOM   3342  C CB  . LYS A 1 418 ? 48.150  0.214   66.081  1.00 19.32 ? 418 LYS A CB  1 
ATOM   3343  C CG  . LYS A 1 418 ? 49.458  1.016   65.899  1.00 22.55 ? 418 LYS A CG  1 
ATOM   3344  C CD  . LYS A 1 418 ? 50.583  0.200   65.259  1.00 26.59 ? 418 LYS A CD  1 
ATOM   3345  C CE  . LYS A 1 418 ? 51.927  0.951   65.291  1.00 29.27 ? 418 LYS A CE  1 
ATOM   3346  N NZ  . LYS A 1 418 ? 51.797  2.406   64.954  1.00 30.90 ? 418 LYS A NZ  1 
ATOM   3347  N N   . GLY A 1 419 ? 44.579  0.889   66.930  1.00 16.18 ? 419 GLY A N   1 
ATOM   3348  C CA  . GLY A 1 419 ? 43.254  0.299   66.803  1.00 15.56 ? 419 GLY A CA  1 
ATOM   3349  C C   . GLY A 1 419 ? 42.956  -0.915  67.669  1.00 14.41 ? 419 GLY A C   1 
ATOM   3350  O O   . GLY A 1 419 ? 41.925  -1.554  67.492  1.00 14.57 ? 419 GLY A O   1 
ATOM   3351  N N   . LEU A 1 420 ? 43.841  -1.220  68.610  1.00 13.07 ? 420 LEU A N   1 
ATOM   3352  C CA  . LEU A 1 420 ? 43.665  -2.370  69.485  1.00 12.14 ? 420 LEU A CA  1 
ATOM   3353  C C   . LEU A 1 420 ? 42.429  -2.267  70.379  1.00 11.55 ? 420 LEU A C   1 
ATOM   3354  O O   . LEU A 1 420 ? 41.723  -3.243  70.573  1.00 11.09 ? 420 LEU A O   1 
ATOM   3355  C CB  . LEU A 1 420 ? 44.866  -2.501  70.405  1.00 12.31 ? 420 LEU A CB  1 
ATOM   3356  C CG  . LEU A 1 420 ? 44.850  -3.657  71.395  1.00 13.13 ? 420 LEU A CG  1 
ATOM   3357  C CD1 . LEU A 1 420 ? 44.608  -4.972  70.683  1.00 14.78 ? 420 LEU A CD1 1 
ATOM   3358  C CD2 . LEU A 1 420 ? 46.150  -3.687  72.221  1.00 14.24 ? 420 LEU A CD2 1 
ATOM   3359  N N   . HIS A 1 421 ? 42.202  -1.104  70.967  1.00 10.77 ? 421 HIS A N   1 
ATOM   3360  C CA  . HIS A 1 421 ? 41.056  -0.966  71.860  1.00 10.64 ? 421 HIS A CA  1 
ATOM   3361  C C   . HIS A 1 421 ? 39.745  -1.144  71.097  1.00 10.13 ? 421 HIS A C   1 
ATOM   3362  O O   . HIS A 1 421 ? 38.857  -1.813  71.571  1.00 9.86  ? 421 HIS A O   1 
ATOM   3363  C CB  . HIS A 1 421 ? 41.041  0.397   72.539  1.00 10.40 ? 421 HIS A CB  1 
ATOM   3364  C CG  . HIS A 1 421 ? 42.034  0.542   73.650  1.00 9.88  ? 421 HIS A CG  1 
ATOM   3365  N ND1 . HIS A 1 421 ? 41.656  0.711   74.964  1.00 9.42  ? 421 HIS A ND1 1 
ATOM   3366  C CD2 . HIS A 1 421 ? 43.389  0.577   73.642  1.00 11.01 ? 421 HIS A CD2 1 
ATOM   3367  C CE1 . HIS A 1 421 ? 42.735  0.827   75.719  1.00 9.53  ? 421 HIS A CE1 1 
ATOM   3368  N NE2 . HIS A 1 421 ? 43.801  0.761   74.939  1.00 9.59  ? 421 HIS A NE2 1 
ATOM   3369  N N   . HIS A 1 422 ? 39.633  -0.512  69.932  1.00 10.24 ? 422 HIS A N   1 
ATOM   3370  C CA  . HIS A 1 422 ? 38.402  -0.555  69.160  1.00 10.48 ? 422 HIS A CA  1 
ATOM   3371  C C   . HIS A 1 422 ? 38.206  -1.945  68.591  1.00 10.94 ? 422 HIS A C   1 
ATOM   3372  O O   . HIS A 1 422 ? 37.061  -2.421  68.462  1.00 10.88 ? 422 HIS A O   1 
ATOM   3373  C CB  . HIS A 1 422 ? 38.383  0.527   68.078  1.00 10.64 ? 422 HIS A CB  1 
ATOM   3374  C CG  . HIS A 1 422 ? 37.007  0.897   67.631  1.00 10.27 ? 422 HIS A CG  1 
ATOM   3375  N ND1 . HIS A 1 422 ? 36.025  1.308   68.505  1.00 10.76 ? 422 HIS A ND1 1 
ATOM   3376  C CD2 . HIS A 1 422 ? 36.437  0.887   66.403  1.00 10.84 ? 422 HIS A CD2 1 
ATOM   3377  C CE1 . HIS A 1 422 ? 34.913  1.547   67.833  1.00 10.38 ? 422 HIS A CE1 1 
ATOM   3378  N NE2 . HIS A 1 422 ? 35.134  1.292   66.556  1.00 8.76  ? 422 HIS A NE2 1 
ATOM   3379  N N   . LYS A 1 423 ? 39.317  -2.624  68.300  1.00 11.91 ? 423 LYS A N   1 
ATOM   3380  C CA  . LYS A 1 423 ? 39.236  -4.007  67.842  1.00 12.64 ? 423 LYS A CA  1 
ATOM   3381  C C   . LYS A 1 423 ? 38.518  -4.845  68.906  1.00 11.90 ? 423 LYS A C   1 
ATOM   3382  O O   . LYS A 1 423 ? 37.602  -5.608  68.587  1.00 11.96 ? 423 LYS A O   1 
ATOM   3383  C CB  . LYS A 1 423 ? 40.630  -4.603  67.567  1.00 14.11 ? 423 LYS A CB  1 
ATOM   3384  C CG  . LYS A 1 423 ? 40.617  -5.936  66.818  1.00 17.43 ? 423 LYS A CG  1 
ATOM   3385  C CD  . LYS A 1 423 ? 41.649  -6.936  67.357  1.00 22.03 ? 423 LYS A CD  1 
ATOM   3386  C CE  . LYS A 1 423 ? 43.035  -6.827  66.763  1.00 23.33 ? 423 LYS A CE  1 
ATOM   3387  N NZ  . LYS A 1 423 ? 43.640  -8.231  66.753  1.00 23.61 ? 423 LYS A NZ  1 
ATOM   3388  N N   . ILE A 1 424 ? 38.946  -4.707  70.160  1.00 11.68 ? 424 ILE A N   1 
ATOM   3389  C CA  . ILE A 1 424 ? 38.388  -5.483  71.261  1.00 11.47 ? 424 ILE A CA  1 
ATOM   3390  C C   . ILE A 1 424 ? 36.940  -5.069  71.505  1.00 11.08 ? 424 ILE A C   1 
ATOM   3391  O O   . ILE A 1 424 ? 36.100  -5.911  71.767  1.00 11.22 ? 424 ILE A O   1 
ATOM   3392  C CB  . ILE A 1 424 ? 39.223  -5.338  72.544  1.00 11.70 ? 424 ILE A CB  1 
ATOM   3393  C CG1 . ILE A 1 424 ? 40.616  -5.962  72.355  1.00 12.92 ? 424 ILE A CG1 1 
ATOM   3394  C CG2 . ILE A 1 424 ? 38.515  -6.022  73.716  1.00 10.95 ? 424 ILE A CG2 1 
ATOM   3395  C CD1 . ILE A 1 424 ? 41.629  -5.496  73.375  1.00 13.08 ? 424 ILE A CD1 1 
ATOM   3396  N N   . LEU A 1 425 ? 36.658  -3.774  71.402  1.00 11.02 ? 425 LEU A N   1 
ATOM   3397  C CA  . LEU A 1 425 ? 35.285  -3.277  71.540  1.00 10.09 ? 425 LEU A CA  1 
ATOM   3398  C C   . LEU A 1 425 ? 34.366  -3.899  70.483  1.00 10.14 ? 425 LEU A C   1 
ATOM   3399  O O   . LEU A 1 425 ? 33.271  -4.401  70.786  1.00 8.51  ? 425 LEU A O   1 
ATOM   3400  C CB  . LEU A 1 425 ? 35.281  -1.755  71.416  1.00 9.97  ? 425 LEU A CB  1 
ATOM   3401  C CG  . LEU A 1 425 ? 34.004  -1.001  71.774  1.00 9.65  ? 425 LEU A CG  1 
ATOM   3402  C CD1 . LEU A 1 425 ? 33.676  -1.179  73.255  1.00 9.04  ? 425 LEU A CD1 1 
ATOM   3403  C CD2 . LEU A 1 425 ? 34.146  0.467   71.444  1.00 8.52  ? 425 LEU A CD2 1 
ATOM   3404  N N   . LEU A 1 426 ? 34.818  -3.904  69.233  1.00 9.34  ? 426 LEU A N   1 
ATOM   3405  C CA  . LEU A 1 426 ? 34.004  -4.465  68.165  1.00 9.88  ? 426 LEU A CA  1 
ATOM   3406  C C   . LEU A 1 426 ? 33.764  -5.951  68.384  1.00 9.32  ? 426 LEU A C   1 
ATOM   3407  O O   . LEU A 1 426 ? 32.650  -6.466  68.150  1.00 8.91  ? 426 LEU A O   1 
ATOM   3408  C CB  . LEU A 1 426 ? 34.654  -4.233  66.802  1.00 9.39  ? 426 LEU A CB  1 
ATOM   3409  C CG  . LEU A 1 426 ? 34.510  -2.818  66.257  1.00 11.01 ? 426 LEU A CG  1 
ATOM   3410  C CD1 . LEU A 1 426 ? 35.660  -2.505  65.319  1.00 11.92 ? 426 LEU A CD1 1 
ATOM   3411  C CD2 . LEU A 1 426 ? 33.157  -2.636  65.570  1.00 12.16 ? 426 LEU A CD2 1 
ATOM   3412  N N   . ALA A 1 427 ? 34.801  -6.647  68.823  1.00 9.36  ? 427 ALA A N   1 
ATOM   3413  C CA  . ALA A 1 427 ? 34.701  -8.095  69.014  1.00 9.76  ? 427 ALA A CA  1 
ATOM   3414  C C   . ALA A 1 427 ? 33.637  -8.419  70.057  1.00 9.67  ? 427 ALA A C   1 
ATOM   3415  O O   . ALA A 1 427 ? 32.836  -9.363  69.887  1.00 11.07 ? 427 ALA A O   1 
ATOM   3416  C CB  . ALA A 1 427 ? 36.046  -8.684  69.409  1.00 9.83  ? 427 ALA A CB  1 
ATOM   3417  N N   . ASN A 1 428 ? 33.591  -7.611  71.113  1.00 9.51  ? 428 ASN A N   1 
ATOM   3418  C CA  . ASN A 1 428 ? 32.584  -7.810  72.149  1.00 9.42  ? 428 ASN A CA  1 
ATOM   3419  C C   . ASN A 1 428 ? 31.193  -7.439  71.653  1.00 9.05  ? 428 ASN A C   1 
ATOM   3420  O O   . ASN A 1 428 ? 30.247  -8.161  71.908  1.00 9.63  ? 428 ASN A O   1 
ATOM   3421  C CB  . ASN A 1 428 ? 32.958  -7.048  73.398  1.00 9.51  ? 428 ASN A CB  1 
ATOM   3422  C CG  . ASN A 1 428 ? 34.014  -7.766  74.205  1.00 10.89 ? 428 ASN A CG  1 
ATOM   3423  O OD1 . ASN A 1 428 ? 33.690  -8.519  75.109  1.00 11.29 ? 428 ASN A OD1 1 
ATOM   3424  N ND2 . ASN A 1 428 ? 35.287  -7.553  73.858  1.00 11.26 ? 428 ASN A ND2 1 
ATOM   3425  N N   . PHE A 1 429 ? 31.076  -6.328  70.933  1.00 9.04  ? 429 PHE A N   1 
ATOM   3426  C CA  . PHE A 1 429 ? 29.803  -5.915  70.312  1.00 9.34  ? 429 PHE A CA  1 
ATOM   3427  C C   . PHE A 1 429 ? 29.208  -7.063  69.511  1.00 9.29  ? 429 PHE A C   1 
ATOM   3428  O O   . PHE A 1 429 ? 28.015  -7.397  69.636  1.00 9.47  ? 429 PHE A O   1 
ATOM   3429  C CB  . PHE A 1 429 ? 30.044  -4.697  69.409  1.00 9.39  ? 429 PHE A CB  1 
ATOM   3430  C CG  . PHE A 1 429 ? 28.869  -4.322  68.536  1.00 8.98  ? 429 PHE A CG  1 
ATOM   3431  C CD1 . PHE A 1 429 ? 27.901  -3.448  68.990  1.00 9.51  ? 429 PHE A CD1 1 
ATOM   3432  C CD2 . PHE A 1 429 ? 28.770  -4.810  67.247  1.00 8.42  ? 429 PHE A CD2 1 
ATOM   3433  C CE1 . PHE A 1 429 ? 26.838  -3.092  68.172  1.00 7.90  ? 429 PHE A CE1 1 
ATOM   3434  C CE2 . PHE A 1 429 ? 27.707  -4.496  66.440  1.00 7.38  ? 429 PHE A CE2 1 
ATOM   3435  C CZ  . PHE A 1 429 ? 26.740  -3.625  66.895  1.00 8.19  ? 429 PHE A CZ  1 
ATOM   3436  N N   . LEU A 1 430 ? 30.055  -7.692  68.704  1.00 9.50  ? 430 LEU A N   1 
ATOM   3437  C CA  . LEU A 1 430 ? 29.665  -8.800  67.838  1.00 9.90  ? 430 LEU A CA  1 
ATOM   3438  C C   . LEU A 1 430 ? 29.376  -10.106 68.582  1.00 9.58  ? 430 LEU A C   1 
ATOM   3439  O O   . LEU A 1 430 ? 28.367  -10.776 68.337  1.00 10.28 ? 430 LEU A O   1 
ATOM   3440  C CB  . LEU A 1 430 ? 30.789  -9.035  66.827  1.00 9.49  ? 430 LEU A CB  1 
ATOM   3441  C CG  . LEU A 1 430 ? 31.069  -7.916  65.844  1.00 9.70  ? 430 LEU A CG  1 
ATOM   3442  C CD1 . LEU A 1 430 ? 32.403  -8.072  65.117  1.00 10.22 ? 430 LEU A CD1 1 
ATOM   3443  C CD2 . LEU A 1 430 ? 29.919  -7.822  64.878  1.00 9.74  ? 430 LEU A CD2 1 
ATOM   3444  N N   . ALA A 1 431 ? 30.258  -10.462 69.501  1.00 9.49  ? 431 ALA A N   1 
ATOM   3445  C CA  . ALA A 1 431 ? 30.136  -11.700 70.262  1.00 9.43  ? 431 ALA A CA  1 
ATOM   3446  C C   . ALA A 1 431 ? 28.916  -11.743 71.151  1.00 9.41  ? 431 ALA A C   1 
ATOM   3447  O O   . ALA A 1 431 ? 28.342  -12.796 71.380  1.00 9.95  ? 431 ALA A O   1 
ATOM   3448  C CB  . ALA A 1 431 ? 31.384  -11.914 71.107  1.00 9.45  ? 431 ALA A CB  1 
ATOM   3449  N N   . GLN A 1 432 ? 28.546  -10.605 71.719  1.00 9.25  ? 432 GLN A N   1 
ATOM   3450  C CA  . GLN A 1 432 ? 27.414  -10.588 72.627  1.00 9.01  ? 432 GLN A CA  1 
ATOM   3451  C C   . GLN A 1 432 ? 26.100  -10.919 71.926  1.00 8.40  ? 432 GLN A C   1 
ATOM   3452  O O   . GLN A 1 432 ? 25.327  -11.717 72.421  1.00 8.25  ? 432 GLN A O   1 
ATOM   3453  C CB  . GLN A 1 432 ? 27.358  -9.250  73.365  1.00 8.80  ? 432 GLN A CB  1 
ATOM   3454  C CG  . GLN A 1 432 ? 28.468  -9.130  74.439  1.00 9.10  ? 432 GLN A CG  1 
ATOM   3455  C CD  . GLN A 1 432 ? 28.293  -10.107 75.605  1.00 10.10 ? 432 GLN A CD  1 
ATOM   3456  O OE1 . GLN A 1 432 ? 27.172  -10.514 75.914  1.00 11.89 ? 432 GLN A OE1 1 
ATOM   3457  N NE2 . GLN A 1 432 ? 29.404  -10.475 76.261  1.00 9.72  ? 432 GLN A NE2 1 
ATOM   3458  N N   . THR A 1 433 ? 25.847  -10.346 70.757  1.00 8.75  ? 433 THR A N   1 
ATOM   3459  C CA  . THR A 1 433 ? 24.602  -10.651 70.084  1.00 8.51  ? 433 THR A CA  1 
ATOM   3460  C C   . THR A 1 433 ? 24.688  -12.064 69.539  1.00 8.66  ? 433 THR A C   1 
ATOM   3461  O O   . THR A 1 433 ? 23.674  -12.763 69.467  1.00 9.49  ? 433 THR A O   1 
ATOM   3462  C CB  . THR A 1 433 ? 24.263  -9.648  68.966  1.00 8.97  ? 433 THR A CB  1 
ATOM   3463  O OG1 . THR A 1 433 ? 25.240  -9.717  67.929  1.00 7.40  ? 433 THR A OG1 1 
ATOM   3464  C CG2 . THR A 1 433 ? 24.314  -8.182  69.465  1.00 9.62  ? 433 THR A CG2 1 
ATOM   3465  N N   . GLU A 1 434 ? 25.879  -12.474 69.137  1.00 8.74  ? 434 GLU A N   1 
ATOM   3466  C CA  . GLU A 1 434 ? 26.064  -13.839 68.655  1.00 9.61  ? 434 GLU A CA  1 
ATOM   3467  C C   . GLU A 1 434 ? 25.719  -14.819 69.790  1.00 9.86  ? 434 GLU A C   1 
ATOM   3468  O O   . GLU A 1 434 ? 24.962  -15.777 69.576  1.00 10.57 ? 434 GLU A O   1 
ATOM   3469  C CB  . GLU A 1 434 ? 27.487  -14.065 68.142  1.00 9.62  ? 434 GLU A CB  1 
ATOM   3470  C CG  . GLU A 1 434 ? 27.709  -15.450 67.530  1.00 11.42 ? 434 GLU A CG  1 
ATOM   3471  C CD  . GLU A 1 434 ? 29.174  -15.757 67.244  1.00 11.56 ? 434 GLU A CD  1 
ATOM   3472  O OE1 . GLU A 1 434 ? 29.415  -16.757 66.515  1.00 12.84 ? 434 GLU A OE1 1 
ATOM   3473  O OE2 . GLU A 1 434 ? 30.085  -15.086 67.770  1.00 10.50 ? 434 GLU A OE2 1 
ATOM   3474  N N   . ALA A 1 435 ? 26.237  -14.550 70.990  1.00 10.02 ? 435 ALA A N   1 
ATOM   3475  C CA  . ALA A 1 435 ? 25.985  -15.406 72.159  1.00 9.84  ? 435 ALA A CA  1 
ATOM   3476  C C   . ALA A 1 435 ? 24.526  -15.430 72.577  1.00 9.99  ? 435 ALA A C   1 
ATOM   3477  O O   . ALA A 1 435 ? 23.982  -16.489 72.939  1.00 9.96  ? 435 ALA A O   1 
ATOM   3478  C CB  . ALA A 1 435 ? 26.828  -14.972 73.325  1.00 9.57  ? 435 ALA A CB  1 
ATOM   3479  N N   . LEU A 1 436 ? 23.905  -14.257 72.582  1.00 10.29 ? 436 LEU A N   1 
ATOM   3480  C CA  . LEU A 1 436 ? 22.507  -14.131 72.958  1.00 10.56 ? 436 LEU A CA  1 
ATOM   3481  C C   . LEU A 1 436 ? 21.655  -14.948 72.003  1.00 10.61 ? 436 LEU A C   1 
ATOM   3482  O O   . LEU A 1 436 ? 20.670  -15.558 72.398  1.00 10.66 ? 436 LEU A O   1 
ATOM   3483  C CB  . LEU A 1 436 ? 22.066  -12.662 72.923  1.00 10.63 ? 436 LEU A CB  1 
ATOM   3484  C CG  . LEU A 1 436 ? 22.541  -11.828 74.116  1.00 10.48 ? 436 LEU A CG  1 
ATOM   3485  C CD1 . LEU A 1 436 ? 22.339  -10.353 73.890  1.00 11.21 ? 436 LEU A CD1 1 
ATOM   3486  C CD2 . LEU A 1 436 ? 21.805  -12.231 75.390  1.00 9.95  ? 436 LEU A CD2 1 
ATOM   3487  N N   . MET A 1 437 ? 22.027  -14.937 70.738  1.00 10.55 ? 437 MET A N   1 
ATOM   3488  C CA  . MET A 1 437 ? 21.288  -15.681 69.742  1.00 11.56 ? 437 MET A CA  1 
ATOM   3489  C C   . MET A 1 437 ? 21.544  -17.180 69.866  1.00 11.09 ? 437 MET A C   1 
ATOM   3490  O O   . MET A 1 437 ? 20.604  -17.948 69.943  1.00 11.32 ? 437 MET A O   1 
ATOM   3491  C CB  . MET A 1 437 ? 21.673  -15.221 68.334  1.00 11.37 ? 437 MET A CB  1 
ATOM   3492  C CG  . MET A 1 437 ? 20.870  -15.840 67.223  1.00 13.89 ? 437 MET A CG  1 
ATOM   3493  S SD  . MET A 1 437 ? 21.521  -17.465 66.659  1.00 17.84 ? 437 MET A SD  1 
ATOM   3494  C CE  . MET A 1 437 ? 22.928  -16.944 65.673  1.00 21.28 ? 437 MET A CE  1 
ATOM   3495  N N   . ARG A 1 438 ? 22.814  -17.569 69.888  1.00 12.05 ? 438 ARG A N   1 
ATOM   3496  C CA  . ARG A 1 438 ? 23.203  -18.985 69.817  1.00 13.14 ? 438 ARG A CA  1 
ATOM   3497  C C   . ARG A 1 438 ? 23.055  -19.779 71.102  1.00 13.36 ? 438 ARG A C   1 
ATOM   3498  O O   . ARG A 1 438 ? 22.656  -20.965 71.078  1.00 12.32 ? 438 ARG A O   1 
ATOM   3499  C CB  . ARG A 1 438 ? 24.656  -19.123 69.351  1.00 13.40 ? 438 ARG A CB  1 
ATOM   3500  C CG  . ARG A 1 438 ? 24.938  -18.590 67.975  1.00 14.47 ? 438 ARG A CG  1 
ATOM   3501  C CD  . ARG A 1 438 ? 24.844  -19.647 66.896  1.00 17.91 ? 438 ARG A CD  1 
ATOM   3502  N NE  . ARG A 1 438 ? 25.777  -20.743 67.125  1.00 20.02 ? 438 ARG A NE  1 
ATOM   3503  C CZ  . ARG A 1 438 ? 25.620  -21.953 66.612  1.00 23.61 ? 438 ARG A CZ  1 
ATOM   3504  N NH1 . ARG A 1 438 ? 24.566  -22.202 65.847  1.00 25.65 ? 438 ARG A NH1 1 
ATOM   3505  N NH2 . ARG A 1 438 ? 26.508  -22.913 66.859  1.00 24.24 ? 438 ARG A NH2 1 
ATOM   3506  N N   . GLY A 1 439 ? 23.403  -19.162 72.226  1.00 13.11 ? 439 GLY A N   1 
ATOM   3507  C CA  . GLY A 1 439 ? 23.399  -19.912 73.463  1.00 13.52 ? 439 GLY A CA  1 
ATOM   3508  C C   . GLY A 1 439 ? 24.398  -21.054 73.396  1.00 13.38 ? 439 GLY A C   1 
ATOM   3509  O O   . GLY A 1 439 ? 25.273  -21.082 72.527  1.00 12.95 ? 439 GLY A O   1 
ATOM   3510  N N   . LYS A 1 440 ? 24.268  -21.992 74.328  1.00 13.51 ? 440 LYS A N   1 
ATOM   3511  C CA  . LYS A 1 440 ? 25.191  -23.110 74.451  1.00 13.67 ? 440 LYS A CA  1 
ATOM   3512  C C   . LYS A 1 440 ? 24.366  -24.252 75.029  1.00 14.03 ? 440 LYS A C   1 
ATOM   3513  O O   . LYS A 1 440 ? 23.823  -24.133 76.113  1.00 13.41 ? 440 LYS A O   1 
ATOM   3514  C CB  . LYS A 1 440 ? 26.390  -22.761 75.349  1.00 13.44 ? 440 LYS A CB  1 
ATOM   3515  C CG  . LYS A 1 440 ? 27.355  -23.937 75.581  1.00 13.57 ? 440 LYS A CG  1 
ATOM   3516  C CD  . LYS A 1 440 ? 28.441  -23.666 76.618  1.00 14.79 ? 440 LYS A CD  1 
ATOM   3517  C CE  . LYS A 1 440 ? 29.435  -22.613 76.203  1.00 14.87 ? 440 LYS A CE  1 
ATOM   3518  N NZ  . LYS A 1 440 ? 30.467  -22.314 77.248  1.00 15.07 ? 440 LYS A NZ  1 
ATOM   3519  N N   . SER A 1 441 ? 24.270  -25.356 74.297  1.00 14.77 ? 441 SER A N   1 
ATOM   3520  C CA  . SER A 1 441 ? 23.396  -26.450 74.712  1.00 14.96 ? 441 SER A CA  1 
ATOM   3521  C C   . SER A 1 441 ? 24.019  -27.302 75.813  1.00 15.32 ? 441 SER A C   1 
ATOM   3522  O O   . SER A 1 441 ? 25.218  -27.231 76.075  1.00 15.26 ? 441 SER A O   1 
ATOM   3523  C CB  . SER A 1 441 ? 23.058  -27.338 73.506  1.00 15.26 ? 441 SER A CB  1 
ATOM   3524  O OG  . SER A 1 441 ? 24.247  -27.964 73.027  1.00 14.85 ? 441 SER A OG  1 
ATOM   3525  N N   . THR A 1 442 ? 23.179  -28.105 76.454  1.00 15.99 ? 442 THR A N   1 
ATOM   3526  C CA  . THR A 1 442 ? 23.627  -29.078 77.439  1.00 17.33 ? 442 THR A CA  1 
ATOM   3527  C C   . THR A 1 442 ? 24.758  -29.918 76.851  1.00 17.38 ? 442 THR A C   1 
ATOM   3528  O O   . THR A 1 442 ? 25.798  -30.089 77.461  1.00 17.26 ? 442 THR A O   1 
ATOM   3529  C CB  . THR A 1 442 ? 22.437  -29.975 77.822  1.00 17.71 ? 442 THR A CB  1 
ATOM   3530  O OG1 . THR A 1 442 ? 21.454  -29.185 78.493  1.00 18.37 ? 442 THR A OG1 1 
ATOM   3531  C CG2 . THR A 1 442 ? 22.820  -31.047 78.859  1.00 18.95 ? 442 THR A CG2 1 
ATOM   3532  N N   . GLU A 1 443 ? 24.563  -30.407 75.633  1.00 18.66 ? 443 GLU A N   1 
ATOM   3533  C CA  . GLU A 1 443 ? 25.581  -31.239 75.010  1.00 19.41 ? 443 GLU A CA  1 
ATOM   3534  C C   . GLU A 1 443 ? 26.862  -30.470 74.746  1.00 18.73 ? 443 GLU A C   1 
ATOM   3535  O O   . GLU A 1 443 ? 27.955  -30.995 74.967  1.00 18.45 ? 443 GLU A O   1 
ATOM   3536  C CB  . GLU A 1 443 ? 25.051  -31.899 73.742  1.00 20.67 ? 443 GLU A CB  1 
ATOM   3537  C CG  . GLU A 1 443 ? 24.239  -33.154 74.047  1.00 23.90 ? 443 GLU A CG  1 
ATOM   3538  C CD  . GLU A 1 443 ? 24.899  -34.061 75.094  1.00 27.10 ? 443 GLU A CD  1 
ATOM   3539  O OE1 . GLU A 1 443 ? 26.038  -34.530 74.845  1.00 29.08 ? 443 GLU A OE1 1 
ATOM   3540  O OE2 . GLU A 1 443 ? 24.274  -34.299 76.169  1.00 28.98 ? 443 GLU A OE2 1 
ATOM   3541  N N   . GLU A 1 444 ? 26.739  -29.220 74.311  1.00 17.98 ? 444 GLU A N   1 
ATOM   3542  C CA  . GLU A 1 444 ? 27.916  -28.412 74.050  1.00 17.85 ? 444 GLU A CA  1 
ATOM   3543  C C   . GLU A 1 444 ? 28.692  -28.127 75.335  1.00 17.36 ? 444 GLU A C   1 
ATOM   3544  O O   . GLU A 1 444 ? 29.924  -28.199 75.355  1.00 16.84 ? 444 GLU A O   1 
ATOM   3545  C CB  . GLU A 1 444 ? 27.536  -27.103 73.334  1.00 17.85 ? 444 GLU A CB  1 
ATOM   3546  C CG  . GLU A 1 444 ? 27.241  -27.281 71.847  1.00 18.23 ? 444 GLU A CG  1 
ATOM   3547  C CD  . GLU A 1 444 ? 26.479  -26.120 71.222  1.00 19.99 ? 444 GLU A CD  1 
ATOM   3548  O OE1 . GLU A 1 444 ? 26.482  -26.026 69.970  1.00 18.82 ? 444 GLU A OE1 1 
ATOM   3549  O OE2 . GLU A 1 444 ? 25.862  -25.310 71.966  1.00 15.02 ? 444 GLU A OE2 1 
ATOM   3550  N N   . ALA A 1 445 ? 27.972  -27.784 76.402  1.00 17.16 ? 445 ALA A N   1 
ATOM   3551  C CA  . ALA A 1 445 ? 28.598  -27.521 77.693  1.00 17.17 ? 445 ALA A CA  1 
ATOM   3552  C C   . ALA A 1 445 ? 29.207  -28.800 78.278  1.00 17.46 ? 445 ALA A C   1 
ATOM   3553  O O   . ALA A 1 445 ? 30.249  -28.757 78.951  1.00 15.74 ? 445 ALA A O   1 
ATOM   3554  C CB  . ALA A 1 445 ? 27.575  -26.948 78.678  1.00 16.87 ? 445 ALA A CB  1 
ATOM   3555  N N   . ARG A 1 446 ? 28.545  -29.925 78.036  1.00 18.51 ? 446 ARG A N   1 
ATOM   3556  C CA  . ARG A 1 446 ? 29.051  -31.208 78.540  1.00 19.76 ? 446 ARG A CA  1 
ATOM   3557  C C   . ARG A 1 446 ? 30.387  -31.525 77.895  1.00 20.32 ? 446 ARG A C   1 
ATOM   3558  O O   . ARG A 1 446 ? 31.327  -31.900 78.578  1.00 20.72 ? 446 ARG A O   1 
ATOM   3559  C CB  . ARG A 1 446 ? 28.081  -32.350 78.276  1.00 19.68 ? 446 ARG A CB  1 
ATOM   3560  C CG  . ARG A 1 446 ? 28.646  -33.739 78.646  1.00 21.34 ? 446 ARG A CG  1 
ATOM   3561  C CD  . ARG A 1 446 ? 27.803  -34.901 78.123  1.00 23.41 ? 446 ARG A CD  1 
ATOM   3562  N NE  . ARG A 1 446 ? 26.390  -34.739 78.468  1.00 25.76 ? 446 ARG A NE  1 
ATOM   3563  C CZ  . ARG A 1 446 ? 25.888  -34.872 79.688  1.00 27.77 ? 446 ARG A CZ  1 
ATOM   3564  N NH1 . ARG A 1 446 ? 26.667  -35.188 80.716  1.00 28.35 ? 446 ARG A NH1 1 
ATOM   3565  N NH2 . ARG A 1 446 ? 24.588  -34.694 79.886  1.00 28.88 ? 446 ARG A NH2 1 
ATOM   3566  N N   . LYS A 1 447 ? 30.464  -31.403 76.579  1.00 21.33 ? 447 LYS A N   1 
ATOM   3567  C CA  . LYS A 1 447 ? 31.729  -31.633 75.893  1.00 22.63 ? 447 LYS A CA  1 
ATOM   3568  C C   . LYS A 1 447 ? 32.851  -30.764 76.473  1.00 22.42 ? 447 LYS A C   1 
ATOM   3569  O O   . LYS A 1 447 ? 33.963  -31.238 76.662  1.00 22.13 ? 447 LYS A O   1 
ATOM   3570  C CB  . LYS A 1 447 ? 31.579  -31.419 74.385  1.00 23.06 ? 447 LYS A CB  1 
ATOM   3571  C CG  . LYS A 1 447 ? 30.693  -32.476 73.725  1.00 26.13 ? 447 LYS A CG  1 
ATOM   3572  C CD  . LYS A 1 447 ? 30.814  -32.515 72.183  1.00 30.24 ? 447 LYS A CD  1 
ATOM   3573  C CE  . LYS A 1 447 ? 30.320  -31.229 71.509  1.00 32.89 ? 447 LYS A CE  1 
ATOM   3574  N NZ  . LYS A 1 447 ? 28.821  -31.153 71.305  1.00 34.20 ? 447 LYS A NZ  1 
ATOM   3575  N N   . GLU A 1 448 ? 32.568  -29.500 76.769  1.00 22.55 ? 448 GLU A N   1 
ATOM   3576  C CA  . GLU A 1 448 ? 33.589  -28.623 77.339  1.00 23.04 ? 448 GLU A CA  1 
ATOM   3577  C C   . GLU A 1 448 ? 34.058  -29.104 78.707  1.00 23.40 ? 448 GLU A C   1 
ATOM   3578  O O   . GLU A 1 448 ? 35.249  -29.120 79.002  1.00 23.22 ? 448 GLU A O   1 
ATOM   3579  C CB  . GLU A 1 448 ? 33.055  -27.190 77.490  1.00 23.36 ? 448 GLU A CB  1 
ATOM   3580  C CG  . GLU A 1 448 ? 33.014  -26.404 76.197  1.00 23.31 ? 448 GLU A CG  1 
ATOM   3581  C CD  . GLU A 1 448 ? 32.380  -25.020 76.358  1.00 24.31 ? 448 GLU A CD  1 
ATOM   3582  O OE1 . GLU A 1 448 ? 31.853  -24.695 77.455  1.00 21.72 ? 448 GLU A OE1 1 
ATOM   3583  O OE2 . GLU A 1 448 ? 32.409  -24.261 75.369  1.00 23.32 ? 448 GLU A OE2 1 
ATOM   3584  N N   . LEU A 1 449 ? 33.107  -29.463 79.554  1.00 24.27 ? 449 LEU A N   1 
ATOM   3585  C CA  . LEU A 1 449 ? 33.413  -29.953 80.891  1.00 25.23 ? 449 LEU A CA  1 
ATOM   3586  C C   . LEU A 1 449 ? 34.268  -31.237 80.839  1.00 26.17 ? 449 LEU A C   1 
ATOM   3587  O O   . LEU A 1 449 ? 35.206  -31.383 81.626  1.00 26.55 ? 449 LEU A O   1 
ATOM   3588  C CB  . LEU A 1 449 ? 32.111  -30.207 81.662  1.00 25.05 ? 449 LEU A CB  1 
ATOM   3589  C CG  . LEU A 1 449 ? 31.528  -29.091 82.562  1.00 26.20 ? 449 LEU A CG  1 
ATOM   3590  C CD1 . LEU A 1 449 ? 32.304  -27.792 82.509  1.00 26.28 ? 449 LEU A CD1 1 
ATOM   3591  C CD2 . LEU A 1 449 ? 30.052  -28.858 82.274  1.00 25.76 ? 449 LEU A CD2 1 
ATOM   3592  N N   . GLN A 1 450 ? 33.944  -32.154 79.930  1.00 27.22 ? 450 GLN A N   1 
ATOM   3593  C CA  . GLN A 1 450 ? 34.730  -33.393 79.801  1.00 28.67 ? 450 GLN A CA  1 
ATOM   3594  C C   . GLN A 1 450 ? 36.154  -33.015 79.437  1.00 29.52 ? 450 GLN A C   1 
ATOM   3595  O O   . GLN A 1 450 ? 37.107  -33.495 80.051  1.00 29.51 ? 450 GLN A O   1 
ATOM   3596  C CB  . GLN A 1 450 ? 34.181  -34.356 78.731  1.00 28.89 ? 450 GLN A CB  1 
ATOM   3597  C CG  . GLN A 1 450 ? 32.678  -34.557 78.716  1.00 30.94 ? 450 GLN A CG  1 
ATOM   3598  C CD  . GLN A 1 450 ? 32.226  -35.975 79.051  1.00 33.33 ? 450 GLN A CD  1 
ATOM   3599  O OE1 . GLN A 1 450 ? 31.208  -36.440 78.527  1.00 33.88 ? 450 GLN A OE1 1 
ATOM   3600  N NE2 . GLN A 1 450 ? 32.954  -36.648 79.948  1.00 35.15 ? 450 GLN A NE2 1 
ATOM   3601  N N   . ALA A 1 451 ? 36.290  -32.126 78.451  1.00 30.60 ? 451 ALA A N   1 
ATOM   3602  C CA  . ALA A 1 451 ? 37.601  -31.712 77.961  1.00 31.22 ? 451 ALA A CA  1 
ATOM   3603  C C   . ALA A 1 451 ? 38.426  -31.055 79.053  1.00 31.84 ? 451 ALA A C   1 
ATOM   3604  O O   . ALA A 1 451 ? 39.651  -31.149 79.055  1.00 32.34 ? 451 ALA A O   1 
ATOM   3605  C CB  . ALA A 1 451 ? 37.455  -30.791 76.757  1.00 31.38 ? 451 ALA A CB  1 
ATOM   3606  N N   . ALA A 1 452 ? 37.758  -30.399 79.992  1.00 32.40 ? 452 ALA A N   1 
ATOM   3607  C CA  . ALA A 1 452 ? 38.450  -29.765 81.108  1.00 32.90 ? 452 ALA A CA  1 
ATOM   3608  C C   . ALA A 1 452 ? 38.813  -30.775 82.191  1.00 33.45 ? 452 ALA A C   1 
ATOM   3609  O O   . ALA A 1 452 ? 39.397  -30.411 83.210  1.00 34.06 ? 452 ALA A O   1 
ATOM   3610  C CB  . ALA A 1 452 ? 37.602  -28.651 81.693  1.00 32.84 ? 452 ALA A CB  1 
ATOM   3611  N N   . GLY A 1 453 ? 38.450  -32.035 81.987  1.00 33.90 ? 453 GLY A N   1 
ATOM   3612  C CA  . GLY A 1 453 ? 38.805  -33.093 82.920  1.00 33.97 ? 453 GLY A CA  1 
ATOM   3613  C C   . GLY A 1 453 ? 37.933  -33.232 84.156  1.00 34.19 ? 453 GLY A C   1 
ATOM   3614  O O   . GLY A 1 453 ? 38.359  -33.818 85.155  1.00 34.04 ? 453 GLY A O   1 
ATOM   3615  N N   . LYS A 1 454 ? 36.707  -32.722 84.102  1.00 34.17 ? 454 LYS A N   1 
ATOM   3616  C CA  . LYS A 1 454 ? 35.817  -32.828 85.246  1.00 34.27 ? 454 LYS A CA  1 
ATOM   3617  C C   . LYS A 1 454 ? 35.391  -34.282 85.453  1.00 34.22 ? 454 LYS A C   1 
ATOM   3618  O O   . LYS A 1 454 ? 35.109  -34.989 84.485  1.00 33.99 ? 454 LYS A O   1 
ATOM   3619  C CB  . LYS A 1 454 ? 34.570  -31.972 85.030  1.00 34.50 ? 454 LYS A CB  1 
ATOM   3620  C CG  . LYS A 1 454 ? 34.852  -30.485 84.852  1.00 35.31 ? 454 LYS A CG  1 
ATOM   3621  C CD  . LYS A 1 454 ? 35.150  -29.825 86.177  1.00 37.33 ? 454 LYS A CD  1 
ATOM   3622  C CE  . LYS A 1 454 ? 35.111  -28.304 86.069  1.00 37.83 ? 454 LYS A CE  1 
ATOM   3623  N NZ  . LYS A 1 454 ? 34.861  -27.675 87.399  1.00 38.50 ? 454 LYS A NZ  1 
ATOM   3624  N N   . SER A 1 455 ? 35.338  -34.717 86.708  1.00 33.97 ? 455 SER A N   1 
ATOM   3625  C CA  . SER A 1 455 ? 34.843  -36.048 87.030  1.00 34.14 ? 455 SER A CA  1 
ATOM   3626  C C   . SER A 1 455 ? 33.365  -36.084 86.688  1.00 34.45 ? 455 SER A C   1 
ATOM   3627  O O   . SER A 1 455 ? 32.721  -35.042 86.632  1.00 34.38 ? 455 SER A O   1 
ATOM   3628  C CB  . SER A 1 455 ? 34.996  -36.319 88.515  1.00 34.21 ? 455 SER A CB  1 
ATOM   3629  O OG  . SER A 1 455 ? 34.115  -35.481 89.240  1.00 32.49 ? 455 SER A OG  1 
ATOM   3630  N N   . PRO A 1 456 ? 32.808  -37.270 86.477  1.00 34.89 ? 456 PRO A N   1 
ATOM   3631  C CA  . PRO A 1 456 ? 31.381  -37.375 86.137  1.00 34.91 ? 456 PRO A CA  1 
ATOM   3632  C C   . PRO A 1 456 ? 30.475  -36.666 87.158  1.00 34.71 ? 456 PRO A C   1 
ATOM   3633  O O   . PRO A 1 456 ? 29.533  -35.973 86.760  1.00 34.69 ? 456 PRO A O   1 
ATOM   3634  C CB  . PRO A 1 456 ? 31.133  -38.887 86.112  1.00 35.09 ? 456 PRO A CB  1 
ATOM   3635  C CG  . PRO A 1 456 ? 32.491  -39.485 85.818  1.00 35.09 ? 456 PRO A CG  1 
ATOM   3636  C CD  . PRO A 1 456 ? 33.471  -38.588 86.526  1.00 34.93 ? 456 PRO A CD  1 
ATOM   3637  N N   . GLU A 1 457 ? 30.759  -36.827 88.447  1.00 34.18 ? 457 GLU A N   1 
ATOM   3638  C CA  . GLU A 1 457 ? 29.955  -36.183 89.476  1.00 33.99 ? 457 GLU A CA  1 
ATOM   3639  C C   . GLU A 1 457 ? 30.054  -34.667 89.359  1.00 32.54 ? 457 GLU A C   1 
ATOM   3640  O O   . GLU A 1 457 ? 29.038  -33.987 89.321  1.00 32.40 ? 457 GLU A O   1 
ATOM   3641  C CB  . GLU A 1 457 ? 30.386  -36.625 90.880  1.00 34.57 ? 457 GLU A CB  1 
ATOM   3642  C CG  . GLU A 1 457 ? 29.566  -37.765 91.468  1.00 37.82 ? 457 GLU A CG  1 
ATOM   3643  C CD  . GLU A 1 457 ? 28.580  -37.295 92.530  1.00 41.84 ? 457 GLU A CD  1 
ATOM   3644  O OE1 . GLU A 1 457 ? 27.572  -36.645 92.166  1.00 44.65 ? 457 GLU A OE1 1 
ATOM   3645  O OE2 . GLU A 1 457 ? 28.809  -37.571 93.734  1.00 44.00 ? 457 GLU A OE2 1 
ATOM   3646  N N   . ASP A 1 458 ? 31.278  -34.153 89.286  1.00 30.92 ? 458 ASP A N   1 
ATOM   3647  C CA  . ASP A 1 458 ? 31.512  -32.719 89.201  1.00 29.91 ? 458 ASP A CA  1 
ATOM   3648  C C   . ASP A 1 458 ? 30.871  -32.147 87.949  1.00 28.65 ? 458 ASP A C   1 
ATOM   3649  O O   . ASP A 1 458 ? 30.294  -31.057 87.954  1.00 28.17 ? 458 ASP A O   1 
ATOM   3650  C CB  . ASP A 1 458 ? 33.014  -32.434 89.164  1.00 29.84 ? 458 ASP A CB  1 
ATOM   3651  C CG  . ASP A 1 458 ? 33.654  -32.497 90.530  1.00 30.55 ? 458 ASP A CG  1 
ATOM   3652  O OD1 . ASP A 1 458 ? 32.929  -32.701 91.528  1.00 31.87 ? 458 ASP A OD1 1 
ATOM   3653  O OD2 . ASP A 1 458 ? 34.879  -32.340 90.703  1.00 31.10 ? 458 ASP A OD2 1 
ATOM   3654  N N   . LEU A 1 459 ? 30.985  -32.908 86.873  1.00 27.43 ? 459 LEU A N   1 
ATOM   3655  C CA  . LEU A 1 459 ? 30.424  -32.523 85.596  1.00 26.66 ? 459 LEU A CA  1 
ATOM   3656  C C   . LEU A 1 459 ? 28.911  -32.375 85.688  1.00 26.18 ? 459 LEU A C   1 
ATOM   3657  O O   . LEU A 1 459 ? 28.358  -31.336 85.325  1.00 25.49 ? 459 LEU A O   1 
ATOM   3658  C CB  . LEU A 1 459 ? 30.800  -33.559 84.532  1.00 26.36 ? 459 LEU A CB  1 
ATOM   3659  C CG  . LEU A 1 459 ? 30.467  -33.160 83.098  1.00 26.20 ? 459 LEU A CG  1 
ATOM   3660  C CD1 . LEU A 1 459 ? 31.441  -33.775 82.104  1.00 25.40 ? 459 LEU A CD1 1 
ATOM   3661  C CD2 . LEU A 1 459 ? 29.042  -33.538 82.779  1.00 27.28 ? 459 LEU A CD2 1 
ATOM   3662  N N   . GLU A 1 460 ? 28.239  -33.415 86.170  1.00 25.64 ? 460 GLU A N   1 
ATOM   3663  C CA  . GLU A 1 460 ? 26.781  -33.401 86.248  1.00 25.73 ? 460 GLU A CA  1 
ATOM   3664  C C   . GLU A 1 460 ? 26.287  -32.295 87.166  1.00 25.24 ? 460 GLU A C   1 
ATOM   3665  O O   . GLU A 1 460 ? 25.219  -31.737 86.947  1.00 24.54 ? 460 GLU A O   1 
ATOM   3666  C CB  . GLU A 1 460 ? 26.239  -34.754 86.729  1.00 25.98 ? 460 GLU A CB  1 
ATOM   3667  C CG  . GLU A 1 460 ? 26.530  -35.920 85.801  1.00 26.77 ? 460 GLU A CG  1 
ATOM   3668  C CD  . GLU A 1 460 ? 26.037  -35.717 84.385  1.00 28.34 ? 460 GLU A CD  1 
ATOM   3669  O OE1 . GLU A 1 460 ? 26.734  -36.175 83.459  1.00 29.60 ? 460 GLU A OE1 1 
ATOM   3670  O OE2 . GLU A 1 460 ? 24.957  -35.119 84.194  1.00 29.49 ? 460 GLU A OE2 1 
ATOM   3671  N N   . ARG A 1 461 ? 27.073  -31.993 88.194  1.00 25.07 ? 461 ARG A N   1 
ATOM   3672  C CA  . ARG A 1 461 ? 26.723  -30.963 89.155  1.00 25.57 ? 461 ARG A CA  1 
ATOM   3673  C C   . ARG A 1 461 ? 26.731  -29.568 88.535  1.00 24.12 ? 461 ARG A C   1 
ATOM   3674  O O   . ARG A 1 461 ? 25.828  -28.767 88.773  1.00 24.56 ? 461 ARG A O   1 
ATOM   3675  C CB  . ARG A 1 461 ? 27.715  -30.979 90.319  1.00 26.35 ? 461 ARG A CB  1 
ATOM   3676  C CG  . ARG A 1 461 ? 27.065  -31.095 91.684  1.00 30.86 ? 461 ARG A CG  1 
ATOM   3677  C CD  . ARG A 1 461 ? 26.941  -29.794 92.462  1.00 36.40 ? 461 ARG A CD  1 
ATOM   3678  N NE  . ARG A 1 461 ? 26.084  -29.966 93.641  1.00 40.93 ? 461 ARG A NE  1 
ATOM   3679  C CZ  . ARG A 1 461 ? 25.707  -28.987 94.464  1.00 43.58 ? 461 ARG A CZ  1 
ATOM   3680  N NH1 . ARG A 1 461 ? 26.112  -27.740 94.261  1.00 44.47 ? 461 ARG A NH1 1 
ATOM   3681  N NH2 . ARG A 1 461 ? 24.923  -29.262 95.502  1.00 45.22 ? 461 ARG A NH2 1 
ATOM   3682  N N   . LEU A 1 462 ? 27.746  -29.288 87.736  1.00 22.59 ? 462 LEU A N   1 
ATOM   3683  C CA  . LEU A 1 462 ? 27.931  -27.954 87.195  1.00 21.95 ? 462 LEU A CA  1 
ATOM   3684  C C   . LEU A 1 462 ? 27.212  -27.724 85.871  1.00 20.58 ? 462 LEU A C   1 
ATOM   3685  O O   . LEU A 1 462 ? 26.873  -26.593 85.523  1.00 19.91 ? 462 LEU A O   1 
ATOM   3686  C CB  . LEU A 1 462 ? 29.423  -27.722 87.011  1.00 22.38 ? 462 LEU A CB  1 
ATOM   3687  C CG  . LEU A 1 462 ? 29.895  -26.308 86.703  1.00 23.88 ? 462 LEU A CG  1 
ATOM   3688  C CD1 . LEU A 1 462 ? 29.314  -25.301 87.688  1.00 24.82 ? 462 LEU A CD1 1 
ATOM   3689  C CD2 . LEU A 1 462 ? 31.424  -26.264 86.736  1.00 25.31 ? 462 LEU A CD2 1 
ATOM   3690  N N   . LEU A 1 463 ? 26.993  -28.809 85.143  1.00 18.97 ? 463 LEU A N   1 
ATOM   3691  C CA  . LEU A 1 463 ? 26.455  -28.760 83.787  1.00 18.38 ? 463 LEU A CA  1 
ATOM   3692  C C   . LEU A 1 463 ? 25.288  -27.795 83.566  1.00 17.08 ? 463 LEU A C   1 
ATOM   3693  O O   . LEU A 1 463 ? 25.384  -26.922 82.717  1.00 17.37 ? 463 LEU A O   1 
ATOM   3694  C CB  . LEU A 1 463 ? 26.088  -30.177 83.305  1.00 18.00 ? 463 LEU A CB  1 
ATOM   3695  C CG  . LEU A 1 463 ? 25.468  -30.328 81.913  1.00 18.77 ? 463 LEU A CG  1 
ATOM   3696  C CD1 . LEU A 1 463 ? 26.375  -29.776 80.837  1.00 18.76 ? 463 LEU A CD1 1 
ATOM   3697  C CD2 . LEU A 1 463 ? 25.163  -31.797 81.615  1.00 19.79 ? 463 LEU A CD2 1 
ATOM   3698  N N   . PRO A 1 464 ? 24.192  -27.924 84.306  1.00 16.19 ? 464 PRO A N   1 
ATOM   3699  C CA  . PRO A 1 464 ? 23.030  -27.083 84.022  1.00 15.49 ? 464 PRO A CA  1 
ATOM   3700  C C   . PRO A 1 464 ? 23.328  -25.584 84.169  1.00 14.74 ? 464 PRO A C   1 
ATOM   3701  O O   . PRO A 1 464 ? 22.774  -24.795 83.416  1.00 13.43 ? 464 PRO A O   1 
ATOM   3702  C CB  . PRO A 1 464 ? 21.980  -27.561 85.031  1.00 15.50 ? 464 PRO A CB  1 
ATOM   3703  C CG  . PRO A 1 464 ? 22.706  -28.274 86.056  1.00 16.20 ? 464 PRO A CG  1 
ATOM   3704  C CD  . PRO A 1 464 ? 23.941  -28.837 85.428  1.00 16.07 ? 464 PRO A CD  1 
ATOM   3705  N N   . HIS A 1 465 ? 24.233  -25.217 85.072  1.00 14.54 ? 465 HIS A N   1 
ATOM   3706  C CA  . HIS A 1 465 ? 24.568  -23.812 85.290  1.00 14.41 ? 465 HIS A CA  1 
ATOM   3707  C C   . HIS A 1 465 ? 25.367  -23.215 84.153  1.00 14.61 ? 465 HIS A C   1 
ATOM   3708  O O   . HIS A 1 465 ? 25.492  -21.985 84.060  1.00 15.07 ? 465 HIS A O   1 
ATOM   3709  C CB  . HIS A 1 465 ? 25.385  -23.652 86.568  1.00 14.91 ? 465 HIS A CB  1 
ATOM   3710  C CG  . HIS A 1 465 ? 24.689  -24.140 87.796  1.00 14.71 ? 465 HIS A CG  1 
ATOM   3711  N ND1 . HIS A 1 465 ? 23.884  -23.330 88.567  1.00 15.73 ? 465 HIS A ND1 1 
ATOM   3712  C CD2 . HIS A 1 465 ? 24.692  -25.353 88.397  1.00 15.92 ? 465 HIS A CD2 1 
ATOM   3713  C CE1 . HIS A 1 465 ? 23.417  -24.029 89.589  1.00 17.52 ? 465 HIS A CE1 1 
ATOM   3714  N NE2 . HIS A 1 465 ? 23.893  -25.257 89.509  1.00 15.07 ? 465 HIS A NE2 1 
ATOM   3715  N N   . LYS A 1 466 ? 25.950  -24.083 83.332  1.00 14.42 ? 466 LYS A N   1 
ATOM   3716  C CA  . LYS A 1 466 ? 26.778  -23.678 82.204  1.00 14.67 ? 466 LYS A CA  1 
ATOM   3717  C C   . LYS A 1 466 ? 25.988  -23.612 80.904  1.00 14.02 ? 466 LYS A C   1 
ATOM   3718  O O   . LYS A 1 466 ? 26.533  -23.266 79.875  1.00 13.74 ? 466 LYS A O   1 
ATOM   3719  C CB  . LYS A 1 466 ? 27.932  -24.667 81.985  1.00 15.46 ? 466 LYS A CB  1 
ATOM   3720  C CG  . LYS A 1 466 ? 28.776  -24.984 83.222  1.00 17.35 ? 466 LYS A CG  1 
ATOM   3721  C CD  . LYS A 1 466 ? 30.065  -24.187 83.329  1.00 21.09 ? 466 LYS A CD  1 
ATOM   3722  C CE  . LYS A 1 466 ? 30.800  -24.036 82.028  1.00 23.06 ? 466 LYS A CE  1 
ATOM   3723  N NZ  . LYS A 1 466 ? 32.277  -23.888 82.274  1.00 26.59 ? 466 LYS A NZ  1 
ATOM   3724  N N   . VAL A 1 467 ? 24.704  -23.936 80.945  1.00 13.42 ? 467 VAL A N   1 
ATOM   3725  C CA  . VAL A 1 467 ? 23.893  -23.917 79.737  1.00 13.17 ? 467 VAL A CA  1 
ATOM   3726  C C   . VAL A 1 467 ? 23.309  -22.522 79.471  1.00 12.99 ? 467 VAL A C   1 
ATOM   3727  O O   . VAL A 1 467 ? 22.842  -21.872 80.390  1.00 11.80 ? 467 VAL A O   1 
ATOM   3728  C CB  . VAL A 1 467 ? 22.763  -24.919 79.860  1.00 13.26 ? 467 VAL A CB  1 
ATOM   3729  C CG1 . VAL A 1 467 ? 21.776  -24.786 78.694  1.00 13.52 ? 467 VAL A CG1 1 
ATOM   3730  C CG2 . VAL A 1 467 ? 23.356  -26.325 79.927  1.00 15.23 ? 467 VAL A CG2 1 
ATOM   3731  N N   . PHE A 1 468 ? 23.353  -22.093 78.213  1.00 12.40 ? 468 PHE A N   1 
ATOM   3732  C CA  . PHE A 1 468 ? 22.751  -20.836 77.777  1.00 12.16 ? 468 PHE A CA  1 
ATOM   3733  C C   . PHE A 1 468 ? 21.624  -21.210 76.849  1.00 12.34 ? 468 PHE A C   1 
ATOM   3734  O O   . PHE A 1 468 ? 21.865  -21.804 75.798  1.00 12.06 ? 468 PHE A O   1 
ATOM   3735  C CB  . PHE A 1 468 ? 23.758  -19.965 77.030  1.00 11.61 ? 468 PHE A CB  1 
ATOM   3736  C CG  . PHE A 1 468 ? 24.819  -19.369 77.896  1.00 11.74 ? 468 PHE A CG  1 
ATOM   3737  C CD1 . PHE A 1 468 ? 25.813  -20.157 78.437  1.00 11.35 ? 468 PHE A CD1 1 
ATOM   3738  C CD2 . PHE A 1 468 ? 24.836  -18.000 78.159  1.00 12.46 ? 468 PHE A CD2 1 
ATOM   3739  C CE1 . PHE A 1 468 ? 26.803  -19.623 79.237  1.00 13.24 ? 468 PHE A CE1 1 
ATOM   3740  C CE2 . PHE A 1 468 ? 25.844  -17.456 78.963  1.00 11.88 ? 468 PHE A CE2 1 
ATOM   3741  C CZ  . PHE A 1 468 ? 26.819  -18.266 79.492  1.00 13.35 ? 468 PHE A CZ  1 
ATOM   3742  N N   . GLU A 1 469 ? 20.394  -20.865 77.203  1.00 11.95 ? 469 GLU A N   1 
ATOM   3743  C CA  . GLU A 1 469 ? 19.255  -21.246 76.370  1.00 12.18 ? 469 GLU A CA  1 
ATOM   3744  C C   . GLU A 1 469 ? 19.208  -20.445 75.074  1.00 12.01 ? 469 GLU A C   1 
ATOM   3745  O O   . GLU A 1 469 ? 18.602  -20.858 74.092  1.00 11.02 ? 469 GLU A O   1 
ATOM   3746  C CB  . GLU A 1 469 ? 17.964  -21.102 77.166  1.00 12.65 ? 469 GLU A CB  1 
ATOM   3747  C CG  . GLU A 1 469 ? 17.902  -22.156 78.271  1.00 14.37 ? 469 GLU A CG  1 
ATOM   3748  C CD  . GLU A 1 469 ? 16.638  -22.113 79.117  1.00 17.28 ? 469 GLU A CD  1 
ATOM   3749  O OE1 . GLU A 1 469 ? 16.045  -21.029 79.296  1.00 19.22 ? 469 GLU A OE1 1 
ATOM   3750  O OE2 . GLU A 1 469 ? 16.248  -23.179 79.626  1.00 16.75 ? 469 GLU A OE2 1 
ATOM   3751  N N   . GLY A 1 470 ? 19.855  -19.285 75.072  1.00 11.38 ? 470 GLY A N   1 
ATOM   3752  C CA  . GLY A 1 470 ? 19.908  -18.471 73.865  1.00 10.90 ? 470 GLY A CA  1 
ATOM   3753  C C   . GLY A 1 470 ? 18.540  -18.019 73.379  1.00 10.92 ? 470 GLY A C   1 
ATOM   3754  O O   . GLY A 1 470 ? 17.627  -17.775 74.175  1.00 10.39 ? 470 GLY A O   1 
ATOM   3755  N N   . ASN A 1 471 ? 18.403  -17.885 72.061  1.00 11.23 ? 471 ASN A N   1 
ATOM   3756  C CA  . ASN A 1 471 ? 17.171  -17.414 71.440  1.00 12.00 ? 471 ASN A CA  1 
ATOM   3757  C C   . ASN A 1 471 ? 16.749  -16.037 71.948  1.00 11.92 ? 471 ASN A C   1 
ATOM   3758  O O   . ASN A 1 471 ? 15.551  -15.716 71.984  1.00 11.82 ? 471 ASN A O   1 
ATOM   3759  C CB  . ASN A 1 471 ? 16.022  -18.418 71.631  1.00 12.47 ? 471 ASN A CB  1 
ATOM   3760  C CG  . ASN A 1 471 ? 15.020  -18.384 70.477  1.00 14.53 ? 471 ASN A CG  1 
ATOM   3761  O OD1 . ASN A 1 471 ? 15.387  -18.076 69.342  1.00 18.94 ? 471 ASN A OD1 1 
ATOM   3762  N ND2 . ASN A 1 471 ? 13.774  -18.752 70.750  1.00 15.90 ? 471 ASN A ND2 1 
ATOM   3763  N N   . ARG A 1 472 ? 17.734  -15.234 72.354  1.00 11.87 ? 472 ARG A N   1 
ATOM   3764  C CA  . ARG A 1 472 ? 17.482  -13.881 72.838  1.00 11.22 ? 472 ARG A CA  1 
ATOM   3765  C C   . ARG A 1 472 ? 17.729  -12.871 71.723  1.00 11.56 ? 472 ARG A C   1 
ATOM   3766  O O   . ARG A 1 472 ? 18.839  -12.730 71.239  1.00 10.49 ? 472 ARG A O   1 
ATOM   3767  C CB  . ARG A 1 472 ? 18.351  -13.630 74.047  1.00 11.48 ? 472 ARG A CB  1 
ATOM   3768  C CG  . ARG A 1 472 ? 17.817  -14.386 75.259  1.00 12.99 ? 472 ARG A CG  1 
ATOM   3769  C CD  . ARG A 1 472 ? 18.880  -14.928 76.152  1.00 14.31 ? 472 ARG A CD  1 
ATOM   3770  N NE  . ARG A 1 472 ? 18.375  -15.152 77.502  1.00 16.63 ? 472 ARG A NE  1 
ATOM   3771  C CZ  . ARG A 1 472 ? 17.758  -16.241 77.922  1.00 17.13 ? 472 ARG A CZ  1 
ATOM   3772  N NH1 . ARG A 1 472 ? 17.561  -17.270 77.107  1.00 18.20 ? 472 ARG A NH1 1 
ATOM   3773  N NH2 . ARG A 1 472 ? 17.354  -16.315 79.187  1.00 15.98 ? 472 ARG A NH2 1 
ATOM   3774  N N   . PRO A 1 473 ? 16.678  -12.187 71.286  1.00 11.91 ? 473 PRO A N   1 
ATOM   3775  C CA  . PRO A 1 473 ? 16.767  -11.345 70.091  1.00 11.23 ? 473 PRO A CA  1 
ATOM   3776  C C   . PRO A 1 473 ? 17.416  -9.994  70.276  1.00 10.56 ? 473 PRO A C   1 
ATOM   3777  O O   . PRO A 1 473 ? 17.319  -9.388  71.336  1.00 10.77 ? 473 PRO A O   1 
ATOM   3778  C CB  . PRO A 1 473 ? 15.305  -11.178 69.722  1.00 12.15 ? 473 PRO A CB  1 
ATOM   3779  C CG  . PRO A 1 473 ? 14.651  -11.080 71.039  1.00 12.58 ? 473 PRO A CG  1 
ATOM   3780  C CD  . PRO A 1 473 ? 15.305  -12.207 71.816  1.00 12.12 ? 473 PRO A CD  1 
ATOM   3781  N N   . THR A 1 474 ? 18.123  -9.547  69.240  1.00 10.10 ? 474 THR A N   1 
ATOM   3782  C CA  . THR A 1 474 ? 18.769  -8.241  69.254  1.00 9.62  ? 474 THR A CA  1 
ATOM   3783  C C   . THR A 1 474 ? 18.746  -7.609  67.888  1.00 9.36  ? 474 THR A C   1 
ATOM   3784  O O   . THR A 1 474 ? 18.620  -8.290  66.873  1.00 9.17  ? 474 THR A O   1 
ATOM   3785  C CB  . THR A 1 474 ? 20.241  -8.366  69.624  1.00 9.70  ? 474 THR A CB  1 
ATOM   3786  O OG1 . THR A 1 474 ? 20.894  -9.256  68.687  1.00 9.50  ? 474 THR A OG1 1 
ATOM   3787  C CG2 . THR A 1 474 ? 20.443  -8.995  71.006  1.00 10.41 ? 474 THR A CG2 1 
ATOM   3788  N N   . ASN A 1 475 ? 18.842  -6.283  67.894  1.00 9.39  ? 475 ASN A N   1 
ATOM   3789  C CA  . ASN A 1 475 ? 19.108  -5.494  66.715  1.00 9.10  ? 475 ASN A CA  1 
ATOM   3790  C C   . ASN A 1 475 ? 20.559  -5.057  66.822  1.00 9.23  ? 475 ASN A C   1 
ATOM   3791  O O   . ASN A 1 475 ? 21.013  -4.725  67.919  1.00 9.12  ? 475 ASN A O   1 
ATOM   3792  C CB  . ASN A 1 475 ? 18.286  -4.210  66.729  1.00 8.95  ? 475 ASN A CB  1 
ATOM   3793  C CG  . ASN A 1 475 ? 16.839  -4.428  66.416  1.00 9.09  ? 475 ASN A CG  1 
ATOM   3794  O OD1 . ASN A 1 475 ? 15.961  -3.778  67.007  1.00 9.32  ? 475 ASN A OD1 1 
ATOM   3795  N ND2 . ASN A 1 475 ? 16.569  -5.317  65.461  1.00 5.12  ? 475 ASN A ND2 1 
ATOM   3796  N N   . SER A 1 476 ? 21.300  -5.100  65.719  1.00 9.07  ? 476 SER A N   1 
ATOM   3797  C CA  . SER A 1 476 ? 22.625  -4.473  65.687  1.00 9.46  ? 476 SER A CA  1 
ATOM   3798  C C   . SER A 1 476 ? 22.582  -3.325  64.694  1.00 9.41  ? 476 SER A C   1 
ATOM   3799  O O   . SER A 1 476 ? 22.203  -3.525  63.539  1.00 9.86  ? 476 SER A O   1 
ATOM   3800  C CB  . SER A 1 476 ? 23.722  -5.469  65.305  1.00 9.17  ? 476 SER A CB  1 
ATOM   3801  O OG  . SER A 1 476 ? 23.971  -6.349  66.382  1.00 9.96  ? 476 SER A OG  1 
ATOM   3802  N N   . ILE A 1 477 ? 22.922  -2.126  65.171  1.00 8.91  ? 477 ILE A N   1 
ATOM   3803  C CA  . ILE A 1 477 ? 22.950  -0.923  64.377  1.00 8.82  ? 477 ILE A CA  1 
ATOM   3804  C C   . ILE A 1 477 ? 24.397  -0.397  64.320  1.00 9.07  ? 477 ILE A C   1 
ATOM   3805  O O   . ILE A 1 477 ? 24.950  0.072   65.304  1.00 8.71  ? 477 ILE A O   1 
ATOM   3806  C CB  . ILE A 1 477 ? 21.965  0.127   64.951  1.00 9.40  ? 477 ILE A CB  1 
ATOM   3807  C CG1 . ILE A 1 477 ? 20.529  -0.386  64.802  1.00 11.12 ? 477 ILE A CG1 1 
ATOM   3808  C CG2 . ILE A 1 477 ? 22.107  1.430   64.204  1.00 8.80  ? 477 ILE A CG2 1 
ATOM   3809  C CD1 . ILE A 1 477 ? 19.514  0.258   65.688  1.00 11.80 ? 477 ILE A CD1 1 
ATOM   3810  N N   . VAL A 1 478 ? 25.007  -0.519  63.150  1.00 9.32  ? 478 VAL A N   1 
ATOM   3811  C CA  . VAL A 1 478 ? 26.407  -0.168  62.926  1.00 9.61  ? 478 VAL A CA  1 
ATOM   3812  C C   . VAL A 1 478 ? 26.485  0.984   61.920  1.00 9.83  ? 478 VAL A C   1 
ATOM   3813  O O   . VAL A 1 478 ? 25.827  0.952   60.891  1.00 9.49  ? 478 VAL A O   1 
ATOM   3814  C CB  . VAL A 1 478 ? 27.175  -1.379  62.376  1.00 9.69  ? 478 VAL A CB  1 
ATOM   3815  C CG1 . VAL A 1 478 ? 28.658  -1.071  62.229  1.00 10.09 ? 478 VAL A CG1 1 
ATOM   3816  C CG2 . VAL A 1 478 ? 26.966  -2.567  63.278  1.00 10.63 ? 478 VAL A CG2 1 
ATOM   3817  N N   . PHE A 1 479 ? 27.271  2.005   62.239  1.00 9.94  ? 479 PHE A N   1 
ATOM   3818  C CA  . PHE A 1 479 ? 27.382  3.209   61.402  1.00 9.47  ? 479 PHE A CA  1 
ATOM   3819  C C   . PHE A 1 479 ? 28.853  3.550   61.232  1.00 9.05  ? 479 PHE A C   1 
ATOM   3820  O O   . PHE A 1 479 ? 29.666  3.255   62.090  1.00 7.91  ? 479 PHE A O   1 
ATOM   3821  C CB  . PHE A 1 479 ? 26.593  4.390   61.986  1.00 9.75  ? 479 PHE A CB  1 
ATOM   3822  C CG  . PHE A 1 479 ? 26.566  4.423   63.484  1.00 10.00 ? 479 PHE A CG  1 
ATOM   3823  C CD1 . PHE A 1 479 ? 27.472  5.181   64.200  1.00 10.67 ? 479 PHE A CD1 1 
ATOM   3824  C CD2 . PHE A 1 479 ? 25.609  3.690   64.180  1.00 8.76  ? 479 PHE A CD2 1 
ATOM   3825  C CE1 . PHE A 1 479 ? 27.447  5.159   65.590  1.00 8.69  ? 479 PHE A CE1 1 
ATOM   3826  C CE2 . PHE A 1 479 ? 25.575  3.675   65.547  1.00 8.48  ? 479 PHE A CE2 1 
ATOM   3827  C CZ  . PHE A 1 479 ? 26.489  4.418   66.259  1.00 8.47  ? 479 PHE A CZ  1 
ATOM   3828  N N   . THR A 1 480 ? 29.200  4.157   60.099  1.00 9.11  ? 480 THR A N   1 
ATOM   3829  C CA  . THR A 1 480 ? 30.599  4.396   59.772  1.00 9.14  ? 480 THR A CA  1 
ATOM   3830  C C   . THR A 1 480 ? 31.359  5.125   60.868  1.00 9.27  ? 480 THR A C   1 
ATOM   3831  O O   . THR A 1 480 ? 32.427  4.686   61.305  1.00 9.20  ? 480 THR A O   1 
ATOM   3832  C CB  . THR A 1 480 ? 30.680  5.159   58.455  1.00 8.78  ? 480 THR A CB  1 
ATOM   3833  O OG1 . THR A 1 480 ? 29.985  4.420   57.440  1.00 7.84  ? 480 THR A OG1 1 
ATOM   3834  C CG2 . THR A 1 480 ? 32.102  5.258   57.982  1.00 10.08 ? 480 THR A CG2 1 
ATOM   3835  N N   . LYS A 1 481 ? 30.800  6.232   61.336  1.00 9.01  ? 481 LYS A N   1 
ATOM   3836  C CA  . LYS A 1 481 ? 31.501  7.037   62.320  1.00 9.25  ? 481 LYS A CA  1 
ATOM   3837  C C   . LYS A 1 481 ? 30.510  7.942   63.019  1.00 8.66  ? 481 LYS A C   1 
ATOM   3838  O O   . LYS A 1 481 ? 29.555  8.392   62.399  1.00 7.74  ? 481 LYS A O   1 
ATOM   3839  C CB  . LYS A 1 481 ? 32.598  7.859   61.636  1.00 10.00 ? 481 LYS A CB  1 
ATOM   3840  C CG  . LYS A 1 481 ? 33.533  8.583   62.586  1.00 10.90 ? 481 LYS A CG  1 
ATOM   3841  C CD  . LYS A 1 481 ? 34.688  9.302   61.858  1.00 12.26 ? 481 LYS A CD  1 
ATOM   3842  C CE  . LYS A 1 481 ? 35.656  9.965   62.850  1.00 12.59 ? 481 LYS A CE  1 
ATOM   3843  N NZ  . LYS A 1 481 ? 36.983  10.315  62.185  1.00 13.09 ? 481 LYS A NZ  1 
ATOM   3844  N N   . LEU A 1 482 ? 30.717  8.181   64.308  1.00 8.07  ? 482 LEU A N   1 
ATOM   3845  C CA  . LEU A 1 482 ? 29.791  9.037   65.055  1.00 7.86  ? 482 LEU A CA  1 
ATOM   3846  C C   . LEU A 1 482 ? 30.177  10.521  64.940  1.00 8.26  ? 482 LEU A C   1 
ATOM   3847  O O   . LEU A 1 482 ? 30.768  11.125  65.843  1.00 7.16  ? 482 LEU A O   1 
ATOM   3848  C CB  . LEU A 1 482 ? 29.664  8.593   66.515  1.00 8.33  ? 482 LEU A CB  1 
ATOM   3849  C CG  . LEU A 1 482 ? 28.536  9.301   67.276  1.00 9.07  ? 482 LEU A CG  1 
ATOM   3850  C CD1 . LEU A 1 482 ? 27.169  8.870   66.755  1.00 9.61  ? 482 LEU A CD1 1 
ATOM   3851  C CD2 . LEU A 1 482 ? 28.631  9.028   68.776  1.00 12.50 ? 482 LEU A CD2 1 
ATOM   3852  N N   . THR A 1 483 ? 29.793  11.106  63.821  1.00 8.35  ? 483 THR A N   1 
ATOM   3853  C CA  . THR A 1 483 ? 30.015  12.517  63.563  1.00 9.38  ? 483 THR A CA  1 
ATOM   3854  C C   . THR A 1 483 ? 28.744  13.236  63.950  1.00 9.79  ? 483 THR A C   1 
ATOM   3855  O O   . THR A 1 483 ? 27.738  12.593  64.248  1.00 8.18  ? 483 THR A O   1 
ATOM   3856  C CB  . THR A 1 483 ? 30.211  12.725  62.094  1.00 9.96  ? 483 THR A CB  1 
ATOM   3857  O OG1 . THR A 1 483 ? 29.103  12.144  61.409  1.00 9.81  ? 483 THR A OG1 1 
ATOM   3858  C CG2 . THR A 1 483 ? 31.431  11.961  61.576  1.00 9.53  ? 483 THR A CG2 1 
ATOM   3859  N N   . PRO A 1 484 ? 28.772  14.563  63.954  1.00 9.50  ? 484 PRO A N   1 
ATOM   3860  C CA  . PRO A 1 484 ? 27.557  15.318  64.210  1.00 9.41  ? 484 PRO A CA  1 
ATOM   3861  C C   . PRO A 1 484 ? 26.414  14.909  63.277  1.00 9.18  ? 484 PRO A C   1 
ATOM   3862  O O   . PRO A 1 484 ? 25.282  14.716  63.747  1.00 9.56  ? 484 PRO A O   1 
ATOM   3863  C CB  . PRO A 1 484 ? 27.990  16.763  63.973  1.00 9.56  ? 484 PRO A CB  1 
ATOM   3864  C CG  . PRO A 1 484 ? 29.433  16.764  64.369  1.00 10.28 ? 484 PRO A CG  1 
ATOM   3865  C CD  . PRO A 1 484 ? 29.962  15.430  63.861  1.00 10.14 ? 484 PRO A CD  1 
ATOM   3866  N N   . PHE A 1 485 ? 26.701  14.752  61.989  1.00 8.78  ? 485 PHE A N   1 
ATOM   3867  C CA  . PHE A 1 485 ? 25.673  14.368  61.026  1.00 8.76  ? 485 PHE A CA  1 
ATOM   3868  C C   . PHE A 1 485 ? 25.061  13.002  61.378  1.00 8.58  ? 485 PHE A C   1 
ATOM   3869  O O   . PHE A 1 485 ? 23.827  12.835  61.373  1.00 8.28  ? 485 PHE A O   1 
ATOM   3870  C CB  . PHE A 1 485 ? 26.255  14.366  59.613  1.00 8.78  ? 485 PHE A CB  1 
ATOM   3871  C CG  . PHE A 1 485 ? 25.267  13.963  58.534  1.00 9.64  ? 485 PHE A CG  1 
ATOM   3872  C CD1 . PHE A 1 485 ? 24.660  14.920  57.752  1.00 9.75  ? 485 PHE A CD1 1 
ATOM   3873  C CD2 . PHE A 1 485 ? 24.967  12.629  58.311  1.00 11.05 ? 485 PHE A CD2 1 
ATOM   3874  C CE1 . PHE A 1 485 ? 23.756  14.564  56.756  1.00 9.85  ? 485 PHE A CE1 1 
ATOM   3875  C CE2 . PHE A 1 485 ? 24.061  12.260  57.315  1.00 10.26 ? 485 PHE A CE2 1 
ATOM   3876  C CZ  . PHE A 1 485 ? 23.458  13.227  56.546  1.00 10.19 ? 485 PHE A CZ  1 
ATOM   3877  N N   . MET A 1 486 ? 25.908  12.034  61.686  1.00 8.51  ? 486 MET A N   1 
ATOM   3878  C CA  . MET A 1 486 ? 25.429  10.679  61.934  1.00 9.16  ? 486 MET A CA  1 
ATOM   3879  C C   . MET A 1 486 ? 24.625  10.626  63.222  1.00 8.87  ? 486 MET A C   1 
ATOM   3880  O O   . MET A 1 486 ? 23.637  9.918   63.315  1.00 9.36  ? 486 MET A O   1 
ATOM   3881  C CB  . MET A 1 486 ? 26.586  9.678   61.959  1.00 9.14  ? 486 MET A CB  1 
ATOM   3882  C CG  . MET A 1 486 ? 26.145  8.219   62.156  1.00 9.45  ? 486 MET A CG  1 
ATOM   3883  S SD  . MET A 1 486 ? 25.000  7.694   60.845  1.00 10.49 ? 486 MET A SD  1 
ATOM   3884  C CE  . MET A 1 486 ? 26.077  7.522   59.467  1.00 9.87  ? 486 MET A CE  1 
ATOM   3885  N N   . LEU A 1 487 ? 25.029  11.401  64.216  1.00 8.53  ? 487 LEU A N   1 
ATOM   3886  C CA  . LEU A 1 487 ? 24.282  11.410  65.460  1.00 8.20  ? 487 LEU A CA  1 
ATOM   3887  C C   . LEU A 1 487 ? 22.876  11.940  65.196  1.00 8.33  ? 487 LEU A C   1 
ATOM   3888  O O   . LEU A 1 487 ? 21.892  11.389  65.709  1.00 8.12  ? 487 LEU A O   1 
ATOM   3889  C CB  . LEU A 1 487 ? 25.001  12.227  66.523  1.00 8.64  ? 487 LEU A CB  1 
ATOM   3890  C CG  . LEU A 1 487 ? 24.276  12.364  67.861  1.00 7.50  ? 487 LEU A CG  1 
ATOM   3891  C CD1 . LEU A 1 487 ? 24.000  11.003  68.520  1.00 6.37  ? 487 LEU A CD1 1 
ATOM   3892  C CD2 . LEU A 1 487 ? 25.101  13.228  68.781  1.00 6.89  ? 487 LEU A CD2 1 
ATOM   3893  N N   . GLY A 1 488 ? 22.776  12.995  64.380  1.00 8.27  ? 488 GLY A N   1 
ATOM   3894  C CA  . GLY A 1 488 ? 21.487  13.577  64.043  1.00 8.39  ? 488 GLY A CA  1 
ATOM   3895  C C   . GLY A 1 488 ? 20.555  12.550  63.407  1.00 8.74  ? 488 GLY A C   1 
ATOM   3896  O O   . GLY A 1 488 ? 19.374  12.452  63.750  1.00 8.23  ? 488 GLY A O   1 
ATOM   3897  N N   . ALA A 1 489 ? 21.110  11.788  62.467  1.00 8.64  ? 489 ALA A N   1 
ATOM   3898  C CA  . ALA A 1 489 ? 20.378  10.739  61.768  1.00 8.89  ? 489 ALA A CA  1 
ATOM   3899  C C   . ALA A 1 489 ? 19.887  9.670   62.743  1.00 8.98  ? 489 ALA A C   1 
ATOM   3900  O O   . ALA A 1 489 ? 18.729  9.247   62.684  1.00 9.07  ? 489 ALA A O   1 
ATOM   3901  C CB  . ALA A 1 489 ? 21.265  10.110  60.715  1.00 8.59  ? 489 ALA A CB  1 
ATOM   3902  N N   . LEU A 1 490 ? 20.764  9.251   63.642  1.00 8.79  ? 490 LEU A N   1 
ATOM   3903  C CA  . LEU A 1 490 ? 20.412  8.219   64.622  1.00 8.72  ? 490 LEU A CA  1 
ATOM   3904  C C   . LEU A 1 490 ? 19.294  8.646   65.569  1.00 8.47  ? 490 LEU A C   1 
ATOM   3905  O O   . LEU A 1 490 ? 18.363  7.886   65.826  1.00 8.45  ? 490 LEU A O   1 
ATOM   3906  C CB  . LEU A 1 490 ? 21.655  7.793   65.398  1.00 8.63  ? 490 LEU A CB  1 
ATOM   3907  C CG  . LEU A 1 490 ? 22.736  7.100   64.562  1.00 9.07  ? 490 LEU A CG  1 
ATOM   3908  C CD1 . LEU A 1 490 ? 24.066  6.994   65.300  1.00 9.08  ? 490 LEU A CD1 1 
ATOM   3909  C CD2 . LEU A 1 490 ? 22.274  5.714   64.110  1.00 10.89 ? 490 LEU A CD2 1 
ATOM   3910  N N   . VAL A 1 491 ? 19.403  9.856   66.114  1.00 8.41  ? 491 VAL A N   1 
ATOM   3911  C CA  . VAL A 1 491 ? 18.398  10.341  67.051  1.00 8.74  ? 491 VAL A CA  1 
ATOM   3912  C C   . VAL A 1 491 ? 17.053  10.464  66.340  1.00 8.13  ? 491 VAL A C   1 
ATOM   3913  O O   . VAL A 1 491 ? 16.023  10.065  66.883  1.00 9.32  ? 491 VAL A O   1 
ATOM   3914  C CB  . VAL A 1 491 ? 18.791  11.710  67.665  1.00 8.43  ? 491 VAL A CB  1 
ATOM   3915  C CG1 . VAL A 1 491 ? 17.699  12.228  68.619  1.00 9.13  ? 491 VAL A CG1 1 
ATOM   3916  C CG2 . VAL A 1 491 ? 20.141  11.625  68.382  1.00 9.27  ? 491 VAL A CG2 1 
ATOM   3917  N N   . ALA A 1 492 ? 17.066  11.007  65.124  1.00 7.68  ? 492 ALA A N   1 
ATOM   3918  C CA  . ALA A 1 492 ? 15.830  11.177  64.349  1.00 8.08  ? 492 ALA A CA  1 
ATOM   3919  C C   . ALA A 1 492 ? 15.167  9.820   64.044  1.00 8.02  ? 492 ALA A C   1 
ATOM   3920  O O   . ALA A 1 492 ? 13.935  9.681   64.092  1.00 8.33  ? 492 ALA A O   1 
ATOM   3921  C CB  . ALA A 1 492 ? 16.090  11.943  63.071  1.00 8.10  ? 492 ALA A CB  1 
ATOM   3922  N N   . MET A 1 493 ? 15.995  8.823   63.776  1.00 8.12  ? 493 MET A N   1 
ATOM   3923  C CA  . MET A 1 493 ? 15.519  7.475   63.518  1.00 8.21  ? 493 MET A CA  1 
ATOM   3924  C C   . MET A 1 493 ? 14.685  6.977   64.697  1.00 7.66  ? 493 MET A C   1 
ATOM   3925  O O   . MET A 1 493 ? 13.609  6.426   64.526  1.00 7.17  ? 493 MET A O   1 
ATOM   3926  C CB  . MET A 1 493 ? 16.702  6.547   63.259  1.00 8.37  ? 493 MET A CB  1 
ATOM   3927  C CG  . MET A 1 493 ? 16.308  5.140   62.888  1.00 8.76  ? 493 MET A CG  1 
ATOM   3928  S SD  . MET A 1 493 ? 17.686  4.035   62.524  1.00 9.32  ? 493 MET A SD  1 
ATOM   3929  C CE  . MET A 1 493 ? 18.451  3.917   64.076  1.00 8.77  ? 493 MET A CE  1 
ATOM   3930  N N   . TYR A 1 494 ? 15.198  7.168   65.900  1.00 7.92  ? 494 TYR A N   1 
ATOM   3931  C CA  . TYR A 1 494 ? 14.478  6.766   67.095  1.00 8.21  ? 494 TYR A CA  1 
ATOM   3932  C C   . TYR A 1 494 ? 13.259  7.637   67.348  1.00 8.02  ? 494 TYR A C   1 
ATOM   3933  O O   . TYR A 1 494 ? 12.230  7.140   67.799  1.00 8.30  ? 494 TYR A O   1 
ATOM   3934  C CB  . TYR A 1 494 ? 15.406  6.682   68.312  1.00 8.55  ? 494 TYR A CB  1 
ATOM   3935  C CG  . TYR A 1 494 ? 16.167  5.383   68.381  1.00 9.99  ? 494 TYR A CG  1 
ATOM   3936  C CD1 . TYR A 1 494 ? 17.503  5.315   67.979  1.00 9.13  ? 494 TYR A CD1 1 
ATOM   3937  C CD2 . TYR A 1 494 ? 15.559  4.217   68.856  1.00 10.71 ? 494 TYR A CD2 1 
ATOM   3938  C CE1 . TYR A 1 494 ? 18.209  4.123   68.042  1.00 8.70  ? 494 TYR A CE1 1 
ATOM   3939  C CE2 . TYR A 1 494 ? 16.257  3.020   68.914  1.00 11.27 ? 494 TYR A CE2 1 
ATOM   3940  C CZ  . TYR A 1 494 ? 17.579  2.980   68.497  1.00 10.16 ? 494 TYR A CZ  1 
ATOM   3941  O OH  . TYR A 1 494 ? 18.293  1.819   68.568  1.00 11.93 ? 494 TYR A OH  1 
ATOM   3942  N N   . GLU A 1 495 ? 13.349  8.915   67.025  1.00 7.43  ? 495 GLU A N   1 
ATOM   3943  C CA  . GLU A 1 495 ? 12.192  9.777   67.181  1.00 8.04  ? 495 GLU A CA  1 
ATOM   3944  C C   . GLU A 1 495 ? 11.040  9.197   66.360  1.00 7.86  ? 495 GLU A C   1 
ATOM   3945  O O   . GLU A 1 495 ? 9.918   9.072   66.851  1.00 7.55  ? 495 GLU A O   1 
ATOM   3946  C CB  . GLU A 1 495 ? 12.500  11.238  66.756  1.00 7.73  ? 495 GLU A CB  1 
ATOM   3947  C CG  . GLU A 1 495 ? 13.400  12.003  67.724  1.00 8.24  ? 495 GLU A CG  1 
ATOM   3948  C CD  . GLU A 1 495 ? 13.672  13.451  67.306  1.00 9.37  ? 495 GLU A CD  1 
ATOM   3949  O OE1 . GLU A 1 495 ? 13.599  13.724  66.091  1.00 11.20 ? 495 GLU A OE1 1 
ATOM   3950  O OE2 . GLU A 1 495 ? 13.979  14.280  68.196  1.00 7.30  ? 495 GLU A OE2 1 
ATOM   3951  N N   . HIS A 1 496 ? 11.335  8.796   65.126  1.00 8.23  ? 496 HIS A N   1 
ATOM   3952  C CA  . HIS A 1 496 ? 10.301  8.315   64.222  1.00 8.54  ? 496 HIS A CA  1 
ATOM   3953  C C   . HIS A 1 496 ? 9.811   6.918   64.593  1.00 8.97  ? 496 HIS A C   1 
ATOM   3954  O O   . HIS A 1 496 ? 8.643   6.606   64.363  1.00 9.87  ? 496 HIS A O   1 
ATOM   3955  C CB  . HIS A 1 496 ? 10.754  8.425   62.770  1.00 8.83  ? 496 HIS A CB  1 
ATOM   3956  C CG  . HIS A 1 496 ? 10.901  9.844   62.316  1.00 9.04  ? 496 HIS A CG  1 
ATOM   3957  N ND1 . HIS A 1 496 ? 9.996   10.823  62.668  1.00 10.00 ? 496 HIS A ND1 1 
ATOM   3958  C CD2 . HIS A 1 496 ? 11.825  10.449  61.534  1.00 9.36  ? 496 HIS A CD2 1 
ATOM   3959  C CE1 . HIS A 1 496 ? 10.364  11.973  62.133  1.00 10.73 ? 496 HIS A CE1 1 
ATOM   3960  N NE2 . HIS A 1 496 ? 11.472  11.777  61.443  1.00 9.29  ? 496 HIS A NE2 1 
ATOM   3961  N N   . LYS A 1 497 ? 10.697  6.094   65.138  1.00 8.80  ? 497 LYS A N   1 
ATOM   3962  C CA  . LYS A 1 497 ? 10.311  4.778   65.679  1.00 9.09  ? 497 LYS A CA  1 
ATOM   3963  C C   . LYS A 1 497 ? 9.186   4.975   66.695  1.00 9.16  ? 497 LYS A C   1 
ATOM   3964  O O   . LYS A 1 497 ? 8.114   4.390   66.592  1.00 10.21 ? 497 LYS A O   1 
ATOM   3965  C CB  . LYS A 1 497 ? 11.497  4.103   66.372  1.00 8.97  ? 497 LYS A CB  1 
ATOM   3966  C CG  . LYS A 1 497 ? 11.122  2.810   67.102  1.00 8.50  ? 497 LYS A CG  1 
ATOM   3967  C CD  . LYS A 1 497 ? 12.165  2.384   68.131  1.00 7.00  ? 497 LYS A CD  1 
ATOM   3968  C CE  . LYS A 1 497 ? 11.651  1.247   69.037  1.00 8.80  ? 497 LYS A CE  1 
ATOM   3969  N NZ  . LYS A 1 497 ? 12.659  0.774   70.007  1.00 6.83  ? 497 LYS A NZ  1 
ATOM   3970  N N   . ILE A 1 498 ? 9.439   5.881   67.642  1.00 9.87  ? 498 ILE A N   1 
ATOM   3971  C CA  . ILE A 1 498 ? 8.503   6.225   68.711  1.00 9.66  ? 498 ILE A CA  1 
ATOM   3972  C C   . ILE A 1 498 ? 7.169   6.735   68.142  1.00 10.05 ? 498 ILE A C   1 
ATOM   3973  O O   . ILE A 1 498 ? 6.090   6.396   68.621  1.00 8.62  ? 498 ILE A O   1 
ATOM   3974  C CB  . ILE A 1 498 ? 9.157   7.303   69.632  1.00 9.69  ? 498 ILE A CB  1 
ATOM   3975  C CG1 . ILE A 1 498 ? 10.285  6.677   70.450  1.00 10.39 ? 498 ILE A CG1 1 
ATOM   3976  C CG2 . ILE A 1 498 ? 8.131   7.934   70.550  1.00 9.12  ? 498 ILE A CG2 1 
ATOM   3977  C CD1 . ILE A 1 498 ? 11.299  7.662   70.965  1.00 12.44 ? 498 ILE A CD1 1 
ATOM   3978  N N   . PHE A 1 499 ? 7.262   7.572   67.117  1.00 10.41 ? 499 PHE A N   1 
ATOM   3979  C CA  . PHE A 1 499 ? 6.084   8.150   66.478  1.00 10.88 ? 499 PHE A CA  1 
ATOM   3980  C C   . PHE A 1 499 ? 5.236   7.014   65.883  1.00 10.05 ? 499 PHE A C   1 
ATOM   3981  O O   . PHE A 1 499 ? 4.025   6.942   66.090  1.00 10.20 ? 499 PHE A O   1 
ATOM   3982  C CB  . PHE A 1 499 ? 6.517   9.139   65.399  1.00 11.04 ? 499 PHE A CB  1 
ATOM   3983  C CG  . PHE A 1 499 ? 5.408   9.562   64.474  1.00 13.01 ? 499 PHE A CG  1 
ATOM   3984  C CD1 . PHE A 1 499 ? 4.336   10.284  64.931  1.00 14.84 ? 499 PHE A CD1 1 
ATOM   3985  C CD2 . PHE A 1 499 ? 5.456   9.239   63.139  1.00 16.83 ? 499 PHE A CD2 1 
ATOM   3986  C CE1 . PHE A 1 499 ? 3.334   10.692  64.064  1.00 16.57 ? 499 PHE A CE1 1 
ATOM   3987  C CE2 . PHE A 1 499 ? 4.451   9.622   62.282  1.00 18.48 ? 499 PHE A CE2 1 
ATOM   3988  C CZ  . PHE A 1 499 ? 3.391   10.359  62.751  1.00 18.38 ? 499 PHE A CZ  1 
ATOM   3989  N N   . VAL A 1 500 ? 5.887   6.081   65.219  1.00 9.51  ? 500 VAL A N   1 
ATOM   3990  C CA  . VAL A 1 500 ? 5.171   4.988   64.568  1.00 9.71  ? 500 VAL A CA  1 
ATOM   3991  C C   . VAL A 1 500 ? 4.454   4.072   65.581  1.00 9.68  ? 500 VAL A C   1 
ATOM   3992  O O   . VAL A 1 500 ? 3.298   3.674   65.366  1.00 8.89  ? 500 VAL A O   1 
ATOM   3993  C CB  . VAL A 1 500 ? 6.102   4.173   63.643  1.00 8.92  ? 500 VAL A CB  1 
ATOM   3994  C CG1 . VAL A 1 500 ? 5.415   2.931   63.173  1.00 8.92  ? 500 VAL A CG1 1 
ATOM   3995  C CG2 . VAL A 1 500 ? 6.522   5.009   62.458  1.00 10.08 ? 500 VAL A CG2 1 
ATOM   3996  N N   . GLN A 1 501 ? 5.157   3.693   66.645  1.00 9.01  ? 501 GLN A N   1 
ATOM   3997  C CA  . GLN A 1 501 ? 4.541   2.941   67.720  1.00 8.97  ? 501 GLN A CA  1 
ATOM   3998  C C   . GLN A 1 501 ? 3.325   3.672   68.286  1.00 9.11  ? 501 GLN A C   1 
ATOM   3999  O O   . GLN A 1 501 ? 2.300   3.058   68.527  1.00 8.93  ? 501 GLN A O   1 
ATOM   4000  C CB  . GLN A 1 501 ? 5.561   2.615   68.819  1.00 8.62  ? 501 GLN A CB  1 
ATOM   4001  C CG  . GLN A 1 501 ? 6.641   1.667   68.333  1.00 8.66  ? 501 GLN A CG  1 
ATOM   4002  C CD  . GLN A 1 501 ? 7.631   1.229   69.401  1.00 9.47  ? 501 GLN A CD  1 
ATOM   4003  O OE1 . GLN A 1 501 ? 7.966   2.006   70.297  1.00 9.40  ? 501 GLN A OE1 1 
ATOM   4004  N NE2 . GLN A 1 501 ? 8.148   -0.007  69.270  1.00 8.30  ? 501 GLN A NE2 1 
ATOM   4005  N N   . GLY A 1 502 ? 3.442   4.973   68.491  1.00 9.34  ? 502 GLY A N   1 
ATOM   4006  C CA  . GLY A 1 502 ? 2.329   5.742   69.032  1.00 9.95  ? 502 GLY A CA  1 
ATOM   4007  C C   . GLY A 1 502 ? 1.100   5.713   68.121  1.00 10.59 ? 502 GLY A C   1 
ATOM   4008  O O   . GLY A 1 502 ? -0.036  5.652   68.597  1.00 11.03 ? 502 GLY A O   1 
ATOM   4009  N N   . ILE A 1 503 ? 1.322   5.747   66.810  1.00 10.57 ? 503 ILE A N   1 
ATOM   4010  C CA  . ILE A 1 503 ? 0.221   5.752   65.847  1.00 11.58 ? 503 ILE A CA  1 
ATOM   4011  C C   . ILE A 1 503 ? -0.454  4.389   65.896  1.00 11.53 ? 503 ILE A C   1 
ATOM   4012  O O   . ILE A 1 503 ? -1.685  4.273   65.932  1.00 11.61 ? 503 ILE A O   1 
ATOM   4013  C CB  . ILE A 1 503 ? 0.742   6.004   64.443  1.00 11.23 ? 503 ILE A CB  1 
ATOM   4014  C CG1 . ILE A 1 503 ? 1.266   7.440   64.307  1.00 12.44 ? 503 ILE A CG1 1 
ATOM   4015  C CG2 . ILE A 1 503 ? -0.313  5.645   63.366  1.00 13.25 ? 503 ILE A CG2 1 
ATOM   4016  C CD1 . ILE A 1 503 ? 0.353   8.523   64.751  1.00 15.24 ? 503 ILE A CD1 1 
ATOM   4017  N N   . ILE A 1 504 ? 0.376   3.363   65.909  1.00 11.03 ? 504 ILE A N   1 
ATOM   4018  C CA  . ILE A 1 504 ? -0.122  2.009   65.979  1.00 11.29 ? 504 ILE A CA  1 
ATOM   4019  C C   . ILE A 1 504 ? -0.957  1.791   67.253  1.00 11.41 ? 504 ILE A C   1 
ATOM   4020  O O   . ILE A 1 504 ? -2.020  1.183   67.189  1.00 11.08 ? 504 ILE A O   1 
ATOM   4021  C CB  . ILE A 1 504 ? 1.052   1.044   65.848  1.00 10.52 ? 504 ILE A CB  1 
ATOM   4022  C CG1 . ILE A 1 504 ? 1.505   1.028   64.383  1.00 12.08 ? 504 ILE A CG1 1 
ATOM   4023  C CG2 . ILE A 1 504 ? 0.663   -0.343  66.309  1.00 11.84 ? 504 ILE A CG2 1 
ATOM   4024  C CD1 . ILE A 1 504 ? 2.747   0.230   64.094  1.00 10.93 ? 504 ILE A CD1 1 
ATOM   4025  N N   . TRP A 1 505 ? -0.520  2.335   68.386  1.00 11.29 ? 505 TRP A N   1 
ATOM   4026  C CA  . TRP A 1 505 ? -1.244  2.154   69.636  1.00 11.74 ? 505 TRP A CA  1 
ATOM   4027  C C   . TRP A 1 505 ? -2.427  3.095   69.762  1.00 13.00 ? 505 TRP A C   1 
ATOM   4028  O O   . TRP A 1 505 ? -3.212  2.957   70.687  1.00 13.13 ? 505 TRP A O   1 
ATOM   4029  C CB  . TRP A 1 505 ? -0.326  2.383   70.838  1.00 11.75 ? 505 TRP A CB  1 
ATOM   4030  C CG  . TRP A 1 505 ? 0.638   1.245   71.070  1.00 10.47 ? 505 TRP A CG  1 
ATOM   4031  C CD1 . TRP A 1 505 ? 0.391   -0.089  70.922  1.00 9.85  ? 505 TRP A CD1 1 
ATOM   4032  C CD2 . TRP A 1 505 ? 1.998   1.350   71.497  1.00 12.21 ? 505 TRP A CD2 1 
ATOM   4033  N NE1 . TRP A 1 505 ? 1.511   -0.821  71.241  1.00 10.43 ? 505 TRP A NE1 1 
ATOM   4034  C CE2 . TRP A 1 505 ? 2.519   0.042   71.581  1.00 10.50 ? 505 TRP A CE2 1 
ATOM   4035  C CE3 . TRP A 1 505 ? 2.844   2.424   71.807  1.00 10.69 ? 505 TRP A CE3 1 
ATOM   4036  C CZ2 . TRP A 1 505 ? 3.842   -0.213  71.956  1.00 10.98 ? 505 TRP A CZ2 1 
ATOM   4037  C CZ3 . TRP A 1 505 ? 4.135   2.165   72.162  1.00 10.52 ? 505 TRP A CZ3 1 
ATOM   4038  C CH2 . TRP A 1 505 ? 4.629   0.853   72.235  1.00 9.69  ? 505 TRP A CH2 1 
ATOM   4039  N N   . ASP A 1 506 ? -2.520  4.062   68.857  1.00 13.52 ? 506 ASP A N   1 
ATOM   4040  C CA  . ASP A 1 506 ? -3.580  5.078   68.859  1.00 14.34 ? 506 ASP A CA  1 
ATOM   4041  C C   . ASP A 1 506 ? -3.534  6.013   70.073  1.00 14.03 ? 506 ASP A C   1 
ATOM   4042  O O   . ASP A 1 506 ? -4.575  6.492   70.536  1.00 14.45 ? 506 ASP A O   1 
ATOM   4043  C CB  . ASP A 1 506 ? -4.966  4.431   68.742  1.00 15.12 ? 506 ASP A CB  1 
ATOM   4044  C CG  . ASP A 1 506 ? -5.975  5.332   68.037  1.00 17.65 ? 506 ASP A CG  1 
ATOM   4045  O OD1 . ASP A 1 506 ? -5.663  5.862   66.947  1.00 21.93 ? 506 ASP A OD1 1 
ATOM   4046  O OD2 . ASP A 1 506 ? -7.099  5.580   68.517  1.00 19.58 ? 506 ASP A OD2 1 
ATOM   4047  N N   . ILE A 1 507 ? -2.327  6.291   70.568  1.00 13.57 ? 507 ILE A N   1 
ATOM   4048  C CA  . ILE A 1 507 ? -2.140  7.208   71.694  1.00 13.38 ? 507 ILE A CA  1 
ATOM   4049  C C   . ILE A 1 507 ? -1.515  8.499   71.179  1.00 12.72 ? 507 ILE A C   1 
ATOM   4050  O O   . ILE A 1 507 ? -1.160  8.595   70.002  1.00 11.79 ? 507 ILE A O   1 
ATOM   4051  C CB  . ILE A 1 507 ? -1.279  6.573   72.815  1.00 13.63 ? 507 ILE A CB  1 
ATOM   4052  C CG1 . ILE A 1 507 ? 0.049   6.015   72.271  1.00 15.50 ? 507 ILE A CG1 1 
ATOM   4053  C CG2 . ILE A 1 507 ? -2.027  5.441   73.461  1.00 13.57 ? 507 ILE A CG2 1 
ATOM   4054  C CD1 . ILE A 1 507 ? 1.172   7.000   72.251  1.00 18.36 ? 507 ILE A CD1 1 
ATOM   4055  N N   . ASN A 1 508 ? -1.396  9.490   72.059  1.00 12.24 ? 508 ASN A N   1 
ATOM   4056  C CA  . ASN A 1 508 ? -0.802  10.770  71.680  1.00 11.89 ? 508 ASN A CA  1 
ATOM   4057  C C   . ASN A 1 508 ? 0.635   10.789  72.178  1.00 11.15 ? 508 ASN A C   1 
ATOM   4058  O O   . ASN A 1 508 ? 0.868   10.906  73.367  1.00 10.68 ? 508 ASN A O   1 
ATOM   4059  C CB  . ASN A 1 508 ? -1.603  11.939  72.275  1.00 11.74 ? 508 ASN A CB  1 
ATOM   4060  C CG  . ASN A 1 508 ? -1.122  13.274  71.778  1.00 11.51 ? 508 ASN A CG  1 
ATOM   4061  O OD1 . ASN A 1 508 ? -0.179  13.331  70.983  1.00 12.00 ? 508 ASN A OD1 1 
ATOM   4062  N ND2 . ASN A 1 508 ? -1.764  14.375  72.233  1.00 10.65 ? 508 ASN A ND2 1 
ATOM   4063  N N   . SER A 1 509 ? 1.594   10.625  71.271  1.00 10.62 ? 509 SER A N   1 
ATOM   4064  C CA  . SER A 1 509 ? 3.000   10.609  71.646  1.00 10.48 ? 509 SER A CA  1 
ATOM   4065  C C   . SER A 1 509 ? 3.535   11.961  72.045  1.00 10.29 ? 509 SER A C   1 
ATOM   4066  O O   . SER A 1 509 ? 4.673   12.059  72.501  1.00 10.36 ? 509 SER A O   1 
ATOM   4067  C CB  . SER A 1 509 ? 3.859   10.128  70.472  1.00 10.65 ? 509 SER A CB  1 
ATOM   4068  O OG  . SER A 1 509 ? 3.607   8.790   70.114  1.00 10.65 ? 509 SER A OG  1 
ATOM   4069  N N   . PHE A 1 510 ? 2.706   12.993  71.931  1.00 10.53 ? 510 PHE A N   1 
ATOM   4070  C CA  . PHE A 1 510 ? 3.180   14.361  72.010  1.00 10.11 ? 510 PHE A CA  1 
ATOM   4071  C C   . PHE A 1 510 ? 2.686   15.236  73.137  1.00 10.19 ? 510 PHE A C   1 
ATOM   4072  O O   . PHE A 1 510 ? 3.081   16.380  73.211  1.00 10.45 ? 510 PHE A O   1 
ATOM   4073  C CB  . PHE A 1 510 ? 2.970   14.995  70.633  1.00 10.83 ? 510 PHE A CB  1 
ATOM   4074  C CG  . PHE A 1 510 ? 3.667   14.228  69.568  1.00 9.17  ? 510 PHE A CG  1 
ATOM   4075  C CD1 . PHE A 1 510 ? 2.962   13.418  68.714  1.00 10.99 ? 510 PHE A CD1 1 
ATOM   4076  C CD2 . PHE A 1 510 ? 5.043   14.210  69.518  1.00 9.60  ? 510 PHE A CD2 1 
ATOM   4077  C CE1 . PHE A 1 510 ? 3.616   12.654  67.777  1.00 10.13 ? 510 PHE A CE1 1 
ATOM   4078  C CE2 . PHE A 1 510 ? 5.701   13.432  68.593  1.00 10.13 ? 510 PHE A CE2 1 
ATOM   4079  C CZ  . PHE A 1 510 ? 4.989   12.650  67.725  1.00 10.87 ? 510 PHE A CZ  1 
ATOM   4080  N N   . ASP A 1 511 ? 1.861   14.681  74.022  1.00 10.37 ? 511 ASP A N   1 
ATOM   4081  C CA  . ASP A 1 511 ? 1.400   15.373  75.226  1.00 10.67 ? 511 ASP A CA  1 
ATOM   4082  C C   . ASP A 1 511 ? 2.040   14.685  76.442  1.00 10.97 ? 511 ASP A C   1 
ATOM   4083  O O   . ASP A 1 511 ? 2.855   13.750  76.283  1.00 11.10 ? 511 ASP A O   1 
ATOM   4084  C CB  . ASP A 1 511 ? -0.142  15.402  75.297  1.00 10.62 ? 511 ASP A CB  1 
ATOM   4085  C CG  . ASP A 1 511 ? -0.768  14.017  75.417  1.00 11.38 ? 511 ASP A CG  1 
ATOM   4086  O OD1 . ASP A 1 511 ? -2.018  13.924  75.261  1.00 10.11 ? 511 ASP A OD1 1 
ATOM   4087  O OD2 . ASP A 1 511 ? -0.108  12.980  75.657  1.00 12.73 ? 511 ASP A OD2 1 
ATOM   4088  N N   . GLN A 1 512 ? 1.710   15.153  77.639  1.00 10.73 ? 512 GLN A N   1 
ATOM   4089  C CA  . GLN A 1 512 ? 2.273   14.598  78.877  1.00 11.40 ? 512 GLN A CA  1 
ATOM   4090  C C   . GLN A 1 512 ? 1.457   15.023  80.095  1.00 11.68 ? 512 GLN A C   1 
ATOM   4091  O O   . GLN A 1 512 ? 1.967   15.630  81.049  1.00 11.45 ? 512 GLN A O   1 
ATOM   4092  C CB  . GLN A 1 512 ? 3.743   15.000  79.056  1.00 11.92 ? 512 GLN A CB  1 
ATOM   4093  C CG  . GLN A 1 512 ? 4.050   16.478  79.009  1.00 12.32 ? 512 GLN A CG  1 
ATOM   4094  C CD  . GLN A 1 512 ? 3.998   17.080  77.618  1.00 12.98 ? 512 GLN A CD  1 
ATOM   4095  O OE1 . GLN A 1 512 ? 4.515   16.506  76.646  1.00 12.06 ? 512 GLN A OE1 1 
ATOM   4096  N NE2 . GLN A 1 512 ? 3.373   18.259  77.517  1.00 16.08 ? 512 GLN A NE2 1 
ATOM   4097  N N   . TRP A 1 513 ? 0.187   14.652  80.072  1.00 11.64 ? 513 TRP A N   1 
ATOM   4098  C CA  . TRP A 1 513 ? -0.721  15.027  81.135  1.00 11.75 ? 513 TRP A CA  1 
ATOM   4099  C C   . TRP A 1 513 ? -0.355  14.314  82.429  1.00 12.15 ? 513 TRP A C   1 
ATOM   4100  O O   . TRP A 1 513 ? -0.792  14.718  83.496  1.00 11.63 ? 513 TRP A O   1 
ATOM   4101  C CB  . TRP A 1 513 ? -2.160  14.742  80.724  1.00 11.85 ? 513 TRP A CB  1 
ATOM   4102  C CG  . TRP A 1 513 ? -2.612  15.611  79.602  1.00 11.12 ? 513 TRP A CG  1 
ATOM   4103  C CD1 . TRP A 1 513 ? -2.854  15.228  78.318  1.00 11.63 ? 513 TRP A CD1 1 
ATOM   4104  C CD2 . TRP A 1 513 ? -2.862  17.025  79.652  1.00 13.77 ? 513 TRP A CD2 1 
ATOM   4105  N NE1 . TRP A 1 513 ? -3.241  16.312  77.568  1.00 11.43 ? 513 TRP A NE1 1 
ATOM   4106  C CE2 . TRP A 1 513 ? -3.246  17.429  78.361  1.00 12.43 ? 513 TRP A CE2 1 
ATOM   4107  C CE3 . TRP A 1 513 ? -2.790  17.994  80.662  1.00 13.50 ? 513 TRP A CE3 1 
ATOM   4108  C CZ2 . TRP A 1 513 ? -3.567  18.757  78.049  1.00 14.89 ? 513 TRP A CZ2 1 
ATOM   4109  C CZ3 . TRP A 1 513 ? -3.105  19.304  80.360  1.00 14.82 ? 513 TRP A CZ3 1 
ATOM   4110  C CH2 . TRP A 1 513 ? -3.488  19.679  79.060  1.00 15.24 ? 513 TRP A CH2 1 
ATOM   4111  N N   . GLY A 1 514 ? 0.467   13.273  82.320  1.00 12.66 ? 514 GLY A N   1 
ATOM   4112  C CA  . GLY A 1 514 ? 0.885   12.477  83.457  1.00 13.62 ? 514 GLY A CA  1 
ATOM   4113  C C   . GLY A 1 514 ? 1.764   13.169  84.475  1.00 14.22 ? 514 GLY A C   1 
ATOM   4114  O O   . GLY A 1 514 ? 1.996   12.629  85.561  1.00 14.64 ? 514 GLY A O   1 
ATOM   4115  N N   . VAL A 1 515 ? 2.232   14.368  84.160  1.00 14.98 ? 515 VAL A N   1 
ATOM   4116  C CA  . VAL A 1 515 ? 3.103   15.074  85.078  1.00 16.23 ? 515 VAL A CA  1 
ATOM   4117  C C   . VAL A 1 515 ? 2.348   16.034  85.999  1.00 15.68 ? 515 VAL A C   1 
ATOM   4118  O O   . VAL A 1 515 ? 2.908   16.540  86.974  1.00 16.20 ? 515 VAL A O   1 
ATOM   4119  C CB  . VAL A 1 515 ? 4.199   15.832  84.303  1.00 16.92 ? 515 VAL A CB  1 
ATOM   4120  C CG1 . VAL A 1 515 ? 4.805   14.898  83.268  1.00 18.87 ? 515 VAL A CG1 1 
ATOM   4121  C CG2 . VAL A 1 515 ? 3.653   17.095  83.626  1.00 17.89 ? 515 VAL A CG2 1 
ATOM   4122  N N   . GLU A 1 516 ? 1.064   16.225  85.745  1.00 14.50 ? 516 GLU A N   1 
ATOM   4123  C CA  . GLU A 1 516 ? 0.324   17.249  86.480  1.00 14.57 ? 516 GLU A CA  1 
ATOM   4124  C C   . GLU A 1 516 ? 0.071   16.966  87.961  1.00 12.98 ? 516 GLU A C   1 
ATOM   4125  O O   . GLU A 1 516 ? 0.213   17.850  88.804  1.00 12.11 ? 516 GLU A O   1 
ATOM   4126  C CB  . GLU A 1 516 ? -1.010  17.504  85.781  1.00 15.30 ? 516 GLU A CB  1 
ATOM   4127  C CG  . GLU A 1 516 ? -1.385  18.966  85.723  1.00 19.82 ? 516 GLU A CG  1 
ATOM   4128  C CD  . GLU A 1 516 ? -2.796  19.197  85.202  1.00 23.59 ? 516 GLU A CD  1 
ATOM   4129  O OE1 . GLU A 1 516 ? -3.538  19.965  85.873  1.00 29.62 ? 516 GLU A OE1 1 
ATOM   4130  O OE2 . GLU A 1 516 ? -3.165  18.626  84.146  1.00 21.15 ? 516 GLU A OE2 1 
ATOM   4131  N N   . LEU A 1 517 ? -0.339  15.745  88.280  1.00 12.51 ? 517 LEU A N   1 
ATOM   4132  C CA  . LEU A 1 517 ? -0.770  15.436  89.649  1.00 12.27 ? 517 LEU A CA  1 
ATOM   4133  C C   . LEU A 1 517 ? 0.360   15.631  90.655  1.00 12.36 ? 517 LEU A C   1 
ATOM   4134  O O   . LEU A 1 517 ? 0.184   16.272  91.680  1.00 12.16 ? 517 LEU A O   1 
ATOM   4135  C CB  . LEU A 1 517 ? -1.337  14.018  89.712  1.00 12.04 ? 517 LEU A CB  1 
ATOM   4136  C CG  . LEU A 1 517 ? -1.854  13.542  91.077  1.00 11.59 ? 517 LEU A CG  1 
ATOM   4137  C CD1 . LEU A 1 517 ? -2.875  14.502  91.677  1.00 12.94 ? 517 LEU A CD1 1 
ATOM   4138  C CD2 . LEU A 1 517 ? -2.402  12.127  90.937  1.00 12.03 ? 517 LEU A CD2 1 
ATOM   4139  N N   . GLY A 1 518 ? 1.536   15.105  90.349  1.00 12.62 ? 518 GLY A N   1 
ATOM   4140  C CA  . GLY A 1 518 ? 2.676   15.259  91.249  1.00 12.69 ? 518 GLY A CA  1 
ATOM   4141  C C   . GLY A 1 518 ? 3.012   16.721  91.480  1.00 13.07 ? 518 GLY A C   1 
ATOM   4142  O O   . GLY A 1 518 ? 3.308   17.135  92.597  1.00 12.48 ? 518 GLY A O   1 
ATOM   4143  N N   . LYS A 1 519 ? 2.932   17.528  90.435  1.00 13.76 ? 519 LYS A N   1 
ATOM   4144  C CA  . LYS A 1 519 ? 3.210   18.953  90.571  1.00 14.94 ? 519 LYS A CA  1 
ATOM   4145  C C   . LYS A 1 519 ? 2.195   19.594  91.507  1.00 14.35 ? 519 LYS A C   1 
ATOM   4146  O O   . LYS A 1 519 ? 2.562   20.410  92.357  1.00 13.81 ? 519 LYS A O   1 
ATOM   4147  C CB  . LYS A 1 519 ? 3.137   19.683  89.222  1.00 15.94 ? 519 LYS A CB  1 
ATOM   4148  C CG  . LYS A 1 519 ? 4.127   19.228  88.183  1.00 20.04 ? 519 LYS A CG  1 
ATOM   4149  C CD  . LYS A 1 519 ? 4.251   20.287  87.073  1.00 24.73 ? 519 LYS A CD  1 
ATOM   4150  C CE  . LYS A 1 519 ? 4.666   19.668  85.758  1.00 27.35 ? 519 LYS A CE  1 
ATOM   4151  N NZ  . LYS A 1 519 ? 4.438   20.597  84.599  1.00 30.03 ? 519 LYS A NZ  1 
ATOM   4152  N N   . GLN A 1 520 ? 0.922   19.239  91.352  1.00 14.08 ? 520 GLN A N   1 
ATOM   4153  C CA  . GLN A 1 520 ? -0.120  19.829  92.194  1.00 14.37 ? 520 GLN A CA  1 
ATOM   4154  C C   . GLN A 1 520 ? 0.086   19.454  93.647  1.00 13.54 ? 520 GLN A C   1 
ATOM   4155  O O   . GLN A 1 520 ? -0.061  20.283  94.552  1.00 13.25 ? 520 GLN A O   1 
ATOM   4156  C CB  . GLN A 1 520 ? -1.519  19.370  91.781  1.00 14.55 ? 520 GLN A CB  1 
ATOM   4157  C CG  . GLN A 1 520 ? -1.962  19.777  90.398  1.00 16.86 ? 520 GLN A CG  1 
ATOM   4158  C CD  . GLN A 1 520 ? -3.269  19.091  90.010  1.00 20.25 ? 520 GLN A CD  1 
ATOM   4159  O OE1 . GLN A 1 520 ? -3.281  17.897  89.692  1.00 20.94 ? 520 GLN A OE1 1 
ATOM   4160  N NE2 . GLN A 1 520 ? -4.384  19.841  90.078  1.00 22.31 ? 520 GLN A NE2 1 
ATOM   4161  N N   . LEU A 1 521 ? 0.435   18.196  93.882  1.00 12.72 ? 521 LEU A N   1 
ATOM   4162  C CA  . LEU A 1 521 ? 0.596   17.728  95.244  1.00 12.45 ? 521 LEU A CA  1 
ATOM   4163  C C   . LEU A 1 521 ? 1.845   18.297  95.892  1.00 12.62 ? 521 LEU A C   1 
ATOM   4164  O O   . LEU A 1 521 ? 1.845   18.562  97.090  1.00 12.31 ? 521 LEU A O   1 
ATOM   4165  C CB  . LEU A 1 521 ? 0.589   16.185  95.304  1.00 12.52 ? 521 LEU A CB  1 
ATOM   4166  C CG  . LEU A 1 521 ? -0.705  15.551  94.811  1.00 12.87 ? 521 LEU A CG  1 
ATOM   4167  C CD1 . LEU A 1 521 ? -0.765  14.079  95.184  1.00 12.63 ? 521 LEU A CD1 1 
ATOM   4168  C CD2 . LEU A 1 521 ? -1.941  16.321  95.332  1.00 12.72 ? 521 LEU A CD2 1 
ATOM   4169  N N   . ALA A 1 522 ? 2.912   18.496  95.118  1.00 11.98 ? 522 ALA A N   1 
ATOM   4170  C CA  . ALA A 1 522 ? 4.129   19.066  95.690  1.00 11.74 ? 522 ALA A CA  1 
ATOM   4171  C C   . ALA A 1 522 ? 3.889   20.504  96.143  1.00 12.06 ? 522 ALA A C   1 
ATOM   4172  O O   . ALA A 1 522 ? 4.354   20.922  97.204  1.00 10.36 ? 522 ALA A O   1 
ATOM   4173  C CB  . ALA A 1 522 ? 5.296   18.981  94.698  1.00 12.21 ? 522 ALA A CB  1 
ATOM   4174  N N   . LYS A 1 523 ? 3.119   21.254  95.367  1.00 12.76 ? 523 LYS A N   1 
ATOM   4175  C CA  . LYS A 1 523 ? 2.862   22.646  95.715  1.00 13.72 ? 523 LYS A CA  1 
ATOM   4176  C C   . LYS A 1 523 ? 2.143   22.753  97.054  1.00 14.00 ? 523 LYS A C   1 
ATOM   4177  O O   . LYS A 1 523 ? 2.399   23.674  97.835  1.00 13.58 ? 523 LYS A O   1 
ATOM   4178  C CB  . LYS A 1 523 ? 2.104   23.366  94.604  1.00 14.02 ? 523 LYS A CB  1 
ATOM   4179  C CG  . LYS A 1 523 ? 2.955   23.715  93.385  1.00 16.93 ? 523 LYS A CG  1 
ATOM   4180  C CD  . LYS A 1 523 ? 4.322   24.317  93.748  1.00 20.52 ? 523 LYS A CD  1 
ATOM   4181  C CE  . LYS A 1 523 ? 4.195   25.623  94.538  1.00 22.08 ? 523 LYS A CE  1 
ATOM   4182  N NZ  . LYS A 1 523 ? 5.501   26.374  94.570  1.00 21.73 ? 523 LYS A NZ  1 
ATOM   4183  N N   . LYS A 1 524 ? 1.282   21.787  97.345  1.00 14.29 ? 524 LYS A N   1 
ATOM   4184  C CA  . LYS A 1 524 ? 0.545   21.795  98.598  1.00 14.86 ? 524 LYS A CA  1 
ATOM   4185  C C   . LYS A 1 524 ? 1.468   21.458  99.768  1.00 14.30 ? 524 LYS A C   1 
ATOM   4186  O O   . LYS A 1 524 ? 1.340   22.014  100.860 1.00 13.67 ? 524 LYS A O   1 
ATOM   4187  C CB  . LYS A 1 524 ? -0.622  20.807  98.538  1.00 15.53 ? 524 LYS A CB  1 
ATOM   4188  C CG  . LYS A 1 524 ? -1.736  21.243  97.577  1.00 18.65 ? 524 LYS A CG  1 
ATOM   4189  C CD  . LYS A 1 524 ? -3.038  20.512  97.852  1.00 24.00 ? 524 LYS A CD  1 
ATOM   4190  C CE  . LYS A 1 524 ? -3.565  20.791  99.268  1.00 26.53 ? 524 LYS A CE  1 
ATOM   4191  N NZ  . LYS A 1 524 ? -4.465  19.697  99.799  1.00 28.75 ? 524 LYS A NZ  1 
ATOM   4192  N N   . ILE A 1 525 ? 2.411   20.557  99.537  1.00 12.98 ? 525 ILE A N   1 
ATOM   4193  C CA  . ILE A 1 525 ? 3.311   20.139  100.604 1.00 13.62 ? 525 ILE A CA  1 
ATOM   4194  C C   . ILE A 1 525 ? 4.377   21.181  100.966 1.00 13.64 ? 525 ILE A C   1 
ATOM   4195  O O   . ILE A 1 525 ? 4.721   21.323  102.136 1.00 13.75 ? 525 ILE A O   1 
ATOM   4196  C CB  . ILE A 1 525 ? 3.974   18.766  100.237 1.00 13.37 ? 525 ILE A CB  1 
ATOM   4197  C CG1 . ILE A 1 525 ? 2.920   17.653  100.252 1.00 13.81 ? 525 ILE A CG1 1 
ATOM   4198  C CG2 . ILE A 1 525 ? 5.151   18.467  101.172 1.00 13.40 ? 525 ILE A CG2 1 
ATOM   4199  C CD1 . ILE A 1 525 ? 3.403   16.317  99.679  1.00 14.63 ? 525 ILE A CD1 1 
ATOM   4200  N N   . GLU A 1 526 ? 4.873   21.945  99.992  1.00 14.23 ? 526 GLU A N   1 
ATOM   4201  C CA  . GLU A 1 526 ? 5.958   22.909  100.284 1.00 14.91 ? 526 GLU A CA  1 
ATOM   4202  C C   . GLU A 1 526 ? 5.768   23.721  101.572 1.00 15.37 ? 526 GLU A C   1 
ATOM   4203  O O   . GLU A 1 526 ? 6.635   23.682  102.456 1.00 14.82 ? 526 GLU A O   1 
ATOM   4204  C CB  . GLU A 1 526 ? 6.197   23.841  99.096  1.00 15.22 ? 526 GLU A CB  1 
ATOM   4205  C CG  . GLU A 1 526 ? 6.656   23.082  97.876  1.00 17.36 ? 526 GLU A CG  1 
ATOM   4206  C CD  . GLU A 1 526 ? 6.964   23.956  96.680  1.00 18.59 ? 526 GLU A CD  1 
ATOM   4207  O OE1 . GLU A 1 526 ? 6.761   25.182  96.728  1.00 18.04 ? 526 GLU A OE1 1 
ATOM   4208  O OE2 . GLU A 1 526 ? 7.425   23.384  95.681  1.00 21.26 ? 526 GLU A OE2 1 
ATOM   4209  N N   . PRO A 1 527 ? 4.648   24.432  101.710 1.00 16.20 ? 527 PRO A N   1 
ATOM   4210  C CA  . PRO A 1 527 ? 4.459   25.292  102.889 1.00 16.56 ? 527 PRO A CA  1 
ATOM   4211  C C   . PRO A 1 527 ? 4.272   24.494  104.170 1.00 16.71 ? 527 PRO A C   1 
ATOM   4212  O O   . PRO A 1 527 ? 4.502   25.028  105.250 1.00 16.37 ? 527 PRO A O   1 
ATOM   4213  C CB  . PRO A 1 527 ? 3.194   26.077  102.548 1.00 16.87 ? 527 PRO A CB  1 
ATOM   4214  C CG  . PRO A 1 527 ? 2.427   25.148  101.649 1.00 17.02 ? 527 PRO A CG  1 
ATOM   4215  C CD  . PRO A 1 527 ? 3.501   24.524  100.786 1.00 16.02 ? 527 PRO A CD  1 
ATOM   4216  N N   . GLU A 1 528 ? 3.896   23.226  104.053 1.00 16.81 ? 528 GLU A N   1 
ATOM   4217  C CA  . GLU A 1 528 ? 3.686   22.397  105.233 1.00 17.76 ? 528 GLU A CA  1 
ATOM   4218  C C   . GLU A 1 528 ? 5.006   21.977  105.867 1.00 18.58 ? 528 GLU A C   1 
ATOM   4219  O O   . GLU A 1 528 ? 5.039   21.603  107.034 1.00 18.28 ? 528 GLU A O   1 
ATOM   4220  C CB  . GLU A 1 528 ? 2.835   21.172  104.884 1.00 17.61 ? 528 GLU A CB  1 
ATOM   4221  C CG  . GLU A 1 528 ? 1.429   21.509  104.394 1.00 17.54 ? 528 GLU A CG  1 
ATOM   4222  C CD  . GLU A 1 528 ? 0.611   20.273  104.043 1.00 19.24 ? 528 GLU A CD  1 
ATOM   4223  O OE1 . GLU A 1 528 ? 1.193   19.286  103.563 1.00 16.30 ? 528 GLU A OE1 1 
ATOM   4224  O OE2 . GLU A 1 528 ? -0.622  20.278  104.260 1.00 17.23 ? 528 GLU A OE2 1 
ATOM   4225  N N   . LEU A 1 529 ? 6.098   22.036  105.097 1.00 19.55 ? 529 LEU A N   1 
ATOM   4226  C CA  . LEU A 1 529 ? 7.401   21.630  105.612 1.00 20.99 ? 529 LEU A CA  1 
ATOM   4227  C C   . LEU A 1 529 ? 7.979   22.653  106.573 1.00 22.84 ? 529 LEU A C   1 
ATOM   4228  O O   . LEU A 1 529 ? 8.736   22.304  107.445 1.00 23.48 ? 529 LEU A O   1 
ATOM   4229  C CB  . LEU A 1 529 ? 8.384   21.381  104.469 1.00 20.63 ? 529 LEU A CB  1 
ATOM   4230  C CG  . LEU A 1 529 ? 7.971   20.233  103.554 1.00 20.30 ? 529 LEU A CG  1 
ATOM   4231  C CD1 . LEU A 1 529 ? 8.933   20.084  102.360 1.00 19.72 ? 529 LEU A CD1 1 
ATOM   4232  C CD2 . LEU A 1 529 ? 7.889   18.937  104.346 1.00 21.08 ? 529 LEU A CD2 1 
ATOM   4233  N N   . ASP A 1 530 ? 7.621   23.914  106.392 1.00 25.24 ? 530 ASP A N   1 
ATOM   4234  C CA  . ASP A 1 530 ? 8.079   24.981  107.277 1.00 27.43 ? 530 ASP A CA  1 
ATOM   4235  C C   . ASP A 1 530 ? 7.494   24.771  108.670 1.00 28.39 ? 530 ASP A C   1 
ATOM   4236  O O   . ASP A 1 530 ? 6.306   24.477  108.813 1.00 28.83 ? 530 ASP A O   1 
ATOM   4237  C CB  . ASP A 1 530 ? 7.618   26.349  106.743 1.00 27.72 ? 530 ASP A CB  1 
ATOM   4238  C CG  . ASP A 1 530 ? 8.191   26.674  105.367 1.00 29.59 ? 530 ASP A CG  1 
ATOM   4239  O OD1 . ASP A 1 530 ? 7.452   27.255  104.534 1.00 32.42 ? 530 ASP A OD1 1 
ATOM   4240  O OD2 . ASP A 1 530 ? 9.370   26.408  105.035 1.00 30.83 ? 530 ASP A OD2 1 
ATOM   4241  N N   . GLY A 1 531 ? 8.330   24.908  109.693 1.00 29.80 ? 531 GLY A N   1 
ATOM   4242  C CA  . GLY A 1 531 ? 7.858   24.845  111.065 1.00 30.23 ? 531 GLY A CA  1 
ATOM   4243  C C   . GLY A 1 531 ? 7.923   23.477  111.704 1.00 30.58 ? 531 GLY A C   1 
ATOM   4244  O O   . GLY A 1 531 ? 8.139   22.457  111.045 1.00 31.27 ? 531 GLY A O   1 
ATOM   4245  N N   . SER A 1 532 ? 7.700   23.470  113.013 1.00 30.21 ? 532 SER A N   1 
ATOM   4246  C CA  . SER A 1 532 ? 7.770   22.271  113.824 1.00 29.65 ? 532 SER A CA  1 
ATOM   4247  C C   . SER A 1 532 ? 6.445   21.500  113.929 1.00 28.55 ? 532 SER A C   1 
ATOM   4248  O O   . SER A 1 532 ? 6.433   20.366  114.403 1.00 28.58 ? 532 SER A O   1 
ATOM   4249  C CB  . SER A 1 532 ? 8.230   22.679  115.227 1.00 29.92 ? 532 SER A CB  1 
ATOM   4250  O OG  . SER A 1 532 ? 7.622   23.910  115.597 1.00 31.94 ? 532 SER A OG  1 
ATOM   4251  N N   . ALA A 1 533 ? 5.344   22.107  113.486 1.00 27.55 ? 533 ALA A N   1 
ATOM   4252  C CA  . ALA A 1 533 ? 4.009   21.507  113.639 1.00 26.26 ? 533 ALA A CA  1 
ATOM   4253  C C   . ALA A 1 533 ? 3.835   20.202  112.880 1.00 25.11 ? 533 ALA A C   1 
ATOM   4254  O O   . ALA A 1 533 ? 4.277   20.070  111.737 1.00 24.43 ? 533 ALA A O   1 
ATOM   4255  C CB  . ALA A 1 533 ? 2.938   22.483  113.205 1.00 26.47 ? 533 ALA A CB  1 
ATOM   4256  N N   . GLN A 1 534 ? 3.173   19.256  113.537 1.00 23.38 ? 534 GLN A N   1 
ATOM   4257  C CA  . GLN A 1 534 ? 2.841   17.972  112.953 1.00 22.77 ? 534 GLN A CA  1 
ATOM   4258  C C   . GLN A 1 534 ? 1.891   18.174  111.792 1.00 21.29 ? 534 GLN A C   1 
ATOM   4259  O O   . GLN A 1 534 ? 1.053   19.073  111.813 1.00 20.47 ? 534 GLN A O   1 
ATOM   4260  C CB  . GLN A 1 534 ? 2.172   17.082  113.988 1.00 23.22 ? 534 GLN A CB  1 
ATOM   4261  C CG  . GLN A 1 534 ? 3.032   16.758  115.191 1.00 24.96 ? 534 GLN A CG  1 
ATOM   4262  C CD  . GLN A 1 534 ? 4.220   15.891  114.841 1.00 26.33 ? 534 GLN A CD  1 
ATOM   4263  O OE1 . GLN A 1 534 ? 4.074   14.691  114.600 1.00 27.71 ? 534 GLN A OE1 1 
ATOM   4264  N NE2 . GLN A 1 534 ? 5.401   16.497  114.808 1.00 27.64 ? 534 GLN A NE2 1 
ATOM   4265  N N   . VAL A 1 535 ? 2.038   17.356  110.761 1.00 19.47 ? 535 VAL A N   1 
ATOM   4266  C CA  . VAL A 1 535 ? 1.150   17.444  109.620 1.00 18.44 ? 535 VAL A CA  1 
ATOM   4267  C C   . VAL A 1 535 ? 0.208   16.248  109.657 1.00 18.16 ? 535 VAL A C   1 
ATOM   4268  O O   . VAL A 1 535 ? 0.636   15.114  109.899 1.00 16.66 ? 535 VAL A O   1 
ATOM   4269  C CB  . VAL A 1 535 ? 1.945   17.504  108.305 1.00 18.73 ? 535 VAL A CB  1 
ATOM   4270  C CG1 . VAL A 1 535 ? 1.016   17.395  107.099 1.00 18.13 ? 535 VAL A CG1 1 
ATOM   4271  C CG2 . VAL A 1 535 ? 2.744   18.807  108.260 1.00 18.83 ? 535 VAL A CG2 1 
ATOM   4272  N N   . THR A 1 536 ? -1.076  16.521  109.427 1.00 17.76 ? 536 THR A N   1 
ATOM   4273  C CA  . THR A 1 536 ? -2.121  15.504  109.448 1.00 17.90 ? 536 THR A CA  1 
ATOM   4274  C C   . THR A 1 536 ? -3.047  15.609  108.255 1.00 17.73 ? 536 THR A C   1 
ATOM   4275  O O   . THR A 1 536 ? -4.038  14.903  108.193 1.00 18.96 ? 536 THR A O   1 
ATOM   4276  C CB  . THR A 1 536 ? -3.008  15.701  110.681 1.00 18.47 ? 536 THR A CB  1 
ATOM   4277  O OG1 . THR A 1 536 ? -3.463  17.058  110.706 1.00 19.90 ? 536 THR A OG1 1 
ATOM   4278  C CG2 . THR A 1 536 ? -2.247  15.541  111.952 1.00 18.66 ? 536 THR A CG2 1 
ATOM   4279  N N   . SER A 1 537 ? -2.733  16.492  107.320 1.00 17.49 ? 537 SER A N   1 
ATOM   4280  C CA  . SER A 1 537 ? -3.598  16.789  106.180 1.00 17.34 ? 537 SER A CA  1 
ATOM   4281  C C   . SER A 1 537 ? -3.611  15.787  105.021 1.00 16.62 ? 537 SER A C   1 
ATOM   4282  O O   . SER A 1 537 ? -4.395  15.964  104.078 1.00 16.73 ? 537 SER A O   1 
ATOM   4283  C CB  . SER A 1 537 ? -3.215  18.149  105.621 1.00 17.30 ? 537 SER A CB  1 
ATOM   4284  O OG  . SER A 1 537 ? -1.868  18.146  105.161 1.00 19.06 ? 537 SER A OG  1 
ATOM   4285  N N   . HIS A 1 538 ? -2.757  14.762  105.073 1.00 14.84 ? 538 HIS A N   1 
ATOM   4286  C CA  . HIS A 1 538 ? -2.684  13.757  104.013 1.00 13.90 ? 538 HIS A CA  1 
ATOM   4287  C C   . HIS A 1 538 ? -3.013  12.350  104.526 1.00 13.41 ? 538 HIS A C   1 
ATOM   4288  O O   . HIS A 1 538 ? -3.504  12.168  105.659 1.00 12.80 ? 538 HIS A O   1 
ATOM   4289  C CB  . HIS A 1 538 ? -1.263  13.720  103.412 1.00 13.46 ? 538 HIS A CB  1 
ATOM   4290  C CG  . HIS A 1 538 ? -0.739  15.064  103.013 1.00 12.54 ? 538 HIS A CG  1 
ATOM   4291  N ND1 . HIS A 1 538 ? -0.825  15.543  101.724 1.00 12.30 ? 538 HIS A ND1 1 
ATOM   4292  C CD2 . HIS A 1 538 ? -0.126  16.031  103.731 1.00 11.80 ? 538 HIS A CD2 1 
ATOM   4293  C CE1 . HIS A 1 538 ? -0.301  16.754  101.670 1.00 12.19 ? 538 HIS A CE1 1 
ATOM   4294  N NE2 . HIS A 1 538 ? 0.130   17.076  102.874 1.00 12.69 ? 538 HIS A NE2 1 
ATOM   4295  N N   . ASP A 1 539 ? -2.741  11.361  103.677 1.00 12.48 ? 539 ASP A N   1 
ATOM   4296  C CA  . ASP A 1 539 ? -2.812  9.976   104.075 1.00 12.20 ? 539 ASP A CA  1 
ATOM   4297  C C   . ASP A 1 539 ? -1.756  9.768   105.171 1.00 12.53 ? 539 ASP A C   1 
ATOM   4298  O O   . ASP A 1 539 ? -0.818  10.571  105.327 1.00 12.08 ? 539 ASP A O   1 
ATOM   4299  C CB  . ASP A 1 539 ? -2.527  9.064   102.893 1.00 12.45 ? 539 ASP A CB  1 
ATOM   4300  C CG  . ASP A 1 539 ? -1.104  9.216   102.382 1.00 11.96 ? 539 ASP A CG  1 
ATOM   4301  O OD1 . ASP A 1 539 ? -0.199  8.482   102.858 1.00 12.01 ? 539 ASP A OD1 1 
ATOM   4302  O OD2 . ASP A 1 539 ? -0.814  10.069  101.525 1.00 11.77 ? 539 ASP A OD2 1 
ATOM   4303  N N   . ALA A 1 540 ? -1.892  8.686   105.927 1.00 12.80 ? 540 ALA A N   1 
ATOM   4304  C CA  . ALA A 1 540 ? -0.990  8.430   107.058 1.00 12.44 ? 540 ALA A CA  1 
ATOM   4305  C C   . ALA A 1 540 ? 0.511   8.313   106.698 1.00 12.04 ? 540 ALA A C   1 
ATOM   4306  O O   . ALA A 1 540 ? 1.369   8.639   107.525 1.00 11.97 ? 540 ALA A O   1 
ATOM   4307  C CB  . ALA A 1 540 ? -1.436  7.178   107.793 1.00 12.71 ? 540 ALA A CB  1 
ATOM   4308  N N   . SER A 1 541 ? 0.824   7.791   105.509 1.00 11.84 ? 541 SER A N   1 
ATOM   4309  C CA  . SER A 1 541 ? 2.227   7.644   105.076 1.00 11.64 ? 541 SER A CA  1 
ATOM   4310  C C   . SER A 1 541 ? 2.859   9.001   104.796 1.00 11.14 ? 541 SER A C   1 
ATOM   4311  O O   . SER A 1 541 ? 3.901   9.342   105.358 1.00 11.25 ? 541 SER A O   1 
ATOM   4312  C CB  . SER A 1 541 ? 2.319   6.770   103.828 1.00 11.88 ? 541 SER A CB  1 
ATOM   4313  O OG  . SER A 1 541 ? 3.632   6.750   103.284 1.00 11.85 ? 541 SER A OG  1 
ATOM   4314  N N   . THR A 1 542 ? 2.210   9.783   103.945 1.00 10.76 ? 542 THR A N   1 
ATOM   4315  C CA  . THR A 1 542 ? 2.676   11.121  103.623 1.00 10.70 ? 542 THR A CA  1 
ATOM   4316  C C   . THR A 1 542 ? 2.881   11.941  104.901 1.00 11.31 ? 542 THR A C   1 
ATOM   4317  O O   . THR A 1 542 ? 3.902   12.604  105.043 1.00 11.36 ? 542 THR A O   1 
ATOM   4318  C CB  . THR A 1 542 ? 1.693   11.809  102.689 1.00 11.13 ? 542 THR A CB  1 
ATOM   4319  O OG1 . THR A 1 542 ? 1.634   11.101  101.440 1.00 10.63 ? 542 THR A OG1 1 
ATOM   4320  C CG2 . THR A 1 542 ? 2.154   13.206  102.326 1.00 10.71 ? 542 THR A CG2 1 
ATOM   4321  N N   . ASN A 1 543 ? 1.900   11.901  105.811 1.00 11.41 ? 543 ASN A N   1 
ATOM   4322  C CA  . ASN A 1 543 ? 1.997   12.568  107.119 1.00 11.09 ? 543 ASN A CA  1 
ATOM   4323  C C   . ASN A 1 543 ? 3.195   12.047  107.914 1.00 10.60 ? 543 ASN A C   1 
ATOM   4324  O O   . ASN A 1 543 ? 3.967   12.817  108.482 1.00 10.53 ? 543 ASN A O   1 
ATOM   4325  C CB  . ASN A 1 543 ? 0.753   12.277  107.981 1.00 11.70 ? 543 ASN A CB  1 
ATOM   4326  C CG  . ASN A 1 543 ? -0.538  12.907  107.455 1.00 12.10 ? 543 ASN A CG  1 
ATOM   4327  O OD1 . ASN A 1 543 ? -0.538  13.812  106.600 1.00 13.38 ? 543 ASN A OD1 1 
ATOM   4328  N ND2 . ASN A 1 543 ? -1.669  12.437  108.012 1.00 13.79 ? 543 ASN A ND2 1 
ATOM   4329  N N   . GLY A 1 544 ? 3.318   10.723  107.991 1.00 9.99  ? 544 GLY A N   1 
ATOM   4330  C CA  . GLY A 1 544 ? 4.386   10.093  108.749 1.00 9.49  ? 544 GLY A CA  1 
ATOM   4331  C C   . GLY A 1 544 ? 5.758   10.484  108.248 1.00 9.18  ? 544 GLY A C   1 
ATOM   4332  O O   . GLY A 1 544 ? 6.672   10.737  109.028 1.00 9.51  ? 544 GLY A O   1 
ATOM   4333  N N   . LEU A 1 545 ? 5.898   10.509  106.933 1.00 9.04  ? 545 LEU A N   1 
ATOM   4334  C CA  . LEU A 1 545 ? 7.155   10.886  106.299 1.00 9.21  ? 545 LEU A CA  1 
ATOM   4335  C C   . LEU A 1 545 ? 7.483   12.334  106.618 1.00 8.83  ? 545 LEU A C   1 
ATOM   4336  O O   . LEU A 1 545 ? 8.594   12.655  107.007 1.00 8.18  ? 545 LEU A O   1 
ATOM   4337  C CB  . LEU A 1 545 ? 7.056   10.654  104.812 1.00 9.16  ? 545 LEU A CB  1 
ATOM   4338  C CG  . LEU A 1 545 ? 6.954   9.173   104.397 1.00 9.73  ? 545 LEU A CG  1 
ATOM   4339  C CD1 . LEU A 1 545 ? 6.433   9.025   103.022 1.00 8.88  ? 545 LEU A CD1 1 
ATOM   4340  C CD2 . LEU A 1 545 ? 8.311   8.501   104.490 1.00 9.67  ? 545 LEU A CD2 1 
ATOM   4341  N N   . ILE A 1 546 ? 6.496   13.210  106.488 1.00 9.56  ? 546 ILE A N   1 
ATOM   4342  C CA  . ILE A 1 546 ? 6.724   14.611  106.799 1.00 9.86  ? 546 ILE A CA  1 
ATOM   4343  C C   . ILE A 1 546 ? 7.153   14.773  108.235 1.00 10.39 ? 546 ILE A C   1 
ATOM   4344  O O   . ILE A 1 546 ? 8.122   15.480  108.543 1.00 10.30 ? 546 ILE A O   1 
ATOM   4345  C CB  . ILE A 1 546 ? 5.485   15.431  106.520 1.00 10.18 ? 546 ILE A CB  1 
ATOM   4346  C CG1 . ILE A 1 546 ? 5.273   15.528  105.029 1.00 10.70 ? 546 ILE A CG1 1 
ATOM   4347  C CG2 . ILE A 1 546 ? 5.621   16.831  107.140 1.00 11.62 ? 546 ILE A CG2 1 
ATOM   4348  C CD1 . ILE A 1 546 ? 3.882   15.949  104.642 1.00 11.19 ? 546 ILE A CD1 1 
ATOM   4349  N N   . ASN A 1 547 ? 6.455   14.094  109.135 1.00 11.28 ? 547 ASN A N   1 
ATOM   4350  C CA  . ASN A 1 547 ? 6.743   14.269  110.550 1.00 11.57 ? 547 ASN A CA  1 
ATOM   4351  C C   . ASN A 1 547 ? 8.127   13.708  110.959 1.00 11.12 ? 547 ASN A C   1 
ATOM   4352  O O   . ASN A 1 547 ? 8.805   14.249  111.847 1.00 11.06 ? 547 ASN A O   1 
ATOM   4353  C CB  . ASN A 1 547 ? 5.554   13.728  111.362 1.00 11.94 ? 547 ASN A CB  1 
ATOM   4354  C CG  . ASN A 1 547 ? 4.277   14.580  111.157 1.00 13.79 ? 547 ASN A CG  1 
ATOM   4355  O OD1 . ASN A 1 547 ? 4.356   15.779  110.885 1.00 14.71 ? 547 ASN A OD1 1 
ATOM   4356  N ND2 . ASN A 1 547 ? 3.118   13.951  111.239 1.00 15.77 ? 547 ASN A ND2 1 
ATOM   4357  N N   . PHE A 1 548 ? 8.565   12.661  110.272 1.00 11.30 ? 548 PHE A N   1 
ATOM   4358  C CA  . PHE A 1 548 ? 9.887   12.097  110.486 1.00 11.22 ? 548 PHE A CA  1 
ATOM   4359  C C   . PHE A 1 548 ? 10.933  13.081  109.968 1.00 11.00 ? 548 PHE A C   1 
ATOM   4360  O O   . PHE A 1 548 ? 11.957  13.307  110.598 1.00 9.79  ? 548 PHE A O   1 
ATOM   4361  C CB  . PHE A 1 548 ? 10.021  10.758  109.774 1.00 11.51 ? 548 PHE A CB  1 
ATOM   4362  C CG  . PHE A 1 548 ? 11.396  10.159  109.861 1.00 10.79 ? 548 PHE A CG  1 
ATOM   4363  C CD1 . PHE A 1 548 ? 11.799  9.463   110.985 1.00 10.83 ? 548 PHE A CD1 1 
ATOM   4364  C CD2 . PHE A 1 548 ? 12.271  10.263  108.797 1.00 10.09 ? 548 PHE A CD2 1 
ATOM   4365  C CE1 . PHE A 1 548 ? 13.056  8.924   111.059 1.00 10.49 ? 548 PHE A CE1 1 
ATOM   4366  C CE2 . PHE A 1 548 ? 13.521  9.719   108.856 1.00 10.82 ? 548 PHE A CE2 1 
ATOM   4367  C CZ  . PHE A 1 548 ? 13.920  9.030   109.977 1.00 10.54 ? 548 PHE A CZ  1 
ATOM   4368  N N   . ILE A 1 549 ? 10.671  13.680  108.813 1.00 11.32 ? 549 ILE A N   1 
ATOM   4369  C CA  . ILE A 1 549 ? 11.560  14.714  108.302 1.00 11.83 ? 549 ILE A CA  1 
ATOM   4370  C C   . ILE A 1 549 ? 11.712  15.889  109.300 1.00 12.67 ? 549 ILE A C   1 
ATOM   4371  O O   . ILE A 1 549 ? 12.824  16.346  109.602 1.00 11.82 ? 549 ILE A O   1 
ATOM   4372  C CB  . ILE A 1 549 ? 11.024  15.209  106.943 1.00 11.72 ? 549 ILE A CB  1 
ATOM   4373  C CG1 . ILE A 1 549 ? 11.303  14.143  105.866 1.00 10.82 ? 549 ILE A CG1 1 
ATOM   4374  C CG2 . ILE A 1 549 ? 11.652  16.549  106.589 1.00 12.76 ? 549 ILE A CG2 1 
ATOM   4375  C CD1 . ILE A 1 549 ? 10.445  14.263  104.605 1.00 9.28  ? 549 ILE A CD1 1 
ATOM   4376  N N   . LYS A 1 550 ? 10.590  16.383  109.820 1.00 13.38 ? 550 LYS A N   1 
ATOM   4377  C CA  . LYS A 1 550 ? 10.654  17.478  110.790 1.00 13.58 ? 550 LYS A CA  1 
ATOM   4378  C C   . LYS A 1 550 ? 11.442  17.042  112.028 1.00 13.44 ? 550 LYS A C   1 
ATOM   4379  O O   . LYS A 1 550 ? 12.230  17.804  112.585 1.00 13.31 ? 550 LYS A O   1 
ATOM   4380  C CB  . LYS A 1 550 ? 9.259   17.945  111.188 1.00 13.64 ? 550 LYS A CB  1 
ATOM   4381  C CG  . LYS A 1 550 ? 8.484   18.539  110.034 1.00 15.33 ? 550 LYS A CG  1 
ATOM   4382  C CD  . LYS A 1 550 ? 7.214   19.241  110.480 1.00 17.78 ? 550 LYS A CD  1 
ATOM   4383  C CE  . LYS A 1 550 ? 6.633   20.069  109.338 1.00 17.85 ? 550 LYS A CE  1 
ATOM   4384  N NZ  . LYS A 1 550 ? 5.821   21.203  109.817 1.00 16.47 ? 550 LYS A NZ  1 
ATOM   4385  N N   . GLN A 1 551 ? 11.253  15.804  112.444 1.00 13.15 ? 551 GLN A N   1 
ATOM   4386  C CA  . GLN A 1 551 ? 11.965  15.304  113.610 1.00 13.34 ? 551 GLN A CA  1 
ATOM   4387  C C   . GLN A 1 551 ? 13.478  15.274  113.382 1.00 13.29 ? 551 GLN A C   1 
ATOM   4388  O O   . GLN A 1 551 ? 14.259  15.674  114.255 1.00 12.52 ? 551 GLN A O   1 
ATOM   4389  C CB  . GLN A 1 551 ? 11.497  13.890  113.952 1.00 13.89 ? 551 GLN A CB  1 
ATOM   4390  C CG  . GLN A 1 551 ? 12.172  13.296  115.190 1.00 15.13 ? 551 GLN A CG  1 
ATOM   4391  C CD  . GLN A 1 551 ? 11.988  11.796  115.308 1.00 17.04 ? 551 GLN A CD  1 
ATOM   4392  O OE1 . GLN A 1 551 ? 12.734  11.030  114.701 1.00 17.16 ? 551 GLN A OE1 1 
ATOM   4393  N NE2 . GLN A 1 551 ? 11.010  11.370  116.119 1.00 17.58 ? 551 GLN A NE2 1 
ATOM   4394  N N   . GLN A 1 552 ? 13.876  14.739  112.229 1.00 12.61 ? 552 GLN A N   1 
ATOM   4395  C CA  . GLN A 1 552 ? 15.280  14.490  111.931 1.00 13.53 ? 552 GLN A CA  1 
ATOM   4396  C C   . GLN A 1 552 ? 16.039  15.716  111.446 1.00 14.38 ? 552 GLN A C   1 
ATOM   4397  O O   . GLN A 1 552 ? 17.252  15.725  111.411 1.00 14.04 ? 552 GLN A O   1 
ATOM   4398  C CB  . GLN A 1 552 ? 15.397  13.321  110.955 1.00 12.41 ? 552 GLN A CB  1 
ATOM   4399  C CG  . GLN A 1 552 ? 15.091  12.000  111.643 1.00 11.92 ? 552 GLN A CG  1 
ATOM   4400  C CD  . GLN A 1 552 ? 16.045  11.716  112.778 1.00 9.47  ? 552 GLN A CD  1 
ATOM   4401  O OE1 . GLN A 1 552 ? 17.246  11.740  112.579 1.00 10.95 ? 552 GLN A OE1 1 
ATOM   4402  N NE2 . GLN A 1 552 ? 15.515  11.440  113.978 1.00 10.05 ? 552 GLN A NE2 1 
ATOM   4403  N N   . ARG A 1 553 ? 15.302  16.757  111.121 1.00 16.64 ? 553 ARG A N   1 
ATOM   4404  C CA  . ARG A 1 553 ? 15.885  18.037  110.824 1.00 19.94 ? 553 ARG A CA  1 
ATOM   4405  C C   . ARG A 1 553 ? 16.791  18.450  111.994 1.00 21.49 ? 553 ARG A C   1 
ATOM   4406  O O   . ARG A 1 553 ? 17.837  19.070  111.807 1.00 22.27 ? 553 ARG A O   1 
ATOM   4407  C CB  . ARG A 1 553 ? 14.726  19.021  110.718 1.00 20.38 ? 553 ARG A CB  1 
ATOM   4408  C CG  . ARG A 1 553 ? 14.942  20.237  109.947 1.00 23.58 ? 553 ARG A CG  1 
ATOM   4409  C CD  . ARG A 1 553 ? 13.740  20.512  109.014 1.00 25.86 ? 553 ARG A CD  1 
ATOM   4410  N NE  . ARG A 1 553 ? 12.569  21.005  109.731 1.00 25.94 ? 553 ARG A NE  1 
ATOM   4411  C CZ  . ARG A 1 553 ? 11.415  21.309  109.150 1.00 26.07 ? 553 ARG A CZ  1 
ATOM   4412  N NH1 . ARG A 1 553 ? 11.257  21.158  107.840 1.00 26.52 ? 553 ARG A NH1 1 
ATOM   4413  N NH2 . ARG A 1 553 ? 10.417  21.767  109.877 1.00 25.35 ? 553 ARG A NH2 1 
ATOM   4414  N N   . GLU A 1 554 ? 16.380  18.082  113.202 1.00 23.43 ? 554 GLU A N   1 
ATOM   4415  C CA  . GLU A 1 554 ? 17.049  18.525  114.424 1.00 25.09 ? 554 GLU A CA  1 
ATOM   4416  C C   . GLU A 1 554 ? 18.153  17.602  114.916 1.00 25.31 ? 554 GLU A C   1 
ATOM   4417  O O   . GLU A 1 554 ? 18.739  17.847  115.966 1.00 25.69 ? 554 GLU A O   1 
ATOM   4418  C CB  . GLU A 1 554 ? 16.016  18.670  115.544 1.00 25.87 ? 554 GLU A CB  1 
ATOM   4419  C CG  . GLU A 1 554 ? 14.733  19.376  115.120 1.00 28.83 ? 554 GLU A CG  1 
ATOM   4420  C CD  . GLU A 1 554 ? 14.957  20.808  114.676 1.00 31.73 ? 554 GLU A CD  1 
ATOM   4421  O OE1 . GLU A 1 554 ? 14.193  21.287  113.808 1.00 34.01 ? 554 GLU A OE1 1 
ATOM   4422  O OE2 . GLU A 1 554 ? 15.894  21.462  115.194 1.00 35.42 ? 554 GLU A OE2 1 
ATOM   4423  N N   . ALA A 1 555 ? 18.458  16.547  114.169 1.00 24.77 ? 555 ALA A N   1 
ATOM   4424  C CA  . ALA A 1 555 ? 19.457  15.606  114.628 1.00 24.69 ? 555 ALA A CA  1 
ATOM   4425  C C   . ALA A 1 555 ? 20.856  16.067  114.234 1.00 24.92 ? 555 ALA A C   1 
ATOM   4426  O O   . ALA A 1 555 ? 21.040  16.646  113.172 1.00 24.78 ? 555 ALA A O   1 
ATOM   4427  C CB  . ALA A 1 555 ? 19.158  14.224  114.061 1.00 24.51 ? 555 ALA A CB  1 
ATOM   4428  N N   . ARG A 1 556 ? 21.835  15.838  115.104 1.00 25.57 ? 556 ARG A N   1 
ATOM   4429  C CA  . ARG A 1 556 ? 23.228  16.155  114.796 1.00 26.52 ? 556 ARG A CA  1 
ATOM   4430  C C   . ARG A 1 556 ? 23.908  14.824  114.510 1.00 26.23 ? 556 ARG A C   1 
ATOM   4431  O O   . ARG A 1 556 ? 24.060  14.042  115.424 1.00 26.55 ? 556 ARG A O   1 
ATOM   4432  C CB  . ARG A 1 556 ? 23.991  16.740  116.003 1.00 27.16 ? 556 ARG A CB  1 
ATOM   4433  C CG  . ARG A 1 556 ? 23.592  18.057  116.679 1.00 30.12 ? 556 ARG A CG  1 
ATOM   4434  C CD  . ARG A 1 556 ? 24.575  18.335  117.897 1.00 33.29 ? 556 ARG A CD  1 
ATOM   4435  N NE  . ARG A 1 556 ? 24.368  19.564  118.685 1.00 35.88 ? 556 ARG A NE  1 
ATOM   4436  C CZ  . ARG A 1 556 ? 24.943  19.824  119.888 1.00 36.45 ? 556 ARG A CZ  1 
ATOM   4437  N NH1 . ARG A 1 556 ? 25.771  18.949  120.482 1.00 33.72 ? 556 ARG A NH1 1 
ATOM   4438  N NH2 . ARG A 1 556 ? 24.683  20.975  120.510 1.00 36.45 ? 556 ARG A NH2 1 
ATOM   4439  N N   . VAL A 1 557 ? 24.334  14.543  113.287 1.00 26.60 ? 557 VAL A N   1 
ATOM   4440  C CA  . VAL A 1 557 ? 25.065  13.297  113.038 1.00 27.16 ? 557 VAL A CA  1 
ATOM   4441  C C   . VAL A 1 557 ? 26.440  13.595  112.427 1.00 28.05 ? 557 VAL A C   1 
ATOM   4442  O O   . VAL A 1 557 ? 26.845  14.751  112.287 1.00 28.44 ? 557 VAL A O   1 
ATOM   4443  C CB  . VAL A 1 557 ? 24.278  12.314  112.136 1.00 26.97 ? 557 VAL A CB  1 
ATOM   4444  C CG1 . VAL A 1 557 ? 22.912  12.046  112.719 1.00 27.09 ? 557 VAL A CG1 1 
ATOM   4445  C CG2 . VAL A 1 557 ? 24.137  12.852  110.749 1.00 27.18 ? 557 VAL A CG2 1 
ATOM   4446  N N   . MET B 1 1   ? 9.069   -28.246 88.408  1.00 34.12 ? 1   MET B N   1 
ATOM   4447  C CA  . MET B 1 1   ? 8.776   -27.766 89.784  1.00 34.07 ? 1   MET B CA  1 
ATOM   4448  C C   . MET B 1 1   ? 10.077  -27.503 90.544  1.00 32.86 ? 1   MET B C   1 
ATOM   4449  O O   . MET B 1 1   ? 10.844  -28.420 90.826  1.00 33.39 ? 1   MET B O   1 
ATOM   4450  C CB  . MET B 1 1   ? 7.952   -28.797 90.561  1.00 35.12 ? 1   MET B CB  1 
ATOM   4451  C CG  . MET B 1 1   ? 6.552   -29.057 90.043  1.00 37.89 ? 1   MET B CG  1 
ATOM   4452  S SD  . MET B 1 1   ? 5.396   -27.756 90.476  1.00 44.38 ? 1   MET B SD  1 
ATOM   4453  C CE  . MET B 1 1   ? 3.909   -28.314 89.625  1.00 43.56 ? 1   MET B CE  1 
ATOM   4454  N N   . ALA B 1 2   ? 10.338  -26.238 90.821  1.00 30.94 ? 2   ALA B N   1 
ATOM   4455  C CA  . ALA B 1 2   ? 11.451  -25.820 91.659  1.00 29.47 ? 2   ALA B CA  1 
ATOM   4456  C C   . ALA B 1 2   ? 11.053  -25.722 93.147  1.00 28.27 ? 2   ALA B C   1 
ATOM   4457  O O   . ALA B 1 2   ? 9.875   -25.762 93.485  1.00 27.79 ? 2   ALA B O   1 
ATOM   4458  C CB  . ALA B 1 2   ? 11.962  -24.476 91.157  1.00 29.15 ? 2   ALA B CB  1 
ATOM   4459  N N   . ALA B 1 3   ? 12.038  -25.550 94.022  1.00 26.87 ? 3   ALA B N   1 
ATOM   4460  C CA  . ALA B 1 3   ? 11.785  -25.459 95.466  1.00 26.27 ? 3   ALA B CA  1 
ATOM   4461  C C   . ALA B 1 3   ? 10.728  -24.420 95.805  1.00 25.37 ? 3   ALA B C   1 
ATOM   4462  O O   . ALA B 1 3   ? 9.786   -24.696 96.559  1.00 25.50 ? 3   ALA B O   1 
ATOM   4463  C CB  . ALA B 1 3   ? 13.066  -25.146 96.208  1.00 26.20 ? 3   ALA B CB  1 
ATOM   4464  N N   . LEU B 1 4   ? 10.879  -23.219 95.262  1.00 24.17 ? 4   LEU B N   1 
ATOM   4465  C CA  . LEU B 1 4   ? 9.923   -22.166 95.554  1.00 23.63 ? 4   LEU B CA  1 
ATOM   4466  C C   . LEU B 1 4   ? 8.499   -22.576 95.208  1.00 23.26 ? 4   LEU B C   1 
ATOM   4467  O O   . LEU B 1 4   ? 7.582   -22.439 96.023  1.00 23.22 ? 4   LEU B O   1 
ATOM   4468  C CB  . LEU B 1 4   ? 10.266  -20.864 94.814  1.00 23.25 ? 4   LEU B CB  1 
ATOM   4469  C CG  . LEU B 1 4   ? 9.297   -19.729 95.155  1.00 22.29 ? 4   LEU B CG  1 
ATOM   4470  C CD1 . LEU B 1 4   ? 9.170   -19.572 96.655  1.00 22.39 ? 4   LEU B CD1 1 
ATOM   4471  C CD2 . LEU B 1 4   ? 9.712   -18.398 94.540  1.00 21.51 ? 4   LEU B CD2 1 
ATOM   4472  N N   . THR B 1 5   ? 8.301   -23.066 93.994  1.00 23.15 ? 5   THR B N   1 
ATOM   4473  C CA  . THR B 1 5   ? 6.958   -23.380 93.551  1.00 23.14 ? 5   THR B CA  1 
ATOM   4474  C C   . THR B 1 5   ? 6.347   -24.539 94.349  1.00 22.84 ? 5   THR B C   1 
ATOM   4475  O O   . THR B 1 5   ? 5.129   -24.628 94.483  1.00 21.68 ? 5   THR B O   1 
ATOM   4476  C CB  . THR B 1 5   ? 6.925   -23.620 92.036  1.00 23.49 ? 5   THR B CB  1 
ATOM   4477  O OG1 . THR B 1 5   ? 8.154   -24.204 91.604  1.00 25.56 ? 5   THR B OG1 1 
ATOM   4478  C CG2 . THR B 1 5   ? 6.918   -22.284 91.283  1.00 24.49 ? 5   THR B CG2 1 
ATOM   4479  N N   . ARG B 1 6   ? 7.184   -25.412 94.892  1.00 23.30 ? 6   ARG B N   1 
ATOM   4480  C CA  . ARG B 1 6   ? 6.668   -26.523 95.696  1.00 23.67 ? 6   ARG B CA  1 
ATOM   4481  C C   . ARG B 1 6   ? 6.414   -26.133 97.147  1.00 22.86 ? 6   ARG B C   1 
ATOM   4482  O O   . ARG B 1 6   ? 5.768   -26.867 97.891  1.00 22.74 ? 6   ARG B O   1 
ATOM   4483  C CB  . ARG B 1 6   ? 7.611   -27.716 95.626  1.00 24.42 ? 6   ARG B CB  1 
ATOM   4484  C CG  . ARG B 1 6   ? 7.504   -28.458 94.299  1.00 27.78 ? 6   ARG B CG  1 
ATOM   4485  C CD  . ARG B 1 6   ? 8.744   -29.236 93.919  1.00 32.77 ? 6   ARG B CD  1 
ATOM   4486  N NE  . ARG B 1 6   ? 8.981   -30.363 94.813  1.00 37.57 ? 6   ARG B NE  1 
ATOM   4487  C CZ  . ARG B 1 6   ? 9.766   -31.403 94.529  1.00 41.26 ? 6   ARG B CZ  1 
ATOM   4488  N NH1 . ARG B 1 6   ? 10.416  -31.473 93.366  1.00 42.57 ? 6   ARG B NH1 1 
ATOM   4489  N NH2 . ARG B 1 6   ? 9.912   -32.375 95.420  1.00 42.84 ? 6   ARG B NH2 1 
ATOM   4490  N N   . ASP B 1 7   ? 6.903   -24.965 97.548  1.00 21.83 ? 7   ASP B N   1 
ATOM   4491  C CA  . ASP B 1 7   ? 6.747   -24.525 98.921  1.00 20.70 ? 7   ASP B CA  1 
ATOM   4492  C C   . ASP B 1 7   ? 5.280   -24.192 99.250  1.00 20.68 ? 7   ASP B C   1 
ATOM   4493  O O   . ASP B 1 7   ? 4.646   -23.443 98.537  1.00 19.96 ? 7   ASP B O   1 
ATOM   4494  C CB  . ASP B 1 7   ? 7.645   -23.320 99.159  1.00 20.52 ? 7   ASP B CB  1 
ATOM   4495  C CG  . ASP B 1 7   ? 7.683   -22.905 100.597 1.00 19.47 ? 7   ASP B CG  1 
ATOM   4496  O OD1 . ASP B 1 7   ? 6.765   -22.194 101.034 1.00 19.76 ? 7   ASP B OD1 1 
ATOM   4497  O OD2 . ASP B 1 7   ? 8.600   -23.233 101.365 1.00 20.47 ? 7   ASP B OD2 1 
ATOM   4498  N N   . PRO B 1 8   ? 4.741   -24.753 100.333 1.00 20.84 ? 8   PRO B N   1 
ATOM   4499  C CA  . PRO B 1 8   ? 3.330   -24.532 100.707 1.00 20.78 ? 8   PRO B CA  1 
ATOM   4500  C C   . PRO B 1 8   ? 2.977   -23.091 101.069 1.00 20.61 ? 8   PRO B C   1 
ATOM   4501  O O   . PRO B 1 8   ? 1.875   -22.633 100.783 1.00 20.45 ? 8   PRO B O   1 
ATOM   4502  C CB  . PRO B 1 8   ? 3.133   -25.423 101.944 1.00 21.46 ? 8   PRO B CB  1 
ATOM   4503  C CG  . PRO B 1 8   ? 4.336   -26.295 102.035 1.00 21.24 ? 8   PRO B CG  1 
ATOM   4504  C CD  . PRO B 1 8   ? 5.439   -25.654 101.261 1.00 21.44 ? 8   PRO B CD  1 
ATOM   4505  N N   . GLN B 1 9   ? 3.901   -22.404 101.721 1.00 20.67 ? 9   GLN B N   1 
ATOM   4506  C CA  . GLN B 1 9   ? 3.713   -21.009 102.079 1.00 21.11 ? 9   GLN B CA  1 
ATOM   4507  C C   . GLN B 1 9   ? 3.594   -20.160 100.827 1.00 20.42 ? 9   GLN B C   1 
ATOM   4508  O O   . GLN B 1 9   ? 2.806   -19.212 100.776 1.00 20.73 ? 9   GLN B O   1 
ATOM   4509  C CB  . GLN B 1 9   ? 4.899   -20.529 102.895 1.00 21.71 ? 9   GLN B CB  1 
ATOM   4510  C CG  . GLN B 1 9   ? 5.112   -21.320 104.147 1.00 24.70 ? 9   GLN B CG  1 
ATOM   4511  C CD  . GLN B 1 9   ? 3.812   -21.592 104.851 1.00 28.52 ? 9   GLN B CD  1 
ATOM   4512  O OE1 . GLN B 1 9   ? 3.050   -20.659 105.117 1.00 31.26 ? 9   GLN B OE1 1 
ATOM   4513  N NE2 . GLN B 1 9   ? 3.537   -22.866 105.143 1.00 29.59 ? 9   GLN B NE2 1 
ATOM   4514  N N   . PHE B 1 10  ? 4.391   -20.498 99.819  1.00 19.66 ? 10  PHE B N   1 
ATOM   4515  C CA  . PHE B 1 10  ? 4.331   -19.784 98.558  1.00 19.32 ? 10  PHE B CA  1 
ATOM   4516  C C   . PHE B 1 10  ? 2.988   -20.015 97.890  1.00 19.25 ? 10  PHE B C   1 
ATOM   4517  O O   . PHE B 1 10  ? 2.381   -19.096 97.331  1.00 17.99 ? 10  PHE B O   1 
ATOM   4518  C CB  . PHE B 1 10  ? 5.435   -20.239 97.618  1.00 19.17 ? 10  PHE B CB  1 
ATOM   4519  C CG  . PHE B 1 10  ? 5.411   -19.524 96.311  1.00 18.86 ? 10  PHE B CG  1 
ATOM   4520  C CD1 . PHE B 1 10  ? 5.597   -18.155 96.266  1.00 19.71 ? 10  PHE B CD1 1 
ATOM   4521  C CD2 . PHE B 1 10  ? 5.161   -20.207 95.129  1.00 20.00 ? 10  PHE B CD2 1 
ATOM   4522  C CE1 . PHE B 1 10  ? 5.564   -17.479 95.068  1.00 20.22 ? 10  PHE B CE1 1 
ATOM   4523  C CE2 . PHE B 1 10  ? 5.127   -19.536 93.929  1.00 20.39 ? 10  PHE B CE2 1 
ATOM   4524  C CZ  . PHE B 1 10  ? 5.328   -18.169 93.896  1.00 20.58 ? 10  PHE B CZ  1 
ATOM   4525  N N   . GLN B 1 11  ? 2.528   -21.260 97.945  1.00 19.85 ? 11  GLN B N   1 
ATOM   4526  C CA  . GLN B 1 11  ? 1.240   -21.596 97.384  1.00 20.39 ? 11  GLN B CA  1 
ATOM   4527  C C   . GLN B 1 11  ? 0.120   -20.822 98.085  1.00 20.61 ? 11  GLN B C   1 
ATOM   4528  O O   . GLN B 1 11  ? -0.805  -20.383 97.420  1.00 20.52 ? 11  GLN B O   1 
ATOM   4529  C CB  . GLN B 1 11  ? 1.012   -23.106 97.421  1.00 21.06 ? 11  GLN B CB  1 
ATOM   4530  C CG  . GLN B 1 11  ? 1.894   -23.834 96.429  1.00 22.95 ? 11  GLN B CG  1 
ATOM   4531  C CD  . GLN B 1 11  ? 1.874   -25.353 96.593  1.00 27.60 ? 11  GLN B CD  1 
ATOM   4532  O OE1 . GLN B 1 11  ? 2.728   -26.052 96.030  1.00 29.85 ? 11  GLN B OE1 1 
ATOM   4533  N NE2 . GLN B 1 11  ? 0.913   -25.862 97.357  1.00 29.51 ? 11  GLN B NE2 1 
ATOM   4534  N N   . LYS B 1 12  ? 0.214   -20.648 99.404  1.00 20.98 ? 12  LYS B N   1 
ATOM   4535  C CA  . LYS B 1 12  ? -0.774  -19.868 100.156 1.00 21.48 ? 12  LYS B CA  1 
ATOM   4536  C C   . LYS B 1 12  ? -0.772  -18.419 99.684  1.00 21.26 ? 12  LYS B C   1 
ATOM   4537  O O   . LYS B 1 12  ? -1.829  -17.795 99.553  1.00 20.96 ? 12  LYS B O   1 
ATOM   4538  C CB  . LYS B 1 12  ? -0.504  -19.906 101.668 1.00 22.11 ? 12  LYS B CB  1 
ATOM   4539  C CG  . LYS B 1 12  ? -0.963  -21.181 102.343 1.00 24.65 ? 12  LYS B CG  1 
ATOM   4540  C CD  . LYS B 1 12  ? -0.693  -21.230 103.846 1.00 28.19 ? 12  LYS B CD  1 
ATOM   4541  C CE  . LYS B 1 12  ? -0.943  -22.668 104.370 1.00 30.67 ? 12  LYS B CE  1 
ATOM   4542  N NZ  . LYS B 1 12  ? -1.466  -22.759 105.772 1.00 32.38 ? 12  LYS B NZ  1 
ATOM   4543  N N   . LEU B 1 13  ? 0.424   -17.884 99.457  1.00 20.92 ? 13  LEU B N   1 
ATOM   4544  C CA  . LEU B 1 13  ? 0.564   -16.526 98.933  1.00 20.94 ? 13  LEU B CA  1 
ATOM   4545  C C   . LEU B 1 13  ? -0.117  -16.380 97.572  1.00 20.59 ? 13  LEU B C   1 
ATOM   4546  O O   . LEU B 1 13  ? -0.866  -15.433 97.340  1.00 19.60 ? 13  LEU B O   1 
ATOM   4547  C CB  . LEU B 1 13  ? 2.045   -16.129 98.841  1.00 20.83 ? 13  LEU B CB  1 
ATOM   4548  C CG  . LEU B 1 13  ? 2.610   -15.576 100.143 1.00 22.82 ? 13  LEU B CG  1 
ATOM   4549  C CD1 . LEU B 1 13  ? 4.123   -15.711 100.212 1.00 24.35 ? 13  LEU B CD1 1 
ATOM   4550  C CD2 . LEU B 1 13  ? 2.170   -14.124 100.320 1.00 23.28 ? 13  LEU B CD2 1 
ATOM   4551  N N   . GLN B 1 14  ? 0.143   -17.328 96.677  1.00 21.24 ? 14  GLN B N   1 
ATOM   4552  C CA  . GLN B 1 14  ? -0.443  -17.313 95.346  1.00 21.79 ? 14  GLN B CA  1 
ATOM   4553  C C   . GLN B 1 14  ? -1.952  -17.390 95.407  1.00 22.35 ? 14  GLN B C   1 
ATOM   4554  O O   . GLN B 1 14  ? -2.656  -16.766 94.613  1.00 21.84 ? 14  GLN B O   1 
ATOM   4555  C CB  . GLN B 1 14  ? 0.036   -18.509 94.543  1.00 22.04 ? 14  GLN B CB  1 
ATOM   4556  C CG  . GLN B 1 14  ? 1.465   -18.494 94.162  1.00 23.49 ? 14  GLN B CG  1 
ATOM   4557  C CD  . GLN B 1 14  ? 1.792   -19.708 93.330  1.00 26.22 ? 14  GLN B CD  1 
ATOM   4558  O OE1 . GLN B 1 14  ? 1.706   -20.845 93.823  1.00 27.49 ? 14  GLN B OE1 1 
ATOM   4559  N NE2 . GLN B 1 14  ? 2.127   -19.488 92.060  1.00 26.63 ? 14  GLN B NE2 1 
ATOM   4560  N N   . GLN B 1 15  ? -2.445  -18.195 96.341  1.00 23.23 ? 15  GLN B N   1 
ATOM   4561  C CA  . GLN B 1 15  ? -3.875  -18.371 96.509  1.00 23.94 ? 15  GLN B CA  1 
ATOM   4562  C C   . GLN B 1 15  ? -4.503  -17.094 97.053  1.00 23.32 ? 15  GLN B C   1 
ATOM   4563  O O   . GLN B 1 15  ? -5.529  -16.646 96.548  1.00 23.38 ? 15  GLN B O   1 
ATOM   4564  C CB  . GLN B 1 15  ? -4.148  -19.602 97.399  1.00 25.00 ? 15  GLN B CB  1 
ATOM   4565  C CG  . GLN B 1 15  ? -3.707  -20.920 96.702  1.00 27.07 ? 15  GLN B CG  1 
ATOM   4566  C CD  . GLN B 1 15  ? -3.580  -22.129 97.640  1.00 31.45 ? 15  GLN B CD  1 
ATOM   4567  O OE1 . GLN B 1 15  ? -3.254  -23.232 97.192  1.00 32.36 ? 15  GLN B OE1 1 
ATOM   4568  N NE2 . GLN B 1 15  ? -3.832  -21.921 98.932  1.00 33.57 ? 15  GLN B NE2 1 
ATOM   4569  N N   . TRP B 1 16  ? -3.882  -16.486 98.052  1.00 22.96 ? 16  TRP B N   1 
ATOM   4570  C CA  . TRP B 1 16  ? -4.393  -15.233 98.581  1.00 23.03 ? 16  TRP B CA  1 
ATOM   4571  C C   . TRP B 1 16  ? -4.483  -14.194 97.471  1.00 22.70 ? 16  TRP B C   1 
ATOM   4572  O O   . TRP B 1 16  ? -5.454  -13.452 97.379  1.00 22.40 ? 16  TRP B O   1 
ATOM   4573  C CB  . TRP B 1 16  ? -3.485  -14.695 99.682  1.00 23.07 ? 16  TRP B CB  1 
ATOM   4574  C CG  . TRP B 1 16  ? -4.086  -13.550 100.451 1.00 24.37 ? 16  TRP B CG  1 
ATOM   4575  C CD1 . TRP B 1 16  ? -4.726  -13.621 101.664 1.00 25.20 ? 16  TRP B CD1 1 
ATOM   4576  C CD2 . TRP B 1 16  ? -4.103  -12.165 100.075 1.00 25.63 ? 16  TRP B CD2 1 
ATOM   4577  N NE1 . TRP B 1 16  ? -5.132  -12.368 102.056 1.00 25.80 ? 16  TRP B NE1 1 
ATOM   4578  C CE2 . TRP B 1 16  ? -4.766  -11.457 101.101 1.00 25.63 ? 16  TRP B CE2 1 
ATOM   4579  C CE3 . TRP B 1 16  ? -3.638  -11.451 98.966  1.00 26.25 ? 16  TRP B CE3 1 
ATOM   4580  C CZ2 . TRP B 1 16  ? -4.969  -10.083 101.052 1.00 27.08 ? 16  TRP B CZ2 1 
ATOM   4581  C CZ3 . TRP B 1 16  ? -3.835  -10.091 98.920  1.00 27.27 ? 16  TRP B CZ3 1 
ATOM   4582  C CH2 . TRP B 1 16  ? -4.502  -9.416  99.961  1.00 27.60 ? 16  TRP B CH2 1 
ATOM   4583  N N   . TYR B 1 17  ? -3.441  -14.140 96.654  1.00 22.92 ? 17  TYR B N   1 
ATOM   4584  C CA  . TYR B 1 17  ? -3.353  -13.182 95.560  1.00 23.34 ? 17  TYR B CA  1 
ATOM   4585  C C   . TYR B 1 17  ? -4.493  -13.377 94.583  1.00 24.35 ? 17  TYR B C   1 
ATOM   4586  O O   . TYR B 1 17  ? -5.193  -12.438 94.258  1.00 23.20 ? 17  TYR B O   1 
ATOM   4587  C CB  . TYR B 1 17  ? -2.008  -13.329 94.842  1.00 23.40 ? 17  TYR B CB  1 
ATOM   4588  C CG  . TYR B 1 17  ? -1.874  -12.488 93.595  1.00 22.86 ? 17  TYR B CG  1 
ATOM   4589  C CD1 . TYR B 1 17  ? -1.457  -11.167 93.665  1.00 22.07 ? 17  TYR B CD1 1 
ATOM   4590  C CD2 . TYR B 1 17  ? -2.172  -13.013 92.349  1.00 23.18 ? 17  TYR B CD2 1 
ATOM   4591  C CE1 . TYR B 1 17  ? -1.327  -10.388 92.519  1.00 22.29 ? 17  TYR B CE1 1 
ATOM   4592  C CE2 . TYR B 1 17  ? -2.048  -12.243 91.196  1.00 23.46 ? 17  TYR B CE2 1 
ATOM   4593  C CZ  . TYR B 1 17  ? -1.632  -10.931 91.288  1.00 22.43 ? 17  TYR B CZ  1 
ATOM   4594  O OH  . TYR B 1 17  ? -1.515  -10.174 90.136  1.00 19.85 ? 17  TYR B OH  1 
ATOM   4595  N N   . ARG B 1 18  ? -4.672  -14.605 94.114  1.00 26.30 ? 18  ARG B N   1 
ATOM   4596  C CA  . ARG B 1 18  ? -5.752  -14.909 93.185  1.00 28.31 ? 18  ARG B CA  1 
ATOM   4597  C C   . ARG B 1 18  ? -7.099  -14.502 93.765  1.00 29.40 ? 18  ARG B C   1 
ATOM   4598  O O   . ARG B 1 18  ? -7.937  -13.950 93.066  1.00 29.23 ? 18  ARG B O   1 
ATOM   4599  C CB  . ARG B 1 18  ? -5.792  -16.401 92.847  1.00 28.59 ? 18  ARG B CB  1 
ATOM   4600  C CG  . ARG B 1 18  ? -4.572  -16.928 92.111  1.00 31.18 ? 18  ARG B CG  1 
ATOM   4601  C CD  . ARG B 1 18  ? -4.729  -18.385 91.648  1.00 34.43 ? 18  ARG B CD  1 
ATOM   4602  N NE  . ARG B 1 18  ? -3.530  -19.196 91.882  1.00 37.87 ? 18  ARG B NE  1 
ATOM   4603  C CZ  . ARG B 1 18  ? -3.468  -20.213 92.738  1.00 39.51 ? 18  ARG B CZ  1 
ATOM   4604  N NH1 . ARG B 1 18  ? -2.339  -20.890 92.886  1.00 41.04 ? 18  ARG B NH1 1 
ATOM   4605  N NH2 . ARG B 1 18  ? -4.530  -20.556 93.458  1.00 40.33 ? 18  ARG B NH2 1 
ATOM   4606  N N   . GLU B 1 19  ? -7.319  -14.742 95.049  1.00 31.05 ? 19  GLU B N   1 
ATOM   4607  C CA  . GLU B 1 19  ? -8.634  -14.421 95.585  1.00 32.45 ? 19  GLU B CA  1 
ATOM   4608  C C   . GLU B 1 19  ? -8.837  -13.012 96.195  1.00 32.53 ? 19  GLU B C   1 
ATOM   4609  O O   . GLU B 1 19  ? -9.983  -12.613 96.415  1.00 32.33 ? 19  GLU B O   1 
ATOM   4610  C CB  . GLU B 1 19  ? -9.131  -15.537 96.502  1.00 33.25 ? 19  GLU B CB  1 
ATOM   4611  C CG  . GLU B 1 19  ? -8.248  -15.905 97.672  1.00 35.83 ? 19  GLU B CG  1 
ATOM   4612  C CD  . GLU B 1 19  ? -8.733  -15.291 98.965  1.00 39.65 ? 19  GLU B CD  1 
ATOM   4613  O OE1 . GLU B 1 19  ? -9.647  -14.431 98.914  1.00 41.49 ? 19  GLU B OE1 1 
ATOM   4614  O OE2 . GLU B 1 19  ? -8.203  -15.668 100.037 1.00 42.09 ? 19  GLU B OE2 1 
ATOM   4615  N N   . HIS B 1 20  ? -7.770  -12.242 96.413  1.00 32.26 ? 20  HIS B N   1 
ATOM   4616  C CA  . HIS B 1 20  ? -7.926  -10.904 96.995  1.00 32.58 ? 20  HIS B CA  1 
ATOM   4617  C C   . HIS B 1 20  ? -7.313  -9.749  96.197  1.00 32.79 ? 20  HIS B C   1 
ATOM   4618  O O   . HIS B 1 20  ? -7.559  -8.584  96.512  1.00 31.86 ? 20  HIS B O   1 
ATOM   4619  C CB  . HIS B 1 20  ? -7.296  -10.860 98.391  1.00 32.70 ? 20  HIS B CB  1 
ATOM   4620  C CG  . HIS B 1 20  ? -7.976  -11.731 99.399  1.00 33.51 ? 20  HIS B CG  1 
ATOM   4621  N ND1 . HIS B 1 20  ? -9.276  -11.526 99.806  1.00 35.03 ? 20  HIS B ND1 1 
ATOM   4622  C CD2 . HIS B 1 20  ? -7.530  -12.803 100.093 1.00 34.78 ? 20  HIS B CD2 1 
ATOM   4623  C CE1 . HIS B 1 20  ? -9.603  -12.440 100.705 1.00 36.17 ? 20  HIS B CE1 1 
ATOM   4624  N NE2 . HIS B 1 20  ? -8.561  -13.229 100.896 1.00 34.68 ? 20  HIS B NE2 1 
ATOM   4625  N N   . ARG B 1 21  ? -6.525  -10.041 95.176  1.00 33.34 ? 21  ARG B N   1 
ATOM   4626  C CA  . ARG B 1 21  ? -5.779  -8.964  94.544  1.00 34.43 ? 21  ARG B CA  1 
ATOM   4627  C C   . ARG B 1 21  ? -6.690  -7.898  93.960  1.00 34.80 ? 21  ARG B C   1 
ATOM   4628  O O   . ARG B 1 21  ? -6.387  -6.708  94.031  1.00 34.55 ? 21  ARG B O   1 
ATOM   4629  C CB  . ARG B 1 21  ? -4.752  -9.495  93.550  1.00 34.90 ? 21  ARG B CB  1 
ATOM   4630  C CG  . ARG B 1 21  ? -5.271  -9.846  92.207  1.00 37.12 ? 21  ARG B CG  1 
ATOM   4631  C CD  . ARG B 1 21  ? -4.853  -8.864  91.143  1.00 39.82 ? 21  ARG B CD  1 
ATOM   4632  N NE  . ARG B 1 21  ? -4.832  -9.519  89.843  1.00 42.14 ? 21  ARG B NE  1 
ATOM   4633  C CZ  . ARG B 1 21  ? -3.999  -9.217  88.859  1.00 44.23 ? 21  ARG B CZ  1 
ATOM   4634  N NH1 . ARG B 1 21  ? -3.097  -8.243  89.013  1.00 43.97 ? 21  ARG B NH1 1 
ATOM   4635  N NH2 . ARG B 1 21  ? -4.068  -9.900  87.716  1.00 44.66 ? 21  ARG B NH2 1 
ATOM   4636  N N   . SER B 1 22  ? -7.830  -8.329  93.439  1.00 35.23 ? 22  SER B N   1 
ATOM   4637  C CA  . SER B 1 22  ? -8.839  -7.422  92.919  1.00 35.89 ? 22  SER B CA  1 
ATOM   4638  C C   . SER B 1 22  ? -9.270  -6.411  93.987  1.00 35.70 ? 22  SER B C   1 
ATOM   4639  O O   . SER B 1 22  ? -9.748  -5.337  93.659  1.00 36.25 ? 22  SER B O   1 
ATOM   4640  C CB  . SER B 1 22  ? -10.057 -8.228  92.438  1.00 36.15 ? 22  SER B CB  1 
ATOM   4641  O OG  . SER B 1 22  ? -10.683 -7.622  91.316  1.00 37.74 ? 22  SER B OG  1 
ATOM   4642  N N   . GLU B 1 23  ? -9.090  -6.754  95.260  1.00 35.76 ? 23  GLU B N   1 
ATOM   4643  C CA  . GLU B 1 23  ? -9.492  -5.889  96.379  1.00 35.52 ? 23  GLU B CA  1 
ATOM   4644  C C   . GLU B 1 23  ? -8.391  -4.962  96.913  1.00 34.56 ? 23  GLU B C   1 
ATOM   4645  O O   . GLU B 1 23  ? -8.632  -4.172  97.827  1.00 35.33 ? 23  GLU B O   1 
ATOM   4646  C CB  . GLU B 1 23  ? -9.976  -6.762  97.542  1.00 36.03 ? 23  GLU B CB  1 
ATOM   4647  C CG  . GLU B 1 23  ? -11.064 -7.751  97.156  1.00 37.67 ? 23  GLU B CG  1 
ATOM   4648  C CD  . GLU B 1 23  ? -11.173 -8.939  98.110  1.00 39.58 ? 23  GLU B CD  1 
ATOM   4649  O OE1 . GLU B 1 23  ? -11.715 -9.981  97.679  1.00 41.45 ? 23  GLU B OE1 1 
ATOM   4650  O OE2 . GLU B 1 23  ? -10.726 -8.841  99.277  1.00 39.41 ? 23  GLU B OE2 1 
ATOM   4651  N N   . LEU B 1 24  ? -7.186  -5.068  96.369  1.00 32.75 ? 24  LEU B N   1 
ATOM   4652  C CA  . LEU B 1 24  ? -6.057  -4.259  96.826  1.00 31.03 ? 24  LEU B CA  1 
ATOM   4653  C C   . LEU B 1 24  ? -6.124  -2.856  96.214  1.00 29.24 ? 24  LEU B C   1 
ATOM   4654  O O   . LEU B 1 24  ? -5.830  -2.692  95.029  1.00 28.71 ? 24  LEU B O   1 
ATOM   4655  C CB  . LEU B 1 24  ? -4.740  -4.924  96.394  1.00 31.28 ? 24  LEU B CB  1 
ATOM   4656  C CG  . LEU B 1 24  ? -3.818  -5.739  97.317  1.00 31.37 ? 24  LEU B CG  1 
ATOM   4657  C CD1 . LEU B 1 24  ? -4.318  -5.926  98.736  1.00 31.86 ? 24  LEU B CD1 1 
ATOM   4658  C CD2 . LEU B 1 24  ? -3.510  -7.075  96.666  1.00 31.27 ? 24  LEU B CD2 1 
ATOM   4659  N N   . ASN B 1 25  ? -6.545  -1.870  97.003  1.00 26.37 ? 25  ASN B N   1 
ATOM   4660  C CA  . ASN B 1 25  ? -6.565  -0.483  96.564  1.00 25.20 ? 25  ASN B CA  1 
ATOM   4661  C C   . ASN B 1 25  ? -6.016  0.392   97.684  1.00 24.19 ? 25  ASN B C   1 
ATOM   4662  O O   . ASN B 1 25  ? -6.557  0.435   98.788  1.00 23.24 ? 25  ASN B O   1 
ATOM   4663  C CB  . ASN B 1 25  ? -7.959  -0.018  96.144  1.00 25.11 ? 25  ASN B CB  1 
ATOM   4664  C CG  . ASN B 1 25  ? -7.969  1.430   95.673  1.00 24.49 ? 25  ASN B CG  1 
ATOM   4665  O OD1 . ASN B 1 25  ? -8.062  2.346   96.481  1.00 23.19 ? 25  ASN B OD1 1 
ATOM   4666  N ND2 . ASN B 1 25  ? -7.882  1.637   94.360  1.00 23.25 ? 25  ASN B ND2 1 
ATOM   4667  N N   . LEU B 1 26  ? -4.930  1.089   97.390  1.00 23.10 ? 26  LEU B N   1 
ATOM   4668  C CA  . LEU B 1 26  ? -4.258  1.878   98.411  1.00 22.96 ? 26  LEU B CA  1 
ATOM   4669  C C   . LEU B 1 26  ? -5.106  2.985   99.041  1.00 23.54 ? 26  LEU B C   1 
ATOM   4670  O O   . LEU B 1 26  ? -5.036  3.186   100.238 1.00 23.22 ? 26  LEU B O   1 
ATOM   4671  C CB  . LEU B 1 26  ? -2.939  2.423   97.873  1.00 22.28 ? 26  LEU B CB  1 
ATOM   4672  C CG  . LEU B 1 26  ? -1.899  1.343   97.525  1.00 21.51 ? 26  LEU B CG  1 
ATOM   4673  C CD1 . LEU B 1 26  ? -0.717  1.950   96.786  1.00 20.55 ? 26  LEU B CD1 1 
ATOM   4674  C CD2 . LEU B 1 26  ? -1.422  0.595   98.755  1.00 21.79 ? 26  LEU B CD2 1 
ATOM   4675  N N   . ARG B 1 27  ? -5.896  3.713   98.260  1.00 24.70 ? 27  ARG B N   1 
ATOM   4676  C CA  . ARG B 1 27  ? -6.742  4.755   98.851  1.00 25.75 ? 27  ARG B CA  1 
ATOM   4677  C C   . ARG B 1 27  ? -7.646  4.188   99.926  1.00 26.71 ? 27  ARG B C   1 
ATOM   4678  O O   . ARG B 1 27  ? -7.793  4.752   101.013 1.00 26.07 ? 27  ARG B O   1 
ATOM   4679  C CB  . ARG B 1 27  ? -7.657  5.381   97.804  1.00 26.52 ? 27  ARG B CB  1 
ATOM   4680  C CG  . ARG B 1 27  ? -7.164  6.627   97.170  1.00 26.27 ? 27  ARG B CG  1 
ATOM   4681  C CD  . ARG B 1 27  ? -8.298  7.545   96.722  1.00 27.74 ? 27  ARG B CD  1 
ATOM   4682  N NE  . ARG B 1 27  ? -7.860  8.454   95.675  1.00 27.78 ? 27  ARG B NE  1 
ATOM   4683  C CZ  . ARG B 1 27  ? -8.559  9.486   95.213  1.00 27.48 ? 27  ARG B CZ  1 
ATOM   4684  N NH1 . ARG B 1 27  ? -8.052  10.232  94.248  1.00 25.12 ? 27  ARG B NH1 1 
ATOM   4685  N NH2 . ARG B 1 27  ? -9.752  9.777   95.708  1.00 27.93 ? 27  ARG B NH2 1 
ATOM   4686  N N   . ARG B 1 28  ? -8.279  3.066   99.602  1.00 27.66 ? 28  ARG B N   1 
ATOM   4687  C CA  . ARG B 1 28  ? -9.224  2.454   100.516 1.00 28.43 ? 28  ARG B CA  1 
ATOM   4688  C C   . ARG B 1 28  ? -8.511  1.921   101.744 1.00 28.20 ? 28  ARG B C   1 
ATOM   4689  O O   . ARG B 1 28  ? -8.991  2.089   102.864 1.00 28.51 ? 28  ARG B O   1 
ATOM   4690  C CB  . ARG B 1 28  ? -10.063 1.377   99.797  1.00 28.94 ? 28  ARG B CB  1 
ATOM   4691  C CG  . ARG B 1 28  ? -11.427 1.927   99.331  1.00 31.13 ? 28  ARG B CG  1 
ATOM   4692  C CD  . ARG B 1 28  ? -11.952 1.418   97.984  1.00 33.04 ? 28  ARG B CD  1 
ATOM   4693  N NE  . ARG B 1 28  ? -11.697 0.000   97.729  1.00 34.06 ? 28  ARG B NE  1 
ATOM   4694  C CZ  . ARG B 1 28  ? -11.489 -0.512  96.515  1.00 34.28 ? 28  ARG B CZ  1 
ATOM   4695  N NH1 . ARG B 1 28  ? -11.499 0.270   95.444  1.00 35.98 ? 28  ARG B NH1 1 
ATOM   4696  N NH2 . ARG B 1 28  ? -11.265 -1.806  96.362  1.00 34.70 ? 28  ARG B NH2 1 
ATOM   4697  N N   . LEU B 1 29  ? -7.349  1.311   101.548 1.00 27.72 ? 29  LEU B N   1 
ATOM   4698  C CA  . LEU B 1 29  ? -6.589  0.806   102.676 1.00 27.21 ? 29  LEU B CA  1 
ATOM   4699  C C   . LEU B 1 29  ? -6.216  1.919   103.634 1.00 27.26 ? 29  LEU B C   1 
ATOM   4700  O O   . LEU B 1 29  ? -6.369  1.765   104.838 1.00 27.29 ? 29  LEU B O   1 
ATOM   4701  C CB  . LEU B 1 29  ? -5.341  0.073   102.208 1.00 26.99 ? 29  LEU B CB  1 
ATOM   4702  C CG  . LEU B 1 29  ? -5.678  -1.287  101.604 1.00 27.24 ? 29  LEU B CG  1 
ATOM   4703  C CD1 . LEU B 1 29  ? -4.439  -1.923  100.973 1.00 27.17 ? 29  LEU B CD1 1 
ATOM   4704  C CD2 . LEU B 1 29  ? -6.293  -2.186  102.671 1.00 27.04 ? 29  LEU B CD2 1 
ATOM   4705  N N   . PHE B 1 30  ? -5.723  3.039   103.116 1.00 27.61 ? 30  PHE B N   1 
ATOM   4706  C CA  . PHE B 1 30  ? -5.348  4.135   104.003 1.00 27.89 ? 30  PHE B CA  1 
ATOM   4707  C C   . PHE B 1 30  ? -6.599  4.759   104.620 1.00 29.55 ? 30  PHE B C   1 
ATOM   4708  O O   . PHE B 1 30  ? -6.598  5.120   105.791 1.00 29.57 ? 30  PHE B O   1 
ATOM   4709  C CB  . PHE B 1 30  ? -4.501  5.181   103.287 1.00 27.26 ? 30  PHE B CB  1 
ATOM   4710  C CG  . PHE B 1 30  ? -3.021  4.856   103.264 1.00 24.35 ? 30  PHE B CG  1 
ATOM   4711  C CD1 . PHE B 1 30  ? -2.434  4.316   102.136 1.00 20.48 ? 30  PHE B CD1 1 
ATOM   4712  C CD2 . PHE B 1 30  ? -2.223  5.096   104.372 1.00 21.08 ? 30  PHE B CD2 1 
ATOM   4713  C CE1 . PHE B 1 30  ? -1.094  4.025   102.110 1.00 18.28 ? 30  PHE B CE1 1 
ATOM   4714  C CE2 . PHE B 1 30  ? -0.878  4.809   104.348 1.00 19.61 ? 30  PHE B CE2 1 
ATOM   4715  C CZ  . PHE B 1 30  ? -0.313  4.263   103.213 1.00 18.60 ? 30  PHE B CZ  1 
ATOM   4716  N N   . ASP B 1 31  ? -7.668  4.866   103.841 1.00 31.17 ? 31  ASP B N   1 
ATOM   4717  C CA  . ASP B 1 31  ? -8.916  5.418   104.367 1.00 32.83 ? 31  ASP B CA  1 
ATOM   4718  C C   . ASP B 1 31  ? -9.476  4.546   105.503 1.00 33.36 ? 31  ASP B C   1 
ATOM   4719  O O   . ASP B 1 31  ? -9.991  5.074   106.491 1.00 34.02 ? 31  ASP B O   1 
ATOM   4720  C CB  . ASP B 1 31  ? -9.930  5.631   103.237 1.00 33.04 ? 31  ASP B CB  1 
ATOM   4721  C CG  . ASP B 1 31  ? -9.600  6.847   102.392 1.00 34.48 ? 31  ASP B CG  1 
ATOM   4722  O OD1 . ASP B 1 31  ? -10.119 6.982   101.266 1.00 36.91 ? 31  ASP B OD1 1 
ATOM   4723  O OD2 . ASP B 1 31  ? -8.813  7.735   102.778 1.00 37.92 ? 31  ASP B OD2 1 
ATOM   4724  N N   . ALA B 1 32  ? -9.320  3.227   105.390 1.00 34.08 ? 32  ALA B N   1 
ATOM   4725  C CA  . ALA B 1 32  ? -9.833  2.281   106.390 1.00 34.41 ? 32  ALA B CA  1 
ATOM   4726  C C   . ALA B 1 32  ? -8.919  1.989   107.592 1.00 34.74 ? 32  ALA B C   1 
ATOM   4727  O O   . ALA B 1 32  ? -9.365  1.366   108.558 1.00 34.91 ? 32  ALA B O   1 
ATOM   4728  C CB  . ALA B 1 32  ? -10.200 0.961   105.712 1.00 34.35 ? 32  ALA B CB  1 
ATOM   4729  N N   . ASN B 1 33  ? -7.651  2.398   107.550 1.00 34.59 ? 33  ASN B N   1 
ATOM   4730  C CA  . ASN B 1 33  ? -6.744  2.132   108.676 1.00 34.47 ? 33  ASN B CA  1 
ATOM   4731  C C   . ASN B 1 33  ? -5.828  3.329   108.936 1.00 33.98 ? 33  ASN B C   1 
ATOM   4732  O O   . ASN B 1 33  ? -4.811  3.512   108.269 1.00 33.41 ? 33  ASN B O   1 
ATOM   4733  C CB  . ASN B 1 33  ? -5.930  0.851   108.433 1.00 34.64 ? 33  ASN B CB  1 
ATOM   4734  C CG  . ASN B 1 33  ? -4.969  0.511   109.588 1.00 35.99 ? 33  ASN B CG  1 
ATOM   4735  O OD1 . ASN B 1 33  ? -5.001  1.120   110.667 1.00 37.73 ? 33  ASN B OD1 1 
ATOM   4736  N ND2 . ASN B 1 33  ? -4.097  -0.475  109.349 1.00 37.31 ? 33  ASN B ND2 1 
ATOM   4737  N N   . LYS B 1 34  ? -6.204  4.143   109.918 1.00 33.15 ? 34  LYS B N   1 
ATOM   4738  C CA  . LYS B 1 34  ? -5.425  5.325   110.260 1.00 32.48 ? 34  LYS B CA  1 
ATOM   4739  C C   . LYS B 1 34  ? -4.070  4.937   110.858 1.00 30.71 ? 34  LYS B C   1 
ATOM   4740  O O   . LYS B 1 34  ? -3.166  5.762   110.906 1.00 31.00 ? 34  LYS B O   1 
ATOM   4741  C CB  . LYS B 1 34  ? -6.212  6.257   111.202 1.00 32.98 ? 34  LYS B CB  1 
ATOM   4742  C CG  . LYS B 1 34  ? -6.910  5.567   112.375 1.00 35.40 ? 34  LYS B CG  1 
ATOM   4743  C CD  . LYS B 1 34  ? -7.740  6.566   113.196 1.00 39.26 ? 34  LYS B CD  1 
ATOM   4744  C CE  . LYS B 1 34  ? -8.792  5.865   114.054 1.00 41.07 ? 34  LYS B CE  1 
ATOM   4745  N NZ  . LYS B 1 34  ? -9.879  5.253   113.230 1.00 42.02 ? 34  LYS B NZ  1 
ATOM   4746  N N   . ASP B 1 35  ? -3.926  3.679   111.273 1.00 28.55 ? 35  ASP B N   1 
ATOM   4747  C CA  . ASP B 1 35  ? -2.675  3.182   111.843 1.00 27.46 ? 35  ASP B CA  1 
ATOM   4748  C C   . ASP B 1 35  ? -1.797  2.497   110.789 1.00 24.70 ? 35  ASP B C   1 
ATOM   4749  O O   . ASP B 1 35  ? -0.799  1.863   111.122 1.00 23.37 ? 35  ASP B O   1 
ATOM   4750  C CB  . ASP B 1 35  ? -2.975  2.156   112.937 1.00 28.14 ? 35  ASP B CB  1 
ATOM   4751  C CG  . ASP B 1 35  ? -2.217  2.426   114.245 1.00 32.27 ? 35  ASP B CG  1 
ATOM   4752  O OD1 . ASP B 1 35  ? -2.116  1.475   115.060 1.00 37.66 ? 35  ASP B OD1 1 
ATOM   4753  O OD2 . ASP B 1 35  ? -1.718  3.538   114.572 1.00 36.31 ? 35  ASP B OD2 1 
ATOM   4754  N N   . ARG B 1 36  ? -2.181  2.613   109.525 1.00 22.23 ? 36  ARG B N   1 
ATOM   4755  C CA  . ARG B 1 36  ? -1.471  1.914   108.469 1.00 20.34 ? 36  ARG B CA  1 
ATOM   4756  C C   . ARG B 1 36  ? 0.015   2.269   108.389 1.00 19.25 ? 36  ARG B C   1 
ATOM   4757  O O   . ARG B 1 36  ? 0.849   1.400   108.169 1.00 18.27 ? 36  ARG B O   1 
ATOM   4758  C CB  . ARG B 1 36  ? -2.144  2.150   107.120 1.00 20.14 ? 36  ARG B CB  1 
ATOM   4759  C CG  . ARG B 1 36  ? -1.502  1.333   106.026 1.00 18.55 ? 36  ARG B CG  1 
ATOM   4760  C CD  . ARG B 1 36  ? -2.278  1.255   104.740 1.00 17.29 ? 36  ARG B CD  1 
ATOM   4761  N NE  . ARG B 1 36  ? -1.473  0.592   103.718 1.00 15.81 ? 36  ARG B NE  1 
ATOM   4762  C CZ  . ARG B 1 36  ? -1.466  -0.711  103.495 1.00 13.95 ? 36  ARG B CZ  1 
ATOM   4763  N NH1 . ARG B 1 36  ? -2.277  -1.506  104.169 1.00 11.92 ? 36  ARG B NH1 1 
ATOM   4764  N NH2 . ARG B 1 36  ? -0.694  -1.214  102.543 1.00 14.50 ? 36  ARG B NH2 1 
ATOM   4765  N N   . PHE B 1 37  ? 0.345   3.549   108.516 1.00 18.04 ? 37  PHE B N   1 
ATOM   4766  C CA  . PHE B 1 37  ? 1.744   3.954   108.474 1.00 17.53 ? 37  PHE B CA  1 
ATOM   4767  C C   . PHE B 1 37  ? 2.495   3.296   109.626 1.00 17.64 ? 37  PHE B C   1 
ATOM   4768  O O   . PHE B 1 37  ? 3.566   2.730   109.433 1.00 15.88 ? 37  PHE B O   1 
ATOM   4769  C CB  . PHE B 1 37  ? 1.882   5.470   108.558 1.00 17.17 ? 37  PHE B CB  1 
ATOM   4770  C CG  . PHE B 1 37  ? 3.285   5.937   108.760 1.00 16.02 ? 37  PHE B CG  1 
ATOM   4771  C CD1 . PHE B 1 37  ? 4.216   5.869   107.727 1.00 16.02 ? 37  PHE B CD1 1 
ATOM   4772  C CD2 . PHE B 1 37  ? 3.686   6.435   109.989 1.00 15.76 ? 37  PHE B CD2 1 
ATOM   4773  C CE1 . PHE B 1 37  ? 5.515   6.286   107.919 1.00 15.15 ? 37  PHE B CE1 1 
ATOM   4774  C CE2 . PHE B 1 37  ? 4.983   6.871   110.187 1.00 15.96 ? 37  PHE B CE2 1 
ATOM   4775  C CZ  . PHE B 1 37  ? 5.910   6.789   109.146 1.00 14.76 ? 37  PHE B CZ  1 
ATOM   4776  N N   . ASN B 1 38  ? 1.925   3.369   110.829 1.00 17.98 ? 38  ASN B N   1 
ATOM   4777  C CA  . ASN B 1 38  ? 2.579   2.768   111.982 1.00 19.07 ? 38  ASN B CA  1 
ATOM   4778  C C   . ASN B 1 38  ? 2.772   1.259   111.826 1.00 18.48 ? 38  ASN B C   1 
ATOM   4779  O O   . ASN B 1 38  ? 3.799   0.728   112.211 1.00 18.77 ? 38  ASN B O   1 
ATOM   4780  C CB  . ASN B 1 38  ? 1.833   3.064   113.288 1.00 19.69 ? 38  ASN B CB  1 
ATOM   4781  C CG  . ASN B 1 38  ? 2.587   2.546   114.492 1.00 23.14 ? 38  ASN B CG  1 
ATOM   4782  O OD1 . ASN B 1 38  ? 3.642   3.093   114.875 1.00 28.22 ? 38  ASN B OD1 1 
ATOM   4783  N ND2 . ASN B 1 38  ? 2.098   1.453   115.065 1.00 26.02 ? 38  ASN B ND2 1 
ATOM   4784  N N   . HIS B 1 39  ? 1.809   0.572   111.240 1.00 18.59 ? 39  HIS B N   1 
ATOM   4785  C CA  . HIS B 1 39  ? 1.917   -0.880  111.105 1.00 19.10 ? 39  HIS B CA  1 
ATOM   4786  C C   . HIS B 1 39  ? 2.829   -1.317  109.953 1.00 18.02 ? 39  HIS B C   1 
ATOM   4787  O O   . HIS B 1 39  ? 3.330   -2.434  109.973 1.00 17.83 ? 39  HIS B O   1 
ATOM   4788  C CB  . HIS B 1 39  ? 0.547   -1.500  110.873 1.00 20.18 ? 39  HIS B CB  1 
ATOM   4789  C CG  . HIS B 1 39  ? -0.308  -1.562  112.098 1.00 25.21 ? 39  HIS B CG  1 
ATOM   4790  N ND1 . HIS B 1 39  ? 0.208   -1.484  113.374 1.00 29.90 ? 39  HIS B ND1 1 
ATOM   4791  C CD2 . HIS B 1 39  ? -1.650  -1.699  112.240 1.00 29.25 ? 39  HIS B CD2 1 
ATOM   4792  C CE1 . HIS B 1 39  ? -0.779  -1.568  114.251 1.00 31.00 ? 39  HIS B CE1 1 
ATOM   4793  N NE2 . HIS B 1 39  ? -1.917  -1.694  113.588 1.00 30.89 ? 39  HIS B NE2 1 
ATOM   4794  N N   . PHE B 1 40  ? 3.048   -0.447  108.967 1.00 16.12 ? 40  PHE B N   1 
ATOM   4795  C CA  . PHE B 1 40  ? 3.832   -0.831  107.786 1.00 15.84 ? 40  PHE B CA  1 
ATOM   4796  C C   . PHE B 1 40  ? 5.068   0.061   107.520 1.00 14.67 ? 40  PHE B C   1 
ATOM   4797  O O   . PHE B 1 40  ? 5.362   0.393   106.376 1.00 12.76 ? 40  PHE B O   1 
ATOM   4798  C CB  . PHE B 1 40  ? 2.930   -0.850  106.549 1.00 15.83 ? 40  PHE B CB  1 
ATOM   4799  C CG  . PHE B 1 40  ? 1.832   -1.878  106.608 1.00 18.13 ? 40  PHE B CG  1 
ATOM   4800  C CD1 . PHE B 1 40  ? 0.599   -1.567  107.144 1.00 20.16 ? 40  PHE B CD1 1 
ATOM   4801  C CD2 . PHE B 1 40  ? 2.027   -3.152  106.111 1.00 19.71 ? 40  PHE B CD2 1 
ATOM   4802  C CE1 . PHE B 1 40  ? -0.423  -2.513  107.200 1.00 19.98 ? 40  PHE B CE1 1 
ATOM   4803  C CE2 . PHE B 1 40  ? 1.008   -4.101  106.161 1.00 20.40 ? 40  PHE B CE2 1 
ATOM   4804  C CZ  . PHE B 1 40  ? -0.219  -3.775  106.707 1.00 19.98 ? 40  PHE B CZ  1 
ATOM   4805  N N   . SER B 1 41  ? 5.786   0.400   108.592 1.00 13.95 ? 41  SER B N   1 
ATOM   4806  C CA  . SER B 1 41  ? 7.008   1.191   108.536 1.00 14.12 ? 41  SER B CA  1 
ATOM   4807  C C   . SER B 1 41  ? 7.934   0.718   109.655 1.00 14.61 ? 41  SER B C   1 
ATOM   4808  O O   . SER B 1 41  ? 7.472   0.197   110.670 1.00 13.79 ? 41  SER B O   1 
ATOM   4809  C CB  . SER B 1 41  ? 6.696   2.677   108.697 1.00 14.30 ? 41  SER B CB  1 
ATOM   4810  O OG  . SER B 1 41  ? 6.276   2.975   110.025 1.00 13.63 ? 41  SER B OG  1 
ATOM   4811  N N   . LEU B 1 42  ? 9.233   0.874   109.439 1.00 14.28 ? 42  LEU B N   1 
ATOM   4812  C CA  . LEU B 1 42  ? 10.269  0.448   110.361 1.00 15.01 ? 42  LEU B CA  1 
ATOM   4813  C C   . LEU B 1 42  ? 11.172  1.639   110.596 1.00 14.54 ? 42  LEU B C   1 
ATOM   4814  O O   . LEU B 1 42  ? 11.556  2.329   109.636 1.00 13.76 ? 42  LEU B O   1 
ATOM   4815  C CB  . LEU B 1 42  ? 11.127  -0.621  109.687 1.00 15.54 ? 42  LEU B CB  1 
ATOM   4816  C CG  . LEU B 1 42  ? 11.395  -1.997  110.253 1.00 20.11 ? 42  LEU B CG  1 
ATOM   4817  C CD1 . LEU B 1 42  ? 12.388  -2.681  109.290 1.00 20.58 ? 42  LEU B CD1 1 
ATOM   4818  C CD2 . LEU B 1 42  ? 11.920  -1.985  111.704 1.00 21.57 ? 42  LEU B CD2 1 
ATOM   4819  N N   . THR B 1 43  ? 11.518  1.913   111.848 1.00 14.35 ? 43  THR B N   1 
ATOM   4820  C CA  . THR B 1 43  ? 12.494  2.962   112.107 1.00 14.57 ? 43  THR B CA  1 
ATOM   4821  C C   . THR B 1 43  ? 13.728  2.323   112.731 1.00 14.42 ? 43  THR B C   1 
ATOM   4822  O O   . THR B 1 43  ? 13.621  1.599   113.730 1.00 12.61 ? 43  THR B O   1 
ATOM   4823  C CB  . THR B 1 43  ? 11.924  4.101   113.000 1.00 15.04 ? 43  THR B CB  1 
ATOM   4824  O OG1 . THR B 1 43  ? 11.367  3.569   114.191 1.00 20.28 ? 43  THR B OG1 1 
ATOM   4825  C CG2 . THR B 1 43  ? 10.734  4.721   112.391 1.00 13.79 ? 43  THR B CG2 1 
ATOM   4826  N N   . LEU B 1 44  ? 14.887  2.542   112.113 1.00 13.29 ? 44  LEU B N   1 
ATOM   4827  C CA  . LEU B 1 44  ? 16.141  2.032   112.640 1.00 13.59 ? 44  LEU B CA  1 
ATOM   4828  C C   . LEU B 1 44  ? 16.973  3.205   113.135 1.00 13.07 ? 44  LEU B C   1 
ATOM   4829  O O   . LEU B 1 44  ? 17.100  4.223   112.453 1.00 12.46 ? 44  LEU B O   1 
ATOM   4830  C CB  . LEU B 1 44  ? 16.977  1.296   111.574 1.00 13.81 ? 44  LEU B CB  1 
ATOM   4831  C CG  . LEU B 1 44  ? 16.385  0.344   110.529 1.00 16.26 ? 44  LEU B CG  1 
ATOM   4832  C CD1 . LEU B 1 44  ? 17.459  -0.546  109.905 1.00 16.65 ? 44  LEU B CD1 1 
ATOM   4833  C CD2 . LEU B 1 44  ? 15.228  -0.475  111.022 1.00 17.78 ? 44  LEU B CD2 1 
ATOM   4834  N N   . ASN B 1 45  ? 17.526  3.070   114.329 1.00 12.24 ? 45  ASN B N   1 
ATOM   4835  C CA  . ASN B 1 45  ? 18.441  4.065   114.855 1.00 11.82 ? 45  ASN B CA  1 
ATOM   4836  C C   . ASN B 1 45  ? 19.819  3.446   114.830 1.00 11.43 ? 45  ASN B C   1 
ATOM   4837  O O   . ASN B 1 45  ? 20.124  2.550   115.608 1.00 10.84 ? 45  ASN B O   1 
ATOM   4838  C CB  . ASN B 1 45  ? 18.061  4.501   116.268 1.00 12.49 ? 45  ASN B CB  1 
ATOM   4839  C CG  . ASN B 1 45  ? 19.018  5.525   116.810 1.00 11.99 ? 45  ASN B CG  1 
ATOM   4840  O OD1 . ASN B 1 45  ? 19.950  5.939   116.099 1.00 11.70 ? 45  ASN B OD1 1 
ATOM   4841  N ND2 . ASN B 1 45  ? 18.798  5.963   118.054 1.00 9.76  ? 45  ASN B ND2 1 
ATOM   4842  N N   . THR B 1 46  ? 20.654  3.908   113.912 1.00 10.60 ? 46  THR B N   1 
ATOM   4843  C CA  . THR B 1 46  ? 21.965  3.323   113.746 1.00 10.97 ? 46  THR B CA  1 
ATOM   4844  C C   . THR B 1 46  ? 22.950  3.913   114.722 1.00 10.87 ? 46  THR B C   1 
ATOM   4845  O O   . THR B 1 46  ? 24.090  3.522   114.726 1.00 10.35 ? 46  THR B O   1 
ATOM   4846  C CB  . THR B 1 46  ? 22.500  3.607   112.344 1.00 11.32 ? 46  THR B CB  1 
ATOM   4847  O OG1 . THR B 1 46  ? 22.783  5.008   112.225 1.00 10.48 ? 46  THR B OG1 1 
ATOM   4848  C CG2 . THR B 1 46  ? 21.448  3.339   111.277 1.00 11.54 ? 46  THR B CG2 1 
ATOM   4849  N N   . ASN B 1 47  ? 22.496  4.889   115.509 1.00 10.90 ? 47  ASN B N   1 
ATOM   4850  C CA  . ASN B 1 47  ? 23.359  5.701   116.374 1.00 10.56 ? 47  ASN B CA  1 
ATOM   4851  C C   . ASN B 1 47  ? 24.178  6.719   115.598 1.00 10.75 ? 47  ASN B C   1 
ATOM   4852  O O   . ASN B 1 47  ? 24.858  7.547   116.197 1.00 8.85  ? 47  ASN B O   1 
ATOM   4853  C CB  . ASN B 1 47  ? 24.249  4.864   117.272 1.00 10.85 ? 47  ASN B CB  1 
ATOM   4854  C CG  . ASN B 1 47  ? 23.471  4.252   118.402 1.00 11.44 ? 47  ASN B CG  1 
ATOM   4855  O OD1 . ASN B 1 47  ? 22.443  4.794   118.814 1.00 11.60 ? 47  ASN B OD1 1 
ATOM   4856  N ND2 . ASN B 1 47  ? 23.932  3.107   118.887 1.00 12.84 ? 47  ASN B ND2 1 
ATOM   4857  N N   . HIS B 1 48  ? 24.076  6.670   114.266 1.00 10.70 ? 48  HIS B N   1 
ATOM   4858  C CA  . HIS B 1 48  ? 24.733  7.642   113.401 1.00 10.98 ? 48  HIS B CA  1 
ATOM   4859  C C   . HIS B 1 48  ? 23.757  8.138   112.347 1.00 10.33 ? 48  HIS B C   1 
ATOM   4860  O O   . HIS B 1 48  ? 24.157  8.507   111.257 1.00 9.76  ? 48  HIS B O   1 
ATOM   4861  C CB  . HIS B 1 48  ? 25.931  7.015   112.701 1.00 11.25 ? 48  HIS B CB  1 
ATOM   4862  C CG  . HIS B 1 48  ? 26.948  6.464   113.643 1.00 14.63 ? 48  HIS B CG  1 
ATOM   4863  N ND1 . HIS B 1 48  ? 28.079  7.163   113.994 1.00 19.61 ? 48  HIS B ND1 1 
ATOM   4864  C CD2 . HIS B 1 48  ? 26.991  5.300   114.330 1.00 17.14 ? 48  HIS B CD2 1 
ATOM   4865  C CE1 . HIS B 1 48  ? 28.791  6.442   114.841 1.00 19.87 ? 48  HIS B CE1 1 
ATOM   4866  N NE2 . HIS B 1 48  ? 28.153  5.308   115.061 1.00 20.47 ? 48  HIS B NE2 1 
ATOM   4867  N N   . GLY B 1 49  ? 22.486  8.226   112.726 1.00 9.95  ? 49  GLY B N   1 
ATOM   4868  C CA  . GLY B 1 49  ? 21.417  8.583   111.822 1.00 9.88  ? 49  GLY B CA  1 
ATOM   4869  C C   . GLY B 1 49  ? 20.296  7.556   111.900 1.00 9.67  ? 49  GLY B C   1 
ATOM   4870  O O   . GLY B 1 49  ? 20.534  6.372   112.189 1.00 9.46  ? 49  GLY B O   1 
ATOM   4871  N N   . HIS B 1 50  ? 19.069  8.020   111.683 1.00 9.31  ? 50  HIS B N   1 
ATOM   4872  C CA  . HIS B 1 50  ? 17.913  7.150   111.632 1.00 9.41  ? 50  HIS B CA  1 
ATOM   4873  C C   . HIS B 1 50  ? 17.555  6.813   110.179 1.00 9.44  ? 50  HIS B C   1 
ATOM   4874  O O   . HIS B 1 50  ? 17.817  7.597   109.260 1.00 8.72  ? 50  HIS B O   1 
ATOM   4875  C CB  . HIS B 1 50  ? 16.732  7.855   112.275 1.00 9.80  ? 50  HIS B CB  1 
ATOM   4876  C CG  . HIS B 1 50  ? 16.773  7.880   113.771 1.00 10.99 ? 50  HIS B CG  1 
ATOM   4877  N ND1 . HIS B 1 50  ? 17.683  8.633   114.482 1.00 11.37 ? 50  HIS B ND1 1 
ATOM   4878  C CD2 . HIS B 1 50  ? 16.004  7.251   114.689 1.00 12.83 ? 50  HIS B CD2 1 
ATOM   4879  C CE1 . HIS B 1 50  ? 17.456  8.484   115.774 1.00 12.25 ? 50  HIS B CE1 1 
ATOM   4880  N NE2 . HIS B 1 50  ? 16.462  7.630   115.928 1.00 12.90 ? 50  HIS B NE2 1 
ATOM   4881  N N   . ILE B 1 51  ? 16.981  5.634   109.983 1.00 9.21  ? 51  ILE B N   1 
ATOM   4882  C CA  . ILE B 1 51  ? 16.462  5.221   108.697 1.00 9.36  ? 51  ILE B CA  1 
ATOM   4883  C C   . ILE B 1 51  ? 14.990  4.852   108.903 1.00 9.68  ? 51  ILE B C   1 
ATOM   4884  O O   . ILE B 1 51  ? 14.645  4.002   109.756 1.00 8.30  ? 51  ILE B O   1 
ATOM   4885  C CB  . ILE B 1 51  ? 17.207  3.981   108.135 1.00 9.43  ? 51  ILE B CB  1 
ATOM   4886  C CG1 . ILE B 1 51  ? 18.726  4.188   108.123 1.00 9.27  ? 51  ILE B CG1 1 
ATOM   4887  C CG2 . ILE B 1 51  ? 16.699  3.691   106.738 1.00 9.65  ? 51  ILE B CG2 1 
ATOM   4888  C CD1 . ILE B 1 51  ? 19.543  2.946   107.724 1.00 9.00  ? 51  ILE B CD1 1 
ATOM   4889  N N   . LEU B 1 52  ? 14.114  5.526   108.168 1.00 9.70  ? 52  LEU B N   1 
ATOM   4890  C CA  . LEU B 1 52  ? 12.715  5.193   108.166 1.00 9.70  ? 52  LEU B CA  1 
ATOM   4891  C C   . LEU B 1 52  ? 12.451  4.414   106.874 1.00 9.82  ? 52  LEU B C   1 
ATOM   4892  O O   . LEU B 1 52  ? 12.641  4.938   105.771 1.00 9.56  ? 52  LEU B O   1 
ATOM   4893  C CB  . LEU B 1 52  ? 11.842  6.442   108.230 1.00 10.67 ? 52  LEU B CB  1 
ATOM   4894  C CG  . LEU B 1 52  ? 10.355  6.262   107.879 1.00 12.08 ? 52  LEU B CG  1 
ATOM   4895  C CD1 . LEU B 1 52  ? 9.711   5.265   108.811 1.00 13.76 ? 52  LEU B CD1 1 
ATOM   4896  C CD2 . LEU B 1 52  ? 9.577   7.585   107.943 1.00 13.13 ? 52  LEU B CD2 1 
ATOM   4897  N N   . VAL B 1 53  ? 12.088  3.136   107.007 1.00 9.44  ? 53  VAL B N   1 
ATOM   4898  C CA  . VAL B 1 53  ? 11.721  2.335   105.843 1.00 9.25  ? 53  VAL B CA  1 
ATOM   4899  C C   . VAL B 1 53  ? 10.211  2.270   105.869 1.00 9.31  ? 53  VAL B C   1 
ATOM   4900  O O   . VAL B 1 53  ? 9.612   1.512   106.646 1.00 10.23 ? 53  VAL B O   1 
ATOM   4901  C CB  . VAL B 1 53  ? 12.335  0.932   105.880 1.00 8.90  ? 53  VAL B CB  1 
ATOM   4902  C CG1 . VAL B 1 53  ? 11.973  0.126   104.607 1.00 8.81  ? 53  VAL B CG1 1 
ATOM   4903  C CG2 . VAL B 1 53  ? 13.855  1.030   106.055 1.00 9.46  ? 53  VAL B CG2 1 
ATOM   4904  N N   . ASP B 1 54  ? 9.590   3.111   105.071 1.00 9.41  ? 54  ASP B N   1 
ATOM   4905  C CA  . ASP B 1 54  ? 8.138   3.188   105.004 1.00 9.81  ? 54  ASP B CA  1 
ATOM   4906  C C   . ASP B 1 54  ? 7.637   2.393   103.828 1.00 10.00 ? 54  ASP B C   1 
ATOM   4907  O O   . ASP B 1 54  ? 7.768   2.827   102.671 1.00 10.06 ? 54  ASP B O   1 
ATOM   4908  C CB  . ASP B 1 54  ? 7.703   4.637   104.844 1.00 10.21 ? 54  ASP B CB  1 
ATOM   4909  C CG  . ASP B 1 54  ? 6.189   4.790   104.757 1.00 10.54 ? 54  ASP B CG  1 
ATOM   4910  O OD1 . ASP B 1 54  ? 5.453   3.778   104.866 1.00 9.57  ? 54  ASP B OD1 1 
ATOM   4911  O OD2 . ASP B 1 54  ? 5.663   5.889   104.551 1.00 10.28 ? 54  ASP B OD2 1 
ATOM   4912  N N   . TYR B 1 55  ? 7.061   1.225   104.127 1.00 9.62  ? 55  TYR B N   1 
ATOM   4913  C CA  . TYR B 1 55  ? 6.545   0.325   103.099 1.00 10.12 ? 55  TYR B CA  1 
ATOM   4914  C C   . TYR B 1 55  ? 5.002   0.252   103.110 1.00 9.77  ? 55  TYR B C   1 
ATOM   4915  O O   . TYR B 1 55  ? 4.380   -0.722  102.629 1.00 9.37  ? 55  TYR B O   1 
ATOM   4916  C CB  . TYR B 1 55  ? 7.187   -1.056  103.270 1.00 10.07 ? 55  TYR B CB  1 
ATOM   4917  C CG  . TYR B 1 55  ? 6.935   -1.744  104.590 1.00 10.95 ? 55  TYR B CG  1 
ATOM   4918  C CD1 . TYR B 1 55  ? 5.937   -2.706  104.716 1.00 11.11 ? 55  TYR B CD1 1 
ATOM   4919  C CD2 . TYR B 1 55  ? 7.741   -1.480  105.711 1.00 11.01 ? 55  TYR B CD2 1 
ATOM   4920  C CE1 . TYR B 1 55  ? 5.723   -3.350  105.927 1.00 12.32 ? 55  TYR B CE1 1 
ATOM   4921  C CE2 . TYR B 1 55  ? 7.520   -2.112  106.915 1.00 12.17 ? 55  TYR B CE2 1 
ATOM   4922  C CZ  . TYR B 1 55  ? 6.522   -3.052  107.011 1.00 12.59 ? 55  TYR B CZ  1 
ATOM   4923  O OH  . TYR B 1 55  ? 6.317   -3.684  108.208 1.00 12.16 ? 55  TYR B OH  1 
ATOM   4924  N N   . SER B 1 56  ? 4.391   1.305   103.629 1.00 10.14 ? 56  SER B N   1 
ATOM   4925  C CA  . SER B 1 56  ? 2.943   1.359   103.780 1.00 10.45 ? 56  SER B CA  1 
ATOM   4926  C C   . SER B 1 56  ? 2.194   1.596   102.476 1.00 10.42 ? 56  SER B C   1 
ATOM   4927  O O   . SER B 1 56  ? 1.008   1.240   102.385 1.00 10.90 ? 56  SER B O   1 
ATOM   4928  C CB  . SER B 1 56  ? 2.535   2.408   104.838 1.00 10.51 ? 56  SER B CB  1 
ATOM   4929  O OG  . SER B 1 56  ? 2.758   3.737   104.414 1.00 10.70 ? 56  SER B OG  1 
ATOM   4930  N N   . LYS B 1 57  ? 2.871   2.164   101.468 1.00 9.76  ? 57  LYS B N   1 
ATOM   4931  C CA  . LYS B 1 57  ? 2.233   2.434   100.174 1.00 9.75  ? 57  LYS B CA  1 
ATOM   4932  C C   . LYS B 1 57  ? 2.437   1.265   99.212  1.00 10.44 ? 57  LYS B C   1 
ATOM   4933  O O   . LYS B 1 57  ? 2.598   1.453   97.996  1.00 9.81  ? 57  LYS B O   1 
ATOM   4934  C CB  . LYS B 1 57  ? 2.741   3.734   99.537  1.00 9.87  ? 57  LYS B CB  1 
ATOM   4935  C CG  . LYS B 1 57  ? 2.546   5.022   100.365 1.00 10.07 ? 57  LYS B CG  1 
ATOM   4936  C CD  . LYS B 1 57  ? 2.646   6.266   99.450  1.00 9.21  ? 57  LYS B CD  1 
ATOM   4937  C CE  . LYS B 1 57  ? 2.743   7.590   100.194 1.00 8.86  ? 57  LYS B CE  1 
ATOM   4938  N NZ  . LYS B 1 57  ? 4.046   7.811   100.915 1.00 8.88  ? 57  LYS B NZ  1 
ATOM   4939  N N   . ASN B 1 58  ? 2.463   0.061   99.786  1.00 10.27 ? 58  ASN B N   1 
ATOM   4940  C CA  . ASN B 1 58  ? 2.535   -1.186  99.066  1.00 10.40 ? 58  ASN B CA  1 
ATOM   4941  C C   . ASN B 1 58  ? 1.187   -1.917  99.082  1.00 11.19 ? 58  ASN B C   1 
ATOM   4942  O O   . ASN B 1 58  ? 0.379   -1.713  99.977  1.00 11.38 ? 58  ASN B O   1 
ATOM   4943  C CB  . ASN B 1 58  ? 3.611   -2.090  99.671  1.00 10.16 ? 58  ASN B CB  1 
ATOM   4944  C CG  . ASN B 1 58  ? 5.001   -1.640  99.308  1.00 10.64 ? 58  ASN B CG  1 
ATOM   4945  O OD1 . ASN B 1 58  ? 5.776   -1.180  100.160 1.00 12.34 ? 58  ASN B OD1 1 
ATOM   4946  N ND2 . ASN B 1 58  ? 5.336   -1.774  98.037  1.00 7.60  ? 58  ASN B ND2 1 
ATOM   4947  N N   . LEU B 1 59  ? 0.964   -2.745  98.066  1.00 12.15 ? 59  LEU B N   1 
ATOM   4948  C CA  . LEU B 1 59  ? -0.285  -3.482  97.879  1.00 13.29 ? 59  LEU B CA  1 
ATOM   4949  C C   . LEU B 1 59  ? -0.269  -4.712  98.773  1.00 13.56 ? 59  LEU B C   1 
ATOM   4950  O O   . LEU B 1 59  ? -0.256  -5.854  98.304  1.00 13.21 ? 59  LEU B O   1 
ATOM   4951  C CB  . LEU B 1 59  ? -0.451  -3.870  96.397  1.00 13.41 ? 59  LEU B CB  1 
ATOM   4952  C CG  . LEU B 1 59  ? -0.551  -2.690  95.412  1.00 16.38 ? 59  LEU B CG  1 
ATOM   4953  C CD1 . LEU B 1 59  ? -0.580  -3.185  93.994  1.00 17.97 ? 59  LEU B CD1 1 
ATOM   4954  C CD2 . LEU B 1 59  ? -1.780  -1.878  95.683  1.00 18.16 ? 59  LEU B CD2 1 
ATOM   4955  N N   . VAL B 1 60  ? -0.210  -4.458  100.076 1.00 13.35 ? 60  VAL B N   1 
ATOM   4956  C CA  . VAL B 1 60  ? -0.152  -5.520  101.050 1.00 14.25 ? 60  VAL B CA  1 
ATOM   4957  C C   . VAL B 1 60  ? -1.043  -5.216  102.252 1.00 13.78 ? 60  VAL B C   1 
ATOM   4958  O O   . VAL B 1 60  ? -1.406  -4.074  102.494 1.00 13.58 ? 60  VAL B O   1 
ATOM   4959  C CB  . VAL B 1 60  ? 1.302   -5.732  101.561 1.00 14.25 ? 60  VAL B CB  1 
ATOM   4960  C CG1 . VAL B 1 60  ? 2.239   -6.048  100.407 1.00 15.15 ? 60  VAL B CG1 1 
ATOM   4961  C CG2 . VAL B 1 60  ? 1.791   -4.522  102.325 1.00 14.72 ? 60  VAL B CG2 1 
ATOM   4962  N N   . THR B 1 61  ? -1.422  -6.265  102.971 1.00 15.12 ? 61  THR B N   1 
ATOM   4963  C CA  . THR B 1 61  ? -2.176  -6.129  104.215 1.00 15.04 ? 61  THR B CA  1 
ATOM   4964  C C   . THR B 1 61  ? -1.384  -6.861  105.265 1.00 15.76 ? 61  THR B C   1 
ATOM   4965  O O   . THR B 1 61  ? -0.373  -7.491  104.960 1.00 15.05 ? 61  THR B O   1 
ATOM   4966  C CB  . THR B 1 61  ? -3.552  -6.817  104.140 1.00 15.84 ? 61  THR B CB  1 
ATOM   4967  O OG1 . THR B 1 61  ? -3.362  -8.207  103.859 1.00 15.72 ? 61  THR B OG1 1 
ATOM   4968  C CG2 . THR B 1 61  ? -4.387  -6.311  102.980 1.00 14.97 ? 61  THR B CG2 1 
ATOM   4969  N N   . GLU B 1 62  ? -1.877  -6.839  106.502 1.00 16.12 ? 62  GLU B N   1 
ATOM   4970  C CA  . GLU B 1 62  ? -1.192  -7.539  107.583 1.00 16.89 ? 62  GLU B CA  1 
ATOM   4971  C C   . GLU B 1 62  ? -1.030  -9.014  107.249 1.00 15.74 ? 62  GLU B C   1 
ATOM   4972  O O   . GLU B 1 62  ? 0.011   -9.611  107.535 1.00 14.63 ? 62  GLU B O   1 
ATOM   4973  C CB  . GLU B 1 62  ? -1.953  -7.383  108.905 1.00 18.04 ? 62  GLU B CB  1 
ATOM   4974  C CG  . GLU B 1 62  ? -2.282  -5.945  109.253 1.00 22.07 ? 62  GLU B CG  1 
ATOM   4975  C CD  . GLU B 1 62  ? -1.210  -5.238  110.044 1.00 27.70 ? 62  GLU B CD  1 
ATOM   4976  O OE1 . GLU B 1 62  ? -1.538  -4.192  110.657 1.00 31.27 ? 62  GLU B OE1 1 
ATOM   4977  O OE2 . GLU B 1 62  ? -0.051  -5.715  110.060 1.00 33.00 ? 62  GLU B OE2 1 
ATOM   4978  N N   . ASP B 1 63  ? -2.062  -9.606  106.655 1.00 15.45 ? 63  ASP B N   1 
ATOM   4979  C CA  . ASP B 1 63  ? -2.001  -11.030 106.335 1.00 15.05 ? 63  ASP B CA  1 
ATOM   4980  C C   . ASP B 1 63  ? -0.923  -11.298 105.290 1.00 14.50 ? 63  ASP B C   1 
ATOM   4981  O O   . ASP B 1 63  ? -0.167  -12.251 105.403 1.00 13.30 ? 63  ASP B O   1 
ATOM   4982  C CB  . ASP B 1 63  ? -3.335  -11.564 105.830 1.00 15.46 ? 63  ASP B CB  1 
ATOM   4983  C CG  . ASP B 1 63  ? -4.396  -11.599 106.909 1.00 16.71 ? 63  ASP B CG  1 
ATOM   4984  O OD1 . ASP B 1 63  ? -4.062  -11.625 108.104 1.00 16.61 ? 63  ASP B OD1 1 
ATOM   4985  O OD2 . ASP B 1 63  ? -5.596  -11.569 106.630 1.00 21.19 ? 63  ASP B OD2 1 
ATOM   4986  N N   . VAL B 1 64  ? -0.858  -10.454 104.269 1.00 13.91 ? 64  VAL B N   1 
ATOM   4987  C CA  . VAL B 1 64  ? 0.154   -10.652 103.244 1.00 13.83 ? 64  VAL B CA  1 
ATOM   4988  C C   . VAL B 1 64  ? 1.526   -10.666 103.901 1.00 13.04 ? 64  VAL B C   1 
ATOM   4989  O O   . VAL B 1 64  ? 2.296   -11.574 103.683 1.00 12.88 ? 64  VAL B O   1 
ATOM   4990  C CB  . VAL B 1 64  ? 0.066   -9.612  102.110 1.00 13.49 ? 64  VAL B CB  1 
ATOM   4991  C CG1 . VAL B 1 64  ? 1.207   -9.816  101.120 1.00 14.23 ? 64  VAL B CG1 1 
ATOM   4992  C CG2 . VAL B 1 64  ? -1.255  -9.724  101.378 1.00 14.88 ? 64  VAL B CG2 1 
ATOM   4993  N N   . MET B 1 65  ? 1.827   -9.678  104.734 1.00 13.67 ? 65  MET B N   1 
ATOM   4994  C CA  . MET B 1 65  ? 3.143   -9.632  105.360 1.00 13.93 ? 65  MET B CA  1 
ATOM   4995  C C   . MET B 1 65  ? 3.409   -10.865 106.216 1.00 14.27 ? 65  MET B C   1 
ATOM   4996  O O   . MET B 1 65  ? 4.524   -11.395 106.213 1.00 14.36 ? 65  MET B O   1 
ATOM   4997  C CB  . MET B 1 65  ? 3.321   -8.367  106.191 1.00 13.87 ? 65  MET B CB  1 
ATOM   4998  C CG  . MET B 1 65  ? 3.157   -7.072  105.406 1.00 13.92 ? 65  MET B CG  1 
ATOM   4999  S SD  . MET B 1 65  ? 4.206   -6.910  103.936 1.00 13.71 ? 65  MET B SD  1 
ATOM   5000  C CE  . MET B 1 65  ? 5.815   -7.109  104.630 1.00 16.11 ? 65  MET B CE  1 
ATOM   5001  N N   . ARG B 1 66  ? 2.404   -11.314 106.958 1.00 14.46 ? 66  ARG B N   1 
ATOM   5002  C CA  . ARG B 1 66  ? 2.569   -12.502 107.796 1.00 15.45 ? 66  ARG B CA  1 
ATOM   5003  C C   . ARG B 1 66  ? 2.910   -13.710 106.924 1.00 14.91 ? 66  ARG B C   1 
ATOM   5004  O O   . ARG B 1 66  ? 3.830   -14.480 107.235 1.00 14.80 ? 66  ARG B O   1 
ATOM   5005  C CB  . ARG B 1 66  ? 1.305   -12.757 108.619 1.00 15.93 ? 66  ARG B CB  1 
ATOM   5006  C CG  . ARG B 1 66  ? 1.340   -14.031 109.447 1.00 18.61 ? 66  ARG B CG  1 
ATOM   5007  C CD  . ARG B 1 66  ? 0.079   -14.251 110.287 1.00 22.24 ? 66  ARG B CD  1 
ATOM   5008  N NE  . ARG B 1 66  ? -1.157  -14.075 109.526 1.00 24.35 ? 66  ARG B NE  1 
ATOM   5009  C CZ  . ARG B 1 66  ? -1.739  -15.001 108.774 1.00 25.58 ? 66  ARG B CZ  1 
ATOM   5010  N NH1 . ARG B 1 66  ? -1.222  -16.215 108.655 1.00 29.02 ? 66  ARG B NH1 1 
ATOM   5011  N NH2 . ARG B 1 66  ? -2.858  -14.711 108.126 1.00 26.95 ? 66  ARG B NH2 1 
ATOM   5012  N N   . MET B 1 67  ? 2.183   -13.857 105.822 1.00 14.95 ? 67  MET B N   1 
ATOM   5013  C CA  . MET B 1 67  ? 2.430   -14.954 104.904 1.00 14.93 ? 67  MET B CA  1 
ATOM   5014  C C   . MET B 1 67  ? 3.825   -14.841 104.261 1.00 14.38 ? 67  MET B C   1 
ATOM   5015  O O   . MET B 1 67  ? 4.484   -15.842 104.040 1.00 13.91 ? 67  MET B O   1 
ATOM   5016  C CB  . MET B 1 67  ? 1.347   -15.005 103.830 1.00 15.39 ? 67  MET B CB  1 
ATOM   5017  C CG  . MET B 1 67  ? -0.039  -15.485 104.317 1.00 17.62 ? 67  MET B CG  1 
ATOM   5018  S SD  . MET B 1 67  ? -1.125  -15.758 102.898 1.00 22.28 ? 67  MET B SD  1 
ATOM   5019  C CE  . MET B 1 67  ? -1.574  -14.088 102.580 1.00 23.93 ? 67  MET B CE  1 
ATOM   5020  N N   . LEU B 1 68  ? 4.277   -13.627 103.967 1.00 13.69 ? 68  LEU B N   1 
ATOM   5021  C CA  . LEU B 1 68  ? 5.599   -13.454 103.378 1.00 13.67 ? 68  LEU B CA  1 
ATOM   5022  C C   . LEU B 1 68  ? 6.691   -13.821 104.392 1.00 13.34 ? 68  LEU B C   1 
ATOM   5023  O O   . LEU B 1 68  ? 7.680   -14.477 104.053 1.00 13.11 ? 68  LEU B O   1 
ATOM   5024  C CB  . LEU B 1 68  ? 5.777   -12.014 102.846 1.00 13.28 ? 68  LEU B CB  1 
ATOM   5025  C CG  . LEU B 1 68  ? 4.997   -11.640 101.587 1.00 12.71 ? 68  LEU B CG  1 
ATOM   5026  C CD1 . LEU B 1 68  ? 4.963   -10.114 101.452 1.00 12.02 ? 68  LEU B CD1 1 
ATOM   5027  C CD2 . LEU B 1 68  ? 5.595   -12.286 100.334 1.00 14.36 ? 68  LEU B CD2 1 
ATOM   5028  N N   . VAL B 1 69  ? 6.508   -13.438 105.647 1.00 13.37 ? 69  VAL B N   1 
ATOM   5029  C CA  . VAL B 1 69  ? 7.474   -13.812 106.673 1.00 13.71 ? 69  VAL B CA  1 
ATOM   5030  C C   . VAL B 1 69  ? 7.491   -15.353 106.808 1.00 13.87 ? 69  VAL B C   1 
ATOM   5031  O O   . VAL B 1 69  ? 8.558   -15.967 106.927 1.00 14.00 ? 69  VAL B O   1 
ATOM   5032  C CB  . VAL B 1 69  ? 7.180   -13.098 108.030 1.00 13.90 ? 69  VAL B CB  1 
ATOM   5033  C CG1 . VAL B 1 69  ? 8.064   -13.630 109.145 1.00 15.40 ? 69  VAL B CG1 1 
ATOM   5034  C CG2 . VAL B 1 69  ? 7.422   -11.612 107.902 1.00 14.85 ? 69  VAL B CG2 1 
ATOM   5035  N N   . ASP B 1 70  ? 6.316   -15.965 106.747 1.00 14.08 ? 70  ASP B N   1 
ATOM   5036  C CA  . ASP B 1 70  ? 6.199   -17.427 106.833 1.00 14.75 ? 70  ASP B CA  1 
ATOM   5037  C C   . ASP B 1 70  ? 6.953   -18.093 105.687 1.00 14.66 ? 70  ASP B C   1 
ATOM   5038  O O   . ASP B 1 70  ? 7.527   -19.159 105.844 1.00 14.23 ? 70  ASP B O   1 
ATOM   5039  C CB  . ASP B 1 70  ? 4.736   -17.860 106.791 1.00 15.01 ? 70  ASP B CB  1 
ATOM   5040  C CG  . ASP B 1 70  ? 3.989   -17.587 108.091 1.00 16.61 ? 70  ASP B CG  1 
ATOM   5041  O OD1 . ASP B 1 70  ? 4.610   -17.216 109.103 1.00 16.67 ? 70  ASP B OD1 1 
ATOM   5042  O OD2 . ASP B 1 70  ? 2.746   -17.701 108.156 1.00 19.59 ? 70  ASP B OD2 1 
ATOM   5043  N N   . LEU B 1 71  ? 6.920   -17.471 104.515 1.00 14.25 ? 71  LEU B N   1 
ATOM   5044  C CA  . LEU B 1 71  ? 7.668   -17.979 103.379 1.00 14.25 ? 71  LEU B CA  1 
ATOM   5045  C C   . LEU B 1 71  ? 9.174   -17.919 103.665 1.00 13.69 ? 71  LEU B C   1 
ATOM   5046  O O   . LEU B 1 71  ? 9.906   -18.880 103.406 1.00 13.40 ? 71  LEU B O   1 
ATOM   5047  C CB  . LEU B 1 71  ? 7.303   -17.179 102.123 1.00 14.18 ? 71  LEU B CB  1 
ATOM   5048  C CG  . LEU B 1 71  ? 8.087   -17.485 100.846 1.00 15.82 ? 71  LEU B CG  1 
ATOM   5049  C CD1 . LEU B 1 71  ? 7.859   -18.926 100.390 1.00 15.52 ? 71  LEU B CD1 1 
ATOM   5050  C CD2 . LEU B 1 71  ? 7.692   -16.509 99.740  1.00 16.62 ? 71  LEU B CD2 1 
ATOM   5051  N N   . ALA B 1 72  ? 9.644   -16.800 104.215 1.00 13.13 ? 72  ALA B N   1 
ATOM   5052  C CA  . ALA B 1 72  ? 11.051  -16.662 104.524 1.00 13.54 ? 72  ALA B CA  1 
ATOM   5053  C C   . ALA B 1 72  ? 11.510  -17.767 105.482 1.00 14.13 ? 72  ALA B C   1 
ATOM   5054  O O   . ALA B 1 72  ? 12.611  -18.304 105.377 1.00 13.82 ? 72  ALA B O   1 
ATOM   5055  C CB  . ALA B 1 72  ? 11.336  -15.294 105.138 1.00 13.96 ? 72  ALA B CB  1 
ATOM   5056  N N   . LYS B 1 73  ? 10.657  -18.100 106.429 1.00 14.94 ? 73  LYS B N   1 
ATOM   5057  C CA  . LYS B 1 73  ? 10.997  -19.132 107.386 1.00 15.66 ? 73  LYS B CA  1 
ATOM   5058  C C   . LYS B 1 73  ? 11.012  -20.504 106.724 1.00 15.38 ? 73  LYS B C   1 
ATOM   5059  O O   . LYS B 1 73  ? 11.927  -21.274 106.936 1.00 15.67 ? 73  LYS B O   1 
ATOM   5060  C CB  . LYS B 1 73  ? 10.005  -19.078 108.548 1.00 16.63 ? 73  LYS B CB  1 
ATOM   5061  C CG  . LYS B 1 73  ? 10.390  -18.006 109.544 1.00 17.92 ? 73  LYS B CG  1 
ATOM   5062  C CD  . LYS B 1 73  ? 9.541   -18.015 110.791 1.00 22.95 ? 73  LYS B CD  1 
ATOM   5063  C CE  . LYS B 1 73  ? 8.283   -17.233 110.591 1.00 25.55 ? 73  LYS B CE  1 
ATOM   5064  N NZ  . LYS B 1 73  ? 7.732   -16.659 111.883 1.00 29.24 ? 73  LYS B NZ  1 
ATOM   5065  N N   . SER B 1 74  ? 10.004  -20.768 105.896 1.00 15.59 ? 74  SER B N   1 
ATOM   5066  C CA  . SER B 1 74  ? 9.850   -22.029 105.194 1.00 15.68 ? 74  SER B CA  1 
ATOM   5067  C C   . SER B 1 74  ? 11.004  -22.241 104.233 1.00 15.56 ? 74  SER B C   1 
ATOM   5068  O O   . SER B 1 74  ? 11.469  -23.366 104.044 1.00 15.07 ? 74  SER B O   1 
ATOM   5069  C CB  . SER B 1 74  ? 8.524   -22.020 104.422 1.00 15.96 ? 74  SER B CB  1 
ATOM   5070  O OG  . SER B 1 74  ? 8.323   -23.228 103.723 1.00 17.57 ? 74  SER B OG  1 
ATOM   5071  N N   . ARG B 1 75  ? 11.471  -21.144 103.631 1.00 14.82 ? 75  ARG B N   1 
ATOM   5072  C CA  . ARG B 1 75  ? 12.577  -21.202 102.693 1.00 14.63 ? 75  ARG B CA  1 
ATOM   5073  C C   . ARG B 1 75  ? 13.966  -21.189 103.376 1.00 14.59 ? 75  ARG B C   1 
ATOM   5074  O O   . ARG B 1 75  ? 14.998  -21.235 102.700 1.00 15.35 ? 75  ARG B O   1 
ATOM   5075  C CB  . ARG B 1 75  ? 12.440  -20.088 101.646 1.00 14.16 ? 75  ARG B CB  1 
ATOM   5076  C CG  . ARG B 1 75  ? 11.244  -20.238 100.712 1.00 13.48 ? 75  ARG B CG  1 
ATOM   5077  C CD  . ARG B 1 75  ? 11.321  -21.408 99.716  1.00 16.64 ? 75  ARG B CD  1 
ATOM   5078  N NE  . ARG B 1 75  ? 12.613  -21.405 99.040  1.00 16.58 ? 75  ARG B NE  1 
ATOM   5079  C CZ  . ARG B 1 75  ? 13.499  -22.382 99.099  1.00 18.84 ? 75  ARG B CZ  1 
ATOM   5080  N NH1 . ARG B 1 75  ? 13.226  -23.511 99.751  1.00 20.50 ? 75  ARG B NH1 1 
ATOM   5081  N NH2 . ARG B 1 75  ? 14.663  -22.241 98.494  1.00 18.29 ? 75  ARG B NH2 1 
ATOM   5082  N N   . GLY B 1 76  ? 13.998  -21.164 104.708 1.00 13.84 ? 76  GLY B N   1 
ATOM   5083  C CA  . GLY B 1 76  ? 15.252  -21.280 105.444 1.00 13.28 ? 76  GLY B CA  1 
ATOM   5084  C C   . GLY B 1 76  ? 16.197  -20.089 105.376 1.00 13.23 ? 76  GLY B C   1 
ATOM   5085  O O   . GLY B 1 76  ? 17.423  -20.241 105.365 1.00 12.65 ? 76  GLY B O   1 
ATOM   5086  N N   . VAL B 1 77  ? 15.624  -18.899 105.307 1.00 13.42 ? 77  VAL B N   1 
ATOM   5087  C CA  . VAL B 1 77  ? 16.419  -17.685 105.215 1.00 13.71 ? 77  VAL B CA  1 
ATOM   5088  C C   . VAL B 1 77  ? 17.408  -17.509 106.365 1.00 14.11 ? 77  VAL B C   1 
ATOM   5089  O O   . VAL B 1 77  ? 18.585  -17.255 106.135 1.00 13.56 ? 77  VAL B O   1 
ATOM   5090  C CB  . VAL B 1 77  ? 15.516  -16.457 105.137 1.00 13.52 ? 77  VAL B CB  1 
ATOM   5091  C CG1 . VAL B 1 77  ? 16.320  -15.171 105.341 1.00 13.39 ? 77  VAL B CG1 1 
ATOM   5092  C CG2 . VAL B 1 77  ? 14.817  -16.426 103.799 1.00 14.34 ? 77  VAL B CG2 1 
ATOM   5093  N N   . GLU B 1 78  ? 16.945  -17.659 107.604 1.00 14.60 ? 78  GLU B N   1 
ATOM   5094  C CA  . GLU B 1 78  ? 17.848  -17.446 108.740 1.00 14.66 ? 78  GLU B CA  1 
ATOM   5095  C C   . GLU B 1 78  ? 19.030  -18.415 108.730 1.00 14.32 ? 78  GLU B C   1 
ATOM   5096  O O   . GLU B 1 78  ? 20.181  -18.018 108.908 1.00 14.63 ? 78  GLU B O   1 
ATOM   5097  C CB  . GLU B 1 78  ? 17.077  -17.490 110.067 1.00 15.04 ? 78  GLU B CB  1 
ATOM   5098  C CG  . GLU B 1 78  ? 16.228  -16.245 110.276 1.00 16.06 ? 78  GLU B CG  1 
ATOM   5099  C CD  . GLU B 1 78  ? 15.124  -16.392 111.318 1.00 19.06 ? 78  GLU B CD  1 
ATOM   5100  O OE1 . GLU B 1 78  ? 15.064  -15.550 112.229 1.00 20.74 ? 78  GLU B OE1 1 
ATOM   5101  O OE2 . GLU B 1 78  ? 14.291  -17.313 111.210 1.00 19.86 ? 78  GLU B OE2 1 
ATOM   5102  N N   . ALA B 1 79  ? 18.752  -19.686 108.482 1.00 13.95 ? 79  ALA B N   1 
ATOM   5103  C CA  . ALA B 1 79  ? 19.800  -20.688 108.435 1.00 13.54 ? 79  ALA B CA  1 
ATOM   5104  C C   . ALA B 1 79  ? 20.799  -20.365 107.338 1.00 12.86 ? 79  ALA B C   1 
ATOM   5105  O O   . ALA B 1 79  ? 22.005  -20.485 107.542 1.00 12.43 ? 79  ALA B O   1 
ATOM   5106  C CB  . ALA B 1 79  ? 19.211  -22.068 108.221 1.00 13.83 ? 79  ALA B CB  1 
ATOM   5107  N N   . ALA B 1 80  ? 20.303  -19.961 106.170 1.00 12.29 ? 80  ALA B N   1 
ATOM   5108  C CA  . ALA B 1 80  ? 21.201  -19.594 105.080 1.00 12.04 ? 80  ALA B CA  1 
ATOM   5109  C C   . ALA B 1 80  ? 22.063  -18.407 105.499 1.00 11.81 ? 80  ALA B C   1 
ATOM   5110  O O   . ALA B 1 80  ? 23.261  -18.371 105.251 1.00 10.71 ? 80  ALA B O   1 
ATOM   5111  C CB  . ALA B 1 80  ? 20.394  -19.261 103.832 1.00 12.54 ? 80  ALA B CB  1 
ATOM   5112  N N   . ARG B 1 81  ? 21.436  -17.415 106.126 1.00 12.08 ? 81  ARG B N   1 
ATOM   5113  C CA  . ARG B 1 81  ? 22.170  -16.243 106.601 1.00 11.50 ? 81  ARG B CA  1 
ATOM   5114  C C   . ARG B 1 81  ? 23.332  -16.667 107.502 1.00 12.32 ? 81  ARG B C   1 
ATOM   5115  O O   . ARG B 1 81  ? 24.466  -16.229 107.322 1.00 11.56 ? 81  ARG B O   1 
ATOM   5116  C CB  . ARG B 1 81  ? 21.235  -15.316 107.370 1.00 11.39 ? 81  ARG B CB  1 
ATOM   5117  C CG  . ARG B 1 81  ? 21.920  -14.099 107.942 1.00 11.03 ? 81  ARG B CG  1 
ATOM   5118  C CD  . ARG B 1 81  ? 21.088  -13.341 108.943 1.00 10.34 ? 81  ARG B CD  1 
ATOM   5119  N NE  . ARG B 1 81  ? 20.757  -14.203 110.068 1.00 10.01 ? 81  ARG B NE  1 
ATOM   5120  C CZ  . ARG B 1 81  ? 19.637  -14.158 110.792 1.00 11.69 ? 81  ARG B CZ  1 
ATOM   5121  N NH1 . ARG B 1 81  ? 18.705  -13.263 110.567 1.00 13.83 ? 81  ARG B NH1 1 
ATOM   5122  N NH2 . ARG B 1 81  ? 19.441  -15.049 111.764 1.00 10.45 ? 81  ARG B NH2 1 
ATOM   5123  N N   . GLU B 1 82  ? 23.053  -17.550 108.461 1.00 12.74 ? 82  GLU B N   1 
ATOM   5124  C CA  . GLU B 1 82  ? 24.107  -18.016 109.350 1.00 12.67 ? 82  GLU B CA  1 
ATOM   5125  C C   . GLU B 1 82  ? 25.225  -18.705 108.589 1.00 12.75 ? 82  GLU B C   1 
ATOM   5126  O O   . GLU B 1 82  ? 26.394  -18.530 108.923 1.00 12.44 ? 82  GLU B O   1 
ATOM   5127  C CB  . GLU B 1 82  ? 23.531  -18.925 110.430 1.00 13.16 ? 82  GLU B CB  1 
ATOM   5128  C CG  . GLU B 1 82  ? 22.579  -18.193 111.361 1.00 13.31 ? 82  GLU B CG  1 
ATOM   5129  C CD  . GLU B 1 82  ? 23.192  -16.928 111.929 1.00 16.15 ? 82  GLU B CD  1 
ATOM   5130  O OE1 . GLU B 1 82  ? 24.135  -17.056 112.752 1.00 16.29 ? 82  GLU B OE1 1 
ATOM   5131  O OE2 . GLU B 1 82  ? 22.750  -15.812 111.536 1.00 14.25 ? 82  GLU B OE2 1 
ATOM   5132  N N   . ARG B 1 83  ? 24.875  -19.482 107.568 1.00 12.85 ? 83  ARG B N   1 
ATOM   5133  C CA  . ARG B 1 83  ? 25.896  -20.150 106.762 1.00 13.75 ? 83  ARG B CA  1 
ATOM   5134  C C   . ARG B 1 83  ? 26.836  -19.126 106.116 1.00 13.21 ? 83  ARG B C   1 
ATOM   5135  O O   . ARG B 1 83  ? 28.059  -19.302 106.111 1.00 12.09 ? 83  ARG B O   1 
ATOM   5136  C CB  . ARG B 1 83  ? 25.240  -21.041 105.705 1.00 14.14 ? 83  ARG B CB  1 
ATOM   5137  C CG  . ARG B 1 83  ? 24.524  -22.275 106.272 1.00 16.48 ? 83  ARG B CG  1 
ATOM   5138  C CD  . ARG B 1 83  ? 24.231  -23.360 105.243 1.00 20.06 ? 83  ARG B CD  1 
ATOM   5139  N NE  . ARG B 1 83  ? 23.239  -22.968 104.234 1.00 24.65 ? 83  ARG B NE  1 
ATOM   5140  C CZ  . ARG B 1 83  ? 21.911  -23.087 104.363 1.00 27.19 ? 83  ARG B CZ  1 
ATOM   5141  N NH1 . ARG B 1 83  ? 21.370  -23.565 105.470 1.00 27.84 ? 83  ARG B NH1 1 
ATOM   5142  N NH2 . ARG B 1 83  ? 21.116  -22.712 103.372 1.00 28.72 ? 83  ARG B NH2 1 
ATOM   5143  N N   . MET B 1 84  ? 26.272  -18.039 105.580 1.00 12.95 ? 84  MET B N   1 
ATOM   5144  C CA  . MET B 1 84  ? 27.104  -16.995 104.980 1.00 12.80 ? 84  MET B CA  1 
ATOM   5145  C C   . MET B 1 84  ? 28.059  -16.398 106.012 1.00 12.65 ? 84  MET B C   1 
ATOM   5146  O O   . MET B 1 84  ? 29.273  -16.385 105.804 1.00 12.18 ? 84  MET B O   1 
ATOM   5147  C CB  . MET B 1 84  ? 26.242  -15.871 104.365 1.00 13.12 ? 84  MET B CB  1 
ATOM   5148  C CG  . MET B 1 84  ? 27.055  -14.674 103.899 1.00 13.83 ? 84  MET B CG  1 
ATOM   5149  S SD  . MET B 1 84  ? 26.165  -13.464 102.839 1.00 14.96 ? 84  MET B SD  1 
ATOM   5150  C CE  . MET B 1 84  ? 24.981  -12.890 103.924 1.00 15.04 ? 84  MET B CE  1 
ATOM   5151  N N   . PHE B 1 85  ? 27.509  -15.929 107.138 1.00 12.40 ? 85  PHE B N   1 
ATOM   5152  C CA  . PHE B 1 85  ? 28.291  -15.233 108.148 1.00 13.25 ? 85  PHE B CA  1 
ATOM   5153  C C   . PHE B 1 85  ? 29.335  -16.110 108.812 1.00 13.84 ? 85  PHE B C   1 
ATOM   5154  O O   . PHE B 1 85  ? 30.356  -15.617 109.285 1.00 14.31 ? 85  PHE B O   1 
ATOM   5155  C CB  . PHE B 1 85  ? 27.385  -14.650 109.247 1.00 13.04 ? 85  PHE B CB  1 
ATOM   5156  C CG  . PHE B 1 85  ? 26.773  -13.321 108.918 1.00 13.00 ? 85  PHE B CG  1 
ATOM   5157  C CD1 . PHE B 1 85  ? 25.654  -13.238 108.108 1.00 13.97 ? 85  PHE B CD1 1 
ATOM   5158  C CD2 . PHE B 1 85  ? 27.267  -12.161 109.494 1.00 13.34 ? 85  PHE B CD2 1 
ATOM   5159  C CE1 . PHE B 1 85  ? 25.051  -12.016 107.838 1.00 14.65 ? 85  PHE B CE1 1 
ATOM   5160  C CE2 . PHE B 1 85  ? 26.686  -10.932 109.225 1.00 14.71 ? 85  PHE B CE2 1 
ATOM   5161  C CZ  . PHE B 1 85  ? 25.563  -10.861 108.400 1.00 14.79 ? 85  PHE B CZ  1 
ATOM   5162  N N   . ASN B 1 86  ? 29.077  -17.412 108.825 1.00 15.02 ? 86  ASN B N   1 
ATOM   5163  C CA  . ASN B 1 86  ? 29.963  -18.369 109.465 1.00 15.89 ? 86  ASN B CA  1 
ATOM   5164  C C   . ASN B 1 86  ? 31.071  -18.867 108.533 1.00 16.66 ? 86  ASN B C   1 
ATOM   5165  O O   . ASN B 1 86  ? 31.938  -19.630 108.952 1.00 16.23 ? 86  ASN B O   1 
ATOM   5166  C CB  . ASN B 1 86  ? 29.151  -19.541 109.996 1.00 16.33 ? 86  ASN B CB  1 
ATOM   5167  C CG  . ASN B 1 86  ? 28.415  -19.209 111.286 1.00 16.91 ? 86  ASN B CG  1 
ATOM   5168  O OD1 . ASN B 1 86  ? 27.350  -19.783 111.573 1.00 20.01 ? 86  ASN B OD1 1 
ATOM   5169  N ND2 . ASN B 1 86  ? 28.976  -18.301 112.075 1.00 15.68 ? 86  ASN B ND2 1 
ATOM   5170  N N   . GLY B 1 87  ? 31.050  -18.424 107.279 1.00 16.13 ? 87  GLY B N   1 
ATOM   5171  C CA  . GLY B 1 87  ? 32.116  -18.746 106.357 1.00 16.72 ? 87  GLY B CA  1 
ATOM   5172  C C   . GLY B 1 87  ? 31.968  -20.071 105.648 1.00 17.13 ? 87  GLY B C   1 
ATOM   5173  O O   . GLY B 1 87  ? 32.950  -20.585 105.121 1.00 17.80 ? 87  GLY B O   1 
ATOM   5174  N N   . GLU B 1 88  ? 30.754  -20.611 105.625 1.00 17.27 ? 88  GLU B N   1 
ATOM   5175  C CA  . GLU B 1 88  ? 30.471  -21.845 104.902 1.00 17.64 ? 88  GLU B CA  1 
ATOM   5176  C C   . GLU B 1 88  ? 30.433  -21.554 103.407 1.00 17.46 ? 88  GLU B C   1 
ATOM   5177  O O   . GLU B 1 88  ? 30.204  -20.408 102.987 1.00 16.15 ? 88  GLU B O   1 
ATOM   5178  C CB  . GLU B 1 88  ? 29.176  -22.480 105.401 1.00 18.02 ? 88  GLU B CB  1 
ATOM   5179  C CG  . GLU B 1 88  ? 29.272  -22.912 106.858 1.00 19.40 ? 88  GLU B CG  1 
ATOM   5180  C CD  . GLU B 1 88  ? 28.004  -23.537 107.384 1.00 21.00 ? 88  GLU B CD  1 
ATOM   5181  O OE1 . GLU B 1 88  ? 27.363  -24.304 106.647 1.00 23.91 ? 88  GLU B OE1 1 
ATOM   5182  O OE2 . GLU B 1 88  ? 27.640  -23.253 108.545 1.00 22.60 ? 88  GLU B OE2 1 
ATOM   5183  N N   . LYS B 1 89  ? 30.684  -22.590 102.605 1.00 16.83 ? 89  LYS B N   1 
ATOM   5184  C CA  . LYS B 1 89  ? 30.867  -22.417 101.165 1.00 17.05 ? 89  LYS B CA  1 
ATOM   5185  C C   . LYS B 1 89  ? 29.525  -22.369 100.451 1.00 16.50 ? 89  LYS B C   1 
ATOM   5186  O O   . LYS B 1 89  ? 29.148  -23.297 99.721  1.00 15.83 ? 89  LYS B O   1 
ATOM   5187  C CB  . LYS B 1 89  ? 31.785  -23.522 100.624 1.00 17.54 ? 89  LYS B CB  1 
ATOM   5188  C CG  . LYS B 1 89  ? 33.173  -23.501 101.264 1.00 20.34 ? 89  LYS B CG  1 
ATOM   5189  C CD  . LYS B 1 89  ? 34.042  -24.699 100.882 1.00 24.19 ? 89  LYS B CD  1 
ATOM   5190  C CE  . LYS B 1 89  ? 35.278  -24.781 101.789 1.00 25.76 ? 89  LYS B CE  1 
ATOM   5191  N NZ  . LYS B 1 89  ? 36.029  -23.493 101.781 1.00 28.89 ? 89  LYS B NZ  1 
ATOM   5192  N N   . ILE B 1 90  ? 28.805  -21.264 100.654 1.00 15.26 ? 90  ILE B N   1 
ATOM   5193  C CA  . ILE B 1 90  ? 27.466  -21.143 100.132 1.00 15.28 ? 90  ILE B CA  1 
ATOM   5194  C C   . ILE B 1 90  ? 27.448  -20.784 98.658  1.00 14.68 ? 90  ILE B C   1 
ATOM   5195  O O   . ILE B 1 90  ? 26.411  -20.891 98.038  1.00 15.20 ? 90  ILE B O   1 
ATOM   5196  C CB  . ILE B 1 90  ? 26.602  -20.150 100.959 1.00 15.29 ? 90  ILE B CB  1 
ATOM   5197  C CG1 . ILE B 1 90  ? 27.122  -18.719 100.832 1.00 14.45 ? 90  ILE B CG1 1 
ATOM   5198  C CG2 . ILE B 1 90  ? 26.574  -20.555 102.407 1.00 15.32 ? 90  ILE B CG2 1 
ATOM   5199  C CD1 . ILE B 1 90  ? 26.045  -17.680 101.163 1.00 14.29 ? 90  ILE B CD1 1 
ATOM   5200  N N   . ASN B 1 91  ? 28.572  -20.343 98.111  1.00 14.45 ? 91  ASN B N   1 
ATOM   5201  C CA  . ASN B 1 91  ? 28.692  -20.171 96.663  1.00 14.11 ? 91  ASN B CA  1 
ATOM   5202  C C   . ASN B 1 91  ? 28.996  -21.589 96.195  1.00 14.75 ? 91  ASN B C   1 
ATOM   5203  O O   . ASN B 1 91  ? 30.148  -21.948 96.007  1.00 14.36 ? 91  ASN B O   1 
ATOM   5204  C CB  . ASN B 1 91  ? 29.831  -19.212 96.325  1.00 13.90 ? 91  ASN B CB  1 
ATOM   5205  C CG  . ASN B 1 91  ? 30.065  -19.058 94.821  1.00 13.59 ? 91  ASN B CG  1 
ATOM   5206  O OD1 . ASN B 1 91  ? 29.501  -19.782 94.002  1.00 13.92 ? 91  ASN B OD1 1 
ATOM   5207  N ND2 . ASN B 1 91  ? 30.921  -18.116 94.463  1.00 11.98 ? 91  ASN B ND2 1 
ATOM   5208  N N   . TYR B 1 92  ? 27.946  -22.386 96.036  1.00 15.67 ? 92  TYR B N   1 
ATOM   5209  C CA  . TYR B 1 92  ? 28.090  -23.824 95.799  1.00 16.47 ? 92  TYR B CA  1 
ATOM   5210  C C   . TYR B 1 92  ? 28.552  -24.266 94.423  1.00 16.26 ? 92  TYR B C   1 
ATOM   5211  O O   . TYR B 1 92  ? 29.135  -25.340 94.310  1.00 17.33 ? 92  TYR B O   1 
ATOM   5212  C CB  . TYR B 1 92  ? 26.790  -24.570 96.157  1.00 17.03 ? 92  TYR B CB  1 
ATOM   5213  C CG  . TYR B 1 92  ? 25.510  -23.982 95.594  1.00 17.57 ? 92  TYR B CG  1 
ATOM   5214  C CD1 . TYR B 1 92  ? 25.068  -24.286 94.310  1.00 17.83 ? 92  TYR B CD1 1 
ATOM   5215  C CD2 . TYR B 1 92  ? 24.730  -23.142 96.372  1.00 19.19 ? 92  TYR B CD2 1 
ATOM   5216  C CE1 . TYR B 1 92  ? 23.893  -23.746 93.817  1.00 18.31 ? 92  TYR B CE1 1 
ATOM   5217  C CE2 . TYR B 1 92  ? 23.570  -22.606 95.905  1.00 18.68 ? 92  TYR B CE2 1 
ATOM   5218  C CZ  . TYR B 1 92  ? 23.142  -22.900 94.638  1.00 19.86 ? 92  TYR B CZ  1 
ATOM   5219  O OH  . TYR B 1 92  ? 21.958  -22.340 94.227  1.00 19.92 ? 92  TYR B OH  1 
ATOM   5220  N N   . THR B 1 93  ? 28.298  -23.500 93.371  1.00 15.26 ? 93  THR B N   1 
ATOM   5221  C CA  . THR B 1 93  ? 28.795  -23.922 92.064  1.00 14.49 ? 93  THR B CA  1 
ATOM   5222  C C   . THR B 1 93  ? 30.302  -23.704 91.953  1.00 15.10 ? 93  THR B C   1 
ATOM   5223  O O   . THR B 1 93  ? 30.949  -24.344 91.125  1.00 15.46 ? 93  THR B O   1 
ATOM   5224  C CB  . THR B 1 93  ? 28.122  -23.171 90.923  1.00 14.60 ? 93  THR B CB  1 
ATOM   5225  O OG1 . THR B 1 93  ? 28.407  -21.768 91.037  1.00 11.03 ? 93  THR B OG1 1 
ATOM   5226  C CG2 . THR B 1 93  ? 26.617  -23.298 90.975  1.00 14.54 ? 93  THR B CG2 1 
ATOM   5227  N N   . GLU B 1 94  ? 30.859  -22.796 92.762  1.00 15.25 ? 94  GLU B N   1 
ATOM   5228  C CA  . GLU B 1 94  ? 32.300  -22.515 92.722  1.00 15.79 ? 94  GLU B CA  1 
ATOM   5229  C C   . GLU B 1 94  ? 33.064  -22.954 93.970  1.00 15.84 ? 94  GLU B C   1 
ATOM   5230  O O   . GLU B 1 94  ? 34.266  -22.678 94.072  1.00 15.64 ? 94  GLU B O   1 
ATOM   5231  C CB  . GLU B 1 94  ? 32.550  -21.024 92.513  1.00 16.22 ? 94  GLU B CB  1 
ATOM   5232  C CG  . GLU B 1 94  ? 31.889  -20.477 91.268  1.00 17.02 ? 94  GLU B CG  1 
ATOM   5233  C CD  . GLU B 1 94  ? 32.267  -19.042 90.996  1.00 20.47 ? 94  GLU B CD  1 
ATOM   5234  O OE1 . GLU B 1 94  ? 32.015  -18.183 91.860  1.00 22.19 ? 94  GLU B OE1 1 
ATOM   5235  O OE2 . GLU B 1 94  ? 32.826  -18.779 89.920  1.00 23.77 ? 94  GLU B OE2 1 
ATOM   5236  N N   . GLY B 1 95  ? 32.362  -23.602 94.903  1.00 15.48 ? 95  GLY B N   1 
ATOM   5237  C CA  . GLY B 1 95  ? 32.946  -24.084 96.153  1.00 15.80 ? 95  GLY B CA  1 
ATOM   5238  C C   . GLY B 1 95  ? 33.627  -23.001 96.957  1.00 15.59 ? 95  GLY B C   1 
ATOM   5239  O O   . GLY B 1 95  ? 34.732  -23.186 97.447  1.00 16.22 ? 95  GLY B O   1 
ATOM   5240  N N   . ARG B 1 96  ? 32.956  -21.864 97.127  1.00 15.44 ? 96  ARG B N   1 
ATOM   5241  C CA  . ARG B 1 96  ? 33.560  -20.729 97.820  1.00 14.75 ? 96  ARG B CA  1 
ATOM   5242  C C   . ARG B 1 96  ? 32.678  -20.182 98.923  1.00 13.69 ? 96  ARG B C   1 
ATOM   5243  O O   . ARG B 1 96  ? 31.451  -20.280 98.876  1.00 13.10 ? 96  ARG B O   1 
ATOM   5244  C CB  . ARG B 1 96  ? 33.823  -19.572 96.853  1.00 15.42 ? 96  ARG B CB  1 
ATOM   5245  C CG  . ARG B 1 96  ? 34.789  -19.867 95.715  1.00 16.72 ? 96  ARG B CG  1 
ATOM   5246  C CD  . ARG B 1 96  ? 35.117  -18.649 94.863  1.00 19.06 ? 96  ARG B CD  1 
ATOM   5247  N NE  . ARG B 1 96  ? 36.050  -18.983 93.793  1.00 21.36 ? 96  ARG B NE  1 
ATOM   5248  C CZ  . ARG B 1 96  ? 36.170  -18.318 92.654  1.00 23.58 ? 96  ARG B CZ  1 
ATOM   5249  N NH1 . ARG B 1 96  ? 37.059  -18.716 91.746  1.00 24.48 ? 96  ARG B NH1 1 
ATOM   5250  N NH2 . ARG B 1 96  ? 35.419  -17.254 92.413  1.00 22.24 ? 96  ARG B NH2 1 
ATOM   5251  N N   . ALA B 1 97  ? 33.325  -19.601 99.918  1.00 13.10 ? 97  ALA B N   1 
ATOM   5252  C CA  . ALA B 1 97  ? 32.619  -18.864 100.950 1.00 12.92 ? 97  ALA B CA  1 
ATOM   5253  C C   . ALA B 1 97  ? 32.179  -17.534 100.317 1.00 12.60 ? 97  ALA B C   1 
ATOM   5254  O O   . ALA B 1 97  ? 32.582  -17.198 99.190  1.00 12.03 ? 97  ALA B O   1 
ATOM   5255  C CB  . ALA B 1 97  ? 33.526  -18.631 102.143 1.00 12.82 ? 97  ALA B CB  1 
ATOM   5256  N N   . VAL B 1 98  ? 31.353  -16.793 101.047 1.00 12.97 ? 98  VAL B N   1 
ATOM   5257  C CA  . VAL B 1 98  ? 30.824  -15.491 100.605 1.00 12.25 ? 98  VAL B CA  1 
ATOM   5258  C C   . VAL B 1 98  ? 30.989  -14.588 101.822 1.00 11.98 ? 98  VAL B C   1 
ATOM   5259  O O   . VAL B 1 98  ? 30.201  -14.662 102.760 1.00 12.21 ? 98  VAL B O   1 
ATOM   5260  C CB  . VAL B 1 98  ? 29.361  -15.619 100.172 1.00 12.45 ? 98  VAL B CB  1 
ATOM   5261  C CG1 . VAL B 1 98  ? 28.744  -14.256 99.890  1.00 12.06 ? 98  VAL B CG1 1 
ATOM   5262  C CG2 . VAL B 1 98  ? 29.251  -16.552 98.929  1.00 12.19 ? 98  VAL B CG2 1 
ATOM   5263  N N   . LEU B 1 99  ? 32.025  -13.750 101.819 1.00 11.86 ? 99  LEU B N   1 
ATOM   5264  C CA  . LEU B 1 99  ? 32.420  -13.045 103.046 1.00 11.57 ? 99  LEU B CA  1 
ATOM   5265  C C   . LEU B 1 99  ? 32.745  -11.561 102.915 1.00 11.05 ? 99  LEU B C   1 
ATOM   5266  O O   . LEU B 1 99  ? 33.687  -11.047 103.528 1.00 11.01 ? 99  LEU B O   1 
ATOM   5267  C CB  . LEU B 1 99  ? 33.575  -13.792 103.742 1.00 11.44 ? 99  LEU B CB  1 
ATOM   5268  C CG  . LEU B 1 99  ? 33.208  -15.095 104.478 1.00 11.37 ? 99  LEU B CG  1 
ATOM   5269  C CD1 . LEU B 1 99  ? 34.464  -15.800 105.052 1.00 12.38 ? 99  LEU B CD1 1 
ATOM   5270  C CD2 . LEU B 1 99  ? 32.200  -14.843 105.591 1.00 11.15 ? 99  LEU B CD2 1 
ATOM   5271  N N   . HIS B 1 100 ? 31.925  -10.848 102.158 1.00 10.87 ? 100 HIS B N   1 
ATOM   5272  C CA  . HIS B 1 100 ? 32.063  -9.406  102.153 1.00 10.60 ? 100 HIS B CA  1 
ATOM   5273  C C   . HIS B 1 100 ? 31.755  -8.902  103.565 1.00 10.17 ? 100 HIS B C   1 
ATOM   5274  O O   . HIS B 1 100 ? 32.224  -7.844  103.955 1.00 10.48 ? 100 HIS B O   1 
ATOM   5275  C CB  . HIS B 1 100 ? 31.178  -8.728  101.094 1.00 9.91  ? 100 HIS B CB  1 
ATOM   5276  C CG  . HIS B 1 100 ? 29.829  -9.349  100.930 1.00 8.92  ? 100 HIS B CG  1 
ATOM   5277  N ND1 . HIS B 1 100 ? 29.615  -10.481 100.169 1.00 8.83  ? 100 HIS B ND1 1 
ATOM   5278  C CD2 . HIS B 1 100 ? 28.625  -9.012  101.448 1.00 11.08 ? 100 HIS B CD2 1 
ATOM   5279  C CE1 . HIS B 1 100 ? 28.334  -10.797 100.206 1.00 8.51  ? 100 HIS B CE1 1 
ATOM   5280  N NE2 . HIS B 1 100 ? 27.710  -9.921  100.980 1.00 9.73  ? 100 HIS B NE2 1 
ATOM   5281  N N   . VAL B 1 101 ? 30.992  -9.657  104.355 1.00 11.24 ? 101 VAL B N   1 
ATOM   5282  C CA  . VAL B 1 101 ? 30.706  -9.210  105.719 1.00 11.33 ? 101 VAL B CA  1 
ATOM   5283  C C   . VAL B 1 101 ? 32.005  -9.225  106.557 1.00 11.41 ? 101 VAL B C   1 
ATOM   5284  O O   . VAL B 1 101 ? 32.169  -8.449  107.523 1.00 11.57 ? 101 VAL B O   1 
ATOM   5285  C CB  . VAL B 1 101 ? 29.564  -10.014 106.414 1.00 11.05 ? 101 VAL B CB  1 
ATOM   5286  C CG1 . VAL B 1 101 ? 28.249  -9.877  105.672 1.00 12.58 ? 101 VAL B CG1 1 
ATOM   5287  C CG2 . VAL B 1 101 ? 29.934  -11.493 106.576 1.00 11.66 ? 101 VAL B CG2 1 
ATOM   5288  N N   . ALA B 1 102 ? 32.948  -10.084 106.185 1.00 11.28 ? 102 ALA B N   1 
ATOM   5289  C CA  . ALA B 1 102 ? 34.241  -10.115 106.880 1.00 10.74 ? 102 ALA B CA  1 
ATOM   5290  C C   . ALA B 1 102 ? 35.048  -8.853  106.615 1.00 11.01 ? 102 ALA B C   1 
ATOM   5291  O O   . ALA B 1 102 ? 35.760  -8.386  107.482 1.00 10.71 ? 102 ALA B O   1 
ATOM   5292  C CB  . ALA B 1 102 ? 35.044  -11.320 106.459 1.00 10.67 ? 102 ALA B CB  1 
ATOM   5293  N N   . LEU B 1 103 ? 34.948  -8.307  105.405 1.00 10.89 ? 103 LEU B N   1 
ATOM   5294  C CA  . LEU B 1 103 ? 35.702  -7.113  105.037 1.00 11.10 ? 103 LEU B CA  1 
ATOM   5295  C C   . LEU B 1 103 ? 35.445  -5.917  105.940 1.00 11.24 ? 103 LEU B C   1 
ATOM   5296  O O   . LEU B 1 103 ? 36.346  -5.098  106.168 1.00 11.49 ? 103 LEU B O   1 
ATOM   5297  C CB  . LEU B 1 103 ? 35.361  -6.717  103.594 1.00 11.04 ? 103 LEU B CB  1 
ATOM   5298  C CG  . LEU B 1 103 ? 35.664  -7.824  102.593 1.00 11.76 ? 103 LEU B CG  1 
ATOM   5299  C CD1 . LEU B 1 103 ? 35.095  -7.449  101.207 1.00 12.96 ? 103 LEU B CD1 1 
ATOM   5300  C CD2 . LEU B 1 103 ? 37.160  -8.057  102.522 1.00 13.16 ? 103 LEU B CD2 1 
ATOM   5301  N N   . ARG B 1 104 ? 34.215  -5.829  106.449 1.00 11.62 ? 104 ARG B N   1 
ATOM   5302  C CA  . ARG B 1 104 ? 33.771  -4.728  107.288 1.00 11.92 ? 104 ARG B CA  1 
ATOM   5303  C C   . ARG B 1 104 ? 33.435  -5.179  108.719 1.00 13.22 ? 104 ARG B C   1 
ATOM   5304  O O   . ARG B 1 104 ? 32.669  -4.506  109.428 1.00 12.34 ? 104 ARG B O   1 
ATOM   5305  C CB  . ARG B 1 104 ? 32.568  -4.000  106.647 1.00 11.49 ? 104 ARG B CB  1 
ATOM   5306  C CG  . ARG B 1 104 ? 31.290  -4.812  106.515 1.00 10.95 ? 104 ARG B CG  1 
ATOM   5307  C CD  . ARG B 1 104 ? 30.848  -5.093  105.088 1.00 9.56  ? 104 ARG B CD  1 
ATOM   5308  N NE  . ARG B 1 104 ? 29.512  -5.670  105.034 1.00 7.24  ? 104 ARG B NE  1 
ATOM   5309  C CZ  . ARG B 1 104 ? 28.803  -5.796  103.935 1.00 8.12  ? 104 ARG B CZ  1 
ATOM   5310  N NH1 . ARG B 1 104 ? 27.572  -6.306  103.990 1.00 7.55  ? 104 ARG B NH1 1 
ATOM   5311  N NH2 . ARG B 1 104 ? 29.311  -5.389  102.780 1.00 8.97  ? 104 ARG B NH2 1 
ATOM   5312  N N   . ASN B 1 105 ? 34.019  -6.316  109.123 1.00 13.76 ? 105 ASN B N   1 
ATOM   5313  C CA  . ASN B 1 105 ? 33.835  -6.866  110.459 1.00 14.85 ? 105 ASN B CA  1 
ATOM   5314  C C   . ASN B 1 105 ? 34.692  -6.084  111.452 1.00 15.75 ? 105 ASN B C   1 
ATOM   5315  O O   . ASN B 1 105 ? 35.749  -6.546  111.907 1.00 16.41 ? 105 ASN B O   1 
ATOM   5316  C CB  . ASN B 1 105 ? 34.187  -8.355  110.474 1.00 15.15 ? 105 ASN B CB  1 
ATOM   5317  C CG  . ASN B 1 105 ? 34.018  -8.993  111.852 1.00 16.25 ? 105 ASN B CG  1 
ATOM   5318  O OD1 . ASN B 1 105 ? 33.307  -8.462  112.727 1.00 14.83 ? 105 ASN B OD1 1 
ATOM   5319  N ND2 . ASN B 1 105 ? 34.713  -10.111 112.064 1.00 15.71 ? 105 ASN B ND2 1 
ATOM   5320  N N   . ARG B 1 106 ? 34.230  -4.883  111.777 1.00 15.92 ? 106 ARG B N   1 
ATOM   5321  C CA  . ARG B 1 106 ? 34.947  -3.990  112.682 1.00 16.52 ? 106 ARG B CA  1 
ATOM   5322  C C   . ARG B 1 106 ? 35.136  -4.591  114.076 1.00 17.17 ? 106 ARG B C   1 
ATOM   5323  O O   . ARG B 1 106 ? 36.099  -4.288  114.763 1.00 16.84 ? 106 ARG B O   1 
ATOM   5324  C CB  . ARG B 1 106 ? 34.190  -2.663  112.800 1.00 16.51 ? 106 ARG B CB  1 
ATOM   5325  C CG  . ARG B 1 106 ? 33.909  -1.979  111.454 1.00 16.28 ? 106 ARG B CG  1 
ATOM   5326  C CD  . ARG B 1 106 ? 35.133  -1.767  110.619 1.00 17.95 ? 106 ARG B CD  1 
ATOM   5327  N NE  . ARG B 1 106 ? 36.059  -0.829  111.225 1.00 18.08 ? 106 ARG B NE  1 
ATOM   5328  C CZ  . ARG B 1 106 ? 37.335  -0.737  110.904 1.00 21.15 ? 106 ARG B CZ  1 
ATOM   5329  N NH1 . ARG B 1 106 ? 38.109  0.158   111.502 1.00 19.79 ? 106 ARG B NH1 1 
ATOM   5330  N NH2 . ARG B 1 106 ? 37.855  -1.540  109.984 1.00 22.32 ? 106 ARG B NH2 1 
ATOM   5331  N N   . SER B 1 107 ? 34.207  -5.437  114.486 1.00 18.25 ? 107 SER B N   1 
ATOM   5332  C CA  . SER B 1 107 ? 34.289  -6.097  115.778 1.00 19.30 ? 107 SER B CA  1 
ATOM   5333  C C   . SER B 1 107 ? 35.418  -7.117  115.835 1.00 19.27 ? 107 SER B C   1 
ATOM   5334  O O   . SER B 1 107 ? 35.819  -7.530  116.915 1.00 19.33 ? 107 SER B O   1 
ATOM   5335  C CB  . SER B 1 107 ? 32.980  -6.794  116.079 1.00 19.48 ? 107 SER B CB  1 
ATOM   5336  O OG  . SER B 1 107 ? 32.990  -8.101  115.512 1.00 24.44 ? 107 SER B OG  1 
ATOM   5337  N N   . ASN B 1 108 ? 35.935  -7.521  114.679 1.00 19.26 ? 108 ASN B N   1 
ATOM   5338  C CA  . ASN B 1 108 ? 37.025  -8.479  114.610 1.00 19.47 ? 108 ASN B CA  1 
ATOM   5339  C C   . ASN B 1 108 ? 36.752  -9.866  115.205 1.00 19.72 ? 108 ASN B C   1 
ATOM   5340  O O   . ASN B 1 108 ? 37.681  -10.624 115.480 1.00 19.83 ? 108 ASN B O   1 
ATOM   5341  C CB  . ASN B 1 108 ? 38.291  -7.864  115.196 1.00 19.80 ? 108 ASN B CB  1 
ATOM   5342  C CG  . ASN B 1 108 ? 38.880  -6.804  114.287 1.00 20.53 ? 108 ASN B CG  1 
ATOM   5343  O OD1 . ASN B 1 108 ? 39.414  -5.793  114.751 1.00 22.06 ? 108 ASN B OD1 1 
ATOM   5344  N ND2 . ASN B 1 108 ? 38.787  -7.035  112.974 1.00 16.43 ? 108 ASN B ND2 1 
ATOM   5345  N N   . THR B 1 109 ? 35.483  -10.213 115.365 1.00 19.95 ? 109 THR B N   1 
ATOM   5346  C CA  . THR B 1 109 ? 35.107  -11.558 115.783 1.00 20.30 ? 109 THR B CA  1 
ATOM   5347  C C   . THR B 1 109 ? 35.630  -12.533 114.726 1.00 19.63 ? 109 THR B C   1 
ATOM   5348  O O   . THR B 1 109 ? 35.474  -12.290 113.540 1.00 19.19 ? 109 THR B O   1 
ATOM   5349  C CB  . THR B 1 109 ? 33.587  -11.654 115.879 1.00 20.42 ? 109 THR B CB  1 
ATOM   5350  O OG1 . THR B 1 109 ? 33.116  -10.738 116.883 1.00 23.03 ? 109 THR B OG1 1 
ATOM   5351  C CG2 . THR B 1 109 ? 33.159  -12.992 116.403 1.00 21.49 ? 109 THR B CG2 1 
ATOM   5352  N N   . PRO B 1 110 ? 36.296  -13.607 115.132 1.00 19.44 ? 110 PRO B N   1 
ATOM   5353  C CA  . PRO B 1 110 ? 36.858  -14.538 114.155 1.00 19.00 ? 110 PRO B CA  1 
ATOM   5354  C C   . PRO B 1 110 ? 35.832  -15.110 113.203 1.00 18.84 ? 110 PRO B C   1 
ATOM   5355  O O   . PRO B 1 110 ? 34.734  -15.464 113.608 1.00 17.72 ? 110 PRO B O   1 
ATOM   5356  C CB  . PRO B 1 110 ? 37.460  -15.649 115.023 1.00 19.41 ? 110 PRO B CB  1 
ATOM   5357  C CG  . PRO B 1 110 ? 37.771  -14.979 116.315 1.00 20.02 ? 110 PRO B CG  1 
ATOM   5358  C CD  . PRO B 1 110 ? 36.658  -13.972 116.517 1.00 19.64 ? 110 PRO B CD  1 
ATOM   5359  N N   . ILE B 1 111 ? 36.205  -15.151 111.929 1.00 18.71 ? 111 ILE B N   1 
ATOM   5360  C CA  . ILE B 1 111 ? 35.412  -15.794 110.892 1.00 18.91 ? 111 ILE B CA  1 
ATOM   5361  C C   . ILE B 1 111 ? 36.344  -16.788 110.206 1.00 18.76 ? 111 ILE B C   1 
ATOM   5362  O O   . ILE B 1 111 ? 37.311  -16.410 109.554 1.00 18.20 ? 111 ILE B O   1 
ATOM   5363  C CB  . ILE B 1 111 ? 34.833  -14.772 109.868 1.00 19.02 ? 111 ILE B CB  1 
ATOM   5364  C CG1 . ILE B 1 111 ? 33.918  -13.768 110.559 1.00 19.17 ? 111 ILE B CG1 1 
ATOM   5365  C CG2 . ILE B 1 111 ? 34.043  -15.502 108.811 1.00 19.14 ? 111 ILE B CG2 1 
ATOM   5366  C CD1 . ILE B 1 111 ? 33.489  -12.600 109.655 1.00 20.24 ? 111 ILE B CD1 1 
ATOM   5367  N N   . LEU B 1 112 ? 36.034  -18.066 110.353 1.00 19.36 ? 112 LEU B N   1 
ATOM   5368  C CA  . LEU B 1 112 ? 36.908  -19.115 109.858 1.00 20.13 ? 112 LEU B CA  1 
ATOM   5369  C C   . LEU B 1 112 ? 36.526  -19.652 108.486 1.00 20.76 ? 112 LEU B C   1 
ATOM   5370  O O   . LEU B 1 112 ? 35.348  -19.872 108.194 1.00 20.70 ? 112 LEU B O   1 
ATOM   5371  C CB  . LEU B 1 112 ? 36.928  -20.285 110.842 1.00 20.39 ? 112 LEU B CB  1 
ATOM   5372  C CG  . LEU B 1 112 ? 37.018  -19.936 112.335 1.00 21.26 ? 112 LEU B CG  1 
ATOM   5373  C CD1 . LEU B 1 112 ? 36.941  -21.210 113.190 1.00 23.55 ? 112 LEU B CD1 1 
ATOM   5374  C CD2 . LEU B 1 112 ? 38.269  -19.175 112.652 1.00 21.50 ? 112 LEU B CD2 1 
ATOM   5375  N N   . VAL B 1 113 ? 37.549  -19.862 107.664 1.00 21.07 ? 113 VAL B N   1 
ATOM   5376  C CA  . VAL B 1 113 ? 37.422  -20.537 106.390 1.00 21.90 ? 113 VAL B CA  1 
ATOM   5377  C C   . VAL B 1 113 ? 38.508  -21.611 106.312 1.00 22.50 ? 113 VAL B C   1 
ATOM   5378  O O   . VAL B 1 113 ? 39.685  -21.312 106.447 1.00 22.69 ? 113 VAL B O   1 
ATOM   5379  C CB  . VAL B 1 113 ? 37.588  -19.580 105.224 1.00 22.10 ? 113 VAL B CB  1 
ATOM   5380  C CG1 . VAL B 1 113 ? 37.700  -20.352 103.908 1.00 22.13 ? 113 VAL B CG1 1 
ATOM   5381  C CG2 . VAL B 1 113 ? 36.415  -18.596 105.190 1.00 21.14 ? 113 VAL B CG2 1 
ATOM   5382  N N   . ASP B 1 114 ? 38.099  -22.855 106.087 1.00 23.66 ? 114 ASP B N   1 
ATOM   5383  C CA  . ASP B 1 114 ? 39.028  -23.982 106.005 1.00 24.17 ? 114 ASP B CA  1 
ATOM   5384  C C   . ASP B 1 114 ? 39.979  -23.995 107.178 1.00 24.71 ? 114 ASP B C   1 
ATOM   5385  O O   . ASP B 1 114 ? 41.192  -24.157 106.987 1.00 25.09 ? 114 ASP B O   1 
ATOM   5386  C CB  . ASP B 1 114 ? 39.853  -23.943 104.715 1.00 24.49 ? 114 ASP B CB  1 
ATOM   5387  C CG  . ASP B 1 114 ? 39.003  -24.082 103.476 1.00 25.92 ? 114 ASP B CG  1 
ATOM   5388  O OD1 . ASP B 1 114 ? 39.390  -23.537 102.425 1.00 28.85 ? 114 ASP B OD1 1 
ATOM   5389  O OD2 . ASP B 1 114 ? 37.929  -24.703 103.465 1.00 26.26 ? 114 ASP B OD2 1 
ATOM   5390  N N   . GLY B 1 115 ? 39.431  -23.806 108.375 1.00 24.42 ? 115 GLY B N   1 
ATOM   5391  C CA  . GLY B 1 115 ? 40.220  -23.863 109.591 1.00 24.72 ? 115 GLY B CA  1 
ATOM   5392  C C   . GLY B 1 115 ? 41.025  -22.635 109.975 1.00 24.11 ? 115 GLY B C   1 
ATOM   5393  O O   . GLY B 1 115 ? 41.786  -22.694 110.940 1.00 24.89 ? 115 GLY B O   1 
ATOM   5394  N N   . LYS B 1 116 ? 40.874  -21.524 109.256 1.00 23.11 ? 116 LYS B N   1 
ATOM   5395  C CA  . LYS B 1 116 ? 41.668  -20.336 109.551 1.00 21.61 ? 116 LYS B CA  1 
ATOM   5396  C C   . LYS B 1 116 ? 40.829  -19.043 109.636 1.00 20.94 ? 116 LYS B C   1 
ATOM   5397  O O   . LYS B 1 116 ? 39.967  -18.782 108.793 1.00 19.87 ? 116 LYS B O   1 
ATOM   5398  C CB  . LYS B 1 116 ? 42.770  -20.177 108.503 1.00 21.63 ? 116 LYS B CB  1 
ATOM   5399  C CG  . LYS B 1 116 ? 43.767  -19.110 108.860 1.00 22.37 ? 116 LYS B CG  1 
ATOM   5400  C CD  . LYS B 1 116 ? 44.716  -18.801 107.732 1.00 23.52 ? 116 LYS B CD  1 
ATOM   5401  C CE  . LYS B 1 116 ? 45.835  -17.899 108.205 1.00 23.65 ? 116 LYS B CE  1 
ATOM   5402  N NZ  . LYS B 1 116 ? 46.547  -17.280 107.073 1.00 24.66 ? 116 LYS B NZ  1 
ATOM   5403  N N   . ASP B 1 117 ? 41.082  -18.248 110.671 1.00 19.60 ? 117 ASP B N   1 
ATOM   5404  C CA  . ASP B 1 117 ? 40.393  -16.973 110.829 1.00 19.05 ? 117 ASP B CA  1 
ATOM   5405  C C   . ASP B 1 117 ? 40.863  -16.052 109.719 1.00 18.55 ? 117 ASP B C   1 
ATOM   5406  O O   . ASP B 1 117 ? 42.068  -15.866 109.542 1.00 17.63 ? 117 ASP B O   1 
ATOM   5407  C CB  . ASP B 1 117 ? 40.763  -16.364 112.174 1.00 18.85 ? 117 ASP B CB  1 
ATOM   5408  C CG  . ASP B 1 117 ? 40.050  -15.059 112.447 1.00 18.92 ? 117 ASP B CG  1 
ATOM   5409  O OD1 . ASP B 1 117 ? 39.087  -14.707 111.698 1.00 16.45 ? 117 ASP B OD1 1 
ATOM   5410  O OD2 . ASP B 1 117 ? 40.390  -14.342 113.419 1.00 16.55 ? 117 ASP B OD2 1 
ATOM   5411  N N   . VAL B 1 118 ? 39.924  -15.455 108.980 1.00 17.75 ? 118 VAL B N   1 
ATOM   5412  C CA  . VAL B 1 118 ? 40.304  -14.557 107.886 1.00 17.57 ? 118 VAL B CA  1 
ATOM   5413  C C   . VAL B 1 118 ? 40.592  -13.120 108.329 1.00 16.48 ? 118 VAL B C   1 
ATOM   5414  O O   . VAL B 1 118 ? 41.181  -12.341 107.579 1.00 15.05 ? 118 VAL B O   1 
ATOM   5415  C CB  . VAL B 1 118 ? 39.222  -14.520 106.755 1.00 17.51 ? 118 VAL B CB  1 
ATOM   5416  C CG1 . VAL B 1 118 ? 38.980  -15.918 106.190 1.00 18.28 ? 118 VAL B CG1 1 
ATOM   5417  C CG2 . VAL B 1 118 ? 37.921  -13.905 107.268 1.00 18.55 ? 118 VAL B CG2 1 
ATOM   5418  N N   . MET B 1 119 ? 40.212  -12.770 109.556 1.00 16.61 ? 119 MET B N   1 
ATOM   5419  C CA  . MET B 1 119 ? 40.305  -11.380 110.011 1.00 16.19 ? 119 MET B CA  1 
ATOM   5420  C C   . MET B 1 119 ? 41.708  -10.774 110.060 1.00 16.83 ? 119 MET B C   1 
ATOM   5421  O O   . MET B 1 119 ? 41.892  -9.620  109.659 1.00 17.58 ? 119 MET B O   1 
ATOM   5422  C CB  . MET B 1 119 ? 39.563  -11.197 111.340 1.00 16.25 ? 119 MET B CB  1 
ATOM   5423  C CG  . MET B 1 119 ? 38.048  -11.390 111.211 1.00 15.99 ? 119 MET B CG  1 
ATOM   5424  S SD  . MET B 1 119 ? 37.283  -10.469 109.805 1.00 14.15 ? 119 MET B SD  1 
ATOM   5425  C CE  . MET B 1 119 ? 37.878  -8.824  110.136 1.00 11.52 ? 119 MET B CE  1 
ATOM   5426  N N   . PRO B 1 120 ? 42.709  -11.516 110.527 1.00 16.83 ? 120 PRO B N   1 
ATOM   5427  C CA  . PRO B 1 120 ? 44.084  -11.007 110.485 1.00 16.55 ? 120 PRO B CA  1 
ATOM   5428  C C   . PRO B 1 120 ? 44.509  -10.569 109.083 1.00 16.02 ? 120 PRO B C   1 
ATOM   5429  O O   . PRO B 1 120 ? 45.113  -9.517  108.939 1.00 14.65 ? 120 PRO B O   1 
ATOM   5430  C CB  . PRO B 1 120 ? 44.915  -12.207 110.976 1.00 16.83 ? 120 PRO B CB  1 
ATOM   5431  C CG  . PRO B 1 120 ? 43.985  -12.926 111.869 1.00 17.26 ? 120 PRO B CG  1 
ATOM   5432  C CD  . PRO B 1 120 ? 42.628  -12.829 111.193 1.00 16.94 ? 120 PRO B CD  1 
ATOM   5433  N N   . GLU B 1 121 ? 44.208  -11.349 108.058 1.00 15.99 ? 121 GLU B N   1 
ATOM   5434  C CA  . GLU B 1 121 ? 44.595  -10.917 106.718 1.00 17.44 ? 121 GLU B CA  1 
ATOM   5435  C C   . GLU B 1 121 ? 43.725  -9.733  106.246 1.00 16.54 ? 121 GLU B C   1 
ATOM   5436  O O   . GLU B 1 121 ? 44.219  -8.827  105.583 1.00 16.37 ? 121 GLU B O   1 
ATOM   5437  C CB  . GLU B 1 121 ? 44.548  -12.076 105.722 1.00 18.28 ? 121 GLU B CB  1 
ATOM   5438  C CG  . GLU B 1 121 ? 45.909  -12.721 105.492 1.00 23.47 ? 121 GLU B CG  1 
ATOM   5439  C CD  . GLU B 1 121 ? 46.987  -11.699 105.139 1.00 28.91 ? 121 GLU B CD  1 
ATOM   5440  O OE1 . GLU B 1 121 ? 46.686  -10.725 104.381 1.00 33.61 ? 121 GLU B OE1 1 
ATOM   5441  O OE2 . GLU B 1 121 ? 48.126  -11.859 105.630 1.00 30.91 ? 121 GLU B OE2 1 
ATOM   5442  N N   . VAL B 1 122 ? 42.436  -9.750  106.580 1.00 15.90 ? 122 VAL B N   1 
ATOM   5443  C CA  . VAL B 1 122 ? 41.579  -8.622  106.231 1.00 15.60 ? 122 VAL B CA  1 
ATOM   5444  C C   . VAL B 1 122 ? 42.206  -7.362  106.821 1.00 15.62 ? 122 VAL B C   1 
ATOM   5445  O O   . VAL B 1 122 ? 42.389  -6.345  106.139 1.00 14.86 ? 122 VAL B O   1 
ATOM   5446  C CB  . VAL B 1 122 ? 40.132  -8.805  106.757 1.00 15.25 ? 122 VAL B CB  1 
ATOM   5447  C CG1 . VAL B 1 122 ? 39.358  -7.479  106.720 1.00 15.74 ? 122 VAL B CG1 1 
ATOM   5448  C CG2 . VAL B 1 122 ? 39.397  -9.865  105.961 1.00 16.29 ? 122 VAL B CG2 1 
ATOM   5449  N N   . ASN B 1 123 ? 42.562  -7.429  108.108 1.00 15.59 ? 123 ASN B N   1 
ATOM   5450  C CA  . ASN B 1 123 ? 43.113  -6.257  108.788 1.00 15.36 ? 123 ASN B CA  1 
ATOM   5451  C C   . ASN B 1 123 ? 44.519  -5.848  108.314 1.00 15.24 ? 123 ASN B C   1 
ATOM   5452  O O   . ASN B 1 123 ? 44.851  -4.658  108.309 1.00 14.44 ? 123 ASN B O   1 
ATOM   5453  C CB  . ASN B 1 123 ? 43.076  -6.457  110.313 1.00 15.93 ? 123 ASN B CB  1 
ATOM   5454  C CG  . ASN B 1 123 ? 41.667  -6.376  110.872 1.00 16.81 ? 123 ASN B CG  1 
ATOM   5455  O OD1 . ASN B 1 123 ? 40.861  -5.557  110.426 1.00 18.25 ? 123 ASN B OD1 1 
ATOM   5456  N ND2 . ASN B 1 123 ? 41.359  -7.234  111.848 1.00 16.52 ? 123 ASN B ND2 1 
ATOM   5457  N N   . LYS B 1 124 ? 45.338  -6.820  107.911 1.00 14.71 ? 124 LYS B N   1 
ATOM   5458  C CA  . LYS B 1 124 ? 46.659  -6.508  107.385 1.00 14.95 ? 124 LYS B CA  1 
ATOM   5459  C C   . LYS B 1 124 ? 46.512  -5.652  106.132 1.00 14.41 ? 124 LYS B C   1 
ATOM   5460  O O   . LYS B 1 124 ? 47.222  -4.665  105.929 1.00 13.73 ? 124 LYS B O   1 
ATOM   5461  C CB  . LYS B 1 124 ? 47.419  -7.800  107.054 1.00 15.25 ? 124 LYS B CB  1 
ATOM   5462  C CG  . LYS B 1 124 ? 48.786  -7.575  106.449 1.00 18.49 ? 124 LYS B CG  1 
ATOM   5463  C CD  . LYS B 1 124 ? 49.595  -8.844  106.360 1.00 22.23 ? 124 LYS B CD  1 
ATOM   5464  C CE  . LYS B 1 124 ? 51.005  -8.559  105.872 1.00 25.20 ? 124 LYS B CE  1 
ATOM   5465  N NZ  . LYS B 1 124 ? 51.708  -9.841  105.573 1.00 27.55 ? 124 LYS B NZ  1 
ATOM   5466  N N   . VAL B 1 125 ? 45.591  -6.033  105.264 1.00 14.34 ? 125 VAL B N   1 
ATOM   5467  C CA  . VAL B 1 125 ? 45.406  -5.249  104.045 1.00 13.92 ? 125 VAL B CA  1 
ATOM   5468  C C   . VAL B 1 125 ? 44.870  -3.874  104.367 1.00 13.62 ? 125 VAL B C   1 
ATOM   5469  O O   . VAL B 1 125 ? 45.344  -2.871  103.824 1.00 14.63 ? 125 VAL B O   1 
ATOM   5470  C CB  . VAL B 1 125 ? 44.480  -5.958  103.048 1.00 14.14 ? 125 VAL B CB  1 
ATOM   5471  C CG1 . VAL B 1 125 ? 44.205  -5.050  101.850 1.00 13.54 ? 125 VAL B CG1 1 
ATOM   5472  C CG2 . VAL B 1 125 ? 45.097  -7.275  102.594 1.00 13.97 ? 125 VAL B CG2 1 
ATOM   5473  N N   . LEU B 1 126 ? 43.891  -3.798  105.260 1.00 13.37 ? 126 LEU B N   1 
ATOM   5474  C CA  . LEU B 1 126 ? 43.369  -2.498  105.645 1.00 13.68 ? 126 LEU B CA  1 
ATOM   5475  C C   . LEU B 1 126 ? 44.476  -1.607  106.202 1.00 14.56 ? 126 LEU B C   1 
ATOM   5476  O O   . LEU B 1 126 ? 44.537  -0.407  105.914 1.00 13.59 ? 126 LEU B O   1 
ATOM   5477  C CB  . LEU B 1 126 ? 42.230  -2.649  106.667 1.00 13.65 ? 126 LEU B CB  1 
ATOM   5478  C CG  . LEU B 1 126 ? 40.905  -3.127  106.072 1.00 12.30 ? 126 LEU B CG  1 
ATOM   5479  C CD1 . LEU B 1 126 ? 39.985  -3.595  107.192 1.00 13.66 ? 126 LEU B CD1 1 
ATOM   5480  C CD2 . LEU B 1 126 ? 40.243  -2.027  105.242 1.00 13.50 ? 126 LEU B CD2 1 
ATOM   5481  N N   . ASP B 1 127 ? 45.360  -2.196  107.013 1.00 15.38 ? 127 ASP B N   1 
ATOM   5482  C CA  . ASP B 1 127 ? 46.458  -1.433  107.585 1.00 15.85 ? 127 ASP B CA  1 
ATOM   5483  C C   . ASP B 1 127 ? 47.366  -0.900  106.488 1.00 15.37 ? 127 ASP B C   1 
ATOM   5484  O O   . ASP B 1 127 ? 47.798  0.246   106.540 1.00 15.30 ? 127 ASP B O   1 
ATOM   5485  C CB  . ASP B 1 127 ? 47.248  -2.271  108.591 1.00 16.49 ? 127 ASP B CB  1 
ATOM   5486  C CG  . ASP B 1 127 ? 46.518  -2.434  109.910 1.00 19.92 ? 127 ASP B CG  1 
ATOM   5487  O OD1 . ASP B 1 127 ? 45.638  -1.609  110.225 1.00 21.93 ? 127 ASP B OD1 1 
ATOM   5488  O OD2 . ASP B 1 127 ? 46.758  -3.360  110.706 1.00 26.59 ? 127 ASP B OD2 1 
ATOM   5489  N N   . LYS B 1 128 ? 47.627  -1.723  105.485 1.00 15.29 ? 128 LYS B N   1 
ATOM   5490  C CA  . LYS B 1 128 ? 48.421  -1.304  104.354 1.00 15.50 ? 128 LYS B CA  1 
ATOM   5491  C C   . LYS B 1 128 ? 47.721  -0.177  103.592 1.00 14.92 ? 128 LYS B C   1 
ATOM   5492  O O   . LYS B 1 128 ? 48.365  0.790   103.179 1.00 15.03 ? 128 LYS B O   1 
ATOM   5493  C CB  . LYS B 1 128 ? 48.686  -2.482  103.415 1.00 15.87 ? 128 LYS B CB  1 
ATOM   5494  C CG  . LYS B 1 128 ? 49.664  -2.124  102.322 1.00 18.68 ? 128 LYS B CG  1 
ATOM   5495  C CD  . LYS B 1 128 ? 49.614  -3.093  101.139 1.00 21.69 ? 128 LYS B CD  1 
ATOM   5496  C CE  . LYS B 1 128 ? 50.408  -4.344  101.390 1.00 22.82 ? 128 LYS B CE  1 
ATOM   5497  N NZ  . LYS B 1 128 ? 51.857  -4.014  101.638 1.00 23.94 ? 128 LYS B NZ  1 
ATOM   5498  N N   . MET B 1 129 ? 46.413  -0.299  103.403 1.00 14.54 ? 129 MET B N   1 
ATOM   5499  C CA  . MET B 1 129 ? 45.657  0.758   102.722 1.00 14.92 ? 129 MET B CA  1 
ATOM   5500  C C   . MET B 1 129 ? 45.802  2.073   103.484 1.00 14.96 ? 129 MET B C   1 
ATOM   5501  O O   . MET B 1 129 ? 46.101  3.106   102.908 1.00 14.44 ? 129 MET B O   1 
ATOM   5502  C CB  . MET B 1 129 ? 44.169  0.374   102.615 1.00 15.01 ? 129 MET B CB  1 
ATOM   5503  C CG  . MET B 1 129 ? 43.913  -0.781  101.671 1.00 15.35 ? 129 MET B CG  1 
ATOM   5504  S SD  . MET B 1 129 ? 42.240  -1.503  101.754 1.00 13.89 ? 129 MET B SD  1 
ATOM   5505  C CE  . MET B 1 129 ? 41.275  -0.215  100.866 1.00 15.11 ? 129 MET B CE  1 
ATOM   5506  N N   . LYS B 1 130 ? 45.598  2.025   104.794 1.00 15.64 ? 130 LYS B N   1 
ATOM   5507  C CA  . LYS B 1 130 ? 45.711  3.218   105.622 1.00 16.14 ? 130 LYS B CA  1 
ATOM   5508  C C   . LYS B 1 130 ? 47.078  3.919   105.471 1.00 15.86 ? 130 LYS B C   1 
ATOM   5509  O O   . LYS B 1 130 ? 47.153  5.135   105.277 1.00 14.91 ? 130 LYS B O   1 
ATOM   5510  C CB  . LYS B 1 130 ? 45.447  2.840   107.079 1.00 16.51 ? 130 LYS B CB  1 
ATOM   5511  C CG  . LYS B 1 130 ? 45.448  4.026   108.047 1.00 18.61 ? 130 LYS B CG  1 
ATOM   5512  C CD  . LYS B 1 130 ? 45.033  3.594   109.444 1.00 21.96 ? 130 LYS B CD  1 
ATOM   5513  C CE  . LYS B 1 130 ? 44.907  4.785   110.388 1.00 23.95 ? 130 LYS B CE  1 
ATOM   5514  N NZ  . LYS B 1 130 ? 44.467  4.357   111.763 1.00 26.54 ? 130 LYS B NZ  1 
ATOM   5515  N N   . SER B 1 131 ? 48.158  3.161   105.583 1.00 16.67 ? 131 SER B N   1 
ATOM   5516  C CA  . SER B 1 131 ? 49.507  3.727   105.457 1.00 17.11 ? 131 SER B CA  1 
ATOM   5517  C C   . SER B 1 131 ? 49.694  4.371   104.099 1.00 16.77 ? 131 SER B C   1 
ATOM   5518  O O   . SER B 1 131 ? 50.149  5.508   104.017 1.00 16.41 ? 131 SER B O   1 
ATOM   5519  C CB  . SER B 1 131 ? 50.584  2.664   105.676 1.00 18.06 ? 131 SER B CB  1 
ATOM   5520  O OG  . SER B 1 131 ? 51.841  3.114   105.176 1.00 20.65 ? 131 SER B OG  1 
ATOM   5521  N N   . PHE B 1 132 ? 49.317  3.655   103.040 1.00 16.47 ? 132 PHE B N   1 
ATOM   5522  C CA  . PHE B 1 132 ? 49.424  4.190   101.691 1.00 16.09 ? 132 PHE B CA  1 
ATOM   5523  C C   . PHE B 1 132 ? 48.638  5.497   101.536 1.00 15.93 ? 132 PHE B C   1 
ATOM   5524  O O   . PHE B 1 132 ? 49.160  6.460   100.993 1.00 16.21 ? 132 PHE B O   1 
ATOM   5525  C CB  . PHE B 1 132 ? 48.936  3.176   100.658 1.00 16.01 ? 132 PHE B CB  1 
ATOM   5526  C CG  . PHE B 1 132 ? 49.204  3.578   99.247  1.00 15.45 ? 132 PHE B CG  1 
ATOM   5527  C CD1 . PHE B 1 132 ? 50.496  3.614   98.750  1.00 16.77 ? 132 PHE B CD1 1 
ATOM   5528  C CD2 . PHE B 1 132 ? 48.168  3.927   98.405  1.00 15.79 ? 132 PHE B CD2 1 
ATOM   5529  C CE1 . PHE B 1 132 ? 50.736  3.979   97.434  1.00 15.20 ? 132 PHE B CE1 1 
ATOM   5530  C CE2 . PHE B 1 132 ? 48.401  4.280   97.086  1.00 14.38 ? 132 PHE B CE2 1 
ATOM   5531  C CZ  . PHE B 1 132 ? 49.680  4.315   96.600  1.00 15.91 ? 132 PHE B CZ  1 
ATOM   5532  N N   . CYS B 1 133 ? 47.388  5.528   101.997 1.00 15.61 ? 133 CYS B N   1 
ATOM   5533  C CA  . CYS B 1 133 ? 46.583  6.745   101.871 1.00 15.72 ? 133 CYS B CA  1 
ATOM   5534  C C   . CYS B 1 133 ? 47.224  7.908   102.611 1.00 15.84 ? 133 CYS B C   1 
ATOM   5535  O O   . CYS B 1 133 ? 47.194  9.045   102.150 1.00 15.59 ? 133 CYS B O   1 
ATOM   5536  C CB  . CYS B 1 133 ? 45.161  6.537   102.402 1.00 15.89 ? 133 CYS B CB  1 
ATOM   5537  S SG  . CYS B 1 133 ? 44.161  5.448   101.360 1.00 16.19 ? 133 CYS B SG  1 
ATOM   5538  N N   . GLN B 1 134 ? 47.770  7.642   103.782 1.00 16.47 ? 134 GLN B N   1 
ATOM   5539  C CA  . GLN B 1 134 ? 48.391  8.722   104.539 1.00 17.60 ? 134 GLN B CA  1 
ATOM   5540  C C   . GLN B 1 134 ? 49.579  9.273   103.759 1.00 17.33 ? 134 GLN B C   1 
ATOM   5541  O O   . GLN B 1 134 ? 49.725  10.486  103.606 1.00 17.57 ? 134 GLN B O   1 
ATOM   5542  C CB  . GLN B 1 134 ? 48.801  8.264   105.933 1.00 17.91 ? 134 GLN B CB  1 
ATOM   5543  C CG  . GLN B 1 134 ? 49.217  9.428   106.834 1.00 21.46 ? 134 GLN B CG  1 
ATOM   5544  C CD  . GLN B 1 134 ? 50.589  9.981   106.500 1.00 24.47 ? 134 GLN B CD  1 
ATOM   5545  O OE1 . GLN B 1 134 ? 51.473  9.244   106.040 1.00 26.17 ? 134 GLN B OE1 1 
ATOM   5546  N NE2 . GLN B 1 134 ? 50.777  11.278  106.738 1.00 26.13 ? 134 GLN B NE2 1 
ATOM   5547  N N   . ARG B 1 135 ? 50.405  8.378   103.228 1.00 17.15 ? 135 ARG B N   1 
ATOM   5548  C CA  . ARG B 1 135 ? 51.570  8.798   102.453 1.00 17.49 ? 135 ARG B CA  1 
ATOM   5549  C C   . ARG B 1 135 ? 51.167  9.595   101.212 1.00 16.26 ? 135 ARG B C   1 
ATOM   5550  O O   . ARG B 1 135 ? 51.744  10.649  100.938 1.00 15.51 ? 135 ARG B O   1 
ATOM   5551  C CB  . ARG B 1 135 ? 52.404  7.588   102.042 1.00 17.95 ? 135 ARG B CB  1 
ATOM   5552  C CG  . ARG B 1 135 ? 53.104  6.908   103.209 1.00 20.56 ? 135 ARG B CG  1 
ATOM   5553  C CD  . ARG B 1 135 ? 53.759  5.588   102.844 1.00 24.61 ? 135 ARG B CD  1 
ATOM   5554  N NE  . ARG B 1 135 ? 54.982  5.758   102.054 1.00 27.35 ? 135 ARG B NE  1 
ATOM   5555  C CZ  . ARG B 1 135 ? 55.511  4.814   101.270 1.00 29.56 ? 135 ARG B CZ  1 
ATOM   5556  N NH1 . ARG B 1 135 ? 54.919  3.629   101.134 1.00 30.00 ? 135 ARG B NH1 1 
ATOM   5557  N NH2 . ARG B 1 135 ? 56.634  5.054   100.600 1.00 30.85 ? 135 ARG B NH2 1 
ATOM   5558  N N   . VAL B 1 136 ? 50.181  9.099   100.461 1.00 15.25 ? 136 VAL B N   1 
ATOM   5559  C CA  . VAL B 1 136 ? 49.756  9.800   99.242  1.00 15.04 ? 136 VAL B CA  1 
ATOM   5560  C C   . VAL B 1 136 ? 49.094  11.154  99.547  1.00 15.12 ? 136 VAL B C   1 
ATOM   5561  O O   . VAL B 1 136 ? 49.460  12.176  98.973  1.00 14.20 ? 136 VAL B O   1 
ATOM   5562  C CB  . VAL B 1 136 ? 48.779  8.961   98.413  1.00 14.83 ? 136 VAL B CB  1 
ATOM   5563  C CG1 . VAL B 1 136 ? 48.305  9.752   97.215  1.00 15.40 ? 136 VAL B CG1 1 
ATOM   5564  C CG2 . VAL B 1 136 ? 49.441  7.668   97.964  1.00 15.11 ? 136 VAL B CG2 1 
ATOM   5565  N N   . ARG B 1 137 ? 48.100  11.148  100.431 1.00 15.36 ? 137 ARG B N   1 
ATOM   5566  C CA  . ARG B 1 137 ? 47.335  12.363  100.723 1.00 15.81 ? 137 ARG B CA  1 
ATOM   5567  C C   . ARG B 1 137 ? 48.173  13.458  101.376 1.00 16.85 ? 137 ARG B C   1 
ATOM   5568  O O   . ARG B 1 137 ? 47.982  14.636  101.078 1.00 17.63 ? 137 ARG B O   1 
ATOM   5569  C CB  . ARG B 1 137 ? 46.117  12.046  101.604 1.00 15.78 ? 137 ARG B CB  1 
ATOM   5570  C CG  . ARG B 1 137 ? 45.035  11.250  100.886 1.00 14.11 ? 137 ARG B CG  1 
ATOM   5571  C CD  . ARG B 1 137 ? 43.999  10.619  101.787 1.00 14.09 ? 137 ARG B CD  1 
ATOM   5572  N NE  . ARG B 1 137 ? 43.353  11.575  102.684 1.00 14.87 ? 137 ARG B NE  1 
ATOM   5573  C CZ  . ARG B 1 137 ? 42.285  12.311  102.374 1.00 16.90 ? 137 ARG B CZ  1 
ATOM   5574  N NH1 . ARG B 1 137 ? 41.716  12.220  101.181 1.00 17.12 ? 137 ARG B NH1 1 
ATOM   5575  N NH2 . ARG B 1 137 ? 41.774  13.142  103.278 1.00 18.31 ? 137 ARG B NH2 1 
ATOM   5576  N N   . SER B 1 138 ? 49.087  13.071  102.263 1.00 17.66 ? 138 SER B N   1 
ATOM   5577  C CA  . SER B 1 138 ? 49.963  14.031  102.954 1.00 18.61 ? 138 SER B CA  1 
ATOM   5578  C C   . SER B 1 138 ? 51.002  14.692  102.033 1.00 19.86 ? 138 SER B C   1 
ATOM   5579  O O   . SER B 1 138 ? 51.583  15.724  102.383 1.00 20.32 ? 138 SER B O   1 
ATOM   5580  C CB  . SER B 1 138 ? 50.698  13.334  104.091 1.00 18.80 ? 138 SER B CB  1 
ATOM   5581  O OG  . SER B 1 138 ? 51.743  12.504  103.600 1.00 18.58 ? 138 SER B OG  1 
ATOM   5582  N N   . GLY B 1 139 ? 51.244  14.108  100.862 1.00 19.90 ? 139 GLY B N   1 
ATOM   5583  C CA  . GLY B 1 139 ? 52.274  14.629  99.982  1.00 20.77 ? 139 GLY B CA  1 
ATOM   5584  C C   . GLY B 1 139 ? 53.622  13.934  100.161 1.00 21.27 ? 139 GLY B C   1 
ATOM   5585  O O   . GLY B 1 139 ? 54.560  14.231  99.425  1.00 21.61 ? 139 GLY B O   1 
ATOM   5586  N N   . ASP B 1 140 ? 53.702  13.011  101.118 1.00 21.79 ? 140 ASP B N   1 
ATOM   5587  C CA  . ASP B 1 140 ? 54.902  12.227  101.389 1.00 22.83 ? 140 ASP B CA  1 
ATOM   5588  C C   . ASP B 1 140 ? 55.327  11.375  100.193 1.00 22.25 ? 140 ASP B C   1 
ATOM   5589  O O   . ASP B 1 140 ? 56.516  11.249  99.901  1.00 21.44 ? 140 ASP B O   1 
ATOM   5590  C CB  . ASP B 1 140 ? 54.650  11.303  102.576 1.00 23.76 ? 140 ASP B CB  1 
ATOM   5591  C CG  . ASP B 1 140 ? 55.845  10.430  102.909 1.00 28.18 ? 140 ASP B CG  1 
ATOM   5592  O OD1 . ASP B 1 140 ? 55.745  9.602   103.848 1.00 35.30 ? 140 ASP B OD1 1 
ATOM   5593  O OD2 . ASP B 1 140 ? 56.927  10.477  102.285 1.00 35.19 ? 140 ASP B OD2 1 
ATOM   5594  N N   . TRP B 1 141 ? 54.348  10.766  99.530  1.00 20.95 ? 141 TRP B N   1 
ATOM   5595  C CA  . TRP B 1 141 ? 54.612  9.935   98.371  1.00 20.39 ? 141 TRP B CA  1 
ATOM   5596  C C   . TRP B 1 141 ? 54.885  10.809  97.156  1.00 20.46 ? 141 TRP B C   1 
ATOM   5597  O O   . TRP B 1 141 ? 54.010  11.533  96.696  1.00 20.46 ? 141 TRP B O   1 
ATOM   5598  C CB  . TRP B 1 141 ? 53.415  9.021   98.096  1.00 20.22 ? 141 TRP B CB  1 
ATOM   5599  C CG  . TRP B 1 141 ? 53.628  8.091   96.937  1.00 18.67 ? 141 TRP B CG  1 
ATOM   5600  C CD1 . TRP B 1 141 ? 53.647  8.418   95.617  1.00 17.89 ? 141 TRP B CD1 1 
ATOM   5601  C CD2 . TRP B 1 141 ? 53.836  6.674   97.003  1.00 17.63 ? 141 TRP B CD2 1 
ATOM   5602  N NE1 . TRP B 1 141 ? 53.863  7.295   94.857  1.00 18.49 ? 141 TRP B NE1 1 
ATOM   5603  C CE2 . TRP B 1 141 ? 53.988  6.210   95.681  1.00 18.42 ? 141 TRP B CE2 1 
ATOM   5604  C CE3 . TRP B 1 141 ? 53.920  5.751   98.047  1.00 18.76 ? 141 TRP B CE3 1 
ATOM   5605  C CZ2 . TRP B 1 141 ? 54.209  4.861   95.376  1.00 18.61 ? 141 TRP B CZ2 1 
ATOM   5606  C CZ3 . TRP B 1 141 ? 54.149  4.411   97.747  1.00 19.95 ? 141 TRP B CZ3 1 
ATOM   5607  C CH2 . TRP B 1 141 ? 54.291  3.980   96.416  1.00 18.16 ? 141 TRP B CH2 1 
ATOM   5608  N N   . LYS B 1 142 ? 56.088  10.715  96.606  1.00 20.66 ? 142 LYS B N   1 
ATOM   5609  C CA  . LYS B 1 142 ? 56.464  11.567  95.479  1.00 20.66 ? 142 LYS B CA  1 
ATOM   5610  C C   . LYS B 1 142 ? 56.456  10.859  94.136  1.00 20.42 ? 142 LYS B C   1 
ATOM   5611  O O   . LYS B 1 142 ? 56.766  9.682   94.046  1.00 20.24 ? 142 LYS B O   1 
ATOM   5612  C CB  . LYS B 1 142 ? 57.868  12.126  95.692  1.00 21.06 ? 142 LYS B CB  1 
ATOM   5613  C CG  . LYS B 1 142 ? 58.101  12.743  97.046  1.00 21.58 ? 142 LYS B CG  1 
ATOM   5614  C CD  . LYS B 1 142 ? 57.227  13.946  97.259  1.00 22.56 ? 142 LYS B CD  1 
ATOM   5615  C CE  . LYS B 1 142 ? 57.553  14.639  98.587  1.00 22.89 ? 142 LYS B CE  1 
ATOM   5616  N NZ  . LYS B 1 142 ? 56.879  15.949  98.624  1.00 23.83 ? 142 LYS B NZ  1 
ATOM   5617  N N   . GLY B 1 143 ? 56.131  11.609  93.090  1.00 19.82 ? 143 GLY B N   1 
ATOM   5618  C CA  . GLY B 1 143 ? 56.208  11.101  91.735  1.00 20.15 ? 143 GLY B CA  1 
ATOM   5619  C C   . GLY B 1 143 ? 57.666  11.078  91.297  1.00 19.66 ? 143 GLY B C   1 
ATOM   5620  O O   . GLY B 1 143 ? 58.541  11.478  92.057  1.00 19.34 ? 143 GLY B O   1 
ATOM   5621  N N   . TYR B 1 144 ? 57.915  10.628  90.073  1.00 19.35 ? 144 TYR B N   1 
ATOM   5622  C CA  . TYR B 1 144 ? 59.272  10.460  89.556  1.00 19.25 ? 144 TYR B CA  1 
ATOM   5623  C C   . TYR B 1 144 ? 60.088  11.751  89.448  1.00 19.62 ? 144 TYR B C   1 
ATOM   5624  O O   . TYR B 1 144 ? 61.317  11.688  89.385  1.00 19.31 ? 144 TYR B O   1 
ATOM   5625  C CB  . TYR B 1 144 ? 59.266  9.705   88.214  1.00 19.33 ? 144 TYR B CB  1 
ATOM   5626  C CG  . TYR B 1 144 ? 58.857  10.490  86.991  1.00 18.33 ? 144 TYR B CG  1 
ATOM   5627  C CD1 . TYR B 1 144 ? 59.818  10.993  86.117  1.00 18.31 ? 144 TYR B CD1 1 
ATOM   5628  C CD2 . TYR B 1 144 ? 57.514  10.655  86.653  1.00 17.62 ? 144 TYR B CD2 1 
ATOM   5629  C CE1 . TYR B 1 144 ? 59.468  11.672  84.977  1.00 17.89 ? 144 TYR B CE1 1 
ATOM   5630  C CE2 . TYR B 1 144 ? 57.155  11.333  85.520  1.00 17.57 ? 144 TYR B CE2 1 
ATOM   5631  C CZ  . TYR B 1 144 ? 58.139  11.838  84.677  1.00 17.93 ? 144 TYR B CZ  1 
ATOM   5632  O OH  . TYR B 1 144 ? 57.800  12.525  83.554  1.00 19.23 ? 144 TYR B OH  1 
ATOM   5633  N N   . THR B 1 145 ? 59.431  12.907  89.406  1.00 19.41 ? 145 THR B N   1 
ATOM   5634  C CA  . THR B 1 145 ? 60.166  14.170  89.418  1.00 19.64 ? 145 THR B CA  1 
ATOM   5635  C C   . THR B 1 145 ? 60.034  14.875  90.756  1.00 20.03 ? 145 THR B C   1 
ATOM   5636  O O   . THR B 1 145 ? 60.296  16.079  90.844  1.00 20.75 ? 145 THR B O   1 
ATOM   5637  C CB  . THR B 1 145 ? 59.698  15.138  88.340  1.00 19.74 ? 145 THR B CB  1 
ATOM   5638  O OG1 . THR B 1 145 ? 58.366  15.581  88.631  1.00 19.39 ? 145 THR B OG1 1 
ATOM   5639  C CG2 . THR B 1 145 ? 59.633  14.485  86.977  1.00 19.15 ? 145 THR B CG2 1 
ATOM   5640  N N   . GLY B 1 146 ? 59.610  14.145  91.784  1.00 20.14 ? 146 GLY B N   1 
ATOM   5641  C CA  . GLY B 1 146 ? 59.504  14.693  93.124  1.00 20.30 ? 146 GLY B CA  1 
ATOM   5642  C C   . GLY B 1 146 ? 58.271  15.517  93.472  1.00 20.41 ? 146 GLY B C   1 
ATOM   5643  O O   . GLY B 1 146 ? 58.247  16.196  94.499  1.00 20.50 ? 146 GLY B O   1 
ATOM   5644  N N   . LYS B 1 147 ? 57.233  15.448  92.652  1.00 19.96 ? 147 LYS B N   1 
ATOM   5645  C CA  . LYS B 1 147 ? 55.998  16.180  92.935  1.00 19.73 ? 147 LYS B CA  1 
ATOM   5646  C C   . LYS B 1 147 ? 54.993  15.319  93.691  1.00 18.19 ? 147 LYS B C   1 
ATOM   5647  O O   . LYS B 1 147 ? 55.072  14.094  93.660  1.00 17.33 ? 147 LYS B O   1 
ATOM   5648  C CB  . LYS B 1 147 ? 55.349  16.650  91.631  1.00 19.82 ? 147 LYS B CB  1 
ATOM   5649  C CG  . LYS B 1 147 ? 56.156  17.671  90.883  1.00 22.94 ? 147 LYS B CG  1 
ATOM   5650  C CD  . LYS B 1 147 ? 55.315  18.394  89.869  1.00 26.22 ? 147 LYS B CD  1 
ATOM   5651  C CE  . LYS B 1 147 ? 56.141  19.410  89.107  1.00 28.50 ? 147 LYS B CE  1 
ATOM   5652  N NZ  . LYS B 1 147 ? 57.477  18.842  88.819  1.00 32.11 ? 147 LYS B NZ  1 
ATOM   5653  N N   . THR B 1 148 ? 54.047  15.960  94.366  1.00 16.64 ? 148 THR B N   1 
ATOM   5654  C CA  . THR B 1 148 ? 52.976  15.229  95.048  1.00 15.96 ? 148 THR B CA  1 
ATOM   5655  C C   . THR B 1 148 ? 51.915  14.737  94.060  1.00 15.32 ? 148 THR B C   1 
ATOM   5656  O O   . THR B 1 148 ? 51.760  15.282  92.974  1.00 14.99 ? 148 THR B O   1 
ATOM   5657  C CB  . THR B 1 148 ? 52.278  16.113  96.092  1.00 15.87 ? 148 THR B CB  1 
ATOM   5658  O OG1 . THR B 1 148 ? 51.765  17.296  95.461  1.00 16.93 ? 148 THR B OG1 1 
ATOM   5659  C CG2 . THR B 1 148 ? 53.265  16.629  97.139  1.00 16.94 ? 148 THR B CG2 1 
ATOM   5660  N N   . ILE B 1 149 ? 51.180  13.706  94.454  1.00 14.99 ? 149 ILE B N   1 
ATOM   5661  C CA  . ILE B 1 149 ? 50.122  13.153  93.608  1.00 14.92 ? 149 ILE B CA  1 
ATOM   5662  C C   . ILE B 1 149 ? 48.870  14.020  93.678  1.00 14.35 ? 149 ILE B C   1 
ATOM   5663  O O   . ILE B 1 149 ? 48.358  14.239  94.766  1.00 14.54 ? 149 ILE B O   1 
ATOM   5664  C CB  . ILE B 1 149 ? 49.788  11.744  94.089  1.00 14.78 ? 149 ILE B CB  1 
ATOM   5665  C CG1 . ILE B 1 149 ? 51.004  10.835  93.920  1.00 15.67 ? 149 ILE B CG1 1 
ATOM   5666  C CG2 . ILE B 1 149 ? 48.587  11.182  93.358  1.00 15.18 ? 149 ILE B CG2 1 
ATOM   5667  C CD1 . ILE B 1 149 ? 51.620  10.875  92.574  1.00 15.74 ? 149 ILE B CD1 1 
ATOM   5668  N N   . THR B 1 150 ? 48.367  14.472  92.526  1.00 14.09 ? 150 THR B N   1 
ATOM   5669  C CA  . THR B 1 150 ? 47.155  15.300  92.471  1.00 14.18 ? 150 THR B CA  1 
ATOM   5670  C C   . THR B 1 150 ? 45.950  14.577  91.862  1.00 14.17 ? 150 THR B C   1 
ATOM   5671  O O   . THR B 1 150 ? 44.823  15.044  91.971  1.00 13.62 ? 150 THR B O   1 
ATOM   5672  C CB  . THR B 1 150 ? 47.387  16.519  91.593  1.00 13.84 ? 150 THR B CB  1 
ATOM   5673  O OG1 . THR B 1 150 ? 47.838  16.094  90.299  1.00 13.70 ? 150 THR B OG1 1 
ATOM   5674  C CG2 . THR B 1 150 ? 48.474  17.396  92.138  1.00 14.81 ? 150 THR B CG2 1 
ATOM   5675  N N   . ASP B 1 151 ? 46.221  13.470  91.181  1.00 13.90 ? 151 ASP B N   1 
ATOM   5676  C CA  . ASP B 1 151 ? 45.206  12.713  90.503  1.00 13.62 ? 151 ASP B CA  1 
ATOM   5677  C C   . ASP B 1 151 ? 45.440  11.222  90.680  1.00 13.55 ? 151 ASP B C   1 
ATOM   5678  O O   . ASP B 1 151 ? 46.538  10.742  90.474  1.00 13.30 ? 151 ASP B O   1 
ATOM   5679  C CB  . ASP B 1 151 ? 45.267  13.042  89.023  1.00 13.75 ? 151 ASP B CB  1 
ATOM   5680  C CG  . ASP B 1 151 ? 44.868  14.446  88.734  1.00 13.79 ? 151 ASP B CG  1 
ATOM   5681  O OD1 . ASP B 1 151 ? 45.759  15.331  88.692  1.00 14.07 ? 151 ASP B OD1 1 
ATOM   5682  O OD2 . ASP B 1 151 ? 43.673  14.748  88.525  1.00 14.88 ? 151 ASP B OD2 1 
ATOM   5683  N N   . VAL B 1 152 ? 44.379  10.510  91.043  1.00 13.29 ? 152 VAL B N   1 
ATOM   5684  C CA  . VAL B 1 152 ? 44.390  9.068   91.188  1.00 13.92 ? 152 VAL B CA  1 
ATOM   5685  C C   . VAL B 1 152 ? 43.458  8.505   90.125  1.00 13.48 ? 152 VAL B C   1 
ATOM   5686  O O   . VAL B 1 152 ? 42.303  8.951   89.993  1.00 14.08 ? 152 VAL B O   1 
ATOM   5687  C CB  . VAL B 1 152 ? 43.905  8.667   92.580  1.00 13.78 ? 152 VAL B CB  1 
ATOM   5688  C CG1 . VAL B 1 152 ? 43.526  7.201   92.624  1.00 16.37 ? 152 VAL B CG1 1 
ATOM   5689  C CG2 . VAL B 1 152 ? 44.998  9.004   93.620  1.00 15.71 ? 152 VAL B CG2 1 
ATOM   5690  N N   . ILE B 1 153 ? 43.939  7.521   89.376  1.00 12.88 ? 153 ILE B N   1 
ATOM   5691  C CA  . ILE B 1 153 ? 43.154  6.962   88.294  1.00 12.32 ? 153 ILE B CA  1 
ATOM   5692  C C   . ILE B 1 153 ? 42.911  5.475   88.508  1.00 11.97 ? 153 ILE B C   1 
ATOM   5693  O O   . ILE B 1 153 ? 43.824  4.677   88.372  1.00 12.09 ? 153 ILE B O   1 
ATOM   5694  C CB  . ILE B 1 153 ? 43.848  7.178   86.925  1.00 12.34 ? 153 ILE B CB  1 
ATOM   5695  C CG1 . ILE B 1 153 ? 44.104  8.665   86.654  1.00 13.11 ? 153 ILE B CG1 1 
ATOM   5696  C CG2 . ILE B 1 153 ? 42.979  6.584   85.820  1.00 11.95 ? 153 ILE B CG2 1 
ATOM   5697  C CD1 . ILE B 1 153 ? 45.410  9.202   87.216  1.00 15.18 ? 153 ILE B CD1 1 
ATOM   5698  N N   . ASN B 1 154 ? 41.671  5.104   88.808  1.00 11.00 ? 154 ASN B N   1 
ATOM   5699  C CA  . ASN B 1 154 ? 41.320  3.697   88.983  1.00 10.85 ? 154 ASN B CA  1 
ATOM   5700  C C   . ASN B 1 154 ? 41.033  3.080   87.618  1.00 10.55 ? 154 ASN B C   1 
ATOM   5701  O O   . ASN B 1 154 ? 40.238  3.630   86.847  1.00 10.31 ? 154 ASN B O   1 
ATOM   5702  C CB  . ASN B 1 154 ? 40.091  3.565   89.883  1.00 10.98 ? 154 ASN B CB  1 
ATOM   5703  C CG  . ASN B 1 154 ? 39.810  2.141   90.297  1.00 12.00 ? 154 ASN B CG  1 
ATOM   5704  O OD1 . ASN B 1 154 ? 38.917  1.477   89.760  1.00 15.04 ? 154 ASN B OD1 1 
ATOM   5705  N ND2 . ASN B 1 154 ? 40.541  1.672   91.285  1.00 12.29 ? 154 ASN B ND2 1 
ATOM   5706  N N   . ILE B 1 155 ? 41.703  1.971   87.308  1.00 10.41 ? 155 ILE B N   1 
ATOM   5707  C CA  . ILE B 1 155 ? 41.438  1.218   86.074  1.00 11.04 ? 155 ILE B CA  1 
ATOM   5708  C C   . ILE B 1 155 ? 40.951  -0.187  86.443  1.00 11.14 ? 155 ILE B C   1 
ATOM   5709  O O   . ILE B 1 155 ? 41.685  -0.967  87.066  1.00 11.19 ? 155 ILE B O   1 
ATOM   5710  C CB  . ILE B 1 155 ? 42.689  1.100   85.179  1.00 10.61 ? 155 ILE B CB  1 
ATOM   5711  C CG1 . ILE B 1 155 ? 43.283  2.473   84.932  1.00 11.60 ? 155 ILE B CG1 1 
ATOM   5712  C CG2 . ILE B 1 155 ? 42.318  0.336   83.863  1.00 11.47 ? 155 ILE B CG2 1 
ATOM   5713  C CD1 . ILE B 1 155 ? 44.473  2.487   83.982  1.00 11.77 ? 155 ILE B CD1 1 
ATOM   5714  N N   . GLY B 1 156 ? 39.703  -0.475  86.080  1.00 11.61 ? 156 GLY B N   1 
ATOM   5715  C CA  . GLY B 1 156 ? 39.060  -1.740  86.370  1.00 12.06 ? 156 GLY B CA  1 
ATOM   5716  C C   . GLY B 1 156 ? 37.704  -1.811  85.685  1.00 12.01 ? 156 GLY B C   1 
ATOM   5717  O O   . GLY B 1 156 ? 37.172  -0.783  85.273  1.00 12.44 ? 156 GLY B O   1 
ATOM   5718  N N   . ILE B 1 157 ? 37.160  -3.016  85.553  1.00 12.73 ? 157 ILE B N   1 
ATOM   5719  C CA  . ILE B 1 157 ? 35.839  -3.216  84.949  1.00 13.43 ? 157 ILE B CA  1 
ATOM   5720  C C   . ILE B 1 157 ? 34.886  -3.829  85.969  1.00 12.41 ? 157 ILE B C   1 
ATOM   5721  O O   . ILE B 1 157 ? 35.321  -4.351  86.986  1.00 11.52 ? 157 ILE B O   1 
ATOM   5722  C CB  . ILE B 1 157 ? 35.916  -4.116  83.697  1.00 13.53 ? 157 ILE B CB  1 
ATOM   5723  C CG1 . ILE B 1 157 ? 36.297  -5.549  84.081  1.00 15.84 ? 157 ILE B CG1 1 
ATOM   5724  C CG2 . ILE B 1 157 ? 36.863  -3.526  82.685  1.00 15.56 ? 157 ILE B CG2 1 
ATOM   5725  C CD1 . ILE B 1 157 ? 36.383  -6.544  82.902  1.00 18.99 ? 157 ILE B CD1 1 
ATOM   5726  N N   . GLY B 1 158 ? 33.589  -3.728  85.691  1.00 12.73 ? 158 GLY B N   1 
ATOM   5727  C CA  . GLY B 1 158 ? 32.571  -4.300  86.549  1.00 12.59 ? 158 GLY B CA  1 
ATOM   5728  C C   . GLY B 1 158 ? 32.702  -3.901  88.006  1.00 12.11 ? 158 GLY B C   1 
ATOM   5729  O O   . GLY B 1 158 ? 32.701  -2.719  88.342  1.00 11.45 ? 158 GLY B O   1 
ATOM   5730  N N   . GLY B 1 159 ? 32.830  -4.897  88.875  1.00 12.14 ? 159 GLY B N   1 
ATOM   5731  C CA  . GLY B 1 159 ? 32.901  -4.656  90.304  1.00 12.35 ? 159 GLY B CA  1 
ATOM   5732  C C   . GLY B 1 159 ? 34.158  -3.943  90.779  1.00 12.12 ? 159 GLY B C   1 
ATOM   5733  O O   . GLY B 1 159 ? 34.234  -3.488  91.916  1.00 12.40 ? 159 GLY B O   1 
ATOM   5734  N N   . SER B 1 160 ? 35.159  -3.867  89.917  1.00 12.04 ? 160 SER B N   1 
ATOM   5735  C CA  . SER B 1 160 ? 36.382  -3.158  90.242  1.00 11.94 ? 160 SER B CA  1 
ATOM   5736  C C   . SER B 1 160 ? 36.243  -1.690  89.901  1.00 12.03 ? 160 SER B C   1 
ATOM   5737  O O   . SER B 1 160 ? 37.161  -0.928  90.133  1.00 12.89 ? 160 SER B O   1 
ATOM   5738  C CB  . SER B 1 160 ? 37.570  -3.735  89.473  1.00 12.08 ? 160 SER B CB  1 
ATOM   5739  O OG  . SER B 1 160 ? 37.824  -5.068  89.863  1.00 12.39 ? 160 SER B OG  1 
ATOM   5740  N N   . ASP B 1 161 ? 35.093  -1.321  89.357  1.00 11.10 ? 161 ASP B N   1 
ATOM   5741  C CA  . ASP B 1 161 ? 34.812  0.031   88.935  1.00 11.26 ? 161 ASP B CA  1 
ATOM   5742  C C   . ASP B 1 161 ? 33.576  0.665   89.570  1.00 10.58 ? 161 ASP B C   1 
ATOM   5743  O O   . ASP B 1 161 ? 33.666  1.755   90.112  1.00 10.44 ? 161 ASP B O   1 
ATOM   5744  C CB  . ASP B 1 161 ? 34.621  0.064   87.416  1.00 11.76 ? 161 ASP B CB  1 
ATOM   5745  C CG  . ASP B 1 161 ? 33.977  1.370   86.921  1.00 12.14 ? 161 ASP B CG  1 
ATOM   5746  O OD1 . ASP B 1 161 ? 34.670  2.408   86.874  1.00 11.89 ? 161 ASP B OD1 1 
ATOM   5747  O OD2 . ASP B 1 161 ? 32.780  1.454   86.577  1.00 13.36 ? 161 ASP B OD2 1 
ATOM   5748  N N   . LEU B 1 162 ? 32.431  0.004   89.454  1.00 10.88 ? 162 LEU B N   1 
ATOM   5749  C CA  . LEU B 1 162 ? 31.142  0.618   89.787  1.00 11.85 ? 162 LEU B CA  1 
ATOM   5750  C C   . LEU B 1 162 ? 30.995  1.064   91.224  1.00 10.83 ? 162 LEU B C   1 
ATOM   5751  O O   . LEU B 1 162 ? 30.471  2.148   91.482  1.00 9.08  ? 162 LEU B O   1 
ATOM   5752  C CB  . LEU B 1 162 ? 29.980  -0.308  89.435  1.00 12.84 ? 162 LEU B CB  1 
ATOM   5753  C CG  . LEU B 1 162 ? 29.578  -0.405  87.970  1.00 16.57 ? 162 LEU B CG  1 
ATOM   5754  C CD1 . LEU B 1 162 ? 28.420  -1.404  87.823  1.00 18.57 ? 162 LEU B CD1 1 
ATOM   5755  C CD2 . LEU B 1 162 ? 29.149  0.946   87.465  1.00 18.86 ? 162 LEU B CD2 1 
ATOM   5756  N N   . GLY B 1 163 ? 31.462  0.231   92.152  1.00 9.84  ? 163 GLY B N   1 
ATOM   5757  C CA  . GLY B 1 163 ? 31.403  0.554   93.563  1.00 10.28 ? 163 GLY B CA  1 
ATOM   5758  C C   . GLY B 1 163 ? 32.191  1.781   93.953  1.00 9.83  ? 163 GLY B C   1 
ATOM   5759  O O   . GLY B 1 163 ? 31.632  2.723   94.500  1.00 9.84  ? 163 GLY B O   1 
ATOM   5760  N N   . PRO B 1 164 ? 33.499  1.750   93.728  1.00 9.49  ? 164 PRO B N   1 
ATOM   5761  C CA  . PRO B 1 164 ? 34.368  2.901   93.986  1.00 9.57  ? 164 PRO B CA  1 
ATOM   5762  C C   . PRO B 1 164 ? 33.865  4.194   93.321  1.00 9.31  ? 164 PRO B C   1 
ATOM   5763  O O   . PRO B 1 164 ? 33.856  5.245   93.950  1.00 9.05  ? 164 PRO B O   1 
ATOM   5764  C CB  . PRO B 1 164 ? 35.705  2.436   93.395  1.00 9.77  ? 164 PRO B CB  1 
ATOM   5765  C CG  . PRO B 1 164 ? 35.683  0.960   93.609  1.00 9.78  ? 164 PRO B CG  1 
ATOM   5766  C CD  . PRO B 1 164 ? 34.273  0.586   93.248  1.00 10.31 ? 164 PRO B CD  1 
ATOM   5767  N N   . LEU B 1 165 ? 33.408  4.090   92.078  1.00 8.98  ? 165 LEU B N   1 
ATOM   5768  C CA  . LEU B 1 165 ? 32.861  5.237   91.371  1.00 9.24  ? 165 LEU B CA  1 
ATOM   5769  C C   . LEU B 1 165 ? 31.601  5.740   92.080  1.00 8.71  ? 165 LEU B C   1 
ATOM   5770  O O   . LEU B 1 165 ? 31.525  6.912   92.416  1.00 7.75  ? 165 LEU B O   1 
ATOM   5771  C CB  . LEU B 1 165 ? 32.583  4.896   89.910  1.00 9.56  ? 165 LEU B CB  1 
ATOM   5772  C CG  . LEU B 1 165 ? 32.137  6.087   89.033  1.00 11.50 ? 165 LEU B CG  1 
ATOM   5773  C CD1 . LEU B 1 165 ? 32.368  5.732   87.581  1.00 14.58 ? 165 LEU B CD1 1 
ATOM   5774  C CD2 . LEU B 1 165 ? 30.667  6.414   89.261  1.00 12.32 ? 165 LEU B CD2 1 
ATOM   5775  N N   . MET B 1 166 ? 30.630  4.863   92.335  1.00 8.00  ? 166 MET B N   1 
ATOM   5776  C CA  . MET B 1 166 ? 29.382  5.308   92.971  1.00 7.86  ? 166 MET B CA  1 
ATOM   5777  C C   . MET B 1 166 ? 29.635  5.939   94.353  1.00 7.51  ? 166 MET B C   1 
ATOM   5778  O O   . MET B 1 166 ? 29.085  6.996   94.677  1.00 7.08  ? 166 MET B O   1 
ATOM   5779  C CB  . MET B 1 166 ? 28.367  4.152   93.034  1.00 8.25  ? 166 MET B CB  1 
ATOM   5780  C CG  . MET B 1 166 ? 27.028  4.461   93.732  1.00 8.20  ? 166 MET B CG  1 
ATOM   5781  S SD  . MET B 1 166 ? 27.153  4.340   95.534  1.00 10.89 ? 166 MET B SD  1 
ATOM   5782  C CE  . MET B 1 166 ? 27.215  2.608   95.820  1.00 11.17 ? 166 MET B CE  1 
ATOM   5783  N N   . VAL B 1 167 ? 30.496  5.315   95.153  1.00 7.36  ? 167 VAL B N   1 
ATOM   5784  C CA  . VAL B 1 167 ? 30.773  5.825   96.499  1.00 7.92  ? 167 VAL B CA  1 
ATOM   5785  C C   . VAL B 1 167 ? 31.530  7.164   96.467  1.00 7.24  ? 167 VAL B C   1 
ATOM   5786  O O   . VAL B 1 167 ? 31.155  8.096   97.177  1.00 7.94  ? 167 VAL B O   1 
ATOM   5787  C CB  . VAL B 1 167 ? 31.511  4.775   97.347  1.00 7.31  ? 167 VAL B CB  1 
ATOM   5788  C CG1 . VAL B 1 167 ? 31.930  5.328   98.662  1.00 7.71  ? 167 VAL B CG1 1 
ATOM   5789  C CG2 . VAL B 1 167 ? 30.636  3.543   97.542  1.00 7.91  ? 167 VAL B CG2 1 
ATOM   5790  N N   . THR B 1 168 ? 32.591  7.287   95.681  1.00 8.08  ? 168 THR B N   1 
ATOM   5791  C CA  . THR B 1 168 ? 33.257  8.586   95.595  1.00 8.17  ? 168 THR B CA  1 
ATOM   5792  C C   . THR B 1 168 ? 32.312  9.678   95.067  1.00 8.66  ? 168 THR B C   1 
ATOM   5793  O O   . THR B 1 168 ? 32.420  10.826  95.481  1.00 9.46  ? 168 THR B O   1 
ATOM   5794  C CB  . THR B 1 168 ? 34.545  8.571   94.754  1.00 8.66  ? 168 THR B CB  1 
ATOM   5795  O OG1 . THR B 1 168 ? 34.306  7.999   93.460  1.00 6.71  ? 168 THR B OG1 1 
ATOM   5796  C CG2 . THR B 1 168 ? 35.631  7.719   95.422  1.00 10.04 ? 168 THR B CG2 1 
ATOM   5797  N N   . GLU B 1 169 ? 31.418  9.340   94.135  1.00 8.38  ? 169 GLU B N   1 
ATOM   5798  C CA  . GLU B 1 169 ? 30.447  10.309  93.652  1.00 8.48  ? 169 GLU B CA  1 
ATOM   5799  C C   . GLU B 1 169 ? 29.518  10.722  94.774  1.00 8.60  ? 169 GLU B C   1 
ATOM   5800  O O   . GLU B 1 169 ? 29.234  11.915  94.954  1.00 8.59  ? 169 GLU B O   1 
ATOM   5801  C CB  . GLU B 1 169 ? 29.630  9.755   92.484  1.00 8.64  ? 169 GLU B CB  1 
ATOM   5802  C CG  . GLU B 1 169 ? 30.408  9.743   91.164  1.00 8.83  ? 169 GLU B CG  1 
ATOM   5803  C CD  . GLU B 1 169 ? 30.801  11.124  90.714  1.00 8.95  ? 169 GLU B CD  1 
ATOM   5804  O OE1 . GLU B 1 169 ? 32.019  11.403  90.679  1.00 10.27 ? 169 GLU B OE1 1 
ATOM   5805  O OE2 . GLU B 1 169 ? 29.891  11.925  90.420  1.00 10.09 ? 169 GLU B OE2 1 
ATOM   5806  N N   . ALA B 1 170 ? 29.058  9.736   95.535  1.00 8.41  ? 170 ALA B N   1 
ATOM   5807  C CA  . ALA B 1 170 ? 28.133  9.984   96.635  1.00 8.06  ? 170 ALA B CA  1 
ATOM   5808  C C   . ALA B 1 170 ? 28.778  10.732  97.792  1.00 8.27  ? 170 ALA B C   1 
ATOM   5809  O O   . ALA B 1 170 ? 28.091  11.471  98.495  1.00 8.49  ? 170 ALA B O   1 
ATOM   5810  C CB  . ALA B 1 170 ? 27.546  8.671   97.140  1.00 8.40  ? 170 ALA B CB  1 
ATOM   5811  N N   . LEU B 1 171 ? 30.072  10.530  98.013  1.00 7.91  ? 171 LEU B N   1 
ATOM   5812  C CA  . LEU B 1 171 ? 30.743  11.144  99.155  1.00 8.82  ? 171 LEU B CA  1 
ATOM   5813  C C   . LEU B 1 171 ? 31.683  12.288  98.775  1.00 9.13  ? 171 LEU B C   1 
ATOM   5814  O O   . LEU B 1 171 ? 32.613  12.610  99.520  1.00 9.46  ? 171 LEU B O   1 
ATOM   5815  C CB  . LEU B 1 171 ? 31.524  10.084  99.942  1.00 8.74  ? 171 LEU B CB  1 
ATOM   5816  C CG  . LEU B 1 171 ? 30.667  8.919   100.445 1.00 7.93  ? 171 LEU B CG  1 
ATOM   5817  C CD1 . LEU B 1 171 ? 31.559  7.961   101.176 1.00 8.76  ? 171 LEU B CD1 1 
ATOM   5818  C CD2 . LEU B 1 171 ? 29.525  9.395   101.343 1.00 7.88  ? 171 LEU B CD2 1 
ATOM   5819  N N   . LYS B 1 172 ? 31.389  12.933  97.653  1.00 10.06 ? 172 LYS B N   1 
ATOM   5820  C CA  . LYS B 1 172 ? 32.218  14.007  97.113  1.00 11.50 ? 172 LYS B CA  1 
ATOM   5821  C C   . LYS B 1 172 ? 32.476  15.131  98.148  1.00 12.16 ? 172 LYS B C   1 
ATOM   5822  O O   . LYS B 1 172 ? 33.600  15.622  98.252  1.00 12.39 ? 172 LYS B O   1 
ATOM   5823  C CB  . LYS B 1 172 ? 31.612  14.513  95.787  1.00 11.65 ? 172 LYS B CB  1 
ATOM   5824  C CG  . LYS B 1 172 ? 32.546  15.338  94.898  1.00 14.25 ? 172 LYS B CG  1 
ATOM   5825  C CD  . LYS B 1 172 ? 33.788  14.569  94.429  1.00 14.61 ? 172 LYS B CD  1 
ATOM   5826  C CE  . LYS B 1 172 ? 33.472  13.404  93.480  1.00 16.28 ? 172 LYS B CE  1 
ATOM   5827  N NZ  . LYS B 1 172 ? 34.735  12.857  92.894  1.00 15.66 ? 172 LYS B NZ  1 
ATOM   5828  N N   . PRO B 1 173 ? 31.496  15.510  98.967  1.00 12.61 ? 173 PRO B N   1 
ATOM   5829  C CA  . PRO B 1 173 ? 31.773  16.542  99.981  1.00 13.13 ? 173 PRO B CA  1 
ATOM   5830  C C   . PRO B 1 173 ? 32.818  16.151  101.031 1.00 13.42 ? 173 PRO B C   1 
ATOM   5831  O O   . PRO B 1 173 ? 33.252  17.027  101.797 1.00 13.24 ? 173 PRO B O   1 
ATOM   5832  C CB  . PRO B 1 173 ? 30.421  16.738  100.679 1.00 13.42 ? 173 PRO B CB  1 
ATOM   5833  C CG  . PRO B 1 173 ? 29.397  16.193  99.757  1.00 12.32 ? 173 PRO B CG  1 
ATOM   5834  C CD  . PRO B 1 173 ? 30.099  15.047  99.023  1.00 12.64 ? 173 PRO B CD  1 
ATOM   5835  N N   . TYR B 1 174 ? 33.192  14.870  101.108 1.00 12.98 ? 174 TYR B N   1 
ATOM   5836  C CA  . TYR B 1 174 ? 34.144  14.412  102.114 1.00 13.37 ? 174 TYR B CA  1 
ATOM   5837  C C   . TYR B 1 174 ? 35.575  14.272  101.567 1.00 14.17 ? 174 TYR B C   1 
ATOM   5838  O O   . TYR B 1 174 ? 36.453  13.738  102.237 1.00 13.76 ? 174 TYR B O   1 
ATOM   5839  C CB  . TYR B 1 174 ? 33.659  13.078  102.730 1.00 12.89 ? 174 TYR B CB  1 
ATOM   5840  C CG  . TYR B 1 174 ? 32.338  13.228  103.439 1.00 12.88 ? 174 TYR B CG  1 
ATOM   5841  C CD1 . TYR B 1 174 ? 31.140  13.035  102.762 1.00 12.64 ? 174 TYR B CD1 1 
ATOM   5842  C CD2 . TYR B 1 174 ? 32.279  13.601  104.782 1.00 13.80 ? 174 TYR B CD2 1 
ATOM   5843  C CE1 . TYR B 1 174 ? 29.922  13.196  103.406 1.00 12.39 ? 174 TYR B CE1 1 
ATOM   5844  C CE2 . TYR B 1 174 ? 31.056  13.770  105.433 1.00 13.06 ? 174 TYR B CE2 1 
ATOM   5845  C CZ  . TYR B 1 174 ? 29.886  13.572  104.735 1.00 10.96 ? 174 TYR B CZ  1 
ATOM   5846  O OH  . TYR B 1 174 ? 28.676  13.740  105.354 1.00 9.64  ? 174 TYR B OH  1 
ATOM   5847  N N   . SER B 1 175 ? 35.793  14.768  100.357 1.00 15.20 ? 175 SER B N   1 
ATOM   5848  C CA  . SER B 1 175 ? 37.084  14.656  99.675  1.00 15.92 ? 175 SER B CA  1 
ATOM   5849  C C   . SER B 1 175 ? 37.977  15.904  99.733  1.00 17.25 ? 175 SER B C   1 
ATOM   5850  O O   . SER B 1 175 ? 38.909  16.002  98.952  1.00 16.88 ? 175 SER B O   1 
ATOM   5851  C CB  . SER B 1 175 ? 36.842  14.365  98.208  1.00 15.78 ? 175 SER B CB  1 
ATOM   5852  O OG  . SER B 1 175 ? 36.168  15.465  97.613  1.00 14.37 ? 175 SER B OG  1 
ATOM   5853  N N   . SER B 1 176 ? 37.686  16.876  100.599 1.00 18.61 ? 176 SER B N   1 
ATOM   5854  C CA  . SER B 1 176 ? 38.599  18.022  100.727 1.00 19.80 ? 176 SER B CA  1 
ATOM   5855  C C   . SER B 1 176 ? 39.974  17.492  101.142 1.00 20.57 ? 176 SER B C   1 
ATOM   5856  O O   . SER B 1 176 ? 40.081  16.642  102.035 1.00 20.64 ? 176 SER B O   1 
ATOM   5857  C CB  . SER B 1 176 ? 38.097  19.041  101.759 1.00 20.12 ? 176 SER B CB  1 
ATOM   5858  O OG  . SER B 1 176 ? 38.923  20.202  101.760 1.00 21.58 ? 176 SER B OG  1 
ATOM   5859  N N   . GLY B 1 177 ? 41.018  17.940  100.455 1.00 21.31 ? 177 GLY B N   1 
ATOM   5860  C CA  . GLY B 1 177 ? 42.370  17.516  100.790 1.00 21.96 ? 177 GLY B CA  1 
ATOM   5861  C C   . GLY B 1 177 ? 42.801  16.213  100.132 1.00 21.85 ? 177 GLY B C   1 
ATOM   5862  O O   . GLY B 1 177 ? 43.939  15.772  100.309 1.00 23.78 ? 177 GLY B O   1 
ATOM   5863  N N   . GLY B 1 178 ? 41.903  15.579  99.383  1.00 20.21 ? 178 GLY B N   1 
ATOM   5864  C CA  . GLY B 1 178 ? 42.258  14.366  98.673  1.00 18.19 ? 178 GLY B CA  1 
ATOM   5865  C C   . GLY B 1 178 ? 42.534  14.680  97.226  1.00 16.62 ? 178 GLY B C   1 
ATOM   5866  O O   . GLY B 1 178 ? 42.116  15.707  96.707  1.00 15.71 ? 178 GLY B O   1 
ATOM   5867  N N   . PRO B 1 179 ? 43.248  13.805  96.547  1.00 14.72 ? 179 PRO B N   1 
ATOM   5868  C CA  . PRO B 1 179 ? 43.506  14.036  95.143  1.00 14.33 ? 179 PRO B CA  1 
ATOM   5869  C C   . PRO B 1 179 ? 42.198  13.824  94.389  1.00 14.10 ? 179 PRO B C   1 
ATOM   5870  O O   . PRO B 1 179 ? 41.260  13.223  94.939  1.00 13.65 ? 179 PRO B O   1 
ATOM   5871  C CB  . PRO B 1 179 ? 44.527  12.946  94.799  1.00 14.05 ? 179 PRO B CB  1 
ATOM   5872  C CG  . PRO B 1 179 ? 44.199  11.840  95.760  1.00 14.38 ? 179 PRO B CG  1 
ATOM   5873  C CD  . PRO B 1 179 ? 43.872  12.561  97.027  1.00 15.25 ? 179 PRO B CD  1 
ATOM   5874  N N   . ARG B 1 180 ? 42.131  14.347  93.181  1.00 13.89 ? 180 ARG B N   1 
ATOM   5875  C CA  . ARG B 1 180 ? 41.007  14.063  92.273  1.00 14.03 ? 180 ARG B CA  1 
ATOM   5876  C C   . ARG B 1 180 ? 40.953  12.558  91.947  1.00 13.43 ? 180 ARG B C   1 
ATOM   5877  O O   . ARG B 1 180 ? 41.990  11.908  91.858  1.00 13.00 ? 180 ARG B O   1 
ATOM   5878  C CB  . ARG B 1 180 ? 41.189  14.832  90.965  1.00 13.97 ? 180 ARG B CB  1 
ATOM   5879  C CG  . ARG B 1 180 ? 40.910  16.321  91.031  1.00 16.63 ? 180 ARG B CG  1 
ATOM   5880  C CD  . ARG B 1 180 ? 41.216  17.063  89.714  1.00 18.67 ? 180 ARG B CD  1 
ATOM   5881  N NE  . ARG B 1 180 ? 42.653  17.077  89.431  1.00 20.10 ? 180 ARG B NE  1 
ATOM   5882  C CZ  . ARG B 1 180 ? 43.486  18.066  89.773  1.00 22.84 ? 180 ARG B CZ  1 
ATOM   5883  N NH1 . ARG B 1 180 ? 43.028  19.159  90.381  1.00 20.99 ? 180 ARG B NH1 1 
ATOM   5884  N NH2 . ARG B 1 180 ? 44.786  17.974  89.477  1.00 22.42 ? 180 ARG B NH2 1 
ATOM   5885  N N   . VAL B 1 181 ? 39.759  11.998  91.761  1.00 13.04 ? 181 VAL B N   1 
ATOM   5886  C CA  . VAL B 1 181 ? 39.664  10.600  91.342  1.00 12.84 ? 181 VAL B CA  1 
ATOM   5887  C C   . VAL B 1 181 ? 39.035  10.483  89.964  1.00 12.41 ? 181 VAL B C   1 
ATOM   5888  O O   . VAL B 1 181 ? 38.069  11.192  89.634  1.00 11.83 ? 181 VAL B O   1 
ATOM   5889  C CB  . VAL B 1 181 ? 38.907  9.658   92.316  1.00 13.19 ? 181 VAL B CB  1 
ATOM   5890  C CG1 . VAL B 1 181 ? 39.788  9.279   93.476  1.00 17.03 ? 181 VAL B CG1 1 
ATOM   5891  C CG2 . VAL B 1 181 ? 37.562  10.246  92.793  1.00 11.95 ? 181 VAL B CG2 1 
ATOM   5892  N N   . TRP B 1 182 ? 39.618  9.588   89.168  1.00 11.88 ? 182 TRP B N   1 
ATOM   5893  C CA  . TRP B 1 182 ? 39.182  9.278   87.821  1.00 11.75 ? 182 TRP B CA  1 
ATOM   5894  C C   . TRP B 1 182 ? 38.939  7.770   87.715  1.00 11.63 ? 182 TRP B C   1 
ATOM   5895  O O   . TRP B 1 182 ? 39.703  6.997   88.278  1.00 11.97 ? 182 TRP B O   1 
ATOM   5896  C CB  . TRP B 1 182 ? 40.261  9.654   86.802  1.00 11.83 ? 182 TRP B CB  1 
ATOM   5897  C CG  . TRP B 1 182 ? 40.699  11.075  86.869  1.00 12.61 ? 182 TRP B CG  1 
ATOM   5898  C CD1 . TRP B 1 182 ? 41.530  11.622  87.790  1.00 14.02 ? 182 TRP B CD1 1 
ATOM   5899  C CD2 . TRP B 1 182 ? 40.347  12.125  85.972  1.00 15.69 ? 182 TRP B CD2 1 
ATOM   5900  N NE1 . TRP B 1 182 ? 41.716  12.958  87.528  1.00 13.48 ? 182 TRP B NE1 1 
ATOM   5901  C CE2 . TRP B 1 182 ? 40.997  13.294  86.415  1.00 14.33 ? 182 TRP B CE2 1 
ATOM   5902  C CE3 . TRP B 1 182 ? 39.537  12.203  84.835  1.00 16.53 ? 182 TRP B CE3 1 
ATOM   5903  C CZ2 . TRP B 1 182 ? 40.876  14.521  85.758  1.00 16.22 ? 182 TRP B CZ2 1 
ATOM   5904  C CZ3 . TRP B 1 182 ? 39.410  13.425  84.185  1.00 18.71 ? 182 TRP B CZ3 1 
ATOM   5905  C CH2 . TRP B 1 182 ? 40.076  14.565  84.648  1.00 19.22 ? 182 TRP B CH2 1 
ATOM   5906  N N   . TYR B 1 183 ? 37.892  7.379   86.987  1.00 10.52 ? 183 TYR B N   1 
ATOM   5907  C CA  . TYR B 1 183 ? 37.540  5.983   86.766  1.00 10.77 ? 183 TYR B CA  1 
ATOM   5908  C C   . TYR B 1 183 ? 37.564  5.691   85.267  1.00 10.75 ? 183 TYR B C   1 
ATOM   5909  O O   . TYR B 1 183 ? 36.917  6.379   84.485  1.00 11.79 ? 183 TYR B O   1 
ATOM   5910  C CB  . TYR B 1 183 ? 36.164  5.662   87.391  1.00 10.51 ? 183 TYR B CB  1 
ATOM   5911  C CG  . TYR B 1 183 ? 36.284  5.747   88.867  1.00 9.69  ? 183 TYR B CG  1 
ATOM   5912  C CD1 . TYR B 1 183 ? 36.126  6.959   89.523  1.00 9.30  ? 183 TYR B CD1 1 
ATOM   5913  C CD2 . TYR B 1 183 ? 36.676  4.655   89.601  1.00 9.44  ? 183 TYR B CD2 1 
ATOM   5914  C CE1 . TYR B 1 183 ? 36.310  7.058   90.875  1.00 8.97  ? 183 TYR B CE1 1 
ATOM   5915  C CE2 . TYR B 1 183 ? 36.863  4.739   90.957  1.00 9.49  ? 183 TYR B CE2 1 
ATOM   5916  C CZ  . TYR B 1 183 ? 36.683  5.946   91.592  1.00 9.44  ? 183 TYR B CZ  1 
ATOM   5917  O OH  . TYR B 1 183 ? 36.880  6.041   92.945  1.00 9.45  ? 183 TYR B OH  1 
ATOM   5918  N N   . VAL B 1 184 ? 38.376  4.716   84.888  1.00 10.85 ? 184 VAL B N   1 
ATOM   5919  C CA  . VAL B 1 184 ? 38.497  4.256   83.519  1.00 10.81 ? 184 VAL B CA  1 
ATOM   5920  C C   . VAL B 1 184 ? 38.098  2.791   83.519  1.00 10.88 ? 184 VAL B C   1 
ATOM   5921  O O   . VAL B 1 184 ? 38.723  1.963   84.166  1.00 10.37 ? 184 VAL B O   1 
ATOM   5922  C CB  . VAL B 1 184 ? 39.932  4.383   82.996  1.00 10.92 ? 184 VAL B CB  1 
ATOM   5923  C CG1 . VAL B 1 184 ? 40.056  3.733   81.640  1.00 10.60 ? 184 VAL B CG1 1 
ATOM   5924  C CG2 . VAL B 1 184 ? 40.339  5.846   82.905  1.00 11.88 ? 184 VAL B CG2 1 
ATOM   5925  N N   . SER B 1 185 ? 37.062  2.467   82.775  1.00 10.62 ? 185 SER B N   1 
ATOM   5926  C CA  . SER B 1 185 ? 36.546  1.113   82.785  1.00 11.11 ? 185 SER B CA  1 
ATOM   5927  C C   . SER B 1 185 ? 36.315  0.542   81.392  1.00 10.78 ? 185 SER B C   1 
ATOM   5928  O O   . SER B 1 185 ? 36.593  -0.621  81.147  1.00 11.00 ? 185 SER B O   1 
ATOM   5929  C CB  . SER B 1 185 ? 35.219  1.096   83.536  1.00 9.90  ? 185 SER B CB  1 
ATOM   5930  O OG  . SER B 1 185 ? 34.335  2.088   83.023  1.00 11.56 ? 185 SER B OG  1 
ATOM   5931  N N   . ASN B 1 186 ? 35.770  1.352   80.484  1.00 10.81 ? 186 ASN B N   1 
ATOM   5932  C CA  . ASN B 1 186 ? 35.431  0.836   79.167  1.00 10.13 ? 186 ASN B CA  1 
ATOM   5933  C C   . ASN B 1 186 ? 36.690  0.466   78.390  1.00 10.28 ? 186 ASN B C   1 
ATOM   5934  O O   . ASN B 1 186 ? 37.681  1.196   78.441  1.00 9.37  ? 186 ASN B O   1 
ATOM   5935  C CB  . ASN B 1 186 ? 34.656  1.882   78.383  1.00 10.12 ? 186 ASN B CB  1 
ATOM   5936  C CG  . ASN B 1 186 ? 33.726  1.281   77.356  1.00 9.78  ? 186 ASN B CG  1 
ATOM   5937  O OD1 . ASN B 1 186 ? 34.004  0.228   76.766  1.00 9.90  ? 186 ASN B OD1 1 
ATOM   5938  N ND2 . ASN B 1 186 ? 32.595  1.949   77.137  1.00 8.71  ? 186 ASN B ND2 1 
ATOM   5939  N N   . ILE B 1 187 ? 36.667  -0.664  77.689  1.00 10.09 ? 187 ILE B N   1 
ATOM   5940  C CA  . ILE B 1 187 ? 37.784  -0.957  76.802  1.00 10.73 ? 187 ILE B CA  1 
ATOM   5941  C C   . ILE B 1 187 ? 37.779  0.076   75.673  1.00 10.69 ? 187 ILE B C   1 
ATOM   5942  O O   . ILE B 1 187 ? 38.834  0.386   75.115  1.00 10.09 ? 187 ILE B O   1 
ATOM   5943  C CB  . ILE B 1 187 ? 37.766  -2.407  76.260  1.00 10.61 ? 187 ILE B CB  1 
ATOM   5944  C CG1 . ILE B 1 187 ? 39.002  -2.645  75.388  1.00 10.70 ? 187 ILE B CG1 1 
ATOM   5945  C CG2 . ILE B 1 187 ? 36.475  -2.679  75.484  1.00 12.90 ? 187 ILE B CG2 1 
ATOM   5946  C CD1 . ILE B 1 187 ? 40.333  -2.597  76.101  1.00 10.69 ? 187 ILE B CD1 1 
ATOM   5947  N N   . ASP B 1 188 ? 36.608  0.639   75.347  1.00 10.79 ? 188 ASP B N   1 
ATOM   5948  C CA  . ASP B 1 188 ? 36.550  1.741   74.367  1.00 10.77 ? 188 ASP B CA  1 
ATOM   5949  C C   . ASP B 1 188 ? 37.675  2.744   74.648  1.00 10.72 ? 188 ASP B C   1 
ATOM   5950  O O   . ASP B 1 188 ? 37.681  3.387   75.696  1.00 10.55 ? 188 ASP B O   1 
ATOM   5951  C CB  . ASP B 1 188 ? 35.199  2.456   74.450  1.00 10.79 ? 188 ASP B CB  1 
ATOM   5952  C CG  . ASP B 1 188 ? 35.056  3.563   73.429  1.00 11.01 ? 188 ASP B CG  1 
ATOM   5953  O OD1 . ASP B 1 188 ? 33.940  4.133   73.333  1.00 10.46 ? 188 ASP B OD1 1 
ATOM   5954  O OD2 . ASP B 1 188 ? 35.985  3.917   72.661  1.00 7.40  ? 188 ASP B OD2 1 
ATOM   5955  N N   . GLY B 1 189 ? 38.592  2.895   73.688  1.00 10.34 ? 189 GLY B N   1 
ATOM   5956  C CA  . GLY B 1 189 ? 39.759  3.751   73.809  1.00 10.66 ? 189 GLY B CA  1 
ATOM   5957  C C   . GLY B 1 189 ? 39.498  5.209   74.136  1.00 10.55 ? 189 GLY B C   1 
ATOM   5958  O O   . GLY B 1 189 ? 40.371  5.915   74.647  1.00 10.27 ? 189 GLY B O   1 
ATOM   5959  N N   . THR B 1 190 ? 38.312  5.676   73.763  1.00 10.49 ? 190 THR B N   1 
ATOM   5960  C CA  . THR B 1 190 ? 37.863  6.989   74.158  1.00 10.54 ? 190 THR B CA  1 
ATOM   5961  C C   . THR B 1 190 ? 38.054  7.182   75.656  1.00 10.62 ? 190 THR B C   1 
ATOM   5962  O O   . THR B 1 190 ? 38.462  8.243   76.090  1.00 9.64  ? 190 THR B O   1 
ATOM   5963  C CB  . THR B 1 190 ? 36.360  7.117   73.848  1.00 11.07 ? 190 THR B CB  1 
ATOM   5964  O OG1 . THR B 1 190 ? 36.184  7.320   72.448  1.00 10.33 ? 190 THR B OG1 1 
ATOM   5965  C CG2 . THR B 1 190 ? 35.741  8.360   74.519  1.00 10.46 ? 190 THR B CG2 1 
ATOM   5966  N N   . HIS B 1 191 ? 37.741  6.150   76.447  1.00 10.86 ? 191 HIS B N   1 
ATOM   5967  C CA  . HIS B 1 191 ? 37.703  6.324   77.900  1.00 10.99 ? 191 HIS B CA  1 
ATOM   5968  C C   . HIS B 1 191 ? 39.074  6.688   78.460  1.00 10.77 ? 191 HIS B C   1 
ATOM   5969  O O   . HIS B 1 191 ? 39.216  7.705   79.122  1.00 10.58 ? 191 HIS B O   1 
ATOM   5970  C CB  . HIS B 1 191 ? 37.124  5.101   78.617  1.00 10.94 ? 191 HIS B CB  1 
ATOM   5971  C CG  . HIS B 1 191 ? 36.373  5.443   79.876  1.00 11.67 ? 191 HIS B CG  1 
ATOM   5972  N ND1 . HIS B 1 191 ? 35.722  4.496   80.640  1.00 12.01 ? 191 HIS B ND1 1 
ATOM   5973  C CD2 . HIS B 1 191 ? 36.155  6.631   80.493  1.00 11.60 ? 191 HIS B CD2 1 
ATOM   5974  C CE1 . HIS B 1 191 ? 35.130  5.085   81.665  1.00 10.79 ? 191 HIS B CE1 1 
ATOM   5975  N NE2 . HIS B 1 191 ? 35.376  6.383   81.602  1.00 8.72  ? 191 HIS B NE2 1 
ATOM   5976  N N   . ILE B 1 192 ? 40.080  5.873   78.163  1.00 10.99 ? 192 ILE B N   1 
ATOM   5977  C CA  . ILE B 1 192 ? 41.446  6.144   78.619  1.00 11.26 ? 192 ILE B CA  1 
ATOM   5978  C C   . ILE B 1 192 ? 42.047  7.381   77.900  1.00 11.92 ? 192 ILE B C   1 
ATOM   5979  O O   . ILE B 1 192 ? 42.668  8.229   78.543  1.00 11.52 ? 192 ILE B O   1 
ATOM   5980  C CB  . ILE B 1 192 ? 42.343  4.861   78.496  1.00 11.29 ? 192 ILE B CB  1 
ATOM   5981  C CG1 . ILE B 1 192 ? 43.685  4.985   79.245  1.00 11.97 ? 192 ILE B CG1 1 
ATOM   5982  C CG2 . ILE B 1 192 ? 42.664  4.541   77.058  1.00 12.00 ? 192 ILE B CG2 1 
ATOM   5983  C CD1 . ILE B 1 192 ? 43.612  5.539   80.640  1.00 12.47 ? 192 ILE B CD1 1 
ATOM   5984  N N   . ALA B 1 193 ? 41.811  7.525   76.594  1.00 12.03 ? 193 ALA B N   1 
ATOM   5985  C CA  . ALA B 1 193 ? 42.388  8.657   75.846  1.00 12.15 ? 193 ALA B CA  1 
ATOM   5986  C C   . ALA B 1 193 ? 41.947  10.007  76.399  1.00 13.19 ? 193 ALA B C   1 
ATOM   5987  O O   . ALA B 1 193 ? 42.777  10.904  76.651  1.00 12.64 ? 193 ALA B O   1 
ATOM   5988  C CB  . ALA B 1 193 ? 42.028  8.562   74.378  1.00 11.67 ? 193 ALA B CB  1 
ATOM   5989  N N   . LYS B 1 194 ? 40.641  10.151  76.611  1.00 13.99 ? 194 LYS B N   1 
ATOM   5990  C CA  . LYS B 1 194 ? 40.104  11.403  77.081  1.00 14.50 ? 194 LYS B CA  1 
ATOM   5991  C C   . LYS B 1 194 ? 40.513  11.703  78.517  1.00 14.31 ? 194 LYS B C   1 
ATOM   5992  O O   . LYS B 1 194 ? 40.605  12.863  78.914  1.00 14.22 ? 194 LYS B O   1 
ATOM   5993  C CB  . LYS B 1 194 ? 38.577  11.486  76.848  1.00 14.74 ? 194 LYS B CB  1 
ATOM   5994  C CG  . LYS B 1 194 ? 37.670  10.759  77.837  1.00 16.74 ? 194 LYS B CG  1 
ATOM   5995  C CD  . LYS B 1 194 ? 36.236  10.733  77.281  1.00 19.34 ? 194 LYS B CD  1 
ATOM   5996  C CE  . LYS B 1 194 ? 35.228  10.088  78.223  1.00 19.93 ? 194 LYS B CE  1 
ATOM   5997  N NZ  . LYS B 1 194 ? 35.176  10.783  79.541  1.00 21.23 ? 194 LYS B NZ  1 
ATOM   5998  N N   . THR B 1 195 ? 40.786  10.655  79.285  1.00 14.27 ? 195 THR B N   1 
ATOM   5999  C CA  . THR B 1 195 ? 41.252  10.802  80.657  1.00 13.79 ? 195 THR B CA  1 
ATOM   6000  C C   . THR B 1 195 ? 42.729  11.241  80.689  1.00 13.57 ? 195 THR B C   1 
ATOM   6001  O O   . THR B 1 195 ? 43.070  12.229  81.315  1.00 14.25 ? 195 THR B O   1 
ATOM   6002  C CB  . THR B 1 195 ? 41.060  9.469   81.404  1.00 13.42 ? 195 THR B CB  1 
ATOM   6003  O OG1 . THR B 1 195 ? 39.660  9.151   81.469  1.00 13.30 ? 195 THR B OG1 1 
ATOM   6004  C CG2 . THR B 1 195 ? 41.500  9.580   82.856  1.00 13.87 ? 195 THR B CG2 1 
ATOM   6005  N N   . LEU B 1 196 ? 43.589  10.529  79.966  1.00 14.06 ? 196 LEU B N   1 
ATOM   6006  C CA  . LEU B 1 196 ? 45.020  10.833  79.934  1.00 14.17 ? 196 LEU B CA  1 
ATOM   6007  C C   . LEU B 1 196 ? 45.316  12.231  79.431  1.00 15.01 ? 196 LEU B C   1 
ATOM   6008  O O   . LEU B 1 196 ? 46.250  12.869  79.897  1.00 14.40 ? 196 LEU B O   1 
ATOM   6009  C CB  . LEU B 1 196 ? 45.760  9.832   79.070  1.00 14.09 ? 196 LEU B CB  1 
ATOM   6010  C CG  . LEU B 1 196 ? 45.739  8.380   79.538  1.00 14.56 ? 196 LEU B CG  1 
ATOM   6011  C CD1 . LEU B 1 196 ? 46.487  7.504   78.532  1.00 14.80 ? 196 LEU B CD1 1 
ATOM   6012  C CD2 . LEU B 1 196 ? 46.358  8.244   80.929  1.00 15.65 ? 196 LEU B CD2 1 
ATOM   6013  N N   . ALA B 1 197 ? 44.492  12.716  78.508  1.00 15.61 ? 197 ALA B N   1 
ATOM   6014  C CA  . ALA B 1 197 ? 44.677  14.050  77.939  1.00 16.40 ? 197 ALA B CA  1 
ATOM   6015  C C   . ALA B 1 197 ? 44.581  15.166  78.977  1.00 16.52 ? 197 ALA B C   1 
ATOM   6016  O O   . ALA B 1 197 ? 45.036  16.294  78.747  1.00 16.69 ? 197 ALA B O   1 
ATOM   6017  C CB  . ALA B 1 197 ? 43.656  14.285  76.846  1.00 16.63 ? 197 ALA B CB  1 
ATOM   6018  N N   . GLN B 1 198 ? 43.976  14.856  80.108  1.00 16.14 ? 198 GLN B N   1 
ATOM   6019  C CA  . GLN B 1 198 ? 43.761  15.837  81.144  1.00 16.72 ? 198 GLN B CA  1 
ATOM   6020  C C   . GLN B 1 198 ? 44.719  15.689  82.331  1.00 16.56 ? 198 GLN B C   1 
ATOM   6021  O O   . GLN B 1 198 ? 44.570  16.388  83.332  1.00 16.96 ? 198 GLN B O   1 
ATOM   6022  C CB  . GLN B 1 198 ? 42.326  15.705  81.624  1.00 16.89 ? 198 GLN B CB  1 
ATOM   6023  C CG  . GLN B 1 198 ? 41.306  15.880  80.482  1.00 18.08 ? 198 GLN B CG  1 
ATOM   6024  C CD  . GLN B 1 198 ? 39.895  15.747  80.968  1.00 20.12 ? 198 GLN B CD  1 
ATOM   6025  O OE1 . GLN B 1 198 ? 39.406  16.603  81.705  1.00 20.64 ? 198 GLN B OE1 1 
ATOM   6026  N NE2 . GLN B 1 198 ? 39.236  14.651  80.589  1.00 18.61 ? 198 GLN B NE2 1 
ATOM   6027  N N   . LEU B 1 199 ? 45.706  14.806  82.199  1.00 15.97 ? 199 LEU B N   1 
ATOM   6028  C CA  . LEU B 1 199 ? 46.599  14.466  83.301  1.00 15.60 ? 199 LEU B CA  1 
ATOM   6029  C C   . LEU B 1 199 ? 48.065  14.790  83.069  1.00 15.71 ? 199 LEU B C   1 
ATOM   6030  O O   . LEU B 1 199 ? 48.533  14.829  81.948  1.00 14.68 ? 199 LEU B O   1 
ATOM   6031  C CB  . LEU B 1 199 ? 46.528  12.960  83.548  1.00 15.56 ? 199 LEU B CB  1 
ATOM   6032  C CG  . LEU B 1 199 ? 45.206  12.386  84.053  1.00 16.14 ? 199 LEU B CG  1 
ATOM   6033  C CD1 . LEU B 1 199 ? 45.330  10.894  84.072  1.00 17.21 ? 199 LEU B CD1 1 
ATOM   6034  C CD2 . LEU B 1 199 ? 44.872  12.919  85.433  1.00 17.24 ? 199 LEU B CD2 1 
ATOM   6035  N N   . ASN B 1 200 ? 48.782  14.963  84.175  1.00 16.42 ? 200 ASN B N   1 
ATOM   6036  C CA  . ASN B 1 200 ? 50.212  15.169  84.160  1.00 16.70 ? 200 ASN B CA  1 
ATOM   6037  C C   . ASN B 1 200 ? 50.851  13.901  84.679  1.00 16.36 ? 200 ASN B C   1 
ATOM   6038  O O   . ASN B 1 200 ? 50.586  13.496  85.804  1.00 15.82 ? 200 ASN B O   1 
ATOM   6039  C CB  . ASN B 1 200 ? 50.585  16.343  85.046  1.00 17.36 ? 200 ASN B CB  1 
ATOM   6040  C CG  . ASN B 1 200 ? 52.048  16.722  84.929  1.00 17.93 ? 200 ASN B CG  1 
ATOM   6041  O OD1 . ASN B 1 200 ? 52.875  15.917  84.532  1.00 18.91 ? 200 ASN B OD1 1 
ATOM   6042  N ND2 . ASN B 1 200 ? 52.368  17.955  85.296  1.00 21.77 ? 200 ASN B ND2 1 
ATOM   6043  N N   . PRO B 1 201 ? 51.712  13.284  83.881  1.00 16.12 ? 201 PRO B N   1 
ATOM   6044  C CA  . PRO B 1 201 ? 52.357  12.036  84.288  1.00 16.36 ? 201 PRO B CA  1 
ATOM   6045  C C   . PRO B 1 201 ? 53.151  12.205  85.574  1.00 15.70 ? 201 PRO B C   1 
ATOM   6046  O O   . PRO B 1 201 ? 53.277  11.256  86.333  1.00 15.61 ? 201 PRO B O   1 
ATOM   6047  C CB  . PRO B 1 201 ? 53.308  11.713  83.126  1.00 16.42 ? 201 PRO B CB  1 
ATOM   6048  C CG  . PRO B 1 201 ? 53.057  12.715  82.064  1.00 17.72 ? 201 PRO B CG  1 
ATOM   6049  C CD  . PRO B 1 201 ? 52.169  13.768  82.568  1.00 17.15 ? 201 PRO B CD  1 
ATOM   6050  N N   . GLU B 1 202 ? 53.643  13.410  85.848  1.00 15.22 ? 202 GLU B N   1 
ATOM   6051  C CA  . GLU B 1 202 ? 54.438  13.631  87.063  1.00 15.58 ? 202 GLU B CA  1 
ATOM   6052  C C   . GLU B 1 202 ? 53.644  13.574  88.370  1.00 15.35 ? 202 GLU B C   1 
ATOM   6053  O O   . GLU B 1 202 ? 54.224  13.352  89.441  1.00 14.82 ? 202 GLU B O   1 
ATOM   6054  C CB  . GLU B 1 202 ? 55.136  14.982  86.981  1.00 15.82 ? 202 GLU B CB  1 
ATOM   6055  C CG  . GLU B 1 202 ? 56.148  15.047  85.847  1.00 18.30 ? 202 GLU B CG  1 
ATOM   6056  C CD  . GLU B 1 202 ? 56.795  16.401  85.702  1.00 21.15 ? 202 GLU B CD  1 
ATOM   6057  O OE1 . GLU B 1 202 ? 57.172  17.014  86.724  1.00 19.52 ? 202 GLU B OE1 1 
ATOM   6058  O OE2 . GLU B 1 202 ? 56.939  16.825  84.542  1.00 26.58 ? 202 GLU B OE2 1 
ATOM   6059  N N   . SER B 1 203 ? 52.330  13.772  88.287  1.00 15.13 ? 203 SER B N   1 
ATOM   6060  C CA  . SER B 1 203 ? 51.490  13.842  89.480  1.00 15.00 ? 203 SER B CA  1 
ATOM   6061  C C   . SER B 1 203 ? 50.258  12.934  89.451  1.00 15.23 ? 203 SER B C   1 
ATOM   6062  O O   . SER B 1 203 ? 49.309  13.159  90.191  1.00 14.74 ? 203 SER B O   1 
ATOM   6063  C CB  . SER B 1 203 ? 51.046  15.287  89.703  1.00 15.01 ? 203 SER B CB  1 
ATOM   6064  O OG  . SER B 1 203 ? 50.420  15.817  88.542  1.00 16.50 ? 203 SER B OG  1 
ATOM   6065  N N   . SER B 1 204 ? 50.282  11.903  88.615  1.00 15.21 ? 204 SER B N   1 
ATOM   6066  C CA  . SER B 1 204 ? 49.167  10.975  88.503  1.00 15.40 ? 204 SER B CA  1 
ATOM   6067  C C   . SER B 1 204 ? 49.556  9.590   88.995  1.00 15.77 ? 204 SER B C   1 
ATOM   6068  O O   . SER B 1 204 ? 50.652  9.093   88.712  1.00 16.45 ? 204 SER B O   1 
ATOM   6069  C CB  . SER B 1 204 ? 48.700  10.889  87.055  1.00 15.23 ? 204 SER B CB  1 
ATOM   6070  O OG  . SER B 1 204 ? 48.175  12.130  86.633  1.00 14.74 ? 204 SER B OG  1 
ATOM   6071  N N   . LEU B 1 205 ? 48.663  8.990   89.768  1.00 15.39 ? 205 LEU B N   1 
ATOM   6072  C CA  . LEU B 1 205 ? 48.866  7.658   90.294  1.00 15.67 ? 205 LEU B CA  1 
ATOM   6073  C C   . LEU B 1 205 ? 47.756  6.738   89.768  1.00 15.27 ? 205 LEU B C   1 
ATOM   6074  O O   . LEU B 1 205 ? 46.559  7.003   89.976  1.00 15.05 ? 205 LEU B O   1 
ATOM   6075  C CB  . LEU B 1 205 ? 48.843  7.688   91.817  1.00 16.16 ? 205 LEU B CB  1 
ATOM   6076  C CG  . LEU B 1 205 ? 48.850  6.325   92.508  1.00 18.27 ? 205 LEU B CG  1 
ATOM   6077  C CD1 . LEU B 1 205 ? 50.220  5.735   92.456  1.00 19.75 ? 205 LEU B CD1 1 
ATOM   6078  C CD2 . LEU B 1 205 ? 48.408  6.490   93.943  1.00 20.74 ? 205 LEU B CD2 1 
ATOM   6079  N N   . PHE B 1 206 ? 48.162  5.651   89.117  1.00 14.91 ? 206 PHE B N   1 
ATOM   6080  C CA  . PHE B 1 206 ? 47.233  4.678   88.565  1.00 14.39 ? 206 PHE B CA  1 
ATOM   6081  C C   . PHE B 1 206 ? 47.077  3.494   89.490  1.00 15.15 ? 206 PHE B C   1 
ATOM   6082  O O   . PHE B 1 206 ? 48.057  2.989   90.074  1.00 14.57 ? 206 PHE B O   1 
ATOM   6083  C CB  . PHE B 1 206 ? 47.701  4.206   87.189  1.00 14.61 ? 206 PHE B CB  1 
ATOM   6084  C CG  . PHE B 1 206 ? 47.749  5.301   86.180  1.00 13.38 ? 206 PHE B CG  1 
ATOM   6085  C CD1 . PHE B 1 206 ? 48.882  6.088   86.049  1.00 12.90 ? 206 PHE B CD1 1 
ATOM   6086  C CD2 . PHE B 1 206 ? 46.632  5.585   85.401  1.00 13.55 ? 206 PHE B CD2 1 
ATOM   6087  C CE1 . PHE B 1 206 ? 48.924  7.109   85.135  1.00 13.43 ? 206 PHE B CE1 1 
ATOM   6088  C CE2 . PHE B 1 206 ? 46.659  6.601   84.494  1.00 13.35 ? 206 PHE B CE2 1 
ATOM   6089  C CZ  . PHE B 1 206 ? 47.813  7.371   84.349  1.00 12.42 ? 206 PHE B CZ  1 
ATOM   6090  N N   . ILE B 1 207 ? 45.826  3.068   89.628  1.00 14.58 ? 207 ILE B N   1 
ATOM   6091  C CA  . ILE B 1 207 ? 45.464  1.939   90.446  1.00 14.33 ? 207 ILE B CA  1 
ATOM   6092  C C   . ILE B 1 207 ? 44.892  0.889   89.520  1.00 13.97 ? 207 ILE B C   1 
ATOM   6093  O O   . ILE B 1 207 ? 43.818  1.089   88.955  1.00 12.99 ? 207 ILE B O   1 
ATOM   6094  C CB  . ILE B 1 207 ? 44.399  2.349   91.472  1.00 15.15 ? 207 ILE B CB  1 
ATOM   6095  C CG1 . ILE B 1 207 ? 44.929  3.463   92.389  1.00 16.36 ? 207 ILE B CG1 1 
ATOM   6096  C CG2 . ILE B 1 207 ? 43.969  1.130   92.280  1.00 15.74 ? 207 ILE B CG2 1 
ATOM   6097  C CD1 . ILE B 1 207 ? 43.896  4.009   93.323  1.00 18.35 ? 207 ILE B CD1 1 
ATOM   6098  N N   . ILE B 1 208 ? 45.621  -0.206  89.335  1.00 13.96 ? 208 ILE B N   1 
ATOM   6099  C CA  . ILE B 1 208 ? 45.174  -1.267  88.449  1.00 14.02 ? 208 ILE B CA  1 
ATOM   6100  C C   . ILE B 1 208 ? 44.429  -2.316  89.274  1.00 14.43 ? 208 ILE B C   1 
ATOM   6101  O O   . ILE B 1 208 ? 45.042  -3.061  90.047  1.00 13.37 ? 208 ILE B O   1 
ATOM   6102  C CB  . ILE B 1 208 ? 46.356  -1.894  87.719  1.00 13.77 ? 208 ILE B CB  1 
ATOM   6103  C CG1 . ILE B 1 208 ? 47.281  -0.808  87.169  1.00 13.22 ? 208 ILE B CG1 1 
ATOM   6104  C CG2 . ILE B 1 208 ? 45.852  -2.796  86.609  1.00 14.18 ? 208 ILE B CG2 1 
ATOM   6105  C CD1 . ILE B 1 208 ? 46.577  0.219   86.264  1.00 12.83 ? 208 ILE B CD1 1 
ATOM   6106  N N   . ALA B 1 209 ? 43.109  -2.358  89.101  1.00 14.82 ? 209 ALA B N   1 
ATOM   6107  C CA  . ALA B 1 209 ? 42.243  -3.249  89.869  1.00 15.50 ? 209 ALA B CA  1 
ATOM   6108  C C   . ALA B 1 209 ? 41.836  -4.503  89.101  1.00 16.28 ? 209 ALA B C   1 
ATOM   6109  O O   . ALA B 1 209 ? 40.921  -4.482  88.260  1.00 16.52 ? 209 ALA B O   1 
ATOM   6110  C CB  . ALA B 1 209 ? 41.012  -2.491  90.362  1.00 15.40 ? 209 ALA B CB  1 
ATOM   6111  N N   . SER B 1 210 ? 42.533  -5.598  89.416  1.00 17.16 ? 210 SER B N   1 
ATOM   6112  C CA  . SER B 1 210 ? 42.311  -6.898  88.804  1.00 18.14 ? 210 SER B CA  1 
ATOM   6113  C C   . SER B 1 210 ? 42.905  -8.025  89.672  1.00 18.27 ? 210 SER B C   1 
ATOM   6114  O O   . SER B 1 210 ? 44.126  -8.122  89.836  1.00 18.94 ? 210 SER B O   1 
ATOM   6115  C CB  . SER B 1 210 ? 42.954  -6.956  87.421  1.00 18.11 ? 210 SER B CB  1 
ATOM   6116  O OG  . SER B 1 210 ? 42.958  -8.289  86.945  1.00 19.11 ? 210 SER B OG  1 
ATOM   6117  N N   . LYS B 1 211 ? 42.041  -8.879  90.202  1.00 18.46 ? 211 LYS B N   1 
ATOM   6118  C CA  . LYS B 1 211 ? 42.474  -9.988  91.053  1.00 18.71 ? 211 LYS B CA  1 
ATOM   6119  C C   . LYS B 1 211 ? 43.544  -10.840 90.383  1.00 18.37 ? 211 LYS B C   1 
ATOM   6120  O O   . LYS B 1 211 ? 44.595  -11.091 90.965  1.00 18.02 ? 211 LYS B O   1 
ATOM   6121  C CB  . LYS B 1 211 ? 41.279  -10.872 91.407  1.00 18.59 ? 211 LYS B CB  1 
ATOM   6122  C CG  . LYS B 1 211 ? 41.632  -12.148 92.154  1.00 21.11 ? 211 LYS B CG  1 
ATOM   6123  C CD  . LYS B 1 211 ? 41.870  -11.899 93.624  1.00 21.53 ? 211 LYS B CD  1 
ATOM   6124  C CE  . LYS B 1 211 ? 41.666  -13.160 94.442  1.00 22.34 ? 211 LYS B CE  1 
ATOM   6125  N NZ  . LYS B 1 211 ? 42.756  -14.161 94.200  1.00 20.47 ? 211 LYS B NZ  1 
ATOM   6126  N N   . THR B 1 212 ? 43.273  -11.279 89.160  1.00 18.37 ? 212 THR B N   1 
ATOM   6127  C CA  . THR B 1 212 ? 44.198  -12.155 88.444  1.00 18.72 ? 212 THR B CA  1 
ATOM   6128  C C   . THR B 1 212 ? 45.325  -11.388 87.792  1.00 18.65 ? 212 THR B C   1 
ATOM   6129  O O   . THR B 1 212 ? 46.357  -11.957 87.444  1.00 19.14 ? 212 THR B O   1 
ATOM   6130  C CB  . THR B 1 212 ? 43.469  -12.886 87.343  1.00 18.64 ? 212 THR B CB  1 
ATOM   6131  O OG1 . THR B 1 212 ? 42.867  -11.924 86.474  1.00 20.75 ? 212 THR B OG1 1 
ATOM   6132  C CG2 . THR B 1 212 ? 42.311  -13.719 87.894  1.00 19.38 ? 212 THR B CG2 1 
ATOM   6133  N N   . PHE B 1 213 ? 45.105  -10.091 87.615  1.00 18.07 ? 213 PHE B N   1 
ATOM   6134  C CA  . PHE B 1 213 ? 45.992  -9.234  86.855  1.00 17.98 ? 213 PHE B CA  1 
ATOM   6135  C C   . PHE B 1 213 ? 46.165  -9.745  85.429  1.00 17.94 ? 213 PHE B C   1 
ATOM   6136  O O   . PHE B 1 213 ? 47.203  -9.538  84.812  1.00 18.51 ? 213 PHE B O   1 
ATOM   6137  C CB  . PHE B 1 213 ? 47.345  -9.036  87.519  1.00 17.90 ? 213 PHE B CB  1 
ATOM   6138  C CG  . PHE B 1 213 ? 47.777  -7.600  87.533  1.00 17.08 ? 213 PHE B CG  1 
ATOM   6139  C CD1 . PHE B 1 213 ? 47.081  -6.673  88.290  1.00 18.29 ? 213 PHE B CD1 1 
ATOM   6140  C CD2 . PHE B 1 213 ? 48.848  -7.166  86.780  1.00 17.58 ? 213 PHE B CD2 1 
ATOM   6141  C CE1 . PHE B 1 213 ? 47.467  -5.346  88.314  1.00 18.09 ? 213 PHE B CE1 1 
ATOM   6142  C CE2 . PHE B 1 213 ? 49.227  -5.833  86.795  1.00 18.58 ? 213 PHE B CE2 1 
ATOM   6143  C CZ  . PHE B 1 213 ? 48.536  -4.928  87.565  1.00 19.03 ? 213 PHE B CZ  1 
ATOM   6144  N N   . THR B 1 214 ? 45.138  -10.405 84.917  1.00 17.71 ? 214 THR B N   1 
ATOM   6145  C CA  . THR B 1 214 ? 45.123  -10.819 83.530  1.00 18.03 ? 214 THR B CA  1 
ATOM   6146  C C   . THR B 1 214 ? 43.830  -10.393 82.841  1.00 17.90 ? 214 THR B C   1 
ATOM   6147  O O   . THR B 1 214 ? 43.659  -10.650 81.657  1.00 18.63 ? 214 THR B O   1 
ATOM   6148  C CB  . THR B 1 214 ? 45.341  -12.334 83.378  1.00 18.26 ? 214 THR B CB  1 
ATOM   6149  O OG1 . THR B 1 214 ? 44.296  -13.056 84.033  1.00 17.57 ? 214 THR B OG1 1 
ATOM   6150  C CG2 . THR B 1 214 ? 46.648  -12.774 84.054  1.00 19.10 ? 214 THR B CG2 1 
ATOM   6151  N N   . THR B 1 215 ? 42.933  -9.715  83.554  1.00 17.31 ? 215 THR B N   1 
ATOM   6152  C CA  . THR B 1 215 ? 41.674  -9.278  82.955  1.00 16.53 ? 215 THR B CA  1 
ATOM   6153  C C   . THR B 1 215 ? 41.927  -8.460  81.688  1.00 15.80 ? 215 THR B C   1 
ATOM   6154  O O   . THR B 1 215 ? 42.532  -7.394  81.753  1.00 15.10 ? 215 THR B O   1 
ATOM   6155  C CB  . THR B 1 215 ? 40.897  -8.412  83.934  1.00 16.89 ? 215 THR B CB  1 
ATOM   6156  O OG1 . THR B 1 215 ? 40.886  -9.029  85.230  1.00 16.76 ? 215 THR B OG1 1 
ATOM   6157  C CG2 . THR B 1 215 ? 39.433  -8.313  83.511  1.00 15.85 ? 215 THR B CG2 1 
ATOM   6158  N N   . GLN B 1 216 ? 41.423  -8.937  80.556  1.00 14.95 ? 216 GLN B N   1 
ATOM   6159  C CA  . GLN B 1 216 ? 41.752  -8.329  79.258  1.00 14.25 ? 216 GLN B CA  1 
ATOM   6160  C C   . GLN B 1 216 ? 41.520  -6.820  79.159  1.00 13.69 ? 216 GLN B C   1 
ATOM   6161  O O   . GLN B 1 216 ? 42.432  -6.080  78.844  1.00 13.26 ? 216 GLN B O   1 
ATOM   6162  C CB  . GLN B 1 216 ? 40.993  -8.998  78.103  1.00 14.16 ? 216 GLN B CB  1 
ATOM   6163  C CG  . GLN B 1 216 ? 41.402  -8.414  76.714  1.00 14.26 ? 216 GLN B CG  1 
ATOM   6164  C CD  . GLN B 1 216 ? 40.587  -8.988  75.561  1.00 16.37 ? 216 GLN B CD  1 
ATOM   6165  O OE1 . GLN B 1 216 ? 41.102  -9.183  74.453  1.00 15.86 ? 216 GLN B OE1 1 
ATOM   6166  N NE2 . GLN B 1 216 ? 39.317  -9.267  75.825  1.00 16.05 ? 216 GLN B NE2 1 
ATOM   6167  N N   . GLU B 1 217 ? 40.298  -6.370  79.405  1.00 13.01 ? 217 GLU B N   1 
ATOM   6168  C CA  . GLU B 1 217 ? 40.017  -4.966  79.211  1.00 12.96 ? 217 GLU B CA  1 
ATOM   6169  C C   . GLU B 1 217 ? 40.843  -4.141  80.163  1.00 12.34 ? 217 GLU B C   1 
ATOM   6170  O O   . GLU B 1 217 ? 41.468  -3.174  79.769  1.00 12.02 ? 217 GLU B O   1 
ATOM   6171  C CB  . GLU B 1 217 ? 38.540  -4.679  79.359  1.00 13.46 ? 217 GLU B CB  1 
ATOM   6172  C CG  . GLU B 1 217 ? 37.693  -5.448  78.342  1.00 15.02 ? 217 GLU B CG  1 
ATOM   6173  C CD  . GLU B 1 217 ? 36.242  -5.043  78.387  1.00 15.48 ? 217 GLU B CD  1 
ATOM   6174  O OE1 . GLU B 1 217 ? 35.364  -5.888  78.131  1.00 17.08 ? 217 GLU B OE1 1 
ATOM   6175  O OE2 . GLU B 1 217 ? 35.973  -3.869  78.691  1.00 17.64 ? 217 GLU B OE2 1 
ATOM   6176  N N   . THR B 1 218 ? 40.880  -4.547  81.416  1.00 12.28 ? 218 THR B N   1 
ATOM   6177  C CA  . THR B 1 218 ? 41.616  -3.797  82.410  1.00 12.01 ? 218 THR B CA  1 
ATOM   6178  C C   . THR B 1 218 ? 43.127  -3.714  82.132  1.00 12.67 ? 218 THR B C   1 
ATOM   6179  O O   . THR B 1 218 ? 43.703  -2.633  82.191  1.00 11.64 ? 218 THR B O   1 
ATOM   6180  C CB  . THR B 1 218 ? 41.343  -4.418  83.767  1.00 12.43 ? 218 THR B CB  1 
ATOM   6181  O OG1 . THR B 1 218 ? 39.942  -4.265  84.069  1.00 12.17 ? 218 THR B OG1 1 
ATOM   6182  C CG2 . THR B 1 218 ? 42.105  -3.673  84.876  1.00 12.61 ? 218 THR B CG2 1 
ATOM   6183  N N   . ILE B 1 219 ? 43.773  -4.844  81.839  1.00 12.91 ? 219 ILE B N   1 
ATOM   6184  C CA  . ILE B 1 219 ? 45.213  -4.823  81.568  1.00 13.78 ? 219 ILE B CA  1 
ATOM   6185  C C   . ILE B 1 219 ? 45.539  -4.074  80.255  1.00 12.89 ? 219 ILE B C   1 
ATOM   6186  O O   . ILE B 1 219 ? 46.572  -3.441  80.152  1.00 13.69 ? 219 ILE B O   1 
ATOM   6187  C CB  . ILE B 1 219 ? 45.802  -6.251  81.588  1.00 14.39 ? 219 ILE B CB  1 
ATOM   6188  C CG1 . ILE B 1 219 ? 45.597  -6.888  82.964  1.00 15.40 ? 219 ILE B CG1 1 
ATOM   6189  C CG2 . ILE B 1 219 ? 47.281  -6.227  81.214  1.00 16.50 ? 219 ILE B CG2 1 
ATOM   6190  C CD1 . ILE B 1 219 ? 46.176  -6.083  84.107  1.00 17.19 ? 219 ILE B CD1 1 
ATOM   6191  N N   . THR B 1 220 ? 44.650  -4.106  79.269  1.00 12.49 ? 220 THR B N   1 
ATOM   6192  C CA  . THR B 1 220 ? 44.886  -3.341  78.043  1.00 11.86 ? 220 THR B CA  1 
ATOM   6193  C C   . THR B 1 220 ? 44.890  -1.866  78.404  1.00 11.71 ? 220 THR B C   1 
ATOM   6194  O O   . THR B 1 220 ? 45.787  -1.121  78.031  1.00 11.64 ? 220 THR B O   1 
ATOM   6195  C CB  . THR B 1 220 ? 43.810  -3.615  77.009  1.00 12.11 ? 220 THR B CB  1 
ATOM   6196  O OG1 . THR B 1 220 ? 43.807  -5.005  76.657  1.00 10.36 ? 220 THR B OG1 1 
ATOM   6197  C CG2 . THR B 1 220 ? 44.114  -2.893  75.717  1.00 11.59 ? 220 THR B CG2 1 
ATOM   6198  N N   . ASN B 1 221 ? 43.870  -1.438  79.139  1.00 11.41 ? 221 ASN B N   1 
ATOM   6199  C CA  . ASN B 1 221 ? 43.832  -0.063  79.598  1.00 11.13 ? 221 ASN B CA  1 
ATOM   6200  C C   . ASN B 1 221 ? 45.082  0.249   80.419  1.00 11.37 ? 221 ASN B C   1 
ATOM   6201  O O   . ASN B 1 221 ? 45.672  1.318   80.266  1.00 11.35 ? 221 ASN B O   1 
ATOM   6202  C CB  . ASN B 1 221 ? 42.561  0.227   80.437  1.00 11.14 ? 221 ASN B CB  1 
ATOM   6203  C CG  . ASN B 1 221 ? 41.360  0.618   79.584  1.00 10.20 ? 221 ASN B CG  1 
ATOM   6204  O OD1 . ASN B 1 221 ? 41.500  1.307   78.583  1.00 10.21 ? 221 ASN B OD1 1 
ATOM   6205  N ND2 . ASN B 1 221 ? 40.163  0.192   80.003  1.00 9.11  ? 221 ASN B ND2 1 
ATOM   6206  N N   . ALA B 1 222 ? 45.478  -0.674  81.290  1.00 11.30 ? 222 ALA B N   1 
ATOM   6207  C CA  . ALA B 1 222 ? 46.651  -0.473  82.146  1.00 11.77 ? 222 ALA B CA  1 
ATOM   6208  C C   . ALA B 1 222 ? 47.898  -0.308  81.299  1.00 12.43 ? 222 ALA B C   1 
ATOM   6209  O O   . ALA B 1 222 ? 48.698  0.595   81.541  1.00 12.20 ? 222 ALA B O   1 
ATOM   6210  C CB  . ALA B 1 222 ? 46.837  -1.629  83.075  1.00 11.90 ? 222 ALA B CB  1 
ATOM   6211  N N   . GLU B 1 223 ? 48.048  -1.173  80.300  1.00 13.30 ? 223 GLU B N   1 
ATOM   6212  C CA  . GLU B 1 223 ? 49.214  -1.104  79.410  1.00 14.18 ? 223 GLU B CA  1 
ATOM   6213  C C   . GLU B 1 223 ? 49.229  0.173   78.602  1.00 14.19 ? 223 GLU B C   1 
ATOM   6214  O O   . GLU B 1 223 ? 50.302  0.724   78.323  1.00 14.03 ? 223 GLU B O   1 
ATOM   6215  C CB  . GLU B 1 223 ? 49.283  -2.368  78.542  1.00 14.96 ? 223 GLU B CB  1 
ATOM   6216  C CG  . GLU B 1 223 ? 49.526  -3.578  79.439  1.00 17.06 ? 223 GLU B CG  1 
ATOM   6217  C CD  . GLU B 1 223 ? 49.881  -4.856  78.724  1.00 21.10 ? 223 GLU B CD  1 
ATOM   6218  O OE1 . GLU B 1 223 ? 50.601  -5.668  79.347  1.00 26.11 ? 223 GLU B OE1 1 
ATOM   6219  O OE2 . GLU B 1 223 ? 49.434  -5.067  77.578  1.00 24.93 ? 223 GLU B OE2 1 
ATOM   6220  N N   . THR B 1 224 ? 48.046  0.683   78.247  1.00 13.59 ? 224 THR B N   1 
ATOM   6221  C CA  . THR B 1 224 ? 47.977  1.934   77.501  1.00 13.47 ? 224 THR B CA  1 
ATOM   6222  C C   . THR B 1 224 ? 48.421  3.086   78.392  1.00 13.51 ? 224 THR B C   1 
ATOM   6223  O O   . THR B 1 224 ? 49.147  3.977   77.958  1.00 12.97 ? 224 THR B O   1 
ATOM   6224  C CB  . THR B 1 224 ? 46.573  2.145   76.949  1.00 13.59 ? 224 THR B CB  1 
ATOM   6225  O OG1 . THR B 1 224 ? 46.351  1.191   75.915  1.00 13.42 ? 224 THR B OG1 1 
ATOM   6226  C CG2 . THR B 1 224 ? 46.423  3.506   76.265  1.00 13.53 ? 224 THR B CG2 1 
ATOM   6227  N N   . ALA B 1 225 ? 48.010  3.049   79.654  1.00 14.24 ? 225 ALA B N   1 
ATOM   6228  C CA  . ALA B 1 225 ? 48.389  4.092   80.606  1.00 14.35 ? 225 ALA B CA  1 
ATOM   6229  C C   . ALA B 1 225 ? 49.899  4.057   80.862  1.00 14.67 ? 225 ALA B C   1 
ATOM   6230  O O   . ALA B 1 225 ? 50.554  5.103   80.937  1.00 13.68 ? 225 ALA B O   1 
ATOM   6231  C CB  . ALA B 1 225 ? 47.631  3.908   81.913  1.00 14.67 ? 225 ALA B CB  1 
ATOM   6232  N N   . LYS B 1 226 ? 50.454  2.857   80.983  1.00 14.87 ? 226 LYS B N   1 
ATOM   6233  C CA  . LYS B 1 226 ? 51.895  2.728   81.226  1.00 15.75 ? 226 LYS B CA  1 
ATOM   6234  C C   . LYS B 1 226 ? 52.706  3.281   80.052  1.00 15.99 ? 226 LYS B C   1 
ATOM   6235  O O   . LYS B 1 226 ? 53.708  3.953   80.243  1.00 15.98 ? 226 LYS B O   1 
ATOM   6236  C CB  . LYS B 1 226 ? 52.287  1.278   81.524  1.00 15.78 ? 226 LYS B CB  1 
ATOM   6237  C CG  . LYS B 1 226 ? 53.809  1.103   81.719  1.00 17.16 ? 226 LYS B CG  1 
ATOM   6238  C CD  . LYS B 1 226 ? 54.173  -0.217  82.366  1.00 18.22 ? 226 LYS B CD  1 
ATOM   6239  C CE  . LYS B 1 226 ? 53.687  -1.399  81.563  1.00 20.21 ? 226 LYS B CE  1 
ATOM   6240  N NZ  . LYS B 1 226 ? 54.503  -2.639  81.834  1.00 20.23 ? 226 LYS B NZ  1 
ATOM   6241  N N   . GLU B 1 227 ? 52.243  3.014   78.842  1.00 16.02 ? 227 GLU B N   1 
ATOM   6242  C CA  . GLU B 1 227 ? 52.916  3.458   77.634  1.00 16.64 ? 227 GLU B CA  1 
ATOM   6243  C C   . GLU B 1 227 ? 52.935  4.977   77.587  1.00 16.23 ? 227 GLU B C   1 
ATOM   6244  O O   . GLU B 1 227 ? 53.973  5.580   77.303  1.00 16.05 ? 227 GLU B O   1 
ATOM   6245  C CB  . GLU B 1 227 ? 52.222  2.875   76.395  1.00 16.56 ? 227 GLU B CB  1 
ATOM   6246  C CG  . GLU B 1 227 ? 52.773  3.360   75.056  1.00 18.86 ? 227 GLU B CG  1 
ATOM   6247  C CD  . GLU B 1 227 ? 52.050  2.716   73.874  1.00 21.21 ? 227 GLU B CD  1 
ATOM   6248  O OE1 . GLU B 1 227 ? 50.925  3.141   73.566  1.00 21.17 ? 227 GLU B OE1 1 
ATOM   6249  O OE2 . GLU B 1 227 ? 52.604  1.787   73.254  1.00 23.95 ? 227 GLU B OE2 1 
ATOM   6250  N N   . TRP B 1 228 ? 51.797  5.584   77.905  1.00 15.49 ? 228 TRP B N   1 
ATOM   6251  C CA  . TRP B 1 228 ? 51.673  7.042   77.973  1.00 15.44 ? 228 TRP B CA  1 
ATOM   6252  C C   . TRP B 1 228 ? 52.607  7.604   79.045  1.00 15.55 ? 228 TRP B C   1 
ATOM   6253  O O   . TRP B 1 228 ? 53.279  8.613   78.842  1.00 15.15 ? 228 TRP B O   1 
ATOM   6254  C CB  . TRP B 1 228 ? 50.227  7.410   78.281  1.00 15.27 ? 228 TRP B CB  1 
ATOM   6255  C CG  . TRP B 1 228 ? 49.945  8.841   78.638  1.00 14.80 ? 228 TRP B CG  1 
ATOM   6256  C CD1 . TRP B 1 228 ? 49.634  9.872   77.787  1.00 15.69 ? 228 TRP B CD1 1 
ATOM   6257  C CD2 . TRP B 1 228 ? 49.861  9.379   79.958  1.00 15.11 ? 228 TRP B CD2 1 
ATOM   6258  N NE1 . TRP B 1 228 ? 49.392  11.022  78.505  1.00 15.95 ? 228 TRP B NE1 1 
ATOM   6259  C CE2 . TRP B 1 228 ? 49.527  10.748  79.840  1.00 15.83 ? 228 TRP B CE2 1 
ATOM   6260  C CE3 . TRP B 1 228 ? 50.052  8.846   81.236  1.00 15.33 ? 228 TRP B CE3 1 
ATOM   6261  C CZ2 . TRP B 1 228 ? 49.383  11.573  80.938  1.00 15.84 ? 228 TRP B CZ2 1 
ATOM   6262  C CZ3 . TRP B 1 228 ? 49.905  9.676   82.325  1.00 15.36 ? 228 TRP B CZ3 1 
ATOM   6263  C CH2 . TRP B 1 228 ? 49.565  11.015  82.171  1.00 15.01 ? 228 TRP B CH2 1 
ATOM   6264  N N   . PHE B 1 229 ? 52.631  6.950   80.194  1.00 15.80 ? 229 PHE B N   1 
ATOM   6265  C CA  . PHE B 1 229 ? 53.479  7.392   81.278  1.00 16.21 ? 229 PHE B CA  1 
ATOM   6266  C C   . PHE B 1 229 ? 54.966  7.339   80.882  1.00 16.87 ? 229 PHE B C   1 
ATOM   6267  O O   . PHE B 1 229 ? 55.698  8.309   81.067  1.00 16.28 ? 229 PHE B O   1 
ATOM   6268  C CB  . PHE B 1 229 ? 53.237  6.544   82.520  1.00 16.06 ? 229 PHE B CB  1 
ATOM   6269  C CG  . PHE B 1 229 ? 54.193  6.845   83.622  1.00 15.42 ? 229 PHE B CG  1 
ATOM   6270  C CD1 . PHE B 1 229 ? 54.036  7.973   84.384  1.00 14.63 ? 229 PHE B CD1 1 
ATOM   6271  C CD2 . PHE B 1 229 ? 55.291  6.030   83.850  1.00 16.63 ? 229 PHE B CD2 1 
ATOM   6272  C CE1 . PHE B 1 229 ? 54.935  8.280   85.397  1.00 15.77 ? 229 PHE B CE1 1 
ATOM   6273  C CE2 . PHE B 1 229 ? 56.202  6.334   84.867  1.00 15.22 ? 229 PHE B CE2 1 
ATOM   6274  C CZ  . PHE B 1 229 ? 56.020  7.456   85.630  1.00 14.81 ? 229 PHE B CZ  1 
ATOM   6275  N N   . LEU B 1 230 ? 55.406  6.210   80.332  1.00 17.46 ? 230 LEU B N   1 
ATOM   6276  C CA  . LEU B 1 230 ? 56.810  6.062   79.939  1.00 18.83 ? 230 LEU B CA  1 
ATOM   6277  C C   . LEU B 1 230 ? 57.253  6.972   78.795  1.00 19.90 ? 230 LEU B C   1 
ATOM   6278  O O   . LEU B 1 230 ? 58.447  7.271   78.651  1.00 19.47 ? 230 LEU B O   1 
ATOM   6279  C CB  . LEU B 1 230 ? 57.109  4.605   79.602  1.00 18.85 ? 230 LEU B CB  1 
ATOM   6280  C CG  . LEU B 1 230 ? 57.138  3.708   80.828  1.00 19.23 ? 230 LEU B CG  1 
ATOM   6281  C CD1 . LEU B 1 230 ? 57.257  2.237   80.430  1.00 20.70 ? 230 LEU B CD1 1 
ATOM   6282  C CD2 . LEU B 1 230 ? 58.269  4.113   81.778  1.00 20.99 ? 230 LEU B CD2 1 
ATOM   6283  N N   . GLN B 1 231 ? 56.296  7.403   77.980  1.00 21.07 ? 231 GLN B N   1 
ATOM   6284  C CA  . GLN B 1 231 ? 56.572  8.352   76.904  1.00 22.12 ? 231 GLN B CA  1 
ATOM   6285  C C   . GLN B 1 231 ? 57.175  9.616   77.525  1.00 21.64 ? 231 GLN B C   1 
ATOM   6286  O O   . GLN B 1 231 ? 58.074  10.231  76.954  1.00 21.17 ? 231 GLN B O   1 
ATOM   6287  C CB  . GLN B 1 231 ? 55.271  8.607   76.111  1.00 22.89 ? 231 GLN B CB  1 
ATOM   6288  C CG  . GLN B 1 231 ? 55.092  9.945   75.371  1.00 27.28 ? 231 GLN B CG  1 
ATOM   6289  C CD  . GLN B 1 231 ? 53.678  10.048  74.758  1.00 32.20 ? 231 GLN B CD  1 
ATOM   6290  O OE1 . GLN B 1 231 ? 52.811  10.800  75.246  1.00 34.22 ? 231 GLN B OE1 1 
ATOM   6291  N NE2 . GLN B 1 231 ? 53.437  9.258   73.717  1.00 35.24 ? 231 GLN B NE2 1 
ATOM   6292  N N   . ALA B 1 232 ? 56.719  9.977   78.722  1.00 21.13 ? 232 ALA B N   1 
ATOM   6293  C CA  . ALA B 1 232 ? 57.260  11.146  79.414  1.00 20.86 ? 232 ALA B CA  1 
ATOM   6294  C C   . ALA B 1 232 ? 58.408  10.765  80.357  1.00 20.82 ? 232 ALA B C   1 
ATOM   6295  O O   . ALA B 1 232 ? 59.438  11.418  80.372  1.00 20.76 ? 232 ALA B O   1 
ATOM   6296  C CB  . ALA B 1 232 ? 56.162  11.857  80.194  1.00 20.62 ? 232 ALA B CB  1 
ATOM   6297  N N   . ALA B 1 233 ? 58.232  9.696   81.126  1.00 20.78 ? 233 ALA B N   1 
ATOM   6298  C CA  . ALA B 1 233 ? 59.192  9.331   82.165  1.00 21.16 ? 233 ALA B CA  1 
ATOM   6299  C C   . ALA B 1 233 ? 60.405  8.552   81.650  1.00 22.11 ? 233 ALA B C   1 
ATOM   6300  O O   . ALA B 1 233 ? 61.500  8.645   82.217  1.00 21.20 ? 233 ALA B O   1 
ATOM   6301  C CB  . ALA B 1 233 ? 58.496  8.541   83.269  1.00 21.04 ? 233 ALA B CB  1 
ATOM   6302  N N   . LYS B 1 234 ? 60.187  7.751   80.612  1.00 23.74 ? 234 LYS B N   1 
ATOM   6303  C CA  . LYS B 1 234 ? 61.252  6.973   79.962  1.00 25.20 ? 234 LYS B CA  1 
ATOM   6304  C C   . LYS B 1 234 ? 61.797  5.816   80.811  1.00 25.36 ? 234 LYS B C   1 
ATOM   6305  O O   . LYS B 1 234 ? 61.906  4.696   80.330  1.00 25.78 ? 234 LYS B O   1 
ATOM   6306  C CB  . LYS B 1 234 ? 62.391  7.891   79.506  1.00 25.79 ? 234 LYS B CB  1 
ATOM   6307  C CG  . LYS B 1 234 ? 62.176  8.543   78.139  1.00 28.57 ? 234 LYS B CG  1 
ATOM   6308  C CD  . LYS B 1 234 ? 61.779  10.013  78.232  1.00 30.99 ? 234 LYS B CD  1 
ATOM   6309  C CE  . LYS B 1 234 ? 61.873  10.727  76.875  1.00 32.21 ? 234 LYS B CE  1 
ATOM   6310  N NZ  . LYS B 1 234 ? 60.715  10.468  75.946  1.00 33.73 ? 234 LYS B NZ  1 
ATOM   6311  N N   . ASP B 1 235 ? 62.120  6.087   82.070  1.00 25.52 ? 235 ASP B N   1 
ATOM   6312  C CA  . ASP B 1 235 ? 62.681  5.092   82.977  1.00 25.70 ? 235 ASP B CA  1 
ATOM   6313  C C   . ASP B 1 235 ? 61.664  4.079   83.527  1.00 25.10 ? 235 ASP B C   1 
ATOM   6314  O O   . ASP B 1 235 ? 60.756  4.445   84.277  1.00 24.93 ? 235 ASP B O   1 
ATOM   6315  C CB  . ASP B 1 235 ? 63.323  5.840   84.139  1.00 26.20 ? 235 ASP B CB  1 
ATOM   6316  C CG  . ASP B 1 235 ? 64.040  4.935   85.089  1.00 28.10 ? 235 ASP B CG  1 
ATOM   6317  O OD1 . ASP B 1 235 ? 64.261  3.748   84.764  1.00 29.68 ? 235 ASP B OD1 1 
ATOM   6318  O OD2 . ASP B 1 235 ? 64.422  5.347   86.202  1.00 32.61 ? 235 ASP B OD2 1 
ATOM   6319  N N   . PRO B 1 236 ? 61.835  2.810   83.175  1.00 24.47 ? 236 PRO B N   1 
ATOM   6320  C CA  . PRO B 1 236 ? 60.933  1.742   83.634  1.00 24.28 ? 236 PRO B CA  1 
ATOM   6321  C C   . PRO B 1 236 ? 60.782  1.656   85.150  1.00 23.93 ? 236 PRO B C   1 
ATOM   6322  O O   . PRO B 1 236 ? 59.733  1.217   85.635  1.00 23.44 ? 236 PRO B O   1 
ATOM   6323  C CB  . PRO B 1 236 ? 61.603  0.458   83.119  1.00 24.50 ? 236 PRO B CB  1 
ATOM   6324  C CG  . PRO B 1 236 ? 62.509  0.900   82.009  1.00 25.01 ? 236 PRO B CG  1 
ATOM   6325  C CD  . PRO B 1 236 ? 62.902  2.307   82.291  1.00 24.36 ? 236 PRO B CD  1 
ATOM   6326  N N   . SER B 1 237 ? 61.820  2.040   85.885  1.00 23.29 ? 237 SER B N   1 
ATOM   6327  C CA  . SER B 1 237 ? 61.789  1.999   87.336  1.00 23.34 ? 237 SER B CA  1 
ATOM   6328  C C   . SER B 1 237 ? 60.839  3.060   87.900  1.00 22.43 ? 237 SER B C   1 
ATOM   6329  O O   . SER B 1 237 ? 60.414  2.961   89.037  1.00 21.82 ? 237 SER B O   1 
ATOM   6330  C CB  . SER B 1 237 ? 63.196  2.198   87.918  1.00 23.79 ? 237 SER B CB  1 
ATOM   6331  O OG  . SER B 1 237 ? 63.653  3.528   87.719  1.00 25.62 ? 237 SER B OG  1 
ATOM   6332  N N   . ALA B 1 238 ? 60.508  4.066   87.096  1.00 21.55 ? 238 ALA B N   1 
ATOM   6333  C CA  . ALA B 1 238 ? 59.577  5.118   87.522  1.00 21.34 ? 238 ALA B CA  1 
ATOM   6334  C C   . ALA B 1 238 ? 58.138  4.611   87.661  1.00 20.74 ? 238 ALA B C   1 
ATOM   6335  O O   . ALA B 1 238 ? 57.329  5.188   88.405  1.00 21.04 ? 238 ALA B O   1 
ATOM   6336  C CB  . ALA B 1 238 ? 59.622  6.271   86.560  1.00 21.47 ? 238 ALA B CB  1 
ATOM   6337  N N   . VAL B 1 239 ? 57.831  3.526   86.957  1.00 20.11 ? 239 VAL B N   1 
ATOM   6338  C CA  . VAL B 1 239 ? 56.503  2.921   86.996  1.00 19.16 ? 239 VAL B CA  1 
ATOM   6339  C C   . VAL B 1 239 ? 56.053  2.595   88.427  1.00 18.76 ? 239 VAL B C   1 
ATOM   6340  O O   . VAL B 1 239 ? 54.885  2.803   88.773  1.00 18.64 ? 239 VAL B O   1 
ATOM   6341  C CB  . VAL B 1 239 ? 56.438  1.650   86.127  1.00 18.91 ? 239 VAL B CB  1 
ATOM   6342  C CG1 . VAL B 1 239 ? 55.108  0.927   86.325  1.00 18.05 ? 239 VAL B CG1 1 
ATOM   6343  C CG2 . VAL B 1 239 ? 56.658  1.988   84.659  1.00 18.58 ? 239 VAL B CG2 1 
ATOM   6344  N N   . ALA B 1 240 ? 56.973  2.110   89.258  1.00 18.30 ? 240 ALA B N   1 
ATOM   6345  C CA  . ALA B 1 240 ? 56.653  1.758   90.648  1.00 17.96 ? 240 ALA B CA  1 
ATOM   6346  C C   . ALA B 1 240 ? 56.232  2.947   91.536  1.00 17.46 ? 240 ALA B C   1 
ATOM   6347  O O   . ALA B 1 240 ? 55.675  2.749   92.611  1.00 17.35 ? 240 ALA B O   1 
ATOM   6348  C CB  . ALA B 1 240 ? 57.838  1.026   91.294  1.00 18.11 ? 240 ALA B CB  1 
ATOM   6349  N N   . LYS B 1 241 ? 56.513  4.169   91.097  1.00 16.98 ? 241 LYS B N   1 
ATOM   6350  C CA  . LYS B 1 241 ? 56.116  5.355   91.846  1.00 16.96 ? 241 LYS B CA  1 
ATOM   6351  C C   . LYS B 1 241 ? 54.751  5.870   91.383  1.00 15.97 ? 241 LYS B C   1 
ATOM   6352  O O   . LYS B 1 241 ? 54.175  6.760   92.005  1.00 15.72 ? 241 LYS B O   1 
ATOM   6353  C CB  . LYS B 1 241 ? 57.133  6.477   91.645  1.00 17.31 ? 241 LYS B CB  1 
ATOM   6354  C CG  . LYS B 1 241 ? 58.533  6.165   92.174  1.00 19.68 ? 241 LYS B CG  1 
ATOM   6355  C CD  . LYS B 1 241 ? 59.506  7.268   91.823  1.00 22.92 ? 241 LYS B CD  1 
ATOM   6356  C CE  . LYS B 1 241 ? 60.870  7.017   92.461  1.00 24.49 ? 241 LYS B CE  1 
ATOM   6357  N NZ  . LYS B 1 241 ? 60.792  7.182   93.937  1.00 26.57 ? 241 LYS B NZ  1 
ATOM   6358  N N   . HIS B 1 242 ? 54.236  5.305   90.298  1.00 15.51 ? 242 HIS B N   1 
ATOM   6359  C CA  . HIS B 1 242 ? 52.997  5.805   89.695  1.00 14.91 ? 242 HIS B CA  1 
ATOM   6360  C C   . HIS B 1 242 ? 51.915  4.755   89.427  1.00 14.59 ? 242 HIS B C   1 
ATOM   6361  O O   . HIS B 1 242 ? 50.850  5.084   88.930  1.00 14.30 ? 242 HIS B O   1 
ATOM   6362  C CB  . HIS B 1 242 ? 53.360  6.537   88.403  1.00 14.78 ? 242 HIS B CB  1 
ATOM   6363  C CG  . HIS B 1 242 ? 54.104  7.801   88.652  1.00 15.53 ? 242 HIS B CG  1 
ATOM   6364  N ND1 . HIS B 1 242 ? 53.464  8.998   88.893  1.00 14.09 ? 242 HIS B ND1 1 
ATOM   6365  C CD2 . HIS B 1 242 ? 55.431  8.045   88.784  1.00 15.55 ? 242 HIS B CD2 1 
ATOM   6366  C CE1 . HIS B 1 242 ? 54.370  9.930   89.143  1.00 16.92 ? 242 HIS B CE1 1 
ATOM   6367  N NE2 . HIS B 1 242 ? 55.570  9.378   89.079  1.00 14.38 ? 242 HIS B NE2 1 
ATOM   6368  N N   . PHE B 1 243 ? 52.193  3.500   89.751  1.00 14.63 ? 243 PHE B N   1 
ATOM   6369  C CA  . PHE B 1 243 ? 51.250  2.414   89.533  1.00 14.53 ? 243 PHE B CA  1 
ATOM   6370  C C   . PHE B 1 243 ? 51.232  1.479   90.717  1.00 14.42 ? 243 PHE B C   1 
ATOM   6371  O O   . PHE B 1 243 ? 52.288  1.050   91.195  1.00 14.40 ? 243 PHE B O   1 
ATOM   6372  C CB  . PHE B 1 243 ? 51.638  1.605   88.281  1.00 14.59 ? 243 PHE B CB  1 
ATOM   6373  C CG  . PHE B 1 243 ? 51.403  2.321   86.998  1.00 15.00 ? 243 PHE B CG  1 
ATOM   6374  C CD1 . PHE B 1 243 ? 52.259  3.320   86.578  1.00 15.99 ? 243 PHE B CD1 1 
ATOM   6375  C CD2 . PHE B 1 243 ? 50.328  1.989   86.193  1.00 15.10 ? 243 PHE B CD2 1 
ATOM   6376  C CE1 . PHE B 1 243 ? 52.039  3.985   85.396  1.00 15.39 ? 243 PHE B CE1 1 
ATOM   6377  C CE2 . PHE B 1 243 ? 50.113  2.653   85.001  1.00 15.34 ? 243 PHE B CE2 1 
ATOM   6378  C CZ  . PHE B 1 243 ? 50.959  3.648   84.602  1.00 15.82 ? 243 PHE B CZ  1 
ATOM   6379  N N   . VAL B 1 244 ? 50.035  1.200   91.220  1.00 14.03 ? 244 VAL B N   1 
ATOM   6380  C CA  . VAL B 1 244 ? 49.838  0.188   92.239  1.00 14.14 ? 244 VAL B CA  1 
ATOM   6381  C C   . VAL B 1 244 ? 48.728  -0.785  91.784  1.00 14.10 ? 244 VAL B C   1 
ATOM   6382  O O   . VAL B 1 244 ? 47.937  -0.508  90.856  1.00 13.75 ? 244 VAL B O   1 
ATOM   6383  C CB  . VAL B 1 244 ? 49.541  0.788   93.629  1.00 14.35 ? 244 VAL B CB  1 
ATOM   6384  C CG1 . VAL B 1 244 ? 50.498  1.955   93.930  1.00 15.16 ? 244 VAL B CG1 1 
ATOM   6385  C CG2 . VAL B 1 244 ? 48.099  1.224   93.744  1.00 15.54 ? 244 VAL B CG2 1 
ATOM   6386  N N   . ALA B 1 245 ? 48.683  -1.938  92.421  1.00 13.11 ? 245 ALA B N   1 
ATOM   6387  C CA  . ALA B 1 245 ? 47.755  -2.964  92.016  1.00 13.18 ? 245 ALA B CA  1 
ATOM   6388  C C   . ALA B 1 245 ? 46.848  -3.424  93.130  1.00 13.23 ? 245 ALA B C   1 
ATOM   6389  O O   . ALA B 1 245 ? 47.244  -3.515  94.303  1.00 13.37 ? 245 ALA B O   1 
ATOM   6390  C CB  . ALA B 1 245 ? 48.528  -4.175  91.453  1.00 13.06 ? 245 ALA B CB  1 
ATOM   6391  N N   . LEU B 1 246 ? 45.603  -3.694  92.755  1.00 13.39 ? 246 LEU B N   1 
ATOM   6392  C CA  . LEU B 1 246 ? 44.692  -4.351  93.664  1.00 13.41 ? 246 LEU B CA  1 
ATOM   6393  C C   . LEU B 1 246 ? 44.584  -5.735  93.049  1.00 14.65 ? 246 LEU B C   1 
ATOM   6394  O O   . LEU B 1 246 ? 43.839  -5.917  92.089  1.00 13.78 ? 246 LEU B O   1 
ATOM   6395  C CB  . LEU B 1 246 ? 43.351  -3.634  93.716  1.00 13.03 ? 246 LEU B CB  1 
ATOM   6396  C CG  . LEU B 1 246 ? 43.449  -2.113  93.734  1.00 11.57 ? 246 LEU B CG  1 
ATOM   6397  C CD1 . LEU B 1 246 ? 42.046  -1.475  93.815  1.00 9.80  ? 246 LEU B CD1 1 
ATOM   6398  C CD2 . LEU B 1 246 ? 44.347  -1.651  94.873  1.00 10.72 ? 246 LEU B CD2 1 
ATOM   6399  N N   . SER B 1 247 ? 45.349  -6.698  93.582  1.00 15.77 ? 247 SER B N   1 
ATOM   6400  C CA  . SER B 1 247 ? 45.445  -8.033  92.988  1.00 16.55 ? 247 SER B CA  1 
ATOM   6401  C C   . SER B 1 247 ? 46.119  -9.036  93.919  1.00 17.25 ? 247 SER B C   1 
ATOM   6402  O O   . SER B 1 247 ? 46.592  -8.670  94.988  1.00 17.05 ? 247 SER B O   1 
ATOM   6403  C CB  . SER B 1 247 ? 46.298  -7.948  91.716  1.00 16.89 ? 247 SER B CB  1 
ATOM   6404  O OG  . SER B 1 247 ? 46.416  -9.205  91.052  1.00 17.47 ? 247 SER B OG  1 
ATOM   6405  N N   . THR B 1 248 ? 46.180  -10.302 93.495  1.00 17.87 ? 248 THR B N   1 
ATOM   6406  C CA  . THR B 1 248 ? 46.943  -11.307 94.234  1.00 17.91 ? 248 THR B CA  1 
ATOM   6407  C C   . THR B 1 248 ? 48.038  -11.911 93.367  1.00 19.11 ? 248 THR B C   1 
ATOM   6408  O O   . THR B 1 248 ? 48.849  -12.673 93.860  1.00 18.71 ? 248 THR B O   1 
ATOM   6409  C CB  . THR B 1 248 ? 46.058  -12.466 94.803  1.00 18.16 ? 248 THR B CB  1 
ATOM   6410  O OG1 . THR B 1 248 ? 45.241  -13.044 93.775  1.00 17.00 ? 248 THR B OG1 1 
ATOM   6411  C CG2 . THR B 1 248 ? 45.073  -11.961 95.856  1.00 17.28 ? 248 THR B CG2 1 
ATOM   6412  N N   . ASN B 1 249 ? 48.073  -11.560 92.086  1.00 19.59 ? 249 ASN B N   1 
ATOM   6413  C CA  . ASN B 1 249 ? 49.055  -12.142 91.187  1.00 20.41 ? 249 ASN B CA  1 
ATOM   6414  C C   . ASN B 1 249 ? 50.407  -11.440 91.257  1.00 20.43 ? 249 ASN B C   1 
ATOM   6415  O O   . ASN B 1 249 ? 50.741  -10.605 90.426  1.00 20.15 ? 249 ASN B O   1 
ATOM   6416  C CB  . ASN B 1 249 ? 48.528  -12.164 89.762  1.00 20.49 ? 249 ASN B CB  1 
ATOM   6417  C CG  . ASN B 1 249 ? 49.306  -13.130 88.876  1.00 22.00 ? 249 ASN B CG  1 
ATOM   6418  O OD1 . ASN B 1 249 ? 50.490  -13.368 89.107  1.00 21.42 ? 249 ASN B OD1 1 
ATOM   6419  N ND2 . ASN B 1 249 ? 48.632  -13.703 87.871  1.00 21.59 ? 249 ASN B ND2 1 
ATOM   6420  N N   . THR B 1 250 ? 51.190  -11.809 92.255  1.00 20.89 ? 250 THR B N   1 
ATOM   6421  C CA  . THR B 1 250 ? 52.477  -11.178 92.493  1.00 21.40 ? 250 THR B CA  1 
ATOM   6422  C C   . THR B 1 250 ? 53.390  -11.153 91.274  1.00 21.58 ? 250 THR B C   1 
ATOM   6423  O O   . THR B 1 250 ? 53.991  -10.136 90.976  1.00 22.16 ? 250 THR B O   1 
ATOM   6424  C CB  . THR B 1 250 ? 53.194  -11.890 93.647  1.00 21.83 ? 250 THR B CB  1 
ATOM   6425  O OG1 . THR B 1 250 ? 52.313  -11.985 94.774  1.00 21.88 ? 250 THR B OG1 1 
ATOM   6426  C CG2 . THR B 1 250 ? 54.367  -11.051 94.150  1.00 21.86 ? 250 THR B CG2 1 
ATOM   6427  N N   . THR B 1 251 ? 53.480  -12.257 90.544  1.00 21.99 ? 251 THR B N   1 
ATOM   6428  C CA  . THR B 1 251 ? 54.414  -12.315 89.424  1.00 22.06 ? 251 THR B CA  1 
ATOM   6429  C C   . THR B 1 251 ? 54.038  -11.325 88.321  1.00 21.74 ? 251 THR B C   1 
ATOM   6430  O O   . THR B 1 251 ? 54.881  -10.595 87.805  1.00 21.21 ? 251 THR B O   1 
ATOM   6431  C CB  . THR B 1 251 ? 54.477  -13.743 88.863  1.00 22.41 ? 251 THR B CB  1 
ATOM   6432  O OG1 . THR B 1 251 ? 54.959  -14.643 89.874  1.00 24.10 ? 251 THR B OG1 1 
ATOM   6433  C CG2 . THR B 1 251 ? 55.511  -13.843 87.742  1.00 23.29 ? 251 THR B CG2 1 
ATOM   6434  N N   . LYS B 1 252 ? 52.763  -11.322 87.950  1.00 21.54 ? 252 LYS B N   1 
ATOM   6435  C CA  . LYS B 1 252 ? 52.289  -10.428 86.903  1.00 21.47 ? 252 LYS B CA  1 
ATOM   6436  C C   . LYS B 1 252 ? 52.394  -8.961  87.306  1.00 20.96 ? 252 LYS B C   1 
ATOM   6437  O O   . LYS B 1 252 ? 52.695  -8.112  86.475  1.00 20.92 ? 252 LYS B O   1 
ATOM   6438  C CB  . LYS B 1 252 ? 50.851  -10.777 86.531  1.00 21.87 ? 252 LYS B CB  1 
ATOM   6439  C CG  . LYS B 1 252 ? 50.728  -12.057 85.722  1.00 23.80 ? 252 LYS B CG  1 
ATOM   6440  C CD  . LYS B 1 252 ? 51.741  -12.096 84.570  1.00 27.48 ? 252 LYS B CD  1 
ATOM   6441  C CE  . LYS B 1 252 ? 51.361  -13.138 83.514  1.00 29.47 ? 252 LYS B CE  1 
ATOM   6442  N NZ  . LYS B 1 252 ? 52.354  -13.189 82.392  1.00 32.39 ? 252 LYS B NZ  1 
ATOM   6443  N N   . VAL B 1 253 ? 52.148  -8.668  88.578  1.00 20.64 ? 253 VAL B N   1 
ATOM   6444  C CA  . VAL B 1 253 ? 52.242  -7.301  89.079  1.00 20.66 ? 253 VAL B CA  1 
ATOM   6445  C C   . VAL B 1 253 ? 53.685  -6.811  89.000  1.00 21.25 ? 253 VAL B C   1 
ATOM   6446  O O   . VAL B 1 253 ? 53.955  -5.690  88.571  1.00 20.84 ? 253 VAL B O   1 
ATOM   6447  C CB  . VAL B 1 253 ? 51.708  -7.217  90.540  1.00 20.48 ? 253 VAL B CB  1 
ATOM   6448  C CG1 . VAL B 1 253 ? 52.107  -5.906  91.205  1.00 20.35 ? 253 VAL B CG1 1 
ATOM   6449  C CG2 . VAL B 1 253 ? 50.204  -7.396  90.560  1.00 20.43 ? 253 VAL B CG2 1 
ATOM   6450  N N   . LYS B 1 254 ? 54.616  -7.660  89.423  1.00 22.10 ? 254 LYS B N   1 
ATOM   6451  C CA  . LYS B 1 254 ? 56.047  -7.340  89.332  1.00 23.49 ? 254 LYS B CA  1 
ATOM   6452  C C   . LYS B 1 254 ? 56.491  -7.166  87.882  1.00 23.27 ? 254 LYS B C   1 
ATOM   6453  O O   . LYS B 1 254 ? 57.219  -6.226  87.553  1.00 22.96 ? 254 LYS B O   1 
ATOM   6454  C CB  . LYS B 1 254 ? 56.889  -8.440  89.990  1.00 24.26 ? 254 LYS B CB  1 
ATOM   6455  C CG  . LYS B 1 254 ? 58.341  -8.044  90.217  1.00 27.47 ? 254 LYS B CG  1 
ATOM   6456  C CD  . LYS B 1 254 ? 59.033  -8.917  91.277  1.00 31.09 ? 254 LYS B CD  1 
ATOM   6457  C CE  . LYS B 1 254 ? 58.793  -10.408 91.069  1.00 33.38 ? 254 LYS B CE  1 
ATOM   6458  N NZ  . LYS B 1 254 ? 59.424  -11.239 92.150  1.00 35.05 ? 254 LYS B NZ  1 
ATOM   6459  N N   . GLU B 1 255 ? 56.051  -8.067  87.017  1.00 23.64 ? 255 GLU B N   1 
ATOM   6460  C CA  . GLU B 1 255 ? 56.428  -7.999  85.605  1.00 23.99 ? 255 GLU B CA  1 
ATOM   6461  C C   . GLU B 1 255 ? 55.894  -6.713  84.956  1.00 23.45 ? 255 GLU B C   1 
ATOM   6462  O O   . GLU B 1 255 ? 56.516  -6.172  84.040  1.00 22.95 ? 255 GLU B O   1 
ATOM   6463  C CB  . GLU B 1 255 ? 55.926  -9.228  84.847  1.00 24.78 ? 255 GLU B CB  1 
ATOM   6464  C CG  . GLU B 1 255 ? 56.616  -10.529 85.255  1.00 27.21 ? 255 GLU B CG  1 
ATOM   6465  C CD  . GLU B 1 255 ? 56.096  -11.749 84.503  1.00 30.25 ? 255 GLU B CD  1 
ATOM   6466  O OE1 . GLU B 1 255 ? 55.104  -11.625 83.741  1.00 31.43 ? 255 GLU B OE1 1 
ATOM   6467  O OE2 . GLU B 1 255 ? 56.690  -12.840 84.672  1.00 31.57 ? 255 GLU B OE2 1 
ATOM   6468  N N   . PHE B 1 256 ? 54.749  -6.217  85.428  1.00 22.84 ? 256 PHE B N   1 
ATOM   6469  C CA  . PHE B 1 256 ? 54.194  -4.962  84.897  1.00 22.30 ? 256 PHE B CA  1 
ATOM   6470  C C   . PHE B 1 256 ? 55.105  -3.778  85.271  1.00 21.94 ? 256 PHE B C   1 
ATOM   6471  O O   . PHE B 1 256 ? 55.150  -2.762  84.567  1.00 21.95 ? 256 PHE B O   1 
ATOM   6472  C CB  . PHE B 1 256 ? 52.779  -4.732  85.451  1.00 22.45 ? 256 PHE B CB  1 
ATOM   6473  C CG  . PHE B 1 256 ? 52.065  -3.535  84.867  1.00 21.25 ? 256 PHE B CG  1 
ATOM   6474  C CD1 . PHE B 1 256 ? 51.193  -3.685  83.800  1.00 21.98 ? 256 PHE B CD1 1 
ATOM   6475  C CD2 . PHE B 1 256 ? 52.238  -2.274  85.404  1.00 21.14 ? 256 PHE B CD2 1 
ATOM   6476  C CE1 . PHE B 1 256 ? 50.528  -2.607  83.274  1.00 20.94 ? 256 PHE B CE1 1 
ATOM   6477  C CE2 . PHE B 1 256 ? 51.571  -1.185  84.878  1.00 20.32 ? 256 PHE B CE2 1 
ATOM   6478  C CZ  . PHE B 1 256 ? 50.719  -1.356  83.807  1.00 20.79 ? 256 PHE B CZ  1 
ATOM   6479  N N   . GLY B 1 257 ? 55.823  -3.903  86.386  1.00 21.61 ? 257 GLY B N   1 
ATOM   6480  C CA  . GLY B 1 257 ? 56.705  -2.840  86.850  1.00 21.53 ? 257 GLY B CA  1 
ATOM   6481  C C   . GLY B 1 257 ? 56.251  -2.213  88.166  1.00 21.42 ? 257 GLY B C   1 
ATOM   6482  O O   . GLY B 1 257 ? 56.795  -1.219  88.638  1.00 21.14 ? 257 GLY B O   1 
ATOM   6483  N N   . ILE B 1 258 ? 55.229  -2.805  88.759  1.00 21.49 ? 258 ILE B N   1 
ATOM   6484  C CA  . ILE B 1 258 ? 54.721  -2.353  90.038  1.00 21.49 ? 258 ILE B CA  1 
ATOM   6485  C C   . ILE B 1 258 ? 55.513  -3.024  91.143  1.00 21.28 ? 258 ILE B C   1 
ATOM   6486  O O   . ILE B 1 258 ? 55.796  -4.198  91.072  1.00 20.70 ? 258 ILE B O   1 
ATOM   6487  C CB  . ILE B 1 258 ? 53.235  -2.717  90.150  1.00 21.61 ? 258 ILE B CB  1 
ATOM   6488  C CG1 . ILE B 1 258 ? 52.427  -1.841  89.185  1.00 21.49 ? 258 ILE B CG1 1 
ATOM   6489  C CG2 . ILE B 1 258 ? 52.753  -2.561  91.588  1.00 22.13 ? 258 ILE B CG2 1 
ATOM   6490  C CD1 . ILE B 1 258 ? 51.003  -2.360  88.890  1.00 21.75 ? 258 ILE B CD1 1 
ATOM   6491  N N   . ASP B 1 259 ? 55.875  -2.265  92.160  1.00 21.95 ? 259 ASP B N   1 
ATOM   6492  C CA  . ASP B 1 259 ? 56.555  -2.836  93.309  1.00 22.74 ? 259 ASP B CA  1 
ATOM   6493  C C   . ASP B 1 259 ? 55.520  -3.628  94.113  1.00 23.19 ? 259 ASP B C   1 
ATOM   6494  O O   . ASP B 1 259 ? 54.503  -3.070  94.540  1.00 23.37 ? 259 ASP B O   1 
ATOM   6495  C CB  . ASP B 1 259 ? 57.145  -1.711  94.134  1.00 22.70 ? 259 ASP B CB  1 
ATOM   6496  C CG  . ASP B 1 259 ? 57.712  -2.176  95.444  1.00 23.54 ? 259 ASP B CG  1 
ATOM   6497  O OD1 . ASP B 1 259 ? 57.581  -3.368  95.806  1.00 24.06 ? 259 ASP B OD1 1 
ATOM   6498  O OD2 . ASP B 1 259 ? 58.292  -1.377  96.196  1.00 25.57 ? 259 ASP B OD2 1 
ATOM   6499  N N   . PRO B 1 260 ? 55.772  -4.919  94.322  1.00 23.82 ? 260 PRO B N   1 
ATOM   6500  C CA  . PRO B 1 260 ? 54.823  -5.791  95.024  1.00 23.90 ? 260 PRO B CA  1 
ATOM   6501  C C   . PRO B 1 260 ? 54.481  -5.387  96.455  1.00 23.64 ? 260 PRO B C   1 
ATOM   6502  O O   . PRO B 1 260 ? 53.502  -5.901  97.000  1.00 22.73 ? 260 PRO B O   1 
ATOM   6503  C CB  . PRO B 1 260 ? 55.509  -7.156  95.015  1.00 24.31 ? 260 PRO B CB  1 
ATOM   6504  C CG  . PRO B 1 260 ? 56.924  -6.900  94.697  1.00 24.49 ? 260 PRO B CG  1 
ATOM   6505  C CD  . PRO B 1 260 ? 56.985  -5.641  93.908  1.00 24.03 ? 260 PRO B CD  1 
ATOM   6506  N N   . GLN B 1 261 ? 55.237  -4.485  97.063  1.00 23.57 ? 261 GLN B N   1 
ATOM   6507  C CA  . GLN B 1 261 ? 54.830  -4.031  98.385  1.00 24.04 ? 261 GLN B CA  1 
ATOM   6508  C C   . GLN B 1 261 ? 53.579  -3.165  98.220  1.00 22.71 ? 261 GLN B C   1 
ATOM   6509  O O   . GLN B 1 261 ? 52.838  -2.947  99.174  1.00 23.14 ? 261 GLN B O   1 
ATOM   6510  C CB  . GLN B 1 261 ? 55.965  -3.362  99.188  1.00 24.68 ? 261 GLN B CB  1 
ATOM   6511  C CG  . GLN B 1 261 ? 56.588  -2.093  98.661  1.00 28.29 ? 261 GLN B CG  1 
ATOM   6512  C CD  . GLN B 1 261 ? 58.012  -1.899  99.233  1.00 32.26 ? 261 GLN B CD  1 
ATOM   6513  O OE1 . GLN B 1 261 ? 58.357  -2.498  100.262 1.00 35.36 ? 261 GLN B OE1 1 
ATOM   6514  N NE2 . GLN B 1 261 ? 58.833  -1.095  98.560  1.00 33.91 ? 261 GLN B NE2 1 
ATOM   6515  N N   . ASN B 1 262 ? 53.318  -2.749  96.986  1.00 21.18 ? 262 ASN B N   1 
ATOM   6516  C CA  . ASN B 1 262 ? 52.119  -1.976  96.664  1.00 20.61 ? 262 ASN B CA  1 
ATOM   6517  C C   . ASN B 1 262 ? 51.071  -2.802  95.916  1.00 19.50 ? 262 ASN B C   1 
ATOM   6518  O O   . ASN B 1 262 ? 50.362  -2.294  95.047  1.00 19.54 ? 262 ASN B O   1 
ATOM   6519  C CB  . ASN B 1 262 ? 52.481  -0.747  95.849  1.00 20.42 ? 262 ASN B CB  1 
ATOM   6520  C CG  . ASN B 1 262 ? 53.591  0.063   96.482  1.00 20.57 ? 262 ASN B CG  1 
ATOM   6521  O OD1 . ASN B 1 262 ? 53.568  0.354   97.684  1.00 21.64 ? 262 ASN B OD1 1 
ATOM   6522  N ND2 . ASN B 1 262 ? 54.571  0.434   95.674  1.00 18.75 ? 262 ASN B ND2 1 
ATOM   6523  N N   . MET B 1 263 ? 51.004  -4.086  96.238  1.00 18.48 ? 263 MET B N   1 
ATOM   6524  C CA  . MET B 1 263 ? 49.945  -4.938  95.736  1.00 18.03 ? 263 MET B CA  1 
ATOM   6525  C C   . MET B 1 263 ? 49.018  -5.144  96.921  1.00 17.10 ? 263 MET B C   1 
ATOM   6526  O O   . MET B 1 263 ? 49.443  -5.662  97.949  1.00 16.49 ? 263 MET B O   1 
ATOM   6527  C CB  . MET B 1 263 ? 50.472  -6.278  95.237  1.00 18.33 ? 263 MET B CB  1 
ATOM   6528  C CG  . MET B 1 263 ? 49.408  -7.089  94.513  1.00 18.74 ? 263 MET B CG  1 
ATOM   6529  S SD  . MET B 1 263 ? 49.945  -8.718  93.942  1.00 19.45 ? 263 MET B SD  1 
ATOM   6530  C CE  . MET B 1 263 ? 49.953  -9.588  95.468  1.00 20.83 ? 263 MET B CE  1 
ATOM   6531  N N   . PHE B 1 264 ? 47.765  -4.701  96.778  1.00 15.73 ? 264 PHE B N   1 
ATOM   6532  C CA  . PHE B 1 264 ? 46.774  -4.772  97.841  1.00 14.44 ? 264 PHE B CA  1 
ATOM   6533  C C   . PHE B 1 264 ? 45.840  -5.938  97.576  1.00 14.32 ? 264 PHE B C   1 
ATOM   6534  O O   . PHE B 1 264 ? 45.068  -5.918  96.618  1.00 13.08 ? 264 PHE B O   1 
ATOM   6535  C CB  . PHE B 1 264 ? 45.998  -3.455  97.917  1.00 14.44 ? 264 PHE B CB  1 
ATOM   6536  C CG  . PHE B 1 264 ? 46.857  -2.261  98.214  1.00 13.72 ? 264 PHE B CG  1 
ATOM   6537  C CD1 . PHE B 1 264 ? 47.580  -1.648  97.217  1.00 13.55 ? 264 PHE B CD1 1 
ATOM   6538  C CD2 . PHE B 1 264 ? 46.971  -1.772  99.514  1.00 15.61 ? 264 PHE B CD2 1 
ATOM   6539  C CE1 . PHE B 1 264 ? 48.368  -0.547  97.478  1.00 12.56 ? 264 PHE B CE1 1 
ATOM   6540  C CE2 . PHE B 1 264 ? 47.763  -0.662  99.790  1.00 14.16 ? 264 PHE B CE2 1 
ATOM   6541  C CZ  . PHE B 1 264 ? 48.469  -0.051  98.771  1.00 14.81 ? 264 PHE B CZ  1 
ATOM   6542  N N   . GLU B 1 265 ? 45.918  -6.957  98.427  1.00 13.54 ? 265 GLU B N   1 
ATOM   6543  C CA  . GLU B 1 265 ? 45.233  -8.217  98.188  1.00 14.44 ? 265 GLU B CA  1 
ATOM   6544  C C   . GLU B 1 265 ? 43.772  -8.292  98.617  1.00 13.82 ? 265 GLU B C   1 
ATOM   6545  O O   . GLU B 1 265 ? 43.313  -7.519  99.442  1.00 12.65 ? 265 GLU B O   1 
ATOM   6546  C CB  . GLU B 1 265 ? 46.010  -9.357  98.873  1.00 14.97 ? 265 GLU B CB  1 
ATOM   6547  C CG  . GLU B 1 265 ? 47.424  -9.521  98.348  1.00 18.88 ? 265 GLU B CG  1 
ATOM   6548  C CD  . GLU B 1 265 ? 48.181  -10.690 98.964  1.00 25.50 ? 265 GLU B CD  1 
ATOM   6549  O OE1 . GLU B 1 265 ? 47.602  -11.460 99.763  1.00 29.93 ? 265 GLU B OE1 1 
ATOM   6550  O OE2 . GLU B 1 265 ? 49.384  -10.844 98.641  1.00 31.13 ? 265 GLU B OE2 1 
ATOM   6551  N N   . PHE B 1 266 ? 43.049  -9.209  97.983  1.00 13.49 ? 266 PHE B N   1 
ATOM   6552  C CA  . PHE B 1 266 ? 41.702  -9.588  98.398  1.00 14.15 ? 266 PHE B CA  1 
ATOM   6553  C C   . PHE B 1 266 ? 41.541  -11.083 98.064  1.00 14.26 ? 266 PHE B C   1 
ATOM   6554  O O   . PHE B 1 266 ? 42.488  -11.697 97.537  1.00 15.40 ? 266 PHE B O   1 
ATOM   6555  C CB  . PHE B 1 266 ? 40.577  -8.656  97.878  1.00 14.43 ? 266 PHE B CB  1 
ATOM   6556  C CG  . PHE B 1 266 ? 40.568  -8.430  96.393  1.00 15.10 ? 266 PHE B CG  1 
ATOM   6557  C CD1 . PHE B 1 266 ? 39.515  -8.901  95.614  1.00 18.34 ? 266 PHE B CD1 1 
ATOM   6558  C CD2 . PHE B 1 266 ? 41.574  -7.722  95.781  1.00 16.54 ? 266 PHE B CD2 1 
ATOM   6559  C CE1 . PHE B 1 266 ? 39.488  -8.670  94.237  1.00 19.29 ? 266 PHE B CE1 1 
ATOM   6560  C CE2 . PHE B 1 266 ? 41.559  -7.498  94.411  1.00 17.17 ? 266 PHE B CE2 1 
ATOM   6561  C CZ  . PHE B 1 266 ? 40.520  -7.970  93.639  1.00 18.31 ? 266 PHE B CZ  1 
ATOM   6562  N N   . TRP B 1 267 ? 40.379  -11.661 98.342  1.00 13.82 ? 267 TRP B N   1 
ATOM   6563  C CA  . TRP B 1 267 ? 40.235  -13.103 98.364  1.00 14.13 ? 267 TRP B CA  1 
ATOM   6564  C C   . TRP B 1 267 ? 39.079  -13.634 97.520  1.00 14.75 ? 267 TRP B C   1 
ATOM   6565  O O   . TRP B 1 267 ? 38.188  -12.876 97.105  1.00 13.71 ? 267 TRP B O   1 
ATOM   6566  C CB  . TRP B 1 267 ? 40.114  -13.526 99.843  1.00 14.38 ? 267 TRP B CB  1 
ATOM   6567  C CG  . TRP B 1 267 ? 41.267  -12.957 100.616 1.00 15.36 ? 267 TRP B CG  1 
ATOM   6568  C CD1 . TRP B 1 267 ? 42.502  -13.516 100.757 1.00 17.44 ? 267 TRP B CD1 1 
ATOM   6569  C CD2 . TRP B 1 267 ? 41.332  -11.681 101.275 1.00 14.93 ? 267 TRP B CD2 1 
ATOM   6570  N NE1 . TRP B 1 267 ? 43.320  -12.684 101.480 1.00 17.68 ? 267 TRP B NE1 1 
ATOM   6571  C CE2 . TRP B 1 267 ? 42.634  -11.545 101.799 1.00 16.04 ? 267 TRP B CE2 1 
ATOM   6572  C CE3 . TRP B 1 267 ? 40.427  -10.640 101.470 1.00 15.03 ? 267 TRP B CE3 1 
ATOM   6573  C CZ2 . TRP B 1 267 ? 43.038  -10.430 102.518 1.00 14.50 ? 267 TRP B CZ2 1 
ATOM   6574  C CZ3 . TRP B 1 267 ? 40.827  -9.526  102.181 1.00 14.25 ? 267 TRP B CZ3 1 
ATOM   6575  C CH2 . TRP B 1 267 ? 42.121  -9.428  102.699 1.00 13.59 ? 267 TRP B CH2 1 
ATOM   6576  N N   . ASP B 1 268 ? 39.104  -14.946 97.283  1.00 14.62 ? 268 ASP B N   1 
ATOM   6577  C CA  . ASP B 1 268 ? 38.124  -15.616 96.443  1.00 15.97 ? 268 ASP B CA  1 
ATOM   6578  C C   . ASP B 1 268 ? 36.708  -15.451 96.948  1.00 14.84 ? 268 ASP B C   1 
ATOM   6579  O O   . ASP B 1 268 ? 35.771  -15.524 96.175  1.00 14.59 ? 268 ASP B O   1 
ATOM   6580  C CB  . ASP B 1 268 ? 38.397  -17.123 96.398  1.00 17.30 ? 268 ASP B CB  1 
ATOM   6581  C CG  . ASP B 1 268 ? 39.606  -17.472 95.605  1.00 22.10 ? 268 ASP B CG  1 
ATOM   6582  O OD1 . ASP B 1 268 ? 40.262  -18.484 95.973  1.00 28.47 ? 268 ASP B OD1 1 
ATOM   6583  O OD2 . ASP B 1 268 ? 39.965  -16.823 94.597  1.00 26.78 ? 268 ASP B OD2 1 
ATOM   6584  N N   . TRP B 1 269 ? 36.558  -15.243 98.250  1.00 14.14 ? 269 TRP B N   1 
ATOM   6585  C CA  . TRP B 1 269 ? 35.249  -15.117 98.851  1.00 13.29 ? 269 TRP B CA  1 
ATOM   6586  C C   . TRP B 1 269 ? 34.735  -13.679 98.851  1.00 13.13 ? 269 TRP B C   1 
ATOM   6587  O O   . TRP B 1 269 ? 33.743  -13.389 99.500  1.00 13.15 ? 269 TRP B O   1 
ATOM   6588  C CB  . TRP B 1 269 ? 35.219  -15.707 100.270 1.00 13.58 ? 269 TRP B CB  1 
ATOM   6589  C CG  . TRP B 1 269 ? 36.463  -15.466 101.110 1.00 14.30 ? 269 TRP B CG  1 
ATOM   6590  C CD1 . TRP B 1 269 ? 37.459  -16.379 101.386 1.00 15.43 ? 269 TRP B CD1 1 
ATOM   6591  C CD2 . TRP B 1 269 ? 36.812  -14.277 101.821 1.00 15.01 ? 269 TRP B CD2 1 
ATOM   6592  N NE1 . TRP B 1 269 ? 38.417  -15.807 102.191 1.00 14.04 ? 269 TRP B NE1 1 
ATOM   6593  C CE2 . TRP B 1 269 ? 38.047  -14.518 102.472 1.00 14.22 ? 269 TRP B CE2 1 
ATOM   6594  C CE3 . TRP B 1 269 ? 36.221  -13.018 101.967 1.00 15.29 ? 269 TRP B CE3 1 
ATOM   6595  C CZ2 . TRP B 1 269 ? 38.681  -13.561 103.257 1.00 13.80 ? 269 TRP B CZ2 1 
ATOM   6596  C CZ3 . TRP B 1 269 ? 36.855  -12.072 102.756 1.00 15.11 ? 269 TRP B CZ3 1 
ATOM   6597  C CH2 . TRP B 1 269 ? 38.074  -12.349 103.391 1.00 15.29 ? 269 TRP B CH2 1 
ATOM   6598  N N   . VAL B 1 270 ? 35.433  -12.803 98.134  1.00 12.70 ? 270 VAL B N   1 
ATOM   6599  C CA  . VAL B 1 270 ? 34.992  -11.436 97.897  1.00 12.14 ? 270 VAL B CA  1 
ATOM   6600  C C   . VAL B 1 270 ? 34.520  -11.375 96.448  1.00 11.49 ? 270 VAL B C   1 
ATOM   6601  O O   . VAL B 1 270 ? 35.337  -11.384 95.522  1.00 11.61 ? 270 VAL B O   1 
ATOM   6602  C CB  . VAL B 1 270 ? 36.138  -10.455 98.056  1.00 11.82 ? 270 VAL B CB  1 
ATOM   6603  C CG1 . VAL B 1 270 ? 35.702  -9.053  97.692  1.00 11.92 ? 270 VAL B CG1 1 
ATOM   6604  C CG2 . VAL B 1 270 ? 36.705  -10.500 99.472  1.00 11.87 ? 270 VAL B CG2 1 
ATOM   6605  N N   . GLY B 1 271 ? 33.218  -11.345 96.230  1.00 10.95 ? 271 GLY B N   1 
ATOM   6606  C CA  . GLY B 1 271 ? 32.711  -11.229 94.868  1.00 11.01 ? 271 GLY B CA  1 
ATOM   6607  C C   . GLY B 1 271 ? 32.947  -9.818  94.352  1.00 11.08 ? 271 GLY B C   1 
ATOM   6608  O O   . GLY B 1 271 ? 32.854  -8.850  95.110  1.00 10.69 ? 271 GLY B O   1 
ATOM   6609  N N   . GLY B 1 272 ? 33.262  -9.689  93.066  1.00 11.51 ? 272 GLY B N   1 
ATOM   6610  C CA  . GLY B 1 272 ? 33.541  -8.376  92.493  1.00 11.12 ? 272 GLY B CA  1 
ATOM   6611  C C   . GLY B 1 272 ? 32.465  -7.333  92.808  1.00 10.81 ? 272 GLY B C   1 
ATOM   6612  O O   . GLY B 1 272 ? 32.773  -6.199  93.192  1.00 10.85 ? 272 GLY B O   1 
ATOM   6613  N N   . ARG B 1 273 ? 31.204  -7.728  92.635  1.00 10.65 ? 273 ARG B N   1 
ATOM   6614  C CA  . ARG B 1 273 ? 30.049  -6.861  92.866  1.00 10.11 ? 273 ARG B CA  1 
ATOM   6615  C C   . ARG B 1 273 ? 29.756  -6.668  94.362  1.00 10.07 ? 273 ARG B C   1 
ATOM   6616  O O   . ARG B 1 273 ? 28.795  -6.008  94.729  1.00 9.99  ? 273 ARG B O   1 
ATOM   6617  C CB  . ARG B 1 273 ? 28.825  -7.372  92.108  1.00 10.69 ? 273 ARG B CB  1 
ATOM   6618  C CG  . ARG B 1 273 ? 28.321  -8.775  92.508  1.00 10.98 ? 273 ARG B CG  1 
ATOM   6619  C CD  . ARG B 1 273 ? 27.158  -9.263  91.654  1.00 11.95 ? 273 ARG B CD  1 
ATOM   6620  N NE  . ARG B 1 273 ? 26.848  -10.657 91.939  1.00 12.89 ? 273 ARG B NE  1 
ATOM   6621  C CZ  . ARG B 1 273 ? 27.428  -11.694 91.362  1.00 12.66 ? 273 ARG B CZ  1 
ATOM   6622  N NH1 . ARG B 1 273 ? 28.336  -11.529 90.398  1.00 12.00 ? 273 ARG B NH1 1 
ATOM   6623  N NH2 . ARG B 1 273 ? 27.064  -12.914 91.723  1.00 12.81 ? 273 ARG B NH2 1 
ATOM   6624  N N   . TYR B 1 274 ? 30.623  -7.209  95.215  1.00 10.14 ? 274 TYR B N   1 
ATOM   6625  C CA  . TYR B 1 274 ? 30.550  -7.009  96.671  1.00 10.05 ? 274 TYR B CA  1 
ATOM   6626  C C   . TYR B 1 274 ? 31.944  -6.605  97.164  1.00 9.86  ? 274 TYR B C   1 
ATOM   6627  O O   . TYR B 1 274 ? 32.298  -6.828  98.309  1.00 10.84 ? 274 TYR B O   1 
ATOM   6628  C CB  . TYR B 1 274 ? 30.101  -8.306  97.393  1.00 10.18 ? 274 TYR B CB  1 
ATOM   6629  C CG  . TYR B 1 274 ? 28.718  -8.791  97.026  1.00 10.69 ? 274 TYR B CG  1 
ATOM   6630  C CD1 . TYR B 1 274 ? 28.531  -9.794  96.071  1.00 9.67  ? 274 TYR B CD1 1 
ATOM   6631  C CD2 . TYR B 1 274 ? 27.592  -8.245  97.622  1.00 10.11 ? 274 TYR B CD2 1 
ATOM   6632  C CE1 . TYR B 1 274 ? 27.272  -10.230 95.741  1.00 11.60 ? 274 TYR B CE1 1 
ATOM   6633  C CE2 . TYR B 1 274 ? 26.320  -8.675  97.276  1.00 11.22 ? 274 TYR B CE2 1 
ATOM   6634  C CZ  . TYR B 1 274 ? 26.168  -9.670  96.347  1.00 10.24 ? 274 TYR B CZ  1 
ATOM   6635  O OH  . TYR B 1 274 ? 24.904  -10.092 96.013  1.00 10.39 ? 274 TYR B OH  1 
ATOM   6636  N N   . SER B 1 275 ? 32.751  -5.989  96.313  1.00 9.73  ? 275 SER B N   1 
ATOM   6637  C CA  . SER B 1 275 ? 34.163  -5.821  96.633  1.00 9.73  ? 275 SER B CA  1 
ATOM   6638  C C   . SER B 1 275 ? 34.590  -4.421  97.087  1.00 9.26  ? 275 SER B C   1 
ATOM   6639  O O   . SER B 1 275 ? 35.710  -4.218  97.514  1.00 9.02  ? 275 SER B O   1 
ATOM   6640  C CB  . SER B 1 275 ? 34.995  -6.246  95.415  1.00 10.24 ? 275 SER B CB  1 
ATOM   6641  O OG  . SER B 1 275 ? 34.936  -5.279  94.375  1.00 11.39 ? 275 SER B OG  1 
ATOM   6642  N N   . LEU B 1 276 ? 33.707  -3.439  96.999  1.00 9.27  ? 276 LEU B N   1 
ATOM   6643  C CA  . LEU B 1 276 ? 34.136  -2.096  97.342  1.00 9.26  ? 276 LEU B CA  1 
ATOM   6644  C C   . LEU B 1 276 ? 34.654  -1.999  98.774  1.00 9.62  ? 276 LEU B C   1 
ATOM   6645  O O   . LEU B 1 276 ? 35.411  -1.088  99.108  1.00 9.53  ? 276 LEU B O   1 
ATOM   6646  C CB  . LEU B 1 276 ? 33.013  -1.085  97.060  1.00 9.44  ? 276 LEU B CB  1 
ATOM   6647  C CG  . LEU B 1 276 ? 31.829  -1.025  97.999  1.00 7.50  ? 276 LEU B CG  1 
ATOM   6648  C CD1 . LEU B 1 276 ? 32.187  -0.142  99.198  1.00 9.54  ? 276 LEU B CD1 1 
ATOM   6649  C CD2 . LEU B 1 276 ? 30.587  -0.448  97.275  1.00 9.85  ? 276 LEU B CD2 1 
ATOM   6650  N N   . TRP B 1 277 ? 34.280  -2.967  99.611  1.00 10.09 ? 277 TRP B N   1 
ATOM   6651  C CA  . TRP B 1 277 ? 34.670  -2.978  101.024 1.00 10.29 ? 277 TRP B CA  1 
ATOM   6652  C C   . TRP B 1 277 ? 36.088  -3.470  101.258 1.00 10.55 ? 277 TRP B C   1 
ATOM   6653  O O   . TRP B 1 277 ? 36.612  -3.336  102.371 1.00 9.81  ? 277 TRP B O   1 
ATOM   6654  C CB  . TRP B 1 277 ? 33.700  -3.845  101.826 1.00 9.80  ? 277 TRP B CB  1 
ATOM   6655  C CG  . TRP B 1 277 ? 32.275  -3.699  101.361 1.00 9.62  ? 277 TRP B CG  1 
ATOM   6656  C CD1 . TRP B 1 277 ? 31.619  -4.497  100.488 1.00 11.51 ? 277 TRP B CD1 1 
ATOM   6657  C CD2 . TRP B 1 277 ? 31.362  -2.663  101.719 1.00 9.60  ? 277 TRP B CD2 1 
ATOM   6658  N NE1 . TRP B 1 277 ? 30.347  -4.026  100.264 1.00 11.21 ? 277 TRP B NE1 1 
ATOM   6659  C CE2 . TRP B 1 277 ? 30.157  -2.905  101.026 1.00 10.42 ? 277 TRP B CE2 1 
ATOM   6660  C CE3 . TRP B 1 277 ? 31.433  -1.556  102.562 1.00 9.91  ? 277 TRP B CE3 1 
ATOM   6661  C CZ2 . TRP B 1 277 ? 29.047  -2.102  101.164 1.00 9.77  ? 277 TRP B CZ2 1 
ATOM   6662  C CZ3 . TRP B 1 277 ? 30.310  -0.751  102.704 1.00 7.22  ? 277 TRP B CZ3 1 
ATOM   6663  C CH2 . TRP B 1 277 ? 29.133  -1.033  102.004 1.00 8.66  ? 277 TRP B CH2 1 
ATOM   6664  N N   . SER B 1 278 ? 36.690  -4.019  100.199 1.00 10.12 ? 278 SER B N   1 
ATOM   6665  C CA  . SER B 1 278 ? 38.020  -4.575  100.228 1.00 10.26 ? 278 SER B CA  1 
ATOM   6666  C C   . SER B 1 278 ? 39.034  -3.577  99.698  1.00 10.31 ? 278 SER B C   1 
ATOM   6667  O O   . SER B 1 278 ? 38.736  -2.378  99.539  1.00 10.34 ? 278 SER B O   1 
ATOM   6668  C CB  . SER B 1 278 ? 38.052  -5.864  99.373  1.00 10.01 ? 278 SER B CB  1 
ATOM   6669  O OG  . SER B 1 278 ? 37.999  -5.579  97.977  1.00 8.45  ? 278 SER B OG  1 
ATOM   6670  N N   . ALA B 1 279 ? 40.220  -4.096  99.409  1.00 10.30 ? 279 ALA B N   1 
ATOM   6671  C CA  . ALA B 1 279 ? 41.285  -3.367  98.752  1.00 9.94  ? 279 ALA B CA  1 
ATOM   6672  C C   . ALA B 1 279 ? 40.719  -2.622  97.534  1.00 9.98  ? 279 ALA B C   1 
ATOM   6673  O O   . ALA B 1 279 ? 41.166  -1.540  97.178  1.00 9.66  ? 279 ALA B O   1 
ATOM   6674  C CB  . ALA B 1 279 ? 42.378  -4.374  98.301  1.00 10.84 ? 279 ALA B CB  1 
ATOM   6675  N N   . ILE B 1 280 ? 39.725  -3.216  96.889  1.00 10.64 ? 280 ILE B N   1 
ATOM   6676  C CA  . ILE B 1 280 ? 39.090  -2.589  95.736  1.00 10.68 ? 280 ILE B CA  1 
ATOM   6677  C C   . ILE B 1 280 ? 38.612  -1.162  96.063  1.00 10.86 ? 280 ILE B C   1 
ATOM   6678  O O   . ILE B 1 280 ? 38.546  -0.304  95.182  1.00 10.47 ? 280 ILE B O   1 
ATOM   6679  C CB  . ILE B 1 280 ? 37.953  -3.491  95.203  1.00 10.62 ? 280 ILE B CB  1 
ATOM   6680  C CG1 . ILE B 1 280 ? 38.528  -4.771  94.594  1.00 10.41 ? 280 ILE B CG1 1 
ATOM   6681  C CG2 . ILE B 1 280 ? 37.054  -2.757  94.198  1.00 10.55 ? 280 ILE B CG2 1 
ATOM   6682  C CD1 . ILE B 1 280 ? 39.284  -4.598  93.297  1.00 11.04 ? 280 ILE B CD1 1 
ATOM   6683  N N   . GLY B 1 281 ? 38.342  -0.884  97.333  1.00 10.43 ? 281 GLY B N   1 
ATOM   6684  C CA  . GLY B 1 281 ? 37.937  0.444   97.737  1.00 10.55 ? 281 GLY B CA  1 
ATOM   6685  C C   . GLY B 1 281 ? 39.076  1.434   97.923  1.00 10.87 ? 281 GLY B C   1 
ATOM   6686  O O   . GLY B 1 281 ? 38.851  2.539   98.405  1.00 10.89 ? 281 GLY B O   1 
ATOM   6687  N N   . LEU B 1 282 ? 40.294  1.082   97.509  1.00 10.85 ? 282 LEU B N   1 
ATOM   6688  C CA  . LEU B 1 282 ? 41.428  1.972   97.750  1.00 10.61 ? 282 LEU B CA  1 
ATOM   6689  C C   . LEU B 1 282 ? 41.200  3.379   97.214  1.00 10.35 ? 282 LEU B C   1 
ATOM   6690  O O   . LEU B 1 282 ? 41.565  4.359   97.856  1.00 9.40  ? 282 LEU B O   1 
ATOM   6691  C CB  . LEU B 1 282 ? 42.731  1.401   97.171  1.00 10.72 ? 282 LEU B CB  1 
ATOM   6692  C CG  . LEU B 1 282 ? 43.983  2.248   97.445  1.00 11.88 ? 282 LEU B CG  1 
ATOM   6693  C CD1 . LEU B 1 282 ? 44.215  2.316   98.917  1.00 12.66 ? 282 LEU B CD1 1 
ATOM   6694  C CD2 . LEU B 1 282 ? 45.221  1.683   96.727  1.00 13.43 ? 282 LEU B CD2 1 
ATOM   6695  N N   . SER B 1 283 ? 40.613  3.503   96.034  1.00 10.54 ? 283 SER B N   1 
ATOM   6696  C CA  . SER B 1 283 ? 40.418  4.843   95.476  1.00 10.40 ? 283 SER B CA  1 
ATOM   6697  C C   . SER B 1 283 ? 39.431  5.636   96.314  1.00 10.16 ? 283 SER B C   1 
ATOM   6698  O O   . SER B 1 283 ? 39.545  6.855   96.399  1.00 10.54 ? 283 SER B O   1 
ATOM   6699  C CB  . SER B 1 283 ? 39.983  4.801   94.012  1.00 10.78 ? 283 SER B CB  1 
ATOM   6700  O OG  . SER B 1 283 ? 38.800  4.060   93.874  1.00 10.93 ? 283 SER B OG  1 
ATOM   6701  N N   . ILE B 1 284 ? 38.488  4.959   96.955  1.00 9.89  ? 284 ILE B N   1 
ATOM   6702  C CA  . ILE B 1 284 ? 37.587  5.650   97.887  1.00 10.01 ? 284 ILE B CA  1 
ATOM   6703  C C   . ILE B 1 284 ? 38.398  6.206   99.057  1.00 9.97  ? 284 ILE B C   1 
ATOM   6704  O O   . ILE B 1 284 ? 38.266  7.366   99.431  1.00 10.01 ? 284 ILE B O   1 
ATOM   6705  C CB  . ILE B 1 284 ? 36.520  4.695   98.471  1.00 9.70  ? 284 ILE B CB  1 
ATOM   6706  C CG1 . ILE B 1 284 ? 35.641  4.094   97.377  1.00 9.68  ? 284 ILE B CG1 1 
ATOM   6707  C CG2 . ILE B 1 284 ? 35.662  5.439   99.514  1.00 10.41 ? 284 ILE B CG2 1 
ATOM   6708  C CD1 . ILE B 1 284 ? 34.918  2.807   97.830  1.00 8.76  ? 284 ILE B CD1 1 
ATOM   6709  N N   . ALA B 1 285 ? 39.216  5.355   99.661  1.00 10.56 ? 285 ALA B N   1 
ATOM   6710  C CA  . ALA B 1 285 ? 40.003  5.770   100.820 1.00 11.11 ? 285 ALA B CA  1 
ATOM   6711  C C   . ALA B 1 285 ? 40.982  6.894   100.467 1.00 11.22 ? 285 ALA B C   1 
ATOM   6712  O O   . ALA B 1 285 ? 41.217  7.811   101.270 1.00 11.17 ? 285 ALA B O   1 
ATOM   6713  C CB  . ALA B 1 285 ? 40.721  4.590   101.432 1.00 11.70 ? 285 ALA B CB  1 
ATOM   6714  N N   . LEU B 1 286 ? 41.523  6.861   99.260  1.00 11.05 ? 286 LEU B N   1 
ATOM   6715  C CA  . LEU B 1 286 ? 42.445  7.910   98.860  1.00 11.38 ? 286 LEU B CA  1 
ATOM   6716  C C   . LEU B 1 286 ? 41.742  9.250   98.730  1.00 11.41 ? 286 LEU B C   1 
ATOM   6717  O O   . LEU B 1 286 ? 42.273  10.281  99.140  1.00 11.14 ? 286 LEU B O   1 
ATOM   6718  C CB  . LEU B 1 286 ? 43.107  7.568   97.535  1.00 11.54 ? 286 LEU B CB  1 
ATOM   6719  C CG  . LEU B 1 286 ? 44.237  6.553   97.631  1.00 12.98 ? 286 LEU B CG  1 
ATOM   6720  C CD1 . LEU B 1 286 ? 44.507  5.948   96.255  1.00 13.07 ? 286 LEU B CD1 1 
ATOM   6721  C CD2 . LEU B 1 286 ? 45.491  7.204   98.195  1.00 14.13 ? 286 LEU B CD2 1 
ATOM   6722  N N   . HIS B 1 287 ? 40.547  9.219   98.153  1.00 11.78 ? 287 HIS B N   1 
ATOM   6723  C CA  . HIS B 1 287 ? 39.776  10.432  97.845  1.00 11.25 ? 287 HIS B CA  1 
ATOM   6724  C C   . HIS B 1 287 ? 39.193  11.081  99.083  1.00 11.29 ? 287 HIS B C   1 
ATOM   6725  O O   . HIS B 1 287 ? 39.295  12.291  99.259  1.00 11.05 ? 287 HIS B O   1 
ATOM   6726  C CB  . HIS B 1 287 ? 38.632  10.095  96.858  1.00 11.43 ? 287 HIS B CB  1 
ATOM   6727  C CG  . HIS B 1 287 ? 38.019  11.295  96.179  1.00 12.07 ? 287 HIS B CG  1 
ATOM   6728  N ND1 . HIS B 1 287 ? 36.656  11.518  96.141  1.00 15.10 ? 287 HIS B ND1 1 
ATOM   6729  C CD2 . HIS B 1 287 ? 38.579  12.315  95.493  1.00 9.97  ? 287 HIS B CD2 1 
ATOM   6730  C CE1 . HIS B 1 287 ? 36.412  12.635  95.477  1.00 13.55 ? 287 HIS B CE1 1 
ATOM   6731  N NE2 . HIS B 1 287 ? 37.560  13.139  95.072  1.00 13.62 ? 287 HIS B NE2 1 
ATOM   6732  N N   . VAL B 1 288 ? 38.537  10.303  99.933  1.00 11.38 ? 288 VAL B N   1 
ATOM   6733  C CA  . VAL B 1 288 ? 37.874  10.902  101.091 1.00 11.58 ? 288 VAL B CA  1 
ATOM   6734  C C   . VAL B 1 288 ? 38.581  10.630  102.422 1.00 11.47 ? 288 VAL B C   1 
ATOM   6735  O O   . VAL B 1 288 ? 38.087  11.021  103.463 1.00 11.99 ? 288 VAL B O   1 
ATOM   6736  C CB  . VAL B 1 288 ? 36.389  10.479  101.180 1.00 11.65 ? 288 VAL B CB  1 
ATOM   6737  C CG1 . VAL B 1 288 ? 35.651  10.864  99.881  1.00 11.84 ? 288 VAL B CG1 1 
ATOM   6738  C CG2 . VAL B 1 288 ? 36.242  9.004   101.462 1.00 11.75 ? 288 VAL B CG2 1 
ATOM   6739  N N   . GLY B 1 289 ? 39.710  9.932   102.370 1.00 11.38 ? 289 GLY B N   1 
ATOM   6740  C CA  . GLY B 1 289 ? 40.491  9.599   103.547 1.00 11.68 ? 289 GLY B CA  1 
ATOM   6741  C C   . GLY B 1 289 ? 40.130  8.249   104.148 1.00 11.90 ? 289 GLY B C   1 
ATOM   6742  O O   . GLY B 1 289 ? 38.987  7.777   104.048 1.00 11.32 ? 289 GLY B O   1 
ATOM   6743  N N   . PHE B 1 290 ? 41.107  7.623   104.793 1.00 12.04 ? 290 PHE B N   1 
ATOM   6744  C CA  . PHE B 1 290 ? 40.897  6.302   105.349 1.00 12.43 ? 290 PHE B CA  1 
ATOM   6745  C C   . PHE B 1 290 ? 39.903  6.334   106.510 1.00 12.86 ? 290 PHE B C   1 
ATOM   6746  O O   . PHE B 1 290 ? 39.163  5.388   106.705 1.00 12.31 ? 290 PHE B O   1 
ATOM   6747  C CB  . PHE B 1 290 ? 42.224  5.655   105.775 1.00 12.67 ? 290 PHE B CB  1 
ATOM   6748  C CG  . PHE B 1 290 ? 42.103  4.200   106.004 1.00 12.83 ? 290 PHE B CG  1 
ATOM   6749  C CD1 . PHE B 1 290 ? 42.122  3.320   104.937 1.00 16.40 ? 290 PHE B CD1 1 
ATOM   6750  C CD2 . PHE B 1 290 ? 41.879  3.709   107.267 1.00 14.04 ? 290 PHE B CD2 1 
ATOM   6751  C CE1 . PHE B 1 290 ? 41.964  1.966   105.147 1.00 15.56 ? 290 PHE B CE1 1 
ATOM   6752  C CE2 . PHE B 1 290 ? 41.704  2.355   107.468 1.00 14.89 ? 290 PHE B CE2 1 
ATOM   6753  C CZ  . PHE B 1 290 ? 41.751  1.494   106.416 1.00 14.73 ? 290 PHE B CZ  1 
ATOM   6754  N N   . ASP B 1 291 ? 39.872  7.425   107.270 1.00 13.65 ? 291 ASP B N   1 
ATOM   6755  C CA  . ASP B 1 291 ? 38.920  7.545   108.377 1.00 14.69 ? 291 ASP B CA  1 
ATOM   6756  C C   . ASP B 1 291 ? 37.498  7.439   107.812 1.00 13.72 ? 291 ASP B C   1 
ATOM   6757  O O   . ASP B 1 291 ? 36.627  6.768   108.363 1.00 12.65 ? 291 ASP B O   1 
ATOM   6758  C CB  . ASP B 1 291 ? 39.079  8.894   109.103 1.00 15.77 ? 291 ASP B CB  1 
ATOM   6759  C CG  . ASP B 1 291 ? 40.282  8.938   110.034 1.00 20.00 ? 291 ASP B CG  1 
ATOM   6760  O OD1 . ASP B 1 291 ? 40.750  7.860   110.474 1.00 26.54 ? 291 ASP B OD1 1 
ATOM   6761  O OD2 . ASP B 1 291 ? 40.812  10.014  110.410 1.00 25.49 ? 291 ASP B OD2 1 
ATOM   6762  N N   . ASN B 1 292 ? 37.259  8.135   106.711 1.00 13.14 ? 292 ASN B N   1 
ATOM   6763  C CA  . ASN B 1 292 ? 35.947  8.093   106.109 1.00 12.74 ? 292 ASN B CA  1 
ATOM   6764  C C   . ASN B 1 292 ? 35.643  6.715   105.530 1.00 11.65 ? 292 ASN B C   1 
ATOM   6765  O O   . ASN B 1 292 ? 34.508  6.269   105.604 1.00 11.20 ? 292 ASN B O   1 
ATOM   6766  C CB  . ASN B 1 292 ? 35.760  9.226   105.104 1.00 13.17 ? 292 ASN B CB  1 
ATOM   6767  C CG  . ASN B 1 292 ? 35.436  10.555  105.781 1.00 13.29 ? 292 ASN B CG  1 
ATOM   6768  O OD1 . ASN B 1 292 ? 34.778  10.593  106.840 1.00 11.92 ? 292 ASN B OD1 1 
ATOM   6769  N ND2 . ASN B 1 292 ? 35.895  11.654  105.177 1.00 11.60 ? 292 ASN B ND2 1 
ATOM   6770  N N   . PHE B 1 293 ? 36.656  6.041   104.980 1.00 11.77 ? 293 PHE B N   1 
ATOM   6771  C CA  . PHE B 1 293 ? 36.501  4.681   104.480 1.00 11.08 ? 293 PHE B CA  1 
ATOM   6772  C C   . PHE B 1 293 ? 36.107  3.751   105.626 1.00 11.38 ? 293 PHE B C   1 
ATOM   6773  O O   . PHE B 1 293 ? 35.244  2.897   105.469 1.00 10.21 ? 293 PHE B O   1 
ATOM   6774  C CB  . PHE B 1 293 ? 37.786  4.205   103.777 1.00 11.79 ? 293 PHE B CB  1 
ATOM   6775  C CG  . PHE B 1 293 ? 37.643  2.882   103.093 1.00 10.13 ? 293 PHE B CG  1 
ATOM   6776  C CD1 . PHE B 1 293 ? 36.773  2.733   102.024 1.00 11.33 ? 293 PHE B CD1 1 
ATOM   6777  C CD2 . PHE B 1 293 ? 38.351  1.783   103.535 1.00 10.95 ? 293 PHE B CD2 1 
ATOM   6778  C CE1 . PHE B 1 293 ? 36.617  1.498   101.383 1.00 12.21 ? 293 PHE B CE1 1 
ATOM   6779  C CE2 . PHE B 1 293 ? 38.209  0.531   102.907 1.00 12.25 ? 293 PHE B CE2 1 
ATOM   6780  C CZ  . PHE B 1 293 ? 37.322  0.392   101.826 1.00 11.82 ? 293 PHE B CZ  1 
ATOM   6781  N N   . GLU B 1 294 ? 36.720  3.930   106.789 1.00 11.29 ? 294 GLU B N   1 
ATOM   6782  C CA  . GLU B 1 294 ? 36.360  3.121   107.947 1.00 11.69 ? 294 GLU B CA  1 
ATOM   6783  C C   . GLU B 1 294 ? 34.924  3.366   108.389 1.00 11.35 ? 294 GLU B C   1 
ATOM   6784  O O   . GLU B 1 294 ? 34.278  2.454   108.823 1.00 11.11 ? 294 GLU B O   1 
ATOM   6785  C CB  . GLU B 1 294 ? 37.312  3.354   109.120 1.00 12.18 ? 294 GLU B CB  1 
ATOM   6786  C CG  . GLU B 1 294 ? 38.701  2.788   108.883 1.00 14.77 ? 294 GLU B CG  1 
ATOM   6787  C CD  . GLU B 1 294 ? 39.603  2.942   110.098 1.00 18.76 ? 294 GLU B CD  1 
ATOM   6788  O OE1 . GLU B 1 294 ? 39.835  4.088   110.519 1.00 21.20 ? 294 GLU B OE1 1 
ATOM   6789  O OE2 . GLU B 1 294 ? 40.078  1.917   110.619 1.00 21.50 ? 294 GLU B OE2 1 
ATOM   6790  N N   . GLN B 1 295 ? 34.431  4.590   108.276 1.00 11.67 ? 295 GLN B N   1 
ATOM   6791  C CA  . GLN B 1 295 ? 33.046  4.889   108.633 1.00 11.89 ? 295 GLN B CA  1 
ATOM   6792  C C   . GLN B 1 295 ? 32.081  4.188   107.682 1.00 10.99 ? 295 GLN B C   1 
ATOM   6793  O O   . GLN B 1 295 ? 31.052  3.667   108.106 1.00 10.70 ? 295 GLN B O   1 
ATOM   6794  C CB  . GLN B 1 295 ? 32.788  6.382   108.597 1.00 12.67 ? 295 GLN B CB  1 
ATOM   6795  C CG  . GLN B 1 295 ? 33.486  7.156   109.708 1.00 15.81 ? 295 GLN B CG  1 
ATOM   6796  C CD  . GLN B 1 295 ? 32.954  6.828   111.093 1.00 21.27 ? 295 GLN B CD  1 
ATOM   6797  O OE1 . GLN B 1 295 ? 31.840  6.315   111.246 1.00 26.92 ? 295 GLN B OE1 1 
ATOM   6798  N NE2 . GLN B 1 295 ? 33.751  7.118   112.108 1.00 24.24 ? 295 GLN B NE2 1 
ATOM   6799  N N   . LEU B 1 296 ? 32.420  4.193   106.399 1.00 10.15 ? 296 LEU B N   1 
ATOM   6800  C CA  . LEU B 1 296 ? 31.667  3.449   105.395 1.00 10.43 ? 296 LEU B CA  1 
ATOM   6801  C C   . LEU B 1 296 ? 31.590  1.960   105.801 1.00 10.54 ? 296 LEU B C   1 
ATOM   6802  O O   . LEU B 1 296 ? 30.514  1.365   105.819 1.00 10.92 ? 296 LEU B O   1 
ATOM   6803  C CB  . LEU B 1 296 ? 32.354  3.625   104.028 1.00 9.86  ? 296 LEU B CB  1 
ATOM   6804  C CG  . LEU B 1 296 ? 31.787  2.894   102.799 1.00 10.24 ? 296 LEU B CG  1 
ATOM   6805  C CD1 . LEU B 1 296 ? 30.564  3.599   102.312 1.00 10.88 ? 296 LEU B CD1 1 
ATOM   6806  C CD2 . LEU B 1 296 ? 32.834  2.786   101.672 1.00 10.36 ? 296 LEU B CD2 1 
ATOM   6807  N N   . LEU B 1 297 ? 32.726  1.365   106.140 1.00 11.07 ? 297 LEU B N   1 
ATOM   6808  C CA  . LEU B 1 297 ? 32.764  -0.038  106.571 1.00 11.79 ? 297 LEU B CA  1 
ATOM   6809  C C   . LEU B 1 297 ? 31.898  -0.257  107.829 1.00 11.10 ? 297 LEU B C   1 
ATOM   6810  O O   . LEU B 1 297 ? 31.169  -1.240  107.956 1.00 10.92 ? 297 LEU B O   1 
ATOM   6811  C CB  . LEU B 1 297 ? 34.199  -0.444  106.884 1.00 12.28 ? 297 LEU B CB  1 
ATOM   6812  C CG  . LEU B 1 297 ? 35.227  -0.535  105.746 1.00 14.48 ? 297 LEU B CG  1 
ATOM   6813  C CD1 . LEU B 1 297 ? 36.614  -0.722  106.330 1.00 16.95 ? 297 LEU B CD1 1 
ATOM   6814  C CD2 . LEU B 1 297 ? 34.952  -1.652  104.789 1.00 15.96 ? 297 LEU B CD2 1 
ATOM   6815  N N   . SER B 1 298 ? 31.987  0.690   108.746 1.00 11.16 ? 298 SER B N   1 
ATOM   6816  C CA  . SER B 1 298 ? 31.233  0.642   109.992 1.00 10.94 ? 298 SER B CA  1 
ATOM   6817  C C   . SER B 1 298 ? 29.739  0.718   109.788 1.00 9.68  ? 298 SER B C   1 
ATOM   6818  O O   . SER B 1 298 ? 28.965  0.072   110.519 1.00 8.54  ? 298 SER B O   1 
ATOM   6819  C CB  . SER B 1 298 ? 31.711  1.769   110.909 1.00 11.84 ? 298 SER B CB  1 
ATOM   6820  O OG  . SER B 1 298 ? 33.066  1.532   111.263 1.00 14.80 ? 298 SER B OG  1 
ATOM   6821  N N   . GLY B 1 299 ? 29.316  1.508   108.803 1.00 8.65  ? 299 GLY B N   1 
ATOM   6822  C CA  . GLY B 1 299 ? 27.894  1.611   108.491 1.00 8.08  ? 299 GLY B CA  1 
ATOM   6823  C C   . GLY B 1 299 ? 27.354  0.290   107.984 1.00 7.94  ? 299 GLY B C   1 
ATOM   6824  O O   . GLY B 1 299 ? 26.275  -0.154  108.382 1.00 8.07  ? 299 GLY B O   1 
ATOM   6825  N N   . ALA B 1 300 ? 28.120  -0.348  107.107 1.00 7.65  ? 300 ALA B N   1 
ATOM   6826  C CA  . ALA B 1 300 ? 27.756  -1.656  106.583 1.00 7.81  ? 300 ALA B CA  1 
ATOM   6827  C C   . ALA B 1 300 ? 27.762  -2.689  107.716 1.00 8.18  ? 300 ALA B C   1 
ATOM   6828  O O   . ALA B 1 300 ? 26.875  -3.548  107.805 1.00 9.07  ? 300 ALA B O   1 
ATOM   6829  C CB  . ALA B 1 300 ? 28.708  -2.034  105.503 1.00 7.82  ? 300 ALA B CB  1 
ATOM   6830  N N   . HIS B 1 301 ? 28.753  -2.590  108.589 1.00 8.56  ? 301 HIS B N   1 
ATOM   6831  C CA  . HIS B 1 301 ? 28.864  -3.513  109.727 1.00 9.32  ? 301 HIS B CA  1 
ATOM   6832  C C   . HIS B 1 301 ? 27.629  -3.400  110.607 1.00 9.22  ? 301 HIS B C   1 
ATOM   6833  O O   . HIS B 1 301 ? 27.103  -4.417  111.088 1.00 10.42 ? 301 HIS B O   1 
ATOM   6834  C CB  . HIS B 1 301 ? 30.113  -3.208  110.537 1.00 9.10  ? 301 HIS B CB  1 
ATOM   6835  C CG  . HIS B 1 301 ? 30.386  -4.195  111.633 1.00 9.77  ? 301 HIS B CG  1 
ATOM   6836  N ND1 . HIS B 1 301 ? 30.365  -5.563  111.436 1.00 10.78 ? 301 HIS B ND1 1 
ATOM   6837  C CD2 . HIS B 1 301 ? 30.713  -4.008  112.933 1.00 11.68 ? 301 HIS B CD2 1 
ATOM   6838  C CE1 . HIS B 1 301 ? 30.663  -6.172  112.573 1.00 13.22 ? 301 HIS B CE1 1 
ATOM   6839  N NE2 . HIS B 1 301 ? 30.882  -5.251  113.496 1.00 11.72 ? 301 HIS B NE2 1 
ATOM   6840  N N   . TRP B 1 302 ? 27.155  -2.177  110.827 1.00 9.26  ? 302 TRP B N   1 
ATOM   6841  C CA  . TRP B 1 302 ? 25.937  -1.977  111.618 1.00 9.01  ? 302 TRP B CA  1 
ATOM   6842  C C   . TRP B 1 302 ? 24.742  -2.688  110.965 1.00 8.71  ? 302 TRP B C   1 
ATOM   6843  O O   . TRP B 1 302 ? 23.991  -3.411  111.613 1.00 8.76  ? 302 TRP B O   1 
ATOM   6844  C CB  . TRP B 1 302 ? 25.625  -0.473  111.844 1.00 9.39  ? 302 TRP B CB  1 
ATOM   6845  C CG  . TRP B 1 302 ? 24.437  -0.332  112.733 1.00 8.98  ? 302 TRP B CG  1 
ATOM   6846  C CD1 . TRP B 1 302 ? 24.452  -0.209  114.100 1.00 9.39  ? 302 TRP B CD1 1 
ATOM   6847  C CD2 . TRP B 1 302 ? 23.060  -0.404  112.355 1.00 8.85  ? 302 TRP B CD2 1 
ATOM   6848  N NE1 . TRP B 1 302 ? 23.166  -0.187  114.584 1.00 10.82 ? 302 TRP B NE1 1 
ATOM   6849  C CE2 . TRP B 1 302 ? 22.294  -0.317  113.535 1.00 9.05  ? 302 TRP B CE2 1 
ATOM   6850  C CE3 . TRP B 1 302 ? 22.383  -0.553  111.132 1.00 7.10  ? 302 TRP B CE3 1 
ATOM   6851  C CZ2 . TRP B 1 302 ? 20.907  -0.355  113.526 1.00 10.21 ? 302 TRP B CZ2 1 
ATOM   6852  C CZ3 . TRP B 1 302 ? 21.024  -0.583  111.131 1.00 7.98  ? 302 TRP B CZ3 1 
ATOM   6853  C CH2 . TRP B 1 302 ? 20.289  -0.496  112.316 1.00 9.40  ? 302 TRP B CH2 1 
ATOM   6854  N N   . MET B 1 303 ? 24.554  -2.485  109.665 1.00 9.13  ? 303 MET B N   1 
ATOM   6855  C CA  . MET B 1 303 ? 23.452  -3.113  108.957 1.00 9.23  ? 303 MET B CA  1 
ATOM   6856  C C   . MET B 1 303 ? 23.590  -4.640  108.944 1.00 9.20  ? 303 MET B C   1 
ATOM   6857  O O   . MET B 1 303 ? 22.591  -5.354  109.040 1.00 9.52  ? 303 MET B O   1 
ATOM   6858  C CB  . MET B 1 303 ? 23.358  -2.597  107.527 1.00 8.75  ? 303 MET B CB  1 
ATOM   6859  C CG  . MET B 1 303 ? 22.155  -3.104  106.777 1.00 9.19  ? 303 MET B CG  1 
ATOM   6860  S SD  . MET B 1 303 ? 20.583  -2.665  107.438 1.00 10.49 ? 303 MET B SD  1 
ATOM   6861  C CE  . MET B 1 303 ? 20.658  -0.822  107.373 1.00 9.33  ? 303 MET B CE  1 
ATOM   6862  N N   . ASP B 1 304 ? 24.819  -5.124  108.816 1.00 9.64  ? 304 ASP B N   1 
ATOM   6863  C CA  . ASP B 1 304 ? 25.066  -6.565  108.852 1.00 9.59  ? 304 ASP B CA  1 
ATOM   6864  C C   . ASP B 1 304 ? 24.495  -7.100  110.160 1.00 9.89  ? 304 ASP B C   1 
ATOM   6865  O O   . ASP B 1 304 ? 23.835  -8.136  110.171 1.00 9.43  ? 304 ASP B O   1 
ATOM   6866  C CB  . ASP B 1 304 ? 26.552  -6.873  108.870 1.00 10.43 ? 304 ASP B CB  1 
ATOM   6867  C CG  . ASP B 1 304 ? 27.230  -6.607  107.547 1.00 10.09 ? 304 ASP B CG  1 
ATOM   6868  O OD1 . ASP B 1 304 ? 26.523  -6.549  106.522 1.00 10.75 ? 304 ASP B OD1 1 
ATOM   6869  O OD2 . ASP B 1 304 ? 28.468  -6.448  107.467 1.00 9.61  ? 304 ASP B OD2 1 
ATOM   6870  N N   . GLN B 1 305 ? 24.788  -6.393  111.247 1.00 9.69  ? 305 GLN B N   1 
ATOM   6871  C CA  . GLN B 1 305 ? 24.363  -6.817  112.578 1.00 10.64 ? 305 GLN B CA  1 
ATOM   6872  C C   . GLN B 1 305 ? 22.840  -6.703  112.700 1.00 10.28 ? 305 GLN B C   1 
ATOM   6873  O O   . GLN B 1 305 ? 22.185  -7.580  113.267 1.00 10.91 ? 305 GLN B O   1 
ATOM   6874  C CB  . GLN B 1 305 ? 25.094  -6.035  113.669 1.00 10.56 ? 305 GLN B CB  1 
ATOM   6875  C CG  . GLN B 1 305 ? 26.587  -6.345  113.755 1.00 13.84 ? 305 GLN B CG  1 
ATOM   6876  C CD  . GLN B 1 305 ? 27.335  -5.372  114.650 1.00 18.45 ? 305 GLN B CD  1 
ATOM   6877  O OE1 . GLN B 1 305 ? 27.523  -5.641  115.833 1.00 19.39 ? 305 GLN B OE1 1 
ATOM   6878  N NE2 . GLN B 1 305 ? 27.755  -4.233  114.092 1.00 21.92 ? 305 GLN B NE2 1 
ATOM   6879  N N   . HIS B 1 306 ? 22.275  -5.622  112.163 1.00 10.32 ? 306 HIS B N   1 
ATOM   6880  C CA  . HIS B 1 306 ? 20.830  -5.472  112.116 1.00 9.42  ? 306 HIS B CA  1 
ATOM   6881  C C   . HIS B 1 306 ? 20.174  -6.689  111.445 1.00 9.95  ? 306 HIS B C   1 
ATOM   6882  O O   . HIS B 1 306 ? 19.235  -7.303  111.987 1.00 10.10 ? 306 HIS B O   1 
ATOM   6883  C CB  . HIS B 1 306 ? 20.422  -4.194  111.343 1.00 9.41  ? 306 HIS B CB  1 
ATOM   6884  C CG  . HIS B 1 306 ? 18.943  -4.088  111.135 1.00 8.15  ? 306 HIS B CG  1 
ATOM   6885  N ND1 . HIS B 1 306 ? 18.296  -4.616  110.041 1.00 11.75 ? 306 HIS B ND1 1 
ATOM   6886  C CD2 . HIS B 1 306 ? 17.978  -3.571  111.922 1.00 8.16  ? 306 HIS B CD2 1 
ATOM   6887  C CE1 . HIS B 1 306 ? 16.997  -4.402  110.147 1.00 8.23  ? 306 HIS B CE1 1 
ATOM   6888  N NE2 . HIS B 1 306 ? 16.776  -3.777  111.287 1.00 12.75 ? 306 HIS B NE2 1 
ATOM   6889  N N   . PHE B 1 307 ? 20.694  -7.049  110.274 1.00 9.11  ? 307 PHE B N   1 
ATOM   6890  C CA  . PHE B 1 307 ? 20.178  -8.164  109.491 1.00 9.17  ? 307 PHE B CA  1 
ATOM   6891  C C   . PHE B 1 307 ? 20.316  -9.477  110.248 1.00 9.34  ? 307 PHE B C   1 
ATOM   6892  O O   . PHE B 1 307 ? 19.437  -10.321 110.224 1.00 9.81  ? 307 PHE B O   1 
ATOM   6893  C CB  . PHE B 1 307 ? 20.951  -8.222  108.164 1.00 9.22  ? 307 PHE B CB  1 
ATOM   6894  C CG  . PHE B 1 307 ? 20.648  -9.426  107.303 1.00 8.88  ? 307 PHE B CG  1 
ATOM   6895  C CD1 . PHE B 1 307 ? 19.344  -9.792  107.004 1.00 9.32  ? 307 PHE B CD1 1 
ATOM   6896  C CD2 . PHE B 1 307 ? 21.686  -10.152 106.746 1.00 8.81  ? 307 PHE B CD2 1 
ATOM   6897  C CE1 . PHE B 1 307 ? 19.080  -10.885 106.186 1.00 10.39 ? 307 PHE B CE1 1 
ATOM   6898  C CE2 . PHE B 1 307 ? 21.434  -11.220 105.920 1.00 7.71  ? 307 PHE B CE2 1 
ATOM   6899  C CZ  . PHE B 1 307 ? 20.129  -11.602 105.648 1.00 8.57  ? 307 PHE B CZ  1 
ATOM   6900  N N   . ARG B 1 308 ? 21.428  -9.635  110.938 1.00 10.25 ? 308 ARG B N   1 
ATOM   6901  C CA  . ARG B 1 308 ? 21.696  -10.871 111.653 1.00 10.87 ? 308 ARG B CA  1 
ATOM   6902  C C   . ARG B 1 308 ? 20.877  -11.080 112.929 1.00 10.76 ? 308 ARG B C   1 
ATOM   6903  O O   . ARG B 1 308 ? 20.583  -12.220 113.278 1.00 10.48 ? 308 ARG B O   1 
ATOM   6904  C CB  . ARG B 1 308 ? 23.174  -10.941 112.023 1.00 11.65 ? 308 ARG B CB  1 
ATOM   6905  C CG  . ARG B 1 308 ? 23.572  -12.362 112.439 1.00 15.20 ? 308 ARG B CG  1 
ATOM   6906  C CD  . ARG B 1 308 ? 25.030  -12.667 112.366 1.00 17.66 ? 308 ARG B CD  1 
ATOM   6907  N NE  . ARG B 1 308 ? 25.251  -14.101 112.425 1.00 18.06 ? 308 ARG B NE  1 
ATOM   6908  C CZ  . ARG B 1 308 ? 26.429  -14.652 112.632 1.00 20.38 ? 308 ARG B CZ  1 
ATOM   6909  N NH1 . ARG B 1 308 ? 27.500  -13.892 112.792 1.00 20.90 ? 308 ARG B NH1 1 
ATOM   6910  N NH2 . ARG B 1 308 ? 26.541  -15.964 112.669 1.00 20.58 ? 308 ARG B NH2 1 
ATOM   6911  N N   . THR B 1 309 ? 20.531  -9.997  113.623 1.00 10.70 ? 309 THR B N   1 
ATOM   6912  C CA  . THR B 1 309 ? 19.937  -10.098 114.973 1.00 10.66 ? 309 THR B CA  1 
ATOM   6913  C C   . THR B 1 309 ? 18.479  -9.708  115.109 1.00 11.35 ? 309 THR B C   1 
ATOM   6914  O O   . THR B 1 309 ? 17.895  -9.854  116.196 1.00 11.62 ? 309 THR B O   1 
ATOM   6915  C CB  . THR B 1 309 ? 20.724  -9.222  115.968 1.00 10.99 ? 309 THR B CB  1 
ATOM   6916  O OG1 . THR B 1 309 ? 20.630  -7.833  115.610 1.00 10.65 ? 309 THR B OG1 1 
ATOM   6917  C CG2 . THR B 1 309 ? 22.202  -9.529  115.949 1.00 11.38 ? 309 THR B CG2 1 
ATOM   6918  N N   . THR B 1 310 ? 17.878  -9.205  114.037 1.00 11.13 ? 310 THR B N   1 
ATOM   6919  C CA  . THR B 1 310 ? 16.503  -8.734  114.084 1.00 11.47 ? 310 THR B CA  1 
ATOM   6920  C C   . THR B 1 310 ? 15.474  -9.752  113.644 1.00 11.75 ? 310 THR B C   1 
ATOM   6921  O O   . THR B 1 310 ? 15.606  -10.331 112.582 1.00 11.75 ? 310 THR B O   1 
ATOM   6922  C CB  . THR B 1 310 ? 16.372  -7.474  113.185 1.00 11.20 ? 310 THR B CB  1 
ATOM   6923  O OG1 . THR B 1 310 ? 17.306  -6.490  113.630 1.00 9.39  ? 310 THR B OG1 1 
ATOM   6924  C CG2 . THR B 1 310 ? 15.034  -6.819  113.358 1.00 11.06 ? 310 THR B CG2 1 
ATOM   6925  N N   . PRO B 1 311 ? 14.452  -9.985  114.470 1.00 12.30 ? 311 PRO B N   1 
ATOM   6926  C CA  . PRO B 1 311 ? 13.337  -10.846 114.073 1.00 12.34 ? 311 PRO B CA  1 
ATOM   6927  C C   . PRO B 1 311 ? 12.861  -10.470 112.676 1.00 12.51 ? 311 PRO B C   1 
ATOM   6928  O O   . PRO B 1 311 ? 12.736  -9.284  112.318 1.00 12.07 ? 311 PRO B O   1 
ATOM   6929  C CB  . PRO B 1 311 ? 12.276  -10.568 115.140 1.00 12.41 ? 311 PRO B CB  1 
ATOM   6930  C CG  . PRO B 1 311 ? 13.096  -10.173 116.371 1.00 12.62 ? 311 PRO B CG  1 
ATOM   6931  C CD  . PRO B 1 311 ? 14.288  -9.457  115.838 1.00 12.25 ? 311 PRO B CD  1 
ATOM   6932  N N   . LEU B 1 312 ? 12.577  -11.486 111.879 1.00 12.92 ? 312 LEU B N   1 
ATOM   6933  C CA  . LEU B 1 312 ? 12.250  -11.273 110.470 1.00 13.55 ? 312 LEU B CA  1 
ATOM   6934  C C   . LEU B 1 312 ? 11.210  -10.216 110.215 1.00 13.69 ? 312 LEU B C   1 
ATOM   6935  O O   . LEU B 1 312 ? 11.364  -9.406  109.300 1.00 13.13 ? 312 LEU B O   1 
ATOM   6936  C CB  . LEU B 1 312 ? 11.794  -12.570 109.833 1.00 14.28 ? 312 LEU B CB  1 
ATOM   6937  C CG  . LEU B 1 312 ? 12.835  -13.686 109.819 1.00 15.55 ? 312 LEU B CG  1 
ATOM   6938  C CD1 . LEU B 1 312 ? 12.277  -14.853 109.053 1.00 17.98 ? 312 LEU B CD1 1 
ATOM   6939  C CD2 . LEU B 1 312 ? 14.142  -13.235 109.224 1.00 15.94 ? 312 LEU B CD2 1 
ATOM   6940  N N   . GLU B 1 313 ? 10.143  -10.224 111.006 1.00 13.35 ? 313 GLU B N   1 
ATOM   6941  C CA  . GLU B 1 313 ? 9.052   -9.299  110.787 1.00 13.94 ? 313 GLU B CA  1 
ATOM   6942  C C   . GLU B 1 313 ? 9.418   -7.815  110.973 1.00 13.57 ? 313 GLU B C   1 
ATOM   6943  O O   . GLU B 1 313 ? 8.624   -6.956  110.616 1.00 13.19 ? 313 GLU B O   1 
ATOM   6944  C CB  . GLU B 1 313 ? 7.833   -9.698  111.646 1.00 14.17 ? 313 GLU B CB  1 
ATOM   6945  C CG  . GLU B 1 313 ? 8.039   -9.529  113.141 1.00 15.73 ? 313 GLU B CG  1 
ATOM   6946  C CD  . GLU B 1 313 ? 8.700   -10.728 113.826 1.00 18.90 ? 313 GLU B CD  1 
ATOM   6947  O OE1 . GLU B 1 313 ? 8.704   -10.736 115.090 1.00 21.08 ? 313 GLU B OE1 1 
ATOM   6948  O OE2 . GLU B 1 313 ? 9.222   -11.636 113.132 1.00 18.08 ? 313 GLU B OE2 1 
ATOM   6949  N N   . LYS B 1 314 ? 10.603  -7.519  111.510 1.00 13.30 ? 314 LYS B N   1 
ATOM   6950  C CA  . LYS B 1 314 ? 11.072  -6.132  111.690 1.00 13.62 ? 314 LYS B CA  1 
ATOM   6951  C C   . LYS B 1 314 ? 12.482  -5.931  111.116 1.00 12.51 ? 314 LYS B C   1 
ATOM   6952  O O   . LYS B 1 314 ? 13.165  -4.966  111.462 1.00 12.03 ? 314 LYS B O   1 
ATOM   6953  C CB  . LYS B 1 314 ? 11.129  -5.738  113.178 1.00 14.80 ? 314 LYS B CB  1 
ATOM   6954  C CG  . LYS B 1 314 ? 9.948   -6.205  113.995 1.00 19.85 ? 314 LYS B CG  1 
ATOM   6955  C CD  . LYS B 1 314 ? 9.370   -5.096  114.851 1.00 25.74 ? 314 LYS B CD  1 
ATOM   6956  C CE  . LYS B 1 314 ? 9.888   -5.158  116.257 1.00 29.02 ? 314 LYS B CE  1 
ATOM   6957  N NZ  . LYS B 1 314 ? 9.046   -4.383  117.224 1.00 32.50 ? 314 LYS B NZ  1 
ATOM   6958  N N   . ASN B 1 315 ? 12.885  -6.827  110.225 1.00 11.52 ? 315 ASN B N   1 
ATOM   6959  C CA  . ASN B 1 315 ? 14.210  -6.851  109.640 1.00 11.02 ? 315 ASN B CA  1 
ATOM   6960  C C   . ASN B 1 315 ? 14.187  -6.165  108.262 1.00 10.82 ? 315 ASN B C   1 
ATOM   6961  O O   . ASN B 1 315 ? 13.562  -6.660  107.323 1.00 10.49 ? 315 ASN B O   1 
ATOM   6962  C CB  . ASN B 1 315 ? 14.591  -8.327  109.536 1.00 11.01 ? 315 ASN B CB  1 
ATOM   6963  C CG  . ASN B 1 315 ? 16.040  -8.554  109.224 1.00 11.37 ? 315 ASN B CG  1 
ATOM   6964  O OD1 . ASN B 1 315 ? 16.598  -7.960  108.298 1.00 11.05 ? 315 ASN B OD1 1 
ATOM   6965  N ND2 . ASN B 1 315 ? 16.661  -9.481  109.971 1.00 10.92 ? 315 ASN B ND2 1 
ATOM   6966  N N   . ALA B 1 316 ? 14.855  -5.027  108.139 1.00 10.36 ? 316 ALA B N   1 
ATOM   6967  C CA  . ALA B 1 316 ? 14.688  -4.180  106.953 1.00 10.32 ? 316 ALA B CA  1 
ATOM   6968  C C   . ALA B 1 316 ? 14.993  -4.855  105.614 1.00 9.89  ? 316 ALA B C   1 
ATOM   6969  O O   . ALA B 1 316 ? 14.158  -4.826  104.704 1.00 9.11  ? 316 ALA B O   1 
ATOM   6970  C CB  . ALA B 1 316 ? 15.441  -2.891  107.113 1.00 10.42 ? 316 ALA B CB  1 
ATOM   6971  N N   . PRO B 1 317 ? 16.159  -5.462  105.469 1.00 10.39 ? 317 PRO B N   1 
ATOM   6972  C CA  . PRO B 1 317 ? 16.492  -6.141  104.208 1.00 10.18 ? 317 PRO B CA  1 
ATOM   6973  C C   . PRO B 1 317 ? 15.549  -7.294  103.894 1.00 10.39 ? 317 PRO B C   1 
ATOM   6974  O O   . PRO B 1 317 ? 15.272  -7.551  102.728 1.00 10.05 ? 317 PRO B O   1 
ATOM   6975  C CB  . PRO B 1 317 ? 17.899  -6.670  104.428 1.00 10.44 ? 317 PRO B CB  1 
ATOM   6976  C CG  . PRO B 1 317 ? 18.301  -6.291  105.807 1.00 11.20 ? 317 PRO B CG  1 
ATOM   6977  C CD  . PRO B 1 317 ? 17.250  -5.509  106.447 1.00 9.97  ? 317 PRO B CD  1 
ATOM   6978  N N   . VAL B 1 318 ? 15.111  -8.015  104.920 1.00 9.63  ? 318 VAL B N   1 
ATOM   6979  C CA  . VAL B 1 318 ? 14.164  -9.105  104.723 1.00 9.80  ? 318 VAL B CA  1 
ATOM   6980  C C   . VAL B 1 318 ? 12.826  -8.573  104.217 1.00 9.28  ? 318 VAL B C   1 
ATOM   6981  O O   . VAL B 1 318 ? 12.230  -9.133  103.294 1.00 8.77  ? 318 VAL B O   1 
ATOM   6982  C CB  . VAL B 1 318 ? 13.944  -9.880  106.028 1.00 9.70  ? 318 VAL B CB  1 
ATOM   6983  C CG1 . VAL B 1 318 ? 12.842  -10.898 105.854 1.00 9.16  ? 318 VAL B CG1 1 
ATOM   6984  C CG2 . VAL B 1 318 ? 15.240  -10.530 106.447 1.00 10.10 ? 318 VAL B CG2 1 
ATOM   6985  N N   . LEU B 1 319 ? 12.359  -7.474  104.799 1.00 9.36  ? 319 LEU B N   1 
ATOM   6986  C CA  . LEU B 1 319 ? 11.070  -6.945  104.375 1.00 10.31 ? 319 LEU B CA  1 
ATOM   6987  C C   . LEU B 1 319 ? 11.159  -6.432  102.919 1.00 10.24 ? 319 LEU B C   1 
ATOM   6988  O O   . LEU B 1 319 ? 10.252  -6.646  102.103 1.00 9.16  ? 319 LEU B O   1 
ATOM   6989  C CB  . LEU B 1 319 ? 10.567  -5.873  105.336 1.00 10.85 ? 319 LEU B CB  1 
ATOM   6990  C CG  . LEU B 1 319 ? 10.133  -6.386  106.729 1.00 11.38 ? 319 LEU B CG  1 
ATOM   6991  C CD1 . LEU B 1 319 ? 9.484   -5.269  107.518 1.00 14.69 ? 319 LEU B CD1 1 
ATOM   6992  C CD2 . LEU B 1 319 ? 9.187   -7.573  106.640 1.00 14.37 ? 319 LEU B CD2 1 
ATOM   6993  N N   . LEU B 1 320 ? 12.261  -5.768  102.598 1.00 9.67  ? 320 LEU B N   1 
ATOM   6994  C CA  . LEU B 1 320 ? 12.421  -5.258  101.244 1.00 10.29 ? 320 LEU B CA  1 
ATOM   6995  C C   . LEU B 1 320 ? 12.437  -6.420  100.266 1.00 10.36 ? 320 LEU B C   1 
ATOM   6996  O O   . LEU B 1 320 ? 11.805  -6.370  99.206  1.00 10.30 ? 320 LEU B O   1 
ATOM   6997  C CB  . LEU B 1 320 ? 13.702  -4.454  101.131 1.00 10.09 ? 320 LEU B CB  1 
ATOM   6998  C CG  . LEU B 1 320 ? 13.653  -3.126  101.886 1.00 10.25 ? 320 LEU B CG  1 
ATOM   6999  C CD1 . LEU B 1 320 ? 15.015  -2.433  101.736 1.00 12.13 ? 320 LEU B CD1 1 
ATOM   7000  C CD2 . LEU B 1 320 ? 12.566  -2.221  101.350 1.00 11.79 ? 320 LEU B CD2 1 
ATOM   7001  N N   . ALA B 1 321 ? 13.143  -7.477  100.649 1.00 10.19 ? 321 ALA B N   1 
ATOM   7002  C CA  . ALA B 1 321 ? 13.229  -8.671  99.819  1.00 10.26 ? 321 ALA B CA  1 
ATOM   7003  C C   . ALA B 1 321 ? 11.844  -9.258  99.606  1.00 9.99  ? 321 ALA B C   1 
ATOM   7004  O O   . ALA B 1 321 ? 11.447  -9.583  98.471  1.00 10.22 ? 321 ALA B O   1 
ATOM   7005  C CB  . ALA B 1 321 ? 14.143  -9.695  100.483 1.00 9.86  ? 321 ALA B CB  1 
ATOM   7006  N N   . LEU B 1 322 ? 11.092  -9.372  100.693 1.00 10.02 ? 322 LEU B N   1 
ATOM   7007  C CA  . LEU B 1 322 ? 9.783   -9.990  100.623 1.00 10.20 ? 322 LEU B CA  1 
ATOM   7008  C C   . LEU B 1 322 ? 8.815   -9.212  99.757  1.00 9.29  ? 322 LEU B C   1 
ATOM   7009  O O   . LEU B 1 322 ? 8.078   -9.800  98.997  1.00 8.71  ? 322 LEU B O   1 
ATOM   7010  C CB  . LEU B 1 322 ? 9.221   -10.250 102.023 1.00 10.57 ? 322 LEU B CB  1 
ATOM   7011  C CG  . LEU B 1 322 ? 9.957   -11.396 102.713 1.00 10.29 ? 322 LEU B CG  1 
ATOM   7012  C CD1 . LEU B 1 322 ? 9.520   -11.489 104.155 1.00 11.50 ? 322 LEU B CD1 1 
ATOM   7013  C CD2 . LEU B 1 322 ? 9.716   -12.741 102.020 1.00 12.65 ? 322 LEU B CD2 1 
ATOM   7014  N N   . LEU B 1 323 ? 8.842   -7.890  99.845  1.00 9.72  ? 323 LEU B N   1 
ATOM   7015  C CA  . LEU B 1 323 ? 7.973   -7.074  99.034  1.00 9.94  ? 323 LEU B CA  1 
ATOM   7016  C C   . LEU B 1 323 ? 8.281   -7.315  97.564  1.00 9.77  ? 323 LEU B C   1 
ATOM   7017  O O   . LEU B 1 323 ? 7.362   -7.463  96.750  1.00 10.52 ? 323 LEU B O   1 
ATOM   7018  C CB  . LEU B 1 323 ? 8.128   -5.591  99.434  1.00 10.41 ? 323 LEU B CB  1 
ATOM   7019  C CG  . LEU B 1 323 ? 7.537   -5.321  100.832 1.00 11.77 ? 323 LEU B CG  1 
ATOM   7020  C CD1 . LEU B 1 323 ? 8.096   -4.038  101.418 1.00 11.07 ? 323 LEU B CD1 1 
ATOM   7021  C CD2 . LEU B 1 323 ? 6.043   -5.267  100.771 1.00 11.28 ? 323 LEU B CD2 1 
ATOM   7022  N N   . GLY B 1 324 ? 9.570   -7.432  97.250  1.00 9.36  ? 324 GLY B N   1 
ATOM   7023  C CA  . GLY B 1 324 ? 10.010  -7.700  95.898  1.00 9.54  ? 324 GLY B CA  1 
ATOM   7024  C C   . GLY B 1 324 ? 9.515   -9.054  95.417  1.00 10.03 ? 324 GLY B C   1 
ATOM   7025  O O   . GLY B 1 324 ? 9.068   -9.175  94.289  1.00 9.39  ? 324 GLY B O   1 
ATOM   7026  N N   . ILE B 1 325 ? 9.569   -10.072 96.276  1.00 9.85  ? 325 ILE B N   1 
ATOM   7027  C CA  . ILE B 1 325 ? 9.053   -11.394 95.896  1.00 10.13 ? 325 ILE B CA  1 
ATOM   7028  C C   . ILE B 1 325 ? 7.554   -11.282 95.544  1.00 9.59  ? 325 ILE B C   1 
ATOM   7029  O O   . ILE B 1 325 ? 7.064   -11.834 94.561  1.00 9.53  ? 325 ILE B O   1 
ATOM   7030  C CB  . ILE B 1 325 ? 9.235   -12.415 97.057  1.00 10.07 ? 325 ILE B CB  1 
ATOM   7031  C CG1 . ILE B 1 325 ? 10.700  -12.757 97.338  1.00 11.30 ? 325 ILE B CG1 1 
ATOM   7032  C CG2 . ILE B 1 325 ? 8.441   -13.697 96.774  1.00 10.34 ? 325 ILE B CG2 1 
ATOM   7033  C CD1 . ILE B 1 325 ? 11.490  -13.326 96.182  1.00 13.42 ? 325 ILE B CD1 1 
ATOM   7034  N N   . TRP B 1 326 ? 6.819   -10.559 96.364  1.00 10.10 ? 326 TRP B N   1 
ATOM   7035  C CA  . TRP B 1 326 ? 5.391   -10.375 96.144  1.00 10.32 ? 326 TRP B CA  1 
ATOM   7036  C C   . TRP B 1 326 ? 5.117   -9.754  94.767  1.00 10.52 ? 326 TRP B C   1 
ATOM   7037  O O   . TRP B 1 326 ? 4.267   -10.239 94.002  1.00 10.29 ? 326 TRP B O   1 
ATOM   7038  C CB  . TRP B 1 326 ? 4.869   -9.514  97.275  1.00 10.55 ? 326 TRP B CB  1 
ATOM   7039  C CG  . TRP B 1 326 ? 3.446   -9.132  97.272  1.00 11.55 ? 326 TRP B CG  1 
ATOM   7040  C CD1 . TRP B 1 326 ? 2.961   -7.867  97.326  1.00 13.25 ? 326 TRP B CD1 1 
ATOM   7041  C CD2 . TRP B 1 326 ? 2.312   -10.000 97.359  1.00 12.91 ? 326 TRP B CD2 1 
ATOM   7042  N NE1 . TRP B 1 326 ? 1.592   -7.886  97.383  1.00 15.76 ? 326 TRP B NE1 1 
ATOM   7043  C CE2 . TRP B 1 326 ? 1.168   -9.187  97.409  1.00 14.18 ? 326 TRP B CE2 1 
ATOM   7044  C CE3 . TRP B 1 326 ? 2.145   -11.390 97.360  1.00 13.89 ? 326 TRP B CE3 1 
ATOM   7045  C CZ2 . TRP B 1 326 ? -0.124  -9.708  97.463  1.00 15.93 ? 326 TRP B CZ2 1 
ATOM   7046  C CZ3 . TRP B 1 326 ? 0.867   -11.909 97.416  1.00 13.95 ? 326 TRP B CZ3 1 
ATOM   7047  C CH2 . TRP B 1 326 ? -0.251  -11.074 97.476  1.00 15.17 ? 326 TRP B CH2 1 
ATOM   7048  N N   . TYR B 1 327 ? 5.868   -8.716  94.408  1.00 10.27 ? 327 TYR B N   1 
ATOM   7049  C CA  . TYR B 1 327 ? 5.633   -8.056  93.119  1.00 10.55 ? 327 TYR B CA  1 
ATOM   7050  C C   . TYR B 1 327 ? 6.151   -8.886  91.942  1.00 10.41 ? 327 TYR B C   1 
ATOM   7051  O O   . TYR B 1 327 ? 5.537   -8.908  90.878  1.00 10.28 ? 327 TYR B O   1 
ATOM   7052  C CB  . TYR B 1 327 ? 6.238   -6.635  93.093  1.00 10.44 ? 327 TYR B CB  1 
ATOM   7053  C CG  . TYR B 1 327 ? 5.531   -5.692  94.024  1.00 9.53  ? 327 TYR B CG  1 
ATOM   7054  C CD1 . TYR B 1 327 ? 4.165   -5.514  93.945  1.00 9.74  ? 327 TYR B CD1 1 
ATOM   7055  C CD2 . TYR B 1 327 ? 6.224   -5.014  95.024  1.00 9.27  ? 327 TYR B CD2 1 
ATOM   7056  C CE1 . TYR B 1 327 ? 3.509   -4.693  94.802  1.00 10.53 ? 327 TYR B CE1 1 
ATOM   7057  C CE2 . TYR B 1 327 ? 5.569   -4.179  95.890  1.00 10.15 ? 327 TYR B CE2 1 
ATOM   7058  C CZ  . TYR B 1 327 ? 4.207   -4.011  95.774  1.00 10.26 ? 327 TYR B CZ  1 
ATOM   7059  O OH  . TYR B 1 327 ? 3.527   -3.181  96.638  1.00 10.88 ? 327 TYR B OH  1 
ATOM   7060  N N   . ILE B 1 328 ? 7.257   -9.587  92.157  1.00 10.43 ? 328 ILE B N   1 
ATOM   7061  C CA  . ILE B 1 328 ? 7.873   -10.378 91.102  1.00 10.66 ? 328 ILE B CA  1 
ATOM   7062  C C   . ILE B 1 328 ? 7.125   -11.693 90.850  1.00 11.08 ? 328 ILE B C   1 
ATOM   7063  O O   . ILE B 1 328 ? 6.725   -11.976 89.715  1.00 11.25 ? 328 ILE B O   1 
ATOM   7064  C CB  . ILE B 1 328 ? 9.334   -10.654 91.440  1.00 10.16 ? 328 ILE B CB  1 
ATOM   7065  C CG1 . ILE B 1 328 ? 10.155  -9.360  91.296  1.00 9.92  ? 328 ILE B CG1 1 
ATOM   7066  C CG2 . ILE B 1 328 ? 9.894   -11.707 90.503  1.00 10.61 ? 328 ILE B CG2 1 
ATOM   7067  C CD1 . ILE B 1 328 ? 11.453  -9.391  91.988  1.00 9.22  ? 328 ILE B CD1 1 
ATOM   7068  N N   . ASN B 1 329 ? 6.932   -12.484 91.903  1.00 11.36 ? 329 ASN B N   1 
ATOM   7069  C CA  . ASN B 1 329 ? 6.318   -13.803 91.743  1.00 12.27 ? 329 ASN B CA  1 
ATOM   7070  C C   . ASN B 1 329 ? 4.785   -13.885 91.805  1.00 12.68 ? 329 ASN B C   1 
ATOM   7071  O O   . ASN B 1 329 ? 4.204   -14.886 91.385  1.00 12.94 ? 329 ASN B O   1 
ATOM   7072  C CB  . ASN B 1 329 ? 6.971   -14.776 92.718  1.00 12.31 ? 329 ASN B CB  1 
ATOM   7073  C CG  . ASN B 1 329 ? 8.458   -14.900 92.477  1.00 13.04 ? 329 ASN B CG  1 
ATOM   7074  O OD1 . ASN B 1 329 ? 9.274   -14.527 93.332  1.00 13.00 ? 329 ASN B OD1 1 
ATOM   7075  N ND2 . ASN B 1 329 ? 8.829   -15.419 91.304  1.00 12.92 ? 329 ASN B ND2 1 
ATOM   7076  N N   . CYS B 1 330 ? 4.118   -12.864 92.323  1.00 12.70 ? 330 CYS B N   1 
ATOM   7077  C CA  . CYS B 1 330 ? 2.657   -12.857 92.321  1.00 13.06 ? 330 CYS B CA  1 
ATOM   7078  C C   . CYS B 1 330 ? 2.130   -11.844 91.299  1.00 13.15 ? 330 CYS B C   1 
ATOM   7079  O O   . CYS B 1 330 ? 1.365   -12.205 90.433  1.00 13.01 ? 330 CYS B O   1 
ATOM   7080  C CB  . CYS B 1 330 ? 2.089   -12.630 93.723  1.00 13.04 ? 330 CYS B CB  1 
ATOM   7081  S SG  . CYS B 1 330 ? 2.545   -13.956 94.879  1.00 14.83 ? 330 CYS B SG  1 
ATOM   7082  N N   . PHE B 1 331 ? 2.587   -10.591 91.360  1.00 12.55 ? 331 PHE B N   1 
ATOM   7083  C CA  . PHE B 1 331 ? 2.149   -9.586  90.401  1.00 12.14 ? 331 PHE B CA  1 
ATOM   7084  C C   . PHE B 1 331 ? 2.845   -9.687  89.028  1.00 12.40 ? 331 PHE B C   1 
ATOM   7085  O O   . PHE B 1 331 ? 2.329   -9.169  88.057  1.00 13.00 ? 331 PHE B O   1 
ATOM   7086  C CB  . PHE B 1 331 ? 2.309   -8.161  90.958  1.00 11.83 ? 331 PHE B CB  1 
ATOM   7087  C CG  . PHE B 1 331 ? 1.216   -7.738  91.908  1.00 12.73 ? 331 PHE B CG  1 
ATOM   7088  C CD1 . PHE B 1 331 ? 1.347   -7.958  93.264  1.00 12.82 ? 331 PHE B CD1 1 
ATOM   7089  C CD2 . PHE B 1 331 ? 0.079   -7.088  91.450  1.00 15.42 ? 331 PHE B CD2 1 
ATOM   7090  C CE1 . PHE B 1 331 ? 0.376   -7.547  94.138  1.00 13.28 ? 331 PHE B CE1 1 
ATOM   7091  C CE2 . PHE B 1 331 ? -0.922  -6.694  92.337  1.00 13.97 ? 331 PHE B CE2 1 
ATOM   7092  C CZ  . PHE B 1 331 ? -0.758  -6.919  93.675  1.00 14.15 ? 331 PHE B CZ  1 
ATOM   7093  N N   . GLY B 1 332 ? 4.005   -10.329 88.944  1.00 11.89 ? 332 GLY B N   1 
ATOM   7094  C CA  . GLY B 1 332 ? 4.698   -10.486 87.676  1.00 12.32 ? 332 GLY B CA  1 
ATOM   7095  C C   . GLY B 1 332 ? 5.437   -9.253  87.154  1.00 12.11 ? 332 GLY B C   1 
ATOM   7096  O O   . GLY B 1 332 ? 5.713   -9.160  85.969  1.00 12.77 ? 332 GLY B O   1 
ATOM   7097  N N   . CYS B 1 333 ? 5.790   -8.327  88.035  1.00 11.11 ? 333 CYS B N   1 
ATOM   7098  C CA  . CYS B 1 333 ? 6.489   -7.113  87.619  1.00 10.79 ? 333 CYS B CA  1 
ATOM   7099  C C   . CYS B 1 333 ? 7.932   -7.429  87.213  1.00 9.98  ? 333 CYS B C   1 
ATOM   7100  O O   . CYS B 1 333 ? 8.706   -7.948  88.005  1.00 9.64  ? 333 CYS B O   1 
ATOM   7101  C CB  . CYS B 1 333 ? 6.483   -6.087  88.756  1.00 10.37 ? 333 CYS B CB  1 
ATOM   7102  S SG  . CYS B 1 333 ? 4.840   -5.573  89.315  1.00 11.01 ? 333 CYS B SG  1 
ATOM   7103  N N   . GLU B 1 334 ? 8.298   -7.103  85.980  1.00 9.53  ? 334 GLU B N   1 
ATOM   7104  C CA  . GLU B 1 334 ? 9.647   -7.360  85.506  1.00 9.68  ? 334 GLU B CA  1 
ATOM   7105  C C   . GLU B 1 334 ? 10.733  -6.476  86.141  1.00 9.69  ? 334 GLU B C   1 
ATOM   7106  O O   . GLU B 1 334 ? 11.890  -6.880  86.202  1.00 9.67  ? 334 GLU B O   1 
ATOM   7107  C CB  . GLU B 1 334 ? 9.726   -7.118  83.998  1.00 10.01 ? 334 GLU B CB  1 
ATOM   7108  C CG  . GLU B 1 334 ? 9.165   -8.211  83.130  1.00 9.83  ? 334 GLU B CG  1 
ATOM   7109  C CD  . GLU B 1 334 ? 9.568   -8.048  81.668  1.00 9.49  ? 334 GLU B CD  1 
ATOM   7110  O OE1 . GLU B 1 334 ? 10.707  -7.610  81.400  1.00 9.57  ? 334 GLU B OE1 1 
ATOM   7111  O OE2 . GLU B 1 334 ? 8.735   -8.347  80.790  1.00 11.19 ? 334 GLU B OE2 1 
ATOM   7112  N N   . THR B 1 335 ? 10.383  -5.265  86.572  1.00 9.59  ? 335 THR B N   1 
ATOM   7113  C CA  . THR B 1 335 ? 11.419  -4.315  86.992  1.00 9.41  ? 335 THR B CA  1 
ATOM   7114  C C   . THR B 1 335 ? 11.264  -3.769  88.397  1.00 9.56  ? 335 THR B C   1 
ATOM   7115  O O   . THR B 1 335 ? 10.244  -3.951  89.045  1.00 9.23  ? 335 THR B O   1 
ATOM   7116  C CB  . THR B 1 335 ? 11.498  -3.115  86.018  1.00 9.79  ? 335 THR B CB  1 
ATOM   7117  O OG1 . THR B 1 335 ? 10.475  -2.175  86.315  1.00 7.98  ? 335 THR B OG1 1 
ATOM   7118  C CG2 . THR B 1 335 ? 11.175  -3.520  84.581  1.00 10.41 ? 335 THR B CG2 1 
ATOM   7119  N N   . HIS B 1 336 ? 12.315  -3.095  88.843  1.00 9.06  ? 336 HIS B N   1 
ATOM   7120  C CA  . HIS B 1 336 ? 12.368  -2.483  90.134  1.00 8.92  ? 336 HIS B CA  1 
ATOM   7121  C C   . HIS B 1 336 ? 13.116  -1.185  89.948  1.00 8.60  ? 336 HIS B C   1 
ATOM   7122  O O   . HIS B 1 336 ? 14.294  -1.187  89.578  1.00 9.03  ? 336 HIS B O   1 
ATOM   7123  C CB  . HIS B 1 336 ? 13.104  -3.370  91.125  1.00 8.83  ? 336 HIS B CB  1 
ATOM   7124  C CG  . HIS B 1 336 ? 13.144  -2.804  92.510  1.00 9.99  ? 336 HIS B CG  1 
ATOM   7125  N ND1 . HIS B 1 336 ? 12.070  -2.867  93.371  1.00 10.72 ? 336 HIS B ND1 1 
ATOM   7126  C CD2 . HIS B 1 336 ? 14.122  -2.144  93.175  1.00 9.88  ? 336 HIS B CD2 1 
ATOM   7127  C CE1 . HIS B 1 336 ? 12.390  -2.282  94.507  1.00 11.52 ? 336 HIS B CE1 1 
ATOM   7128  N NE2 . HIS B 1 336 ? 13.635  -1.843  94.418  1.00 9.67  ? 336 HIS B NE2 1 
ATOM   7129  N N   . ALA B 1 337 ? 12.439  -0.080  90.201  1.00 8.31  ? 337 ALA B N   1 
ATOM   7130  C CA  . ALA B 1 337 ? 13.060  1.233   90.014  1.00 8.31  ? 337 ALA B CA  1 
ATOM   7131  C C   . ALA B 1 337 ? 13.644  1.770   91.322  1.00 7.87  ? 337 ALA B C   1 
ATOM   7132  O O   . ALA B 1 337 ? 12.992  1.721   92.388  1.00 7.79  ? 337 ALA B O   1 
ATOM   7133  C CB  . ALA B 1 337 ? 12.062  2.201   89.431  1.00 7.98  ? 337 ALA B CB  1 
ATOM   7134  N N   . MET B 1 338 ? 14.875  2.278   91.232  1.00 7.84  ? 338 MET B N   1 
ATOM   7135  C CA  . MET B 1 338 ? 15.585  2.882   92.358  1.00 7.48  ? 338 MET B CA  1 
ATOM   7136  C C   . MET B 1 338 ? 15.807  4.380   92.055  1.00 7.82  ? 338 MET B C   1 
ATOM   7137  O O   . MET B 1 338 ? 16.556  4.763   91.135  1.00 6.77  ? 338 MET B O   1 
ATOM   7138  C CB  . MET B 1 338 ? 16.873  2.103   92.628  1.00 8.75  ? 338 MET B CB  1 
ATOM   7139  C CG  . MET B 1 338 ? 16.583  0.711   93.189  1.00 10.72 ? 338 MET B CG  1 
ATOM   7140  S SD  . MET B 1 338 ? 18.007  -0.345  93.465  1.00 13.98 ? 338 MET B SD  1 
ATOM   7141  C CE  . MET B 1 338 ? 18.765  0.517   94.934  1.00 12.11 ? 338 MET B CE  1 
ATOM   7142  N N   . LEU B 1 339 ? 15.126  5.216   92.839  1.00 7.11  ? 339 LEU B N   1 
ATOM   7143  C CA  . LEU B 1 339 ? 15.007  6.653   92.593  1.00 6.87  ? 339 LEU B CA  1 
ATOM   7144  C C   . LEU B 1 339 ? 15.411  7.480   93.798  1.00 6.92  ? 339 LEU B C   1 
ATOM   7145  O O   . LEU B 1 339 ? 14.566  7.943   94.555  1.00 7.63  ? 339 LEU B O   1 
ATOM   7146  C CB  . LEU B 1 339 ? 13.567  6.967   92.230  1.00 6.87  ? 339 LEU B CB  1 
ATOM   7147  C CG  . LEU B 1 339 ? 12.954  6.091   91.149  1.00 6.88  ? 339 LEU B CG  1 
ATOM   7148  C CD1 . LEU B 1 339 ? 11.439  6.255   90.969  1.00 8.48  ? 339 LEU B CD1 1 
ATOM   7149  C CD2 . LEU B 1 339 ? 13.668  6.331   89.830  1.00 6.55  ? 339 LEU B CD2 1 
ATOM   7150  N N   . PRO B 1 340 ? 16.713  7.675   93.967  1.00 7.22  ? 340 PRO B N   1 
ATOM   7151  C CA  . PRO B 1 340 ? 17.225  8.483   95.065  1.00 7.01  ? 340 PRO B CA  1 
ATOM   7152  C C   . PRO B 1 340 ? 17.054  9.969   94.763  1.00 7.53  ? 340 PRO B C   1 
ATOM   7153  O O   . PRO B 1 340 ? 17.467  10.420  93.714  1.00 8.62  ? 340 PRO B O   1 
ATOM   7154  C CB  . PRO B 1 340 ? 18.683  8.091   95.138  1.00 7.59  ? 340 PRO B CB  1 
ATOM   7155  C CG  . PRO B 1 340 ? 19.044  7.507   93.796  1.00 7.26  ? 340 PRO B CG  1 
ATOM   7156  C CD  . PRO B 1 340 ? 17.784  7.128   93.113  1.00 7.10  ? 340 PRO B CD  1 
ATOM   7157  N N   . TYR B 1 341 ? 16.393  10.718  95.642  1.00 7.31  ? 341 TYR B N   1 
ATOM   7158  C CA  . TYR B 1 341 ? 16.254  12.162  95.411  1.00 7.24  ? 341 TYR B CA  1 
ATOM   7159  C C   . TYR B 1 341 ? 17.526  12.828  95.941  1.00 6.91  ? 341 TYR B C   1 
ATOM   7160  O O   . TYR B 1 341 ? 17.526  13.494  96.949  1.00 6.51  ? 341 TYR B O   1 
ATOM   7161  C CB  . TYR B 1 341 ? 14.975  12.700  96.052  1.00 6.60  ? 341 TYR B CB  1 
ATOM   7162  C CG  . TYR B 1 341 ? 13.815  12.554  95.112  1.00 6.65  ? 341 TYR B CG  1 
ATOM   7163  C CD1 . TYR B 1 341 ? 13.479  11.309  94.595  1.00 5.05  ? 341 TYR B CD1 1 
ATOM   7164  C CD2 . TYR B 1 341 ? 13.077  13.653  94.693  1.00 7.55  ? 341 TYR B CD2 1 
ATOM   7165  C CE1 . TYR B 1 341 ? 12.455  11.164  93.696  1.00 6.10  ? 341 TYR B CE1 1 
ATOM   7166  C CE2 . TYR B 1 341 ? 12.019  13.510  93.765  1.00 7.69  ? 341 TYR B CE2 1 
ATOM   7167  C CZ  . TYR B 1 341 ? 11.726  12.256  93.264  1.00 7.42  ? 341 TYR B CZ  1 
ATOM   7168  O OH  . TYR B 1 341 ? 10.691  12.077  92.319  1.00 7.53  ? 341 TYR B OH  1 
ATOM   7169  N N   . ASP B 1 342 ? 18.609  12.638  95.207  1.00 7.12  ? 342 ASP B N   1 
ATOM   7170  C CA  . ASP B 1 342 ? 19.925  13.026  95.673  1.00 7.17  ? 342 ASP B CA  1 
ATOM   7171  C C   . ASP B 1 342 ? 20.885  12.909  94.506  1.00 7.00  ? 342 ASP B C   1 
ATOM   7172  O O   . ASP B 1 342 ? 21.151  11.825  94.018  1.00 6.84  ? 342 ASP B O   1 
ATOM   7173  C CB  . ASP B 1 342 ? 20.373  12.115  96.804  1.00 7.31  ? 342 ASP B CB  1 
ATOM   7174  C CG  . ASP B 1 342 ? 21.687  12.543  97.405  1.00 8.66  ? 342 ASP B CG  1 
ATOM   7175  O OD1 . ASP B 1 342 ? 21.691  13.387  98.348  1.00 8.02  ? 342 ASP B OD1 1 
ATOM   7176  O OD2 . ASP B 1 342 ? 22.772  12.091  96.969  1.00 7.67  ? 342 ASP B OD2 1 
ATOM   7177  N N   . GLN B 1 343 ? 21.391  14.045  94.061  1.00 7.16  ? 343 GLN B N   1 
ATOM   7178  C CA  . GLN B 1 343 ? 22.269  14.094  92.910  1.00 6.81  ? 343 GLN B CA  1 
ATOM   7179  C C   . GLN B 1 343 ? 23.600  13.387  93.182  1.00 7.18  ? 343 GLN B C   1 
ATOM   7180  O O   . GLN B 1 343 ? 24.192  12.802  92.262  1.00 7.13  ? 343 GLN B O   1 
ATOM   7181  C CB  . GLN B 1 343 ? 22.496  15.551  92.500  1.00 7.54  ? 343 GLN B CB  1 
ATOM   7182  C CG  . GLN B 1 343 ? 23.295  15.682  91.218  1.00 7.82  ? 343 GLN B CG  1 
ATOM   7183  C CD  . GLN B 1 343 ? 22.552  15.153  90.010  1.00 11.05 ? 343 GLN B CD  1 
ATOM   7184  O OE1 . GLN B 1 343 ? 21.310  15.160  89.981  1.00 11.54 ? 343 GLN B OE1 1 
ATOM   7185  N NE2 . GLN B 1 343 ? 23.308  14.651  89.014  1.00 10.63 ? 343 GLN B NE2 1 
ATOM   7186  N N   . TYR B 1 344 ? 24.079  13.424  94.427  1.00 7.02  ? 344 TYR B N   1 
ATOM   7187  C CA  . TYR B 1 344 ? 25.305  12.717  94.773  1.00 7.57  ? 344 TYR B CA  1 
ATOM   7188  C C   . TYR B 1 344 ? 25.144  11.188  94.542  1.00 7.73  ? 344 TYR B C   1 
ATOM   7189  O O   . TYR B 1 344 ? 26.085  10.516  94.135  1.00 8.52  ? 344 TYR B O   1 
ATOM   7190  C CB  . TYR B 1 344 ? 25.733  13.011  96.216  1.00 7.76  ? 344 TYR B CB  1 
ATOM   7191  C CG  . TYR B 1 344 ? 26.475  14.322  96.373  1.00 8.08  ? 344 TYR B CG  1 
ATOM   7192  C CD1 . TYR B 1 344 ? 26.168  15.206  97.405  1.00 10.49 ? 344 TYR B CD1 1 
ATOM   7193  C CD2 . TYR B 1 344 ? 27.489  14.677  95.492  1.00 9.16  ? 344 TYR B CD2 1 
ATOM   7194  C CE1 . TYR B 1 344 ? 26.835  16.399  97.536  1.00 9.32  ? 344 TYR B CE1 1 
ATOM   7195  C CE2 . TYR B 1 344 ? 28.166  15.861  95.618  1.00 9.09  ? 344 TYR B CE2 1 
ATOM   7196  C CZ  . TYR B 1 344 ? 27.851  16.714  96.640  1.00 11.28 ? 344 TYR B CZ  1 
ATOM   7197  O OH  . TYR B 1 344 ? 28.556  17.888  96.752  1.00 10.46 ? 344 TYR B OH  1 
ATOM   7198  N N   . LEU B 1 345 ? 23.951  10.674  94.797  1.00 7.58  ? 345 LEU B N   1 
ATOM   7199  C CA  . LEU B 1 345 ? 23.633  9.271   94.561  1.00 8.24  ? 345 LEU B CA  1 
ATOM   7200  C C   . LEU B 1 345 ? 23.266  8.993   93.093  1.00 8.19  ? 345 LEU B C   1 
ATOM   7201  O O   . LEU B 1 345 ? 22.593  8.004   92.812  1.00 9.48  ? 345 LEU B O   1 
ATOM   7202  C CB  . LEU B 1 345 ? 22.456  8.845   95.452  1.00 8.04  ? 345 LEU B CB  1 
ATOM   7203  C CG  . LEU B 1 345 ? 22.775  8.572   96.913  1.00 8.79  ? 345 LEU B CG  1 
ATOM   7204  C CD1 . LEU B 1 345 ? 21.518  8.396   97.727  1.00 11.02 ? 345 LEU B CD1 1 
ATOM   7205  C CD2 . LEU B 1 345 ? 23.636  7.362   97.058  1.00 10.24 ? 345 LEU B CD2 1 
ATOM   7206  N N   . HIS B 1 346 ? 23.713  9.820   92.150  1.00 7.97  ? 346 HIS B N   1 
ATOM   7207  C CA  . HIS B 1 346 ? 23.317  9.624   90.747  1.00 8.10  ? 346 HIS B CA  1 
ATOM   7208  C C   . HIS B 1 346 ? 23.722  8.264   90.142  1.00 7.92  ? 346 HIS B C   1 
ATOM   7209  O O   . HIS B 1 346 ? 23.142  7.866   89.128  1.00 8.21  ? 346 HIS B O   1 
ATOM   7210  C CB  . HIS B 1 346 ? 23.767  10.789  89.854  1.00 7.93  ? 346 HIS B CB  1 
ATOM   7211  C CG  . HIS B 1 346 ? 25.244  10.876  89.620  1.00 9.27  ? 346 HIS B CG  1 
ATOM   7212  N ND1 . HIS B 1 346 ? 25.791  10.819  88.358  1.00 9.65  ? 346 HIS B ND1 1 
ATOM   7213  C CD2 . HIS B 1 346 ? 26.282  11.073  90.469  1.00 10.36 ? 346 HIS B CD2 1 
ATOM   7214  C CE1 . HIS B 1 346 ? 27.101  10.966  88.441  1.00 10.68 ? 346 HIS B CE1 1 
ATOM   7215  N NE2 . HIS B 1 346 ? 27.426  11.103  89.712  1.00 10.45 ? 346 HIS B NE2 1 
ATOM   7216  N N   . ARG B 1 347 ? 24.665  7.542   90.769  1.00 7.48  ? 347 ARG B N   1 
ATOM   7217  C CA  . ARG B 1 347 ? 25.113  6.246   90.225  1.00 7.71  ? 347 ARG B CA  1 
ATOM   7218  C C   . ARG B 1 347 ? 24.763  5.050   91.131  1.00 7.63  ? 347 ARG B C   1 
ATOM   7219  O O   . ARG B 1 347 ? 25.203  3.905   90.910  1.00 7.85  ? 347 ARG B O   1 
ATOM   7220  C CB  . ARG B 1 347 ? 26.617  6.285   89.910  1.00 7.22  ? 347 ARG B CB  1 
ATOM   7221  C CG  . ARG B 1 347 ? 26.984  7.361   88.908  1.00 9.09  ? 347 ARG B CG  1 
ATOM   7222  C CD  . ARG B 1 347 ? 26.164  7.307   87.634  1.00 9.37  ? 347 ARG B CD  1 
ATOM   7223  N NE  . ARG B 1 347 ? 26.511  6.133   86.832  1.00 7.41  ? 347 ARG B NE  1 
ATOM   7224  C CZ  . ARG B 1 347 ? 25.827  5.685   85.796  1.00 9.34  ? 347 ARG B CZ  1 
ATOM   7225  N NH1 . ARG B 1 347 ? 24.695  6.250   85.440  1.00 12.65 ? 347 ARG B NH1 1 
ATOM   7226  N NH2 . ARG B 1 347 ? 26.261  4.636   85.110  1.00 10.82 ? 347 ARG B NH2 1 
ATOM   7227  N N   . PHE B 1 348 ? 23.910  5.310   92.112  1.00 8.17  ? 348 PHE B N   1 
ATOM   7228  C CA  . PHE B 1 348 ? 23.404  4.267   93.016  1.00 8.04  ? 348 PHE B CA  1 
ATOM   7229  C C   . PHE B 1 348 ? 22.601  3.190   92.263  1.00 7.88  ? 348 PHE B C   1 
ATOM   7230  O O   . PHE B 1 348 ? 22.807  1.984   92.461  1.00 6.67  ? 348 PHE B O   1 
ATOM   7231  C CB  . PHE B 1 348 ? 22.519  4.948   94.076  1.00 7.77  ? 348 PHE B CB  1 
ATOM   7232  C CG  . PHE B 1 348 ? 22.196  4.111   95.279  1.00 7.67  ? 348 PHE B CG  1 
ATOM   7233  C CD1 . PHE B 1 348 ? 23.174  3.810   96.226  1.00 9.74  ? 348 PHE B CD1 1 
ATOM   7234  C CD2 . PHE B 1 348 ? 20.896  3.720   95.528  1.00 8.26  ? 348 PHE B CD2 1 
ATOM   7235  C CE1 . PHE B 1 348 ? 22.859  3.074   97.367  1.00 8.86  ? 348 PHE B CE1 1 
ATOM   7236  C CE2 . PHE B 1 348 ? 20.581  2.993   96.658  1.00 9.53  ? 348 PHE B CE2 1 
ATOM   7237  C CZ  . PHE B 1 348 ? 21.573  2.675   97.576  1.00 9.00  ? 348 PHE B CZ  1 
ATOM   7238  N N   . ALA B 1 349 ? 21.672  3.598   91.397  1.00 8.33  ? 349 ALA B N   1 
ATOM   7239  C CA  . ALA B 1 349 ? 20.862  2.603   90.690  1.00 8.68  ? 349 ALA B CA  1 
ATOM   7240  C C   . ALA B 1 349 ? 21.739  1.796   89.758  1.00 8.24  ? 349 ALA B C   1 
ATOM   7241  O O   . ALA B 1 349 ? 21.557  0.581   89.602  1.00 7.41  ? 349 ALA B O   1 
ATOM   7242  C CB  . ALA B 1 349 ? 19.714  3.249   89.888  1.00 8.81  ? 349 ALA B CB  1 
ATOM   7243  N N   . ALA B 1 350 ? 22.687  2.471   89.123  1.00 8.32  ? 350 ALA B N   1 
ATOM   7244  C CA  . ALA B 1 350 ? 23.592  1.795   88.199  1.00 8.39  ? 350 ALA B CA  1 
ATOM   7245  C C   . ALA B 1 350 ? 24.446  0.751   88.938  1.00 9.05  ? 350 ALA B C   1 
ATOM   7246  O O   . ALA B 1 350 ? 24.745  -0.318  88.402  1.00 8.34  ? 350 ALA B O   1 
ATOM   7247  C CB  . ALA B 1 350 ? 24.451  2.793   87.465  1.00 9.09  ? 350 ALA B CB  1 
ATOM   7248  N N   . TYR B 1 351 ? 24.833  1.053   90.167  1.00 9.00  ? 351 TYR B N   1 
ATOM   7249  C CA  . TYR B 1 351 ? 25.597  0.096   90.967  1.00 9.56  ? 351 TYR B CA  1 
ATOM   7250  C C   . TYR B 1 351 ? 24.759  -1.169  91.238  1.00 9.69  ? 351 TYR B C   1 
ATOM   7251  O O   . TYR B 1 351 ? 25.246  -2.305  91.141  1.00 9.87  ? 351 TYR B O   1 
ATOM   7252  C CB  . TYR B 1 351 ? 25.993  0.737   92.290  1.00 9.18  ? 351 TYR B CB  1 
ATOM   7253  C CG  . TYR B 1 351 ? 26.654  -0.218  93.248  1.00 9.67  ? 351 TYR B CG  1 
ATOM   7254  C CD1 . TYR B 1 351 ? 28.009  -0.485  93.148  1.00 9.99  ? 351 TYR B CD1 1 
ATOM   7255  C CD2 . TYR B 1 351 ? 25.925  -0.851  94.251  1.00 11.10 ? 351 TYR B CD2 1 
ATOM   7256  C CE1 . TYR B 1 351 ? 28.633  -1.337  94.020  1.00 11.17 ? 351 TYR B CE1 1 
ATOM   7257  C CE2 . TYR B 1 351 ? 26.544  -1.733  95.135  1.00 9.27  ? 351 TYR B CE2 1 
ATOM   7258  C CZ  . TYR B 1 351 ? 27.895  -1.974  95.000  1.00 11.06 ? 351 TYR B CZ  1 
ATOM   7259  O OH  . TYR B 1 351 ? 28.547  -2.836  95.849  1.00 11.66 ? 351 TYR B OH  1 
ATOM   7260  N N   . PHE B 1 352 ? 23.490  -0.984  91.570  1.00 9.90  ? 352 PHE B N   1 
ATOM   7261  C CA  . PHE B 1 352 ? 22.653  -2.151  91.863  1.00 10.76 ? 352 PHE B CA  1 
ATOM   7262  C C   . PHE B 1 352 ? 22.195  -2.907  90.637  1.00 11.05 ? 352 PHE B C   1 
ATOM   7263  O O   . PHE B 1 352 ? 21.757  -4.056  90.743  1.00 11.55 ? 352 PHE B O   1 
ATOM   7264  C CB  . PHE B 1 352 ? 21.553  -1.814  92.882  1.00 10.87 ? 352 PHE B CB  1 
ATOM   7265  C CG  . PHE B 1 352 ? 22.094  -1.767  94.270  1.00 11.65 ? 352 PHE B CG  1 
ATOM   7266  C CD1 . PHE B 1 352 ? 22.278  -0.570  94.926  1.00 12.08 ? 352 PHE B CD1 1 
ATOM   7267  C CD2 . PHE B 1 352 ? 22.496  -2.934  94.888  1.00 10.76 ? 352 PHE B CD2 1 
ATOM   7268  C CE1 . PHE B 1 352 ? 22.844  -0.548  96.169  1.00 11.25 ? 352 PHE B CE1 1 
ATOM   7269  C CE2 . PHE B 1 352 ? 23.059  -2.905  96.133  1.00 12.45 ? 352 PHE B CE2 1 
ATOM   7270  C CZ  . PHE B 1 352 ? 23.222  -1.707  96.779  1.00 12.07 ? 352 PHE B CZ  1 
ATOM   7271  N N   . GLN B 1 353 ? 22.357  -2.316  89.453  1.00 11.91 ? 353 GLN B N   1 
ATOM   7272  C CA  . GLN B 1 353 ? 22.119  -3.091  88.250  1.00 12.17 ? 353 GLN B CA  1 
ATOM   7273  C C   . GLN B 1 353 ? 23.107  -4.248  88.244  1.00 12.64 ? 353 GLN B C   1 
ATOM   7274  O O   . GLN B 1 353 ? 22.742  -5.336  87.816  1.00 14.88 ? 353 GLN B O   1 
ATOM   7275  C CB  . GLN B 1 353 ? 22.243  -2.266  86.970  1.00 11.85 ? 353 GLN B CB  1 
ATOM   7276  C CG  . GLN B 1 353 ? 21.058  -1.432  86.719  1.00 11.26 ? 353 GLN B CG  1 
ATOM   7277  C CD  . GLN B 1 353 ? 21.137  -0.688  85.404  1.00 11.80 ? 353 GLN B CD  1 
ATOM   7278  O OE1 . GLN B 1 353 ? 22.231  -0.337  84.961  1.00 10.47 ? 353 GLN B OE1 1 
ATOM   7279  N NE2 . GLN B 1 353 ? 19.974  -0.419  84.791  1.00 9.40  ? 353 GLN B NE2 1 
ATOM   7280  N N   . GLN B 1 354 ? 24.342  -4.054  88.715  1.00 11.29 ? 354 GLN B N   1 
ATOM   7281  C CA  . GLN B 1 354 ? 25.250  -5.187  88.830  1.00 11.65 ? 354 GLN B CA  1 
ATOM   7282  C C   . GLN B 1 354 ? 24.944  -5.965  90.093  1.00 10.78 ? 354 GLN B C   1 
ATOM   7283  O O   . GLN B 1 354 ? 24.729  -7.173  90.040  1.00 12.04 ? 354 GLN B O   1 
ATOM   7284  C CB  . GLN B 1 354 ? 26.756  -4.821  88.822  1.00 11.71 ? 354 GLN B CB  1 
ATOM   7285  C CG  . GLN B 1 354 ? 27.629  -6.082  88.925  1.00 13.48 ? 354 GLN B CG  1 
ATOM   7286  C CD  . GLN B 1 354 ? 29.135  -5.862  88.796  1.00 14.08 ? 354 GLN B CD  1 
ATOM   7287  O OE1 . GLN B 1 354 ? 29.890  -6.818  88.550  1.00 15.81 ? 354 GLN B OE1 1 
ATOM   7288  N NE2 . GLN B 1 354 ? 29.566  -4.634  88.946  1.00 11.97 ? 354 GLN B NE2 1 
ATOM   7289  N N   . GLY B 1 355 ? 24.913  -5.276  91.231  1.00 9.63  ? 355 GLY B N   1 
ATOM   7290  C CA  . GLY B 1 355 ? 24.743  -5.956  92.502  1.00 10.10 ? 355 GLY B CA  1 
ATOM   7291  C C   . GLY B 1 355 ? 23.521  -6.853  92.548  1.00 9.31  ? 355 GLY B C   1 
ATOM   7292  O O   . GLY B 1 355 ? 23.570  -7.976  93.079  1.00 9.98  ? 355 GLY B O   1 
ATOM   7293  N N   . ASP B 1 356 ? 22.420  -6.361  91.998  1.00 9.07  ? 356 ASP B N   1 
ATOM   7294  C CA  . ASP B 1 356 ? 21.171  -7.109  92.011  1.00 9.20  ? 356 ASP B CA  1 
ATOM   7295  C C   . ASP B 1 356 ? 21.138  -8.072  90.823  1.00 9.31  ? 356 ASP B C   1 
ATOM   7296  O O   . ASP B 1 356 ? 21.093  -9.293  91.008  1.00 9.98  ? 356 ASP B O   1 
ATOM   7297  C CB  . ASP B 1 356 ? 19.988  -6.127  91.994  1.00 8.98  ? 356 ASP B CB  1 
ATOM   7298  C CG  . ASP B 1 356 ? 18.666  -6.754  92.403  1.00 10.30 ? 356 ASP B CG  1 
ATOM   7299  O OD1 . ASP B 1 356 ? 18.400  -7.934  92.055  1.00 10.69 ? 356 ASP B OD1 1 
ATOM   7300  O OD2 . ASP B 1 356 ? 17.793  -6.099  93.017  1.00 8.44  ? 356 ASP B OD2 1 
ATOM   7301  N N   . MET B 1 357 ? 21.245  -7.536  89.611  1.00 8.93  ? 357 MET B N   1 
ATOM   7302  C CA  . MET B 1 357 ? 21.002  -8.317  88.395  1.00 8.70  ? 357 MET B CA  1 
ATOM   7303  C C   . MET B 1 357 ? 22.048  -9.394  88.116  1.00 8.38  ? 357 MET B C   1 
ATOM   7304  O O   . MET B 1 357 ? 21.703  -10.466 87.605  1.00 8.41  ? 357 MET B O   1 
ATOM   7305  C CB  . MET B 1 357 ? 20.841  -7.407  87.173  1.00 8.92  ? 357 MET B CB  1 
ATOM   7306  C CG  . MET B 1 357 ? 19.735  -6.337  87.338  1.00 8.61  ? 357 MET B CG  1 
ATOM   7307  S SD  . MET B 1 357 ? 19.589  -5.195  85.929  1.00 8.34  ? 357 MET B SD  1 
ATOM   7308  C CE  . MET B 1 357 ? 19.099  -6.230  84.570  1.00 7.78  ? 357 MET B CE  1 
ATOM   7309  N N   . GLU B 1 358 ? 23.307  -9.110  88.411  1.00 8.39  ? 358 GLU B N   1 
ATOM   7310  C CA  . GLU B 1 358 ? 24.338  -10.106 88.197  1.00 9.01  ? 358 GLU B CA  1 
ATOM   7311  C C   . GLU B 1 358 ? 24.237  -11.189 89.269  1.00 9.12  ? 358 GLU B C   1 
ATOM   7312  O O   . GLU B 1 358 ? 24.623  -12.337 89.037  1.00 10.09 ? 358 GLU B O   1 
ATOM   7313  C CB  . GLU B 1 358 ? 25.729  -9.496  88.160  1.00 8.80  ? 358 GLU B CB  1 
ATOM   7314  C CG  . GLU B 1 358 ? 26.749  -10.495 87.640  1.00 9.52  ? 358 GLU B CG  1 
ATOM   7315  C CD  . GLU B 1 358 ? 28.128  -9.916  87.438  1.00 10.90 ? 358 GLU B CD  1 
ATOM   7316  O OE1 . GLU B 1 358 ? 28.556  -9.826  86.269  1.00 14.53 ? 358 GLU B OE1 1 
ATOM   7317  O OE2 . GLU B 1 358 ? 28.775  -9.555  88.440  1.00 10.63 ? 358 GLU B OE2 1 
ATOM   7318  N N   . SER B 1 359 ? 23.713  -10.820 90.434  1.00 9.24  ? 359 SER B N   1 
ATOM   7319  C CA  . SER B 1 359 ? 23.512  -11.777 91.518  1.00 9.54  ? 359 SER B CA  1 
ATOM   7320  C C   . SER B 1 359 ? 22.319  -12.715 91.255  1.00 10.40 ? 359 SER B C   1 
ATOM   7321  O O   . SER B 1 359 ? 22.461  -13.937 91.315  1.00 10.64 ? 359 SER B O   1 
ATOM   7322  C CB  . SER B 1 359 ? 23.269  -11.048 92.837  1.00 9.55  ? 359 SER B CB  1 
ATOM   7323  O OG  . SER B 1 359 ? 24.469  -10.479 93.336  1.00 9.27  ? 359 SER B OG  1 
ATOM   7324  N N   . ASN B 1 360 ? 21.160  -12.140 90.945  1.00 9.69  ? 360 ASN B N   1 
ATOM   7325  C CA  . ASN B 1 360 ? 19.938  -12.929 90.846  1.00 10.02 ? 360 ASN B CA  1 
ATOM   7326  C C   . ASN B 1 360 ? 19.329  -13.115 89.450  1.00 10.01 ? 360 ASN B C   1 
ATOM   7327  O O   . ASN B 1 360 ? 18.245  -13.672 89.311  1.00 9.42  ? 360 ASN B O   1 
ATOM   7328  C CB  . ASN B 1 360 ? 18.924  -12.377 91.833  1.00 9.70  ? 360 ASN B CB  1 
ATOM   7329  C CG  . ASN B 1 360 ? 19.410  -12.495 93.269  1.00 11.22 ? 360 ASN B CG  1 
ATOM   7330  O OD1 . ASN B 1 360 ? 20.326  -13.293 93.567  1.00 11.08 ? 360 ASN B OD1 1 
ATOM   7331  N ND2 . ASN B 1 360 ? 18.807  -11.706 94.173  1.00 12.62 ? 360 ASN B ND2 1 
ATOM   7332  N N   . GLY B 1 361 ? 20.029  -12.654 88.419  1.00 10.31 ? 361 GLY B N   1 
ATOM   7333  C CA  . GLY B 1 361 ? 19.603  -12.914 87.066  1.00 10.04 ? 361 GLY B CA  1 
ATOM   7334  C C   . GLY B 1 361 ? 19.997  -14.351 86.759  1.00 10.32 ? 361 GLY B C   1 
ATOM   7335  O O   . GLY B 1 361 ? 20.895  -14.584 85.975  1.00 9.95  ? 361 GLY B O   1 
ATOM   7336  N N   . LYS B 1 362 ? 19.311  -15.310 87.381  1.00 10.56 ? 362 LYS B N   1 
ATOM   7337  C CA  . LYS B 1 362 ? 19.710  -16.722 87.308  1.00 10.60 ? 362 LYS B CA  1 
ATOM   7338  C C   . LYS B 1 362 ? 18.528  -17.609 86.986  1.00 11.42 ? 362 LYS B C   1 
ATOM   7339  O O   . LYS B 1 362 ? 17.390  -17.185 87.099  1.00 11.29 ? 362 LYS B O   1 
ATOM   7340  C CB  . LYS B 1 362 ? 20.273  -17.140 88.662  1.00 10.68 ? 362 LYS B CB  1 
ATOM   7341  C CG  . LYS B 1 362 ? 21.411  -16.305 89.159  1.00 9.87  ? 362 LYS B CG  1 
ATOM   7342  C CD  . LYS B 1 362 ? 22.715  -16.695 88.486  1.00 9.30  ? 362 LYS B CD  1 
ATOM   7343  C CE  . LYS B 1 362 ? 23.786  -15.651 88.659  1.00 9.55  ? 362 LYS B CE  1 
ATOM   7344  N NZ  . LYS B 1 362 ? 24.380  -15.574 90.036  1.00 8.81  ? 362 LYS B NZ  1 
ATOM   7345  N N   . TYR B 1 363 ? 18.781  -18.870 86.635  1.00 11.71 ? 363 TYR B N   1 
ATOM   7346  C CA  . TYR B 1 363 ? 17.671  -19.738 86.297  1.00 12.86 ? 363 TYR B CA  1 
ATOM   7347  C C   . TYR B 1 363 ? 17.859  -21.203 86.686  1.00 13.27 ? 363 TYR B C   1 
ATOM   7348  O O   . TYR B 1 363 ? 16.963  -21.988 86.470  1.00 14.27 ? 363 TYR B O   1 
ATOM   7349  C CB  . TYR B 1 363 ? 17.293  -19.591 84.821  1.00 12.55 ? 363 TYR B CB  1 
ATOM   7350  C CG  . TYR B 1 363 ? 18.146  -20.391 83.865  1.00 14.38 ? 363 TYR B CG  1 
ATOM   7351  C CD1 . TYR B 1 363 ? 17.585  -21.399 83.086  1.00 15.75 ? 363 TYR B CD1 1 
ATOM   7352  C CD2 . TYR B 1 363 ? 19.490  -20.128 83.719  1.00 14.14 ? 363 TYR B CD2 1 
ATOM   7353  C CE1 . TYR B 1 363 ? 18.356  -22.129 82.212  1.00 17.87 ? 363 TYR B CE1 1 
ATOM   7354  C CE2 . TYR B 1 363 ? 20.260  -20.846 82.848  1.00 15.38 ? 363 TYR B CE2 1 
ATOM   7355  C CZ  . TYR B 1 363 ? 19.694  -21.835 82.090  1.00 16.81 ? 363 TYR B CZ  1 
ATOM   7356  O OH  . TYR B 1 363 ? 20.481  -22.552 81.232  1.00 17.97 ? 363 TYR B OH  1 
ATOM   7357  N N   . ILE B 1 364 ? 18.993  -21.546 87.285  1.00 14.00 ? 364 ILE B N   1 
ATOM   7358  C CA  . ILE B 1 364 ? 19.231  -22.909 87.745  1.00 14.65 ? 364 ILE B CA  1 
ATOM   7359  C C   . ILE B 1 364 ? 19.259  -22.918 89.254  1.00 15.02 ? 364 ILE B C   1 
ATOM   7360  O O   . ILE B 1 364 ? 19.993  -22.135 89.869  1.00 15.54 ? 364 ILE B O   1 
ATOM   7361  C CB  . ILE B 1 364 ? 20.560  -23.440 87.215  1.00 14.42 ? 364 ILE B CB  1 
ATOM   7362  C CG1 . ILE B 1 364 ? 20.567  -23.399 85.692  1.00 15.12 ? 364 ILE B CG1 1 
ATOM   7363  C CG2 . ILE B 1 364 ? 20.836  -24.863 87.779  1.00 14.40 ? 364 ILE B CG2 1 
ATOM   7364  C CD1 . ILE B 1 364 ? 19.363  -24.002 85.035  1.00 16.21 ? 364 ILE B CD1 1 
ATOM   7365  N N   . THR B 1 365 ? 18.474  -23.811 89.847  1.00 15.18 ? 365 THR B N   1 
ATOM   7366  C CA  . THR B 1 365 ? 18.400  -23.904 91.305  1.00 16.07 ? 365 THR B CA  1 
ATOM   7367  C C   . THR B 1 365 ? 19.523  -24.757 91.878  1.00 16.81 ? 365 THR B C   1 
ATOM   7368  O O   . THR B 1 365 ? 20.267  -25.411 91.148  1.00 16.92 ? 365 THR B O   1 
ATOM   7369  C CB  . THR B 1 365 ? 17.034  -24.441 91.777  1.00 15.16 ? 365 THR B CB  1 
ATOM   7370  O OG1 . THR B 1 365 ? 16.887  -25.822 91.422  1.00 15.28 ? 365 THR B OG1 1 
ATOM   7371  C CG2 . THR B 1 365 ? 15.881  -23.710 91.073  1.00 16.89 ? 365 THR B CG2 1 
ATOM   7372  N N   . LYS B 1 366 ? 19.633  -24.735 93.199  1.00 18.34 ? 366 LYS B N   1 
ATOM   7373  C CA  . LYS B 1 366 ? 20.690  -25.452 93.896  1.00 19.41 ? 366 LYS B CA  1 
ATOM   7374  C C   . LYS B 1 366 ? 20.687  -26.944 93.549  1.00 19.89 ? 366 LYS B C   1 
ATOM   7375  O O   . LYS B 1 366 ? 21.730  -27.580 93.545  1.00 19.88 ? 366 LYS B O   1 
ATOM   7376  C CB  . LYS B 1 366 ? 20.541  -25.260 95.409  1.00 19.82 ? 366 LYS B CB  1 
ATOM   7377  C CG  . LYS B 1 366 ? 21.660  -25.862 96.227  1.00 21.97 ? 366 LYS B CG  1 
ATOM   7378  C CD  . LYS B 1 366 ? 21.608  -25.383 97.673  1.00 25.92 ? 366 LYS B CD  1 
ATOM   7379  C CE  . LYS B 1 366 ? 22.712  -26.009 98.513  1.00 27.95 ? 366 LYS B CE  1 
ATOM   7380  N NZ  . LYS B 1 366 ? 22.670  -25.546 99.946  1.00 30.22 ? 366 LYS B NZ  1 
ATOM   7381  N N   . SER B 1 367 ? 19.518  -27.491 93.244  1.00 20.43 ? 367 SER B N   1 
ATOM   7382  C CA  . SER B 1 367 ? 19.424  -28.904 92.901  1.00 20.95 ? 367 SER B CA  1 
ATOM   7383  C C   . SER B 1 367 ? 19.736  -29.171 91.436  1.00 21.00 ? 367 SER B C   1 
ATOM   7384  O O   . SER B 1 367 ? 19.728  -30.320 91.004  1.00 21.32 ? 367 SER B O   1 
ATOM   7385  C CB  . SER B 1 367 ? 18.023  -29.407 93.199  1.00 21.29 ? 367 SER B CB  1 
ATOM   7386  O OG  . SER B 1 367 ? 17.115  -28.884 92.250  1.00 22.47 ? 367 SER B OG  1 
ATOM   7387  N N   . GLY B 1 368 ? 19.986  -28.123 90.658  1.00 20.58 ? 368 GLY B N   1 
ATOM   7388  C CA  . GLY B 1 368 ? 20.245  -28.291 89.245  1.00 20.66 ? 368 GLY B CA  1 
ATOM   7389  C C   . GLY B 1 368 ? 18.998  -28.208 88.389  1.00 20.83 ? 368 GLY B C   1 
ATOM   7390  O O   . GLY B 1 368 ? 19.100  -28.152 87.177  1.00 21.03 ? 368 GLY B O   1 
ATOM   7391  N N   . THR B 1 369 ? 17.819  -28.182 88.993  1.00 21.45 ? 369 THR B N   1 
ATOM   7392  C CA  . THR B 1 369 ? 16.616  -28.084 88.179  1.00 21.99 ? 369 THR B CA  1 
ATOM   7393  C C   . THR B 1 369 ? 16.379  -26.620 87.827  1.00 20.78 ? 369 THR B C   1 
ATOM   7394  O O   . THR B 1 369 ? 16.697  -25.722 88.599  1.00 20.05 ? 369 THR B O   1 
ATOM   7395  C CB  . THR B 1 369 ? 15.364  -28.712 88.833  1.00 22.85 ? 369 THR B CB  1 
ATOM   7396  O OG1 . THR B 1 369 ? 14.476  -27.691 89.290  1.00 26.71 ? 369 THR B OG1 1 
ATOM   7397  C CG2 . THR B 1 369 ? 15.688  -29.525 90.071  1.00 24.68 ? 369 THR B CG2 1 
ATOM   7398  N N   . ARG B 1 370 ? 15.848  -26.399 86.638  1.00 19.39 ? 370 ARG B N   1 
ATOM   7399  C CA  . ARG B 1 370 ? 15.587  -25.062 86.143  1.00 18.93 ? 370 ARG B CA  1 
ATOM   7400  C C   . ARG B 1 370 ? 14.462  -24.460 86.939  1.00 17.88 ? 370 ARG B C   1 
ATOM   7401  O O   . ARG B 1 370 ? 13.498  -25.151 87.260  1.00 17.71 ? 370 ARG B O   1 
ATOM   7402  C CB  . ARG B 1 370 ? 15.144  -25.143 84.679  1.00 19.33 ? 370 ARG B CB  1 
ATOM   7403  C CG  . ARG B 1 370 ? 15.169  -23.836 83.916  1.00 20.94 ? 370 ARG B CG  1 
ATOM   7404  C CD  . ARG B 1 370 ? 14.256  -23.843 82.701  1.00 22.39 ? 370 ARG B CD  1 
ATOM   7405  N NE  . ARG B 1 370 ? 14.363  -22.652 81.849  1.00 23.25 ? 370 ARG B NE  1 
ATOM   7406  C CZ  . ARG B 1 370 ? 13.896  -21.446 82.165  1.00 24.12 ? 370 ARG B CZ  1 
ATOM   7407  N NH1 . ARG B 1 370 ? 13.301  -21.225 83.343  1.00 23.61 ? 370 ARG B NH1 1 
ATOM   7408  N NH2 . ARG B 1 370 ? 14.031  -20.448 81.305  1.00 22.37 ? 370 ARG B NH2 1 
ATOM   7409  N N   . VAL B 1 371 ? 14.556  -23.172 87.250  1.00 16.06 ? 371 VAL B N   1 
ATOM   7410  C CA  . VAL B 1 371 ? 13.431  -22.507 87.886  1.00 15.32 ? 371 VAL B CA  1 
ATOM   7411  C C   . VAL B 1 371 ? 12.183  -22.584 87.015  1.00 14.68 ? 371 VAL B C   1 
ATOM   7412  O O   . VAL B 1 371 ? 12.282  -22.636 85.794  1.00 14.83 ? 371 VAL B O   1 
ATOM   7413  C CB  . VAL B 1 371 ? 13.722  -21.014 88.150  1.00 14.44 ? 371 VAL B CB  1 
ATOM   7414  C CG1 . VAL B 1 371 ? 14.844  -20.871 89.134  1.00 15.29 ? 371 VAL B CG1 1 
ATOM   7415  C CG2 . VAL B 1 371 ? 14.012  -20.282 86.839  1.00 14.45 ? 371 VAL B CG2 1 
ATOM   7416  N N   . ASP B 1 372 ? 11.007  -22.601 87.639  1.00 14.67 ? 372 ASP B N   1 
ATOM   7417  C CA  . ASP B 1 372 ? 9.741   -22.521 86.914  1.00 15.00 ? 372 ASP B CA  1 
ATOM   7418  C C   . ASP B 1 372 ? 8.967   -21.291 87.395  1.00 14.43 ? 372 ASP B C   1 
ATOM   7419  O O   . ASP B 1 372 ? 7.740   -21.277 87.463  1.00 14.70 ? 372 ASP B O   1 
ATOM   7420  C CB  . ASP B 1 372 ? 8.902   -23.803 87.028  1.00 15.41 ? 372 ASP B CB  1 
ATOM   7421  C CG  . ASP B 1 372 ? 8.525   -24.148 88.459  1.00 18.46 ? 372 ASP B CG  1 
ATOM   7422  O OD1 . ASP B 1 372 ? 9.163   -23.630 89.402  1.00 17.20 ? 372 ASP B OD1 1 
ATOM   7423  O OD2 . ASP B 1 372 ? 7.603   -24.957 88.723  1.00 21.43 ? 372 ASP B OD2 1 
ATOM   7424  N N   . HIS B 1 373 ? 9.721   -20.249 87.704  1.00 13.63 ? 373 HIS B N   1 
ATOM   7425  C CA  . HIS B 1 373 ? 9.177   -18.992 88.190  1.00 12.64 ? 373 HIS B CA  1 
ATOM   7426  C C   . HIS B 1 373 ? 10.185  -17.906 87.857  1.00 11.98 ? 373 HIS B C   1 
ATOM   7427  O O   . HIS B 1 373 ? 11.320  -18.197 87.443  1.00 11.71 ? 373 HIS B O   1 
ATOM   7428  C CB  . HIS B 1 373 ? 8.999   -19.038 89.704  1.00 12.51 ? 373 HIS B CB  1 
ATOM   7429  C CG  . HIS B 1 373 ? 10.223  -19.487 90.440  1.00 11.93 ? 373 HIS B CG  1 
ATOM   7430  N ND1 . HIS B 1 373 ? 11.274  -18.642 90.738  1.00 12.65 ? 373 HIS B ND1 1 
ATOM   7431  C CD2 . HIS B 1 373 ? 10.569  -20.700 90.926  1.00 12.27 ? 373 HIS B CD2 1 
ATOM   7432  C CE1 . HIS B 1 373 ? 12.214  -19.322 91.369  1.00 13.19 ? 373 HIS B CE1 1 
ATOM   7433  N NE2 . HIS B 1 373 ? 11.807  -20.572 91.500  1.00 12.13 ? 373 HIS B NE2 1 
ATOM   7434  N N   . GLN B 1 374 ? 9.778   -16.662 88.071  1.00 11.06 ? 374 GLN B N   1 
ATOM   7435  C CA  . GLN B 1 374 ? 10.647  -15.516 87.837  1.00 10.88 ? 374 GLN B CA  1 
ATOM   7436  C C   . GLN B 1 374 ? 11.717  -15.409 88.911  1.00 10.65 ? 374 GLN B C   1 
ATOM   7437  O O   . GLN B 1 374 ? 11.517  -15.821 90.068  1.00 10.09 ? 374 GLN B O   1 
ATOM   7438  C CB  . GLN B 1 374 ? 9.825   -14.225 87.846  1.00 12.03 ? 374 GLN B CB  1 
ATOM   7439  C CG  . GLN B 1 374 ? 8.996   -14.052 86.615  1.00 12.75 ? 374 GLN B CG  1 
ATOM   7440  C CD  . GLN B 1 374 ? 9.857   -13.935 85.371  1.00 15.75 ? 374 GLN B CD  1 
ATOM   7441  O OE1 . GLN B 1 374 ? 10.871  -13.229 85.380  1.00 13.95 ? 374 GLN B OE1 1 
ATOM   7442  N NE2 . GLN B 1 374 ? 9.474   -14.641 84.302  1.00 15.93 ? 374 GLN B NE2 1 
ATOM   7443  N N   . THR B 1 375 ? 12.860  -14.873 88.510  1.00 9.68  ? 375 THR B N   1 
ATOM   7444  C CA  . THR B 1 375 ? 13.912  -14.530 89.448  1.00 9.56  ? 375 THR B CA  1 
ATOM   7445  C C   . THR B 1 375 ? 14.147  -13.015 89.425  1.00 9.46  ? 375 THR B C   1 
ATOM   7446  O O   . THR B 1 375 ? 13.185  -12.267 89.335  1.00 9.84  ? 375 THR B O   1 
ATOM   7447  C CB  . THR B 1 375 ? 15.194  -15.343 89.235  1.00 9.42  ? 375 THR B CB  1 
ATOM   7448  O OG1 . THR B 1 375 ? 15.689  -15.205 87.895  1.00 9.24  ? 375 THR B OG1 1 
ATOM   7449  C CG2 . THR B 1 375 ? 14.905  -16.845 89.437  1.00 10.24 ? 375 THR B CG2 1 
ATOM   7450  N N   . GLY B 1 376 ? 15.397  -12.576 89.506  1.00 8.88  ? 376 GLY B N   1 
ATOM   7451  C CA  . GLY B 1 376 ? 15.696  -11.161 89.697  1.00 9.08  ? 376 GLY B CA  1 
ATOM   7452  C C   . GLY B 1 376 ? 15.059  -10.222 88.705  1.00 8.76  ? 376 GLY B C   1 
ATOM   7453  O O   . GLY B 1 376 ? 14.923  -10.573 87.536  1.00 8.86  ? 376 GLY B O   1 
ATOM   7454  N N   . PRO B 1 377 ? 14.715  -9.004  89.145  1.00 8.82  ? 377 PRO B N   1 
ATOM   7455  C CA  . PRO B 1 377 ? 14.120  -8.011  88.264  1.00 8.35  ? 377 PRO B CA  1 
ATOM   7456  C C   . PRO B 1 377 ? 15.183  -7.163  87.561  1.00 8.28  ? 377 PRO B C   1 
ATOM   7457  O O   . PRO B 1 377 ? 16.355  -7.216  87.949  1.00 7.48  ? 377 PRO B O   1 
ATOM   7458  C CB  . PRO B 1 377 ? 13.344  -7.139  89.251  1.00 7.90  ? 377 PRO B CB  1 
ATOM   7459  C CG  . PRO B 1 377 ? 14.273  -7.053  90.410  1.00 9.13  ? 377 PRO B CG  1 
ATOM   7460  C CD  . PRO B 1 377 ? 14.905  -8.451  90.501  1.00 9.05  ? 377 PRO B CD  1 
ATOM   7461  N N   . ILE B 1 378 ? 14.758  -6.435  86.532  1.00 8.51  ? 378 ILE B N   1 
ATOM   7462  C CA  . ILE B 1 378 ? 15.595  -5.460  85.850  1.00 8.41  ? 378 ILE B CA  1 
ATOM   7463  C C   . ILE B 1 378 ? 15.555  -4.205  86.710  1.00 8.25  ? 378 ILE B C   1 
ATOM   7464  O O   . ILE B 1 378 ? 14.496  -3.654  86.963  1.00 8.54  ? 378 ILE B O   1 
ATOM   7465  C CB  . ILE B 1 378 ? 15.051  -5.161  84.435  1.00 8.55  ? 378 ILE B CB  1 
ATOM   7466  C CG1 . ILE B 1 378 ? 15.159  -6.400  83.538  1.00 8.88  ? 378 ILE B CG1 1 
ATOM   7467  C CG2 . ILE B 1 378 ? 15.811  -4.007  83.816  1.00 8.59  ? 378 ILE B CG2 1 
ATOM   7468  C CD1 . ILE B 1 378 ? 14.269  -6.358  82.305  1.00 9.89  ? 378 ILE B CD1 1 
ATOM   7469  N N   . VAL B 1 379 ? 16.713  -3.798  87.205  1.00 8.57  ? 379 VAL B N   1 
ATOM   7470  C CA  . VAL B 1 379 ? 16.828  -2.649  88.081  1.00 7.91  ? 379 VAL B CA  1 
ATOM   7471  C C   . VAL B 1 379 ? 17.192  -1.443  87.207  1.00 7.78  ? 379 VAL B C   1 
ATOM   7472  O O   . VAL B 1 379 ? 17.992  -1.557  86.286  1.00 8.16  ? 379 VAL B O   1 
ATOM   7473  C CB  . VAL B 1 379 ? 17.921  -2.892  89.151  1.00 8.32  ? 379 VAL B CB  1 
ATOM   7474  C CG1 . VAL B 1 379 ? 18.183  -1.635  89.974  1.00 10.03 ? 379 VAL B CG1 1 
ATOM   7475  C CG2 . VAL B 1 379 ? 17.543  -4.034  90.082  1.00 8.00  ? 379 VAL B CG2 1 
ATOM   7476  N N   . TRP B 1 380 ? 16.572  -0.298  87.472  1.00 8.14  ? 380 TRP B N   1 
ATOM   7477  C CA  . TRP B 1 380 ? 16.823  0.898   86.695  1.00 7.64  ? 380 TRP B CA  1 
ATOM   7478  C C   . TRP B 1 380 ? 16.431  2.121   87.500  1.00 7.92  ? 380 TRP B C   1 
ATOM   7479  O O   . TRP B 1 380 ? 15.843  2.020   88.594  1.00 7.70  ? 380 TRP B O   1 
ATOM   7480  C CB  . TRP B 1 380 ? 16.028  0.854   85.381  1.00 8.07  ? 380 TRP B CB  1 
ATOM   7481  C CG  . TRP B 1 380 ? 14.559  0.830   85.561  1.00 7.13  ? 380 TRP B CG  1 
ATOM   7482  C CD1 . TRP B 1 380 ? 13.792  -0.197  86.020  1.00 10.03 ? 380 TRP B CD1 1 
ATOM   7483  C CD2 . TRP B 1 380 ? 13.659  1.905   85.291  1.00 9.46  ? 380 TRP B CD2 1 
ATOM   7484  N NE1 . TRP B 1 380 ? 12.467  0.177   86.064  1.00 9.35  ? 380 TRP B NE1 1 
ATOM   7485  C CE2 . TRP B 1 380 ? 12.360  1.464   85.604  1.00 8.13  ? 380 TRP B CE2 1 
ATOM   7486  C CE3 . TRP B 1 380 ? 13.820  3.201   84.804  1.00 9.46  ? 380 TRP B CE3 1 
ATOM   7487  C CZ2 . TRP B 1 380 ? 11.232  2.274   85.440  1.00 10.39 ? 380 TRP B CZ2 1 
ATOM   7488  C CZ3 . TRP B 1 380 ? 12.673  4.016   84.656  1.00 8.35  ? 380 TRP B CZ3 1 
ATOM   7489  C CH2 . TRP B 1 380 ? 11.421  3.547   84.966  1.00 7.22  ? 380 TRP B CH2 1 
ATOM   7490  N N   . GLY B 1 381 ? 16.771  3.284   86.973  1.00 7.82  ? 381 GLY B N   1 
ATOM   7491  C CA  . GLY B 1 381 ? 16.414  4.520   87.640  1.00 7.63  ? 381 GLY B CA  1 
ATOM   7492  C C   . GLY B 1 381 ? 17.403  5.647   87.404  1.00 8.30  ? 381 GLY B C   1 
ATOM   7493  O O   . GLY B 1 381 ? 18.532  5.429   86.976  1.00 7.69  ? 381 GLY B O   1 
ATOM   7494  N N   . GLU B 1 382 ? 16.926  6.862   87.645  1.00 8.56  ? 382 GLU B N   1 
ATOM   7495  C CA  . GLU B 1 382 ? 17.742  8.058   87.668  1.00 8.54  ? 382 GLU B CA  1 
ATOM   7496  C C   . GLU B 1 382 ? 17.338  8.756   88.948  1.00 8.48  ? 382 GLU B C   1 
ATOM   7497  O O   . GLU B 1 382 ? 16.224  8.573   89.416  1.00 9.19  ? 382 GLU B O   1 
ATOM   7498  C CB  . GLU B 1 382 ? 17.447  8.986   86.486  1.00 8.64  ? 382 GLU B CB  1 
ATOM   7499  C CG  . GLU B 1 382 ? 17.975  8.494   85.155  1.00 9.34  ? 382 GLU B CG  1 
ATOM   7500  C CD  . GLU B 1 382 ? 19.494  8.491   85.043  1.00 9.82  ? 382 GLU B CD  1 
ATOM   7501  O OE1 . GLU B 1 382 ? 20.004  7.888   84.077  1.00 11.44 ? 382 GLU B OE1 1 
ATOM   7502  O OE2 . GLU B 1 382 ? 20.200  9.062   85.896  1.00 8.18  ? 382 GLU B OE2 1 
ATOM   7503  N N   . PRO B 1 383 ? 18.216  9.566   89.507  1.00 8.62  ? 383 PRO B N   1 
ATOM   7504  C CA  . PRO B 1 383 ? 17.866  10.318  90.719  1.00 8.37  ? 383 PRO B CA  1 
ATOM   7505  C C   . PRO B 1 383 ? 16.803  11.367  90.473  1.00 8.18  ? 383 PRO B C   1 
ATOM   7506  O O   . PRO B 1 383 ? 16.705  11.928  89.391  1.00 7.72  ? 383 PRO B O   1 
ATOM   7507  C CB  . PRO B 1 383 ? 19.164  11.011  91.093  1.00 8.70  ? 383 PRO B CB  1 
ATOM   7508  C CG  . PRO B 1 383 ? 19.914  11.114  89.797  1.00 8.77  ? 383 PRO B CG  1 
ATOM   7509  C CD  . PRO B 1 383 ? 19.600  9.825   89.063  1.00 8.04  ? 383 PRO B CD  1 
ATOM   7510  N N   . GLY B 1 384 ? 15.989  11.620  91.487  1.00 7.73  ? 384 GLY B N   1 
ATOM   7511  C CA  . GLY B 1 384 ? 15.011  12.683  91.380  1.00 7.52  ? 384 GLY B CA  1 
ATOM   7512  C C   . GLY B 1 384 ? 15.723  13.982  91.664  1.00 7.22  ? 384 GLY B C   1 
ATOM   7513  O O   . GLY B 1 384 ? 16.686  13.981  92.442  1.00 6.84  ? 384 GLY B O   1 
ATOM   7514  N N   . THR B 1 385 ? 15.270  15.094  91.079  1.00 7.23  ? 385 THR B N   1 
ATOM   7515  C CA  . THR B 1 385 ? 14.089  15.149  90.219  1.00 7.96  ? 385 THR B CA  1 
ATOM   7516  C C   . THR B 1 385 ? 14.387  14.883  88.742  1.00 8.51  ? 385 THR B C   1 
ATOM   7517  O O   . THR B 1 385 ? 13.483  14.968  87.913  1.00 9.75  ? 385 THR B O   1 
ATOM   7518  C CB  . THR B 1 385 ? 13.412  16.534  90.315  1.00 8.89  ? 385 THR B CB  1 
ATOM   7519  O OG1 . THR B 1 385 ? 14.352  17.568  89.994  1.00 7.23  ? 385 THR B OG1 1 
ATOM   7520  C CG2 . THR B 1 385 ? 12.966  16.827  91.721  1.00 8.70  ? 385 THR B CG2 1 
ATOM   7521  N N   . ASN B 1 386 ? 15.623  14.560  88.393  1.00 9.15  ? 386 ASN B N   1 
ATOM   7522  C CA  . ASN B 1 386 ? 15.948  14.319  86.984  1.00 9.60  ? 386 ASN B CA  1 
ATOM   7523  C C   . ASN B 1 386 ? 15.016  13.252  86.381  1.00 10.09 ? 386 ASN B C   1 
ATOM   7524  O O   . ASN B 1 386 ? 14.383  13.478  85.353  1.00 10.01 ? 386 ASN B O   1 
ATOM   7525  C CB  . ASN B 1 386 ? 17.403  13.891  86.795  1.00 10.14 ? 386 ASN B CB  1 
ATOM   7526  C CG  . ASN B 1 386 ? 18.412  14.880  87.381  1.00 12.31 ? 386 ASN B CG  1 
ATOM   7527  O OD1 . ASN B 1 386 ? 18.096  16.045  87.621  1.00 15.25 ? 386 ASN B OD1 1 
ATOM   7528  N ND2 . ASN B 1 386 ? 19.653  14.410  87.597  1.00 13.60 ? 386 ASN B ND2 1 
ATOM   7529  N N   . GLY B 1 387 ? 14.915  12.096  87.033  1.00 10.36 ? 387 GLY B N   1 
ATOM   7530  C CA  . GLY B 1 387 ? 14.078  11.027  86.518  1.00 10.99 ? 387 GLY B CA  1 
ATOM   7531  C C   . GLY B 1 387 ? 12.624  11.436  86.440  1.00 10.98 ? 387 GLY B C   1 
ATOM   7532  O O   . GLY B 1 387 ? 11.894  11.115  85.490  1.00 12.32 ? 387 GLY B O   1 
ATOM   7533  N N   . GLN B 1 388 ? 12.200  12.176  87.450  1.00 11.41 ? 388 GLN B N   1 
ATOM   7534  C CA  . GLN B 1 388 ? 10.857  12.691  87.523  1.00 11.50 ? 388 GLN B CA  1 
ATOM   7535  C C   . GLN B 1 388 ? 10.513  13.455  86.244  1.00 12.37 ? 388 GLN B C   1 
ATOM   7536  O O   . GLN B 1 388 ? 9.396   13.359  85.748  1.00 12.25 ? 388 GLN B O   1 
ATOM   7537  C CB  . GLN B 1 388 ? 10.745  13.570  88.771  1.00 11.66 ? 388 GLN B CB  1 
ATOM   7538  C CG  . GLN B 1 388 ? 9.402   14.075  89.091  1.00 10.42 ? 388 GLN B CG  1 
ATOM   7539  C CD  . GLN B 1 388 ? 9.416   14.931  90.327  1.00 9.30  ? 388 GLN B CD  1 
ATOM   7540  O OE1 . GLN B 1 388 ? 9.902   14.505  91.378  1.00 10.16 ? 388 GLN B OE1 1 
ATOM   7541  N NE2 . GLN B 1 388 ? 8.879   16.142  90.218  1.00 9.13  ? 388 GLN B NE2 1 
ATOM   7542  N N   . HIS B 1 389 ? 11.464  14.203  85.682  1.00 12.41 ? 389 HIS B N   1 
ATOM   7543  C CA  . HIS B 1 389 ? 11.159  14.959  84.456  1.00 12.53 ? 389 HIS B CA  1 
ATOM   7544  C C   . HIS B 1 389 ? 11.508  14.218  83.163  1.00 12.28 ? 389 HIS B C   1 
ATOM   7545  O O   . HIS B 1 389 ? 11.492  14.807  82.095  1.00 13.91 ? 389 HIS B O   1 
ATOM   7546  C CB  . HIS B 1 389 ? 11.859  16.312  84.499  1.00 12.46 ? 389 HIS B CB  1 
ATOM   7547  C CG  . HIS B 1 389 ? 11.448  17.133  85.677  1.00 13.29 ? 389 HIS B CG  1 
ATOM   7548  N ND1 . HIS B 1 389 ? 10.134  17.463  85.921  1.00 12.85 ? 389 HIS B ND1 1 
ATOM   7549  C CD2 . HIS B 1 389 ? 12.161  17.640  86.706  1.00 13.53 ? 389 HIS B CD2 1 
ATOM   7550  C CE1 . HIS B 1 389 ? 10.056  18.155  87.045  1.00 13.17 ? 389 HIS B CE1 1 
ATOM   7551  N NE2 . HIS B 1 389 ? 11.273  18.281  87.538  1.00 13.22 ? 389 HIS B NE2 1 
ATOM   7552  N N   . ALA B 1 390 ? 11.852  12.939  83.266  1.00 11.95 ? 390 ALA B N   1 
ATOM   7553  C CA  . ALA B 1 390 ? 12.201  12.144  82.113  1.00 11.70 ? 390 ALA B CA  1 
ATOM   7554  C C   . ALA B 1 390 ? 11.134  11.107  81.864  1.00 11.34 ? 390 ALA B C   1 
ATOM   7555  O O   . ALA B 1 390 ? 10.475  11.151  80.831  1.00 11.46 ? 390 ALA B O   1 
ATOM   7556  C CB  . ALA B 1 390 ? 13.586  11.450  82.287  1.00 11.67 ? 390 ALA B CB  1 
ATOM   7557  N N   . PHE B 1 391 ? 10.928  10.211  82.825  1.00 10.49 ? 391 PHE B N   1 
ATOM   7558  C CA  . PHE B 1 391 ? 10.078  9.047   82.588  1.00 10.40 ? 391 PHE B CA  1 
ATOM   7559  C C   . PHE B 1 391 ? 8.896   8.811   83.526  1.00 9.95  ? 391 PHE B C   1 
ATOM   7560  O O   . PHE B 1 391 ? 8.213   7.803   83.361  1.00 9.58  ? 391 PHE B O   1 
ATOM   7561  C CB  . PHE B 1 391 ? 10.948  7.781   82.595  1.00 10.15 ? 391 PHE B CB  1 
ATOM   7562  C CG  . PHE B 1 391 ? 11.807  7.638   83.824  1.00 10.39 ? 391 PHE B CG  1 
ATOM   7563  C CD1 . PHE B 1 391 ? 11.264  7.218   85.025  1.00 10.04 ? 391 PHE B CD1 1 
ATOM   7564  C CD2 . PHE B 1 391 ? 13.162  7.933   83.772  1.00 10.48 ? 391 PHE B CD2 1 
ATOM   7565  C CE1 . PHE B 1 391 ? 12.059  7.099   86.159  1.00 9.03  ? 391 PHE B CE1 1 
ATOM   7566  C CE2 . PHE B 1 391 ? 13.964  7.821   84.902  1.00 9.75  ? 391 PHE B CE2 1 
ATOM   7567  C CZ  . PHE B 1 391 ? 13.411  7.395   86.094  1.00 9.98  ? 391 PHE B CZ  1 
ATOM   7568  N N   . TYR B 1 392 ? 8.615   9.693   84.486  1.00 9.08  ? 392 TYR B N   1 
ATOM   7569  C CA  . TYR B 1 392 ? 7.502   9.401   85.396  1.00 9.17  ? 392 TYR B CA  1 
ATOM   7570  C C   . TYR B 1 392 ? 6.142   9.406   84.700  1.00 9.38  ? 392 TYR B C   1 
ATOM   7571  O O   . TYR B 1 392 ? 5.200   8.835   85.229  1.00 9.93  ? 392 TYR B O   1 
ATOM   7572  C CB  . TYR B 1 392 ? 7.419   10.355  86.578  1.00 9.02  ? 392 TYR B CB  1 
ATOM   7573  C CG  . TYR B 1 392 ? 8.437   10.157  87.684  1.00 8.98  ? 392 TYR B CG  1 
ATOM   7574  C CD1 . TYR B 1 392 ? 9.670   9.535   87.460  1.00 8.89  ? 392 TYR B CD1 1 
ATOM   7575  C CD2 . TYR B 1 392 ? 8.168   10.615  88.958  1.00 9.61  ? 392 TYR B CD2 1 
ATOM   7576  C CE1 . TYR B 1 392 ? 10.614  9.406   88.491  1.00 8.82  ? 392 TYR B CE1 1 
ATOM   7577  C CE2 . TYR B 1 392 ? 9.090   10.493  89.982  1.00 8.32  ? 392 TYR B CE2 1 
ATOM   7578  C CZ  . TYR B 1 392 ? 10.320  9.904   89.741  1.00 9.31  ? 392 TYR B CZ  1 
ATOM   7579  O OH  . TYR B 1 392 ? 11.222  9.794   90.770  1.00 8.49  ? 392 TYR B OH  1 
ATOM   7580  N N   . GLN B 1 393 ? 6.025   10.076  83.555  1.00 9.15  ? 393 GLN B N   1 
ATOM   7581  C CA  . GLN B 1 393 ? 4.783   10.013  82.782  1.00 9.05  ? 393 GLN B CA  1 
ATOM   7582  C C   . GLN B 1 393 ? 4.357   8.552   82.629  1.00 8.95  ? 393 GLN B C   1 
ATOM   7583  O O   . GLN B 1 393 ? 3.164   8.217   82.779  1.00 9.49  ? 393 GLN B O   1 
ATOM   7584  C CB  . GLN B 1 393 ? 4.946   10.658  81.395  1.00 8.87  ? 393 GLN B CB  1 
ATOM   7585  C CG  . GLN B 1 393 ? 3.867   10.237  80.372  1.00 9.06  ? 393 GLN B CG  1 
ATOM   7586  C CD  . GLN B 1 393 ? 2.515   10.883  80.630  1.00 10.69 ? 393 GLN B CD  1 
ATOM   7587  O OE1 . GLN B 1 393 ? 2.446   12.078  80.897  1.00 9.77  ? 393 GLN B OE1 1 
ATOM   7588  N NE2 . GLN B 1 393 ? 1.437   10.097  80.538  1.00 10.20 ? 393 GLN B NE2 1 
ATOM   7589  N N   . LEU B 1 394 ? 5.314   7.675   82.317  1.00 8.76  ? 394 LEU B N   1 
ATOM   7590  C CA  . LEU B 1 394 ? 5.005   6.251   82.128  1.00 9.01  ? 394 LEU B CA  1 
ATOM   7591  C C   . LEU B 1 394 ? 4.626   5.564   83.451  1.00 8.63  ? 394 LEU B C   1 
ATOM   7592  O O   . LEU B 1 394 ? 3.751   4.703   83.486  1.00 8.49  ? 394 LEU B O   1 
ATOM   7593  C CB  . LEU B 1 394 ? 6.187   5.520   81.461  1.00 9.08  ? 394 LEU B CB  1 
ATOM   7594  C CG  . LEU B 1 394 ? 5.915   4.074   81.000  1.00 8.49  ? 394 LEU B CG  1 
ATOM   7595  C CD1 . LEU B 1 394 ? 6.666   3.779   79.708  1.00 7.98  ? 394 LEU B CD1 1 
ATOM   7596  C CD2 . LEU B 1 394 ? 6.293   3.073   82.093  1.00 10.60 ? 394 LEU B CD2 1 
ATOM   7597  N N   . ILE B 1 395 ? 5.292   5.943   84.538  1.00 8.58  ? 395 ILE B N   1 
ATOM   7598  C CA  . ILE B 1 395 ? 4.999   5.351   85.829  1.00 9.42  ? 395 ILE B CA  1 
ATOM   7599  C C   . ILE B 1 395 ? 3.555   5.708   86.261  1.00 9.14  ? 395 ILE B C   1 
ATOM   7600  O O   . ILE B 1 395 ? 2.827   4.863   86.746  1.00 8.49  ? 395 ILE B O   1 
ATOM   7601  C CB  . ILE B 1 395 ? 6.042   5.749   86.896  1.00 9.73  ? 395 ILE B CB  1 
ATOM   7602  C CG1 . ILE B 1 395 ? 7.449   5.397   86.411  1.00 10.33 ? 395 ILE B CG1 1 
ATOM   7603  C CG2 . ILE B 1 395 ? 5.740   5.022   88.199  1.00 11.15 ? 395 ILE B CG2 1 
ATOM   7604  C CD1 . ILE B 1 395 ? 8.591   5.682   87.405  1.00 9.81  ? 395 ILE B CD1 1 
ATOM   7605  N N   . HIS B 1 396 ? 3.148   6.950   86.022  1.00 9.28  ? 396 HIS B N   1 
ATOM   7606  C CA  . HIS B 1 396 ? 1.823   7.426   86.405  1.00 9.51  ? 396 HIS B CA  1 
ATOM   7607  C C   . HIS B 1 396 ? 0.688   7.008   85.454  1.00 9.88  ? 396 HIS B C   1 
ATOM   7608  O O   . HIS B 1 396 ? -0.405  6.747   85.911  1.00 10.68 ? 396 HIS B O   1 
ATOM   7609  C CB  . HIS B 1 396 ? 1.806   8.961   86.482  1.00 9.12  ? 396 HIS B CB  1 
ATOM   7610  C CG  . HIS B 1 396 ? 2.474   9.521   87.699  1.00 10.62 ? 396 HIS B CG  1 
ATOM   7611  N ND1 . HIS B 1 396 ? 1.847   9.600   88.924  1.00 10.30 ? 396 HIS B ND1 1 
ATOM   7612  C CD2 . HIS B 1 396 ? 3.711   10.038  87.874  1.00 11.29 ? 396 HIS B CD2 1 
ATOM   7613  C CE1 . HIS B 1 396 ? 2.674   10.140  89.801  1.00 13.06 ? 396 HIS B CE1 1 
ATOM   7614  N NE2 . HIS B 1 396 ? 3.811   10.415  89.190  1.00 10.11 ? 396 HIS B NE2 1 
ATOM   7615  N N   . GLN B 1 397 ? 0.939   6.984   84.146  1.00 10.46 ? 397 GLN B N   1 
ATOM   7616  C CA  . GLN B 1 397 ? -0.149  6.782   83.191  1.00 10.45 ? 397 GLN B CA  1 
ATOM   7617  C C   . GLN B 1 397 ? 0.152   5.774   82.082  1.00 10.97 ? 397 GLN B C   1 
ATOM   7618  O O   . GLN B 1 397 ? -0.507  5.769   81.028  1.00 11.58 ? 397 GLN B O   1 
ATOM   7619  C CB  . GLN B 1 397 ? -0.559  8.129   82.579  1.00 10.52 ? 397 GLN B CB  1 
ATOM   7620  C CG  . GLN B 1 397 ? -1.320  9.079   83.516  1.00 9.83  ? 397 GLN B CG  1 
ATOM   7621  C CD  . GLN B 1 397 ? -1.946  10.264  82.774  1.00 11.17 ? 397 GLN B CD  1 
ATOM   7622  O OE1 . GLN B 1 397 ? -3.089  10.662  83.053  1.00 12.78 ? 397 GLN B OE1 1 
ATOM   7623  N NE2 . GLN B 1 397 ? -1.227  10.790  81.803  1.00 6.11  ? 397 GLN B NE2 1 
ATOM   7624  N N   . GLY B 1 398 ? 1.159   4.936   82.282  1.00 11.06 ? 398 GLY B N   1 
ATOM   7625  C CA  . GLY B 1 398 ? 1.443   3.885   81.323  1.00 11.04 ? 398 GLY B CA  1 
ATOM   7626  C C   . GLY B 1 398 ? 0.666   2.632   81.670  1.00 11.35 ? 398 GLY B C   1 
ATOM   7627  O O   . GLY B 1 398 ? -0.302  2.702   82.425  1.00 11.77 ? 398 GLY B O   1 
ATOM   7628  N N   . THR B 1 399 ? 1.097   1.489   81.146  1.00 11.70 ? 399 THR B N   1 
ATOM   7629  C CA  . THR B 1 399 ? 0.389   0.218   81.327  1.00 12.36 ? 399 THR B CA  1 
ATOM   7630  C C   . THR B 1 399 ? 1.217   -0.821  82.069  1.00 12.99 ? 399 THR B C   1 
ATOM   7631  O O   . THR B 1 399 ? 0.926   -2.004  81.988  1.00 13.39 ? 399 THR B O   1 
ATOM   7632  C CB  . THR B 1 399 ? -0.015  -0.393  79.961  1.00 12.22 ? 399 THR B CB  1 
ATOM   7633  O OG1 . THR B 1 399 ? 1.142   -0.515  79.106  1.00 11.94 ? 399 THR B OG1 1 
ATOM   7634  C CG2 . THR B 1 399 ? -0.950  0.532   79.205  1.00 12.93 ? 399 THR B CG2 1 
ATOM   7635  N N   . LYS B 1 400 ? 2.253   -0.378  82.775  1.00 13.43 ? 400 LYS B N   1 
ATOM   7636  C CA  . LYS B 1 400 ? 3.138   -1.281  83.501  1.00 13.89 ? 400 LYS B CA  1 
ATOM   7637  C C   . LYS B 1 400 ? 3.035   -0.999  84.996  1.00 13.63 ? 400 LYS B C   1 
ATOM   7638  O O   . LYS B 1 400 ? 2.934   0.155   85.401  1.00 14.01 ? 400 LYS B O   1 
ATOM   7639  C CB  . LYS B 1 400 ? 4.604   -1.021  83.085  1.00 14.64 ? 400 LYS B CB  1 
ATOM   7640  C CG  . LYS B 1 400 ? 5.148   -1.830  81.934  1.00 14.91 ? 400 LYS B CG  1 
ATOM   7641  C CD  . LYS B 1 400 ? 4.976   -1.123  80.602  1.00 16.11 ? 400 LYS B CD  1 
ATOM   7642  C CE  . LYS B 1 400 ? 5.271   -2.072  79.480  1.00 15.44 ? 400 LYS B CE  1 
ATOM   7643  N NZ  . LYS B 1 400 ? 4.617   -1.663  78.185  1.00 13.86 ? 400 LYS B NZ  1 
ATOM   7644  N N   . MET B 1 401 ? 3.040   -2.045  85.819  1.00 12.67 ? 401 MET B N   1 
ATOM   7645  C CA  . MET B 1 401 ? 3.170   -1.869  87.252  1.00 12.55 ? 401 MET B CA  1 
ATOM   7646  C C   . MET B 1 401 ? 4.679   -1.895  87.539  1.00 11.33 ? 401 MET B C   1 
ATOM   7647  O O   . MET B 1 401 ? 5.366   -2.820  87.124  1.00 10.11 ? 401 MET B O   1 
ATOM   7648  C CB  . MET B 1 401 ? 2.478   -3.000  87.996  1.00 13.24 ? 401 MET B CB  1 
ATOM   7649  C CG  . MET B 1 401 ? 2.456   -2.809  89.473  1.00 15.30 ? 401 MET B CG  1 
ATOM   7650  S SD  . MET B 1 401 ? 1.828   -4.281  90.343  1.00 19.12 ? 401 MET B SD  1 
ATOM   7651  C CE  . MET B 1 401 ? 1.998   -3.758  91.804  1.00 19.41 ? 401 MET B CE  1 
ATOM   7652  N N   . ILE B 1 402 ? 5.167   -0.889  88.260  1.00 10.27 ? 402 ILE B N   1 
ATOM   7653  C CA  . ILE B 1 402 ? 6.597   -0.701  88.486  1.00 10.10 ? 402 ILE B CA  1 
ATOM   7654  C C   . ILE B 1 402 ? 6.858   -0.370  89.941  1.00 9.24  ? 402 ILE B C   1 
ATOM   7655  O O   . ILE B 1 402 ? 6.712   0.772   90.358  1.00 9.59  ? 402 ILE B O   1 
ATOM   7656  C CB  . ILE B 1 402 ? 7.123   0.487   87.633  1.00 10.02 ? 402 ILE B CB  1 
ATOM   7657  C CG1 . ILE B 1 402 ? 6.934   0.205   86.144  1.00 9.92  ? 402 ILE B CG1 1 
ATOM   7658  C CG2 . ILE B 1 402 ? 8.582   0.747   87.958  1.00 10.56 ? 402 ILE B CG2 1 
ATOM   7659  C CD1 . ILE B 1 402 ? 7.071   1.409   85.223  1.00 10.98 ? 402 ILE B CD1 1 
ATOM   7660  N N   . PRO B 1 403 ? 7.240   -1.355  90.733  1.00 9.26  ? 403 PRO B N   1 
ATOM   7661  C CA  . PRO B 1 403 ? 7.592   -1.059  92.120  1.00 9.15  ? 403 PRO B CA  1 
ATOM   7662  C C   . PRO B 1 403 ? 8.749   -0.057  92.143  1.00 9.22  ? 403 PRO B C   1 
ATOM   7663  O O   . PRO B 1 403 ? 9.730   -0.265  91.416  1.00 9.37  ? 403 PRO B O   1 
ATOM   7664  C CB  . PRO B 1 403 ? 8.042   -2.420  92.672  1.00 9.22  ? 403 PRO B CB  1 
ATOM   7665  C CG  . PRO B 1 403 ? 7.413   -3.427  91.742  1.00 10.07 ? 403 PRO B CG  1 
ATOM   7666  C CD  . PRO B 1 403 ? 7.427   -2.778  90.391  1.00 9.14  ? 403 PRO B CD  1 
ATOM   7667  N N   . CYS B 1 404 ? 8.649   0.991   92.955  1.00 8.88  ? 404 CYS B N   1 
ATOM   7668  C CA  . CYS B 1 404 ? 9.712   1.988   93.068  1.00 8.42  ? 404 CYS B CA  1 
ATOM   7669  C C   . CYS B 1 404 ? 10.166  2.182   94.508  1.00 8.72  ? 404 CYS B C   1 
ATOM   7670  O O   . CYS B 1 404 ? 9.330   2.247   95.438  1.00 8.58  ? 404 CYS B O   1 
ATOM   7671  C CB  . CYS B 1 404 ? 9.260   3.363   92.574  1.00 8.70  ? 404 CYS B CB  1 
ATOM   7672  S SG  . CYS B 1 404 ? 8.712   3.444   90.853  1.00 7.91  ? 404 CYS B SG  1 
ATOM   7673  N N   . ASP B 1 405 ? 11.479  2.303   94.674  1.00 8.07  ? 405 ASP B N   1 
ATOM   7674  C CA  . ASP B 1 405 ? 12.060  2.710   95.928  1.00 8.65  ? 405 ASP B CA  1 
ATOM   7675  C C   . ASP B 1 405 ? 12.476  4.190   95.798  1.00 8.51  ? 405 ASP B C   1 
ATOM   7676  O O   . ASP B 1 405 ? 13.363  4.525   94.992  1.00 8.29  ? 405 ASP B O   1 
ATOM   7677  C CB  . ASP B 1 405 ? 13.309  1.893   96.271  1.00 8.84  ? 405 ASP B CB  1 
ATOM   7678  C CG  . ASP B 1 405 ? 13.014  0.454   96.635  1.00 10.84 ? 405 ASP B CG  1 
ATOM   7679  O OD1 . ASP B 1 405 ? 11.826  0.079   96.804  1.00 9.06  ? 405 ASP B OD1 1 
ATOM   7680  O OD2 . ASP B 1 405 ? 13.956  -0.358  96.777  1.00 10.50 ? 405 ASP B OD2 1 
ATOM   7681  N N   . PHE B 1 406 ? 11.818  5.055   96.571  1.00 8.50  ? 406 PHE B N   1 
ATOM   7682  C CA  . PHE B 1 406 ? 12.145  6.472   96.670  1.00 8.55  ? 406 PHE B CA  1 
ATOM   7683  C C   . PHE B 1 406 ? 13.029  6.640   97.906  1.00 8.48  ? 406 PHE B C   1 
ATOM   7684  O O   . PHE B 1 406 ? 12.651  6.223   98.984  1.00 8.59  ? 406 PHE B O   1 
ATOM   7685  C CB  . PHE B 1 406 ? 10.878  7.305   96.839  1.00 8.39  ? 406 PHE B CB  1 
ATOM   7686  C CG  . PHE B 1 406 ? 10.132  7.556   95.561  1.00 7.85  ? 406 PHE B CG  1 
ATOM   7687  C CD1 . PHE B 1 406 ? 9.476   6.520   94.903  1.00 7.69  ? 406 PHE B CD1 1 
ATOM   7688  C CD2 . PHE B 1 406 ? 10.053  8.826   95.043  1.00 8.60  ? 406 PHE B CD2 1 
ATOM   7689  C CE1 . PHE B 1 406 ? 8.790   6.757   93.735  1.00 8.44  ? 406 PHE B CE1 1 
ATOM   7690  C CE2 . PHE B 1 406 ? 9.369   9.072   93.877  1.00 9.52  ? 406 PHE B CE2 1 
ATOM   7691  C CZ  . PHE B 1 406 ? 8.731   8.027   93.223  1.00 9.43  ? 406 PHE B CZ  1 
ATOM   7692  N N   . LEU B 1 407 ? 14.198  7.249   97.739  1.00 8.05  ? 407 LEU B N   1 
ATOM   7693  C CA  . LEU B 1 407 ? 15.122  7.467   98.839  1.00 7.88  ? 407 LEU B CA  1 
ATOM   7694  C C   . LEU B 1 407 ? 15.530  8.928   98.950  1.00 7.90  ? 407 LEU B C   1 
ATOM   7695  O O   . LEU B 1 407 ? 15.671  9.627   97.937  1.00 7.14  ? 407 LEU B O   1 
ATOM   7696  C CB  . LEU B 1 407 ? 16.387  6.628   98.667  1.00 7.76  ? 407 LEU B CB  1 
ATOM   7697  C CG  . LEU B 1 407 ? 16.200  5.128   98.485  1.00 9.47  ? 407 LEU B CG  1 
ATOM   7698  C CD1 . LEU B 1 407 ? 16.228  4.762   97.013  1.00 12.38 ? 407 LEU B CD1 1 
ATOM   7699  C CD2 . LEU B 1 407 ? 17.307  4.363   99.191  1.00 11.56 ? 407 LEU B CD2 1 
ATOM   7700  N N   . ILE B 1 408 ? 15.746  9.390   100.176 1.00 7.69  ? 408 ILE B N   1 
ATOM   7701  C CA  . ILE B 1 408 ? 16.218  10.773  100.366 1.00 7.80  ? 408 ILE B CA  1 
ATOM   7702  C C   . ILE B 1 408 ? 16.805  11.015  101.752 1.00 7.83  ? 408 ILE B C   1 
ATOM   7703  O O   . ILE B 1 408 ? 16.339  10.437  102.743 1.00 7.12  ? 408 ILE B O   1 
ATOM   7704  C CB  . ILE B 1 408 ? 15.063  11.762  100.103 1.00 7.89  ? 408 ILE B CB  1 
ATOM   7705  C CG1 . ILE B 1 408 ? 15.614  13.169  99.793  1.00 7.57  ? 408 ILE B CG1 1 
ATOM   7706  C CG2 . ILE B 1 408 ? 14.075  11.771  101.280 1.00 8.50  ? 408 ILE B CG2 1 
ATOM   7707  C CD1 . ILE B 1 408 ? 14.550  14.159  99.432  1.00 8.62  ? 408 ILE B CD1 1 
ATOM   7708  N N   . PRO B 1 409 ? 17.849  11.839  101.831 1.00 7.75  ? 409 PRO B N   1 
ATOM   7709  C CA  . PRO B 1 409 ? 18.331  12.297  103.127 1.00 7.32  ? 409 PRO B CA  1 
ATOM   7710  C C   . PRO B 1 409 ? 17.544  13.511  103.578 1.00 7.86  ? 409 PRO B C   1 
ATOM   7711  O O   . PRO B 1 409 ? 17.243  14.404  102.786 1.00 7.09  ? 409 PRO B O   1 
ATOM   7712  C CB  . PRO B 1 409 ? 19.777  12.715  102.839 1.00 7.66  ? 409 PRO B CB  1 
ATOM   7713  C CG  . PRO B 1 409 ? 19.764  13.145  101.395 1.00 8.33  ? 409 PRO B CG  1 
ATOM   7714  C CD  . PRO B 1 409 ? 18.707  12.311  100.731 1.00 7.45  ? 409 PRO B CD  1 
ATOM   7715  N N   . VAL B 1 410 ? 17.207  13.540  104.856 1.00 8.84  ? 410 VAL B N   1 
ATOM   7716  C CA  . VAL B 1 410 ? 16.548  14.691  105.439 1.00 9.11  ? 410 VAL B CA  1 
ATOM   7717  C C   . VAL B 1 410 ? 17.455  15.924  105.345 1.00 9.59  ? 410 VAL B C   1 
ATOM   7718  O O   . VAL B 1 410 ? 17.003  17.011  104.998 1.00 10.16 ? 410 VAL B O   1 
ATOM   7719  C CB  . VAL B 1 410 ? 16.223  14.441  106.925 1.00 9.45  ? 410 VAL B CB  1 
ATOM   7720  C CG1 . VAL B 1 410 ? 15.554  15.644  107.555 1.00 9.32  ? 410 VAL B CG1 1 
ATOM   7721  C CG2 . VAL B 1 410 ? 15.344  13.237  107.070 1.00 9.49  ? 410 VAL B CG2 1 
ATOM   7722  N N   . GLN B 1 411 ? 18.723  15.760  105.695 1.00 10.16 ? 411 GLN B N   1 
ATOM   7723  C CA  . GLN B 1 411 ? 19.656  16.862  105.720 1.00 10.27 ? 411 GLN B CA  1 
ATOM   7724  C C   . GLN B 1 411 ? 20.512  16.858  104.462 1.00 10.33 ? 411 GLN B C   1 
ATOM   7725  O O   . GLN B 1 411 ? 21.108  15.853  104.124 1.00 9.48  ? 411 GLN B O   1 
ATOM   7726  C CB  . GLN B 1 411 ? 20.545  16.766  106.956 1.00 10.36 ? 411 GLN B CB  1 
ATOM   7727  C CG  . GLN B 1 411 ? 19.734  16.818  108.258 1.00 10.58 ? 411 GLN B CG  1 
ATOM   7728  C CD  . GLN B 1 411 ? 20.584  16.751  109.508 1.00 10.54 ? 411 GLN B CD  1 
ATOM   7729  O OE1 . GLN B 1 411 ? 21.804  16.918  109.456 1.00 9.49  ? 411 GLN B OE1 1 
ATOM   7730  N NE2 . GLN B 1 411 ? 19.937  16.505  110.643 1.00 12.57 ? 411 GLN B NE2 1 
ATOM   7731  N N   . THR B 1 412 ? 20.584  18.001  103.789 1.00 10.68 ? 412 THR B N   1 
ATOM   7732  C CA  . THR B 1 412 ? 21.393  18.124  102.584 1.00 10.30 ? 412 THR B CA  1 
ATOM   7733  C C   . THR B 1 412 ? 22.810  18.543  102.904 1.00 10.41 ? 412 THR B C   1 
ATOM   7734  O O   . THR B 1 412 ? 23.068  19.216  103.914 1.00 9.51  ? 412 THR B O   1 
ATOM   7735  C CB  . THR B 1 412 ? 20.763  19.171  101.609 1.00 11.46 ? 412 THR B CB  1 
ATOM   7736  O OG1 . THR B 1 412 ? 21.568  19.281  100.433 1.00 10.41 ? 412 THR B OG1 1 
ATOM   7737  C CG2 . THR B 1 412 ? 20.800  20.575  102.195 1.00 11.56 ? 412 THR B CG2 1 
ATOM   7738  N N   . GLN B 1 413 ? 23.732  18.154  102.028 1.00 10.28 ? 413 GLN B N   1 
ATOM   7739  C CA  . GLN B 1 413 ? 25.123  18.562  102.120 1.00 10.40 ? 413 GLN B CA  1 
ATOM   7740  C C   . GLN B 1 413 ? 25.277  20.040  101.720 1.00 10.73 ? 413 GLN B C   1 
ATOM   7741  O O   . GLN B 1 413 ? 26.285  20.662  102.035 1.00 10.61 ? 413 GLN B O   1 
ATOM   7742  C CB  . GLN B 1 413 ? 26.014  17.696  101.221 1.00 10.39 ? 413 GLN B CB  1 
ATOM   7743  C CG  . GLN B 1 413 ? 26.054  16.183  101.568 1.00 10.38 ? 413 GLN B CG  1 
ATOM   7744  C CD  . GLN B 1 413 ? 26.856  15.877  102.822 1.00 10.79 ? 413 GLN B CD  1 
ATOM   7745  O OE1 . GLN B 1 413 ? 27.769  16.621  103.179 1.00 11.39 ? 413 GLN B OE1 1 
ATOM   7746  N NE2 . GLN B 1 413 ? 26.552  14.754  103.468 1.00 11.04 ? 413 GLN B NE2 1 
ATOM   7747  N N   . HIS B 1 414 ? 24.294  20.579  101.014 1.00 10.35 ? 414 HIS B N   1 
ATOM   7748  C CA  . HIS B 1 414 ? 24.350  21.938  100.495 1.00 10.53 ? 414 HIS B CA  1 
ATOM   7749  C C   . HIS B 1 414 ? 23.062  22.684  100.778 1.00 10.87 ? 414 HIS B C   1 
ATOM   7750  O O   . HIS B 1 414 ? 22.209  22.864  99.905  1.00 10.51 ? 414 HIS B O   1 
ATOM   7751  C CB  . HIS B 1 414 ? 24.615  21.903  98.998  1.00 10.62 ? 414 HIS B CB  1 
ATOM   7752  C CG  . HIS B 1 414 ? 25.913  21.280  98.646  1.00 10.45 ? 414 HIS B CG  1 
ATOM   7753  N ND1 . HIS B 1 414 ? 27.111  21.953  98.746  1.00 11.16 ? 414 HIS B ND1 1 
ATOM   7754  C CD2 . HIS B 1 414 ? 26.217  20.024  98.248  1.00 10.83 ? 414 HIS B CD2 1 
ATOM   7755  C CE1 . HIS B 1 414 ? 28.093  21.144  98.394  1.00 11.65 ? 414 HIS B CE1 1 
ATOM   7756  N NE2 . HIS B 1 414 ? 27.577  19.970  98.080  1.00 10.77 ? 414 HIS B NE2 1 
ATOM   7757  N N   . PRO B 1 415 ? 22.924  23.148  102.012 1.00 11.72 ? 415 PRO B N   1 
ATOM   7758  C CA  . PRO B 1 415 ? 21.716  23.863  102.438 1.00 11.99 ? 415 PRO B CA  1 
ATOM   7759  C C   . PRO B 1 415 ? 21.681  25.304  101.946 1.00 12.25 ? 415 PRO B C   1 
ATOM   7760  O O   . PRO B 1 415 ? 21.473  26.244  102.705 1.00 12.13 ? 415 PRO B O   1 
ATOM   7761  C CB  . PRO B 1 415 ? 21.794  23.804  103.956 1.00 11.94 ? 415 PRO B CB  1 
ATOM   7762  C CG  . PRO B 1 415 ? 23.257  23.674  104.265 1.00 12.75 ? 415 PRO B CG  1 
ATOM   7763  C CD  . PRO B 1 415 ? 23.908  22.986  103.098 1.00 11.62 ? 415 PRO B CD  1 
ATOM   7764  N N   . ILE B 1 416 ? 21.855  25.463  100.651 1.00 12.48 ? 416 ILE B N   1 
ATOM   7765  C CA  . ILE B 1 416 ? 21.873  26.783  100.041 1.00 12.61 ? 416 ILE B CA  1 
ATOM   7766  C C   . ILE B 1 416 ? 20.477  27.426  100.039 1.00 12.91 ? 416 ILE B C   1 
ATOM   7767  O O   . ILE B 1 416 ? 19.449  26.752  100.219 1.00 12.34 ? 416 ILE B O   1 
ATOM   7768  C CB  . ILE B 1 416 ? 22.419  26.677  98.619  1.00 12.46 ? 416 ILE B CB  1 
ATOM   7769  C CG1 . ILE B 1 416 ? 21.532  25.761  97.790  1.00 12.85 ? 416 ILE B CG1 1 
ATOM   7770  C CG2 . ILE B 1 416 ? 23.883  26.174  98.631  1.00 14.28 ? 416 ILE B CG2 1 
ATOM   7771  C CD1 . ILE B 1 416 ? 21.827  25.820  96.309  1.00 13.65 ? 416 ILE B CD1 1 
ATOM   7772  N N   . ARG B 1 417 ? 20.462  28.742  99.868  1.00 12.80 ? 417 ARG B N   1 
ATOM   7773  C CA  . ARG B 1 417 ? 19.237  29.551  99.844  1.00 13.01 ? 417 ARG B CA  1 
ATOM   7774  C C   . ARG B 1 417 ? 18.399  29.277  101.070 1.00 12.63 ? 417 ARG B C   1 
ATOM   7775  O O   . ARG B 1 417 ? 17.198  29.167  100.973 1.00 11.38 ? 417 ARG B O   1 
ATOM   7776  C CB  . ARG B 1 417 ? 18.394  29.284  98.593  1.00 13.57 ? 417 ARG B CB  1 
ATOM   7777  C CG  . ARG B 1 417 ? 19.112  29.491  97.240  1.00 14.53 ? 417 ARG B CG  1 
ATOM   7778  C CD  . ARG B 1 417 ? 19.272  30.951  96.811  1.00 14.51 ? 417 ARG B CD  1 
ATOM   7779  N NE  . ARG B 1 417 ? 17.997  31.656  96.776  1.00 15.93 ? 417 ARG B NE  1 
ATOM   7780  C CZ  . ARG B 1 417 ? 17.110  31.589  95.796  1.00 16.61 ? 417 ARG B CZ  1 
ATOM   7781  N NH1 . ARG B 1 417 ? 17.325  30.844  94.710  1.00 15.90 ? 417 ARG B NH1 1 
ATOM   7782  N NH2 . ARG B 1 417 ? 15.988  32.284  95.901  1.00 18.16 ? 417 ARG B NH2 1 
ATOM   7783  N N   . LYS B 1 418 ? 19.055  29.147  102.214 1.00 13.06 ? 418 LYS B N   1 
ATOM   7784  C CA  . LYS B 1 418 ? 18.395  28.882  103.481 1.00 13.85 ? 418 LYS B CA  1 
ATOM   7785  C C   . LYS B 1 418 ? 17.476  27.669  103.423 1.00 13.72 ? 418 LYS B C   1 
ATOM   7786  O O   . LYS B 1 418 ? 16.418  27.650  104.060 1.00 11.94 ? 418 LYS B O   1 
ATOM   7787  C CB  . LYS B 1 418 ? 17.622  30.119  103.959 1.00 15.13 ? 418 LYS B CB  1 
ATOM   7788  C CG  . LYS B 1 418 ? 18.537  31.322  104.201 1.00 17.58 ? 418 LYS B CG  1 
ATOM   7789  C CD  . LYS B 1 418 ? 17.745  32.554  104.596 1.00 22.28 ? 418 LYS B CD  1 
ATOM   7790  C CE  . LYS B 1 418 ? 18.625  33.800  104.732 1.00 25.62 ? 418 LYS B CE  1 
ATOM   7791  N NZ  . LYS B 1 418 ? 17.810  35.063  104.602 1.00 29.15 ? 418 LYS B NZ  1 
ATOM   7792  N N   . GLY B 1 419 ? 17.896  26.662  102.652 1.00 12.69 ? 419 GLY B N   1 
ATOM   7793  C CA  . GLY B 1 419 ? 17.180  25.406  102.566 1.00 12.11 ? 419 GLY B CA  1 
ATOM   7794  C C   . GLY B 1 419 ? 16.110  25.312  101.501 1.00 11.02 ? 419 GLY B C   1 
ATOM   7795  O O   . GLY B 1 419 ? 15.419  24.308  101.436 1.00 9.90  ? 419 GLY B O   1 
ATOM   7796  N N   . LEU B 1 420 ? 15.973  26.344  100.660 1.00 10.67 ? 420 LEU B N   1 
ATOM   7797  C CA  . LEU B 1 420 ? 14.922  26.368  99.654  1.00 10.25 ? 420 LEU B CA  1 
ATOM   7798  C C   . LEU B 1 420 ? 14.953  25.199  98.669  1.00 9.35  ? 420 LEU B C   1 
ATOM   7799  O O   . LEU B 1 420 ? 13.914  24.585  98.381  1.00 8.20  ? 420 LEU B O   1 
ATOM   7800  C CB  . LEU B 1 420 ? 14.979  27.663  98.863  1.00 10.53 ? 420 LEU B CB  1 
ATOM   7801  C CG  . LEU B 1 420 ? 13.985  27.801  97.702  1.00 11.36 ? 420 LEU B CG  1 
ATOM   7802  C CD1 . LEU B 1 420 ? 12.523  27.804  98.166  1.00 12.97 ? 420 LEU B CD1 1 
ATOM   7803  C CD2 . LEU B 1 420 ? 14.309  29.067  96.964  1.00 11.74 ? 420 LEU B CD2 1 
ATOM   7804  N N   . HIS B 1 421 ? 16.127  24.929  98.117  1.00 8.64  ? 421 HIS B N   1 
ATOM   7805  C CA  . HIS B 1 421 ? 16.252  23.842  97.164  1.00 9.19  ? 421 HIS B CA  1 
ATOM   7806  C C   . HIS B 1 421 ? 15.821  22.530  97.816  1.00 9.21  ? 421 HIS B C   1 
ATOM   7807  O O   . HIS B 1 421 ? 15.078  21.753  97.208  1.00 8.68  ? 421 HIS B O   1 
ATOM   7808  C CB  . HIS B 1 421 ? 17.681  23.706  96.670  1.00 9.14  ? 421 HIS B CB  1 
ATOM   7809  C CG  . HIS B 1 421 ? 18.052  24.681  95.590  1.00 9.82  ? 421 HIS B CG  1 
ATOM   7810  N ND1 . HIS B 1 421 ? 18.309  26.015  95.844  1.00 12.36 ? 421 HIS B ND1 1 
ATOM   7811  C CD2 . HIS B 1 421 ? 18.236  24.512  94.259  1.00 8.10  ? 421 HIS B CD2 1 
ATOM   7812  C CE1 . HIS B 1 421 ? 18.609  26.627  94.711  1.00 7.25  ? 421 HIS B CE1 1 
ATOM   7813  N NE2 . HIS B 1 421 ? 18.584  25.735  93.736  1.00 10.90 ? 421 HIS B NE2 1 
ATOM   7814  N N   . HIS B 1 422 ? 16.300  22.290  99.030  1.00 9.35  ? 422 HIS B N   1 
ATOM   7815  C CA  . HIS B 1 422 ? 16.045  21.019  99.680  1.00 9.82  ? 422 HIS B CA  1 
ATOM   7816  C C   . HIS B 1 422 ? 14.570  20.899  100.081 1.00 9.53  ? 422 HIS B C   1 
ATOM   7817  O O   . HIS B 1 422 ? 14.015  19.817  100.063 1.00 8.92  ? 422 HIS B O   1 
ATOM   7818  C CB  . HIS B 1 422 ? 16.992  20.757  100.863 1.00 10.13 ? 422 HIS B CB  1 
ATOM   7819  C CG  . HIS B 1 422 ? 17.120  19.306  101.198 1.00 10.23 ? 422 HIS B CG  1 
ATOM   7820  N ND1 . HIS B 1 422 ? 17.510  18.367  100.267 1.00 10.33 ? 422 HIS B ND1 1 
ATOM   7821  C CD2 . HIS B 1 422 ? 16.894  18.625  102.352 1.00 9.97  ? 422 HIS B CD2 1 
ATOM   7822  C CE1 . HIS B 1 422 ? 17.510  17.169  100.829 1.00 10.22 ? 422 HIS B CE1 1 
ATOM   7823  N NE2 . HIS B 1 422 ? 17.152  17.298  102.096 1.00 9.25  ? 422 HIS B NE2 1 
ATOM   7824  N N   . LYS B 1 423 ? 13.934  22.020  100.394 1.00 9.95  ? 423 LYS B N   1 
ATOM   7825  C CA  . LYS B 1 423 ? 12.506  22.031  100.666 1.00 10.95 ? 423 LYS B CA  1 
ATOM   7826  C C   . LYS B 1 423 ? 11.703  21.581  99.425  1.00 10.72 ? 423 LYS B C   1 
ATOM   7827  O O   . LYS B 1 423 ? 10.790  20.739  99.529  1.00 10.51 ? 423 LYS B O   1 
ATOM   7828  C CB  . LYS B 1 423 ? 12.082  23.430  101.131 1.00 11.51 ? 423 LYS B CB  1 
ATOM   7829  C CG  . LYS B 1 423 ? 10.606  23.715  101.104 1.00 14.98 ? 423 LYS B CG  1 
ATOM   7830  C CD  . LYS B 1 423 ? 10.343  25.132  101.638 1.00 19.92 ? 423 LYS B CD  1 
ATOM   7831  C CE  . LYS B 1 423 ? 9.129   25.796  101.028 1.00 24.04 ? 423 LYS B CE  1 
ATOM   7832  N NZ  . LYS B 1 423 ? 8.588   26.843  101.970 1.00 26.79 ? 423 LYS B NZ  1 
ATOM   7833  N N   . ILE B 1 424 ? 12.053  22.108  98.253  1.00 10.00 ? 424 ILE B N   1 
ATOM   7834  C CA  . ILE B 1 424 ? 11.356  21.729  97.031  1.00 10.09 ? 424 ILE B CA  1 
ATOM   7835  C C   . ILE B 1 424 ? 11.645  20.260  96.719  1.00 9.68  ? 424 ILE B C   1 
ATOM   7836  O O   . ILE B 1 424 ? 10.756  19.504  96.299  1.00 9.37  ? 424 ILE B O   1 
ATOM   7837  C CB  . ILE B 1 424 ? 11.752  22.642  95.860  1.00 10.12 ? 424 ILE B CB  1 
ATOM   7838  C CG1 . ILE B 1 424 ? 11.378  24.093  96.152  1.00 11.20 ? 424 ILE B CG1 1 
ATOM   7839  C CG2 . ILE B 1 424 ? 11.055  22.206  94.575  1.00 9.68  ? 424 ILE B CG2 1 
ATOM   7840  C CD1 . ILE B 1 424 ? 12.108  25.081  95.290  1.00 12.74 ? 424 ILE B CD1 1 
ATOM   7841  N N   . LEU B 1 425 ? 12.888  19.843  96.953  1.00 9.54  ? 425 LEU B N   1 
ATOM   7842  C CA  . LEU B 1 425 ? 13.261  18.461  96.662  1.00 9.38  ? 425 LEU B CA  1 
ATOM   7843  C C   . LEU B 1 425 ? 12.425  17.517  97.539  1.00 9.55  ? 425 LEU B C   1 
ATOM   7844  O O   . LEU B 1 425 ? 11.820  16.548  97.061  1.00 9.18  ? 425 LEU B O   1 
ATOM   7845  C CB  . LEU B 1 425 ? 14.752  18.263  96.906  1.00 10.02 ? 425 LEU B CB  1 
ATOM   7846  C CG  . LEU B 1 425 ? 15.334  16.906  96.531  1.00 7.87  ? 425 LEU B CG  1 
ATOM   7847  C CD1 . LEU B 1 425 ? 15.244  16.655  95.043  1.00 8.38  ? 425 LEU B CD1 1 
ATOM   7848  C CD2 . LEU B 1 425 ? 16.757  16.836  97.033  1.00 8.56  ? 425 LEU B CD2 1 
ATOM   7849  N N   . LEU B 1 426 ? 12.409  17.789  98.830  1.00 9.17  ? 426 LEU B N   1 
ATOM   7850  C CA  . LEU B 1 426 ? 11.617  16.984  99.751  1.00 9.18  ? 426 LEU B CA  1 
ATOM   7851  C C   . LEU B 1 426 ? 10.130  16.981  99.351  1.00 9.28  ? 426 LEU B C   1 
ATOM   7852  O O   . LEU B 1 426 ? 9.471   15.940  99.371  1.00 8.59  ? 426 LEU B O   1 
ATOM   7853  C CB  . LEU B 1 426 ? 11.793  17.482  101.182 1.00 8.82  ? 426 LEU B CB  1 
ATOM   7854  C CG  . LEU B 1 426 ? 13.111  17.137  101.873 1.00 9.24  ? 426 LEU B CG  1 
ATOM   7855  C CD1 . LEU B 1 426 ? 13.407  18.097  103.009 1.00 11.84 ? 426 LEU B CD1 1 
ATOM   7856  C CD2 . LEU B 1 426 ? 13.109  15.708  102.392 1.00 8.58  ? 426 LEU B CD2 1 
ATOM   7857  N N   . ALA B 1 427 ? 9.597   18.141  98.974  1.00 9.23  ? 427 ALA B N   1 
ATOM   7858  C CA  . ALA B 1 427 ? 8.188   18.221  98.636  1.00 9.56  ? 427 ALA B CA  1 
ATOM   7859  C C   . ALA B 1 427 ? 7.866   17.337  97.454  1.00 9.67  ? 427 ALA B C   1 
ATOM   7860  O O   . ALA B 1 427 ? 6.819   16.716  97.390  1.00 9.75  ? 427 ALA B O   1 
ATOM   7861  C CB  . ALA B 1 427 ? 7.774   19.661  98.346  1.00 9.77  ? 427 ALA B CB  1 
ATOM   7862  N N   . ASN B 1 428 ? 8.793   17.250  96.514  1.00 9.42  ? 428 ASN B N   1 
ATOM   7863  C CA  . ASN B 1 428 ? 8.564   16.447  95.330  1.00 8.80  ? 428 ASN B CA  1 
ATOM   7864  C C   . ASN B 1 428 ? 8.718   14.957  95.657  1.00 8.82  ? 428 ASN B C   1 
ATOM   7865  O O   . ASN B 1 428 ? 7.926   14.134  95.198  1.00 8.74  ? 428 ASN B O   1 
ATOM   7866  C CB  . ASN B 1 428 ? 9.494   16.907  94.208  1.00 9.16  ? 428 ASN B CB  1 
ATOM   7867  C CG  . ASN B 1 428 ? 8.963   18.115  93.489  1.00 9.04  ? 428 ASN B CG  1 
ATOM   7868  O OD1 . ASN B 1 428 ? 9.201   19.275  93.902  1.00 12.98 ? 428 ASN B OD1 1 
ATOM   7869  N ND2 . ASN B 1 428 ? 8.221   17.874  92.429  1.00 6.96  ? 428 ASN B ND2 1 
ATOM   7870  N N   . PHE B 1 429 ? 9.715   14.627  96.479  1.00 8.61  ? 429 PHE B N   1 
ATOM   7871  C CA  . PHE B 1 429 ? 9.927   13.262  96.971  1.00 8.13  ? 429 PHE B CA  1 
ATOM   7872  C C   . PHE B 1 429 ? 8.621   12.727  97.584  1.00 8.04  ? 429 PHE B C   1 
ATOM   7873  O O   . PHE B 1 429 ? 8.164   11.629  97.264  1.00 8.43  ? 429 PHE B O   1 
ATOM   7874  C CB  . PHE B 1 429 ? 11.078  13.230  98.006  1.00 8.24  ? 429 PHE B CB  1 
ATOM   7875  C CG  . PHE B 1 429 ? 11.183  11.937  98.779  1.00 8.29  ? 429 PHE B CG  1 
ATOM   7876  C CD1 . PHE B 1 429 ? 12.061  10.933  98.376  1.00 8.92  ? 429 PHE B CD1 1 
ATOM   7877  C CD2 . PHE B 1 429 ? 10.417  11.721  99.918  1.00 9.58  ? 429 PHE B CD2 1 
ATOM   7878  C CE1 . PHE B 1 429 ? 12.155  9.763   99.075  1.00 8.29  ? 429 PHE B CE1 1 
ATOM   7879  C CE2 . PHE B 1 429 ? 10.524  10.530  100.626 1.00 9.11  ? 429 PHE B CE2 1 
ATOM   7880  C CZ  . PHE B 1 429 ? 11.366  9.551   100.200 1.00 8.69  ? 429 PHE B CZ  1 
ATOM   7881  N N   . LEU B 1 430 ? 8.007   13.539  98.430  1.00 7.95  ? 430 LEU B N   1 
ATOM   7882  C CA  . LEU B 1 430 ? 6.787   13.157  99.132  1.00 7.79  ? 430 LEU B CA  1 
ATOM   7883  C C   . LEU B 1 430 ? 5.574   13.106  98.198  1.00 7.72  ? 430 LEU B C   1 
ATOM   7884  O O   . LEU B 1 430 ? 4.791   12.135  98.218  1.00 7.63  ? 430 LEU B O   1 
ATOM   7885  C CB  . LEU B 1 430 ? 6.513   14.151  100.274 1.00 8.03  ? 430 LEU B CB  1 
ATOM   7886  C CG  . LEU B 1 430 ? 7.555   14.186  101.382 1.00 8.56  ? 430 LEU B CG  1 
ATOM   7887  C CD1 . LEU B 1 430 ? 7.448   15.470  102.186 1.00 8.92  ? 430 LEU B CD1 1 
ATOM   7888  C CD2 . LEU B 1 430 ? 7.445   12.982  102.301 1.00 10.54 ? 430 LEU B CD2 1 
ATOM   7889  N N   . ALA B 1 431 ? 5.427   14.144  97.382  1.00 7.48  ? 431 ALA B N   1 
ATOM   7890  C CA  . ALA B 1 431 ? 4.261   14.282  96.506  1.00 7.81  ? 431 ALA B CA  1 
ATOM   7891  C C   . ALA B 1 431 ? 4.160   13.204  95.457  1.00 8.15  ? 431 ALA B C   1 
ATOM   7892  O O   . ALA B 1 431 ? 3.044   12.810  95.056  1.00 8.01  ? 431 ALA B O   1 
ATOM   7893  C CB  . ALA B 1 431 ? 4.271   15.624  95.841  1.00 7.73  ? 431 ALA B CB  1 
ATOM   7894  N N   . GLN B 1 432 ? 5.312   12.753  94.968  1.00 7.94  ? 432 GLN B N   1 
ATOM   7895  C CA  . GLN B 1 432 ? 5.305   11.777  93.926  1.00 8.32  ? 432 GLN B CA  1 
ATOM   7896  C C   . GLN B 1 432 ? 4.746   10.458  94.400  1.00 8.58  ? 432 GLN B C   1 
ATOM   7897  O O   . GLN B 1 432 ? 3.925   9.866   93.687  1.00 8.01  ? 432 GLN B O   1 
ATOM   7898  C CB  . GLN B 1 432 ? 6.680   11.628  93.284  1.00 8.81  ? 432 GLN B CB  1 
ATOM   7899  C CG  . GLN B 1 432 ? 7.030   12.807  92.363  1.00 7.67  ? 432 GLN B CG  1 
ATOM   7900  C CD  . GLN B 1 432 ? 6.193   12.871  91.096  1.00 8.25  ? 432 GLN B CD  1 
ATOM   7901  O OE1 . GLN B 1 432 ? 5.985   13.948  90.541  1.00 10.42 ? 432 GLN B OE1 1 
ATOM   7902  N NE2 . GLN B 1 432 ? 5.762   11.733  90.610  1.00 6.23  ? 432 GLN B NE2 1 
ATOM   7903  N N   . THR B 1 433 ? 5.144   10.002  95.586  1.00 8.36  ? 433 THR B N   1 
ATOM   7904  C CA  . THR B 1 433 ? 4.616   8.739   96.079  1.00 9.01  ? 433 THR B CA  1 
ATOM   7905  C C   . THR B 1 433 ? 3.150   8.906   96.460  1.00 9.11  ? 433 THR B C   1 
ATOM   7906  O O   . THR B 1 433 ? 2.364   7.976   96.273  1.00 9.96  ? 433 THR B O   1 
ATOM   7907  C CB  . THR B 1 433 ? 5.444   8.126   97.248  1.00 9.02  ? 433 THR B CB  1 
ATOM   7908  O OG1 . THR B 1 433 ? 5.412   8.985   98.391  1.00 9.15  ? 433 THR B OG1 1 
ATOM   7909  C CG2 . THR B 1 433 ? 6.922   7.989   96.884  1.00 10.33 ? 433 THR B CG2 1 
ATOM   7910  N N   . GLU B 1 434 ? 2.793   10.083  97.001  1.00 9.83  ? 434 GLU B N   1 
ATOM   7911  C CA  . GLU B 1 434 ? 1.410   10.402  97.340  1.00 9.97  ? 434 GLU B CA  1 
ATOM   7912  C C   . GLU B 1 434 ? 0.545   10.324  96.086  1.00 10.31 ? 434 GLU B C   1 
ATOM   7913  O O   . GLU B 1 434 ? -0.534  9.739   96.112  1.00 9.72  ? 434 GLU B O   1 
ATOM   7914  C CB  . GLU B 1 434 ? 1.288   11.807  97.931  1.00 10.64 ? 434 GLU B CB  1 
ATOM   7915  C CG  . GLU B 1 434 ? -0.122  12.146  98.375  1.00 10.32 ? 434 GLU B CG  1 
ATOM   7916  C CD  . GLU B 1 434 ? -0.249  13.541  98.935  1.00 11.88 ? 434 GLU B CD  1 
ATOM   7917  O OE1 . GLU B 1 434 ? -1.226  13.787  99.683  1.00 11.36 ? 434 GLU B OE1 1 
ATOM   7918  O OE2 . GLU B 1 434 ? 0.609   14.394  98.626  1.00 14.03 ? 434 GLU B OE2 1 
ATOM   7919  N N   . ALA B 1 435 ? 1.030   10.915  94.990  1.00 10.41 ? 435 ALA B N   1 
ATOM   7920  C CA  . ALA B 1 435 ? 0.281   10.940  93.727  1.00 10.76 ? 435 ALA B CA  1 
ATOM   7921  C C   . ALA B 1 435 ? 0.139   9.527   93.149  1.00 11.15 ? 435 ALA B C   1 
ATOM   7922  O O   . ALA B 1 435 ? -0.937  9.126   92.662  1.00 11.56 ? 435 ALA B O   1 
ATOM   7923  C CB  . ALA B 1 435 ? 0.996   11.841  92.710  1.00 10.73 ? 435 ALA B CB  1 
ATOM   7924  N N   . LEU B 1 436 ? 1.239   8.780   93.183  1.00 10.91 ? 436 LEU B N   1 
ATOM   7925  C CA  . LEU B 1 436 ? 1.245   7.422   92.663  1.00 10.59 ? 436 LEU B CA  1 
ATOM   7926  C C   . LEU B 1 436 ? 0.198   6.573   93.402  1.00 11.47 ? 436 LEU B C   1 
ATOM   7927  O O   . LEU B 1 436 ? -0.475  5.734   92.810  1.00 11.28 ? 436 LEU B O   1 
ATOM   7928  C CB  . LEU B 1 436 ? 2.651   6.818   92.773  1.00 10.36 ? 436 LEU B CB  1 
ATOM   7929  C CG  . LEU B 1 436 ? 3.679   7.316   91.721  1.00 9.44  ? 436 LEU B CG  1 
ATOM   7930  C CD1 . LEU B 1 436 ? 5.067   6.935   92.079  1.00 8.45  ? 436 LEU B CD1 1 
ATOM   7931  C CD2 . LEU B 1 436 ? 3.336   6.788   90.335  1.00 11.13 ? 436 LEU B CD2 1 
ATOM   7932  N N   . MET B 1 437 ? 0.084   6.784   94.704  1.00 12.10 ? 437 MET B N   1 
ATOM   7933  C CA  . MET B 1 437 ? -0.880  6.047   95.497  1.00 13.07 ? 437 MET B CA  1 
ATOM   7934  C C   . MET B 1 437 ? -2.318  6.532   95.263  1.00 12.56 ? 437 MET B C   1 
ATOM   7935  O O   . MET B 1 437 ? -3.193  5.739   94.983  1.00 13.29 ? 437 MET B O   1 
ATOM   7936  C CB  . MET B 1 437 ? -0.507  6.147   96.975  1.00 12.76 ? 437 MET B CB  1 
ATOM   7937  C CG  . MET B 1 437 ? -1.415  5.356   97.882  1.00 17.56 ? 437 MET B CG  1 
ATOM   7938  S SD  . MET B 1 437 ? -2.905  6.225   98.362  1.00 20.54 ? 437 MET B SD  1 
ATOM   7939  C CE  . MET B 1 437 ? -2.219  7.307   99.740  1.00 21.04 ? 437 MET B CE  1 
ATOM   7940  N N   . ARG B 1 438 ? -2.532  7.840   95.339  1.00 12.82 ? 438 ARG B N   1 
ATOM   7941  C CA  . ARG B 1 438 ? -3.873  8.418   95.320  1.00 13.68 ? 438 ARG B CA  1 
ATOM   7942  C C   . ARG B 1 438 ? -4.552  8.446   93.957  1.00 13.22 ? 438 ARG B C   1 
ATOM   7943  O O   . ARG B 1 438 ? -5.740  8.132   93.843  1.00 13.63 ? 438 ARG B O   1 
ATOM   7944  C CB  . ARG B 1 438 ? -3.826  9.851   95.838  1.00 13.77 ? 438 ARG B CB  1 
ATOM   7945  C CG  . ARG B 1 438 ? -3.489  10.000  97.299  1.00 17.35 ? 438 ARG B CG  1 
ATOM   7946  C CD  . ARG B 1 438 ? -4.675  9.776   98.222  1.00 20.67 ? 438 ARG B CD  1 
ATOM   7947  N NE  . ARG B 1 438 ? -5.696  10.807  98.031  1.00 24.04 ? 438 ARG B NE  1 
ATOM   7948  C CZ  . ARG B 1 438 ? -6.948  10.723  98.483  1.00 26.27 ? 438 ARG B CZ  1 
ATOM   7949  N NH1 . ARG B 1 438 ? -7.348  9.661   99.162  1.00 26.68 ? 438 ARG B NH1 1 
ATOM   7950  N NH2 . ARG B 1 438 ? -7.800  11.708  98.257  1.00 26.37 ? 438 ARG B NH2 1 
ATOM   7951  N N   . GLY B 1 439 ? -3.801  8.814   92.925  1.00 12.93 ? 439 GLY B N   1 
ATOM   7952  C CA  . GLY B 1 439 ? -4.379  9.014   91.614  1.00 12.92 ? 439 GLY B CA  1 
ATOM   7953  C C   . GLY B 1 439 ? -5.324  10.227  91.637  1.00 13.09 ? 439 GLY B C   1 
ATOM   7954  O O   . GLY B 1 439 ? -5.291  11.039  92.563  1.00 12.46 ? 439 GLY B O   1 
ATOM   7955  N N   . LYS B 1 440 ? -6.158  10.329  90.606  1.00 12.69 ? 440 LYS B N   1 
ATOM   7956  C CA  . LYS B 1 440 ? -7.148  11.386  90.465  1.00 12.74 ? 440 LYS B CA  1 
ATOM   7957  C C   . LYS B 1 440 ? -8.283  10.790  89.651  1.00 12.73 ? 440 LYS B C   1 
ATOM   7958  O O   . LYS B 1 440 ? -8.093  10.451  88.497  1.00 12.76 ? 440 LYS B O   1 
ATOM   7959  C CB  . LYS B 1 440 ? -6.573  12.594  89.740  1.00 12.58 ? 440 LYS B CB  1 
ATOM   7960  C CG  . LYS B 1 440 ? -7.555  13.777  89.567  1.00 13.02 ? 440 LYS B CG  1 
ATOM   7961  C CD  . LYS B 1 440 ? -7.002  14.795  88.596  1.00 13.51 ? 440 LYS B CD  1 
ATOM   7962  C CE  . LYS B 1 440 ? -5.814  15.558  89.179  1.00 13.60 ? 440 LYS B CE  1 
ATOM   7963  N NZ  . LYS B 1 440 ? -5.367  16.727  88.346  1.00 13.48 ? 440 LYS B NZ  1 
ATOM   7964  N N   . SER B 1 441 ? -9.456  10.667  90.259  1.00 12.45 ? 441 SER B N   1 
ATOM   7965  C CA  . SER B 1 441 ? -10.596 10.033  89.614  1.00 12.95 ? 441 SER B CA  1 
ATOM   7966  C C   . SER B 1 441 ? -11.212 10.901  88.527  1.00 12.71 ? 441 SER B C   1 
ATOM   7967  O O   . SER B 1 441 ? -10.997 12.111  88.463  1.00 12.70 ? 441 SER B O   1 
ATOM   7968  C CB  . SER B 1 441 ? -11.683 9.721   90.657  1.00 13.12 ? 441 SER B CB  1 
ATOM   7969  O OG  . SER B 1 441 ? -12.133 10.905  91.305  1.00 13.12 ? 441 SER B OG  1 
ATOM   7970  N N   . THR B 1 442 ? -12.002 10.264  87.680  1.00 12.96 ? 442 THR B N   1 
ATOM   7971  C CA  . THR B 1 442 ? -12.773 10.969  86.689  1.00 13.24 ? 442 THR B CA  1 
ATOM   7972  C C   . THR B 1 442 ? -13.560 12.075  87.370  1.00 13.54 ? 442 THR B C   1 
ATOM   7973  O O   . THR B 1 442 ? -13.610 13.208  86.876  1.00 13.99 ? 442 THR B O   1 
ATOM   7974  C CB  . THR B 1 442 ? -13.738 9.977   86.013  1.00 13.81 ? 442 THR B CB  1 
ATOM   7975  O OG1 . THR B 1 442 ? -12.984 8.958   85.339  1.00 14.09 ? 442 THR B OG1 1 
ATOM   7976  C CG2 . THR B 1 442 ? -14.525 10.630  84.912  1.00 14.14 ? 442 THR B CG2 1 
ATOM   7977  N N   . GLU B 1 443 ? -14.196 11.750  88.489  1.00 12.95 ? 443 GLU B N   1 
ATOM   7978  C CA  . GLU B 1 443 ? -15.016 12.738  89.185  1.00 13.71 ? 443 GLU B CA  1 
ATOM   7979  C C   . GLU B 1 443 ? -14.177 13.938  89.603  1.00 13.92 ? 443 GLU B C   1 
ATOM   7980  O O   . GLU B 1 443 ? -14.568 15.086  89.362  1.00 13.35 ? 443 GLU B O   1 
ATOM   7981  C CB  . GLU B 1 443 ? -15.744 12.130  90.402  1.00 14.12 ? 443 GLU B CB  1 
ATOM   7982  C CG  . GLU B 1 443 ? -16.524 13.190  91.175  1.00 15.38 ? 443 GLU B CG  1 
ATOM   7983  C CD  . GLU B 1 443 ? -17.474 12.634  92.222  1.00 19.27 ? 443 GLU B CD  1 
ATOM   7984  O OE1 . GLU B 1 443 ? -18.150 13.457  92.891  1.00 20.75 ? 443 GLU B OE1 1 
ATOM   7985  O OE2 . GLU B 1 443 ? -17.544 11.404  92.369  1.00 18.95 ? 443 GLU B OE2 1 
ATOM   7986  N N   . GLU B 1 444 ? -13.002 13.679  90.189  1.00 13.93 ? 444 GLU B N   1 
ATOM   7987  C CA  . GLU B 1 444 ? -12.129 14.760  90.640  1.00 14.89 ? 444 GLU B CA  1 
ATOM   7988  C C   . GLU B 1 444 ? -11.627 15.584  89.471  1.00 14.39 ? 444 GLU B C   1 
ATOM   7989  O O   . GLU B 1 444 ? -11.573 16.815  89.541  1.00 14.89 ? 444 GLU B O   1 
ATOM   7990  C CB  . GLU B 1 444 ? -10.937 14.226  91.467  1.00 14.35 ? 444 GLU B CB  1 
ATOM   7991  C CG  . GLU B 1 444 ? -11.347 13.609  92.788  1.00 17.06 ? 444 GLU B CG  1 
ATOM   7992  C CD  . GLU B 1 444 ? -10.257 12.769  93.444  1.00 18.50 ? 444 GLU B CD  1 
ATOM   7993  O OE1 . GLU B 1 444 ? -9.471  12.100  92.743  1.00 17.14 ? 444 GLU B OE1 1 
ATOM   7994  O OE2 . GLU B 1 444 ? -10.203 12.768  94.683  1.00 22.82 ? 444 GLU B OE2 1 
ATOM   7995  N N   . ALA B 1 445 ? -11.275 14.911  88.392  1.00 14.73 ? 445 ALA B N   1 
ATOM   7996  C CA  . ALA B 1 445 ? -10.731 15.580  87.210  1.00 14.45 ? 445 ALA B CA  1 
ATOM   7997  C C   . ALA B 1 445 ? -11.797 16.447  86.538  1.00 14.79 ? 445 ALA B C   1 
ATOM   7998  O O   . ALA B 1 445 ? -11.536 17.575  86.110  1.00 13.82 ? 445 ALA B O   1 
ATOM   7999  C CB  . ALA B 1 445 ? -10.199 14.545  86.242  1.00 14.21 ? 445 ALA B CB  1 
ATOM   8000  N N   . ARG B 1 446 ? -13.013 15.925  86.454  1.00 15.57 ? 446 ARG B N   1 
ATOM   8001  C CA  . ARG B 1 446 ? -14.094 16.685  85.854  1.00 15.91 ? 446 ARG B CA  1 
ATOM   8002  C C   . ARG B 1 446 ? -14.282 18.009  86.608  1.00 16.61 ? 446 ARG B C   1 
ATOM   8003  O O   . ARG B 1 446 ? -14.413 19.065  85.995  1.00 15.86 ? 446 ARG B O   1 
ATOM   8004  C CB  . ARG B 1 446 ? -15.402 15.885  85.851  1.00 16.27 ? 446 ARG B CB  1 
ATOM   8005  C CG  . ARG B 1 446 ? -16.582 16.688  85.304  1.00 17.78 ? 446 ARG B CG  1 
ATOM   8006  C CD  . ARG B 1 446 ? -17.940 16.005  85.385  1.00 19.78 ? 446 ARG B CD  1 
ATOM   8007  N NE  . ARG B 1 446 ? -18.041 14.892  84.458  1.00 21.54 ? 446 ARG B NE  1 
ATOM   8008  C CZ  . ARG B 1 446 ? -17.812 13.645  84.788  1.00 22.08 ? 446 ARG B CZ  1 
ATOM   8009  N NH1 . ARG B 1 446 ? -17.478 13.337  86.037  1.00 24.47 ? 446 ARG B NH1 1 
ATOM   8010  N NH2 . ARG B 1 446 ? -17.941 12.690  83.878  1.00 22.94 ? 446 ARG B NH2 1 
ATOM   8011  N N   . LYS B 1 447 ? -14.288 17.940  87.933  1.00 17.60 ? 447 LYS B N   1 
ATOM   8012  C CA  . LYS B 1 447 ? -14.466 19.127  88.751  1.00 19.06 ? 447 LYS B CA  1 
ATOM   8013  C C   . LYS B 1 447 ? -13.380 20.186  88.521  1.00 19.36 ? 447 LYS B C   1 
ATOM   8014  O O   . LYS B 1 447 ? -13.666 21.388  88.481  1.00 19.64 ? 447 LYS B O   1 
ATOM   8015  C CB  . LYS B 1 447 ? -14.586 18.716  90.212  1.00 19.78 ? 447 LYS B CB  1 
ATOM   8016  C CG  . LYS B 1 447 ? -15.974 18.149  90.487  1.00 21.86 ? 447 LYS B CG  1 
ATOM   8017  C CD  . LYS B 1 447 ? -16.197 17.797  91.928  1.00 24.03 ? 447 LYS B CD  1 
ATOM   8018  C CE  . LYS B 1 447 ? -17.408 16.876  92.066  1.00 23.64 ? 447 LYS B CE  1 
ATOM   8019  N NZ  . LYS B 1 447 ? -17.241 15.830  93.088  1.00 23.59 ? 447 LYS B NZ  1 
ATOM   8020  N N   . GLU B 1 448 ? -12.137 19.753  88.336  1.00 19.69 ? 448 GLU B N   1 
ATOM   8021  C CA  . GLU B 1 448 ? -11.054 20.686  88.014  1.00 19.82 ? 448 GLU B CA  1 
ATOM   8022  C C   . GLU B 1 448 ? -11.311 21.377  86.684  1.00 19.58 ? 448 GLU B C   1 
ATOM   8023  O O   . GLU B 1 448 ? -11.198 22.592  86.590  1.00 19.33 ? 448 GLU B O   1 
ATOM   8024  C CB  . GLU B 1 448 ? -9.706  19.962  87.947  1.00 20.00 ? 448 GLU B CB  1 
ATOM   8025  C CG  . GLU B 1 448 ? -9.142  19.603  89.308  1.00 21.51 ? 448 GLU B CG  1 
ATOM   8026  C CD  . GLU B 1 448 ? -7.824  18.845  89.235  1.00 22.67 ? 448 GLU B CD  1 
ATOM   8027  O OE1 . GLU B 1 448 ? -7.184  18.678  90.292  1.00 25.28 ? 448 GLU B OE1 1 
ATOM   8028  O OE2 . GLU B 1 448 ? -7.425  18.421  88.137  1.00 23.76 ? 448 GLU B OE2 1 
ATOM   8029  N N   . LEU B 1 449 ? -11.658 20.605  85.658  1.00 19.59 ? 449 LEU B N   1 
ATOM   8030  C CA  . LEU B 1 449 ? -11.899 21.160  84.323  1.00 20.46 ? 449 LEU B CA  1 
ATOM   8031  C C   . LEU B 1 449 ? -13.066 22.140  84.318  1.00 21.08 ? 449 LEU B C   1 
ATOM   8032  O O   . LEU B 1 449 ? -13.038 23.140  83.602  1.00 21.67 ? 449 LEU B O   1 
ATOM   8033  C CB  . LEU B 1 449 ? -12.141 20.046  83.296  1.00 20.10 ? 449 LEU B CB  1 
ATOM   8034  C CG  . LEU B 1 449 ? -10.926 19.138  83.031  1.00 20.42 ? 449 LEU B CG  1 
ATOM   8035  C CD1 . LEU B 1 449 ? -11.344 17.872  82.316  1.00 19.55 ? 449 LEU B CD1 1 
ATOM   8036  C CD2 . LEU B 1 449 ? -9.839  19.878  82.230  1.00 20.60 ? 449 LEU B CD2 1 
ATOM   8037  N N   . GLN B 1 450 ? -14.097 21.839  85.093  1.00 21.88 ? 450 GLN B N   1 
ATOM   8038  C CA  . GLN B 1 450 ? -15.234 22.743  85.222  1.00 23.22 ? 450 GLN B CA  1 
ATOM   8039  C C   . GLN B 1 450 ? -14.785 24.019  85.907  1.00 23.65 ? 450 GLN B C   1 
ATOM   8040  O O   . GLN B 1 450 ? -15.084 25.110  85.447  1.00 23.36 ? 450 GLN B O   1 
ATOM   8041  C CB  . GLN B 1 450 ? -16.370 22.092  86.015  1.00 23.34 ? 450 GLN B CB  1 
ATOM   8042  C CG  . GLN B 1 450 ? -17.268 21.195  85.153  1.00 25.46 ? 450 GLN B CG  1 
ATOM   8043  C CD  . GLN B 1 450 ? -18.070 20.185  85.964  1.00 27.05 ? 450 GLN B CD  1 
ATOM   8044  O OE1 . GLN B 1 450 ? -19.118 19.684  85.512  1.00 27.44 ? 450 GLN B OE1 1 
ATOM   8045  N NE2 . GLN B 1 450 ? -17.578 19.869  87.144  1.00 25.88 ? 450 GLN B NE2 1 
ATOM   8046  N N   . ALA B 1 451 ? -14.059 23.876  87.010  1.00 24.60 ? 451 ALA B N   1 
ATOM   8047  C CA  . ALA B 1 451 ? -13.561 25.036  87.734  1.00 25.62 ? 451 ALA B CA  1 
ATOM   8048  C C   . ALA B 1 451 ? -12.644 25.876  86.839  1.00 26.55 ? 451 ALA B C   1 
ATOM   8049  O O   . ALA B 1 451 ? -12.525 27.084  87.030  1.00 26.76 ? 451 ALA B O   1 
ATOM   8050  C CB  . ALA B 1 451 ? -12.839 24.605  88.989  1.00 25.48 ? 451 ALA B CB  1 
ATOM   8051  N N   . ALA B 1 452 ? -12.025 25.241  85.846  1.00 27.23 ? 452 ALA B N   1 
ATOM   8052  C CA  . ALA B 1 452 ? -11.137 25.936  84.916  1.00 27.68 ? 452 ALA B CA  1 
ATOM   8053  C C   . ALA B 1 452 ? -11.893 26.622  83.771  1.00 28.24 ? 452 ALA B C   1 
ATOM   8054  O O   . ALA B 1 452 ? -11.287 27.275  82.923  1.00 28.50 ? 452 ALA B O   1 
ATOM   8055  C CB  . ALA B 1 452 ? -10.106 24.965  84.362  1.00 27.75 ? 452 ALA B CB  1 
ATOM   8056  N N   . GLY B 1 453 ? -13.212 26.469  83.738  1.00 28.44 ? 453 GLY B N   1 
ATOM   8057  C CA  . GLY B 1 453 ? -14.019 27.124  82.727  1.00 28.85 ? 453 GLY B CA  1 
ATOM   8058  C C   . GLY B 1 453 ? -14.048 26.420  81.395  1.00 29.12 ? 453 GLY B C   1 
ATOM   8059  O O   . GLY B 1 453 ? -14.469 26.999  80.392  1.00 29.09 ? 453 GLY B O   1 
ATOM   8060  N N   . LYS B 1 454 ? -13.621 25.164  81.362  1.00 29.27 ? 454 LYS B N   1 
ATOM   8061  C CA  . LYS B 1 454 ? -13.640 24.444  80.103  1.00 29.46 ? 454 LYS B CA  1 
ATOM   8062  C C   . LYS B 1 454 ? -15.076 24.316  79.633  1.00 29.43 ? 454 LYS B C   1 
ATOM   8063  O O   . LYS B 1 454 ? -15.982 24.097  80.440  1.00 29.41 ? 454 LYS B O   1 
ATOM   8064  C CB  . LYS B 1 454 ? -13.035 23.045  80.246  1.00 29.52 ? 454 LYS B CB  1 
ATOM   8065  C CG  . LYS B 1 454 ? -11.548 23.017  80.477  1.00 30.13 ? 454 LYS B CG  1 
ATOM   8066  C CD  . LYS B 1 454 ? -10.781 23.581  79.295  1.00 31.71 ? 454 LYS B CD  1 
ATOM   8067  C CE  . LYS B 1 454 ? -9.318  23.133  79.316  1.00 32.39 ? 454 LYS B CE  1 
ATOM   8068  N NZ  . LYS B 1 454 ? -8.453  23.897  78.369  1.00 32.63 ? 454 LYS B NZ  1 
ATOM   8069  N N   . SER B 1 455 ? -15.279 24.466  78.331  1.00 29.30 ? 455 SER B N   1 
ATOM   8070  C CA  . SER B 1 455 ? -16.584 24.247  77.736  1.00 29.72 ? 455 SER B CA  1 
ATOM   8071  C C   . SER B 1 455 ? -16.895 22.755  77.878  1.00 30.08 ? 455 SER B C   1 
ATOM   8072  O O   . SER B 1 455 ? -15.983 21.957  78.136  1.00 29.59 ? 455 SER B O   1 
ATOM   8073  C CB  . SER B 1 455 ? -16.557 24.623  76.263  1.00 29.89 ? 455 SER B CB  1 
ATOM   8074  O OG  . SER B 1 455 ? -15.823 23.664  75.520  1.00 29.76 ? 455 SER B OG  1 
ATOM   8075  N N   . PRO B 1 456 ? -18.161 22.372  77.741  1.00 30.16 ? 456 PRO B N   1 
ATOM   8076  C CA  . PRO B 1 456 ? -18.536 20.960  77.839  1.00 30.37 ? 456 PRO B CA  1 
ATOM   8077  C C   . PRO B 1 456 ? -17.833 20.095  76.797  1.00 30.07 ? 456 PRO B C   1 
ATOM   8078  O O   . PRO B 1 456 ? -17.412 18.996  77.132  1.00 29.62 ? 456 PRO B O   1 
ATOM   8079  C CB  . PRO B 1 456 ? -20.050 20.983  77.611  1.00 30.54 ? 456 PRO B CB  1 
ATOM   8080  C CG  . PRO B 1 456 ? -20.455 22.347  78.056  1.00 30.80 ? 456 PRO B CG  1 
ATOM   8081  C CD  . PRO B 1 456 ? -19.341 23.230  77.534  1.00 30.85 ? 456 PRO B CD  1 
ATOM   8082  N N   . GLU B 1 457 ? -17.675 20.591  75.575  1.00 29.93 ? 457 GLU B N   1 
ATOM   8083  C CA  . GLU B 1 457 ? -17.021 19.802  74.535  1.00 30.24 ? 457 GLU B CA  1 
ATOM   8084  C C   . GLU B 1 457 ? -15.539 19.607  74.860  1.00 28.69 ? 457 GLU B C   1 
ATOM   8085  O O   . GLU B 1 457 ? -15.029 18.490  74.801  1.00 27.97 ? 457 GLU B O   1 
ATOM   8086  C CB  . GLU B 1 457 ? -17.192 20.451  73.160  1.00 31.19 ? 457 GLU B CB  1 
ATOM   8087  C CG  . GLU B 1 457 ? -17.565 19.462  72.064  1.00 34.55 ? 457 GLU B CG  1 
ATOM   8088  C CD  . GLU B 1 457 ? -16.368 18.713  71.496  1.00 38.45 ? 457 GLU B CD  1 
ATOM   8089  O OE1 . GLU B 1 457 ? -15.735 17.922  72.237  1.00 41.73 ? 457 GLU B OE1 1 
ATOM   8090  O OE2 . GLU B 1 457 ? -16.068 18.906  70.294  1.00 41.22 ? 457 GLU B OE2 1 
ATOM   8091  N N   . ASP B 1 458 ? -14.855 20.692  75.212  1.00 26.81 ? 458 ASP B N   1 
ATOM   8092  C CA  . ASP B 1 458 ? -13.442 20.613  75.572  1.00 25.71 ? 458 ASP B CA  1 
ATOM   8093  C C   . ASP B 1 458 ? -13.268 19.743  76.806  1.00 24.56 ? 458 ASP B C   1 
ATOM   8094  O O   . ASP B 1 458 ? -12.331 18.951  76.911  1.00 23.84 ? 458 ASP B O   1 
ATOM   8095  C CB  . ASP B 1 458 ? -12.875 22.007  75.846  1.00 25.49 ? 458 ASP B CB  1 
ATOM   8096  C CG  . ASP B 1 458 ? -12.584 22.769  74.582  1.00 26.47 ? 458 ASP B CG  1 
ATOM   8097  O OD1 . ASP B 1 458 ? -12.301 23.977  74.673  1.00 28.02 ? 458 ASP B OD1 1 
ATOM   8098  O OD2 . ASP B 1 458 ? -12.606 22.241  73.450  1.00 27.29 ? 458 ASP B OD2 1 
ATOM   8099  N N   . LEU B 1 459 ? -14.187 19.886  77.745  1.00 23.32 ? 459 LEU B N   1 
ATOM   8100  C CA  . LEU B 1 459 ? -14.100 19.118  78.963  1.00 23.35 ? 459 LEU B CA  1 
ATOM   8101  C C   . LEU B 1 459 ? -14.187 17.612  78.669  1.00 23.07 ? 459 LEU B C   1 
ATOM   8102  O O   . LEU B 1 459 ? -13.371 16.833  79.162  1.00 22.36 ? 459 LEU B O   1 
ATOM   8103  C CB  . LEU B 1 459 ? -15.201 19.540  79.931  1.00 23.29 ? 459 LEU B CB  1 
ATOM   8104  C CG  . LEU B 1 459 ? -15.202 18.784  81.257  1.00 23.82 ? 459 LEU B CG  1 
ATOM   8105  C CD1 . LEU B 1 459 ? -15.712 19.657  82.389  1.00 24.30 ? 459 LEU B CD1 1 
ATOM   8106  C CD2 . LEU B 1 459 ? -16.033 17.522  81.139  1.00 24.71 ? 459 LEU B CD2 1 
ATOM   8107  N N   . GLU B 1 460 ? -15.166 17.208  77.870  1.00 23.39 ? 460 GLU B N   1 
ATOM   8108  C CA  . GLU B 1 460 ? -15.381 15.782  77.598  1.00 24.15 ? 460 GLU B CA  1 
ATOM   8109  C C   . GLU B 1 460 ? -14.205 15.213  76.812  1.00 23.80 ? 460 GLU B C   1 
ATOM   8110  O O   . GLU B 1 460 ? -13.832 14.058  76.972  1.00 23.19 ? 460 GLU B O   1 
ATOM   8111  C CB  . GLU B 1 460 ? -16.686 15.553  76.823  1.00 24.62 ? 460 GLU B CB  1 
ATOM   8112  C CG  . GLU B 1 460 ? -17.981 15.691  77.633  1.00 27.47 ? 460 GLU B CG  1 
ATOM   8113  C CD  . GLU B 1 460 ? -18.049 14.837  78.901  1.00 29.85 ? 460 GLU B CD  1 
ATOM   8114  O OE1 . GLU B 1 460 ? -18.640 15.325  79.895  1.00 32.56 ? 460 GLU B OE1 1 
ATOM   8115  O OE2 . GLU B 1 460 ? -17.539 13.684  78.930  1.00 29.77 ? 460 GLU B OE2 1 
ATOM   8116  N N   . ARG B 1 461 ? -13.637 16.039  75.951  1.00 23.88 ? 461 ARG B N   1 
ATOM   8117  C CA  . ARG B 1 461 ? -12.501 15.634  75.137  1.00 24.13 ? 461 ARG B CA  1 
ATOM   8118  C C   . ARG B 1 461 ? -11.256 15.364  75.984  1.00 22.92 ? 461 ARG B C   1 
ATOM   8119  O O   . ARG B 1 461 ? -10.563 14.365  75.795  1.00 22.36 ? 461 ARG B O   1 
ATOM   8120  C CB  . ARG B 1 461 ? -12.222 16.733  74.116  1.00 25.02 ? 461 ARG B CB  1 
ATOM   8121  C CG  . ARG B 1 461 ? -10.780 16.850  73.641  1.00 29.25 ? 461 ARG B CG  1 
ATOM   8122  C CD  . ARG B 1 461 ? -10.527 18.139  72.854  1.00 34.47 ? 461 ARG B CD  1 
ATOM   8123  N NE  . ARG B 1 461 ? -9.148  18.630  72.915  1.00 38.47 ? 461 ARG B NE  1 
ATOM   8124  C CZ  . ARG B 1 461 ? -8.771  19.823  72.453  1.00 41.78 ? 461 ARG B CZ  1 
ATOM   8125  N NH1 . ARG B 1 461 ? -9.667  20.634  71.906  1.00 43.31 ? 461 ARG B NH1 1 
ATOM   8126  N NH2 . ARG B 1 461 ? -7.503  20.214  72.530  1.00 42.58 ? 461 ARG B NH2 1 
ATOM   8127  N N   . LEU B 1 462 ? -10.985 16.262  76.927  1.00 21.07 ? 462 LEU B N   1 
ATOM   8128  C CA  . LEU B 1 462 ? -9.785  16.179  77.738  1.00 19.81 ? 462 LEU B CA  1 
ATOM   8129  C C   . LEU B 1 462 ? -9.911  15.241  78.926  1.00 18.06 ? 462 LEU B C   1 
ATOM   8130  O O   . LEU B 1 462 ? -8.912  14.618  79.341  1.00 17.08 ? 462 LEU B O   1 
ATOM   8131  C CB  . LEU B 1 462 ? -9.465  17.581  78.244  1.00 20.19 ? 462 LEU B CB  1 
ATOM   8132  C CG  . LEU B 1 462 ? -8.142  17.869  78.938  1.00 23.44 ? 462 LEU B CG  1 
ATOM   8133  C CD1 . LEU B 1 462 ? -6.958  17.196  78.231  1.00 26.01 ? 462 LEU B CD1 1 
ATOM   8134  C CD2 . LEU B 1 462 ? -7.956  19.394  78.959  1.00 25.92 ? 462 LEU B CD2 1 
ATOM   8135  N N   . LEU B 1 463 ? -11.134 15.137  79.454  1.00 15.97 ? 463 LEU B N   1 
ATOM   8136  C CA  . LEU B 1 463 ? -11.395 14.422  80.704  1.00 15.47 ? 463 LEU B CA  1 
ATOM   8137  C C   . LEU B 1 463 ? -10.604 13.117  80.879  1.00 14.27 ? 463 LEU B C   1 
ATOM   8138  O O   . LEU B 1 463 ? -9.833  13.000  81.825  1.00 13.45 ? 463 LEU B O   1 
ATOM   8139  C CB  . LEU B 1 463 ? -12.911 14.200  80.911  1.00 15.10 ? 463 LEU B CB  1 
ATOM   8140  C CG  . LEU B 1 463 ? -13.322 13.514  82.222  1.00 14.78 ? 463 LEU B CG  1 
ATOM   8141  C CD1 . LEU B 1 463 ? -12.670 14.165  83.427  1.00 13.63 ? 463 LEU B CD1 1 
ATOM   8142  C CD2 . LEU B 1 463 ? -14.839 13.508  82.363  1.00 15.71 ? 463 LEU B CD2 1 
ATOM   8143  N N   . PRO B 1 464 ? -10.783 12.131  80.004  1.00 13.92 ? 464 PRO B N   1 
ATOM   8144  C CA  . PRO B 1 464 ? -10.109 10.843  80.212  1.00 13.67 ? 464 PRO B CA  1 
ATOM   8145  C C   . PRO B 1 464 ? -8.594  10.963  80.283  1.00 13.54 ? 464 PRO B C   1 
ATOM   8146  O O   . PRO B 1 464 ? -7.974  10.175  81.012  1.00 13.07 ? 464 PRO B O   1 
ATOM   8147  C CB  . PRO B 1 464 ? -10.525 10.017  78.992  1.00 13.76 ? 464 PRO B CB  1 
ATOM   8148  C CG  . PRO B 1 464 ? -11.031 10.984  78.015  1.00 13.60 ? 464 PRO B CG  1 
ATOM   8149  C CD  . PRO B 1 464 ? -11.618 12.110  78.793  1.00 14.14 ? 464 PRO B CD  1 
ATOM   8150  N N   . HIS B 1 465 ? -8.013  11.922  79.547  1.00 12.70 ? 465 HIS B N   1 
ATOM   8151  C CA  . HIS B 1 465 ? -6.556  12.104  79.546  1.00 13.32 ? 465 HIS B CA  1 
ATOM   8152  C C   . HIS B 1 465 ? -6.013  12.646  80.872  1.00 13.04 ? 465 HIS B C   1 
ATOM   8153  O O   . HIS B 1 465 ? -4.835  12.472  81.169  1.00 11.68 ? 465 HIS B O   1 
ATOM   8154  C CB  . HIS B 1 465 ? -6.115  13.009  78.386  1.00 12.98 ? 465 HIS B CB  1 
ATOM   8155  C CG  . HIS B 1 465 ? -6.488  12.478  77.040  1.00 12.45 ? 465 HIS B CG  1 
ATOM   8156  N ND1 . HIS B 1 465 ? -5.729  11.541  76.369  1.00 10.48 ? 465 HIS B ND1 1 
ATOM   8157  C CD2 . HIS B 1 465 ? -7.550  12.740  76.245  1.00 11.90 ? 465 HIS B CD2 1 
ATOM   8158  C CE1 . HIS B 1 465 ? -6.312  11.244  75.224  1.00 12.74 ? 465 HIS B CE1 1 
ATOM   8159  N NE2 . HIS B 1 465 ? -7.412  11.967  75.116  1.00 12.05 ? 465 HIS B NE2 1 
ATOM   8160  N N   . LYS B 1 466 ? -6.881  13.266  81.672  1.00 13.21 ? 466 LYS B N   1 
ATOM   8161  C CA  . LYS B 1 466 ? -6.490  13.861  82.960  1.00 13.77 ? 466 LYS B CA  1 
ATOM   8162  C C   . LYS B 1 466 ? -6.642  12.938  84.172  1.00 13.26 ? 466 LYS B C   1 
ATOM   8163  O O   . LYS B 1 466 ? -6.348  13.325  85.314  1.00 12.00 ? 466 LYS B O   1 
ATOM   8164  C CB  . LYS B 1 466 ? -7.361  15.078  83.237  1.00 14.12 ? 466 LYS B CB  1 
ATOM   8165  C CG  . LYS B 1 466 ? -7.277  16.149  82.197  1.00 17.19 ? 466 LYS B CG  1 
ATOM   8166  C CD  . LYS B 1 466 ? -5.957  16.838  82.279  1.00 21.06 ? 466 LYS B CD  1 
ATOM   8167  C CE  . LYS B 1 466 ? -6.037  18.242  81.757  1.00 22.64 ? 466 LYS B CE  1 
ATOM   8168  N NZ  . LYS B 1 466 ? -5.254  19.135  82.635  1.00 24.28 ? 466 LYS B NZ  1 
ATOM   8169  N N   . VAL B 1 467 ? -7.126  11.738  83.931  1.00 12.71 ? 467 VAL B N   1 
ATOM   8170  C CA  . VAL B 1 467 ? -7.376  10.801  85.002  1.00 12.58 ? 467 VAL B CA  1 
ATOM   8171  C C   . VAL B 1 467 ? -6.118  9.992   85.347  1.00 12.16 ? 467 VAL B C   1 
ATOM   8172  O O   . VAL B 1 467 ? -5.411  9.513   84.463  1.00 11.65 ? 467 VAL B O   1 
ATOM   8173  C CB  . VAL B 1 467 ? -8.518  9.859   84.608  1.00 12.98 ? 467 VAL B CB  1 
ATOM   8174  C CG1 . VAL B 1 467 ? -8.629  8.697   85.565  1.00 14.00 ? 467 VAL B CG1 1 
ATOM   8175  C CG2 . VAL B 1 467 ? -9.841  10.642  84.563  1.00 13.12 ? 467 VAL B CG2 1 
ATOM   8176  N N   . PHE B 1 468 ? -5.864  9.852   86.638  1.00 11.71 ? 468 PHE B N   1 
ATOM   8177  C CA  . PHE B 1 468 ? -4.759  9.045   87.131  1.00 11.14 ? 468 PHE B CA  1 
ATOM   8178  C C   . PHE B 1 468 ? -5.330  7.858   87.870  1.00 11.57 ? 468 PHE B C   1 
ATOM   8179  O O   . PHE B 1 468 ? -5.987  8.032   88.900  1.00 11.34 ? 468 PHE B O   1 
ATOM   8180  C CB  . PHE B 1 468 ? -3.867  9.852   88.087  1.00 11.55 ? 468 PHE B CB  1 
ATOM   8181  C CG  . PHE B 1 468 ? -3.030  10.880  87.408  1.00 11.04 ? 468 PHE B CG  1 
ATOM   8182  C CD1 . PHE B 1 468 ? -3.620  11.994  86.844  1.00 10.43 ? 468 PHE B CD1 1 
ATOM   8183  C CD2 . PHE B 1 468 ? -1.647  10.734  87.328  1.00 10.21 ? 468 PHE B CD2 1 
ATOM   8184  C CE1 . PHE B 1 468 ? -2.847  12.963  86.207  1.00 11.82 ? 468 PHE B CE1 1 
ATOM   8185  C CE2 . PHE B 1 468 ? -0.885  11.688  86.695  1.00 10.40 ? 468 PHE B CE2 1 
ATOM   8186  C CZ  . PHE B 1 468 ? -1.487  12.810  86.139  1.00 10.50 ? 468 PHE B CZ  1 
ATOM   8187  N N   . GLU B 1 469 ? -5.038  6.655   87.396  1.00 11.76 ? 469 GLU B N   1 
ATOM   8188  C CA  . GLU B 1 469 ? -5.582  5.466   88.037  1.00 12.96 ? 469 GLU B CA  1 
ATOM   8189  C C   . GLU B 1 469 ? -5.023  5.183   89.436  1.00 12.80 ? 469 GLU B C   1 
ATOM   8190  O O   . GLU B 1 469 ? -5.676  4.521   90.262  1.00 12.42 ? 469 GLU B O   1 
ATOM   8191  C CB  . GLU B 1 469 ? -5.448  4.264   87.101  1.00 13.27 ? 469 GLU B CB  1 
ATOM   8192  C CG  . GLU B 1 469 ? -6.292  4.446   85.842  1.00 15.49 ? 469 GLU B CG  1 
ATOM   8193  C CD  . GLU B 1 469 ? -6.446  3.188   84.985  1.00 18.49 ? 469 GLU B CD  1 
ATOM   8194  O OE1 . GLU B 1 469 ? -5.492  2.389   84.899  1.00 22.75 ? 469 GLU B OE1 1 
ATOM   8195  O OE2 . GLU B 1 469 ? -7.524  3.021   84.348  1.00 20.30 ? 469 GLU B OE2 1 
ATOM   8196  N N   . GLY B 1 470 ? -3.847  5.720   89.729  1.00 12.65 ? 470 GLY B N   1 
ATOM   8197  C CA  . GLY B 1 470 ? -3.221  5.515   91.014  1.00 12.66 ? 470 GLY B CA  1 
ATOM   8198  C C   . GLY B 1 470 ? -2.995  4.049   91.358  1.00 12.86 ? 470 GLY B C   1 
ATOM   8199  O O   . GLY B 1 470 ? -2.798  3.206   90.486  1.00 13.13 ? 470 GLY B O   1 
ATOM   8200  N N   . ASN B 1 471 ? -2.964  3.758   92.647  1.00 13.21 ? 471 ASN B N   1 
ATOM   8201  C CA  . ASN B 1 471 ? -2.731  2.391   93.136  1.00 13.70 ? 471 ASN B CA  1 
ATOM   8202  C C   . ASN B 1 471 ? -1.357  1.869   92.731  1.00 13.13 ? 471 ASN B C   1 
ATOM   8203  O O   . ASN B 1 471 ? -1.156  0.677   92.567  1.00 13.04 ? 471 ASN B O   1 
ATOM   8204  C CB  . ASN B 1 471 ? -3.849  1.442   92.665  1.00 14.53 ? 471 ASN B CB  1 
ATOM   8205  C CG  . ASN B 1 471 ? -4.143  0.340   93.672  1.00 15.88 ? 471 ASN B CG  1 
ATOM   8206  O OD1 . ASN B 1 471 ? -3.860  0.496   94.852  1.00 20.23 ? 471 ASN B OD1 1 
ATOM   8207  N ND2 . ASN B 1 471 ? -4.715  -0.787  93.203  1.00 17.76 ? 471 ASN B ND2 1 
ATOM   8208  N N   . ARG B 1 472 ? -0.406  2.781   92.554  1.00 12.72 ? 472 ARG B N   1 
ATOM   8209  C CA  . ARG B 1 472 ? 0.942   2.398   92.157  1.00 12.41 ? 472 ARG B CA  1 
ATOM   8210  C C   . ARG B 1 472 ? 1.852   2.401   93.392  1.00 12.04 ? 472 ARG B C   1 
ATOM   8211  O O   . ARG B 1 472 ? 2.085   3.420   93.996  1.00 13.00 ? 472 ARG B O   1 
ATOM   8212  C CB  . ARG B 1 472 ? 1.412   3.325   91.063  1.00 12.80 ? 472 ARG B CB  1 
ATOM   8213  C CG  . ARG B 1 472 ? 0.629   3.056   89.770  1.00 13.75 ? 472 ARG B CG  1 
ATOM   8214  C CD  . ARG B 1 472 ? 0.411   4.250   88.951  1.00 15.07 ? 472 ARG B CD  1 
ATOM   8215  N NE  . ARG B 1 472 ? 0.318   3.941   87.535  1.00 15.17 ? 472 ARG B NE  1 
ATOM   8216  C CZ  . ARG B 1 472 ? -0.759  3.479   86.910  1.00 17.35 ? 472 ARG B CZ  1 
ATOM   8217  N NH1 . ARG B 1 472 ? -0.703  3.255   85.598  1.00 16.93 ? 472 ARG B NH1 1 
ATOM   8218  N NH2 . ARG B 1 472 ? -1.893  3.251   87.563  1.00 17.66 ? 472 ARG B NH2 1 
ATOM   8219  N N   . PRO B 1 473 ? 2.347   1.236   93.776  1.00 11.90 ? 473 PRO B N   1 
ATOM   8220  C CA  . PRO B 1 473 ? 3.038   1.081   95.062  1.00 11.56 ? 473 PRO B CA  1 
ATOM   8221  C C   . PRO B 1 473 ? 4.498   1.508   95.096  1.00 10.94 ? 473 PRO B C   1 
ATOM   8222  O O   . PRO B 1 473 ? 5.228   1.383   94.108  1.00 11.30 ? 473 PRO B O   1 
ATOM   8223  C CB  . PRO B 1 473 ? 2.936   -0.419  95.277  1.00 12.30 ? 473 PRO B CB  1 
ATOM   8224  C CG  . PRO B 1 473 ? 3.151   -0.921  93.918  1.00 11.35 ? 473 PRO B CG  1 
ATOM   8225  C CD  . PRO B 1 473 ? 2.269   -0.044  93.064  1.00 11.86 ? 473 PRO B CD  1 
ATOM   8226  N N   . THR B 1 474 ? 4.910   2.024   96.250  1.00 10.22 ? 474 THR B N   1 
ATOM   8227  C CA  . THR B 1 474 ? 6.277   2.470   96.454  1.00 9.10  ? 474 THR B CA  1 
ATOM   8228  C C   . THR B 1 474 ? 6.741   2.194   97.865  1.00 8.48  ? 474 THR B C   1 
ATOM   8229  O O   . THR B 1 474 ? 5.932   2.056   98.771  1.00 8.34  ? 474 THR B O   1 
ATOM   8230  C CB  . THR B 1 474 ? 6.370   4.012   96.297  1.00 8.86  ? 474 THR B CB  1 
ATOM   8231  O OG1 . THR B 1 474 ? 5.432   4.651   97.177  1.00 9.21  ? 474 THR B OG1 1 
ATOM   8232  C CG2 . THR B 1 474 ? 5.971   4.477   94.930  1.00 8.06  ? 474 THR B CG2 1 
ATOM   8233  N N   . ASN B 1 475 ? 8.055   2.176   98.015  1.00 7.94  ? 475 ASN B N   1 
ATOM   8234  C CA  . ASN B 1 475 ? 8.736   2.256   99.300  1.00 7.91  ? 475 ASN B CA  1 
ATOM   8235  C C   . ASN B 1 475 ? 9.309   3.675   99.394  1.00 7.32  ? 475 ASN B C   1 
ATOM   8236  O O   . ASN B 1 475 ? 9.779   4.224   98.382  1.00 6.01  ? 475 ASN B O   1 
ATOM   8237  C CB  . ASN B 1 475 ? 9.915   1.283   99.377  1.00 7.12  ? 475 ASN B CB  1 
ATOM   8238  C CG  . ASN B 1 475 ? 9.482   -0.176  99.476  1.00 8.60  ? 475 ASN B CG  1 
ATOM   8239  O OD1 . ASN B 1 475 ? 10.083  -1.063  98.836  1.00 10.80 ? 475 ASN B OD1 1 
ATOM   8240  N ND2 . ASN B 1 475 ? 8.451   -0.436  100.270 1.00 6.16  ? 475 ASN B ND2 1 
ATOM   8241  N N   . SER B 1 476 ? 9.285   4.240   100.601 1.00 7.57  ? 476 SER B N   1 
ATOM   8242  C CA  . SER B 1 476 ? 9.946   5.497   100.887 1.00 7.16  ? 476 SER B CA  1 
ATOM   8243  C C   . SER B 1 476 ? 10.953  5.225   101.979 1.00 7.45  ? 476 SER B C   1 
ATOM   8244  O O   . SER B 1 476 ? 10.593  4.785   103.077 1.00 7.97  ? 476 SER B O   1 
ATOM   8245  C CB  . SER B 1 476 ? 8.975   6.599   101.286 1.00 6.82  ? 476 SER B CB  1 
ATOM   8246  O OG  . SER B 1 476 ? 8.318   7.132   100.155 1.00 8.86  ? 476 SER B OG  1 
ATOM   8247  N N   . ILE B 1 477 ? 12.228  5.416   101.642 1.00 7.47  ? 477 ILE B N   1 
ATOM   8248  C CA  . ILE B 1 477 ? 13.324  5.206   102.562 1.00 7.82  ? 477 ILE B CA  1 
ATOM   8249  C C   . ILE B 1 477 ? 13.971  6.570   102.826 1.00 8.26  ? 477 ILE B C   1 
ATOM   8250  O O   . ILE B 1 477 ? 14.592  7.157   101.949 1.00 8.20  ? 477 ILE B O   1 
ATOM   8251  C CB  . ILE B 1 477 ? 14.333  4.198   101.996 1.00 8.20  ? 477 ILE B CB  1 
ATOM   8252  C CG1 . ILE B 1 477 ? 13.647  2.843   101.739 1.00 8.74  ? 477 ILE B CG1 1 
ATOM   8253  C CG2 . ILE B 1 477 ? 15.527  4.050   102.922 1.00 8.03  ? 477 ILE B CG2 1 
ATOM   8254  C CD1 . ILE B 1 477 ? 14.442  1.946   100.844 1.00 10.56 ? 477 ILE B CD1 1 
ATOM   8255  N N   . VAL B 1 478 ? 13.787  7.054   104.042 1.00 8.21  ? 478 VAL B N   1 
ATOM   8256  C CA  . VAL B 1 478 ? 14.284  8.340   104.452 1.00 8.64  ? 478 VAL B CA  1 
ATOM   8257  C C   . VAL B 1 478 ? 15.321  8.153   105.549 1.00 9.35  ? 478 VAL B C   1 
ATOM   8258  O O   . VAL B 1 478 ? 15.117  7.342   106.474 1.00 9.22  ? 478 VAL B O   1 
ATOM   8259  C CB  . VAL B 1 478 ? 13.142  9.222   104.940 1.00 8.81  ? 478 VAL B CB  1 
ATOM   8260  C CG1 . VAL B 1 478 ? 13.667  10.632  105.247 1.00 10.05 ? 478 VAL B CG1 1 
ATOM   8261  C CG2 . VAL B 1 478 ? 12.035  9.274   103.922 1.00 8.26  ? 478 VAL B CG2 1 
ATOM   8262  N N   . PHE B 1 479 ? 16.441  8.867   105.432 1.00 8.67  ? 479 PHE B N   1 
ATOM   8263  C CA  . PHE B 1 479 ? 17.556  8.718   106.380 1.00 8.56  ? 479 PHE B CA  1 
ATOM   8264  C C   . PHE B 1 479 ? 18.064  10.101  106.756 1.00 9.16  ? 479 PHE B C   1 
ATOM   8265  O O   . PHE B 1 479 ? 17.883  11.077  106.012 1.00 7.19  ? 479 PHE B O   1 
ATOM   8266  C CB  . PHE B 1 479 ? 18.696  7.845   105.832 1.00 9.27  ? 479 PHE B CB  1 
ATOM   8267  C CG  . PHE B 1 479 ? 18.948  8.034   104.360 1.00 8.07  ? 479 PHE B CG  1 
ATOM   8268  C CD1 . PHE B 1 479 ? 19.931  8.896   103.908 1.00 10.30 ? 479 PHE B CD1 1 
ATOM   8269  C CD2 . PHE B 1 479 ? 18.172  7.363   103.422 1.00 10.92 ? 479 PHE B CD2 1 
ATOM   8270  C CE1 . PHE B 1 479 ? 20.117  9.082   102.535 1.00 9.50  ? 479 PHE B CE1 1 
ATOM   8271  C CE2 . PHE B 1 479 ? 18.368  7.550   102.077 1.00 9.39  ? 479 PHE B CE2 1 
ATOM   8272  C CZ  . PHE B 1 479 ? 19.341  8.399   101.636 1.00 7.95  ? 479 PHE B CZ  1 
ATOM   8273  N N   . THR B 1 480 ? 18.716  10.192  107.908 1.00 8.48  ? 480 THR B N   1 
ATOM   8274  C CA  . THR B 1 480 ? 19.043  11.508  108.417 1.00 8.81  ? 480 THR B CA  1 
ATOM   8275  C C   . THR B 1 480 ? 19.941  12.340  107.506 1.00 8.16  ? 480 THR B C   1 
ATOM   8276  O O   . THR B 1 480 ? 19.622  13.497  107.196 1.00 8.14  ? 480 THR B O   1 
ATOM   8277  C CB  . THR B 1 480 ? 19.648  11.381  109.796 1.00 8.24  ? 480 THR B CB  1 
ATOM   8278  O OG1 . THR B 1 480 ? 18.714  10.695  110.645 1.00 9.46  ? 480 THR B OG1 1 
ATOM   8279  C CG2 . THR B 1 480 ? 19.833  12.763  110.429 1.00 10.17 ? 480 THR B CG2 1 
ATOM   8280  N N   . LYS B 1 481 ? 21.053  11.761  107.095 1.00 9.01  ? 481 LYS B N   1 
ATOM   8281  C CA  . LYS B 1 481 ? 22.028  12.461  106.263 1.00 9.22  ? 481 LYS B CA  1 
ATOM   8282  C C   . LYS B 1 481 ? 22.882  11.436  105.543 1.00 9.39  ? 481 LYS B C   1 
ATOM   8283  O O   . LYS B 1 481 ? 23.196  10.384  106.100 1.00 8.65  ? 481 LYS B O   1 
ATOM   8284  C CB  . LYS B 1 481 ? 22.909  13.363  107.128 1.00 9.69  ? 481 LYS B CB  1 
ATOM   8285  C CG  . LYS B 1 481 ? 23.788  14.341  106.349 1.00 10.98 ? 481 LYS B CG  1 
ATOM   8286  C CD  . LYS B 1 481 ? 24.424  15.390  107.264 1.00 13.14 ? 481 LYS B CD  1 
ATOM   8287  C CE  . LYS B 1 481 ? 25.344  16.330  106.500 1.00 15.08 ? 481 LYS B CE  1 
ATOM   8288  N NZ  . LYS B 1 481 ? 25.792  17.482  107.321 1.00 12.00 ? 481 LYS B NZ  1 
ATOM   8289  N N   . LEU B 1 482 ? 23.253  11.728  104.302 1.00 8.94  ? 482 LEU B N   1 
ATOM   8290  C CA  . LEU B 1 482 ? 24.084  10.792  103.556 1.00 9.37  ? 482 LEU B CA  1 
ATOM   8291  C C   . LEU B 1 482 ? 25.558  11.006  103.899 1.00 9.17  ? 482 LEU B C   1 
ATOM   8292  O O   . LEU B 1 482 ? 26.298  11.701  103.200 1.00 8.10  ? 482 LEU B O   1 
ATOM   8293  C CB  . LEU B 1 482 ? 23.831  10.923  102.055 1.00 9.65  ? 482 LEU B CB  1 
ATOM   8294  C CG  . LEU B 1 482 ? 24.453  9.823   101.187 1.00 11.02 ? 482 LEU B CG  1 
ATOM   8295  C CD1 . LEU B 1 482 ? 23.869  8.460   101.528 1.00 9.83  ? 482 LEU B CD1 1 
ATOM   8296  C CD2 . LEU B 1 482 ? 24.273  10.143  99.712  1.00 11.72 ? 482 LEU B CD2 1 
ATOM   8297  N N   . THR B 1 483 ? 25.957  10.434  105.025 1.00 9.25  ? 483 THR B N   1 
ATOM   8298  C CA  . THR B 1 483 ? 27.327  10.451  105.471 1.00 9.30  ? 483 THR B CA  1 
ATOM   8299  C C   . THR B 1 483 ? 27.972  9.134   104.993 1.00 8.88  ? 483 THR B C   1 
ATOM   8300  O O   . THR B 1 483 ? 27.267  8.239   104.484 1.00 7.99  ? 483 THR B O   1 
ATOM   8301  C CB  . THR B 1 483 ? 27.352  10.480  106.993 1.00 9.68  ? 483 THR B CB  1 
ATOM   8302  O OG1 . THR B 1 483 ? 26.584  9.380   107.478 1.00 7.78  ? 483 THR B OG1 1 
ATOM   8303  C CG2 . THR B 1 483 ? 26.652  11.725  107.551 1.00 10.36 ? 483 THR B CG2 1 
ATOM   8304  N N   . PRO B 1 484 ? 29.299  9.013   105.109 1.00 8.95  ? 484 PRO B N   1 
ATOM   8305  C CA  . PRO B 1 484 ? 29.965  7.750   104.778 1.00 8.97  ? 484 PRO B CA  1 
ATOM   8306  C C   . PRO B 1 484 ? 29.352  6.557   105.523 1.00 8.69  ? 484 PRO B C   1 
ATOM   8307  O O   . PRO B 1 484 ? 29.080  5.535   104.917 1.00 7.57  ? 484 PRO B O   1 
ATOM   8308  C CB  . PRO B 1 484 ? 31.428  8.001   105.177 1.00 9.04  ? 484 PRO B CB  1 
ATOM   8309  C CG  . PRO B 1 484 ? 31.593  9.464   105.086 1.00 8.95  ? 484 PRO B CG  1 
ATOM   8310  C CD  . PRO B 1 484 ? 30.270  10.063  105.452 1.00 8.86  ? 484 PRO B CD  1 
ATOM   8311  N N   . PHE B 1 485 ? 29.110  6.699   106.815 1.00 8.50  ? 485 PHE B N   1 
ATOM   8312  C CA  . PHE B 1 485 ? 28.510  5.620   107.588 1.00 9.43  ? 485 PHE B CA  1 
ATOM   8313  C C   . PHE B 1 485 ? 27.113  5.294   107.063 1.00 9.28  ? 485 PHE B C   1 
ATOM   8314  O O   . PHE B 1 485 ? 26.776  4.123   106.890 1.00 10.18 ? 485 PHE B O   1 
ATOM   8315  C CB  . PHE B 1 485 ? 28.453  5.994   109.074 1.00 9.43  ? 485 PHE B CB  1 
ATOM   8316  C CG  . PHE B 1 485 ? 27.788  4.964   109.957 1.00 10.71 ? 485 PHE B CG  1 
ATOM   8317  C CD1 . PHE B 1 485 ? 28.534  4.204   110.839 1.00 11.30 ? 485 PHE B CD1 1 
ATOM   8318  C CD2 . PHE B 1 485 ? 26.413  4.806   109.948 1.00 11.25 ? 485 PHE B CD2 1 
ATOM   8319  C CE1 . PHE B 1 485 ? 27.931  3.280   111.651 1.00 11.93 ? 485 PHE B CE1 1 
ATOM   8320  C CE2 . PHE B 1 485 ? 25.810  3.903   110.772 1.00 11.43 ? 485 PHE B CE2 1 
ATOM   8321  C CZ  . PHE B 1 485 ? 26.567  3.137   111.625 1.00 12.03 ? 485 PHE B CZ  1 
ATOM   8322  N N   . MET B 1 486 ? 26.285  6.302   106.802 1.00 8.79  ? 486 MET B N   1 
ATOM   8323  C CA  . MET B 1 486 ? 24.925  6.003   106.346 1.00 8.89  ? 486 MET B CA  1 
ATOM   8324  C C   . MET B 1 486 ? 24.931  5.344   104.958 1.00 8.48  ? 486 MET B C   1 
ATOM   8325  O O   . MET B 1 486 ? 24.141  4.436   104.702 1.00 9.58  ? 486 MET B O   1 
ATOM   8326  C CB  . MET B 1 486 ? 24.050  7.246   106.355 1.00 8.15  ? 486 MET B CB  1 
ATOM   8327  C CG  . MET B 1 486 ? 22.618  7.008   105.921 1.00 9.19  ? 486 MET B CG  1 
ATOM   8328  S SD  . MET B 1 486 ? 21.726  5.789   106.938 1.00 10.40 ? 486 MET B SD  1 
ATOM   8329  C CE  . MET B 1 486 ? 21.579  6.712   108.455 1.00 9.84  ? 486 MET B CE  1 
ATOM   8330  N N   . LEU B 1 487 ? 25.815  5.780   104.065 1.00 8.38  ? 487 LEU B N   1 
ATOM   8331  C CA  . LEU B 1 487 ? 25.910  5.136   102.752 1.00 8.72  ? 487 LEU B CA  1 
ATOM   8332  C C   . LEU B 1 487 ? 26.284  3.656   102.916 1.00 8.17  ? 487 LEU B C   1 
ATOM   8333  O O   . LEU B 1 487 ? 25.724  2.783   102.276 1.00 8.22  ? 487 LEU B O   1 
ATOM   8334  C CB  . LEU B 1 487 ? 26.941  5.840   101.865 1.00 8.51  ? 487 LEU B CB  1 
ATOM   8335  C CG  . LEU B 1 487 ? 27.167  5.244   100.498 1.00 8.80  ? 487 LEU B CG  1 
ATOM   8336  C CD1 . LEU B 1 487 ? 25.894  5.261   99.656  1.00 8.63  ? 487 LEU B CD1 1 
ATOM   8337  C CD2 . LEU B 1 487 ? 28.276  5.971   99.779  1.00 10.17 ? 487 LEU B CD2 1 
ATOM   8338  N N   . GLY B 1 488 ? 27.233  3.373   103.791 1.00 8.75  ? 488 GLY B N   1 
ATOM   8339  C CA  . GLY B 1 488 ? 27.613  2.006   104.044 1.00 8.53  ? 488 GLY B CA  1 
ATOM   8340  C C   . GLY B 1 488 ? 26.428  1.156   104.468 1.00 8.18  ? 488 GLY B C   1 
ATOM   8341  O O   . GLY B 1 488 ? 26.237  0.028   103.988 1.00 7.71  ? 488 GLY B O   1 
ATOM   8342  N N   . ALA B 1 489 ? 25.618  1.716   105.364 1.00 8.15  ? 489 ALA B N   1 
ATOM   8343  C CA  . ALA B 1 489 ? 24.460  1.020   105.871 1.00 7.61  ? 489 ALA B CA  1 
ATOM   8344  C C   . ALA B 1 489 ? 23.457  0.755   104.751 1.00 7.74  ? 489 ALA B C   1 
ATOM   8345  O O   . ALA B 1 489 ? 22.935  -0.347  104.640 1.00 6.94  ? 489 ALA B O   1 
ATOM   8346  C CB  . ALA B 1 489 ? 23.807  1.817   106.991 1.00 7.69  ? 489 ALA B CB  1 
ATOM   8347  N N   . LEU B 1 490 ? 23.206  1.766   103.923 1.00 7.44  ? 490 LEU B N   1 
ATOM   8348  C CA  . LEU B 1 490 ? 22.253  1.642   102.839 1.00 7.75  ? 490 LEU B CA  1 
ATOM   8349  C C   . LEU B 1 490 ? 22.693  0.621   101.790 1.00 7.79  ? 490 LEU B C   1 
ATOM   8350  O O   . LEU B 1 490 ? 21.874  -0.183  101.308 1.00 9.11  ? 490 LEU B O   1 
ATOM   8351  C CB  . LEU B 1 490 ? 22.028  3.006   102.194 1.00 8.40  ? 490 LEU B CB  1 
ATOM   8352  C CG  . LEU B 1 490 ? 21.364  4.044   103.086 1.00 8.27  ? 490 LEU B CG  1 
ATOM   8353  C CD1 . LEU B 1 490 ? 21.361  5.433   102.446 1.00 9.33  ? 490 LEU B CD1 1 
ATOM   8354  C CD2 . LEU B 1 490 ? 19.970  3.623   103.388 1.00 10.06 ? 490 LEU B CD2 1 
ATOM   8355  N N   . VAL B 1 491 ? 23.968  0.636   101.431 1.00 7.56  ? 491 VAL B N   1 
ATOM   8356  C CA  . VAL B 1 491 ? 24.448  -0.321  100.429 1.00 8.76  ? 491 VAL B CA  1 
ATOM   8357  C C   . VAL B 1 491 ? 24.324  -1.740  100.991 1.00 9.08  ? 491 VAL B C   1 
ATOM   8358  O O   . VAL B 1 491 ? 23.801  -2.636  100.330 1.00 8.90  ? 491 VAL B O   1 
ATOM   8359  C CB  . VAL B 1 491 ? 25.874  -0.034  99.977  1.00 8.53  ? 491 VAL B CB  1 
ATOM   8360  C CG1 . VAL B 1 491 ? 26.364  -1.097  98.988  1.00 10.56 ? 491 VAL B CG1 1 
ATOM   8361  C CG2 . VAL B 1 491 ? 25.951  1.298   99.321  1.00 9.42  ? 491 VAL B CG2 1 
ATOM   8362  N N   . ALA B 1 492 ? 24.796  -1.938  102.213 1.00 9.29  ? 492 ALA B N   1 
ATOM   8363  C CA  . ALA B 1 492 ? 24.688  -3.248  102.849 1.00 9.28  ? 492 ALA B CA  1 
ATOM   8364  C C   . ALA B 1 492 ? 23.239  -3.722  102.945 1.00 8.92  ? 492 ALA B C   1 
ATOM   8365  O O   . ALA B 1 492 ? 22.959  -4.924  102.795 1.00 8.86  ? 492 ALA B O   1 
ATOM   8366  C CB  . ALA B 1 492 ? 25.332  -3.230  104.233 1.00 9.30  ? 492 ALA B CB  1 
ATOM   8367  N N   . MET B 1 493 ? 22.317  -2.796  103.190 1.00 8.30  ? 493 MET B N   1 
ATOM   8368  C CA  . MET B 1 493 ? 20.910  -3.144  103.297 1.00 8.55  ? 493 MET B CA  1 
ATOM   8369  C C   . MET B 1 493 ? 20.444  -3.801  102.009 1.00 8.65  ? 493 MET B C   1 
ATOM   8370  O O   . MET B 1 493 ? 19.797  -4.850  102.048 1.00 6.83  ? 493 MET B O   1 
ATOM   8371  C CB  . MET B 1 493 ? 20.050  -1.919  103.614 1.00 8.48  ? 493 MET B CB  1 
ATOM   8372  C CG  . MET B 1 493 ? 18.573  -2.228  103.873 1.00 9.17  ? 493 MET B CG  1 
ATOM   8373  S SD  . MET B 1 493 ? 17.596  -0.721  104.236 1.00 9.96  ? 493 MET B SD  1 
ATOM   8374  C CE  . MET B 1 493 ? 17.800  0.176   102.747 1.00 11.94 ? 493 MET B CE  1 
ATOM   8375  N N   . TYR B 1 494 ? 20.811  -3.214  100.866 1.00 8.67  ? 494 TYR B N   1 
ATOM   8376  C CA  . TYR B 1 494 ? 20.432  -3.797  99.582  1.00 8.60  ? 494 TYR B CA  1 
ATOM   8377  C C   . TYR B 1 494 ? 21.167  -5.106  99.284  1.00 8.63  ? 494 TYR B C   1 
ATOM   8378  O O   . TYR B 1 494 ? 20.585  -6.032  98.723  1.00 7.30  ? 494 TYR B O   1 
ATOM   8379  C CB  . TYR B 1 494 ? 20.569  -2.784  98.448  1.00 9.40  ? 494 TYR B CB  1 
ATOM   8380  C CG  . TYR B 1 494 ? 19.386  -1.850  98.359  1.00 9.00  ? 494 TYR B CG  1 
ATOM   8381  C CD1 . TYR B 1 494 ? 19.420  -0.592  98.962  1.00 8.22  ? 494 TYR B CD1 1 
ATOM   8382  C CD2 . TYR B 1 494 ? 18.238  -2.214  97.667  1.00 10.34 ? 494 TYR B CD2 1 
ATOM   8383  C CE1 . TYR B 1 494 ? 18.338  0.268   98.878  1.00 8.00  ? 494 TYR B CE1 1 
ATOM   8384  C CE2 . TYR B 1 494 ? 17.145  -1.367  97.593  1.00 10.11 ? 494 TYR B CE2 1 
ATOM   8385  C CZ  . TYR B 1 494 ? 17.209  -0.119  98.199  1.00 8.03  ? 494 TYR B CZ  1 
ATOM   8386  O OH  . TYR B 1 494 ? 16.138  0.745   98.117  1.00 9.80  ? 494 TYR B OH  1 
ATOM   8387  N N   . GLU B 1 495 ? 22.428  -5.209  99.689  1.00 9.08  ? 495 GLU B N   1 
ATOM   8388  C CA  . GLU B 1 495 ? 23.140  -6.467  99.529  1.00 9.08  ? 495 GLU B CA  1 
ATOM   8389  C C   . GLU B 1 495 ? 22.348  -7.597  100.222 1.00 9.22  ? 495 GLU B C   1 
ATOM   8390  O O   . GLU B 1 495 ? 22.180  -8.690  99.675  1.00 8.37  ? 495 GLU B O   1 
ATOM   8391  C CB  . GLU B 1 495 ? 24.546  -6.378  100.127 1.00 9.20  ? 495 GLU B CB  1 
ATOM   8392  C CG  . GLU B 1 495 ? 25.473  -5.408  99.406  1.00 9.01  ? 495 GLU B CG  1 
ATOM   8393  C CD  . GLU B 1 495 ? 26.890  -5.357  99.945  1.00 9.20  ? 495 GLU B CD  1 
ATOM   8394  O OE1 . GLU B 1 495 ? 27.092  -5.535  101.170 1.00 8.45  ? 495 GLU B OE1 1 
ATOM   8395  O OE2 . GLU B 1 495 ? 27.818  -5.090  99.122  1.00 7.36  ? 495 GLU B OE2 1 
ATOM   8396  N N   . HIS B 1 496 ? 21.872  -7.342  101.439 1.00 8.63  ? 496 HIS B N   1 
ATOM   8397  C CA  . HIS B 1 496 ? 21.160  -8.376  102.176 1.00 8.79  ? 496 HIS B CA  1 
ATOM   8398  C C   . HIS B 1 496 ? 19.753  -8.623  101.608 1.00 8.84  ? 496 HIS B C   1 
ATOM   8399  O O   . HIS B 1 496 ? 19.242  -9.732  101.684 1.00 9.03  ? 496 HIS B O   1 
ATOM   8400  C CB  . HIS B 1 496 ? 21.206  -8.093  103.692 1.00 8.74  ? 496 HIS B CB  1 
ATOM   8401  C CG  . HIS B 1 496 ? 22.585  -8.196  104.257 1.00 7.93  ? 496 HIS B CG  1 
ATOM   8402  N ND1 . HIS B 1 496 ? 23.501  -9.117  103.798 1.00 10.27 ? 496 HIS B ND1 1 
ATOM   8403  C CD2 . HIS B 1 496 ? 23.232  -7.457  105.189 1.00 10.28 ? 496 HIS B CD2 1 
ATOM   8404  C CE1 . HIS B 1 496 ? 24.646  -8.952  104.436 1.00 10.17 ? 496 HIS B CE1 1 
ATOM   8405  N NE2 . HIS B 1 496 ? 24.507  -7.955  105.293 1.00 10.64 ? 496 HIS B NE2 1 
ATOM   8406  N N   . LYS B 1 497 ? 19.130  -7.615  101.002 1.00 8.85  ? 497 LYS B N   1 
ATOM   8407  C CA  . LYS B 1 497 ? 17.845  -7.817  100.320 1.00 8.50  ? 497 LYS B CA  1 
ATOM   8408  C C   . LYS B 1 497 ? 18.039  -8.849  99.213  1.00 8.53  ? 497 LYS B C   1 
ATOM   8409  O O   . LYS B 1 497 ? 17.277  -9.823  99.091  1.00 9.18  ? 497 LYS B O   1 
ATOM   8410  C CB  . LYS B 1 497 ? 17.349  -6.493  99.695  1.00 8.25  ? 497 LYS B CB  1 
ATOM   8411  C CG  . LYS B 1 497 ? 16.192  -6.670  98.707  1.00 9.13  ? 497 LYS B CG  1 
ATOM   8412  C CD  . LYS B 1 497 ? 15.969  -5.459  97.805  1.00 9.23  ? 497 LYS B CD  1 
ATOM   8413  C CE  . LYS B 1 497 ? 14.836  -5.727  96.817  1.00 10.57 ? 497 LYS B CE  1 
ATOM   8414  N NZ  . LYS B 1 497 ? 14.587  -4.645  95.815  1.00 8.63  ? 497 LYS B NZ  1 
ATOM   8415  N N   . ILE B 1 498 ? 19.073  -8.612  98.410  1.00 7.96  ? 498 ILE B N   1 
ATOM   8416  C CA  . ILE B 1 498 ? 19.417  -9.426  97.263  1.00 8.10  ? 498 ILE B CA  1 
ATOM   8417  C C   . ILE B 1 498 ? 19.684  -10.880 97.733  1.00 9.06  ? 498 ILE B C   1 
ATOM   8418  O O   . ILE B 1 498 ? 19.218  -11.854 97.128  1.00 9.21  ? 498 ILE B O   1 
ATOM   8419  C CB  . ILE B 1 498 ? 20.619  -8.786  96.562  1.00 8.54  ? 498 ILE B CB  1 
ATOM   8420  C CG1 . ILE B 1 498 ? 20.175  -7.452  95.912  1.00 7.94  ? 498 ILE B CG1 1 
ATOM   8421  C CG2 . ILE B 1 498 ? 21.209  -9.708  95.506  1.00 7.59  ? 498 ILE B CG2 1 
ATOM   8422  C CD1 . ILE B 1 498 ? 21.266  -6.496  95.605  1.00 9.85  ? 498 ILE B CD1 1 
ATOM   8423  N N   . PHE B 1 499 ? 20.405  -10.999 98.830  1.00 9.33  ? 499 PHE B N   1 
ATOM   8424  C CA  . PHE B 1 499 ? 20.700  -12.308 99.429  1.00 9.78  ? 499 PHE B CA  1 
ATOM   8425  C C   . PHE B 1 499 ? 19.444  -13.061 99.799  1.00 9.69  ? 499 PHE B C   1 
ATOM   8426  O O   . PHE B 1 499 ? 19.305  -14.249 99.463  1.00 9.30  ? 499 PHE B O   1 
ATOM   8427  C CB  . PHE B 1 499 ? 21.598  -12.138 100.647 1.00 10.08 ? 499 PHE B CB  1 
ATOM   8428  C CG  . PHE B 1 499 ? 21.764  -13.388 101.463 1.00 11.15 ? 499 PHE B CG  1 
ATOM   8429  C CD1 . PHE B 1 499 ? 22.709  -14.332 101.107 1.00 12.78 ? 499 PHE B CD1 1 
ATOM   8430  C CD2 . PHE B 1 499 ? 20.951  -13.635 102.569 1.00 12.15 ? 499 PHE B CD2 1 
ATOM   8431  C CE1 . PHE B 1 499 ? 22.857  -15.514 101.837 1.00 12.33 ? 499 PHE B CE1 1 
ATOM   8432  C CE2 . PHE B 1 499 ? 21.097  -14.821 103.322 1.00 13.36 ? 499 PHE B CE2 1 
ATOM   8433  C CZ  . PHE B 1 499 ? 22.059  -15.749 102.951 1.00 13.07 ? 499 PHE B CZ  1 
ATOM   8434  N N   . VAL B 1 500 ? 18.531  -12.391 100.507 1.00 8.82  ? 500 VAL B N   1 
ATOM   8435  C CA  . VAL B 1 500 ? 17.279  -13.020 100.932 1.00 9.41  ? 500 VAL B CA  1 
ATOM   8436  C C   . VAL B 1 500 ? 16.460  -13.483 99.725  1.00 9.45  ? 500 VAL B C   1 
ATOM   8437  O O   . VAL B 1 500 ? 15.910  -14.588 99.709  1.00 9.02  ? 500 VAL B O   1 
ATOM   8438  C CB  . VAL B 1 500 ? 16.460  -12.051 101.791 1.00 8.79  ? 500 VAL B CB  1 
ATOM   8439  C CG1 . VAL B 1 500 ? 15.096  -12.584 102.082 1.00 9.75  ? 500 VAL B CG1 1 
ATOM   8440  C CG2 . VAL B 1 500 ? 17.206  -11.777 103.083 1.00 10.18 ? 500 VAL B CG2 1 
ATOM   8441  N N   . GLN B 1 501 ? 16.406  -12.649 98.693  1.00 9.49  ? 501 GLN B N   1 
ATOM   8442  C CA  . GLN B 1 501 ? 15.657  -13.018 97.496  1.00 9.89  ? 501 GLN B CA  1 
ATOM   8443  C C   . GLN B 1 501 ? 16.226  -14.278 96.845  1.00 9.96  ? 501 GLN B C   1 
ATOM   8444  O O   . GLN B 1 501 ? 15.475  -15.198 96.472  1.00 11.00 ? 501 GLN B O   1 
ATOM   8445  C CB  . GLN B 1 501 ? 15.557  -11.830 96.516  1.00 9.30  ? 501 GLN B CB  1 
ATOM   8446  C CG  . GLN B 1 501 ? 14.629  -10.730 97.040  1.00 8.66  ? 501 GLN B CG  1 
ATOM   8447  C CD  . GLN B 1 501 ? 14.401  -9.574  96.062  1.00 8.53  ? 501 GLN B CD  1 
ATOM   8448  O OE1 . GLN B 1 501 ? 15.289  -9.210  95.280  1.00 8.22  ? 501 GLN B OE1 1 
ATOM   8449  N NE2 . GLN B 1 501 ? 13.183  -9.031  96.076  1.00 9.54  ? 501 GLN B NE2 1 
ATOM   8450  N N   . GLY B 1 502 ? 17.547  -14.334 96.723  1.00 10.81 ? 502 GLY B N   1 
ATOM   8451  C CA  . GLY B 1 502 ? 18.209  -15.495 96.162  1.00 10.72 ? 502 GLY B CA  1 
ATOM   8452  C C   . GLY B 1 502 ? 17.942  -16.775 96.952  1.00 11.20 ? 502 GLY B C   1 
ATOM   8453  O O   . GLY B 1 502 ? 17.784  -17.861 96.359  1.00 10.76 ? 502 GLY B O   1 
ATOM   8454  N N   . ILE B 1 503 ? 17.863  -16.662 98.278  1.00 10.82 ? 503 ILE B N   1 
ATOM   8455  C CA  . ILE B 1 503 ? 17.645  -17.839 99.101  1.00 11.91 ? 503 ILE B CA  1 
ATOM   8456  C C   . ILE B 1 503 ? 16.232  -18.324 98.823  1.00 11.43 ? 503 ILE B C   1 
ATOM   8457  O O   . ILE B 1 503 ? 16.010  -19.506 98.668  1.00 11.16 ? 503 ILE B O   1 
ATOM   8458  C CB  . ILE B 1 503 ? 17.839  -17.561 100.625 1.00 11.96 ? 503 ILE B CB  1 
ATOM   8459  C CG1 . ILE B 1 503 ? 19.287  -17.205 100.959 1.00 12.95 ? 503 ILE B CG1 1 
ATOM   8460  C CG2 . ILE B 1 503 ? 17.399  -18.785 101.448 1.00 13.74 ? 503 ILE B CG2 1 
ATOM   8461  C CD1 . ILE B 1 503 ? 20.331  -18.197 100.428 1.00 14.74 ? 503 ILE B CD1 1 
ATOM   8462  N N   . ILE B 1 504 ? 15.288  -17.396 98.730  1.00 11.58 ? 504 ILE B N   1 
ATOM   8463  C CA  . ILE B 1 504 ? 13.895  -17.733 98.490  1.00 11.85 ? 504 ILE B CA  1 
ATOM   8464  C C   . ILE B 1 504 ? 13.694  -18.394 97.121  1.00 12.03 ? 504 ILE B C   1 
ATOM   8465  O O   . ILE B 1 504 ? 12.927  -19.351 96.995  1.00 11.69 ? 504 ILE B O   1 
ATOM   8466  C CB  . ILE B 1 504 ? 13.020  -16.503 98.650  1.00 12.11 ? 504 ILE B CB  1 
ATOM   8467  C CG1 . ILE B 1 504 ? 12.908  -16.169 100.138 1.00 12.35 ? 504 ILE B CG1 1 
ATOM   8468  C CG2 . ILE B 1 504 ? 11.638  -16.748 98.069  1.00 12.87 ? 504 ILE B CG2 1 
ATOM   8469  C CD1 . ILE B 1 504 ? 12.143  -14.917 100.461 1.00 11.17 ? 504 ILE B CD1 1 
ATOM   8470  N N   . TRP B 1 505 ? 14.408  -17.901 96.117  1.00 12.08 ? 505 TRP B N   1 
ATOM   8471  C CA  . TRP B 1 505 ? 14.355  -18.460 94.766  1.00 12.04 ? 505 TRP B CA  1 
ATOM   8472  C C   . TRP B 1 505 ? 15.176  -19.744 94.594  1.00 12.35 ? 505 TRP B C   1 
ATOM   8473  O O   . TRP B 1 505 ? 15.039  -20.437 93.585  1.00 12.93 ? 505 TRP B O   1 
ATOM   8474  C CB  . TRP B 1 505 ? 14.870  -17.423 93.755  1.00 12.03 ? 505 TRP B CB  1 
ATOM   8475  C CG  . TRP B 1 505 ? 13.930  -16.297 93.546  1.00 11.22 ? 505 TRP B CG  1 
ATOM   8476  C CD1 . TRP B 1 505 ? 12.575  -16.346 93.551  1.00 11.27 ? 505 TRP B CD1 1 
ATOM   8477  C CD2 . TRP B 1 505 ? 14.282  -14.924 93.307  1.00 10.38 ? 505 TRP B CD2 1 
ATOM   8478  N NE1 . TRP B 1 505 ? 12.049  -15.091 93.351  1.00 11.74 ? 505 TRP B NE1 1 
ATOM   8479  C CE2 . TRP B 1 505 ? 13.081  -14.200 93.188  1.00 11.63 ? 505 TRP B CE2 1 
ATOM   8480  C CE3 . TRP B 1 505 ? 15.495  -14.238 93.181  1.00 11.59 ? 505 TRP B CE3 1 
ATOM   8481  C CZ2 . TRP B 1 505 ? 13.053  -12.832 92.944  1.00 11.55 ? 505 TRP B CZ2 1 
ATOM   8482  C CZ3 . TRP B 1 505 ? 15.467  -12.861 92.954  1.00 10.22 ? 505 TRP B CZ3 1 
ATOM   8483  C CH2 . TRP B 1 505 ? 14.260  -12.181 92.846  1.00 9.90  ? 505 TRP B CH2 1 
ATOM   8484  N N   . ASP B 1 506 ? 16.038  -20.031 95.558  1.00 12.94 ? 506 ASP B N   1 
ATOM   8485  C CA  . ASP B 1 506 ? 16.906  -21.217 95.564  1.00 13.50 ? 506 ASP B CA  1 
ATOM   8486  C C   . ASP B 1 506 ? 17.958  -21.162 94.474  1.00 13.24 ? 506 ASP B C   1 
ATOM   8487  O O   . ASP B 1 506 ? 18.352  -22.186 93.918  1.00 13.43 ? 506 ASP B O   1 
ATOM   8488  C CB  . ASP B 1 506 ? 16.081  -22.502 95.436  1.00 13.73 ? 506 ASP B CB  1 
ATOM   8489  C CG  . ASP B 1 506 ? 16.794  -23.700 96.012  1.00 16.16 ? 506 ASP B CG  1 
ATOM   8490  O OD1 . ASP B 1 506 ? 17.548  -23.545 96.989  1.00 19.74 ? 506 ASP B OD1 1 
ATOM   8491  O OD2 . ASP B 1 506 ? 16.674  -24.824 95.542  1.00 18.00 ? 506 ASP B OD2 1 
ATOM   8492  N N   . ILE B 1 507 ? 18.395  -19.954 94.148  1.00 12.72 ? 507 ILE B N   1 
ATOM   8493  C CA  . ILE B 1 507 ? 19.463  -19.778 93.179  1.00 12.59 ? 507 ILE B CA  1 
ATOM   8494  C C   . ILE B 1 507 ? 20.736  -19.377 93.912  1.00 12.27 ? 507 ILE B C   1 
ATOM   8495  O O   . ILE B 1 507 ? 20.726  -19.149 95.129  1.00 11.76 ? 507 ILE B O   1 
ATOM   8496  C CB  . ILE B 1 507 ? 19.069  -18.721 92.144  1.00 13.07 ? 507 ILE B CB  1 
ATOM   8497  C CG1 . ILE B 1 507 ? 18.635  -17.424 92.840  1.00 14.07 ? 507 ILE B CG1 1 
ATOM   8498  C CG2 . ILE B 1 507 ? 17.936  -19.230 91.326  1.00 12.69 ? 507 ILE B CG2 1 
ATOM   8499  C CD1 . ILE B 1 507 ? 19.119  -16.213 92.176  1.00 16.59 ? 507 ILE B CD1 1 
ATOM   8500  N N   . ASN B 1 508 ? 21.832  -19.303 93.167  1.00 11.81 ? 508 ASN B N   1 
ATOM   8501  C CA  . ASN B 1 508 ? 23.116  -18.880 93.703  1.00 10.91 ? 508 ASN B CA  1 
ATOM   8502  C C   . ASN B 1 508 ? 23.331  -17.406 93.389  1.00 10.83 ? 508 ASN B C   1 
ATOM   8503  O O   . ASN B 1 508 ? 23.619  -17.033 92.257  1.00 10.05 ? 508 ASN B O   1 
ATOM   8504  C CB  . ASN B 1 508 ? 24.256  -19.693 93.096  1.00 10.92 ? 508 ASN B CB  1 
ATOM   8505  C CG  . ASN B 1 508 ? 25.595  -19.439 93.777  1.00 12.39 ? 508 ASN B CG  1 
ATOM   8506  O OD1 . ASN B 1 508 ? 25.699  -18.614 94.694  1.00 12.16 ? 508 ASN B OD1 1 
ATOM   8507  N ND2 . ASN B 1 508 ? 26.634  -20.165 93.338  1.00 13.27 ? 508 ASN B ND2 1 
ATOM   8508  N N   . SER B 1 509 ? 23.204  -16.569 94.408  1.00 10.47 ? 509 SER B N   1 
ATOM   8509  C CA  . SER B 1 509 ? 23.376  -15.127 94.221  1.00 10.44 ? 509 SER B CA  1 
ATOM   8510  C C   . SER B 1 509 ? 24.839  -14.717 93.999  1.00 10.63 ? 509 SER B C   1 
ATOM   8511  O O   . SER B 1 509 ? 25.118  -13.563 93.678  1.00 11.24 ? 509 SER B O   1 
ATOM   8512  C CB  . SER B 1 509 ? 22.831  -14.407 95.464  1.00 9.41  ? 509 SER B CB  1 
ATOM   8513  O OG  . SER B 1 509 ? 21.415  -14.494 95.500  1.00 10.71 ? 509 SER B OG  1 
ATOM   8514  N N   . PHE B 1 510 ? 25.771  -15.664 94.110  1.00 10.40 ? 510 PHE B N   1 
ATOM   8515  C CA  . PHE B 1 510 ? 27.192  -15.322 94.169  1.00 10.62 ? 510 PHE B CA  1 
ATOM   8516  C C   . PHE B 1 510 ? 28.142  -15.789 93.051  1.00 11.06 ? 510 PHE B C   1 
ATOM   8517  O O   . PHE B 1 510 ? 29.326  -15.443 93.069  1.00 11.49 ? 510 PHE B O   1 
ATOM   8518  C CB  . PHE B 1 510 ? 27.676  -15.709 95.563  1.00 10.54 ? 510 PHE B CB  1 
ATOM   8519  C CG  . PHE B 1 510 ? 26.872  -15.041 96.637  1.00 9.40  ? 510 PHE B CG  1 
ATOM   8520  C CD1 . PHE B 1 510 ? 25.928  -15.745 97.377  1.00 8.88  ? 510 PHE B CD1 1 
ATOM   8521  C CD2 . PHE B 1 510 ? 26.977  -13.679 96.818  1.00 8.55  ? 510 PHE B CD2 1 
ATOM   8522  C CE1 . PHE B 1 510 ? 25.154  -15.107 98.317  1.00 9.79  ? 510 PHE B CE1 1 
ATOM   8523  C CE2 . PHE B 1 510 ? 26.203  -13.025 97.757  1.00 9.20  ? 510 PHE B CE2 1 
ATOM   8524  C CZ  . PHE B 1 510 ? 25.293  -13.729 98.517  1.00 9.94  ? 510 PHE B CZ  1 
ATOM   8525  N N   . ASP B 1 511 ? 27.613  -16.520 92.072  1.00 11.25 ? 511 ASP B N   1 
ATOM   8526  C CA  . ASP B 1 511 ? 28.378  -16.945 90.902  1.00 11.54 ? 511 ASP B CA  1 
ATOM   8527  C C   . ASP B 1 511 ? 27.941  -16.066 89.710  1.00 11.76 ? 511 ASP B C   1 
ATOM   8528  O O   . ASP B 1 511 ? 27.134  -15.146 89.861  1.00 11.19 ? 511 ASP B O   1 
ATOM   8529  C CB  . ASP B 1 511 ? 28.193  -18.462 90.628  1.00 11.61 ? 511 ASP B CB  1 
ATOM   8530  C CG  . ASP B 1 511 ? 26.751  -18.843 90.339  1.00 13.14 ? 511 ASP B CG  1 
ATOM   8531  O OD1 . ASP B 1 511 ? 26.411  -20.080 90.279  1.00 11.28 ? 511 ASP B OD1 1 
ATOM   8532  O OD2 . ASP B 1 511 ? 25.885  -17.962 90.133  1.00 14.93 ? 511 ASP B OD2 1 
ATOM   8533  N N   . GLN B 1 512 ? 28.513  -16.314 88.544  1.00 11.68 ? 512 GLN B N   1 
ATOM   8534  C CA  . GLN B 1 512 ? 28.167  -15.546 87.355  1.00 12.06 ? 512 GLN B CA  1 
ATOM   8535  C C   . GLN B 1 512 ? 28.615  -16.295 86.112  1.00 11.76 ? 512 GLN B C   1 
ATOM   8536  O O   . GLN B 1 512 ? 29.387  -15.782 85.315  1.00 12.38 ? 512 GLN B O   1 
ATOM   8537  C CB  . GLN B 1 512 ? 28.762  -14.119 87.413  1.00 11.78 ? 512 GLN B CB  1 
ATOM   8538  C CG  . GLN B 1 512 ? 30.253  -14.019 87.642  1.00 13.50 ? 512 GLN B CG  1 
ATOM   8539  C CD  . GLN B 1 512 ? 30.684  -14.294 89.070  1.00 14.12 ? 512 GLN B CD  1 
ATOM   8540  O OE1 . GLN B 1 512 ? 30.029  -13.867 90.014  1.00 12.13 ? 512 GLN B OE1 1 
ATOM   8541  N NE2 . GLN B 1 512 ? 31.805  -15.003 89.227  1.00 14.38 ? 512 GLN B NE2 1 
ATOM   8542  N N   . TRP B 1 513 ? 28.113  -17.513 85.951  1.00 12.13 ? 513 TRP B N   1 
ATOM   8543  C CA  . TRP B 1 513 ? 28.447  -18.359 84.802  1.00 12.46 ? 513 TRP B CA  1 
ATOM   8544  C C   . TRP B 1 513 ? 27.942  -17.787 83.476  1.00 12.99 ? 513 TRP B C   1 
ATOM   8545  O O   . TRP B 1 513 ? 28.443  -18.132 82.398  1.00 13.35 ? 513 TRP B O   1 
ATOM   8546  C CB  . TRP B 1 513 ? 27.868  -19.766 85.019  1.00 12.30 ? 513 TRP B CB  1 
ATOM   8547  C CG  . TRP B 1 513 ? 28.532  -20.453 86.157  1.00 13.45 ? 513 TRP B CG  1 
ATOM   8548  C CD1 . TRP B 1 513 ? 27.989  -20.750 87.379  1.00 13.42 ? 513 TRP B CD1 1 
ATOM   8549  C CD2 . TRP B 1 513 ? 29.891  -20.905 86.201  1.00 15.46 ? 513 TRP B CD2 1 
ATOM   8550  N NE1 . TRP B 1 513 ? 28.928  -21.361 88.177  1.00 12.71 ? 513 TRP B NE1 1 
ATOM   8551  C CE2 . TRP B 1 513 ? 30.105  -21.471 87.477  1.00 15.33 ? 513 TRP B CE2 1 
ATOM   8552  C CE3 . TRP B 1 513 ? 30.949  -20.899 85.284  1.00 18.10 ? 513 TRP B CE3 1 
ATOM   8553  C CZ2 . TRP B 1 513 ? 31.327  -22.025 87.857  1.00 17.06 ? 513 TRP B CZ2 1 
ATOM   8554  C CZ3 . TRP B 1 513 ? 32.165  -21.435 85.666  1.00 20.13 ? 513 TRP B CZ3 1 
ATOM   8555  C CH2 . TRP B 1 513 ? 32.346  -21.987 86.944  1.00 18.67 ? 513 TRP B CH2 1 
ATOM   8556  N N   . GLY B 1 514 ? 26.953  -16.910 83.560  1.00 13.76 ? 514 GLY B N   1 
ATOM   8557  C CA  . GLY B 1 514 ? 26.373  -16.274 82.383  1.00 14.22 ? 514 GLY B CA  1 
ATOM   8558  C C   . GLY B 1 514 ? 27.278  -15.305 81.634  1.00 14.91 ? 514 GLY B C   1 
ATOM   8559  O O   . GLY B 1 514 ? 26.902  -14.796 80.573  1.00 14.63 ? 514 GLY B O   1 
ATOM   8560  N N   . VAL B 1 515 ? 28.467  -15.032 82.154  1.00 14.61 ? 515 VAL B N   1 
ATOM   8561  C CA  . VAL B 1 515 ? 29.365  -14.122 81.466  1.00 15.72 ? 515 VAL B CA  1 
ATOM   8562  C C   . VAL B 1 515 ? 30.320  -14.865 80.540  1.00 15.36 ? 515 VAL B C   1 
ATOM   8563  O O   . VAL B 1 515 ? 30.942  -14.277 79.647  1.00 14.59 ? 515 VAL B O   1 
ATOM   8564  C CB  . VAL B 1 515 ? 30.145  -13.237 82.469  1.00 16.94 ? 515 VAL B CB  1 
ATOM   8565  C CG1 . VAL B 1 515 ? 29.181  -12.717 83.565  1.00 18.97 ? 515 VAL B CG1 1 
ATOM   8566  C CG2 . VAL B 1 515 ? 31.304  -13.983 83.092  1.00 16.84 ? 515 VAL B CG2 1 
ATOM   8567  N N   . GLU B 1 516 ? 30.394  -16.177 80.703  1.00 14.91 ? 516 GLU B N   1 
ATOM   8568  C CA  . GLU B 1 516 ? 31.388  -16.957 79.959  1.00 15.79 ? 516 GLU B CA  1 
ATOM   8569  C C   . GLU B 1 516 ? 31.245  -17.020 78.420  1.00 14.80 ? 516 GLU B C   1 
ATOM   8570  O O   . GLU B 1 516 ? 32.229  -16.828 77.706  1.00 15.32 ? 516 GLU B O   1 
ATOM   8571  C CB  . GLU B 1 516 ? 31.468  -18.366 80.550  1.00 16.37 ? 516 GLU B CB  1 
ATOM   8572  C CG  . GLU B 1 516 ? 32.521  -19.237 79.898  1.00 19.48 ? 516 GLU B CG  1 
ATOM   8573  C CD  . GLU B 1 516 ? 32.841  -20.478 80.709  1.00 24.16 ? 516 GLU B CD  1 
ATOM   8574  O OE1 . GLU B 1 516 ? 32.237  -20.685 81.806  1.00 22.49 ? 516 GLU B OE1 1 
ATOM   8575  O OE2 . GLU B 1 516 ? 33.723  -21.239 80.236  1.00 27.54 ? 516 GLU B OE2 1 
ATOM   8576  N N   . LEU B 1 517 ? 30.057  -17.313 77.907  1.00 14.17 ? 517 LEU B N   1 
ATOM   8577  C CA  . LEU B 1 517 ? 29.883  -17.508 76.469  1.00 13.21 ? 517 LEU B CA  1 
ATOM   8578  C C   . LEU B 1 517 ? 30.325  -16.298 75.653  1.00 13.17 ? 517 LEU B C   1 
ATOM   8579  O O   . LEU B 1 517 ? 31.068  -16.427 74.675  1.00 12.04 ? 517 LEU B O   1 
ATOM   8580  C CB  . LEU B 1 517 ? 28.438  -17.851 76.158  1.00 13.43 ? 517 LEU B CB  1 
ATOM   8581  C CG  . LEU B 1 517 ? 28.033  -18.090 74.705  1.00 12.26 ? 517 LEU B CG  1 
ATOM   8582  C CD1 . LEU B 1 517 ? 28.926  -19.144 74.027  1.00 12.86 ? 517 LEU B CD1 1 
ATOM   8583  C CD2 . LEU B 1 517 ? 26.573  -18.502 74.647  1.00 12.36 ? 517 LEU B CD2 1 
ATOM   8584  N N   . GLY B 1 518 ? 29.883  -15.116 76.071  1.00 12.93 ? 518 GLY B N   1 
ATOM   8585  C CA  . GLY B 1 518 ? 30.284  -13.896 75.409  1.00 13.18 ? 518 GLY B CA  1 
ATOM   8586  C C   . GLY B 1 518 ? 31.788  -13.742 75.389  1.00 13.10 ? 518 GLY B C   1 
ATOM   8587  O O   . GLY B 1 518 ? 32.357  -13.314 74.387  1.00 12.47 ? 518 GLY B O   1 
ATOM   8588  N N   . LYS B 1 519 ? 32.448  -14.077 76.494  1.00 14.03 ? 519 LYS B N   1 
ATOM   8589  C CA  . LYS B 1 519 ? 33.898  -13.970 76.534  1.00 15.00 ? 519 LYS B CA  1 
ATOM   8590  C C   . LYS B 1 519 ? 34.526  -14.945 75.540  1.00 14.99 ? 519 LYS B C   1 
ATOM   8591  O O   . LYS B 1 519 ? 35.454  -14.590 74.808  1.00 14.76 ? 519 LYS B O   1 
ATOM   8592  C CB  . LYS B 1 519 ? 34.461  -14.259 77.928  1.00 15.90 ? 519 LYS B CB  1 
ATOM   8593  C CG  . LYS B 1 519 ? 34.252  -13.161 78.954  1.00 19.28 ? 519 LYS B CG  1 
ATOM   8594  C CD  . LYS B 1 519 ? 35.026  -13.508 80.228  1.00 22.30 ? 519 LYS B CD  1 
ATOM   8595  C CE  . LYS B 1 519 ? 34.642  -12.639 81.427  1.00 24.94 ? 519 LYS B CE  1 
ATOM   8596  N NZ  . LYS B 1 519 ? 34.963  -13.340 82.732  1.00 26.40 ? 519 LYS B NZ  1 
ATOM   8597  N N   . GLN B 1 520 ? 34.031  -16.177 75.511  1.00 14.69 ? 520 GLN B N   1 
ATOM   8598  C CA  . GLN B 1 520 ? 34.563  -17.149 74.557  1.00 14.53 ? 520 GLN B CA  1 
ATOM   8599  C C   . GLN B 1 520 ? 34.389  -16.690 73.101  1.00 13.75 ? 520 GLN B C   1 
ATOM   8600  O O   . GLN B 1 520 ? 35.334  -16.708 72.300  1.00 13.27 ? 520 GLN B O   1 
ATOM   8601  C CB  . GLN B 1 520 ? 33.847  -18.481 74.717  1.00 15.20 ? 520 GLN B CB  1 
ATOM   8602  C CG  . GLN B 1 520 ? 34.067  -19.172 76.038  1.00 15.96 ? 520 GLN B CG  1 
ATOM   8603  C CD  . GLN B 1 520 ? 33.170  -20.382 76.155  1.00 19.22 ? 520 GLN B CD  1 
ATOM   8604  O OE1 . GLN B 1 520 ? 31.960  -20.249 76.372  1.00 17.25 ? 520 GLN B OE1 1 
ATOM   8605  N NE2 . GLN B 1 520 ? 33.743  -21.572 75.942  1.00 20.06 ? 520 GLN B NE2 1 
ATOM   8606  N N   . LEU B 1 521 ? 33.182  -16.273 72.750  1.00 13.04 ? 521 LEU B N   1 
ATOM   8607  C CA  . LEU B 1 521 ? 32.922  -15.867 71.379  1.00 13.01 ? 521 LEU B CA  1 
ATOM   8608  C C   . LEU B 1 521 ? 33.691  -14.632 70.958  1.00 12.93 ? 521 LEU B C   1 
ATOM   8609  O O   . LEU B 1 521 ? 34.042  -14.526 69.787  1.00 12.48 ? 521 LEU B O   1 
ATOM   8610  C CB  . LEU B 1 521 ? 31.432  -15.695 71.110  1.00 13.23 ? 521 LEU B CB  1 
ATOM   8611  C CG  . LEU B 1 521 ? 30.566  -16.923 71.381  1.00 14.35 ? 521 LEU B CG  1 
ATOM   8612  C CD1 . LEU B 1 521 ? 29.159  -16.703 70.807  1.00 15.43 ? 521 LEU B CD1 1 
ATOM   8613  C CD2 . LEU B 1 521 ? 31.179  -18.203 70.813  1.00 16.47 ? 521 LEU B CD2 1 
ATOM   8614  N N   . ALA B 1 522 ? 33.956  -13.696 71.871  1.00 13.21 ? 522 ALA B N   1 
ATOM   8615  C CA  . ALA B 1 522 ? 34.765  -12.519 71.515  1.00 13.77 ? 522 ALA B CA  1 
ATOM   8616  C C   . ALA B 1 522 ? 36.200  -12.904 71.193  1.00 14.36 ? 522 ALA B C   1 
ATOM   8617  O O   . ALA B 1 522 ? 36.803  -12.366 70.272  1.00 14.32 ? 522 ALA B O   1 
ATOM   8618  C CB  . ALA B 1 522 ? 34.754  -11.472 72.634  1.00 14.27 ? 522 ALA B CB  1 
ATOM   8619  N N   . LYS B 1 523 ? 36.754  -13.847 71.945  1.00 15.18 ? 523 LYS B N   1 
ATOM   8620  C CA  . LYS B 1 523 ? 38.125  -14.247 71.696  1.00 15.98 ? 523 LYS B CA  1 
ATOM   8621  C C   . LYS B 1 523 ? 38.238  -14.882 70.320  1.00 15.31 ? 523 LYS B C   1 
ATOM   8622  O O   . LYS B 1 523 ? 39.274  -14.761 69.674  1.00 14.89 ? 523 LYS B O   1 
ATOM   8623  C CB  . LYS B 1 523 ? 38.632  -15.224 72.759  1.00 17.15 ? 523 LYS B CB  1 
ATOM   8624  C CG  . LYS B 1 523 ? 38.964  -14.596 74.099  1.00 20.34 ? 523 LYS B CG  1 
ATOM   8625  C CD  . LYS B 1 523 ? 39.710  -13.241 73.999  1.00 23.97 ? 523 LYS B CD  1 
ATOM   8626  C CE  . LYS B 1 523 ? 41.217  -13.375 73.965  1.00 25.64 ? 523 LYS B CE  1 
ATOM   8627  N NZ  . LYS B 1 523 ? 41.863  -12.124 73.467  1.00 24.99 ? 523 LYS B NZ  1 
ATOM   8628  N N   . LYS B 1 524 ? 37.167  -15.530 69.860  1.00 14.98 ? 524 LYS B N   1 
ATOM   8629  C CA  . LYS B 1 524 ? 37.180  -16.144 68.535  1.00 15.43 ? 524 LYS B CA  1 
ATOM   8630  C C   . LYS B 1 524 ? 37.138  -15.078 67.440  1.00 14.94 ? 524 LYS B C   1 
ATOM   8631  O O   . LYS B 1 524 ? 37.848  -15.162 66.438  1.00 13.18 ? 524 LYS B O   1 
ATOM   8632  C CB  . LYS B 1 524 ? 35.990  -17.085 68.366  1.00 16.72 ? 524 LYS B CB  1 
ATOM   8633  C CG  . LYS B 1 524 ? 36.044  -18.340 69.241  1.00 19.45 ? 524 LYS B CG  1 
ATOM   8634  C CD  . LYS B 1 524 ? 37.207  -19.241 68.850  1.00 24.06 ? 524 LYS B CD  1 
ATOM   8635  C CE  . LYS B 1 524 ? 37.095  -20.637 69.487  1.00 26.51 ? 524 LYS B CE  1 
ATOM   8636  N NZ  . LYS B 1 524 ? 36.683  -21.697 68.506  1.00 30.99 ? 524 LYS B NZ  1 
ATOM   8637  N N   . ILE B 1 525 ? 36.315  -14.053 67.651  1.00 14.28 ? 525 ILE B N   1 
ATOM   8638  C CA  . ILE B 1 525 ? 36.151  -12.962 66.681  1.00 14.06 ? 525 ILE B CA  1 
ATOM   8639  C C   . ILE B 1 525 ? 37.346  -12.012 66.579  1.00 13.84 ? 525 ILE B C   1 
ATOM   8640  O O   . ILE B 1 525 ? 37.621  -11.495 65.496  1.00 13.66 ? 525 ILE B O   1 
ATOM   8641  C CB  . ILE B 1 525 ? 34.847  -12.194 66.986  1.00 13.78 ? 525 ILE B CB  1 
ATOM   8642  C CG1 . ILE B 1 525 ? 33.655  -13.107 66.669  1.00 13.70 ? 525 ILE B CG1 1 
ATOM   8643  C CG2 . ILE B 1 525 ? 34.774  -10.870 66.201  1.00 13.78 ? 525 ILE B CG2 1 
ATOM   8644  C CD1 . ILE B 1 525 ? 32.339  -12.614 67.206  1.00 14.30 ? 525 ILE B CD1 1 
ATOM   8645  N N   . GLU B 1 526 ? 38.062  -11.781 67.676  1.00 13.53 ? 526 GLU B N   1 
ATOM   8646  C CA  . GLU B 1 526 ? 39.177  -10.837 67.646  1.00 14.20 ? 526 GLU B CA  1 
ATOM   8647  C C   . GLU B 1 526 ? 40.102  -10.948 66.426  1.00 14.01 ? 526 GLU B C   1 
ATOM   8648  O O   . GLU B 1 526 ? 40.175  -9.994  65.639  1.00 13.89 ? 526 GLU B O   1 
ATOM   8649  C CB  . GLU B 1 526 ? 39.989  -10.890 68.935  1.00 15.16 ? 526 GLU B CB  1 
ATOM   8650  C CG  . GLU B 1 526 ? 39.382  -10.028 70.011  1.00 17.51 ? 526 GLU B CG  1 
ATOM   8651  C CD  . GLU B 1 526 ? 40.024  -10.218 71.379  1.00 21.30 ? 526 GLU B CD  1 
ATOM   8652  O OE1 . GLU B 1 526 ? 39.313  -10.052 72.387  1.00 27.17 ? 526 GLU B OE1 1 
ATOM   8653  O OE2 . GLU B 1 526 ? 41.216  -10.513 71.450  1.00 23.54 ? 526 GLU B OE2 1 
ATOM   8654  N N   . PRO B 1 527 ? 40.832  -12.052 66.279  1.00 13.32 ? 527 PRO B N   1 
ATOM   8655  C CA  . PRO B 1 527 ? 41.758  -12.213 65.150  1.00 13.93 ? 527 PRO B CA  1 
ATOM   8656  C C   . PRO B 1 527 ? 41.092  -12.116 63.779  1.00 13.28 ? 527 PRO B C   1 
ATOM   8657  O O   . PRO B 1 527 ? 41.738  -11.676 62.829  1.00 13.19 ? 527 PRO B O   1 
ATOM   8658  C CB  . PRO B 1 527 ? 42.346  -13.618 65.374  1.00 13.42 ? 527 PRO B CB  1 
ATOM   8659  C CG  . PRO B 1 527 ? 41.349  -14.315 66.247  1.00 14.18 ? 527 PRO B CG  1 
ATOM   8660  C CD  . PRO B 1 527 ? 40.875  -13.220 67.175  1.00 13.75 ? 527 PRO B CD  1 
ATOM   8661  N N   . GLU B 1 528 ? 39.825  -12.505 63.686  1.00 12.92 ? 528 GLU B N   1 
ATOM   8662  C CA  . GLU B 1 528 ? 39.100  -12.459 62.420  1.00 13.36 ? 528 GLU B CA  1 
ATOM   8663  C C   . GLU B 1 528 ? 38.866  -11.041 61.916  1.00 13.45 ? 528 GLU B C   1 
ATOM   8664  O O   . GLU B 1 528 ? 38.613  -10.831 60.713  1.00 13.00 ? 528 GLU B O   1 
ATOM   8665  C CB  . GLU B 1 528 ? 37.757  -13.174 62.543  1.00 13.50 ? 528 GLU B CB  1 
ATOM   8666  C CG  . GLU B 1 528 ? 37.845  -14.640 62.971  1.00 15.14 ? 528 GLU B CG  1 
ATOM   8667  C CD  . GLU B 1 528 ? 36.485  -15.291 63.060  1.00 17.95 ? 528 GLU B CD  1 
ATOM   8668  O OE1 . GLU B 1 528 ? 35.530  -14.609 63.504  1.00 17.12 ? 528 GLU B OE1 1 
ATOM   8669  O OE2 . GLU B 1 528 ? 36.351  -16.478 62.667  1.00 17.87 ? 528 GLU B OE2 1 
ATOM   8670  N N   . LEU B 1 529 ? 38.909  -10.066 62.823  1.00 13.93 ? 529 LEU B N   1 
ATOM   8671  C CA  . LEU B 1 529 ? 38.743  -8.677  62.431  1.00 14.19 ? 529 LEU B CA  1 
ATOM   8672  C C   . LEU B 1 529 ? 40.009  -8.124  61.757  1.00 15.19 ? 529 LEU B C   1 
ATOM   8673  O O   . LEU B 1 529 ? 39.944  -7.142  61.013  1.00 14.81 ? 529 LEU B O   1 
ATOM   8674  C CB  . LEU B 1 529 ? 38.389  -7.818  63.642  1.00 14.26 ? 529 LEU B CB  1 
ATOM   8675  C CG  . LEU B 1 529 ? 37.037  -8.079  64.296  1.00 13.53 ? 529 LEU B CG  1 
ATOM   8676  C CD1 . LEU B 1 529 ? 36.887  -7.180  65.511  1.00 14.08 ? 529 LEU B CD1 1 
ATOM   8677  C CD2 . LEU B 1 529 ? 35.907  -7.819  63.330  1.00 14.39 ? 529 LEU B CD2 1 
ATOM   8678  N N   . ASP B 1 530 ? 41.158  -8.737  62.017  1.00 15.50 ? 530 ASP B N   1 
ATOM   8679  C CA  . ASP B 1 530 ? 42.400  -8.262  61.411  1.00 16.34 ? 530 ASP B CA  1 
ATOM   8680  C C   . ASP B 1 530 ? 42.393  -8.645  59.941  1.00 15.98 ? 530 ASP B C   1 
ATOM   8681  O O   . ASP B 1 530 ? 41.887  -9.709  59.593  1.00 15.40 ? 530 ASP B O   1 
ATOM   8682  C CB  . ASP B 1 530 ? 43.617  -8.902  62.081  1.00 16.88 ? 530 ASP B CB  1 
ATOM   8683  C CG  . ASP B 1 530 ? 43.852  -8.381  63.476  1.00 19.86 ? 530 ASP B CG  1 
ATOM   8684  O OD1 . ASP B 1 530 ? 44.389  -9.137  64.312  1.00 23.41 ? 530 ASP B OD1 1 
ATOM   8685  O OD2 . ASP B 1 530 ? 43.524  -7.235  63.829  1.00 20.45 ? 530 ASP B OD2 1 
ATOM   8686  N N   . GLY B 1 531 ? 42.934  -7.772  59.095  1.00 15.59 ? 531 GLY B N   1 
ATOM   8687  C CA  . GLY B 1 531 ? 43.044  -8.021  57.660  1.00 15.97 ? 531 GLY B CA  1 
ATOM   8688  C C   . GLY B 1 531 ? 41.764  -7.770  56.881  1.00 15.91 ? 531 GLY B C   1 
ATOM   8689  O O   . GLY B 1 531 ? 40.691  -7.584  57.466  1.00 16.71 ? 531 GLY B O   1 
ATOM   8690  N N   . SER B 1 532 ? 41.847  -7.828  55.559  1.00 15.76 ? 532 SER B N   1 
ATOM   8691  C CA  . SER B 1 532 ? 40.695  -7.500  54.724  1.00 15.78 ? 532 SER B CA  1 
ATOM   8692  C C   . SER B 1 532 ? 39.837  -8.675  54.249  1.00 15.77 ? 532 SER B C   1 
ATOM   8693  O O   . SER B 1 532 ? 38.864  -8.461  53.540  1.00 15.63 ? 532 SER B O   1 
ATOM   8694  C CB  . SER B 1 532 ? 41.197  -6.714  53.513  1.00 16.41 ? 532 SER B CB  1 
ATOM   8695  O OG  . SER B 1 532 ? 42.139  -7.497  52.804  1.00 18.01 ? 532 SER B OG  1 
ATOM   8696  N N   . ALA B 1 533 ? 40.159  -9.913  54.628  1.00 15.24 ? 533 ALA B N   1 
ATOM   8697  C CA  . ALA B 1 533 ? 39.364  -11.051 54.161  1.00 15.20 ? 533 ALA B CA  1 
ATOM   8698  C C   . ALA B 1 533 ? 37.923  -11.106 54.698  1.00 15.06 ? 533 ALA B C   1 
ATOM   8699  O O   . ALA B 1 533 ? 37.636  -10.727 55.850  1.00 14.72 ? 533 ALA B O   1 
ATOM   8700  C CB  . ALA B 1 533 ? 40.082  -12.369 54.485  1.00 15.46 ? 533 ALA B CB  1 
ATOM   8701  N N   . GLN B 1 534 ? 37.028  -11.610 53.856  1.00 15.13 ? 534 GLN B N   1 
ATOM   8702  C CA  . GLN B 1 534 ? 35.640  -11.844 54.238  1.00 15.36 ? 534 GLN B CA  1 
ATOM   8703  C C   . GLN B 1 534 ? 35.594  -12.952 55.281  1.00 15.09 ? 534 GLN B C   1 
ATOM   8704  O O   . GLN B 1 534 ? 36.341  -13.923 55.181  1.00 14.15 ? 534 GLN B O   1 
ATOM   8705  C CB  . GLN B 1 534 ? 34.815  -12.297 53.036  1.00 15.69 ? 534 GLN B CB  1 
ATOM   8706  C CG  . GLN B 1 534 ? 34.749  -11.297 51.914  1.00 18.57 ? 534 GLN B CG  1 
ATOM   8707  C CD  . GLN B 1 534 ? 33.930  -10.091 52.295  1.00 19.52 ? 534 GLN B CD  1 
ATOM   8708  O OE1 . GLN B 1 534 ? 34.464  -8.998  52.428  1.00 22.54 ? 534 GLN B OE1 1 
ATOM   8709  N NE2 . GLN B 1 534 ? 32.643  -10.289 52.493  1.00 20.23 ? 534 GLN B NE2 1 
ATOM   8710  N N   . VAL B 1 535 ? 34.720  -12.802 56.276  1.00 14.46 ? 535 VAL B N   1 
ATOM   8711  C CA  . VAL B 1 535 ? 34.533  -13.821 57.307  1.00 14.48 ? 535 VAL B CA  1 
ATOM   8712  C C   . VAL B 1 535 ? 33.223  -14.535 57.012  1.00 15.07 ? 535 VAL B C   1 
ATOM   8713  O O   . VAL B 1 535 ? 32.209  -13.899 56.714  1.00 14.43 ? 535 VAL B O   1 
ATOM   8714  C CB  . VAL B 1 535 ? 34.542  -13.206 58.723  1.00 14.69 ? 535 VAL B CB  1 
ATOM   8715  C CG1 . VAL B 1 535 ? 34.235  -14.243 59.799  1.00 14.21 ? 535 VAL B CG1 1 
ATOM   8716  C CG2 . VAL B 1 535 ? 35.874  -12.571 59.004  1.00 14.69 ? 535 VAL B CG2 1 
ATOM   8717  N N   . THR B 1 536 ? 33.269  -15.866 57.052  1.00 15.42 ? 536 THR B N   1 
ATOM   8718  C CA  . THR B 1 536 ? 32.131  -16.697 56.727  1.00 15.85 ? 536 THR B CA  1 
ATOM   8719  C C   . THR B 1 536 ? 31.952  -17.804 57.754  1.00 15.38 ? 536 THR B C   1 
ATOM   8720  O O   . THR B 1 536 ? 31.155  -18.698 57.556  1.00 15.76 ? 536 THR B O   1 
ATOM   8721  C CB  . THR B 1 536 ? 32.354  -17.371 55.361  1.00 16.77 ? 536 THR B CB  1 
ATOM   8722  O OG1 . THR B 1 536 ? 33.491  -18.241 55.459  1.00 17.11 ? 536 THR B OG1 1 
ATOM   8723  C CG2 . THR B 1 536 ? 32.728  -16.378 54.294  1.00 17.40 ? 536 THR B CG2 1 
ATOM   8724  N N   . SER B 1 537 ? 32.685  -17.734 58.857  1.00 15.40 ? 537 SER B N   1 
ATOM   8725  C CA  . SER B 1 537 ? 32.709  -18.791 59.864  1.00 15.45 ? 537 SER B CA  1 
ATOM   8726  C C   . SER B 1 537 ? 31.563  -18.814 60.902  1.00 15.03 ? 537 SER B C   1 
ATOM   8727  O O   . SER B 1 537 ? 31.469  -19.754 61.698  1.00 15.32 ? 537 SER B O   1 
ATOM   8728  C CB  . SER B 1 537 ? 34.032  -18.681 60.619  1.00 15.43 ? 537 SER B CB  1 
ATOM   8729  O OG  . SER B 1 537 ? 34.165  -17.417 61.239  1.00 17.25 ? 537 SER B OG  1 
ATOM   8730  N N   . HIS B 1 538 ? 30.720  -17.790 60.921  1.00 13.57 ? 538 HIS B N   1 
ATOM   8731  C CA  . HIS B 1 538 ? 29.635  -17.713 61.910  1.00 12.92 ? 538 HIS B CA  1 
ATOM   8732  C C   . HIS B 1 538 ? 28.265  -17.794 61.224  1.00 12.77 ? 538 HIS B C   1 
ATOM   8733  O O   . HIS B 1 538 ? 28.183  -18.064 60.032  1.00 13.43 ? 538 HIS B O   1 
ATOM   8734  C CB  . HIS B 1 538 ? 29.720  -16.365 62.644  1.00 12.62 ? 538 HIS B CB  1 
ATOM   8735  C CG  . HIS B 1 538 ? 31.054  -16.087 63.271  1.00 10.96 ? 538 HIS B CG  1 
ATOM   8736  N ND1 . HIS B 1 538 ? 31.298  -16.291 64.608  1.00 10.05 ? 538 HIS B ND1 1 
ATOM   8737  C CD2 . HIS B 1 538 ? 32.205  -15.592 62.753  1.00 12.32 ? 538 HIS B CD2 1 
ATOM   8738  C CE1 . HIS B 1 538 ? 32.546  -15.961 64.886  1.00 10.68 ? 538 HIS B CE1 1 
ATOM   8739  N NE2 . HIS B 1 538 ? 33.123  -15.534 63.779  1.00 11.63 ? 538 HIS B NE2 1 
ATOM   8740  N N   . ASP B 1 539 ? 27.196  -17.548 61.984  1.00 12.18 ? 539 ASP B N   1 
ATOM   8741  C CA  . ASP B 1 539 ? 25.873  -17.344 61.410  1.00 11.35 ? 539 ASP B CA  1 
ATOM   8742  C C   . ASP B 1 539 ? 25.962  -16.157 60.445  1.00 11.30 ? 539 ASP B C   1 
ATOM   8743  O O   . ASP B 1 539 ? 26.900  -15.345 60.537  1.00 10.57 ? 539 ASP B O   1 
ATOM   8744  C CB  . ASP B 1 539 ? 24.858  -17.034 62.512  1.00 11.27 ? 539 ASP B CB  1 
ATOM   8745  C CG  . ASP B 1 539 ? 25.161  -15.733 63.217  1.00 10.91 ? 539 ASP B CG  1 
ATOM   8746  O OD1 . ASP B 1 539 ? 24.680  -14.679 62.740  1.00 10.78 ? 539 ASP B OD1 1 
ATOM   8747  O OD2 . ASP B 1 539 ? 25.912  -15.654 64.218  1.00 11.44 ? 539 ASP B OD2 1 
ATOM   8748  N N   . ALA B 1 540 ? 24.973  -16.027 59.561  1.00 10.62 ? 540 ALA B N   1 
ATOM   8749  C CA  . ALA B 1 540 ? 24.991  -15.009 58.518  1.00 11.29 ? 540 ALA B CA  1 
ATOM   8750  C C   . ALA B 1 540 ? 25.020  -13.589 59.066  1.00 10.88 ? 540 ALA B C   1 
ATOM   8751  O O   . ALA B 1 540 ? 25.615  -12.715 58.455  1.00 11.46 ? 540 ALA B O   1 
ATOM   8752  C CB  . ALA B 1 540 ? 23.804  -15.168 57.590  1.00 11.13 ? 540 ALA B CB  1 
ATOM   8753  N N   . SER B 1 541 ? 24.370  -13.359 60.203  1.00 10.77 ? 541 SER B N   1 
ATOM   8754  C CA  . SER B 1 541 ? 24.343  -12.022 60.786  1.00 10.18 ? 541 SER B CA  1 
ATOM   8755  C C   . SER B 1 541 ? 25.729  -11.624 61.291  1.00 9.39  ? 541 SER B C   1 
ATOM   8756  O O   . SER B 1 541 ? 26.244  -10.557 60.939  1.00 9.66  ? 541 SER B O   1 
ATOM   8757  C CB  . SER B 1 541 ? 23.323  -11.940 61.936  1.00 10.48 ? 541 SER B CB  1 
ATOM   8758  O OG  . SER B 1 541 ? 23.394  -10.659 62.564  1.00 10.44 ? 541 SER B OG  1 
ATOM   8759  N N   . THR B 1 542 ? 26.329  -12.463 62.123  1.00 9.09  ? 542 THR B N   1 
ATOM   8760  C CA  . THR B 1 542 ? 27.643  -12.167 62.644  1.00 9.85  ? 542 THR B CA  1 
ATOM   8761  C C   . THR B 1 542 ? 28.612  -11.941 61.461  1.00 9.72  ? 542 THR B C   1 
ATOM   8762  O O   . THR B 1 542 ? 29.390  -10.988 61.470  1.00 9.19  ? 542 THR B O   1 
ATOM   8763  C CB  . THR B 1 542 ? 28.127  -13.288 63.585  1.00 10.37 ? 542 THR B CB  1 
ATOM   8764  O OG1 . THR B 1 542 ? 27.221  -13.435 64.694  1.00 10.28 ? 542 THR B OG1 1 
ATOM   8765  C CG2 . THR B 1 542 ? 29.449  -12.926 64.247  1.00 11.52 ? 542 THR B CG2 1 
ATOM   8766  N N   . ASN B 1 543 ? 28.540  -12.801 60.440  1.00 10.23 ? 543 ASN B N   1 
ATOM   8767  C CA  . ASN B 1 543 ? 29.395  -12.637 59.257  1.00 10.39 ? 543 ASN B CA  1 
ATOM   8768  C C   . ASN B 1 543 ? 29.148  -11.306 58.584  1.00 10.54 ? 543 ASN B C   1 
ATOM   8769  O O   . ASN B 1 543 ? 30.096  -10.613 58.201  1.00 11.22 ? 543 ASN B O   1 
ATOM   8770  C CB  . ASN B 1 543 ? 29.135  -13.725 58.200  1.00 10.22 ? 543 ASN B CB  1 
ATOM   8771  C CG  . ASN B 1 543 ? 29.525  -15.129 58.663  1.00 11.15 ? 543 ASN B CG  1 
ATOM   8772  O OD1 . ASN B 1 543 ? 30.309  -15.301 59.617  1.00 11.72 ? 543 ASN B OD1 1 
ATOM   8773  N ND2 . ASN B 1 543 ? 29.001  -16.155 57.953  1.00 11.11 ? 543 ASN B ND2 1 
ATOM   8774  N N   . GLY B 1 544 ? 27.861  -10.993 58.401  1.00 10.58 ? 544 GLY B N   1 
ATOM   8775  C CA  . GLY B 1 544 ? 27.425  -9.811  57.701  1.00 10.40 ? 544 GLY B CA  1 
ATOM   8776  C C   . GLY B 1 544 ? 27.909  -8.542  58.382  1.00 10.58 ? 544 GLY B C   1 
ATOM   8777  O O   . GLY B 1 544 ? 28.309  -7.577  57.715  1.00 10.52 ? 544 GLY B O   1 
ATOM   8778  N N   . LEU B 1 545 ? 27.854  -8.544  59.712  1.00 9.32  ? 545 LEU B N   1 
ATOM   8779  C CA  . LEU B 1 545 ? 28.278  -7.388  60.492  1.00 10.26 ? 545 LEU B CA  1 
ATOM   8780  C C   . LEU B 1 545 ? 29.789  -7.202  60.379  1.00 9.21  ? 545 LEU B C   1 
ATOM   8781  O O   . LEU B 1 545 ? 30.283  -6.112  60.153  1.00 9.63  ? 545 LEU B O   1 
ATOM   8782  C CB  . LEU B 1 545 ? 27.837  -7.552  61.959  1.00 9.63  ? 545 LEU B CB  1 
ATOM   8783  C CG  . LEU B 1 545 ? 26.326  -7.533  62.188  1.00 9.69  ? 545 LEU B CG  1 
ATOM   8784  C CD1 . LEU B 1 545 ? 25.920  -8.272  63.472  1.00 11.04 ? 545 LEU B CD1 1 
ATOM   8785  C CD2 . LEU B 1 545 ? 25.837  -6.087  62.240  1.00 10.09 ? 545 LEU B CD2 1 
ATOM   8786  N N   . ILE B 1 546 ? 30.525  -8.280  60.533  1.00 9.90  ? 546 ILE B N   1 
ATOM   8787  C CA  . ILE B 1 546 ? 31.970  -8.210  60.399  1.00 10.07 ? 546 ILE B CA  1 
ATOM   8788  C C   . ILE B 1 546 ? 32.341  -7.670  59.020  1.00 9.70  ? 546 ILE B C   1 
ATOM   8789  O O   . ILE B 1 546 ? 33.174  -6.780  58.894  1.00 10.16 ? 546 ILE B O   1 
ATOM   8790  C CB  . ILE B 1 546 ? 32.596  -9.594  60.599  1.00 10.11 ? 546 ILE B CB  1 
ATOM   8791  C CG1 . ILE B 1 546 ? 32.596  -9.952  62.080  1.00 11.08 ? 546 ILE B CG1 1 
ATOM   8792  C CG2 . ILE B 1 546 ? 34.007  -9.605  60.052  1.00 11.14 ? 546 ILE B CG2 1 
ATOM   8793  C CD1 . ILE B 1 546 ? 32.840  -11.405 62.343  1.00 11.39 ? 546 ILE B CD1 1 
ATOM   8794  N N   . ASN B 1 547 ? 31.696  -8.178  57.987  1.00 10.31 ? 547 ASN B N   1 
ATOM   8795  C CA  . ASN B 1 547 ? 32.033  -7.758  56.637  1.00 10.67 ? 547 ASN B CA  1 
ATOM   8796  C C   . ASN B 1 547 ? 31.712  -6.277  56.374  1.00 10.82 ? 547 ASN B C   1 
ATOM   8797  O O   . ASN B 1 547 ? 32.451  -5.571  55.681  1.00 11.48 ? 547 ASN B O   1 
ATOM   8798  C CB  . ASN B 1 547 ? 31.436  -8.738  55.612  1.00 10.95 ? 547 ASN B CB  1 
ATOM   8799  C CG  . ASN B 1 547 ? 32.080  -10.124 55.711  1.00 9.93  ? 547 ASN B CG  1 
ATOM   8800  O OD1 . ASN B 1 547 ? 33.247  -10.239 56.066  1.00 12.21 ? 547 ASN B OD1 1 
ATOM   8801  N ND2 . ASN B 1 547 ? 31.306  -11.168 55.467  1.00 11.19 ? 547 ASN B ND2 1 
ATOM   8802  N N   . PHE B 1 548 ? 30.634  -5.787  56.955  1.00 11.17 ? 548 PHE B N   1 
ATOM   8803  C CA  . PHE B 1 548 ? 30.292  -4.377  56.813  1.00 10.59 ? 548 PHE B CA  1 
ATOM   8804  C C   . PHE B 1 548 ? 31.349  -3.525  57.506  1.00 10.81 ? 548 PHE B C   1 
ATOM   8805  O O   . PHE B 1 548 ? 31.785  -2.494  56.998  1.00 10.95 ? 548 PHE B O   1 
ATOM   8806  C CB  . PHE B 1 548 ? 28.929  -4.126  57.447  1.00 10.69 ? 548 PHE B CB  1 
ATOM   8807  C CG  . PHE B 1 548 ? 28.495  -2.685  57.437  1.00 10.69 ? 548 PHE B CG  1 
ATOM   8808  C CD1 . PHE B 1 548 ? 27.971  -2.114  56.297  1.00 11.47 ? 548 PHE B CD1 1 
ATOM   8809  C CD2 . PHE B 1 548 ? 28.590  -1.911  58.591  1.00 11.84 ? 548 PHE B CD2 1 
ATOM   8810  C CE1 . PHE B 1 548 ? 27.554  -0.797  56.298  1.00 12.88 ? 548 PHE B CE1 1 
ATOM   8811  C CE2 . PHE B 1 548 ? 28.169  -0.609  58.601  1.00 11.28 ? 548 PHE B CE2 1 
ATOM   8812  C CZ  . PHE B 1 548 ? 27.641  -0.050  57.453  1.00 13.04 ? 548 PHE B CZ  1 
ATOM   8813  N N   . ILE B 1 549 ? 31.742  -3.957  58.692  1.00 11.08 ? 549 ILE B N   1 
ATOM   8814  C CA  . ILE B 1 549 ? 32.802  -3.289  59.447  1.00 10.85 ? 549 ILE B CA  1 
ATOM   8815  C C   . ILE B 1 549 ? 34.082  -3.198  58.608  1.00 11.15 ? 549 ILE B C   1 
ATOM   8816  O O   . ILE B 1 549 ? 34.744  -2.164  58.548  1.00 11.16 ? 549 ILE B O   1 
ATOM   8817  C CB  . ILE B 1 549 ? 33.049  -4.064  60.762  1.00 10.48 ? 549 ILE B CB  1 
ATOM   8818  C CG1 . ILE B 1 549 ? 31.891  -3.796  61.742  1.00 10.01 ? 549 ILE B CG1 1 
ATOM   8819  C CG2 . ILE B 1 549 ? 34.371  -3.641  61.374  1.00 11.91 ? 549 ILE B CG2 1 
ATOM   8820  C CD1 . ILE B 1 549 ? 31.778  -4.779  62.918  1.00 9.64  ? 549 ILE B CD1 1 
ATOM   8821  N N   . LYS B 1 550 ? 34.421  -4.281  57.921  1.00 11.70 ? 550 LYS B N   1 
ATOM   8822  C CA  . LYS B 1 550 ? 35.629  -4.280  57.101  1.00 11.83 ? 550 LYS B CA  1 
ATOM   8823  C C   . LYS B 1 550 ? 35.512  -3.333  55.922  1.00 12.38 ? 550 LYS B C   1 
ATOM   8824  O O   . LYS B 1 550 ? 36.464  -2.646  55.583  1.00 13.53 ? 550 LYS B O   1 
ATOM   8825  C CB  . LYS B 1 550 ? 35.946  -5.695  56.643  1.00 11.70 ? 550 LYS B CB  1 
ATOM   8826  C CG  . LYS B 1 550 ? 36.270  -6.591  57.801  1.00 11.25 ? 550 LYS B CG  1 
ATOM   8827  C CD  . LYS B 1 550 ? 37.096  -7.814  57.392  1.00 12.45 ? 550 LYS B CD  1 
ATOM   8828  C CE  . LYS B 1 550 ? 37.681  -8.527  58.618  1.00 11.73 ? 550 LYS B CE  1 
ATOM   8829  N NZ  . LYS B 1 550 ? 38.756  -9.551  58.255  1.00 12.18 ? 550 LYS B NZ  1 
ATOM   8830  N N   . GLN B 1 551 ? 34.339  -3.284  55.309  1.00 12.50 ? 551 GLN B N   1 
ATOM   8831  C CA  . GLN B 1 551 ? 34.106  -2.394  54.187  1.00 13.06 ? 551 GLN B CA  1 
ATOM   8832  C C   . GLN B 1 551 ? 34.183  -0.946  54.618  1.00 13.22 ? 551 GLN B C   1 
ATOM   8833  O O   . GLN B 1 551 ? 34.764  -0.119  53.932  1.00 13.16 ? 551 GLN B O   1 
ATOM   8834  C CB  . GLN B 1 551 ? 32.721  -2.641  53.626  1.00 13.35 ? 551 GLN B CB  1 
ATOM   8835  C CG  . GLN B 1 551 ? 32.271  -1.619  52.568  1.00 15.11 ? 551 GLN B CG  1 
ATOM   8836  C CD  . GLN B 1 551 ? 30.809  -1.752  52.250  1.00 17.31 ? 551 GLN B CD  1 
ATOM   8837  O OE1 . GLN B 1 551 ? 29.970  -1.159  52.920  1.00 14.37 ? 551 GLN B OE1 1 
ATOM   8838  N NE2 . GLN B 1 551 ? 30.488  -2.554  51.237  1.00 16.41 ? 551 GLN B NE2 1 
ATOM   8839  N N   . GLN B 1 552 ? 33.610  -0.634  55.771  1.00 13.06 ? 552 GLN B N   1 
ATOM   8840  C CA  . GLN B 1 552 ? 33.485  0.770   56.192  1.00 14.01 ? 552 GLN B CA  1 
ATOM   8841  C C   . GLN B 1 552 ? 34.680  1.347   56.956  1.00 15.56 ? 552 GLN B C   1 
ATOM   8842  O O   . GLN B 1 552 ? 34.833  2.566   57.086  1.00 13.79 ? 552 GLN B O   1 
ATOM   8843  C CB  . GLN B 1 552 ? 32.213  0.945   57.017  1.00 13.47 ? 552 GLN B CB  1 
ATOM   8844  C CG  . GLN B 1 552 ? 30.922  0.902   56.202  1.00 14.00 ? 552 GLN B CG  1 
ATOM   8845  C CD  . GLN B 1 552 ? 30.890  1.996   55.167  1.00 14.38 ? 552 GLN B CD  1 
ATOM   8846  O OE1 . GLN B 1 552 ? 31.071  3.176   55.499  1.00 13.30 ? 552 GLN B OE1 1 
ATOM   8847  N NE2 . GLN B 1 552 ? 30.710  1.610   53.895  1.00 13.25 ? 552 GLN B NE2 1 
ATOM   8848  N N   . ARG B 1 553 ? 35.550  0.502   57.470  1.00 17.64 ? 553 ARG B N   1 
ATOM   8849  C CA  . ARG B 1 553 ? 36.641  1.088   58.219  1.00 20.49 ? 553 ARG B CA  1 
ATOM   8850  C C   . ARG B 1 553 ? 37.627  1.800   57.303  1.00 22.19 ? 553 ARG B C   1 
ATOM   8851  O O   . ARG B 1 553 ? 38.457  2.541   57.775  1.00 23.76 ? 553 ARG B O   1 
ATOM   8852  C CB  . ARG B 1 553 ? 37.332  0.080   59.088  1.00 20.65 ? 553 ARG B CB  1 
ATOM   8853  C CG  . ARG B 1 553 ? 38.158  -0.938  58.384  1.00 21.10 ? 553 ARG B CG  1 
ATOM   8854  C CD  . ARG B 1 553 ? 38.633  -1.990  59.398  1.00 21.87 ? 553 ARG B CD  1 
ATOM   8855  N NE  . ARG B 1 553 ? 39.248  -3.141  58.768  1.00 21.59 ? 553 ARG B NE  1 
ATOM   8856  C CZ  . ARG B 1 553 ? 39.448  -4.299  59.368  1.00 19.58 ? 553 ARG B CZ  1 
ATOM   8857  N NH1 . ARG B 1 553 ? 40.026  -5.279  58.700  1.00 17.86 ? 553 ARG B NH1 1 
ATOM   8858  N NH2 . ARG B 1 553 ? 39.068  -4.478  60.625  1.00 18.72 ? 553 ARG B NH2 1 
ATOM   8859  N N   . GLU B 1 554 ? 37.507  1.594   56.004  1.00 24.54 ? 554 GLU B N   1 
ATOM   8860  C CA  . GLU B 1 554 ? 38.343  2.307   55.037  1.00 26.44 ? 554 GLU B CA  1 
ATOM   8861  C C   . GLU B 1 554 ? 37.606  3.478   54.385  1.00 26.55 ? 554 GLU B C   1 
ATOM   8862  O O   . GLU B 1 554 ? 38.149  4.140   53.499  1.00 27.12 ? 554 GLU B O   1 
ATOM   8863  C CB  . GLU B 1 554 ? 38.868  1.362   53.956  1.00 27.29 ? 554 GLU B CB  1 
ATOM   8864  C CG  . GLU B 1 554 ? 38.274  -0.045  53.955  1.00 29.99 ? 554 GLU B CG  1 
ATOM   8865  C CD  . GLU B 1 554 ? 39.277  -1.082  53.472  1.00 33.60 ? 554 GLU B CD  1 
ATOM   8866  O OE1 . GLU B 1 554 ? 40.206  -1.413  54.242  1.00 36.44 ? 554 GLU B OE1 1 
ATOM   8867  O OE2 . GLU B 1 554 ? 39.140  -1.569  52.325  1.00 37.00 ? 554 GLU B OE2 1 
ATOM   8868  N N   . ALA B 1 555 ? 36.382  3.752   54.823  1.00 26.00 ? 555 ALA B N   1 
ATOM   8869  C CA  . ALA B 1 555 ? 35.618  4.845   54.236  1.00 25.78 ? 555 ALA B CA  1 
ATOM   8870  C C   . ALA B 1 555 ? 36.077  6.195   54.783  1.00 26.10 ? 555 ALA B C   1 
ATOM   8871  O O   . ALA B 1 555 ? 36.305  6.345   55.975  1.00 25.47 ? 555 ALA B O   1 
ATOM   8872  C CB  . ALA B 1 555 ? 34.141  4.650   54.491  1.00 25.66 ? 555 ALA B CB  1 
ATOM   8873  N N   . ARG B 1 556 ? 36.210  7.180   53.903  1.00 26.72 ? 556 ARG B N   1 
ATOM   8874  C CA  . ARG B 1 556 ? 36.574  8.521   54.324  1.00 27.59 ? 556 ARG B CA  1 
ATOM   8875  C C   . ARG B 1 556 ? 35.301  9.332   54.407  1.00 27.60 ? 556 ARG B C   1 
ATOM   8876  O O   . ARG B 1 556 ? 34.727  9.687   53.381  1.00 26.61 ? 556 ARG B O   1 
ATOM   8877  C CB  . ARG B 1 556 ? 37.563  9.159   53.343  1.00 28.39 ? 556 ARG B CB  1 
ATOM   8878  C CG  . ARG B 1 556 ? 38.946  8.515   53.360  1.00 31.94 ? 556 ARG B CG  1 
ATOM   8879  C CD  . ARG B 1 556 ? 40.020  9.303   52.614  1.00 36.60 ? 556 ARG B CD  1 
ATOM   8880  N NE  . ARG B 1 556 ? 40.321  10.571  53.279  1.00 40.74 ? 556 ARG B NE  1 
ATOM   8881  C CZ  . ARG B 1 556 ? 41.381  10.784  54.061  1.00 43.40 ? 556 ARG B CZ  1 
ATOM   8882  N NH1 . ARG B 1 556 ? 41.560  11.973  54.622  1.00 44.26 ? 556 ARG B NH1 1 
ATOM   8883  N NH2 . ARG B 1 556 ? 42.268  9.818   54.280  1.00 44.70 ? 556 ARG B NH2 1 
ATOM   8884  N N   . VAL B 1 557 ? 34.827  9.611   55.615  1.00 28.11 ? 557 VAL B N   1 
ATOM   8885  C CA  . VAL B 1 557 ? 33.589  10.373  55.726  1.00 29.20 ? 557 VAL B CA  1 
ATOM   8886  C C   . VAL B 1 557 ? 33.900  11.860  55.655  1.00 30.11 ? 557 VAL B C   1 
ATOM   8887  O O   . VAL B 1 557 ? 34.614  12.381  56.514  1.00 30.32 ? 557 VAL B O   1 
ATOM   8888  C CB  . VAL B 1 557 ? 32.663  9.977   56.945  1.00 29.35 ? 557 VAL B CB  1 
ATOM   8889  C CG1 . VAL B 1 557 ? 33.293  8.960   57.865  1.00 29.85 ? 557 VAL B CG1 1 
ATOM   8890  C CG2 . VAL B 1 557 ? 32.192  11.199  57.727  1.00 30.29 ? 557 VAL B CG2 1 
ATOM   8891  N N   . MET C 1 1   ? 28.212  49.695  110.120 1.00 36.41 ? 1   MET C N   1 
ATOM   8892  C CA  . MET C 1 1   ? 29.318  49.402  109.155 1.00 35.98 ? 1   MET C CA  1 
ATOM   8893  C C   . MET C 1 1   ? 29.733  50.672  108.410 1.00 34.81 ? 1   MET C C   1 
ATOM   8894  O O   . MET C 1 1   ? 28.905  51.533  108.099 1.00 35.17 ? 1   MET C O   1 
ATOM   8895  C CB  . MET C 1 1   ? 28.936  48.261  108.206 1.00 36.71 ? 1   MET C CB  1 
ATOM   8896  C CG  . MET C 1 1   ? 29.516  46.932  108.666 1.00 38.72 ? 1   MET C CG  1 
ATOM   8897  S SD  . MET C 1 1   ? 28.644  45.456  108.144 1.00 44.84 ? 1   MET C SD  1 
ATOM   8898  C CE  . MET C 1 1   ? 28.668  44.500  109.739 1.00 44.35 ? 1   MET C CE  1 
ATOM   8899  N N   . ALA C 1 2   ? 31.042  50.812  108.226 1.00 33.04 ? 2   ALA C N   1 
ATOM   8900  C CA  . ALA C 1 2   ? 31.634  51.967  107.567 1.00 31.58 ? 2   ALA C CA  1 
ATOM   8901  C C   . ALA C 1 2   ? 31.909  51.765  106.080 1.00 30.11 ? 2   ALA C C   1 
ATOM   8902  O O   . ALA C 1 2   ? 31.859  50.655  105.556 1.00 29.46 ? 2   ALA C O   1 
ATOM   8903  C CB  . ALA C 1 2   ? 32.930  52.334  108.289 1.00 31.17 ? 2   ALA C CB  1 
ATOM   8904  N N   . ALA C 1 3   ? 32.217  52.871  105.415 1.00 29.11 ? 3   ALA C N   1 
ATOM   8905  C CA  . ALA C 1 3   ? 32.512  52.855  103.994 1.00 28.10 ? 3   ALA C CA  1 
ATOM   8906  C C   . ALA C 1 3   ? 33.497  51.747  103.652 1.00 26.91 ? 3   ALA C C   1 
ATOM   8907  O O   . ALA C 1 3   ? 33.276  51.001  102.710 1.00 26.70 ? 3   ALA C O   1 
ATOM   8908  C CB  . ALA C 1 3   ? 33.056  54.210  103.555 1.00 28.00 ? 3   ALA C CB  1 
ATOM   8909  N N   . LEU C 1 4   ? 34.580  51.617  104.415 1.00 25.42 ? 4   LEU C N   1 
ATOM   8910  C CA  . LEU C 1 4   ? 35.599  50.632  104.067 1.00 24.35 ? 4   LEU C CA  1 
ATOM   8911  C C   . LEU C 1 4   ? 35.136  49.200  104.224 1.00 24.08 ? 4   LEU C C   1 
ATOM   8912  O O   . LEU C 1 4   ? 35.433  48.355  103.395 1.00 23.13 ? 4   LEU C O   1 
ATOM   8913  C CB  . LEU C 1 4   ? 36.883  50.812  104.894 1.00 24.07 ? 4   LEU C CB  1 
ATOM   8914  C CG  . LEU C 1 4   ? 37.941  49.717  104.647 1.00 23.14 ? 4   LEU C CG  1 
ATOM   8915  C CD1 . LEU C 1 4   ? 38.404  49.686  103.195 1.00 23.06 ? 4   LEU C CD1 1 
ATOM   8916  C CD2 . LEU C 1 4   ? 39.159  49.864  105.562 1.00 21.92 ? 4   LEU C CD2 1 
ATOM   8917  N N   . THR C 1 5   ? 34.462  48.913  105.329 1.00 23.65 ? 5   THR C N   1 
ATOM   8918  C CA  . THR C 1 5   ? 34.040  47.559  105.589 1.00 23.83 ? 5   THR C CA  1 
ATOM   8919  C C   . THR C 1 5   ? 32.951  47.152  104.590 1.00 23.80 ? 5   THR C C   1 
ATOM   8920  O O   . THR C 1 5   ? 32.850  45.985  104.242 1.00 23.49 ? 5   THR C O   1 
ATOM   8921  C CB  . THR C 1 5   ? 33.575  47.419  107.048 1.00 23.76 ? 5   THR C CB  1 
ATOM   8922  O OG1 . THR C 1 5   ? 32.833  48.572  107.440 1.00 24.74 ? 5   THR C OG1 1 
ATOM   8923  C CG2 . THR C 1 5   ? 34.765  47.468  107.962 1.00 23.36 ? 5   THR C CG2 1 
ATOM   8924  N N   . ARG C 1 6   ? 32.173  48.123  104.123 1.00 24.34 ? 6   ARG C N   1 
ATOM   8925  C CA  . ARG C 1 6   ? 31.119  47.874  103.127 1.00 25.15 ? 6   ARG C CA  1 
ATOM   8926  C C   . ARG C 1 6   ? 31.685  47.749  101.708 1.00 24.46 ? 6   ARG C C   1 
ATOM   8927  O O   . ARG C 1 6   ? 30.956  47.396  100.769 1.00 24.23 ? 6   ARG C O   1 
ATOM   8928  C CB  . ARG C 1 6   ? 30.087  49.008  103.137 1.00 25.86 ? 6   ARG C CB  1 
ATOM   8929  C CG  . ARG C 1 6   ? 29.252  49.101  104.416 1.00 28.92 ? 6   ARG C CG  1 
ATOM   8930  C CD  . ARG C 1 6   ? 28.243  50.255  104.463 1.00 33.75 ? 6   ARG C CD  1 
ATOM   8931  N NE  . ARG C 1 6   ? 28.621  51.418  103.643 1.00 38.11 ? 6   ARG C NE  1 
ATOM   8932  C CZ  . ARG C 1 6   ? 28.712  52.679  104.082 1.00 40.52 ? 6   ARG C CZ  1 
ATOM   8933  N NH1 . ARG C 1 6   ? 29.058  53.645  103.240 1.00 42.05 ? 6   ARG C NH1 1 
ATOM   8934  N NH2 . ARG C 1 6   ? 28.479  52.988  105.354 1.00 42.51 ? 6   ARG C NH2 1 
ATOM   8935  N N   . ASP C 1 7   ? 32.979  48.016  101.546 1.00 23.56 ? 7   ASP C N   1 
ATOM   8936  C CA  . ASP C 1 7   ? 33.598  48.001  100.213 1.00 22.93 ? 7   ASP C CA  1 
ATOM   8937  C C   . ASP C 1 7   ? 33.855  46.599  99.680  1.00 22.37 ? 7   ASP C C   1 
ATOM   8938  O O   . ASP C 1 7   ? 34.491  45.783  100.319 1.00 21.08 ? 7   ASP C O   1 
ATOM   8939  C CB  . ASP C 1 7   ? 34.897  48.807  100.206 1.00 23.14 ? 7   ASP C CB  1 
ATOM   8940  C CG  . ASP C 1 7   ? 35.434  49.001  98.809  1.00 22.37 ? 7   ASP C CG  1 
ATOM   8941  O OD1 . ASP C 1 7   ? 35.151  50.052  98.191  1.00 22.44 ? 7   ASP C OD1 1 
ATOM   8942  O OD2 . ASP C 1 7   ? 36.113  48.137  98.256  1.00 21.12 ? 7   ASP C OD2 1 
ATOM   8943  N N   . PRO C 1 8   ? 33.356  46.314  98.481  1.00 22.27 ? 8   PRO C N   1 
ATOM   8944  C CA  . PRO C 1 8   ? 33.513  44.973  97.913  1.00 22.25 ? 8   PRO C CA  1 
ATOM   8945  C C   . PRO C 1 8   ? 34.964  44.568  97.702  1.00 21.79 ? 8   PRO C C   1 
ATOM   8946  O O   . PRO C 1 8   ? 35.287  43.412  97.925  1.00 21.65 ? 8   PRO C O   1 
ATOM   8947  C CB  . PRO C 1 8   ? 32.786  45.043  96.569  1.00 22.41 ? 8   PRO C CB  1 
ATOM   8948  C CG  . PRO C 1 8   ? 32.265  46.427  96.423  1.00 23.21 ? 8   PRO C CG  1 
ATOM   8949  C CD  . PRO C 1 8   ? 32.626  47.235  97.609  1.00 22.17 ? 8   PRO C CD  1 
ATOM   8950  N N   . GLN C 1 9   ? 35.831  45.488  97.282  1.00 22.03 ? 9   GLN C N   1 
ATOM   8951  C CA  . GLN C 1 9   ? 37.229  45.119  97.053  1.00 22.42 ? 9   GLN C CA  1 
ATOM   8952  C C   . GLN C 1 9   ? 37.890  44.813  98.389  1.00 21.81 ? 9   GLN C C   1 
ATOM   8953  O O   . GLN C 1 9   ? 38.760  43.959  98.491  1.00 22.18 ? 9   GLN C O   1 
ATOM   8954  C CB  . GLN C 1 9   ? 38.001  46.230  96.330  1.00 22.81 ? 9   GLN C CB  1 
ATOM   8955  C CG  . GLN C 1 9   ? 37.386  46.662  95.030  1.00 24.60 ? 9   GLN C CG  1 
ATOM   8956  C CD  . GLN C 1 9   ? 36.991  45.490  94.180  1.00 28.09 ? 9   GLN C CD  1 
ATOM   8957  O OE1 . GLN C 1 9   ? 37.808  44.597  93.935  1.00 31.50 ? 9   GLN C OE1 1 
ATOM   8958  N NE2 . GLN C 1 9   ? 35.732  45.463  93.743  1.00 29.52 ? 9   GLN C NE2 1 
ATOM   8959  N N   . PHE C 1 10  ? 37.471  45.514  99.424  1.00 22.47 ? 10  PHE C N   1 
ATOM   8960  C CA  . PHE C 1 10  ? 38.037  45.264  100.743 1.00 22.27 ? 10  PHE C CA  1 
ATOM   8961  C C   . PHE C 1 10  ? 37.583  43.894  101.211 1.00 22.81 ? 10  PHE C C   1 
ATOM   8962  O O   . PHE C 1 10  ? 38.372  43.100  101.742 1.00 22.70 ? 10  PHE C O   1 
ATOM   8963  C CB  . PHE C 1 10  ? 37.595  46.326  101.735 1.00 22.68 ? 10  PHE C CB  1 
ATOM   8964  C CG  . PHE C 1 10  ? 38.128  46.096  103.117 1.00 22.48 ? 10  PHE C CG  1 
ATOM   8965  C CD1 . PHE C 1 10  ? 39.483  46.181  103.362 1.00 23.97 ? 10  PHE C CD1 1 
ATOM   8966  C CD2 . PHE C 1 10  ? 37.280  45.748  104.159 1.00 24.74 ? 10  PHE C CD2 1 
ATOM   8967  C CE1 . PHE C 1 10  ? 40.000  45.951  104.648 1.00 25.13 ? 10  PHE C CE1 1 
ATOM   8968  C CE2 . PHE C 1 10  ? 37.780  45.518  105.435 1.00 24.73 ? 10  PHE C CE2 1 
ATOM   8969  C CZ  . PHE C 1 10  ? 39.151  45.616  105.674 1.00 25.14 ? 10  PHE C CZ  1 
ATOM   8970  N N   . GLN C 1 11  ? 36.303  43.604  100.980 1.00 23.60 ? 11  GLN C N   1 
ATOM   8971  C CA  . GLN C 1 11  ? 35.739  42.309  101.379 1.00 24.16 ? 11  GLN C CA  1 
ATOM   8972  C C   . GLN C 1 11  ? 36.470  41.186  100.647 1.00 24.12 ? 11  GLN C C   1 
ATOM   8973  O O   . GLN C 1 11  ? 36.789  40.162  101.235 1.00 23.99 ? 11  GLN C O   1 
ATOM   8974  C CB  . GLN C 1 11  ? 34.220  42.276  101.144 1.00 24.42 ? 11  GLN C CB  1 
ATOM   8975  C CG  . GLN C 1 11  ? 33.482  43.423  101.855 1.00 26.17 ? 11  GLN C CG  1 
ATOM   8976  C CD  . GLN C 1 11  ? 31.978  43.251  101.939 1.00 28.31 ? 11  GLN C CD  1 
ATOM   8977  O OE1 . GLN C 1 11  ? 31.303  44.001  102.650 1.00 28.60 ? 11  GLN C OE1 1 
ATOM   8978  N NE2 . GLN C 1 11  ? 31.446  42.279  101.211 1.00 30.58 ? 11  GLN C NE2 1 
ATOM   8979  N N   . LYS C 1 12  ? 36.797  41.383  99.375  1.00 24.56 ? 12  LYS C N   1 
ATOM   8980  C CA  . LYS C 1 12  ? 37.538  40.346  98.672  1.00 25.27 ? 12  LYS C CA  1 
ATOM   8981  C C   . LYS C 1 12  ? 38.969  40.212  99.210  1.00 24.75 ? 12  LYS C C   1 
ATOM   8982  O O   . LYS C 1 12  ? 39.522  39.113  99.278  1.00 24.25 ? 12  LYS C O   1 
ATOM   8983  C CB  . LYS C 1 12  ? 37.491  40.538  97.151  1.00 25.89 ? 12  LYS C CB  1 
ATOM   8984  C CG  . LYS C 1 12  ? 38.373  41.607  96.562  1.00 29.38 ? 12  LYS C CG  1 
ATOM   8985  C CD  . LYS C 1 12  ? 38.770  41.210  95.121  1.00 32.95 ? 12  LYS C CD  1 
ATOM   8986  C CE  . LYS C 1 12  ? 39.564  42.326  94.414  1.00 34.55 ? 12  LYS C CE  1 
ATOM   8987  N NZ  . LYS C 1 12  ? 39.831  42.059  92.974  1.00 35.70 ? 12  LYS C NZ  1 
ATOM   8988  N N   . LEU C 1 13  ? 39.551  41.326  99.631  1.00 24.45 ? 13  LEU C N   1 
ATOM   8989  C CA  . LEU C 1 13  ? 40.885  41.302  100.220 1.00 24.43 ? 13  LEU C CA  1 
ATOM   8990  C C   . LEU C 1 13  ? 40.850  40.432  101.482 1.00 24.05 ? 13  LEU C C   1 
ATOM   8991  O O   . LEU C 1 13  ? 41.687  39.564  101.694 1.00 23.46 ? 13  LEU C O   1 
ATOM   8992  C CB  . LEU C 1 13  ? 41.297  42.726  100.614 1.00 24.30 ? 13  LEU C CB  1 
ATOM   8993  C CG  . LEU C 1 13  ? 42.587  43.408  100.136 1.00 25.68 ? 13  LEU C CG  1 
ATOM   8994  C CD1 . LEU C 1 13  ? 43.081  44.347  101.257 1.00 26.39 ? 13  LEU C CD1 1 
ATOM   8995  C CD2 . LEU C 1 13  ? 43.710  42.477  99.705  1.00 25.42 ? 13  LEU C CD2 1 
ATOM   8996  N N   . GLN C 1 14  ? 39.872  40.702  102.328 1.00 24.80 ? 14  GLN C N   1 
ATOM   8997  C CA  . GLN C 1 14  ? 39.704  39.983  103.587 1.00 25.53 ? 14  GLN C CA  1 
ATOM   8998  C C   . GLN C 1 14  ? 39.561  38.488  103.350 1.00 25.76 ? 14  GLN C C   1 
ATOM   8999  O O   . GLN C 1 14  ? 40.216  37.645  103.966 1.00 25.62 ? 14  GLN C O   1 
ATOM   9000  C CB  . GLN C 1 14  ? 38.431  40.467  104.268 1.00 25.84 ? 14  GLN C CB  1 
ATOM   9001  C CG  . GLN C 1 14  ? 38.394  41.926  104.665 1.00 27.10 ? 14  GLN C CG  1 
ATOM   9002  C CD  . GLN C 1 14  ? 37.200  42.227  105.579 1.00 29.30 ? 14  GLN C CD  1 
ATOM   9003  O OE1 . GLN C 1 14  ? 36.059  42.321  105.104 1.00 30.65 ? 14  GLN C OE1 1 
ATOM   9004  N NE2 . GLN C 1 14  ? 37.461  42.366  106.892 1.00 27.18 ? 14  GLN C NE2 1 
ATOM   9005  N N   . GLN C 1 15  ? 38.664  38.172  102.437 1.00 26.64 ? 15  GLN C N   1 
ATOM   9006  C CA  . GLN C 1 15  ? 38.387  36.797  102.085 1.00 27.09 ? 15  GLN C CA  1 
ATOM   9007  C C   . GLN C 1 15  ? 39.675  36.115  101.656 1.00 26.63 ? 15  GLN C C   1 
ATOM   9008  O O   . GLN C 1 15  ? 40.003  35.006  102.092 1.00 26.15 ? 15  GLN C O   1 
ATOM   9009  C CB  . GLN C 1 15  ? 37.361  36.806  100.952 1.00 28.06 ? 15  GLN C CB  1 
ATOM   9010  C CG  . GLN C 1 15  ? 36.366  35.669  100.962 1.00 31.11 ? 15  GLN C CG  1 
ATOM   9011  C CD  . GLN C 1 15  ? 36.761  34.590  100.006 1.00 35.67 ? 15  GLN C CD  1 
ATOM   9012  O OE1 . GLN C 1 15  ? 35.960  34.171  99.163  1.00 38.31 ? 15  GLN C OE1 1 
ATOM   9013  N NE2 . GLN C 1 15  ? 38.006  34.135  100.114 1.00 38.35 ? 15  GLN C NE2 1 
ATOM   9014  N N   . TRP C 1 16  ? 40.428  36.790  100.800 1.00 26.17 ? 16  TRP C N   1 
ATOM   9015  C CA  . TRP C 1 16  ? 41.649  36.205  100.297 1.00 25.83 ? 16  TRP C CA  1 
ATOM   9016  C C   . TRP C 1 16  ? 42.616  35.958  101.451 1.00 26.07 ? 16  TRP C C   1 
ATOM   9017  O O   . TRP C 1 16  ? 43.261  34.911  101.514 1.00 25.73 ? 16  TRP C O   1 
ATOM   9018  C CB  . TRP C 1 16  ? 42.268  37.109  99.226  1.00 25.76 ? 16  TRP C CB  1 
ATOM   9019  C CG  . TRP C 1 16  ? 43.390  36.472  98.495  1.00 24.89 ? 16  TRP C CG  1 
ATOM   9020  C CD1 . TRP C 1 16  ? 43.351  35.943  97.238  1.00 24.92 ? 16  TRP C CD1 1 
ATOM   9021  C CD2 . TRP C 1 16  ? 44.727  36.290  98.964  1.00 24.09 ? 16  TRP C CD2 1 
ATOM   9022  N NE1 . TRP C 1 16  ? 44.585  35.446  96.896  1.00 25.47 ? 16  TRP C NE1 1 
ATOM   9023  C CE2 . TRP C 1 16  ? 45.448  35.643  97.940  1.00 24.43 ? 16  TRP C CE2 1 
ATOM   9024  C CE3 . TRP C 1 16  ? 45.399  36.617  100.149 1.00 23.50 ? 16  TRP C CE3 1 
ATOM   9025  C CZ2 . TRP C 1 16  ? 46.793  35.314  98.064  1.00 24.68 ? 16  TRP C CZ2 1 
ATOM   9026  C CZ3 . TRP C 1 16  ? 46.734  36.279  100.271 1.00 22.84 ? 16  TRP C CZ3 1 
ATOM   9027  C CH2 . TRP C 1 16  ? 47.416  35.635  99.237  1.00 24.14 ? 16  TRP C CH2 1 
ATOM   9028  N N   . TYR C 1 17  ? 42.714  36.925  102.360 1.00 26.76 ? 17  TYR C N   1 
ATOM   9029  C CA  . TYR C 1 17  ? 43.608  36.819  103.520 1.00 27.21 ? 17  TYR C CA  1 
ATOM   9030  C C   . TYR C 1 17  ? 43.237  35.586  104.338 1.00 28.16 ? 17  TYR C C   1 
ATOM   9031  O O   . TYR C 1 17  ? 44.092  34.797  104.739 1.00 28.02 ? 17  TYR C O   1 
ATOM   9032  C CB  . TYR C 1 17  ? 43.505  38.090  104.388 1.00 26.99 ? 17  TYR C CB  1 
ATOM   9033  C CG  . TYR C 1 17  ? 44.216  38.007  105.726 1.00 25.73 ? 17  TYR C CG  1 
ATOM   9034  C CD1 . TYR C 1 17  ? 43.529  37.660  106.882 1.00 26.04 ? 17  TYR C CD1 1 
ATOM   9035  C CD2 . TYR C 1 17  ? 45.567  38.300  105.838 1.00 24.65 ? 17  TYR C CD2 1 
ATOM   9036  C CE1 . TYR C 1 17  ? 44.173  37.588  108.107 1.00 25.34 ? 17  TYR C CE1 1 
ATOM   9037  C CE2 . TYR C 1 17  ? 46.222  38.225  107.064 1.00 23.50 ? 17  TYR C CE2 1 
ATOM   9038  C CZ  . TYR C 1 17  ? 45.525  37.872  108.189 1.00 24.36 ? 17  TYR C CZ  1 
ATOM   9039  O OH  . TYR C 1 17  ? 46.177  37.791  109.402 1.00 25.07 ? 17  TYR C OH  1 
ATOM   9040  N N   . ARG C 1 18  ? 41.946  35.436  104.581 1.00 29.50 ? 18  ARG C N   1 
ATOM   9041  C CA  . ARG C 1 18  ? 41.441  34.290  105.317 1.00 31.15 ? 18  ARG C CA  1 
ATOM   9042  C C   . ARG C 1 18  ? 41.797  32.970  104.623 1.00 31.72 ? 18  ARG C C   1 
ATOM   9043  O O   . ARG C 1 18  ? 42.174  32.004  105.275 1.00 31.93 ? 18  ARG C O   1 
ATOM   9044  C CB  . ARG C 1 18  ? 39.924  34.410  105.476 1.00 31.52 ? 18  ARG C CB  1 
ATOM   9045  C CG  . ARG C 1 18  ? 39.482  35.529  106.424 1.00 33.30 ? 18  ARG C CG  1 
ATOM   9046  C CD  . ARG C 1 18  ? 38.010  35.458  106.839 1.00 35.78 ? 18  ARG C CD  1 
ATOM   9047  N NE  . ARG C 1 18  ? 37.098  35.467  105.692 1.00 37.67 ? 18  ARG C NE  1 
ATOM   9048  C CZ  . ARG C 1 18  ? 36.435  36.540  105.252 1.00 38.93 ? 18  ARG C CZ  1 
ATOM   9049  N NH1 . ARG C 1 18  ? 35.634  36.436  104.199 1.00 39.15 ? 18  ARG C NH1 1 
ATOM   9050  N NH2 . ARG C 1 18  ? 36.572  37.717  105.849 1.00 39.79 ? 18  ARG C NH2 1 
ATOM   9051  N N   . GLU C 1 19  ? 41.712  32.942  103.301 1.00 32.70 ? 19  GLU C N   1 
ATOM   9052  C CA  . GLU C 1 19  ? 41.927  31.704  102.554 1.00 33.61 ? 19  GLU C CA  1 
ATOM   9053  C C   . GLU C 1 19  ? 43.362  31.355  102.129 1.00 33.81 ? 19  GLU C C   1 
ATOM   9054  O O   . GLU C 1 19  ? 43.686  30.168  101.992 1.00 33.56 ? 19  GLU C O   1 
ATOM   9055  C CB  . GLU C 1 19  ? 41.025  31.696  101.320 1.00 33.95 ? 19  GLU C CB  1 
ATOM   9056  C CG  . GLU C 1 19  ? 39.559  31.533  101.669 1.00 35.82 ? 19  GLU C CG  1 
ATOM   9057  C CD  . GLU C 1 19  ? 38.634  31.689  100.478 1.00 38.88 ? 19  GLU C CD  1 
ATOM   9058  O OE1 . GLU C 1 19  ? 39.118  31.988  99.363  1.00 39.93 ? 19  GLU C OE1 1 
ATOM   9059  O OE2 . GLU C 1 19  ? 37.407  31.530  100.671 1.00 41.08 ? 19  GLU C OE2 1 
ATOM   9060  N N   . HIS C 1 20  ? 44.228  32.347  101.924 1.00 34.06 ? 20  HIS C N   1 
ATOM   9061  C CA  . HIS C 1 20  ? 45.556  32.050  101.383 1.00 34.23 ? 20  HIS C CA  1 
ATOM   9062  C C   . HIS C 1 20  ? 46.765  32.571  102.148 1.00 34.90 ? 20  HIS C C   1 
ATOM   9063  O O   . HIS C 1 20  ? 47.896  32.385  101.696 1.00 34.65 ? 20  HIS C O   1 
ATOM   9064  C CB  . HIS C 1 20  ? 45.640  32.587  99.957  1.00 34.51 ? 20  HIS C CB  1 
ATOM   9065  C CG  . HIS C 1 20  ? 44.493  32.173  99.089  1.00 33.79 ? 20  HIS C CG  1 
ATOM   9066  N ND1 . HIS C 1 20  ? 44.359  30.894  98.599  1.00 34.32 ? 20  HIS C ND1 1 
ATOM   9067  C CD2 . HIS C 1 20  ? 43.429  32.866  98.627  1.00 33.52 ? 20  HIS C CD2 1 
ATOM   9068  C CE1 . HIS C 1 20  ? 43.262  30.818  97.868  1.00 34.07 ? 20  HIS C CE1 1 
ATOM   9069  N NE2 . HIS C 1 20  ? 42.676  32.000  97.874  1.00 33.80 ? 20  HIS C NE2 1 
ATOM   9070  N N   . ARG C 1 21  ? 46.563  33.188  103.305 1.00 35.44 ? 21  ARG C N   1 
ATOM   9071  C CA  . ARG C 1 21  ? 47.688  33.801  103.998 1.00 36.17 ? 21  ARG C CA  1 
ATOM   9072  C C   . ARG C 1 21  ? 48.854  32.843  104.275 1.00 36.29 ? 21  ARG C C   1 
ATOM   9073  O O   . ARG C 1 21  ? 49.974  33.291  104.512 1.00 35.88 ? 21  ARG C O   1 
ATOM   9074  C CB  . ARG C 1 21  ? 47.247  34.586  105.246 1.00 36.52 ? 21  ARG C CB  1 
ATOM   9075  C CG  . ARG C 1 21  ? 46.726  33.796  106.420 1.00 38.06 ? 21  ARG C CG  1 
ATOM   9076  C CD  . ARG C 1 21  ? 46.918  34.542  107.751 1.00 41.23 ? 21  ARG C CD  1 
ATOM   9077  N NE  . ARG C 1 21  ? 48.324  34.513  108.169 1.00 43.36 ? 21  ARG C NE  1 
ATOM   9078  C CZ  . ARG C 1 21  ? 48.848  35.212  109.176 1.00 44.94 ? 21  ARG C CZ  1 
ATOM   9079  N NH1 . ARG C 1 21  ? 50.143  35.087  109.444 1.00 46.06 ? 21  ARG C NH1 1 
ATOM   9080  N NH2 . ARG C 1 21  ? 48.105  36.035  109.912 1.00 44.92 ? 21  ARG C NH2 1 
ATOM   9081  N N   . SER C 1 22  ? 48.610  31.534  104.186 1.00 36.35 ? 22  SER C N   1 
ATOM   9082  C CA  . SER C 1 22  ? 49.671  30.546  104.390 1.00 36.39 ? 22  SER C CA  1 
ATOM   9083  C C   . SER C 1 22  ? 50.708  30.505  103.265 1.00 36.08 ? 22  SER C C   1 
ATOM   9084  O O   . SER C 1 22  ? 51.834  30.073  103.495 1.00 36.27 ? 22  SER C O   1 
ATOM   9085  C CB  . SER C 1 22  ? 49.084  29.145  104.614 1.00 36.69 ? 22  SER C CB  1 
ATOM   9086  O OG  . SER C 1 22  ? 47.836  28.996  103.957 1.00 37.87 ? 22  SER C OG  1 
ATOM   9087  N N   . GLU C 1 23  ? 50.364  30.947  102.059 1.00 35.58 ? 23  GLU C N   1 
ATOM   9088  C CA  . GLU C 1 23  ? 51.375  30.974  101.000 1.00 35.69 ? 23  GLU C CA  1 
ATOM   9089  C C   . GLU C 1 23  ? 52.306  32.178  101.156 1.00 34.31 ? 23  GLU C C   1 
ATOM   9090  O O   . GLU C 1 23  ? 53.357  32.251  100.524 1.00 34.23 ? 23  GLU C O   1 
ATOM   9091  C CB  . GLU C 1 23  ? 50.790  30.894  99.576  1.00 36.27 ? 23  GLU C CB  1 
ATOM   9092  C CG  . GLU C 1 23  ? 49.630  31.803  99.232  1.00 38.88 ? 23  GLU C CG  1 
ATOM   9093  C CD  . GLU C 1 23  ? 48.587  31.081  98.381  1.00 41.45 ? 23  GLU C CD  1 
ATOM   9094  O OE1 . GLU C 1 23  ? 48.356  31.514  97.230  1.00 43.32 ? 23  GLU C OE1 1 
ATOM   9095  O OE2 . GLU C 1 23  ? 48.003  30.074  98.863  1.00 43.23 ? 23  GLU C OE2 1 
ATOM   9096  N N   . LEU C 1 24  ? 51.940  33.105  102.031 1.00 32.71 ? 24  LEU C N   1 
ATOM   9097  C CA  . LEU C 1 24  ? 52.780  34.268  102.270 1.00 31.43 ? 24  LEU C CA  1 
ATOM   9098  C C   . LEU C 1 24  ? 53.982  33.958  103.174 1.00 30.41 ? 24  LEU C C   1 
ATOM   9099  O O   . LEU C 1 24  ? 54.000  34.358  104.340 1.00 30.73 ? 24  LEU C O   1 
ATOM   9100  C CB  . LEU C 1 24  ? 51.935  35.394  102.861 1.00 30.99 ? 24  LEU C CB  1 
ATOM   9101  C CG  . LEU C 1 24  ? 50.713  35.710  102.002 1.00 30.88 ? 24  LEU C CG  1 
ATOM   9102  C CD1 . LEU C 1 24  ? 49.751  36.605  102.743 1.00 30.83 ? 24  LEU C CD1 1 
ATOM   9103  C CD2 . LEU C 1 24  ? 51.157  36.349  100.672 1.00 30.99 ? 24  LEU C CD2 1 
ATOM   9104  N N   . ASN C 1 25  ? 54.971  33.241  102.634 1.00 28.98 ? 25  ASN C N   1 
ATOM   9105  C CA  . ASN C 1 25  ? 56.239  32.997  103.321 1.00 28.19 ? 25  ASN C CA  1 
ATOM   9106  C C   . ASN C 1 25  ? 57.363  33.552  102.453 1.00 27.31 ? 25  ASN C C   1 
ATOM   9107  O O   . ASN C 1 25  ? 57.645  33.028  101.374 1.00 26.87 ? 25  ASN C O   1 
ATOM   9108  C CB  . ASN C 1 25  ? 56.481  31.510  103.593 1.00 28.07 ? 25  ASN C CB  1 
ATOM   9109  C CG  . ASN C 1 25  ? 57.855  31.245  104.199 1.00 27.99 ? 25  ASN C CG  1 
ATOM   9110  O OD1 . ASN C 1 25  ? 58.847  31.090  103.484 1.00 28.72 ? 25  ASN C OD1 1 
ATOM   9111  N ND2 . ASN C 1 25  ? 57.919  31.192  105.521 1.00 29.44 ? 25  ASN C ND2 1 
ATOM   9112  N N   . LEU C 1 26  ? 58.006  34.613  102.923 1.00 26.56 ? 26  LEU C N   1 
ATOM   9113  C CA  . LEU C 1 26  ? 59.023  35.298  102.122 1.00 25.72 ? 26  LEU C CA  1 
ATOM   9114  C C   . LEU C 1 26  ? 60.112  34.387  101.583 1.00 25.85 ? 26  LEU C C   1 
ATOM   9115  O O   . LEU C 1 26  ? 60.460  34.468  100.408 1.00 25.00 ? 26  LEU C O   1 
ATOM   9116  C CB  . LEU C 1 26  ? 59.639  36.456  102.913 1.00 25.11 ? 26  LEU C CB  1 
ATOM   9117  C CG  . LEU C 1 26  ? 58.609  37.548  103.222 1.00 25.26 ? 26  LEU C CG  1 
ATOM   9118  C CD1 . LEU C 1 26  ? 59.135  38.653  104.142 1.00 23.51 ? 26  LEU C CD1 1 
ATOM   9119  C CD2 . LEU C 1 26  ? 58.083  38.154  101.920 1.00 25.41 ? 26  LEU C CD2 1 
ATOM   9120  N N   . ARG C 1 27  ? 60.657  33.522  102.428 1.00 25.76 ? 27  ARG C N   1 
ATOM   9121  C CA  . ARG C 1 27  ? 61.732  32.650  101.985 1.00 26.49 ? 27  ARG C CA  1 
ATOM   9122  C C   . ARG C 1 27  ? 61.307  31.865  100.744 1.00 26.85 ? 27  ARG C C   1 
ATOM   9123  O O   . ARG C 1 27  ? 62.044  31.788  99.764  1.00 26.98 ? 27  ARG C O   1 
ATOM   9124  C CB  . ARG C 1 27  ? 62.142  31.687  103.105 1.00 26.34 ? 27  ARG C CB  1 
ATOM   9125  C CG  . ARG C 1 27  ? 63.633  31.615  103.317 1.00 26.03 ? 27  ARG C CG  1 
ATOM   9126  C CD  . ARG C 1 27  ? 64.064  30.478  104.207 1.00 26.85 ? 27  ARG C CD  1 
ATOM   9127  N NE  . ARG C 1 27  ? 64.974  30.897  105.267 1.00 27.68 ? 27  ARG C NE  1 
ATOM   9128  C CZ  . ARG C 1 27  ? 65.959  30.147  105.753 1.00 27.67 ? 27  ARG C CZ  1 
ATOM   9129  N NH1 . ARG C 1 27  ? 66.194  28.936  105.250 1.00 28.37 ? 27  ARG C NH1 1 
ATOM   9130  N NH2 . ARG C 1 27  ? 66.720  30.612  106.740 1.00 26.09 ? 27  ARG C NH2 1 
ATOM   9131  N N   . ARG C 1 28  ? 60.105  31.303  100.807 1.00 27.37 ? 28  ARG C N   1 
ATOM   9132  C CA  . ARG C 1 28  ? 59.518  30.509  99.727  1.00 27.99 ? 28  ARG C CA  1 
ATOM   9133  C C   . ARG C 1 28  ? 59.278  31.359  98.483  1.00 27.54 ? 28  ARG C C   1 
ATOM   9134  O O   . ARG C 1 28  ? 59.584  30.955  97.349  1.00 27.53 ? 28  ARG C O   1 
ATOM   9135  C CB  . ARG C 1 28  ? 58.188  29.937  100.227 1.00 28.52 ? 28  ARG C CB  1 
ATOM   9136  C CG  . ARG C 1 28  ? 57.361  29.137  99.219  1.00 31.26 ? 28  ARG C CG  1 
ATOM   9137  C CD  . ARG C 1 28  ? 56.061  28.585  99.825  1.00 34.05 ? 28  ARG C CD  1 
ATOM   9138  N NE  . ARG C 1 28  ? 56.263  28.221  101.232 1.00 36.10 ? 28  ARG C NE  1 
ATOM   9139  C CZ  . ARG C 1 28  ? 55.392  28.441  102.216 1.00 37.27 ? 28  ARG C CZ  1 
ATOM   9140  N NH1 . ARG C 1 28  ? 54.218  29.012  101.976 1.00 37.49 ? 28  ARG C NH1 1 
ATOM   9141  N NH2 . ARG C 1 28  ? 55.707  28.089  103.460 1.00 37.87 ? 28  ARG C NH2 1 
ATOM   9142  N N   . LEU C 1 29  ? 58.729  32.546  98.700  1.00 26.73 ? 29  LEU C N   1 
ATOM   9143  C CA  . LEU C 1 29  ? 58.418  33.449  97.597  1.00 26.57 ? 29  LEU C CA  1 
ATOM   9144  C C   . LEU C 1 29  ? 59.648  33.834  96.788  1.00 26.01 ? 29  LEU C C   1 
ATOM   9145  O O   . LEU C 1 29  ? 59.600  33.802  95.560  1.00 25.66 ? 29  LEU C O   1 
ATOM   9146  C CB  . LEU C 1 29  ? 57.719  34.699  98.111  1.00 26.44 ? 29  LEU C CB  1 
ATOM   9147  C CG  . LEU C 1 29  ? 56.315  34.456  98.664  1.00 27.37 ? 29  LEU C CG  1 
ATOM   9148  C CD1 . LEU C 1 29  ? 55.748  35.712  99.295  1.00 28.13 ? 29  LEU C CD1 1 
ATOM   9149  C CD2 . LEU C 1 29  ? 55.388  33.955  97.584  1.00 29.20 ? 29  LEU C CD2 1 
ATOM   9150  N N   . PHE C 1 30  ? 60.727  34.225  97.463  1.00 25.32 ? 30  PHE C N   1 
ATOM   9151  C CA  . PHE C 1 30  ? 61.963  34.577  96.772  1.00 25.49 ? 30  PHE C CA  1 
ATOM   9152  C C   . PHE C 1 30  ? 62.629  33.356  96.111  1.00 26.43 ? 30  PHE C C   1 
ATOM   9153  O O   . PHE C 1 30  ? 63.225  33.471  95.042  1.00 25.98 ? 30  PHE C O   1 
ATOM   9154  C CB  . PHE C 1 30  ? 62.940  35.285  97.716  1.00 25.06 ? 30  PHE C CB  1 
ATOM   9155  C CG  . PHE C 1 30  ? 62.628  36.744  97.901  1.00 22.72 ? 30  PHE C CG  1 
ATOM   9156  C CD1 . PHE C 1 30  ? 61.912  37.178  98.994  1.00 20.27 ? 30  PHE C CD1 1 
ATOM   9157  C CD2 . PHE C 1 30  ? 63.013  37.670  96.942  1.00 22.06 ? 30  PHE C CD2 1 
ATOM   9158  C CE1 . PHE C 1 30  ? 61.589  38.524  99.139  1.00 19.38 ? 30  PHE C CE1 1 
ATOM   9159  C CE2 . PHE C 1 30  ? 62.715  39.018  97.090  1.00 20.86 ? 30  PHE C CE2 1 
ATOM   9160  C CZ  . PHE C 1 30  ? 62.000  39.439  98.197  1.00 19.47 ? 30  PHE C CZ  1 
ATOM   9161  N N   . ASP C 1 31  ? 62.532  32.198  96.750  1.00 27.31 ? 31  ASP C N   1 
ATOM   9162  C CA  . ASP C 1 31  ? 63.085  30.971  96.176  1.00 28.28 ? 31  ASP C CA  1 
ATOM   9163  C C   . ASP C 1 31  ? 62.337  30.580  94.895  1.00 28.29 ? 31  ASP C C   1 
ATOM   9164  O O   . ASP C 1 31  ? 62.938  30.050  93.953  1.00 28.66 ? 31  ASP C O   1 
ATOM   9165  C CB  . ASP C 1 31  ? 63.043  29.837  97.207  1.00 28.70 ? 31  ASP C CB  1 
ATOM   9166  C CG  . ASP C 1 31  ? 64.219  29.874  98.164  1.00 30.08 ? 31  ASP C CG  1 
ATOM   9167  O OD1 . ASP C 1 31  ? 65.078  30.770  98.032  1.00 33.73 ? 31  ASP C OD1 1 
ATOM   9168  O OD2 . ASP C 1 31  ? 64.387  29.046  99.080  1.00 32.29 ? 31  ASP C OD2 1 
ATOM   9169  N N   . ALA C 1 32  ? 61.045  30.884  94.837  1.00 28.61 ? 32  ALA C N   1 
ATOM   9170  C CA  . ALA C 1 32  ? 60.216  30.545  93.680  1.00 28.82 ? 32  ALA C CA  1 
ATOM   9171  C C   . ALA C 1 32  ? 60.135  31.606  92.555  1.00 29.44 ? 32  ALA C C   1 
ATOM   9172  O O   . ALA C 1 32  ? 59.814  31.258  91.425  1.00 29.76 ? 32  ALA C O   1 
ATOM   9173  C CB  . ALA C 1 32  ? 58.816  30.183  94.142  1.00 28.82 ? 32  ALA C CB  1 
ATOM   9174  N N   . ASN C 1 33  ? 60.399  32.882  92.852  1.00 29.94 ? 33  ASN C N   1 
ATOM   9175  C CA  . ASN C 1 33  ? 60.339  33.960  91.845  1.00 29.80 ? 33  ASN C CA  1 
ATOM   9176  C C   . ASN C 1 33  ? 61.655  34.739  91.814  1.00 29.75 ? 33  ASN C C   1 
ATOM   9177  O O   . ASN C 1 33  ? 61.859  35.688  92.583  1.00 29.07 ? 33  ASN C O   1 
ATOM   9178  C CB  . ASN C 1 33  ? 59.158  34.917  92.128  1.00 30.18 ? 33  ASN C CB  1 
ATOM   9179  C CG  . ASN C 1 33  ? 59.035  36.077  91.092  1.00 31.23 ? 33  ASN C CG  1 
ATOM   9180  O OD1 . ASN C 1 33  ? 59.728  36.107  90.060  1.00 30.94 ? 33  ASN C OD1 1 
ATOM   9181  N ND2 . ASN C 1 33  ? 58.121  37.024  91.373  1.00 32.46 ? 33  ASN C ND2 1 
ATOM   9182  N N   . LYS C 1 34  ? 62.547  34.335  90.919  1.00 29.41 ? 34  LYS C N   1 
ATOM   9183  C CA  . LYS C 1 34  ? 63.849  34.975  90.794  1.00 29.70 ? 34  LYS C CA  1 
ATOM   9184  C C   . LYS C 1 34  ? 63.758  36.465  90.423  1.00 28.63 ? 34  LYS C C   1 
ATOM   9185  O O   . LYS C 1 34  ? 64.697  37.224  90.657  1.00 28.76 ? 34  LYS C O   1 
ATOM   9186  C CB  . LYS C 1 34  ? 64.699  34.203  89.777  1.00 30.73 ? 34  LYS C CB  1 
ATOM   9187  C CG  . LYS C 1 34  ? 66.168  34.614  89.718  1.00 33.51 ? 34  LYS C CG  1 
ATOM   9188  C CD  . LYS C 1 34  ? 67.121  33.409  89.868  1.00 37.08 ? 34  LYS C CD  1 
ATOM   9189  C CE  . LYS C 1 34  ? 67.873  33.422  91.214  1.00 38.74 ? 34  LYS C CE  1 
ATOM   9190  N NZ  . LYS C 1 34  ? 69.017  34.404  91.240  1.00 40.13 ? 34  LYS C NZ  1 
ATOM   9191  N N   . ASP C 1 35  ? 62.649  36.895  89.845  1.00 27.14 ? 35  ASP C N   1 
ATOM   9192  C CA  . ASP C 1 35  ? 62.526  38.312  89.525  1.00 26.83 ? 35  ASP C CA  1 
ATOM   9193  C C   . ASP C 1 35  ? 61.543  39.014  90.451  1.00 24.62 ? 35  ASP C C   1 
ATOM   9194  O O   . ASP C 1 35  ? 60.917  40.015  90.082  1.00 24.39 ? 35  ASP C O   1 
ATOM   9195  C CB  . ASP C 1 35  ? 62.152  38.535  88.069  1.00 28.13 ? 35  ASP C CB  1 
ATOM   9196  C CG  . ASP C 1 35  ? 61.070  37.629  87.612  1.00 30.92 ? 35  ASP C CG  1 
ATOM   9197  O OD1 . ASP C 1 35  ? 61.326  36.892  86.626  1.00 36.17 ? 35  ASP C OD1 1 
ATOM   9198  O OD2 . ASP C 1 35  ? 59.939  37.583  88.161  1.00 36.45 ? 35  ASP C OD2 1 
ATOM   9199  N N   . ARG C 1 36  ? 61.442  38.503  91.672  1.00 21.91 ? 36  ARG C N   1 
ATOM   9200  C CA  . ARG C 1 36  ? 60.545  39.092  92.648  1.00 20.43 ? 36  ARG C CA  1 
ATOM   9201  C C   . ARG C 1 36  ? 60.955  40.539  92.915  1.00 19.16 ? 36  ARG C C   1 
ATOM   9202  O O   . ARG C 1 36  ? 60.101  41.406  93.057  1.00 18.67 ? 36  ARG C O   1 
ATOM   9203  C CB  . ARG C 1 36  ? 60.556  38.293  93.955  1.00 19.92 ? 36  ARG C CB  1 
ATOM   9204  C CG  . ARG C 1 36  ? 59.529  38.773  94.953  1.00 19.20 ? 36  ARG C CG  1 
ATOM   9205  C CD  . ARG C 1 36  ? 59.510  38.012  96.247  1.00 18.26 ? 36  ARG C CD  1 
ATOM   9206  N NE  . ARG C 1 36  ? 58.668  38.670  97.229  1.00 17.57 ? 36  ARG C NE  1 
ATOM   9207  C CZ  . ARG C 1 36  ? 57.351  38.609  97.248  1.00 17.71 ? 36  ARG C CZ  1 
ATOM   9208  N NH1 . ARG C 1 36  ? 56.690  37.896  96.340  1.00 17.25 ? 36  ARG C NH1 1 
ATOM   9209  N NH2 . ARG C 1 36  ? 56.680  39.257  98.195  1.00 17.45 ? 36  ARG C NH2 1 
ATOM   9210  N N   . PHE C 1 37  ? 62.253  40.801  92.990  1.00 18.43 ? 37  PHE C N   1 
ATOM   9211  C CA  . PHE C 1 37  ? 62.696  42.171  93.240  1.00 18.61 ? 37  PHE C CA  1 
ATOM   9212  C C   . PHE C 1 37  ? 62.236  43.085  92.111  1.00 18.90 ? 37  PHE C C   1 
ATOM   9213  O O   . PHE C 1 37  ? 61.715  44.178  92.345  1.00 18.66 ? 37  PHE C O   1 
ATOM   9214  C CB  . PHE C 1 37  ? 64.213  42.243  93.392  1.00 18.49 ? 37  PHE C CB  1 
ATOM   9215  C CG  . PHE C 1 37  ? 64.754  43.644  93.368  1.00 17.75 ? 37  PHE C CG  1 
ATOM   9216  C CD1 . PHE C 1 37  ? 64.668  44.444  94.487  1.00 17.56 ? 37  PHE C CD1 1 
ATOM   9217  C CD2 . PHE C 1 37  ? 65.345  44.159  92.225  1.00 18.55 ? 37  PHE C CD2 1 
ATOM   9218  C CE1 . PHE C 1 37  ? 65.163  45.732  94.471  1.00 17.07 ? 37  PHE C CE1 1 
ATOM   9219  C CE2 . PHE C 1 37  ? 65.844  45.448  92.198  1.00 18.64 ? 37  PHE C CE2 1 
ATOM   9220  C CZ  . PHE C 1 37  ? 65.751  46.240  93.329  1.00 18.67 ? 37  PHE C CZ  1 
ATOM   9221  N N   . ASN C 1 38  ? 62.414  42.630  90.877  1.00 19.00 ? 38  ASN C N   1 
ATOM   9222  C CA  . ASN C 1 38  ? 62.010  43.422  89.728  1.00 19.56 ? 38  ASN C CA  1 
ATOM   9223  C C   . ASN C 1 38  ? 60.513  43.696  89.717  1.00 19.09 ? 38  ASN C C   1 
ATOM   9224  O O   . ASN C 1 38  ? 60.093  44.786  89.373  1.00 19.33 ? 38  ASN C O   1 
ATOM   9225  C CB  . ASN C 1 38  ? 62.434  42.757  88.414  1.00 20.13 ? 38  ASN C CB  1 
ATOM   9226  C CG  . ASN C 1 38  ? 63.932  42.720  88.241  1.00 22.63 ? 38  ASN C CG  1 
ATOM   9227  O OD1 . ASN C 1 38  ? 64.639  43.627  88.684  1.00 27.42 ? 38  ASN C OD1 1 
ATOM   9228  N ND2 . ASN C 1 38  ? 64.434  41.673  87.594  1.00 24.96 ? 38  ASN C ND2 1 
ATOM   9229  N N   . HIS C 1 39  ? 59.705  42.731  90.128  1.00 18.74 ? 39  HIS C N   1 
ATOM   9230  C CA  . HIS C 1 39  ? 58.259  42.905  90.100  1.00 18.94 ? 39  HIS C CA  1 
ATOM   9231  C C   . HIS C 1 39  ? 57.681  43.729  91.265  1.00 17.86 ? 39  HIS C C   1 
ATOM   9232  O O   . HIS C 1 39  ? 56.573  44.233  91.170  1.00 17.72 ? 39  HIS C O   1 
ATOM   9233  C CB  . HIS C 1 39  ? 57.575  41.540  90.085  1.00 20.08 ? 39  HIS C CB  1 
ATOM   9234  C CG  . HIS C 1 39  ? 57.779  40.769  88.814  1.00 23.94 ? 39  HIS C CG  1 
ATOM   9235  N ND1 . HIS C 1 39  ? 56.964  39.716  88.446  1.00 28.65 ? 39  HIS C ND1 1 
ATOM   9236  C CD2 . HIS C 1 39  ? 58.690  40.904  87.821  1.00 27.56 ? 39  HIS C CD2 1 
ATOM   9237  C CE1 . HIS C 1 39  ? 57.376  39.224  87.289  1.00 27.94 ? 39  HIS C CE1 1 
ATOM   9238  N NE2 . HIS C 1 39  ? 58.419  39.929  86.887  1.00 29.14 ? 39  HIS C NE2 1 
ATOM   9239  N N   . PHE C 1 40  ? 58.421  43.863  92.358  1.00 16.59 ? 40  PHE C N   1 
ATOM   9240  C CA  . PHE C 1 40  ? 57.890  44.537  93.540  1.00 15.72 ? 40  PHE C CA  1 
ATOM   9241  C C   . PHE C 1 40  ? 58.817  45.673  94.025  1.00 15.10 ? 40  PHE C C   1 
ATOM   9242  O O   . PHE C 1 40  ? 59.152  45.777  95.204  1.00 13.19 ? 40  PHE C O   1 
ATOM   9243  C CB  . PHE C 1 40  ? 57.657  43.512  94.666  1.00 16.22 ? 40  PHE C CB  1 
ATOM   9244  C CG  . PHE C 1 40  ? 56.609  42.445  94.348  1.00 17.36 ? 40  PHE C CG  1 
ATOM   9245  C CD1 . PHE C 1 40  ? 56.985  41.182  93.911  1.00 20.20 ? 40  PHE C CD1 1 
ATOM   9246  C CD2 . PHE C 1 40  ? 55.263  42.694  94.522  1.00 19.88 ? 40  PHE C CD2 1 
ATOM   9247  C CE1 . PHE C 1 40  ? 56.035  40.199  93.625  1.00 19.43 ? 40  PHE C CE1 1 
ATOM   9248  C CE2 . PHE C 1 40  ? 54.295  41.703  94.239  1.00 21.22 ? 40  PHE C CE2 1 
ATOM   9249  C CZ  . PHE C 1 40  ? 54.694  40.460  93.795  1.00 19.53 ? 40  PHE C CZ  1 
ATOM   9250  N N   . SER C 1 41  ? 59.257  46.495  93.088  1.00 14.84 ? 41  SER C N   1 
ATOM   9251  C CA  . SER C 1 41  ? 60.059  47.650  93.412  1.00 14.67 ? 41  SER C CA  1 
ATOM   9252  C C   . SER C 1 41  ? 59.836  48.708  92.348  1.00 15.10 ? 41  SER C C   1 
ATOM   9253  O O   . SER C 1 41  ? 59.425  48.411  91.227  1.00 13.77 ? 41  SER C O   1 
ATOM   9254  C CB  . SER C 1 41  ? 61.541  47.291  93.495  1.00 15.15 ? 41  SER C CB  1 
ATOM   9255  O OG  . SER C 1 41  ? 62.062  46.859  92.246  1.00 15.47 ? 41  SER C OG  1 
ATOM   9256  N N   . LEU C 1 42  ? 60.112  49.941  92.715  1.00 14.76 ? 42  LEU C N   1 
ATOM   9257  C CA  . LEU C 1 42  ? 60.014  51.060  91.806  1.00 15.70 ? 42  LEU C CA  1 
ATOM   9258  C C   . LEU C 1 42  ? 61.341  51.783  91.859  1.00 15.53 ? 42  LEU C C   1 
ATOM   9259  O O   . LEU C 1 42  ? 61.949  51.895  92.920  1.00 14.00 ? 42  LEU C O   1 
ATOM   9260  C CB  . LEU C 1 42  ? 58.939  52.045  92.287  1.00 15.64 ? 42  LEU C CB  1 
ATOM   9261  C CG  . LEU C 1 42  ? 57.588  51.509  92.755  1.00 17.53 ? 42  LEU C CG  1 
ATOM   9262  C CD1 . LEU C 1 42  ? 56.786  52.585  93.448  1.00 18.66 ? 42  LEU C CD1 1 
ATOM   9263  C CD2 . LEU C 1 42  ? 56.820  50.962  91.583  1.00 18.46 ? 42  LEU C CD2 1 
ATOM   9264  N N   . THR C 1 43  ? 61.783  52.298  90.728  1.00 15.90 ? 43  THR C N   1 
ATOM   9265  C CA  . THR C 1 43  ? 62.951  53.146  90.732  1.00 17.24 ? 43  THR C CA  1 
ATOM   9266  C C   . THR C 1 43  ? 62.516  54.454  90.128  1.00 16.43 ? 43  THR C C   1 
ATOM   9267  O O   . THR C 1 43  ? 61.993  54.481  89.020  1.00 17.43 ? 43  THR C O   1 
ATOM   9268  C CB  . THR C 1 43  ? 64.071  52.544  89.918  1.00 17.68 ? 43  THR C CB  1 
ATOM   9269  O OG1 . THR C 1 43  ? 63.688  52.541  88.538  1.00 23.25 ? 43  THR C OG1 1 
ATOM   9270  C CG2 . THR C 1 43  ? 64.288  51.117  90.272  1.00 18.29 ? 43  THR C CG2 1 
ATOM   9271  N N   . LEU C 1 44  ? 62.691  55.536  90.868  1.00 16.05 ? 44  LEU C N   1 
ATOM   9272  C CA  . LEU C 1 44  ? 62.298  56.849  90.402  1.00 15.62 ? 44  LEU C CA  1 
ATOM   9273  C C   . LEU C 1 44  ? 63.531  57.721  90.157  1.00 14.92 ? 44  LEU C C   1 
ATOM   9274  O O   . LEU C 1 44  ? 64.397  57.867  91.049  1.00 15.08 ? 44  LEU C O   1 
ATOM   9275  C CB  . LEU C 1 44  ? 61.390  57.509  91.432  1.00 16.23 ? 44  LEU C CB  1 
ATOM   9276  C CG  . LEU C 1 44  ? 60.201  56.689  91.959  1.00 17.48 ? 44  LEU C CG  1 
ATOM   9277  C CD1 . LEU C 1 44  ? 59.419  57.524  92.938  1.00 19.24 ? 44  LEU C CD1 1 
ATOM   9278  C CD2 . LEU C 1 44  ? 59.307  56.269  90.831  1.00 20.41 ? 44  LEU C CD2 1 
ATOM   9279  N N   . ASN C 1 45  ? 63.640  58.266  88.948  1.00 12.63 ? 45  ASN C N   1 
ATOM   9280  C CA  . ASN C 1 45  ? 64.716  59.183  88.632  1.00 12.36 ? 45  ASN C CA  1 
ATOM   9281  C C   . ASN C 1 45  ? 64.151  60.605  88.721  1.00 11.17 ? 45  ASN C C   1 
ATOM   9282  O O   . ASN C 1 45  ? 63.332  60.992  87.912  1.00 11.57 ? 45  ASN C O   1 
ATOM   9283  C CB  . ASN C 1 45  ? 65.316  58.925  87.235  1.00 11.34 ? 45  ASN C CB  1 
ATOM   9284  C CG  . ASN C 1 45  ? 66.391  59.933  86.877  1.00 12.06 ? 45  ASN C CG  1 
ATOM   9285  O OD1 . ASN C 1 45  ? 66.798  60.738  87.730  1.00 10.71 ? 45  ASN C OD1 1 
ATOM   9286  N ND2 . ASN C 1 45  ? 66.857  59.913  85.617  1.00 11.67 ? 45  ASN C ND2 1 
ATOM   9287  N N   . THR C 1 46  ? 64.551  61.363  89.729  1.00 10.63 ? 46  THR C N   1 
ATOM   9288  C CA  . THR C 1 46  ? 64.032  62.719  89.892  1.00 10.44 ? 46  THR C CA  1 
ATOM   9289  C C   . THR C 1 46  ? 64.822  63.790  89.150  1.00 10.45 ? 46  THR C C   1 
ATOM   9290  O O   . THR C 1 46  ? 64.477  64.977  89.242  1.00 9.59  ? 46  THR C O   1 
ATOM   9291  C CB  . THR C 1 46  ? 64.090  63.142  91.366  1.00 10.75 ? 46  THR C CB  1 
ATOM   9292  O OG1 . THR C 1 46  ? 65.466  63.284  91.756  1.00 10.09 ? 46  THR C OG1 1 
ATOM   9293  C CG2 . THR C 1 46  ? 63.519  62.084  92.291  1.00 10.33 ? 46  THR C CG2 1 
ATOM   9294  N N   . ASN C 1 47  ? 65.886  63.373  88.462  1.00 10.39 ? 47  ASN C N   1 
ATOM   9295  C CA  . ASN C 1 47  ? 66.863  64.260  87.840  1.00 10.93 ? 47  ASN C CA  1 
ATOM   9296  C C   . ASN C 1 47  ? 67.855  64.870  88.817  1.00 10.91 ? 47  ASN C C   1 
ATOM   9297  O O   . ASN C 1 47  ? 68.824  65.520  88.392  1.00 10.05 ? 47  ASN C O   1 
ATOM   9298  C CB  . ASN C 1 47  ? 66.198  65.354  86.990  1.00 11.17 ? 47  ASN C CB  1 
ATOM   9299  C CG  . ASN C 1 47  ? 65.615  64.791  85.735  1.00 13.04 ? 47  ASN C CG  1 
ATOM   9300  O OD1 . ASN C 1 47  ? 66.072  63.741  85.257  1.00 12.80 ? 47  ASN C OD1 1 
ATOM   9301  N ND2 . ASN C 1 47  ? 64.603  65.467  85.179  1.00 13.08 ? 47  ASN C ND2 1 
ATOM   9302  N N   . HIS C 1 48  ? 67.604  64.652  90.103  1.00 10.47 ? 48  HIS C N   1 
ATOM   9303  C CA  . HIS C 1 48  ? 68.455  65.144  91.173  1.00 11.21 ? 48  HIS C CA  1 
ATOM   9304  C C   . HIS C 1 48  ? 68.711  64.018  92.174  1.00 11.34 ? 48  HIS C C   1 
ATOM   9305  O O   . HIS C 1 48  ? 68.859  64.248  93.382  1.00 11.30 ? 48  HIS C O   1 
ATOM   9306  C CB  . HIS C 1 48  ? 67.790  66.331  91.858  1.00 11.67 ? 48  HIS C CB  1 
ATOM   9307  C CG  . HIS C 1 48  ? 67.452  67.444  90.920  1.00 12.89 ? 48  HIS C CG  1 
ATOM   9308  N ND1 . HIS C 1 48  ? 68.415  68.244  90.342  1.00 17.17 ? 48  HIS C ND1 1 
ATOM   9309  C CD2 . HIS C 1 48  ? 66.267  67.860  90.419  1.00 15.58 ? 48  HIS C CD2 1 
ATOM   9310  C CE1 . HIS C 1 48  ? 67.833  69.122  89.546  1.00 16.66 ? 48  HIS C CE1 1 
ATOM   9311  N NE2 . HIS C 1 48  ? 66.528  68.915  89.581  1.00 15.66 ? 48  HIS C NE2 1 
ATOM   9312  N N   . GLY C 1 49  ? 68.793  62.806  91.646  1.00 11.14 ? 49  GLY C N   1 
ATOM   9313  C CA  . GLY C 1 49  ? 68.969  61.619  92.450  1.00 11.00 ? 49  GLY C CA  1 
ATOM   9314  C C   . GLY C 1 49  ? 67.874  60.615  92.152  1.00 11.02 ? 49  GLY C C   1 
ATOM   9315  O O   . GLY C 1 49  ? 66.794  60.982  91.709  1.00 10.92 ? 49  GLY C O   1 
ATOM   9316  N N   . HIS C 1 50  ? 68.179  59.343  92.371  1.00 10.95 ? 50  HIS C N   1 
ATOM   9317  C CA  . HIS C 1 50  ? 67.224  58.263  92.209  1.00 10.82 ? 50  HIS C CA  1 
ATOM   9318  C C   . HIS C 1 50  ? 66.704  57.802  93.577  1.00 11.14 ? 50  HIS C C   1 
ATOM   9319  O O   . HIS C 1 50  ? 67.418  57.884  94.580  1.00 10.73 ? 50  HIS C O   1 
ATOM   9320  C CB  . HIS C 1 50  ? 67.867  57.061  91.501  1.00 10.94 ? 50  HIS C CB  1 
ATOM   9321  C CG  . HIS C 1 50  ? 68.071  57.259  90.032  1.00 11.03 ? 50  HIS C CG  1 
ATOM   9322  N ND1 . HIS C 1 50  ? 68.897  58.241  89.522  1.00 12.50 ? 50  HIS C ND1 1 
ATOM   9323  C CD2 . HIS C 1 50  ? 67.579  56.588  88.960  1.00 11.65 ? 50  HIS C CD2 1 
ATOM   9324  C CE1 . HIS C 1 50  ? 68.879  58.186  88.198  1.00 12.16 ? 50  HIS C CE1 1 
ATOM   9325  N NE2 . HIS C 1 50  ? 68.077  57.201  87.830  1.00 9.65  ? 50  HIS C NE2 1 
ATOM   9326  N N   . ILE C 1 51  ? 65.462  57.334  93.587  1.00 10.52 ? 51  ILE C N   1 
ATOM   9327  C CA  . ILE C 1 51  ? 64.860  56.700  94.750  1.00 10.82 ? 51  ILE C CA  1 
ATOM   9328  C C   . ILE C 1 51  ? 64.471  55.270  94.367  1.00 11.28 ? 51  ILE C C   1 
ATOM   9329  O O   . ILE C 1 51  ? 63.756  55.067  93.397  1.00 11.58 ? 51  ILE C O   1 
ATOM   9330  C CB  . ILE C 1 51  ? 63.598  57.416  95.203  1.00 10.82 ? 51  ILE C CB  1 
ATOM   9331  C CG1 . ILE C 1 51  ? 63.835  58.925  95.348  1.00 10.11 ? 51  ILE C CG1 1 
ATOM   9332  C CG2 . ILE C 1 51  ? 63.107  56.749  96.501  1.00 11.81 ? 51  ILE C CG2 1 
ATOM   9333  C CD1 . ILE C 1 51  ? 62.619  59.697  95.800  1.00 12.73 ? 51  ILE C CD1 1 
ATOM   9334  N N   . LEU C 1 52  ? 64.975  54.289  95.095  1.00 11.28 ? 52  LEU C N   1 
ATOM   9335  C CA  . LEU C 1 52  ? 64.539  52.918  94.918  1.00 12.08 ? 52  LEU C CA  1 
ATOM   9336  C C   . LEU C 1 52  ? 63.594  52.590  96.059  1.00 12.13 ? 52  LEU C C   1 
ATOM   9337  O O   . LEU C 1 52  ? 64.014  52.596  97.205  1.00 12.25 ? 52  LEU C O   1 
ATOM   9338  C CB  . LEU C 1 52  ? 65.716  51.955  94.967  1.00 12.22 ? 52  LEU C CB  1 
ATOM   9339  C CG  . LEU C 1 52  ? 65.435  50.461  95.145  1.00 13.03 ? 52  LEU C CG  1 
ATOM   9340  C CD1 . LEU C 1 52  ? 64.527  49.896  94.013  1.00 13.36 ? 52  LEU C CD1 1 
ATOM   9341  C CD2 . LEU C 1 52  ? 66.758  49.712  95.176  1.00 14.71 ? 52  LEU C CD2 1 
ATOM   9342  N N   . VAL C 1 53  ? 62.328  52.326  95.730  1.00 12.19 ? 53  VAL C N   1 
ATOM   9343  C CA  . VAL C 1 53  ? 61.316  51.903  96.699  1.00 12.16 ? 53  VAL C CA  1 
ATOM   9344  C C   . VAL C 1 53  ? 61.121  50.404  96.488  1.00 12.14 ? 53  VAL C C   1 
ATOM   9345  O O   . VAL C 1 53  ? 60.372  49.963  95.592  1.00 12.02 ? 53  VAL C O   1 
ATOM   9346  C CB  . VAL C 1 53  ? 59.976  52.639  96.528  1.00 12.32 ? 53  VAL C CB  1 
ATOM   9347  C CG1 . VAL C 1 53  ? 58.946  52.148  97.529  1.00 12.64 ? 53  VAL C CG1 1 
ATOM   9348  C CG2 . VAL C 1 53  ? 60.156  54.155  96.665  1.00 13.06 ? 53  VAL C CG2 1 
ATOM   9349  N N   . ASP C 1 54  ? 61.830  49.632  97.299  1.00 11.43 ? 54  ASP C N   1 
ATOM   9350  C CA  . ASP C 1 54  ? 61.797  48.168  97.211  1.00 11.27 ? 54  ASP C CA  1 
ATOM   9351  C C   . ASP C 1 54  ? 60.806  47.633  98.217  1.00 11.81 ? 54  ASP C C   1 
ATOM   9352  O O   . ASP C 1 54  ? 61.097  47.609  99.426  1.00 11.48 ? 54  ASP C O   1 
ATOM   9353  C CB  . ASP C 1 54  ? 63.181  47.619  97.502  1.00 10.76 ? 54  ASP C CB  1 
ATOM   9354  C CG  . ASP C 1 54  ? 63.253  46.094  97.473  1.00 10.91 ? 54  ASP C CG  1 
ATOM   9355  O OD1 . ASP C 1 54  ? 62.230  45.386  97.314  1.00 11.26 ? 54  ASP C OD1 1 
ATOM   9356  O OD2 . ASP C 1 54  ? 64.341  45.536  97.620  1.00 12.39 ? 54  ASP C OD2 1 
ATOM   9357  N N   . TYR C 1 55  ? 59.646  47.196  97.727  1.00 11.34 ? 55  TYR C N   1 
ATOM   9358  C CA  . TYR C 1 55  ? 58.624  46.646  98.608  1.00 11.83 ? 55  TYR C CA  1 
ATOM   9359  C C   . TYR C 1 55  ? 58.506  45.117  98.426  1.00 11.76 ? 55  TYR C C   1 
ATOM   9360  O O   . TYR C 1 55  ? 57.469  44.520  98.745  1.00 11.63 ? 55  TYR C O   1 
ATOM   9361  C CB  . TYR C 1 55  ? 57.285  47.363  98.421  1.00 11.53 ? 55  TYR C CB  1 
ATOM   9362  C CG  . TYR C 1 55  ? 56.730  47.311  97.006  1.00 13.04 ? 55  TYR C CG  1 
ATOM   9363  C CD1 . TYR C 1 55  ? 55.736  46.404  96.661  1.00 13.64 ? 55  TYR C CD1 1 
ATOM   9364  C CD2 . TYR C 1 55  ? 57.201  48.172  96.026  1.00 13.68 ? 55  TYR C CD2 1 
ATOM   9365  C CE1 . TYR C 1 55  ? 55.231  46.347  95.374  1.00 14.35 ? 55  TYR C CE1 1 
ATOM   9366  C CE2 . TYR C 1 55  ? 56.696  48.126  94.724  1.00 13.60 ? 55  TYR C CE2 1 
ATOM   9367  C CZ  . TYR C 1 55  ? 55.716  47.209  94.414  1.00 14.49 ? 55  TYR C CZ  1 
ATOM   9368  O OH  . TYR C 1 55  ? 55.222  47.154  93.134  1.00 17.33 ? 55  TYR C OH  1 
ATOM   9369  N N   . SER C 1 56  ? 59.594  44.493  97.986  1.00 11.87 ? 56  SER C N   1 
ATOM   9370  C CA  . SER C 1 56  ? 59.593  43.045  97.677  1.00 12.32 ? 56  SER C CA  1 
ATOM   9371  C C   . SER C 1 56  ? 59.631  42.133  98.900  1.00 12.69 ? 56  SER C C   1 
ATOM   9372  O O   . SER C 1 56  ? 59.141  40.999  98.845  1.00 13.20 ? 56  SER C O   1 
ATOM   9373  C CB  . SER C 1 56  ? 60.703  42.683  96.687  1.00 12.41 ? 56  SER C CB  1 
ATOM   9374  O OG  . SER C 1 56  ? 62.006  42.820  97.214  1.00 13.47 ? 56  SER C OG  1 
ATOM   9375  N N   . LYS C 1 57  ? 60.162  42.618  100.016 1.00 12.70 ? 57  LYS C N   1 
ATOM   9376  C CA  . LYS C 1 57  ? 60.158  41.822  101.243 1.00 12.83 ? 57  LYS C CA  1 
ATOM   9377  C C   . LYS C 1 57  ? 58.856  41.993  102.052 1.00 14.27 ? 57  LYS C C   1 
ATOM   9378  O O   . LYS C 1 57  ? 58.869  41.989  103.291 1.00 15.04 ? 57  LYS C O   1 
ATOM   9379  C CB  . LYS C 1 57  ? 61.392  42.143  102.097 1.00 12.45 ? 57  LYS C CB  1 
ATOM   9380  C CG  . LYS C 1 57  ? 62.746  41.982  101.403 1.00 11.75 ? 57  LYS C CG  1 
ATOM   9381  C CD  . LYS C 1 57  ? 63.871  41.888  102.442 1.00 13.25 ? 57  LYS C CD  1 
ATOM   9382  C CE  . LYS C 1 57  ? 65.267  42.017  101.846 1.00 11.81 ? 57  LYS C CE  1 
ATOM   9383  N NZ  . LYS C 1 57  ? 65.591  43.409  101.447 1.00 8.69  ? 57  LYS C NZ  1 
ATOM   9384  N N   . ASN C 1 58  ? 57.736  42.162  101.354 1.00 14.67 ? 58  ASN C N   1 
ATOM   9385  C CA  . ASN C 1 58  ? 56.432  42.269  101.984 1.00 15.43 ? 58  ASN C CA  1 
ATOM   9386  C C   . ASN C 1 58  ? 55.613  40.984  101.791 1.00 16.58 ? 58  ASN C C   1 
ATOM   9387  O O   . ASN C 1 58  ? 55.873  40.205  100.872 1.00 17.29 ? 58  ASN C O   1 
ATOM   9388  C CB  . ASN C 1 58  ? 55.671  43.472  101.439 1.00 15.23 ? 58  ASN C CB  1 
ATOM   9389  C CG  . ASN C 1 58  ? 56.172  44.782  102.020 1.00 14.98 ? 58  ASN C CG  1 
ATOM   9390  O OD1 . ASN C 1 58  ? 56.801  45.598  101.322 1.00 18.45 ? 58  ASN C OD1 1 
ATOM   9391  N ND2 . ASN C 1 58  ? 55.916  44.980  103.302 1.00 12.31 ? 58  ASN C ND2 1 
ATOM   9392  N N   . LEU C 1 59  ? 54.655  40.761  102.677 1.00 17.26 ? 59  LEU C N   1 
ATOM   9393  C CA  . LEU C 1 59  ? 53.818  39.568  102.646 1.00 18.33 ? 59  LEU C CA  1 
ATOM   9394  C C   . LEU C 1 59  ? 52.737  39.744  101.582 1.00 18.23 ? 59  LEU C C   1 
ATOM   9395  O O   . LEU C 1 59  ? 51.559  39.834  101.885 1.00 17.58 ? 59  LEU C O   1 
ATOM   9396  C CB  . LEU C 1 59  ? 53.196  39.331  104.034 1.00 18.64 ? 59  LEU C CB  1 
ATOM   9397  C CG  . LEU C 1 59  ? 54.169  39.002  105.180 1.00 19.78 ? 59  LEU C CG  1 
ATOM   9398  C CD1 . LEU C 1 59  ? 53.416  38.469  106.391 1.00 21.06 ? 59  LEU C CD1 1 
ATOM   9399  C CD2 . LEU C 1 59  ? 55.219  38.009  104.745 1.00 21.87 ? 59  LEU C CD2 1 
ATOM   9400  N N   . VAL C 1 60  ? 53.174  39.859  100.335 1.00 18.73 ? 60  VAL C N   1 
ATOM   9401  C CA  . VAL C 1 60  ? 52.271  40.032  99.219  1.00 19.25 ? 60  VAL C CA  1 
ATOM   9402  C C   . VAL C 1 60  ? 52.693  39.223  97.985  1.00 19.01 ? 60  VAL C C   1 
ATOM   9403  O O   . VAL C 1 60  ? 53.835  38.810  97.849  1.00 18.25 ? 60  VAL C O   1 
ATOM   9404  C CB  . VAL C 1 60  ? 52.201  41.519  98.790  1.00 19.17 ? 60  VAL C CB  1 
ATOM   9405  C CG1 . VAL C 1 60  ? 51.778  42.403  99.955  1.00 20.51 ? 60  VAL C CG1 1 
ATOM   9406  C CG2 . VAL C 1 60  ? 53.537  41.972  98.214  1.00 19.64 ? 60  VAL C CG2 1 
ATOM   9407  N N   . THR C 1 61  ? 51.730  39.014  97.094  1.00 19.78 ? 61  THR C N   1 
ATOM   9408  C CA  . THR C 1 61  ? 51.959  38.380  95.789  1.00 20.06 ? 61  THR C CA  1 
ATOM   9409  C C   . THR C 1 61  ? 51.368  39.299  94.735  1.00 20.37 ? 61  THR C C   1 
ATOM   9410  O O   . THR C 1 61  ? 50.784  40.323  95.045  1.00 20.47 ? 61  THR C O   1 
ATOM   9411  C CB  . THR C 1 61  ? 51.239  37.033  95.670  1.00 20.14 ? 61  THR C CB  1 
ATOM   9412  O OG1 . THR C 1 61  ? 49.830  37.237  95.821  1.00 19.51 ? 61  THR C OG1 1 
ATOM   9413  C CG2 . THR C 1 61  ? 51.608  36.078  96.804  1.00 21.21 ? 61  THR C CG2 1 
ATOM   9414  N N   . GLU C 1 62  ? 51.482  38.918  93.477  1.00 20.65 ? 62  GLU C N   1 
ATOM   9415  C CA  . GLU C 1 62  ? 50.947  39.754  92.430  1.00 21.17 ? 62  GLU C CA  1 
ATOM   9416  C C   . GLU C 1 62  ? 49.443  39.922  92.598  1.00 20.00 ? 62  GLU C C   1 
ATOM   9417  O O   . GLU C 1 62  ? 48.913  41.005  92.382  1.00 20.11 ? 62  GLU C O   1 
ATOM   9418  C CB  . GLU C 1 62  ? 51.359  39.206  91.059  1.00 21.82 ? 62  GLU C CB  1 
ATOM   9419  C CG  . GLU C 1 62  ? 52.832  39.500  90.795  1.00 25.78 ? 62  GLU C CG  1 
ATOM   9420  C CD  . GLU C 1 62  ? 53.602  38.410  90.062  1.00 31.95 ? 62  GLU C CD  1 
ATOM   9421  O OE1 . GLU C 1 62  ? 54.824  38.249  90.360  1.00 34.71 ? 62  GLU C OE1 1 
ATOM   9422  O OE2 . GLU C 1 62  ? 53.017  37.737  89.174  1.00 36.14 ? 62  GLU C OE2 1 
ATOM   9423  N N   . ASP C 1 63  ? 48.751  38.866  93.011  1.00 19.33 ? 63  ASP C N   1 
ATOM   9424  C CA  . ASP C 1 63  ? 47.300  38.938  93.182  1.00 18.49 ? 63  ASP C CA  1 
ATOM   9425  C C   . ASP C 1 63  ? 46.915  39.886  94.312  1.00 17.40 ? 63  ASP C C   1 
ATOM   9426  O O   . ASP C 1 63  ? 45.975  40.649  94.198  1.00 16.35 ? 63  ASP C O   1 
ATOM   9427  C CB  . ASP C 1 63  ? 46.705  37.557  93.448  1.00 19.07 ? 63  ASP C CB  1 
ATOM   9428  C CG  . ASP C 1 63  ? 46.580  36.717  92.178  1.00 20.18 ? 63  ASP C CG  1 
ATOM   9429  O OD1 . ASP C 1 63  ? 46.604  35.477  92.285  1.00 22.02 ? 63  ASP C OD1 1 
ATOM   9430  O OD2 . ASP C 1 63  ? 46.454  37.218  91.039  1.00 22.57 ? 63  ASP C OD2 1 
ATOM   9431  N N   . VAL C 1 64  ? 47.648  39.838  95.414  1.00 17.19 ? 64  VAL C N   1 
ATOM   9432  C CA  . VAL C 1 64  ? 47.359  40.751  96.516  1.00 16.53 ? 64  VAL C CA  1 
ATOM   9433  C C   . VAL C 1 64  ? 47.543  42.206  96.074  1.00 16.10 ? 64  VAL C C   1 
ATOM   9434  O O   . VAL C 1 64  ? 46.689  43.058  96.320  1.00 15.89 ? 64  VAL C O   1 
ATOM   9435  C CB  . VAL C 1 64  ? 48.244  40.438  97.723  1.00 16.60 ? 64  VAL C CB  1 
ATOM   9436  C CG1 . VAL C 1 64  ? 48.053  41.474  98.827  1.00 16.62 ? 64  VAL C CG1 1 
ATOM   9437  C CG2 . VAL C 1 64  ? 47.926  39.038  98.252  1.00 17.71 ? 64  VAL C CG2 1 
ATOM   9438  N N   . MET C 1 65  ? 48.634  42.506  95.379  1.00 15.90 ? 65  MET C N   1 
ATOM   9439  C CA  . MET C 1 65  ? 48.857  43.896  94.984  1.00 15.56 ? 65  MET C CA  1 
ATOM   9440  C C   . MET C 1 65  ? 47.750  44.361  94.036  1.00 15.07 ? 65  MET C C   1 
ATOM   9441  O O   . MET C 1 65  ? 47.279  45.466  94.141  1.00 14.16 ? 65  MET C O   1 
ATOM   9442  C CB  . MET C 1 65  ? 50.230  44.081  94.350  1.00 15.52 ? 65  MET C CB  1 
ATOM   9443  C CG  . MET C 1 65  ? 51.405  43.758  95.263  1.00 16.94 ? 65  MET C CG  1 
ATOM   9444  S SD  . MET C 1 65  ? 51.490  44.764  96.763  1.00 16.53 ? 65  MET C SD  1 
ATOM   9445  C CE  . MET C 1 65  ? 51.289  46.415  96.069  1.00 17.19 ? 65  MET C CE  1 
ATOM   9446  N N   . ARG C 1 66  ? 47.332  43.510  93.103  1.00 16.11 ? 66  ARG C N   1 
ATOM   9447  C CA  . ARG C 1 66  ? 46.234  43.886  92.216  1.00 16.68 ? 66  ARG C CA  1 
ATOM   9448  C C   . ARG C 1 66  ? 44.969  44.148  93.033  1.00 16.28 ? 66  ARG C C   1 
ATOM   9449  O O   . ARG C 1 66  ? 44.237  45.102  92.788  1.00 16.11 ? 66  ARG C O   1 
ATOM   9450  C CB  . ARG C 1 66  ? 45.971  42.790  91.178  1.00 17.57 ? 66  ARG C CB  1 
ATOM   9451  C CG  . ARG C 1 66  ? 44.789  43.095  90.268  1.00 20.85 ? 66  ARG C CG  1 
ATOM   9452  C CD  . ARG C 1 66  ? 44.410  41.944  89.335  1.00 25.49 ? 66  ARG C CD  1 
ATOM   9453  N NE  . ARG C 1 66  ? 44.543  40.647  89.999  1.00 29.29 ? 66  ARG C NE  1 
ATOM   9454  C CZ  . ARG C 1 66  ? 43.591  40.049  90.716  1.00 33.12 ? 66  ARG C CZ  1 
ATOM   9455  N NH1 . ARG C 1 66  ? 42.399  40.616  90.889  1.00 35.04 ? 66  ARG C NH1 1 
ATOM   9456  N NH2 . ARG C 1 66  ? 43.835  38.869  91.276  1.00 34.08 ? 66  ARG C NH2 1 
ATOM   9457  N N   . MET C 1 67  ? 44.694  43.298  94.008  1.00 16.40 ? 67  MET C N   1 
ATOM   9458  C CA  . MET C 1 67  ? 43.507  43.517  94.832  1.00 16.93 ? 67  MET C CA  1 
ATOM   9459  C C   . MET C 1 67  ? 43.607  44.833  95.605  1.00 16.10 ? 67  MET C C   1 
ATOM   9460  O O   . MET C 1 67  ? 42.630  45.560  95.751  1.00 15.57 ? 67  MET C O   1 
ATOM   9461  C CB  . MET C 1 67  ? 43.304  42.349  95.804  1.00 17.24 ? 67  MET C CB  1 
ATOM   9462  C CG  . MET C 1 67  ? 42.858  41.064  95.086  1.00 21.06 ? 67  MET C CG  1 
ATOM   9463  S SD  . MET C 1 67  ? 42.336  39.768  96.244  1.00 25.83 ? 67  MET C SD  1 
ATOM   9464  C CE  . MET C 1 67  ? 43.912  39.268  96.867  1.00 28.64 ? 67  MET C CE  1 
ATOM   9465  N N   . LEU C 1 68  ? 44.800  45.133  96.108  1.00 16.33 ? 68  LEU C N   1 
ATOM   9466  C CA  . LEU C 1 68  ? 45.010  46.369  96.851  1.00 16.05 ? 68  LEU C CA  1 
ATOM   9467  C C   . LEU C 1 68  ? 44.785  47.590  95.944  1.00 16.12 ? 68  LEU C C   1 
ATOM   9468  O O   . LEU C 1 68  ? 44.095  48.544  96.325  1.00 16.01 ? 68  LEU C O   1 
ATOM   9469  C CB  . LEU C 1 68  ? 46.413  46.356  97.477  1.00 16.05 ? 68  LEU C CB  1 
ATOM   9470  C CG  . LEU C 1 68  ? 46.583  45.430  98.689  1.00 14.64 ? 68  LEU C CG  1 
ATOM   9471  C CD1 . LEU C 1 68  ? 48.048  45.298  99.080  1.00 15.27 ? 68  LEU C CD1 1 
ATOM   9472  C CD2 . LEU C 1 68  ? 45.760  45.915  99.863  1.00 13.82 ? 68  LEU C CD2 1 
ATOM   9473  N N   . VAL C 1 69  ? 45.348  47.552  94.739  1.00 16.20 ? 69  VAL C N   1 
ATOM   9474  C CA  . VAL C 1 69  ? 45.139  48.623  93.769  1.00 16.78 ? 69  VAL C CA  1 
ATOM   9475  C C   . VAL C 1 69  ? 43.635  48.785  93.472  1.00 16.93 ? 69  VAL C C   1 
ATOM   9476  O O   . VAL C 1 69  ? 43.127  49.909  93.419  1.00 17.21 ? 69  VAL C O   1 
ATOM   9477  C CB  . VAL C 1 69  ? 45.976  48.377  92.478  1.00 16.69 ? 69  VAL C CB  1 
ATOM   9478  C CG1 . VAL C 1 69  ? 45.554  49.300  91.352  1.00 16.79 ? 69  VAL C CG1 1 
ATOM   9479  C CG2 . VAL C 1 69  ? 47.455  48.555  92.778  1.00 17.01 ? 69  VAL C CG2 1 
ATOM   9480  N N   . ASP C 1 70  ? 42.923  47.662  93.319  1.00 17.48 ? 70  ASP C N   1 
ATOM   9481  C CA  . ASP C 1 70  ? 41.485  47.684  93.066  1.00 17.41 ? 70  ASP C CA  1 
ATOM   9482  C C   . ASP C 1 70  ? 40.757  48.371  94.206  1.00 17.20 ? 70  ASP C C   1 
ATOM   9483  O O   . ASP C 1 70  ? 39.763  49.048  93.998  1.00 16.24 ? 70  ASP C O   1 
ATOM   9484  C CB  . ASP C 1 70  ? 40.934  46.270  92.902  1.00 17.85 ? 70  ASP C CB  1 
ATOM   9485  C CG  . ASP C 1 70  ? 41.321  45.637  91.574  1.00 19.24 ? 70  ASP C CG  1 
ATOM   9486  O OD1 . ASP C 1 70  ? 41.690  46.366  90.641  1.00 18.98 ? 70  ASP C OD1 1 
ATOM   9487  O OD2 . ASP C 1 70  ? 41.326  44.405  91.393  1.00 23.15 ? 70  ASP C OD2 1 
ATOM   9488  N N   . LEU C 1 71  ? 41.264  48.198  95.425  1.00 17.16 ? 71  LEU C N   1 
ATOM   9489  C CA  . LEU C 1 71  ? 40.688  48.868  96.584  1.00 17.07 ? 71  LEU C CA  1 
ATOM   9490  C C   . LEU C 1 71  ? 40.846  50.386  96.506  1.00 16.84 ? 71  LEU C C   1 
ATOM   9491  O O   . LEU C 1 71  ? 39.921  51.140  96.810  1.00 16.45 ? 71  LEU C O   1 
ATOM   9492  C CB  . LEU C 1 71  ? 41.365  48.357  97.855  1.00 17.12 ? 71  LEU C CB  1 
ATOM   9493  C CG  . LEU C 1 71  ? 40.878  48.992  99.152  1.00 17.47 ? 71  LEU C CG  1 
ATOM   9494  C CD1 . LEU C 1 71  ? 39.423  48.676  99.403  1.00 17.65 ? 71  LEU C CD1 1 
ATOM   9495  C CD2 . LEU C 1 71  ? 41.787  48.521  100.322 1.00 18.25 ? 71  LEU C CD2 1 
ATOM   9496  N N   . ALA C 1 72  ? 42.028  50.837  96.106  1.00 17.04 ? 72  ALA C N   1 
ATOM   9497  C CA  . ALA C 1 72  ? 42.271  52.261  95.981  1.00 17.54 ? 72  ALA C CA  1 
ATOM   9498  C C   . ALA C 1 72  ? 41.327  52.850  94.949  1.00 17.95 ? 72  ALA C C   1 
ATOM   9499  O O   . ALA C 1 72  ? 40.841  53.949  95.124  1.00 18.29 ? 72  ALA C O   1 
ATOM   9500  C CB  . ALA C 1 72  ? 43.728  52.531  95.614  1.00 18.12 ? 72  ALA C CB  1 
ATOM   9501  N N   . LYS C 1 73  ? 41.065  52.112  93.871  1.00 18.81 ? 73  LYS C N   1 
ATOM   9502  C CA  . LYS C 1 73  ? 40.130  52.579  92.844  1.00 19.85 ? 73  LYS C CA  1 
ATOM   9503  C C   . LYS C 1 73  ? 38.695  52.661  93.388  1.00 19.54 ? 73  LYS C C   1 
ATOM   9504  O O   . LYS C 1 73  ? 38.045  53.695  93.274  1.00 19.58 ? 73  LYS C O   1 
ATOM   9505  C CB  . LYS C 1 73  ? 40.202  51.687  91.592  1.00 20.28 ? 73  LYS C CB  1 
ATOM   9506  C CG  . LYS C 1 73  ? 41.574  51.725  90.881  1.00 23.25 ? 73  LYS C CG  1 
ATOM   9507  C CD  . LYS C 1 73  ? 41.851  50.475  90.032  1.00 27.12 ? 73  LYS C CD  1 
ATOM   9508  C CE  . LYS C 1 73  ? 40.982  50.433  88.793  1.00 29.86 ? 73  LYS C CE  1 
ATOM   9509  N NZ  . LYS C 1 73  ? 41.643  49.725  87.653  1.00 32.67 ? 73  LYS C NZ  1 
ATOM   9510  N N   . SER C 1 74  ? 38.223  51.591  94.016  1.00 19.64 ? 74  SER C N   1 
ATOM   9511  C CA  . SER C 1 74  ? 36.868  51.580  94.552  1.00 20.15 ? 74  SER C CA  1 
ATOM   9512  C C   . SER C 1 74  ? 36.661  52.641  95.630  1.00 19.64 ? 74  SER C C   1 
ATOM   9513  O O   . SER C 1 74  ? 35.586  53.223  95.698  1.00 19.73 ? 74  SER C O   1 
ATOM   9514  C CB  . SER C 1 74  ? 36.480  50.178  95.045  1.00 20.36 ? 74  SER C CB  1 
ATOM   9515  O OG  . SER C 1 74  ? 35.268  50.216  95.772  1.00 23.19 ? 74  SER C OG  1 
ATOM   9516  N N   . ARG C 1 75  ? 37.687  52.919  96.451  1.00 19.14 ? 75  ARG C N   1 
ATOM   9517  C CA  . ARG C 1 75  ? 37.581  53.952  97.483  1.00 18.53 ? 75  ARG C CA  1 
ATOM   9518  C C   . ARG C 1 75  ? 37.775  55.371  96.929  1.00 18.44 ? 75  ARG C C   1 
ATOM   9519  O O   . ARG C 1 75  ? 37.738  56.349  97.685  1.00 19.14 ? 75  ARG C O   1 
ATOM   9520  C CB  . ARG C 1 75  ? 38.565  53.679  98.645  1.00 18.06 ? 75  ARG C CB  1 
ATOM   9521  C CG  . ARG C 1 75  ? 38.336  52.342  99.329  1.00 18.50 ? 75  ARG C CG  1 
ATOM   9522  C CD  . ARG C 1 75  ? 37.073  52.296  100.171 1.00 18.92 ? 75  ARG C CD  1 
ATOM   9523  N NE  . ARG C 1 75  ? 37.019  53.470  101.033 1.00 20.38 ? 75  ARG C NE  1 
ATOM   9524  C CZ  . ARG C 1 75  ? 36.107  54.430  100.969 1.00 22.09 ? 75  ARG C CZ  1 
ATOM   9525  N NH1 . ARG C 1 75  ? 35.102  54.383  100.100 1.00 23.68 ? 75  ARG C NH1 1 
ATOM   9526  N NH2 . ARG C 1 75  ? 36.203  55.458  101.777 1.00 22.47 ? 75  ARG C NH2 1 
ATOM   9527  N N   . GLY C 1 76  ? 38.020  55.484  95.622  1.00 18.19 ? 76  GLY C N   1 
ATOM   9528  C CA  . GLY C 1 76  ? 38.081  56.773  94.956  1.00 17.32 ? 76  GLY C CA  1 
ATOM   9529  C C   . GLY C 1 76  ? 39.306  57.610  95.273  1.00 16.39 ? 76  GLY C C   1 
ATOM   9530  O O   . GLY C 1 76  ? 39.228  58.831  95.361  1.00 15.65 ? 76  GLY C O   1 
ATOM   9531  N N   . VAL C 1 77  ? 40.447  56.952  95.410  1.00 16.19 ? 77  VAL C N   1 
ATOM   9532  C CA  . VAL C 1 77  ? 41.692  57.643  95.698  1.00 15.88 ? 77  VAL C CA  1 
ATOM   9533  C C   . VAL C 1 77  ? 42.024  58.728  94.659  1.00 15.73 ? 77  VAL C C   1 
ATOM   9534  O O   . VAL C 1 77  ? 42.299  59.869  95.027  1.00 15.18 ? 77  VAL C O   1 
ATOM   9535  C CB  . VAL C 1 77  ? 42.847  56.631  95.837  1.00 15.53 ? 77  VAL C CB  1 
ATOM   9536  C CG1 . VAL C 1 77  ? 44.192  57.331  95.811  1.00 15.35 ? 77  VAL C CG1 1 
ATOM   9537  C CG2 . VAL C 1 77  ? 42.672  55.812  97.122  1.00 15.87 ? 77  VAL C CG2 1 
ATOM   9538  N N   . GLU C 1 78  ? 42.006  58.386  93.370  1.00 16.16 ? 78  GLU C N   1 
ATOM   9539  C CA  . GLU C 1 78  ? 42.302  59.394  92.333  1.00 16.88 ? 78  GLU C CA  1 
ATOM   9540  C C   . GLU C 1 78  ? 41.378  60.620  92.398  1.00 16.10 ? 78  GLU C C   1 
ATOM   9541  O O   . GLU C 1 78  ? 41.838  61.761  92.453  1.00 15.62 ? 78  GLU C O   1 
ATOM   9542  C CB  . GLU C 1 78  ? 42.295  58.761  90.936  1.00 17.52 ? 78  GLU C CB  1 
ATOM   9543  C CG  . GLU C 1 78  ? 43.377  57.712  90.766  1.00 20.14 ? 78  GLU C CG  1 
ATOM   9544  C CD  . GLU C 1 78  ? 43.335  57.017  89.420  1.00 25.40 ? 78  GLU C CD  1 
ATOM   9545  O OE1 . GLU C 1 78  ? 44.224  57.278  88.584  1.00 28.36 ? 78  GLU C OE1 1 
ATOM   9546  O OE2 . GLU C 1 78  ? 42.422  56.198  89.204  1.00 28.91 ? 78  GLU C OE2 1 
ATOM   9547  N N   . ALA C 1 79  ? 40.071  60.400  92.420  1.00 16.16 ? 79  ALA C N   1 
ATOM   9548  C CA  . ALA C 1 79  ? 39.136  61.523  92.545  1.00 15.90 ? 79  ALA C CA  1 
ATOM   9549  C C   . ALA C 1 79  ? 39.441  62.405  93.769  1.00 15.17 ? 79  ALA C C   1 
ATOM   9550  O O   . ALA C 1 79  ? 39.434  63.639  93.686  1.00 14.82 ? 79  ALA C O   1 
ATOM   9551  C CB  . ALA C 1 79  ? 37.694  61.019  92.581  1.00 16.45 ? 79  ALA C CB  1 
ATOM   9552  N N   . ALA C 1 80  ? 39.710  61.777  94.908  1.00 14.80 ? 80  ALA C N   1 
ATOM   9553  C CA  . ALA C 1 80  ? 40.052  62.536  96.113  1.00 14.25 ? 80  ALA C CA  1 
ATOM   9554  C C   . ALA C 1 80  ? 41.337  63.346  95.917  1.00 13.59 ? 80  ALA C C   1 
ATOM   9555  O O   . ALA C 1 80  ? 41.433  64.481  96.352  1.00 12.54 ? 80  ALA C O   1 
ATOM   9556  C CB  . ALA C 1 80  ? 40.218  61.596  97.299  1.00 14.47 ? 80  ALA C CB  1 
ATOM   9557  N N   . ARG C 1 81  ? 42.335  62.746  95.278  1.00 13.95 ? 81  ARG C N   1 
ATOM   9558  C CA  . ARG C 1 81  ? 43.591  63.441  95.026  1.00 14.08 ? 81  ARG C CA  1 
ATOM   9559  C C   . ARG C 1 81  ? 43.327  64.713  94.229  1.00 14.24 ? 81  ARG C C   1 
ATOM   9560  O O   . ARG C 1 81  ? 43.814  65.813  94.544  1.00 13.42 ? 81  ARG C O   1 
ATOM   9561  C CB  . ARG C 1 81  ? 44.561  62.510  94.277  1.00 14.62 ? 81  ARG C CB  1 
ATOM   9562  C CG  . ARG C 1 81  ? 45.898  63.155  93.886  1.00 14.76 ? 81  ARG C CG  1 
ATOM   9563  C CD  . ARG C 1 81  ? 46.716  62.340  92.907  1.00 14.44 ? 81  ARG C CD  1 
ATOM   9564  N NE  . ARG C 1 81  ? 45.937  62.079  91.702  1.00 15.17 ? 81  ARG C NE  1 
ATOM   9565  C CZ  . ARG C 1 81  ? 46.030  61.009  90.933  1.00 16.92 ? 81  ARG C CZ  1 
ATOM   9566  N NH1 . ARG C 1 81  ? 46.917  60.060  91.171  1.00 17.95 ? 81  ARG C NH1 1 
ATOM   9567  N NH2 . ARG C 1 81  ? 45.236  60.911  89.876  1.00 18.58 ? 81  ARG C NH2 1 
ATOM   9568  N N   . GLU C 1 82  ? 42.529  64.559  93.188  1.00 14.82 ? 82  GLU C N   1 
ATOM   9569  C CA  . GLU C 1 82  ? 42.221  65.681  92.306  1.00 15.68 ? 82  GLU C CA  1 
ATOM   9570  C C   . GLU C 1 82  ? 41.520  66.789  93.070  1.00 15.40 ? 82  GLU C C   1 
ATOM   9571  O O   . GLU C 1 82  ? 41.816  67.955  92.884  1.00 15.84 ? 82  GLU C O   1 
ATOM   9572  C CB  . GLU C 1 82  ? 41.367  65.185  91.147  1.00 15.64 ? 82  GLU C CB  1 
ATOM   9573  C CG  . GLU C 1 82  ? 42.119  64.244  90.233  1.00 18.94 ? 82  GLU C CG  1 
ATOM   9574  C CD  . GLU C 1 82  ? 43.457  64.815  89.836  1.00 21.44 ? 82  GLU C CD  1 
ATOM   9575  O OE1 . GLU C 1 82  ? 43.444  65.811  89.080  1.00 23.76 ? 82  GLU C OE1 1 
ATOM   9576  O OE2 . GLU C 1 82  ? 44.502  64.305  90.308  1.00 20.08 ? 82  GLU C OE2 1 
ATOM   9577  N N   . ARG C 1 83  ? 40.606  66.406  93.957  1.00 16.35 ? 83  ARG C N   1 
ATOM   9578  C CA  . ARG C 1 83  ? 39.893  67.361  94.790  1.00 16.65 ? 83  ARG C CA  1 
ATOM   9579  C C   . ARG C 1 83  ? 40.892  68.174  95.621  1.00 15.76 ? 83  ARG C C   1 
ATOM   9580  O O   . ARG C 1 83  ? 40.772  69.396  95.750  1.00 15.32 ? 83  ARG C O   1 
ATOM   9581  C CB  . ARG C 1 83  ? 38.910  66.635  95.710  1.00 16.76 ? 83  ARG C CB  1 
ATOM   9582  C CG  . ARG C 1 83  ? 37.545  66.306  95.084  1.00 21.15 ? 83  ARG C CG  1 
ATOM   9583  C CD  . ARG C 1 83  ? 36.581  65.567  96.030  1.00 25.54 ? 83  ARG C CD  1 
ATOM   9584  N NE  . ARG C 1 83  ? 36.414  64.177  95.607  1.00 30.16 ? 83  ARG C NE  1 
ATOM   9585  C CZ  . ARG C 1 83  ? 36.599  63.109  96.382  1.00 31.37 ? 83  ARG C CZ  1 
ATOM   9586  N NH1 . ARG C 1 83  ? 36.960  63.236  97.656  1.00 31.90 ? 83  ARG C NH1 1 
ATOM   9587  N NH2 . ARG C 1 83  ? 36.423  61.902  95.873  1.00 32.35 ? 83  ARG C NH2 1 
ATOM   9588  N N   . MET C 1 84  ? 41.883  67.498  96.188  1.00 16.15 ? 84  MET C N   1 
ATOM   9589  C CA  . MET C 1 84  ? 42.910  68.195  96.968  1.00 16.32 ? 84  MET C CA  1 
ATOM   9590  C C   . MET C 1 84  ? 43.674  69.195  96.115  1.00 16.21 ? 84  MET C C   1 
ATOM   9591  O O   . MET C 1 84  ? 43.771  70.390  96.452  1.00 16.01 ? 84  MET C O   1 
ATOM   9592  C CB  . MET C 1 84  ? 43.905  67.194  97.587  1.00 16.90 ? 84  MET C CB  1 
ATOM   9593  C CG  . MET C 1 84  ? 45.068  67.861  98.310  1.00 18.85 ? 84  MET C CG  1 
ATOM   9594  S SD  . MET C 1 84  ? 46.019  66.742  99.376  1.00 23.99 ? 84  MET C SD  1 
ATOM   9595  C CE  . MET C 1 84  ? 46.938  66.021  98.228  1.00 21.59 ? 84  MET C CE  1 
ATOM   9596  N N   . PHE C 1 85  ? 44.203  68.707  95.000  1.00 16.50 ? 85  PHE C N   1 
ATOM   9597  C CA  . PHE C 1 85  ? 45.048  69.514  94.139  1.00 17.48 ? 85  PHE C CA  1 
ATOM   9598  C C   . PHE C 1 85  ? 44.280  70.655  93.493  1.00 17.83 ? 85  PHE C C   1 
ATOM   9599  O O   . PHE C 1 85  ? 44.856  71.705  93.225  1.00 18.37 ? 85  PHE C O   1 
ATOM   9600  C CB  . PHE C 1 85  ? 45.726  68.647  93.064  1.00 17.61 ? 85  PHE C CB  1 
ATOM   9601  C CG  . PHE C 1 85  ? 46.997  67.958  93.523  1.00 17.73 ? 85  PHE C CG  1 
ATOM   9602  C CD1 . PHE C 1 85  ? 46.950  66.786  94.252  1.00 18.68 ? 85  PHE C CD1 1 
ATOM   9603  C CD2 . PHE C 1 85  ? 48.247  68.461  93.160  1.00 17.78 ? 85  PHE C CD2 1 
ATOM   9604  C CE1 . PHE C 1 85  ? 48.124  66.148  94.655  1.00 18.26 ? 85  PHE C CE1 1 
ATOM   9605  C CE2 . PHE C 1 85  ? 49.409  67.830  93.557  1.00 18.03 ? 85  PHE C CE2 1 
ATOM   9606  C CZ  . PHE C 1 85  ? 49.355  66.668  94.297  1.00 17.17 ? 85  PHE C CZ  1 
ATOM   9607  N N   . ASN C 1 86  ? 42.982  70.451  93.272  1.00 18.84 ? 86  ASN C N   1 
ATOM   9608  C CA  . ASN C 1 86  ? 42.118  71.474  92.685  1.00 19.10 ? 86  ASN C CA  1 
ATOM   9609  C C   . ASN C 1 86  ? 41.578  72.499  93.690  1.00 18.96 ? 86  ASN C C   1 
ATOM   9610  O O   . ASN C 1 86  ? 40.831  73.393  93.322  1.00 18.15 ? 86  ASN C O   1 
ATOM   9611  C CB  . ASN C 1 86  ? 40.950  70.828  91.936  1.00 19.65 ? 86  ASN C CB  1 
ATOM   9612  C CG  . ASN C 1 86  ? 41.389  70.136  90.655  1.00 20.49 ? 86  ASN C CG  1 
ATOM   9613  O OD1 . ASN C 1 86  ? 40.783  69.153  90.216  1.00 24.19 ? 86  ASN C OD1 1 
ATOM   9614  N ND2 . ASN C 1 86  ? 42.452  70.640  90.057  1.00 21.11 ? 86  ASN C ND2 1 
ATOM   9615  N N   . GLY C 1 87  ? 41.940  72.367  94.959  1.00 18.46 ? 87  GLY C N   1 
ATOM   9616  C CA  . GLY C 1 87  ? 41.543  73.348  95.951  1.00 18.36 ? 87  GLY C CA  1 
ATOM   9617  C C   . GLY C 1 87  ? 40.133  73.188  96.512  1.00 18.10 ? 87  GLY C C   1 
ATOM   9618  O O   . GLY C 1 87  ? 39.579  74.137  97.052  1.00 18.04 ? 87  GLY C O   1 
ATOM   9619  N N   . GLU C 1 88  ? 39.541  72.011  96.378  1.00 18.47 ? 88  GLU C N   1 
ATOM   9620  C CA  . GLU C 1 88  ? 38.217  71.783  96.953  1.00 18.74 ? 88  GLU C CA  1 
ATOM   9621  C C   . GLU C 1 88  ? 38.356  71.663  98.476  1.00 19.34 ? 88  GLU C C   1 
ATOM   9622  O O   . GLU C 1 88  ? 39.441  71.389  98.984  1.00 18.83 ? 88  GLU C O   1 
ATOM   9623  C CB  . GLU C 1 88  ? 37.549  70.559  96.317  1.00 19.30 ? 88  GLU C CB  1 
ATOM   9624  C CG  . GLU C 1 88  ? 37.267  70.779  94.833  1.00 20.97 ? 88  GLU C CG  1 
ATOM   9625  C CD  . GLU C 1 88  ? 36.675  69.572  94.149  1.00 22.15 ? 88  GLU C CD  1 
ATOM   9626  O OE1 . GLU C 1 88  ? 35.717  68.981  94.701  1.00 21.75 ? 88  GLU C OE1 1 
ATOM   9627  O OE2 . GLU C 1 88  ? 37.180  69.214  93.054  1.00 23.92 ? 88  GLU C OE2 1 
ATOM   9628  N N   . LYS C 1 89  ? 37.260  71.888  99.199  1.00 19.85 ? 89  LYS C N   1 
ATOM   9629  C CA  . LYS C 1 89  ? 37.288  71.929  100.662 1.00 20.37 ? 89  LYS C CA  1 
ATOM   9630  C C   . LYS C 1 89  ? 37.162  70.543  101.230 1.00 19.71 ? 89  LYS C C   1 
ATOM   9631  O O   . LYS C 1 89  ? 36.173  70.218  101.873 1.00 20.01 ? 89  LYS C O   1 
ATOM   9632  C CB  . LYS C 1 89  ? 36.144  72.806  101.185 1.00 20.88 ? 89  LYS C CB  1 
ATOM   9633  C CG  . LYS C 1 89  ? 35.978  74.119  100.461 1.00 23.39 ? 89  LYS C CG  1 
ATOM   9634  C CD  . LYS C 1 89  ? 36.781  75.200  101.109 1.00 27.27 ? 89  LYS C CD  1 
ATOM   9635  C CE  . LYS C 1 89  ? 36.904  76.416  100.214 1.00 29.08 ? 89  LYS C CE  1 
ATOM   9636  N NZ  . LYS C 1 89  ? 35.807  77.407  100.444 1.00 30.64 ? 89  LYS C NZ  1 
ATOM   9637  N N   . ILE C 1 90  ? 38.168  69.715  100.992 1.00 19.07 ? 90  ILE C N   1 
ATOM   9638  C CA  . ILE C 1 90  ? 38.110  68.323  101.415 1.00 18.71 ? 90  ILE C CA  1 
ATOM   9639  C C   . ILE C 1 90  ? 38.269  68.129  102.920 1.00 18.42 ? 90  ILE C C   1 
ATOM   9640  O O   . ILE C 1 90  ? 38.019  67.031  103.399 1.00 18.98 ? 90  ILE C O   1 
ATOM   9641  C CB  . ILE C 1 90  ? 39.174  67.476  100.702 1.00 18.44 ? 90  ILE C CB  1 
ATOM   9642  C CG1 . ILE C 1 90  ? 40.579  67.965  101.050 1.00 17.98 ? 90  ILE C CG1 1 
ATOM   9643  C CG2 . ILE C 1 90  ? 38.937  67.488  99.205  1.00 19.74 ? 90  ILE C CG2 1 
ATOM   9644  C CD1 . ILE C 1 90  ? 41.660  66.947  100.700 1.00 17.65 ? 90  ILE C CD1 1 
ATOM   9645  N N   . ASN C 1 91  ? 38.740  69.153  103.628 1.00 18.19 ? 91  ASN C N   1 
ATOM   9646  C CA  . ASN C 1 91  ? 38.747  69.158  105.098 1.00 18.67 ? 91  ASN C CA  1 
ATOM   9647  C C   . ASN C 1 91  ? 37.313  69.516  105.468 1.00 18.79 ? 91  ASN C C   1 
ATOM   9648  O O   . ASN C 1 91  ? 36.997  70.670  105.771 1.00 19.81 ? 91  ASN C O   1 
ATOM   9649  C CB  . ASN C 1 91  ? 39.735  70.176  105.664 1.00 18.07 ? 91  ASN C CB  1 
ATOM   9650  C CG  . ASN C 1 91  ? 39.719  70.232  107.191 1.00 18.83 ? 91  ASN C CG  1 
ATOM   9651  O OD1 . ASN C 1 91  ? 38.846  69.643  107.830 1.00 18.40 ? 91  ASN C OD1 1 
ATOM   9652  N ND2 . ASN C 1 91  ? 40.671  70.970  107.778 1.00 15.74 ? 91  ASN C ND2 1 
ATOM   9653  N N   . TYR C 1 92  ? 36.452  68.514  105.429 1.00 19.04 ? 92  TYR C N   1 
ATOM   9654  C CA  . TYR C 1 92  ? 35.009  68.752  105.493 1.00 20.18 ? 92  TYR C CA  1 
ATOM   9655  C C   . TYR C 1 92  ? 34.463  69.159  106.848 1.00 20.57 ? 92  TYR C C   1 
ATOM   9656  O O   . TYR C 1 92  ? 33.485  69.896  106.909 1.00 20.61 ? 92  TYR C O   1 
ATOM   9657  C CB  . TYR C 1 92  ? 34.230  67.553  104.950 1.00 20.27 ? 92  TYR C CB  1 
ATOM   9658  C CG  . TYR C 1 92  ? 34.686  66.215  105.459 1.00 21.23 ? 92  TYR C CG  1 
ATOM   9659  C CD1 . TYR C 1 92  ? 34.266  65.726  106.688 1.00 21.97 ? 92  TYR C CD1 1 
ATOM   9660  C CD2 . TYR C 1 92  ? 35.541  65.437  104.705 1.00 22.16 ? 92  TYR C CD2 1 
ATOM   9661  C CE1 . TYR C 1 92  ? 34.689  64.488  107.135 1.00 23.13 ? 92  TYR C CE1 1 
ATOM   9662  C CE2 . TYR C 1 92  ? 35.962  64.224  105.139 1.00 23.00 ? 92  TYR C CE2 1 
ATOM   9663  C CZ  . TYR C 1 92  ? 35.551  63.751  106.355 1.00 22.62 ? 92  TYR C CZ  1 
ATOM   9664  O OH  . TYR C 1 92  ? 35.996  62.522  106.752 1.00 23.86 ? 92  TYR C OH  1 
ATOM   9665  N N   . THR C 1 93  ? 35.087  68.716  107.938 1.00 20.69 ? 93  THR C N   1 
ATOM   9666  C CA  . THR C 1 93  ? 34.555  69.070  109.242 1.00 20.61 ? 93  THR C CA  1 
ATOM   9667  C C   . THR C 1 93  ? 34.831  70.533  109.524 1.00 20.69 ? 93  THR C C   1 
ATOM   9668  O O   . THR C 1 93  ? 34.062  71.167  110.235 1.00 21.26 ? 93  THR C O   1 
ATOM   9669  C CB  . THR C 1 93  ? 35.115  68.165  110.367 1.00 20.64 ? 93  THR C CB  1 
ATOM   9670  O OG1 . THR C 1 93  ? 36.530  68.334  110.480 1.00 20.11 ? 93  THR C OG1 1 
ATOM   9671  C CG2 . THR C 1 93  ? 34.933  66.715  110.040 1.00 19.57 ? 93  THR C CG2 1 
ATOM   9672  N N   . GLU C 1 94  ? 35.904  71.080  108.956 1.00 20.27 ? 94  GLU C N   1 
ATOM   9673  C CA  . GLU C 1 94  ? 36.221  72.491  109.154 1.00 20.01 ? 94  GLU C CA  1 
ATOM   9674  C C   . GLU C 1 94  ? 35.843  73.353  107.941 1.00 19.71 ? 94  GLU C C   1 
ATOM   9675  O O   . GLU C 1 94  ? 35.867  74.587  108.007 1.00 19.53 ? 94  GLU C O   1 
ATOM   9676  C CB  . GLU C 1 94  ? 37.692  72.664  109.492 1.00 20.28 ? 94  GLU C CB  1 
ATOM   9677  C CG  . GLU C 1 94  ? 38.094  71.956  110.776 1.00 21.10 ? 94  GLU C CG  1 
ATOM   9678  C CD  . GLU C 1 94  ? 39.542  72.182  111.146 1.00 22.67 ? 94  GLU C CD  1 
ATOM   9679  O OE1 . GLU C 1 94  ? 40.404  72.097  110.249 1.00 23.35 ? 94  GLU C OE1 1 
ATOM   9680  O OE2 . GLU C 1 94  ? 39.823  72.427  112.340 1.00 24.94 ? 94  GLU C OE2 1 
ATOM   9681  N N   . GLY C 1 95  ? 35.494  72.706  106.839 1.00 19.21 ? 95  GLY C N   1 
ATOM   9682  C CA  . GLY C 1 95  ? 35.095  73.430  105.648 1.00 19.51 ? 95  GLY C CA  1 
ATOM   9683  C C   . GLY C 1 95  ? 36.263  74.185  105.046 1.00 18.95 ? 95  GLY C C   1 
ATOM   9684  O O   . GLY C 1 95  ? 36.151  75.368  104.711 1.00 19.61 ? 95  GLY C O   1 
ATOM   9685  N N   . ARG C 1 96  ? 37.393  73.502  104.908 1.00 18.07 ? 96  ARG C N   1 
ATOM   9686  C CA  . ARG C 1 96  ? 38.603  74.148  104.434 1.00 17.26 ? 96  ARG C CA  1 
ATOM   9687  C C   . ARG C 1 96  ? 39.265  73.359  103.319 1.00 16.01 ? 96  ARG C C   1 
ATOM   9688  O O   . ARG C 1 96  ? 39.108  72.136  103.215 1.00 14.64 ? 96  ARG C O   1 
ATOM   9689  C CB  . ARG C 1 96  ? 39.610  74.266  105.574 1.00 17.97 ? 96  ARG C CB  1 
ATOM   9690  C CG  . ARG C 1 96  ? 39.289  75.327  106.583 1.00 19.48 ? 96  ARG C CG  1 
ATOM   9691  C CD  . ARG C 1 96  ? 40.191  75.293  107.787 1.00 20.28 ? 96  ARG C CD  1 
ATOM   9692  N NE  . ARG C 1 96  ? 39.709  76.189  108.827 1.00 23.23 ? 96  ARG C NE  1 
ATOM   9693  C CZ  . ARG C 1 96  ? 40.217  76.257  110.046 1.00 25.76 ? 96  ARG C CZ  1 
ATOM   9694  N NH1 . ARG C 1 96  ? 41.225  75.469  110.387 1.00 28.07 ? 96  ARG C NH1 1 
ATOM   9695  N NH2 . ARG C 1 96  ? 39.710  77.109  110.927 1.00 26.40 ? 96  ARG C NH2 1 
ATOM   9696  N N   . ALA C 1 97  ? 40.014  74.080  102.495 1.00 15.69 ? 97  ALA C N   1 
ATOM   9697  C CA  . ALA C 1 97  ? 40.846  73.450  101.479 1.00 15.00 ? 97  ALA C CA  1 
ATOM   9698  C C   . ALA C 1 97  ? 42.083  72.859  102.188 1.00 14.20 ? 97  ALA C C   1 
ATOM   9699  O O   . ALA C 1 97  ? 42.338  73.180  103.352 1.00 13.49 ? 97  ALA C O   1 
ATOM   9700  C CB  . ALA C 1 97  ? 41.270  74.483  100.419 1.00 15.10 ? 97  ALA C CB  1 
ATOM   9701  N N   . VAL C 1 98  ? 42.823  72.011  101.471 1.00 13.21 ? 98  VAL C N   1 
ATOM   9702  C CA  . VAL C 1 98  ? 44.022  71.325  101.979 1.00 12.88 ? 98  VAL C CA  1 
ATOM   9703  C C   . VAL C 1 98  ? 45.047  71.495  100.859 1.00 12.05 ? 98  VAL C C   1 
ATOM   9704  O O   . VAL C 1 98  ? 45.053  70.743  99.889  1.00 11.41 ? 98  VAL C O   1 
ATOM   9705  C CB  . VAL C 1 98  ? 43.727  69.851  102.267 1.00 12.52 ? 98  VAL C CB  1 
ATOM   9706  C CG1 . VAL C 1 98  ? 44.994  69.080  102.657 1.00 13.94 ? 98  VAL C CG1 1 
ATOM   9707  C CG2 . VAL C 1 98  ? 42.692  69.727  103.390 1.00 14.27 ? 98  VAL C CG2 1 
ATOM   9708  N N   . LEU C 1 99  ? 45.881  72.519  100.987 1.00 11.63 ? 99  LEU C N   1 
ATOM   9709  C CA  . LEU C 1 99  ? 46.773  72.903  99.915  1.00 11.85 ? 99  LEU C CA  1 
ATOM   9710  C C   . LEU C 1 99  ? 48.225  73.110  100.334 1.00 11.72 ? 99  LEU C C   1 
ATOM   9711  O O   . LEU C 1 99  ? 48.836  74.110  99.964  1.00 11.85 ? 99  LEU C O   1 
ATOM   9712  C CB  . LEU C 1 99  ? 46.230  74.172  99.214  1.00 11.95 ? 99  LEU C CB  1 
ATOM   9713  C CG  . LEU C 1 99  ? 44.989  73.969  98.332  1.00 12.99 ? 99  LEU C CG  1 
ATOM   9714  C CD1 . LEU C 1 99  ? 44.493  75.282  97.814  1.00 14.71 ? 99  LEU C CD1 1 
ATOM   9715  C CD2 . LEU C 1 99  ? 45.310  73.037  97.174  1.00 15.32 ? 99  LEU C CD2 1 
ATOM   9716  N N   . HIS C 1 100 ? 48.803  72.178  101.096 1.00 11.54 ? 100 HIS C N   1 
ATOM   9717  C CA  . HIS C 1 100 ? 50.248  72.232  101.265 1.00 11.26 ? 100 HIS C CA  1 
ATOM   9718  C C   . HIS C 1 100 ? 50.917  72.050  99.882  1.00 10.92 ? 100 HIS C C   1 
ATOM   9719  O O   . HIS C 1 100 ? 52.042  72.480  99.688  1.00 10.96 ? 100 HIS C O   1 
ATOM   9720  C CB  . HIS C 1 100 ? 50.775  71.196  102.281 1.00 11.32 ? 100 HIS C CB  1 
ATOM   9721  C CG  . HIS C 1 100 ? 50.093  69.865  102.216 1.00 11.57 ? 100 HIS C CG  1 
ATOM   9722  N ND1 . HIS C 1 100 ? 48.878  69.621  102.825 1.00 12.79 ? 100 HIS C ND1 1 
ATOM   9723  C CD2 . HIS C 1 100 ? 50.466  68.695  101.645 1.00 11.81 ? 100 HIS C CD2 1 
ATOM   9724  C CE1 . HIS C 1 100 ? 48.527  68.366  102.613 1.00 11.04 ? 100 HIS C CE1 1 
ATOM   9725  N NE2 . HIS C 1 100 ? 49.473  67.782  101.901 1.00 10.22 ? 100 HIS C NE2 1 
ATOM   9726  N N   . VAL C 1 101 ? 50.243  71.418  98.918  1.00 11.92 ? 101 VAL C N   1 
ATOM   9727  C CA  . VAL C 1 101 ? 50.852  71.281  97.578  1.00 12.26 ? 101 VAL C CA  1 
ATOM   9728  C C   . VAL C 1 101 ? 51.019  72.639  96.898  1.00 12.90 ? 101 VAL C C   1 
ATOM   9729  O O   . VAL C 1 101 ? 51.877  72.811  96.018  1.00 13.04 ? 101 VAL C O   1 
ATOM   9730  C CB  . VAL C 1 101 ? 50.072  70.348  96.612  1.00 11.86 ? 101 VAL C CB  1 
ATOM   9731  C CG1 . VAL C 1 101 ? 50.131  68.907  97.081  1.00 13.30 ? 101 VAL C CG1 1 
ATOM   9732  C CG2 . VAL C 1 101 ? 48.640  70.819  96.409  1.00 12.87 ? 101 VAL C CG2 1 
ATOM   9733  N N   . ALA C 1 102 ? 50.189  73.603  97.273  1.00 13.18 ? 102 ALA C N   1 
ATOM   9734  C CA  . ALA C 1 102 ? 50.292  74.929  96.672  1.00 13.14 ? 102 ALA C CA  1 
ATOM   9735  C C   . ALA C 1 102 ? 51.526  75.643  97.169  1.00 12.69 ? 102 ALA C C   1 
ATOM   9736  O O   . ALA C 1 102 ? 52.133  76.433  96.446  1.00 12.97 ? 102 ALA C O   1 
ATOM   9737  C CB  . ALA C 1 102 ? 49.025  75.769  96.958  1.00 13.42 ? 102 ALA C CB  1 
ATOM   9738  N N   . LEU C 1 103 ? 51.914  75.367  98.406  1.00 12.59 ? 103 LEU C N   1 
ATOM   9739  C CA  . LEU C 1 103 ? 53.066  76.014  99.009  1.00 12.36 ? 103 LEU C CA  1 
ATOM   9740  C C   . LEU C 1 103 ? 54.342  75.749  98.246  1.00 12.00 ? 103 LEU C C   1 
ATOM   9741  O O   . LEU C 1 103 ? 55.203  76.619  98.157  1.00 12.58 ? 103 LEU C O   1 
ATOM   9742  C CB  . LEU C 1 103 ? 53.255  75.539  100.457 1.00 12.69 ? 103 LEU C CB  1 
ATOM   9743  C CG  . LEU C 1 103 ? 52.042  75.785  101.353 1.00 12.65 ? 103 LEU C CG  1 
ATOM   9744  C CD1 . LEU C 1 103 ? 52.212  75.108  102.729 1.00 11.44 ? 103 LEU C CD1 1 
ATOM   9745  C CD2 . LEU C 1 103 ? 51.832  77.292  101.507 1.00 13.22 ? 103 LEU C CD2 1 
ATOM   9746  N N   . ARG C 1 104 ? 54.459  74.544  97.706  1.00 11.87 ? 104 ARG C N   1 
ATOM   9747  C CA  . ARG C 1 104 ? 55.632  74.160  96.937  1.00 12.11 ? 104 ARG C CA  1 
ATOM   9748  C C   . ARG C 1 104 ? 55.342  74.057  95.439  1.00 12.70 ? 104 ARG C C   1 
ATOM   9749  O O   . ARG C 1 104 ? 56.069  73.373  94.717  1.00 12.46 ? 104 ARG C O   1 
ATOM   9750  C CB  . ARG C 1 104 ? 56.201  72.819  97.443  1.00 11.97 ? 104 ARG C CB  1 
ATOM   9751  C CG  . ARG C 1 104 ? 55.275  71.626  97.349  1.00 11.55 ? 104 ARG C CG  1 
ATOM   9752  C CD  . ARG C 1 104 ? 54.877  71.028  98.691  1.00 11.17 ? 104 ARG C CD  1 
ATOM   9753  N NE  . ARG C 1 104 ? 54.254  69.718  98.553  1.00 10.74 ? 104 ARG C NE  1 
ATOM   9754  C CZ  . ARG C 1 104 ? 53.914  68.937  99.585  1.00 11.38 ? 104 ARG C CZ  1 
ATOM   9755  N NH1 . ARG C 1 104 ? 53.384  67.732  99.389  1.00 10.09 ? 104 ARG C NH1 1 
ATOM   9756  N NH2 . ARG C 1 104 ? 54.105  69.367  100.816 1.00 10.20 ? 104 ARG C NH2 1 
ATOM   9757  N N   . ASN C 1 105 ? 54.288  74.720  94.968  1.00 13.79 ? 105 ASN C N   1 
ATOM   9758  C CA  . ASN C 1 105 ? 53.919  74.649  93.544  1.00 14.67 ? 105 ASN C CA  1 
ATOM   9759  C C   . ASN C 1 105 ? 54.883  75.458  92.664  1.00 15.20 ? 105 ASN C C   1 
ATOM   9760  O O   . ASN C 1 105 ? 54.538  76.539  92.189  1.00 15.55 ? 105 ASN C O   1 
ATOM   9761  C CB  . ASN C 1 105 ? 52.485  75.159  93.350  1.00 14.60 ? 105 ASN C CB  1 
ATOM   9762  C CG  . ASN C 1 105 ? 52.039  75.125  91.887  1.00 15.64 ? 105 ASN C CG  1 
ATOM   9763  O OD1 . ASN C 1 105 ? 52.633  74.431  91.053  1.00 14.80 ? 105 ASN C OD1 1 
ATOM   9764  N ND2 . ASN C 1 105 ? 50.968  75.849  91.580  1.00 14.99 ? 105 ASN C ND2 1 
ATOM   9765  N N   . ARG C 1 106 ? 56.086  74.931  92.448  1.00 15.97 ? 106 ARG C N   1 
ATOM   9766  C CA  . ARG C 1 106 ? 57.124  75.656  91.710  1.00 16.58 ? 106 ARG C CA  1 
ATOM   9767  C C   . ARG C 1 106 ? 56.710  76.075  90.292  1.00 17.11 ? 106 ARG C C   1 
ATOM   9768  O O   . ARG C 1 106 ? 57.224  77.062  89.772  1.00 16.83 ? 106 ARG C O   1 
ATOM   9769  C CB  . ARG C 1 106 ? 58.401  74.811  91.605  1.00 16.57 ? 106 ARG C CB  1 
ATOM   9770  C CG  . ARG C 1 106 ? 58.964  74.330  92.941  1.00 16.20 ? 106 ARG C CG  1 
ATOM   9771  C CD  . ARG C 1 106 ? 59.071  75.402  93.969  1.00 16.66 ? 106 ARG C CD  1 
ATOM   9772  N NE  . ARG C 1 106 ? 60.139  76.339  93.676  1.00 16.22 ? 106 ARG C NE  1 
ATOM   9773  C CZ  . ARG C 1 106 ? 60.246  77.546  94.196  1.00 16.47 ? 106 ARG C CZ  1 
ATOM   9774  N NH1 . ARG C 1 106 ? 59.343  77.997  95.042  1.00 15.33 ? 106 ARG C NH1 1 
ATOM   9775  N NH2 . ARG C 1 106 ? 61.286  78.310  93.876  1.00 17.83 ? 106 ARG C NH2 1 
ATOM   9776  N N   . SER C 1 107 ? 55.800  75.314  89.694  1.00 17.87 ? 107 SER C N   1 
ATOM   9777  C CA  . SER C 1 107 ? 55.303  75.552  88.329  1.00 19.27 ? 107 SER C CA  1 
ATOM   9778  C C   . SER C 1 107 ? 54.471  76.818  88.221  1.00 19.65 ? 107 SER C C   1 
ATOM   9779  O O   . SER C 1 107 ? 54.324  77.399  87.136  1.00 19.27 ? 107 SER C O   1 
ATOM   9780  C CB  . SER C 1 107 ? 54.418  74.386  87.911  1.00 19.58 ? 107 SER C CB  1 
ATOM   9781  O OG  . SER C 1 107 ? 53.061  74.653  88.270  1.00 22.80 ? 107 SER C OG  1 
ATOM   9782  N N   . ASN C 1 108 ? 53.873  77.205  89.346  1.00 19.65 ? 108 ASN C N   1 
ATOM   9783  C CA  . ASN C 1 108 ? 53.012  78.379  89.420  1.00 19.97 ? 108 ASN C CA  1 
ATOM   9784  C C   . ASN C 1 108 ? 51.697  78.275  88.658  1.00 20.44 ? 108 ASN C C   1 
ATOM   9785  O O   . ASN C 1 108 ? 50.988  79.256  88.489  1.00 20.16 ? 108 ASN C O   1 
ATOM   9786  C CB  . ASN C 1 108 ? 53.791  79.645  89.076  1.00 20.14 ? 108 ASN C CB  1 
ATOM   9787  C CG  . ASN C 1 108 ? 54.716  80.040  90.193  1.00 19.98 ? 108 ASN C CG  1 
ATOM   9788  O OD1 . ASN C 1 108 ? 54.364  79.889  91.369  1.00 17.81 ? 108 ASN C OD1 1 
ATOM   9789  N ND2 . ASN C 1 108 ? 55.914  80.503  89.854  1.00 18.74 ? 108 ASN C ND2 1 
ATOM   9790  N N   . THR C 1 109 ? 51.375  77.064  88.218  1.00 20.92 ? 109 THR C N   1 
ATOM   9791  C CA  . THR C 1 109 ? 50.080  76.786  87.648  1.00 21.52 ? 109 THR C CA  1 
ATOM   9792  C C   . THR C 1 109 ? 49.037  77.238  88.660  1.00 20.91 ? 109 THR C C   1 
ATOM   9793  O O   . THR C 1 109 ? 49.161  76.918  89.834  1.00 19.63 ? 109 THR C O   1 
ATOM   9794  C CB  . THR C 1 109 ? 49.940  75.282  87.450  1.00 21.68 ? 109 THR C CB  1 
ATOM   9795  O OG1 . THR C 1 109 ? 50.959  74.820  86.558  1.00 25.04 ? 109 THR C OG1 1 
ATOM   9796  C CG2 . THR C 1 109 ? 48.660  74.957  86.713  1.00 23.91 ? 109 THR C CG2 1 
ATOM   9797  N N   . PRO C 1 110 ? 48.018  77.982  88.232  1.00 20.35 ? 110 PRO C N   1 
ATOM   9798  C CA  . PRO C 1 110 ? 47.001  78.436  89.174  1.00 19.84 ? 110 PRO C CA  1 
ATOM   9799  C C   . PRO C 1 110 ? 46.322  77.317  89.928  1.00 19.09 ? 110 PRO C C   1 
ATOM   9800  O O   . PRO C 1 110 ? 46.045  76.240  89.388  1.00 18.54 ? 110 PRO C O   1 
ATOM   9801  C CB  . PRO C 1 110 ? 45.987  79.160  88.281  1.00 20.14 ? 110 PRO C CB  1 
ATOM   9802  C CG  . PRO C 1 110 ? 46.774  79.618  87.125  1.00 20.46 ? 110 PRO C CG  1 
ATOM   9803  C CD  . PRO C 1 110 ? 47.780  78.507  86.877  1.00 20.81 ? 110 PRO C CD  1 
ATOM   9804  N N   . ILE C 1 111 ? 46.071  77.584  91.201  1.00 18.57 ? 111 ILE C N   1 
ATOM   9805  C CA  . ILE C 1 111 ? 45.309  76.680  92.051  1.00 18.80 ? 111 ILE C CA  1 
ATOM   9806  C C   . ILE C 1 111 ? 44.308  77.581  92.743  1.00 18.86 ? 111 ILE C C   1 
ATOM   9807  O O   . ILE C 1 111 ? 44.706  78.470  93.473  1.00 18.54 ? 111 ILE C O   1 
ATOM   9808  C CB  . ILE C 1 111 ? 46.184  75.975  93.085  1.00 18.33 ? 111 ILE C CB  1 
ATOM   9809  C CG1 . ILE C 1 111 ? 47.231  75.090  92.402  1.00 19.98 ? 111 ILE C CG1 1 
ATOM   9810  C CG2 . ILE C 1 111 ? 45.326  75.087  93.968  1.00 18.14 ? 111 ILE C CG2 1 
ATOM   9811  C CD1 . ILE C 1 111 ? 48.284  74.555  93.365  1.00 19.53 ? 111 ILE C CD1 1 
ATOM   9812  N N   . LEU C 1 112 ? 43.027  77.345  92.494  1.00 20.01 ? 112 LEU C N   1 
ATOM   9813  C CA  . LEU C 1 112 ? 41.962  78.209  93.000  1.00 21.75 ? 112 LEU C CA  1 
ATOM   9814  C C   . LEU C 1 112 ? 41.198  77.644  94.168  1.00 22.71 ? 112 LEU C C   1 
ATOM   9815  O O   . LEU C 1 112 ? 40.898  76.451  94.220  1.00 23.00 ? 112 LEU C O   1 
ATOM   9816  C CB  . LEU C 1 112 ? 40.905  78.469  91.916  1.00 21.69 ? 112 LEU C CB  1 
ATOM   9817  C CG  . LEU C 1 112 ? 41.344  78.660  90.472  1.00 23.14 ? 112 LEU C CG  1 
ATOM   9818  C CD1 . LEU C 1 112 ? 40.107  78.684  89.566  1.00 24.90 ? 112 LEU C CD1 1 
ATOM   9819  C CD2 . LEU C 1 112 ? 42.160  79.916  90.311  1.00 24.32 ? 112 LEU C CD2 1 
ATOM   9820  N N   . VAL C 1 113 ? 40.858  78.523  95.097  1.00 23.91 ? 113 VAL C N   1 
ATOM   9821  C CA  . VAL C 1 113 ? 39.913  78.174  96.132  1.00 25.32 ? 113 VAL C CA  1 
ATOM   9822  C C   . VAL C 1 113 ? 38.883  79.288  96.069  1.00 25.95 ? 113 VAL C C   1 
ATOM   9823  O O   . VAL C 1 113 ? 39.228  80.471  96.102  1.00 26.06 ? 113 VAL C O   1 
ATOM   9824  C CB  . VAL C 1 113 ? 40.551  78.018  97.523  1.00 26.16 ? 113 VAL C CB  1 
ATOM   9825  C CG1 . VAL C 1 113 ? 41.739  78.912  97.663  1.00 27.32 ? 113 VAL C CG1 1 
ATOM   9826  C CG2 . VAL C 1 113 ? 39.528  78.263  98.624  1.00 26.31 ? 113 VAL C CG2 1 
ATOM   9827  N N   . ASP C 1 114 ? 37.629  78.902  95.884  1.00 26.84 ? 114 ASP C N   1 
ATOM   9828  C CA  . ASP C 1 114 ? 36.546  79.873  95.770  1.00 27.06 ? 114 ASP C CA  1 
ATOM   9829  C C   . ASP C 1 114 ? 36.820  80.772  94.570  1.00 27.16 ? 114 ASP C C   1 
ATOM   9830  O O   . ASP C 1 114 ? 36.591  81.984  94.611  1.00 28.17 ? 114 ASP C O   1 
ATOM   9831  C CB  . ASP C 1 114 ? 36.422  80.694  97.053  1.00 27.36 ? 114 ASP C CB  1 
ATOM   9832  C CG  . ASP C 1 114 ? 35.897  79.873  98.235  1.00 28.00 ? 114 ASP C CG  1 
ATOM   9833  O OD1 . ASP C 1 114 ? 36.305  80.150  99.390  1.00 30.26 ? 114 ASP C OD1 1 
ATOM   9834  O OD2 . ASP C 1 114 ? 35.065  78.954  98.105  1.00 29.78 ? 114 ASP C OD2 1 
ATOM   9835  N N   . GLY C 1 115 ? 37.361  80.176  93.515  1.00 26.48 ? 115 GLY C N   1 
ATOM   9836  C CA  . GLY C 1 115 ? 37.612  80.879  92.273  1.00 25.91 ? 115 GLY C CA  1 
ATOM   9837  C C   . GLY C 1 115 ? 38.835  81.781  92.212  1.00 25.59 ? 115 GLY C C   1 
ATOM   9838  O O   . GLY C 1 115 ? 39.092  82.383  91.170  1.00 25.42 ? 115 GLY C O   1 
ATOM   9839  N N   . LYS C 1 116 ? 39.588  81.886  93.304  1.00 24.78 ? 116 LYS C N   1 
ATOM   9840  C CA  . LYS C 1 116 ? 40.759  82.751  93.335  1.00 24.15 ? 116 LYS C CA  1 
ATOM   9841  C C   . LYS C 1 116 ? 42.083  81.971  93.419  1.00 23.39 ? 116 LYS C C   1 
ATOM   9842  O O   . LYS C 1 116 ? 42.252  81.093  94.264  1.00 22.68 ? 116 LYS C O   1 
ATOM   9843  C CB  . LYS C 1 116 ? 40.663  83.724  94.512  1.00 24.34 ? 116 LYS C CB  1 
ATOM   9844  C CG  . LYS C 1 116 ? 41.885  84.628  94.633  1.00 26.51 ? 116 LYS C CG  1 
ATOM   9845  C CD  . LYS C 1 116 ? 41.674  85.774  95.604  1.00 29.25 ? 116 LYS C CD  1 
ATOM   9846  C CE  . LYS C 1 116 ? 42.730  86.857  95.417  1.00 31.50 ? 116 LYS C CE  1 
ATOM   9847  N NZ  . LYS C 1 116 ? 42.442  88.103  96.204  1.00 33.12 ? 116 LYS C NZ  1 
ATOM   9848  N N   . ASP C 1 117 ? 43.025  82.315  92.544  1.00 22.12 ? 117 ASP C N   1 
ATOM   9849  C CA  . ASP C 1 117 ? 44.338  81.689  92.553  1.00 21.60 ? 117 ASP C CA  1 
ATOM   9850  C C   . ASP C 1 117 ? 45.104  82.011  93.835  1.00 20.79 ? 117 ASP C C   1 
ATOM   9851  O O   . ASP C 1 117 ? 45.320  83.182  94.157  1.00 20.49 ? 117 ASP C O   1 
ATOM   9852  C CB  . ASP C 1 117 ? 45.144  82.186  91.363  1.00 21.34 ? 117 ASP C CB  1 
ATOM   9853  C CG  . ASP C 1 117 ? 46.438  81.427  91.170  1.00 21.27 ? 117 ASP C CG  1 
ATOM   9854  O OD1 . ASP C 1 117 ? 46.708  80.419  91.898  1.00 17.46 ? 117 ASP C OD1 1 
ATOM   9855  O OD2 . ASP C 1 117 ? 47.246  81.781  90.284  1.00 18.16 ? 117 ASP C OD2 1 
ATOM   9856  N N   . VAL C 1 118 ? 45.531  80.980  94.554  1.00 19.44 ? 118 VAL C N   1 
ATOM   9857  C CA  . VAL C 1 118 ? 46.336  81.192  95.761  1.00 19.15 ? 118 VAL C CA  1 
ATOM   9858  C C   . VAL C 1 118 ? 47.811  81.458  95.499  1.00 18.54 ? 118 VAL C C   1 
ATOM   9859  O O   . VAL C 1 118 ? 48.529  81.851  96.400  1.00 18.31 ? 118 VAL C O   1 
ATOM   9860  C CB  . VAL C 1 118 ? 46.298  79.973  96.716  1.00 18.96 ? 118 VAL C CB  1 
ATOM   9861  C CG1 . VAL C 1 118 ? 44.868  79.681  97.158  1.00 19.59 ? 118 VAL C CG1 1 
ATOM   9862  C CG2 . VAL C 1 118 ? 46.950  78.746  96.069  1.00 19.12 ? 118 VAL C CG2 1 
ATOM   9863  N N   . MET C 1 119 ? 48.292  81.245  94.280  1.00 18.23 ? 119 MET C N   1 
ATOM   9864  C CA  . MET C 1 119 ? 49.728  81.338  94.081  1.00 18.19 ? 119 MET C CA  1 
ATOM   9865  C C   . MET C 1 119 ? 50.354  82.704  94.332  1.00 18.56 ? 119 MET C C   1 
ATOM   9866  O O   . MET C 1 119 ? 51.411  82.774  94.937  1.00 19.21 ? 119 MET C O   1 
ATOM   9867  C CB  . MET C 1 119 ? 50.130  80.763  92.726  1.00 18.10 ? 119 MET C CB  1 
ATOM   9868  C CG  . MET C 1 119 ? 49.848  79.263  92.625  1.00 17.41 ? 119 MET C CG  1 
ATOM   9869  S SD  . MET C 1 119 ? 50.518  78.241  94.009  1.00 14.95 ? 119 MET C SD  1 
ATOM   9870  C CE  . MET C 1 119 ? 52.201  78.733  94.015  1.00 15.78 ? 119 MET C CE  1 
ATOM   9871  N N   . PRO C 1 120 ? 49.750  83.796  93.871  1.00 19.30 ? 120 PRO C N   1 
ATOM   9872  C CA  . PRO C 1 120 ? 50.333  85.105  94.156  1.00 19.58 ? 120 PRO C CA  1 
ATOM   9873  C C   . PRO C 1 120 ? 50.584  85.335  95.659  1.00 19.49 ? 120 PRO C C   1 
ATOM   9874  O O   . PRO C 1 120 ? 51.630  85.873  95.982  1.00 19.81 ? 120 PRO C O   1 
ATOM   9875  C CB  . PRO C 1 120 ? 49.303  86.091  93.573  1.00 19.74 ? 120 PRO C CB  1 
ATOM   9876  C CG  . PRO C 1 120 ? 48.636  85.330  92.497  1.00 20.11 ? 120 PRO C CG  1 
ATOM   9877  C CD  . PRO C 1 120 ? 48.564  83.892  93.006  1.00 19.11 ? 120 PRO C CD  1 
ATOM   9878  N N   . GLU C 1 121 ? 49.682  84.921  96.548  1.00 20.04 ? 121 GLU C N   1 
ATOM   9879  C CA  . GLU C 1 121 ? 49.901  85.146  97.982  1.00 20.60 ? 121 GLU C CA  1 
ATOM   9880  C C   . GLU C 1 121 ? 50.989  84.219  98.513  1.00 19.25 ? 121 GLU C C   1 
ATOM   9881  O O   . GLU C 1 121 ? 51.801  84.610  99.356  1.00 18.97 ? 121 GLU C O   1 
ATOM   9882  C CB  . GLU C 1 121 ? 48.618  84.986  98.793  1.00 21.37 ? 121 GLU C CB  1 
ATOM   9883  C CG  . GLU C 1 121 ? 47.717  86.227  98.832  1.00 26.73 ? 121 GLU C CG  1 
ATOM   9884  C CD  . GLU C 1 121 ? 48.428  87.510  99.250  1.00 32.80 ? 121 GLU C CD  1 
ATOM   9885  O OE1 . GLU C 1 121 ? 47.731  88.511  99.498  1.00 38.87 ? 121 GLU C OE1 1 
ATOM   9886  O OE2 . GLU C 1 121 ? 49.673  87.547  99.336  1.00 37.49 ? 121 GLU C OE2 1 
ATOM   9887  N N   . VAL C 1 122 ? 50.990  82.980  98.039  1.00 18.02 ? 122 VAL C N   1 
ATOM   9888  C CA  . VAL C 1 122 ? 52.062  82.052  98.381  1.00 17.02 ? 122 VAL C CA  1 
ATOM   9889  C C   . VAL C 1 122 ? 53.411  82.662  98.022  1.00 16.93 ? 122 VAL C C   1 
ATOM   9890  O O   . VAL C 1 122 ? 54.349  82.689  98.838  1.00 15.87 ? 122 VAL C O   1 
ATOM   9891  C CB  . VAL C 1 122 ? 51.915  80.722  97.605  1.00 16.69 ? 122 VAL C CB  1 
ATOM   9892  C CG1 . VAL C 1 122 ? 53.176  79.870  97.742  1.00 16.65 ? 122 VAL C CG1 1 
ATOM   9893  C CG2 . VAL C 1 122 ? 50.721  79.957  98.088  1.00 16.41 ? 122 VAL C CG2 1 
ATOM   9894  N N   . ASN C 1 123 ? 53.517  83.130  96.775  1.00 16.98 ? 123 ASN C N   1 
ATOM   9895  C CA  . ASN C 1 123 ? 54.751  83.721  96.278  1.00 17.18 ? 123 ASN C CA  1 
ATOM   9896  C C   . ASN C 1 123 ? 55.119  85.044  96.957  1.00 17.43 ? 123 ASN C C   1 
ATOM   9897  O O   . ASN C 1 123 ? 56.296  85.349  97.159  1.00 17.26 ? 123 ASN C O   1 
ATOM   9898  C CB  . ASN C 1 123 ? 54.677  83.881  94.747  1.00 17.22 ? 123 ASN C CB  1 
ATOM   9899  C CG  . ASN C 1 123 ? 54.702  82.550  94.033  1.00 18.01 ? 123 ASN C CG  1 
ATOM   9900  O OD1 . ASN C 1 123 ? 53.984  82.334  93.046  1.00 20.05 ? 123 ASN C OD1 1 
ATOM   9901  N ND2 . ASN C 1 123 ? 55.513  81.629  94.541  1.00 14.75 ? 123 ASN C ND2 1 
ATOM   9902  N N   . LYS C 1 124 ? 54.126  85.839  97.313  1.00 17.81 ? 124 LYS C N   1 
ATOM   9903  C CA  . LYS C 1 124 ? 54.425  87.079  98.012  1.00 18.35 ? 124 LYS C CA  1 
ATOM   9904  C C   . LYS C 1 124 ? 55.132  86.755  99.346  1.00 17.68 ? 124 LYS C C   1 
ATOM   9905  O O   . LYS C 1 124 ? 56.169  87.333  99.675  1.00 17.81 ? 124 LYS C O   1 
ATOM   9906  C CB  . LYS C 1 124 ? 53.148  87.885  98.238  1.00 19.34 ? 124 LYS C CB  1 
ATOM   9907  C CG  . LYS C 1 124 ? 53.382  89.175  98.991  1.00 22.40 ? 124 LYS C CG  1 
ATOM   9908  C CD  . LYS C 1 124 ? 52.099  89.957  99.194  1.00 26.95 ? 124 LYS C CD  1 
ATOM   9909  C CE  . LYS C 1 124 ? 52.227  90.860  100.406 1.00 29.12 ? 124 LYS C CE  1 
ATOM   9910  N NZ  . LYS C 1 124 ? 51.507  92.161  100.220 1.00 32.13 ? 124 LYS C NZ  1 
ATOM   9911  N N   . VAL C 1 125 ? 54.597  85.798  100.094 1.00 16.74 ? 125 VAL C N   1 
ATOM   9912  C CA  . VAL C 1 125 ? 55.231  85.418  101.364 1.00 15.89 ? 125 VAL C CA  1 
ATOM   9913  C C   . VAL C 1 125 ? 56.622  84.813  101.117 1.00 15.17 ? 125 VAL C C   1 
ATOM   9914  O O   . VAL C 1 125 ? 57.580  85.124  101.813 1.00 14.25 ? 125 VAL C O   1 
ATOM   9915  C CB  . VAL C 1 125 ? 54.337  84.447  102.173 1.00 15.83 ? 125 VAL C CB  1 
ATOM   9916  C CG1 . VAL C 1 125 ? 55.075  83.922  103.398 1.00 14.58 ? 125 VAL C CG1 1 
ATOM   9917  C CG2 . VAL C 1 125 ? 53.043  85.134  102.577 1.00 16.08 ? 125 VAL C CG2 1 
ATOM   9918  N N   . LEU C 1 126 ? 56.748  83.949  100.119 1.00 15.73 ? 126 LEU C N   1 
ATOM   9919  C CA  . LEU C 1 126 ? 58.060  83.388  99.800  1.00 16.01 ? 126 LEU C CA  1 
ATOM   9920  C C   . LEU C 1 126 ? 59.073  84.497  99.489  1.00 16.46 ? 126 LEU C C   1 
ATOM   9921  O O   . LEU C 1 126 ? 60.218  84.442  99.923  1.00 15.28 ? 126 LEU C O   1 
ATOM   9922  C CB  . LEU C 1 126 ? 57.980  82.380  98.652  1.00 15.93 ? 126 LEU C CB  1 
ATOM   9923  C CG  . LEU C 1 126 ? 57.396  81.012  99.011  1.00 16.00 ? 126 LEU C CG  1 
ATOM   9924  C CD1 . LEU C 1 126 ? 57.097  80.228  97.743  1.00 16.76 ? 126 LEU C CD1 1 
ATOM   9925  C CD2 . LEU C 1 126 ? 58.370  80.251  99.899  1.00 15.89 ? 126 LEU C CD2 1 
ATOM   9926  N N   . ASP C 1 127 ? 58.644  85.507  98.737  1.00 17.02 ? 127 ASP C N   1 
ATOM   9927  C CA  . ASP C 1 127 ? 59.521  86.636  98.454  1.00 17.60 ? 127 ASP C CA  1 
ATOM   9928  C C   . ASP C 1 127 ? 59.901  87.353  99.739  1.00 17.39 ? 127 ASP C C   1 
ATOM   9929  O O   . ASP C 1 127 ? 61.060  87.728  99.951  1.00 16.61 ? 127 ASP C O   1 
ATOM   9930  C CB  . ASP C 1 127 ? 58.835  87.629  97.522  1.00 18.01 ? 127 ASP C CB  1 
ATOM   9931  C CG  . ASP C 1 127 ? 58.837  87.171  96.100  1.00 20.72 ? 127 ASP C CG  1 
ATOM   9932  O OD1 . ASP C 1 127 ? 59.565  86.206  95.774  1.00 24.07 ? 127 ASP C OD1 1 
ATOM   9933  O OD2 . ASP C 1 127 ? 58.126  87.713  95.233  1.00 23.93 ? 127 ASP C OD2 1 
ATOM   9934  N N   . LYS C 1 128 ? 58.912  87.550  100.600 1.00 17.38 ? 128 LYS C N   1 
ATOM   9935  C CA  . LYS C 1 128 ? 59.159  88.253  101.842 1.00 17.55 ? 128 LYS C CA  1 
ATOM   9936  C C   . LYS C 1 128 ? 60.160  87.445  102.655 1.00 16.97 ? 128 LYS C C   1 
ATOM   9937  O O   . LYS C 1 128 ? 61.061  87.998  103.278 1.00 16.49 ? 128 LYS C O   1 
ATOM   9938  C CB  . LYS C 1 128 ? 57.851  88.444  102.595 1.00 17.81 ? 128 LYS C CB  1 
ATOM   9939  C CG  . LYS C 1 128 ? 57.957  89.238  103.837 1.00 19.81 ? 128 LYS C CG  1 
ATOM   9940  C CD  . LYS C 1 128 ? 56.645  89.125  104.617 1.00 21.22 ? 128 LYS C CD  1 
ATOM   9941  C CE  . LYS C 1 128 ? 56.561  90.165  105.703 1.00 21.80 ? 128 LYS C CE  1 
ATOM   9942  N NZ  . LYS C 1 128 ? 56.408  91.517  105.143 1.00 21.33 ? 128 LYS C NZ  1 
ATOM   9943  N N   . MET C 1 129 ? 60.008  86.120  102.622 1.00 16.88 ? 129 MET C N   1 
ATOM   9944  C CA  . MET C 1 129 ? 60.914  85.219  103.325 1.00 16.74 ? 129 MET C CA  1 
ATOM   9945  C C   . MET C 1 129 ? 62.327  85.299  102.779 1.00 16.64 ? 129 MET C C   1 
ATOM   9946  O O   . MET C 1 129 ? 63.316  85.336  103.526 1.00 16.80 ? 129 MET C O   1 
ATOM   9947  C CB  . MET C 1 129 ? 60.408  83.774  103.192 1.00 16.58 ? 129 MET C CB  1 
ATOM   9948  C CG  . MET C 1 129 ? 59.205  83.451  104.053 1.00 15.93 ? 129 MET C CG  1 
ATOM   9949  S SD  . MET C 1 129 ? 58.470  81.828  103.682 1.00 16.49 ? 129 MET C SD  1 
ATOM   9950  C CE  . MET C 1 129 ? 59.650  80.734  104.491 1.00 16.59 ? 129 MET C CE  1 
ATOM   9951  N N   . LYS C 1 130 ? 62.441  85.298  101.465 1.00 16.93 ? 130 LYS C N   1 
ATOM   9952  C CA  . LYS C 1 130 ? 63.756  85.372  100.841 1.00 17.68 ? 130 LYS C CA  1 
ATOM   9953  C C   . LYS C 1 130 ? 64.469  86.662  101.250 1.00 17.77 ? 130 LYS C C   1 
ATOM   9954  O O   . LYS C 1 130 ? 65.648  86.659  101.605 1.00 17.30 ? 130 LYS C O   1 
ATOM   9955  C CB  . LYS C 1 130 ? 63.595  85.298  99.325  1.00 18.05 ? 130 LYS C CB  1 
ATOM   9956  C CG  . LYS C 1 130 ? 64.876  85.371  98.550  1.00 19.32 ? 130 LYS C CG  1 
ATOM   9957  C CD  . LYS C 1 130 ? 64.581  85.157  97.068  1.00 21.88 ? 130 LYS C CD  1 
ATOM   9958  C CE  . LYS C 1 130 ? 65.709  85.673  96.195  1.00 24.93 ? 130 LYS C CE  1 
ATOM   9959  N NZ  . LYS C 1 130 ? 66.504  84.608  95.546  1.00 27.39 ? 130 LYS C NZ  1 
ATOM   9960  N N   . SER C 1 131 ? 63.743  87.768  101.202 1.00 18.80 ? 131 SER C N   1 
ATOM   9961  C CA  . SER C 1 131 ? 64.313  89.064  101.571 1.00 19.44 ? 131 SER C CA  1 
ATOM   9962  C C   . SER C 1 131 ? 64.819  89.024  103.002 1.00 19.15 ? 131 SER C C   1 
ATOM   9963  O O   . SER C 1 131 ? 65.977  89.358  103.286 1.00 19.31 ? 131 SER C O   1 
ATOM   9964  C CB  . SER C 1 131 ? 63.264  90.171  101.397 1.00 20.07 ? 131 SER C CB  1 
ATOM   9965  O OG  . SER C 1 131 ? 63.717  91.390  101.969 1.00 21.40 ? 131 SER C OG  1 
ATOM   9966  N N   . PHE C 1 132 ? 63.951  88.584  103.904 1.00 19.09 ? 132 PHE C N   1 
ATOM   9967  C CA  . PHE C 1 132 ? 64.302  88.515  105.322 1.00 18.40 ? 132 PHE C CA  1 
ATOM   9968  C C   . PHE C 1 132 ? 65.551  87.663  105.542 1.00 18.02 ? 132 PHE C C   1 
ATOM   9969  O O   . PHE C 1 132 ? 66.453  88.071  106.253 1.00 17.51 ? 132 PHE C O   1 
ATOM   9970  C CB  . PHE C 1 132 ? 63.136  88.002  106.158 1.00 18.27 ? 132 PHE C CB  1 
ATOM   9971  C CG  . PHE C 1 132 ? 63.402  88.042  107.629 1.00 17.88 ? 132 PHE C CG  1 
ATOM   9972  C CD1 . PHE C 1 132 ? 63.421  89.255  108.311 1.00 18.36 ? 132 PHE C CD1 1 
ATOM   9973  C CD2 . PHE C 1 132 ? 63.670  86.880  108.329 1.00 17.86 ? 132 PHE C CD2 1 
ATOM   9974  C CE1 . PHE C 1 132 ? 63.670  89.298  109.659 1.00 18.00 ? 132 PHE C CE1 1 
ATOM   9975  C CE2 . PHE C 1 132 ? 63.928  86.922  109.679 1.00 17.24 ? 132 PHE C CE2 1 
ATOM   9976  C CZ  . PHE C 1 132 ? 63.933  88.131  110.347 1.00 17.49 ? 132 PHE C CZ  1 
ATOM   9977  N N   . CYS C 1 133 ? 65.603  86.484  104.916 1.00 17.82 ? 133 CYS C N   1 
ATOM   9978  C CA  . CYS C 1 133 ? 66.735  85.574  105.055 1.00 17.20 ? 133 CYS C CA  1 
ATOM   9979  C C   . CYS C 1 133 ? 68.013  86.209  104.543 1.00 17.86 ? 133 CYS C C   1 
ATOM   9980  O O   . CYS C 1 133 ? 69.079  86.065  105.144 1.00 17.20 ? 133 CYS C O   1 
ATOM   9981  C CB  . CYS C 1 133 ? 66.470  84.269  104.296 1.00 17.39 ? 133 CYS C CB  1 
ATOM   9982  S SG  . CYS C 1 133 ? 65.242  83.183  105.112 1.00 16.16 ? 133 CYS C SG  1 
ATOM   9983  N N   . GLN C 1 134 ? 67.905  86.886  103.407 1.00 18.87 ? 134 GLN C N   1 
ATOM   9984  C CA  . GLN C 1 134 ? 69.053  87.592  102.859 1.00 20.55 ? 134 GLN C CA  1 
ATOM   9985  C C   . GLN C 1 134 ? 69.555  88.573  103.911 1.00 19.92 ? 134 GLN C C   1 
ATOM   9986  O O   . GLN C 1 134 ? 70.712  88.539  104.290 1.00 20.14 ? 134 GLN C O   1 
ATOM   9987  C CB  . GLN C 1 134 ? 68.676  88.348  101.587 1.00 21.08 ? 134 GLN C CB  1 
ATOM   9988  C CG  . GLN C 1 134 ? 69.810  88.427  100.584 1.00 25.99 ? 134 GLN C CG  1 
ATOM   9989  C CD  . GLN C 1 134 ? 71.010  89.183  101.107 1.00 30.10 ? 134 GLN C CD  1 
ATOM   9990  O OE1 . GLN C 1 134 ? 72.122  88.637  101.158 1.00 34.72 ? 134 GLN C OE1 1 
ATOM   9991  N NE2 . GLN C 1 134 ? 70.802  90.443  101.487 1.00 32.91 ? 134 GLN C NE2 1 
ATOM   9992  N N   . ARG C 1 135 ? 68.663  89.407  104.425 1.00 20.44 ? 135 ARG C N   1 
ATOM   9993  C CA  . ARG C 1 135 ? 69.071  90.419  105.392 1.00 20.67 ? 135 ARG C CA  1 
ATOM   9994  C C   . ARG C 1 135 ? 69.718  89.855  106.652 1.00 20.19 ? 135 ARG C C   1 
ATOM   9995  O O   . ARG C 1 135 ? 70.727  90.377  107.129 1.00 19.69 ? 135 ARG C O   1 
ATOM   9996  C CB  . ARG C 1 135 ? 67.882  91.285  105.770 1.00 21.24 ? 135 ARG C CB  1 
ATOM   9997  C CG  . ARG C 1 135 ? 67.384  92.152  104.643 1.00 24.02 ? 135 ARG C CG  1 
ATOM   9998  C CD  . ARG C 1 135 ? 66.080  92.829  104.957 1.00 27.41 ? 135 ARG C CD  1 
ATOM   9999  N NE  . ARG C 1 135 ? 66.269  93.973  105.841 1.00 30.35 ? 135 ARG C NE  1 
ATOM   10000 C CZ  . ARG C 1 135 ? 65.290  94.574  106.508 1.00 31.93 ? 135 ARG C CZ  1 
ATOM   10001 N NH1 . ARG C 1 135 ? 64.033  94.140  106.407 1.00 32.41 ? 135 ARG C NH1 1 
ATOM   10002 N NH2 . ARG C 1 135 ? 65.568  95.620  107.272 1.00 31.62 ? 135 ARG C NH2 1 
ATOM   10003 N N   . VAL C 1 136 ? 69.150  88.784  107.200 1.00 19.59 ? 136 VAL C N   1 
ATOM   10004 C CA  . VAL C 1 136 ? 69.678  88.230  108.441 1.00 19.19 ? 136 VAL C CA  1 
ATOM   10005 C C   . VAL C 1 136 ? 70.995  87.482  108.239 1.00 19.28 ? 136 VAL C C   1 
ATOM   10006 O O   . VAL C 1 136 ? 71.944  87.690  108.986 1.00 19.37 ? 136 VAL C O   1 
ATOM   10007 C CB  . VAL C 1 136 ? 68.636  87.330  109.131 1.00 19.11 ? 136 VAL C CB  1 
ATOM   10008 C CG1 . VAL C 1 136 ? 69.224  86.667  110.357 1.00 18.50 ? 136 VAL C CG1 1 
ATOM   10009 C CG2 . VAL C 1 136 ? 67.404  88.141  109.504 1.00 19.33 ? 136 VAL C CG2 1 
ATOM   10010 N N   . ARG C 1 137 ? 71.047  86.616  107.229 1.00 19.56 ? 137 ARG C N   1 
ATOM   10011 C CA  . ARG C 1 137 ? 72.236  85.821  106.942 1.00 19.81 ? 137 ARG C CA  1 
ATOM   10012 C C   . ARG C 1 137 ? 73.450  86.668  106.548 1.00 20.20 ? 137 ARG C C   1 
ATOM   10013 O O   . ARG C 1 137 ? 74.571  86.340  106.922 1.00 20.31 ? 137 ARG C O   1 
ATOM   10014 C CB  . ARG C 1 137 ? 71.950  84.812  105.824 1.00 19.85 ? 137 ARG C CB  1 
ATOM   10015 C CG  . ARG C 1 137 ? 71.104  83.621  106.256 1.00 19.09 ? 137 ARG C CG  1 
ATOM   10016 C CD  . ARG C 1 137 ? 70.581  82.816  105.075 1.00 17.48 ? 137 ARG C CD  1 
ATOM   10017 N NE  . ARG C 1 137 ? 71.674  82.222  104.310 1.00 17.50 ? 137 ARG C NE  1 
ATOM   10018 C CZ  . ARG C 1 137 ? 72.264  81.069  104.608 1.00 18.03 ? 137 ARG C CZ  1 
ATOM   10019 N NH1 . ARG C 1 137 ? 71.873  80.366  105.662 1.00 16.22 ? 137 ARG C NH1 1 
ATOM   10020 N NH2 . ARG C 1 137 ? 73.248  80.609  103.848 1.00 18.57 ? 137 ARG C NH2 1 
ATOM   10021 N N   . SER C 1 138 ? 73.215  87.749  105.802 1.00 21.11 ? 138 SER C N   1 
ATOM   10022 C CA  . SER C 1 138 ? 74.296  88.633  105.333 1.00 21.49 ? 138 SER C CA  1 
ATOM   10023 C C   . SER C 1 138 ? 74.826  89.571  106.404 1.00 22.07 ? 138 SER C C   1 
ATOM   10024 O O   . SER C 1 138 ? 75.890  90.162  106.234 1.00 22.86 ? 138 SER C O   1 
ATOM   10025 C CB  . SER C 1 138 ? 73.808  89.494  104.176 1.00 21.54 ? 138 SER C CB  1 
ATOM   10026 O OG  . SER C 1 138 ? 72.988  90.554  104.655 1.00 21.06 ? 138 SER C OG  1 
ATOM   10027 N N   . GLY C 1 139 ? 74.100  89.722  107.506 1.00 21.90 ? 139 GLY C N   1 
ATOM   10028 C CA  . GLY C 1 139 ? 74.522  90.637  108.560 1.00 21.86 ? 139 GLY C CA  1 
ATOM   10029 C C   . GLY C 1 139 ? 73.939  92.040  108.423 1.00 21.90 ? 139 GLY C C   1 
ATOM   10030 O O   . GLY C 1 139 ? 74.255  92.916  109.215 1.00 22.36 ? 139 GLY C O   1 
ATOM   10031 N N   . ASP C 1 140 ? 73.116  92.261  107.402 1.00 21.95 ? 140 ASP C N   1 
ATOM   10032 C CA  . ASP C 1 140 ? 72.446  93.541  107.206 1.00 21.93 ? 140 ASP C CA  1 
ATOM   10033 C C   . ASP C 1 140 ? 71.525  93.828  108.396 1.00 21.52 ? 140 ASP C C   1 
ATOM   10034 O O   . ASP C 1 140 ? 71.521  94.928  108.946 1.00 20.51 ? 140 ASP C O   1 
ATOM   10035 C CB  . ASP C 1 140 ? 71.637  93.502  105.906 1.00 22.63 ? 140 ASP C CB  1 
ATOM   10036 C CG  . ASP C 1 140 ? 70.702  94.671  105.761 1.00 24.92 ? 140 ASP C CG  1 
ATOM   10037 O OD1 . ASP C 1 140 ? 69.769  94.598  104.936 1.00 30.58 ? 140 ASP C OD1 1 
ATOM   10038 O OD2 . ASP C 1 140 ? 70.795  95.712  106.420 1.00 30.27 ? 140 ASP C OD2 1 
ATOM   10039 N N   . TRP C 1 141 ? 70.747  92.821  108.790 1.00 20.38 ? 141 TRP C N   1 
ATOM   10040 C CA  . TRP C 1 141 ? 69.835  92.949  109.925 1.00 19.78 ? 141 TRP C CA  1 
ATOM   10041 C C   . TRP C 1 141 ? 70.641  93.016  111.222 1.00 19.59 ? 141 TRP C C   1 
ATOM   10042 O O   . TRP C 1 141 ? 71.405  92.098  111.550 1.00 19.16 ? 141 TRP C O   1 
ATOM   10043 C CB  . TRP C 1 141 ? 68.850  91.757  109.963 1.00 19.74 ? 141 TRP C CB  1 
ATOM   10044 C CG  . TRP C 1 141 ? 67.780  91.885  110.981 1.00 18.28 ? 141 TRP C CG  1 
ATOM   10045 C CD1 . TRP C 1 141 ? 67.912  91.736  112.330 1.00 19.58 ? 141 TRP C CD1 1 
ATOM   10046 C CD2 . TRP C 1 141 ? 66.420  92.220  110.751 1.00 19.61 ? 141 TRP C CD2 1 
ATOM   10047 N NE1 . TRP C 1 141 ? 66.706  91.947  112.950 1.00 19.02 ? 141 TRP C NE1 1 
ATOM   10048 C CE2 . TRP C 1 141 ? 65.775  92.262  112.001 1.00 18.77 ? 141 TRP C CE2 1 
ATOM   10049 C CE3 . TRP C 1 141 ? 65.672  92.501  109.609 1.00 20.92 ? 141 TRP C CE3 1 
ATOM   10050 C CZ2 . TRP C 1 141 ? 64.419  92.552  112.137 1.00 20.75 ? 141 TRP C CZ2 1 
ATOM   10051 C CZ3 . TRP C 1 141 ? 64.325  92.800  109.746 1.00 22.41 ? 141 TRP C CZ3 1 
ATOM   10052 C CH2 . TRP C 1 141 ? 63.714  92.823  111.001 1.00 20.77 ? 141 TRP C CH2 1 
ATOM   10053 N N   . LYS C 1 142 ? 70.460  94.095  111.972 1.00 19.35 ? 142 LYS C N   1 
ATOM   10054 C CA  . LYS C 1 142 ? 71.195  94.267  113.226 1.00 19.82 ? 142 LYS C CA  1 
ATOM   10055 C C   . LYS C 1 142 ? 70.303  94.208  114.458 1.00 19.05 ? 142 LYS C C   1 
ATOM   10056 O O   . LYS C 1 142 ? 69.158  94.627  114.416 1.00 18.53 ? 142 LYS C O   1 
ATOM   10057 C CB  . LYS C 1 142 ? 71.895  95.634  113.243 1.00 19.53 ? 142 LYS C CB  1 
ATOM   10058 C CG  . LYS C 1 142 ? 72.819  95.878  112.065 1.00 20.85 ? 142 LYS C CG  1 
ATOM   10059 C CD  . LYS C 1 142 ? 73.977  94.899  112.026 1.00 20.77 ? 142 LYS C CD  1 
ATOM   10060 C CE  . LYS C 1 142 ? 75.072  95.414  111.077 1.00 21.46 ? 142 LYS C CE  1 
ATOM   10061 N NZ  . LYS C 1 142 ? 74.532  95.677  109.711 1.00 19.42 ? 142 LYS C NZ  1 
ATOM   10062 N N   . GLY C 1 143 ? 70.865  93.731  115.558 1.00 19.49 ? 143 GLY C N   1 
ATOM   10063 C CA  . GLY C 1 143 ? 70.185  93.764  116.840 1.00 19.79 ? 143 GLY C CA  1 
ATOM   10064 C C   . GLY C 1 143 ? 70.178  95.201  117.357 1.00 20.35 ? 143 GLY C C   1 
ATOM   10065 O O   . GLY C 1 143 ? 70.720  96.104  116.707 1.00 19.69 ? 143 GLY C O   1 
ATOM   10066 N N   . TYR C 1 144 ? 69.601  95.401  118.535 1.00 20.52 ? 144 TYR C N   1 
ATOM   10067 C CA  . TYR C 1 144 ? 69.389  96.733  119.106 1.00 20.75 ? 144 TYR C CA  1 
ATOM   10068 C C   . TYR C 1 144 ? 70.682  97.496  119.449 1.00 21.61 ? 144 TYR C C   1 
ATOM   10069 O O   . TYR C 1 144 ? 70.643  98.709  119.714 1.00 21.76 ? 144 TYR C O   1 
ATOM   10070 C CB  . TYR C 1 144 ? 68.484  96.628  120.350 1.00 20.73 ? 144 TYR C CB  1 
ATOM   10071 C CG  . TYR C 1 144 ? 69.177  96.201  121.629 1.00 19.69 ? 144 TYR C CG  1 
ATOM   10072 C CD1 . TYR C 1 144 ? 69.465  97.131  122.623 1.00 20.24 ? 144 TYR C CD1 1 
ATOM   10073 C CD2 . TYR C 1 144 ? 69.509  94.873  121.861 1.00 18.37 ? 144 TYR C CD2 1 
ATOM   10074 C CE1 . TYR C 1 144 ? 70.090  96.762  123.783 1.00 20.46 ? 144 TYR C CE1 1 
ATOM   10075 C CE2 . TYR C 1 144 ? 70.129  94.483  123.021 1.00 19.24 ? 144 TYR C CE2 1 
ATOM   10076 C CZ  . TYR C 1 144 ? 70.419  95.436  123.989 1.00 20.23 ? 144 TYR C CZ  1 
ATOM   10077 O OH  . TYR C 1 144 ? 71.039  95.082  125.157 1.00 21.00 ? 144 TYR C OH  1 
ATOM   10078 N N   . THR C 1 145 ? 71.817  96.803  119.463 1.00 21.57 ? 145 THR C N   1 
ATOM   10079 C CA  . THR C 1 145 ? 73.072  97.455  119.773 1.00 21.95 ? 145 THR C CA  1 
ATOM   10080 C C   . THR C 1 145 ? 74.013  97.481  118.573 1.00 22.19 ? 145 THR C C   1 
ATOM   10081 O O   . THR C 1 145 ? 75.185  97.839  118.707 1.00 21.70 ? 145 THR C O   1 
ATOM   10082 C CB  . THR C 1 145 ? 73.734  96.774  120.965 1.00 22.38 ? 145 THR C CB  1 
ATOM   10083 O OG1 . THR C 1 145 ? 74.291  95.523  120.562 1.00 22.02 ? 145 THR C OG1 1 
ATOM   10084 C CG2 . THR C 1 145 ? 72.696  96.408  122.018 1.00 23.33 ? 145 THR C CG2 1 
ATOM   10085 N N   . GLY C 1 146 ? 73.492  97.119  117.401 1.00 21.55 ? 146 GLY C N   1 
ATOM   10086 C CA  . GLY C 1 146 ? 74.283  97.112  116.178 1.00 21.59 ? 146 GLY C CA  1 
ATOM   10087 C C   . GLY C 1 146 ? 74.977  95.809  115.798 1.00 21.53 ? 146 GLY C C   1 
ATOM   10088 O O   . GLY C 1 146 ? 75.712  95.788  114.809 1.00 21.42 ? 146 GLY C O   1 
ATOM   10089 N N   . LYS C 1 147 ? 74.744  94.720  116.533 1.00 20.60 ? 147 LYS C N   1 
ATOM   10090 C CA  . LYS C 1 147 ? 75.407  93.457  116.219 1.00 20.60 ? 147 LYS C CA  1 
ATOM   10091 C C   . LYS C 1 147 ? 74.621  92.600  115.223 1.00 19.63 ? 147 LYS C C   1 
ATOM   10092 O O   . LYS C 1 147 ? 73.392  92.715  115.091 1.00 18.53 ? 147 LYS C O   1 
ATOM   10093 C CB  . LYS C 1 147 ? 75.669  92.624  117.472 1.00 21.30 ? 147 LYS C CB  1 
ATOM   10094 C CG  . LYS C 1 147 ? 76.213  93.392  118.632 1.00 24.26 ? 147 LYS C CG  1 
ATOM   10095 C CD  . LYS C 1 147 ? 77.543  94.082  118.294 1.00 27.94 ? 147 LYS C CD  1 
ATOM   10096 C CE  . LYS C 1 147 ? 78.733  93.151  118.473 1.00 30.45 ? 147 LYS C CE  1 
ATOM   10097 N NZ  . LYS C 1 147 ? 79.988  93.911  118.835 1.00 32.79 ? 147 LYS C NZ  1 
ATOM   10098 N N   . THR C 1 148 ? 75.346  91.754  114.508 1.00 18.69 ? 148 THR C N   1 
ATOM   10099 C CA  . THR C 1 148 ? 74.708  90.876  113.541 1.00 18.49 ? 148 THR C CA  1 
ATOM   10100 C C   . THR C 1 148 ? 74.155  89.699  114.331 1.00 18.43 ? 148 THR C C   1 
ATOM   10101 O O   . THR C 1 148 ? 74.567  89.421  115.455 1.00 17.75 ? 148 THR C O   1 
ATOM   10102 C CB  . THR C 1 148 ? 75.676  90.365  112.512 1.00 18.79 ? 148 THR C CB  1 
ATOM   10103 O OG1 . THR C 1 148 ? 76.671  89.580  113.163 1.00 17.48 ? 148 THR C OG1 1 
ATOM   10104 C CG2 . THR C 1 148 ? 76.446  91.518  111.839 1.00 18.68 ? 148 THR C CG2 1 
ATOM   10105 N N   . ILE C 1 149 ? 73.263  88.967  113.711 1.00 18.31 ? 149 ILE C N   1 
ATOM   10106 C CA  . ILE C 1 149 ? 72.549  87.942  114.438 1.00 18.71 ? 149 ILE C CA  1 
ATOM   10107 C C   . ILE C 1 149 ? 73.240  86.613  114.231 1.00 17.95 ? 149 ILE C C   1 
ATOM   10108 O O   . ILE C 1 149 ? 73.534  86.247  113.102 1.00 18.31 ? 149 ILE C O   1 
ATOM   10109 C CB  . ILE C 1 149 ? 71.100  87.974  113.961 1.00 18.96 ? 149 ILE C CB  1 
ATOM   10110 C CG1 . ILE C 1 149 ? 70.460  89.266  114.519 1.00 20.82 ? 149 ILE C CG1 1 
ATOM   10111 C CG2 . ILE C 1 149 ? 70.366  86.699  114.375 1.00 19.11 ? 149 ILE C CG2 1 
ATOM   10112 C CD1 . ILE C 1 149 ? 69.763  89.152  115.787 1.00 22.34 ? 149 ILE C CD1 1 
ATOM   10113 N N   . THR C 1 150 ? 73.521  85.922  115.329 1.00 17.69 ? 150 THR C N   1 
ATOM   10114 C CA  . THR C 1 150 ? 74.249  84.664  115.303 1.00 17.32 ? 150 THR C CA  1 
ATOM   10115 C C   . THR C 1 150 ? 73.377  83.464  115.687 1.00 16.75 ? 150 THR C C   1 
ATOM   10116 O O   . THR C 1 150 ? 73.740  82.305  115.445 1.00 16.23 ? 150 THR C O   1 
ATOM   10117 C CB  . THR C 1 150 ? 75.434  84.736  116.275 1.00 17.72 ? 150 THR C CB  1 
ATOM   10118 O OG1 . THR C 1 150 ? 74.981  85.080  117.595 1.00 18.13 ? 150 THR C OG1 1 
ATOM   10119 C CG2 . THR C 1 150 ? 76.396  85.862  115.893 1.00 18.17 ? 150 THR C CG2 1 
ATOM   10120 N N   . ASP C 1 151 ? 72.222  83.749  116.275 1.00 15.77 ? 151 ASP C N   1 
ATOM   10121 C CA  . ASP C 1 151 ? 71.360  82.700  116.782 1.00 15.44 ? 151 ASP C CA  1 
ATOM   10122 C C   . ASP C 1 151 ? 69.924  83.011  116.460 1.00 14.28 ? 151 ASP C C   1 
ATOM   10123 O O   . ASP C 1 151 ? 69.455  84.125  116.662 1.00 14.40 ? 151 ASP C O   1 
ATOM   10124 C CB  . ASP C 1 151 ? 71.537  82.538  118.292 1.00 15.57 ? 151 ASP C CB  1 
ATOM   10125 C CG  . ASP C 1 151 ? 72.910  82.006  118.660 1.00 16.86 ? 151 ASP C CG  1 
ATOM   10126 O OD1 . ASP C 1 151 ? 73.843  82.826  118.840 1.00 16.68 ? 151 ASP C OD1 1 
ATOM   10127 O OD2 . ASP C 1 151 ? 73.140  80.789  118.768 1.00 14.54 ? 151 ASP C OD2 1 
ATOM   10128 N N   . VAL C 1 152 ? 69.237  82.003  115.939 1.00 13.99 ? 152 VAL C N   1 
ATOM   10129 C CA  . VAL C 1 152 ? 67.831  82.106  115.587 1.00 13.29 ? 152 VAL C CA  1 
ATOM   10130 C C   . VAL C 1 152 ? 67.124  81.079  116.464 1.00 13.00 ? 152 VAL C C   1 
ATOM   10131 O O   . VAL C 1 152 ? 67.542  79.914  116.516 1.00 12.87 ? 152 VAL C O   1 
ATOM   10132 C CB  . VAL C 1 152 ? 67.591  81.781  114.116 1.00 13.44 ? 152 VAL C CB  1 
ATOM   10133 C CG1 . VAL C 1 152 ? 66.116  81.544  113.855 1.00 14.13 ? 152 VAL C CG1 1 
ATOM   10134 C CG2 . VAL C 1 152 ? 68.104  82.905  113.226 1.00 13.68 ? 152 VAL C CG2 1 
ATOM   10135 N N   . ILE C 1 153 ? 66.085  81.518  117.172 1.00 12.96 ? 153 ILE C N   1 
ATOM   10136 C CA  . ILE C 1 153 ? 65.338  80.641  118.071 1.00 12.63 ? 153 ILE C CA  1 
ATOM   10137 C C   . ILE C 1 153 ? 63.878  80.599  117.666 1.00 12.48 ? 153 ILE C C   1 
ATOM   10138 O O   . ILE C 1 153 ? 63.157  81.602  117.757 1.00 12.13 ? 153 ILE C O   1 
ATOM   10139 C CB  . ILE C 1 153 ? 65.440  81.114  119.541 1.00 12.81 ? 153 ILE C CB  1 
ATOM   10140 C CG1 . ILE C 1 153 ? 66.892  81.272  119.995 1.00 13.12 ? 153 ILE C CG1 1 
ATOM   10141 C CG2 . ILE C 1 153 ? 64.714  80.131  120.467 1.00 12.13 ? 153 ILE C CG2 1 
ATOM   10142 C CD1 . ILE C 1 153 ? 67.520  82.628  119.653 1.00 14.28 ? 153 ILE C CD1 1 
ATOM   10143 N N   . ASN C 1 154 ? 63.457  79.431  117.199 1.00 12.00 ? 154 ASN C N   1 
ATOM   10144 C CA  . ASN C 1 154 ? 62.083  79.174  116.838 1.00 11.87 ? 154 ASN C CA  1 
ATOM   10145 C C   . ASN C 1 154 ? 61.315  78.715  118.069 1.00 11.63 ? 154 ASN C C   1 
ATOM   10146 O O   . ASN C 1 154 ? 61.751  77.791  118.777 1.00 11.28 ? 154 ASN C O   1 
ATOM   10147 C CB  . ASN C 1 154 ? 62.032  78.073  115.784 1.00 11.84 ? 154 ASN C CB  1 
ATOM   10148 C CG  . ASN C 1 154 ? 60.678  77.961  115.130 1.00 12.56 ? 154 ASN C CG  1 
ATOM   10149 O OD1 . ASN C 1 154 ? 60.376  78.701  114.190 1.00 13.44 ? 154 ASN C OD1 1 
ATOM   10150 N ND2 . ASN C 1 154 ? 59.839  77.044  115.635 1.00 11.75 ? 154 ASN C ND2 1 
ATOM   10151 N N   . ILE C 1 155 ? 60.201  79.378  118.334 1.00 11.13 ? 155 ILE C N   1 
ATOM   10152 C CA  . ILE C 1 155 ? 59.355  79.044  119.470 1.00 11.12 ? 155 ILE C CA  1 
ATOM   10153 C C   . ILE C 1 155 ? 58.014  78.660  118.882 1.00 11.39 ? 155 ILE C C   1 
ATOM   10154 O O   . ILE C 1 155 ? 57.360  79.470  118.208 1.00 11.20 ? 155 ILE C O   1 
ATOM   10155 C CB  . ILE C 1 155 ? 59.190  80.210  120.457 1.00 11.05 ? 155 ILE C CB  1 
ATOM   10156 C CG1 . ILE C 1 155 ? 60.542  80.674  121.012 1.00 11.79 ? 155 ILE C CG1 1 
ATOM   10157 C CG2 . ILE C 1 155 ? 58.312  79.770  121.615 1.00 11.24 ? 155 ILE C CG2 1 
ATOM   10158 C CD1 . ILE C 1 155 ? 60.477  81.830  122.024 1.00 12.29 ? 155 ILE C CD1 1 
ATOM   10159 N N   . GLY C 1 156 ? 57.612  77.422  119.110 1.00 10.53 ? 156 GLY C N   1 
ATOM   10160 C CA  . GLY C 1 156 ? 56.326  76.952  118.609 1.00 11.66 ? 156 GLY C CA  1 
ATOM   10161 C C   . GLY C 1 156 ? 55.978  75.582  119.141 1.00 11.67 ? 156 GLY C C   1 
ATOM   10162 O O   . GLY C 1 156 ? 56.797  74.948  119.760 1.00 12.22 ? 156 GLY C O   1 
ATOM   10163 N N   . ILE C 1 157 ? 54.751  75.135  118.927 1.00 13.30 ? 157 ILE C N   1 
ATOM   10164 C CA  . ILE C 1 157 ? 54.372  73.781  119.304 1.00 13.92 ? 157 ILE C CA  1 
ATOM   10165 C C   . ILE C 1 157 ? 53.904  72.964  118.114 1.00 13.79 ? 157 ILE C C   1 
ATOM   10166 O O   . ILE C 1 157 ? 53.546  73.492  117.055 1.00 14.94 ? 157 ILE C O   1 
ATOM   10167 C CB  . ILE C 1 157 ? 53.253  73.772  120.374 1.00 14.31 ? 157 ILE C CB  1 
ATOM   10168 C CG1 . ILE C 1 157 ? 51.961  74.361  119.815 1.00 15.94 ? 157 ILE C CG1 1 
ATOM   10169 C CG2 . ILE C 1 157 ? 53.731  74.421  121.657 1.00 15.57 ? 157 ILE C CG2 1 
ATOM   10170 C CD1 . ILE C 1 157 ? 50.796  74.263  120.767 1.00 18.17 ? 157 ILE C CD1 1 
ATOM   10171 N N   . GLY C 1 158 ? 53.901  71.656  118.293 1.00 14.25 ? 158 GLY C N   1 
ATOM   10172 C CA  . GLY C 1 158 ? 53.402  70.765  117.257 1.00 13.76 ? 158 GLY C CA  1 
ATOM   10173 C C   . GLY C 1 158 ? 54.007  71.030  115.903 1.00 14.00 ? 158 GLY C C   1 
ATOM   10174 O O   . GLY C 1 158 ? 55.227  70.961  115.726 1.00 11.97 ? 158 GLY C O   1 
ATOM   10175 N N   . GLY C 1 159 ? 53.140  71.336  114.937 1.00 14.77 ? 159 GLY C N   1 
ATOM   10176 C CA  . GLY C 1 159 ? 53.576  71.576  113.572 1.00 15.70 ? 159 GLY C CA  1 
ATOM   10177 C C   . GLY C 1 159 ? 54.473  72.783  113.378 1.00 15.78 ? 159 GLY C C   1 
ATOM   10178 O O   . GLY C 1 159 ? 55.192  72.888  112.379 1.00 16.36 ? 159 GLY C O   1 
ATOM   10179 N N   . SER C 1 160 ? 54.446  73.703  114.329 1.00 15.92 ? 160 SER C N   1 
ATOM   10180 C CA  . SER C 1 160 ? 55.301  74.868  114.226 1.00 16.05 ? 160 SER C CA  1 
ATOM   10181 C C   . SER C 1 160 ? 56.721  74.565  114.697 1.00 15.92 ? 160 SER C C   1 
ATOM   10182 O O   . SER C 1 160 ? 57.604  75.420  114.601 1.00 17.11 ? 160 SER C O   1 
ATOM   10183 C CB  . SER C 1 160 ? 54.705  76.013  115.022 1.00 16.07 ? 160 SER C CB  1 
ATOM   10184 O OG  . SER C 1 160 ? 53.425  76.335  114.487 1.00 17.30 ? 160 SER C OG  1 
ATOM   10185 N N   . ASP C 1 161 ? 56.941  73.355  115.190 1.00 14.86 ? 161 ASP C N   1 
ATOM   10186 C CA  . ASP C 1 161 ? 58.234  72.958  115.743 1.00 14.46 ? 161 ASP C CA  1 
ATOM   10187 C C   . ASP C 1 161 ? 58.871  71.759  115.048 1.00 14.49 ? 161 ASP C C   1 
ATOM   10188 O O   . ASP C 1 161 ? 60.004  71.836  114.558 1.00 14.10 ? 161 ASP C O   1 
ATOM   10189 C CB  . ASP C 1 161 ? 58.054  72.616  117.236 1.00 14.72 ? 161 ASP C CB  1 
ATOM   10190 C CG  . ASP C 1 161 ? 59.239  71.861  117.821 1.00 14.17 ? 161 ASP C CG  1 
ATOM   10191 O OD1 . ASP C 1 161 ? 60.280  72.505  118.059 1.00 11.24 ? 161 ASP C OD1 1 
ATOM   10192 O OD2 . ASP C 1 161 ? 59.229  70.625  118.061 1.00 14.16 ? 161 ASP C OD2 1 
ATOM   10193 N N   . LEU C 1 162 ? 58.127  70.652  114.994 1.00 14.24 ? 162 LEU C N   1 
ATOM   10194 C CA  . LEU C 1 162 ? 58.691  69.363  114.586 1.00 13.99 ? 162 LEU C CA  1 
ATOM   10195 C C   . LEU C 1 162 ? 59.308  69.355  113.188 1.00 12.79 ? 162 LEU C C   1 
ATOM   10196 O O   . LEU C 1 162 ? 60.356  68.779  112.997 1.00 11.19 ? 162 LEU C O   1 
ATOM   10197 C CB  . LEU C 1 162 ? 57.632  68.274  114.679 1.00 14.79 ? 162 LEU C CB  1 
ATOM   10198 C CG  . LEU C 1 162 ? 57.527  67.398  115.927 1.00 19.45 ? 162 LEU C CG  1 
ATOM   10199 C CD1 . LEU C 1 162 ? 56.184  66.730  115.969 1.00 20.65 ? 162 LEU C CD1 1 
ATOM   10200 C CD2 . LEU C 1 162 ? 58.612  66.344  115.921 1.00 22.59 ? 162 LEU C CD2 1 
ATOM   10201 N N   . GLY C 1 163 ? 58.633  69.963  112.215 1.00 12.22 ? 163 GLY C N   1 
ATOM   10202 C CA  . GLY C 1 163 ? 59.137  69.992  110.854 1.00 12.28 ? 163 GLY C CA  1 
ATOM   10203 C C   . GLY C 1 163 ? 60.424  70.796  110.724 1.00 11.45 ? 163 GLY C C   1 
ATOM   10204 O O   . GLY C 1 163 ? 61.435  70.314  110.235 1.00 10.92 ? 163 GLY C O   1 
ATOM   10205 N N   . PRO C 1 164 ? 60.382  72.057  111.105 1.00 11.18 ? 164 PRO C N   1 
ATOM   10206 C CA  . PRO C 1 164 ? 61.597  72.872  111.081 1.00 11.11 ? 164 PRO C CA  1 
ATOM   10207 C C   . PRO C 1 164 ? 62.756  72.231  111.836 1.00 10.88 ? 164 PRO C C   1 
ATOM   10208 O O   . PRO C 1 164 ? 63.891  72.241  111.340 1.00 10.39 ? 164 PRO C O   1 
ATOM   10209 C CB  . PRO C 1 164 ? 61.141  74.193  111.705 1.00 11.67 ? 164 PRO C CB  1 
ATOM   10210 C CG  . PRO C 1 164 ? 59.671  74.275  111.322 1.00 11.53 ? 164 PRO C CG  1 
ATOM   10211 C CD  . PRO C 1 164 ? 59.190  72.836  111.470 1.00 11.66 ? 164 PRO C CD  1 
ATOM   10212 N N   . LEU C 1 165 ? 62.491  71.625  112.988 1.00 10.51 ? 165 LEU C N   1 
ATOM   10213 C CA  . LEU C 1 165 ? 63.555  70.962  113.732 1.00 10.08 ? 165 LEU C CA  1 
ATOM   10214 C C   . LEU C 1 165 ? 64.093  69.757  112.944 1.00 9.87  ? 165 LEU C C   1 
ATOM   10215 O O   . LEU C 1 165 ? 65.300  69.605  112.805 1.00 9.08  ? 165 LEU C O   1 
ATOM   10216 C CB  . LEU C 1 165 ? 63.054  70.517  115.116 1.00 10.40 ? 165 LEU C CB  1 
ATOM   10217 C CG  . LEU C 1 165 ? 64.030  69.810  116.062 1.00 13.49 ? 165 LEU C CG  1 
ATOM   10218 C CD1 . LEU C 1 165 ? 63.421  69.705  117.448 1.00 15.66 ? 165 LEU C CD1 1 
ATOM   10219 C CD2 . LEU C 1 165 ? 64.376  68.419  115.597 1.00 15.97 ? 165 LEU C CD2 1 
ATOM   10220 N N   . MET C 1 166 ? 63.193  68.910  112.432 1.00 9.30  ? 166 MET C N   1 
ATOM   10221 C CA  . MET C 1 166 ? 63.598  67.708  111.714 1.00 9.44  ? 166 MET C CA  1 
ATOM   10222 C C   . MET C 1 166 ? 64.410  68.072  110.465 1.00 9.62  ? 166 MET C C   1 
ATOM   10223 O O   . MET C 1 166 ? 65.447  67.460  110.174 1.00 9.49  ? 166 MET C O   1 
ATOM   10224 C CB  . MET C 1 166 ? 62.354  66.890  111.336 1.00 9.65  ? 166 MET C CB  1 
ATOM   10225 C CG  . MET C 1 166 ? 62.663  65.604  110.562 1.00 10.33 ? 166 MET C CG  1 
ATOM   10226 S SD  . MET C 1 166 ? 62.815  65.862  108.783 1.00 11.14 ? 166 MET C SD  1 
ATOM   10227 C CE  . MET C 1 166 ? 61.174  66.176  108.295 1.00 11.24 ? 166 MET C CE  1 
ATOM   10228 N N   . VAL C 1 167 ? 63.960  69.095  109.746 1.00 9.40  ? 167 VAL C N   1 
ATOM   10229 C CA  . VAL C 1 167 ? 64.618  69.452  108.499 1.00 9.63  ? 167 VAL C CA  1 
ATOM   10230 C C   . VAL C 1 167 ? 65.973  70.099  108.734 1.00 9.45  ? 167 VAL C C   1 
ATOM   10231 O O   . VAL C 1 167 ? 66.924  69.766  108.050 1.00 8.52  ? 167 VAL C O   1 
ATOM   10232 C CB  . VAL C 1 167 ? 63.733  70.330  107.617 1.00 9.56  ? 167 VAL C CB  1 
ATOM   10233 C CG1 . VAL C 1 167 ? 64.509  70.804  106.389 1.00 10.63 ? 167 VAL C CG1 1 
ATOM   10234 C CG2 . VAL C 1 167 ? 62.473  69.570  107.205 1.00 10.28 ? 167 VAL C CG2 1 
ATOM   10235 N N   . THR C 1 168 ? 66.074  71.013  109.698 1.00 9.63  ? 168 THR C N   1 
ATOM   10236 C CA  . THR C 1 168 ? 67.367  71.635  109.968 1.00 9.99  ? 168 THR C CA  1 
ATOM   10237 C C   . THR C 1 168 ? 68.339  70.591  110.476 1.00 9.93  ? 168 THR C C   1 
ATOM   10238 O O   . THR C 1 168 ? 69.520  70.629  110.152 1.00 9.73  ? 168 THR C O   1 
ATOM   10239 C CB  . THR C 1 168 ? 67.287  72.824  110.934 1.00 9.78  ? 168 THR C CB  1 
ATOM   10240 O OG1 . THR C 1 168 ? 66.497  72.493  112.090 1.00 10.43 ? 168 THR C OG1 1 
ATOM   10241 C CG2 . THR C 1 168 ? 66.602  73.993  110.277 1.00 9.61  ? 168 THR C CG2 1 
ATOM   10242 N N   . GLU C 1 169 ? 67.848  69.617  111.235 1.00 9.78  ? 169 GLU C N   1 
ATOM   10243 C CA  . GLU C 1 169 ? 68.742  68.559  111.687 1.00 9.60  ? 169 GLU C CA  1 
ATOM   10244 C C   . GLU C 1 169 ? 69.242  67.711  110.511 1.00 9.78  ? 169 GLU C C   1 
ATOM   10245 O O   . GLU C 1 169 ? 70.415  67.321  110.451 1.00 9.34  ? 169 GLU C O   1 
ATOM   10246 C CB  . GLU C 1 169 ? 68.036  67.662  112.704 1.00 9.98  ? 169 GLU C CB  1 
ATOM   10247 C CG  . GLU C 1 169 ? 67.874  68.301  114.060 1.00 9.17  ? 169 GLU C CG  1 
ATOM   10248 C CD  . GLU C 1 169 ? 69.210  68.596  114.719 1.00 11.33 ? 169 GLU C CD  1 
ATOM   10249 O OE1 . GLU C 1 169 ? 69.514  69.783  114.942 1.00 10.55 ? 169 GLU C OE1 1 
ATOM   10250 O OE2 . GLU C 1 169 ? 69.964  67.637  114.983 1.00 11.53 ? 169 GLU C OE2 1 
ATOM   10251 N N   . ALA C 1 170 ? 68.334  67.425  109.582 1.00 9.61  ? 170 ALA C N   1 
ATOM   10252 C CA  . ALA C 1 170 ? 68.641  66.560  108.457 1.00 9.89  ? 170 ALA C CA  1 
ATOM   10253 C C   . ALA C 1 170 ? 69.540  67.259  107.446 1.00 10.47 ? 170 ALA C C   1 
ATOM   10254 O O   . ALA C 1 170 ? 70.310  66.599  106.784 1.00 9.40  ? 170 ALA C O   1 
ATOM   10255 C CB  . ALA C 1 170 ? 67.364  66.110  107.779 1.00 10.39 ? 170 ALA C CB  1 
ATOM   10256 N N   . LEU C 1 171 ? 69.440  68.588  107.342 1.00 10.65 ? 171 LEU C N   1 
ATOM   10257 C CA  . LEU C 1 171 ? 70.201  69.329  106.335 1.00 11.35 ? 171 LEU C CA  1 
ATOM   10258 C C   . LEU C 1 171 ? 71.355  70.155  106.916 1.00 12.51 ? 171 LEU C C   1 
ATOM   10259 O O   . LEU C 1 171 ? 71.803  71.148  106.327 1.00 11.95 ? 171 LEU C O   1 
ATOM   10260 C CB  . LEU C 1 171 ? 69.261  70.223  105.540 1.00 11.10 ? 171 LEU C CB  1 
ATOM   10261 C CG  . LEU C 1 171 ? 68.161  69.483  104.762 1.00 11.89 ? 171 LEU C CG  1 
ATOM   10262 C CD1 . LEU C 1 171 ? 67.269  70.466  103.995 1.00 11.22 ? 171 LEU C CD1 1 
ATOM   10263 C CD2 . LEU C 1 171 ? 68.773  68.448  103.817 1.00 12.78 ? 171 LEU C CD2 1 
ATOM   10264 N N   . LYS C 1 172 ? 71.859  69.710  108.048 1.00 14.18 ? 172 LYS C N   1 
ATOM   10265 C CA  . LYS C 1 172 ? 72.907  70.441  108.752 1.00 15.60 ? 172 LYS C CA  1 
ATOM   10266 C C   . LYS C 1 172 ? 74.148  70.750  107.884 1.00 15.58 ? 172 LYS C C   1 
ATOM   10267 O O   . LYS C 1 172 ? 74.731  71.836  107.998 1.00 15.96 ? 172 LYS C O   1 
ATOM   10268 C CB  . LYS C 1 172 ? 73.281  69.676  110.025 1.00 16.37 ? 172 LYS C CB  1 
ATOM   10269 C CG  . LYS C 1 172 ? 73.906  70.549  111.121 1.00 18.65 ? 172 LYS C CG  1 
ATOM   10270 C CD  . LYS C 1 172 ? 73.007  71.708  111.558 1.00 19.88 ? 172 LYS C CD  1 
ATOM   10271 C CE  . LYS C 1 172 ? 72.096  71.384  112.732 1.00 20.37 ? 172 LYS C CE  1 
ATOM   10272 N NZ  . LYS C 1 172 ? 71.405  72.599  113.279 1.00 19.54 ? 172 LYS C NZ  1 
ATOM   10273 N N   . PRO C 1 173 ? 74.570  69.841  107.015 1.00 15.82 ? 173 PRO C N   1 
ATOM   10274 C CA  . PRO C 1 173 ? 75.715  70.154  106.147 1.00 16.29 ? 173 PRO C CA  1 
ATOM   10275 C C   . PRO C 1 173 ? 75.456  71.329  105.216 1.00 16.56 ? 173 PRO C C   1 
ATOM   10276 O O   . PRO C 1 173 ? 76.411  71.875  104.644 1.00 17.64 ? 173 PRO C O   1 
ATOM   10277 C CB  . PRO C 1 173 ? 75.912  68.868  105.349 1.00 16.58 ? 173 PRO C CB  1 
ATOM   10278 C CG  . PRO C 1 173 ? 75.296  67.826  106.186 1.00 15.75 ? 173 PRO C CG  1 
ATOM   10279 C CD  . PRO C 1 173 ? 74.085  68.468  106.794 1.00 15.35 ? 173 PRO C CD  1 
ATOM   10280 N N   . TYR C 1 174 ? 74.198  71.727  105.062 1.00 15.89 ? 174 TYR C N   1 
ATOM   10281 C CA  . TYR C 1 174 ? 73.856  72.823  104.161 1.00 15.50 ? 174 TYR C CA  1 
ATOM   10282 C C   . TYR C 1 174 ? 73.742  74.198  104.845 1.00 16.05 ? 174 TYR C C   1 
ATOM   10283 O O   . TYR C 1 174 ? 73.252  75.151  104.244 1.00 15.93 ? 174 TYR C O   1 
ATOM   10284 C CB  . TYR C 1 174 ? 72.572  72.450  103.403 1.00 15.20 ? 174 TYR C CB  1 
ATOM   10285 C CG  . TYR C 1 174 ? 72.785  71.225  102.561 1.00 14.64 ? 174 TYR C CG  1 
ATOM   10286 C CD1 . TYR C 1 174 ? 72.492  69.965  103.050 1.00 14.71 ? 174 TYR C CD1 1 
ATOM   10287 C CD2 . TYR C 1 174 ? 73.355  71.317  101.294 1.00 14.19 ? 174 TYR C CD2 1 
ATOM   10288 C CE1 . TYR C 1 174 ? 72.734  68.833  102.302 1.00 12.73 ? 174 TYR C CE1 1 
ATOM   10289 C CE2 . TYR C 1 174 ? 73.593  70.187  100.529 1.00 14.13 ? 174 TYR C CE2 1 
ATOM   10290 C CZ  . TYR C 1 174 ? 73.277  68.948  101.036 1.00 12.80 ? 174 TYR C CZ  1 
ATOM   10291 O OH  . TYR C 1 174 ? 73.513  67.812  100.308 1.00 11.77 ? 174 TYR C OH  1 
ATOM   10292 N N   . SER C 1 175 ? 74.241  74.306  106.076 1.00 16.82 ? 175 SER C N   1 
ATOM   10293 C CA  . SER C 1 175 ? 74.051  75.515  106.879 1.00 17.43 ? 175 SER C CA  1 
ATOM   10294 C C   . SER C 1 175 ? 75.266  76.434  107.008 1.00 18.73 ? 175 SER C C   1 
ATOM   10295 O O   . SER C 1 175 ? 75.229  77.384  107.799 1.00 17.87 ? 175 SER C O   1 
ATOM   10296 C CB  . SER C 1 175 ? 73.543  75.157  108.283 1.00 17.64 ? 175 SER C CB  1 
ATOM   10297 O OG  . SER C 1 175 ? 74.455  74.349  109.012 1.00 15.43 ? 175 SER C OG  1 
ATOM   10298 N N   . SER C 1 176 ? 76.332  76.178  106.247 1.00 19.70 ? 176 SER C N   1 
ATOM   10299 C CA  . SER C 1 176 ? 77.499  77.063  106.323 1.00 21.18 ? 176 SER C CA  1 
ATOM   10300 C C   . SER C 1 176 ? 77.057  78.486  106.010 1.00 20.85 ? 176 SER C C   1 
ATOM   10301 O O   . SER C 1 176 ? 76.356  78.733  105.034 1.00 21.88 ? 176 SER C O   1 
ATOM   10302 C CB  . SER C 1 176 ? 78.618  76.629  105.366 1.00 21.82 ? 176 SER C CB  1 
ATOM   10303 O OG  . SER C 1 176 ? 79.536  77.692  105.191 1.00 24.58 ? 176 SER C OG  1 
ATOM   10304 N N   . GLY C 1 177 ? 77.451  79.427  106.855 1.00 21.29 ? 177 GLY C N   1 
ATOM   10305 C CA  . GLY C 1 177 ? 77.064  80.812  106.664 1.00 21.13 ? 177 GLY C CA  1 
ATOM   10306 C C   . GLY C 1 177 ? 75.698  81.174  107.228 1.00 20.89 ? 177 GLY C C   1 
ATOM   10307 O O   . GLY C 1 177 ? 75.247  82.316  107.092 1.00 21.60 ? 177 GLY C O   1 
ATOM   10308 N N   . GLY C 1 178 ? 75.024  80.218  107.859 1.00 19.84 ? 178 GLY C N   1 
ATOM   10309 C CA  . GLY C 1 178 ? 73.728  80.503  108.448 1.00 18.83 ? 178 GLY C CA  1 
ATOM   10310 C C   . GLY C 1 178 ? 73.891  80.608  109.943 1.00 18.02 ? 178 GLY C C   1 
ATOM   10311 O O   . GLY C 1 178 ? 74.858  80.090  110.476 1.00 16.62 ? 178 GLY C O   1 
ATOM   10312 N N   . PRO C 1 179 ? 72.956  81.268  110.625 1.00 17.08 ? 179 PRO C N   1 
ATOM   10313 C CA  . PRO C 1 179 ? 73.030  81.376  112.081 1.00 17.09 ? 179 PRO C CA  1 
ATOM   10314 C C   . PRO C 1 179 ? 72.715  80.032  112.709 1.00 16.88 ? 179 PRO C C   1 
ATOM   10315 O O   . PRO C 1 179 ? 72.122  79.184  112.056 1.00 17.02 ? 179 PRO C O   1 
ATOM   10316 C CB  . PRO C 1 179 ? 71.929  82.394  112.417 1.00 17.36 ? 179 PRO C CB  1 
ATOM   10317 C CG  . PRO C 1 179 ? 70.974  82.339  111.268 1.00 17.26 ? 179 PRO C CG  1 
ATOM   10318 C CD  . PRO C 1 179 ? 71.774  81.949  110.075 1.00 17.35 ? 179 PRO C CD  1 
ATOM   10319 N N   . ARG C 1 180 ? 73.141  79.821  113.942 1.00 16.72 ? 180 ARG C N   1 
ATOM   10320 C CA  . ARG C 1 180 ? 72.778  78.615  114.652 1.00 16.58 ? 180 ARG C CA  1 
ATOM   10321 C C   . ARG C 1 180 ? 71.266  78.669  114.834 1.00 15.44 ? 180 ARG C C   1 
ATOM   10322 O O   . ARG C 1 180 ? 70.708  79.758  114.988 1.00 15.20 ? 180 ARG C O   1 
ATOM   10323 C CB  . ARG C 1 180 ? 73.458  78.575  116.023 1.00 17.16 ? 180 ARG C CB  1 
ATOM   10324 C CG  . ARG C 1 180 ? 74.945  78.200  116.038 1.00 19.55 ? 180 ARG C CG  1 
ATOM   10325 C CD  . ARG C 1 180 ? 75.562  78.225  117.439 1.00 21.00 ? 180 ARG C CD  1 
ATOM   10326 N NE  . ARG C 1 180 ? 75.526  79.581  117.998 1.00 24.03 ? 180 ARG C NE  1 
ATOM   10327 C CZ  . ARG C 1 180 ? 76.521  80.461  117.927 1.00 26.34 ? 180 ARG C CZ  1 
ATOM   10328 N NH1 . ARG C 1 180 ? 77.666  80.132  117.341 1.00 27.89 ? 180 ARG C NH1 1 
ATOM   10329 N NH2 . ARG C 1 180 ? 76.379  81.675  118.464 1.00 26.46 ? 180 ARG C NH2 1 
ATOM   10330 N N   . VAL C 1 181 ? 70.592  77.521  114.787 1.00 14.60 ? 181 VAL C N   1 
ATOM   10331 C CA  . VAL C 1 181 ? 69.146  77.498  115.066 1.00 13.53 ? 181 VAL C CA  1 
ATOM   10332 C C   . VAL C 1 181 ? 68.833  76.696  116.330 1.00 12.50 ? 181 VAL C C   1 
ATOM   10333 O O   . VAL C 1 181 ? 69.467  75.664  116.621 1.00 10.22 ? 181 VAL C O   1 
ATOM   10334 C CB  . VAL C 1 181 ? 68.263  76.981  113.887 1.00 13.99 ? 181 VAL C CB  1 
ATOM   10335 C CG1 . VAL C 1 181 ? 68.195  78.001  112.779 1.00 16.06 ? 181 VAL C CG1 1 
ATOM   10336 C CG2 . VAL C 1 181 ? 68.772  75.618  113.346 1.00 14.53 ? 181 VAL C CG2 1 
ATOM   10337 N N   . TRP C 1 182 ? 67.853  77.198  117.078 1.00 11.50 ? 182 TRP C N   1 
ATOM   10338 C CA  . TRP C 1 182 ? 67.397  76.554  118.291 1.00 12.39 ? 182 TRP C CA  1 
ATOM   10339 C C   . TRP C 1 182 ? 65.896  76.364  118.218 1.00 12.15 ? 182 TRP C C   1 
ATOM   10340 O O   . TRP C 1 182 ? 65.195  77.189  117.639 1.00 12.70 ? 182 TRP C O   1 
ATOM   10341 C CB  . TRP C 1 182 ? 67.743  77.406  119.524 1.00 12.29 ? 182 TRP C CB  1 
ATOM   10342 C CG  . TRP C 1 182 ? 69.203  77.770  119.633 1.00 14.74 ? 182 TRP C CG  1 
ATOM   10343 C CD1 . TRP C 1 182 ? 69.863  78.709  118.902 1.00 15.71 ? 182 TRP C CD1 1 
ATOM   10344 C CD2 . TRP C 1 182 ? 70.165  77.238  120.555 1.00 16.70 ? 182 TRP C CD2 1 
ATOM   10345 N NE1 . TRP C 1 182 ? 71.181  78.772  119.283 1.00 16.86 ? 182 TRP C NE1 1 
ATOM   10346 C CE2 . TRP C 1 182 ? 71.397  77.877  120.293 1.00 18.72 ? 182 TRP C CE2 1 
ATOM   10347 C CE3 . TRP C 1 182 ? 70.120  76.272  121.565 1.00 18.83 ? 182 TRP C CE3 1 
ATOM   10348 C CZ2 . TRP C 1 182 ? 72.563  77.595  121.015 1.00 18.90 ? 182 TRP C CZ2 1 
ATOM   10349 C CZ3 . TRP C 1 182 ? 71.277  75.981  122.270 1.00 19.48 ? 182 TRP C CZ3 1 
ATOM   10350 C CH2 . TRP C 1 182 ? 72.480  76.643  121.993 1.00 20.23 ? 182 TRP C CH2 1 
ATOM   10351 N N   . TYR C 1 183 ? 65.395  75.281  118.803 1.00 11.72 ? 183 TYR C N   1 
ATOM   10352 C CA  . TYR C 1 183 ? 63.958  75.031  118.839 1.00 11.53 ? 183 TYR C CA  1 
ATOM   10353 C C   . TYR C 1 183 ? 63.488  74.938  120.287 1.00 11.59 ? 183 TYR C C   1 
ATOM   10354 O O   . TYR C 1 183 ? 64.065  74.201  121.076 1.00 11.73 ? 183 TYR C O   1 
ATOM   10355 C CB  . TYR C 1 183 ? 63.610  73.776  118.020 1.00 11.69 ? 183 TYR C CB  1 
ATOM   10356 C CG  . TYR C 1 183 ? 63.883  74.082  116.572 1.00 11.39 ? 183 TYR C CG  1 
ATOM   10357 C CD1 . TYR C 1 183 ? 65.154  73.939  116.051 1.00 12.43 ? 183 TYR C CD1 1 
ATOM   10358 C CD2 . TYR C 1 183 ? 62.904  74.645  115.775 1.00 11.70 ? 183 TYR C CD2 1 
ATOM   10359 C CE1 . TYR C 1 183 ? 65.436  74.297  114.743 1.00 12.26 ? 183 TYR C CE1 1 
ATOM   10360 C CE2 . TYR C 1 183 ? 63.167  75.004  114.474 1.00 12.13 ? 183 TYR C CE2 1 
ATOM   10361 C CZ  . TYR C 1 183 ? 64.437  74.816  113.960 1.00 12.67 ? 183 TYR C CZ  1 
ATOM   10362 O OH  . TYR C 1 183 ? 64.719  75.176  112.675 1.00 14.39 ? 183 TYR C OH  1 
ATOM   10363 N N   . VAL C 1 184 ? 62.496  75.755  120.638 1.00 12.02 ? 184 VAL C N   1 
ATOM   10364 C CA  . VAL C 1 184 ? 61.878  75.717  121.963 1.00 11.75 ? 184 VAL C CA  1 
ATOM   10365 C C   . VAL C 1 184 ? 60.407  75.377  121.760 1.00 12.01 ? 184 VAL C C   1 
ATOM   10366 O O   . VAL C 1 184 ? 59.689  76.084  121.049 1.00 12.23 ? 184 VAL C O   1 
ATOM   10367 C CB  . VAL C 1 184 ? 62.001  77.062  122.684 1.00 12.48 ? 184 VAL C CB  1 
ATOM   10368 C CG1 . VAL C 1 184 ? 61.216  77.024  123.988 1.00 12.45 ? 184 VAL C CG1 1 
ATOM   10369 C CG2 . VAL C 1 184 ? 63.444  77.379  122.939 1.00 13.07 ? 184 VAL C CG2 1 
ATOM   10370 N N   . SER C 1 185 ? 59.951  74.273  122.344 1.00 11.34 ? 185 SER C N   1 
ATOM   10371 C CA  . SER C 1 185 ? 58.577  73.845  122.146 1.00 11.12 ? 185 SER C CA  1 
ATOM   10372 C C   . SER C 1 185 ? 57.847  73.502  123.457 1.00 10.43 ? 185 SER C C   1 
ATOM   10373 O O   . SER C 1 185 ? 56.685  73.822  123.625 1.00 9.97  ? 185 SER C O   1 
ATOM   10374 C CB  . SER C 1 185 ? 58.549  72.626  121.227 1.00 10.95 ? 185 SER C CB  1 
ATOM   10375 O OG  . SER C 1 185 ? 59.340  71.586  121.790 1.00 11.96 ? 185 SER C OG  1 
ATOM   10376 N N   . ASN C 1 186 ? 58.516  72.790  124.346 1.00 9.79  ? 186 ASN C N   1 
ATOM   10377 C CA  . ASN C 1 186 ? 57.882  72.384  125.607 1.00 9.53  ? 186 ASN C CA  1 
ATOM   10378 C C   . ASN C 1 186 ? 57.523  73.589  126.472 1.00 9.52  ? 186 ASN C C   1 
ATOM   10379 O O   . ASN C 1 186 ? 58.310  74.547  126.579 1.00 9.73  ? 186 ASN C O   1 
ATOM   10380 C CB  . ASN C 1 186 ? 58.835  71.464  126.385 1.00 9.19  ? 186 ASN C CB  1 
ATOM   10381 C CG  . ASN C 1 186 ? 58.103  70.498  127.277 1.00 8.03  ? 186 ASN C CG  1 
ATOM   10382 O OD1 . ASN C 1 186 ? 57.038  70.813  127.799 1.00 8.67  ? 186 ASN C OD1 1 
ATOM   10383 N ND2 . ASN C 1 186 ? 58.665  69.300  127.445 1.00 6.45  ? 186 ASN C ND2 1 
ATOM   10384 N N   . ILE C 1 187 ? 56.347  73.552  127.108 1.00 9.36  ? 187 ILE C N   1 
ATOM   10385 C CA  . ILE C 1 187 ? 55.998  74.589  128.069 1.00 9.36  ? 187 ILE C CA  1 
ATOM   10386 C C   . ILE C 1 187 ? 56.886  74.416  129.304 1.00 9.49  ? 187 ILE C C   1 
ATOM   10387 O O   . ILE C 1 187 ? 57.141  75.375  130.034 1.00 9.15  ? 187 ILE C O   1 
ATOM   10388 C CB  . ILE C 1 187 ? 54.496  74.557  128.453 1.00 9.61  ? 187 ILE C CB  1 
ATOM   10389 C CG1 . ILE C 1 187 ? 54.109  75.767  129.326 1.00 11.88 ? 187 ILE C CG1 1 
ATOM   10390 C CG2 . ILE C 1 187 ? 54.147  73.293  129.183 1.00 8.90  ? 187 ILE C CG2 1 
ATOM   10391 C CD1 . ILE C 1 187 ? 54.466  77.105  128.754 1.00 12.45 ? 187 ILE C CD1 1 
ATOM   10392 N N   . ASP C 1 188 ? 57.349  73.185  129.537 1.00 9.16  ? 188 ASP C N   1 
ATOM   10393 C CA  . ASP C 1 188 ? 58.248  72.930  130.660 1.00 9.21  ? 188 ASP C CA  1 
ATOM   10394 C C   . ASP C 1 188 ? 59.352  73.984  130.600 1.00 9.51  ? 188 ASP C C   1 
ATOM   10395 O O   . ASP C 1 188 ? 60.074  74.056  129.608 1.00 9.02  ? 188 ASP C O   1 
ATOM   10396 C CB  . ASP C 1 188 ? 58.829  71.543  130.533 1.00 8.48  ? 188 ASP C CB  1 
ATOM   10397 C CG  . ASP C 1 188 ? 59.877  71.231  131.596 1.00 10.16 ? 188 ASP C CG  1 
ATOM   10398 O OD1 . ASP C 1 188 ? 60.431  70.101  131.553 1.00 8.44  ? 188 ASP C OD1 1 
ATOM   10399 O OD2 . ASP C 1 188 ? 60.207  72.031  132.503 1.00 9.88  ? 188 ASP C OD2 1 
ATOM   10400 N N   . GLY C 1 189 ? 59.496  74.767  131.673 1.00 9.62  ? 189 GLY C N   1 
ATOM   10401 C CA  . GLY C 1 189 ? 60.426  75.886  131.703 1.00 9.68  ? 189 GLY C CA  1 
ATOM   10402 C C   . GLY C 1 189 ? 61.881  75.524  131.470 1.00 9.57  ? 189 GLY C C   1 
ATOM   10403 O O   . GLY C 1 189 ? 62.680  76.352  131.060 1.00 9.02  ? 189 GLY C O   1 
ATOM   10404 N N   . THR C 1 190 ? 62.231  74.278  131.751 1.00 9.64  ? 190 THR C N   1 
ATOM   10405 C CA  . THR C 1 190 ? 63.556  73.760  131.437 1.00 9.97  ? 190 THR C CA  1 
ATOM   10406 C C   . THR C 1 190 ? 63.943  74.075  129.997 1.00 9.63  ? 190 THR C C   1 
ATOM   10407 O O   . THR C 1 190 ? 65.105  74.384  129.698 1.00 9.12  ? 190 THR C O   1 
ATOM   10408 C CB  . THR C 1 190 ? 63.559  72.211  131.631 1.00 9.98  ? 190 THR C CB  1 
ATOM   10409 O OG1 . THR C 1 190 ? 63.578  71.919  133.025 1.00 10.34 ? 190 THR C OG1 1 
ATOM   10410 C CG2 . THR C 1 190 ? 64.835  71.577  131.102 1.00 11.73 ? 190 THR C CG2 1 
ATOM   10411 N N   . HIS C 1 191 ? 62.970  74.014  129.094 1.00 10.02 ? 191 HIS C N   1 
ATOM   10412 C CA  . HIS C 1 191 ? 63.302  74.114  127.686 1.00 10.14 ? 191 HIS C CA  1 
ATOM   10413 C C   . HIS C 1 191 ? 63.829  75.493  127.338 1.00 10.83 ? 191 HIS C C   1 
ATOM   10414 O O   . HIS C 1 191 ? 64.946  75.631  126.812 1.00 10.97 ? 191 HIS C O   1 
ATOM   10415 C CB  . HIS C 1 191 ? 62.128  73.714  126.778 1.00 10.19 ? 191 HIS C CB  1 
ATOM   10416 C CG  . HIS C 1 191 ? 62.570  73.079  125.490 1.00 10.17 ? 191 HIS C CG  1 
ATOM   10417 N ND1 . HIS C 1 191 ? 61.689  72.664  124.517 1.00 11.90 ? 191 HIS C ND1 1 
ATOM   10418 C CD2 . HIS C 1 191 ? 63.811  72.804  125.017 1.00 9.79  ? 191 HIS C CD2 1 
ATOM   10419 C CE1 . HIS C 1 191 ? 62.366  72.149  123.502 1.00 11.93 ? 191 HIS C CE1 1 
ATOM   10420 N NE2 . HIS C 1 191 ? 63.655  72.213  123.786 1.00 9.80  ? 191 HIS C NE2 1 
ATOM   10421 N N   . ILE C 1 192 ? 63.048  76.511  127.641 1.00 11.42 ? 192 ILE C N   1 
ATOM   10422 C CA  . ILE C 1 192 ? 63.472  77.870  127.328 1.00 12.26 ? 192 ILE C CA  1 
ATOM   10423 C C   . ILE C 1 192 ? 64.625  78.295  128.244 1.00 12.39 ? 192 ILE C C   1 
ATOM   10424 O O   . ILE C 1 192 ? 65.566  78.911  127.778 1.00 12.49 ? 192 ILE C O   1 
ATOM   10425 C CB  . ILE C 1 192 ? 62.303  78.859  127.385 1.00 12.27 ? 192 ILE C CB  1 
ATOM   10426 C CG1 . ILE C 1 192 ? 62.725  80.241  126.852 1.00 14.83 ? 192 ILE C CG1 1 
ATOM   10427 C CG2 . ILE C 1 192 ? 61.765  78.993  128.801 1.00 12.59 ? 192 ILE C CG2 1 
ATOM   10428 C CD1 . ILE C 1 192 ? 62.924  80.306  125.391 1.00 16.64 ? 192 ILE C CD1 1 
ATOM   10429 N N   . ALA C 1 193 ? 64.593  77.923  129.523 1.00 12.56 ? 193 ALA C N   1 
ATOM   10430 C CA  . ALA C 1 193 ? 65.656  78.348  130.441 1.00 12.82 ? 193 ALA C CA  1 
ATOM   10431 C C   . ALA C 1 193 ? 67.041  77.891  129.993 1.00 13.13 ? 193 ALA C C   1 
ATOM   10432 O O   . ALA C 1 193 ? 67.979  78.689  129.932 1.00 13.18 ? 193 ALA C O   1 
ATOM   10433 C CB  . ALA C 1 193 ? 65.375  77.847  131.856 1.00 13.08 ? 193 ALA C CB  1 
ATOM   10434 N N   . LYS C 1 194 ? 67.182  76.614  129.659 1.00 13.52 ? 194 LYS C N   1 
ATOM   10435 C CA  . LYS C 1 194 ? 68.487  76.102  129.265 1.00 14.18 ? 194 LYS C CA  1 
ATOM   10436 C C   . LYS C 1 194 ? 68.905  76.619  127.891 1.00 13.94 ? 194 LYS C C   1 
ATOM   10437 O O   . LYS C 1 194 ? 70.077  76.607  127.559 1.00 14.23 ? 194 LYS C O   1 
ATOM   10438 C CB  . LYS C 1 194 ? 68.548  74.560  129.335 1.00 14.63 ? 194 LYS C CB  1 
ATOM   10439 C CG  . LYS C 1 194 ? 67.904  73.807  128.212 1.00 17.30 ? 194 LYS C CG  1 
ATOM   10440 C CD  . LYS C 1 194 ? 67.745  72.303  128.546 1.00 20.22 ? 194 LYS C CD  1 
ATOM   10441 C CE  . LYS C 1 194 ? 66.978  71.480  127.470 1.00 21.55 ? 194 LYS C CE  1 
ATOM   10442 N NZ  . LYS C 1 194 ? 67.724  71.262  126.178 1.00 22.58 ? 194 LYS C NZ  1 
ATOM   10443 N N   . THR C 1 195 ? 67.940  77.053  127.095 1.00 14.01 ? 195 THR C N   1 
ATOM   10444 C CA  . THR C 1 195 ? 68.235  77.627  125.793 1.00 13.63 ? 195 THR C CA  1 
ATOM   10445 C C   . THR C 1 195 ? 68.753  79.050  125.992 1.00 13.82 ? 195 THR C C   1 
ATOM   10446 O O   . THR C 1 195 ? 69.814  79.417  125.476 1.00 13.95 ? 195 THR C O   1 
ATOM   10447 C CB  . THR C 1 195 ? 66.972  77.624  124.928 1.00 13.98 ? 195 THR C CB  1 
ATOM   10448 O OG1 . THR C 1 195 ? 66.549  76.269  124.682 1.00 14.04 ? 195 THR C OG1 1 
ATOM   10449 C CG2 . THR C 1 195 ? 67.242  78.193  123.550 1.00 13.09 ? 195 THR C CG2 1 
ATOM   10450 N N   . LEU C 1 196 ? 68.008  79.845  126.747 1.00 13.69 ? 196 LEU C N   1 
ATOM   10451 C CA  . LEU C 1 196 ? 68.376  81.248  126.960 1.00 14.64 ? 196 LEU C CA  1 
ATOM   10452 C C   . LEU C 1 196 ? 69.746  81.379  127.634 1.00 15.50 ? 196 LEU C C   1 
ATOM   10453 O O   . LEU C 1 196 ? 70.465  82.362  127.415 1.00 15.79 ? 196 LEU C O   1 
ATOM   10454 C CB  . LEU C 1 196 ? 67.300  81.969  127.771 1.00 13.89 ? 196 LEU C CB  1 
ATOM   10455 C CG  . LEU C 1 196 ? 65.935  82.185  127.090 1.00 14.79 ? 196 LEU C CG  1 
ATOM   10456 C CD1 . LEU C 1 196 ? 64.921  82.883  128.019 1.00 16.01 ? 196 LEU C CD1 1 
ATOM   10457 C CD2 . LEU C 1 196 ? 66.068  82.945  125.765 1.00 15.59 ? 196 LEU C CD2 1 
ATOM   10458 N N   . ALA C 1 197 ? 70.097  80.381  128.434 1.00 16.64 ? 197 ALA C N   1 
ATOM   10459 C CA  . ALA C 1 197 ? 71.354  80.373  129.169 1.00 17.93 ? 197 ALA C CA  1 
ATOM   10460 C C   . ALA C 1 197 ? 72.551  80.307  128.247 1.00 18.85 ? 197 ALA C C   1 
ATOM   10461 O O   . ALA C 1 197 ? 73.680  80.624  128.658 1.00 19.20 ? 197 ALA C O   1 
ATOM   10462 C CB  . ALA C 1 197 ? 71.395  79.212  130.138 1.00 18.27 ? 197 ALA C CB  1 
ATOM   10463 N N   . GLN C 1 198 ? 72.321  79.903  127.005 1.00 19.09 ? 198 GLN C N   1 
ATOM   10464 C CA  . GLN C 1 198 ? 73.411  79.798  126.045 1.00 19.53 ? 198 GLN C CA  1 
ATOM   10465 C C   . GLN C 1 198 ? 73.464  80.959  125.057 1.00 18.91 ? 198 GLN C C   1 
ATOM   10466 O O   . GLN C 1 198 ? 74.313  80.966  124.171 1.00 18.52 ? 198 GLN C O   1 
ATOM   10467 C CB  . GLN C 1 198 ? 73.304  78.466  125.305 1.00 19.93 ? 198 GLN C CB  1 
ATOM   10468 C CG  . GLN C 1 198 ? 73.428  77.277  126.261 1.00 22.96 ? 198 GLN C CG  1 
ATOM   10469 C CD  . GLN C 1 198 ? 73.315  75.944  125.574 1.00 26.25 ? 198 GLN C CD  1 
ATOM   10470 O OE1 . GLN C 1 198 ? 72.296  75.259  125.699 1.00 30.73 ? 198 GLN C OE1 1 
ATOM   10471 N NE2 . GLN C 1 198 ? 74.362  75.555  124.861 1.00 28.97 ? 198 GLN C NE2 1 
ATOM   10472 N N   . LEU C 1 199 ? 72.586  81.945  125.225 1.00 18.26 ? 199 LEU C N   1 
ATOM   10473 C CA  . LEU C 1 199 ? 72.469  83.044  124.270 1.00 17.94 ? 199 LEU C CA  1 
ATOM   10474 C C   . LEU C 1 199 ? 72.790  84.441  124.801 1.00 18.21 ? 199 LEU C C   1 
ATOM   10475 O O   . LEU C 1 199 ? 72.861  84.682  126.002 1.00 17.34 ? 199 LEU C O   1 
ATOM   10476 C CB  . LEU C 1 199 ? 71.026  83.081  123.737 1.00 18.08 ? 199 LEU C CB  1 
ATOM   10477 C CG  . LEU C 1 199 ? 70.544  81.748  123.149 1.00 18.54 ? 199 LEU C CG  1 
ATOM   10478 C CD1 . LEU C 1 199 ? 69.057  81.766  122.942 1.00 18.85 ? 199 LEU C CD1 1 
ATOM   10479 C CD2 . LEU C 1 199 ? 71.273  81.477  121.844 1.00 19.57 ? 199 LEU C CD2 1 
ATOM   10480 N N   . ASN C 1 200 ? 72.952  85.359  123.857 1.00 18.36 ? 200 ASN C N   1 
ATOM   10481 C CA  . ASN C 1 200 ? 73.169  86.768  124.138 1.00 18.76 ? 200 ASN C CA  1 
ATOM   10482 C C   . ASN C 1 200 ? 72.043  87.559  123.470 1.00 18.04 ? 200 ASN C C   1 
ATOM   10483 O O   . ASN C 1 200 ? 71.820  87.440  122.257 1.00 17.76 ? 200 ASN C O   1 
ATOM   10484 C CB  . ASN C 1 200 ? 74.529  87.197  123.598 1.00 19.26 ? 200 ASN C CB  1 
ATOM   10485 C CG  . ASN C 1 200 ? 75.642  86.814  124.518 1.00 22.94 ? 200 ASN C CG  1 
ATOM   10486 O OD1 . ASN C 1 200 ? 76.348  85.823  124.286 1.00 26.47 ? 200 ASN C OD1 1 
ATOM   10487 N ND2 . ASN C 1 200 ? 75.803  87.583  125.596 1.00 21.78 ? 200 ASN C ND2 1 
ATOM   10488 N N   . PRO C 1 201 ? 71.321  88.351  124.245 1.00 17.23 ? 201 PRO C N   1 
ATOM   10489 C CA  . PRO C 1 201 ? 70.181  89.096  123.705 1.00 17.23 ? 201 PRO C CA  1 
ATOM   10490 C C   . PRO C 1 201 ? 70.564  89.989  122.519 1.00 17.02 ? 201 PRO C C   1 
ATOM   10491 O O   . PRO C 1 201 ? 69.742  90.185  121.637 1.00 16.40 ? 201 PRO C O   1 
ATOM   10492 C CB  . PRO C 1 201 ? 69.728  89.949  124.890 1.00 17.05 ? 201 PRO C CB  1 
ATOM   10493 C CG  . PRO C 1 201 ? 70.216  89.194  126.092 1.00 17.36 ? 201 PRO C CG  1 
ATOM   10494 C CD  . PRO C 1 201 ? 71.522  88.613  125.679 1.00 17.87 ? 201 PRO C CD  1 
ATOM   10495 N N   . GLU C 1 202 ? 71.801  90.486  122.500 1.00 17.17 ? 202 GLU C N   1 
ATOM   10496 C CA  . GLU C 1 202 ? 72.232  91.436  121.468 1.00 17.19 ? 202 GLU C CA  1 
ATOM   10497 C C   . GLU C 1 202 ? 72.347  90.801  120.081 1.00 16.80 ? 202 GLU C C   1 
ATOM   10498 O O   . GLU C 1 202 ? 72.266  91.510  119.070 1.00 16.37 ? 202 GLU C O   1 
ATOM   10499 C CB  . GLU C 1 202 ? 73.568  92.088  121.865 1.00 17.45 ? 202 GLU C CB  1 
ATOM   10500 C CG  . GLU C 1 202 ? 73.476  93.058  123.041 1.00 19.72 ? 202 GLU C CG  1 
ATOM   10501 C CD  . GLU C 1 202 ? 73.226  92.383  124.388 1.00 20.97 ? 202 GLU C CD  1 
ATOM   10502 O OE1 . GLU C 1 202 ? 72.465  92.957  125.225 1.00 21.20 ? 202 GLU C OE1 1 
ATOM   10503 O OE2 . GLU C 1 202 ? 73.793  91.287  124.612 1.00 22.67 ? 202 GLU C OE2 1 
ATOM   10504 N N   . SER C 1 203 ? 72.502  89.478  120.033 1.00 16.36 ? 203 SER C N   1 
ATOM   10505 C CA  . SER C 1 203 ? 72.698  88.767  118.766 1.00 16.53 ? 203 SER C CA  1 
ATOM   10506 C C   . SER C 1 203 ? 71.700  87.614  118.516 1.00 16.03 ? 203 SER C C   1 
ATOM   10507 O O   . SER C 1 203 ? 71.928  86.789  117.633 1.00 16.01 ? 203 SER C O   1 
ATOM   10508 C CB  . SER C 1 203 ? 74.139  88.241  118.697 1.00 16.72 ? 203 SER C CB  1 
ATOM   10509 O OG  . SER C 1 203 ? 74.432  87.415  119.804 1.00 17.02 ? 203 SER C OG  1 
ATOM   10510 N N   . SER C 1 204 ? 70.595  87.593  119.265 1.00 15.23 ? 204 SER C N   1 
ATOM   10511 C CA  . SER C 1 204 ? 69.589  86.543  119.153 1.00 15.37 ? 204 SER C CA  1 
ATOM   10512 C C   . SER C 1 204 ? 68.313  87.055  118.524 1.00 15.46 ? 204 SER C C   1 
ATOM   10513 O O   . SER C 1 204 ? 67.827  88.129  118.875 1.00 15.57 ? 204 SER C O   1 
ATOM   10514 C CB  . SER C 1 204 ? 69.280  85.967  120.546 1.00 15.05 ? 204 SER C CB  1 
ATOM   10515 O OG  . SER C 1 204 ? 70.365  85.184  121.015 1.00 14.49 ? 204 SER C OG  1 
ATOM   10516 N N   . LEU C 1 205 ? 67.788  86.276  117.586 1.00 15.68 ? 205 LEU C N   1 
ATOM   10517 C CA  . LEU C 1 205 ? 66.552  86.572  116.885 1.00 15.58 ? 205 LEU C CA  1 
ATOM   10518 C C   . LEU C 1 205 ? 65.524  85.483  117.161 1.00 14.97 ? 205 LEU C C   1 
ATOM   10519 O O   . LEU C 1 205 ? 65.784  84.308  116.893 1.00 15.07 ? 205 LEU C O   1 
ATOM   10520 C CB  . LEU C 1 205 ? 66.802  86.638  115.378 1.00 16.17 ? 205 LEU C CB  1 
ATOM   10521 C CG  . LEU C 1 205 ? 65.553  86.808  114.513 1.00 18.03 ? 205 LEU C CG  1 
ATOM   10522 C CD1 . LEU C 1 205 ? 65.008  88.203  114.730 1.00 20.07 ? 205 LEU C CD1 1 
ATOM   10523 C CD2 . LEU C 1 205 ? 65.901  86.599  113.048 1.00 20.85 ? 205 LEU C CD2 1 
ATOM   10524 N N   . PHE C 1 206 ? 64.355  85.882  117.660 1.00 14.73 ? 206 PHE C N   1 
ATOM   10525 C CA  . PHE C 1 206 ? 63.286  84.943  118.005 1.00 14.24 ? 206 PHE C CA  1 
ATOM   10526 C C   . PHE C 1 206 ? 62.188  84.918  116.961 1.00 14.15 ? 206 PHE C C   1 
ATOM   10527 O O   . PHE C 1 206 ? 61.749  85.966  116.465 1.00 14.75 ? 206 PHE C O   1 
ATOM   10528 C CB  . PHE C 1 206 ? 62.690  85.295  119.380 1.00 14.05 ? 206 PHE C CB  1 
ATOM   10529 C CG  . PHE C 1 206 ? 63.653  85.118  120.498 1.00 14.15 ? 206 PHE C CG  1 
ATOM   10530 C CD1 . PHE C 1 206 ? 64.512  86.145  120.855 1.00 14.56 ? 206 PHE C CD1 1 
ATOM   10531 C CD2 . PHE C 1 206 ? 63.732  83.911  121.181 1.00 13.54 ? 206 PHE C CD2 1 
ATOM   10532 C CE1 . PHE C 1 206 ? 65.434  85.976  121.881 1.00 15.33 ? 206 PHE C CE1 1 
ATOM   10533 C CE2 . PHE C 1 206 ? 64.643  83.733  122.192 1.00 14.07 ? 206 PHE C CE2 1 
ATOM   10534 C CZ  . PHE C 1 206 ? 65.486  84.753  122.564 1.00 14.98 ? 206 PHE C CZ  1 
ATOM   10535 N N   . ILE C 1 207 ? 61.779  83.705  116.619 1.00 13.70 ? 207 ILE C N   1 
ATOM   10536 C CA  . ILE C 1 207 ? 60.718  83.452  115.665 1.00 13.99 ? 207 ILE C CA  1 
ATOM   10537 C C   . ILE C 1 207 ? 59.530  82.857  116.414 1.00 13.39 ? 207 ILE C C   1 
ATOM   10538 O O   . ILE C 1 207 ? 59.574  81.711  116.865 1.00 13.83 ? 207 ILE C O   1 
ATOM   10539 C CB  . ILE C 1 207 ? 61.193  82.484  114.559 1.00 14.09 ? 207 ILE C CB  1 
ATOM   10540 C CG1 . ILE C 1 207 ? 62.427  83.031  113.831 1.00 16.40 ? 207 ILE C CG1 1 
ATOM   10541 C CG2 . ILE C 1 207 ? 60.087  82.233  113.576 1.00 15.52 ? 207 ILE C CG2 1 
ATOM   10542 C CD1 . ILE C 1 207 ? 62.982  82.080  112.785 1.00 18.43 ? 207 ILE C CD1 1 
ATOM   10543 N N   . ILE C 1 208 ? 58.460  83.626  116.523 1.00 12.79 ? 208 ILE C N   1 
ATOM   10544 C CA  . ILE C 1 208 ? 57.293  83.168  117.254 1.00 12.38 ? 208 ILE C CA  1 
ATOM   10545 C C   . ILE C 1 208 ? 56.293  82.634  116.262 1.00 12.31 ? 208 ILE C C   1 
ATOM   10546 O O   . ILE C 1 208 ? 55.666  83.388  115.504 1.00 11.84 ? 208 ILE C O   1 
ATOM   10547 C CB  . ILE C 1 208 ? 56.710  84.294  118.096 1.00 12.05 ? 208 ILE C CB  1 
ATOM   10548 C CG1 . ILE C 1 208 ? 57.837  85.029  118.826 1.00 12.25 ? 208 ILE C CG1 1 
ATOM   10549 C CG2 . ILE C 1 208 ? 55.678  83.746  119.060 1.00 12.34 ? 208 ILE C CG2 1 
ATOM   10550 C CD1 . ILE C 1 208 ? 58.688  84.155  119.699 1.00 11.39 ? 208 ILE C CD1 1 
ATOM   10551 N N   . ALA C 1 209 ? 56.173  81.316  116.259 1.00 11.97 ? 209 ALA C N   1 
ATOM   10552 C CA  . ALA C 1 209 ? 55.344  80.609  115.281 1.00 12.65 ? 209 ALA C CA  1 
ATOM   10553 C C   . ALA C 1 209 ? 53.967  80.230  115.841 1.00 13.11 ? 209 ALA C C   1 
ATOM   10554 O O   . ALA C 1 209 ? 53.831  79.276  116.616 1.00 13.30 ? 209 ALA C O   1 
ATOM   10555 C CB  . ALA C 1 209 ? 56.078  79.378  114.790 1.00 12.60 ? 209 ALA C CB  1 
ATOM   10556 N N   . SER C 1 210 ? 52.948  80.988  115.444 1.00 13.37 ? 210 SER C N   1 
ATOM   10557 C CA  . SER C 1 210 ? 51.587  80.758  115.926 1.00 14.18 ? 210 SER C CA  1 
ATOM   10558 C C   . SER C 1 210 ? 50.577  81.495  115.049 1.00 14.63 ? 210 SER C C   1 
ATOM   10559 O O   . SER C 1 210 ? 50.526  82.715  115.054 1.00 14.69 ? 210 SER C O   1 
ATOM   10560 C CB  . SER C 1 210 ? 51.443  81.253  117.372 1.00 13.83 ? 210 SER C CB  1 
ATOM   10561 O OG  . SER C 1 210 ? 50.065  81.306  117.734 1.00 14.31 ? 210 SER C OG  1 
ATOM   10562 N N   . LYS C 1 211 ? 49.764  80.742  114.322 1.00 15.63 ? 211 LYS C N   1 
ATOM   10563 C CA  . LYS C 1 211 ? 48.785  81.319  113.418 1.00 16.51 ? 211 LYS C CA  1 
ATOM   10564 C C   . LYS C 1 211 ? 47.860  82.330  114.122 1.00 16.53 ? 211 LYS C C   1 
ATOM   10565 O O   . LYS C 1 211 ? 47.641  83.429  113.610 1.00 16.05 ? 211 LYS C O   1 
ATOM   10566 C CB  . LYS C 1 211 ? 47.980  80.204  112.753 1.00 16.88 ? 211 LYS C CB  1 
ATOM   10567 C CG  . LYS C 1 211 ? 46.805  80.678  111.884 1.00 18.82 ? 211 LYS C CG  1 
ATOM   10568 C CD  . LYS C 1 211 ? 47.257  81.283  110.579 1.00 20.21 ? 211 LYS C CD  1 
ATOM   10569 C CE  . LYS C 1 211 ? 46.122  81.255  109.532 1.00 20.08 ? 211 LYS C CE  1 
ATOM   10570 N NZ  . LYS C 1 211 ? 44.970  82.090  109.956 1.00 19.54 ? 211 LYS C NZ  1 
ATOM   10571 N N   . THR C 1 212 ? 47.327  81.949  115.282 1.00 16.68 ? 212 THR C N   1 
ATOM   10572 C CA  . THR C 1 212 ? 46.413  82.809  116.036 1.00 17.33 ? 212 THR C CA  1 
ATOM   10573 C C   . THR C 1 212 ? 47.151  83.822  116.893 1.00 17.08 ? 212 THR C C   1 
ATOM   10574 O O   . THR C 1 212 ? 46.583  84.840  117.287 1.00 16.36 ? 212 THR C O   1 
ATOM   10575 C CB  . THR C 1 212 ? 45.519  81.985  116.978 1.00 17.40 ? 212 THR C CB  1 
ATOM   10576 O OG1 . THR C 1 212 ? 46.329  81.289  117.942 1.00 17.67 ? 212 THR C OG1 1 
ATOM   10577 C CG2 . THR C 1 212 ? 44.769  80.894  116.238 1.00 18.57 ? 212 THR C CG2 1 
ATOM   10578 N N   . PHE C 1 213 ? 48.415  83.522  117.186 1.00 16.48 ? 213 PHE C N   1 
ATOM   10579 C CA  . PHE C 1 213 ? 49.219  84.282  118.139 1.00 16.10 ? 213 PHE C CA  1 
ATOM   10580 C C   . PHE C 1 213 ? 48.580  84.334  119.543 1.00 16.03 ? 213 PHE C C   1 
ATOM   10581 O O   . PHE C 1 213 ? 48.824  85.266  120.307 1.00 16.21 ? 213 PHE C O   1 
ATOM   10582 C CB  . PHE C 1 213 ? 49.553  85.685  117.633 1.00 16.11 ? 213 PHE C CB  1 
ATOM   10583 C CG  . PHE C 1 213 ? 50.991  86.076  117.862 1.00 15.22 ? 213 PHE C CG  1 
ATOM   10584 C CD1 . PHE C 1 213 ? 51.995  85.471  117.141 1.00 13.93 ? 213 PHE C CD1 1 
ATOM   10585 C CD2 . PHE C 1 213 ? 51.341  87.025  118.810 1.00 16.40 ? 213 PHE C CD2 1 
ATOM   10586 C CE1 . PHE C 1 213 ? 53.310  85.794  117.344 1.00 13.55 ? 213 PHE C CE1 1 
ATOM   10587 C CE2 . PHE C 1 213 ? 52.669  87.357  119.009 1.00 15.43 ? 213 PHE C CE2 1 
ATOM   10588 C CZ  . PHE C 1 213 ? 53.650  86.740  118.271 1.00 14.35 ? 213 PHE C CZ  1 
ATOM   10589 N N   . THR C 1 214 ? 47.774  83.323  119.868 1.00 15.71 ? 214 THR C N   1 
ATOM   10590 C CA  . THR C 1 214 ? 47.223  83.155  121.226 1.00 15.83 ? 214 THR C CA  1 
ATOM   10591 C C   . THR C 1 214 ? 47.506  81.748  121.793 1.00 15.58 ? 214 THR C C   1 
ATOM   10592 O O   . THR C 1 214 ? 47.049  81.412  122.896 1.00 15.67 ? 214 THR C O   1 
ATOM   10593 C CB  . THR C 1 214 ? 45.703  83.430  121.277 1.00 15.89 ? 214 THR C CB  1 
ATOM   10594 O OG1 . THR C 1 214 ? 45.001  82.493  120.463 1.00 17.02 ? 214 THR C OG1 1 
ATOM   10595 C CG2 . THR C 1 214 ? 45.364  84.777  120.669 1.00 17.26 ? 214 THR C CG2 1 
ATOM   10596 N N   . THR C 1 215 ? 48.272  80.938  121.064 1.00 14.83 ? 215 THR C N   1 
ATOM   10597 C CA  . THR C 1 215 ? 48.635  79.591  121.522 1.00 14.65 ? 215 THR C CA  1 
ATOM   10598 C C   . THR C 1 215 ? 49.294  79.695  122.891 1.00 14.20 ? 215 THR C C   1 
ATOM   10599 O O   . THR C 1 215 ? 50.334  80.322  123.028 1.00 13.51 ? 215 THR C O   1 
ATOM   10600 C CB  . THR C 1 215 ? 49.591  78.945  120.538 1.00 14.73 ? 215 THR C CB  1 
ATOM   10601 O OG1 . THR C 1 215 ? 49.043  79.031  119.215 1.00 16.10 ? 215 THR C OG1 1 
ATOM   10602 C CG2 . THR C 1 215 ? 49.741  77.457  120.826 1.00 15.76 ? 215 THR C CG2 1 
ATOM   10603 N N   . GLN C 1 216 ? 48.685  79.100  123.914 1.00 13.85 ? 216 GLN C N   1 
ATOM   10604 C CA  . GLN C 1 216 ? 49.181  79.327  125.275 1.00 14.09 ? 216 GLN C CA  1 
ATOM   10605 C C   . GLN C 1 216 ? 50.661  79.018  125.465 1.00 13.24 ? 216 GLN C C   1 
ATOM   10606 O O   . GLN C 1 216 ? 51.415  79.853  125.940 1.00 13.73 ? 216 GLN C O   1 
ATOM   10607 C CB  . GLN C 1 216 ? 48.387  78.534  126.291 1.00 14.51 ? 216 GLN C CB  1 
ATOM   10608 C CG  . GLN C 1 216 ? 48.837  78.800  127.718 1.00 15.32 ? 216 GLN C CG  1 
ATOM   10609 C CD  . GLN C 1 216 ? 48.199  77.840  128.695 1.00 16.23 ? 216 GLN C CD  1 
ATOM   10610 O OE1 . GLN C 1 216 ? 47.978  76.689  128.357 1.00 16.39 ? 216 GLN C OE1 1 
ATOM   10611 N NE2 . GLN C 1 216 ? 47.909  78.310  129.905 1.00 16.07 ? 216 GLN C NE2 1 
ATOM   10612 N N   . GLU C 1 217 ? 51.071  77.808  125.124 1.00 13.14 ? 217 GLU C N   1 
ATOM   10613 C CA  . GLU C 1 217 ? 52.451  77.397  125.361 1.00 12.72 ? 217 GLU C CA  1 
ATOM   10614 C C   . GLU C 1 217 ? 53.448  78.254  124.610 1.00 11.59 ? 217 GLU C C   1 
ATOM   10615 O O   . GLU C 1 217 ? 54.400  78.751  125.199 1.00 10.41 ? 217 GLU C O   1 
ATOM   10616 C CB  . GLU C 1 217 ? 52.645  75.920  125.045 1.00 13.41 ? 217 GLU C CB  1 
ATOM   10617 C CG  . GLU C 1 217 ? 51.816  75.063  125.979 1.00 13.98 ? 217 GLU C CG  1 
ATOM   10618 C CD  . GLU C 1 217 ? 52.048  73.574  125.816 1.00 16.25 ? 217 GLU C CD  1 
ATOM   10619 O OE1 . GLU C 1 217 ? 53.198  73.146  125.644 1.00 16.00 ? 217 GLU C OE1 1 
ATOM   10620 O OE2 . GLU C 1 217 ? 51.052  72.841  125.881 1.00 17.49 ? 217 GLU C OE2 1 
ATOM   10621 N N   . THR C 1 218 ? 53.189  78.465  123.334 1.00 11.28 ? 218 THR C N   1 
ATOM   10622 C CA  . THR C 1 218 ? 54.059  79.253  122.489 1.00 11.53 ? 218 THR C CA  1 
ATOM   10623 C C   . THR C 1 218 ? 54.185  80.675  122.981 1.00 11.69 ? 218 THR C C   1 
ATOM   10624 O O   . THR C 1 218 ? 55.296  81.205  123.116 1.00 11.43 ? 218 THR C O   1 
ATOM   10625 C CB  . THR C 1 218 ? 53.506  79.245  121.080 1.00 11.39 ? 218 THR C CB  1 
ATOM   10626 O OG1 . THR C 1 218 ? 53.554  77.903  120.589 1.00 12.42 ? 218 THR C OG1 1 
ATOM   10627 C CG2 . THR C 1 218 ? 54.400  80.032  120.119 1.00 11.63 ? 218 THR C CG2 1 
ATOM   10628 N N   . ILE C 1 219 ? 53.047  81.280  123.277 1.00 12.04 ? 219 ILE C N   1 
ATOM   10629 C CA  . ILE C 1 219 ? 53.047  82.665  123.721 1.00 12.25 ? 219 ILE C CA  1 
ATOM   10630 C C   . ILE C 1 219 ? 53.666  82.788  125.121 1.00 11.97 ? 219 ILE C C   1 
ATOM   10631 O O   . ILE C 1 219 ? 54.372  83.750  125.385 1.00 12.18 ? 219 ILE C O   1 
ATOM   10632 C CB  . ILE C 1 219 ? 51.643  83.266  123.605 1.00 12.80 ? 219 ILE C CB  1 
ATOM   10633 C CG1 . ILE C 1 219 ? 51.191  83.299  122.125 1.00 12.81 ? 219 ILE C CG1 1 
ATOM   10634 C CG2 . ILE C 1 219 ? 51.609  84.663  124.168 1.00 13.93 ? 219 ILE C CG2 1 
ATOM   10635 C CD1 . ILE C 1 219 ? 52.187  83.954  121.178 1.00 13.46 ? 219 ILE C CD1 1 
ATOM   10636 N N   . THR C 1 220 ? 53.459  81.811  126.005 1.00 11.98 ? 220 THR C N   1 
ATOM   10637 C CA  . THR C 1 220 ? 54.144  81.845  127.306 1.00 12.03 ? 220 THR C CA  1 
ATOM   10638 C C   . THR C 1 220 ? 55.664  81.830  127.108 1.00 11.76 ? 220 THR C C   1 
ATOM   10639 O O   . THR C 1 220 ? 56.377  82.678  127.662 1.00 11.50 ? 220 THR C O   1 
ATOM   10640 C CB  . THR C 1 220 ? 53.699  80.677  128.194 1.00 12.26 ? 220 THR C CB  1 
ATOM   10641 O OG1 . THR C 1 220 ? 52.300  80.778  128.434 1.00 11.51 ? 220 THR C OG1 1 
ATOM   10642 C CG2 . THR C 1 220 ? 54.306  80.772  129.583 1.00 13.09 ? 220 THR C CG2 1 
ATOM   10643 N N   . ASN C 1 221 ? 56.155  80.884  126.306 1.00 11.62 ? 221 ASN C N   1 
ATOM   10644 C CA  . ASN C 1 221 ? 57.577  80.821  125.974 1.00 11.19 ? 221 ASN C CA  1 
ATOM   10645 C C   . ASN C 1 221 ? 58.089  82.132  125.357 1.00 11.17 ? 221 ASN C C   1 
ATOM   10646 O O   . ASN C 1 221 ? 59.156  82.625  125.721 1.00 10.51 ? 221 ASN C O   1 
ATOM   10647 C CB  . ASN C 1 221 ? 57.870  79.624  125.045 1.00 10.63 ? 221 ASN C CB  1 
ATOM   10648 C CG  . ASN C 1 221 ? 58.089  78.327  125.819 1.00 11.13 ? 221 ASN C CG  1 
ATOM   10649 O OD1 . ASN C 1 221 ? 58.618  78.358  126.926 1.00 12.23 ? 221 ASN C OD1 1 
ATOM   10650 N ND2 . ASN C 1 221 ? 57.688  77.189  125.244 1.00 9.74  ? 221 ASN C ND2 1 
ATOM   10651 N N   . ALA C 1 222 ? 57.315  82.685  124.428 1.00 11.14 ? 222 ALA C N   1 
ATOM   10652 C CA  . ALA C 1 222 ? 57.664  83.941  123.788 1.00 11.41 ? 222 ALA C CA  1 
ATOM   10653 C C   . ALA C 1 222 ? 57.768  85.091  124.800 1.00 11.41 ? 222 ALA C C   1 
ATOM   10654 O O   . ALA C 1 222 ? 58.687  85.899  124.721 1.00 11.39 ? 222 ALA C O   1 
ATOM   10655 C CB  . ALA C 1 222 ? 56.634  84.276  122.714 1.00 11.16 ? 222 ALA C CB  1 
ATOM   10656 N N   . GLU C 1 223 ? 56.834  85.153  125.748 1.00 11.19 ? 223 GLU C N   1 
ATOM   10657 C CA  . GLU C 1 223 ? 56.834  86.204  126.768 1.00 12.09 ? 223 GLU C CA  1 
ATOM   10658 C C   . GLU C 1 223 ? 58.028  86.057  127.680 1.00 11.94 ? 223 GLU C C   1 
ATOM   10659 O O   . GLU C 1 223 ? 58.601  87.052  128.141 1.00 11.48 ? 223 GLU C O   1 
ATOM   10660 C CB  . GLU C 1 223 ? 55.534  86.194  127.600 1.00 12.62 ? 223 GLU C CB  1 
ATOM   10661 C CG  . GLU C 1 223 ? 54.325  86.643  126.804 1.00 16.25 ? 223 GLU C CG  1 
ATOM   10662 C CD  . GLU C 1 223 ? 53.007  86.509  127.558 1.00 20.65 ? 223 GLU C CD  1 
ATOM   10663 O OE1 . GLU C 1 223 ? 52.028  87.121  127.103 1.00 26.39 ? 223 GLU C OE1 1 
ATOM   10664 O OE2 . GLU C 1 223 ? 52.936  85.773  128.569 1.00 25.63 ? 223 GLU C OE2 1 
ATOM   10665 N N   . THR C 1 224 ? 58.392  84.818  127.974 1.00 11.04 ? 224 THR C N   1 
ATOM   10666 C CA  . THR C 1 224 ? 59.576  84.562  128.791 1.00 11.21 ? 224 THR C CA  1 
ATOM   10667 C C   . THR C 1 224 ? 60.835  85.012  128.061 1.00 11.57 ? 224 THR C C   1 
ATOM   10668 O O   . THR C 1 224 ? 61.710  85.644  128.660 1.00 11.68 ? 224 THR C O   1 
ATOM   10669 C CB  . THR C 1 224 ? 59.629  83.081  129.158 1.00 11.45 ? 224 THR C CB  1 
ATOM   10670 O OG1 . THR C 1 224 ? 58.581  82.815  130.097 1.00 10.43 ? 224 THR C OG1 1 
ATOM   10671 C CG2 . THR C 1 224 ? 60.906  82.731  129.888 1.00 11.50 ? 224 THR C CG2 1 
ATOM   10672 N N   . ALA C 1 225 ? 60.919  84.711  126.766 1.00 11.30 ? 225 ALA C N   1 
ATOM   10673 C CA  . ALA C 1 225 ? 62.036  85.187  125.955 1.00 11.31 ? 225 ALA C CA  1 
ATOM   10674 C C   . ALA C 1 225 ? 62.101  86.727  125.927 1.00 11.67 ? 225 ALA C C   1 
ATOM   10675 O O   . ALA C 1 225 ? 63.179  87.297  126.039 1.00 11.06 ? 225 ALA C O   1 
ATOM   10676 C CB  . ALA C 1 225 ? 61.941  84.643  124.525 1.00 11.66 ? 225 ALA C CB  1 
ATOM   10677 N N   . LYS C 1 226 ? 60.958  87.386  125.745 1.00 12.65 ? 226 LYS C N   1 
ATOM   10678 C CA  . LYS C 1 226 ? 60.909  88.852  125.716 1.00 13.44 ? 226 LYS C CA  1 
ATOM   10679 C C   . LYS C 1 226 ? 61.313  89.450  127.065 1.00 13.94 ? 226 LYS C C   1 
ATOM   10680 O O   . LYS C 1 226 ? 61.973  90.493  127.111 1.00 14.48 ? 226 LYS C O   1 
ATOM   10681 C CB  . LYS C 1 226 ? 59.524  89.360  125.286 1.00 13.48 ? 226 LYS C CB  1 
ATOM   10682 C CG  . LYS C 1 226 ? 59.386  90.890  125.285 1.00 13.91 ? 226 LYS C CG  1 
ATOM   10683 C CD  . LYS C 1 226 ? 58.138  91.411  124.584 1.00 14.64 ? 226 LYS C CD  1 
ATOM   10684 C CE  . LYS C 1 226 ? 56.859  91.028  125.295 1.00 16.13 ? 226 LYS C CE  1 
ATOM   10685 N NZ  . LYS C 1 226 ? 55.705  91.879  124.882 1.00 15.55 ? 226 LYS C NZ  1 
ATOM   10686 N N   . GLU C 1 227 ? 60.904  88.817  128.159 1.00 14.29 ? 227 GLU C N   1 
ATOM   10687 C CA  . GLU C 1 227 ? 61.275  89.299  129.490 1.00 14.54 ? 227 GLU C CA  1 
ATOM   10688 C C   . GLU C 1 227 ? 62.801  89.266  129.631 1.00 14.51 ? 227 GLU C C   1 
ATOM   10689 O O   . GLU C 1 227 ? 63.430  90.246  130.040 1.00 13.16 ? 227 GLU C O   1 
ATOM   10690 C CB  . GLU C 1 227 ? 60.615  88.450  130.577 1.00 15.06 ? 227 GLU C CB  1 
ATOM   10691 C CG  . GLU C 1 227 ? 60.999  88.802  132.012 1.00 14.71 ? 227 GLU C CG  1 
ATOM   10692 C CD  . GLU C 1 227 ? 60.412  87.827  133.031 1.00 17.19 ? 227 GLU C CD  1 
ATOM   10693 O OE1 . GLU C 1 227 ? 59.490  88.227  133.762 1.00 17.62 ? 227 GLU C OE1 1 
ATOM   10694 O OE2 . GLU C 1 227 ? 60.845  86.644  133.084 1.00 19.95 ? 227 GLU C OE2 1 
ATOM   10695 N N   . TRP C 1 228 ? 63.385  88.133  129.257 1.00 14.31 ? 228 TRP C N   1 
ATOM   10696 C CA  . TRP C 1 228 ? 64.834  87.944  129.291 1.00 14.13 ? 228 TRP C CA  1 
ATOM   10697 C C   . TRP C 1 228 ? 65.543  88.954  128.390 1.00 14.19 ? 228 TRP C C   1 
ATOM   10698 O O   . TRP C 1 228 ? 66.563  89.531  128.768 1.00 13.88 ? 228 TRP C O   1 
ATOM   10699 C CB  . TRP C 1 228 ? 65.147  86.526  128.844 1.00 14.06 ? 228 TRP C CB  1 
ATOM   10700 C CG  . TRP C 1 228 ? 66.566  86.182  128.527 1.00 13.03 ? 228 TRP C CG  1 
ATOM   10701 C CD1 . TRP C 1 228 ? 67.480  85.642  129.378 1.00 13.34 ? 228 TRP C CD1 1 
ATOM   10702 C CD2 . TRP C 1 228 ? 67.200  86.215  127.229 1.00 12.92 ? 228 TRP C CD2 1 
ATOM   10703 N NE1 . TRP C 1 228 ? 68.656  85.394  128.715 1.00 13.25 ? 228 TRP C NE1 1 
ATOM   10704 C CE2 . TRP C 1 228 ? 68.511  85.737  127.394 1.00 12.09 ? 228 TRP C CE2 1 
ATOM   10705 C CE3 . TRP C 1 228 ? 66.794  86.621  125.956 1.00 13.71 ? 228 TRP C CE3 1 
ATOM   10706 C CZ2 . TRP C 1 228 ? 69.425  85.654  126.338 1.00 12.30 ? 228 TRP C CZ2 1 
ATOM   10707 C CZ3 . TRP C 1 228 ? 67.700  86.536  124.904 1.00 13.01 ? 228 TRP C CZ3 1 
ATOM   10708 C CH2 . TRP C 1 228 ? 69.002  86.057  125.107 1.00 11.94 ? 228 TRP C CH2 1 
ATOM   10709 N N   . PHE C 1 229 ? 64.994  89.164  127.203 1.00 14.01 ? 229 PHE C N   1 
ATOM   10710 C CA  . PHE C 1 229 ? 65.568  90.122  126.274 1.00 14.60 ? 229 PHE C CA  1 
ATOM   10711 C C   . PHE C 1 229 ? 65.540  91.532  126.850 1.00 15.40 ? 229 PHE C C   1 
ATOM   10712 O O   . PHE C 1 229 ? 66.555  92.233  126.857 1.00 15.54 ? 229 PHE C O   1 
ATOM   10713 C CB  . PHE C 1 229 ? 64.809  90.131  124.945 1.00 14.84 ? 229 PHE C CB  1 
ATOM   10714 C CG  . PHE C 1 229 ? 65.277  91.205  124.021 1.00 14.52 ? 229 PHE C CG  1 
ATOM   10715 C CD1 . PHE C 1 229 ? 66.519  91.110  123.416 1.00 14.65 ? 229 PHE C CD1 1 
ATOM   10716 C CD2 . PHE C 1 229 ? 64.521  92.351  123.825 1.00 15.11 ? 229 PHE C CD2 1 
ATOM   10717 C CE1 . PHE C 1 229 ? 66.981  92.122  122.596 1.00 15.48 ? 229 PHE C CE1 1 
ATOM   10718 C CE2 . PHE C 1 229 ? 64.985  93.359  123.003 1.00 15.61 ? 229 PHE C CE2 1 
ATOM   10719 C CZ  . PHE C 1 229 ? 66.210  93.233  122.387 1.00 14.84 ? 229 PHE C CZ  1 
ATOM   10720 N N   . LEU C 1 230 ? 64.387  91.932  127.364 1.00 16.07 ? 230 LEU C N   1 
ATOM   10721 C CA  . LEU C 1 230 ? 64.219  93.284  127.874 1.00 16.69 ? 230 LEU C CA  1 
ATOM   10722 C C   . LEU C 1 230 ? 64.994  93.535  129.156 1.00 17.45 ? 230 LEU C C   1 
ATOM   10723 O O   . LEU C 1 230 ? 65.254  94.692  129.500 1.00 17.33 ? 230 LEU C O   1 
ATOM   10724 C CB  . LEU C 1 230 ? 62.741  93.615  128.074 1.00 16.72 ? 230 LEU C CB  1 
ATOM   10725 C CG  . LEU C 1 230 ? 61.984  93.966  126.798 1.00 17.22 ? 230 LEU C CG  1 
ATOM   10726 C CD1 . LEU C 1 230 ? 60.505  94.073  127.104 1.00 19.29 ? 230 LEU C CD1 1 
ATOM   10727 C CD2 . LEU C 1 230 ? 62.501  95.254  126.163 1.00 19.04 ? 230 LEU C CD2 1 
ATOM   10728 N N   . GLN C 1 231 ? 65.341  92.475  129.876 1.00 18.55 ? 231 GLN C N   1 
ATOM   10729 C CA  . GLN C 1 231 ? 66.172  92.633  131.059 1.00 20.10 ? 231 GLN C CA  1 
ATOM   10730 C C   . GLN C 1 231 ? 67.512  93.225  130.610 1.00 20.54 ? 231 GLN C C   1 
ATOM   10731 O O   . GLN C 1 231 ? 68.122  94.011  131.322 1.00 20.99 ? 231 GLN C O   1 
ATOM   10732 C CB  . GLN C 1 231 ? 66.341  91.305  131.813 1.00 20.68 ? 231 GLN C CB  1 
ATOM   10733 C CG  . GLN C 1 231 ? 65.191  91.055  132.796 1.00 23.45 ? 231 GLN C CG  1 
ATOM   10734 C CD  . GLN C 1 231 ? 65.158  89.653  133.409 1.00 27.90 ? 231 GLN C CD  1 
ATOM   10735 O OE1 . GLN C 1 231 ? 64.206  89.307  134.133 1.00 29.95 ? 231 GLN C OE1 1 
ATOM   10736 N NE2 . GLN C 1 231 ? 66.178  88.846  133.125 1.00 29.40 ? 231 GLN C NE2 1 
ATOM   10737 N N   . ALA C 1 232 ? 67.957  92.876  129.413 1.00 20.71 ? 232 ALA C N   1 
ATOM   10738 C CA  . ALA C 1 232 ? 69.209  93.429  128.897 1.00 21.52 ? 232 ALA C CA  1 
ATOM   10739 C C   . ALA C 1 232 ? 68.989  94.728  128.113 1.00 21.96 ? 232 ALA C C   1 
ATOM   10740 O O   . ALA C 1 232 ? 69.749  95.676  128.266 1.00 21.64 ? 232 ALA C O   1 
ATOM   10741 C CB  . ALA C 1 232 ? 69.936  92.399  128.031 1.00 21.76 ? 232 ALA C CB  1 
ATOM   10742 N N   . ALA C 1 233 ? 67.947  94.778  127.288 1.00 22.04 ? 233 ALA C N   1 
ATOM   10743 C CA  . ALA C 1 233 ? 67.735  95.922  126.406 1.00 22.81 ? 233 ALA C CA  1 
ATOM   10744 C C   . ALA C 1 233 ? 67.029  97.124  127.050 1.00 23.89 ? 233 ALA C C   1 
ATOM   10745 O O   . ALA C 1 233 ? 67.291  98.264  126.682 1.00 22.90 ? 233 ALA C O   1 
ATOM   10746 C CB  . ALA C 1 233 ? 66.969  95.478  125.172 1.00 22.54 ? 233 ALA C CB  1 
ATOM   10747 N N   . LYS C 1 234 ? 66.135  96.851  127.995 1.00 25.07 ? 234 LYS C N   1 
ATOM   10748 C CA  . LYS C 1 234 ? 65.315  97.874  128.657 1.00 26.85 ? 234 LYS C CA  1 
ATOM   10749 C C   . LYS C 1 234 ? 64.264  98.543  127.762 1.00 27.22 ? 234 LYS C C   1 
ATOM   10750 O O   . LYS C 1 234 ? 63.155  98.820  128.210 1.00 29.35 ? 234 LYS C O   1 
ATOM   10751 C CB  . LYS C 1 234 ? 66.163  98.992  129.259 1.00 27.46 ? 234 LYS C CB  1 
ATOM   10752 C CG  . LYS C 1 234 ? 67.439  98.584  129.955 1.00 29.53 ? 234 LYS C CG  1 
ATOM   10753 C CD  . LYS C 1 234 ? 67.274  97.460  130.929 1.00 32.55 ? 234 LYS C CD  1 
ATOM   10754 C CE  . LYS C 1 234 ? 68.573  97.291  131.717 1.00 34.34 ? 234 LYS C CE  1 
ATOM   10755 N NZ  . LYS C 1 234 ? 68.428  96.351  132.871 1.00 36.42 ? 234 LYS C NZ  1 
ATOM   10756 N N   . ASP C 1 235 ? 64.613  98.812  126.515 1.00 27.20 ? 235 ASP C N   1 
ATOM   10757 C CA  . ASP C 1 235 ? 63.755  99.552  125.601 1.00 26.59 ? 235 ASP C CA  1 
ATOM   10758 C C   . ASP C 1 235 ? 62.731  98.691  124.863 1.00 25.61 ? 235 ASP C C   1 
ATOM   10759 O O   . ASP C 1 235 ? 63.089  97.844  124.061 1.00 24.76 ? 235 ASP C O   1 
ATOM   10760 C CB  . ASP C 1 235 ? 64.658  100.282 124.616 1.00 26.86 ? 235 ASP C CB  1 
ATOM   10761 C CG  . ASP C 1 235 ? 63.898  101.077 123.591 1.00 28.46 ? 235 ASP C CG  1 
ATOM   10762 O OD1 . ASP C 1 235 ? 62.676  101.311 123.738 1.00 29.39 ? 235 ASP C OD1 1 
ATOM   10763 O OD2 . ASP C 1 235 ? 64.476  101.526 122.587 1.00 33.74 ? 235 ASP C OD2 1 
ATOM   10764 N N   . PRO C 1 236 ? 61.454  98.945  125.127 1.00 24.96 ? 236 PRO C N   1 
ATOM   10765 C CA  . PRO C 1 236 ? 60.355  98.199  124.509 1.00 24.72 ? 236 PRO C CA  1 
ATOM   10766 C C   . PRO C 1 236 ? 60.402  98.212  122.992 1.00 24.16 ? 236 PRO C C   1 
ATOM   10767 O O   . PRO C 1 236 ? 59.977  97.243  122.351 1.00 23.95 ? 236 PRO C O   1 
ATOM   10768 C CB  . PRO C 1 236 ? 59.110  98.933  125.010 1.00 24.99 ? 236 PRO C CB  1 
ATOM   10769 C CG  . PRO C 1 236 ? 59.539  99.569  126.284 1.00 25.26 ? 236 PRO C CG  1 
ATOM   10770 C CD  . PRO C 1 236 ? 60.962  99.966  126.073 1.00 25.69 ? 236 PRO C CD  1 
ATOM   10771 N N   . SER C 1 237 ? 60.913  99.304  122.428 1.00 23.30 ? 237 SER C N   1 
ATOM   10772 C CA  . SER C 1 237 ? 61.023  99.431  120.990 1.00 23.10 ? 237 SER C CA  1 
ATOM   10773 C C   . SER C 1 237 ? 62.087  98.482  120.420 1.00 22.05 ? 237 SER C C   1 
ATOM   10774 O O   . SER C 1 237 ? 62.048  98.159  119.242 1.00 22.09 ? 237 SER C O   1 
ATOM   10775 C CB  . SER C 1 237 ? 61.325  100.885 120.599 1.00 23.18 ? 237 SER C CB  1 
ATOM   10776 O OG  . SER C 1 237 ? 62.693  101.178 120.832 1.00 25.48 ? 237 SER C OG  1 
ATOM   10777 N N   . ALA C 1 238 ? 63.018  98.013  121.244 1.00 20.80 ? 238 ALA C N   1 
ATOM   10778 C CA  . ALA C 1 238 ? 64.052  97.114  120.747 1.00 20.01 ? 238 ALA C CA  1 
ATOM   10779 C C   . ALA C 1 238 ? 63.511  95.705  120.451 1.00 19.05 ? 238 ALA C C   1 
ATOM   10780 O O   . ALA C 1 238 ? 64.183  94.908  119.812 1.00 17.83 ? 238 ALA C O   1 
ATOM   10781 C CB  . ALA C 1 238 ? 65.206  97.032  121.727 1.00 20.28 ? 238 ALA C CB  1 
ATOM   10782 N N   . VAL C 1 239 ? 62.316  95.396  120.946 1.00 18.21 ? 239 VAL C N   1 
ATOM   10783 C CA  . VAL C 1 239 ? 61.719  94.086  120.700 1.00 17.63 ? 239 VAL C CA  1 
ATOM   10784 C C   . VAL C 1 239 ? 61.511  93.854  119.194 1.00 17.47 ? 239 VAL C C   1 
ATOM   10785 O O   . VAL C 1 239 ? 61.697  92.740  118.693 1.00 16.08 ? 239 VAL C O   1 
ATOM   10786 C CB  . VAL C 1 239 ? 60.390  93.944  121.460 1.00 17.69 ? 239 VAL C CB  1 
ATOM   10787 C CG1 . VAL C 1 239 ? 59.604  92.728  121.007 1.00 17.85 ? 239 VAL C CG1 1 
ATOM   10788 C CG2 . VAL C 1 239 ? 60.653  93.868  122.963 1.00 17.42 ? 239 VAL C CG2 1 
ATOM   10789 N N   . ALA C 1 240 ? 61.155  94.910  118.460 1.00 17.12 ? 240 ALA C N   1 
ATOM   10790 C CA  . ALA C 1 240 ? 60.940  94.780  117.013 1.00 17.10 ? 240 ALA C CA  1 
ATOM   10791 C C   . ALA C 1 240 ? 62.176  94.350  116.216 1.00 17.00 ? 240 ALA C C   1 
ATOM   10792 O O   . ALA C 1 240 ? 62.040  93.864  115.092 1.00 17.41 ? 240 ALA C O   1 
ATOM   10793 C CB  . ALA C 1 240 ? 60.327  96.069  116.425 1.00 17.16 ? 240 ALA C CB  1 
ATOM   10794 N N   . LYS C 1 241 ? 63.368  94.503  116.792 1.00 16.81 ? 241 LYS C N   1 
ATOM   10795 C CA  . LYS C 1 241 ? 64.608  94.093  116.128 1.00 16.84 ? 241 LYS C CA  1 
ATOM   10796 C C   . LYS C 1 241 ? 65.011  92.637  116.410 1.00 16.28 ? 241 LYS C C   1 
ATOM   10797 O O   . LYS C 1 241 ? 65.896  92.082  115.737 1.00 16.12 ? 241 LYS C O   1 
ATOM   10798 C CB  . LYS C 1 241 ? 65.764  94.977  116.602 1.00 17.97 ? 241 LYS C CB  1 
ATOM   10799 C CG  . LYS C 1 241 ? 65.697  96.421  116.145 1.00 20.82 ? 241 LYS C CG  1 
ATOM   10800 C CD  . LYS C 1 241 ? 66.807  96.742  115.171 1.00 26.45 ? 241 LYS C CD  1 
ATOM   10801 C CE  . LYS C 1 241 ? 66.469  96.354  113.729 1.00 27.27 ? 241 LYS C CE  1 
ATOM   10802 N NZ  . LYS C 1 241 ? 67.683  96.264  112.883 1.00 26.12 ? 241 LYS C NZ  1 
ATOM   10803 N N   . HIS C 1 242 ? 64.369  92.019  117.400 1.00 15.25 ? 242 HIS C N   1 
ATOM   10804 C CA  . HIS C 1 242 ? 64.751  90.679  117.831 1.00 15.08 ? 242 HIS C CA  1 
ATOM   10805 C C   . HIS C 1 242 ? 63.622  89.648  117.842 1.00 14.41 ? 242 HIS C C   1 
ATOM   10806 O O   . HIS C 1 242 ? 63.863  88.499  118.159 1.00 14.46 ? 242 HIS C O   1 
ATOM   10807 C CB  . HIS C 1 242 ? 65.376  90.771  119.235 1.00 14.82 ? 242 HIS C CB  1 
ATOM   10808 C CG  . HIS C 1 242 ? 66.689  91.470  119.248 1.00 14.98 ? 242 HIS C CG  1 
ATOM   10809 N ND1 . HIS C 1 242 ? 67.887  90.796  119.158 1.00 13.29 ? 242 HIS C ND1 1 
ATOM   10810 C CD2 . HIS C 1 242 ? 66.995  92.792  119.295 1.00 15.20 ? 242 HIS C CD2 1 
ATOM   10811 C CE1 . HIS C 1 242 ? 68.878  91.673  119.149 1.00 16.03 ? 242 HIS C CE1 1 
ATOM   10812 N NE2 . HIS C 1 242 ? 68.364  92.889  119.237 1.00 15.95 ? 242 HIS C NE2 1 
ATOM   10813 N N   . PHE C 1 243 ? 62.411  90.059  117.469 1.00 14.56 ? 243 PHE C N   1 
ATOM   10814 C CA  . PHE C 1 243 ? 61.258  89.180  117.443 1.00 14.25 ? 243 PHE C CA  1 
ATOM   10815 C C   . PHE C 1 243 ? 60.451  89.344  116.149 1.00 14.10 ? 243 PHE C C   1 
ATOM   10816 O O   . PHE C 1 243 ? 60.098  90.461  115.760 1.00 14.42 ? 243 PHE C O   1 
ATOM   10817 C CB  . PHE C 1 243 ? 60.353  89.471  118.647 1.00 14.35 ? 243 PHE C CB  1 
ATOM   10818 C CG  . PHE C 1 243 ? 60.922  89.016  119.955 1.00 13.52 ? 243 PHE C CG  1 
ATOM   10819 C CD1 . PHE C 1 243 ? 61.913  89.745  120.592 1.00 14.60 ? 243 PHE C CD1 1 
ATOM   10820 C CD2 . PHE C 1 243 ? 60.472  87.854  120.548 1.00 14.20 ? 243 PHE C CD2 1 
ATOM   10821 C CE1 . PHE C 1 243 ? 62.427  89.318  121.801 1.00 14.42 ? 243 PHE C CE1 1 
ATOM   10822 C CE2 . PHE C 1 243 ? 60.988  87.425  121.741 1.00 13.41 ? 243 PHE C CE2 1 
ATOM   10823 C CZ  . PHE C 1 243 ? 61.962  88.154  122.376 1.00 13.94 ? 243 PHE C CZ  1 
ATOM   10824 N N   . VAL C 1 244 ? 60.219  88.230  115.465 1.00 13.16 ? 244 VAL C N   1 
ATOM   10825 C CA  . VAL C 1 244 ? 59.366  88.202  114.292 1.00 13.28 ? 244 VAL C CA  1 
ATOM   10826 C C   . VAL C 1 244 ? 58.290  87.138  114.461 1.00 12.49 ? 244 VAL C C   1 
ATOM   10827 O O   . VAL C 1 244 ? 58.414  86.248  115.304 1.00 11.98 ? 244 VAL C O   1 
ATOM   10828 C CB  . VAL C 1 244 ? 60.177  87.954  113.022 1.00 13.66 ? 244 VAL C CB  1 
ATOM   10829 C CG1 . VAL C 1 244 ? 61.317  88.953  112.958 1.00 15.42 ? 244 VAL C CG1 1 
ATOM   10830 C CG2 . VAL C 1 244 ? 60.708  86.546  112.971 1.00 14.62 ? 244 VAL C CG2 1 
ATOM   10831 N N   . ALA C 1 245 ? 57.236  87.224  113.657 1.00 11.99 ? 245 ALA C N   1 
ATOM   10832 C CA  . ALA C 1 245 ? 56.095  86.320  113.821 1.00 11.95 ? 245 ALA C CA  1 
ATOM   10833 C C   . ALA C 1 245 ? 55.693  85.564  112.567 1.00 12.03 ? 245 ALA C C   1 
ATOM   10834 O O   . ALA C 1 245 ? 55.707  86.125  111.468 1.00 11.66 ? 245 ALA C O   1 
ATOM   10835 C CB  . ALA C 1 245 ? 54.914  87.097  114.314 1.00 12.42 ? 245 ALA C CB  1 
ATOM   10836 N N   . LEU C 1 246 ? 55.342  84.293  112.742 1.00 10.76 ? 246 LEU C N   1 
ATOM   10837 C CA  . LEU C 1 246 ? 54.775  83.507  111.663 1.00 11.40 ? 246 LEU C CA  1 
ATOM   10838 C C   . LEU C 1 246 ? 53.332  83.395  112.109 1.00 12.12 ? 246 LEU C C   1 
ATOM   10839 O O   . LEU C 1 246 ? 52.992  82.570  112.951 1.00 11.33 ? 246 LEU C O   1 
ATOM   10840 C CB  . LEU C 1 246 ? 55.460  82.145  111.528 1.00 11.26 ? 246 LEU C CB  1 
ATOM   10841 C CG  . LEU C 1 246 ? 56.990  82.166  111.670 1.00 12.41 ? 246 LEU C CG  1 
ATOM   10842 C CD1 . LEU C 1 246 ? 57.609  80.760  111.519 1.00 13.12 ? 246 LEU C CD1 1 
ATOM   10843 C CD2 . LEU C 1 246 ? 57.608  83.115  110.669 1.00 12.43 ? 246 LEU C CD2 1 
ATOM   10844 N N   . SER C 1 247 ? 52.489  84.280  111.577 1.00 13.23 ? 247 SER C N   1 
ATOM   10845 C CA  . SER C 1 247 ? 51.131  84.418  112.072 1.00 13.48 ? 247 SER C CA  1 
ATOM   10846 C C   . SER C 1 247 ? 50.284  85.225  111.093 1.00 14.35 ? 247 SER C C   1 
ATOM   10847 O O   . SER C 1 247 ? 50.809  85.721  110.086 1.00 14.20 ? 247 SER C O   1 
ATOM   10848 C CB  . SER C 1 247 ? 51.179  85.141  113.417 1.00 13.97 ? 247 SER C CB  1 
ATOM   10849 O OG  . SER C 1 247 ? 49.909  85.168  114.041 1.00 14.12 ? 247 SER C OG  1 
ATOM   10850 N N   . THR C 1 248 ? 48.979  85.296  111.366 1.00 14.54 ? 248 THR C N   1 
ATOM   10851 C CA  . THR C 1 248 ? 48.078  86.184  110.631 1.00 14.82 ? 248 THR C CA  1 
ATOM   10852 C C   . THR C 1 248 ? 47.351  87.171  111.567 1.00 15.04 ? 248 THR C C   1 
ATOM   10853 O O   . THR C 1 248 ? 46.598  88.024  111.101 1.00 14.79 ? 248 THR C O   1 
ATOM   10854 C CB  . THR C 1 248 ? 47.034  85.398  109.807 1.00 14.70 ? 248 THR C CB  1 
ATOM   10855 O OG1 . THR C 1 248 ? 46.210  84.596  110.664 1.00 15.24 ? 248 THR C OG1 1 
ATOM   10856 C CG2 . THR C 1 248 ? 47.694  84.412  108.850 1.00 14.67 ? 248 THR C CG2 1 
ATOM   10857 N N   . ASN C 1 249 ? 47.599  87.081  112.870 1.00 15.13 ? 249 ASN C N   1 
ATOM   10858 C CA  . ASN C 1 249 ? 46.903  87.920  113.842 1.00 15.75 ? 249 ASN C CA  1 
ATOM   10859 C C   . ASN C 1 249 ? 47.657  89.223  114.038 1.00 16.02 ? 249 ASN C C   1 
ATOM   10860 O O   . ASN C 1 249 ? 48.400  89.391  115.008 1.00 16.35 ? 249 ASN C O   1 
ATOM   10861 C CB  . ASN C 1 249 ? 46.718  87.169  115.166 1.00 15.97 ? 249 ASN C CB  1 
ATOM   10862 C CG  . ASN C 1 249 ? 45.709  87.841  116.100 1.00 17.24 ? 249 ASN C CG  1 
ATOM   10863 O OD1 . ASN C 1 249 ? 45.028  87.167  116.890 1.00 19.45 ? 249 ASN C OD1 1 
ATOM   10864 N ND2 . ASN C 1 249 ? 45.583  89.161  115.991 1.00 16.74 ? 249 ASN C ND2 1 
ATOM   10865 N N   . THR C 1 250 ? 47.468  90.135  113.090 1.00 15.80 ? 250 THR C N   1 
ATOM   10866 C CA  . THR C 1 250 ? 48.160  91.415  113.081 1.00 16.62 ? 250 THR C CA  1 
ATOM   10867 C C   . THR C 1 250 ? 48.112  92.175  114.406 1.00 16.35 ? 250 THR C C   1 
ATOM   10868 O O   . THR C 1 250 ? 49.111  92.703  114.866 1.00 17.01 ? 250 THR C O   1 
ATOM   10869 C CB  . THR C 1 250 ? 47.555  92.325  111.988 1.00 16.83 ? 250 THR C CB  1 
ATOM   10870 O OG1 . THR C 1 250 ? 47.378  91.589  110.770 1.00 17.95 ? 250 THR C OG1 1 
ATOM   10871 C CG2 . THR C 1 250 ? 48.520  93.452  111.638 1.00 17.38 ? 250 THR C CG2 1 
ATOM   10872 N N   . THR C 1 251 ? 46.938  92.238  114.996 1.00 17.45 ? 251 THR C N   1 
ATOM   10873 C CA  . THR C 1 251 ? 46.731  93.000  116.228 1.00 17.67 ? 251 THR C CA  1 
ATOM   10874 C C   . THR C 1 251 ? 47.549  92.447  117.394 1.00 17.77 ? 251 THR C C   1 
ATOM   10875 O O   . THR C 1 251 ? 48.243  93.194  118.087 1.00 18.20 ? 251 THR C O   1 
ATOM   10876 C CB  . THR C 1 251 ? 45.240  92.982  116.549 1.00 17.93 ? 251 THR C CB  1 
ATOM   10877 O OG1 . THR C 1 251 ? 44.547  93.752  115.558 1.00 19.53 ? 251 THR C OG1 1 
ATOM   10878 C CG2 . THR C 1 251 ? 44.940  93.694  117.875 1.00 18.00 ? 251 THR C CG2 1 
ATOM   10879 N N   . LYS C 1 252 ? 47.472  91.141  117.604 1.00 17.81 ? 252 LYS C N   1 
ATOM   10880 C CA  . LYS C 1 252 ? 48.214  90.504  118.701 1.00 18.56 ? 252 LYS C CA  1 
ATOM   10881 C C   . LYS C 1 252 ? 49.712  90.574  118.474 1.00 17.62 ? 252 LYS C C   1 
ATOM   10882 O O   . LYS C 1 252 ? 50.486  90.745  119.408 1.00 17.64 ? 252 LYS C O   1 
ATOM   10883 C CB  . LYS C 1 252 ? 47.790  89.049  118.871 1.00 18.65 ? 252 LYS C CB  1 
ATOM   10884 C CG  . LYS C 1 252 ? 46.408  88.873  119.466 1.00 21.42 ? 252 LYS C CG  1 
ATOM   10885 C CD  . LYS C 1 252 ? 46.305  89.477  120.844 1.00 25.66 ? 252 LYS C CD  1 
ATOM   10886 C CE  . LYS C 1 252 ? 45.012  89.056  121.528 1.00 28.06 ? 252 LYS C CE  1 
ATOM   10887 N NZ  . LYS C 1 252 ? 44.886  89.734  122.837 1.00 30.79 ? 252 LYS C NZ  1 
ATOM   10888 N N   . VAL C 1 253 ? 50.121  90.437  117.225 1.00 17.30 ? 253 VAL C N   1 
ATOM   10889 C CA  . VAL C 1 253 ? 51.522  90.545  116.883 1.00 17.20 ? 253 VAL C CA  1 
ATOM   10890 C C   . VAL C 1 253 ? 52.020  91.934  117.256 1.00 17.43 ? 253 VAL C C   1 
ATOM   10891 O O   . VAL C 1 253 ? 52.979  92.080  118.009 1.00 16.69 ? 253 VAL C O   1 
ATOM   10892 C CB  . VAL C 1 253 ? 51.756  90.223  115.405 1.00 17.32 ? 253 VAL C CB  1 
ATOM   10893 C CG1 . VAL C 1 253 ? 53.132  90.686  114.951 1.00 16.89 ? 253 VAL C CG1 1 
ATOM   10894 C CG2 . VAL C 1 253 ? 51.606  88.723  115.194 1.00 17.58 ? 253 VAL C CG2 1 
ATOM   10895 N N   . LYS C 1 254 ? 51.327  92.959  116.779 1.00 18.40 ? 254 LYS C N   1 
ATOM   10896 C CA  . LYS C 1 254 ? 51.702  94.328  117.098 1.00 19.15 ? 254 LYS C CA  1 
ATOM   10897 C C   . LYS C 1 254 ? 51.707  94.557  118.601 1.00 19.17 ? 254 LYS C C   1 
ATOM   10898 O O   . LYS C 1 254 ? 52.625  95.157  119.135 1.00 18.98 ? 254 LYS C O   1 
ATOM   10899 C CB  . LYS C 1 254 ? 50.777  95.340  116.393 1.00 19.82 ? 254 LYS C CB  1 
ATOM   10900 C CG  . LYS C 1 254 ? 50.836  96.725  117.003 1.00 22.82 ? 254 LYS C CG  1 
ATOM   10901 C CD  . LYS C 1 254 ? 51.033  97.814  115.964 1.00 28.51 ? 254 LYS C CD  1 
ATOM   10902 C CE  . LYS C 1 254 ? 49.707  98.389  115.469 1.00 31.13 ? 254 LYS C CE  1 
ATOM   10903 N NZ  . LYS C 1 254 ? 49.809  99.870  115.302 1.00 33.08 ? 254 LYS C NZ  1 
ATOM   10904 N N   . GLU C 1 255 ? 50.704  94.046  119.294 1.00 20.01 ? 255 GLU C N   1 
ATOM   10905 C CA  . GLU C 1 255 ? 50.601  94.267  120.740 1.00 20.56 ? 255 GLU C CA  1 
ATOM   10906 C C   . GLU C 1 255 ? 51.771  93.645  121.503 1.00 20.18 ? 255 GLU C C   1 
ATOM   10907 O O   . GLU C 1 255 ? 52.210  94.173  122.533 1.00 19.46 ? 255 GLU C O   1 
ATOM   10908 C CB  . GLU C 1 255 ? 49.261  93.775  121.259 1.00 20.82 ? 255 GLU C CB  1 
ATOM   10909 C CG  . GLU C 1 255 ? 48.148  94.737  120.891 1.00 23.47 ? 255 GLU C CG  1 
ATOM   10910 C CD  . GLU C 1 255 ? 46.756  94.207  121.196 1.00 26.84 ? 255 GLU C CD  1 
ATOM   10911 O OE1 . GLU C 1 255 ? 45.798  95.017  121.148 1.00 27.10 ? 255 GLU C OE1 1 
ATOM   10912 O OE2 . GLU C 1 255 ? 46.624  92.994  121.474 1.00 27.91 ? 255 GLU C OE2 1 
ATOM   10913 N N   . PHE C 1 256 ? 52.304  92.548  120.967 1.00 19.74 ? 256 PHE C N   1 
ATOM   10914 C CA  . PHE C 1 256 ? 53.463  91.887  121.555 1.00 18.81 ? 256 PHE C CA  1 
ATOM   10915 C C   . PHE C 1 256 ? 54.725  92.736  121.452 1.00 18.84 ? 256 PHE C C   1 
ATOM   10916 O O   . PHE C 1 256 ? 55.664  92.577  122.241 1.00 18.49 ? 256 PHE C O   1 
ATOM   10917 C CB  . PHE C 1 256 ? 53.693  90.541  120.869 1.00 19.06 ? 256 PHE C CB  1 
ATOM   10918 C CG  . PHE C 1 256 ? 54.786  89.702  121.499 1.00 17.63 ? 256 PHE C CG  1 
ATOM   10919 C CD1 . PHE C 1 256 ? 54.480  88.718  122.431 1.00 18.29 ? 256 PHE C CD1 1 
ATOM   10920 C CD2 . PHE C 1 256 ? 56.100  89.873  121.133 1.00 16.70 ? 256 PHE C CD2 1 
ATOM   10921 C CE1 . PHE C 1 256 ? 55.491  87.933  122.992 1.00 18.60 ? 256 PHE C CE1 1 
ATOM   10922 C CE2 . PHE C 1 256 ? 57.110  89.087  121.693 1.00 16.90 ? 256 PHE C CE2 1 
ATOM   10923 C CZ  . PHE C 1 256 ? 56.804  88.126  122.618 1.00 16.02 ? 256 PHE C CZ  1 
ATOM   10924 N N   . GLY C 1 257 ? 54.763  93.625  120.470 1.00 19.28 ? 257 GLY C N   1 
ATOM   10925 C CA  . GLY C 1 257 ? 55.919  94.491  120.268 1.00 19.28 ? 257 GLY C CA  1 
ATOM   10926 C C   . GLY C 1 257 ? 56.632  94.196  118.960 1.00 19.17 ? 257 GLY C C   1 
ATOM   10927 O O   . GLY C 1 257 ? 57.676  94.773  118.663 1.00 18.92 ? 257 GLY C O   1 
ATOM   10928 N N   . ILE C 1 258 ? 56.068  93.278  118.180 1.00 19.26 ? 258 ILE C N   1 
ATOM   10929 C CA  . ILE C 1 258 ? 56.617  92.928  116.886 1.00 19.76 ? 258 ILE C CA  1 
ATOM   10930 C C   . ILE C 1 258 ? 56.099  93.913  115.837 1.00 20.63 ? 258 ILE C C   1 
ATOM   10931 O O   . ILE C 1 258 ? 54.935  94.313  115.864 1.00 21.24 ? 258 ILE C O   1 
ATOM   10932 C CB  . ILE C 1 258 ? 56.228  91.476  116.521 1.00 19.40 ? 258 ILE C CB  1 
ATOM   10933 C CG1 . ILE C 1 258 ? 56.991  90.496  117.422 1.00 18.57 ? 258 ILE C CG1 1 
ATOM   10934 C CG2 . ILE C 1 258 ? 56.499  91.174  115.040 1.00 18.93 ? 258 ILE C CG2 1 
ATOM   10935 C CD1 . ILE C 1 258 ? 56.400  89.115  117.462 1.00 17.26 ? 258 ILE C CD1 1 
ATOM   10936 N N   . ASP C 1 259 ? 56.974  94.314  114.935 1.00 21.90 ? 259 ASP C N   1 
ATOM   10937 C CA  . ASP C 1 259 ? 56.593  95.168  113.814 1.00 23.26 ? 259 ASP C CA  1 
ATOM   10938 C C   . ASP C 1 259 ? 55.829  94.286  112.842 1.00 24.18 ? 259 ASP C C   1 
ATOM   10939 O O   . ASP C 1 259 ? 56.401  93.347  112.307 1.00 24.34 ? 259 ASP C O   1 
ATOM   10940 C CB  . ASP C 1 259 ? 57.862  95.712  113.164 1.00 23.23 ? 259 ASP C CB  1 
ATOM   10941 C CG  . ASP C 1 259 ? 57.591  96.510  111.920 1.00 25.10 ? 259 ASP C CG  1 
ATOM   10942 O OD1 . ASP C 1 259 ? 56.416  96.590  111.481 1.00 25.13 ? 259 ASP C OD1 1 
ATOM   10943 O OD2 . ASP C 1 259 ? 58.525  97.078  111.317 1.00 26.70 ? 259 ASP C OD2 1 
ATOM   10944 N N   . PRO C 1 260 ? 54.543  94.575  112.629 1.00 25.78 ? 260 PRO C N   1 
ATOM   10945 C CA  . PRO C 1 260 ? 53.678  93.766  111.756 1.00 26.17 ? 260 PRO C CA  1 
ATOM   10946 C C   . PRO C 1 260 ? 54.224  93.576  110.349 1.00 26.45 ? 260 PRO C C   1 
ATOM   10947 O O   . PRO C 1 260 ? 53.808  92.649  109.639 1.00 26.71 ? 260 PRO C O   1 
ATOM   10948 C CB  . PRO C 1 260 ? 52.369  94.555  111.692 1.00 26.62 ? 260 PRO C CB  1 
ATOM   10949 C CG  . PRO C 1 260 ? 52.445  95.613  112.712 1.00 26.92 ? 260 PRO C CG  1 
ATOM   10950 C CD  . PRO C 1 260 ? 53.827  95.712  113.231 1.00 26.12 ? 260 PRO C CD  1 
ATOM   10951 N N   . GLN C 1 261 ? 55.128  94.455  109.941 1.00 25.94 ? 261 GLN C N   1 
ATOM   10952 C CA  . GLN C 1 261 ? 55.818  94.279  108.679 1.00 26.03 ? 261 GLN C CA  1 
ATOM   10953 C C   . GLN C 1 261 ? 56.589  92.954  108.706 1.00 24.53 ? 261 GLN C C   1 
ATOM   10954 O O   . GLN C 1 261 ? 56.889  92.386  107.653 1.00 24.53 ? 261 GLN C O   1 
ATOM   10955 C CB  . GLN C 1 261 ? 56.757  95.460  108.416 1.00 26.87 ? 261 GLN C CB  1 
ATOM   10956 C CG  . GLN C 1 261 ? 58.159  95.079  107.951 1.00 30.18 ? 261 GLN C CG  1 
ATOM   10957 C CD  . GLN C 1 261 ? 59.197  96.159  108.235 1.00 34.68 ? 261 GLN C CD  1 
ATOM   10958 O OE1 . GLN C 1 261 ? 58.861  97.355  108.373 1.00 38.36 ? 261 GLN C OE1 1 
ATOM   10959 N NE2 . GLN C 1 261 ? 60.467  95.744  108.328 1.00 36.85 ? 261 GLN C NE2 1 
ATOM   10960 N N   . ASN C 1 262 ? 56.914  92.465  109.901 1.00 22.08 ? 262 ASN C N   1 
ATOM   10961 C CA  . ASN C 1 262 ? 57.627  91.193  110.030 1.00 20.73 ? 262 ASN C CA  1 
ATOM   10962 C C   . ASN C 1 262 ? 56.728  90.042  110.507 1.00 19.64 ? 262 ASN C C   1 
ATOM   10963 O O   . ASN C 1 262 ? 57.129  89.214  111.337 1.00 19.71 ? 262 ASN C O   1 
ATOM   10964 C CB  . ASN C 1 262 ? 58.838  91.352  110.958 1.00 20.43 ? 262 ASN C CB  1 
ATOM   10965 C CG  . ASN C 1 262 ? 59.701  92.525  110.579 1.00 20.13 ? 262 ASN C CG  1 
ATOM   10966 O OD1 . ASN C 1 262 ? 60.073  92.677  109.421 1.00 19.73 ? 262 ASN C OD1 1 
ATOM   10967 N ND2 . ASN C 1 262 ? 60.003  93.382  111.550 1.00 18.76 ? 262 ASN C ND2 1 
ATOM   10968 N N   . MET C 1 263 ? 55.505  90.019  109.989 1.00 18.77 ? 263 MET C N   1 
ATOM   10969 C CA  . MET C 1 263 ? 54.563  88.951  110.244 1.00 17.77 ? 263 MET C CA  1 
ATOM   10970 C C   . MET C 1 263 ? 54.495  88.188  108.933 1.00 17.59 ? 263 MET C C   1 
ATOM   10971 O O   . MET C 1 263 ? 54.037  88.726  107.924 1.00 16.11 ? 263 MET C O   1 
ATOM   10972 C CB  . MET C 1 263 ? 53.182  89.490  110.618 1.00 18.26 ? 263 MET C CB  1 
ATOM   10973 C CG  . MET C 1 263 ? 52.202  88.415  111.012 1.00 17.42 ? 263 MET C CG  1 
ATOM   10974 S SD  . MET C 1 263 ? 50.582  88.996  111.546 1.00 17.43 ? 263 MET C SD  1 
ATOM   10975 C CE  . MET C 1 263 ? 49.865  89.584  109.970 1.00 18.36 ? 263 MET C CE  1 
ATOM   10976 N N   . PHE C 1 264 ? 54.987  86.953  108.954 1.00 16.68 ? 264 PHE C N   1 
ATOM   10977 C CA  . PHE C 1 264 ? 55.013  86.092  107.780 1.00 16.64 ? 264 PHE C CA  1 
ATOM   10978 C C   . PHE C 1 264 ? 53.767  85.230  107.805 1.00 16.29 ? 264 PHE C C   1 
ATOM   10979 O O   . PHE C 1 264 ? 53.596  84.414  108.697 1.00 15.00 ? 264 PHE C O   1 
ATOM   10980 C CB  . PHE C 1 264 ? 56.298  85.266  107.789 1.00 16.17 ? 264 PHE C CB  1 
ATOM   10981 C CG  . PHE C 1 264 ? 57.533  86.114  107.806 1.00 17.10 ? 264 PHE C CG  1 
ATOM   10982 C CD1 . PHE C 1 264 ? 57.976  86.693  108.978 1.00 16.59 ? 264 PHE C CD1 1 
ATOM   10983 C CD2 . PHE C 1 264 ? 58.226  86.385  106.630 1.00 17.60 ? 264 PHE C CD2 1 
ATOM   10984 C CE1 . PHE C 1 264 ? 59.095  87.500  108.991 1.00 17.02 ? 264 PHE C CE1 1 
ATOM   10985 C CE2 . PHE C 1 264 ? 59.354  87.199  106.639 1.00 17.03 ? 264 PHE C CE2 1 
ATOM   10986 C CZ  . PHE C 1 264 ? 59.788  87.755  107.814 1.00 17.43 ? 264 PHE C CZ  1 
ATOM   10987 N N   . GLU C 1 265 ? 52.897  85.409  106.809 1.00 15.99 ? 265 GLU C N   1 
ATOM   10988 C CA  . GLU C 1 265 ? 51.576  84.797  106.834 1.00 16.83 ? 265 GLU C CA  1 
ATOM   10989 C C   . GLU C 1 265 ? 51.448  83.428  106.164 1.00 16.25 ? 265 GLU C C   1 
ATOM   10990 O O   . GLU C 1 265 ? 52.246  83.062  105.328 1.00 16.13 ? 265 GLU C O   1 
ATOM   10991 C CB  . GLU C 1 265 ? 50.558  85.787  106.214 1.00 17.21 ? 265 GLU C CB  1 
ATOM   10992 C CG  . GLU C 1 265 ? 50.323  86.979  107.120 1.00 20.04 ? 265 GLU C CG  1 
ATOM   10993 C CD  . GLU C 1 265 ? 49.237  87.919  106.630 1.00 23.08 ? 265 GLU C CD  1 
ATOM   10994 O OE1 . GLU C 1 265 ? 49.586  89.023  106.190 1.00 27.58 ? 265 GLU C OE1 1 
ATOM   10995 O OE2 . GLU C 1 265 ? 48.046  87.565  106.721 1.00 25.83 ? 265 GLU C OE2 1 
ATOM   10996 N N   . PHE C 1 266 ? 50.437  82.684  106.591 1.00 16.89 ? 266 PHE C N   1 
ATOM   10997 C CA  . PHE C 1 266 ? 50.020  81.441  105.964 1.00 16.84 ? 266 PHE C CA  1 
ATOM   10998 C C   . PHE C 1 266 ? 48.488  81.400  106.039 1.00 17.81 ? 266 PHE C C   1 
ATOM   10999 O O   . PHE C 1 266 ? 47.859  82.351  106.530 1.00 18.25 ? 266 PHE C O   1 
ATOM   11000 C CB  . PHE C 1 266 ? 50.729  80.183  106.503 1.00 17.09 ? 266 PHE C CB  1 
ATOM   11001 C CG  . PHE C 1 266 ? 50.723  80.025  108.002 1.00 15.89 ? 266 PHE C CG  1 
ATOM   11002 C CD1 . PHE C 1 266 ? 49.974  79.020  108.600 1.00 16.94 ? 266 PHE C CD1 1 
ATOM   11003 C CD2 . PHE C 1 266 ? 51.546  80.798  108.798 1.00 15.42 ? 266 PHE C CD2 1 
ATOM   11004 C CE1 . PHE C 1 266 ? 49.999  78.833  109.986 1.00 18.46 ? 266 PHE C CE1 1 
ATOM   11005 C CE2 . PHE C 1 266 ? 51.571  80.628  110.174 1.00 16.02 ? 266 PHE C CE2 1 
ATOM   11006 C CZ  . PHE C 1 266 ? 50.813  79.636  110.771 1.00 16.84 ? 266 PHE C CZ  1 
ATOM   11007 N N   . TRP C 1 267 ? 47.886  80.329  105.541 1.00 17.95 ? 267 TRP C N   1 
ATOM   11008 C CA  . TRP C 1 267 ? 46.436  80.282  105.346 1.00 18.02 ? 267 TRP C CA  1 
ATOM   11009 C C   . TRP C 1 267 ? 45.758  79.111  106.015 1.00 18.05 ? 267 TRP C C   1 
ATOM   11010 O O   . TRP C 1 267 ? 46.417  78.183  106.467 1.00 16.68 ? 267 TRP C O   1 
ATOM   11011 C CB  . TRP C 1 267 ? 46.169  80.310  103.838 1.00 18.33 ? 267 TRP C CB  1 
ATOM   11012 C CG  . TRP C 1 267 ? 46.916  81.443  103.274 1.00 18.44 ? 267 TRP C CG  1 
ATOM   11013 C CD1 . TRP C 1 267 ? 46.491  82.742  103.193 1.00 20.45 ? 267 TRP C CD1 1 
ATOM   11014 C CD2 . TRP C 1 267 ? 48.271  81.439  102.815 1.00 18.44 ? 267 TRP C CD2 1 
ATOM   11015 N NE1 . TRP C 1 267 ? 47.490  83.533  102.679 1.00 19.51 ? 267 TRP C NE1 1 
ATOM   11016 C CE2 . TRP C 1 267 ? 48.591  82.755  102.433 1.00 18.30 ? 267 TRP C CE2 1 
ATOM   11017 C CE3 . TRP C 1 267 ? 49.248  80.447  102.663 1.00 18.13 ? 267 TRP C CE3 1 
ATOM   11018 C CZ2 . TRP C 1 267 ? 49.842  83.107  101.924 1.00 18.97 ? 267 TRP C CZ2 1 
ATOM   11019 C CZ3 . TRP C 1 267 ? 50.489  80.802  102.156 1.00 16.65 ? 267 TRP C CZ3 1 
ATOM   11020 C CH2 . TRP C 1 267 ? 50.773  82.117  101.795 1.00 18.40 ? 267 TRP C CH2 1 
ATOM   11021 N N   . ASP C 1 268 ? 44.424  79.146  106.062 1.00 18.70 ? 268 ASP C N   1 
ATOM   11022 C CA  . ASP C 1 268 ? 43.687  78.109  106.766 1.00 18.76 ? 268 ASP C CA  1 
ATOM   11023 C C   . ASP C 1 268 ? 43.741  76.767  106.056 1.00 18.17 ? 268 ASP C C   1 
ATOM   11024 O O   . ASP C 1 268 ? 43.409  75.744  106.644 1.00 18.06 ? 268 ASP C O   1 
ATOM   11025 C CB  . ASP C 1 268 ? 42.253  78.556  107.148 1.00 19.24 ? 268 ASP C CB  1 
ATOM   11026 C CG  . ASP C 1 268 ? 41.351  78.815  105.952 1.00 21.46 ? 268 ASP C CG  1 
ATOM   11027 O OD1 . ASP C 1 268 ? 41.726  78.500  104.787 1.00 21.82 ? 268 ASP C OD1 1 
ATOM   11028 O OD2 . ASP C 1 268 ? 40.220  79.352  106.105 1.00 22.55 ? 268 ASP C OD2 1 
ATOM   11029 N N   . TRP C 1 269 ? 44.222  76.761  104.815 1.00 16.76 ? 269 TRP C N   1 
ATOM   11030 C CA  . TRP C 1 269 ? 44.401  75.513  104.085 1.00 16.27 ? 269 TRP C CA  1 
ATOM   11031 C C   . TRP C 1 269 ? 45.815  74.929  104.239 1.00 15.23 ? 269 TRP C C   1 
ATOM   11032 O O   . TRP C 1 269 ? 46.197  74.003  103.524 1.00 15.22 ? 269 TRP C O   1 
ATOM   11033 C CB  . TRP C 1 269 ? 44.065  75.665  102.603 1.00 16.08 ? 269 TRP C CB  1 
ATOM   11034 C CG  . TRP C 1 269 ? 44.450  76.963  101.946 1.00 17.23 ? 269 TRP C CG  1 
ATOM   11035 C CD1 . TRP C 1 269 ? 43.618  78.004  101.679 1.00 18.36 ? 269 TRP C CD1 1 
ATOM   11036 C CD2 . TRP C 1 269 ? 45.731  77.330  101.416 1.00 18.81 ? 269 TRP C CD2 1 
ATOM   11037 N NE1 . TRP C 1 269 ? 44.298  79.001  101.024 1.00 19.47 ? 269 TRP C NE1 1 
ATOM   11038 C CE2 . TRP C 1 269 ? 45.600  78.613  100.852 1.00 18.54 ? 269 TRP C CE2 1 
ATOM   11039 C CE3 . TRP C 1 269 ? 46.985  76.712  101.375 1.00 17.59 ? 269 TRP C CE3 1 
ATOM   11040 C CZ2 . TRP C 1 269 ? 46.660  79.286  100.266 1.00 18.16 ? 269 TRP C CZ2 1 
ATOM   11041 C CZ3 . TRP C 1 269 ? 48.035  77.378  100.774 1.00 18.87 ? 269 TRP C CZ3 1 
ATOM   11042 C CH2 . TRP C 1 269 ? 47.866  78.649  100.225 1.00 19.31 ? 269 TRP C CH2 1 
ATOM   11043 N N   . VAL C 1 270 ? 46.582  75.498  105.159 1.00 14.35 ? 270 VAL C N   1 
ATOM   11044 C CA  . VAL C 1 270 ? 47.879  74.964  105.534 1.00 13.69 ? 270 VAL C CA  1 
ATOM   11045 C C   . VAL C 1 270 ? 47.721  74.368  106.929 1.00 13.91 ? 270 VAL C C   1 
ATOM   11046 O O   . VAL C 1 270 ? 47.565  75.103  107.921 1.00 13.71 ? 270 VAL C O   1 
ATOM   11047 C CB  . VAL C 1 270 ? 48.947  76.047  105.611 1.00 13.71 ? 270 VAL C CB  1 
ATOM   11048 C CG1 . VAL C 1 270 ? 50.277  75.451  106.067 1.00 14.11 ? 270 VAL C CG1 1 
ATOM   11049 C CG2 . VAL C 1 270 ? 49.080  76.791  104.270 1.00 13.78 ? 270 VAL C CG2 1 
ATOM   11050 N N   . GLY C 1 271 ? 47.730  73.051  107.009 1.00 13.42 ? 271 GLY C N   1 
ATOM   11051 C CA  . GLY C 1 271 ? 47.653  72.374  108.287 1.00 13.58 ? 271 GLY C CA  1 
ATOM   11052 C C   . GLY C 1 271 ? 49.004  72.464  108.965 1.00 13.04 ? 271 GLY C C   1 
ATOM   11053 O O   . GLY C 1 271 ? 50.049  72.403  108.303 1.00 12.19 ? 271 GLY C O   1 
ATOM   11054 N N   . GLY C 1 272 ? 48.985  72.609  110.283 1.00 12.79 ? 272 GLY C N   1 
ATOM   11055 C CA  . GLY C 1 272 ? 50.212  72.697  111.054 1.00 12.48 ? 272 GLY C CA  1 
ATOM   11056 C C   . GLY C 1 272 ? 51.195  71.585  110.767 1.00 12.08 ? 272 GLY C C   1 
ATOM   11057 O O   . GLY C 1 272 ? 52.400  71.833  110.590 1.00 12.33 ? 272 GLY C O   1 
ATOM   11058 N N   . ARG C 1 273 ? 50.690  70.357  110.717 1.00 11.58 ? 273 ARG C N   1 
ATOM   11059 C CA  . ARG C 1 273 ? 51.551  69.198  110.494 1.00 11.05 ? 273 ARG C CA  1 
ATOM   11060 C C   . ARG C 1 273 ? 51.937  69.033  109.025 1.00 11.00 ? 273 ARG C C   1 
ATOM   11061 O O   . ARG C 1 273 ? 52.625  68.079  108.653 1.00 10.45 ? 273 ARG C O   1 
ATOM   11062 C CB  . ARG C 1 273 ? 50.932  67.926  111.075 1.00 11.56 ? 273 ARG C CB  1 
ATOM   11063 C CG  . ARG C 1 273 ? 49.601  67.491  110.476 1.00 13.00 ? 273 ARG C CG  1 
ATOM   11064 C CD  . ARG C 1 273 ? 48.860  66.456  111.336 1.00 13.81 ? 273 ARG C CD  1 
ATOM   11065 N NE  . ARG C 1 273 ? 47.521  66.247  110.814 1.00 13.51 ? 273 ARG C NE  1 
ATOM   11066 C CZ  . ARG C 1 273 ? 46.426  66.832  111.282 1.00 13.90 ? 273 ARG C CZ  1 
ATOM   11067 N NH1 . ARG C 1 273 ? 46.481  67.626  112.347 1.00 14.30 ? 273 ARG C NH1 1 
ATOM   11068 N NH2 . ARG C 1 273 ? 45.250  66.581  110.699 1.00 15.17 ? 273 ARG C NH2 1 
ATOM   11069 N N   . TYR C 1 274 ? 51.519  69.995  108.208 1.00 10.64 ? 274 TYR C N   1 
ATOM   11070 C CA  . TYR C 1 274 ? 51.876  70.056  106.797 1.00 10.54 ? 274 TYR C CA  1 
ATOM   11071 C C   . TYR C 1 274 ? 52.364  71.456  106.473 1.00 10.63 ? 274 TYR C C   1 
ATOM   11072 O O   . TYR C 1 274 ? 52.293  71.880  105.312 1.00 11.40 ? 274 TYR C O   1 
ATOM   11073 C CB  . TYR C 1 274 ? 50.658  69.783  105.929 1.00 10.19 ? 274 TYR C CB  1 
ATOM   11074 C CG  . TYR C 1 274 ? 50.093  68.412  106.097 1.00 10.74 ? 274 TYR C CG  1 
ATOM   11075 C CD1 . TYR C 1 274 ? 48.975  68.199  106.876 1.00 10.98 ? 274 TYR C CD1 1 
ATOM   11076 C CD2 . TYR C 1 274 ? 50.649  67.338  105.454 1.00 10.16 ? 274 TYR C CD2 1 
ATOM   11077 C CE1 . TYR C 1 274 ? 48.446  66.963  107.027 1.00 9.51  ? 274 TYR C CE1 1 
ATOM   11078 C CE2 . TYR C 1 274 ? 50.127  66.074  105.609 1.00 10.72 ? 274 TYR C CE2 1 
ATOM   11079 C CZ  . TYR C 1 274 ? 49.028  65.892  106.407 1.00 9.65  ? 274 TYR C CZ  1 
ATOM   11080 O OH  . TYR C 1 274 ? 48.472  64.635  106.561 1.00 10.21 ? 274 TYR C OH  1 
ATOM   11081 N N   . SER C 1 275 ? 52.874  72.160  107.481 1.00 10.37 ? 275 SER C N   1 
ATOM   11082 C CA  . SER C 1 275 ? 53.194  73.572  107.341 1.00 10.17 ? 275 SER C CA  1 
ATOM   11083 C C   . SER C 1 275 ? 54.659  73.937  107.122 1.00 9.84  ? 275 SER C C   1 
ATOM   11084 O O   . SER C 1 275 ? 54.945  75.103  106.870 1.00 9.94  ? 275 SER C O   1 
ATOM   11085 C CB  . SER C 1 275 ? 52.670  74.344  108.562 1.00 10.50 ? 275 SER C CB  1 
ATOM   11086 O OG  . SER C 1 275 ? 53.421  74.053  109.730 1.00 12.05 ? 275 SER C OG  1 
ATOM   11087 N N   . LEU C 1 276 ? 55.592  72.990  107.187 1.00 10.07 ? 276 LEU C N   1 
ATOM   11088 C CA  . LEU C 1 276 ? 57.016  73.362  107.066 1.00 10.27 ? 276 LEU C CA  1 
ATOM   11089 C C   . LEU C 1 276 ? 57.353  73.996  105.721 1.00 10.29 ? 276 LEU C C   1 
ATOM   11090 O O   . LEU C 1 276 ? 58.354  74.696  105.591 1.00 10.44 ? 276 LEU C O   1 
ATOM   11091 C CB  . LEU C 1 276 ? 57.955  72.196  107.361 1.00 10.42 ? 276 LEU C CB  1 
ATOM   11092 C CG  . LEU C 1 276 ? 58.025  71.054  106.347 1.00 10.66 ? 276 LEU C CG  1 
ATOM   11093 C CD1 . LEU C 1 276 ? 59.029  71.385  105.233 1.00 8.77  ? 276 LEU C CD1 1 
ATOM   11094 C CD2 . LEU C 1 276 ? 58.416  69.786  107.045 1.00 10.32 ? 276 LEU C CD2 1 
ATOM   11095 N N   . TRP C 1 277 ? 56.479  73.802  104.745 1.00 10.52 ? 277 TRP C N   1 
ATOM   11096 C CA  . TRP C 1 277 ? 56.687  74.324  103.404 1.00 10.46 ? 277 TRP C CA  1 
ATOM   11097 C C   . TRP C 1 277 ? 56.283  75.792  103.281 1.00 10.90 ? 277 TRP C C   1 
ATOM   11098 O O   . TRP C 1 277 ? 56.566  76.406  102.266 1.00 10.50 ? 277 TRP C O   1 
ATOM   11099 C CB  . TRP C 1 277 ? 55.860  73.515  102.414 1.00 10.81 ? 277 TRP C CB  1 
ATOM   11100 C CG  . TRP C 1 277 ? 55.850  72.062  102.725 1.00 9.13  ? 277 TRP C CG  1 
ATOM   11101 C CD1 . TRP C 1 277 ? 54.901  71.384  103.409 1.00 10.32 ? 277 TRP C CD1 1 
ATOM   11102 C CD2 . TRP C 1 277 ? 56.852  71.117  102.382 1.00 9.02  ? 277 TRP C CD2 1 
ATOM   11103 N NE1 . TRP C 1 277 ? 55.233  70.057  103.502 1.00 10.11 ? 277 TRP C NE1 1 
ATOM   11104 C CE2 . TRP C 1 277 ? 56.438  69.867  102.881 1.00 7.76  ? 277 TRP C CE2 1 
ATOM   11105 C CE3 . TRP C 1 277 ? 58.059  71.191  101.689 1.00 8.51  ? 277 TRP C CE3 1 
ATOM   11106 C CZ2 . TRP C 1 277 ? 57.189  68.708  102.712 1.00 8.70  ? 277 TRP C CZ2 1 
ATOM   11107 C CZ3 . TRP C 1 277 ? 58.803  70.036  101.512 1.00 7.80  ? 277 TRP C CZ3 1 
ATOM   11108 C CH2 . TRP C 1 277 ? 58.362  68.809  102.025 1.00 7.32  ? 277 TRP C CH2 1 
ATOM   11109 N N   . SER C 1 278 ? 55.599  76.325  104.300 1.00 10.45 ? 278 SER C N   1 
ATOM   11110 C CA  . SER C 1 278 ? 55.086  77.690  104.289 1.00 10.95 ? 278 SER C CA  1 
ATOM   11111 C C   . SER C 1 278 ? 56.003  78.606  105.074 1.00 10.73 ? 278 SER C C   1 
ATOM   11112 O O   . SER C 1 278 ? 57.158  78.289  105.292 1.00 10.99 ? 278 SER C O   1 
ATOM   11113 C CB  . SER C 1 278 ? 53.701  77.727  104.942 1.00 11.03 ? 278 SER C CB  1 
ATOM   11114 O OG  . SER C 1 278 ? 53.824  77.454  106.333 1.00 12.17 ? 278 SER C OG  1 
ATOM   11115 N N   . ALA C 1 279 ? 55.480  79.754  105.484 1.00 10.70 ? 279 ALA C N   1 
ATOM   11116 C CA  . ALA C 1 279 ? 56.206  80.653  106.373 1.00 10.91 ? 279 ALA C CA  1 
ATOM   11117 C C   . ALA C 1 279 ? 56.750  79.930  107.595 1.00 11.10 ? 279 ALA C C   1 
ATOM   11118 O O   . ALA C 1 279 ? 57.753  80.330  108.147 1.00 10.90 ? 279 ALA C O   1 
ATOM   11119 C CB  . ALA C 1 279 ? 55.282  81.779  106.837 1.00 11.10 ? 279 ALA C CB  1 
ATOM   11120 N N   . ILE C 1 280 ? 56.045  78.906  108.056 1.00 12.13 ? 280 ILE C N   1 
ATOM   11121 C CA  . ILE C 1 280 ? 56.484  78.157  109.231 1.00 12.19 ? 280 ILE C CA  1 
ATOM   11122 C C   . ILE C 1 280 ? 57.911  77.621  109.044 1.00 12.32 ? 280 ILE C C   1 
ATOM   11123 O O   . ILE C 1 280 ? 58.633  77.402  110.009 1.00 11.92 ? 280 ILE C O   1 
ATOM   11124 C CB  . ILE C 1 280 ? 55.476  77.031  109.538 1.00 12.62 ? 280 ILE C CB  1 
ATOM   11125 C CG1 . ILE C 1 280 ? 54.164  77.619  110.082 1.00 13.15 ? 280 ILE C CG1 1 
ATOM   11126 C CG2 . ILE C 1 280 ? 56.054  76.020  110.522 1.00 11.77 ? 280 ILE C CG2 1 
ATOM   11127 C CD1 . ILE C 1 280 ? 54.303  78.364  111.380 1.00 14.45 ? 280 ILE C CD1 1 
ATOM   11128 N N   . GLY C 1 281 ? 58.336  77.464  107.794 1.00 12.44 ? 281 GLY C N   1 
ATOM   11129 C CA  . GLY C 1 281 ? 59.681  77.015  107.515 1.00 12.12 ? 281 GLY C CA  1 
ATOM   11130 C C   . GLY C 1 281 ? 60.744  78.095  107.551 1.00 12.28 ? 281 GLY C C   1 
ATOM   11131 O O   . GLY C 1 281 ? 61.890  77.814  107.217 1.00 12.30 ? 281 GLY C O   1 
ATOM   11132 N N   . LEU C 1 282 ? 60.395  79.309  107.985 1.00 12.38 ? 282 LEU C N   1 
ATOM   11133 C CA  . LEU C 1 282 ? 61.344  80.418  107.945 1.00 12.32 ? 282 LEU C CA  1 
ATOM   11134 C C   . LEU C 1 282 ? 62.674  80.045  108.588 1.00 12.30 ? 282 LEU C C   1 
ATOM   11135 O O   . LEU C 1 282 ? 63.706  80.357  108.038 1.00 11.25 ? 282 LEU C O   1 
ATOM   11136 C CB  . LEU C 1 282 ? 60.775  81.698  108.572 1.00 12.58 ? 282 LEU C CB  1 
ATOM   11137 C CG  . LEU C 1 282 ? 61.652  82.952  108.447 1.00 12.90 ? 282 LEU C CG  1 
ATOM   11138 C CD1 . LEU C 1 282 ? 61.799  83.397  106.998 1.00 13.41 ? 282 LEU C CD1 1 
ATOM   11139 C CD2 . LEU C 1 282 ? 61.082  84.070  109.263 1.00 13.18 ? 282 LEU C CD2 1 
ATOM   11140 N N   . SER C 1 283 ? 62.657  79.365  109.739 1.00 12.57 ? 283 SER C N   1 
ATOM   11141 C CA  . SER C 1 283 ? 63.908  78.947  110.391 1.00 12.23 ? 283 SER C CA  1 
ATOM   11142 C C   . SER C 1 283 ? 64.771  78.021  109.525 1.00 12.84 ? 283 SER C C   1 
ATOM   11143 O O   . SER C 1 283 ? 66.018  78.042  109.615 1.00 12.50 ? 283 SER C O   1 
ATOM   11144 C CB  . SER C 1 283 ? 63.633  78.286  111.743 1.00 12.91 ? 283 SER C CB  1 
ATOM   11145 O OG  . SER C 1 283 ? 62.893  77.075  111.636 1.00 12.36 ? 283 SER C OG  1 
ATOM   11146 N N   . ILE C 1 284 ? 64.127  77.194  108.705 1.00 11.98 ? 284 ILE C N   1 
ATOM   11147 C CA  . ILE C 1 284 ? 64.880  76.351  107.782 1.00 12.03 ? 284 ILE C CA  1 
ATOM   11148 C C   . ILE C 1 284 ? 65.605  77.236  106.765 1.00 12.45 ? 284 ILE C C   1 
ATOM   11149 O O   . ILE C 1 284 ? 66.799  77.081  106.538 1.00 12.66 ? 284 ILE C O   1 
ATOM   11150 C CB  . ILE C 1 284 ? 63.962  75.396  107.010 1.00 11.74 ? 284 ILE C CB  1 
ATOM   11151 C CG1 . ILE C 1 284 ? 63.225  74.448  107.960 1.00 11.89 ? 284 ILE C CG1 1 
ATOM   11152 C CG2 . ILE C 1 284 ? 64.766  74.592  106.001 1.00 12.52 ? 284 ILE C CG2 1 
ATOM   11153 C CD1 . ILE C 1 284 ? 62.026  73.786  107.324 1.00 11.36 ? 284 ILE C CD1 1 
ATOM   11154 N N   . ALA C 1 285 ? 64.864  78.152  106.147 1.00 12.25 ? 285 ALA C N   1 
ATOM   11155 C CA  . ALA C 1 285 ? 65.441  79.057  105.148 1.00 13.04 ? 285 ALA C CA  1 
ATOM   11156 C C   . ALA C 1 285 ? 66.549  79.905  105.756 1.00 13.41 ? 285 ALA C C   1 
ATOM   11157 O O   . ALA C 1 285 ? 67.592  80.131  105.119 1.00 13.74 ? 285 ALA C O   1 
ATOM   11158 C CB  . ALA C 1 285 ? 64.371  79.934  104.549 1.00 13.32 ? 285 ALA C CB  1 
ATOM   11159 N N   . LEU C 1 286 ? 66.346  80.356  106.989 1.00 13.69 ? 286 LEU C N   1 
ATOM   11160 C CA  . LEU C 1 286 ? 67.389  81.110  107.678 1.00 13.84 ? 286 LEU C CA  1 
ATOM   11161 C C   . LEU C 1 286 ? 68.671  80.307  107.871 1.00 13.66 ? 286 LEU C C   1 
ATOM   11162 O O   . LEU C 1 286 ? 69.762  80.842  107.694 1.00 13.89 ? 286 LEU C O   1 
ATOM   11163 C CB  . LEU C 1 286 ? 66.910  81.629  109.041 1.00 13.69 ? 286 LEU C CB  1 
ATOM   11164 C CG  . LEU C 1 286 ? 66.040  82.887  108.967 1.00 15.28 ? 286 LEU C CG  1 
ATOM   11165 C CD1 . LEU C 1 286 ? 65.235  83.126  110.246 1.00 16.43 ? 286 LEU C CD1 1 
ATOM   11166 C CD2 . LEU C 1 286 ? 66.881  84.121  108.626 1.00 16.14 ? 286 LEU C CD2 1 
ATOM   11167 N N   . HIS C 1 287 ? 68.547  79.030  108.229 1.00 13.42 ? 287 HIS C N   1 
ATOM   11168 C CA  . HIS C 1 287 ? 69.703  78.190  108.554 1.00 13.31 ? 287 HIS C CA  1 
ATOM   11169 C C   . HIS C 1 287 ? 70.486  77.683  107.348 1.00 13.69 ? 287 HIS C C   1 
ATOM   11170 O O   . HIS C 1 287 ? 71.723  77.747  107.329 1.00 13.49 ? 287 HIS C O   1 
ATOM   11171 C CB  . HIS C 1 287 ? 69.220  76.988  109.358 1.00 13.23 ? 287 HIS C CB  1 
ATOM   11172 C CG  . HIS C 1 287 ? 70.302  76.226  110.046 1.00 12.66 ? 287 HIS C CG  1 
ATOM   11173 N ND1 . HIS C 1 287 ? 70.370  74.852  110.007 1.00 14.34 ? 287 HIS C ND1 1 
ATOM   11174 C CD2 . HIS C 1 287 ? 71.309  76.627  110.855 1.00 10.75 ? 287 HIS C CD2 1 
ATOM   11175 C CE1 . HIS C 1 287 ? 71.384  74.443  110.743 1.00 11.21 ? 287 HIS C CE1 1 
ATOM   11176 N NE2 . HIS C 1 287 ? 71.979  75.500  111.255 1.00 15.24 ? 287 HIS C NE2 1 
ATOM   11177 N N   . VAL C 1 288 ? 69.774  77.152  106.363 1.00 14.15 ? 288 VAL C N   1 
ATOM   11178 C CA  . VAL C 1 288 ? 70.415  76.620  105.162 1.00 14.80 ? 288 VAL C CA  1 
ATOM   11179 C C   . VAL C 1 288 ? 70.330  77.554  103.957 1.00 14.71 ? 288 VAL C C   1 
ATOM   11180 O O   . VAL C 1 288 ? 70.859  77.239  102.906 1.00 15.47 ? 288 VAL C O   1 
ATOM   11181 C CB  . VAL C 1 288 ? 69.856  75.212  104.756 1.00 14.66 ? 288 VAL C CB  1 
ATOM   11182 C CG1 . VAL C 1 288 ? 70.010  74.235  105.884 1.00 17.16 ? 288 VAL C CG1 1 
ATOM   11183 C CG2 . VAL C 1 288 ? 68.403  75.286  104.329 1.00 16.01 ? 288 VAL C CG2 1 
ATOM   11184 N N   . GLY C 1 289 ? 69.641  78.680  104.077 1.00 15.31 ? 289 GLY C N   1 
ATOM   11185 C CA  . GLY C 1 289 ? 69.557  79.623  102.962 1.00 15.47 ? 289 GLY C CA  1 
ATOM   11186 C C   . GLY C 1 289 ? 68.299  79.426  102.135 1.00 15.83 ? 289 GLY C C   1 
ATOM   11187 O O   . GLY C 1 289 ? 67.773  78.315  102.030 1.00 15.05 ? 289 GLY C O   1 
ATOM   11188 N N   . PHE C 1 290 ? 67.813  80.499  101.528 1.00 16.10 ? 290 PHE C N   1 
ATOM   11189 C CA  . PHE C 1 290 ? 66.582  80.399  100.751 1.00 16.53 ? 290 PHE C CA  1 
ATOM   11190 C C   . PHE C 1 290 ? 66.706  79.503  99.513  1.00 17.13 ? 290 PHE C C   1 
ATOM   11191 O O   . PHE C 1 290 ? 65.737  78.843  99.131  1.00 17.04 ? 290 PHE C O   1 
ATOM   11192 C CB  . PHE C 1 290 ? 66.064  81.777  100.348 1.00 16.56 ? 290 PHE C CB  1 
ATOM   11193 C CG  . PHE C 1 290 ? 64.652  81.757  99.906  1.00 17.14 ? 290 PHE C CG  1 
ATOM   11194 C CD1 . PHE C 1 290 ? 63.624  81.645  100.839 1.00 18.04 ? 290 PHE C CD1 1 
ATOM   11195 C CD2 . PHE C 1 290 ? 64.334  81.808  98.563  1.00 18.20 ? 290 PHE C CD2 1 
ATOM   11196 C CE1 . PHE C 1 290 ? 62.308  81.592  100.425 1.00 18.91 ? 290 PHE C CE1 1 
ATOM   11197 C CE2 . PHE C 1 290 ? 63.033  81.764  98.156  1.00 18.58 ? 290 PHE C CE2 1 
ATOM   11198 C CZ  . PHE C 1 290 ? 62.013  81.661  99.091  1.00 18.72 ? 290 PHE C CZ  1 
ATOM   11199 N N   . ASP C 1 291 ? 67.876  79.500  98.880  1.00 17.40 ? 291 ASP C N   1 
ATOM   11200 C CA  . ASP C 1 291 ? 68.109  78.651  97.708  1.00 17.77 ? 291 ASP C CA  1 
ATOM   11201 C C   . ASP C 1 291 ? 67.870  77.184  98.091  1.00 16.52 ? 291 ASP C C   1 
ATOM   11202 O O   . ASP C 1 291 ? 67.197  76.454  97.370  1.00 15.48 ? 291 ASP C O   1 
ATOM   11203 C CB  . ASP C 1 291 ? 69.541  78.811  97.171  1.00 18.59 ? 291 ASP C CB  1 
ATOM   11204 C CG  . ASP C 1 291 ? 69.759  80.123  96.428  1.00 23.45 ? 291 ASP C CG  1 
ATOM   11205 O OD1 . ASP C 1 291 ? 68.866  81.001  96.447  1.00 28.66 ? 291 ASP C OD1 1 
ATOM   11206 O OD2 . ASP C 1 291 ? 70.812  80.365  95.787  1.00 28.78 ? 291 ASP C OD2 1 
ATOM   11207 N N   . ASN C 1 292 ? 68.445  76.756  99.211  1.00 15.16 ? 292 ASN C N   1 
ATOM   11208 C CA  . ASN C 1 292 ? 68.226  75.387  99.690  1.00 14.81 ? 292 ASN C CA  1 
ATOM   11209 C C   . ASN C 1 292 ? 66.764  75.139  100.101 1.00 14.55 ? 292 ASN C C   1 
ATOM   11210 O O   . ASN C 1 292 ? 66.247  74.050  99.888  1.00 1