data_1JJ2
# 
_entry.id   1JJ2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.386 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1JJ2         pdb_00001jj2 10.2210/pdb1jj2/pdb 
NDB   RR0033       ?            ?                   
RCSB  RCSB013829   ?            ?                   
WWPDB D_1000013829 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-08-01 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2024-02-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp_atom         
2 4 'Structure model' chem_comp_bond         
3 4 'Structure model' database_2             
4 4 'Structure model' pdbx_struct_conn_angle 
5 4 'Structure model' struct_conn            
6 4 'Structure model' struct_ref_seq_dif     
7 4 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                        
2  4 'Structure model' '_database_2.pdbx_database_accession'         
3  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id'  
4  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
5  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_asym_id'  
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id'  
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 
15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 
16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id'  
17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
23 4 'Structure model' '_pdbx_struct_conn_angle.value'               
24 4 'Structure model' '_struct_conn.pdbx_dist_value'                
25 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
26 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
27 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
28 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
29 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
30 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
31 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
32 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
33 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
34 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
35 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
36 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
37 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
38 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
39 4 'Structure model' '_struct_ref_seq_dif.details'                 
40 4 'Structure model' '_struct_site.pdbx_auth_asym_id'              
41 4 'Structure model' '_struct_site.pdbx_auth_comp_id'              
42 4 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JJ2 
_pdbx_database_status.recvd_initial_deposition_date   2001-07-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1FFK 'THE COMPLETE ATOMIC STRUCTURE OF THE LARGE RIBOSOMAL SUBUNIT AT 2.4 A RESOLUTION'               unspecified 
PDB 1C04 'PLACEMENT OF PROTEIN AND RNA STRUCTURES INTO A 5 A-RESOLUTION MAP OF THE 50S RIBOSOMAL SUBUNIT' unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Klein, D.J.'    1 
'Schmeing, T.M.' 2 
'Moore, P.B.'    3 
'Steitz, T.A.'   4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The kink-turn: a new RNA secondary structure motif.'                                              'EMBO J.'         20 
4214 4221 2001 EMJODG UK 0261-4189 0897 ? 11483524 10.1093/emboj/20.15.4214 
1       'The Fully Refined Crystal Structure of the H. marismortui 50S Subunit at 2.4 Angstrom Resolution' 'To be published' ?  ? 
?    ?    ?      ?  ?         0353 ? ?        ?                        
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Klein, D.J.'    1  ? 
primary 'Schmeing, T.M.' 2  ? 
primary 'Moore, P.B.'    3  ? 
primary 'Steitz, T.A.'   4  ? 
1       'Klein, D.J.'    5  ? 
1       'Schmeing, T.M.' 6  ? 
1       'Nissen, P.'     7  ? 
1       'Ban, N.'        8  ? 
1       'Moore, P.B.'    9  ? 
1       'Steitz, T.A.'   10 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat '23S RRNA'                946034.375 1    ? ? ? ? 
2  polymer     nat '5S RRNA'                 39318.414  1    ? ? ? ? 
3  polymer     nat 'RIBOSOMAL PROTEIN L2'    25237.475  1    ? ? ? ? 
4  polymer     nat 'RIBOSOMAL PROTEIN L3'    37265.195  1    ? ? ? ? 
5  polymer     nat 'RIBOSOMAL PROTEIN L4'    26442.098  1    ? ? ? ? 
6  polymer     nat 'RIBOSOMAL PROTEIN L5'    19420.498  1    ? ? ? ? 
7  polymer     nat 'RIBOSOMAL PROTEIN L6'    19830.523  1    ? ? ? ? 
8  polymer     nat 'RIBOSOMAL PROTEIN L7AE'  12600.822  1    ? ? ? ? 
9  polymer     nat 'RIBOSOMAL PROTEIN L10'   37213.805  1    ? ? ? ? 
10 polymer     nat 'RIBOSOMAL PROTEIN L10E'  18022.527  1    ? ? ? ? 
11 polymer     nat 'RIBOSOMAL PROTEIN L13'   16249.214  1    ? ? ? ? 
12 polymer     nat 'RIBOSOMAL PROTEIN L14'   14216.233  1    ? ? ? ? 
13 polymer     nat 'RIBOSOMAL PROTEIN L15'   17874.172  1    ? ? ? ? 
14 polymer     nat 'RIBOSOMAL PROTEIN L15E'  22856.566  1    ? ? ? ? 
15 polymer     nat 'RIBOSOMAL PROTEIN L18'   20509.740  1    ? ? ? ? 
16 polymer     nat 'RIBOSOMAL PROTEIN L18E'  12307.720  1    ? ? ? ? 
17 polymer     nat 'RIBOSOMAL PROTEIN L19E'  16631.322  1    ? ? ? ? 
18 polymer     nat 'RIBOSOMAL PROTEIN L21E'  10436.604  1    ? ? ? ? 
19 polymer     nat 'RIBOSOMAL PROTEIN L22'   16835.746  1    ? ? ? ? 
20 polymer     nat 'RIBOSOMAL PROTEIN L23'   9481.340   1    ? ? ? ? 
21 polymer     nat 'RIBOSOMAL PROTEIN L24'   13539.759  1    ? ? ? ? 
22 polymer     nat 'RIBOSOMAL PROTEIN L24E'  7233.720   1    ? ? ? ? 
23 polymer     nat 'RIBOSOMAL PROTEIN L29'   7758.667   1    ? ? ? ? 
24 polymer     nat 'RIBOSOMAL PROTEIN L30'   17062.885  1    ? ? ? ? 
25 polymer     nat 'RIBOSOMAL PROTEIN L31E'  10253.417  1    ? ? ? ? 
26 polymer     nat 'RIBOSOMAL PROTEIN L32E'  26324.531  1    ? ? ? ? 
27 polymer     nat 'RIBOSOMAL PROTEIN L37Ae' 8097.830   1    ? ? ? ? 
28 polymer     nat 'RIBOSOMAL PROTEIN L37E'  6199.007   1    ? ? ? ? 
29 polymer     nat 'RIBOSOMAL PROTEIN L39E'  5844.700   1    ? ? ? ? 
30 polymer     nat 'RIBOSOMAL PROTEIN L44E'  10815.245  1    ? ? ? ? 
31 non-polymer syn 'MAGNESIUM ION'           24.305     117  ? ? ? ? 
32 non-polymer syn 'POTASSIUM ION'           39.098     2    ? ? ? ? 
33 non-polymer syn 'SODIUM ION'              22.990     86   ? ? ? ? 
34 non-polymer syn 'CHLORIDE ION'            35.453     22   ? ? ? ? 
35 non-polymer syn 'CADMIUM ION'             112.411    5    ? ? ? ? 
36 water       nat water                     18.015     7893 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3  '50S RIBOSOMAL PROTEIN L2P, HMAL2, HL4'          
4  '50S RIBOSOMAL PROTEIN L3P, HMAL3, HL1'          
5  '50S RIBOSOMAL PROTEIN L4E, HMAL4, HL6'          
6  '50S RIBOSOMAL PROTEIN L5P, HMAL5, HL13'         
7  '50S RIBOSOMAL PROTEIN L6P, HMAL6, HL10'         
8  '50S RIBOSOMAL PROTEIN HS6'                      
9  '50S RIBOSOMAL PROTEIN P0, HMAL10, L10E'         
11 '50S RIBOSOMAL PROTEIN L13P, HMAL13'             
12 '50S RIBOSOMAL PROTEIN L14P, HMAL14, HL27'       
13 '50S RIBOSOMAL PROTEIN L15P, HMAL15, HL9'        
15 '50S RIBOSOMAL PROTEIN L18P, HMAL18, HL12'       
16 '50S RIBOSOMAL PROTEIN L18E, HL29, L19'          
17 '50S RIBOSOMAL PROTEIN L19E, HMAL19, HL24'       
18 '50S RIBOSOMAL PROTEIN L21E, HL31'               
19 '50S RIBOSOMAL PROTEIN L22P, HMAL22, HL23'       
20 '50S RIBOSOMAL PROTEIN L23P, HMAL23, HL25, L21'  
21 '50S RIBOSOMAL PROTEIN L24P, HMAL24, HL16, HL15' 
22 '50S RIBOSOMAL PROTEIN L24E, HL21/HL22'          
23 '50S RIBOSOMAL PROTEIN L29P, HMAL29, HL33'       
24 '50S RIBOSOMAL PROTEIN L30P, HMAL30, HL20, HL16' 
25 '50S RIBOSOMAL PROTEIN L31E, L34, HL30'          
26 '50S RIBOSOMAL PROTEIN L32E, HL5'                
28 '50S RIBOSOMAL PROTEIN L37E, L35E'               
29 '50S RIBOSOMAL PROTEINS L39E, HL39E, HL46E'      
30 '50S RIBOSOMAL PROTEIN L44E, LA, HLA'            
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide no no 
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
0 ? 
2  polyribonucleotide no no 
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
9 ? 
3  'polypeptide(L)'   no no 
;GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDEL
QVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVG
GGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
;GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDEL
QVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVG
GGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
A ? 
4  'polypeptide(L)'   no no 
;PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMR
AVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPD
VMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLG
PWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQ
PRLDPEVRYVSNESNQG
;
;PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMR
AVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPD
VMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLG
PWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQ
PRLDPEVRYVSNESNQG
;
B ? 
5  'polypeptide(L)'   no no 
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
C ? 
6  'polypeptide(L)'   no no 
;SSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMA
EEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPA
DAVAFIESTYDVEVSE
;
;SSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMA
EEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPA
DAVAFIESTYDVEVSE
;
D ? 
7  'polypeptide(L)'   no no 
;PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGW
EYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVR
VFQDGVYITRKPNRGDA
;
;PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGW
EYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVR
VFQDGVYITRKPNRGDA
;
E ? 
8  'polypeptide(L)'   no no 
;PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQ
DDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
;
;PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQ
DDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
;
F ? 
9  'polypeptide(L)'   no no 
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
G ? 
10 'polypeptide(L)'   no no 
;KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHNALEAARVAANRYVQNSGAAAN
YKFRIRKFPFHVIRENKAAAAAAAAAAADGMRAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINID
SSPAGNA
;
;KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHNALEAARVAANRYVQNSGAAAN
YKFRIRKFPFHVIRENKAAAAAAAAAAADGMRAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINID
SSPAGNA
;
H ? 
11 'polypeptide(L)'   no no 
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
I ? 
12 'polypeptide(L)'   no no 
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
J ? 
13 'polypeptide(L)'   no no 
;TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADD
VAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDAD
ADEE
;
;TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADD
VAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDAD
ADEE
;
K ? 
14 'polypeptide(L)'   no no 
;ARSAYSYIREAWKRPKEGQIAELMWHRMQEWRNEPAVVRIERPTRLDRARSLGYKAKQGIIVVRVAIRKGSSRRTRFNKG
RRSKRMMVNRITRKKNIQRIAEERANRKFPNLRVLNSYSVGEDGRHKWHEVILIDPDHPAIKSDDQLSWISRTRHRLRTF
RGLTSAGRRCRGLRGQGKGSEKVRPSLRVNGAKA
;
;ARSAYSYIREAWKRPKEGQIAELMWHRMQEWRNEPAVVRIERPTRLDRARSLGYKAKQGIIVVRVAIRKGSSRRTRFNKG
RRSKRMMVNRITRKKNIQRIAEERANRKFPNLRVLNSYSVGEDGRHKWHEVILIDPDHPAIKSDDQLSWISRTRHRLRTF
RGLTSAGRRCRGLRGQGKGSEKVRPSLRVNGAKA
;
L ? 
15 'polypeptide(L)'   no no 
;ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPS
AYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYS
GDFDAADLPEHFDELRETLLDGDIEL
;
;ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPS
AYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYS
GDFDAADLPEHFDELRETLLDGDIEL
;
M ? 
16 'polypeptide(L)'   no no 
;SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVD
FSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
;SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVD
FSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
N ? 
17 'polypeptide(L)'   no no 
;TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSR
KGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
;TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSR
KGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
O ? 
18 'polypeptide(L)'   no no 
;PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGK
EKTIIVTAAHLRRQE
;
;PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGK
EKTIIVTAAHLRRQE
;
P ? 
19 'polypeptide(L)'   no no 
;GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRY
PEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
;GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRY
PEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
Q ? 
20 'polypeptide(L)'   no no 
;SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASR
IGVF
;
;SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASR
IGVF
;
R ? 
21 'polypeptide(L)'   no no 
;SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLE
KTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
;SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLE
KTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
S ? 
22 'polypeptide(L)'   no no PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 
PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA T ? 
23 'polypeptide(L)'   no no TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE U ? 
24 'polypeptide(L)'   no no 
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
V ? 
25 'polypeptide(L)'   no no 
;SASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEE
GEAIVEAETAE
;
;SASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEE
GEAIVEAETAE
;
W ? 
26 'polypeptide(L)'   no no 
;ADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAEV
EEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGK
GDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVSE
;
;ADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAEV
EEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGK
GDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVSE
;
X ? 
27 'polypeptide(L)'   no no RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA 
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA Y ? 
28 'polypeptide(L)'   no no TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE Z ? 
29 'polypeptide(L)'   no no GKKSKATKKRLAKLDNQNSRVPAWVMLKTDEVQRNHKRRHWRRNDTDE GKKSKATKKRLAKLDNQNSRVPAWVMLKTDEVQRNHKRRHWRRNDTDE 1 ? 
30 'polypeptide(L)'   no no 
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
2 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
31 'MAGNESIUM ION' MG  
32 'POTASSIUM ION' K   
33 'SODIUM ION'    NA  
34 'CHLORIDE ION'  CL  
35 'CADMIUM ION'   CD  
36 water           HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    U   n 
1  2    U   n 
1  3    G   n 
1  4    G   n 
1  5    C   n 
1  6    U   n 
1  7    A   n 
1  8    C   n 
1  9    U   n 
1  10   A   n 
1  11   U   n 
1  12   G   n 
1  13   C   n 
1  14   C   n 
1  15   A   n 
1  16   G   n 
1  17   C   n 
1  18   U   n 
1  19   G   n 
1  20   G   n 
1  21   U   n 
1  22   G   n 
1  23   G   n 
1  24   A   n 
1  25   U   n 
1  26   U   n 
1  27   G   n 
1  28   C   n 
1  29   U   n 
1  30   C   n 
1  31   G   n 
1  32   G   n 
1  33   C   n 
1  34   U   n 
1  35   C   n 
1  36   A   n 
1  37   G   n 
1  38   G   n 
1  39   C   n 
1  40   G   n 
1  41   C   n 
1  42   U   n 
1  43   G   n 
1  44   A   n 
1  45   U   n 
1  46   G   n 
1  47   A   n 
1  48   A   n 
1  49   G   n 
1  50   G   n 
1  51   A   n 
1  52   C   n 
1  53   G   n 
1  54   U   n 
1  55   G   n 
1  56   C   n 
1  57   C   n 
1  58   A   n 
1  59   A   n 
1  60   G   n 
1  61   C   n 
1  62   U   n 
1  63   G   n 
1  64   C   n 
1  65   G   n 
1  66   A   n 
1  67   U   n 
1  68   A   n 
1  69   A   n 
1  70   G   n 
1  71   C   n 
1  72   C   n 
1  73   A   n 
1  74   U   n 
1  75   G   n 
1  76   G   n 
1  77   G   n 
1  78   G   n 
1  79   A   n 
1  80   G   n 
1  81   C   n 
1  82   C   n 
1  83   G   n 
1  84   C   n 
1  85   A   n 
1  86   C   n 
1  87   G   n 
1  88   G   n 
1  89   A   n 
1  90   G   n 
1  91   G   n 
1  92   C   n 
1  93   G   n 
1  94   A   n 
1  95   A   n 
1  96   G   n 
1  97   A   n 
1  98   A   n 
1  99   C   n 
1  100  C   n 
1  101  A   n 
1  102  U   n 
1  103  G   n 
1  104  G   n 
1  105  A   n 
1  106  U   n 
1  107  U   n 
1  108  U   n 
1  109  C   n 
1  110  C   n 
1  111  G   n 
1  112  A   n 
1  113  A   n 
1  114  U   n 
1  115  G   n 
1  116  A   n 
1  117  G   n 
1  118  A   n 
1  119  A   n 
1  120  U   n 
1  121  C   n 
1  122  U   n 
1  123  C   n 
1  124  U   n 
1  125  C   n 
1  126  U   n 
1  127  A   n 
1  128  A   n 
1  129  C   n 
1  130  A   n 
1  131  A   n 
1  132  U   n 
1  133  U   n 
1  134  G   n 
1  135  C   n 
1  136  U   n 
1  137  U   n 
1  138  C   n 
1  139  G   n 
1  140  C   n 
1  141  G   n 
1  142  C   n 
1  143  A   n 
1  144  A   n 
1  145  U   n 
1  146  G   n 
1  147  A   n 
1  148  G   n 
1  149  G   n 
1  150  A   n 
1  151  A   n 
1  152  C   n 
1  153  C   n 
1  154  C   n 
1  155  C   n 
1  156  G   n 
1  157  A   n 
1  158  G   n 
1  159  A   n 
1  160  A   n 
1  161  C   n 
1  162  U   n 
1  163  G   n 
1  164  A   n 
1  165  A   n 
1  166  A   n 
1  167  C   n 
1  168  A   n 
1  169  U   n 
1  170  C   n 
1  171  U   n 
1  172  C   n 
1  173  A   n 
1  174  G   n 
1  175  U   n 
1  176  A   n 
1  177  U   n 
1  178  C   n 
1  179  G   n 
1  180  G   n 
1  181  G   n 
1  182  A   n 
1  183  G   n 
1  184  G   n 
1  185  A   n 
1  186  A   n 
1  187  C   n 
1  188  A   n 
1  189  G   n 
1  190  A   n 
1  191  A   n 
1  192  A   n 
1  193  A   n 
1  194  C   n 
1  195  G   n 
1  196  C   n 
1  197  A   n 
1  198  A   n 
1  199  U   n 
1  200  G   n 
1  201  U   n 
1  202  G   n 
1  203  A   n 
1  204  U   n 
1  205  G   n 
1  206  U   n 
1  207  C   n 
1  208  G   n 
1  209  U   n 
1  210  U   n 
1  211  A   n 
1  212  G   n 
1  213  U   n 
1  214  A   n 
1  215  A   n 
1  216  C   n 
1  217  C   n 
1  218  G   n 
1  219  C   n 
1  220  G   n 
1  221  A   n 
1  222  G   n 
1  223  U   n 
1  224  G   n 
1  225  A   n 
1  226  A   n 
1  227  C   n 
1  228  G   n 
1  229  C   n 
1  230  G   n 
1  231  A   n 
1  232  U   n 
1  233  A   n 
1  234  C   n 
1  235  A   n 
1  236  G   n 
1  237  C   n 
1  238  C   n 
1  239  C   n 
1  240  A   n 
1  241  A   n 
1  242  A   n 
1  243  C   n 
1  244  C   n 
1  245  G   n 
1  246  A   n 
1  247  A   n 
1  248  G   n 
1  249  C   n 
1  250  C   n 
1  251  C   n 
1  252  U   n 
1  253  C   n 
1  254  A   n 
1  255  C   n 
1  256  G   n 
1  257  G   n 
1  258  G   n 
1  259  C   n 
1  260  A   n 
1  261  A   n 
1  262  U   n 
1  263  G   n 
1  264  U   n 
1  265  G   n 
1  266  G   n 
1  267  U   n 
1  268  G   n 
1  269  U   n 
1  270  C   n 
1  271  A   n 
1  272  G   n 
1  273  G   n 
1  274  G   n 
1  275  C   n 
1  276  U   n 
1  277  A   n 
1  278  C   n 
1  279  C   n 
1  280  U   n 
1  281  C   n 
1  282  U   n 
1  283  C   n 
1  284  A   n 
1  285  U   n 
1  286  C   n 
1  287  A   n 
1  288  G   n 
1  289  C   n 
1  290  C   n 
1  291  G   n 
1  292  A   n 
1  293  C   n 
1  294  C   n 
1  295  G   n 
1  296  U   n 
1  297  C   n 
1  298  U   n 
1  299  C   n 
1  300  G   n 
1  301  A   n 
1  302  C   n 
1  303  G   n 
1  304  A   n 
1  305  A   n 
1  306  G   n 
1  307  U   n 
1  308  C   n 
1  309  U   n 
1  310  C   n 
1  311  U   n 
1  312  U   n 
1  313  G   n 
1  314  G   n 
1  315  A   n 
1  316  A   n 
1  317  C   n 
1  318  A   n 
1  319  G   n 
1  320  A   n 
1  321  G   n 
1  322  C   n 
1  323  G   n 
1  324  U   n 
1  325  G   n 
1  326  A   n 
1  327  U   n 
1  328  A   n 
1  329  C   n 
1  330  A   n 
1  331  G   n 
1  332  G   n 
1  333  G   n 
1  334  U   n 
1  335  G   n 
1  336  A   n 
1  337  C   n 
1  338  A   n 
1  339  A   n 
1  340  C   n 
1  341  C   n 
1  342  C   n 
1  343  C   n 
1  344  G   n 
1  345  U   n 
1  346  A   n 
1  347  C   n 
1  348  U   n 
1  349  C   n 
1  350  G   n 
1  351  A   n 
1  352  G   n 
1  353  A   n 
1  354  C   n 
1  355  C   n 
1  356  A   n 
1  357  G   n 
1  358  U   n 
1  359  A   n 
1  360  C   n 
1  361  G   n 
1  362  A   n 
1  363  C   n 
1  364  G   n 
1  365  U   n 
1  366  G   n 
1  367  C   n 
1  368  G   n 
1  369  G   n 
1  370  U   n 
1  371  A   n 
1  372  G   n 
1  373  U   n 
1  374  G   n 
1  375  C   n 
1  376  C   n 
1  377  A   n 
1  378  G   n 
1  379  A   n 
1  380  G   n 
1  381  U   n 
1  382  A   n 
1  383  G   n 
1  384  C   n 
1  385  G   n 
1  386  G   n 
1  387  G   n 
1  388  G   n 
1  389  G   n 
1  390  U   n 
1  391  U   n 
1  392  G   n 
1  393  G   n 
1  394  A   n 
1  395  U   n 
1  396  A   n 
1  397  U   n 
1  398  C   n 
1  399  C   n 
1  400  C   n 
1  401  U   n 
1  402  C   n 
1  403  G   n 
1  404  C   n 
1  405  G   n 
1  406  A   n 
1  407  A   n 
1  408  U   n 
1  409  A   n 
1  410  A   n 
1  411  C   n 
1  412  G   n 
1  413  C   n 
1  414  A   n 
1  415  G   n 
1  416  G   n 
1  417  C   n 
1  418  A   n 
1  419  U   n 
1  420  C   n 
1  421  G   n 
1  422  A   n 
1  423  C   n 
1  424  U   n 
1  425  G   n 
1  426  C   n 
1  427  G   n 
1  428  A   n 
1  429  A   n 
1  430  G   n 
1  431  G   n 
1  432  C   n 
1  433  U   n 
1  434  A   n 
1  435  A   n 
1  436  A   n 
1  437  C   n 
1  438  A   n 
1  439  C   n 
1  440  A   n 
1  441  A   n 
1  442  C   n 
1  443  C   n 
1  444  U   n 
1  445  G   n 
1  446  A   n 
1  447  G   n 
1  448  A   n 
1  449  C   n 
1  450  C   n 
1  451  G   n 
1  452  A   n 
1  453  U   n 
1  454  A   n 
1  455  G   n 
1  456  U   n 
1  457  G   n 
1  458  A   n 
1  459  A   n 
1  460  C   n 
1  461  A   n 
1  462  A   n 
1  463  G   n 
1  464  U   n 
1  465  A   n 
1  466  G   n 
1  467  U   n 
1  468  G   n 
1  469  U   n 
1  470  G   n 
1  471  A   n 
1  472  A   n 
1  473  C   n 
1  474  G   n 
1  475  A   n 
1  476  A   n 
1  477  C   n 
1  478  G   n 
1  479  C   n 
1  480  U   n 
1  481  G   n 
1  482  C   n 
1  483  A   n 
1  484  A   n 
1  485  A   n 
1  486  G   n 
1  487  U   n 
1  488  A   n 
1  489  C   n 
1  490  C   n 
1  491  C   n 
1  492  U   n 
1  493  C   n 
1  494  A   n 
1  495  G   n 
1  496  A   n 
1  497  A   n 
1  498  G   n 
1  499  G   n 
1  500  G   n 
1  501  A   n 
1  502  G   n 
1  503  G   n 
1  504  C   n 
1  505  G   n 
1  506  A   n 
1  507  A   n 
1  508  A   n 
1  509  U   n 
1  510  A   n 
1  511  G   n 
1  512  A   n 
1  513  G   n 
1  514  C   n 
1  515  A   n 
1  516  U   n 
1  517  G   n 
1  518  A   n 
1  519  A   n 
1  520  A   n 
1  521  U   n 
1  522  C   n 
1  523  A   n 
1  524  G   n 
1  525  U   n 
1  526  U   n 
1  527  G   n 
1  528  G   n 
1  529  C   n 
1  530  G   n 
1  531  A   n 
1  532  U   n 
1  533  C   n 
1  534  G   n 
1  535  A   n 
1  536  G   n 
1  537  C   n 
1  538  G   n 
1  539  A   n 
1  540  C   n 
1  541  A   n 
1  542  G   n 
1  543  G   n 
1  544  G   n 
1  545  C   n 
1  546  A   n 
1  547  U   n 
1  548  A   n 
1  549  C   n 
1  550  A   n 
1  551  A   n 
1  552  G   n 
1  553  G   n 
1  554  U   n 
1  555  C   n 
1  556  C   n 
1  557  C   n 
1  558  U   n 
1  559  C   n 
1  560  G   n 
1  561  A   n 
1  562  C   n 
1  563  G   n 
1  564  A   n 
1  565  A   n 
1  566  U   n 
1  567  G   n 
1  568  A   n 
1  569  C   n 
1  570  C   n 
1  571  G   n 
1  572  A   n 
1  573  C   n 
1  574  G   n 
1  575  C   n 
1  576  G   n 
1  577  C   n 
1  578  G   n 
1  579  A   n 
1  580  G   n 
1  581  C   n 
1  582  G   n 
1  583  U   n 
1  584  C   n 
1  585  C   n 
1  586  A   n 
1  587  G   n 
1  588  U   n 
1  589  A   n 
1  590  A   n 
1  591  G   n 
1  592  A   n 
1  593  C   n 
1  594  U   n 
1  595  C   n 
1  596  A   n 
1  597  C   n 
1  598  G   n 
1  599  G   n 
1  600  G   n 
1  601  A   n 
1  602  A   n 
1  603  G   n 
1  604  C   n 
1  605  C   n 
1  606  G   n 
1  607  A   n 
1  608  U   n 
1  609  G   n 
1  610  U   n 
1  611  U   n 
1  612  C   n 
1  613  U   n 
1  614  G   n 
1  615  U   n 
1  616  C   n 
1  617  G   n 
1  618  U   n 
1  619  A   n 
1  620  C   n 
1  621  G   n 
1  622  U   n 
1  623  U   n 
1  624  U   n 
1  625  U   n 
1  626  G   n 
1  627  A   n 
1  628  A   n 
1  629  A   n 
1  630  A   n 
1  631  A   n 
1  632  C   n 
1  633  G   n 
1  634  A   n 
1  635  G   n 
1  636  C   n 
1  637  C   n 
1  638  A   n 
1  639  G   n 
1  640  G   n 
1  641  G   n 
1  642  A   n 
1  643  G   n 
1  644  U   n 
1  645  G   n 
1  646  U   n 
1  647  G   n 
1  648  U   n 
1  649  C   n 
1  650  U   n 
1  651  G   n 
1  652  C   n 
1  653  A   n 
1  654  U   n 
1  655  G   n 
1  656  G   n 
1  657  C   n 
1  658  A   n 
1  659  A   n 
1  660  G   n 
1  661  U   n 
1  662  C   n 
1  663  U   n 
1  664  A   n 
1  665  A   n 
1  666  C   n 
1  667  C   n 
1  668  G   n 
1  669  G   n 
1  670  A   n 
1  671  G   n 
1  672  U   n 
1  673  A   n 
1  674  U   n 
1  675  C   n 
1  676  C   n 
1  677  G   n 
1  678  G   n 
1  679  G   n 
1  680  G   n 
1  681  A   n 
1  682  G   n 
1  683  G   n 
1  684  C   n 
1  685  A   n 
1  686  C   n 
1  687  A   n 
1  688  G   n 
1  689  G   n 
1  690  G   n 
1  691  A   n 
1  692  A   n 
1  693  A   n 
1  694  C   n 
1  695  C   n 
1  696  G   n 
1  697  A   n 
1  698  C   n 
1  699  A   n 
1  700  U   n 
1  701  G   n 
1  702  G   n 
1  703  C   n 
1  704  C   n 
1  705  G   n 
1  706  C   n 
1  707  A   n 
1  708  G   n 
1  709  G   n 
1  710  G   n 
1  711  C   n 
1  712  U   n 
1  713  U   n 
1  714  U   n 
1  715  G   n 
1  716  C   n 
1  717  C   n 
1  718  C   n 
1  719  G   n 
1  720  A   n 
1  721  G   n 
1  722  G   n 
1  723  G   n 
1  724  C   n 
1  725  C   n 
1  726  G   n 
1  727  C   n 
1  728  C   n 
1  729  G   n 
1  730  U   n 
1  731  C   n 
1  732  U   n 
1  733  U   n 
1  734  C   n 
1  735  A   n 
1  736  A   n 
1  737  G   n 
1  738  G   n 
1  739  G   n 
1  740  C   n 
1  741  G   n 
1  742  G   n 
1  743  G   n 
1  744  G   n 
1  745  A   n 
1  746  G   n 
1  747  C   n 
1  748  C   n 
1  749  A   n 
1  750  U   n 
1  751  G   n 
1  752  U   n 
1  753  G   n 
1  754  G   n 
1  755  A   n 
1  756  C   n 
1  757  A   n 
1  758  C   n 
1  759  G   n 
1  760  A   n 
1  761  C   n 
1  762  C   n 
1  763  C   n 
1  764  G   n 
1  765  A   n 
1  766  A   n 
1  767  U   n 
1  768  C   n 
1  769  C   n 
1  770  G   n 
1  771  G   n 
1  772  A   n 
1  773  C   n 
1  774  G   n 
1  775  A   n 
1  776  U   n 
1  777  C   n 
1  778  U   n 
1  779  A   n 
1  780  C   n 
1  781  G   n 
1  782  C   n 
1  783  A   n 
1  784  U   n 
1  785  G   n 
1  786  G   n 
1  787  A   n 
1  788  C   n 
1  789  A   n 
1  790  A   n 
1  791  G   n 
1  792  A   n 
1  793  U   n 
1  794  G   n 
1  795  A   n 
1  796  A   n 
1  797  G   n 
1  798  C   n 
1  799  G   n 
1  800  U   n 
1  801  G   n 
1  802  C   n 
1  803  C   n 
1  804  G   n 
1  805  A   n 
1  806  A   n 
1  807  A   n 
1  808  G   n 
1  809  G   n 
1  810  C   n 
1  811  A   n 
1  812  C   n 
1  813  G   n 
1  814  U   n 
1  815  G   n 
1  816  G   n 
1  817  A   n 
1  818  A   n 
1  819  G   n 
1  820  U   n 
1  821  C   n 
1  822  U   n 
1  823  G   n 
1  824  U   n 
1  825  U   n 
1  826  A   n 
1  827  G   n 
1  828  A   n 
1  829  G   n 
1  830  U   n 
1  831  U   n 
1  832  G   n 
1  833  G   n 
1  834  U   n 
1  835  G   n 
1  836  U   n 
1  837  C   n 
1  838  C   n 
1  839  U   n 
1  840  A   n 
1  841  C   n 
1  842  A   n 
1  843  A   n 
1  844  U   n 
1  845  A   n 
1  846  C   n 
1  847  C   n 
1  848  C   n 
1  849  U   n 
1  850  C   n 
1  851  U   n 
1  852  C   n 
1  853  G   n 
1  854  U   n 
1  855  G   n 
1  856  A   n 
1  857  U   n 
1  858  C   n 
1  859  U   n 
1  860  A   n 
1  861  U   n 
1  862  G   n 
1  863  U   n 
1  864  G   n 
1  865  U   n 
1  866  A   n 
1  867  G   n 
1  868  G   n 
1  869  G   n 
1  870  G   n 
1  871  U   n 
1  872  G   n 
1  873  A   n 
1  874  A   n 
1  875  A   n 
1  876  G   n 
1  877  G   n 
1  878  C   n 
1  879  C   n 
1  880  C   n 
1  881  A   n 
1  882  U   n 
1  883  C   n 
1  884  G   n 
1  885  A   n 
1  886  G   n 
1  887  U   n 
1  888  C   n 
1  889  C   n 
1  890  G   n 
1  891  G   n 
1  892  C   n 
1  893  A   n 
1  894  A   n 
1  895  C   n 
1  896  A   n 
1  897  G   n 
1  898  C   n 
1  899  U   n 
1  900  G   n 
1  901  G   n 
1  902  U   n 
1  903  U   n 
1  904  C   n 
1  905  C   n 
1  906  A   n 
1  907  A   n 
1  908  U   n 
1  909  C   n 
1  910  G   n 
1  911  A   n 
1  912  A   n 
1  913  A   n 
1  914  C   n 
1  915  A   n 
1  916  U   n 
1  917  G   n 
1  918  U   n 
1  919  C   n 
1  920  G   n 
1  921  A   n 
1  922  A   n 
1  923  G   n 
1  924  C   n 
1  925  A   n 
1  926  U   n 
1  927  G   n 
1  928  A   n 
1  929  C   n 
1  930  C   n 
1  931  U   n 
1  932  C   n 
1  933  C   n 
1  934  G   n 
1  935  C   n 
1  936  C   n 
1  937  G   n 
1  938  A   n 
1  939  G   n 
1  940  G   n 
1  941  U   n 
1  942  A   n 
1  943  G   n 
1  944  U   n 
1  945  C   n 
1  946  U   n 
1  947  G   n 
1  948  U   n 
1  949  G   n 
1  950  A   n 
1  951  G   n 
1  952  G   n 
1  953  U   n 
1  954  A   n 
1  955  G   n 
1  956  A   n 
1  957  G   n 
1  958  C   n 
1  959  G   n 
1  960  A   n 
1  961  C   n 
1  962  C   n 
1  963  G   n 
1  964  A   n 
1  965  U   n 
1  966  U   n 
1  967  G   n 
1  968  G   n 
1  969  U   n 
1  970  G   n 
1  971  U   n 
1  972  G   n 
1  973  U   n 
1  974  C   n 
1  975  C   n 
1  976  G   n 
1  977  C   n 
1  978  C   n 
1  979  U   n 
1  980  C   n 
1  981  C   n 
1  982  G   n 
1  983  A   n 
1  984  G   n 
1  985  A   n 
1  986  G   n 
1  987  G   n 
1  988  A   n 
1  989  G   n 
1  990  U   n 
1  991  C   n 
1  992  G   n 
1  993  G   n 
1  994  C   n 
1  995  A   n 
1  996  C   n 
1  997  A   n 
1  998  C   n 
1  999  C   n 
1  1000 U   n 
1  1001 G   n 
1  1002 U   n 
1  1003 C   n 
1  1004 A   n 
1  1005 A   n 
1  1006 A   n 
1  1007 C   n 
1  1008 U   n 
1  1009 C   n 
1  1010 C   n 
1  1011 A   n 
1  1012 A   n 
1  1013 A   n 
1  1014 C   n 
1  1015 U   n 
1  1016 U   n 
1  1017 A   n 
1  1018 C   n 
1  1019 A   n 
1  1020 G   n 
1  1021 A   n 
1  1022 C   n 
1  1023 G   n 
1  1024 C   n 
1  1025 C   n 
1  1026 G   n 
1  1027 U   n 
1  1028 U   n 
1  1029 U   n 
1  1030 G   n 
1  1031 A   n 
1  1032 C   n 
1  1033 G   n 
1  1034 C   n 
1  1035 G   n 
1  1036 G   n 
1  1037 G   n 
1  1038 G   n 
1  1039 A   n 
1  1040 U   n 
1  1041 U   n 
1  1042 C   n 
1  1043 C   n 
1  1044 G   n 
1  1045 G   n 
1  1046 U   n 
1  1047 G   n 
1  1048 C   n 
1  1049 G   n 
1  1050 C   n 
1  1051 G   n 
1  1052 G   n 
1  1053 G   n 
1  1054 G   n 
1  1055 U   n 
1  1056 A   n 
1  1057 A   n 
1  1058 G   n 
1  1059 C   n 
1  1060 C   n 
1  1061 U   n 
1  1062 G   n 
1  1063 U   n 
1  1064 G   n 
1  1065 U   n 
1  1066 A   n 
1  1067 C   n 
1  1068 C   n 
1  1069 A   n 
1  1070 G   n 
1  1071 G   n 
1  1072 A   n 
1  1073 G   n 
1  1074 G   n 
1  1075 G   n 
1  1076 G   n 
1  1077 A   n 
1  1078 A   n 
1  1079 C   n 
1  1080 A   n 
1  1081 A   n 
1  1082 C   n 
1  1083 C   n 
1  1084 C   n 
1  1085 A   n 
1  1086 G   n 
1  1087 A   n 
1  1088 G   n 
1  1089 A   n 
1  1090 U   n 
1  1091 A   n 
1  1092 G   n 
1  1093 G   n 
1  1094 U   n 
1  1095 U   n 
1  1096 A   n 
1  1097 A   n 
1  1098 G   n 
1  1099 G   n 
1  1100 U   n 
1  1101 C   n 
1  1102 C   n 
1  1103 C   n 
1  1104 C   n 
1  1105 A   n 
1  1106 A   n 
1  1107 G   n 
1  1108 U   n 
1  1109 G   n 
1  1110 U   n 
1  1111 G   n 
1  1112 G   n 
1  1113 A   n 
1  1114 U   n 
1  1115 U   n 
1  1116 A   n 
1  1117 A   n 
1  1118 G   n 
1  1119 U   n 
1  1120 G   n 
1  1121 U   n 
1  1122 A   n 
1  1123 A   n 
1  1124 U   n 
1  1125 C   n 
1  1126 C   n 
1  1127 U   n 
1  1128 C   n 
1  1129 U   n 
1  1130 G   n 
1  1131 A   n 
1  1132 A   n 
1  1133 G   n 
1  1134 G   n 
1  1135 U   n 
1  1136 G   n 
1  1137 G   n 
1  1138 U   n 
1  1139 C   n 
1  1140 U   n 
1  1141 C   n 
1  1142 G   n 
1  1143 A   n 
1  1144 G   n 
1  1145 C   n 
1  1146 C   n 
1  1147 C   n 
1  1148 U   n 
1  1149 A   n 
1  1150 G   n 
1  1151 A   n 
1  1152 C   n 
1  1153 A   n 
1  1154 G   n 
1  1155 C   n 
1  1156 C   n 
1  1157 G   n 
1  1158 G   n 
1  1159 G   n 
1  1160 A   n 
1  1161 G   n 
1  1162 G   n 
1  1163 U   n 
1  1164 G   n 
1  1165 A   n 
1  1166 G   n 
1  1167 C   n 
1  1168 U   n 
1  1169 U   n 
1  1170 A   n 
1  1171 G   n 
1  1172 A   n 
1  1173 A   n 
1  1174 G   n 
1  1175 C   n 
1  1176 A   n 
1  1177 G   n 
1  1178 C   n 
1  1179 U   n 
1  1180 A   n 
1  1181 C   n 
1  1182 C   n 
1  1183 C   n 
1  1184 U   n 
1  1185 C   n 
1  1186 U   n 
1  1187 A   n 
1  1188 A   n 
1  1189 G   n 
1  1190 A   n 
1  1191 A   n 
1  1192 A   n 
1  1193 A   n 
1  1194 G   n 
1  1195 C   n 
1  1196 G   n 
1  1197 U   n 
1  1198 A   n 
1  1199 A   n 
1  1200 C   n 
1  1201 A   n 
1  1202 G   n 
1  1203 C   n 
1  1204 U   n 
1  1205 U   n 
1  1206 A   n 
1  1207 C   n 
1  1208 C   n 
1  1209 G   n 
1  1210 G   n 
1  1211 C   n 
1  1212 C   n 
1  1213 G   n 
1  1214 A   n 
1  1215 G   n 
1  1216 G   n 
1  1217 U   n 
1  1218 U   n 
1  1219 U   n 
1  1220 G   n 
1  1221 A   n 
1  1222 G   n 
1  1223 G   n 
1  1224 C   n 
1  1225 G   n 
1  1226 C   n 
1  1227 C   n 
1  1228 C   n 
1  1229 A   n 
1  1230 A   n 
1  1231 A   n 
1  1232 A   n 
1  1233 U   n 
1  1234 G   n 
1  1235 A   n 
1  1236 U   n 
1  1237 C   n 
1  1238 G   n 
1  1239 G   n 
1  1240 G   n 
1  1241 A   n 
1  1242 C   n 
1  1243 U   n 
1  1244 C   n 
1  1245 A   n 
1  1246 A   n 
1  1247 A   n 
1  1248 U   n 
1  1249 C   n 
1  1250 C   n 
1  1251 A   n 
1  1252 C   n 
1  1253 C   n 
1  1254 A   n 
1  1255 C   n 
1  1256 C   n 
1  1257 G   n 
1  1258 A   n 
1  1259 G   n 
1  1260 A   n 
1  1261 C   n 
1  1262 C   n 
1  1263 U   n 
1  1264 G   n 
1  1265 U   n 
1  1266 C   n 
1  1267 C   n 
1  1268 G   n 
1  1269 U   n 
1  1270 A   n 
1  1271 C   n 
1  1272 C   n 
1  1273 A   n 
1  1274 C   n 
1  1275 U   n 
1  1276 C   n 
1  1277 A   n 
1  1278 U   n 
1  1279 A   n 
1  1280 C   n 
1  1281 U   n 
1  1282 G   n 
1  1283 G   n 
1  1284 U   n 
1  1285 A   n 
1  1286 A   n 
1  1287 U   n 
1  1288 C   n 
1  1289 G   n 
1  1290 A   n 
1  1291 G   n 
1  1292 U   n 
1  1293 A   n 
1  1294 G   n 
1  1295 A   n 
1  1296 U   n 
1  1297 U   n 
1  1298 G   n 
1  1299 G   n 
1  1300 C   n 
1  1301 G   n 
1  1302 C   n 
1  1303 U   n 
1  1304 C   n 
1  1305 U   n 
1  1306 A   n 
1  1307 A   n 
1  1308 U   n 
1  1309 U   n 
1  1310 G   n 
1  1311 G   n 
1  1312 A   n 
1  1313 U   n 
1  1314 G   n 
1  1315 G   n 
1  1316 A   n 
1  1317 A   n 
1  1318 G   n 
1  1319 U   n 
1  1320 A   n 
1  1321 G   n 
1  1322 G   n 
1  1323 G   n 
1  1324 G   n 
1  1325 U   n 
1  1326 G   n 
1  1327 A   n 
1  1328 A   n 
1  1329 A   n 
1  1330 A   n 
1  1331 C   n 
1  1332 U   n 
1  1333 C   n 
1  1334 C   n 
1  1335 U   n 
1  1336 A   n 
1  1337 U   n 
1  1338 G   n 
1  1339 G   n 
1  1340 A   n 
1  1341 C   n 
1  1342 C   n 
1  1343 G   n 
1  1344 A   n 
1  1345 U   n 
1  1346 U   n 
1  1347 A   n 
1  1348 G   n 
1  1349 U   n 
1  1350 G   n 
1  1351 A   n 
1  1352 C   n 
1  1353 G   n 
1  1354 A   n 
1  1355 A   n 
1  1356 A   n 
1  1357 A   n 
1  1358 U   n 
1  1359 C   n 
1  1360 C   n 
1  1361 U   n 
1  1362 G   n 
1  1363 G   n 
1  1364 C   n 
1  1365 C   n 
1  1366 A   n 
1  1367 U   n 
1  1368 A   n 
1  1369 G   n 
1  1370 U   n 
1  1371 A   n 
1  1372 G   n 
1  1373 C   n 
1  1374 A   n 
1  1375 G   n 
1  1376 C   n 
1  1377 G   n 
1  1378 A   n 
1  1379 U   n 
1  1380 A   n 
1  1381 G   n 
1  1382 U   n 
1  1383 C   n 
1  1384 G   n 
1  1385 G   n 
1  1386 G   n 
1  1387 U   n 
1  1388 G   n 
1  1389 A   n 
1  1390 G   n 
1  1391 A   n 
1  1392 A   n 
1  1393 C   n 
1  1394 C   n 
1  1395 C   n 
1  1396 C   n 
1  1397 G   n 
1  1398 A   n 
1  1399 C   n 
1  1400 G   n 
1  1401 G   n 
1  1402 C   n 
1  1403 C   n 
1  1404 U   n 
1  1405 A   n 
1  1406 A   n 
1  1407 U   n 
1  1408 G   n 
1  1409 G   n 
1  1410 A   n 
1  1411 U   n 
1  1412 A   n 
1  1413 A   n 
1  1414 G   n 
1  1415 G   n 
1  1416 G   n 
1  1417 U   n 
1  1418 U   n 
1  1419 C   n 
1  1420 C   n 
1  1421 U   n 
1  1422 C   n 
1  1423 A   n 
1  1424 G   n 
1  1425 C   n 
1  1426 A   n 
1  1427 C   n 
1  1428 U   n 
1  1429 G   n 
1  1430 C   n 
1  1431 U   n 
1  1432 G   n 
1  1433 A   n 
1  1434 U   n 
1  1435 C   n 
1  1436 A   n 
1  1437 G   n 
1  1438 C   n 
1  1439 U   n 
1  1440 G   n 
1  1441 A   n 
1  1442 G   n 
1  1443 G   n 
1  1444 G   n 
1  1445 U   n 
1  1446 U   n 
1  1447 A   n 
1  1448 G   n 
1  1449 C   n 
1  1450 C   n 
1  1451 G   n 
1  1452 G   n 
1  1453 U   n 
1  1454 C   n 
1  1455 C   n 
1  1456 U   n 
1  1457 A   n 
1  1458 A   n 
1  1459 G   n 
1  1460 U   n 
1  1461 C   n 
1  1462 A   n 
1  1463 U   n 
1  1464 A   n 
1  1465 C   n 
1  1466 C   n 
1  1467 G   n 
1  1468 C   n 
1  1469 A   n 
1  1470 A   n 
1  1471 C   n 
1  1472 U   n 
1  1473 C   n 
1  1474 G   n 
1  1475 A   n 
1  1476 C   n 
1  1477 U   n 
1  1478 A   n 
1  1479 U   n 
1  1480 G   n 
1  1481 A   n 
1  1482 C   n 
1  1483 G   n 
1  1484 A   n 
1  1485 A   n 
1  1486 A   n 
1  1487 U   n 
1  1488 G   n 
1  1489 G   n 
1  1490 G   n 
1  1491 A   n 
1  1492 A   n 
1  1493 A   n 
1  1494 C   n 
1  1495 G   n 
1  1496 G   n 
1  1497 G   n 
1  1498 U   n 
1  1499 U   n 
1  1500 A   n 
1  1501 A   n 
1  1502 U   n 
1  1503 A   n 
1  1504 U   n 
1  1505 U   n 
1  1506 C   n 
1  1507 C   n 
1  1508 C   n 
1  1509 G   n 
1  1510 U   n 
1  1511 G   n 
1  1512 C   n 
1  1513 C   n 
1  1514 A   n 
1  1515 C   n 
1  1516 U   n 
1  1517 A   n 
1  1518 U   n 
1  1519 G   n 
1  1520 C   n 
1  1521 A   n 
1  1522 G   n 
1  1523 U   n 
1  1524 G   n 
1  1525 A   n 
1  1526 A   n 
1  1527 A   n 
1  1528 G   n 
1  1529 U   n 
1  1530 U   n 
1  1531 G   n 
1  1532 A   n 
1  1533 C   n 
1  1534 G   n 
1  1535 C   n 
1  1536 C   n 
1  1537 C   n 
1  1538 U   n 
1  1539 G   n 
1  1540 G   n 
1  1541 G   n 
1  1542 G   n 
1  1543 U   n 
1  1544 C   n 
1  1545 G   n 
1  1546 A   n 
1  1547 U   n 
1  1548 C   n 
1  1549 A   n 
1  1550 C   n 
1  1551 G   n 
1  1552 C   n 
1  1553 U   n 
1  1554 G   n 
1  1555 G   n 
1  1556 G   n 
1  1557 C   n 
1  1558 A   n 
1  1559 U   n 
1  1560 U   n 
1  1561 C   n 
1  1562 G   n 
1  1563 C   n 
1  1564 C   n 
1  1565 C   n 
1  1566 A   n 
1  1567 G   n 
1  1568 U   n 
1  1569 C   n 
1  1570 G   n 
1  1571 A   n 
1  1572 A   n 
1  1573 C   n 
1  1574 C   n 
1  1575 G   n 
1  1576 U   n 
1  1577 C   n 
1  1578 C   n 
1  1579 A   n 
1  1580 A   n 
1  1581 C   n 
1  1582 U   n 
1  1583 C   n 
1  1584 C   n 
1  1585 G   n 
1  1586 U   n 
1  1587 G   n 
1  1588 G   n 
1  1589 A   n 
1  1590 A   n 
1  1591 G   n 
1  1592 C   n 
1  1593 C   n 
1  1594 G   n 
1  1595 U   n 
1  1596 A   n 
1  1597 A   n 
1  1598 U   n 
1  1599 G   n 
1  1600 G   n 
1  1601 C   n 
1  1602 A   n 
1  1603 G   n 
1  1604 G   n 
1  1605 A   n 
1  1606 A   n 
1  1607 G   n 
1  1608 C   n 
1  1609 G   n 
1  1610 G   n 
1  1611 A   n 
1  1612 C   n 
1  1613 G   n 
1  1614 A   n 
1  1615 A   n 
1  1616 C   n 
1  1617 G   n 
1  1618 G   n 
1  1619 C   n 
1  1620 G   n 
1  1621 G   n 
1  1622 C   n 
1  1623 A   n 
1  1624 U   n 
1  1625 A   n 
1  1626 G   n 
1  1627 G   n 
1  1628 G   n 
1  1629 A   n 
1  1630 A   n 
1  1631 A   n 
1  1632 C   n 
1  1633 G   n 
1  1634 U   n 
1  1635 G   n 
1  1636 A   n 
1  1637 U   n 
1  1638 U   n 
1  1639 C   n 
1  1640 A   n 
1  1641 A   n 
1  1642 C   n 
1  1643 C   n 
1  1644 U   n 
1  1645 G   n 
1  1646 G   n 
1  1647 G   n 
1  1648 G   n 
1  1649 C   n 
1  1650 C   n 
1  1651 C   n 
1  1652 A   n 
1  1653 U   n 
1  1654 G   n 
1  1655 A   n 
1  1656 A   n 
1  1657 A   n 
1  1658 A   n 
1  1659 G   n 
1  1660 A   n 
1  1661 C   n 
1  1662 G   n 
1  1663 A   n 
1  1664 G   n 
1  1665 C   n 
1  1666 A   n 
1  1667 U   n 
1  1668 A   n 
1  1669 G   n 
1  1670 U   n 
1  1671 G   n 
1  1672 U   n 
1  1673 C   n 
1  1674 C   n 
1  1675 G   n 
1  1676 U   n 
1  1677 A   n 
1  1678 C   n 
1  1679 C   n 
1  1680 G   n 
1  1681 A   n 
1  1682 G   n 
1  1683 A   n 
1  1684 A   n 
1  1685 C   n 
1  1686 C   n 
1  1687 G   n 
1  1688 A   n 
1  1689 C   n 
1  1690 A   n 
1  1691 C   n 
1  1692 A   n 
1  1693 G   n 
1  1694 G   n 
1  1695 U   n 
1  1696 G   n 
1  1697 U   n 
1  1698 C   n 
1  1699 C   n 
1  1700 A   n 
1  1701 U   n 
1  1702 G   n 
1  1703 G   n 
1  1704 C   n 
1  1705 G   n 
1  1706 G   n 
1  1707 C   n 
1  1708 G   n 
1  1709 A   n 
1  1710 A   n 
1  1711 A   n 
1  1712 G   n 
1  1713 C   n 
1  1714 C   n 
1  1715 A   n 
1  1716 A   n 
1  1717 G   n 
1  1718 G   n 
1  1719 C   n 
1  1720 C   n 
1  1721 U   n 
1  1722 G   n 
1  1723 U   n 
1  1724 C   n 
1  1725 G   n 
1  1726 G   n 
1  1727 G   n 
1  1728 A   n 
1  1729 G   n 
1  1730 C   n 
1  1731 A   n 
1  1732 A   n 
1  1733 C   n 
1  1734 C   n 
1  1735 A   n 
1  1736 A   n 
1  1737 C   n 
1  1738 G   n 
1  1739 U   n 
1  1740 U   n 
1  1741 A   n 
1  1742 G   n 
1  1743 G   n 
1  1744 G   n 
1  1745 A   n 
1  1746 A   n 
1  1747 U   n 
1  1748 U   n 
1  1749 C   n 
1  1750 G   n 
1  1751 G   n 
1  1752 C   n 
1  1753 A   n 
1  1754 A   n 
1  1755 G   n 
1  1756 U   n 
1  1757 U   n 
1  1758 A   n 
1  1759 G   n 
1  1760 U   n 
1  1761 C   n 
1  1762 C   n 
1  1763 C   n 
1  1764 G   n 
1  1765 U   n 
1  1766 A   n 
1  1767 C   n 
1  1768 C   n 
1  1769 U   n 
1  1770 U   n 
1  1771 C   n 
1  1772 G   n 
1  1773 G   n 
1  1774 A   n 
1  1775 A   n 
1  1776 G   n 
1  1777 A   n 
1  1778 A   n 
1  1779 G   n 
1  1780 G   n 
1  1781 G   n 
1  1782 A   n 
1  1783 U   n 
1  1784 G   n 
1  1785 C   n 
1  1786 C   n 
1  1787 U   n 
1  1788 G   n 
1  1789 C   n 
1  1790 U   n 
1  1791 C   n 
1  1792 C   n 
1  1793 G   n 
1  1794 G   n 
1  1795 A   n 
1  1796 A   n 
1  1797 C   n 
1  1798 G   n 
1  1799 G   n 
1  1800 A   n 
1  1801 G   n 
1  1802 C   n 
1  1803 A   n 
1  1804 G   n 
1  1805 G   n 
1  1806 U   n 
1  1807 C   n 
1  1808 G   n 
1  1809 C   n 
1  1810 A   n 
1  1811 G   n 
1  1812 U   n 
1  1813 G   n 
1  1814 A   n 
1  1815 C   n 
1  1816 U   n 
1  1817 C   n 
1  1818 G   n 
1  1819 G   n 
1  1820 A   n 
1  1821 A   n 
1  1822 G   n 
1  1823 C   n 
1  1824 U   n 
1  1825 C   n 
1  1826 G   n 
1  1827 G   n 
1  1828 A   n 
1  1829 C   n 
1  1830 U   n 
1  1831 G   n 
1  1832 U   n 
1  1833 C   n 
1  1834 U   n 
1  1835 A   n 
1  1836 G   n 
1  1837 U   n 
1  1838 A   n 
1  1839 A   n 
1  1840 C   n 
1  1841 A   n 
1  1842 A   n 
1  1843 C   n 
1  1844 A   n 
1  1845 U   n 
1  1846 A   n 
1  1847 G   n 
1  1848 G   n 
1  1849 U   n 
1  1850 G   n 
1  1851 A   n 
1  1852 C   n 
1  1853 C   n 
1  1854 G   n 
1  1855 C   n 
1  1856 A   n 
1  1857 A   n 
1  1858 A   n 
1  1859 U   n 
1  1860 C   n 
1  1861 C   n 
1  1862 G   n 
1  1863 C   n 
1  1864 A   n 
1  1865 A   n 
1  1866 G   n 
1  1867 G   n 
1  1868 A   n 
1  1869 C   n 
1  1870 U   n 
1  1871 C   n 
1  1872 G   n 
1  1873 U   n 
1  1874 A   n 
1  1875 C   n 
1  1876 G   n 
1  1877 G   n 
1  1878 U   n 
1  1879 C   n 
1  1880 A   n 
1  1881 C   n 
1  1882 U   n 
1  1883 G   n 
1  1884 A   n 
1  1885 A   n 
1  1886 U   n 
1  1887 C   n 
1  1888 C   n 
1  1889 U   n 
1  1890 G   n 
1  1891 C   n 
1  1892 C   n 
1  1893 C   n 
1  1894 A   n 
1  1895 G   n 
1  1896 U   n 
1  1897 G   n 
1  1898 C   n 
1  1899 A   n 
1  1900 G   n 
1  1901 G   n 
1  1902 U   n 
1  1903 A   n 
1  1904 U   n 
1  1905 C   n 
1  1906 U   n 
1  1907 G   n 
1  1908 A   n 
1  1909 A   n 
1  1910 C   n 
1  1911 A   n 
1  1912 C   n 
1  1913 C   n 
1  1914 U   n 
1  1915 C   n 
1  1916 G   n 
1  1917 U   n 
1  1918 A   n 
1  1919 C   n 
1  1920 A   n 
1  1921 A   n 
1  1922 G   n 
1  1923 A   n 
1  1924 G   n 
1  1925 G   n 
1  1926 A   n 
1  1927 C   n 
1  1928 G   n 
1  1929 A   n 
1  1930 A   n 
1  1931 G   n 
1  1932 G   n 
1  1933 A   n 
1  1934 C   n 
1  1935 C   n 
1  1936 U   n 
1  1937 G   n 
1  1938 U   n 
1  1939 C   n 
1  1940 A   n 
1  1941 A   n 
1  1942 C   n 
1  1943 G   n 
1  1944 G   n 
1  1945 C   n 
1  1946 G   n 
1  1947 G   n 
1  1948 G   n 
1  1949 G   n 
1  1950 G   n 
1  1951 U   n 
1  1952 A   n 
1  1953 A   n 
1  1954 C   n 
1  1955 U   n 
1  1956 A   n 
1  1957 U   n 
1  1958 G   n 
1  1959 A   n 
1  1960 C   n 
1  1961 C   n 
1  1962 C   n 
1  1963 U   n 
1  1964 C   n 
1  1965 U   n 
1  1966 U   n 
1  1967 A   n 
1  1968 A   n 
1  1969 G   n 
1  1970 G   n 
1  1971 U   n 
1  1972 A   n 
1  1973 G   n 
1  1974 C   n 
1  1975 G   n 
1  1976 U   n 
1  1977 A   n 
1  1978 G   n 
1  1979 U   n 
1  1980 A   n 
1  1981 C   n 
1  1982 C   n 
1  1983 U   n 
1  1984 U   n 
1  1985 G   n 
1  1986 C   n 
1  1987 C   n 
1  1988 G   n 
1  1989 C   n 
1  1990 A   n 
1  1991 U   n 
1  1992 C   n 
1  1993 A   n 
1  1994 G   n 
1  1995 U   n 
1  1996 A   n 
1  1997 G   n 
1  1998 C   n 
1  1999 G   n 
1  2000 G   n 
1  2001 C   n 
1  2002 U   n 
1  2003 U   n 
1  2004 G   n 
1  2005 C   n 
1  2006 A   n 
1  2007 U   n 
1  2008 G   n 
1  2009 A   n 
1  2010 A   n 
1  2011 U   n 
1  2012 G   n 
1  2013 G   n 
1  2014 A   n 
1  2015 U   n 
1  2016 U   n 
1  2017 A   n 
1  2018 A   n 
1  2019 C   n 
1  2020 C   n 
1  2021 A   n 
1  2022 G   n 
1  2023 A   n 
1  2024 G   n 
1  2025 C   n 
1  2026 U   n 
1  2027 U   n 
1  2028 C   n 
1  2029 A   n 
1  2030 C   n 
1  2031 U   n 
1  2032 G   n 
1  2033 U   n 
1  2034 C   n 
1  2035 C   n 
1  2036 C   n 
1  2037 A   n 
1  2038 A   n 
1  2039 C   n 
1  2040 G   n 
1  2041 U   n 
1  2042 U   n 
1  2043 G   n 
1  2044 G   n 
1  2045 G   n 
1  2046 C   n 
1  2047 C   n 
1  2048 C   n 
1  2049 G   n 
1  2050 G   n 
1  2051 U   n 
1  2052 G   n 
1  2053 A   n 
1  2054 A   n 
1  2055 C   n 
1  2056 U   n 
1  2057 G   n 
1  2058 U   n 
1  2059 A   n 
1  2060 C   n 
1  2061 A   n 
1  2062 U   n 
1  2063 U   n 
1  2064 C   n 
1  2065 C   n 
1  2066 A   n 
1  2067 G   n 
1  2068 U   n 
1  2069 G   n 
1  2070 C   n 
1  2071 G   n 
1  2072 G   n 
1  2073 A   n 
1  2074 G   n 
1  2075 U   n 
1  2076 C   n 
1  2077 U   n 
1  2078 G   n 
1  2079 G   n 
1  2080 A   n 
1  2081 G   n 
1  2082 A   n 
1  2083 C   n 
1  2084 A   n 
1  2085 C   n 
1  2086 C   n 
1  2087 C   n 
1  2088 A   n 
1  2089 G   n 
1  2090 G   n 
1  2091 G   n 
1  2092 G   n 
1  2093 G   n 
1  2094 A   n 
1  2095 A   n 
1  2096 G   n 
1  2097 C   n 
1  2098 G   n 
1  2099 A   n 
1  2100 A   n 
1  2101 G   n 
1  2102 A   n 
1  2103 C   n 
1  2104 C   n 
1  2105 C   n 
1  2106 U   n 
1  2107 A   n 
1  2108 U   n 
1  2109 G   n 
1  2110 G   n 
1  2111 A   n 
1  2112 G   n 
1  2113 C   n 
1  2114 U   n 
1  2115 U   n 
1  2116 U   n 
1  2117 A   n 
1  2118 C   n 
1  2119 U   n 
1  2120 G   n 
1  2121 C   n 
1  2122 A   n 
1  2123 G   n 
1  2124 G   n 
1  2125 C   n 
1  2126 U   n 
1  2127 G   n 
1  2128 U   n 
1  2129 C   n 
1  2130 G   n 
1  2131 C   n 
1  2132 U   n 
1  2133 G   n 
1  2134 A   n 
1  2135 G   n 
1  2136 A   n 
1  2137 C   n 
1  2138 G   n 
1  2139 U   n 
1  2140 G   n 
1  2141 G   n 
1  2142 U   n 
1  2143 C   n 
1  2144 G   n 
1  2145 C   n 
1  2146 C   n 
1  2147 G   n 
1  2148 A   n 
1  2149 U   n 
1  2150 G   n 
1  2151 U   n 
1  2152 G   n 
1  2153 C   n 
1  2154 A   n 
1  2155 G   n 
1  2156 C   n 
1  2157 A   n 
1  2158 U   n 
1  2159 A   n 
1  2160 G   n 
1  2161 G   n 
1  2162 U   n 
1  2163 A   n 
1  2164 G   n 
1  2165 G   n 
1  2166 A   n 
1  2167 G   n 
1  2168 A   n 
1  2169 C   n 
1  2170 A   n 
1  2171 C   n 
1  2172 U   n 
1  2173 A   n 
1  2174 C   n 
1  2175 A   n 
1  2176 C   n 
1  2177 A   n 
1  2178 G   n 
1  2179 G   n 
1  2180 U   n 
1  2181 A   n 
1  2182 C   n 
1  2183 C   n 
1  2184 C   n 
1  2185 G   n 
1  2186 C   n 
1  2187 G   n 
1  2188 C   n 
1  2189 U   n 
1  2190 A   n 
1  2191 G   n 
1  2192 C   n 
1  2193 G   n 
1  2194 G   n 
1  2195 G   n 
1  2196 C   n 
1  2197 C   n 
1  2198 A   n 
1  2199 C   n 
1  2200 C   n 
1  2201 G   n 
1  2202 A   n 
1  2203 G   n 
1  2204 U   n 
1  2205 C   n 
1  2206 A   n 
1  2207 A   n 
1  2208 C   n 
1  2209 A   n 
1  2210 G   n 
1  2211 U   n 
1  2212 G   n 
1  2213 A   n 
1  2214 A   n 
1  2215 A   n 
1  2216 U   n 
1  2217 A   n 
1  2218 C   n 
1  2219 U   n 
1  2220 A   n 
1  2221 C   n 
1  2222 C   n 
1  2223 C   n 
1  2224 G   n 
1  2225 U   n 
1  2226 C   n 
1  2227 G   n 
1  2228 G   n 
1  2229 U   n 
1  2230 G   n 
1  2231 A   n 
1  2232 C   n 
1  2233 U   n 
1  2234 G   n 
1  2235 C   n 
1  2236 G   n 
1  2237 A   n 
1  2238 C   n 
1  2239 U   n 
1  2240 C   n 
1  2241 U   n 
1  2242 C   n 
1  2243 A   n 
1  2244 C   n 
1  2245 U   n 
1  2246 C   n 
1  2247 C   n 
1  2248 G   n 
1  2249 G   n 
1  2250 G   n 
1  2251 A   n 
1  2252 G   n 
1  2253 G   n 
1  2254 A   n 
1  2255 G   n 
1  2256 G   n 
1  2257 A   n 
1  2258 C   n 
1  2259 A   n 
1  2260 C   n 
1  2261 C   n 
1  2262 G   n 
1  2263 A   n 
1  2264 U   n 
1  2265 A   n 
1  2266 G   n 
1  2267 C   n 
1  2268 C   n 
1  2269 G   n 
1  2270 G   n 
1  2271 G   n 
1  2272 C   n 
1  2273 A   n 
1  2274 G   n 
1  2275 U   n 
1  2276 U   n 
1  2277 U   n 
1  2278 G   n 
1  2279 A   n 
1  2280 C   n 
1  2281 U   n 
1  2282 G   n 
1  2283 G   n 
1  2284 G   n 
1  2285 G   n 
1  2286 C   n 
1  2287 G   n 
1  2288 G   n 
1  2289 U   n 
1  2290 A   n 
1  2291 C   n 
1  2292 G   n 
1  2293 C   n 
1  2294 G   n 
1  2295 C   n 
1  2296 U   n 
1  2297 C   n 
1  2298 G   n 
1  2299 A   n 
1  2300 A   n 
1  2301 A   n 
1  2302 A   n 
1  2303 G   n 
1  2304 A   n 
1  2305 U   n 
1  2306 A   n 
1  2307 U   n 
1  2308 C   n 
1  2309 G   n 
1  2310 A   n 
1  2311 G   n 
1  2312 C   n 
1  2313 G   n 
1  2314 C   n 
1  2315 G   n 
1  2316 C   n 
1  2317 C   n 
1  2318 C   n 
1  2319 U   n 
1  2320 A   n 
1  2321 U   n 
1  2322 G   n 
1  2323 G   n 
1  2324 C   n 
1  2325 U   n 
1  2326 A   n 
1  2327 U   n 
1  2328 C   n 
1  2329 U   n 
1  2330 C   n 
1  2331 A   n 
1  2332 G   n 
1  2333 C   n 
1  2334 C   n 
1  2335 G   n 
1  2336 G   n 
1  2337 G   n 
1  2338 A   n 
1  2339 C   n 
1  2340 A   n 
1  2341 G   n 
1  2342 A   n 
1  2343 G   n 
1  2344 A   n 
1  2345 C   n 
1  2346 C   n 
1  2347 C   n 
1  2348 G   n 
1  2349 G   n 
1  2350 C   n 
1  2351 G   n 
1  2352 A   n 
1  2353 A   n 
1  2354 G   n 
1  2355 A   n 
1  2356 G   n 
1  2357 U   n 
1  2358 G   n 
1  2359 C   n 
1  2360 A   n 
1  2361 A   n 
1  2362 G   n 
1  2363 A   n 
1  2364 G   n 
1  2365 C   n 
1  2366 A   n 
1  2367 A   n 
1  2368 A   n 
1  2369 A   n 
1  2370 G   n 
1  2371 A   n 
1  2372 U   n 
1  2373 A   n 
1  2374 G   n 
1  2375 C   n 
1  2376 U   n 
1  2377 U   n 
1  2378 G   n 
1  2379 A   n 
1  2380 C   n 
1  2381 A   n 
1  2382 G   n 
1  2383 U   n 
1  2384 G   n 
1  2385 U   n 
1  2386 U   n 
1  2387 C   n 
1  2388 U   n 
1  2389 U   n 
1  2390 C   n 
1  2391 C   n 
1  2392 C   n 
1  2393 A   n 
1  2394 A   n 
1  2395 C   n 
1  2396 G   n 
1  2397 A   n 
1  2398 G   n 
1  2399 G   n 
1  2400 A   n 
1  2401 A   n 
1  2402 C   n 
1  2403 G   n 
1  2404 C   n 
1  2405 U   n 
1  2406 G   n 
1  2407 A   n 
1  2408 C   n 
1  2409 G   n 
1  2410 C   n 
1  2411 G   n 
1  2412 A   n 
1  2413 A   n 
1  2414 A   n 
1  2415 G   n 
1  2416 C   n 
1  2417 G   n 
1  2418 U   n 
1  2419 G   n 
1  2420 G   n 
1  2421 U   n 
1  2422 C   n 
1  2423 U   n 
1  2424 A   n 
1  2425 G   n 
1  2426 C   n 
1  2427 G   n 
1  2428 A   n 
1  2429 A   n 
1  2430 C   n 
1  2431 C   n 
1  2432 A   n 
1  2433 A   n 
1  2434 U   n 
1  2435 U   n 
1  2436 A   n 
1  2437 G   n 
1  2438 C   n 
1  2439 C   n 
1  2440 U   n 
1  2441 G   n 
1  2442 C   n 
1  2443 U   n 
1  2444 U   n 
1  2445 G   n 
1  2446 A   n 
1  2447 U   n 
1  2448 G   n 
1  2449 C   n 
1  2450 G   n 
1  2451 G   n 
1  2452 G   n 
1  2453 C   n 
1  2454 A   n 
1  2455 A   n 
1  2456 U   n 
1  2457 U   n 
1  2458 G   n 
1  2459 A   n 
1  2460 U   n 
1  2461 G   n 
1  2462 A   n 
1  2463 C   n 
1  2464 A   n 
1  2465 G   n 
1  2466 A   n 
1  2467 A   n 
1  2468 A   n 
1  2469 A   n 
1  2470 G   n 
1  2471 C   n 
1  2472 U   n 
1  2473 A   n 
1  2474 C   n 
1  2475 C   n 
1  2476 C   n 
1  2477 U   n 
1  2478 A   n 
1  2479 G   n 
1  2480 G   n 
1  2481 G   n 
1  2482 A   n 
1  2483 U   n 
1  2484 A   n 
1  2485 A   n 
1  2486 C   n 
1  2487 A   n 
1  2488 G   n 
1  2489 A   n 
1  2490 G   n 
1  2491 U   n 
1  2492 C   n 
1  2493 G   n 
1  2494 U   n 
1  2495 C   n 
1  2496 A   n 
1  2497 C   n 
1  2498 U   n 
1  2499 C   n 
1  2500 G   n 
1  2501 C   n 
1  2502 A   n 
1  2503 A   n 
1  2504 G   n 
1  2505 A   n 
1  2506 G   n 
1  2507 C   n 
1  2508 A   n 
1  2509 C   n 
1  2510 A   n 
1  2511 U   n 
1  2512 A   n 
1  2513 U   n 
1  2514 C   n 
1  2515 G   n 
1  2516 A   n 
1  2517 C   n 
1  2518 C   n 
1  2519 G   n 
1  2520 A   n 
1  2521 G   n 
1  2522 U   n 
1  2523 G   n 
1  2524 G   n 
1  2525 C   n 
1  2526 U   n 
1  2527 U   n 
1  2528 G   n 
1  2529 C   n 
1  2530 U   n 
1  2531 A   n 
1  2532 C   n 
1  2533 C   n 
1  2534 U   n 
1  2535 C   n 
1  2536 G   n 
1  2537 A   n 
1  2538 U   n 
1  2539 G   n 
1  2540 U   n 
1  2541 C   n 
1  2542 G   n 
1  2543 G   n 
1  2544 U   n 
1  2545 U   n 
1  2546 C   n 
1  2547 C   n 
1  2548 C   n 
1  2549 U   n 
1  2550 C   n 
1  2551 C   n 
1  2552 A   n 
1  2553 U   n 
1  2554 C   n 
1  2555 C   n 
1  2556 U   n 
1  2557 G   n 
1  2558 C   n 
1  2559 C   n 
1  2560 C   n 
1  2561 G   n 
1  2562 U   n 
1  2563 G   n 
1  2564 C   n 
1  2565 A   n 
1  2566 G   n 
1  2567 A   n 
1  2568 A   n 
1  2569 G   n 
1  2570 C   n 
1  2571 G   n 
1  2572 G   n 
1  2573 G   n 
1  2574 C   n 
1  2575 A   n 
1  2576 A   n 
1  2577 G   n 
1  2578 G   n 
1  2579 G   n 
1  2580 U   n 
1  2581 G   n 
1  2582 A   n 
1  2583 G   n 
1  2584 G   n 
1  2585 U   n 
1  2586 U   n 
1  2587 G   n 
1  2588 U   n 
1  2589 U   n 
1  2590 C   n 
1  2591 G   n 
1  2592 C   n 
1  2593 C   n 
1  2594 U   n 
1  2595 A   n 
1  2596 U   n 
1  2597 U   n 
1  2598 A   n 
1  2599 A   n 
1  2600 A   n 
1  2601 G   n 
1  2602 G   n 
1  2603 A   n 
1  2604 G   n 
1  2605 G   n 
1  2606 U   n 
1  2607 C   n 
1  2608 G   n 
1  2609 U   n 
1  2610 G   n 
1  2611 A   n 
1  2612 G   n 
1  2613 C   n 
1  2614 U   n 
1  2615 G   n 
1  2616 G   n 
1  2617 G   n 
1  2618 U   n 
1  2619 U   n 
1  2620 U   n 
1  2621 A   n 
1  2622 G   n 
1  2623 A   n 
1  2624 C   n 
1  2625 C   n 
1  2626 G   n 
1  2627 U   n 
1  2628 C   n 
1  2629 G   n 
1  2630 U   n 
1  2631 G   n 
1  2632 A   n 
1  2633 G   n 
1  2634 A   n 
1  2635 C   n 
1  2636 A   n 
1  2637 G   n 
1  2638 G   n 
1  2639 U   n 
1  2640 C   n 
1  2641 G   n 
1  2642 G   n 
1  2643 C   n 
1  2644 U   n 
1  2645 G   n 
1  2646 C   n 
1  2647 U   n 
1  2648 A   n 
1  2649 U   n 
1  2650 C   n 
1  2651 U   n 
1  2652 A   n 
1  2653 C   n 
1  2654 U   n 
1  2655 G   n 
1  2656 G   n 
1  2657 G   n 
1  2658 U   n 
1  2659 G   n 
1  2660 U   n 
1  2661 G   n 
1  2662 U   n 
1  2663 A   n 
1  2664 A   n 
1  2665 U   n 
1  2666 G   n 
1  2667 G   n 
1  2668 U   n 
1  2669 G   n 
1  2670 U   n 
1  2671 C   n 
1  2672 U   n 
1  2673 G   n 
1  2674 A   n 
1  2675 C   n 
1  2676 A   n 
1  2677 A   n 
1  2678 G   n 
1  2679 A   n 
1  2680 A   n 
1  2681 C   n 
1  2682 G   n 
1  2683 A   n 
1  2684 C   n 
1  2685 C   n 
1  2686 G   n 
1  2687 U   n 
1  2688 A   n 
1  2689 U   n 
1  2690 A   n 
1  2691 G   n 
1  2692 U   n 
1  2693 A   n 
1  2694 C   n 
1  2695 G   n 
1  2696 A   n 
1  2697 G   n 
1  2698 A   n 
1  2699 G   n 
1  2700 G   n 
1  2701 A   n 
1  2702 A   n 
1  2703 C   n 
1  2704 U   n 
1  2705 A   n 
1  2706 C   n 
1  2707 G   n 
1  2708 G   n 
1  2709 U   n 
1  2710 U   n 
1  2711 G   n 
1  2712 G   n 
1  2713 U   n 
1  2714 G   n 
1  2715 G   n 
1  2716 C   n 
1  2717 C   n 
1  2718 A   n 
1  2719 C   n 
1  2720 U   n 
1  2721 G   n 
1  2722 G   n 
1  2723 U   n 
1  2724 G   n 
1  2725 U   n 
1  2726 A   n 
1  2727 C   n 
1  2728 C   n 
1  2729 G   n 
1  2730 G   n 
1  2731 U   n 
1  2732 U   n 
1  2733 G   n 
1  2734 U   n 
1  2735 U   n 
1  2736 C   n 
1  2737 G   n 
1  2738 A   n 
1  2739 G   n 
1  2740 A   n 
1  2741 G   n 
1  2742 A   n 
1  2743 G   n 
1  2744 C   n 
1  2745 A   n 
1  2746 C   n 
1  2747 G   n 
1  2748 U   n 
1  2749 G   n 
1  2750 C   n 
1  2751 C   n 
1  2752 G   n 
1  2753 G   n 
1  2754 G   n 
1  2755 U   n 
1  2756 A   n 
1  2757 G   n 
1  2758 C   n 
1  2759 C   n 
1  2760 A   n 
1  2761 C   n 
1  2762 G   n 
1  2763 C   n 
1  2764 C   n 
1  2765 A   n 
1  2766 C   n 
1  2767 A   n 
1  2768 C   n 
1  2769 G   n 
1  2770 G   n 
1  2771 G   n 
1  2772 G   n 
1  2773 U   n 
1  2774 A   n 
1  2775 A   n 
1  2776 G   n 
1  2777 A   n 
1  2778 G   n 
1  2779 C   n 
1  2780 U   n 
1  2781 G   n 
1  2782 A   n 
1  2783 A   n 
1  2784 C   n 
1  2785 G   n 
1  2786 C   n 
1  2787 A   n 
1  2788 U   n 
1  2789 C   n 
1  2790 U   n 
1  2791 A   n 
1  2792 A   n 
1  2793 G   n 
1  2794 C   n 
1  2795 U   n 
1  2796 C   n 
1  2797 G   n 
1  2798 A   n 
1  2799 A   n 
1  2800 A   n 
1  2801 C   n 
1  2802 C   n 
1  2803 C   n 
1  2804 A   n 
1  2805 C   n 
1  2806 U   n 
1  2807 U   n 
1  2808 G   n 
1  2809 G   n 
1  2810 A   n 
1  2811 A   n 
1  2812 A   n 
1  2813 A   n 
1  2814 G   n 
1  2815 A   n 
1  2816 G   n 
1  2817 A   n 
1  2818 C   n 
1  2819 A   n 
1  2820 C   n 
1  2821 C   n 
1  2822 G   n 
1  2823 C   n 
1  2824 C   n 
1  2825 G   n 
1  2826 A   n 
1  2827 G   n 
1  2828 G   n 
1  2829 U   n 
1  2830 C   n 
1  2831 C   n 
1  2832 C   n 
1  2833 G   n 
1  2834 C   n 
1  2835 G   n 
1  2836 U   n 
1  2837 A   n 
1  2838 C   n 
1  2839 A   n 
1  2840 A   n 
1  2841 G   n 
1  2842 A   n 
1  2843 C   n 
1  2844 G   n 
1  2845 C   n 
1  2846 G   n 
1  2847 G   n 
1  2848 U   n 
1  2849 C   n 
1  2850 G   n 
1  2851 A   n 
1  2852 U   n 
1  2853 A   n 
1  2854 G   n 
1  2855 A   n 
1  2856 C   n 
1  2857 U   n 
1  2858 C   n 
1  2859 G   n 
1  2860 G   n 
1  2861 G   n 
1  2862 G   n 
1  2863 U   n 
1  2864 G   n 
1  2865 U   n 
1  2866 G   n 
1  2867 C   n 
1  2868 G   n 
1  2869 C   n 
1  2870 G   n 
1  2871 U   n 
1  2872 C   n 
1  2873 G   n 
1  2874 A   n 
1  2875 G   n 
1  2876 G   n 
1  2877 U   n 
1  2878 A   n 
1  2879 A   n 
1  2880 C   n 
1  2881 G   n 
1  2882 A   n 
1  2883 G   n 
1  2884 A   n 
1  2885 C   n 
1  2886 G   n 
1  2887 U   n 
1  2888 U   n 
1  2889 A   n 
1  2890 A   n 
1  2891 G   n 
1  2892 C   n 
1  2893 C   n 
1  2894 C   n 
1  2895 A   n 
1  2896 C   n 
1  2897 G   n 
1  2898 A   n 
1  2899 G   n 
1  2900 C   n 
1  2901 A   n 
1  2902 C   n 
1  2903 U   n 
1  2904 A   n 
1  2905 A   n 
1  2906 C   n 
1  2907 A   n 
1  2908 G   n 
1  2909 A   n 
1  2910 C   n 
1  2911 C   n 
1  2912 A   n 
1  2913 A   n 
1  2914 A   n 
1  2915 G   n 
1  2916 C   n 
1  2917 C   n 
1  2918 A   n 
1  2919 U   n 
1  2920 C   n 
1  2921 A   n 
1  2922 U   n 
2  1    U   n 
2  2    U   n 
2  3    A   n 
2  4    G   n 
2  5    G   n 
2  6    C   n 
2  7    G   n 
2  8    G   n 
2  9    C   n 
2  10   C   n 
2  11   A   n 
2  12   C   n 
2  13   A   n 
2  14   G   n 
2  15   C   n 
2  16   G   n 
2  17   G   n 
2  18   U   n 
2  19   G   n 
2  20   G   n 
2  21   G   n 
2  22   G   n 
2  23   U   n 
2  24   U   n 
2  25   G   n 
2  26   C   n 
2  27   C   n 
2  28   U   n 
2  29   C   n 
2  30   C   n 
2  31   C   n 
2  32   G   n 
2  33   U   n 
2  34   A   n 
2  35   C   n 
2  36   C   n 
2  37   C   n 
2  38   A   n 
2  39   U   n 
2  40   C   n 
2  41   C   n 
2  42   C   n 
2  43   G   n 
2  44   A   n 
2  45   A   n 
2  46   C   n 
2  47   A   n 
2  48   C   n 
2  49   G   n 
2  50   G   n 
2  51   A   n 
2  52   A   n 
2  53   G   n 
2  54   A   n 
2  55   U   n 
2  56   A   n 
2  57   A   n 
2  58   G   n 
2  59   C   n 
2  60   C   n 
2  61   C   n 
2  62   A   n 
2  63   C   n 
2  64   C   n 
2  65   A   n 
2  66   G   n 
2  67   C   n 
2  68   G   n 
2  69   U   n 
2  70   U   n 
2  71   C   n 
2  72   C   n 
2  73   G   n 
2  74   G   n 
2  75   G   n 
2  76   G   n 
2  77   A   n 
2  78   G   n 
2  79   U   n 
2  80   A   n 
2  81   C   n 
2  82   U   n 
2  83   G   n 
2  84   G   n 
2  85   A   n 
2  86   G   n 
2  87   U   n 
2  88   G   n 
2  89   C   n 
2  90   G   n 
2  91   C   n 
2  92   G   n 
2  93   A   n 
2  94   G   n 
2  95   C   n 
2  96   C   n 
2  97   U   n 
2  98   C   n 
2  99   U   n 
2  100  G   n 
2  101  G   n 
2  102  G   n 
2  103  A   n 
2  104  A   n 
2  105  A   n 
2  106  C   n 
2  107  C   n 
2  108  C   n 
2  109  G   n 
2  110  G   n 
2  111  U   n 
2  112  U   n 
2  113  C   n 
2  114  G   n 
2  115  C   n 
2  116  C   n 
2  117  G   n 
2  118  C   n 
2  119  C   n 
2  120  A   n 
2  121  C   n 
2  122  C   n 
3  1    GLY n 
3  2    ARG n 
3  3    ARG n 
3  4    ILE n 
3  5    GLN n 
3  6    GLY n 
3  7    GLN n 
3  8    ARG n 
3  9    ARG n 
3  10   GLY n 
3  11   ARG n 
3  12   GLY n 
3  13   THR n 
3  14   SER n 
3  15   THR n 
3  16   PHE n 
3  17   ARG n 
3  18   ALA n 
3  19   PRO n 
3  20   SER n 
3  21   HIS n 
3  22   ARG n 
3  23   TYR n 
3  24   LYS n 
3  25   ALA n 
3  26   ASP n 
3  27   LEU n 
3  28   GLU n 
3  29   HIS n 
3  30   ARG n 
3  31   LYS n 
3  32   VAL n 
3  33   GLU n 
3  34   ASP n 
3  35   GLY n 
3  36   ASP n 
3  37   VAL n 
3  38   ILE n 
3  39   ALA n 
3  40   GLY n 
3  41   THR n 
3  42   VAL n 
3  43   VAL n 
3  44   ASP n 
3  45   ILE n 
3  46   GLU n 
3  47   HIS n 
3  48   ASP n 
3  49   PRO n 
3  50   ALA n 
3  51   ARG n 
3  52   SER n 
3  53   ALA n 
3  54   PRO n 
3  55   VAL n 
3  56   ALA n 
3  57   ALA n 
3  58   VAL n 
3  59   GLU n 
3  60   PHE n 
3  61   GLU n 
3  62   ASP n 
3  63   GLY n 
3  64   ASP n 
3  65   ARG n 
3  66   ARG n 
3  67   LEU n 
3  68   ILE n 
3  69   LEU n 
3  70   ALA n 
3  71   PRO n 
3  72   GLU n 
3  73   GLY n 
3  74   VAL n 
3  75   GLY n 
3  76   VAL n 
3  77   GLY n 
3  78   ASP n 
3  79   GLU n 
3  80   LEU n 
3  81   GLN n 
3  82   VAL n 
3  83   GLY n 
3  84   VAL n 
3  85   ASP n 
3  86   ALA n 
3  87   GLU n 
3  88   ILE n 
3  89   ALA n 
3  90   PRO n 
3  91   GLY n 
3  92   ASN n 
3  93   THR n 
3  94   LEU n 
3  95   PRO n 
3  96   LEU n 
3  97   ALA n 
3  98   GLU n 
3  99   ILE n 
3  100  PRO n 
3  101  GLU n 
3  102  GLY n 
3  103  VAL n 
3  104  PRO n 
3  105  VAL n 
3  106  CYS n 
3  107  ASN n 
3  108  VAL n 
3  109  GLU n 
3  110  SER n 
3  111  SER n 
3  112  PRO n 
3  113  GLY n 
3  114  ASP n 
3  115  GLY n 
3  116  GLY n 
3  117  LYS n 
3  118  PHE n 
3  119  ALA n 
3  120  ARG n 
3  121  ALA n 
3  122  SER n 
3  123  GLY n 
3  124  VAL n 
3  125  ASN n 
3  126  ALA n 
3  127  GLN n 
3  128  LEU n 
3  129  LEU n 
3  130  THR n 
3  131  HIS n 
3  132  ASP n 
3  133  ARG n 
3  134  ASN n 
3  135  VAL n 
3  136  ALA n 
3  137  VAL n 
3  138  VAL n 
3  139  LYS n 
3  140  LEU n 
3  141  PRO n 
3  142  SER n 
3  143  GLY n 
3  144  GLU n 
3  145  MET n 
3  146  LYS n 
3  147  ARG n 
3  148  LEU n 
3  149  ASP n 
3  150  PRO n 
3  151  GLN n 
3  152  CYS n 
3  153  ARG n 
3  154  ALA n 
3  155  THR n 
3  156  ILE n 
3  157  GLY n 
3  158  VAL n 
3  159  VAL n 
3  160  GLY n 
3  161  GLY n 
3  162  GLY n 
3  163  GLY n 
3  164  ARG n 
3  165  THR n 
3  166  ASP n 
3  167  LYS n 
3  168  PRO n 
3  169  PHE n 
3  170  VAL n 
3  171  LYS n 
3  172  ALA n 
3  173  GLY n 
3  174  ASN n 
3  175  LYS n 
3  176  HIS n 
3  177  HIS n 
3  178  LYS n 
3  179  MET n 
3  180  LYS n 
3  181  ALA n 
3  182  ARG n 
3  183  GLY n 
3  184  THR n 
3  185  LYS n 
3  186  TRP n 
3  187  PRO n 
3  188  ASN n 
3  189  VAL n 
3  190  ARG n 
3  191  GLY n 
3  192  VAL n 
3  193  ALA n 
3  194  MET n 
3  195  ASN n 
3  196  ALA n 
3  197  VAL n 
3  198  ASP n 
3  199  HIS n 
3  200  PRO n 
3  201  PHE n 
3  202  GLY n 
3  203  GLY n 
3  204  GLY n 
3  205  GLY n 
3  206  ARG n 
3  207  GLN n 
3  208  HIS n 
3  209  PRO n 
3  210  GLY n 
3  211  LYS n 
3  212  PRO n 
3  213  LYS n 
3  214  SER n 
3  215  ILE n 
3  216  SER n 
3  217  ARG n 
3  218  ASN n 
3  219  ALA n 
3  220  PRO n 
3  221  PRO n 
3  222  GLY n 
3  223  ARG n 
3  224  LYS n 
3  225  VAL n 
3  226  GLY n 
3  227  ASP n 
3  228  ILE n 
3  229  ALA n 
3  230  SER n 
3  231  LYS n 
3  232  ARG n 
3  233  THR n 
3  234  GLY n 
3  235  ARG n 
3  236  GLY n 
3  237  GLY n 
3  238  ASN n 
3  239  GLU n 
4  1    PRO n 
4  2    GLN n 
4  3    PRO n 
4  4    SER n 
4  5    ARG n 
4  6    PRO n 
4  7    ARG n 
4  8    LYS n 
4  9    GLY n 
4  10   SER n 
4  11   LEU n 
4  12   GLY n 
4  13   PHE n 
4  14   GLY n 
4  15   PRO n 
4  16   ARG n 
4  17   LYS n 
4  18   ARG n 
4  19   SER n 
4  20   THR n 
4  21   SER n 
4  22   GLU n 
4  23   THR n 
4  24   PRO n 
4  25   ARG n 
4  26   PHE n 
4  27   ASN n 
4  28   SER n 
4  29   TRP n 
4  30   PRO n 
4  31   SER n 
4  32   ASP n 
4  33   ASP n 
4  34   GLY n 
4  35   GLN n 
4  36   PRO n 
4  37   GLY n 
4  38   VAL n 
4  39   GLN n 
4  40   GLY n 
4  41   PHE n 
4  42   ALA n 
4  43   GLY n 
4  44   TYR n 
4  45   LYS n 
4  46   ALA n 
4  47   GLY n 
4  48   MET n 
4  49   THR n 
4  50   HIS n 
4  51   VAL n 
4  52   VAL n 
4  53   LEU n 
4  54   VAL n 
4  55   ASN n 
4  56   ASP n 
4  57   GLU n 
4  58   PRO n 
4  59   ASN n 
4  60   SER n 
4  61   PRO n 
4  62   ARG n 
4  63   GLU n 
4  64   GLY n 
4  65   MET n 
4  66   GLU n 
4  67   GLU n 
4  68   THR n 
4  69   VAL n 
4  70   PRO n 
4  71   VAL n 
4  72   THR n 
4  73   VAL n 
4  74   ILE n 
4  75   GLU n 
4  76   THR n 
4  77   PRO n 
4  78   PRO n 
4  79   MET n 
4  80   ARG n 
4  81   ALA n 
4  82   VAL n 
4  83   ALA n 
4  84   LEU n 
4  85   ARG n 
4  86   ALA n 
4  87   TYR n 
4  88   GLU n 
4  89   ASP n 
4  90   THR n 
4  91   PRO n 
4  92   TYR n 
4  93   GLY n 
4  94   GLN n 
4  95   ARG n 
4  96   PRO n 
4  97   LEU n 
4  98   THR n 
4  99   GLU n 
4  100  VAL n 
4  101  TRP n 
4  102  THR n 
4  103  ASP n 
4  104  GLU n 
4  105  PHE n 
4  106  HIS n 
4  107  SER n 
4  108  GLU n 
4  109  LEU n 
4  110  ASP n 
4  111  ARG n 
4  112  THR n 
4  113  LEU n 
4  114  ASP n 
4  115  VAL n 
4  116  PRO n 
4  117  GLU n 
4  118  ASP n 
4  119  HIS n 
4  120  ASP n 
4  121  PRO n 
4  122  ASP n 
4  123  ALA n 
4  124  ALA n 
4  125  GLU n 
4  126  GLU n 
4  127  GLN n 
4  128  ILE n 
4  129  ARG n 
4  130  ASP n 
4  131  ALA n 
4  132  HIS n 
4  133  GLU n 
4  134  ALA n 
4  135  GLY n 
4  136  ASP n 
4  137  LEU n 
4  138  GLY n 
4  139  ASP n 
4  140  LEU n 
4  141  ARG n 
4  142  LEU n 
4  143  ILE n 
4  144  THR n 
4  145  HIS n 
4  146  THR n 
4  147  VAL n 
4  148  PRO n 
4  149  ASP n 
4  150  ALA n 
4  151  VAL n 
4  152  PRO n 
4  153  SER n 
4  154  VAL n 
4  155  PRO n 
4  156  LYS n 
4  157  LYS n 
4  158  LYS n 
4  159  PRO n 
4  160  ASP n 
4  161  VAL n 
4  162  MET n 
4  163  GLU n 
4  164  THR n 
4  165  ARG n 
4  166  VAL n 
4  167  GLY n 
4  168  GLY n 
4  169  GLY n 
4  170  SER n 
4  171  VAL n 
4  172  SER n 
4  173  ASP n 
4  174  ARG n 
4  175  LEU n 
4  176  ASP n 
4  177  HIS n 
4  178  ALA n 
4  179  LEU n 
4  180  ASP n 
4  181  ILE n 
4  182  VAL n 
4  183  GLU n 
4  184  ASP n 
4  185  GLY n 
4  186  GLY n 
4  187  GLU n 
4  188  HIS n 
4  189  ALA n 
4  190  MET n 
4  191  ASN n 
4  192  ASP n 
4  193  ILE n 
4  194  PHE n 
4  195  ARG n 
4  196  ALA n 
4  197  GLY n 
4  198  GLU n 
4  199  TYR n 
4  200  ALA n 
4  201  ASP n 
4  202  VAL n 
4  203  ALA n 
4  204  GLY n 
4  205  VAL n 
4  206  THR n 
4  207  LYS n 
4  208  GLY n 
4  209  LYS n 
4  210  GLY n 
4  211  THR n 
4  212  GLN n 
4  213  GLY n 
4  214  PRO n 
4  215  VAL n 
4  216  LYS n 
4  217  ARG n 
4  218  TRP n 
4  219  GLY n 
4  220  VAL n 
4  221  GLN n 
4  222  LYS n 
4  223  ARG n 
4  224  LYS n 
4  225  GLY n 
4  226  LYS n 
4  227  HIS n 
4  228  ALA n 
4  229  ARG n 
4  230  GLN n 
4  231  GLY n 
4  232  TRP n 
4  233  ARG n 
4  234  ARG n 
4  235  ARG n 
4  236  ILE n 
4  237  GLY n 
4  238  ASN n 
4  239  LEU n 
4  240  GLY n 
4  241  PRO n 
4  242  TRP n 
4  243  ASN n 
4  244  PRO n 
4  245  SER n 
4  246  ARG n 
4  247  VAL n 
4  248  ARG n 
4  249  SER n 
4  250  THR n 
4  251  VAL n 
4  252  PRO n 
4  253  GLN n 
4  254  GLN n 
4  255  GLY n 
4  256  GLN n 
4  257  THR n 
4  258  GLY n 
4  259  TYR n 
4  260  HIS n 
4  261  GLN n 
4  262  ARG n 
4  263  THR n 
4  264  GLU n 
4  265  LEU n 
4  266  ASN n 
4  267  LYS n 
4  268  ARG n 
4  269  LEU n 
4  270  ILE n 
4  271  ASP n 
4  272  ILE n 
4  273  GLY n 
4  274  GLU n 
4  275  GLY n 
4  276  ASP n 
4  277  GLU n 
4  278  PRO n 
4  279  THR n 
4  280  VAL n 
4  281  ASP n 
4  282  GLY n 
4  283  GLY n 
4  284  PHE n 
4  285  VAL n 
4  286  ASN n 
4  287  TYR n 
4  288  GLY n 
4  289  GLU n 
4  290  VAL n 
4  291  ASP n 
4  292  GLY n 
4  293  PRO n 
4  294  TYR n 
4  295  THR n 
4  296  LEU n 
4  297  VAL n 
4  298  LYS n 
4  299  GLY n 
4  300  SER n 
4  301  VAL n 
4  302  PRO n 
4  303  GLY n 
4  304  PRO n 
4  305  ASP n 
4  306  LYS n 
4  307  ARG n 
4  308  LEU n 
4  309  VAL n 
4  310  ARG n 
4  311  PHE n 
4  312  ARG n 
4  313  PRO n 
4  314  ALA n 
4  315  VAL n 
4  316  ARG n 
4  317  PRO n 
4  318  ASN n 
4  319  ASP n 
4  320  GLN n 
4  321  PRO n 
4  322  ARG n 
4  323  LEU n 
4  324  ASP n 
4  325  PRO n 
4  326  GLU n 
4  327  VAL n 
4  328  ARG n 
4  329  TYR n 
4  330  VAL n 
4  331  SER n 
4  332  ASN n 
4  333  GLU n 
4  334  SER n 
4  335  ASN n 
4  336  GLN n 
4  337  GLY n 
5  1    MET n 
5  2    GLN n 
5  3    ALA n 
5  4    THR n 
5  5    ILE n 
5  6    TYR n 
5  7    ASP n 
5  8    LEU n 
5  9    ASP n 
5  10   GLY n 
5  11   ASN n 
5  12   THR n 
5  13   ASP n 
5  14   GLY n 
5  15   GLU n 
5  16   VAL n 
5  17   ASP n 
5  18   LEU n 
5  19   PRO n 
5  20   ASP n 
5  21   VAL n 
5  22   PHE n 
5  23   GLU n 
5  24   THR n 
5  25   PRO n 
5  26   VAL n 
5  27   ARG n 
5  28   SER n 
5  29   ASP n 
5  30   LEU n 
5  31   ILE n 
5  32   GLY n 
5  33   LYS n 
5  34   ALA n 
5  35   VAL n 
5  36   ARG n 
5  37   ALA n 
5  38   ALA n 
5  39   GLN n 
5  40   ALA n 
5  41   ASN n 
5  42   ARG n 
5  43   LYS n 
5  44   GLN n 
5  45   ASP n 
5  46   TYR n 
5  47   GLY n 
5  48   SER n 
5  49   ASP n 
5  50   GLU n 
5  51   TYR n 
5  52   ALA n 
5  53   GLY n 
5  54   LEU n 
5  55   ARG n 
5  56   THR n 
5  57   PRO n 
5  58   ALA n 
5  59   GLU n 
5  60   SER n 
5  61   PHE n 
5  62   GLY n 
5  63   SER n 
5  64   GLY n 
5  65   ARG n 
5  66   GLY n 
5  67   GLN n 
5  68   ALA n 
5  69   HIS n 
5  70   VAL n 
5  71   PRO n 
5  72   LYS n 
5  73   LEU n 
5  74   ASP n 
5  75   GLY n 
5  76   ARG n 
5  77   ALA n 
5  78   ARG n 
5  79   ARG n 
5  80   VAL n 
5  81   PRO n 
5  82   GLN n 
5  83   ALA n 
5  84   VAL n 
5  85   LYS n 
5  86   GLY n 
5  87   ARG n 
5  88   SER n 
5  89   ALA n 
5  90   HIS n 
5  91   PRO n 
5  92   PRO n 
5  93   LYS n 
5  94   THR n 
5  95   GLU n 
5  96   LYS n 
5  97   ASP n 
5  98   ARG n 
5  99   SER n 
5  100  LEU n 
5  101  ASP n 
5  102  LEU n 
5  103  ASN n 
5  104  ASP n 
5  105  LYS n 
5  106  GLU n 
5  107  ARG n 
5  108  GLN n 
5  109  LEU n 
5  110  ALA n 
5  111  VAL n 
5  112  ARG n 
5  113  SER n 
5  114  ALA n 
5  115  LEU n 
5  116  ALA n 
5  117  ALA n 
5  118  THR n 
5  119  ALA n 
5  120  ASP n 
5  121  ALA n 
5  122  ASP n 
5  123  LEU n 
5  124  VAL n 
5  125  ALA n 
5  126  ASP n 
5  127  ARG n 
5  128  GLY n 
5  129  HIS n 
5  130  GLU n 
5  131  PHE n 
5  132  ASP n 
5  133  ARG n 
5  134  ASP n 
5  135  GLU n 
5  136  VAL n 
5  137  PRO n 
5  138  VAL n 
5  139  VAL n 
5  140  VAL n 
5  141  SER n 
5  142  ASP n 
5  143  ASP n 
5  144  PHE n 
5  145  GLU n 
5  146  ASP n 
5  147  LEU n 
5  148  VAL n 
5  149  LYS n 
5  150  THR n 
5  151  GLN n 
5  152  GLU n 
5  153  VAL n 
5  154  VAL n 
5  155  SER n 
5  156  LEU n 
5  157  LEU n 
5  158  GLU n 
5  159  ALA n 
5  160  LEU n 
5  161  ASP n 
5  162  VAL n 
5  163  HIS n 
5  164  ALA n 
5  165  ASP n 
5  166  ILE n 
5  167  ASP n 
5  168  ARG n 
5  169  ALA n 
5  170  ASP n 
5  171  GLU n 
5  172  THR n 
5  173  LYS n 
5  174  ILE n 
5  175  LYS n 
5  176  ALA n 
5  177  GLY n 
5  178  GLN n 
5  179  GLY n 
5  180  SER n 
5  181  ALA n 
5  182  ARG n 
5  183  GLY n 
5  184  ARG n 
5  185  LYS n 
5  186  TYR n 
5  187  ARG n 
5  188  ARG n 
5  189  PRO n 
5  190  ALA n 
5  191  SER n 
5  192  ILE n 
5  193  LEU n 
5  194  PHE n 
5  195  VAL n 
5  196  THR n 
5  197  SER n 
5  198  ASP n 
5  199  GLU n 
5  200  PRO n 
5  201  SER n 
5  202  THR n 
5  203  ALA n 
5  204  ALA n 
5  205  ARG n 
5  206  ASN n 
5  207  LEU n 
5  208  ALA n 
5  209  GLY n 
5  210  ALA n 
5  211  ASP n 
5  212  VAL n 
5  213  ALA n 
5  214  THR n 
5  215  ALA n 
5  216  SER n 
5  217  GLU n 
5  218  VAL n 
5  219  ASN n 
5  220  THR n 
5  221  GLU n 
5  222  ASP n 
5  223  LEU n 
5  224  ALA n 
5  225  PRO n 
5  226  GLY n 
5  227  GLY n 
5  228  ALA n 
5  229  PRO n 
5  230  GLY n 
5  231  ARG n 
5  232  LEU n 
5  233  THR n 
5  234  VAL n 
5  235  PHE n 
5  236  THR n 
5  237  GLU n 
5  238  SER n 
5  239  ALA n 
5  240  LEU n 
5  241  ALA n 
5  242  GLU n 
5  243  VAL n 
5  244  ALA n 
5  245  GLU n 
5  246  ARG n 
6  1    SER n 
6  2    SER n 
6  3    GLU n 
6  4    SER n 
6  5    GLU n 
6  6    SER n 
6  7    GLY n 
6  8    GLY n 
6  9    ASP n 
6  10   PHE n 
6  11   HIS n 
6  12   GLU n 
6  13   MET n 
6  14   ARG n 
6  15   GLU n 
6  16   PRO n 
6  17   ARG n 
6  18   ILE n 
6  19   GLU n 
6  20   LYS n 
6  21   VAL n 
6  22   VAL n 
6  23   VAL n 
6  24   HIS n 
6  25   MET n 
6  26   GLY n 
6  27   ILE n 
6  28   GLY n 
6  29   HIS n 
6  30   GLY n 
6  31   GLY n 
6  32   ARG n 
6  33   ASP n 
6  34   LEU n 
6  35   ALA n 
6  36   ASN n 
6  37   ALA n 
6  38   GLU n 
6  39   ASP n 
6  40   ILE n 
6  41   LEU n 
6  42   GLY n 
6  43   GLU n 
6  44   ILE n 
6  45   THR n 
6  46   GLY n 
6  47   GLN n 
6  48   MET n 
6  49   PRO n 
6  50   VAL n 
6  51   ARG n 
6  52   THR n 
6  53   LYS n 
6  54   ALA n 
6  55   LYS n 
6  56   ARG n 
6  57   THR n 
6  58   VAL n 
6  59   GLY n 
6  60   GLU n 
6  61   PHE n 
6  62   ASP n 
6  63   ILE n 
6  64   ARG n 
6  65   GLU n 
6  66   GLY n 
6  67   ASP n 
6  68   PRO n 
6  69   ILE n 
6  70   GLY n 
6  71   ALA n 
6  72   LYS n 
6  73   VAL n 
6  74   THR n 
6  75   LEU n 
6  76   ARG n 
6  77   ASP n 
6  78   GLU n 
6  79   MET n 
6  80   ALA n 
6  81   GLU n 
6  82   GLU n 
6  83   PHE n 
6  84   LEU n 
6  85   GLN n 
6  86   THR n 
6  87   ALA n 
6  88   LEU n 
6  89   PRO n 
6  90   LEU n 
6  91   ALA n 
6  92   GLU n 
6  93   LEU n 
6  94   ALA n 
6  95   THR n 
6  96   SER n 
6  97   GLN n 
6  98   PHE n 
6  99   ASP n 
6  100  ASP n 
6  101  THR n 
6  102  GLY n 
6  103  ASN n 
6  104  PHE n 
6  105  SER n 
6  106  PHE n 
6  107  GLY n 
6  108  VAL n 
6  109  GLU n 
6  110  GLU n 
6  111  HIS n 
6  112  THR n 
6  113  GLU n 
6  114  PHE n 
6  115  PRO n 
6  116  SER n 
6  117  GLN n 
6  118  GLU n 
6  119  TYR n 
6  120  ASP n 
6  121  PRO n 
6  122  SER n 
6  123  ILE n 
6  124  GLY n 
6  125  ILE n 
6  126  TYR n 
6  127  GLY n 
6  128  LEU n 
6  129  ASP n 
6  130  VAL n 
6  131  THR n 
6  132  VAL n 
6  133  ASN n 
6  134  LEU n 
6  135  VAL n 
6  136  ARG n 
6  137  PRO n 
6  138  GLY n 
6  139  TYR n 
6  140  ARG n 
6  141  VAL n 
6  142  ALA n 
6  143  LYS n 
6  144  ARG n 
6  145  ASP n 
6  146  LYS n 
6  147  ALA n 
6  148  SER n 
6  149  ARG n 
6  150  SER n 
6  151  ILE n 
6  152  PRO n 
6  153  THR n 
6  154  LYS n 
6  155  HIS n 
6  156  ARG n 
6  157  LEU n 
6  158  ASN n 
6  159  PRO n 
6  160  ALA n 
6  161  ASP n 
6  162  ALA n 
6  163  VAL n 
6  164  ALA n 
6  165  PHE n 
6  166  ILE n 
6  167  GLU n 
6  168  SER n 
6  169  THR n 
6  170  TYR n 
6  171  ASP n 
6  172  VAL n 
6  173  GLU n 
6  174  VAL n 
6  175  SER n 
6  176  GLU n 
7  1    PRO n 
7  2    ARG n 
7  3    VAL n 
7  4    GLU n 
7  5    LEU n 
7  6    GLU n 
7  7    ILE n 
7  8    PRO n 
7  9    GLU n 
7  10   ASP n 
7  11   VAL n 
7  12   ASP n 
7  13   ALA n 
7  14   GLU n 
7  15   GLN n 
7  16   ASP n 
7  17   HIS n 
7  18   LEU n 
7  19   ASP n 
7  20   ILE n 
7  21   THR n 
7  22   VAL n 
7  23   GLU n 
7  24   GLY n 
7  25   ASP n 
7  26   ASN n 
7  27   GLY n 
7  28   SER n 
7  29   VAL n 
7  30   THR n 
7  31   ARG n 
7  32   ARG n 
7  33   LEU n 
7  34   TRP n 
7  35   TYR n 
7  36   PRO n 
7  37   ASP n 
7  38   ILE n 
7  39   ASP n 
7  40   VAL n 
7  41   SER n 
7  42   VAL n 
7  43   ASP n 
7  44   GLY n 
7  45   ASP n 
7  46   THR n 
7  47   VAL n 
7  48   VAL n 
7  49   ILE n 
7  50   GLU n 
7  51   SER n 
7  52   ASP n 
7  53   GLU n 
7  54   ASP n 
7  55   ASN n 
7  56   ALA n 
7  57   LYS n 
7  58   THR n 
7  59   MET n 
7  60   SER n 
7  61   THR n 
7  62   ILE n 
7  63   GLY n 
7  64   THR n 
7  65   PHE n 
7  66   GLN n 
7  67   SER n 
7  68   HIS n 
7  69   ILE n 
7  70   GLU n 
7  71   ASN n 
7  72   MET n 
7  73   PHE n 
7  74   HIS n 
7  75   GLY n 
7  76   VAL n 
7  77   THR n 
7  78   GLU n 
7  79   GLY n 
7  80   TRP n 
7  81   GLU n 
7  82   TYR n 
7  83   GLY n 
7  84   MET n 
7  85   GLU n 
7  86   VAL n 
7  87   PHE n 
7  88   TYR n 
7  89   SER n 
7  90   HIS n 
7  91   PHE n 
7  92   PRO n 
7  93   MET n 
7  94   GLN n 
7  95   VAL n 
7  96   ASN n 
7  97   VAL n 
7  98   GLU n 
7  99   GLY n 
7  100  ASP n 
7  101  GLU n 
7  102  VAL n 
7  103  VAL n 
7  104  ILE n 
7  105  GLU n 
7  106  ASN n 
7  107  PHE n 
7  108  LEU n 
7  109  GLY n 
7  110  GLU n 
7  111  LYS n 
7  112  ALA n 
7  113  PRO n 
7  114  ARG n 
7  115  ARG n 
7  116  THR n 
7  117  THR n 
7  118  ILE n 
7  119  HIS n 
7  120  GLY n 
7  121  ASP n 
7  122  THR n 
7  123  ASP n 
7  124  VAL n 
7  125  GLU n 
7  126  ILE n 
7  127  ASP n 
7  128  GLY n 
7  129  GLU n 
7  130  GLU n 
7  131  LEU n 
7  132  THR n 
7  133  VAL n 
7  134  SER n 
7  135  GLY n 
7  136  PRO n 
7  137  ASP n 
7  138  ILE n 
7  139  GLU n 
7  140  ALA n 
7  141  VAL n 
7  142  GLY n 
7  143  GLN n 
7  144  THR n 
7  145  ALA n 
7  146  ALA n 
7  147  ASP n 
7  148  ILE n 
7  149  GLU n 
7  150  GLN n 
7  151  LEU n 
7  152  THR n 
7  153  ARG n 
7  154  ILE n 
7  155  ASN n 
7  156  ASP n 
7  157  LYS n 
7  158  ASP n 
7  159  VAL n 
7  160  ARG n 
7  161  VAL n 
7  162  PHE n 
7  163  GLN n 
7  164  ASP n 
7  165  GLY n 
7  166  VAL n 
7  167  TYR n 
7  168  ILE n 
7  169  THR n 
7  170  ARG n 
7  171  LYS n 
7  172  PRO n 
7  173  ASN n 
7  174  ARG n 
7  175  GLY n 
7  176  ASP n 
7  177  ALA n 
8  1    PRO n 
8  2    VAL n 
8  3    TYR n 
8  4    VAL n 
8  5    ASP n 
8  6    PHE n 
8  7    ASP n 
8  8    VAL n 
8  9    PRO n 
8  10   ALA n 
8  11   ASP n 
8  12   LEU n 
8  13   GLU n 
8  14   ASP n 
8  15   ASP n 
8  16   ALA n 
8  17   LEU n 
8  18   GLU n 
8  19   ALA n 
8  20   LEU n 
8  21   GLU n 
8  22   VAL n 
8  23   ALA n 
8  24   ARG n 
8  25   ASP n 
8  26   THR n 
8  27   GLY n 
8  28   ALA n 
8  29   VAL n 
8  30   LYS n 
8  31   LYS n 
8  32   GLY n 
8  33   THR n 
8  34   ASN n 
8  35   GLU n 
8  36   THR n 
8  37   THR n 
8  38   LYS n 
8  39   SER n 
8  40   ILE n 
8  41   GLU n 
8  42   ARG n 
8  43   GLY n 
8  44   SER n 
8  45   ALA n 
8  46   GLU n 
8  47   LEU n 
8  48   VAL n 
8  49   PHE n 
8  50   VAL n 
8  51   ALA n 
8  52   GLU n 
8  53   ASP n 
8  54   VAL n 
8  55   GLN n 
8  56   PRO n 
8  57   GLU n 
8  58   GLU n 
8  59   ILE n 
8  60   VAL n 
8  61   MET n 
8  62   HIS n 
8  63   ILE n 
8  64   PRO n 
8  65   GLU n 
8  66   LEU n 
8  67   ALA n 
8  68   ASP n 
8  69   GLU n 
8  70   LYS n 
8  71   GLY n 
8  72   VAL n 
8  73   PRO n 
8  74   PHE n 
8  75   ILE n 
8  76   PHE n 
8  77   VAL n 
8  78   GLU n 
8  79   GLN n 
8  80   GLN n 
8  81   ASP n 
8  82   ASP n 
8  83   LEU n 
8  84   GLY n 
8  85   HIS n 
8  86   ALA n 
8  87   ALA n 
8  88   GLY n 
8  89   LEU n 
8  90   GLU n 
8  91   VAL n 
8  92   GLY n 
8  93   SER n 
8  94   ALA n 
8  95   ALA n 
8  96   ALA n 
8  97   ALA n 
8  98   VAL n 
8  99   THR n 
8  100  ASP n 
8  101  ALA n 
8  102  GLY n 
8  103  ALA n 
8  104  ALA n 
8  105  ALA n 
8  106  THR n 
8  107  VAL n 
8  108  LEU n 
8  109  GLU n 
8  110  GLU n 
8  111  ILE n 
8  112  ALA n 
8  113  ASP n 
8  114  LYS n 
8  115  VAL n 
8  116  GLU n 
8  117  GLU n 
8  118  LEU n 
8  119  ARG n 
9  1    MET n 
9  2    SER n 
9  3    ALA n 
9  4    GLU n 
9  5    SER n 
9  6    GLU n 
9  7    ARG n 
9  8    LYS n 
9  9    THR n 
9  10   GLU n 
9  11   THR n 
9  12   ILE n 
9  13   PRO n 
9  14   GLU n 
9  15   TRP n 
9  16   LYS n 
9  17   GLN n 
9  18   GLU n 
9  19   GLU n 
9  20   VAL n 
9  21   ASP n 
9  22   ALA n 
9  23   ILE n 
9  24   VAL n 
9  25   GLU n 
9  26   MET n 
9  27   ILE n 
9  28   GLU n 
9  29   SER n 
9  30   TYR n 
9  31   GLU n 
9  32   SER n 
9  33   VAL n 
9  34   GLY n 
9  35   VAL n 
9  36   VAL n 
9  37   ASN n 
9  38   ILE n 
9  39   ALA n 
9  40   GLY n 
9  41   ILE n 
9  42   PRO n 
9  43   SER n 
9  44   ARG n 
9  45   GLN n 
9  46   LEU n 
9  47   GLN n 
9  48   ASP n 
9  49   MET n 
9  50   ARG n 
9  51   ARG n 
9  52   ASP n 
9  53   LEU n 
9  54   HIS n 
9  55   GLY n 
9  56   THR n 
9  57   ALA n 
9  58   GLU n 
9  59   LEU n 
9  60   ARG n 
9  61   VAL n 
9  62   SER n 
9  63   ARG n 
9  64   ASN n 
9  65   THR n 
9  66   LEU n 
9  67   LEU n 
9  68   GLU n 
9  69   ARG n 
9  70   ALA n 
9  71   LEU n 
9  72   ASP n 
9  73   ASP n 
9  74   VAL n 
9  75   ASP n 
9  76   ASP n 
9  77   GLY n 
9  78   LEU n 
9  79   GLU n 
9  80   ASP n 
9  81   LEU n 
9  82   ASN n 
9  83   GLY n 
9  84   TYR n 
9  85   ILE n 
9  86   THR n 
9  87   GLY n 
9  88   GLN n 
9  89   VAL n 
9  90   GLY n 
9  91   LEU n 
9  92   ILE n 
9  93   GLY n 
9  94   THR n 
9  95   ASP n 
9  96   ASP n 
9  97   ASN n 
9  98   PRO n 
9  99   PHE n 
9  100  SER n 
9  101  LEU n 
9  102  PHE n 
9  103  GLN n 
9  104  GLU n 
9  105  LEU n 
9  106  GLU n 
9  107  ALA n 
9  108  SER n 
9  109  LYS n 
9  110  THR n 
9  111  PRO n 
9  112  ALA n 
9  113  PRO n 
9  114  ILE n 
9  115  GLY n 
9  116  ALA n 
9  117  GLY n 
9  118  GLU n 
9  119  VAL n 
9  120  ALA n 
9  121  PRO n 
9  122  ASN n 
9  123  ASP n 
9  124  ILE n 
9  125  VAL n 
9  126  ILE n 
9  127  PRO n 
9  128  GLU n 
9  129  GLY n 
9  130  ASP n 
9  131  THR n 
9  132  GLY n 
9  133  VAL n 
9  134  ASP n 
9  135  PRO n 
9  136  GLY n 
9  137  PRO n 
9  138  PHE n 
9  139  VAL n 
9  140  GLY n 
9  141  GLU n 
9  142  LEU n 
9  143  GLN n 
9  144  SER n 
9  145  VAL n 
9  146  GLY n 
9  147  ALA n 
9  148  ASP n 
9  149  ALA n 
9  150  ARG n 
9  151  ILE n 
9  152  GLN n 
9  153  GLU n 
9  154  GLY n 
9  155  SER n 
9  156  ILE n 
9  157  GLN n 
9  158  VAL n 
9  159  LEU n 
9  160  SER n 
9  161  ASP n 
9  162  SER n 
9  163  THR n 
9  164  VAL n 
9  165  LEU n 
9  166  ASP n 
9  167  THR n 
9  168  GLY n 
9  169  GLU n 
9  170  GLU n 
9  171  VAL n 
9  172  SER n 
9  173  GLN n 
9  174  GLU n 
9  175  LEU n 
9  176  SER n 
9  177  ASN n 
9  178  VAL n 
9  179  LEU n 
9  180  ASN n 
9  181  GLU n 
9  182  LEU n 
9  183  GLY n 
9  184  ILE n 
9  185  GLU n 
9  186  PRO n 
9  187  LYS n 
9  188  GLU n 
9  189  VAL n 
9  190  GLY n 
9  191  LEU n 
9  192  ASP n 
9  193  LEU n 
9  194  ARG n 
9  195  ALA n 
9  196  VAL n 
9  197  PHE n 
9  198  ALA n 
9  199  ASP n 
9  200  GLY n 
9  201  VAL n 
9  202  LEU n 
9  203  PHE n 
9  204  GLU n 
9  205  PRO n 
9  206  GLU n 
9  207  GLU n 
9  208  LEU n 
9  209  GLU n 
9  210  LEU n 
9  211  ASP n 
9  212  ILE n 
9  213  ASP n 
9  214  GLU n 
9  215  TYR n 
9  216  ARG n 
9  217  SER n 
9  218  ASP n 
9  219  ILE n 
9  220  GLN n 
9  221  ALA n 
9  222  ALA n 
9  223  ALA n 
9  224  GLY n 
9  225  ARG n 
9  226  ALA n 
9  227  PHE n 
9  228  ASN n 
9  229  LEU n 
9  230  SER n 
9  231  VAL n 
9  232  ASN n 
9  233  ALA n 
9  234  ASP n 
9  235  TYR n 
9  236  PRO n 
9  237  THR n 
9  238  ALA n 
9  239  THR n 
9  240  THR n 
9  241  ALA n 
9  242  PRO n 
9  243  THR n 
9  244  MET n 
9  245  LEU n 
9  246  GLN n 
9  247  SER n 
9  248  ASP n 
9  249  ARG n 
9  250  GLY n 
9  251  ASN n 
9  252  ALA n 
9  253  LYS n 
9  254  SER n 
9  255  LEU n 
9  256  ALA n 
9  257  LEU n 
9  258  GLN n 
9  259  ALA n 
9  260  ALA n 
9  261  ILE n 
9  262  GLU n 
9  263  ASP n 
9  264  PRO n 
9  265  GLU n 
9  266  VAL n 
9  267  VAL n 
9  268  PRO n 
9  269  ASP n 
9  270  LEU n 
9  271  VAL n 
9  272  SER n 
9  273  LYS n 
9  274  ALA n 
9  275  ASP n 
9  276  ALA n 
9  277  GLN n 
9  278  VAL n 
9  279  ARG n 
9  280  ALA n 
9  281  LEU n 
9  282  ALA n 
9  283  SER n 
9  284  GLN n 
9  285  ILE n 
9  286  ASP n 
9  287  ASP n 
9  288  GLU n 
9  289  GLU n 
9  290  ALA n 
9  291  LEU n 
9  292  PRO n 
9  293  GLU n 
9  294  GLU n 
9  295  LEU n 
9  296  GLN n 
9  297  GLY n 
9  298  VAL n 
9  299  GLU n 
9  300  ALA n 
9  301  ASP n 
9  302  VAL n 
9  303  ALA n 
9  304  THR n 
9  305  GLU n 
9  306  GLU n 
9  307  PRO n 
9  308  THR n 
9  309  ASP n 
9  310  ASP n 
9  311  GLN n 
9  312  ASP n 
9  313  ASP n 
9  314  ASP n 
9  315  THR n 
9  316  ALA n 
9  317  SER n 
9  318  GLU n 
9  319  ASP n 
9  320  ASP n 
9  321  ALA n 
9  322  ASP n 
9  323  ALA n 
9  324  ASP n 
9  325  ASP n 
9  326  ALA n 
9  327  ALA n 
9  328  GLU n 
9  329  GLU n 
9  330  ALA n 
9  331  ASP n 
9  332  ASP n 
9  333  ASP n 
9  334  ASP n 
9  335  ASP n 
9  336  ASP n 
9  337  ASP n 
9  338  GLU n 
9  339  ASP n 
9  340  ALA n 
9  341  GLY n 
9  342  ASP n 
9  343  ALA n 
9  344  LEU n 
9  345  GLY n 
9  346  ALA n 
9  347  MET n 
9  348  PHE n 
10 1    LYS n 
10 2    PRO n 
10 3    GLY n 
10 4    ALA n 
10 5    MET n 
10 6    TYR n 
10 7    ARG n 
10 8    ASN n 
10 9    SER n 
10 10   SER n 
10 11   LYS n 
10 12   PRO n 
10 13   ALA n 
10 14   TYR n 
10 15   THR n 
10 16   ARG n 
10 17   ARG n 
10 18   GLU n 
10 19   TYR n 
10 20   ILE n 
10 21   SER n 
10 22   GLY n 
10 23   ILE n 
10 24   PRO n 
10 25   GLY n 
10 26   LYS n 
10 27   LYS n 
10 28   ILE n 
10 29   ALA n 
10 30   GLN n 
10 31   PHE n 
10 32   ASP n 
10 33   MET n 
10 34   GLY n 
10 35   ASN n 
10 36   ASN n 
10 37   GLY n 
10 38   ALA n 
10 39   GLY n 
10 40   PRO n 
10 41   THR n 
10 42   TYR n 
10 43   PRO n 
10 44   ALA n 
10 45   GLN n 
10 46   VAL n 
10 47   GLU n 
10 48   LEU n 
10 49   VAL n 
10 50   VAL n 
10 51   GLU n 
10 52   LYS n 
10 53   PRO n 
10 54   VAL n 
10 55   GLN n 
10 56   ILE n 
10 57   ARG n 
10 58   HIS n 
10 59   ASN n 
10 60   ALA n 
10 61   LEU n 
10 62   GLU n 
10 63   ALA n 
10 64   ALA n 
10 65   ARG n 
10 66   VAL n 
10 67   ALA n 
10 68   ALA n 
10 69   ASN n 
10 70   ARG n 
10 71   TYR n 
10 72   VAL n 
10 73   GLN n 
10 74   ASN n 
10 75   SER n 
10 76   GLY n 
10 77   ALA n 
10 78   ALA n 
10 79   ALA n 
10 80   ASN n 
10 81   TYR n 
10 82   LYS n 
10 83   PHE n 
10 84   ARG n 
10 85   ILE n 
10 86   ARG n 
10 87   LYS n 
10 88   PHE n 
10 89   PRO n 
10 90   PHE n 
10 91   HIS n 
10 92   VAL n 
10 93   ILE n 
10 94   ARG n 
10 95   GLU n 
10 96   ASN n 
10 97   LYS n 
10 98   ALA n 
10 99   ALA n 
10 100  ALA n 
10 101  ALA n 
10 102  ALA n 
10 103  ALA n 
10 104  ALA n 
10 105  ALA n 
10 106  ALA n 
10 107  ALA n 
10 108  ALA n 
10 109  ASP n 
10 110  GLY n 
10 111  MET n 
10 112  ARG n 
10 113  ALA n 
10 114  PRO n 
10 115  PHE n 
10 116  GLY n 
10 117  LYS n 
10 118  PRO n 
10 119  VAL n 
10 120  GLY n 
10 121  THR n 
10 122  ALA n 
10 123  ALA n 
10 124  ARG n 
10 125  VAL n 
10 126  HIS n 
10 127  GLY n 
10 128  ALA n 
10 129  ASN n 
10 130  HIS n 
10 131  ILE n 
10 132  PHE n 
10 133  ILE n 
10 134  ALA n 
10 135  TRP n 
10 136  VAL n 
10 137  ASN n 
10 138  PRO n 
10 139  ASP n 
10 140  PRO n 
10 141  ASN n 
10 142  VAL n 
10 143  GLU n 
10 144  GLU n 
10 145  ALA n 
10 146  TRP n 
10 147  ARG n 
10 148  ARG n 
10 149  ALA n 
10 150  LYS n 
10 151  MET n 
10 152  LYS n 
10 153  VAL n 
10 154  THR n 
10 155  PRO n 
10 156  THR n 
10 157  ILE n 
10 158  ASN n 
10 159  ILE n 
10 160  ASP n 
10 161  SER n 
10 162  SER n 
10 163  PRO n 
10 164  ALA n 
10 165  GLY n 
10 166  ASN n 
10 167  ALA n 
11 1    MET n 
11 2    SER n 
11 3    VAL n 
11 4    ALA n 
11 5    GLU n 
11 6    PHE n 
11 7    ASP n 
11 8    ALA n 
11 9    ASP n 
11 10   VAL n 
11 11   ILE n 
11 12   VAL n 
11 13   ASP n 
11 14   ALA n 
11 15   ARG n 
11 16   ASP n 
11 17   CYS n 
11 18   ILE n 
11 19   MET n 
11 20   GLY n 
11 21   ARG n 
11 22   VAL n 
11 23   ALA n 
11 24   SER n 
11 25   GLN n 
11 26   VAL n 
11 27   ALA n 
11 28   GLU n 
11 29   GLN n 
11 30   ALA n 
11 31   LEU n 
11 32   ASP n 
11 33   GLY n 
11 34   GLU n 
11 35   THR n 
11 36   VAL n 
11 37   ALA n 
11 38   VAL n 
11 39   VAL n 
11 40   ASN n 
11 41   ALA n 
11 42   GLU n 
11 43   ARG n 
11 44   ALA n 
11 45   VAL n 
11 46   ILE n 
11 47   THR n 
11 48   GLY n 
11 49   ARG n 
11 50   GLU n 
11 51   GLU n 
11 52   GLN n 
11 53   ILE n 
11 54   VAL n 
11 55   GLU n 
11 56   LYS n 
11 57   TYR n 
11 58   GLU n 
11 59   LYS n 
11 60   ARG n 
11 61   VAL n 
11 62   ASP n 
11 63   ILE n 
11 64   GLY n 
11 65   ASN n 
11 66   ASP n 
11 67   ASN n 
11 68   GLY n 
11 69   TYR n 
11 70   PHE n 
11 71   TYR n 
11 72   PRO n 
11 73   LYS n 
11 74   ARG n 
11 75   PRO n 
11 76   ASP n 
11 77   GLY n 
11 78   ILE n 
11 79   PHE n 
11 80   LYS n 
11 81   ARG n 
11 82   THR n 
11 83   ILE n 
11 84   ARG n 
11 85   GLY n 
11 86   MET n 
11 87   LEU n 
11 88   PRO n 
11 89   HIS n 
11 90   LYS n 
11 91   LYS n 
11 92   GLN n 
11 93   ARG n 
11 94   GLY n 
11 95   ARG n 
11 96   GLU n 
11 97   ALA n 
11 98   PHE n 
11 99   GLU n 
11 100  SER n 
11 101  VAL n 
11 102  ARG n 
11 103  VAL n 
11 104  TYR n 
11 105  LEU n 
11 106  GLY n 
11 107  ASN n 
11 108  PRO n 
11 109  TYR n 
11 110  ASP n 
11 111  GLU n 
11 112  ASP n 
11 113  GLY n 
11 114  GLU n 
11 115  VAL n 
11 116  LEU n 
11 117  ASP n 
11 118  GLY n 
11 119  THR n 
11 120  SER n 
11 121  LEU n 
11 122  ASP n 
11 123  ARG n 
11 124  LEU n 
11 125  SER n 
11 126  ASN n 
11 127  ILE n 
11 128  LYS n 
11 129  PHE n 
11 130  VAL n 
11 131  THR n 
11 132  LEU n 
11 133  GLY n 
11 134  GLU n 
11 135  ILE n 
11 136  SER n 
11 137  GLU n 
11 138  THR n 
11 139  LEU n 
11 140  GLY n 
11 141  ALA n 
11 142  ASN n 
11 143  LYS n 
11 144  THR n 
11 145  TRP n 
12 1    MET n 
12 2    GLU n 
12 3    ALA n 
12 4    LEU n 
12 5    GLY n 
12 6    ALA n 
12 7    ASP n 
12 8    VAL n 
12 9    THR n 
12 10   GLN n 
12 11   GLY n 
12 12   LEU n 
12 13   GLU n 
12 14   LYS n 
12 15   GLY n 
12 16   SER n 
12 17   LEU n 
12 18   ILE n 
12 19   THR n 
12 20   CYS n 
12 21   ALA n 
12 22   ASP n 
12 23   ASN n 
12 24   THR n 
12 25   GLY n 
12 26   ALA n 
12 27   ARG n 
12 28   GLU n 
12 29   LEU n 
12 30   LYS n 
12 31   VAL n 
12 32   ILE n 
12 33   SER n 
12 34   VAL n 
12 35   HIS n 
12 36   GLY n 
12 37   TYR n 
12 38   SER n 
12 39   GLY n 
12 40   THR n 
12 41   LYS n 
12 42   ASN n 
12 43   ARG n 
12 44   HIS n 
12 45   PRO n 
12 46   LYS n 
12 47   ALA n 
12 48   GLY n 
12 49   LEU n 
12 50   GLY n 
12 51   ASP n 
12 52   LYS n 
12 53   ILE n 
12 54   THR n 
12 55   VAL n 
12 56   SER n 
12 57   VAL n 
12 58   THR n 
12 59   LYS n 
12 60   GLY n 
12 61   THR n 
12 62   PRO n 
12 63   GLU n 
12 64   MET n 
12 65   ARG n 
12 66   ARG n 
12 67   GLN n 
12 68   VAL n 
12 69   LEU n 
12 70   GLU n 
12 71   ALA n 
12 72   VAL n 
12 73   VAL n 
12 74   VAL n 
12 75   ARG n 
12 76   GLN n 
12 77   ARG n 
12 78   LYS n 
12 79   PRO n 
12 80   ILE n 
12 81   ARG n 
12 82   ARG n 
12 83   PRO n 
12 84   ASP n 
12 85   GLY n 
12 86   THR n 
12 87   ARG n 
12 88   VAL n 
12 89   LYS n 
12 90   PHE n 
12 91   GLU n 
12 92   ASP n 
12 93   ASN n 
12 94   ALA n 
12 95   ALA n 
12 96   VAL n 
12 97   ILE n 
12 98   VAL n 
12 99   ASP n 
12 100  GLU n 
12 101  ASN n 
12 102  GLU n 
12 103  ASP n 
12 104  PRO n 
12 105  ARG n 
12 106  GLY n 
12 107  THR n 
12 108  GLU n 
12 109  LEU n 
12 110  LYS n 
12 111  GLY n 
12 112  PRO n 
12 113  ILE n 
12 114  ALA n 
12 115  ARG n 
12 116  GLU n 
12 117  VAL n 
12 118  ALA n 
12 119  GLN n 
12 120  ARG n 
12 121  PHE n 
12 122  GLY n 
12 123  SER n 
12 124  VAL n 
12 125  ALA n 
12 126  SER n 
12 127  ALA n 
12 128  ALA n 
12 129  THR n 
12 130  MET n 
12 131  ILE n 
12 132  VAL n 
13 1    THR n 
13 2    SER n 
13 3    LYS n 
13 4    LYS n 
13 5    LYS n 
13 6    ARG n 
13 7    GLN n 
13 8    ARG n 
13 9    GLY n 
13 10   SER n 
13 11   ARG n 
13 12   THR n 
13 13   HIS n 
13 14   GLY n 
13 15   GLY n 
13 16   GLY n 
13 17   SER n 
13 18   HIS n 
13 19   LYS n 
13 20   ASN n 
13 21   ARG n 
13 22   ARG n 
13 23   GLY n 
13 24   ALA n 
13 25   GLY n 
13 26   HIS n 
13 27   ARG n 
13 28   GLY n 
13 29   GLY n 
13 30   ARG n 
13 31   GLY n 
13 32   ASP n 
13 33   ALA n 
13 34   GLY n 
13 35   ARG n 
13 36   ASP n 
13 37   LYS n 
13 38   HIS n 
13 39   GLU n 
13 40   PHE n 
13 41   HIS n 
13 42   ASN n 
13 43   HIS n 
13 44   GLU n 
13 45   PRO n 
13 46   LEU n 
13 47   GLY n 
13 48   LYS n 
13 49   SER n 
13 50   GLY n 
13 51   PHE n 
13 52   LYS n 
13 53   ARG n 
13 54   PRO n 
13 55   GLN n 
13 56   LYS n 
13 57   VAL n 
13 58   GLN n 
13 59   GLU n 
13 60   GLU n 
13 61   ALA n 
13 62   ALA n 
13 63   THR n 
13 64   ILE n 
13 65   ASP n 
13 66   VAL n 
13 67   ARG n 
13 68   GLU n 
13 69   ILE n 
13 70   ASP n 
13 71   GLU n 
13 72   ASN n 
13 73   VAL n 
13 74   THR n 
13 75   LEU n 
13 76   LEU n 
13 77   ALA n 
13 78   ALA n 
13 79   ASP n 
13 80   ASP n 
13 81   VAL n 
13 82   ALA n 
13 83   GLU n 
13 84   VAL n 
13 85   GLU n 
13 86   ASP n 
13 87   GLY n 
13 88   GLY n 
13 89   PHE n 
13 90   ARG n 
13 91   VAL n 
13 92   ASP n 
13 93   VAL n 
13 94   ARG n 
13 95   ASP n 
13 96   VAL n 
13 97   VAL n 
13 98   GLU n 
13 99   GLU n 
13 100  ALA n 
13 101  ASP n 
13 102  ASP n 
13 103  ALA n 
13 104  ASP n 
13 105  TYR n 
13 106  VAL n 
13 107  LYS n 
13 108  VAL n 
13 109  LEU n 
13 110  GLY n 
13 111  ALA n 
13 112  GLY n 
13 113  GLN n 
13 114  VAL n 
13 115  ARG n 
13 116  HIS n 
13 117  GLU n 
13 118  LEU n 
13 119  THR n 
13 120  LEU n 
13 121  ILE n 
13 122  ALA n 
13 123  ASP n 
13 124  ASP n 
13 125  PHE n 
13 126  SER n 
13 127  GLU n 
13 128  GLY n 
13 129  ALA n 
13 130  ARG n 
13 131  GLU n 
13 132  LYS n 
13 133  VAL n 
13 134  GLU n 
13 135  GLY n 
13 136  ALA n 
13 137  GLY n 
13 138  GLY n 
13 139  SER n 
13 140  VAL n 
13 141  GLU n 
13 142  LEU n 
13 143  THR n 
13 144  ASP n 
13 145  LEU n 
13 146  GLY n 
13 147  GLU n 
13 148  GLU n 
13 149  ARG n 
13 150  GLN n 
13 151  ALA n 
13 152  GLU n 
13 153  ALA n 
13 154  GLU n 
13 155  GLU n 
13 156  THR n 
13 157  GLU n 
13 158  ASP n 
13 159  ALA n 
13 160  ASP n 
13 161  ALA n 
13 162  ASP n 
13 163  GLU n 
13 164  GLU n 
14 1    ALA n 
14 2    ARG n 
14 3    SER n 
14 4    ALA n 
14 5    TYR n 
14 6    SER n 
14 7    TYR n 
14 8    ILE n 
14 9    ARG n 
14 10   GLU n 
14 11   ALA n 
14 12   TRP n 
14 13   LYS n 
14 14   ARG n 
14 15   PRO n 
14 16   LYS n 
14 17   GLU n 
14 18   GLY n 
14 19   GLN n 
14 20   ILE n 
14 21   ALA n 
14 22   GLU n 
14 23   LEU n 
14 24   MET n 
14 25   TRP n 
14 26   HIS n 
14 27   ARG n 
14 28   MET n 
14 29   GLN n 
14 30   GLU n 
14 31   TRP n 
14 32   ARG n 
14 33   ASN n 
14 34   GLU n 
14 35   PRO n 
14 36   ALA n 
14 37   VAL n 
14 38   VAL n 
14 39   ARG n 
14 40   ILE n 
14 41   GLU n 
14 42   ARG n 
14 43   PRO n 
14 44   THR n 
14 45   ARG n 
14 46   LEU n 
14 47   ASP n 
14 48   ARG n 
14 49   ALA n 
14 50   ARG n 
14 51   SER n 
14 52   LEU n 
14 53   GLY n 
14 54   TYR n 
14 55   LYS n 
14 56   ALA n 
14 57   LYS n 
14 58   GLN n 
14 59   GLY n 
14 60   ILE n 
14 61   ILE n 
14 62   VAL n 
14 63   VAL n 
14 64   ARG n 
14 65   VAL n 
14 66   ALA n 
14 67   ILE n 
14 68   ARG n 
14 69   LYS n 
14 70   GLY n 
14 71   SER n 
14 72   SER n 
14 73   ARG n 
14 74   ARG n 
14 75   THR n 
14 76   ARG n 
14 77   PHE n 
14 78   ASN n 
14 79   LYS n 
14 80   GLY n 
14 81   ARG n 
14 82   ARG n 
14 83   SER n 
14 84   LYS n 
14 85   ARG n 
14 86   MET n 
14 87   MET n 
14 88   VAL n 
14 89   ASN n 
14 90   ARG n 
14 91   ILE n 
14 92   THR n 
14 93   ARG n 
14 94   LYS n 
14 95   LYS n 
14 96   ASN n 
14 97   ILE n 
14 98   GLN n 
14 99   ARG n 
14 100  ILE n 
14 101  ALA n 
14 102  GLU n 
14 103  GLU n 
14 104  ARG n 
14 105  ALA n 
14 106  ASN n 
14 107  ARG n 
14 108  LYS n 
14 109  PHE n 
14 110  PRO n 
14 111  ASN n 
14 112  LEU n 
14 113  ARG n 
14 114  VAL n 
14 115  LEU n 
14 116  ASN n 
14 117  SER n 
14 118  TYR n 
14 119  SER n 
14 120  VAL n 
14 121  GLY n 
14 122  GLU n 
14 123  ASP n 
14 124  GLY n 
14 125  ARG n 
14 126  HIS n 
14 127  LYS n 
14 128  TRP n 
14 129  HIS n 
14 130  GLU n 
14 131  VAL n 
14 132  ILE n 
14 133  LEU n 
14 134  ILE n 
14 135  ASP n 
14 136  PRO n 
14 137  ASP n 
14 138  HIS n 
14 139  PRO n 
14 140  ALA n 
14 141  ILE n 
14 142  LYS n 
14 143  SER n 
14 144  ASP n 
14 145  ASP n 
14 146  GLN n 
14 147  LEU n 
14 148  SER n 
14 149  TRP n 
14 150  ILE n 
14 151  SER n 
14 152  ARG n 
14 153  THR n 
14 154  ARG n 
14 155  HIS n 
14 156  ARG n 
14 157  LEU n 
14 158  ARG n 
14 159  THR n 
14 160  PHE n 
14 161  ARG n 
14 162  GLY n 
14 163  LEU n 
14 164  THR n 
14 165  SER n 
14 166  ALA n 
14 167  GLY n 
14 168  ARG n 
14 169  ARG n 
14 170  CYS n 
14 171  ARG n 
14 172  GLY n 
14 173  LEU n 
14 174  ARG n 
14 175  GLY n 
14 176  GLN n 
14 177  GLY n 
14 178  LYS n 
14 179  GLY n 
14 180  SER n 
14 181  GLU n 
14 182  LYS n 
14 183  VAL n 
14 184  ARG n 
14 185  PRO n 
14 186  SER n 
14 187  LEU n 
14 188  ARG n 
14 189  VAL n 
14 190  ASN n 
14 191  GLY n 
14 192  ALA n 
14 193  LYS n 
14 194  ALA n 
15 1    ALA n 
15 2    THR n 
15 3    GLY n 
15 4    PRO n 
15 5    ARG n 
15 6    TYR n 
15 7    LYS n 
15 8    VAL n 
15 9    PRO n 
15 10   MET n 
15 11   ARG n 
15 12   ARG n 
15 13   ARG n 
15 14   ARG n 
15 15   GLU n 
15 16   ALA n 
15 17   ARG n 
15 18   THR n 
15 19   ASP n 
15 20   TYR n 
15 21   HIS n 
15 22   GLN n 
15 23   ARG n 
15 24   LEU n 
15 25   ARG n 
15 26   LEU n 
15 27   LEU n 
15 28   LYS n 
15 29   SER n 
15 30   GLY n 
15 31   LYS n 
15 32   PRO n 
15 33   ARG n 
15 34   LEU n 
15 35   VAL n 
15 36   ALA n 
15 37   ARG n 
15 38   LYS n 
15 39   SER n 
15 40   ASN n 
15 41   LYS n 
15 42   HIS n 
15 43   VAL n 
15 44   ARG n 
15 45   ALA n 
15 46   GLN n 
15 47   LEU n 
15 48   VAL n 
15 49   THR n 
15 50   LEU n 
15 51   GLY n 
15 52   PRO n 
15 53   ASN n 
15 54   GLY n 
15 55   ASP n 
15 56   ASP n 
15 57   THR n 
15 58   LEU n 
15 59   ALA n 
15 60   SER n 
15 61   ALA n 
15 62   HIS n 
15 63   SER n 
15 64   SER n 
15 65   ASP n 
15 66   LEU n 
15 67   ALA n 
15 68   GLU n 
15 69   TYR n 
15 70   GLY n 
15 71   TRP n 
15 72   GLU n 
15 73   ALA n 
15 74   PRO n 
15 75   THR n 
15 76   GLY n 
15 77   ASN n 
15 78   MET n 
15 79   PRO n 
15 80   SER n 
15 81   ALA n 
15 82   TYR n 
15 83   LEU n 
15 84   THR n 
15 85   GLY n 
15 86   LEU n 
15 87   LEU n 
15 88   ALA n 
15 89   GLY n 
15 90   LEU n 
15 91   ARG n 
15 92   ALA n 
15 93   GLN n 
15 94   GLU n 
15 95   ALA n 
15 96   GLY n 
15 97   VAL n 
15 98   GLU n 
15 99   GLU n 
15 100  ALA n 
15 101  VAL n 
15 102  LEU n 
15 103  ASP n 
15 104  ILE n 
15 105  GLY n 
15 106  LEU n 
15 107  ASN n 
15 108  SER n 
15 109  PRO n 
15 110  THR n 
15 111  PRO n 
15 112  GLY n 
15 113  SER n 
15 114  LYS n 
15 115  VAL n 
15 116  PHE n 
15 117  ALA n 
15 118  ILE n 
15 119  GLN n 
15 120  GLU n 
15 121  GLY n 
15 122  ALA n 
15 123  ILE n 
15 124  ASP n 
15 125  ALA n 
15 126  GLY n 
15 127  LEU n 
15 128  ASP n 
15 129  ILE n 
15 130  PRO n 
15 131  HIS n 
15 132  ASN n 
15 133  ASP n 
15 134  ASP n 
15 135  VAL n 
15 136  LEU n 
15 137  ALA n 
15 138  ASP n 
15 139  TRP n 
15 140  GLN n 
15 141  ARG n 
15 142  THR n 
15 143  ARG n 
15 144  GLY n 
15 145  ALA n 
15 146  HIS n 
15 147  ILE n 
15 148  ALA n 
15 149  GLU n 
15 150  TYR n 
15 151  ASP n 
15 152  GLU n 
15 153  GLN n 
15 154  LEU n 
15 155  GLU n 
15 156  GLU n 
15 157  PRO n 
15 158  LEU n 
15 159  TYR n 
15 160  SER n 
15 161  GLY n 
15 162  ASP n 
15 163  PHE n 
15 164  ASP n 
15 165  ALA n 
15 166  ALA n 
15 167  ASP n 
15 168  LEU n 
15 169  PRO n 
15 170  GLU n 
15 171  HIS n 
15 172  PHE n 
15 173  ASP n 
15 174  GLU n 
15 175  LEU n 
15 176  ARG n 
15 177  GLU n 
15 178  THR n 
15 179  LEU n 
15 180  LEU n 
15 181  ASP n 
15 182  GLY n 
15 183  ASP n 
15 184  ILE n 
15 185  GLU n 
15 186  LEU n 
16 1    SER n 
16 2    LYS n 
16 3    THR n 
16 4    ASN n 
16 5    PRO n 
16 6    ARG n 
16 7    LEU n 
16 8    SER n 
16 9    SER n 
16 10   LEU n 
16 11   ILE n 
16 12   ALA n 
16 13   ASP n 
16 14   LEU n 
16 15   LYS n 
16 16   SER n 
16 17   ALA n 
16 18   ALA n 
16 19   ARG n 
16 20   SER n 
16 21   SER n 
16 22   GLY n 
16 23   GLY n 
16 24   ALA n 
16 25   VAL n 
16 26   TRP n 
16 27   GLY n 
16 28   ASP n 
16 29   VAL n 
16 30   ALA n 
16 31   GLU n 
16 32   ARG n 
16 33   LEU n 
16 34   GLU n 
16 35   LYS n 
16 36   PRO n 
16 37   ARG n 
16 38   ARG n 
16 39   THR n 
16 40   HIS n 
16 41   ALA n 
16 42   GLU n 
16 43   VAL n 
16 44   ASN n 
16 45   LEU n 
16 46   GLY n 
16 47   ARG n 
16 48   ILE n 
16 49   GLU n 
16 50   ARG n 
16 51   TYR n 
16 52   ALA n 
16 53   GLN n 
16 54   GLU n 
16 55   ASP n 
16 56   GLU n 
16 57   THR n 
16 58   VAL n 
16 59   VAL n 
16 60   VAL n 
16 61   PRO n 
16 62   GLY n 
16 63   LYS n 
16 64   VAL n 
16 65   LEU n 
16 66   GLY n 
16 67   SER n 
16 68   GLY n 
16 69   VAL n 
16 70   LEU n 
16 71   GLN n 
16 72   LYS n 
16 73   ASP n 
16 74   VAL n 
16 75   THR n 
16 76   VAL n 
16 77   ALA n 
16 78   ALA n 
16 79   VAL n 
16 80   ASP n 
16 81   PHE n 
16 82   SER n 
16 83   GLY n 
16 84   THR n 
16 85   ALA n 
16 86   GLU n 
16 87   THR n 
16 88   LYS n 
16 89   ILE n 
16 90   ASP n 
16 91   GLN n 
16 92   VAL n 
16 93   GLY n 
16 94   GLU n 
16 95   ALA n 
16 96   VAL n 
16 97   SER n 
16 98   LEU n 
16 99   GLU n 
16 100  GLN n 
16 101  ALA n 
16 102  ILE n 
16 103  GLU n 
16 104  ASN n 
16 105  ASN n 
16 106  PRO n 
16 107  GLU n 
16 108  GLY n 
16 109  SER n 
16 110  HIS n 
16 111  VAL n 
16 112  ARG n 
16 113  VAL n 
16 114  ILE n 
16 115  ARG n 
17 1    THR n 
17 2    ASP n 
17 3    LEU n 
17 4    SER n 
17 5    ALA n 
17 6    GLN n 
17 7    LYS n 
17 8    ARG n 
17 9    LEU n 
17 10   ALA n 
17 11   ALA n 
17 12   ASP n 
17 13   VAL n 
17 14   LEU n 
17 15   ASP n 
17 16   VAL n 
17 17   GLY n 
17 18   LYS n 
17 19   ASN n 
17 20   ARG n 
17 21   VAL n 
17 22   TRP n 
17 23   PHE n 
17 24   ASN n 
17 25   PRO n 
17 26   GLU n 
17 27   ARG n 
17 28   GLN n 
17 29   GLY n 
17 30   ASP n 
17 31   ILE n 
17 32   ALA n 
17 33   ASP n 
17 34   ALA n 
17 35   ILE n 
17 36   THR n 
17 37   ARG n 
17 38   GLU n 
17 39   ASP n 
17 40   VAL n 
17 41   ARG n 
17 42   GLU n 
17 43   LEU n 
17 44   VAL n 
17 45   ASP n 
17 46   GLU n 
17 47   GLY n 
17 48   ALA n 
17 49   ILE n 
17 50   GLN n 
17 51   ALA n 
17 52   LYS n 
17 53   ASP n 
17 54   LYS n 
17 55   LYS n 
17 56   GLY n 
17 57   ASN n 
17 58   SER n 
17 59   ARG n 
17 60   GLY n 
17 61   ARG n 
17 62   ALA n 
17 63   ARG n 
17 64   GLU n 
17 65   ARG n 
17 66   GLN n 
17 67   LYS n 
17 68   LYS n 
17 69   ARG n 
17 70   ALA n 
17 71   LYS n 
17 72   GLY n 
17 73   HIS n 
17 74   GLN n 
17 75   LYS n 
17 76   GLY n 
17 77   ALA n 
17 78   GLY n 
17 79   SER n 
17 80   ARG n 
17 81   LYS n 
17 82   GLY n 
17 83   LYS n 
17 84   ALA n 
17 85   GLY n 
17 86   ALA n 
17 87   ARG n 
17 88   GLN n 
17 89   ASN n 
17 90   SER n 
17 91   LYS n 
17 92   GLU n 
17 93   ASP n 
17 94   TRP n 
17 95   GLU n 
17 96   SER n 
17 97   ARG n 
17 98   ILE n 
17 99   ARG n 
17 100  ALA n 
17 101  GLN n 
17 102  ARG n 
17 103  THR n 
17 104  LYS n 
17 105  LEU n 
17 106  ARG n 
17 107  GLU n 
17 108  LEU n 
17 109  ARG n 
17 110  ASP n 
17 111  GLU n 
17 112  GLY n 
17 113  THR n 
17 114  LEU n 
17 115  SER n 
17 116  SER n 
17 117  SER n 
17 118  GLN n 
17 119  TYR n 
17 120  ARG n 
17 121  ASP n 
17 122  LEU n 
17 123  TYR n 
17 124  ASP n 
17 125  LYS n 
17 126  ALA n 
17 127  GLY n 
17 128  GLY n 
17 129  GLY n 
17 130  GLU n 
17 131  PHE n 
17 132  ASP n 
17 133  SER n 
17 134  VAL n 
17 135  ALA n 
17 136  ASP n 
17 137  LEU n 
17 138  GLU n 
17 139  ARG n 
17 140  TYR n 
17 141  ILE n 
17 142  ASP n 
17 143  ALA n 
17 144  ASN n 
17 145  HIS n 
17 146  GLY n 
17 147  ASP n 
17 148  ALA n 
18 1    PRO n 
18 2    SER n 
18 3    SER n 
18 4    ASN n 
18 5    GLY n 
18 6    PRO n 
18 7    LEU n 
18 8    GLU n 
18 9    GLY n 
18 10   THR n 
18 11   ARG n 
18 12   GLY n 
18 13   LYS n 
18 14   LEU n 
18 15   LYS n 
18 16   ASN n 
18 17   LYS n 
18 18   PRO n 
18 19   ARG n 
18 20   ASP n 
18 21   ARG n 
18 22   GLY n 
18 23   THR n 
18 24   SER n 
18 25   PRO n 
18 26   PRO n 
18 27   GLN n 
18 28   ARG n 
18 29   ALA n 
18 30   VAL n 
18 31   GLU n 
18 32   GLU n 
18 33   PHE n 
18 34   ASP n 
18 35   ASP n 
18 36   GLY n 
18 37   GLU n 
18 38   LYS n 
18 39   VAL n 
18 40   HIS n 
18 41   LEU n 
18 42   LYS n 
18 43   ILE n 
18 44   ASP n 
18 45   PRO n 
18 46   SER n 
18 47   VAL n 
18 48   PRO n 
18 49   ASN n 
18 50   GLY n 
18 51   ARG n 
18 52   PHE n 
18 53   HIS n 
18 54   PRO n 
18 55   ARG n 
18 56   PHE n 
18 57   ASP n 
18 58   GLY n 
18 59   GLN n 
18 60   THR n 
18 61   GLY n 
18 62   THR n 
18 63   VAL n 
18 64   GLU n 
18 65   GLY n 
18 66   LYS n 
18 67   GLN n 
18 68   GLY n 
18 69   ASP n 
18 70   ALA n 
18 71   TYR n 
18 72   LYS n 
18 73   VAL n 
18 74   ASP n 
18 75   ILE n 
18 76   VAL n 
18 77   ASP n 
18 78   GLY n 
18 79   GLY n 
18 80   LYS n 
18 81   GLU n 
18 82   LYS n 
18 83   THR n 
18 84   ILE n 
18 85   ILE n 
18 86   VAL n 
18 87   THR n 
18 88   ALA n 
18 89   ALA n 
18 90   HIS n 
18 91   LEU n 
18 92   ARG n 
18 93   ARG n 
18 94   GLN n 
18 95   GLU n 
19 1    GLY n 
19 2    ILE n 
19 3    SER n 
19 4    TYR n 
19 5    SER n 
19 6    VAL n 
19 7    GLU n 
19 8    ALA n 
19 9    ASP n 
19 10   PRO n 
19 11   ASP n 
19 12   THR n 
19 13   THR n 
19 14   ALA n 
19 15   LYS n 
19 16   ALA n 
19 17   MET n 
19 18   LEU n 
19 19   ARG n 
19 20   GLU n 
19 21   ARG n 
19 22   GLN n 
19 23   MET n 
19 24   SER n 
19 25   PHE n 
19 26   LYS n 
19 27   HIS n 
19 28   SER n 
19 29   LYS n 
19 30   ALA n 
19 31   ILE n 
19 32   ALA n 
19 33   ARG n 
19 34   GLU n 
19 35   ILE n 
19 36   LYS n 
19 37   GLY n 
19 38   LYS n 
19 39   THR n 
19 40   ALA n 
19 41   GLY n 
19 42   GLU n 
19 43   ALA n 
19 44   VAL n 
19 45   ASP n 
19 46   TYR n 
19 47   LEU n 
19 48   GLU n 
19 49   ALA n 
19 50   VAL n 
19 51   ILE n 
19 52   GLU n 
19 53   GLY n 
19 54   ASP n 
19 55   GLN n 
19 56   PRO n 
19 57   VAL n 
19 58   PRO n 
19 59   PHE n 
19 60   LYS n 
19 61   GLN n 
19 62   HIS n 
19 63   ASN n 
19 64   SER n 
19 65   GLY n 
19 66   VAL n 
19 67   GLY n 
19 68   HIS n 
19 69   LYS n 
19 70   SER n 
19 71   LYS n 
19 72   VAL n 
19 73   ASP n 
19 74   GLY n 
19 75   TRP n 
19 76   ASP n 
19 77   ALA n 
19 78   GLY n 
19 79   ARG n 
19 80   TYR n 
19 81   PRO n 
19 82   GLU n 
19 83   LYS n 
19 84   ALA n 
19 85   SER n 
19 86   LYS n 
19 87   ALA n 
19 88   PHE n 
19 89   LEU n 
19 90   ASP n 
19 91   LEU n 
19 92   LEU n 
19 93   GLU n 
19 94   ASN n 
19 95   ALA n 
19 96   VAL n 
19 97   GLY n 
19 98   ASN n 
19 99   ALA n 
19 100  ASP n 
19 101  HIS n 
19 102  GLN n 
19 103  GLY n 
19 104  PHE n 
19 105  ASP n 
19 106  GLY n 
19 107  GLU n 
19 108  ALA n 
19 109  MET n 
19 110  THR n 
19 111  ILE n 
19 112  LYS n 
19 113  HIS n 
19 114  VAL n 
19 115  ALA n 
19 116  ALA n 
19 117  HIS n 
19 118  LYS n 
19 119  VAL n 
19 120  GLY n 
19 121  GLU n 
19 122  GLN n 
19 123  GLN n 
19 124  GLY n 
19 125  ARG n 
19 126  LYS n 
19 127  PRO n 
19 128  ARG n 
19 129  ALA n 
19 130  MET n 
19 131  GLY n 
19 132  ARG n 
19 133  ALA n 
19 134  SER n 
19 135  ALA n 
19 136  TRP n 
19 137  ASN n 
19 138  SER n 
19 139  PRO n 
19 140  GLN n 
19 141  VAL n 
19 142  ASP n 
19 143  VAL n 
19 144  GLU n 
19 145  LEU n 
19 146  ILE n 
19 147  LEU n 
19 148  GLU n 
19 149  GLU n 
19 150  PRO n 
19 151  GLU n 
19 152  VAL n 
19 153  GLU n 
19 154  ASP n 
20 1    SER n 
20 2    TRP n 
20 3    ASP n 
20 4    VAL n 
20 5    ILE n 
20 6    LYS n 
20 7    HIS n 
20 8    PRO n 
20 9    HIS n 
20 10   VAL n 
20 11   THR n 
20 12   GLU n 
20 13   LYS n 
20 14   ALA n 
20 15   MET n 
20 16   ASN n 
20 17   ASP n 
20 18   MET n 
20 19   ASP n 
20 20   PHE n 
20 21   GLN n 
20 22   ASN n 
20 23   LYS n 
20 24   LEU n 
20 25   GLN n 
20 26   PHE n 
20 27   ALA n 
20 28   VAL n 
20 29   ASP n 
20 30   ASP n 
20 31   ARG n 
20 32   ALA n 
20 33   SER n 
20 34   LYS n 
20 35   GLY n 
20 36   GLU n 
20 37   VAL n 
20 38   ALA n 
20 39   ASP n 
20 40   ALA n 
20 41   VAL n 
20 42   GLU n 
20 43   GLU n 
20 44   GLN n 
20 45   TYR n 
20 46   ASP n 
20 47   VAL n 
20 48   THR n 
20 49   VAL n 
20 50   GLU n 
20 51   GLN n 
20 52   VAL n 
20 53   ASN n 
20 54   THR n 
20 55   GLN n 
20 56   ASN n 
20 57   THR n 
20 58   MET n 
20 59   ASP n 
20 60   GLY n 
20 61   GLU n 
20 62   LYS n 
20 63   LYS n 
20 64   ALA n 
20 65   VAL n 
20 66   VAL n 
20 67   ARG n 
20 68   LEU n 
20 69   SER n 
20 70   GLU n 
20 71   ASP n 
20 72   ASP n 
20 73   ASP n 
20 74   ALA n 
20 75   GLN n 
20 76   GLU n 
20 77   VAL n 
20 78   ALA n 
20 79   SER n 
20 80   ARG n 
20 81   ILE n 
20 82   GLY n 
20 83   VAL n 
20 84   PHE n 
21 1    SER n 
21 2    LYS n 
21 3    GLN n 
21 4    PRO n 
21 5    ASP n 
21 6    LYS n 
21 7    GLN n 
21 8    ARG n 
21 9    LYS n 
21 10   SER n 
21 11   GLN n 
21 12   ARG n 
21 13   ARG n 
21 14   ALA n 
21 15   PRO n 
21 16   LEU n 
21 17   HIS n 
21 18   GLU n 
21 19   ARG n 
21 20   HIS n 
21 21   LYS n 
21 22   GLN n 
21 23   VAL n 
21 24   ARG n 
21 25   ALA n 
21 26   THR n 
21 27   LEU n 
21 28   SER n 
21 29   ALA n 
21 30   ASP n 
21 31   LEU n 
21 32   ARG n 
21 33   GLU n 
21 34   GLU n 
21 35   TYR n 
21 36   GLY n 
21 37   GLN n 
21 38   ARG n 
21 39   ASN n 
21 40   VAL n 
21 41   ARG n 
21 42   VAL n 
21 43   ASN n 
21 44   ALA n 
21 45   GLY n 
21 46   ASP n 
21 47   THR n 
21 48   VAL n 
21 49   GLU n 
21 50   VAL n 
21 51   LEU n 
21 52   ARG n 
21 53   GLY n 
21 54   ASP n 
21 55   PHE n 
21 56   ALA n 
21 57   GLY n 
21 58   GLU n 
21 59   GLU n 
21 60   GLY n 
21 61   GLU n 
21 62   VAL n 
21 63   ILE n 
21 64   ASN n 
21 65   VAL n 
21 66   ASP n 
21 67   LEU n 
21 68   ASP n 
21 69   LYS n 
21 70   ALA n 
21 71   VAL n 
21 72   ILE n 
21 73   HIS n 
21 74   VAL n 
21 75   GLU n 
21 76   ASP n 
21 77   VAL n 
21 78   THR n 
21 79   LEU n 
21 80   GLU n 
21 81   LYS n 
21 82   THR n 
21 83   ASP n 
21 84   GLY n 
21 85   GLU n 
21 86   GLU n 
21 87   VAL n 
21 88   PRO n 
21 89   ARG n 
21 90   PRO n 
21 91   LEU n 
21 92   ASP n 
21 93   THR n 
21 94   SER n 
21 95   ASN n 
21 96   VAL n 
21 97   ARG n 
21 98   VAL n 
21 99   THR n 
21 100  ASP n 
21 101  LEU n 
21 102  ASP n 
21 103  LEU n 
21 104  GLU n 
21 105  ASP n 
21 106  GLU n 
21 107  LYS n 
21 108  ARG n 
21 109  GLU n 
21 110  ALA n 
21 111  ARG n 
21 112  LEU n 
21 113  GLU n 
21 114  SER n 
21 115  GLU n 
21 116  ASP n 
21 117  ASP n 
21 118  SER n 
21 119  ALA n 
22 1    PRO n 
22 2    ARG n 
22 3    THR n 
22 4    ARG n 
22 5    GLU n 
22 6    CYS n 
22 7    ASP n 
22 8    TYR n 
22 9    CYS n 
22 10   GLY n 
22 11   THR n 
22 12   ASP n 
22 13   ILE n 
22 14   GLU n 
22 15   PRO n 
22 16   GLY n 
22 17   THR n 
22 18   GLY n 
22 19   THR n 
22 20   MET n 
22 21   PHE n 
22 22   VAL n 
22 23   HIS n 
22 24   LYS n 
22 25   ASP n 
22 26   GLY n 
22 27   ALA n 
22 28   THR n 
22 29   THR n 
22 30   HIS n 
22 31   PHE n 
22 32   CYS n 
22 33   SER n 
22 34   SER n 
22 35   LYS n 
22 36   CYS n 
22 37   GLU n 
22 38   ASN n 
22 39   ASN n 
22 40   ALA n 
22 41   ASP n 
22 42   LEU n 
22 43   GLY n 
22 44   ARG n 
22 45   GLU n 
22 46   ALA n 
22 47   ARG n 
22 48   ASN n 
22 49   LEU n 
22 50   GLU n 
22 51   TRP n 
22 52   THR n 
22 53   ASP n 
22 54   THR n 
22 55   ALA n 
22 56   ARG n 
22 57   GLY n 
22 58   GLU n 
22 59   ALA n 
22 60   GLY n 
22 61   GLU n 
22 62   ALA n 
22 63   GLU n 
22 64   ASP n 
22 65   GLU n 
22 66   ALA n 
23 1    THR n 
23 2    VAL n 
23 3    LEU n 
23 4    HIS n 
23 5    VAL n 
23 6    GLN n 
23 7    GLU n 
23 8    ILE n 
23 9    ARG n 
23 10   ASP n 
23 11   MET n 
23 12   THR n 
23 13   PRO n 
23 14   ALA n 
23 15   GLU n 
23 16   ARG n 
23 17   GLU n 
23 18   ALA n 
23 19   GLU n 
23 20   LEU n 
23 21   ASP n 
23 22   ASP n 
23 23   LEU n 
23 24   LYS n 
23 25   THR n 
23 26   GLU n 
23 27   LEU n 
23 28   LEU n 
23 29   ASN n 
23 30   ALA n 
23 31   ARG n 
23 32   ALA n 
23 33   VAL n 
23 34   GLN n 
23 35   ALA n 
23 36   ALA n 
23 37   GLY n 
23 38   GLY n 
23 39   ALA n 
23 40   PRO n 
23 41   GLU n 
23 42   ASN n 
23 43   PRO n 
23 44   GLY n 
23 45   ARG n 
23 46   ILE n 
23 47   LYS n 
23 48   GLU n 
23 49   LEU n 
23 50   ARG n 
23 51   LYS n 
23 52   ALA n 
23 53   ILE n 
23 54   ALA n 
23 55   ARG n 
23 56   ILE n 
23 57   LYS n 
23 58   THR n 
23 59   ILE n 
23 60   GLN n 
23 61   GLY n 
23 62   GLU n 
23 63   GLU n 
23 64   GLY n 
23 65   ASP n 
23 66   LEU n 
23 67   GLN n 
23 68   GLU n 
23 69   ASN n 
23 70   GLU n 
24 1    MET n 
24 2    HIS n 
24 3    ALA n 
24 4    LEU n 
24 5    VAL n 
24 6    GLN n 
24 7    LEU n 
24 8    ARG n 
24 9    GLY n 
24 10   GLU n 
24 11   VAL n 
24 12   ASN n 
24 13   MET n 
24 14   HIS n 
24 15   THR n 
24 16   ASP n 
24 17   ILE n 
24 18   GLN n 
24 19   ASP n 
24 20   THR n 
24 21   LEU n 
24 22   GLU n 
24 23   MET n 
24 24   LEU n 
24 25   ASN n 
24 26   ILE n 
24 27   HIS n 
24 28   HIS n 
24 29   VAL n 
24 30   ASN n 
24 31   HIS n 
24 32   CYS n 
24 33   THR n 
24 34   LEU n 
24 35   VAL n 
24 36   PRO n 
24 37   GLU n 
24 38   THR n 
24 39   ASP n 
24 40   ALA n 
24 41   TYR n 
24 42   ARG n 
24 43   GLY n 
24 44   MET n 
24 45   VAL n 
24 46   ALA n 
24 47   LYS n 
24 48   VAL n 
24 49   ASN n 
24 50   ASP n 
24 51   PHE n 
24 52   VAL n 
24 53   ALA n 
24 54   PHE n 
24 55   GLY n 
24 56   GLU n 
24 57   PRO n 
24 58   SER n 
24 59   GLN n 
24 60   GLU n 
24 61   THR n 
24 62   LEU n 
24 63   GLU n 
24 64   THR n 
24 65   VAL n 
24 66   LEU n 
24 67   ALA n 
24 68   THR n 
24 69   ARG n 
24 70   ALA n 
24 71   GLU n 
24 72   PRO n 
24 73   LEU n 
24 74   GLU n 
24 75   GLY n 
24 76   ASP n 
24 77   ALA n 
24 78   ASP n 
24 79   VAL n 
24 80   ASP n 
24 81   ASP n 
24 82   GLU n 
24 83   TRP n 
24 84   VAL n 
24 85   ALA n 
24 86   GLU n 
24 87   HIS n 
24 88   THR n 
24 89   ASP n 
24 90   TYR n 
24 91   ASP n 
24 92   ASP n 
24 93   ILE n 
24 94   SER n 
24 95   GLY n 
24 96   LEU n 
24 97   ALA n 
24 98   PHE n 
24 99   ALA n 
24 100  LEU n 
24 101  LEU n 
24 102  SER n 
24 103  GLU n 
24 104  GLU n 
24 105  THR n 
24 106  THR n 
24 107  LEU n 
24 108  ARG n 
24 109  GLU n 
24 110  GLN n 
24 111  GLY n 
24 112  LEU n 
24 113  SER n 
24 114  PRO n 
24 115  THR n 
24 116  LEU n 
24 117  ARG n 
24 118  LEU n 
24 119  HIS n 
24 120  PRO n 
24 121  PRO n 
24 122  ARG n 
24 123  GLY n 
24 124  GLY n 
24 125  HIS n 
24 126  ASP n 
24 127  GLY n 
24 128  VAL n 
24 129  LYS n 
24 130  HIS n 
24 131  PRO n 
24 132  VAL n 
24 133  LYS n 
24 134  GLU n 
24 135  GLY n 
24 136  GLY n 
24 137  GLN n 
24 138  LEU n 
24 139  GLY n 
24 140  LYS n 
24 141  HIS n 
24 142  ASP n 
24 143  THR n 
24 144  GLU n 
24 145  GLY n 
24 146  ILE n 
24 147  ASP n 
24 148  ASP n 
24 149  LEU n 
24 150  LEU n 
24 151  GLU n 
24 152  ALA n 
24 153  MET n 
24 154  ARG n 
25 1    SER n 
25 2    ALA n 
25 3    SER n 
25 4    ASP n 
25 5    PHE n 
25 6    GLU n 
25 7    GLU n 
25 8    ARG n 
25 9    VAL n 
25 10   VAL n 
25 11   THR n 
25 12   ILE n 
25 13   PRO n 
25 14   LEU n 
25 15   ARG n 
25 16   ASP n 
25 17   ALA n 
25 18   ARG n 
25 19   ALA n 
25 20   GLU n 
25 21   PRO n 
25 22   ASN n 
25 23   HIS n 
25 24   LYS n 
25 25   ARG n 
25 26   ALA n 
25 27   ASP n 
25 28   LYS n 
25 29   ALA n 
25 30   MET n 
25 31   ILE n 
25 32   LEU n 
25 33   ILE n 
25 34   ARG n 
25 35   GLU n 
25 36   HIS n 
25 37   LEU n 
25 38   ALA n 
25 39   LYS n 
25 40   HIS n 
25 41   PHE n 
25 42   SER n 
25 43   VAL n 
25 44   ASP n 
25 45   GLU n 
25 46   ASP n 
25 47   ALA n 
25 48   VAL n 
25 49   ARG n 
25 50   LEU n 
25 51   ASP n 
25 52   PRO n 
25 53   SER n 
25 54   ILE n 
25 55   ASN n 
25 56   GLU n 
25 57   ALA n 
25 58   ALA n 
25 59   TRP n 
25 60   ALA n 
25 61   ARG n 
25 62   GLY n 
25 63   ARG n 
25 64   ALA n 
25 65   ASN n 
25 66   THR n 
25 67   PRO n 
25 68   SER n 
25 69   LYS n 
25 70   ILE n 
25 71   ARG n 
25 72   VAL n 
25 73   ARG n 
25 74   ALA n 
25 75   ALA n 
25 76   ARG n 
25 77   PHE n 
25 78   GLU n 
25 79   GLU n 
25 80   GLU n 
25 81   GLY n 
25 82   GLU n 
25 83   ALA n 
25 84   ILE n 
25 85   VAL n 
25 86   GLU n 
25 87   ALA n 
25 88   GLU n 
25 89   THR n 
25 90   ALA n 
25 91   GLU n 
26 1    ALA n 
26 2    ASP n 
26 3    ASN n 
26 4    GLU n 
26 5    GLU n 
26 6    ASP n 
26 7    VAL n 
26 8    GLU n 
26 9    ALA n 
26 10   GLU n 
26 11   GLU n 
26 12   GLU n 
26 13   TYR n 
26 14   THR n 
26 15   GLU n 
26 16   LEU n 
26 17   THR n 
26 18   ASP n 
26 19   ILE n 
26 20   SER n 
26 21   GLY n 
26 22   VAL n 
26 23   GLY n 
26 24   PRO n 
26 25   SER n 
26 26   LYS n 
26 27   ALA n 
26 28   GLU n 
26 29   SER n 
26 30   LEU n 
26 31   ARG n 
26 32   GLU n 
26 33   ALA n 
26 34   GLY n 
26 35   PHE n 
26 36   GLU n 
26 37   SER n 
26 38   VAL n 
26 39   GLU n 
26 40   ASP n 
26 41   VAL n 
26 42   ARG n 
26 43   GLY n 
26 44   ALA n 
26 45   ASP n 
26 46   GLN n 
26 47   SER n 
26 48   ALA n 
26 49   LEU n 
26 50   ALA n 
26 51   ASP n 
26 52   VAL n 
26 53   SER n 
26 54   GLY n 
26 55   ILE n 
26 56   GLY n 
26 57   ASN n 
26 58   ALA n 
26 59   LEU n 
26 60   ALA n 
26 61   ALA n 
26 62   ARG n 
26 63   ILE n 
26 64   LYS n 
26 65   ALA n 
26 66   ASP n 
26 67   VAL n 
26 68   GLY n 
26 69   GLY n 
26 70   LEU n 
26 71   GLU n 
26 72   VAL n 
26 73   GLU n 
26 74   SER n 
26 75   GLU n 
26 76   THR n 
26 77   GLU n 
26 78   ALA n 
26 79   GLU n 
26 80   VAL n 
26 81   GLU n 
26 82   GLU n 
26 83   GLU n 
26 84   GLY n 
26 85   GLY n 
26 86   GLU n 
26 87   GLU n 
26 88   ALA n 
26 89   PRO n 
26 90   ASP n 
26 91   GLU n 
26 92   ASP n 
26 93   VAL n 
26 94   GLU n 
26 95   THR n 
26 96   GLU n 
26 97   LEU n 
26 98   GLN n 
26 99   ALA n 
26 100  ARG n 
26 101  GLY n 
26 102  LEU n 
26 103  THR n 
26 104  GLU n 
26 105  LYS n 
26 106  THR n 
26 107  PRO n 
26 108  ASP n 
26 109  LEU n 
26 110  SER n 
26 111  ASP n 
26 112  GLU n 
26 113  ASP n 
26 114  ALA n 
26 115  ARG n 
26 116  LEU n 
26 117  LEU n 
26 118  THR n 
26 119  GLN n 
26 120  ARG n 
26 121  HIS n 
26 122  ARG n 
26 123  VAL n 
26 124  GLY n 
26 125  LYS n 
26 126  PRO n 
26 127  GLN n 
26 128  PHE n 
26 129  ASN n 
26 130  ARG n 
26 131  GLN n 
26 132  ASP n 
26 133  HIS n 
26 134  HIS n 
26 135  LYS n 
26 136  LYS n 
26 137  LYS n 
26 138  ARG n 
26 139  VAL n 
26 140  SER n 
26 141  THR n 
26 142  SER n 
26 143  TRP n 
26 144  ARG n 
26 145  LYS n 
26 146  PRO n 
26 147  ARG n 
26 148  GLY n 
26 149  GLN n 
26 150  LEU n 
26 151  SER n 
26 152  LYS n 
26 153  GLN n 
26 154  ARG n 
26 155  ARG n 
26 156  GLY n 
26 157  ILE n 
26 158  LYS n 
26 159  GLY n 
26 160  LYS n 
26 161  GLY n 
26 162  ASP n 
26 163  THR n 
26 164  VAL n 
26 165  GLU n 
26 166  ALA n 
26 167  GLY n 
26 168  PHE n 
26 169  ARG n 
26 170  SER n 
26 171  PRO n 
26 172  THR n 
26 173  ALA n 
26 174  VAL n 
26 175  ARG n 
26 176  GLY n 
26 177  LYS n 
26 178  HIS n 
26 179  PRO n 
26 180  SER n 
26 181  GLY n 
26 182  PHE n 
26 183  GLU n 
26 184  GLU n 
26 185  VAL n 
26 186  ARG n 
26 187  VAL n 
26 188  HIS n 
26 189  ASN n 
26 190  VAL n 
26 191  ASP n 
26 192  ASP n 
26 193  LEU n 
26 194  GLU n 
26 195  GLY n 
26 196  VAL n 
26 197  ASP n 
26 198  GLY n 
26 199  ASP n 
26 200  THR n 
26 201  GLU n 
26 202  ALA n 
26 203  VAL n 
26 204  ARG n 
26 205  ILE n 
26 206  ALA n 
26 207  SER n 
26 208  LYS n 
26 209  VAL n 
26 210  GLY n 
26 211  ALA n 
26 212  ARG n 
26 213  LYS n 
26 214  ARG n 
26 215  GLU n 
26 216  ARG n 
26 217  ILE n 
26 218  GLU n 
26 219  GLU n 
26 220  GLU n 
26 221  ALA n 
26 222  GLU n 
26 223  ASP n 
26 224  ALA n 
26 225  GLY n 
26 226  ILE n 
26 227  ARG n 
26 228  VAL n 
26 229  LEU n 
26 230  ASN n 
26 231  PRO n 
26 232  THR n 
26 233  TYR n 
26 234  VAL n 
26 235  GLU n 
26 236  VAL n 
26 237  GLU n 
26 238  VAL n 
26 239  SER n 
26 240  GLU n 
27 1    ARG n 
27 2    THR n 
27 3    GLY n 
27 4    ARG n 
27 5    PHE n 
27 6    GLY n 
27 7    PRO n 
27 8    ARG n 
27 9    TYR n 
27 10   GLY n 
27 11   LEU n 
27 12   LYS n 
27 13   ILE n 
27 14   ARG n 
27 15   VAL n 
27 16   ARG n 
27 17   VAL n 
27 18   ALA n 
27 19   ASP n 
27 20   VAL n 
27 21   GLU n 
27 22   ILE n 
27 23   LYS n 
27 24   HIS n 
27 25   LYS n 
27 26   LYS n 
27 27   LYS n 
27 28   HIS n 
27 29   LYS n 
27 30   CYS n 
27 31   PRO n 
27 32   VAL n 
27 33   CYS n 
27 34   GLY n 
27 35   PHE n 
27 36   LYS n 
27 37   LYS n 
27 38   LEU n 
27 39   LYS n 
27 40   ARG n 
27 41   ALA n 
27 42   GLY n 
27 43   THR n 
27 44   GLY n 
27 45   ILE n 
27 46   TRP n 
27 47   MET n 
27 48   CYS n 
27 49   GLY n 
27 50   HIS n 
27 51   CYS n 
27 52   GLY n 
27 53   TYR n 
27 54   LYS n 
27 55   ILE n 
27 56   ALA n 
27 57   GLY n 
27 58   GLY n 
27 59   CYS n 
27 60   TYR n 
27 61   GLN n 
27 62   PRO n 
27 63   GLU n 
27 64   THR n 
27 65   VAL n 
27 66   ALA n 
27 67   GLY n 
27 68   LYS n 
27 69   ALA n 
27 70   VAL n 
27 71   MET n 
27 72   LYS n 
27 73   ALA n 
28 1    THR n 
28 2    GLY n 
28 3    ALA n 
28 4    GLY n 
28 5    THR n 
28 6    PRO n 
28 7    SER n 
28 8    GLN n 
28 9    GLY n 
28 10   LYS n 
28 11   LYS n 
28 12   ASN n 
28 13   THR n 
28 14   THR n 
28 15   THR n 
28 16   HIS n 
28 17   THR n 
28 18   LYS n 
28 19   CYS n 
28 20   ARG n 
28 21   ARG n 
28 22   CYS n 
28 23   GLY n 
28 24   GLU n 
28 25   LYS n 
28 26   SER n 
28 27   TYR n 
28 28   HIS n 
28 29   THR n 
28 30   LYS n 
28 31   LYS n 
28 32   LYS n 
28 33   VAL n 
28 34   CYS n 
28 35   SER n 
28 36   SER n 
28 37   CYS n 
28 38   GLY n 
28 39   PHE n 
28 40   GLY n 
28 41   LYS n 
28 42   SER n 
28 43   ALA n 
28 44   LYS n 
28 45   ARG n 
28 46   ARG n 
28 47   ASP n 
28 48   TYR n 
28 49   GLU n 
28 50   TRP n 
28 51   GLN n 
28 52   SER n 
28 53   LYS n 
28 54   ALA n 
28 55   GLY n 
28 56   GLU n 
29 1    GLY n 
29 2    LYS n 
29 3    LYS n 
29 4    SER n 
29 5    LYS n 
29 6    ALA n 
29 7    THR n 
29 8    LYS n 
29 9    LYS n 
29 10   ARG n 
29 11   LEU n 
29 12   ALA n 
29 13   LYS n 
29 14   LEU n 
29 15   ASP n 
29 16   ASN n 
29 17   GLN n 
29 18   ASN n 
29 19   SER n 
29 20   ARG n 
29 21   VAL n 
29 22   PRO n 
29 23   ALA n 
29 24   TRP n 
29 25   VAL n 
29 26   MET n 
29 27   LEU n 
29 28   LYS n 
29 29   THR n 
29 30   ASP n 
29 31   GLU n 
29 32   VAL n 
29 33   GLN n 
29 34   ARG n 
29 35   ASN n 
29 36   HIS n 
29 37   LYS n 
29 38   ARG n 
29 39   ARG n 
29 40   HIS n 
29 41   TRP n 
29 42   ARG n 
29 43   ARG n 
29 44   ASN n 
29 45   ASP n 
29 46   THR n 
29 47   ASP n 
29 48   GLU n 
30 1    MET n 
30 2    GLN n 
30 3    MET n 
30 4    PRO n 
30 5    ARG n 
30 6    ARG n 
30 7    PHE n 
30 8    ASN n 
30 9    THR n 
30 10   TYR n 
30 11   CYS n 
30 12   PRO n 
30 13   HIS n 
30 14   CYS n 
30 15   ASN n 
30 16   GLU n 
30 17   HIS n 
30 18   GLN n 
30 19   GLU n 
30 20   HIS n 
30 21   GLU n 
30 22   VAL n 
30 23   GLU n 
30 24   LYS n 
30 25   VAL n 
30 26   ARG n 
30 27   SER n 
30 28   GLY n 
30 29   ARG n 
30 30   GLN n 
30 31   THR n 
30 32   GLY n 
30 33   MET n 
30 34   LYS n 
30 35   TRP n 
30 36   ILE n 
30 37   ASP n 
30 38   ARG n 
30 39   GLN n 
30 40   ARG n 
30 41   GLU n 
30 42   ARG n 
30 43   ASN n 
30 44   SER n 
30 45   GLY n 
30 46   ILE n 
30 47   GLY n 
30 48   ASN n 
30 49   ASP n 
30 50   GLY n 
30 51   LYS n 
30 52   PHE n 
30 53   SER n 
30 54   LYS n 
30 55   VAL n 
30 56   PRO n 
30 57   GLY n 
30 58   GLY n 
30 59   ASP n 
30 60   LYS n 
30 61   PRO n 
30 62   THR n 
30 63   LYS n 
30 64   LYS n 
30 65   THR n 
30 66   ASP n 
30 67   LEU n 
30 68   LYS n 
30 69   TYR n 
30 70   ARG n 
30 71   CYS n 
30 72   GLY n 
30 73   GLU n 
30 74   CYS n 
30 75   GLY n 
30 76   LYS n 
30 77   ALA n 
30 78   HIS n 
30 79   LEU n 
30 80   ARG n 
30 81   GLU n 
30 82   GLY n 
30 83   TRP n 
30 84   ARG n 
30 85   ALA n 
30 86   GLY n 
30 87   ARG n 
30 88   LEU n 
30 89   GLU n 
30 90   PHE n 
30 91   GLN n 
30 92   GLU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
21 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
22 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
23 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
24 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
25 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
26 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
27 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
28 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
29 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
30 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CD  non-polymer         . 'CADMIUM ION'                ? 'Cd 2'            112.411 
CL  non-polymer         . 'CHLORIDE ION'               ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION'              ? 'K 1'             39.098  
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ? 'Mg 2'            24.305  
NA  non-polymer         . 'SODIUM ION'                 ? 'Na 1'            22.990  
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A  1  1    U   1    2    ?    ?   ?   0 . n 
A  1  2    U   2    3    ?    ?   ?   0 . n 
A  1  3    G   3    4    ?    ?   ?   0 . n 
A  1  4    G   4    5    ?    ?   ?   0 . n 
A  1  5    C   5    6    ?    ?   ?   0 . n 
A  1  6    U   6    7    ?    ?   ?   0 . n 
A  1  7    A   7    8    ?    ?   ?   0 . n 
A  1  8    C   8    9    ?    ?   ?   0 . n 
A  1  9    U   9    10   10   U   U   0 . n 
A  1  10   A   10   11   11   A   A   0 . n 
A  1  11   U   11   12   12   U   U   0 . n 
A  1  12   G   12   13   13   G   G   0 . n 
A  1  13   C   13   14   14   C   C   0 . n 
A  1  14   C   14   15   15   C   C   0 . n 
A  1  15   A   15   16   16   A   A   0 . n 
A  1  16   G   16   17   17   G   G   0 . n 
A  1  17   C   17   18   18   C   C   0 . n 
A  1  18   U   18   19   19   U   U   0 . n 
A  1  19   G   19   20   20   G   G   0 . n 
A  1  20   G   20   21   21   G   G   0 . n 
A  1  21   U   21   22   22   U   U   0 . n 
A  1  22   G   22   23   23   G   G   0 . n 
A  1  23   G   23   24   24   G   G   0 . n 
A  1  24   A   24   25   25   A   A   0 . n 
A  1  25   U   25   26   26   U   U   0 . n 
A  1  26   U   26   27   27   U   U   0 . n 
A  1  27   G   27   28   28   G   G   0 . n 
A  1  28   C   28   29   29   C   C   0 . n 
A  1  29   U   29   30   30   U   U   0 . n 
A  1  30   C   30   31   31   C   C   0 . n 
A  1  31   G   31   32   32   G   G   0 . n 
A  1  32   G   32   33   33   G   G   0 . n 
A  1  33   C   33   34   34   C   C   0 . n 
A  1  34   U   34   35   35   U   U   0 . n 
A  1  35   C   35   36   36   C   C   0 . n 
A  1  36   A   36   37   37   A   A   0 . n 
A  1  37   G   37   38   38   G   G   0 . n 
A  1  38   G   38   39   39   G   G   0 . n 
A  1  39   C   39   40   40   C   C   0 . n 
A  1  40   G   40   41   41   G   G   0 . n 
A  1  41   C   41   42   42   C   C   0 . n 
A  1  42   U   42   43   43   U   U   0 . n 
A  1  43   G   43   44   44   G   G   0 . n 
A  1  44   A   44   45   45   A   A   0 . n 
A  1  45   U   45   46   46   U   U   0 . n 
A  1  46   G   46   47   47   G   G   0 . n 
A  1  47   A   47   48   48   A   A   0 . n 
A  1  48   A   48   49   49   A   A   0 . n 
A  1  49   G   49   50   50   G   G   0 . n 
A  1  50   G   50   51   51   G   G   0 . n 
A  1  51   A   51   52   52   A   A   0 . n 
A  1  52   C   52   53   53   C   C   0 . n 
A  1  53   G   53   54   54   G   G   0 . n 
A  1  54   U   54   55   55   U   U   0 . n 
A  1  55   G   55   56   56   G   G   0 . n 
A  1  56   C   56   57   57   C   C   0 . n 
A  1  57   C   57   58   58   C   C   0 . n 
A  1  58   A   58   59   59   A   A   0 . n 
A  1  59   A   59   60   60   A   A   0 . n 
A  1  60   G   60   61   61   G   G   0 . n 
A  1  61   C   61   62   62   C   C   0 . n 
A  1  62   U   62   63   63   U   U   0 . n 
A  1  63   G   63   64   64   G   G   0 . n 
A  1  64   C   64   65   65   C   C   0 . n 
A  1  65   G   65   66   66   G   G   0 . n 
A  1  66   A   66   67   67   A   A   0 . n 
A  1  67   U   67   68   68   U   U   0 . n 
A  1  68   A   68   69   69   A   A   0 . n 
A  1  69   A   69   70   70   A   A   0 . n 
A  1  70   G   70   71   71   G   G   0 . n 
A  1  71   C   71   72   72   C   C   0 . n 
A  1  72   C   72   73   73   C   C   0 . n 
A  1  73   A   73   74   74   A   A   0 . n 
A  1  74   U   74   75   75   U   U   0 . n 
A  1  75   G   75   76   76   G   G   0 . n 
A  1  76   G   76   77   77   G   G   0 . n 
A  1  77   G   77   78   78   G   G   0 . n 
A  1  78   G   78   79   79   G   G   0 . n 
A  1  79   A   79   80   80   A   A   0 . n 
A  1  80   G   80   81   81   G   G   0 . n 
A  1  81   C   81   82   82   C   C   0 . n 
A  1  82   C   82   83   83   C   C   0 . n 
A  1  83   G   83   84   84   G   G   0 . n 
A  1  84   C   84   85   85   C   C   0 . n 
A  1  85   A   85   86   86   A   A   0 . n 
A  1  86   C   86   87   87   C   C   0 . n 
A  1  87   G   87   88   88   G   G   0 . n 
A  1  88   G   88   89   89   G   G   0 . n 
A  1  89   A   89   90   90   A   A   0 . n 
A  1  90   G   90   91   91   G   G   0 . n 
A  1  91   G   91   92   92   G   G   0 . n 
A  1  92   C   92   93   93   C   C   0 . n 
A  1  93   G   93   94   94   G   G   0 . n 
A  1  94   A   94   95   95   A   A   0 . n 
A  1  95   A   95   96   96   A   A   0 . n 
A  1  96   G   96   97   97   G   G   0 . n 
A  1  97   A   97   98   98   A   A   0 . n 
A  1  98   A   98   99   99   A   A   0 . n 
A  1  99   C   99   100  100  C   C   0 . n 
A  1  100  C   100  101  101  C   C   0 . n 
A  1  101  A   101  102  102  A   A   0 . n 
A  1  102  U   102  103  103  U   U   0 . n 
A  1  103  G   103  104  104  G   G   0 . n 
A  1  104  G   104  105  105  G   G   0 . n 
A  1  105  A   105  106  106  A   A   0 . n 
A  1  106  U   106  107  107  U   U   0 . n 
A  1  107  U   107  108  108  U   U   0 . n 
A  1  108  U   108  109  109  U   U   0 . n 
A  1  109  C   109  110  110  C   C   0 . n 
A  1  110  C   110  111  111  C   C   0 . n 
A  1  111  G   111  112  112  G   G   0 . n 
A  1  112  A   112  113  113  A   A   0 . n 
A  1  113  A   113  114  114  A   A   0 . n 
A  1  114  U   114  115  115  U   U   0 . n 
A  1  115  G   115  116  116  G   G   0 . n 
A  1  116  A   116  117  117  A   A   0 . n 
A  1  117  G   117  118  118  G   G   0 . n 
A  1  118  A   118  119  119  A   A   0 . n 
A  1  119  A   119  120  120  A   A   0 . n 
A  1  120  U   120  121  121  U   U   0 . n 
A  1  121  C   121  122  122  C   C   0 . n 
A  1  122  U   122  123  123  U   U   0 . n 
A  1  123  C   123  124  124  C   C   0 . n 
A  1  124  U   124  125  125  U   U   0 . n 
A  1  125  C   125  126  ?    ?   ?   0 . n 
A  1  126  U   126  127  ?    ?   ?   0 . n 
A  1  127  A   127  128  128  A   A   0 . n 
A  1  128  A   128  129  129  A   A   0 . n 
A  1  129  C   129  130  130  C   C   0 . n 
A  1  130  A   130  131  131  A   A   0 . n 
A  1  131  A   131  132  132  A   A   0 . n 
A  1  132  U   132  133  133  U   U   0 . n 
A  1  133  U   133  134  134  U   U   0 . n 
A  1  134  G   134  135  135  G   G   0 . n 
A  1  135  C   135  136  136  C   C   0 . n 
A  1  136  U   136  137  137  U   U   0 . n 
A  1  137  U   137  138  138  U   U   0 . n 
A  1  138  C   138  139  139  C   C   0 . n 
A  1  139  G   139  140  140  G   G   0 . n 
A  1  140  C   140  141  141  C   C   0 . n 
A  1  141  G   141  142  142  G   G   0 . n 
A  1  142  C   142  143  143  C   C   0 . n 
A  1  143  A   143  144  144  A   A   0 . n 
A  1  144  A   144  145  145  A   A   0 . n 
A  1  145  U   145  146  146  U   U   0 . n 
A  1  146  G   146  147  147  G   G   0 . n 
A  1  147  A   147  148  148  A   A   0 . n 
A  1  148  G   148  149  149  G   G   0 . n 
A  1  149  G   149  150  150  G   G   0 . n 
A  1  150  A   150  151  151  A   A   0 . n 
A  1  151  A   151  152  152  A   A   0 . n 
A  1  152  C   152  153  153  C   C   0 . n 
A  1  153  C   153  154  154  C   C   0 . n 
A  1  154  C   154  155  155  C   C   0 . n 
A  1  155  C   155  156  156  C   C   0 . n 
A  1  156  G   156  157  157  G   G   0 . n 
A  1  157  A   157  158  158  A   A   0 . n 
A  1  158  G   158  159  159  G   G   0 . n 
A  1  159  A   159  160  160  A   A   0 . n 
A  1  160  A   160  161  161  A   A   0 . n 
A  1  161  C   161  162  162  C   C   0 . n 
A  1  162  U   162  163  163  U   U   0 . n 
A  1  163  G   163  164  164  G   G   0 . n 
A  1  164  A   164  165  165  A   A   0 . n 
A  1  165  A   165  166  166  A   A   0 . n 
A  1  166  A   166  167  167  A   A   0 . n 
A  1  167  C   167  168  168  C   C   0 . n 
A  1  168  A   168  169  169  A   A   0 . n 
A  1  169  U   169  170  170  U   U   0 . n 
A  1  170  C   170  171  171  C   C   0 . n 
A  1  171  U   171  172  172  U   U   0 . n 
A  1  172  C   172  173  173  C   C   0 . n 
A  1  173  A   173  174  174  A   A   0 . n 
A  1  174  G   174  175  175  G   G   0 . n 
A  1  175  U   175  176  176  U   U   0 . n 
A  1  176  A   176  177  177  A   A   0 . n 
A  1  177  U   177  178  178  U   U   0 . n 
A  1  178  C   178  179  179  C   C   0 . n 
A  1  179  G   179  180  180  G   G   0 . n 
A  1  180  G   180  181  181  G   G   0 . n 
A  1  181  G   181  182  182  G   G   0 . n 
A  1  182  A   182  183  183  A   A   0 . n 
A  1  183  G   183  184  184  G   G   0 . n 
A  1  184  G   184  185  185  G   G   0 . n 
A  1  185  A   185  186  186  A   A   0 . n 
A  1  186  A   186  187  187  A   A   0 . n 
A  1  187  C   187  188  188  C   C   0 . n 
A  1  188  A   188  189  189  A   A   0 . n 
A  1  189  G   189  190  190  G   G   0 . n 
A  1  190  A   190  191  191  A   A   0 . n 
A  1  191  A   191  192  192  A   A   0 . n 
A  1  192  A   192  193  193  A   A   0 . n 
A  1  193  A   193  194  194  A   A   0 . n 
A  1  194  C   194  195  195  C   C   0 . n 
A  1  195  G   195  196  196  G   G   0 . n 
A  1  196  C   196  197  197  C   C   0 . n 
A  1  197  A   197  198  198  A   A   0 . n 
A  1  198  A   198  199  199  A   A   0 . n 
A  1  199  U   199  200  200  U   U   0 . n 
A  1  200  G   200  201  201  G   G   0 . n 
A  1  201  U   201  202  202  U   U   0 . n 
A  1  202  G   202  203  203  G   G   0 . n 
A  1  203  A   203  204  204  A   A   0 . n 
A  1  204  U   204  205  205  U   U   0 . n 
A  1  205  G   205  206  206  G   G   0 . n 
A  1  206  U   206  207  207  U   U   0 . n 
A  1  207  C   207  208  208  C   C   0 . n 
A  1  208  G   208  209  209  G   G   0 . n 
A  1  209  U   209  210  210  U   U   0 . n 
A  1  210  U   210  211  211  U   U   0 . n 
A  1  211  A   211  212  212  A   A   0 . n 
A  1  212  G   212  213  213  G   G   0 . n 
A  1  213  U   213  214  214  U   U   0 . n 
A  1  214  A   214  215  215  A   A   0 . n 
A  1  215  A   215  216  216  A   A   0 . n 
A  1  216  C   216  217  217  C   C   0 . n 
A  1  217  C   217  218  218  C   C   0 . n 
A  1  218  G   218  219  219  G   G   0 . n 
A  1  219  C   219  220  220  C   C   0 . n 
A  1  220  G   220  221  221  G   G   0 . n 
A  1  221  A   221  222  222  A   A   0 . n 
A  1  222  G   222  223  223  G   G   0 . n 
A  1  223  U   223  224  224  U   U   0 . n 
A  1  224  G   224  225  225  G   G   0 . n 
A  1  225  A   225  226  226  A   A   0 . n 
A  1  226  A   226  227  227  A   A   0 . n 
A  1  227  C   227  228  228  C   C   0 . n 
A  1  228  G   228  229  229  G   G   0 . n 
A  1  229  C   229  230  230  C   C   0 . n 
A  1  230  G   230  231  231  G   G   0 . n 
A  1  231  A   231  232  232  A   A   0 . n 
A  1  232  U   232  233  233  U   U   0 . n 
A  1  233  A   233  234  234  A   A   0 . n 
A  1  234  C   234  235  235  C   C   0 . n 
A  1  235  A   235  236  236  A   A   0 . n 
A  1  236  G   236  237  237  G   G   0 . n 
A  1  237  C   237  238  238  C   C   0 . n 
A  1  238  C   238  239  239  C   C   0 . n 
A  1  239  C   239  240  240  C   C   0 . n 
A  1  240  A   240  241  241  A   A   0 . n 
A  1  241  A   241  242  242  A   A   0 . n 
A  1  242  A   242  243  243  A   A   0 . n 
A  1  243  C   243  244  244  C   C   0 . n 
A  1  244  C   244  245  245  C   C   0 . n 
A  1  245  G   245  246  246  G   G   0 . n 
A  1  246  A   246  247  247  A   A   0 . n 
A  1  247  A   247  248  248  A   A   0 . n 
A  1  248  G   248  249  249  G   G   0 . n 
A  1  249  C   249  250  250  C   C   0 . n 
A  1  250  C   250  251  251  C   C   0 . n 
A  1  251  C   251  252  252  C   C   0 . n 
A  1  252  U   252  253  253  U   U   0 . n 
A  1  253  C   253  254  254  C   C   0 . n 
A  1  254  A   254  255  255  A   A   0 . n 
A  1  255  C   255  256  256  C   C   0 . n 
A  1  256  G   256  257  257  G   G   0 . n 
A  1  257  G   257  258  258  G   G   0 . n 
A  1  258  G   258  259  259  G   G   0 . n 
A  1  259  C   259  260  260  C   C   0 . n 
A  1  260  A   260  261  261  A   A   0 . n 
A  1  261  A   261  262  262  A   A   0 . n 
A  1  262  U   262  263  263  U   U   0 . n 
A  1  263  G   263  264  264  G   G   0 . n 
A  1  264  U   264  265  265  U   U   0 . n 
A  1  265  G   265  266  266  G   G   0 . n 
A  1  266  G   266  267  267  G   G   0 . n 
A  1  267  U   267  268  268  U   U   0 . n 
A  1  268  G   268  269  269  G   G   0 . n 
A  1  269  U   269  270  270  U   U   0 . n 
A  1  270  C   270  271  271  C   C   0 . n 
A  1  271  A   271  272  272  A   A   0 . n 
A  1  272  G   272  273  273  G   G   0 . n 
A  1  273  G   273  274  274  G   G   0 . n 
A  1  274  G   274  275  275  G   G   0 . n 
A  1  275  C   275  276  276  C   C   0 . n 
A  1  276  U   276  277  277  U   U   0 . n 
A  1  277  A   277  278  278  A   A   0 . n 
A  1  278  C   278  279  279  C   C   0 . n 
A  1  279  C   279  280  280  C   C   0 . n 
A  1  280  U   280  281  281  U   U   0 . n 
A  1  281  C   281  282  282  C   C   0 . n 
A  1  282  U   282  283  283  U   U   0 . n 
A  1  283  C   283  284  284  C   C   0 . n 
A  1  284  A   284  285  285  A   A   0 . n 
A  1  285  U   285  286  286  U   U   0 . n 
A  1  286  C   286  287  287  C   C   0 . n 
A  1  287  A   287  288  288  A   A   0 . n 
A  1  288  G   288  289  289  G   G   0 . n 
A  1  289  C   289  290  290  C   C   0 . n 
A  1  290  C   290  291  291  C   C   0 . n 
A  1  291  G   291  292  292  G   G   0 . n 
A  1  292  A   292  293  293  A   A   0 . n 
A  1  293  C   293  294  294  C   C   0 . n 
A  1  294  C   294  295  295  C   C   0 . n 
A  1  295  G   295  296  296  G   G   0 . n 
A  1  296  U   296  297  297  U   U   0 . n 
A  1  297  C   297  298  298  C   C   0 . n 
A  1  298  U   298  299  299  U   U   0 . n 
A  1  299  C   299  300  300  C   C   0 . n 
A  1  300  G   300  301  301  G   G   0 . n 
A  1  301  A   301  302  302  A   A   0 . n 
A  1  302  C   302  303  303  C   C   0 . n 
A  1  303  G   303  304  304  G   G   0 . n 
A  1  304  A   304  305  305  A   A   0 . n 
A  1  305  A   305  306  306  A   A   0 . n 
A  1  306  G   306  307  307  G   G   0 . n 
A  1  307  U   307  308  308  U   U   0 . n 
A  1  308  C   308  309  309  C   C   0 . n 
A  1  309  U   309  310  310  U   U   0 . n 
A  1  310  C   310  311  311  C   C   0 . n 
A  1  311  U   311  312  312  U   U   0 . n 
A  1  312  U   312  313  313  U   U   0 . n 
A  1  313  G   313  314  314  G   G   0 . n 
A  1  314  G   314  315  315  G   G   0 . n 
A  1  315  A   315  316  316  A   A   0 . n 
A  1  316  A   316  317  317  A   A   0 . n 
A  1  317  C   317  318  318  C   C   0 . n 
A  1  318  A   318  319  319  A   A   0 . n 
A  1  319  G   319  320  320  G   G   0 . n 
A  1  320  A   320  321  321  A   A   0 . n 
A  1  321  G   321  322  322  G   G   0 . n 
A  1  322  C   322  323  323  C   C   0 . n 
A  1  323  G   323  324  324  G   G   0 . n 
A  1  324  U   324  325  325  U   U   0 . n 
A  1  325  G   325  326  326  G   G   0 . n 
A  1  326  A   326  327  327  A   A   0 . n 
A  1  327  U   327  328  328  U   U   0 . n 
A  1  328  A   328  329  329  A   A   0 . n 
A  1  329  C   329  330  330  C   C   0 . n 
A  1  330  A   330  331  331  A   A   0 . n 
A  1  331  G   331  332  332  G   G   0 . n 
A  1  332  G   332  333  333  G   G   0 . n 
A  1  333  G   333  334  334  G   G   0 . n 
A  1  334  U   334  335  335  U   U   0 . n 
A  1  335  G   335  336  336  G   G   0 . n 
A  1  336  A   336  337  337  A   A   0 . n 
A  1  337  C   337  338  338  C   C   0 . n 
A  1  338  A   338  339  339  A   A   0 . n 
A  1  339  A   339  340  340  A   A   0 . n 
A  1  340  C   340  341  341  C   C   0 . n 
A  1  341  C   341  342  342  C   C   0 . n 
A  1  342  C   342  343  343  C   C   0 . n 
A  1  343  C   343  344  344  C   C   0 . n 
A  1  344  G   344  345  345  G   G   0 . n 
A  1  345  U   345  346  346  U   U   0 . n 
A  1  346  A   346  347  347  A   A   0 . n 
A  1  347  C   347  348  348  C   C   0 . n 
A  1  348  U   348  349  349  U   U   0 . n 
A  1  349  C   349  350  350  C   C   0 . n 
A  1  350  G   350  351  351  G   G   0 . n 
A  1  351  A   351  352  352  A   A   0 . n 
A  1  352  G   352  353  353  G   G   0 . n 
A  1  353  A   353  354  354  A   A   0 . n 
A  1  354  C   354  355  355  C   C   0 . n 
A  1  355  C   355  356  356  C   C   0 . n 
A  1  356  A   356  357  357  A   A   0 . n 
A  1  357  G   357  358  358  G   G   0 . n 
A  1  358  U   358  359  359  U   U   0 . n 
A  1  359  A   359  360  360  A   A   0 . n 
A  1  360  C   360  361  361  C   C   0 . n 
A  1  361  G   361  362  362  G   G   0 . n 
A  1  362  A   362  363  363  A   A   0 . n 
A  1  363  C   363  364  364  C   C   0 . n 
A  1  364  G   364  365  365  G   G   0 . n 
A  1  365  U   365  366  366  U   U   0 . n 
A  1  366  G   366  367  367  G   G   0 . n 
A  1  367  C   367  368  368  C   C   0 . n 
A  1  368  G   368  369  369  G   G   0 . n 
A  1  369  G   369  370  370  G   G   0 . n 
A  1  370  U   370  371  371  U   U   0 . n 
A  1  371  A   371  372  372  A   A   0 . n 
A  1  372  G   372  373  373  G   G   0 . n 
A  1  373  U   373  374  374  U   U   0 . n 
A  1  374  G   374  375  375  G   G   0 . n 
A  1  375  C   375  376  376  C   C   0 . n 
A  1  376  C   376  377  377  C   C   0 . n 
A  1  377  A   377  378  378  A   A   0 . n 
A  1  378  G   378  379  379  G   G   0 . n 
A  1  379  A   379  380  380  A   A   0 . n 
A  1  380  G   380  381  381  G   G   0 . n 
A  1  381  U   381  382  382  U   U   0 . n 
A  1  382  A   382  383  383  A   A   0 . n 
A  1  383  G   383  384  384  G   G   0 . n 
A  1  384  C   384  385  385  C   C   0 . n 
A  1  385  G   385  386  386  G   G   0 . n 
A  1  386  G   386  387  387  G   G   0 . n 
A  1  387  G   387  388  388  G   G   0 . n 
A  1  388  G   388  389  389  G   G   0 . n 
A  1  389  G   389  390  390  G   G   0 . n 
A  1  390  U   390  391  391  U   U   0 . n 
A  1  391  U   391  392  392  U   U   0 . n 
A  1  392  G   392  393  393  G   G   0 . n 
A  1  393  G   393  394  394  G   G   0 . n 
A  1  394  A   394  395  395  A   A   0 . n 
A  1  395  U   395  396  396  U   U   0 . n 
A  1  396  A   396  397  397  A   A   0 . n 
A  1  397  U   397  398  398  U   U   0 . n 
A  1  398  C   398  399  399  C   C   0 . n 
A  1  399  C   399  400  400  C   C   0 . n 
A  1  400  C   400  401  401  C   C   0 . n 
A  1  401  U   401  402  402  U   U   0 . n 
A  1  402  C   402  403  403  C   C   0 . n 
A  1  403  G   403  404  404  G   G   0 . n 
A  1  404  C   404  405  405  C   C   0 . n 
A  1  405  G   405  406  406  G   G   0 . n 
A  1  406  A   406  407  407  A   A   0 . n 
A  1  407  A   407  408  408  A   A   0 . n 
A  1  408  U   408  409  409  U   U   0 . n 
A  1  409  A   409  410  410  A   A   0 . n 
A  1  410  A   410  411  411  A   A   0 . n 
A  1  411  C   411  412  412  C   C   0 . n 
A  1  412  G   412  413  413  G   G   0 . n 
A  1  413  C   413  414  414  C   C   0 . n 
A  1  414  A   414  415  415  A   A   0 . n 
A  1  415  G   415  416  416  G   G   0 . n 
A  1  416  G   416  417  417  G   G   0 . n 
A  1  417  C   417  418  418  C   C   0 . n 
A  1  418  A   418  419  419  A   A   0 . n 
A  1  419  U   419  420  420  U   U   0 . n 
A  1  420  C   420  421  421  C   C   0 . n 
A  1  421  G   421  422  422  G   G   0 . n 
A  1  422  A   422  423  423  A   A   0 . n 
A  1  423  C   423  424  424  C   C   0 . n 
A  1  424  U   424  425  425  U   U   0 . n 
A  1  425  G   425  426  426  G   G   0 . n 
A  1  426  C   426  427  427  C   C   0 . n 
A  1  427  G   427  428  428  G   G   0 . n 
A  1  428  A   428  429  429  A   A   0 . n 
A  1  429  A   429  430  430  A   A   0 . n 
A  1  430  G   430  431  431  G   G   0 . n 
A  1  431  G   431  432  432  G   G   0 . n 
A  1  432  C   432  433  433  C   C   0 . n 
A  1  433  U   433  434  434  U   U   0 . n 
A  1  434  A   434  435  435  A   A   0 . n 
A  1  435  A   435  436  436  A   A   0 . n 
A  1  436  A   436  437  437  A   A   0 . n 
A  1  437  C   437  438  438  C   C   0 . n 
A  1  438  A   438  439  439  A   A   0 . n 
A  1  439  C   439  440  440  C   C   0 . n 
A  1  440  A   440  441  441  A   A   0 . n 
A  1  441  A   441  442  442  A   A   0 . n 
A  1  442  C   442  443  443  C   C   0 . n 
A  1  443  C   443  444  444  C   C   0 . n 
A  1  444  U   444  445  445  U   U   0 . n 
A  1  445  G   445  446  446  G   G   0 . n 
A  1  446  A   446  447  447  A   A   0 . n 
A  1  447  G   447  448  448  G   G   0 . n 
A  1  448  A   448  449  449  A   A   0 . n 
A  1  449  C   449  450  450  C   C   0 . n 
A  1  450  C   450  451  451  C   C   0 . n 
A  1  451  G   451  452  452  G   G   0 . n 
A  1  452  A   452  453  453  A   A   0 . n 
A  1  453  U   453  454  454  U   U   0 . n 
A  1  454  A   454  455  455  A   A   0 . n 
A  1  455  G   455  456  456  G   G   0 . n 
A  1  456  U   456  457  457  U   U   0 . n 
A  1  457  G   457  458  458  G   G   0 . n 
A  1  458  A   458  459  459  A   A   0 . n 
A  1  459  A   459  460  460  A   A   0 . n 
A  1  460  C   460  461  461  C   C   0 . n 
A  1  461  A   461  462  462  A   A   0 . n 
A  1  462  A   462  463  463  A   A   0 . n 
A  1  463  G   463  464  464  G   G   0 . n 
A  1  464  U   464  465  465  U   U   0 . n 
A  1  465  A   465  466  466  A   A   0 . n 
A  1  466  G   466  467  467  G   G   0 . n 
A  1  467  U   467  468  468  U   U   0 . n 
A  1  468  G   468  469  469  G   G   0 . n 
A  1  469  U   469  470  470  U   U   0 . n 
A  1  470  G   470  471  471  G   G   0 . n 
A  1  471  A   471  472  472  A   A   0 . n 
A  1  472  A   472  473  473  A   A   0 . n 
A  1  473  C   473  474  474  C   C   0 . n 
A  1  474  G   474  475  475  G   G   0 . n 
A  1  475  A   475  476  476  A   A   0 . n 
A  1  476  A   476  477  477  A   A   0 . n 
A  1  477  C   477  478  478  C   C   0 . n 
A  1  478  G   478  479  479  G   G   0 . n 
A  1  479  C   479  480  480  C   C   0 . n 
A  1  480  U   480  481  481  U   U   0 . n 
A  1  481  G   481  482  482  G   G   0 . n 
A  1  482  C   482  483  483  C   C   0 . n 
A  1  483  A   483  484  484  A   A   0 . n 
A  1  484  A   484  485  485  A   A   0 . n 
A  1  485  A   485  486  486  A   A   0 . n 
A  1  486  G   486  487  487  G   G   0 . n 
A  1  487  U   487  488  488  U   U   0 . n 
A  1  488  A   488  489  489  A   A   0 . n 
A  1  489  C   489  490  490  C   C   0 . n 
A  1  490  C   490  491  491  C   C   0 . n 
A  1  491  C   491  492  492  C   C   0 . n 
A  1  492  U   492  493  493  U   U   0 . n 
A  1  493  C   493  494  494  C   C   0 . n 
A  1  494  A   494  495  495  A   A   0 . n 
A  1  495  G   495  496  496  G   G   0 . n 
A  1  496  A   496  497  497  A   A   0 . n 
A  1  497  A   497  498  498  A   A   0 . n 
A  1  498  G   498  499  499  G   G   0 . n 
A  1  499  G   499  500  500  G   G   0 . n 
A  1  500  G   500  501  501  G   G   0 . n 
A  1  501  A   501  502  502  A   A   0 . n 
A  1  502  G   502  503  503  G   G   0 . n 
A  1  503  G   503  504  504  G   G   0 . n 
A  1  504  C   504  505  505  C   C   0 . n 
A  1  505  G   505  506  506  G   G   0 . n 
A  1  506  A   506  507  507  A   A   0 . n 
A  1  507  A   507  508  508  A   A   0 . n 
A  1  508  A   508  509  509  A   A   0 . n 
A  1  509  U   509  510  510  U   U   0 . n 
A  1  510  A   510  511  511  A   A   0 . n 
A  1  511  G   511  512  512  G   G   0 . n 
A  1  512  A   512  513  513  A   A   0 . n 
A  1  513  G   513  514  514  G   G   0 . n 
A  1  514  C   514  515  515  C   C   0 . n 
A  1  515  A   515  516  516  A   A   0 . n 
A  1  516  U   516  517  517  U   U   0 . n 
A  1  517  G   517  518  518  G   G   0 . n 
A  1  518  A   518  519  519  A   A   0 . n 
A  1  519  A   519  520  520  A   A   0 . n 
A  1  520  A   520  521  521  A   A   0 . n 
A  1  521  U   521  522  522  U   U   0 . n 
A  1  522  C   522  523  523  C   C   0 . n 
A  1  523  A   523  524  524  A   A   0 . n 
A  1  524  G   524  525  525  G   G   0 . n 
A  1  525  U   525  526  526  U   U   0 . n 
A  1  526  U   526  527  527  U   U   0 . n 
A  1  527  G   527  528  528  G   G   0 . n 
A  1  528  G   528  529  529  G   G   0 . n 
A  1  529  C   529  530  530  C   C   0 . n 
A  1  530  G   530  531  531  G   G   0 . n 
A  1  531  A   531  532  532  A   A   0 . n 
A  1  532  U   532  533  533  U   U   0 . n 
A  1  533  C   533  534  534  C   C   0 . n 
A  1  534  G   534  535  535  G   G   0 . n 
A  1  535  A   535  536  536  A   A   0 . n 
A  1  536  G   536  537  537  G   G   0 . n 
A  1  537  C   537  538  538  C   C   0 . n 
A  1  538  G   538  539  539  G   G   0 . n 
A  1  539  A   539  540  540  A   A   0 . n 
A  1  540  C   540  541  541  C   C   0 . n 
A  1  541  A   541  542  542  A   A   0 . n 
A  1  542  G   542  543  543  G   G   0 . n 
A  1  543  G   543  544  544  G   G   0 . n 
A  1  544  G   544  545  545  G   G   0 . n 
A  1  545  C   545  546  546  C   C   0 . n 
A  1  546  A   546  547  547  A   A   0 . n 
A  1  547  U   547  548  548  U   U   0 . n 
A  1  548  A   548  549  549  A   A   0 . n 
A  1  549  C   549  550  550  C   C   0 . n 
A  1  550  A   550  551  551  A   A   0 . n 
A  1  551  A   551  552  552  A   A   0 . n 
A  1  552  G   552  553  553  G   G   0 . n 
A  1  553  G   553  554  554  G   G   0 . n 
A  1  554  U   554  555  555  U   U   0 . n 
A  1  555  C   555  556  556  C   C   0 . n 
A  1  556  C   556  557  557  C   C   0 . n 
A  1  557  C   557  558  558  C   C   0 . n 
A  1  558  U   558  559  559  U   U   0 . n 
A  1  559  C   559  560  560  C   C   0 . n 
A  1  560  G   560  561  561  G   G   0 . n 
A  1  561  A   561  562  562  A   A   0 . n 
A  1  562  C   562  563  563  C   C   0 . n 
A  1  563  G   563  564  564  G   G   0 . n 
A  1  564  A   564  565  565  A   A   0 . n 
A  1  565  A   565  566  566  A   A   0 . n 
A  1  566  U   566  567  567  U   U   0 . n 
A  1  567  G   567  568  568  G   G   0 . n 
A  1  568  A   568  569  569  A   A   0 . n 
A  1  569  C   569  570  570  C   C   0 . n 
A  1  570  C   570  571  571  C   C   0 . n 
A  1  571  G   571  572  572  G   G   0 . n 
A  1  572  A   572  573  573  A   A   0 . n 
A  1  573  C   573  574  574  C   C   0 . n 
A  1  574  G   574  575  575  G   G   0 . n 
A  1  575  C   575  576  576  C   C   0 . n 
A  1  576  G   576  577  577  G   G   0 . n 
A  1  577  C   577  578  578  C   C   0 . n 
A  1  578  G   578  579  579  G   G   0 . n 
A  1  579  A   579  580  580  A   A   0 . n 
A  1  580  G   580  581  581  G   G   0 . n 
A  1  581  C   581  582  582  C   C   0 . n 
A  1  582  G   582  583  583  G   G   0 . n 
A  1  583  U   583  584  584  U   U   0 . n 
A  1  584  C   584  585  585  C   C   0 . n 
A  1  585  C   585  586  586  C   C   0 . n 
A  1  586  A   586  587  587  A   A   0 . n 
A  1  587  G   587  588  588  G   G   0 . n 
A  1  588  U   588  589  589  U   U   0 . n 
A  1  589  A   589  590  590  A   A   0 . n 
A  1  590  A   590  591  591  A   A   0 . n 
A  1  591  G   591  592  592  G   G   0 . n 
A  1  592  A   592  593  593  A   A   0 . n 
A  1  593  C   593  594  594  C   C   0 . n 
A  1  594  U   594  595  595  U   U   0 . n 
A  1  595  C   595  596  596  C   C   0 . n 
A  1  596  A   596  597  597  A   A   0 . n 
A  1  597  C   597  598  598  C   C   0 . n 
A  1  598  G   598  599  599  G   G   0 . n 
A  1  599  G   599  600  600  G   G   0 . n 
A  1  600  G   600  601  601  G   G   0 . n 
A  1  601  A   601  602  602  A   A   0 . n 
A  1  602  A   602  603  603  A   A   0 . n 
A  1  603  G   603  604  604  G   G   0 . n 
A  1  604  C   604  605  605  C   C   0 . n 
A  1  605  C   605  606  606  C   C   0 . n 
A  1  606  G   606  607  607  G   G   0 . n 
A  1  607  A   607  608  608  A   A   0 . n 
A  1  608  U   608  609  609  U   U   0 . n 
A  1  609  G   609  610  610  G   G   0 . n 
A  1  610  U   610  611  611  U   U   0 . n 
A  1  611  U   611  612  612  U   U   0 . n 
A  1  612  C   612  613  613  C   C   0 . n 
A  1  613  U   613  614  614  U   U   0 . n 
A  1  614  G   614  615  615  G   G   0 . n 
A  1  615  U   615  616  616  U   U   0 . n 
A  1  616  C   616  617  617  C   C   0 . n 
A  1  617  G   617  618  618  G   G   0 . n 
A  1  618  U   618  619  619  U   U   0 . n 
A  1  619  A   619  620  620  A   A   0 . n 
A  1  620  C   620  621  621  C   C   0 . n 
A  1  621  G   621  622  622  G   G   0 . n 
A  1  622  U   622  623  623  U   U   0 . n 
A  1  623  U   623  624  624  U   U   0 . n 
A  1  624  U   624  625  625  U   U   0 . n 
A  1  625  U   625  626  626  U   U   0 . n 
A  1  626  G   626  627  627  G   G   0 . n 
A  1  627  A   627  628  628  A   A   0 . n 
A  1  628  A   628  629  629  A   A   0 . n 
A  1  629  A   629  630  630  A   A   0 . n 
A  1  630  A   630  631  631  A   A   0 . n 
A  1  631  A   631  632  632  A   A   0 . n 
A  1  632  C   632  633  633  C   C   0 . n 
A  1  633  G   633  634  634  G   G   0 . n 
A  1  634  A   634  635  635  A   A   0 . n 
A  1  635  G   635  636  636  G   G   0 . n 
A  1  636  C   636  637  637  C   C   0 . n 
A  1  637  C   637  638  638  C   C   0 . n 
A  1  638  A   638  639  639  A   A   0 . n 
A  1  639  G   639  640  640  G   G   0 . n 
A  1  640  G   640  641  641  G   G   0 . n 
A  1  641  G   641  642  642  G   G   0 . n 
A  1  642  A   642  643  643  A   A   0 . n 
A  1  643  G   643  644  644  G   G   0 . n 
A  1  644  U   644  645  645  U   U   0 . n 
A  1  645  G   645  646  646  G   G   0 . n 
A  1  646  U   646  647  647  U   U   0 . n 
A  1  647  G   647  648  648  G   G   0 . n 
A  1  648  U   648  649  649  U   U   0 . n 
A  1  649  C   649  650  650  C   C   0 . n 
A  1  650  U   650  651  651  U   U   0 . n 
A  1  651  G   651  652  652  G   G   0 . n 
A  1  652  C   652  653  653  C   C   0 . n 
A  1  653  A   653  654  654  A   A   0 . n 
A  1  654  U   654  655  655  U   U   0 . n 
A  1  655  G   655  656  656  G   G   0 . n 
A  1  656  G   656  657  657  G   G   0 . n 
A  1  657  C   657  658  658  C   C   0 . n 
A  1  658  A   658  659  659  A   A   0 . n 
A  1  659  A   659  660  660  A   A   0 . n 
A  1  660  G   660  661  661  G   G   0 . n 
A  1  661  U   661  662  662  U   U   0 . n 
A  1  662  C   662  663  663  C   C   0 . n 
A  1  663  U   663  664  664  U   U   0 . n 
A  1  664  A   664  665  665  A   A   0 . n 
A  1  665  A   665  666  666  A   A   0 . n 
A  1  666  C   666  667  667  C   C   0 . n 
A  1  667  C   667  668  668  C   C   0 . n 
A  1  668  G   668  669  669  G   G   0 . n 
A  1  669  G   669  670  670  G   G   0 . n 
A  1  670  A   670  671  671  A   A   0 . n 
A  1  671  G   671  672  672  G   G   0 . n 
A  1  672  U   672  673  673  U   U   0 . n 
A  1  673  A   673  674  674  A   A   0 . n 
A  1  674  U   674  675  675  U   U   0 . n 
A  1  675  C   675  676  676  C   C   0 . n 
A  1  676  C   676  677  677  C   C   0 . n 
A  1  677  G   677  678  678  G   G   0 . n 
A  1  678  G   678  679  679  G   G   0 . n 
A  1  679  G   679  680  680  G   G   0 . n 
A  1  680  G   680  681  681  G   G   0 . n 
A  1  681  A   681  682  682  A   A   0 . n 
A  1  682  G   682  683  683  G   G   0 . n 
A  1  683  G   683  684  684  G   G   0 . n 
A  1  684  C   684  685  685  C   C   0 . n 
A  1  685  A   685  686  686  A   A   0 . n 
A  1  686  C   686  687  687  C   C   0 . n 
A  1  687  A   687  688  688  A   A   0 . n 
A  1  688  G   688  689  689  G   G   0 . n 
A  1  689  G   689  690  690  G   G   0 . n 
A  1  690  G   690  691  691  G   G   0 . n 
A  1  691  A   691  692  692  A   A   0 . n 
A  1  692  A   692  693  693  A   A   0 . n 
A  1  693  A   693  694  694  A   A   0 . n 
A  1  694  C   694  695  695  C   C   0 . n 
A  1  695  C   695  696  696  C   C   0 . n 
A  1  696  G   696  697  697  G   G   0 . n 
A  1  697  A   697  698  698  A   A   0 . n 
A  1  698  C   698  699  699  C   C   0 . n 
A  1  699  A   699  700  700  A   A   0 . n 
A  1  700  U   700  701  701  U   U   0 . n 
A  1  701  G   701  702  702  G   G   0 . n 
A  1  702  G   702  703  703  G   G   0 . n 
A  1  703  C   703  704  704  C   C   0 . n 
A  1  704  C   704  705  705  C   C   0 . n 
A  1  705  G   705  706  706  G   G   0 . n 
A  1  706  C   706  707  707  C   C   0 . n 
A  1  707  A   707  708  708  A   A   0 . n 
A  1  708  G   708  709  709  G   G   0 . n 
A  1  709  G   709  710  710  G   G   0 . n 
A  1  710  G   710  711  711  G   G   0 . n 
A  1  711  C   711  712  712  C   C   0 . n 
A  1  712  U   712  713  713  U   U   0 . n 
A  1  713  U   713  714  714  U   U   0 . n 
A  1  714  U   714  715  ?    ?   ?   0 . n 
A  1  715  G   715  716  716  G   G   0 . n 
A  1  716  C   716  717  717  C   C   0 . n 
A  1  717  C   717  718  718  C   C   0 . n 
A  1  718  C   718  719  719  C   C   0 . n 
A  1  719  G   719  720  720  G   G   0 . n 
A  1  720  A   720  721  721  A   A   0 . n 
A  1  721  G   721  722  722  G   G   0 . n 
A  1  722  G   722  723  723  G   G   0 . n 
A  1  723  G   723  724  724  G   G   0 . n 
A  1  724  C   724  725  725  C   C   0 . n 
A  1  725  C   725  726  726  C   C   0 . n 
A  1  726  G   726  727  727  G   G   0 . n 
A  1  727  C   727  728  728  C   C   0 . n 
A  1  728  C   728  729  729  C   C   0 . n 
A  1  729  G   729  730  730  G   G   0 . n 
A  1  730  U   730  731  731  U   U   0 . n 
A  1  731  C   731  732  732  C   C   0 . n 
A  1  732  U   732  733  733  U   U   0 . n 
A  1  733  U   733  734  734  U   U   0 . n 
A  1  734  C   734  735  735  C   C   0 . n 
A  1  735  A   735  736  736  A   A   0 . n 
A  1  736  A   736  737  737  A   A   0 . n 
A  1  737  G   737  738  738  G   G   0 . n 
A  1  738  G   738  739  739  G   G   0 . n 
A  1  739  G   739  740  740  G   G   0 . n 
A  1  740  C   740  741  741  C   C   0 . n 
A  1  741  G   741  742  742  G   G   0 . n 
A  1  742  G   742  743  743  G   G   0 . n 
A  1  743  G   743  744  744  G   G   0 . n 
A  1  744  G   744  745  745  G   G   0 . n 
A  1  745  A   745  746  746  A   A   0 . n 
A  1  746  G   746  747  747  G   G   0 . n 
A  1  747  C   747  748  748  C   C   0 . n 
A  1  748  C   748  749  749  C   C   0 . n 
A  1  749  A   749  750  750  A   A   0 . n 
A  1  750  U   750  751  751  U   U   0 . n 
A  1  751  G   751  752  752  G   G   0 . n 
A  1  752  U   752  753  753  U   U   0 . n 
A  1  753  G   753  754  754  G   G   0 . n 
A  1  754  G   754  755  755  G   G   0 . n 
A  1  755  A   755  756  756  A   A   0 . n 
A  1  756  C   756  757  757  C   C   0 . n 
A  1  757  A   757  758  758  A   A   0 . n 
A  1  758  C   758  759  759  C   C   0 . n 
A  1  759  G   759  760  760  G   G   0 . n 
A  1  760  A   760  761  761  A   A   0 . n 
A  1  761  C   761  762  762  C   C   0 . n 
A  1  762  C   762  763  763  C   C   0 . n 
A  1  763  C   763  764  764  C   C   0 . n 
A  1  764  G   764  765  765  G   G   0 . n 
A  1  765  A   765  766  766  A   A   0 . n 
A  1  766  A   766  767  767  A   A   0 . n 
A  1  767  U   767  768  768  U   U   0 . n 
A  1  768  C   768  769  769  C   C   0 . n 
A  1  769  C   769  770  770  C   C   0 . n 
A  1  770  G   770  771  771  G   G   0 . n 
A  1  771  G   771  772  772  G   G   0 . n 
A  1  772  A   772  773  773  A   A   0 . n 
A  1  773  C   773  774  774  C   C   0 . n 
A  1  774  G   774  775  775  G   G   0 . n 
A  1  775  A   775  776  776  A   A   0 . n 
A  1  776  U   776  777  777  U   U   0 . n 
A  1  777  C   777  778  778  C   C   0 . n 
A  1  778  U   778  779  779  U   U   0 . n 
A  1  779  A   779  780  780  A   A   0 . n 
A  1  780  C   780  781  781  C   C   0 . n 
A  1  781  G   781  782  782  G   G   0 . n 
A  1  782  C   782  783  783  C   C   0 . n 
A  1  783  A   783  784  784  A   A   0 . n 
A  1  784  U   784  785  785  U   U   0 . n 
A  1  785  G   785  786  786  G   G   0 . n 
A  1  786  G   786  787  787  G   G   0 . n 
A  1  787  A   787  788  788  A   A   0 . n 
A  1  788  C   788  789  789  C   C   0 . n 
A  1  789  A   789  790  790  A   A   0 . n 
A  1  790  A   790  791  791  A   A   0 . n 
A  1  791  G   791  792  792  G   G   0 . n 
A  1  792  A   792  793  793  A   A   0 . n 
A  1  793  U   793  794  794  U   U   0 . n 
A  1  794  G   794  795  795  G   G   0 . n 
A  1  795  A   795  796  796  A   A   0 . n 
A  1  796  A   796  797  797  A   A   0 . n 
A  1  797  G   797  798  798  G   G   0 . n 
A  1  798  C   798  799  799  C   C   0 . n 
A  1  799  G   799  800  800  G   G   0 . n 
A  1  800  U   800  801  801  U   U   0 . n 
A  1  801  G   801  802  802  G   G   0 . n 
A  1  802  C   802  803  803  C   C   0 . n 
A  1  803  C   803  804  804  C   C   0 . n 
A  1  804  G   804  805  805  G   G   0 . n 
A  1  805  A   805  806  806  A   A   0 . n 
A  1  806  A   806  807  807  A   A   0 . n 
A  1  807  A   807  808  808  A   A   0 . n 
A  1  808  G   808  809  809  G   G   0 . n 
A  1  809  G   809  810  810  G   G   0 . n 
A  1  810  C   810  811  811  C   C   0 . n 
A  1  811  A   811  812  812  A   A   0 . n 
A  1  812  C   812  813  813  C   C   0 . n 
A  1  813  G   813  814  814  G   G   0 . n 
A  1  814  U   814  815  815  U   U   0 . n 
A  1  815  G   815  816  816  G   G   0 . n 
A  1  816  G   816  817  817  G   G   0 . n 
A  1  817  A   817  818  818  A   A   0 . n 
A  1  818  A   818  819  819  A   A   0 . n 
A  1  819  G   819  820  820  G   G   0 . n 
A  1  820  U   820  821  821  U   U   0 . n 
A  1  821  C   821  822  822  C   C   0 . n 
A  1  822  U   822  823  823  U   U   0 . n 
A  1  823  G   823  824  824  G   G   0 . n 
A  1  824  U   824  825  825  U   U   0 . n 
A  1  825  U   825  826  826  U   U   0 . n 
A  1  826  A   826  827  827  A   A   0 . n 
A  1  827  G   827  828  828  G   G   0 . n 
A  1  828  A   828  829  829  A   A   0 . n 
A  1  829  G   829  830  830  G   G   0 . n 
A  1  830  U   830  831  831  U   U   0 . n 
A  1  831  U   831  832  832  U   U   0 . n 
A  1  832  G   832  833  833  G   G   0 . n 
A  1  833  G   833  834  834  G   G   0 . n 
A  1  834  U   834  835  835  U   U   0 . n 
A  1  835  G   835  836  836  G   G   0 . n 
A  1  836  U   836  837  837  U   U   0 . n 
A  1  837  C   837  838  838  C   C   0 . n 
A  1  838  C   838  839  839  C   C   0 . n 
A  1  839  U   839  840  840  U   U   0 . n 
A  1  840  A   840  841  841  A   A   0 . n 
A  1  841  C   841  842  842  C   C   0 . n 
A  1  842  A   842  843  843  A   A   0 . n 
A  1  843  A   843  844  844  A   A   0 . n 
A  1  844  U   844  845  845  U   U   0 . n 
A  1  845  A   845  846  846  A   A   0 . n 
A  1  846  C   846  847  847  C   C   0 . n 
A  1  847  C   847  848  848  C   C   0 . n 
A  1  848  C   848  849  849  C   C   0 . n 
A  1  849  U   849  850  850  U   U   0 . n 
A  1  850  C   850  851  851  C   C   0 . n 
A  1  851  U   851  852  852  U   U   0 . n 
A  1  852  C   852  853  853  C   C   0 . n 
A  1  853  G   853  854  854  G   G   0 . n 
A  1  854  U   854  855  855  U   U   0 . n 
A  1  855  G   855  856  856  G   G   0 . n 
A  1  856  A   856  857  857  A   A   0 . n 
A  1  857  U   857  858  858  U   U   0 . n 
A  1  858  C   858  859  859  C   C   0 . n 
A  1  859  U   859  860  860  U   U   0 . n 
A  1  860  A   860  861  861  A   A   0 . n 
A  1  861  U   861  862  862  U   U   0 . n 
A  1  862  G   862  863  863  G   G   0 . n 
A  1  863  U   863  864  864  U   U   0 . n 
A  1  864  G   864  865  865  G   G   0 . n 
A  1  865  U   865  866  866  U   U   0 . n 
A  1  866  A   866  867  867  A   A   0 . n 
A  1  867  G   867  868  868  G   G   0 . n 
A  1  868  G   868  869  869  G   G   0 . n 
A  1  869  G   869  870  870  G   G   0 . n 
A  1  870  G   870  871  871  G   G   0 . n 
A  1  871  U   871  872  872  U   U   0 . n 
A  1  872  G   872  873  873  G   G   0 . n 
A  1  873  A   873  874  874  A   A   0 . n 
A  1  874  A   874  875  875  A   A   0 . n 
A  1  875  A   875  876  876  A   A   0 . n 
A  1  876  G   876  877  877  G   G   0 . n 
A  1  877  G   877  878  878  G   G   0 . n 
A  1  878  C   878  879  879  C   C   0 . n 
A  1  879  C   879  880  880  C   C   0 . n 
A  1  880  C   880  881  881  C   C   0 . n 
A  1  881  A   881  882  882  A   A   0 . n 
A  1  882  U   882  883  883  U   U   0 . n 
A  1  883  C   883  884  884  C   C   0 . n 
A  1  884  G   884  885  885  G   G   0 . n 
A  1  885  A   885  886  886  A   A   0 . n 
A  1  886  G   886  887  887  G   G   0 . n 
A  1  887  U   887  888  888  U   U   0 . n 
A  1  888  C   888  889  889  C   C   0 . n 
A  1  889  C   889  890  890  C   C   0 . n 
A  1  890  G   890  891  891  G   G   0 . n 
A  1  891  G   891  892  892  G   G   0 . n 
A  1  892  C   892  893  893  C   C   0 . n 
A  1  893  A   893  894  894  A   A   0 . n 
A  1  894  A   894  895  895  A   A   0 . n 
A  1  895  C   895  896  896  C   C   0 . n 
A  1  896  A   896  897  897  A   A   0 . n 
A  1  897  G   897  898  898  G   G   0 . n 
A  1  898  C   898  899  899  C   C   0 . n 
A  1  899  U   899  900  900  U   U   0 . n 
A  1  900  G   900  901  901  G   G   0 . n 
A  1  901  G   901  902  902  G   G   0 . n 
A  1  902  U   902  903  903  U   U   0 . n 
A  1  903  U   903  904  904  U   U   0 . n 
A  1  904  C   904  905  905  C   C   0 . n 
A  1  905  C   905  906  906  C   C   0 . n 
A  1  906  A   906  907  907  A   A   0 . n 
A  1  907  A   907  908  908  A   A   0 . n 
A  1  908  U   908  909  909  U   U   0 . n 
A  1  909  C   909  910  910  C   C   0 . n 
A  1  910  G   910  911  911  G   G   0 . n 
A  1  911  A   911  912  912  A   A   0 . n 
A  1  912  A   912  913  913  A   A   0 . n 
A  1  913  A   913  914  914  A   A   0 . n 
A  1  914  C   914  915  915  C   C   0 . n 
A  1  915  A   915  916  916  A   A   0 . n 
A  1  916  U   916  917  917  U   U   0 . n 
A  1  917  G   917  918  918  G   G   0 . n 
A  1  918  U   918  919  919  U   U   0 . n 
A  1  919  C   919  920  920  C   C   0 . n 
A  1  920  G   920  921  921  G   G   0 . n 
A  1  921  A   921  922  922  A   A   0 . n 
A  1  922  A   922  923  923  A   A   0 . n 
A  1  923  G   923  924  924  G   G   0 . n 
A  1  924  C   924  925  925  C   C   0 . n 
A  1  925  A   925  926  926  A   A   0 . n 
A  1  926  U   926  927  927  U   U   0 . n 
A  1  927  G   927  928  928  G   G   0 . n 
A  1  928  A   928  929  929  A   A   0 . n 
A  1  929  C   929  930  930  C   C   0 . n 
A  1  930  C   930  931  931  C   C   0 . n 
A  1  931  U   931  932  932  U   U   0 . n 
A  1  932  C   932  933  933  C   C   0 . n 
A  1  933  C   933  934  934  C   C   0 . n 
A  1  934  G   934  935  935  G   G   0 . n 
A  1  935  C   935  936  936  C   C   0 . n 
A  1  936  C   936  937  937  C   C   0 . n 
A  1  937  G   937  938  938  G   G   0 . n 
A  1  938  A   938  939  939  A   A   0 . n 
A  1  939  G   939  940  940  G   G   0 . n 
A  1  940  G   940  941  941  G   G   0 . n 
A  1  941  U   941  942  942  U   U   0 . n 
A  1  942  A   942  943  943  A   A   0 . n 
A  1  943  G   943  944  944  G   G   0 . n 
A  1  944  U   944  945  945  U   U   0 . n 
A  1  945  C   945  946  946  C   C   0 . n 
A  1  946  U   946  947  947  U   U   0 . n 
A  1  947  G   947  948  948  G   G   0 . n 
A  1  948  U   948  949  949  U   U   0 . n 
A  1  949  G   949  950  950  G   G   0 . n 
A  1  950  A   950  951  951  A   A   0 . n 
A  1  951  G   951  952  952  G   G   0 . n 
A  1  952  G   952  953  953  G   G   0 . n 
A  1  953  U   953  954  954  U   U   0 . n 
A  1  954  A   954  955  955  A   A   0 . n 
A  1  955  G   955  956  956  G   G   0 . n 
A  1  956  A   956  957  957  A   A   0 . n 
A  1  957  G   957  958  958  G   G   0 . n 
A  1  958  C   958  959  959  C   C   0 . n 
A  1  959  G   959  960  960  G   G   0 . n 
A  1  960  A   960  961  961  A   A   0 . n 
A  1  961  C   961  962  962  C   C   0 . n 
A  1  962  C   962  963  963  C   C   0 . n 
A  1  963  G   963  964  964  G   G   0 . n 
A  1  964  A   964  965  965  A   A   0 . n 
A  1  965  U   965  966  966  U   U   0 . n 
A  1  966  U   966  967  967  U   U   0 . n 
A  1  967  G   967  968  968  G   G   0 . n 
A  1  968  G   968  969  969  G   G   0 . n 
A  1  969  U   969  970  970  U   U   0 . n 
A  1  970  G   970  971  ?    ?   ?   0 . n 
A  1  971  U   971  972  ?    ?   ?   0 . n 
A  1  972  G   972  973  ?    ?   ?   0 . n 
A  1  973  U   973  974  ?    ?   ?   0 . n 
A  1  974  C   974  975  ?    ?   ?   0 . n 
A  1  975  C   975  976  ?    ?   ?   0 . n 
A  1  976  G   976  977  ?    ?   ?   0 . n 
A  1  977  C   977  978  ?    ?   ?   0 . n 
A  1  978  C   978  979  ?    ?   ?   0 . n 
A  1  979  U   979  980  ?    ?   ?   0 . n 
A  1  980  C   980  981  ?    ?   ?   0 . n 
A  1  981  C   981  982  ?    ?   ?   0 . n 
A  1  982  G   982  983  ?    ?   ?   0 . n 
A  1  983  A   983  984  ?    ?   ?   0 . n 
A  1  984  G   984  985  ?    ?   ?   0 . n 
A  1  985  A   985  986  ?    ?   ?   0 . n 
A  1  986  G   986  987  ?    ?   ?   0 . n 
A  1  987  G   987  988  ?    ?   ?   0 . n 
A  1  988  A   988  989  ?    ?   ?   0 . n 
A  1  989  G   989  990  ?    ?   ?   0 . n 
A  1  990  U   990  991  ?    ?   ?   0 . n 
A  1  991  C   991  992  ?    ?   ?   0 . n 
A  1  992  G   992  993  ?    ?   ?   0 . n 
A  1  993  G   993  994  ?    ?   ?   0 . n 
A  1  994  C   994  995  ?    ?   ?   0 . n 
A  1  995  A   995  996  ?    ?   ?   0 . n 
A  1  996  C   996  997  ?    ?   ?   0 . n 
A  1  997  A   997  998  ?    ?   ?   0 . n 
A  1  998  C   998  999  999  C   C   0 . n 
A  1  999  C   999  1000 1000 C   C   0 . n 
A  1  1000 U   1000 1001 1001 U   U   0 . n 
A  1  1001 G   1001 1002 1002 G   G   0 . n 
A  1  1002 U   1002 1003 1003 U   U   0 . n 
A  1  1003 C   1003 1004 1004 C   C   0 . n 
A  1  1004 A   1004 1005 1005 A   A   0 . n 
A  1  1005 A   1005 1006 1006 A   A   0 . n 
A  1  1006 A   1006 1007 1007 A   A   0 . n 
A  1  1007 C   1007 1008 1008 C   C   0 . n 
A  1  1008 U   1008 1009 1009 U   U   0 . n 
A  1  1009 C   1009 1010 1010 C   C   0 . n 
A  1  1010 C   1010 1011 1011 C   C   0 . n 
A  1  1011 A   1011 1012 1012 A   A   0 . n 
A  1  1012 A   1012 1013 1013 A   A   0 . n 
A  1  1013 A   1013 1014 1014 A   A   0 . n 
A  1  1014 C   1014 1015 1015 C   C   0 . n 
A  1  1015 U   1015 1016 1016 U   U   0 . n 
A  1  1016 U   1016 1017 1017 U   U   0 . n 
A  1  1017 A   1017 1018 1018 A   A   0 . n 
A  1  1018 C   1018 1019 1019 C   C   0 . n 
A  1  1019 A   1019 1020 1020 A   A   0 . n 
A  1  1020 G   1020 1021 1021 G   G   0 . n 
A  1  1021 A   1021 1022 1022 A   A   0 . n 
A  1  1022 C   1022 1023 1023 C   C   0 . n 
A  1  1023 G   1023 1024 1024 G   G   0 . n 
A  1  1024 C   1024 1025 1025 C   C   0 . n 
A  1  1025 C   1025 1026 1026 C   C   0 . n 
A  1  1026 G   1026 1027 1027 G   G   0 . n 
A  1  1027 U   1027 1028 1028 U   U   0 . n 
A  1  1028 U   1028 1029 1029 U   U   0 . n 
A  1  1029 U   1029 1030 1030 U   U   0 . n 
A  1  1030 G   1030 1031 1031 G   G   0 . n 
A  1  1031 A   1031 1032 1032 A   A   0 . n 
A  1  1032 C   1032 1033 1033 C   C   0 . n 
A  1  1033 G   1033 1034 1034 G   G   0 . n 
A  1  1034 C   1034 1035 1035 C   C   0 . n 
A  1  1035 G   1035 1036 1036 G   G   0 . n 
A  1  1036 G   1036 1037 1037 G   G   0 . n 
A  1  1037 G   1037 1038 1038 G   G   0 . n 
A  1  1038 G   1038 1039 1039 G   G   0 . n 
A  1  1039 A   1039 1040 1040 A   A   0 . n 
A  1  1040 U   1040 1041 1041 U   U   0 . n 
A  1  1041 U   1041 1042 1042 U   U   0 . n 
A  1  1042 C   1042 1043 1043 C   C   0 . n 
A  1  1043 C   1043 1044 1044 C   C   0 . n 
A  1  1044 G   1044 1045 1045 G   G   0 . n 
A  1  1045 G   1045 1046 1046 G   G   0 . n 
A  1  1046 U   1046 1047 1047 U   U   0 . n 
A  1  1047 G   1047 1048 1048 G   G   0 . n 
A  1  1048 C   1048 1049 1049 C   C   0 . n 
A  1  1049 G   1049 1050 1050 G   G   0 . n 
A  1  1050 C   1050 1051 1051 C   C   0 . n 
A  1  1051 G   1051 1052 1052 G   G   0 . n 
A  1  1052 G   1052 1053 1053 G   G   0 . n 
A  1  1053 G   1053 1054 1054 G   G   0 . n 
A  1  1054 G   1054 1055 1055 G   G   0 . n 
A  1  1055 U   1055 1056 1056 U   U   0 . n 
A  1  1056 A   1056 1057 1057 A   A   0 . n 
A  1  1057 A   1057 1058 1058 A   A   0 . n 
A  1  1058 G   1058 1059 1059 G   G   0 . n 
A  1  1059 C   1059 1060 1060 C   C   0 . n 
A  1  1060 C   1060 1061 1061 C   C   0 . n 
A  1  1061 U   1061 1062 1062 U   U   0 . n 
A  1  1062 G   1062 1063 1063 G   G   0 . n 
A  1  1063 U   1063 1064 1064 U   U   0 . n 
A  1  1064 G   1064 1065 1065 G   G   0 . n 
A  1  1065 U   1065 1066 1066 U   U   0 . n 
A  1  1066 A   1066 1067 1067 A   A   0 . n 
A  1  1067 C   1067 1068 1068 C   C   0 . n 
A  1  1068 C   1068 1069 1069 C   C   0 . n 
A  1  1069 A   1069 1070 1070 A   A   0 . n 
A  1  1070 G   1070 1071 1071 G   G   0 . n 
A  1  1071 G   1071 1072 1072 G   G   0 . n 
A  1  1072 A   1072 1073 1073 A   A   0 . n 
A  1  1073 G   1073 1074 1074 G   G   0 . n 
A  1  1074 G   1074 1075 1075 G   G   0 . n 
A  1  1075 G   1075 1076 1076 G   G   0 . n 
A  1  1076 G   1076 1077 1077 G   G   0 . n 
A  1  1077 A   1077 1078 1078 A   A   0 . n 
A  1  1078 A   1078 1079 1079 A   A   0 . n 
A  1  1079 C   1079 1080 1080 C   C   0 . n 
A  1  1080 A   1080 1081 1081 A   A   0 . n 
A  1  1081 A   1081 1082 1082 A   A   0 . n 
A  1  1082 C   1082 1083 1083 C   C   0 . n 
A  1  1083 C   1083 1084 1084 C   C   0 . n 
A  1  1084 C   1084 1085 1085 C   C   0 . n 
A  1  1085 A   1085 1086 1086 A   A   0 . n 
A  1  1086 G   1086 1087 1087 G   G   0 . n 
A  1  1087 A   1087 1088 1088 A   A   0 . n 
A  1  1088 G   1088 1089 1089 G   G   0 . n 
A  1  1089 A   1089 1090 1090 A   A   0 . n 
A  1  1090 U   1090 1091 1091 U   U   0 . n 
A  1  1091 A   1091 1092 1092 A   A   0 . n 
A  1  1092 G   1092 1093 1093 G   G   0 . n 
A  1  1093 G   1093 1094 1094 G   G   0 . n 
A  1  1094 U   1094 1095 1095 U   U   0 . n 
A  1  1095 U   1095 1096 1096 U   U   0 . n 
A  1  1096 A   1096 1097 1097 A   A   0 . n 
A  1  1097 A   1097 1098 1098 A   A   0 . n 
A  1  1098 G   1098 1099 1099 G   G   0 . n 
A  1  1099 G   1099 1100 1100 G   G   0 . n 
A  1  1100 U   1100 1101 1101 U   U   0 . n 
A  1  1101 C   1101 1102 1102 C   C   0 . n 
A  1  1102 C   1102 1103 1103 C   C   0 . n 
A  1  1103 C   1103 1104 1104 C   C   0 . n 
A  1  1104 C   1104 1105 1105 C   C   0 . n 
A  1  1105 A   1105 1106 1106 A   A   0 . n 
A  1  1106 A   1106 1107 1107 A   A   0 . n 
A  1  1107 G   1107 1108 1108 G   G   0 . n 
A  1  1108 U   1108 1109 1109 U   U   0 . n 
A  1  1109 G   1109 1110 1110 G   G   0 . n 
A  1  1110 U   1110 1111 1111 U   U   0 . n 
A  1  1111 G   1111 1112 1112 G   G   0 . n 
A  1  1112 G   1112 1113 1113 G   G   0 . n 
A  1  1113 A   1113 1114 1114 A   A   0 . n 
A  1  1114 U   1114 1115 1115 U   U   0 . n 
A  1  1115 U   1115 1116 1116 U   U   0 . n 
A  1  1116 A   1116 1117 1117 A   A   0 . n 
A  1  1117 A   1117 1118 1118 A   A   0 . n 
A  1  1118 G   1118 1119 1119 G   G   0 . n 
A  1  1119 U   1119 1120 1120 U   U   0 . n 
A  1  1120 G   1120 1121 1121 G   G   0 . n 
A  1  1121 U   1121 1122 1122 U   U   0 . n 
A  1  1122 A   1122 1123 1123 A   A   0 . n 
A  1  1123 A   1123 1124 1124 A   A   0 . n 
A  1  1124 U   1124 1125 1125 U   U   0 . n 
A  1  1125 C   1125 1126 1126 C   C   0 . n 
A  1  1126 C   1126 1127 1127 C   C   0 . n 
A  1  1127 U   1127 1128 1128 U   U   0 . n 
A  1  1128 C   1128 1129 1129 C   C   0 . n 
A  1  1129 U   1129 1130 1130 U   U   0 . n 
A  1  1130 G   1130 1131 1131 G   G   0 . n 
A  1  1131 A   1131 1132 1132 A   A   0 . n 
A  1  1132 A   1132 1133 1133 A   A   0 . n 
A  1  1133 G   1133 1134 1134 G   G   0 . n 
A  1  1134 G   1134 1135 1135 G   G   0 . n 
A  1  1135 U   1135 1136 1136 U   U   0 . n 
A  1  1136 G   1136 1137 1137 G   G   0 . n 
A  1  1137 G   1137 1138 1138 G   G   0 . n 
A  1  1138 U   1138 1139 1139 U   U   0 . n 
A  1  1139 C   1139 1140 1140 C   C   0 . n 
A  1  1140 U   1140 1141 1141 U   U   0 . n 
A  1  1141 C   1141 1142 1142 C   C   0 . n 
A  1  1142 G   1142 1143 1143 G   G   0 . n 
A  1  1143 A   1143 1144 1144 A   A   0 . n 
A  1  1144 G   1144 1145 1145 G   G   0 . n 
A  1  1145 C   1145 1146 1146 C   C   0 . n 
A  1  1146 C   1146 1147 1147 C   C   0 . n 
A  1  1147 C   1147 1148 1148 C   C   0 . n 
A  1  1148 U   1148 1149 1149 U   U   0 . n 
A  1  1149 A   1149 1150 1150 A   A   0 . n 
A  1  1150 G   1150 1151 1151 G   G   0 . n 
A  1  1151 A   1151 1152 1152 A   A   0 . n 
A  1  1152 C   1152 1153 1153 C   C   0 . n 
A  1  1153 A   1153 1154 1154 A   A   0 . n 
A  1  1154 G   1154 1155 1155 G   G   0 . n 
A  1  1155 C   1155 1156 1156 C   C   0 . n 
A  1  1156 C   1156 1157 1157 C   C   0 . n 
A  1  1157 G   1157 1158 1158 G   G   0 . n 
A  1  1158 G   1158 1159 1159 G   G   0 . n 
A  1  1159 G   1159 1160 1160 G   G   0 . n 
A  1  1160 A   1160 1161 1161 A   A   0 . n 
A  1  1161 G   1161 1162 1162 G   G   0 . n 
A  1  1162 G   1162 1163 1163 G   G   0 . n 
A  1  1163 U   1163 1164 1164 U   U   0 . n 
A  1  1164 G   1164 1165 1165 G   G   0 . n 
A  1  1165 A   1165 1166 1166 A   A   0 . n 
A  1  1166 G   1166 1167 1167 G   G   0 . n 
A  1  1167 C   1167 1168 1168 C   C   0 . n 
A  1  1168 U   1168 1169 1169 U   U   0 . n 
A  1  1169 U   1169 1170 1170 U   U   0 . n 
A  1  1170 A   1170 1171 1171 A   A   0 . n 
A  1  1171 G   1171 1172 1172 G   G   0 . n 
A  1  1172 A   1172 1173 1173 A   A   0 . n 
A  1  1173 A   1173 1174 1174 A   A   0 . n 
A  1  1174 G   1174 1175 1175 G   G   0 . n 
A  1  1175 C   1175 1176 1176 C   C   0 . n 
A  1  1176 A   1176 1177 1177 A   A   0 . n 
A  1  1177 G   1177 1178 1178 G   G   0 . n 
A  1  1178 C   1178 1179 1179 C   C   0 . n 
A  1  1179 U   1179 1180 1180 U   U   0 . n 
A  1  1180 A   1180 1181 1181 A   A   0 . n 
A  1  1181 C   1181 1182 1182 C   C   0 . n 
A  1  1182 C   1182 1183 1183 C   C   0 . n 
A  1  1183 C   1183 1184 1184 C   C   0 . n 
A  1  1184 U   1184 1185 1185 U   U   0 . n 
A  1  1185 C   1185 1186 1186 C   C   0 . n 
A  1  1186 U   1186 1187 1187 U   U   0 . n 
A  1  1187 A   1187 1188 1188 A   A   0 . n 
A  1  1188 A   1188 1189 1189 A   A   0 . n 
A  1  1189 G   1189 1190 1190 G   G   0 . n 
A  1  1190 A   1190 1191 1191 A   A   0 . n 
A  1  1191 A   1191 1192 1192 A   A   0 . n 
A  1  1192 A   1192 1193 1193 A   A   0 . n 
A  1  1193 A   1193 1194 1194 A   A   0 . n 
A  1  1194 G   1194 1195 1195 G   G   0 . n 
A  1  1195 C   1195 1196 1196 C   C   0 . n 
A  1  1196 G   1196 1197 1197 G   G   0 . n 
A  1  1197 U   1197 1198 1198 U   U   0 . n 
A  1  1198 A   1198 1199 1199 A   A   0 . n 
A  1  1199 A   1199 1200 1200 A   A   0 . n 
A  1  1200 C   1200 1201 1201 C   C   0 . n 
A  1  1201 A   1201 1202 1202 A   A   0 . n 
A  1  1202 G   1202 1203 1203 G   G   0 . n 
A  1  1203 C   1203 1204 1204 C   C   0 . n 
A  1  1204 U   1204 1205 1205 U   U   0 . n 
A  1  1205 U   1205 1206 1206 U   U   0 . n 
A  1  1206 A   1206 1207 1207 A   A   0 . n 
A  1  1207 C   1207 1208 1208 C   C   0 . n 
A  1  1208 C   1208 1209 1209 C   C   0 . n 
A  1  1209 G   1209 1210 1210 G   G   0 . n 
A  1  1210 G   1210 1211 1211 G   G   0 . n 
A  1  1211 C   1211 1212 1212 C   C   0 . n 
A  1  1212 C   1212 1213 1213 C   C   0 . n 
A  1  1213 G   1213 1214 1214 G   G   0 . n 
A  1  1214 A   1214 1215 1215 A   A   0 . n 
A  1  1215 G   1215 1216 1216 G   G   0 . n 
A  1  1216 G   1216 1217 1217 G   G   0 . n 
A  1  1217 U   1217 1218 1218 U   U   0 . n 
A  1  1218 U   1218 1219 1219 U   U   0 . n 
A  1  1219 U   1219 1220 1220 U   U   0 . n 
A  1  1220 G   1220 1221 1221 G   G   0 . n 
A  1  1221 A   1221 1222 1222 A   A   0 . n 
A  1  1222 G   1222 1223 1223 G   G   0 . n 
A  1  1223 G   1223 1224 1224 G   G   0 . n 
A  1  1224 C   1224 1225 1225 C   C   0 . n 
A  1  1225 G   1225 1226 1226 G   G   0 . n 
A  1  1226 C   1226 1227 1227 C   C   0 . n 
A  1  1227 C   1227 1228 1228 C   C   0 . n 
A  1  1228 C   1228 1229 1229 C   C   0 . n 
A  1  1229 A   1229 1230 1230 A   A   0 . n 
A  1  1230 A   1230 1231 1231 A   A   0 . n 
A  1  1231 A   1231 1232 1232 A   A   0 . n 
A  1  1232 A   1232 1233 1233 A   A   0 . n 
A  1  1233 U   1233 1234 1234 U   U   0 . n 
A  1  1234 G   1234 1235 1235 G   G   0 . n 
A  1  1235 A   1235 1236 1236 A   A   0 . n 
A  1  1236 U   1236 1237 1237 U   U   0 . n 
A  1  1237 C   1237 1238 1238 C   C   0 . n 
A  1  1238 G   1238 1239 1239 G   G   0 . n 
A  1  1239 G   1239 1240 1240 G   G   0 . n 
A  1  1240 G   1240 1241 1241 G   G   0 . n 
A  1  1241 A   1241 1242 1242 A   A   0 . n 
A  1  1242 C   1242 1243 1243 C   C   0 . n 
A  1  1243 U   1243 1244 1244 U   U   0 . n 
A  1  1244 C   1244 1245 1245 C   C   0 . n 
A  1  1245 A   1245 1246 1246 A   A   0 . n 
A  1  1246 A   1246 1247 1247 A   A   0 . n 
A  1  1247 A   1247 1248 1248 A   A   0 . n 
A  1  1248 U   1248 1249 1249 U   U   0 . n 
A  1  1249 C   1249 1250 1250 C   C   0 . n 
A  1  1250 C   1250 1251 1251 C   C   0 . n 
A  1  1251 A   1251 1252 1252 A   A   0 . n 
A  1  1252 C   1252 1253 1253 C   C   0 . n 
A  1  1253 C   1253 1254 1254 C   C   0 . n 
A  1  1254 A   1254 1255 1255 A   A   0 . n 
A  1  1255 C   1255 1256 1256 C   C   0 . n 
A  1  1256 C   1256 1257 1257 C   C   0 . n 
A  1  1257 G   1257 1258 1258 G   G   0 . n 
A  1  1258 A   1258 1259 1259 A   A   0 . n 
A  1  1259 G   1259 1260 1260 G   G   0 . n 
A  1  1260 A   1260 1261 1261 A   A   0 . n 
A  1  1261 C   1261 1262 1262 C   C   0 . n 
A  1  1262 C   1262 1263 1263 C   C   0 . n 
A  1  1263 U   1263 1264 1264 U   U   0 . n 
A  1  1264 G   1264 1265 1265 G   G   0 . n 
A  1  1265 U   1265 1266 1266 U   U   0 . n 
A  1  1266 C   1266 1267 1267 C   C   0 . n 
A  1  1267 C   1267 1268 1268 C   C   0 . n 
A  1  1268 G   1268 1269 1269 G   G   0 . n 
A  1  1269 U   1269 1270 1270 U   U   0 . n 
A  1  1270 A   1270 1271 1271 A   A   0 . n 
A  1  1271 C   1271 1272 1272 C   C   0 . n 
A  1  1272 C   1272 1273 1273 C   C   0 . n 
A  1  1273 A   1273 1274 1274 A   A   0 . n 
A  1  1274 C   1274 1275 1275 C   C   0 . n 
A  1  1275 U   1275 1276 1276 U   U   0 . n 
A  1  1276 C   1276 1277 1277 C   C   0 . n 
A  1  1277 A   1277 1278 1278 A   A   0 . n 
A  1  1278 U   1278 1279 1279 U   U   0 . n 
A  1  1279 A   1279 1280 1280 A   A   0 . n 
A  1  1280 C   1280 1281 1281 C   C   0 . n 
A  1  1281 U   1281 1282 1282 U   U   0 . n 
A  1  1282 G   1282 1283 1283 G   G   0 . n 
A  1  1283 G   1283 1284 1284 G   G   0 . n 
A  1  1284 U   1284 1285 1285 U   U   0 . n 
A  1  1285 A   1285 1286 1286 A   A   0 . n 
A  1  1286 A   1286 1287 1287 A   A   0 . n 
A  1  1287 U   1287 1288 1288 U   U   0 . n 
A  1  1288 C   1288 1289 1289 C   C   0 . n 
A  1  1289 G   1289 1290 1290 G   G   0 . n 
A  1  1290 A   1290 1291 1291 A   A   0 . n 
A  1  1291 G   1291 1292 1292 G   G   0 . n 
A  1  1292 U   1292 1293 1293 U   U   0 . n 
A  1  1293 A   1293 1294 1294 A   A   0 . n 
A  1  1294 G   1294 1295 1295 G   G   0 . n 
A  1  1295 A   1295 1296 1296 A   A   0 . n 
A  1  1296 U   1296 1297 1297 U   U   0 . n 
A  1  1297 U   1297 1298 1298 U   U   0 . n 
A  1  1298 G   1298 1299 1299 G   G   0 . n 
A  1  1299 G   1299 1300 1300 G   G   0 . n 
A  1  1300 C   1300 1301 1301 C   C   0 . n 
A  1  1301 G   1301 1302 1302 G   G   0 . n 
A  1  1302 C   1302 1303 1303 C   C   0 . n 
A  1  1303 U   1303 1304 1304 U   U   0 . n 
A  1  1304 C   1304 1305 1305 C   C   0 . n 
A  1  1305 U   1305 1306 1306 U   U   0 . n 
A  1  1306 A   1306 1307 1307 A   A   0 . n 
A  1  1307 A   1307 1308 1308 A   A   0 . n 
A  1  1308 U   1308 1309 1309 U   U   0 . n 
A  1  1309 U   1309 1310 1310 U   U   0 . n 
A  1  1310 G   1310 1311 1311 G   G   0 . n 
A  1  1311 G   1311 1312 1312 G   G   0 . n 
A  1  1312 A   1312 1313 1313 A   A   0 . n 
A  1  1313 U   1313 1314 1314 U   U   0 . n 
A  1  1314 G   1314 1315 1315 G   G   0 . n 
A  1  1315 G   1315 1316 1316 G   G   0 . n 
A  1  1316 A   1316 1317 1317 A   A   0 . n 
A  1  1317 A   1317 1318 1318 A   A   0 . n 
A  1  1318 G   1318 1319 1319 G   G   0 . n 
A  1  1319 U   1319 1320 1320 U   U   0 . n 
A  1  1320 A   1320 1321 1321 A   A   0 . n 
A  1  1321 G   1321 1322 1322 G   G   0 . n 
A  1  1322 G   1322 1323 1323 G   G   0 . n 
A  1  1323 G   1323 1324 1324 G   G   0 . n 
A  1  1324 G   1324 1325 1325 G   G   0 . n 
A  1  1325 U   1325 1326 1326 U   U   0 . n 
A  1  1326 G   1326 1327 1327 G   G   0 . n 
A  1  1327 A   1327 1328 1328 A   A   0 . n 
A  1  1328 A   1328 1329 1329 A   A   0 . n 
A  1  1329 A   1329 1330 1330 A   A   0 . n 
A  1  1330 A   1330 1331 1331 A   A   0 . n 
A  1  1331 C   1331 1332 1332 C   C   0 . n 
A  1  1332 U   1332 1333 1333 U   U   0 . n 
A  1  1333 C   1333 1334 1334 C   C   0 . n 
A  1  1334 C   1334 1335 1335 C   C   0 . n 
A  1  1335 U   1335 1336 1336 U   U   0 . n 
A  1  1336 A   1336 1337 1337 A   A   0 . n 
A  1  1337 U   1337 1338 1338 U   U   0 . n 
A  1  1338 G   1338 1339 1339 G   G   0 . n 
A  1  1339 G   1339 1340 1340 G   G   0 . n 
A  1  1340 A   1340 1341 1341 A   A   0 . n 
A  1  1341 C   1341 1342 1342 C   C   0 . n 
A  1  1342 C   1342 1343 1343 C   C   0 . n 
A  1  1343 G   1343 1344 1344 G   G   0 . n 
A  1  1344 A   1344 1345 1345 A   A   0 . n 
A  1  1345 U   1345 1346 1346 U   U   0 . n 
A  1  1346 U   1346 1347 1347 U   U   0 . n 
A  1  1347 A   1347 1348 1348 A   A   0 . n 
A  1  1348 G   1348 1349 1349 G   G   0 . n 
A  1  1349 U   1349 1350 1350 U   U   0 . n 
A  1  1350 G   1350 1351 1351 G   G   0 . n 
A  1  1351 A   1351 1352 1352 A   A   0 . n 
A  1  1352 C   1352 1353 1353 C   C   0 . n 
A  1  1353 G   1353 1354 1354 G   G   0 . n 
A  1  1354 A   1354 1355 1355 A   A   0 . n 
A  1  1355 A   1355 1356 1356 A   A   0 . n 
A  1  1356 A   1356 1357 1357 A   A   0 . n 
A  1  1357 A   1357 1358 1358 A   A   0 . n 
A  1  1358 U   1358 1359 1359 U   U   0 . n 
A  1  1359 C   1359 1360 1360 C   C   0 . n 
A  1  1360 C   1360 1361 1361 C   C   0 . n 
A  1  1361 U   1361 1362 1362 U   U   0 . n 
A  1  1362 G   1362 1363 1363 G   G   0 . n 
A  1  1363 G   1363 1364 1364 G   G   0 . n 
A  1  1364 C   1364 1365 1365 C   C   0 . n 
A  1  1365 C   1365 1366 1366 C   C   0 . n 
A  1  1366 A   1366 1367 1367 A   A   0 . n 
A  1  1367 U   1367 1368 1368 U   U   0 . n 
A  1  1368 A   1368 1369 1369 A   A   0 . n 
A  1  1369 G   1369 1370 1370 G   G   0 . n 
A  1  1370 U   1370 1371 1371 U   U   0 . n 
A  1  1371 A   1371 1372 1372 A   A   0 . n 
A  1  1372 G   1372 1373 1373 G   G   0 . n 
A  1  1373 C   1373 1374 1374 C   C   0 . n 
A  1  1374 A   1374 1375 1375 A   A   0 . n 
A  1  1375 G   1375 1376 1376 G   G   0 . n 
A  1  1376 C   1376 1377 1377 C   C   0 . n 
A  1  1377 G   1377 1378 1378 G   G   0 . n 
A  1  1378 A   1378 1379 1379 A   A   0 . n 
A  1  1379 U   1379 1380 1380 U   U   0 . n 
A  1  1380 A   1380 1381 1381 A   A   0 . n 
A  1  1381 G   1381 1382 1382 G   G   0 . n 
A  1  1382 U   1382 1383 1383 U   U   0 . n 
A  1  1383 C   1383 1384 1384 C   C   0 . n 
A  1  1384 G   1384 1385 1385 G   G   0 . n 
A  1  1385 G   1385 1386 1386 G   G   0 . n 
A  1  1386 G   1386 1387 1387 G   G   0 . n 
A  1  1387 U   1387 1388 1388 U   U   0 . n 
A  1  1388 G   1388 1389 1389 G   G   0 . n 
A  1  1389 A   1389 1390 1390 A   A   0 . n 
A  1  1390 G   1390 1391 1391 G   G   0 . n 
A  1  1391 A   1391 1392 1392 A   A   0 . n 
A  1  1392 A   1392 1393 1393 A   A   0 . n 
A  1  1393 C   1393 1394 1394 C   C   0 . n 
A  1  1394 C   1394 1395 1395 C   C   0 . n 
A  1  1395 C   1395 1396 1396 C   C   0 . n 
A  1  1396 C   1396 1397 1397 C   C   0 . n 
A  1  1397 G   1397 1398 1398 G   G   0 . n 
A  1  1398 A   1398 1399 1399 A   A   0 . n 
A  1  1399 C   1399 1400 1400 C   C   0 . n 
A  1  1400 G   1400 1401 1401 G   G   0 . n 
A  1  1401 G   1401 1402 1402 G   G   0 . n 
A  1  1402 C   1402 1403 1403 C   C   0 . n 
A  1  1403 C   1403 1404 1404 C   C   0 . n 
A  1  1404 U   1404 1405 1405 U   U   0 . n 
A  1  1405 A   1405 1406 1406 A   A   0 . n 
A  1  1406 A   1406 1407 1407 A   A   0 . n 
A  1  1407 U   1407 1408 1408 U   U   0 . n 
A  1  1408 G   1408 1409 1409 G   G   0 . n 
A  1  1409 G   1409 1410 1410 G   G   0 . n 
A  1  1410 A   1410 1411 1411 A   A   0 . n 
A  1  1411 U   1411 1412 1412 U   U   0 . n 
A  1  1412 A   1412 1413 1413 A   A   0 . n 
A  1  1413 A   1413 1414 1414 A   A   0 . n 
A  1  1414 G   1414 1415 1415 G   G   0 . n 
A  1  1415 G   1415 1416 1416 G   G   0 . n 
A  1  1416 G   1416 1417 1417 G   G   0 . n 
A  1  1417 U   1417 1418 1418 U   U   0 . n 
A  1  1418 U   1418 1419 1419 U   U   0 . n 
A  1  1419 C   1419 1420 1420 C   C   0 . n 
A  1  1420 C   1420 1421 1421 C   C   0 . n 
A  1  1421 U   1421 1422 1422 U   U   0 . n 
A  1  1422 C   1422 1423 1423 C   C   0 . n 
A  1  1423 A   1423 1424 1424 A   A   0 . n 
A  1  1424 G   1424 1425 1425 G   G   0 . n 
A  1  1425 C   1425 1426 1426 C   C   0 . n 
A  1  1426 A   1426 1427 1427 A   A   0 . n 
A  1  1427 C   1427 1428 1428 C   C   0 . n 
A  1  1428 U   1428 1429 1429 U   U   0 . n 
A  1  1429 G   1429 1430 1430 G   G   0 . n 
A  1  1430 C   1430 1431 1431 C   C   0 . n 
A  1  1431 U   1431 1432 1432 U   U   0 . n 
A  1  1432 G   1432 1433 1433 G   G   0 . n 
A  1  1433 A   1433 1434 1434 A   A   0 . n 
A  1  1434 U   1434 1435 1435 U   U   0 . n 
A  1  1435 C   1435 1436 1436 C   C   0 . n 
A  1  1436 A   1436 1437 1437 A   A   0 . n 
A  1  1437 G   1437 1438 1438 G   G   0 . n 
A  1  1438 C   1438 1439 1439 C   C   0 . n 
A  1  1439 U   1439 1440 1440 U   U   0 . n 
A  1  1440 G   1440 1441 1441 G   G   0 . n 
A  1  1441 A   1441 1442 1442 A   A   0 . n 
A  1  1442 G   1442 1443 1443 G   G   0 . n 
A  1  1443 G   1443 1444 1444 G   G   0 . n 
A  1  1444 G   1444 1445 1445 G   G   0 . n 
A  1  1445 U   1445 1446 1446 U   U   0 . n 
A  1  1446 U   1446 1447 1447 U   U   0 . n 
A  1  1447 A   1447 1448 1448 A   A   0 . n 
A  1  1448 G   1448 1449 1449 G   G   0 . n 
A  1  1449 C   1449 1450 1450 C   C   0 . n 
A  1  1450 C   1450 1451 1451 C   C   0 . n 
A  1  1451 G   1451 1452 1452 G   G   0 . n 
A  1  1452 G   1452 1453 1453 G   G   0 . n 
A  1  1453 U   1453 1454 1454 U   U   0 . n 
A  1  1454 C   1454 1455 1455 C   C   0 . n 
A  1  1455 C   1455 1456 1456 C   C   0 . n 
A  1  1456 U   1456 1457 1457 U   U   0 . n 
A  1  1457 A   1457 1458 1458 A   A   0 . n 
A  1  1458 A   1458 1459 1459 A   A   0 . n 
A  1  1459 G   1459 1460 1460 G   G   0 . n 
A  1  1460 U   1460 1461 1461 U   U   0 . n 
A  1  1461 C   1461 1462 1462 C   C   0 . n 
A  1  1462 A   1462 1463 1463 A   A   0 . n 
A  1  1463 U   1463 1464 1464 U   U   0 . n 
A  1  1464 A   1464 1465 1465 A   A   0 . n 
A  1  1465 C   1465 1466 1466 C   C   0 . n 
A  1  1466 C   1466 1467 1467 C   C   0 . n 
A  1  1467 G   1467 1468 1468 G   G   0 . n 
A  1  1468 C   1468 1469 1469 C   C   0 . n 
A  1  1469 A   1469 1470 1470 A   A   0 . n 
A  1  1470 A   1470 1471 1471 A   A   0 . n 
A  1  1471 C   1471 1472 1472 C   C   0 . n 
A  1  1472 U   1472 1473 1473 U   U   0 . n 
A  1  1473 C   1473 1474 1474 C   C   0 . n 
A  1  1474 G   1474 1475 1475 G   G   0 . n 
A  1  1475 A   1475 1476 1476 A   A   0 . n 
A  1  1476 C   1476 1477 1477 C   C   0 . n 
A  1  1477 U   1477 1478 1478 U   U   0 . n 
A  1  1478 A   1478 1479 1479 A   A   0 . n 
A  1  1479 U   1479 1480 1480 U   U   0 . n 
A  1  1480 G   1480 1481 1481 G   G   0 . n 
A  1  1481 A   1481 1482 1482 A   A   0 . n 
A  1  1482 C   1482 1483 1483 C   C   0 . n 
A  1  1483 G   1483 1484 1484 G   G   0 . n 
A  1  1484 A   1484 1485 1485 A   A   0 . n 
A  1  1485 A   1485 1486 1486 A   A   0 . n 
A  1  1486 A   1486 1487 1487 A   A   0 . n 
A  1  1487 U   1487 1488 1488 U   U   0 . n 
A  1  1488 G   1488 1489 1489 G   G   0 . n 
A  1  1489 G   1489 1490 1490 G   G   0 . n 
A  1  1490 G   1490 1491 1491 G   G   0 . n 
A  1  1491 A   1491 1492 1492 A   A   0 . n 
A  1  1492 A   1492 1493 1493 A   A   0 . n 
A  1  1493 A   1493 1494 1494 A   A   0 . n 
A  1  1494 C   1494 1495 1495 C   C   0 . n 
A  1  1495 G   1495 1496 1496 G   G   0 . n 
A  1  1496 G   1496 1497 1497 G   G   0 . n 
A  1  1497 G   1497 1498 1498 G   G   0 . n 
A  1  1498 U   1498 1499 1499 U   U   0 . n 
A  1  1499 U   1499 1500 1500 U   U   0 . n 
A  1  1500 A   1500 1501 1501 A   A   0 . n 
A  1  1501 A   1501 1502 1502 A   A   0 . n 
A  1  1502 U   1502 1503 1503 U   U   0 . n 
A  1  1503 A   1503 1504 1504 A   A   0 . n 
A  1  1504 U   1504 1505 1505 U   U   0 . n 
A  1  1505 U   1505 1506 1506 U   U   0 . n 
A  1  1506 C   1506 1507 1507 C   C   0 . n 
A  1  1507 C   1507 1508 1508 C   C   0 . n 
A  1  1508 C   1508 1509 1509 C   C   0 . n 
A  1  1509 G   1509 1510 1510 G   G   0 . n 
A  1  1510 U   1510 1511 1511 U   U   0 . n 
A  1  1511 G   1511 1512 1512 G   G   0 . n 
A  1  1512 C   1512 1513 1513 C   C   0 . n 
A  1  1513 C   1513 1514 1514 C   C   0 . n 
A  1  1514 A   1514 1515 1515 A   A   0 . n 
A  1  1515 C   1515 1516 1516 C   C   0 . n 
A  1  1516 U   1516 1517 1517 U   U   0 . n 
A  1  1517 A   1517 1518 1518 A   A   0 . n 
A  1  1518 U   1518 1519 1519 U   U   0 . n 
A  1  1519 G   1519 1520 1520 G   G   0 . n 
A  1  1520 C   1520 1521 1521 C   C   0 . n 
A  1  1521 A   1521 1522 1522 A   A   0 . n 
A  1  1522 G   1522 1523 1523 G   G   0 . n 
A  1  1523 U   1523 1524 1524 U   U   0 . n 
A  1  1524 G   1524 1525 1525 G   G   0 . n 
A  1  1525 A   1525 1526 1526 A   A   0 . n 
A  1  1526 A   1526 1527 1527 A   A   0 . n 
A  1  1527 A   1527 1528 1528 A   A   0 . n 
A  1  1528 G   1528 1529 1529 G   G   0 . n 
A  1  1529 U   1529 1530 1530 U   U   0 . n 
A  1  1530 U   1530 1531 1531 U   U   0 . n 
A  1  1531 G   1531 1532 1532 G   G   0 . n 
A  1  1532 A   1532 1533 1533 A   A   0 . n 
A  1  1533 C   1533 1534 1534 C   C   0 . n 
A  1  1534 G   1534 1535 1535 G   G   0 . n 
A  1  1535 C   1535 1536 1536 C   C   0 . n 
A  1  1536 C   1536 1537 1537 C   C   0 . n 
A  1  1537 C   1537 1538 1538 C   C   0 . n 
A  1  1538 U   1538 1539 1539 U   U   0 . n 
A  1  1539 G   1539 1540 1540 G   G   0 . n 
A  1  1540 G   1540 1541 1541 G   G   0 . n 
A  1  1541 G   1541 1542 1542 G   G   0 . n 
A  1  1542 G   1542 1543 1543 G   G   0 . n 
A  1  1543 U   1543 1544 1544 U   U   0 . n 
A  1  1544 C   1544 1545 1545 C   C   0 . n 
A  1  1545 G   1545 1546 1546 G   G   0 . n 
A  1  1546 A   1546 1547 1547 A   A   0 . n 
A  1  1547 U   1547 1548 1548 U   U   0 . n 
A  1  1548 C   1548 1549 1549 C   C   0 . n 
A  1  1549 A   1549 1550 1550 A   A   0 . n 
A  1  1550 C   1550 1551 1551 C   C   0 . n 
A  1  1551 G   1551 1552 1552 G   G   0 . n 
A  1  1552 C   1552 1553 1553 C   C   0 . n 
A  1  1553 U   1553 1554 1554 U   U   0 . n 
A  1  1554 G   1554 1555 1555 G   G   0 . n 
A  1  1555 G   1555 1556 1556 G   G   0 . n 
A  1  1556 G   1556 1557 1557 G   G   0 . n 
A  1  1557 C   1557 1558 1558 C   C   0 . n 
A  1  1558 A   1558 1559 1559 A   A   0 . n 
A  1  1559 U   1559 1560 ?    ?   ?   0 . n 
A  1  1560 U   1560 1561 1561 U   U   0 . n 
A  1  1561 C   1561 1562 1562 C   C   0 . n 
A  1  1562 G   1562 1563 1563 G   G   0 . n 
A  1  1563 C   1563 1564 1564 C   C   0 . n 
A  1  1564 C   1564 1565 1565 C   C   0 . n 
A  1  1565 C   1565 1566 1566 C   C   0 . n 
A  1  1566 A   1566 1567 1567 A   A   0 . n 
A  1  1567 G   1567 1568 1568 G   G   0 . n 
A  1  1568 U   1568 1569 1569 U   U   0 . n 
A  1  1569 C   1569 1570 1570 C   C   0 . n 
A  1  1570 G   1570 1571 1571 G   G   0 . n 
A  1  1571 A   1571 1572 1572 A   A   0 . n 
A  1  1572 A   1572 1573 1573 A   A   0 . n 
A  1  1573 C   1573 1574 1574 C   C   0 . n 
A  1  1574 C   1574 1575 1575 C   C   0 . n 
A  1  1575 G   1575 1576 1576 G   G   0 . n 
A  1  1576 U   1576 1577 1577 U   U   0 . n 
A  1  1577 C   1577 1578 1578 C   C   0 . n 
A  1  1578 C   1578 1579 1579 C   C   0 . n 
A  1  1579 A   1579 1580 1580 A   A   0 . n 
A  1  1580 A   1580 1581 1581 A   A   0 . n 
A  1  1581 C   1581 1582 1582 C   C   0 . n 
A  1  1582 U   1582 1583 1583 U   U   0 . n 
A  1  1583 C   1583 1584 1584 C   C   0 . n 
A  1  1584 C   1584 1585 1585 C   C   0 . n 
A  1  1585 G   1585 1586 1586 G   G   0 . n 
A  1  1586 U   1586 1587 1587 U   U   0 . n 
A  1  1587 G   1587 1588 1588 G   G   0 . n 
A  1  1588 G   1588 1589 1589 G   G   0 . n 
A  1  1589 A   1589 1590 1590 A   A   0 . n 
A  1  1590 A   1590 1591 1591 A   A   0 . n 
A  1  1591 G   1591 1592 1592 G   G   0 . n 
A  1  1592 C   1592 1593 1593 C   C   0 . n 
A  1  1593 C   1593 1594 1594 C   C   0 . n 
A  1  1594 G   1594 1595 1595 G   G   0 . n 
A  1  1595 U   1595 1596 1596 U   U   0 . n 
A  1  1596 A   1596 1597 1597 A   A   0 . n 
A  1  1597 A   1597 1598 1598 A   A   0 . n 
A  1  1598 U   1598 1599 1599 U   U   0 . n 
A  1  1599 G   1599 1600 1600 G   G   0 . n 
A  1  1600 G   1600 1601 1601 G   G   0 . n 
A  1  1601 C   1601 1602 1602 C   C   0 . n 
A  1  1602 A   1602 1603 1603 A   A   0 . n 
A  1  1603 G   1603 1604 1604 G   G   0 . n 
A  1  1604 G   1604 1605 1605 G   G   0 . n 
A  1  1605 A   1605 1606 1606 A   A   0 . n 
A  1  1606 A   1606 1607 1607 A   A   0 . n 
A  1  1607 G   1607 1608 1608 G   G   0 . n 
A  1  1608 C   1608 1609 1609 C   C   0 . n 
A  1  1609 G   1609 1610 1610 G   G   0 . n 
A  1  1610 G   1610 1611 1611 G   G   0 . n 
A  1  1611 A   1611 1612 1612 A   A   0 . n 
A  1  1612 C   1612 1613 1613 C   C   0 . n 
A  1  1613 G   1613 1614 1614 G   G   0 . n 
A  1  1614 A   1614 1615 1615 A   A   0 . n 
A  1  1615 A   1615 1616 1616 A   A   0 . n 
A  1  1616 C   1616 1617 1617 C   C   0 . n 
A  1  1617 G   1617 1618 1618 G   G   0 . n 
A  1  1618 G   1618 1619 1619 G   G   0 . n 
A  1  1619 C   1619 1620 1620 C   C   0 . n 
A  1  1620 G   1620 1621 1621 G   G   0 . n 
A  1  1621 G   1621 1622 1622 G   G   0 . n 
A  1  1622 C   1622 1623 1623 C   C   0 . n 
A  1  1623 A   1623 1624 1624 A   A   0 . n 
A  1  1624 U   1624 1625 1625 U   U   0 . n 
A  1  1625 A   1625 1626 1626 A   A   0 . n 
A  1  1626 G   1626 1627 1627 G   G   0 . n 
A  1  1627 G   1627 1628 1628 G   G   0 . n 
A  1  1628 G   1628 1629 1629 G   G   0 . n 
A  1  1629 A   1629 1630 1630 A   A   0 . n 
A  1  1630 A   1630 1631 1631 A   A   0 . n 
A  1  1631 A   1631 1632 1632 A   A   0 . n 
A  1  1632 C   1632 1633 1633 C   C   0 . n 
A  1  1633 G   1633 1634 1634 G   G   0 . n 
A  1  1634 U   1634 1635 1635 U   U   0 . n 
A  1  1635 G   1635 1636 1636 G   G   0 . n 
A  1  1636 A   1636 1637 1637 A   A   0 . n 
A  1  1637 U   1637 1638 1638 U   U   0 . n 
A  1  1638 U   1638 1639 1639 U   U   0 . n 
A  1  1639 C   1639 1640 1640 C   C   0 . n 
A  1  1640 A   1640 1641 1641 A   A   0 . n 
A  1  1641 A   1641 1642 1642 A   A   0 . n 
A  1  1642 C   1642 1643 1643 C   C   0 . n 
A  1  1643 C   1643 1644 1644 C   C   0 . n 
A  1  1644 U   1644 1645 1645 U   U   0 . n 
A  1  1645 G   1645 1646 1646 G   G   0 . n 
A  1  1646 G   1646 1647 1647 G   G   0 . n 
A  1  1647 G   1647 1648 1648 G   G   0 . n 
A  1  1648 G   1648 1649 1649 G   G   0 . n 
A  1  1649 C   1649 1650 1650 C   C   0 . n 
A  1  1650 C   1650 1651 1651 C   C   0 . n 
A  1  1651 C   1651 1652 1652 C   C   0 . n 
A  1  1652 A   1652 1653 1653 A   A   0 . n 
A  1  1653 U   1653 1654 1654 U   U   0 . n 
A  1  1654 G   1654 1655 1655 G   G   0 . n 
A  1  1655 A   1655 1656 1656 A   A   0 . n 
A  1  1656 A   1656 1657 1657 A   A   0 . n 
A  1  1657 A   1657 1658 1658 A   A   0 . n 
A  1  1658 A   1658 1659 1659 A   A   0 . n 
A  1  1659 G   1659 1660 1660 G   G   0 . n 
A  1  1660 A   1660 1661 1661 A   A   0 . n 
A  1  1661 C   1661 1662 1662 C   C   0 . n 
A  1  1662 G   1662 1663 1663 G   G   0 . n 
A  1  1663 A   1663 1664 1664 A   A   0 . n 
A  1  1664 G   1664 1665 1665 G   G   0 . n 
A  1  1665 C   1665 1666 1666 C   C   0 . n 
A  1  1666 A   1666 1667 1667 A   A   0 . n 
A  1  1667 U   1667 1668 1668 U   U   0 . n 
A  1  1668 A   1668 1669 1669 A   A   0 . n 
A  1  1669 G   1669 1670 1670 G   G   0 . n 
A  1  1670 U   1670 1671 1671 U   U   0 . n 
A  1  1671 G   1671 1672 1672 G   G   0 . n 
A  1  1672 U   1672 1673 1673 U   U   0 . n 
A  1  1673 C   1673 1674 1674 C   C   0 . n 
A  1  1674 C   1674 1675 1675 C   C   0 . n 
A  1  1675 G   1675 1676 1676 G   G   0 . n 
A  1  1676 U   1676 1677 1677 U   U   0 . n 
A  1  1677 A   1677 1678 1678 A   A   0 . n 
A  1  1678 C   1678 1679 1679 C   C   0 . n 
A  1  1679 C   1679 1680 1680 C   C   0 . n 
A  1  1680 G   1680 1681 1681 G   G   0 . n 
A  1  1681 A   1681 1682 1682 A   A   0 . n 
A  1  1682 G   1682 1683 1683 G   G   0 . n 
A  1  1683 A   1683 1684 1684 A   A   0 . n 
A  1  1684 A   1684 1685 1685 A   A   0 . n 
A  1  1685 C   1685 1686 1686 C   C   0 . n 
A  1  1686 C   1686 1687 1687 C   C   0 . n 
A  1  1687 G   1687 1688 1688 G   G   0 . n 
A  1  1688 A   1688 1689 1689 A   A   0 . n 
A  1  1689 C   1689 1690 1690 C   C   0 . n 
A  1  1690 A   1690 1691 1691 A   A   0 . n 
A  1  1691 C   1691 1692 1692 C   C   0 . n 
A  1  1692 A   1692 1693 1693 A   A   0 . n 
A  1  1693 G   1693 1694 1694 G   G   0 . n 
A  1  1694 G   1694 1695 1695 G   G   0 . n 
A  1  1695 U   1695 1696 1696 U   U   0 . n 
A  1  1696 G   1696 1697 1697 G   G   0 . n 
A  1  1697 U   1697 1698 1698 U   U   0 . n 
A  1  1698 C   1698 1699 1699 C   C   0 . n 
A  1  1699 C   1699 1700 1700 C   C   0 . n 
A  1  1700 A   1700 1701 1701 A   A   0 . n 
A  1  1701 U   1701 1702 1702 U   U   0 . n 
A  1  1702 G   1702 1703 1703 G   G   0 . n 
A  1  1703 G   1703 1704 1704 G   G   0 . n 
A  1  1704 C   1704 1705 1705 C   C   0 . n 
A  1  1705 G   1705 1706 1706 G   G   0 . n 
A  1  1706 G   1706 1707 1707 G   G   0 . n 
A  1  1707 C   1707 1708 1708 C   C   0 . n 
A  1  1708 G   1708 1709 1709 G   G   0 . n 
A  1  1709 A   1709 1710 1710 A   A   0 . n 
A  1  1710 A   1710 1711 1711 A   A   0 . n 
A  1  1711 A   1711 1712 1712 A   A   0 . n 
A  1  1712 G   1712 1713 1713 G   G   0 . n 
A  1  1713 C   1713 1714 1714 C   C   0 . n 
A  1  1714 C   1714 1715 1715 C   C   0 . n 
A  1  1715 A   1715 1716 1716 A   A   0 . n 
A  1  1716 A   1716 1717 1717 A   A   0 . n 
A  1  1717 G   1717 1718 1718 G   G   0 . n 
A  1  1718 G   1718 1719 1719 G   G   0 . n 
A  1  1719 C   1719 1720 1720 C   C   0 . n 
A  1  1720 C   1720 1721 1721 C   C   0 . n 
A  1  1721 U   1721 1722 1722 U   U   0 . n 
A  1  1722 G   1722 1723 1723 G   G   0 . n 
A  1  1723 U   1723 1724 1724 U   U   0 . n 
A  1  1724 C   1724 1725 1725 C   C   0 . n 
A  1  1725 G   1725 1726 1726 G   G   0 . n 
A  1  1726 G   1726 1727 1727 G   G   0 . n 
A  1  1727 G   1727 1728 1728 G   G   0 . n 
A  1  1728 A   1728 1729 1729 A   A   0 . n 
A  1  1729 G   1729 1730 1730 G   G   0 . n 
A  1  1730 C   1730 1731 1731 C   C   0 . n 
A  1  1731 A   1731 1732 1732 A   A   0 . n 
A  1  1732 A   1732 1733 1733 A   A   0 . n 
A  1  1733 C   1733 1734 1734 C   C   0 . n 
A  1  1734 C   1734 1735 1735 C   C   0 . n 
A  1  1735 A   1735 1736 1736 A   A   0 . n 
A  1  1736 A   1736 1737 1737 A   A   0 . n 
A  1  1737 C   1737 1738 1738 C   C   0 . n 
A  1  1738 G   1738 1739 1739 G   G   0 . n 
A  1  1739 U   1739 1740 1740 U   U   0 . n 
A  1  1740 U   1740 1741 1741 U   U   0 . n 
A  1  1741 A   1741 1742 1742 A   A   0 . n 
A  1  1742 G   1742 1743 1743 G   G   0 . n 
A  1  1743 G   1743 1744 1744 G   G   0 . n 
A  1  1744 G   1744 1745 1745 G   G   0 . n 
A  1  1745 A   1745 1746 1746 A   A   0 . n 
A  1  1746 A   1746 1747 1747 A   A   0 . n 
A  1  1747 U   1747 1748 1748 U   U   0 . n 
A  1  1748 U   1748 1749 1749 U   U   0 . n 
A  1  1749 C   1749 1750 1750 C   C   0 . n 
A  1  1750 G   1750 1751 1751 G   G   0 . n 
A  1  1751 G   1751 1752 1752 G   G   0 . n 
A  1  1752 C   1752 1753 1753 C   C   0 . n 
A  1  1753 A   1753 1754 1754 A   A   0 . n 
A  1  1754 A   1754 1755 1755 A   A   0 . n 
A  1  1755 G   1755 1756 1756 G   G   0 . n 
A  1  1756 U   1756 1757 1757 U   U   0 . n 
A  1  1757 U   1757 1758 1758 U   U   0 . n 
A  1  1758 A   1758 1759 1759 A   A   0 . n 
A  1  1759 G   1759 1760 1760 G   G   0 . n 
A  1  1760 U   1760 1761 1761 U   U   0 . n 
A  1  1761 C   1761 1762 1762 C   C   0 . n 
A  1  1762 C   1762 1763 1763 C   C   0 . n 
A  1  1763 C   1763 1764 1764 C   C   0 . n 
A  1  1764 G   1764 1765 1765 G   G   0 . n 
A  1  1765 U   1765 1766 1766 U   U   0 . n 
A  1  1766 A   1766 1767 1767 A   A   0 . n 
A  1  1767 C   1767 1768 1768 C   C   0 . n 
A  1  1768 C   1768 1769 1769 C   C   0 . n 
A  1  1769 U   1769 1770 1770 U   U   0 . n 
A  1  1770 U   1770 1771 1771 U   U   0 . n 
A  1  1771 C   1771 1772 1772 C   C   0 . n 
A  1  1772 G   1772 1773 1773 G   G   0 . n 
A  1  1773 G   1773 1774 1774 G   G   0 . n 
A  1  1774 A   1774 1775 1775 A   A   0 . n 
A  1  1775 A   1775 1776 1776 A   A   0 . n 
A  1  1776 G   1776 1777 1777 G   G   0 . n 
A  1  1777 A   1777 1778 1778 A   A   0 . n 
A  1  1778 A   1778 1779 1779 A   A   0 . n 
A  1  1779 G   1779 1780 1780 G   G   0 . n 
A  1  1780 G   1780 1781 1781 G   G   0 . n 
A  1  1781 G   1781 1782 1782 G   G   0 . n 
A  1  1782 A   1782 1783 1783 A   A   0 . n 
A  1  1783 U   1783 1784 1784 U   U   0 . n 
A  1  1784 G   1784 1785 1785 G   G   0 . n 
A  1  1785 C   1785 1786 1786 C   C   0 . n 
A  1  1786 C   1786 1787 1787 C   C   0 . n 
A  1  1787 U   1787 1788 1788 U   U   0 . n 
A  1  1788 G   1788 1789 1789 G   G   0 . n 
A  1  1789 C   1789 1790 1790 C   C   0 . n 
A  1  1790 U   1790 1791 1791 U   U   0 . n 
A  1  1791 C   1791 1792 1792 C   C   0 . n 
A  1  1792 C   1792 1793 1793 C   C   0 . n 
A  1  1793 G   1793 1794 1794 G   G   0 . n 
A  1  1794 G   1794 1795 1795 G   G   0 . n 
A  1  1795 A   1795 1796 1796 A   A   0 . n 
A  1  1796 A   1796 1797 1797 A   A   0 . n 
A  1  1797 C   1797 1798 1798 C   C   0 . n 
A  1  1798 G   1798 1799 1799 G   G   0 . n 
A  1  1799 G   1799 1800 1800 G   G   0 . n 
A  1  1800 A   1800 1801 1801 A   A   0 . n 
A  1  1801 G   1801 1802 1802 G   G   0 . n 
A  1  1802 C   1802 1803 1803 C   C   0 . n 
A  1  1803 A   1803 1804 1804 A   A   0 . n 
A  1  1804 G   1804 1805 1805 G   G   0 . n 
A  1  1805 G   1805 1806 1806 G   G   0 . n 
A  1  1806 U   1806 1807 1807 U   U   0 . n 
A  1  1807 C   1807 1808 1808 C   C   0 . n 
A  1  1808 G   1808 1809 1809 G   G   0 . n 
A  1  1809 C   1809 1810 1810 C   C   0 . n 
A  1  1810 A   1810 1811 1811 A   A   0 . n 
A  1  1811 G   1811 1812 1812 G   G   0 . n 
A  1  1812 U   1812 1813 1813 U   U   0 . n 
A  1  1813 G   1813 1814 1814 G   G   0 . n 
A  1  1814 A   1814 1815 1815 A   A   0 . n 
A  1  1815 C   1815 1816 1816 C   C   0 . n 
A  1  1816 U   1816 1817 1817 U   U   0 . n 
A  1  1817 C   1817 1818 1818 C   C   0 . n 
A  1  1818 G   1818 1819 1819 G   G   0 . n 
A  1  1819 G   1819 1820 1820 G   G   0 . n 
A  1  1820 A   1820 1821 1821 A   A   0 . n 
A  1  1821 A   1821 1822 1822 A   A   0 . n 
A  1  1822 G   1822 1823 1823 G   G   0 . n 
A  1  1823 C   1823 1824 1824 C   C   0 . n 
A  1  1824 U   1824 1825 1825 U   U   0 . n 
A  1  1825 C   1825 1826 1826 C   C   0 . n 
A  1  1826 G   1826 1827 1827 G   G   0 . n 
A  1  1827 G   1827 1828 1828 G   G   0 . n 
A  1  1828 A   1828 1829 1829 A   A   0 . n 
A  1  1829 C   1829 1830 1830 C   C   0 . n 
A  1  1830 U   1830 1831 1831 U   U   0 . n 
A  1  1831 G   1831 1832 1832 G   G   0 . n 
A  1  1832 U   1832 1833 1833 U   U   0 . n 
A  1  1833 C   1833 1834 1834 C   C   0 . n 
A  1  1834 U   1834 1835 1835 U   U   0 . n 
A  1  1835 A   1835 1836 1836 A   A   0 . n 
A  1  1836 G   1836 1837 1837 G   G   0 . n 
A  1  1837 U   1837 1838 1838 U   U   0 . n 
A  1  1838 A   1838 1839 1839 A   A   0 . n 
A  1  1839 A   1839 1840 1840 A   A   0 . n 
A  1  1840 C   1840 1841 1841 C   C   0 . n 
A  1  1841 A   1841 1842 1842 A   A   0 . n 
A  1  1842 A   1842 1843 1843 A   A   0 . n 
A  1  1843 C   1843 1844 1844 C   C   0 . n 
A  1  1844 A   1844 1845 1845 A   A   0 . n 
A  1  1845 U   1845 1846 1846 U   U   0 . n 
A  1  1846 A   1846 1847 1847 A   A   0 . n 
A  1  1847 G   1847 1848 1848 G   G   0 . n 
A  1  1848 G   1848 1849 1849 G   G   0 . n 
A  1  1849 U   1849 1850 1850 U   U   0 . n 
A  1  1850 G   1850 1851 1851 G   G   0 . n 
A  1  1851 A   1851 1852 1852 A   A   0 . n 
A  1  1852 C   1852 1853 1853 C   C   0 . n 
A  1  1853 C   1853 1854 1854 C   C   0 . n 
A  1  1854 G   1854 1855 1855 G   G   0 . n 
A  1  1855 C   1855 1856 1856 C   C   0 . n 
A  1  1856 A   1856 1857 1857 A   A   0 . n 
A  1  1857 A   1857 1858 1858 A   A   0 . n 
A  1  1858 A   1858 1859 1859 A   A   0 . n 
A  1  1859 U   1859 1860 1860 U   U   0 . n 
A  1  1860 C   1860 1861 1861 C   C   0 . n 
A  1  1861 C   1861 1862 1862 C   C   0 . n 
A  1  1862 G   1862 1863 1863 G   G   0 . n 
A  1  1863 C   1863 1864 1864 C   C   0 . n 
A  1  1864 A   1864 1865 1865 A   A   0 . n 
A  1  1865 A   1865 1866 1866 A   A   0 . n 
A  1  1866 G   1866 1867 1867 G   G   0 . n 
A  1  1867 G   1867 1868 1868 G   G   0 . n 
A  1  1868 A   1868 1869 1869 A   A   0 . n 
A  1  1869 C   1869 1870 1870 C   C   0 . n 
A  1  1870 U   1870 1871 1871 U   U   0 . n 
A  1  1871 C   1871 1872 1872 C   C   0 . n 
A  1  1872 G   1872 1873 1873 G   G   0 . n 
A  1  1873 U   1873 1874 1874 U   U   0 . n 
A  1  1874 A   1874 1875 1875 A   A   0 . n 
A  1  1875 C   1875 1876 1876 C   C   0 . n 
A  1  1876 G   1876 1877 1877 G   G   0 . n 
A  1  1877 G   1877 1878 1878 G   G   0 . n 
A  1  1878 U   1878 1879 1879 U   U   0 . n 
A  1  1879 C   1879 1880 1880 C   C   0 . n 
A  1  1880 A   1880 1881 1881 A   A   0 . n 
A  1  1881 C   1881 1882 1882 C   C   0 . n 
A  1  1882 U   1882 1883 1883 U   U   0 . n 
A  1  1883 G   1883 1884 1884 G   G   0 . n 
A  1  1884 A   1884 1885 1885 A   A   0 . n 
A  1  1885 A   1885 1886 1886 A   A   0 . n 
A  1  1886 U   1886 1887 1887 U   U   0 . n 
A  1  1887 C   1887 1888 1888 C   C   0 . n 
A  1  1888 C   1888 1889 1889 C   C   0 . n 
A  1  1889 U   1889 1890 1890 U   U   0 . n 
A  1  1890 G   1890 1891 1891 G   G   0 . n 
A  1  1891 C   1891 1892 1892 C   C   0 . n 
A  1  1892 C   1892 1893 1893 C   C   0 . n 
A  1  1893 C   1893 1894 1894 C   C   0 . n 
A  1  1894 A   1894 1895 1895 A   A   0 . n 
A  1  1895 G   1895 1896 1896 G   G   0 . n 
A  1  1896 U   1896 1897 1897 U   U   0 . n 
A  1  1897 G   1897 1898 1898 G   G   0 . n 
A  1  1898 C   1898 1899 1899 C   C   0 . n 
A  1  1899 A   1899 1900 1900 A   A   0 . n 
A  1  1900 G   1900 1901 1901 G   G   0 . n 
A  1  1901 G   1901 1902 1902 G   G   0 . n 
A  1  1902 U   1902 1903 1903 U   U   0 . n 
A  1  1903 A   1903 1904 1904 A   A   0 . n 
A  1  1904 U   1904 1905 1905 U   U   0 . n 
A  1  1905 C   1905 1906 1906 C   C   0 . n 
A  1  1906 U   1906 1907 1907 U   U   0 . n 
A  1  1907 G   1907 1908 1908 G   G   0 . n 
A  1  1908 A   1908 1909 1909 A   A   0 . n 
A  1  1909 A   1909 1910 1910 A   A   0 . n 
A  1  1910 C   1910 1911 1911 C   C   0 . n 
A  1  1911 A   1911 1912 1912 A   A   0 . n 
A  1  1912 C   1912 1913 1913 C   C   0 . n 
A  1  1913 C   1913 1914 1914 C   C   0 . n 
A  1  1914 U   1914 1915 1915 U   U   0 . n 
A  1  1915 C   1915 1916 1916 C   C   0 . n 
A  1  1916 G   1916 1917 1917 G   G   0 . n 
A  1  1917 U   1917 1918 1918 U   U   0 . n 
A  1  1918 A   1918 1919 1919 A   A   0 . n 
A  1  1919 C   1919 1920 1920 C   C   0 . n 
A  1  1920 A   1920 1921 1921 A   A   0 . n 
A  1  1921 A   1921 1922 1922 A   A   0 . n 
A  1  1922 G   1922 1923 1923 G   G   0 . n 
A  1  1923 A   1923 1924 1924 A   A   0 . n 
A  1  1924 G   1924 1925 1925 G   G   0 . n 
A  1  1925 G   1925 1926 1926 G   G   0 . n 
A  1  1926 A   1926 1927 1927 A   A   0 . n 
A  1  1927 C   1927 1928 1928 C   C   0 . n 
A  1  1928 G   1928 1929 1929 G   G   0 . n 
A  1  1929 A   1929 1930 1930 A   A   0 . n 
A  1  1930 A   1930 1931 1931 A   A   0 . n 
A  1  1931 G   1931 1932 1932 G   G   0 . n 
A  1  1932 G   1932 1933 1933 G   G   0 . n 
A  1  1933 A   1933 1934 1934 A   A   0 . n 
A  1  1934 C   1934 1935 1935 C   C   0 . n 
A  1  1935 C   1935 1936 1936 C   C   0 . n 
A  1  1936 U   1936 1937 1937 U   U   0 . n 
A  1  1937 G   1937 1938 1938 G   G   0 . n 
A  1  1938 U   1938 1939 1939 U   U   0 . n 
A  1  1939 C   1939 1940 1940 C   C   0 . n 
A  1  1940 A   1940 1941 1941 A   A   0 . n 
A  1  1941 A   1941 1942 1942 A   A   0 . n 
A  1  1942 C   1942 1943 1943 C   C   0 . n 
A  1  1943 G   1943 1944 1944 G   G   0 . n 
A  1  1944 G   1944 1945 1945 G   G   0 . n 
A  1  1945 C   1945 1946 1946 C   C   0 . n 
A  1  1946 G   1946 1947 1947 G   G   0 . n 
A  1  1947 G   1947 1948 1948 G   G   0 . n 
A  1  1948 G   1948 1949 1949 G   G   0 . n 
A  1  1949 G   1949 1950 1950 G   G   0 . n 
A  1  1950 G   1950 1951 1951 G   G   0 . n 
A  1  1951 U   1951 1952 ?    ?   ?   0 . n 
A  1  1952 A   1952 1953 ?    ?   ?   0 . n 
A  1  1953 A   1953 1954 ?    ?   ?   0 . n 
A  1  1954 C   1954 1955 ?    ?   ?   0 . n 
A  1  1955 U   1955 1956 ?    ?   ?   0 . n 
A  1  1956 A   1956 1957 ?    ?   ?   0 . n 
A  1  1957 U   1957 1958 ?    ?   ?   0 . n 
A  1  1958 G   1958 1959 ?    ?   ?   0 . n 
A  1  1959 A   1959 1960 ?    ?   ?   0 . n 
A  1  1960 C   1960 1961 ?    ?   ?   0 . n 
A  1  1961 C   1961 1962 ?    ?   ?   0 . n 
A  1  1962 C   1962 1963 ?    ?   ?   0 . n 
A  1  1963 U   1963 1964 1964 U   U   0 . n 
A  1  1964 C   1964 1965 1965 C   C   0 . n 
A  1  1965 U   1965 1966 1966 U   U   0 . n 
A  1  1966 U   1966 1967 1967 U   U   0 . n 
A  1  1967 A   1967 1968 1968 A   A   0 . n 
A  1  1968 A   1968 1969 1969 A   A   0 . n 
A  1  1969 G   1969 1970 1970 G   G   0 . n 
A  1  1970 G   1970 1971 1971 G   G   0 . n 
A  1  1971 U   1971 1972 1972 U   U   0 . n 
A  1  1972 A   1972 1973 1973 A   A   0 . n 
A  1  1973 G   1973 1974 1974 G   G   0 . n 
A  1  1974 C   1974 1975 1975 C   C   0 . n 
A  1  1975 G   1975 1976 1976 G   G   0 . n 
A  1  1976 U   1976 1977 1977 U   U   0 . n 
A  1  1977 A   1977 1978 1978 A   A   0 . n 
A  1  1978 G   1978 1979 1979 G   G   0 . n 
A  1  1979 U   1979 1980 1980 U   U   0 . n 
A  1  1980 A   1980 1981 1981 A   A   0 . n 
A  1  1981 C   1981 1982 1982 C   C   0 . n 
A  1  1982 C   1982 1983 1983 C   C   0 . n 
A  1  1983 U   1983 1984 1984 U   U   0 . n 
A  1  1984 U   1984 1985 1985 U   U   0 . n 
A  1  1985 G   1985 1986 1986 G   G   0 . n 
A  1  1986 C   1986 1987 1987 C   C   0 . n 
A  1  1987 C   1987 1988 1988 C   C   0 . n 
A  1  1988 G   1988 1989 1989 G   G   0 . n 
A  1  1989 C   1989 1990 1990 C   C   0 . n 
A  1  1990 A   1990 1991 1991 A   A   0 . n 
A  1  1991 U   1991 1992 1992 U   U   0 . n 
A  1  1992 C   1992 1993 1993 C   C   0 . n 
A  1  1993 A   1993 1994 1994 A   A   0 . n 
A  1  1994 G   1994 1995 1995 G   G   0 . n 
A  1  1995 U   1995 1996 1996 U   U   0 . n 
A  1  1996 A   1996 1997 1997 A   A   0 . n 
A  1  1997 G   1997 1998 1998 G   G   0 . n 
A  1  1998 C   1998 1999 1999 C   C   0 . n 
A  1  1999 G   1999 2000 2000 G   G   0 . n 
A  1  2000 G   2000 2001 2001 G   G   0 . n 
A  1  2001 C   2001 2002 2002 C   C   0 . n 
A  1  2002 U   2002 2003 2003 U   U   0 . n 
A  1  2003 U   2003 2004 2004 U   U   0 . n 
A  1  2004 G   2004 2005 2005 G   G   0 . n 
A  1  2005 C   2005 2006 2006 C   C   0 . n 
A  1  2006 A   2006 2007 2007 A   A   0 . n 
A  1  2007 U   2007 2008 2008 U   U   0 . n 
A  1  2008 G   2008 2009 2009 G   G   0 . n 
A  1  2009 A   2009 2010 2010 A   A   0 . n 
A  1  2010 A   2010 2011 2011 A   A   0 . n 
A  1  2011 U   2011 2012 2012 U   U   0 . n 
A  1  2012 G   2012 2013 2013 G   G   0 . n 
A  1  2013 G   2013 2014 2014 G   G   0 . n 
A  1  2014 A   2014 2015 2015 A   A   0 . n 
A  1  2015 U   2015 2016 2016 U   U   0 . n 
A  1  2016 U   2016 2017 2017 U   U   0 . n 
A  1  2017 A   2017 2018 2018 A   A   0 . n 
A  1  2018 A   2018 2019 2019 A   A   0 . n 
A  1  2019 C   2019 2020 2020 C   C   0 . n 
A  1  2020 C   2020 2021 2021 C   C   0 . n 
A  1  2021 A   2021 2022 2022 A   A   0 . n 
A  1  2022 G   2022 2023 2023 G   G   0 . n 
A  1  2023 A   2023 2024 2024 A   A   0 . n 
A  1  2024 G   2024 2025 2025 G   G   0 . n 
A  1  2025 C   2025 2026 2026 C   C   0 . n 
A  1  2026 U   2026 2027 2027 U   U   0 . n 
A  1  2027 U   2027 2028 2028 U   U   0 . n 
A  1  2028 C   2028 2029 2029 C   C   0 . n 
A  1  2029 A   2029 2030 2030 A   A   0 . n 
A  1  2030 C   2030 2031 2031 C   C   0 . n 
A  1  2031 U   2031 2032 2032 U   U   0 . n 
A  1  2032 G   2032 2033 2033 G   G   0 . n 
A  1  2033 U   2033 2034 2034 U   U   0 . n 
A  1  2034 C   2034 2035 2035 C   C   0 . n 
A  1  2035 C   2035 2036 2036 C   C   0 . n 
A  1  2036 C   2036 2037 2037 C   C   0 . n 
A  1  2037 A   2037 2038 2038 A   A   0 . n 
A  1  2038 A   2038 2039 2039 A   A   0 . n 
A  1  2039 C   2039 2040 2040 C   C   0 . n 
A  1  2040 G   2040 2041 2041 G   G   0 . n 
A  1  2041 U   2041 2042 2042 U   U   0 . n 
A  1  2042 U   2042 2043 2043 U   U   0 . n 
A  1  2043 G   2043 2044 2044 G   G   0 . n 
A  1  2044 G   2044 2045 2045 G   G   0 . n 
A  1  2045 G   2045 2046 2046 G   G   0 . n 
A  1  2046 C   2046 2047 2047 C   C   0 . n 
A  1  2047 C   2047 2048 2048 C   C   0 . n 
A  1  2048 C   2048 2049 2049 C   C   0 . n 
A  1  2049 G   2049 2050 2050 G   G   0 . n 
A  1  2050 G   2050 2051 2051 G   G   0 . n 
A  1  2051 U   2051 2052 2052 U   U   0 . n 
A  1  2052 G   2052 2053 2053 G   G   0 . n 
A  1  2053 A   2053 2054 2054 A   A   0 . n 
A  1  2054 A   2054 2055 2055 A   A   0 . n 
A  1  2055 C   2055 2056 2056 C   C   0 . n 
A  1  2056 U   2056 2057 2057 U   U   0 . n 
A  1  2057 G   2057 2058 2058 G   G   0 . n 
A  1  2058 U   2058 2059 2059 U   U   0 . n 
A  1  2059 A   2059 2060 2060 A   A   0 . n 
A  1  2060 C   2060 2061 2061 C   C   0 . n 
A  1  2061 A   2061 2062 2062 A   A   0 . n 
A  1  2062 U   2062 2063 2063 U   U   0 . n 
A  1  2063 U   2063 2064 2064 U   U   0 . n 
A  1  2064 C   2064 2065 2065 C   C   0 . n 
A  1  2065 C   2065 2066 2066 C   C   0 . n 
A  1  2066 A   2066 2067 2067 A   A   0 . n 
A  1  2067 G   2067 2068 2068 G   G   0 . n 
A  1  2068 U   2068 2069 2069 U   U   0 . n 
A  1  2069 G   2069 2070 2070 G   G   0 . n 
A  1  2070 C   2070 2071 2071 C   C   0 . n 
A  1  2071 G   2071 2072 2072 G   G   0 . n 
A  1  2072 G   2072 2073 2073 G   G   0 . n 
A  1  2073 A   2073 2074 2074 A   A   0 . n 
A  1  2074 G   2074 2075 2075 G   G   0 . n 
A  1  2075 U   2075 2076 2076 U   U   0 . n 
A  1  2076 C   2076 2077 2077 C   C   0 . n 
A  1  2077 U   2077 2078 2078 U   U   0 . n 
A  1  2078 G   2078 2079 2079 G   G   0 . n 
A  1  2079 G   2079 2080 2080 G   G   0 . n 
A  1  2080 A   2080 2081 2081 A   A   0 . n 
A  1  2081 G   2081 2082 2082 G   G   0 . n 
A  1  2082 A   2082 2083 2083 A   A   0 . n 
A  1  2083 C   2083 2084 2084 C   C   0 . n 
A  1  2084 A   2084 2085 2085 A   A   0 . n 
A  1  2085 C   2085 2086 2086 C   C   0 . n 
A  1  2086 C   2086 2087 2087 C   C   0 . n 
A  1  2087 C   2087 2088 2088 C   C   0 . n 
A  1  2088 A   2088 2089 2089 A   A   0 . n 
A  1  2089 G   2089 2090 2090 G   G   0 . n 
A  1  2090 G   2090 2091 2091 G   G   0 . n 
A  1  2091 G   2091 2092 2092 G   G   0 . n 
A  1  2092 G   2092 2093 2093 G   G   0 . n 
A  1  2093 G   2093 2094 2094 G   G   0 . n 
A  1  2094 A   2094 2095 2095 A   A   0 . n 
A  1  2095 A   2095 2096 2096 A   A   0 . n 
A  1  2096 G   2096 2097 2097 G   G   0 . n 
A  1  2097 C   2097 2098 2098 C   C   0 . n 
A  1  2098 G   2098 2099 2099 G   G   0 . n 
A  1  2099 A   2099 2100 2100 A   A   0 . n 
A  1  2100 A   2100 2101 2101 A   A   0 . n 
A  1  2101 G   2101 2102 2102 G   G   0 . n 
A  1  2102 A   2102 2103 2103 A   A   0 . n 
A  1  2103 C   2103 2104 2104 C   C   0 . n 
A  1  2104 C   2104 2105 2105 C   C   0 . n 
A  1  2105 C   2105 2106 2106 C   C   0 . n 
A  1  2106 U   2106 2107 2107 U   U   0 . n 
A  1  2107 A   2107 2108 2108 A   A   0 . n 
A  1  2108 U   2108 2109 2109 U   U   0 . n 
A  1  2109 G   2109 2110 2110 G   G   0 . n 
A  1  2110 G   2110 2111 2111 G   G   0 . n 
A  1  2111 A   2111 2112 2112 A   A   0 . n 
A  1  2112 G   2112 2113 2113 G   G   0 . n 
A  1  2113 C   2113 2114 2114 C   C   0 . n 
A  1  2114 U   2114 2115 2115 U   U   0 . n 
A  1  2115 U   2115 2116 2116 U   U   0 . n 
A  1  2116 U   2116 2117 2117 U   U   0 . n 
A  1  2117 A   2117 2118 2118 A   A   0 . n 
A  1  2118 C   2118 2119 2119 C   C   0 . n 
A  1  2119 U   2119 2120 2120 U   U   0 . n 
A  1  2120 G   2120 2121 2121 G   G   0 . n 
A  1  2121 C   2121 2122 2122 C   C   0 . n 
A  1  2122 A   2122 2123 2123 A   A   0 . n 
A  1  2123 G   2123 2124 2124 G   G   0 . n 
A  1  2124 G   2124 2125 2125 G   G   0 . n 
A  1  2125 C   2125 2126 2126 C   C   0 . n 
A  1  2126 U   2126 2127 2127 U   U   0 . n 
A  1  2127 G   2127 2128 2128 G   G   0 . n 
A  1  2128 U   2128 2129 2129 U   U   0 . n 
A  1  2129 C   2129 2130 2130 C   C   0 . n 
A  1  2130 G   2130 2131 2131 G   G   0 . n 
A  1  2131 C   2131 2132 2132 C   C   0 . n 
A  1  2132 U   2132 2133 2133 U   U   0 . n 
A  1  2133 G   2133 2134 2134 G   G   0 . n 
A  1  2134 A   2134 2135 2135 A   A   0 . n 
A  1  2135 G   2135 2136 2136 G   G   0 . n 
A  1  2136 A   2136 2137 ?    ?   ?   0 . n 
A  1  2137 C   2137 2138 ?    ?   ?   0 . n 
A  1  2138 G   2138 2139 ?    ?   ?   0 . n 
A  1  2139 U   2139 2140 ?    ?   ?   0 . n 
A  1  2140 G   2140 2141 ?    ?   ?   0 . n 
A  1  2141 G   2141 2142 ?    ?   ?   0 . n 
A  1  2142 U   2142 2143 ?    ?   ?   0 . n 
A  1  2143 C   2143 2144 ?    ?   ?   0 . n 
A  1  2144 G   2144 2145 ?    ?   ?   0 . n 
A  1  2145 C   2145 2146 ?    ?   ?   0 . n 
A  1  2146 C   2146 2147 ?    ?   ?   0 . n 
A  1  2147 G   2147 2148 ?    ?   ?   0 . n 
A  1  2148 A   2148 2149 ?    ?   ?   0 . n 
A  1  2149 U   2149 2150 ?    ?   ?   0 . n 
A  1  2150 G   2150 2151 ?    ?   ?   0 . n 
A  1  2151 U   2151 2152 ?    ?   ?   0 . n 
A  1  2152 G   2152 2153 ?    ?   ?   0 . n 
A  1  2153 C   2153 2154 ?    ?   ?   0 . n 
A  1  2154 A   2154 2155 ?    ?   ?   0 . n 
A  1  2155 G   2155 2156 ?    ?   ?   0 . n 
A  1  2156 C   2156 2157 ?    ?   ?   0 . n 
A  1  2157 A   2157 2158 ?    ?   ?   0 . n 
A  1  2158 U   2158 2159 ?    ?   ?   0 . n 
A  1  2159 A   2159 2160 ?    ?   ?   0 . n 
A  1  2160 G   2160 2161 ?    ?   ?   0 . n 
A  1  2161 G   2161 2162 ?    ?   ?   0 . n 
A  1  2162 U   2162 2163 ?    ?   ?   0 . n 
A  1  2163 A   2163 2164 ?    ?   ?   0 . n 
A  1  2164 G   2164 2165 ?    ?   ?   0 . n 
A  1  2165 G   2165 2166 ?    ?   ?   0 . n 
A  1  2166 A   2166 2167 ?    ?   ?   0 . n 
A  1  2167 G   2167 2168 ?    ?   ?   0 . n 
A  1  2168 A   2168 2169 ?    ?   ?   0 . n 
A  1  2169 C   2169 2170 ?    ?   ?   0 . n 
A  1  2170 A   2170 2171 ?    ?   ?   0 . n 
A  1  2171 C   2171 2172 ?    ?   ?   0 . n 
A  1  2172 U   2172 2173 ?    ?   ?   0 . n 
A  1  2173 A   2173 2174 ?    ?   ?   0 . n 
A  1  2174 C   2174 2175 ?    ?   ?   0 . n 
A  1  2175 A   2175 2176 ?    ?   ?   0 . n 
A  1  2176 C   2176 2177 ?    ?   ?   0 . n 
A  1  2177 A   2177 2178 ?    ?   ?   0 . n 
A  1  2178 G   2178 2179 ?    ?   ?   0 . n 
A  1  2179 G   2179 2180 ?    ?   ?   0 . n 
A  1  2180 U   2180 2181 ?    ?   ?   0 . n 
A  1  2181 A   2181 2182 ?    ?   ?   0 . n 
A  1  2182 C   2182 2183 ?    ?   ?   0 . n 
A  1  2183 C   2183 2184 ?    ?   ?   0 . n 
A  1  2184 C   2184 2185 ?    ?   ?   0 . n 
A  1  2185 G   2185 2186 ?    ?   ?   0 . n 
A  1  2186 C   2186 2187 ?    ?   ?   0 . n 
A  1  2187 G   2187 2188 ?    ?   ?   0 . n 
A  1  2188 C   2188 2189 ?    ?   ?   0 . n 
A  1  2189 U   2189 2190 ?    ?   ?   0 . n 
A  1  2190 A   2190 2191 ?    ?   ?   0 . n 
A  1  2191 G   2191 2192 ?    ?   ?   0 . n 
A  1  2192 C   2192 2193 ?    ?   ?   0 . n 
A  1  2193 G   2193 2194 ?    ?   ?   0 . n 
A  1  2194 G   2194 2195 ?    ?   ?   0 . n 
A  1  2195 G   2195 2196 ?    ?   ?   0 . n 
A  1  2196 C   2196 2197 ?    ?   ?   0 . n 
A  1  2197 C   2197 2198 ?    ?   ?   0 . n 
A  1  2198 A   2198 2199 ?    ?   ?   0 . n 
A  1  2199 C   2199 2200 ?    ?   ?   0 . n 
A  1  2200 C   2200 2201 ?    ?   ?   0 . n 
A  1  2201 G   2201 2202 ?    ?   ?   0 . n 
A  1  2202 A   2202 2203 ?    ?   ?   0 . n 
A  1  2203 G   2203 2204 ?    ?   ?   0 . n 
A  1  2204 U   2204 2205 ?    ?   ?   0 . n 
A  1  2205 C   2205 2206 ?    ?   ?   0 . n 
A  1  2206 A   2206 2207 ?    ?   ?   0 . n 
A  1  2207 A   2207 2208 ?    ?   ?   0 . n 
A  1  2208 C   2208 2209 ?    ?   ?   0 . n 
A  1  2209 A   2209 2210 ?    ?   ?   0 . n 
A  1  2210 G   2210 2211 ?    ?   ?   0 . n 
A  1  2211 U   2211 2212 ?    ?   ?   0 . n 
A  1  2212 G   2212 2213 ?    ?   ?   0 . n 
A  1  2213 A   2213 2214 ?    ?   ?   0 . n 
A  1  2214 A   2214 2215 ?    ?   ?   0 . n 
A  1  2215 A   2215 2216 ?    ?   ?   0 . n 
A  1  2216 U   2216 2217 ?    ?   ?   0 . n 
A  1  2217 A   2217 2218 ?    ?   ?   0 . n 
A  1  2218 C   2218 2219 ?    ?   ?   0 . n 
A  1  2219 U   2219 2220 ?    ?   ?   0 . n 
A  1  2220 A   2220 2221 ?    ?   ?   0 . n 
A  1  2221 C   2221 2222 ?    ?   ?   0 . n 
A  1  2222 C   2222 2223 ?    ?   ?   0 . n 
A  1  2223 C   2223 2224 ?    ?   ?   0 . n 
A  1  2224 G   2224 2225 ?    ?   ?   0 . n 
A  1  2225 U   2225 2226 ?    ?   ?   0 . n 
A  1  2226 C   2226 2227 ?    ?   ?   0 . n 
A  1  2227 G   2227 2228 ?    ?   ?   0 . n 
A  1  2228 G   2228 2229 ?    ?   ?   0 . n 
A  1  2229 U   2229 2230 ?    ?   ?   0 . n 
A  1  2230 G   2230 2231 ?    ?   ?   0 . n 
A  1  2231 A   2231 2232 ?    ?   ?   0 . n 
A  1  2232 C   2232 2233 ?    ?   ?   0 . n 
A  1  2233 U   2233 2234 ?    ?   ?   0 . n 
A  1  2234 G   2234 2235 ?    ?   ?   0 . n 
A  1  2235 C   2235 2236 ?    ?   ?   0 . n 
A  1  2236 G   2236 2237 2237 G   G   0 . n 
A  1  2237 A   2237 2238 2238 A   A   0 . n 
A  1  2238 C   2238 2239 2239 C   C   0 . n 
A  1  2239 U   2239 2240 2240 U   U   0 . n 
A  1  2240 C   2240 2241 2241 C   C   0 . n 
A  1  2241 U   2241 2242 2242 U   U   0 . n 
A  1  2242 C   2242 2243 2243 C   C   0 . n 
A  1  2243 A   2243 2244 2244 A   A   0 . n 
A  1  2244 C   2244 2245 2245 C   C   0 . n 
A  1  2245 U   2245 2246 2246 U   U   0 . n 
A  1  2246 C   2246 2247 2247 C   C   0 . n 
A  1  2247 C   2247 2248 2248 C   C   0 . n 
A  1  2248 G   2248 2249 2249 G   G   0 . n 
A  1  2249 G   2249 2250 2250 G   G   0 . n 
A  1  2250 G   2250 2251 2251 G   G   0 . n 
A  1  2251 A   2251 2252 2252 A   A   0 . n 
A  1  2252 G   2252 2253 2253 G   G   0 . n 
A  1  2253 G   2253 2254 2254 G   G   0 . n 
A  1  2254 A   2254 2255 2255 A   A   0 . n 
A  1  2255 G   2255 2256 2256 G   G   0 . n 
A  1  2256 G   2256 2257 2257 G   G   0 . n 
A  1  2257 A   2257 2258 2258 A   A   0 . n 
A  1  2258 C   2258 2259 2259 C   C   0 . n 
A  1  2259 A   2259 2260 2260 A   A   0 . n 
A  1  2260 C   2260 2261 2261 C   C   0 . n 
A  1  2261 C   2261 2262 2262 C   C   0 . n 
A  1  2262 G   2262 2263 2263 G   G   0 . n 
A  1  2263 A   2263 2264 2264 A   A   0 . n 
A  1  2264 U   2264 2265 2265 U   U   0 . n 
A  1  2265 A   2265 2266 2266 A   A   0 . n 
A  1  2266 G   2266 2267 2267 G   G   0 . n 
A  1  2267 C   2267 2268 2268 C   C   0 . n 
A  1  2268 C   2268 2269 2269 C   C   0 . n 
A  1  2269 G   2269 2270 2270 G   G   0 . n 
A  1  2270 G   2270 2271 2271 G   G   0 . n 
A  1  2271 G   2271 2272 2272 G   G   0 . n 
A  1  2272 C   2272 2273 2273 C   C   0 . n 
A  1  2273 A   2273 2274 2274 A   A   0 . n 
A  1  2274 G   2274 2275 2275 G   G   0 . n 
A  1  2275 U   2275 2276 2276 U   U   0 . n 
A  1  2276 U   2276 2277 2277 U   U   0 . n 
A  1  2277 U   2277 2278 2278 U   U   0 . n 
A  1  2278 G   2278 2279 2279 G   G   0 . n 
A  1  2279 A   2279 2280 2280 A   A   0 . n 
A  1  2280 C   2280 2281 2281 C   C   0 . n 
A  1  2281 U   2281 2282 2282 U   U   0 . n 
A  1  2282 G   2282 2283 2283 G   G   0 . n 
A  1  2283 G   2283 2284 2284 G   G   0 . n 
A  1  2284 G   2284 2285 2285 G   G   0 . n 
A  1  2285 G   2285 2286 2286 G   G   0 . n 
A  1  2286 C   2286 2287 2287 C   C   0 . n 
A  1  2287 G   2287 2288 2288 G   G   0 . n 
A  1  2288 G   2288 2289 2289 G   G   0 . n 
A  1  2289 U   2289 2290 2290 U   U   0 . n 
A  1  2290 A   2290 2291 2291 A   A   0 . n 
A  1  2291 C   2291 2292 2292 C   C   0 . n 
A  1  2292 G   2292 2293 2293 G   G   0 . n 
A  1  2293 C   2293 2294 2294 C   C   0 . n 
A  1  2294 G   2294 2295 2295 G   G   0 . n 
A  1  2295 C   2295 2296 2296 C   C   0 . n 
A  1  2296 U   2296 2297 2297 U   U   0 . n 
A  1  2297 C   2297 2298 2298 C   C   0 . n 
A  1  2298 G   2298 2299 2299 G   G   0 . n 
A  1  2299 A   2299 2300 2300 A   A   0 . n 
A  1  2300 A   2300 2301 2301 A   A   0 . n 
A  1  2301 A   2301 2302 2302 A   A   0 . n 
A  1  2302 A   2302 2303 2303 A   A   0 . n 
A  1  2303 G   2303 2304 2304 G   G   0 . n 
A  1  2304 A   2304 2305 2305 A   A   0 . n 
A  1  2305 U   2305 2306 2306 U   U   0 . n 
A  1  2306 A   2306 2307 2307 A   A   0 . n 
A  1  2307 U   2307 2308 2308 U   U   0 . n 
A  1  2308 C   2308 2309 2309 C   C   0 . n 
A  1  2309 G   2309 2310 2310 G   G   0 . n 
A  1  2310 A   2310 2311 2311 A   A   0 . n 
A  1  2311 G   2311 2312 2312 G   G   0 . n 
A  1  2312 C   2312 2313 2313 C   C   0 . n 
A  1  2313 G   2313 2314 2314 G   G   0 . n 
A  1  2314 C   2314 2315 2315 C   C   0 . n 
A  1  2315 G   2315 2316 2316 G   G   0 . n 
A  1  2316 C   2316 2317 2317 C   C   0 . n 
A  1  2317 C   2317 2318 2318 C   C   0 . n 
A  1  2318 C   2318 2319 2319 C   C   0 . n 
A  1  2319 U   2319 2320 2320 U   U   0 . n 
A  1  2320 A   2320 2321 2321 A   A   0 . n 
A  1  2321 U   2321 2322 2322 U   U   0 . n 
A  1  2322 G   2322 2323 2323 G   G   0 . n 
A  1  2323 G   2323 2324 2324 G   G   0 . n 
A  1  2324 C   2324 2325 2325 C   C   0 . n 
A  1  2325 U   2325 2326 2326 U   U   0 . n 
A  1  2326 A   2326 2327 2327 A   A   0 . n 
A  1  2327 U   2327 2328 2328 U   U   0 . n 
A  1  2328 C   2328 2329 2329 C   C   0 . n 
A  1  2329 U   2329 2330 2330 U   U   0 . n 
A  1  2330 C   2330 2331 2331 C   C   0 . n 
A  1  2331 A   2331 2332 2332 A   A   0 . n 
A  1  2332 G   2332 2333 2333 G   G   0 . n 
A  1  2333 C   2333 2334 2334 C   C   0 . n 
A  1  2334 C   2334 2335 2335 C   C   0 . n 
A  1  2335 G   2335 2336 2336 G   G   0 . n 
A  1  2336 G   2336 2337 2337 G   G   0 . n 
A  1  2337 G   2337 2338 2338 G   G   0 . n 
A  1  2338 A   2338 2339 ?    ?   ?   0 . n 
A  1  2339 C   2339 2340 ?    ?   ?   0 . n 
A  1  2340 A   2340 2341 ?    ?   ?   0 . n 
A  1  2341 G   2341 2342 ?    ?   ?   0 . n 
A  1  2342 A   2342 2343 ?    ?   ?   0 . n 
A  1  2343 G   2343 2344 2344 G   G   0 . n 
A  1  2344 A   2344 2345 2345 A   A   0 . n 
A  1  2345 C   2345 2346 2346 C   C   0 . n 
A  1  2346 C   2346 2347 2347 C   C   0 . n 
A  1  2347 C   2347 2348 2348 C   C   0 . n 
A  1  2348 G   2348 2349 2349 G   G   0 . n 
A  1  2349 G   2349 2350 2350 G   G   0 . n 
A  1  2350 C   2350 2351 2351 C   C   0 . n 
A  1  2351 G   2351 2352 2352 G   G   0 . n 
A  1  2352 A   2352 2353 2353 A   A   0 . n 
A  1  2353 A   2353 2354 2354 A   A   0 . n 
A  1  2354 G   2354 2355 2355 G   G   0 . n 
A  1  2355 A   2355 2356 2356 A   A   0 . n 
A  1  2356 G   2356 2357 2357 G   G   0 . n 
A  1  2357 U   2357 2358 2358 U   U   0 . n 
A  1  2358 G   2358 2359 2359 G   G   0 . n 
A  1  2359 C   2359 2360 2360 C   C   0 . n 
A  1  2360 A   2360 2361 2361 A   A   0 . n 
A  1  2361 A   2361 2362 2362 A   A   0 . n 
A  1  2362 G   2362 2363 2363 G   G   0 . n 
A  1  2363 A   2363 2364 2364 A   A   0 . n 
A  1  2364 G   2364 2365 2365 G   G   0 . n 
A  1  2365 C   2365 2366 2366 C   C   0 . n 
A  1  2366 A   2366 2367 2367 A   A   0 . n 
A  1  2367 A   2367 2368 2368 A   A   0 . n 
A  1  2368 A   2368 2369 2369 A   A   0 . n 
A  1  2369 A   2369 2370 2370 A   A   0 . n 
A  1  2370 G   2370 2371 2371 G   G   0 . n 
A  1  2371 A   2371 2372 2372 A   A   0 . n 
A  1  2372 U   2372 2373 2373 U   U   0 . n 
A  1  2373 A   2373 2374 2374 A   A   0 . n 
A  1  2374 G   2374 2375 2375 G   G   0 . n 
A  1  2375 C   2375 2376 2376 C   C   0 . n 
A  1  2376 U   2376 2377 2377 U   U   0 . n 
A  1  2377 U   2377 2378 2378 U   U   0 . n 
A  1  2378 G   2378 2379 2379 G   G   0 . n 
A  1  2379 A   2379 2380 2380 A   A   0 . n 
A  1  2380 C   2380 2381 2381 C   C   0 . n 
A  1  2381 A   2381 2382 2382 A   A   0 . n 
A  1  2382 G   2382 2383 2383 G   G   0 . n 
A  1  2383 U   2383 2384 2384 U   U   0 . n 
A  1  2384 G   2384 2385 2385 G   G   0 . n 
A  1  2385 U   2385 2386 2386 U   U   0 . n 
A  1  2386 U   2386 2387 2387 U   U   0 . n 
A  1  2387 C   2387 2388 2388 C   C   0 . n 
A  1  2388 U   2388 2389 2389 U   U   0 . n 
A  1  2389 U   2389 2390 2390 U   U   0 . n 
A  1  2390 C   2390 2391 2391 C   C   0 . n 
A  1  2391 C   2391 2392 2392 C   C   0 . n 
A  1  2392 C   2392 2393 2393 C   C   0 . n 
A  1  2393 A   2393 2394 2394 A   A   0 . n 
A  1  2394 A   2394 2395 2395 A   A   0 . n 
A  1  2395 C   2395 2396 2396 C   C   0 . n 
A  1  2396 G   2396 2397 2397 G   G   0 . n 
A  1  2397 A   2397 2398 2398 A   A   0 . n 
A  1  2398 G   2398 2399 2399 G   G   0 . n 
A  1  2399 G   2399 2400 2400 G   G   0 . n 
A  1  2400 A   2400 2401 2401 A   A   0 . n 
A  1  2401 A   2401 2402 2402 A   A   0 . n 
A  1  2402 C   2402 2403 2403 C   C   0 . n 
A  1  2403 G   2403 2404 2404 G   G   0 . n 
A  1  2404 C   2404 2405 2405 C   C   0 . n 
A  1  2405 U   2405 2406 2406 U   U   0 . n 
A  1  2406 G   2406 2407 2407 G   G   0 . n 
A  1  2407 A   2407 2408 2408 A   A   0 . n 
A  1  2408 C   2408 2409 2409 C   C   0 . n 
A  1  2409 G   2409 2410 2410 G   G   0 . n 
A  1  2410 C   2410 2411 2411 C   C   0 . n 
A  1  2411 G   2411 2412 2412 G   G   0 . n 
A  1  2412 A   2412 2413 2413 A   A   0 . n 
A  1  2413 A   2413 2414 2414 A   A   0 . n 
A  1  2414 A   2414 2415 2415 A   A   0 . n 
A  1  2415 G   2415 2416 2416 G   G   0 . n 
A  1  2416 C   2416 2417 2417 C   C   0 . n 
A  1  2417 G   2417 2418 2418 G   G   0 . n 
A  1  2418 U   2418 2419 2419 U   U   0 . n 
A  1  2419 G   2419 2420 2420 G   G   0 . n 
A  1  2420 G   2420 2421 2421 G   G   0 . n 
A  1  2421 U   2421 2422 2422 U   U   0 . n 
A  1  2422 C   2422 2423 2423 C   C   0 . n 
A  1  2423 U   2423 2424 2424 U   U   0 . n 
A  1  2424 A   2424 2425 2425 A   A   0 . n 
A  1  2425 G   2425 2426 2426 G   G   0 . n 
A  1  2426 C   2426 2427 2427 C   C   0 . n 
A  1  2427 G   2427 2428 2428 G   G   0 . n 
A  1  2428 A   2428 2429 2429 A   A   0 . n 
A  1  2429 A   2429 2430 2430 A   A   0 . n 
A  1  2430 C   2430 2431 2431 C   C   0 . n 
A  1  2431 C   2431 2432 2432 C   C   0 . n 
A  1  2432 A   2432 2433 2433 A   A   0 . n 
A  1  2433 A   2433 2434 2434 A   A   0 . n 
A  1  2434 U   2434 2435 2435 U   U   0 . n 
A  1  2435 U   2435 2436 2436 U   U   0 . n 
A  1  2436 A   2436 2437 2437 A   A   0 . n 
A  1  2437 G   2437 2438 2438 G   G   0 . n 
A  1  2438 C   2438 2439 2439 C   C   0 . n 
A  1  2439 C   2439 2440 2440 C   C   0 . n 
A  1  2440 U   2440 2441 2441 U   U   0 . n 
A  1  2441 G   2441 2442 2442 G   G   0 . n 
A  1  2442 C   2442 2443 2443 C   C   0 . n 
A  1  2443 U   2443 2444 2444 U   U   0 . n 
A  1  2444 U   2444 2445 2445 U   U   0 . n 
A  1  2445 G   2445 2446 2446 G   G   0 . n 
A  1  2446 A   2446 2447 2447 A   A   0 . n 
A  1  2447 U   2447 2448 2448 U   U   0 . n 
A  1  2448 G   2448 2449 2449 G   G   0 . n 
A  1  2449 C   2449 2450 2450 C   C   0 . n 
A  1  2450 G   2450 2451 2451 G   G   0 . n 
A  1  2451 G   2451 2452 2452 G   G   0 . n 
A  1  2452 G   2452 2453 2453 G   G   0 . n 
A  1  2453 C   2453 2454 2454 C   C   0 . n 
A  1  2454 A   2454 2455 2455 A   A   0 . n 
A  1  2455 A   2455 2456 2456 A   A   0 . n 
A  1  2456 U   2456 2457 2457 U   U   0 . n 
A  1  2457 U   2457 2458 2458 U   U   0 . n 
A  1  2458 G   2458 2459 2459 G   G   0 . n 
A  1  2459 A   2459 2460 2460 A   A   0 . n 
A  1  2460 U   2460 2461 2461 U   U   0 . n 
A  1  2461 G   2461 2462 2462 G   G   0 . n 
A  1  2462 A   2462 2463 2463 A   A   0 . n 
A  1  2463 C   2463 2464 2464 C   C   0 . n 
A  1  2464 A   2464 2465 2465 A   A   0 . n 
A  1  2465 G   2465 2466 2466 G   G   0 . n 
A  1  2466 A   2466 2467 2467 A   A   0 . n 
A  1  2467 A   2467 2468 2468 A   A   0 . n 
A  1  2468 A   2468 2469 2469 A   A   0 . n 
A  1  2469 A   2469 2470 2470 A   A   0 . n 
A  1  2470 G   2470 2471 2471 G   G   0 . n 
A  1  2471 C   2471 2472 2472 C   C   0 . n 
A  1  2472 U   2472 2473 2473 U   U   0 . n 
A  1  2473 A   2473 2474 2474 A   A   0 . n 
A  1  2474 C   2474 2475 2475 C   C   0 . n 
A  1  2475 C   2475 2476 2476 C   C   0 . n 
A  1  2476 C   2476 2477 2477 C   C   0 . n 
A  1  2477 U   2477 2478 2478 U   U   0 . n 
A  1  2478 A   2478 2479 2479 A   A   0 . n 
A  1  2479 G   2479 2480 2480 G   G   0 . n 
A  1  2480 G   2480 2481 2481 G   G   0 . n 
A  1  2481 G   2481 2482 2482 G   G   0 . n 
A  1  2482 A   2482 2483 2483 A   A   0 . n 
A  1  2483 U   2483 2484 2484 U   U   0 . n 
A  1  2484 A   2484 2485 2485 A   A   0 . n 
A  1  2485 A   2485 2486 2486 A   A   0 . n 
A  1  2486 C   2486 2487 2487 C   C   0 . n 
A  1  2487 A   2487 2488 2488 A   A   0 . n 
A  1  2488 G   2488 2489 2489 G   G   0 . n 
A  1  2489 A   2489 2490 2490 A   A   0 . n 
A  1  2490 G   2490 2491 2491 G   G   0 . n 
A  1  2491 U   2491 2492 2492 U   U   0 . n 
A  1  2492 C   2492 2493 2493 C   C   0 . n 
A  1  2493 G   2493 2494 2494 G   G   0 . n 
A  1  2494 U   2494 2495 2495 U   U   0 . n 
A  1  2495 C   2495 2496 2496 C   C   0 . n 
A  1  2496 A   2496 2497 2497 A   A   0 . n 
A  1  2497 C   2497 2498 2498 C   C   0 . n 
A  1  2498 U   2498 2499 2499 U   U   0 . n 
A  1  2499 C   2499 2500 2500 C   C   0 . n 
A  1  2500 G   2500 2501 2501 G   G   0 . n 
A  1  2501 C   2501 2502 2502 C   C   0 . n 
A  1  2502 A   2502 2503 2503 A   A   0 . n 
A  1  2503 A   2503 2504 2504 A   A   0 . n 
A  1  2504 G   2504 2505 2505 G   G   0 . n 
A  1  2505 A   2505 2506 2506 A   A   0 . n 
A  1  2506 G   2506 2507 2507 G   G   0 . n 
A  1  2507 C   2507 2508 2508 C   C   0 . n 
A  1  2508 A   2508 2509 2509 A   A   0 . n 
A  1  2509 C   2509 2510 2510 C   C   0 . n 
A  1  2510 A   2510 2511 2511 A   A   0 . n 
A  1  2511 U   2511 2512 2512 U   U   0 . n 
A  1  2512 A   2512 2513 2513 A   A   0 . n 
A  1  2513 U   2513 2514 2514 U   U   0 . n 
A  1  2514 C   2514 2515 2515 C   C   0 . n 
A  1  2515 G   2515 2516 2516 G   G   0 . n 
A  1  2516 A   2516 2517 2517 A   A   0 . n 
A  1  2517 C   2517 2518 2518 C   C   0 . n 
A  1  2518 C   2518 2519 2519 C   C   0 . n 
A  1  2519 G   2519 2520 2520 G   G   0 . n 
A  1  2520 A   2520 2521 2521 A   A   0 . n 
A  1  2521 G   2521 2522 2522 G   G   0 . n 
A  1  2522 U   2522 2523 2523 U   U   0 . n 
A  1  2523 G   2523 2524 2524 G   G   0 . n 
A  1  2524 G   2524 2525 2525 G   G   0 . n 
A  1  2525 C   2525 2526 2526 C   C   0 . n 
A  1  2526 U   2526 2527 2527 U   U   0 . n 
A  1  2527 U   2527 2528 2528 U   U   0 . n 
A  1  2528 G   2528 2529 2529 G   G   0 . n 
A  1  2529 C   2529 2530 2530 C   C   0 . n 
A  1  2530 U   2530 2531 2531 U   U   0 . n 
A  1  2531 A   2531 2532 2532 A   A   0 . n 
A  1  2532 C   2532 2533 2533 C   C   0 . n 
A  1  2533 C   2533 2534 2534 C   C   0 . n 
A  1  2534 U   2534 2535 2535 U   U   0 . n 
A  1  2535 C   2535 2536 2536 C   C   0 . n 
A  1  2536 G   2536 2537 2537 G   G   0 . n 
A  1  2537 A   2537 2538 2538 A   A   0 . n 
A  1  2538 U   2538 2539 2539 U   U   0 . n 
A  1  2539 G   2539 2540 2540 G   G   0 . n 
A  1  2540 U   2540 2541 2541 U   U   0 . n 
A  1  2541 C   2541 2542 2542 C   C   0 . n 
A  1  2542 G   2542 2543 2543 G   G   0 . n 
A  1  2543 G   2543 2544 2544 G   G   0 . n 
A  1  2544 U   2544 2545 2545 U   U   0 . n 
A  1  2545 U   2545 2546 2546 U   U   0 . n 
A  1  2546 C   2546 2547 2547 C   C   0 . n 
A  1  2547 C   2547 2548 2548 C   C   0 . n 
A  1  2548 C   2548 2549 2549 C   C   0 . n 
A  1  2549 U   2549 2550 2550 U   U   0 . n 
A  1  2550 C   2550 2551 2551 C   C   0 . n 
A  1  2551 C   2551 2552 2552 C   C   0 . n 
A  1  2552 A   2552 2553 2553 A   A   0 . n 
A  1  2553 U   2553 2554 2554 U   U   0 . n 
A  1  2554 C   2554 2555 2555 C   C   0 . n 
A  1  2555 C   2555 2556 2556 C   C   0 . n 
A  1  2556 U   2556 2557 2557 U   U   0 . n 
A  1  2557 G   2557 2558 2558 G   G   0 . n 
A  1  2558 C   2558 2559 2559 C   C   0 . n 
A  1  2559 C   2559 2560 2560 C   C   0 . n 
A  1  2560 C   2560 2561 2561 C   C   0 . n 
A  1  2561 G   2561 2562 2562 G   G   0 . n 
A  1  2562 U   2562 2563 2563 U   U   0 . n 
A  1  2563 G   2563 2564 2564 G   G   0 . n 
A  1  2564 C   2564 2565 2565 C   C   0 . n 
A  1  2565 A   2565 2566 2566 A   A   0 . n 
A  1  2566 G   2566 2567 2567 G   G   0 . n 
A  1  2567 A   2567 2568 2568 A   A   0 . n 
A  1  2568 A   2568 2569 2569 A   A   0 . n 
A  1  2569 G   2569 2570 2570 G   G   0 . n 
A  1  2570 C   2570 2571 2571 C   C   0 . n 
A  1  2571 G   2571 2572 2572 G   G   0 . n 
A  1  2572 G   2572 2573 2573 G   G   0 . n 
A  1  2573 G   2573 2574 2574 G   G   0 . n 
A  1  2574 C   2574 2575 2575 C   C   0 . n 
A  1  2575 A   2575 2576 2576 A   A   0 . n 
A  1  2576 A   2576 2577 2577 A   A   0 . n 
A  1  2577 G   2577 2578 2578 G   G   0 . n 
A  1  2578 G   2578 2579 2579 G   G   0 . n 
A  1  2579 G   2579 2580 2580 G   G   0 . n 
A  1  2580 U   2580 2581 2581 U   U   0 . n 
A  1  2581 G   2581 2582 2582 G   G   0 . n 
A  1  2582 A   2582 2583 2583 A   A   0 . n 
A  1  2583 G   2583 2584 2584 G   G   0 . n 
A  1  2584 G   2584 2585 2585 G   G   0 . n 
A  1  2585 U   2585 2586 2586 U   U   0 . n 
A  1  2586 U   2586 2587 2587 U   U   0 . n 
A  1  2587 G   2587 2588 2588 G   G   0 . n 
A  1  2588 U   2588 2589 2589 U   U   0 . n 
A  1  2589 U   2589 2590 2590 U   U   0 . n 
A  1  2590 C   2590 2591 2591 C   C   0 . n 
A  1  2591 G   2591 2592 2592 G   G   0 . n 
A  1  2592 C   2592 2593 2593 C   C   0 . n 
A  1  2593 C   2593 2594 2594 C   C   0 . n 
A  1  2594 U   2594 2595 2595 U   U   0 . n 
A  1  2595 A   2595 2596 2596 A   A   0 . n 
A  1  2596 U   2596 2597 2597 U   U   0 . n 
A  1  2597 U   2597 2598 2598 U   U   0 . n 
A  1  2598 A   2598 2599 2599 A   A   0 . n 
A  1  2599 A   2599 2600 2600 A   A   0 . n 
A  1  2600 A   2600 2601 2601 A   A   0 . n 
A  1  2601 G   2601 2602 2602 G   G   0 . n 
A  1  2602 G   2602 2603 2603 G   G   0 . n 
A  1  2603 A   2603 2604 2604 A   A   0 . n 
A  1  2604 G   2604 2605 2605 G   G   0 . n 
A  1  2605 G   2605 2606 2606 G   G   0 . n 
A  1  2606 U   2606 2607 2607 U   U   0 . n 
A  1  2607 C   2607 2608 2608 C   C   0 . n 
A  1  2608 G   2608 2609 2609 G   G   0 . n 
A  1  2609 U   2609 2610 2610 U   U   0 . n 
A  1  2610 G   2610 2611 2611 G   G   0 . n 
A  1  2611 A   2611 2612 2612 A   A   0 . n 
A  1  2612 G   2612 2613 2613 G   G   0 . n 
A  1  2613 C   2613 2614 2614 C   C   0 . n 
A  1  2614 U   2614 2615 2615 U   U   0 . n 
A  1  2615 G   2615 2616 2616 G   G   0 . n 
A  1  2616 G   2616 2617 2617 G   G   0 . n 
A  1  2617 G   2617 2618 2618 G   G   0 . n 
A  1  2618 U   2618 2619 2619 U   U   0 . n 
A  1  2619 U   2619 2620 2620 U   U   0 . n 
A  1  2620 U   2620 2621 2621 U   U   0 . n 
A  1  2621 A   2621 2622 2622 A   A   0 . n 
A  1  2622 G   2622 2623 2623 G   G   0 . n 
A  1  2623 A   2623 2624 2624 A   A   0 . n 
A  1  2624 C   2624 2625 2625 C   C   0 . n 
A  1  2625 C   2625 2626 2626 C   C   0 . n 
A  1  2626 G   2626 2627 2627 G   G   0 . n 
A  1  2627 U   2627 2628 2628 U   U   0 . n 
A  1  2628 C   2628 2629 2629 C   C   0 . n 
A  1  2629 G   2629 2630 2630 G   G   0 . n 
A  1  2630 U   2630 2631 2631 U   U   0 . n 
A  1  2631 G   2631 2632 2632 G   G   0 . n 
A  1  2632 A   2632 2633 2633 A   A   0 . n 
A  1  2633 G   2633 2634 2634 G   G   0 . n 
A  1  2634 A   2634 2635 2635 A   A   0 . n 
A  1  2635 C   2635 2636 2636 C   C   0 . n 
A  1  2636 A   2636 2637 2637 A   A   0 . n 
A  1  2637 G   2637 2638 2638 G   G   0 . n 
A  1  2638 G   2638 2639 2639 G   G   0 . n 
A  1  2639 U   2639 2640 2640 U   U   0 . n 
A  1  2640 C   2640 2641 2641 C   C   0 . n 
A  1  2641 G   2641 2642 2642 G   G   0 . n 
A  1  2642 G   2642 2643 2643 G   G   0 . n 
A  1  2643 C   2643 2644 2644 C   C   0 . n 
A  1  2644 U   2644 2645 2645 U   U   0 . n 
A  1  2645 G   2645 2646 2646 G   G   0 . n 
A  1  2646 C   2646 2647 2647 C   C   0 . n 
A  1  2647 U   2647 2648 2648 U   U   0 . n 
A  1  2648 A   2648 2649 2649 A   A   0 . n 
A  1  2649 U   2649 2650 2650 U   U   0 . n 
A  1  2650 C   2650 2651 2651 C   C   0 . n 
A  1  2651 U   2651 2652 2652 U   U   0 . n 
A  1  2652 A   2652 2653 2653 A   A   0 . n 
A  1  2653 C   2653 2654 2654 C   C   0 . n 
A  1  2654 U   2654 2655 2655 U   U   0 . n 
A  1  2655 G   2655 2656 2656 G   G   0 . n 
A  1  2656 G   2656 2657 2657 G   G   0 . n 
A  1  2657 G   2657 2658 2658 G   G   0 . n 
A  1  2658 U   2658 2659 2659 U   U   0 . n 
A  1  2659 G   2659 2660 2660 G   G   0 . n 
A  1  2660 U   2660 2661 2661 U   U   0 . n 
A  1  2661 G   2661 2662 2662 G   G   0 . n 
A  1  2662 U   2662 2663 2663 U   U   0 . n 
A  1  2663 A   2663 2664 2664 A   A   0 . n 
A  1  2664 A   2664 2665 ?    ?   ?   0 . n 
A  1  2665 U   2665 2666 ?    ?   ?   0 . n 
A  1  2666 G   2666 2667 2667 G   G   0 . n 
A  1  2667 G   2667 2668 2668 G   G   0 . n 
A  1  2668 U   2668 2669 2669 U   U   0 . n 
A  1  2669 G   2669 2670 2670 G   G   0 . n 
A  1  2670 U   2670 2671 2671 U   U   0 . n 
A  1  2671 C   2671 2672 2672 C   C   0 . n 
A  1  2672 U   2672 2673 2673 U   U   0 . n 
A  1  2673 G   2673 2674 2674 G   G   0 . n 
A  1  2674 A   2674 2675 2675 A   A   0 . n 
A  1  2675 C   2675 2676 2676 C   C   0 . n 
A  1  2676 A   2676 2677 2677 A   A   0 . n 
A  1  2677 A   2677 2678 2678 A   A   0 . n 
A  1  2678 G   2678 2679 2679 G   G   0 . n 
A  1  2679 A   2679 2680 2680 A   A   0 . n 
A  1  2680 A   2680 2681 2681 A   A   0 . n 
A  1  2681 C   2681 2682 2682 C   C   0 . n 
A  1  2682 G   2682 2683 2683 G   G   0 . n 
A  1  2683 A   2683 2684 2684 A   A   0 . n 
A  1  2684 C   2684 2685 2685 C   C   0 . n 
A  1  2685 C   2685 2686 2686 C   C   0 . n 
A  1  2686 G   2686 2687 2687 G   G   0 . n 
A  1  2687 U   2687 2688 2688 U   U   0 . n 
A  1  2688 A   2688 2689 2689 A   A   0 . n 
A  1  2689 U   2689 2690 2690 U   U   0 . n 
A  1  2690 A   2690 2691 2691 A   A   0 . n 
A  1  2691 G   2691 2692 2692 G   G   0 . n 
A  1  2692 U   2692 2693 2693 U   U   0 . n 
A  1  2693 A   2693 2694 2694 A   A   0 . n 
A  1  2694 C   2694 2695 2695 C   C   0 . n 
A  1  2695 G   2695 2696 2696 G   G   0 . n 
A  1  2696 A   2696 2697 2697 A   A   0 . n 
A  1  2697 G   2697 2698 2698 G   G   0 . n 
A  1  2698 A   2698 2699 2699 A   A   0 . n 
A  1  2699 G   2699 2700 2700 G   G   0 . n 
A  1  2700 G   2700 2701 2701 G   G   0 . n 
A  1  2701 A   2701 2702 2702 A   A   0 . n 
A  1  2702 A   2702 2703 2703 A   A   0 . n 
A  1  2703 C   2703 2704 2704 C   C   0 . n 
A  1  2704 U   2704 2705 2705 U   U   0 . n 
A  1  2705 A   2705 2706 2706 A   A   0 . n 
A  1  2706 C   2706 2707 2707 C   C   0 . n 
A  1  2707 G   2707 2708 2708 G   G   0 . n 
A  1  2708 G   2708 2709 2709 G   G   0 . n 
A  1  2709 U   2709 2710 2710 U   U   0 . n 
A  1  2710 U   2710 2711 2711 U   U   0 . n 
A  1  2711 G   2711 2712 2712 G   G   0 . n 
A  1  2712 G   2712 2713 2713 G   G   0 . n 
A  1  2713 U   2713 2714 2714 U   U   0 . n 
A  1  2714 G   2714 2715 2715 G   G   0 . n 
A  1  2715 G   2715 2716 2716 G   G   0 . n 
A  1  2716 C   2716 2717 2717 C   C   0 . n 
A  1  2717 C   2717 2718 2718 C   C   0 . n 
A  1  2718 A   2718 2719 2719 A   A   0 . n 
A  1  2719 C   2719 2720 2720 C   C   0 . n 
A  1  2720 U   2720 2721 2721 U   U   0 . n 
A  1  2721 G   2721 2722 2722 G   G   0 . n 
A  1  2722 G   2722 2723 2723 G   G   0 . n 
A  1  2723 U   2723 2724 2724 U   U   0 . n 
A  1  2724 G   2724 2725 2725 G   G   0 . n 
A  1  2725 U   2725 2726 2726 U   U   0 . n 
A  1  2726 A   2726 2727 2727 A   A   0 . n 
A  1  2727 C   2727 2728 2728 C   C   0 . n 
A  1  2728 C   2728 2729 2729 C   C   0 . n 
A  1  2729 G   2729 2730 2730 G   G   0 . n 
A  1  2730 G   2730 2731 2731 G   G   0 . n 
A  1  2731 U   2731 2732 2732 U   U   0 . n 
A  1  2732 U   2732 2733 2733 U   U   0 . n 
A  1  2733 G   2733 2734 2734 G   G   0 . n 
A  1  2734 U   2734 2735 2735 U   U   0 . n 
A  1  2735 U   2735 2736 2736 U   U   0 . n 
A  1  2736 C   2736 2737 2737 C   C   0 . n 
A  1  2737 G   2737 2738 2738 G   G   0 . n 
A  1  2738 A   2738 2739 2739 A   A   0 . n 
A  1  2739 G   2739 2740 2740 G   G   0 . n 
A  1  2740 A   2740 2741 2741 A   A   0 . n 
A  1  2741 G   2741 2742 2742 G   G   0 . n 
A  1  2742 A   2742 2743 2743 A   A   0 . n 
A  1  2743 G   2743 2744 2744 G   G   0 . n 
A  1  2744 C   2744 2745 2745 C   C   0 . n 
A  1  2745 A   2745 2746 2746 A   A   0 . n 
A  1  2746 C   2746 2747 2747 C   C   0 . n 
A  1  2747 G   2747 2748 2748 G   G   0 . n 
A  1  2748 U   2748 2749 2749 U   U   0 . n 
A  1  2749 G   2749 2750 2750 G   G   0 . n 
A  1  2750 C   2750 2751 2751 C   C   0 . n 
A  1  2751 C   2751 2752 2752 C   C   0 . n 
A  1  2752 G   2752 2753 2753 G   G   0 . n 
A  1  2753 G   2753 2754 2754 G   G   0 . n 
A  1  2754 G   2754 2755 2755 G   G   0 . n 
A  1  2755 U   2755 2756 2756 U   U   0 . n 
A  1  2756 A   2756 2757 2757 A   A   0 . n 
A  1  2757 G   2757 2758 2758 G   G   0 . n 
A  1  2758 C   2758 2759 2759 C   C   0 . n 
A  1  2759 C   2759 2760 2760 C   C   0 . n 
A  1  2760 A   2760 2761 2761 A   A   0 . n 
A  1  2761 C   2761 2762 2762 C   C   0 . n 
A  1  2762 G   2762 2763 2763 G   G   0 . n 
A  1  2763 C   2763 2764 2764 C   C   0 . n 
A  1  2764 C   2764 2765 2765 C   C   0 . n 
A  1  2765 A   2765 2766 2766 A   A   0 . n 
A  1  2766 C   2766 2767 2767 C   C   0 . n 
A  1  2767 A   2767 2768 2768 A   A   0 . n 
A  1  2768 C   2768 2769 2769 C   C   0 . n 
A  1  2769 G   2769 2770 2770 G   G   0 . n 
A  1  2770 G   2770 2771 2771 G   G   0 . n 
A  1  2771 G   2771 2772 2772 G   G   0 . n 
A  1  2772 G   2772 2773 2773 G   G   0 . n 
A  1  2773 U   2773 2774 2774 U   U   0 . n 
A  1  2774 A   2774 2775 2775 A   A   0 . n 
A  1  2775 A   2775 2776 2776 A   A   0 . n 
A  1  2776 G   2776 2777 2777 G   G   0 . n 
A  1  2777 A   2777 2778 2778 A   A   0 . n 
A  1  2778 G   2778 2779 2779 G   G   0 . n 
A  1  2779 C   2779 2780 2780 C   C   0 . n 
A  1  2780 U   2780 2781 2781 U   U   0 . n 
A  1  2781 G   2781 2782 2782 G   G   0 . n 
A  1  2782 A   2782 2783 2783 A   A   0 . n 
A  1  2783 A   2783 2784 2784 A   A   0 . n 
A  1  2784 C   2784 2785 2785 C   C   0 . n 
A  1  2785 G   2785 2786 2786 G   G   0 . n 
A  1  2786 C   2786 2787 2787 C   C   0 . n 
A  1  2787 A   2787 2788 2788 A   A   0 . n 
A  1  2788 U   2788 2789 2789 U   U   0 . n 
A  1  2789 C   2789 2790 2790 C   C   0 . n 
A  1  2790 U   2790 2791 2791 U   U   0 . n 
A  1  2791 A   2791 2792 2792 A   A   0 . n 
A  1  2792 A   2792 2793 2793 A   A   0 . n 
A  1  2793 G   2793 2794 2794 G   G   0 . n 
A  1  2794 C   2794 2795 2795 C   C   0 . n 
A  1  2795 U   2795 2796 2796 U   U   0 . n 
A  1  2796 C   2796 2797 2797 C   C   0 . n 
A  1  2797 G   2797 2798 2798 G   G   0 . n 
A  1  2798 A   2798 2799 2799 A   A   0 . n 
A  1  2799 A   2799 2800 2800 A   A   0 . n 
A  1  2800 A   2800 2801 2801 A   A   0 . n 
A  1  2801 C   2801 2802 2802 C   C   0 . n 
A  1  2802 C   2802 2803 2803 C   C   0 . n 
A  1  2803 C   2803 2804 2804 C   C   0 . n 
A  1  2804 A   2804 2805 2805 A   A   0 . n 
A  1  2805 C   2805 2806 2806 C   C   0 . n 
A  1  2806 U   2806 2807 2807 U   U   0 . n 
A  1  2807 U   2807 2808 2808 U   U   0 . n 
A  1  2808 G   2808 2809 2809 G   G   0 . n 
A  1  2809 G   2809 2810 2810 G   G   0 . n 
A  1  2810 A   2810 2811 2811 A   A   0 . n 
A  1  2811 A   2811 2812 2812 A   A   0 . n 
A  1  2812 A   2812 2813 2813 A   A   0 . n 
A  1  2813 A   2813 2814 2814 A   A   0 . n 
A  1  2814 G   2814 2815 2815 G   G   0 . n 
A  1  2815 A   2815 2816 2816 A   A   0 . n 
A  1  2816 G   2816 2817 2817 G   G   0 . n 
A  1  2817 A   2817 2818 2818 A   A   0 . n 
A  1  2818 C   2818 2819 2819 C   C   0 . n 
A  1  2819 A   2819 2820 2820 A   A   0 . n 
A  1  2820 C   2820 2821 2821 C   C   0 . n 
A  1  2821 C   2821 2822 2822 C   C   0 . n 
A  1  2822 G   2822 2823 2823 G   G   0 . n 
A  1  2823 C   2823 2824 2824 C   C   0 . n 
A  1  2824 C   2824 2825 2825 C   C   0 . n 
A  1  2825 G   2825 2826 2826 G   G   0 . n 
A  1  2826 A   2826 2827 2827 A   A   0 . n 
A  1  2827 G   2827 2828 2828 G   G   0 . n 
A  1  2828 G   2828 2829 2829 G   G   0 . n 
A  1  2829 U   2829 2830 2830 U   U   0 . n 
A  1  2830 C   2830 2831 2831 C   C   0 . n 
A  1  2831 C   2831 2832 2832 C   C   0 . n 
A  1  2832 C   2832 2833 2833 C   C   0 . n 
A  1  2833 G   2833 2834 2834 G   G   0 . n 
A  1  2834 C   2834 2835 2835 C   C   0 . n 
A  1  2835 G   2835 2836 2836 G   G   0 . n 
A  1  2836 U   2836 2837 2837 U   U   0 . n 
A  1  2837 A   2837 2838 2838 A   A   0 . n 
A  1  2838 C   2838 2839 2839 C   C   0 . n 
A  1  2839 A   2839 2840 2840 A   A   0 . n 
A  1  2840 A   2840 2841 2841 A   A   0 . n 
A  1  2841 G   2841 2842 2842 G   G   0 . n 
A  1  2842 A   2842 2843 2843 A   A   0 . n 
A  1  2843 C   2843 2844 2844 C   C   0 . n 
A  1  2844 G   2844 2845 2845 G   G   0 . n 
A  1  2845 C   2845 2846 2846 C   C   0 . n 
A  1  2846 G   2846 2847 2847 G   G   0 . n 
A  1  2847 G   2847 2848 2848 G   G   0 . n 
A  1  2848 U   2848 2849 2849 U   U   0 . n 
A  1  2849 C   2849 2850 2850 C   C   0 . n 
A  1  2850 G   2850 2851 2851 G   G   0 . n 
A  1  2851 A   2851 2852 2852 A   A   0 . n 
A  1  2852 U   2852 2853 2853 U   U   0 . n 
A  1  2853 A   2853 2854 2854 A   A   0 . n 
A  1  2854 G   2854 2855 2855 G   G   0 . n 
A  1  2855 A   2855 2856 2856 A   A   0 . n 
A  1  2856 C   2856 2857 2857 C   C   0 . n 
A  1  2857 U   2857 2858 2858 U   U   0 . n 
A  1  2858 C   2858 2859 2859 C   C   0 . n 
A  1  2859 G   2859 2860 2860 G   G   0 . n 
A  1  2860 G   2860 2861 2861 G   G   0 . n 
A  1  2861 G   2861 2862 2862 G   G   0 . n 
A  1  2862 G   2862 2863 2863 G   G   0 . n 
A  1  2863 U   2863 2864 2864 U   U   0 . n 
A  1  2864 G   2864 2865 2865 G   G   0 . n 
A  1  2865 U   2865 2866 2866 U   U   0 . n 
A  1  2866 G   2866 2867 2867 G   G   0 . n 
A  1  2867 C   2867 2868 2868 C   C   0 . n 
A  1  2868 G   2868 2869 2869 G   G   0 . n 
A  1  2869 C   2869 2870 2870 C   C   0 . n 
A  1  2870 G   2870 2871 2871 G   G   0 . n 
A  1  2871 U   2871 2872 2872 U   U   0 . n 
A  1  2872 C   2872 2873 2873 C   C   0 . n 
A  1  2873 G   2873 2874 2874 G   G   0 . n 
A  1  2874 A   2874 2875 2875 A   A   0 . n 
A  1  2875 G   2875 2876 2876 G   G   0 . n 
A  1  2876 G   2876 2877 2877 G   G   0 . n 
A  1  2877 U   2877 2878 2878 U   U   0 . n 
A  1  2878 A   2878 2879 2879 A   A   0 . n 
A  1  2879 A   2879 2880 2880 A   A   0 . n 
A  1  2880 C   2880 2881 2881 C   C   0 . n 
A  1  2881 G   2881 2882 2882 G   G   0 . n 
A  1  2882 A   2882 2883 2883 A   A   0 . n 
A  1  2883 G   2883 2884 2884 G   G   0 . n 
A  1  2884 A   2884 2885 2885 A   A   0 . n 
A  1  2885 C   2885 2886 2886 C   C   0 . n 
A  1  2886 G   2886 2887 2887 G   G   0 . n 
A  1  2887 U   2887 2888 2888 U   U   0 . n 
A  1  2888 U   2888 2889 2889 U   U   0 . n 
A  1  2889 A   2889 2890 2890 A   A   0 . n 
A  1  2890 A   2890 2891 2891 A   A   0 . n 
A  1  2891 G   2891 2892 2892 G   G   0 . n 
A  1  2892 C   2892 2893 2893 C   C   0 . n 
A  1  2893 C   2893 2894 2894 C   C   0 . n 
A  1  2894 C   2894 2895 2895 C   C   0 . n 
A  1  2895 A   2895 2896 2896 A   A   0 . n 
A  1  2896 C   2896 2897 2897 C   C   0 . n 
A  1  2897 G   2897 2898 2898 G   G   0 . n 
A  1  2898 A   2898 2899 2899 A   A   0 . n 
A  1  2899 G   2899 2900 2900 G   G   0 . n 
A  1  2900 C   2900 2901 2901 C   C   0 . n 
A  1  2901 A   2901 2902 2902 A   A   0 . n 
A  1  2902 C   2902 2903 2903 C   C   0 . n 
A  1  2903 U   2903 2904 2904 U   U   0 . n 
A  1  2904 A   2904 2905 2905 A   A   0 . n 
A  1  2905 A   2905 2906 2906 A   A   0 . n 
A  1  2906 C   2906 2907 2907 C   C   0 . n 
A  1  2907 A   2907 2908 2908 A   A   0 . n 
A  1  2908 G   2908 2909 2909 G   G   0 . n 
A  1  2909 A   2909 2910 2910 A   A   0 . n 
A  1  2910 C   2910 2911 2911 C   C   0 . n 
A  1  2911 C   2911 2912 2912 C   C   0 . n 
A  1  2912 A   2912 2913 2913 A   A   0 . n 
A  1  2913 A   2913 2914 2914 A   A   0 . n 
A  1  2914 A   2914 2915 ?    ?   ?   0 . n 
A  1  2915 G   2915 2916 ?    ?   ?   0 . n 
A  1  2916 C   2916 2917 ?    ?   ?   0 . n 
A  1  2917 C   2917 2918 ?    ?   ?   0 . n 
A  1  2918 A   2918 2919 ?    ?   ?   0 . n 
A  1  2919 U   2919 2920 ?    ?   ?   0 . n 
A  1  2920 C   2920 2921 ?    ?   ?   0 . n 
A  1  2921 A   2921 2922 ?    ?   ?   0 . n 
A  1  2922 U   2922 2923 ?    ?   ?   0 . n 
B  2  1    U   1    1    1    U   U   9 . n 
B  2  2    U   2    2    2    U   U   9 . n 
B  2  3    A   3    3    3    A   A   9 . n 
B  2  4    G   4    4    4    G   G   9 . n 
B  2  5    G   5    5    5    G   G   9 . n 
B  2  6    C   6    6    6    C   C   9 . n 
B  2  7    G   7    7    7    G   G   9 . n 
B  2  8    G   8    8    8    G   G   9 . n 
B  2  9    C   9    9    9    C   C   9 . n 
B  2  10   C   10   10   10   C   C   9 . n 
B  2  11   A   11   11   11   A   A   9 . n 
B  2  12   C   12   12   12   C   C   9 . n 
B  2  13   A   13   13   13   A   A   9 . n 
B  2  14   G   14   14   14   G   G   9 . n 
B  2  15   C   15   15   15   C   C   9 . n 
B  2  16   G   16   16   16   G   G   9 . n 
B  2  17   G   17   17   17   G   G   9 . n 
B  2  18   U   18   18   18   U   U   9 . n 
B  2  19   G   19   19   19   G   G   9 . n 
B  2  20   G   20   20   20   G   G   9 . n 
B  2  21   G   21   21   21   G   G   9 . n 
B  2  22   G   22   22   22   G   G   9 . n 
B  2  23   U   23   23   23   U   U   9 . n 
B  2  24   U   24   24   24   U   U   9 . n 
B  2  25   G   25   25   25   G   G   9 . n 
B  2  26   C   26   26   26   C   C   9 . n 
B  2  27   C   27   27   27   C   C   9 . n 
B  2  28   U   28   28   28   U   U   9 . n 
B  2  29   C   29   29   29   C   C   9 . n 
B  2  30   C   30   30   30   C   C   9 . n 
B  2  31   C   31   31   31   C   C   9 . n 
B  2  32   G   32   32   32   G   G   9 . n 
B  2  33   U   33   33   33   U   U   9 . n 
B  2  34   A   34   34   34   A   A   9 . n 
B  2  35   C   35   35   35   C   C   9 . n 
B  2  36   C   36   36   36   C   C   9 . n 
B  2  37   C   37   37   37   C   C   9 . n 
B  2  38   A   38   38   38   A   A   9 . n 
B  2  39   U   39   39   39   U   U   9 . n 
B  2  40   C   40   40   40   C   C   9 . n 
B  2  41   C   41   41   41   C   C   9 . n 
B  2  42   C   42   42   42   C   C   9 . n 
B  2  43   G   43   43   43   G   G   9 . n 
B  2  44   A   44   44   44   A   A   9 . n 
B  2  45   A   45   45   45   A   A   9 . n 
B  2  46   C   46   46   46   C   C   9 . n 
B  2  47   A   47   47   47   A   A   9 . n 
B  2  48   C   48   48   48   C   C   9 . n 
B  2  49   G   49   49   49   G   G   9 . n 
B  2  50   G   50   50   50   G   G   9 . n 
B  2  51   A   51   51   51   A   A   9 . n 
B  2  52   A   52   52   52   A   A   9 . n 
B  2  53   G   53   53   53   G   G   9 . n 
B  2  54   A   54   54   54   A   A   9 . n 
B  2  55   U   55   55   55   U   U   9 . n 
B  2  56   A   56   56   56   A   A   9 . n 
B  2  57   A   57   57   57   A   A   9 . n 
B  2  58   G   58   58   58   G   G   9 . n 
B  2  59   C   59   59   59   C   C   9 . n 
B  2  60   C   60   60   60   C   C   9 . n 
B  2  61   C   61   61   61   C   C   9 . n 
B  2  62   A   62   62   62   A   A   9 . n 
B  2  63   C   63   63   63   C   C   9 . n 
B  2  64   C   64   64   64   C   C   9 . n 
B  2  65   A   65   65   65   A   A   9 . n 
B  2  66   G   66   66   66   G   G   9 . n 
B  2  67   C   67   67   67   C   C   9 . n 
B  2  68   G   68   68   68   G   G   9 . n 
B  2  69   U   69   69   69   U   U   9 . n 
B  2  70   U   70   70   70   U   U   9 . n 
B  2  71   C   71   71   71   C   C   9 . n 
B  2  72   C   72   72   72   C   C   9 . n 
B  2  73   G   73   73   73   G   G   9 . n 
B  2  74   G   74   74   74   G   G   9 . n 
B  2  75   G   75   75   75   G   G   9 . n 
B  2  76   G   76   76   76   G   G   9 . n 
B  2  77   A   77   77   77   A   A   9 . n 
B  2  78   G   78   78   78   G   G   9 . n 
B  2  79   U   79   79   79   U   U   9 . n 
B  2  80   A   80   80   80   A   A   9 . n 
B  2  81   C   81   81   81   C   C   9 . n 
B  2  82   U   82   82   82   U   U   9 . n 
B  2  83   G   83   83   83   G   G   9 . n 
B  2  84   G   84   84   84   G   G   9 . n 
B  2  85   A   85   85   85   A   A   9 . n 
B  2  86   G   86   86   86   G   G   9 . n 
B  2  87   U   87   87   87   U   U   9 . n 
B  2  88   G   88   88   88   G   G   9 . n 
B  2  89   C   89   89   89   C   C   9 . n 
B  2  90   G   90   90   90   G   G   9 . n 
B  2  91   C   91   91   91   C   C   9 . n 
B  2  92   G   92   92   92   G   G   9 . n 
B  2  93   A   93   93   93   A   A   9 . n 
B  2  94   G   94   94   94   G   G   9 . n 
B  2  95   C   95   95   95   C   C   9 . n 
B  2  96   C   96   96   96   C   C   9 . n 
B  2  97   U   97   97   97   U   U   9 . n 
B  2  98   C   98   98   98   C   C   9 . n 
B  2  99   U   99   99   99   U   U   9 . n 
B  2  100  G   100  100  100  G   G   9 . n 
B  2  101  G   101  101  101  G   G   9 . n 
B  2  102  G   102  102  102  G   G   9 . n 
B  2  103  A   103  103  103  A   A   9 . n 
B  2  104  A   104  104  104  A   A   9 . n 
B  2  105  A   105  105  105  A   A   9 . n 
B  2  106  C   106  106  106  C   C   9 . n 
B  2  107  C   107  107  107  C   C   9 . n 
B  2  108  C   108  108  108  C   C   9 . n 
B  2  109  G   109  109  109  G   G   9 . n 
B  2  110  G   110  110  110  G   G   9 . n 
B  2  111  U   111  111  111  U   U   9 . n 
B  2  112  U   112  112  112  U   U   9 . n 
B  2  113  C   113  113  113  C   C   9 . n 
B  2  114  G   114  114  114  G   G   9 . n 
B  2  115  C   115  115  115  C   C   9 . n 
B  2  116  C   116  116  116  C   C   9 . n 
B  2  117  G   117  117  117  G   G   9 . n 
B  2  118  C   118  118  118  C   C   9 . n 
B  2  119  C   119  119  119  C   C   9 . n 
B  2  120  A   120  120  120  A   A   9 . n 
B  2  121  C   121  121  121  C   C   9 . n 
B  2  122  C   122  122  122  C   C   9 . n 
C  3  1    GLY 1    1    1    GLY GLY A . n 
C  3  2    ARG 2    2    2    ARG ARG A . n 
C  3  3    ARG 3    3    3    ARG ARG A . n 
C  3  4    ILE 4    4    4    ILE ILE A . n 
C  3  5    GLN 5    5    5    GLN GLN A . n 
C  3  6    GLY 6    6    6    GLY GLY A . n 
C  3  7    GLN 7    7    7    GLN GLN A . n 
C  3  8    ARG 8    8    8    ARG ARG A . n 
C  3  9    ARG 9    9    9    ARG ARG A . n 
C  3  10   GLY 10   10   10   GLY GLY A . n 
C  3  11   ARG 11   11   11   ARG ARG A . n 
C  3  12   GLY 12   12   12   GLY GLY A . n 
C  3  13   THR 13   13   13   THR THR A . n 
C  3  14   SER 14   14   14   SER SER A . n 
C  3  15   THR 15   15   15   THR THR A . n 
C  3  16   PHE 16   16   16   PHE PHE A . n 
C  3  17   ARG 17   17   17   ARG ARG A . n 
C  3  18   ALA 18   18   18   ALA ALA A . n 
C  3  19   PRO 19   19   19   PRO PRO A . n 
C  3  20   SER 20   20   20   SER SER A . n 
C  3  21   HIS 21   21   21   HIS HIS A . n 
C  3  22   ARG 22   22   22   ARG ARG A . n 
C  3  23   TYR 23   23   23   TYR TYR A . n 
C  3  24   LYS 24   24   24   LYS LYS A . n 
C  3  25   ALA 25   25   25   ALA ALA A . n 
C  3  26   ASP 26   26   26   ASP ASP A . n 
C  3  27   LEU 27   27   27   LEU LEU A . n 
C  3  28   GLU 28   28   28   GLU GLU A . n 
C  3  29   HIS 29   29   29   HIS HIS A . n 
C  3  30   ARG 30   30   30   ARG ARG A . n 
C  3  31   LYS 31   31   31   LYS LYS A . n 
C  3  32   VAL 32   32   32   VAL VAL A . n 
C  3  33   GLU 33   33   33   GLU GLU A . n 
C  3  34   ASP 34   34   34   ASP ASP A . n 
C  3  35   GLY 35   35   35   GLY GLY A . n 
C  3  36   ASP 36   36   36   ASP ASP A . n 
C  3  37   VAL 37   37   37   VAL VAL A . n 
C  3  38   ILE 38   38   38   ILE ILE A . n 
C  3  39   ALA 39   39   39   ALA ALA A . n 
C  3  40   GLY 40   40   40   GLY GLY A . n 
C  3  41   THR 41   41   41   THR THR A . n 
C  3  42   VAL 42   42   42   VAL VAL A . n 
C  3  43   VAL 43   43   43   VAL VAL A . n 
C  3  44   ASP 44   44   44   ASP ASP A . n 
C  3  45   ILE 45   45   45   ILE ILE A . n 
C  3  46   GLU 46   46   46   GLU GLU A . n 
C  3  47   HIS 47   47   47   HIS HIS A . n 
C  3  48   ASP 48   48   48   ASP ASP A . n 
C  3  49   PRO 49   49   49   PRO PRO A . n 
C  3  50   ALA 50   50   50   ALA ALA A . n 
C  3  51   ARG 51   51   51   ARG ARG A . n 
C  3  52   SER 52   52   52   SER SER A . n 
C  3  53   ALA 53   53   53   ALA ALA A . n 
C  3  54   PRO 54   54   54   PRO PRO A . n 
C  3  55   VAL 55   55   55   VAL VAL A . n 
C  3  56   ALA 56   56   56   ALA ALA A . n 
C  3  57   ALA 57   57   57   ALA ALA A . n 
C  3  58   VAL 58   58   58   VAL VAL A . n 
C  3  59   GLU 59   59   59   GLU GLU A . n 
C  3  60   PHE 60   60   60   PHE PHE A . n 
C  3  61   GLU 61   61   61   GLU GLU A . n 
C  3  62   ASP 62   62   62   ASP ASP A . n 
C  3  63   GLY 63   63   63   GLY GLY A . n 
C  3  64   ASP 64   64   64   ASP ASP A . n 
C  3  65   ARG 65   65   65   ARG ARG A . n 
C  3  66   ARG 66   66   66   ARG ARG A . n 
C  3  67   LEU 67   67   67   LEU LEU A . n 
C  3  68   ILE 68   68   68   ILE ILE A . n 
C  3  69   LEU 69   69   69   LEU LEU A . n 
C  3  70   ALA 70   70   70   ALA ALA A . n 
C  3  71   PRO 71   71   71   PRO PRO A . n 
C  3  72   GLU 72   72   72   GLU GLU A . n 
C  3  73   GLY 73   73   73   GLY GLY A . n 
C  3  74   VAL 74   74   74   VAL VAL A . n 
C  3  75   GLY 75   75   75   GLY GLY A . n 
C  3  76   VAL 76   76   76   VAL VAL A . n 
C  3  77   GLY 77   77   77   GLY GLY A . n 
C  3  78   ASP 78   78   78   ASP ASP A . n 
C  3  79   GLU 79   79   79   GLU GLU A . n 
C  3  80   LEU 80   80   80   LEU LEU A . n 
C  3  81   GLN 81   81   81   GLN GLN A . n 
C  3  82   VAL 82   82   82   VAL VAL A . n 
C  3  83   GLY 83   83   83   GLY GLY A . n 
C  3  84   VAL 84   84   84   VAL VAL A . n 
C  3  85   ASP 85   85   85   ASP ASP A . n 
C  3  86   ALA 86   86   86   ALA ALA A . n 
C  3  87   GLU 87   87   87   GLU GLU A . n 
C  3  88   ILE 88   88   88   ILE ILE A . n 
C  3  89   ALA 89   89   89   ALA ALA A . n 
C  3  90   PRO 90   90   90   PRO PRO A . n 
C  3  91   GLY 91   91   91   GLY GLY A . n 
C  3  92   ASN 92   92   92   ASN ASN A . n 
C  3  93   THR 93   93   93   THR THR A . n 
C  3  94   LEU 94   94   94   LEU LEU A . n 
C  3  95   PRO 95   95   95   PRO PRO A . n 
C  3  96   LEU 96   96   96   LEU LEU A . n 
C  3  97   ALA 97   97   97   ALA ALA A . n 
C  3  98   GLU 98   98   98   GLU GLU A . n 
C  3  99   ILE 99   99   99   ILE ILE A . n 
C  3  100  PRO 100  100  100  PRO PRO A . n 
C  3  101  GLU 101  101  101  GLU GLU A . n 
C  3  102  GLY 102  102  102  GLY GLY A . n 
C  3  103  VAL 103  103  103  VAL VAL A . n 
C  3  104  PRO 104  104  104  PRO PRO A . n 
C  3  105  VAL 105  105  105  VAL VAL A . n 
C  3  106  CYS 106  106  106  CYS CYS A . n 
C  3  107  ASN 107  107  107  ASN ASN A . n 
C  3  108  VAL 108  108  108  VAL VAL A . n 
C  3  109  GLU 109  109  109  GLU GLU A . n 
C  3  110  SER 110  110  110  SER SER A . n 
C  3  111  SER 111  111  111  SER SER A . n 
C  3  112  PRO 112  112  112  PRO PRO A . n 
C  3  113  GLY 113  113  113  GLY GLY A . n 
C  3  114  ASP 114  114  114  ASP ASP A . n 
C  3  115  GLY 115  115  115  GLY GLY A . n 
C  3  116  GLY 116  116  116  GLY GLY A . n 
C  3  117  LYS 117  117  117  LYS LYS A . n 
C  3  118  PHE 118  118  118  PHE PHE A . n 
C  3  119  ALA 119  119  119  ALA ALA A . n 
C  3  120  ARG 120  120  120  ARG ARG A . n 
C  3  121  ALA 121  121  121  ALA ALA A . n 
C  3  122  SER 122  122  122  SER SER A . n 
C  3  123  GLY 123  123  123  GLY GLY A . n 
C  3  124  VAL 124  124  124  VAL VAL A . n 
C  3  125  ASN 125  125  125  ASN ASN A . n 
C  3  126  ALA 126  126  126  ALA ALA A . n 
C  3  127  GLN 127  127  127  GLN GLN A . n 
C  3  128  LEU 128  128  128  LEU LEU A . n 
C  3  129  LEU 129  129  129  LEU LEU A . n 
C  3  130  THR 130  130  130  THR THR A . n 
C  3  131  HIS 131  131  131  HIS HIS A . n 
C  3  132  ASP 132  132  132  ASP ASP A . n 
C  3  133  ARG 133  133  133  ARG ARG A . n 
C  3  134  ASN 134  134  134  ASN ASN A . n 
C  3  135  VAL 135  135  135  VAL VAL A . n 
C  3  136  ALA 136  136  136  ALA ALA A . n 
C  3  137  VAL 137  137  137  VAL VAL A . n 
C  3  138  VAL 138  138  138  VAL VAL A . n 
C  3  139  LYS 139  139  139  LYS LYS A . n 
C  3  140  LEU 140  140  140  LEU LEU A . n 
C  3  141  PRO 141  141  141  PRO PRO A . n 
C  3  142  SER 142  142  142  SER SER A . n 
C  3  143  GLY 143  143  143  GLY GLY A . n 
C  3  144  GLU 144  144  144  GLU GLU A . n 
C  3  145  MET 145  145  145  MET MET A . n 
C  3  146  LYS 146  146  146  LYS LYS A . n 
C  3  147  ARG 147  147  147  ARG ARG A . n 
C  3  148  LEU 148  148  148  LEU LEU A . n 
C  3  149  ASP 149  149  149  ASP ASP A . n 
C  3  150  PRO 150  150  150  PRO PRO A . n 
C  3  151  GLN 151  151  151  GLN GLN A . n 
C  3  152  CYS 152  152  152  CYS CYS A . n 
C  3  153  ARG 153  153  153  ARG ARG A . n 
C  3  154  ALA 154  154  154  ALA ALA A . n 
C  3  155  THR 155  155  155  THR THR A . n 
C  3  156  ILE 156  156  156  ILE ILE A . n 
C  3  157  GLY 157  157  157  GLY GLY A . n 
C  3  158  VAL 158  158  158  VAL VAL A . n 
C  3  159  VAL 159  159  159  VAL VAL A . n 
C  3  160  GLY 160  160  160  GLY GLY A . n 
C  3  161  GLY 161  161  161  GLY GLY A . n 
C  3  162  GLY 162  162  162  GLY GLY A . n 
C  3  163  GLY 163  163  163  GLY GLY A . n 
C  3  164  ARG 164  164  164  ARG ARG A . n 
C  3  165  THR 165  165  165  THR THR A . n 
C  3  166  ASP 166  166  166  ASP ASP A . n 
C  3  167  LYS 167  167  167  LYS LYS A . n 
C  3  168  PRO 168  168  168  PRO PRO A . n 
C  3  169  PHE 169  169  169  PHE PHE A . n 
C  3  170  VAL 170  170  170  VAL VAL A . n 
C  3  171  LYS 171  171  171  LYS LYS A . n 
C  3  172  ALA 172  172  172  ALA ALA A . n 
C  3  173  GLY 173  173  173  GLY GLY A . n 
C  3  174  ASN 174  174  174  ASN ASN A . n 
C  3  175  LYS 175  175  175  LYS LYS A . n 
C  3  176  HIS 176  176  176  HIS HIS A . n 
C  3  177  HIS 177  177  177  HIS HIS A . n 
C  3  178  LYS 178  178  178  LYS LYS A . n 
C  3  179  MET 179  179  179  MET MET A . n 
C  3  180  LYS 180  180  180  LYS LYS A . n 
C  3  181  ALA 181  181  181  ALA ALA A . n 
C  3  182  ARG 182  182  182  ARG ARG A . n 
C  3  183  GLY 183  183  183  GLY GLY A . n 
C  3  184  THR 184  184  184  THR THR A . n 
C  3  185  LYS 185  185  185  LYS LYS A . n 
C  3  186  TRP 186  186  186  TRP TRP A . n 
C  3  187  PRO 187  187  187  PRO PRO A . n 
C  3  188  ASN 188  188  188  ASN ASN A . n 
C  3  189  VAL 189  189  189  VAL VAL A . n 
C  3  190  ARG 190  190  190  ARG ARG A . n 
C  3  191  GLY 191  191  191  GLY GLY A . n 
C  3  192  VAL 192  192  192  VAL VAL A . n 
C  3  193  ALA 193  193  193  ALA ALA A . n 
C  3  194  MET 194  194  194  MET MET A . n 
C  3  195  ASN 195  195  195  ASN ASN A . n 
C  3  196  ALA 196  196  196  ALA ALA A . n 
C  3  197  VAL 197  197  197  VAL VAL A . n 
C  3  198  ASP 198  198  198  ASP ASP A . n 
C  3  199  HIS 199  199  199  HIS HIS A . n 
C  3  200  PRO 200  200  200  PRO PRO A . n 
C  3  201  PHE 201  201  201  PHE PHE A . n 
C  3  202  GLY 202  202  202  GLY GLY A . n 
C  3  203  GLY 203  203  203  GLY GLY A . n 
C  3  204  GLY 204  204  204  GLY GLY A . n 
C  3  205  GLY 205  205  205  GLY GLY A . n 
C  3  206  ARG 206  206  206  ARG ARG A . n 
C  3  207  GLN 207  207  207  GLN GLN A . n 
C  3  208  HIS 208  208  208  HIS HIS A . n 
C  3  209  PRO 209  209  209  PRO PRO A . n 
C  3  210  GLY 210  210  210  GLY GLY A . n 
C  3  211  LYS 211  211  211  LYS LYS A . n 
C  3  212  PRO 212  212  212  PRO PRO A . n 
C  3  213  LYS 213  213  213  LYS LYS A . n 
C  3  214  SER 214  214  214  SER SER A . n 
C  3  215  ILE 215  215  215  ILE ILE A . n 
C  3  216  SER 216  216  216  SER SER A . n 
C  3  217  ARG 217  217  217  ARG ARG A . n 
C  3  218  ASN 218  218  218  ASN ASN A . n 
C  3  219  ALA 219  219  219  ALA ALA A . n 
C  3  220  PRO 220  220  220  PRO PRO A . n 
C  3  221  PRO 221  221  221  PRO PRO A . n 
C  3  222  GLY 222  222  222  GLY GLY A . n 
C  3  223  ARG 223  223  223  ARG ARG A . n 
C  3  224  LYS 224  224  224  LYS LYS A . n 
C  3  225  VAL 225  225  225  VAL VAL A . n 
C  3  226  GLY 226  226  226  GLY GLY A . n 
C  3  227  ASP 227  227  227  ASP ASP A . n 
C  3  228  ILE 228  228  228  ILE ILE A . n 
C  3  229  ALA 229  229  229  ALA ALA A . n 
C  3  230  SER 230  230  230  SER SER A . n 
C  3  231  LYS 231  231  231  LYS LYS A . n 
C  3  232  ARG 232  232  232  ARG ARG A . n 
C  3  233  THR 233  233  233  THR THR A . n 
C  3  234  GLY 234  234  234  GLY GLY A . n 
C  3  235  ARG 235  235  235  ARG ARG A . n 
C  3  236  GLY 236  236  236  GLY GLY A . n 
C  3  237  GLY 237  237  237  GLY GLY A . n 
C  3  238  ASN 238  238  ?    ?   ?   A . n 
C  3  239  GLU 239  239  ?    ?   ?   A . n 
D  4  1    PRO 1    1    1    PRO PRO B . n 
D  4  2    GLN 2    2    2    GLN GLN B . n 
D  4  3    PRO 3    3    3    PRO PRO B . n 
D  4  4    SER 4    4    4    SER SER B . n 
D  4  5    ARG 5    5    5    ARG ARG B . n 
D  4  6    PRO 6    6    6    PRO PRO B . n 
D  4  7    ARG 7    7    7    ARG ARG B . n 
D  4  8    LYS 8    8    8    LYS LYS B . n 
D  4  9    GLY 9    9    9    GLY GLY B . n 
D  4  10   SER 10   10   10   SER SER B . n 
D  4  11   LEU 11   11   11   LEU LEU B . n 
D  4  12   GLY 12   12   12   GLY GLY B . n 
D  4  13   PHE 13   13   13   PHE PHE B . n 
D  4  14   GLY 14   14   14   GLY GLY B . n 
D  4  15   PRO 15   15   15   PRO CPR B . n 
D  4  16   ARG 16   16   16   ARG ARG B . n 
D  4  17   LYS 17   17   17   LYS LYS B . n 
D  4  18   ARG 18   18   18   ARG ARG B . n 
D  4  19   SER 19   19   19   SER SER B . n 
D  4  20   THR 20   20   20   THR THR B . n 
D  4  21   SER 21   21   21   SER SER B . n 
D  4  22   GLU 22   22   22   GLU GLU B . n 
D  4  23   THR 23   23   23   THR THR B . n 
D  4  24   PRO 24   24   24   PRO PRO B . n 
D  4  25   ARG 25   25   25   ARG ARG B . n 
D  4  26   PHE 26   26   26   PHE PHE B . n 
D  4  27   ASN 27   27   27   ASN ASN B . n 
D  4  28   SER 28   28   28   SER SER B . n 
D  4  29   TRP 29   29   29   TRP TRP B . n 
D  4  30   PRO 30   30   30   PRO PRO B . n 
D  4  31   SER 31   31   31   SER SER B . n 
D  4  32   ASP 32   32   32   ASP ASP B . n 
D  4  33   ASP 33   33   33   ASP ASP B . n 
D  4  34   GLY 34   34   34   GLY GLY B . n 
D  4  35   GLN 35   35   35   GLN GLN B . n 
D  4  36   PRO 36   36   36   PRO PRO B . n 
D  4  37   GLY 37   37   37   GLY GLY B . n 
D  4  38   VAL 38   38   38   VAL VAL B . n 
D  4  39   GLN 39   39   39   GLN GLN B . n 
D  4  40   GLY 40   40   40   GLY GLY B . n 
D  4  41   PHE 41   41   41   PHE PHE B . n 
D  4  42   ALA 42   42   42   ALA ALA B . n 
D  4  43   GLY 43   43   43   GLY GLY B . n 
D  4  44   TYR 44   44   44   TYR TYR B . n 
D  4  45   LYS 45   45   45   LYS LYS B . n 
D  4  46   ALA 46   46   46   ALA ALA B . n 
D  4  47   GLY 47   47   47   GLY GLY B . n 
D  4  48   MET 48   48   48   MET MET B . n 
D  4  49   THR 49   49   49   THR THR B . n 
D  4  50   HIS 50   50   50   HIS HIS B . n 
D  4  51   VAL 51   51   51   VAL VAL B . n 
D  4  52   VAL 52   52   52   VAL VAL B . n 
D  4  53   LEU 53   53   53   LEU LEU B . n 
D  4  54   VAL 54   54   54   VAL VAL B . n 
D  4  55   ASN 55   55   55   ASN ASN B . n 
D  4  56   ASP 56   56   56   ASP ASP B . n 
D  4  57   GLU 57   57   57   GLU GLU B . n 
D  4  58   PRO 58   58   58   PRO PRO B . n 
D  4  59   ASN 59   59   59   ASN ASN B . n 
D  4  60   SER 60   60   60   SER SER B . n 
D  4  61   PRO 61   61   61   PRO PRO B . n 
D  4  62   ARG 62   62   62   ARG ARG B . n 
D  4  63   GLU 63   63   63   GLU GLU B . n 
D  4  64   GLY 64   64   64   GLY GLY B . n 
D  4  65   MET 65   65   65   MET MET B . n 
D  4  66   GLU 66   66   66   GLU GLU B . n 
D  4  67   GLU 67   67   67   GLU GLU B . n 
D  4  68   THR 68   68   68   THR THR B . n 
D  4  69   VAL 69   69   69   VAL VAL B . n 
D  4  70   PRO 70   70   70   PRO PRO B . n 
D  4  71   VAL 71   71   71   VAL VAL B . n 
D  4  72   THR 72   72   72   THR THR B . n 
D  4  73   VAL 73   73   73   VAL VAL B . n 
D  4  74   ILE 74   74   74   ILE ILE B . n 
D  4  75   GLU 75   75   75   GLU GLU B . n 
D  4  76   THR 76   76   76   THR THR B . n 
D  4  77   PRO 77   77   77   PRO PRO B . n 
D  4  78   PRO 78   78   78   PRO PRO B . n 
D  4  79   MET 79   79   79   MET MET B . n 
D  4  80   ARG 80   80   80   ARG ARG B . n 
D  4  81   ALA 81   81   81   ALA ALA B . n 
D  4  82   VAL 82   82   82   VAL VAL B . n 
D  4  83   ALA 83   83   83   ALA ALA B . n 
D  4  84   LEU 84   84   84   LEU LEU B . n 
D  4  85   ARG 85   85   85   ARG ARG B . n 
D  4  86   ALA 86   86   86   ALA ALA B . n 
D  4  87   TYR 87   87   87   TYR TYR B . n 
D  4  88   GLU 88   88   88   GLU GLU B . n 
D  4  89   ASP 89   89   89   ASP ASP B . n 
D  4  90   THR 90   90   90   THR THR B . n 
D  4  91   PRO 91   91   91   PRO PRO B . n 
D  4  92   TYR 92   92   92   TYR TYR B . n 
D  4  93   GLY 93   93   93   GLY GLY B . n 
D  4  94   GLN 94   94   94   GLN GLN B . n 
D  4  95   ARG 95   95   95   ARG ARG B . n 
D  4  96   PRO 96   96   96   PRO PRO B . n 
D  4  97   LEU 97   97   97   LEU LEU B . n 
D  4  98   THR 98   98   98   THR THR B . n 
D  4  99   GLU 99   99   99   GLU GLU B . n 
D  4  100  VAL 100  100  100  VAL VAL B . n 
D  4  101  TRP 101  101  101  TRP TRP B . n 
D  4  102  THR 102  102  102  THR THR B . n 
D  4  103  ASP 103  103  103  ASP ASP B . n 
D  4  104  GLU 104  104  104  GLU GLU B . n 
D  4  105  PHE 105  105  105  PHE PHE B . n 
D  4  106  HIS 106  106  106  HIS HIS B . n 
D  4  107  SER 107  107  107  SER SER B . n 
D  4  108  GLU 108  108  108  GLU GLU B . n 
D  4  109  LEU 109  109  109  LEU LEU B . n 
D  4  110  ASP 110  110  110  ASP ASP B . n 
D  4  111  ARG 111  111  111  ARG ARG B . n 
D  4  112  THR 112  112  112  THR THR B . n 
D  4  113  LEU 113  113  113  LEU LEU B . n 
D  4  114  ASP 114  114  114  ASP ASP B . n 
D  4  115  VAL 115  115  115  VAL VAL B . n 
D  4  116  PRO 116  116  116  PRO PRO B . n 
D  4  117  GLU 117  117  117  GLU GLU B . n 
D  4  118  ASP 118  118  118  ASP ASP B . n 
D  4  119  HIS 119  119  119  HIS HIS B . n 
D  4  120  ASP 120  120  120  ASP ASP B . n 
D  4  121  PRO 121  121  121  PRO PRO B . n 
D  4  122  ASP 122  122  122  ASP ASP B . n 
D  4  123  ALA 123  123  123  ALA ALA B . n 
D  4  124  ALA 124  124  124  ALA ALA B . n 
D  4  125  GLU 125  125  125  GLU GLU B . n 
D  4  126  GLU 126  126  126  GLU GLU B . n 
D  4  127  GLN 127  127  127  GLN GLN B . n 
D  4  128  ILE 128  128  128  ILE ILE B . n 
D  4  129  ARG 129  129  129  ARG ARG B . n 
D  4  130  ASP 130  130  130  ASP ASP B . n 
D  4  131  ALA 131  131  131  ALA ALA B . n 
D  4  132  HIS 132  132  132  HIS HIS B . n 
D  4  133  GLU 133  133  133  GLU GLU B . n 
D  4  134  ALA 134  134  134  ALA ALA B . n 
D  4  135  GLY 135  135  135  GLY GLY B . n 
D  4  136  ASP 136  136  136  ASP ASP B . n 
D  4  137  LEU 137  137  137  LEU LEU B . n 
D  4  138  GLY 138  138  138  GLY GLY B . n 
D  4  139  ASP 139  139  139  ASP ASP B . n 
D  4  140  LEU 140  140  140  LEU LEU B . n 
D  4  141  ARG 141  141  141  ARG ARG B . n 
D  4  142  LEU 142  142  142  LEU LEU B . n 
D  4  143  ILE 143  143  143  ILE ILE B . n 
D  4  144  THR 144  144  144  THR THR B . n 
D  4  145  HIS 145  145  145  HIS HIS B . n 
D  4  146  THR 146  146  146  THR THR B . n 
D  4  147  VAL 147  147  147  VAL VAL B . n 
D  4  148  PRO 148  148  148  PRO PRO B . n 
D  4  149  ASP 149  149  149  ASP ASP B . n 
D  4  150  ALA 150  150  150  ALA ALA B . n 
D  4  151  VAL 151  151  151  VAL VAL B . n 
D  4  152  PRO 152  152  152  PRO PRO B . n 
D  4  153  SER 153  153  153  SER SER B . n 
D  4  154  VAL 154  154  154  VAL VAL B . n 
D  4  155  PRO 155  155  155  PRO PRO B . n 
D  4  156  LYS 156  156  156  LYS LYS B . n 
D  4  157  LYS 157  157  157  LYS LYS B . n 
D  4  158  LYS 158  158  158  LYS LYS B . n 
D  4  159  PRO 159  159  159  PRO PRO B . n 
D  4  160  ASP 160  160  160  ASP ASP B . n 
D  4  161  VAL 161  161  161  VAL VAL B . n 
D  4  162  MET 162  162  162  MET MET B . n 
D  4  163  GLU 163  163  163  GLU GLU B . n 
D  4  164  THR 164  164  164  THR THR B . n 
D  4  165  ARG 165  165  165  ARG ARG B . n 
D  4  166  VAL 166  166  166  VAL VAL B . n 
D  4  167  GLY 167  167  167  GLY GLY B . n 
D  4  168  GLY 168  168  168  GLY GLY B . n 
D  4  169  GLY 169  169  169  GLY GLY B . n 
D  4  170  SER 170  170  170  SER SER B . n 
D  4  171  VAL 171  171  171  VAL VAL B . n 
D  4  172  SER 172  172  172  SER SER B . n 
D  4  173  ASP 173  173  173  ASP ASP B . n 
D  4  174  ARG 174  174  174  ARG ARG B . n 
D  4  175  LEU 175  175  175  LEU LEU B . n 
D  4  176  ASP 176  176  176  ASP ASP B . n 
D  4  177  HIS 177  177  177  HIS HIS B . n 
D  4  178  ALA 178  178  178  ALA ALA B . n 
D  4  179  LEU 179  179  179  LEU LEU B . n 
D  4  180  ASP 180  180  180  ASP ASP B . n 
D  4  181  ILE 181  181  181  ILE ILE B . n 
D  4  182  VAL 182  182  182  VAL VAL B . n 
D  4  183  GLU 183  183  183  GLU GLU B . n 
D  4  184  ASP 184  184  184  ASP ASP B . n 
D  4  185  GLY 185  185  185  GLY GLY B . n 
D  4  186  GLY 186  186  186  GLY GLY B . n 
D  4  187  GLU 187  187  187  GLU GLU B . n 
D  4  188  HIS 188  188  188  HIS HIS B . n 
D  4  189  ALA 189  189  189  ALA ALA B . n 
D  4  190  MET 190  190  190  MET MET B . n 
D  4  191  ASN 191  191  191  ASN ASN B . n 
D  4  192  ASP 192  192  192  ASP ASP B . n 
D  4  193  ILE 193  193  193  ILE ILE B . n 
D  4  194  PHE 194  194  194  PHE PHE B . n 
D  4  195  ARG 195  195  195  ARG ARG B . n 
D  4  196  ALA 196  196  196  ALA ALA B . n 
D  4  197  GLY 197  197  197  GLY GLY B . n 
D  4  198  GLU 198  198  198  GLU GLU B . n 
D  4  199  TYR 199  199  199  TYR TYR B . n 
D  4  200  ALA 200  200  200  ALA ALA B . n 
D  4  201  ASP 201  201  201  ASP ASP B . n 
D  4  202  VAL 202  202  202  VAL VAL B . n 
D  4  203  ALA 203  203  203  ALA ALA B . n 
D  4  204  GLY 204  204  204  GLY GLY B . n 
D  4  205  VAL 205  205  205  VAL VAL B . n 
D  4  206  THR 206  206  206  THR THR B . n 
D  4  207  LYS 207  207  207  LYS LYS B . n 
D  4  208  GLY 208  208  208  GLY GLY B . n 
D  4  209  LYS 209  209  209  LYS LYS B . n 
D  4  210  GLY 210  210  210  GLY GLY B . n 
D  4  211  THR 211  211  211  THR THR B . n 
D  4  212  GLN 212  212  212  GLN GLN B . n 
D  4  213  GLY 213  213  213  GLY GLY B . n 
D  4  214  PRO 214  214  214  PRO PRO B . n 
D  4  215  VAL 215  215  215  VAL VAL B . n 
D  4  216  LYS 216  216  216  LYS LYS B . n 
D  4  217  ARG 217  217  217  ARG ARG B . n 
D  4  218  TRP 218  218  218  TRP TRP B . n 
D  4  219  GLY 219  219  219  GLY GLY B . n 
D  4  220  VAL 220  220  220  VAL VAL B . n 
D  4  221  GLN 221  221  221  GLN GLN B . n 
D  4  222  LYS 222  222  222  LYS LYS B . n 
D  4  223  ARG 223  223  223  ARG ARG B . n 
D  4  224  LYS 224  224  224  LYS LYS B . n 
D  4  225  GLY 225  225  225  GLY GLY B . n 
D  4  226  LYS 226  226  226  LYS LYS B . n 
D  4  227  HIS 227  227  227  HIS HIS B . n 
D  4  228  ALA 228  228  228  ALA ALA B . n 
D  4  229  ARG 229  229  229  ARG ARG B . n 
D  4  230  GLN 230  230  230  GLN GLN B . n 
D  4  231  GLY 231  231  231  GLY GLY B . n 
D  4  232  TRP 232  232  232  TRP TRP B . n 
D  4  233  ARG 233  233  233  ARG ARG B . n 
D  4  234  ARG 234  234  234  ARG ARG B . n 
D  4  235  ARG 235  235  235  ARG ARG B . n 
D  4  236  ILE 236  236  236  ILE ILE B . n 
D  4  237  GLY 237  237  237  GLY GLY B . n 
D  4  238  ASN 238  238  238  ASN ASN B . n 
D  4  239  LEU 239  239  239  LEU LEU B . n 
D  4  240  GLY 240  240  240  GLY GLY B . n 
D  4  241  PRO 241  241  241  PRO PRO B . n 
D  4  242  TRP 242  242  242  TRP TRP B . n 
D  4  243  ASN 243  243  243  ASN ASN B . n 
D  4  244  PRO 244  244  244  PRO CPR B . n 
D  4  245  SER 245  245  245  SER SER B . n 
D  4  246  ARG 246  246  246  ARG ARG B . n 
D  4  247  VAL 247  247  247  VAL VAL B . n 
D  4  248  ARG 248  248  248  ARG ARG B . n 
D  4  249  SER 249  249  249  SER SER B . n 
D  4  250  THR 250  250  250  THR THR B . n 
D  4  251  VAL 251  251  251  VAL VAL B . n 
D  4  252  PRO 252  252  252  PRO PRO B . n 
D  4  253  GLN 253  253  253  GLN GLN B . n 
D  4  254  GLN 254  254  254  GLN GLN B . n 
D  4  255  GLY 255  255  255  GLY GLY B . n 
D  4  256  GLN 256  256  256  GLN GLN B . n 
D  4  257  THR 257  257  257  THR THR B . n 
D  4  258  GLY 258  258  258  GLY GLY B . n 
D  4  259  TYR 259  259  259  TYR TYR B . n 
D  4  260  HIS 260  260  260  HIS HIS B . n 
D  4  261  GLN 261  261  261  GLN GLN B . n 
D  4  262  ARG 262  262  262  ARG ARG B . n 
D  4  263  THR 263  263  263  THR THR B . n 
D  4  264  GLU 264  264  264  GLU GLU B . n 
D  4  265  LEU 265  265  265  LEU LEU B . n 
D  4  266  ASN 266  266  266  ASN ASN B . n 
D  4  267  LYS 267  267  267  LYS LYS B . n 
D  4  268  ARG 268  268  268  ARG ARG B . n 
D  4  269  LEU 269  269  269  LEU LEU B . n 
D  4  270  ILE 270  270  270  ILE ILE B . n 
D  4  271  ASP 271  271  271  ASP ASP B . n 
D  4  272  ILE 272  272  272  ILE ILE B . n 
D  4  273  GLY 273  273  273  GLY GLY B . n 
D  4  274  GLU 274  274  274  GLU GLU B . n 
D  4  275  GLY 275  275  275  GLY GLY B . n 
D  4  276  ASP 276  276  276  ASP ASP B . n 
D  4  277  GLU 277  277  277  GLU GLU B . n 
D  4  278  PRO 278  278  278  PRO PRO B . n 
D  4  279  THR 279  279  279  THR THR B . n 
D  4  280  VAL 280  280  280  VAL VAL B . n 
D  4  281  ASP 281  281  281  ASP ASP B . n 
D  4  282  GLY 282  282  282  GLY GLY B . n 
D  4  283  GLY 283  283  283  GLY GLY B . n 
D  4  284  PHE 284  284  284  PHE PHE B . n 
D  4  285  VAL 285  285  285  VAL VAL B . n 
D  4  286  ASN 286  286  286  ASN ASN B . n 
D  4  287  TYR 287  287  287  TYR TYR B . n 
D  4  288  GLY 288  288  288  GLY GLY B . n 
D  4  289  GLU 289  289  289  GLU GLU B . n 
D  4  290  VAL 290  290  290  VAL VAL B . n 
D  4  291  ASP 291  291  291  ASP ASP B . n 
D  4  292  GLY 292  292  292  GLY GLY B . n 
D  4  293  PRO 293  293  293  PRO PRO B . n 
D  4  294  TYR 294  294  294  TYR TYR B . n 
D  4  295  THR 295  295  295  THR THR B . n 
D  4  296  LEU 296  296  296  LEU LEU B . n 
D  4  297  VAL 297  297  297  VAL VAL B . n 
D  4  298  LYS 298  298  298  LYS LYS B . n 
D  4  299  GLY 299  299  299  GLY GLY B . n 
D  4  300  SER 300  300  300  SER SER B . n 
D  4  301  VAL 301  301  301  VAL VAL B . n 
D  4  302  PRO 302  302  302  PRO PRO B . n 
D  4  303  GLY 303  303  303  GLY GLY B . n 
D  4  304  PRO 304  304  304  PRO PRO B . n 
D  4  305  ASP 305  305  305  ASP ASP B . n 
D  4  306  LYS 306  306  306  LYS LYS B . n 
D  4  307  ARG 307  307  307  ARG ARG B . n 
D  4  308  LEU 308  308  308  LEU LEU B . n 
D  4  309  VAL 309  309  309  VAL VAL B . n 
D  4  310  ARG 310  310  310  ARG ARG B . n 
D  4  311  PHE 311  311  311  PHE PHE B . n 
D  4  312  ARG 312  312  312  ARG ARG B . n 
D  4  313  PRO 313  313  313  PRO PRO B . n 
D  4  314  ALA 314  314  314  ALA ALA B . n 
D  4  315  VAL 315  315  315  VAL VAL B . n 
D  4  316  ARG 316  316  316  ARG ARG B . n 
D  4  317  PRO 317  317  317  PRO PRO B . n 
D  4  318  ASN 318  318  318  ASN ASN B . n 
D  4  319  ASP 319  319  319  ASP ASP B . n 
D  4  320  GLN 320  320  320  GLN GLN B . n 
D  4  321  PRO 321  321  321  PRO PRO B . n 
D  4  322  ARG 322  322  322  ARG ARG B . n 
D  4  323  LEU 323  323  323  LEU LEU B . n 
D  4  324  ASP 324  324  324  ASP ASP B . n 
D  4  325  PRO 325  325  325  PRO PRO B . n 
D  4  326  GLU 326  326  326  GLU GLU B . n 
D  4  327  VAL 327  327  327  VAL VAL B . n 
D  4  328  ARG 328  328  328  ARG ARG B . n 
D  4  329  TYR 329  329  329  TYR TYR B . n 
D  4  330  VAL 330  330  330  VAL VAL B . n 
D  4  331  SER 331  331  331  SER SER B . n 
D  4  332  ASN 332  332  332  ASN ASN B . n 
D  4  333  GLU 333  333  333  GLU GLU B . n 
D  4  334  SER 334  334  334  SER SER B . n 
D  4  335  ASN 335  335  335  ASN ASN B . n 
D  4  336  GLN 336  336  336  GLN GLN B . n 
D  4  337  GLY 337  337  337  GLY GLY B . n 
E  5  1    MET 1    1    1    MET MET C . n 
E  5  2    GLN 2    2    2    GLN GLN C . n 
E  5  3    ALA 3    3    3    ALA ALA C . n 
E  5  4    THR 4    4    4    THR THR C . n 
E  5  5    ILE 5    5    5    ILE ILE C . n 
E  5  6    TYR 6    6    6    TYR TYR C . n 
E  5  7    ASP 7    7    7    ASP ASP C . n 
E  5  8    LEU 8    8    8    LEU LEU C . n 
E  5  9    ASP 9    9    9    ASP ASP C . n 
E  5  10   GLY 10   10   10   GLY GLY C . n 
E  5  11   ASN 11   11   11   ASN ASN C . n 
E  5  12   THR 12   12   12   THR THR C . n 
E  5  13   ASP 13   13   13   ASP ASP C . n 
E  5  14   GLY 14   14   14   GLY GLY C . n 
E  5  15   GLU 15   15   15   GLU GLU C . n 
E  5  16   VAL 16   16   16   VAL VAL C . n 
E  5  17   ASP 17   17   17   ASP ASP C . n 
E  5  18   LEU 18   18   18   LEU LEU C . n 
E  5  19   PRO 19   19   19   PRO PRO C . n 
E  5  20   ASP 20   20   20   ASP ASP C . n 
E  5  21   VAL 21   21   21   VAL VAL C . n 
E  5  22   PHE 22   22   22   PHE PHE C . n 
E  5  23   GLU 23   23   23   GLU GLU C . n 
E  5  24   THR 24   24   24   THR THR C . n 
E  5  25   PRO 25   25   25   PRO PRO C . n 
E  5  26   VAL 26   26   26   VAL VAL C . n 
E  5  27   ARG 27   27   27   ARG ARG C . n 
E  5  28   SER 28   28   28   SER SER C . n 
E  5  29   ASP 29   29   29   ASP ASP C . n 
E  5  30   LEU 30   30   30   LEU LEU C . n 
E  5  31   ILE 31   31   31   ILE ILE C . n 
E  5  32   GLY 32   32   32   GLY GLY C . n 
E  5  33   LYS 33   33   33   LYS LYS C . n 
E  5  34   ALA 34   34   34   ALA ALA C . n 
E  5  35   VAL 35   35   35   VAL VAL C . n 
E  5  36   ARG 36   36   36   ARG ARG C . n 
E  5  37   ALA 37   37   37   ALA ALA C . n 
E  5  38   ALA 38   38   38   ALA ALA C . n 
E  5  39   GLN 39   39   39   GLN GLN C . n 
E  5  40   ALA 40   40   40   ALA ALA C . n 
E  5  41   ASN 41   41   41   ASN ASN C . n 
E  5  42   ARG 42   42   42   ARG ARG C . n 
E  5  43   LYS 43   43   43   LYS LYS C . n 
E  5  44   GLN 44   44   44   GLN GLN C . n 
E  5  45   ASP 45   45   45   ASP ASP C . n 
E  5  46   TYR 46   46   46   TYR TYR C . n 
E  5  47   GLY 47   47   47   GLY GLY C . n 
E  5  48   SER 48   48   48   SER SER C . n 
E  5  49   ASP 49   49   49   ASP ASP C . n 
E  5  50   GLU 50   50   50   GLU GLU C . n 
E  5  51   TYR 51   51   51   TYR TYR C . n 
E  5  52   ALA 52   52   52   ALA ALA C . n 
E  5  53   GLY 53   53   53   GLY GLY C . n 
E  5  54   LEU 54   54   54   LEU LEU C . n 
E  5  55   ARG 55   55   55   ARG ARG C . n 
E  5  56   THR 56   56   56   THR THR C . n 
E  5  57   PRO 57   57   57   PRO PRO C . n 
E  5  58   ALA 58   58   58   ALA ALA C . n 
E  5  59   GLU 59   59   59   GLU GLU C . n 
E  5  60   SER 60   60   60   SER SER C . n 
E  5  61   PHE 61   61   61   PHE PHE C . n 
E  5  62   GLY 62   62   62   GLY GLY C . n 
E  5  63   SER 63   63   63   SER SER C . n 
E  5  64   GLY 64   64   64   GLY GLY C . n 
E  5  65   ARG 65   65   65   ARG ARG C . n 
E  5  66   GLY 66   66   66   GLY GLY C . n 
E  5  67   GLN 67   67   67   GLN GLN C . n 
E  5  68   ALA 68   68   68   ALA ALA C . n 
E  5  69   HIS 69   69   69   HIS HIS C . n 
E  5  70   VAL 70   70   70   VAL VAL C . n 
E  5  71   PRO 71   71   71   PRO PRO C . n 
E  5  72   LYS 72   72   72   LYS LYS C . n 
E  5  73   LEU 73   73   73   LEU LEU C . n 
E  5  74   ASP 74   74   74   ASP ASP C . n 
E  5  75   GLY 75   75   75   GLY GLY C . n 
E  5  76   ARG 76   76   76   ARG ARG C . n 
E  5  77   ALA 77   77   77   ALA ALA C . n 
E  5  78   ARG 78   78   78   ARG ARG C . n 
E  5  79   ARG 79   79   79   ARG ARG C . n 
E  5  80   VAL 80   80   80   VAL VAL C . n 
E  5  81   PRO 81   81   81   PRO PRO C . n 
E  5  82   GLN 82   82   82   GLN GLN C . n 
E  5  83   ALA 83   83   83   ALA ALA C . n 
E  5  84   VAL 84   84   84   VAL VAL C . n 
E  5  85   LYS 85   85   85   LYS LYS C . n 
E  5  86   GLY 86   86   86   GLY GLY C . n 
E  5  87   ARG 87   87   87   ARG ARG C . n 
E  5  88   SER 88   88   88   SER SER C . n 
E  5  89   ALA 89   89   89   ALA ALA C . n 
E  5  90   HIS 90   90   90   HIS HIS C . n 
E  5  91   PRO 91   91   91   PRO PRO C . n 
E  5  92   PRO 92   92   92   PRO PRO C . n 
E  5  93   LYS 93   93   93   LYS LYS C . n 
E  5  94   THR 94   94   94   THR THR C . n 
E  5  95   GLU 95   95   95   GLU GLU C . n 
E  5  96   LYS 96   96   96   LYS LYS C . n 
E  5  97   ASP 97   97   97   ASP ASP C . n 
E  5  98   ARG 98   98   98   ARG ARG C . n 
E  5  99   SER 99   99   99   SER SER C . n 
E  5  100  LEU 100  100  100  LEU LEU C . n 
E  5  101  ASP 101  101  101  ASP ASP C . n 
E  5  102  LEU 102  102  102  LEU LEU C . n 
E  5  103  ASN 103  103  103  ASN ASN C . n 
E  5  104  ASP 104  104  104  ASP ASP C . n 
E  5  105  LYS 105  105  105  LYS LYS C . n 
E  5  106  GLU 106  106  106  GLU GLU C . n 
E  5  107  ARG 107  107  107  ARG ARG C . n 
E  5  108  GLN 108  108  108  GLN GLN C . n 
E  5  109  LEU 109  109  109  LEU LEU C . n 
E  5  110  ALA 110  110  110  ALA ALA C . n 
E  5  111  VAL 111  111  111  VAL VAL C . n 
E  5  112  ARG 112  112  112  ARG ARG C . n 
E  5  113  SER 113  113  113  SER SER C . n 
E  5  114  ALA 114  114  114  ALA ALA C . n 
E  5  115  LEU 115  115  115  LEU LEU C . n 
E  5  116  ALA 116  116  116  ALA ALA C . n 
E  5  117  ALA 117  117  117  ALA ALA C . n 
E  5  118  THR 118  118  118  THR THR C . n 
E  5  119  ALA 119  119  119  ALA ALA C . n 
E  5  120  ASP 120  120  120  ASP ASP C . n 
E  5  121  ALA 121  121  121  ALA ALA C . n 
E  5  122  ASP 122  122  122  ASP ASP C . n 
E  5  123  LEU 123  123  123  LEU LEU C . n 
E  5  124  VAL 124  124  124  VAL VAL C . n 
E  5  125  ALA 125  125  125  ALA ALA C . n 
E  5  126  ASP 126  126  126  ASP ASP C . n 
E  5  127  ARG 127  127  127  ARG ARG C . n 
E  5  128  GLY 128  128  128  GLY GLY C . n 
E  5  129  HIS 129  129  129  HIS HIS C . n 
E  5  130  GLU 130  130  130  GLU GLU C . n 
E  5  131  PHE 131  131  131  PHE PHE C . n 
E  5  132  ASP 132  132  132  ASP ASP C . n 
E  5  133  ARG 133  133  133  ARG ARG C . n 
E  5  134  ASP 134  134  134  ASP ASP C . n 
E  5  135  GLU 135  135  135  GLU GLU C . n 
E  5  136  VAL 136  136  136  VAL VAL C . n 
E  5  137  PRO 137  137  137  PRO PRO C . n 
E  5  138  VAL 138  138  138  VAL VAL C . n 
E  5  139  VAL 139  139  139  VAL VAL C . n 
E  5  140  VAL 140  140  140  VAL VAL C . n 
E  5  141  SER 141  141  141  SER SER C . n 
E  5  142  ASP 142  142  142  ASP ASP C . n 
E  5  143  ASP 143  143  143  ASP ASP C . n 
E  5  144  PHE 144  144  144  PHE PHE C . n 
E  5  145  GLU 145  145  145  GLU GLU C . n 
E  5  146  ASP 146  146  146  ASP ASP C . n 
E  5  147  LEU 147  147  147  LEU LEU C . n 
E  5  148  VAL 148  148  148  VAL VAL C . n 
E  5  149  LYS 149  149  149  LYS LYS C . n 
E  5  150  THR 150  150  150  THR THR C . n 
E  5  151  GLN 151  151  151  GLN GLN C . n 
E  5  152  GLU 152  152  152  GLU GLU C . n 
E  5  153  VAL 153  153  153  VAL VAL C . n 
E  5  154  VAL 154  154  154  VAL VAL C . n 
E  5  155  SER 155  155  155  SER SER C . n 
E  5  156  LEU 156  156  156  LEU LEU C . n 
E  5  157  LEU 157  157  157  LEU LEU C . n 
E  5  158  GLU 158  158  158  GLU GLU C . n 
E  5  159  ALA 159  159  159  ALA ALA C . n 
E  5  160  LEU 160  160  160  LEU LEU C . n 
E  5  161  ASP 161  161  161  ASP ASP C . n 
E  5  162  VAL 162  162  162  VAL VAL C . n 
E  5  163  HIS 163  163  163  HIS HIS C . n 
E  5  164  ALA 164  164  164  ALA ALA C . n 
E  5  165  ASP 165  165  165  ASP ASP C . n 
E  5  166  ILE 166  166  166  ILE ILE C . n 
E  5  167  ASP 167  167  167  ASP ASP C . n 
E  5  168  ARG 168  168  168  ARG ARG C . n 
E  5  169  ALA 169  169  169  ALA ALA C . n 
E  5  170  ASP 170  170  170  ASP ASP C . n 
E  5  171  GLU 171  171  171  GLU GLU C . n 
E  5  172  THR 172  172  172  THR THR C . n 
E  5  173  LYS 173  173  173  LYS LYS C . n 
E  5  174  ILE 174  174  174  ILE ILE C . n 
E  5  175  LYS 175  175  175  LYS LYS C . n 
E  5  176  ALA 176  176  176  ALA ALA C . n 
E  5  177  GLY 177  177  177  GLY GLY C . n 
E  5  178  GLN 178  178  178  GLN GLN C . n 
E  5  179  GLY 179  179  179  GLY GLY C . n 
E  5  180  SER 180  180  180  SER SER C . n 
E  5  181  ALA 181  181  181  ALA ALA C . n 
E  5  182  ARG 182  182  182  ARG ARG C . n 
E  5  183  GLY 183  183  183  GLY GLY C . n 
E  5  184  ARG 184  184  184  ARG ARG C . n 
E  5  185  LYS 185  185  185  LYS LYS C . n 
E  5  186  TYR 186  186  186  TYR TYR C . n 
E  5  187  ARG 187  187  187  ARG ARG C . n 
E  5  188  ARG 188  188  188  ARG ARG C . n 
E  5  189  PRO 189  189  189  PRO PRO C . n 
E  5  190  ALA 190  190  190  ALA ALA C . n 
E  5  191  SER 191  191  191  SER SER C . n 
E  5  192  ILE 192  192  192  ILE ILE C . n 
E  5  193  LEU 193  193  193  LEU LEU C . n 
E  5  194  PHE 194  194  194  PHE PHE C . n 
E  5  195  VAL 195  195  195  VAL VAL C . n 
E  5  196  THR 196  196  196  THR THR C . n 
E  5  197  SER 197  197  197  SER SER C . n 
E  5  198  ASP 198  198  198  ASP ASP C . n 
E  5  199  GLU 199  199  199  GLU GLU C . n 
E  5  200  PRO 200  200  200  PRO PRO C . n 
E  5  201  SER 201  201  201  SER SER C . n 
E  5  202  THR 202  202  202  THR THR C . n 
E  5  203  ALA 203  203  203  ALA ALA C . n 
E  5  204  ALA 204  204  204  ALA ALA C . n 
E  5  205  ARG 205  205  205  ARG ARG C . n 
E  5  206  ASN 206  206  206  ASN ASN C . n 
E  5  207  LEU 207  207  207  LEU LEU C . n 
E  5  208  ALA 208  208  208  ALA ALA C . n 
E  5  209  GLY 209  209  209  GLY GLY C . n 
E  5  210  ALA 210  210  210  ALA ALA C . n 
E  5  211  ASP 211  211  211  ASP ASP C . n 
E  5  212  VAL 212  212  212  VAL VAL C . n 
E  5  213  ALA 213  213  213  ALA ALA C . n 
E  5  214  THR 214  214  214  THR THR C . n 
E  5  215  ALA 215  215  215  ALA ALA C . n 
E  5  216  SER 216  216  216  SER SER C . n 
E  5  217  GLU 217  217  217  GLU GLU C . n 
E  5  218  VAL 218  218  218  VAL VAL C . n 
E  5  219  ASN 219  219  219  ASN ASN C . n 
E  5  220  THR 220  220  220  THR THR C . n 
E  5  221  GLU 221  221  221  GLU GLU C . n 
E  5  222  ASP 222  222  222  ASP ASP C . n 
E  5  223  LEU 223  223  223  LEU LEU C . n 
E  5  224  ALA 224  224  224  ALA ALA C . n 
E  5  225  PRO 225  225  225  PRO PRO C . n 
E  5  226  GLY 226  226  226  GLY GLY C . n 
E  5  227  GLY 227  227  227  GLY GLY C . n 
E  5  228  ALA 228  228  228  ALA ALA C . n 
E  5  229  PRO 229  229  229  PRO PRO C . n 
E  5  230  GLY 230  230  230  GLY GLY C . n 
E  5  231  ARG 231  231  231  ARG ARG C . n 
E  5  232  LEU 232  232  232  LEU LEU C . n 
E  5  233  THR 233  233  233  THR THR C . n 
E  5  234  VAL 234  234  234  VAL VAL C . n 
E  5  235  PHE 235  235  235  PHE PHE C . n 
E  5  236  THR 236  236  236  THR THR C . n 
E  5  237  GLU 237  237  237  GLU GLU C . n 
E  5  238  SER 238  238  238  SER SER C . n 
E  5  239  ALA 239  239  239  ALA ALA C . n 
E  5  240  LEU 240  240  240  LEU LEU C . n 
E  5  241  ALA 241  241  241  ALA ALA C . n 
E  5  242  GLU 242  242  242  GLU GLU C . n 
E  5  243  VAL 243  243  243  VAL VAL C . n 
E  5  244  ALA 244  244  244  ALA ALA C . n 
E  5  245  GLU 245  245  245  GLU GLU C . n 
E  5  246  ARG 246  246  246  ARG ARG C . n 
F  6  1    SER 1    1    ?    ?   ?   D . n 
F  6  2    SER 2    2    ?    ?   ?   D . n 
F  6  3    GLU 3    3    ?    ?   ?   D . n 
F  6  4    SER 4    4    ?    ?   ?   D . n 
F  6  5    GLU 5    5    ?    ?   ?   D . n 
F  6  6    SER 6    6    ?    ?   ?   D . n 
F  6  7    GLY 7    7    ?    ?   ?   D . n 
F  6  8    GLY 8    8    ?    ?   ?   D . n 
F  6  9    ASP 9    9    ?    ?   ?   D . n 
F  6  10   PHE 10   10   10   PHE PHE D . n 
F  6  11   HIS 11   11   11   HIS HIS D . n 
F  6  12   GLU 12   12   12   GLU GLU D . n 
F  6  13   MET 13   13   13   MET MET D . n 
F  6  14   ARG 14   14   14   ARG ARG D . n 
F  6  15   GLU 15   15   15   GLU GLU D . n 
F  6  16   PRO 16   16   16   PRO PRO D . n 
F  6  17   ARG 17   17   17   ARG ARG D . n 
F  6  18   ILE 18   18   18   ILE ILE D . n 
F  6  19   GLU 19   19   19   GLU GLU D . n 
F  6  20   LYS 20   20   20   LYS LYS D . n 
F  6  21   VAL 21   21   21   VAL VAL D . n 
F  6  22   VAL 22   22   22   VAL VAL D . n 
F  6  23   VAL 23   23   23   VAL VAL D . n 
F  6  24   HIS 24   24   24   HIS HIS D . n 
F  6  25   MET 25   25   25   MET MET D . n 
F  6  26   GLY 26   26   26   GLY GLY D . n 
F  6  27   ILE 27   27   27   ILE ILE D . n 
F  6  28   GLY 28   28   28   GLY GLY D . n 
F  6  29   HIS 29   29   29   HIS HIS D . n 
F  6  30   GLY 30   30   ?    ?   ?   D . n 
F  6  31   GLY 31   31   ?    ?   ?   D . n 
F  6  32   ARG 32   32   ?    ?   ?   D . n 
F  6  33   ASP 33   33   ?    ?   ?   D . n 
F  6  34   LEU 34   34   ?    ?   ?   D . n 
F  6  35   ALA 35   35   35   ALA ALA D . n 
F  6  36   ASN 36   36   36   ASN ASN D . n 
F  6  37   ALA 37   37   37   ALA ALA D . n 
F  6  38   GLU 38   38   38   GLU GLU D . n 
F  6  39   ASP 39   39   39   ASP ASP D . n 
F  6  40   ILE 40   40   40   ILE ILE D . n 
F  6  41   LEU 41   41   41   LEU LEU D . n 
F  6  42   GLY 42   42   42   GLY GLY D . n 
F  6  43   GLU 43   43   43   GLU GLU D . n 
F  6  44   ILE 44   44   44   ILE ILE D . n 
F  6  45   THR 45   45   45   THR THR D . n 
F  6  46   GLY 46   46   46   GLY GLY D . n 
F  6  47   GLN 47   47   47   GLN GLN D . n 
F  6  48   MET 48   48   48   MET MET D . n 
F  6  49   PRO 49   49   49   PRO PRO D . n 
F  6  50   VAL 50   50   50   VAL VAL D . n 
F  6  51   ARG 51   51   51   ARG ARG D . n 
F  6  52   THR 52   52   52   THR THR D . n 
F  6  53   LYS 53   53   53   LYS LYS D . n 
F  6  54   ALA 54   54   54   ALA ALA D . n 
F  6  55   LYS 55   55   55   LYS LYS D . n 
F  6  56   ARG 56   56   56   ARG ARG D . n 
F  6  57   THR 57   57   57   THR THR D . n 
F  6  58   VAL 58   58   58   VAL VAL D . n 
F  6  59   GLY 59   59   59   GLY GLY D . n 
F  6  60   GLU 60   60   60   GLU GLU D . n 
F  6  61   PHE 61   61   61   PHE PHE D . n 
F  6  62   ASP 62   62   62   ASP ASP D . n 
F  6  63   ILE 63   63   63   ILE ILE D . n 
F  6  64   ARG 64   64   64   ARG ARG D . n 
F  6  65   GLU 65   65   65   GLU GLU D . n 
F  6  66   GLY 66   66   66   GLY GLY D . n 
F  6  67   ASP 67   67   67   ASP ASP D . n 
F  6  68   PRO 68   68   68   PRO PRO D . n 
F  6  69   ILE 69   69   69   ILE ILE D . n 
F  6  70   GLY 70   70   70   GLY GLY D . n 
F  6  71   ALA 71   71   71   ALA ALA D . n 
F  6  72   LYS 72   72   72   LYS LYS D . n 
F  6  73   VAL 73   73   73   VAL VAL D . n 
F  6  74   THR 74   74   74   THR THR D . n 
F  6  75   LEU 75   75   75   LEU LEU D . n 
F  6  76   ARG 76   76   76   ARG ARG D . n 
F  6  77   ASP 77   77   77   ASP ASP D . n 
F  6  78   GLU 78   78   78   GLU GLU D . n 
F  6  79   MET 79   79   79   MET MET D . n 
F  6  80   ALA 80   80   80   ALA ALA D . n 
F  6  81   GLU 81   81   81   GLU GLU D . n 
F  6  82   GLU 82   82   82   GLU GLU D . n 
F  6  83   PHE 83   83   83   PHE PHE D . n 
F  6  84   LEU 84   84   84   LEU LEU D . n 
F  6  85   GLN 85   85   85   GLN GLN D . n 
F  6  86   THR 86   86   86   THR THR D . n 
F  6  87   ALA 87   87   87   ALA ALA D . n 
F  6  88   LEU 88   88   88   LEU LEU D . n 
F  6  89   PRO 89   89   89   PRO PRO D . n 
F  6  90   LEU 90   90   90   LEU LEU D . n 
F  6  91   ALA 91   91   91   ALA ALA D . n 
F  6  92   GLU 92   92   92   GLU GLU D . n 
F  6  93   LEU 93   93   93   LEU LEU D . n 
F  6  94   ALA 94   94   94   ALA ALA D . n 
F  6  95   THR 95   95   95   THR THR D . n 
F  6  96   SER 96   96   96   SER SER D . n 
F  6  97   GLN 97   97   97   GLN GLN D . n 
F  6  98   PHE 98   98   98   PHE PHE D . n 
F  6  99   ASP 99   99   99   ASP ASP D . n 
F  6  100  ASP 100  100  100  ASP ASP D . n 
F  6  101  THR 101  101  101  THR THR D . n 
F  6  102  GLY 102  102  102  GLY GLY D . n 
F  6  103  ASN 103  103  103  ASN ASN D . n 
F  6  104  PHE 104  104  104  PHE PHE D . n 
F  6  105  SER 105  105  105  SER SER D . n 
F  6  106  PHE 106  106  106  PHE PHE D . n 
F  6  107  GLY 107  107  107  GLY GLY D . n 
F  6  108  VAL 108  108  ?    ?   ?   D . n 
F  6  109  GLU 109  109  ?    ?   ?   D . n 
F  6  110  GLU 110  110  ?    ?   ?   D . n 
F  6  111  HIS 111  111  ?    ?   ?   D . n 
F  6  112  THR 112  112  ?    ?   ?   D . n 
F  6  113  GLU 113  113  ?    ?   ?   D . n 
F  6  114  PHE 114  114  ?    ?   ?   D . n 
F  6  115  PRO 115  115  ?    ?   ?   D . n 
F  6  116  SER 116  116  ?    ?   ?   D . n 
F  6  117  GLN 117  117  ?    ?   ?   D . n 
F  6  118  GLU 118  118  ?    ?   ?   D . n 
F  6  119  TYR 119  119  ?    ?   ?   D . n 
F  6  120  ASP 120  120  ?    ?   ?   D . n 
F  6  121  PRO 121  121  ?    ?   ?   D . n 
F  6  122  SER 122  122  ?    ?   ?   D . n 
F  6  123  ILE 123  123  ?    ?   ?   D . n 
F  6  124  GLY 124  124  ?    ?   ?   D . n 
F  6  125  ILE 125  125  ?    ?   ?   D . n 
F  6  126  TYR 126  126  ?    ?   ?   D . n 
F  6  127  GLY 127  127  ?    ?   ?   D . n 
F  6  128  LEU 128  128  128  LEU LEU D . n 
F  6  129  ASP 129  129  129  ASP ASP D . n 
F  6  130  VAL 130  130  130  VAL VAL D . n 
F  6  131  THR 131  131  131  THR THR D . n 
F  6  132  VAL 132  132  132  VAL VAL D . n 
F  6  133  ASN 133  133  133  ASN ASN D . n 
F  6  134  LEU 134  134  134  LEU LEU D . n 
F  6  135  VAL 135  135  135  VAL VAL D . n 
F  6  136  ARG 136  136  136  ARG ARG D . n 
F  6  137  PRO 137  137  137  PRO PRO D . n 
F  6  138  GLY 138  138  138  GLY GLY D . n 
F  6  139  TYR 139  139  139  TYR TYR D . n 
F  6  140  ARG 140  140  140  ARG ARG D . n 
F  6  141  VAL 141  141  141  VAL VAL D . n 
F  6  142  ALA 142  142  142  ALA ALA D . n 
F  6  143  LYS 143  143  143  LYS LYS D . n 
F  6  144  ARG 144  144  144  ARG ARG D . n 
F  6  145  ASP 145  145  145  ASP ASP D . n 
F  6  146  LYS 146  146  146  LYS LYS D . n 
F  6  147  ALA 147  147  147  ALA ALA D . n 
F  6  148  SER 148  148  148  SER SER D . n 
F  6  149  ARG 149  149  149  ARG ARG D . n 
F  6  150  SER 150  150  150  SER SER D . n 
F  6  151  ILE 151  151  151  ILE ILE D . n 
F  6  152  PRO 152  152  152  PRO PRO D . n 
F  6  153  THR 153  153  153  THR THR D . n 
F  6  154  LYS 154  154  154  LYS LYS D . n 
F  6  155  HIS 155  155  155  HIS HIS D . n 
F  6  156  ARG 156  156  156  ARG ARG D . n 
F  6  157  LEU 157  157  157  LEU LEU D . n 
F  6  158  ASN 158  158  158  ASN ASN D . n 
F  6  159  PRO 159  159  159  PRO PRO D . n 
F  6  160  ALA 160  160  160  ALA ALA D . n 
F  6  161  ASP 161  161  161  ASP ASP D . n 
F  6  162  ALA 162  162  162  ALA ALA D . n 
F  6  163  VAL 163  163  163  VAL VAL D . n 
F  6  164  ALA 164  164  164  ALA ALA D . n 
F  6  165  PHE 165  165  165  PHE PHE D . n 
F  6  166  ILE 166  166  166  ILE ILE D . n 
F  6  167  GLU 167  167  167  GLU GLU D . n 
F  6  168  SER 168  168  168  SER SER D . n 
F  6  169  THR 169  169  169  THR THR D . n 
F  6  170  TYR 170  170  170  TYR TYR D . n 
F  6  171  ASP 171  171  171  ASP ASP D . n 
F  6  172  VAL 172  172  172  VAL VAL D . n 
F  6  173  GLU 173  173  173  GLU GLU D . n 
F  6  174  VAL 174  174  174  VAL VAL D . n 
F  6  175  SER 175  175  ?    ?   ?   D . n 
F  6  176  GLU 176  176  ?    ?   ?   D . n 
G  7  1    PRO 1    1    1    PRO PRO E . n 
G  7  2    ARG 2    2    2    ARG ARG E . n 
G  7  3    VAL 3    3    3    VAL VAL E . n 
G  7  4    GLU 4    4    4    GLU GLU E . n 
G  7  5    LEU 5    5    5    LEU LEU E . n 
G  7  6    GLU 6    6    6    GLU GLU E . n 
G  7  7    ILE 7    7    7    ILE ILE E . n 
G  7  8    PRO 8    8    8    PRO PRO E . n 
G  7  9    GLU 9    9    9    GLU GLU E . n 
G  7  10   ASP 10   10   10   ASP ASP E . n 
G  7  11   VAL 11   11   11   VAL VAL E . n 
G  7  12   ASP 12   12   12   ASP ASP E . n 
G  7  13   ALA 13   13   13   ALA ALA E . n 
G  7  14   GLU 14   14   14   GLU GLU E . n 
G  7  15   GLN 15   15   15   GLN GLN E . n 
G  7  16   ASP 16   16   16   ASP ASP E . n 
G  7  17   HIS 17   17   17   HIS HIS E . n 
G  7  18   LEU 18   18   18   LEU LEU E . n 
G  7  19   ASP 19   19   19   ASP ASP E . n 
G  7  20   ILE 20   20   20   ILE ILE E . n 
G  7  21   THR 21   21   21   THR THR E . n 
G  7  22   VAL 22   22   22   VAL VAL E . n 
G  7  23   GLU 23   23   23   GLU GLU E . n 
G  7  24   GLY 24   24   24   GLY GLY E . n 
G  7  25   ASP 25   25   25   ASP ASP E . n 
G  7  26   ASN 26   26   26   ASN ASN E . n 
G  7  27   GLY 27   27   27   GLY GLY E . n 
G  7  28   SER 28   28   28   SER SER E . n 
G  7  29   VAL 29   29   29   VAL VAL E . n 
G  7  30   THR 30   30   30   THR THR E . n 
G  7  31   ARG 31   31   31   ARG ARG E . n 
G  7  32   ARG 32   32   32   ARG ARG E . n 
G  7  33   LEU 33   33   33   LEU LEU E . n 
G  7  34   TRP 34   34   34   TRP TRP E . n 
G  7  35   TYR 35   35   35   TYR TYR E . n 
G  7  36   PRO 36   36   36   PRO PRO E . n 
G  7  37   ASP 37   37   37   ASP ASP E . n 
G  7  38   ILE 38   38   38   ILE ILE E . n 
G  7  39   ASP 39   39   39   ASP ASP E . n 
G  7  40   VAL 40   40   40   VAL VAL E . n 
G  7  41   SER 41   41   41   SER SER E . n 
G  7  42   VAL 42   42   42   VAL VAL E . n 
G  7  43   ASP 43   43   43   ASP ASP E . n 
G  7  44   GLY 44   44   44   GLY GLY E . n 
G  7  45   ASP 45   45   45   ASP ASP E . n 
G  7  46   THR 46   46   46   THR THR E . n 
G  7  47   VAL 47   47   47   VAL VAL E . n 
G  7  48   VAL 48   48   48   VAL VAL E . n 
G  7  49   ILE 49   49   49   ILE ILE E . n 
G  7  50   GLU 50   50   50   GLU GLU E . n 
G  7  51   SER 51   51   51   SER SER E . n 
G  7  52   ASP 52   52   52   ASP ASP E . n 
G  7  53   GLU 53   53   53   GLU GLU E . n 
G  7  54   ASP 54   54   54   ASP ASP E . n 
G  7  55   ASN 55   55   55   ASN ASN E . n 
G  7  56   ALA 56   56   56   ALA ALA E . n 
G  7  57   LYS 57   57   57   LYS LYS E . n 
G  7  58   THR 58   58   58   THR THR E . n 
G  7  59   MET 59   59   59   MET MET E . n 
G  7  60   SER 60   60   60   SER SER E . n 
G  7  61   THR 61   61   61   THR THR E . n 
G  7  62   ILE 62   62   62   ILE ILE E . n 
G  7  63   GLY 63   63   63   GLY GLY E . n 
G  7  64   THR 64   64   64   THR THR E . n 
G  7  65   PHE 65   65   65   PHE PHE E . n 
G  7  66   GLN 66   66   66   GLN GLN E . n 
G  7  67   SER 67   67   67   SER SER E . n 
G  7  68   HIS 68   68   68   HIS HIS E . n 
G  7  69   ILE 69   69   69   ILE ILE E . n 
G  7  70   GLU 70   70   70   GLU GLU E . n 
G  7  71   ASN 71   71   71   ASN ASN E . n 
G  7  72   MET 72   72   72   MET MET E . n 
G  7  73   PHE 73   73   73   PHE PHE E . n 
G  7  74   HIS 74   74   74   HIS HIS E . n 
G  7  75   GLY 75   75   75   GLY GLY E . n 
G  7  76   VAL 76   76   76   VAL VAL E . n 
G  7  77   THR 77   77   77   THR THR E . n 
G  7  78   GLU 78   78   78   GLU GLU E . n 
G  7  79   GLY 79   79   79   GLY GLY E . n 
G  7  80   TRP 80   80   80   TRP TRP E . n 
G  7  81   GLU 81   81   81   GLU GLU E . n 
G  7  82   TYR 82   82   82   TYR TYR E . n 
G  7  83   GLY 83   83   83   GLY GLY E . n 
G  7  84   MET 84   84   84   MET MET E . n 
G  7  85   GLU 85   85   85   GLU GLU E . n 
G  7  86   VAL 86   86   86   VAL VAL E . n 
G  7  87   PHE 87   87   87   PHE PHE E . n 
G  7  88   TYR 88   88   88   TYR TYR E . n 
G  7  89   SER 89   89   89   SER SER E . n 
G  7  90   HIS 90   90   90   HIS HIS E . n 
G  7  91   PHE 91   91   91   PHE PHE E . n 
G  7  92   PRO 92   92   92   PRO PRO E . n 
G  7  93   MET 93   93   93   MET MET E . n 
G  7  94   GLN 94   94   94   GLN GLN E . n 
G  7  95   VAL 95   95   95   VAL VAL E . n 
G  7  96   ASN 96   96   96   ASN ASN E . n 
G  7  97   VAL 97   97   97   VAL VAL E . n 
G  7  98   GLU 98   98   98   GLU GLU E . n 
G  7  99   GLY 99   99   99   GLY GLY E . n 
G  7  100  ASP 100  100  100  ASP ASP E . n 
G  7  101  GLU 101  101  101  GLU GLU E . n 
G  7  102  VAL 102  102  102  VAL VAL E . n 
G  7  103  VAL 103  103  103  VAL VAL E . n 
G  7  104  ILE 104  104  104  ILE ILE E . n 
G  7  105  GLU 105  105  105  GLU GLU E . n 
G  7  106  ASN 106  106  106  ASN ASN E . n 
G  7  107  PHE 107  107  107  PHE PHE E . n 
G  7  108  LEU 108  108  108  LEU LEU E . n 
G  7  109  GLY 109  109  109  GLY GLY E . n 
G  7  110  GLU 110  110  110  GLU GLU E . n 
G  7  111  LYS 111  111  111  LYS LYS E . n 
G  7  112  ALA 112  112  112  ALA ALA E . n 
G  7  113  PRO 113  113  113  PRO PRO E . n 
G  7  114  ARG 114  114  114  ARG ARG E . n 
G  7  115  ARG 115  115  115  ARG ARG E . n 
G  7  116  THR 116  116  116  THR THR E . n 
G  7  117  THR 117  117  117  THR THR E . n 
G  7  118  ILE 118  118  118  ILE ILE E . n 
G  7  119  HIS 119  119  119  HIS HIS E . n 
G  7  120  GLY 120  120  120  GLY GLY E . n 
G  7  121  ASP 121  121  121  ASP ASP E . n 
G  7  122  THR 122  122  122  THR THR E . n 
G  7  123  ASP 123  123  123  ASP ASP E . n 
G  7  124  VAL 124  124  124  VAL VAL E . n 
G  7  125  GLU 125  125  125  GLU GLU E . n 
G  7  126  ILE 126  126  126  ILE ILE E . n 
G  7  127  ASP 127  127  127  ASP ASP E . n 
G  7  128  GLY 128  128  128  GLY GLY E . n 
G  7  129  GLU 129  129  129  GLU GLU E . n 
G  7  130  GLU 130  130  130  GLU GLU E . n 
G  7  131  LEU 131  131  131  LEU LEU E . n 
G  7  132  THR 132  132  132  THR THR E . n 
G  7  133  VAL 133  133  133  VAL VAL E . n 
G  7  134  SER 134  134  134  SER SER E . n 
G  7  135  GLY 135  135  135  GLY GLY E . n 
G  7  136  PRO 136  136  136  PRO PRO E . n 
G  7  137  ASP 137  137  137  ASP ASP E . n 
G  7  138  ILE 138  138  138  ILE ILE E . n 
G  7  139  GLU 139  139  139  GLU GLU E . n 
G  7  140  ALA 140  140  140  ALA ALA E . n 
G  7  141  VAL 141  141  141  VAL VAL E . n 
G  7  142  GLY 142  142  142  GLY GLY E . n 
G  7  143  GLN 143  143  143  GLN GLN E . n 
G  7  144  THR 144  144  144  THR THR E . n 
G  7  145  ALA 145  145  145  ALA ALA E . n 
G  7  146  ALA 146  146  146  ALA ALA E . n 
G  7  147  ASP 147  147  147  ASP ASP E . n 
G  7  148  ILE 148  148  148  ILE ILE E . n 
G  7  149  GLU 149  149  149  GLU GLU E . n 
G  7  150  GLN 150  150  150  GLN GLN E . n 
G  7  151  LEU 151  151  151  LEU LEU E . n 
G  7  152  THR 152  152  152  THR THR E . n 
G  7  153  ARG 153  153  153  ARG ARG E . n 
G  7  154  ILE 154  154  154  ILE ILE E . n 
G  7  155  ASN 155  155  155  ASN ASN E . n 
G  7  156  ASP 156  156  156  ASP ASP E . n 
G  7  157  LYS 157  157  157  LYS LYS E . n 
G  7  158  ASP 158  158  158  ASP ASP E . n 
G  7  159  VAL 159  159  159  VAL VAL E . n 
G  7  160  ARG 160  160  160  ARG ARG E . n 
G  7  161  VAL 161  161  161  VAL VAL E . n 
G  7  162  PHE 162  162  162  PHE PHE E . n 
G  7  163  GLN 163  163  163  GLN GLN E . n 
G  7  164  ASP 164  164  164  ASP ASP E . n 
G  7  165  GLY 165  165  165  GLY GLY E . n 
G  7  166  VAL 166  166  166  VAL VAL E . n 
G  7  167  TYR 167  167  167  TYR TYR E . n 
G  7  168  ILE 168  168  168  ILE ILE E . n 
G  7  169  THR 169  169  169  THR THR E . n 
G  7  170  ARG 170  170  170  ARG ARG E . n 
G  7  171  LYS 171  171  171  LYS LYS E . n 
G  7  172  PRO 172  172  172  PRO PRO E . n 
G  7  173  ASN 173  173  ?    ?   ?   E . n 
G  7  174  ARG 174  174  ?    ?   ?   E . n 
G  7  175  GLY 175  175  ?    ?   ?   E . n 
G  7  176  ASP 176  176  ?    ?   ?   E . n 
G  7  177  ALA 177  177  ?    ?   ?   E . n 
H  8  1    PRO 1    1    1    PRO PRO F . n 
H  8  2    VAL 2    2    2    VAL VAL F . n 
H  8  3    TYR 3    3    3    TYR TYR F . n 
H  8  4    VAL 4    4    4    VAL VAL F . n 
H  8  5    ASP 5    5    5    ASP ASP F . n 
H  8  6    PHE 6    6    6    PHE PHE F . n 
H  8  7    ASP 7    7    7    ASP ASP F . n 
H  8  8    VAL 8    8    8    VAL VAL F . n 
H  8  9    PRO 9    9    9    PRO PRO F . n 
H  8  10   ALA 10   10   10   ALA ALA F . n 
H  8  11   ASP 11   11   11   ASP ASP F . n 
H  8  12   LEU 12   12   12   LEU LEU F . n 
H  8  13   GLU 13   13   13   GLU GLU F . n 
H  8  14   ASP 14   14   14   ASP ASP F . n 
H  8  15   ASP 15   15   15   ASP ASP F . n 
H  8  16   ALA 16   16   16   ALA ALA F . n 
H  8  17   LEU 17   17   17   LEU LEU F . n 
H  8  18   GLU 18   18   18   GLU GLU F . n 
H  8  19   ALA 19   19   19   ALA ALA F . n 
H  8  20   LEU 20   20   20   LEU LEU F . n 
H  8  21   GLU 21   21   21   GLU GLU F . n 
H  8  22   VAL 22   22   22   VAL VAL F . n 
H  8  23   ALA 23   23   23   ALA ALA F . n 
H  8  24   ARG 24   24   24   ARG ARG F . n 
H  8  25   ASP 25   25   25   ASP ASP F . n 
H  8  26   THR 26   26   26   THR THR F . n 
H  8  27   GLY 27   27   27   GLY GLY F . n 
H  8  28   ALA 28   28   28   ALA ALA F . n 
H  8  29   VAL 29   29   29   VAL VAL F . n 
H  8  30   LYS 30   30   30   LYS LYS F . n 
H  8  31   LYS 31   31   31   LYS LYS F . n 
H  8  32   GLY 32   32   32   GLY GLY F . n 
H  8  33   THR 33   33   33   THR THR F . n 
H  8  34   ASN 34   34   34   ASN ASN F . n 
H  8  35   GLU 35   35   35   GLU GLU F . n 
H  8  36   THR 36   36   36   THR THR F . n 
H  8  37   THR 37   37   37   THR THR F . n 
H  8  38   LYS 38   38   38   LYS LYS F . n 
H  8  39   SER 39   39   39   SER SER F . n 
H  8  40   ILE 40   40   40   ILE ILE F . n 
H  8  41   GLU 41   41   41   GLU GLU F . n 
H  8  42   ARG 42   42   42   ARG ARG F . n 
H  8  43   GLY 43   43   43   GLY GLY F . n 
H  8  44   SER 44   44   44   SER SER F . n 
H  8  45   ALA 45   45   45   ALA ALA F . n 
H  8  46   GLU 46   46   46   GLU GLU F . n 
H  8  47   LEU 47   47   47   LEU LEU F . n 
H  8  48   VAL 48   48   48   VAL VAL F . n 
H  8  49   PHE 49   49   49   PHE PHE F . n 
H  8  50   VAL 50   50   50   VAL VAL F . n 
H  8  51   ALA 51   51   51   ALA ALA F . n 
H  8  52   GLU 52   52   52   GLU GLU F . n 
H  8  53   ASP 53   53   53   ASP ASP F . n 
H  8  54   VAL 54   54   54   VAL VAL F . n 
H  8  55   GLN 55   55   55   GLN GLN F . n 
H  8  56   PRO 56   56   56   PRO PRO F . n 
H  8  57   GLU 57   57   57   GLU GLU F . n 
H  8  58   GLU 58   58   58   GLU GLU F . n 
H  8  59   ILE 59   59   59   ILE ILE F . n 
H  8  60   VAL 60   60   60   VAL VAL F . n 
H  8  61   MET 61   61   61   MET MET F . n 
H  8  62   HIS 62   62   62   HIS HIS F . n 
H  8  63   ILE 63   63   63   ILE ILE F . n 
H  8  64   PRO 64   64   64   PRO PRO F . n 
H  8  65   GLU 65   65   65   GLU GLU F . n 
H  8  66   LEU 66   66   66   LEU LEU F . n 
H  8  67   ALA 67   67   67   ALA ALA F . n 
H  8  68   ASP 68   68   68   ASP ASP F . n 
H  8  69   GLU 69   69   69   GLU GLU F . n 
H  8  70   LYS 70   70   70   LYS LYS F . n 
H  8  71   GLY 71   71   71   GLY GLY F . n 
H  8  72   VAL 72   72   72   VAL VAL F . n 
H  8  73   PRO 73   73   73   PRO PRO F . n 
H  8  74   PHE 74   74   74   PHE PHE F . n 
H  8  75   ILE 75   75   75   ILE ILE F . n 
H  8  76   PHE 76   76   76   PHE PHE F . n 
H  8  77   VAL 77   77   77   VAL VAL F . n 
H  8  78   GLU 78   78   78   GLU GLU F . n 
H  8  79   GLN 79   79   79   GLN GLN F . n 
H  8  80   GLN 80   80   80   GLN GLN F . n 
H  8  81   ASP 81   81   81   ASP ASP F . n 
H  8  82   ASP 82   82   82   ASP ASP F . n 
H  8  83   LEU 83   83   83   LEU LEU F . n 
H  8  84   GLY 84   84   84   GLY GLY F . n 
H  8  85   HIS 85   85   85   HIS HIS F . n 
H  8  86   ALA 86   86   86   ALA ALA F . n 
H  8  87   ALA 87   87   87   ALA ALA F . n 
H  8  88   GLY 88   88   88   GLY GLY F . n 
H  8  89   LEU 89   89   89   LEU LEU F . n 
H  8  90   GLU 90   90   90   GLU GLU F . n 
H  8  91   VAL 91   91   91   VAL VAL F . n 
H  8  92   GLY 92   92   92   GLY GLY F . n 
H  8  93   SER 93   93   93   SER SER F . n 
H  8  94   ALA 94   94   94   ALA ALA F . n 
H  8  95   ALA 95   95   95   ALA ALA F . n 
H  8  96   ALA 96   96   96   ALA ALA F . n 
H  8  97   ALA 97   97   97   ALA ALA F . n 
H  8  98   VAL 98   98   98   VAL VAL F . n 
H  8  99   THR 99   99   99   THR THR F . n 
H  8  100  ASP 100  100  100  ASP ASP F . n 
H  8  101  ALA 101  101  101  ALA ALA F . n 
H  8  102  GLY 102  102  102  GLY GLY F . n 
H  8  103  ALA 103  103  103  ALA ALA F . n 
H  8  104  ALA 104  104  104  ALA ALA F . n 
H  8  105  ALA 105  105  105  ALA ALA F . n 
H  8  106  THR 106  106  106  THR THR F . n 
H  8  107  VAL 107  107  107  VAL VAL F . n 
H  8  108  LEU 108  108  108  LEU LEU F . n 
H  8  109  GLU 109  109  109  GLU GLU F . n 
H  8  110  GLU 110  110  110  GLU GLU F . n 
H  8  111  ILE 111  111  111  ILE ILE F . n 
H  8  112  ALA 112  112  112  ALA ALA F . n 
H  8  113  ASP 113  113  113  ASP ASP F . n 
H  8  114  LYS 114  114  114  LYS LYS F . n 
H  8  115  VAL 115  115  115  VAL VAL F . n 
H  8  116  GLU 116  116  116  GLU GLU F . n 
H  8  117  GLU 117  117  117  GLU GLU F . n 
H  8  118  LEU 118  118  118  LEU LEU F . n 
H  8  119  ARG 119  119  119  ARG ARG F . n 
I  9  1    MET 1    1    ?    ?   ?   G . n 
I  9  2    SER 2    2    ?    ?   ?   G . n 
I  9  3    ALA 3    3    ?    ?   ?   G . n 
I  9  4    GLU 4    4    ?    ?   ?   G . n 
I  9  5    SER 5    5    ?    ?   ?   G . n 
I  9  6    GLU 6    6    ?    ?   ?   G . n 
I  9  7    ARG 7    7    ?    ?   ?   G . n 
I  9  8    LYS 8    8    ?    ?   ?   G . n 
I  9  9    THR 9    9    ?    ?   ?   G . n 
I  9  10   GLU 10   10   ?    ?   ?   G . n 
I  9  11   THR 11   11   ?    ?   ?   G . n 
I  9  12   ILE 12   12   12   ILE ILE G . n 
I  9  13   PRO 13   13   13   PRO PRO G . n 
I  9  14   GLU 14   14   14   GLU GLU G . n 
I  9  15   TRP 15   15   15   TRP TRP G . n 
I  9  16   LYS 16   16   16   LYS LYS G . n 
I  9  17   GLN 17   17   17   GLN GLN G . n 
I  9  18   GLU 18   18   18   GLU GLU G . n 
I  9  19   GLU 19   19   19   GLU GLU G . n 
I  9  20   VAL 20   20   20   VAL VAL G . n 
I  9  21   ASP 21   21   21   ASP ASP G . n 
I  9  22   ALA 22   22   22   ALA ALA G . n 
I  9  23   ILE 23   23   23   ILE ILE G . n 
I  9  24   VAL 24   24   24   VAL VAL G . n 
I  9  25   GLU 25   25   25   GLU GLU G . n 
I  9  26   MET 26   26   26   MET MET G . n 
I  9  27   ILE 27   27   27   ILE ILE G . n 
I  9  28   GLU 28   28   28   GLU GLU G . n 
I  9  29   SER 29   29   29   SER SER G . n 
I  9  30   TYR 30   30   ?    ?   ?   G . n 
I  9  31   GLU 31   31   ?    ?   ?   G . n 
I  9  32   SER 32   32   ?    ?   ?   G . n 
I  9  33   VAL 33   33   ?    ?   ?   G . n 
I  9  34   GLY 34   34   ?    ?   ?   G . n 
I  9  35   VAL 35   35   ?    ?   ?   G . n 
I  9  36   VAL 36   36   ?    ?   ?   G . n 
I  9  37   ASN 37   37   ?    ?   ?   G . n 
I  9  38   ILE 38   38   ?    ?   ?   G . n 
I  9  39   ALA 39   39   ?    ?   ?   G . n 
I  9  40   GLY 40   40   ?    ?   ?   G . n 
I  9  41   ILE 41   41   ?    ?   ?   G . n 
I  9  42   PRO 42   42   ?    ?   ?   G . n 
I  9  43   SER 43   43   ?    ?   ?   G . n 
I  9  44   ARG 44   44   ?    ?   ?   G . n 
I  9  45   GLN 45   45   ?    ?   ?   G . n 
I  9  46   LEU 46   46   ?    ?   ?   G . n 
I  9  47   GLN 47   47   ?    ?   ?   G . n 
I  9  48   ASP 48   48   ?    ?   ?   G . n 
I  9  49   MET 49   49   ?    ?   ?   G . n 
I  9  50   ARG 50   50   ?    ?   ?   G . n 
I  9  51   ARG 51   51   ?    ?   ?   G . n 
I  9  52   ASP 52   52   ?    ?   ?   G . n 
I  9  53   LEU 53   53   ?    ?   ?   G . n 
I  9  54   HIS 54   54   ?    ?   ?   G . n 
I  9  55   GLY 55   55   ?    ?   ?   G . n 
I  9  56   THR 56   56   ?    ?   ?   G . n 
I  9  57   ALA 57   57   ?    ?   ?   G . n 
I  9  58   GLU 58   58   ?    ?   ?   G . n 
I  9  59   LEU 59   59   ?    ?   ?   G . n 
I  9  60   ARG 60   60   ?    ?   ?   G . n 
I  9  61   VAL 61   61   ?    ?   ?   G . n 
I  9  62   SER 62   62   ?    ?   ?   G . n 
I  9  63   ARG 63   63   63   ARG ARG G . n 
I  9  64   ASN 64   64   64   ASN ASN G . n 
I  9  65   THR 65   65   65   THR THR G . n 
I  9  66   LEU 66   66   66   LEU LEU G . n 
I  9  67   LEU 67   67   67   LEU LEU G . n 
I  9  68   GLU 68   68   68   GLU GLU G . n 
I  9  69   ARG 69   69   69   ARG ARG G . n 
I  9  70   ALA 70   70   70   ALA ALA G . n 
I  9  71   LEU 71   71   71   LEU LEU G . n 
I  9  72   ASP 72   72   72   ASP ASP G . n 
I  9  73   ASP 73   73   73   ASP ASP G . n 
I  9  74   VAL 74   74   ?    ?   ?   G . n 
I  9  75   ASP 75   75   ?    ?   ?   G . n 
I  9  76   ASP 76   76   ?    ?   ?   G . n 
I  9  77   GLY 77   77   ?    ?   ?   G . n 
I  9  78   LEU 78   78   ?    ?   ?   G . n 
I  9  79   GLU 79   79   ?    ?   ?   G . n 
I  9  80   ASP 80   80   ?    ?   ?   G . n 
I  9  81   LEU 81   81   ?    ?   ?   G . n 
I  9  82   ASN 82   82   ?    ?   ?   G . n 
I  9  83   GLY 83   83   ?    ?   ?   G . n 
I  9  84   TYR 84   84   ?    ?   ?   G . n 
I  9  85   ILE 85   85   ?    ?   ?   G . n 
I  9  86   THR 86   86   ?    ?   ?   G . n 
I  9  87   GLY 87   87   ?    ?   ?   G . n 
I  9  88   GLN 88   88   ?    ?   ?   G . n 
I  9  89   VAL 89   89   ?    ?   ?   G . n 
I  9  90   GLY 90   90   ?    ?   ?   G . n 
I  9  91   LEU 91   91   ?    ?   ?   G . n 
I  9  92   ILE 92   92   ?    ?   ?   G . n 
I  9  93   GLY 93   93   ?    ?   ?   G . n 
I  9  94   THR 94   94   ?    ?   ?   G . n 
I  9  95   ASP 95   95   ?    ?   ?   G . n 
I  9  96   ASP 96   96   ?    ?   ?   G . n 
I  9  97   ASN 97   97   ?    ?   ?   G . n 
I  9  98   PRO 98   98   ?    ?   ?   G . n 
I  9  99   PHE 99   99   ?    ?   ?   G . n 
I  9  100  SER 100  100  ?    ?   ?   G . n 
I  9  101  LEU 101  101  ?    ?   ?   G . n 
I  9  102  PHE 102  102  ?    ?   ?   G . n 
I  9  103  GLN 103  103  ?    ?   ?   G . n 
I  9  104  GLU 104  104  ?    ?   ?   G . n 
I  9  105  LEU 105  105  ?    ?   ?   G . n 
I  9  106  GLU 106  106  ?    ?   ?   G . n 
I  9  107  ALA 107  107  ?    ?   ?   G . n 
I  9  108  SER 108  108  ?    ?   ?   G . n 
I  9  109  LYS 109  109  ?    ?   ?   G . n 
I  9  110  THR 110  110  ?    ?   ?   G . n 
I  9  111  PRO 111  111  ?    ?   ?   G . n 
I  9  112  ALA 112  112  ?    ?   ?   G . n 
I  9  113  PRO 113  113  ?    ?   ?   G . n 
I  9  114  ILE 114  114  ?    ?   ?   G . n 
I  9  115  GLY 115  115  ?    ?   ?   G . n 
I  9  116  ALA 116  116  ?    ?   ?   G . n 
I  9  117  GLY 117  117  ?    ?   ?   G . n 
I  9  118  GLU 118  118  ?    ?   ?   G . n 
I  9  119  VAL 119  119  ?    ?   ?   G . n 
I  9  120  ALA 120  120  ?    ?   ?   G . n 
I  9  121  PRO 121  121  ?    ?   ?   G . n 
I  9  122  ASN 122  122  ?    ?   ?   G . n 
I  9  123  ASP 123  123  ?    ?   ?   G . n 
I  9  124  ILE 124  124  ?    ?   ?   G . n 
I  9  125  VAL 125  125  ?    ?   ?   G . n 
I  9  126  ILE 126  126  ?    ?   ?   G . n 
I  9  127  PRO 127  127  ?    ?   ?   G . n 
I  9  128  GLU 128  128  ?    ?   ?   G . n 
I  9  129  GLY 129  129  ?    ?   ?   G . n 
I  9  130  ASP 130  130  ?    ?   ?   G . n 
I  9  131  THR 131  131  ?    ?   ?   G . n 
I  9  132  GLY 132  132  ?    ?   ?   G . n 
I  9  133  VAL 133  133  ?    ?   ?   G . n 
I  9  134  ASP 134  134  ?    ?   ?   G . n 
I  9  135  PRO 135  135  ?    ?   ?   G . n 
I  9  136  GLY 136  136  ?    ?   ?   G . n 
I  9  137  PRO 137  137  ?    ?   ?   G . n 
I  9  138  PHE 138  138  ?    ?   ?   G . n 
I  9  139  VAL 139  139  ?    ?   ?   G . n 
I  9  140  GLY 140  140  ?    ?   ?   G . n 
I  9  141  GLU 141  141  ?    ?   ?   G . n 
I  9  142  LEU 142  142  ?    ?   ?   G . n 
I  9  143  GLN 143  143  ?    ?   ?   G . n 
I  9  144  SER 144  144  ?    ?   ?   G . n 
I  9  145  VAL 145  145  ?    ?   ?   G . n 
I  9  146  GLY 146  146  ?    ?   ?   G . n 
I  9  147  ALA 147  147  ?    ?   ?   G . n 
I  9  148  ASP 148  148  ?    ?   ?   G . n 
I  9  149  ALA 149  149  ?    ?   ?   G . n 
I  9  150  ARG 150  150  ?    ?   ?   G . n 
I  9  151  ILE 151  151  ?    ?   ?   G . n 
I  9  152  GLN 152  152  ?    ?   ?   G . n 
I  9  153  GLU 153  153  ?    ?   ?   G . n 
I  9  154  GLY 154  154  ?    ?   ?   G . n 
I  9  155  SER 155  155  ?    ?   ?   G . n 
I  9  156  ILE 156  156  ?    ?   ?   G . n 
I  9  157  GLN 157  157  ?    ?   ?   G . n 
I  9  158  VAL 158  158  ?    ?   ?   G . n 
I  9  159  LEU 159  159  ?    ?   ?   G . n 
I  9  160  SER 160  160  ?    ?   ?   G . n 
I  9  161  ASP 161  161  ?    ?   ?   G . n 
I  9  162  SER 162  162  ?    ?   ?   G . n 
I  9  163  THR 163  163  ?    ?   ?   G . n 
I  9  164  VAL 164  164  ?    ?   ?   G . n 
I  9  165  LEU 165  165  ?    ?   ?   G . n 
I  9  166  ASP 166  166  ?    ?   ?   G . n 
I  9  167  THR 167  167  ?    ?   ?   G . n 
I  9  168  GLY 168  168  ?    ?   ?   G . n 
I  9  169  GLU 169  169  ?    ?   ?   G . n 
I  9  170  GLU 170  170  ?    ?   ?   G . n 
I  9  171  VAL 171  171  ?    ?   ?   G . n 
I  9  172  SER 172  172  ?    ?   ?   G . n 
I  9  173  GLN 173  173  ?    ?   ?   G . n 
I  9  174  GLU 174  174  ?    ?   ?   G . n 
I  9  175  LEU 175  175  ?    ?   ?   G . n 
I  9  176  SER 176  176  ?    ?   ?   G . n 
I  9  177  ASN 177  177  ?    ?   ?   G . n 
I  9  178  VAL 178  178  ?    ?   ?   G . n 
I  9  179  LEU 179  179  ?    ?   ?   G . n 
I  9  180  ASN 180  180  ?    ?   ?   G . n 
I  9  181  GLU 181  181  ?    ?   ?   G . n 
I  9  182  LEU 182  182  ?    ?   ?   G . n 
I  9  183  GLY 183  183  ?    ?   ?   G . n 
I  9  184  ILE 184  184  ?    ?   ?   G . n 
I  9  185  GLU 185  185  ?    ?   ?   G . n 
I  9  186  PRO 186  186  ?    ?   ?   G . n 
I  9  187  LYS 187  187  ?    ?   ?   G . n 
I  9  188  GLU 188  188  ?    ?   ?   G . n 
I  9  189  VAL 189  189  ?    ?   ?   G . n 
I  9  190  GLY 190  190  ?    ?   ?   G . n 
I  9  191  LEU 191  191  ?    ?   ?   G . n 
I  9  192  ASP 192  192  ?    ?   ?   G . n 
I  9  193  LEU 193  193  ?    ?   ?   G . n 
I  9  194  ARG 194  194  ?    ?   ?   G . n 
I  9  195  ALA 195  195  ?    ?   ?   G . n 
I  9  196  VAL 196  196  ?    ?   ?   G . n 
I  9  197  PHE 197  197  ?    ?   ?   G . n 
I  9  198  ALA 198  198  ?    ?   ?   G . n 
I  9  199  ASP 199  199  ?    ?   ?   G . n 
I  9  200  GLY 200  200  ?    ?   ?   G . n 
I  9  201  VAL 201  201  ?    ?   ?   G . n 
I  9  202  LEU 202  202  ?    ?   ?   G . n 
I  9  203  PHE 203  203  ?    ?   ?   G . n 
I  9  204  GLU 204  204  ?    ?   ?   G . n 
I  9  205  PRO 205  205  ?    ?   ?   G . n 
I  9  206  GLU 206  206  ?    ?   ?   G . n 
I  9  207  GLU 207  207  ?    ?   ?   G . n 
I  9  208  LEU 208  208  ?    ?   ?   G . n 
I  9  209  GLU 209  209  ?    ?   ?   G . n 
I  9  210  LEU 210  210  ?    ?   ?   G . n 
I  9  211  ASP 211  211  ?    ?   ?   G . n 
I  9  212  ILE 212  212  ?    ?   ?   G . n 
I  9  213  ASP 213  213  ?    ?   ?   G . n 
I  9  214  GLU 214  214  ?    ?   ?   G . n 
I  9  215  TYR 215  215  ?    ?   ?   G . n 
I  9  216  ARG 216  216  ?    ?   ?   G . n 
I  9  217  SER 217  217  ?    ?   ?   G . n 
I  9  218  ASP 218  218  ?    ?   ?   G . n 
I  9  219  ILE 219  219  ?    ?   ?   G . n 
I  9  220  GLN 220  220  ?    ?   ?   G . n 
I  9  221  ALA 221  221  ?    ?   ?   G . n 
I  9  222  ALA 222  222  ?    ?   ?   G . n 
I  9  223  ALA 223  223  ?    ?   ?   G . n 
I  9  224  GLY 224  224  ?    ?   ?   G . n 
I  9  225  ARG 225  225  ?    ?   ?   G . n 
I  9  226  ALA 226  226  ?    ?   ?   G . n 
I  9  227  PHE 227  227  ?    ?   ?   G . n 
I  9  228  ASN 228  228  ?    ?   ?   G . n 
I  9  229  LEU 229  229  ?    ?   ?   G . n 
I  9  230  SER 230  230  ?    ?   ?   G . n 
I  9  231  VAL 231  231  ?    ?   ?   G . n 
I  9  232  ASN 232  232  ?    ?   ?   G . n 
I  9  233  ALA 233  233  ?    ?   ?   G . n 
I  9  234  ASP 234  234  ?    ?   ?   G . n 
I  9  235  TYR 235  235  ?    ?   ?   G . n 
I  9  236  PRO 236  236  ?    ?   ?   G . n 
I  9  237  THR 237  237  ?    ?   ?   G . n 
I  9  238  ALA 238  238  ?    ?   ?   G . n 
I  9  239  THR 239  239  ?    ?   ?   G . n 
I  9  240  THR 240  240  ?    ?   ?   G . n 
I  9  241  ALA 241  241  ?    ?   ?   G . n 
I  9  242  PRO 242  242  ?    ?   ?   G . n 
I  9  243  THR 243  243  ?    ?   ?   G . n 
I  9  244  MET 244  244  ?    ?   ?   G . n 
I  9  245  LEU 245  245  ?    ?   ?   G . n 
I  9  246  GLN 246  246  ?    ?   ?   G . n 
I  9  247  SER 247  247  ?    ?   ?   G . n 
I  9  248  ASP 248  248  ?    ?   ?   G . n 
I  9  249  ARG 249  249  ?    ?   ?   G . n 
I  9  250  GLY 250  250  ?    ?   ?   G . n 
I  9  251  ASN 251  251  ?    ?   ?   G . n 
I  9  252  ALA 252  252  ?    ?   ?   G . n 
I  9  253  LYS 253  253  ?    ?   ?   G . n 
I  9  254  SER 254  254  ?    ?   ?   G . n 
I  9  255  LEU 255  255  ?    ?   ?   G . n 
I  9  256  ALA 256  256  ?    ?   ?   G . n 
I  9  257  LEU 257  257  ?    ?   ?   G . n 
I  9  258  GLN 258  258  ?    ?   ?   G . n 
I  9  259  ALA 259  259  ?    ?   ?   G . n 
I  9  260  ALA 260  260  ?    ?   ?   G . n 
I  9  261  ILE 261  261  ?    ?   ?   G . n 
I  9  262  GLU 262  262  ?    ?   ?   G . n 
I  9  263  ASP 263  263  ?    ?   ?   G . n 
I  9  264  PRO 264  264  ?    ?   ?   G . n 
I  9  265  GLU 265  265  ?    ?   ?   G . n 
I  9  266  VAL 266  266  ?    ?   ?   G . n 
I  9  267  VAL 267  267  ?    ?   ?   G . n 
I  9  268  PRO 268  268  ?    ?   ?   G . n 
I  9  269  ASP 269  269  ?    ?   ?   G . n 
I  9  270  LEU 270  270  ?    ?   ?   G . n 
I  9  271  VAL 271  271  ?    ?   ?   G . n 
I  9  272  SER 272  272  ?    ?   ?   G . n 
I  9  273  LYS 273  273  ?    ?   ?   G . n 
I  9  274  ALA 274  274  ?    ?   ?   G . n 
I  9  275  ASP 275  275  ?    ?   ?   G . n 
I  9  276  ALA 276  276  ?    ?   ?   G . n 
I  9  277  GLN 277  277  ?    ?   ?   G . n 
I  9  278  VAL 278  278  ?    ?   ?   G . n 
I  9  279  ARG 279  279  ?    ?   ?   G . n 
I  9  280  ALA 280  280  ?    ?   ?   G . n 
I  9  281  LEU 281  281  ?    ?   ?   G . n 
I  9  282  ALA 282  282  ?    ?   ?   G . n 
I  9  283  SER 283  283  ?    ?   ?   G . n 
I  9  284  GLN 284  284  ?    ?   ?   G . n 
I  9  285  ILE 285  285  ?    ?   ?   G . n 
I  9  286  ASP 286  286  ?    ?   ?   G . n 
I  9  287  ASP 287  287  ?    ?   ?   G . n 
I  9  288  GLU 288  288  ?    ?   ?   G . n 
I  9  289  GLU 289  289  ?    ?   ?   G . n 
I  9  290  ALA 290  290  ?    ?   ?   G . n 
I  9  291  LEU 291  291  ?    ?   ?   G . n 
I  9  292  PRO 292  292  ?    ?   ?   G . n 
I  9  293  GLU 293  293  ?    ?   ?   G . n 
I  9  294  GLU 294  294  ?    ?   ?   G . n 
I  9  295  LEU 295  295  ?    ?   ?   G . n 
I  9  296  GLN 296  296  ?    ?   ?   G . n 
I  9  297  GLY 297  297  ?    ?   ?   G . n 
I  9  298  VAL 298  298  ?    ?   ?   G . n 
I  9  299  GLU 299  299  ?    ?   ?   G . n 
I  9  300  ALA 300  300  ?    ?   ?   G . n 
I  9  301  ASP 301  301  ?    ?   ?   G . n 
I  9  302  VAL 302  302  ?    ?   ?   G . n 
I  9  303  ALA 303  303  ?    ?   ?   G . n 
I  9  304  THR 304  304  ?    ?   ?   G . n 
I  9  305  GLU 305  305  ?    ?   ?   G . n 
I  9  306  GLU 306  306  ?    ?   ?   G . n 
I  9  307  PRO 307  307  ?    ?   ?   G . n 
I  9  308  THR 308  308  ?    ?   ?   G . n 
I  9  309  ASP 309  309  ?    ?   ?   G . n 
I  9  310  ASP 310  310  ?    ?   ?   G . n 
I  9  311  GLN 311  311  ?    ?   ?   G . n 
I  9  312  ASP 312  312  ?    ?   ?   G . n 
I  9  313  ASP 313  313  ?    ?   ?   G . n 
I  9  314  ASP 314  314  ?    ?   ?   G . n 
I  9  315  THR 315  315  ?    ?   ?   G . n 
I  9  316  ALA 316  316  ?    ?   ?   G . n 
I  9  317  SER 317  317  ?    ?   ?   G . n 
I  9  318  GLU 318  318  ?    ?   ?   G . n 
I  9  319  ASP 319  319  ?    ?   ?   G . n 
I  9  320  ASP 320  320  ?    ?   ?   G . n 
I  9  321  ALA 321  321  ?    ?   ?   G . n 
I  9  322  ASP 322  322  ?    ?   ?   G . n 
I  9  323  ALA 323  323  ?    ?   ?   G . n 
I  9  324  ASP 324  324  ?    ?   ?   G . n 
I  9  325  ASP 325  325  ?    ?   ?   G . n 
I  9  326  ALA 326  326  ?    ?   ?   G . n 
I  9  327  ALA 327  327  ?    ?   ?   G . n 
I  9  328  GLU 328  328  ?    ?   ?   G . n 
I  9  329  GLU 329  329  ?    ?   ?   G . n 
I  9  330  ALA 330  330  ?    ?   ?   G . n 
I  9  331  ASP 331  331  ?    ?   ?   G . n 
I  9  332  ASP 332  332  ?    ?   ?   G . n 
I  9  333  ASP 333  333  ?    ?   ?   G . n 
I  9  334  ASP 334  334  ?    ?   ?   G . n 
I  9  335  ASP 335  335  ?    ?   ?   G . n 
I  9  336  ASP 336  336  ?    ?   ?   G . n 
I  9  337  ASP 337  337  ?    ?   ?   G . n 
I  9  338  GLU 338  338  ?    ?   ?   G . n 
I  9  339  ASP 339  339  ?    ?   ?   G . n 
I  9  340  ALA 340  340  ?    ?   ?   G . n 
I  9  341  GLY 341  341  ?    ?   ?   G . n 
I  9  342  ASP 342  342  ?    ?   ?   G . n 
I  9  343  ALA 343  343  ?    ?   ?   G . n 
I  9  344  LEU 344  344  ?    ?   ?   G . n 
I  9  345  GLY 345  345  ?    ?   ?   G . n 
I  9  346  ALA 346  346  ?    ?   ?   G . n 
I  9  347  MET 347  347  ?    ?   ?   G . n 
I  9  348  PHE 348  348  ?    ?   ?   G . n 
J  10 1    LYS 1    1    1    LYS LYS H . n 
J  10 2    PRO 2    2    2    PRO PRO H . n 
J  10 3    GLY 3    3    3    GLY GLY H . n 
J  10 4    ALA 4    4    4    ALA ALA H . n 
J  10 5    MET 5    5    5    MET MET H . n 
J  10 6    TYR 6    6    6    TYR TYR H . n 
J  10 7    ARG 7    7    7    ARG ARG H . n 
J  10 8    ASN 8    8    8    ASN ASN H . n 
J  10 9    SER 9    9    9    SER SER H . n 
J  10 10   SER 10   10   10   SER SER H . n 
J  10 11   LYS 11   11   11   LYS LYS H . n 
J  10 12   PRO 12   12   12   PRO PRO H . n 
J  10 13   ALA 13   13   13   ALA ALA H . n 
J  10 14   TYR 14   14   14   TYR TYR H . n 
J  10 15   THR 15   15   15   THR THR H . n 
J  10 16   ARG 16   16   16   ARG ARG H . n 
J  10 17   ARG 17   17   17   ARG ARG H . n 
J  10 18   GLU 18   18   18   GLU GLU H . n 
J  10 19   TYR 19   19   19   TYR TYR H . n 
J  10 20   ILE 20   20   20   ILE ILE H . n 
J  10 21   SER 21   21   21   SER SER H . n 
J  10 22   GLY 22   22   22   GLY GLY H . n 
J  10 23   ILE 23   23   23   ILE ILE H . n 
J  10 24   PRO 24   24   24   PRO PRO H . n 
J  10 25   GLY 25   25   25   GLY GLY H . n 
J  10 26   LYS 26   26   26   LYS LYS H . n 
J  10 27   LYS 27   27   27   LYS LYS H . n 
J  10 28   ILE 28   28   28   ILE ILE H . n 
J  10 29   ALA 29   29   29   ALA ALA H . n 
J  10 30   GLN 30   30   30   GLN GLN H . n 
J  10 31   PHE 31   31   31   PHE PHE H . n 
J  10 32   ASP 32   32   32   ASP ASP H . n 
J  10 33   MET 33   33   33   MET MET H . n 
J  10 34   GLY 34   34   34   GLY GLY H . n 
J  10 35   ASN 35   35   35   ASN ASN H . n 
J  10 36   ASN 36   36   36   ASN ASN H . n 
J  10 37   GLY 37   37   37   GLY GLY H . n 
J  10 38   ALA 38   38   38   ALA ALA H . n 
J  10 39   GLY 39   39   39   GLY GLY H . n 
J  10 40   PRO 40   40   40   PRO PRO H . n 
J  10 41   THR 41   41   41   THR THR H . n 
J  10 42   TYR 42   42   42   TYR TYR H . n 
J  10 43   PRO 43   43   43   PRO PRO H . n 
J  10 44   ALA 44   44   44   ALA ALA H . n 
J  10 45   GLN 45   45   45   GLN GLN H . n 
J  10 46   VAL 46   46   46   VAL VAL H . n 
J  10 47   GLU 47   47   47   GLU GLU H . n 
J  10 48   LEU 48   48   48   LEU LEU H . n 
J  10 49   VAL 49   49   49   VAL VAL H . n 
J  10 50   VAL 50   50   50   VAL VAL H . n 
J  10 51   GLU 51   51   51   GLU GLU H . n 
J  10 52   LYS 52   52   52   LYS LYS H . n 
J  10 53   PRO 53   53   53   PRO PRO H . n 
J  10 54   VAL 54   54   54   VAL VAL H . n 
J  10 55   GLN 55   55   55   GLN GLN H . n 
J  10 56   ILE 56   56   56   ILE ILE H . n 
J  10 57   ARG 57   57   57   ARG ARG H . n 
J  10 58   HIS 58   58   58   HIS HIS H . n 
J  10 59   ASN 59   59   59   ASN ASN H . n 
J  10 60   ALA 60   60   60   ALA ALA H . n 
J  10 61   LEU 61   61   61   LEU LEU H . n 
J  10 62   GLU 62   62   62   GLU GLU H . n 
J  10 63   ALA 63   63   63   ALA ALA H . n 
J  10 64   ALA 64   64   64   ALA ALA H . n 
J  10 65   ARG 65   65   65   ARG ARG H . n 
J  10 66   VAL 66   66   66   VAL VAL H . n 
J  10 67   ALA 67   67   67   ALA ALA H . n 
J  10 68   ALA 68   68   68   ALA ALA H . n 
J  10 69   ASN 69   69   69   ASN ASN H . n 
J  10 70   ARG 70   70   70   ARG ARG H . n 
J  10 71   TYR 71   71   71   TYR TYR H . n 
J  10 72   VAL 72   72   72   VAL VAL H . n 
J  10 73   GLN 73   73   73   GLN GLN H . n 
J  10 74   ASN 74   74   74   ASN ASN H . n 
J  10 75   SER 75   75   75   SER SER H . n 
J  10 76   GLY 76   76   76   GLY GLY H . n 
J  10 77   ALA 77   77   77   ALA ALA H . n 
J  10 78   ALA 78   78   78   ALA ALA H . n 
J  10 79   ALA 79   79   79   ALA ALA H . n 
J  10 80   ASN 80   80   80   ASN ASN H . n 
J  10 81   TYR 81   81   81   TYR TYR H . n 
J  10 82   LYS 82   82   82   LYS LYS H . n 
J  10 83   PHE 83   83   83   PHE PHE H . n 
J  10 84   ARG 84   84   84   ARG ARG H . n 
J  10 85   ILE 85   85   85   ILE ILE H . n 
J  10 86   ARG 86   86   86   ARG ARG H . n 
J  10 87   LYS 87   87   87   LYS LYS H . n 
J  10 88   PHE 88   88   88   PHE PHE H . n 
J  10 89   PRO 89   89   89   PRO PRO H . n 
J  10 90   PHE 90   90   90   PHE PHE H . n 
J  10 91   HIS 91   91   91   HIS HIS H . n 
J  10 92   VAL 92   92   92   VAL VAL H . n 
J  10 93   ILE 93   93   93   ILE ILE H . n 
J  10 94   ARG 94   94   94   ARG ARG H . n 
J  10 95   GLU 95   95   95   GLU GLU H . n 
J  10 96   ASN 96   96   96   ASN ASN H . n 
J  10 97   LYS 97   97   97   LYS LYS H . n 
J  10 98   ALA 98   98   ?    ?   ?   H . n 
J  10 99   ALA 99   99   ?    ?   ?   H . n 
J  10 100  ALA 100  100  ?    ?   ?   H . n 
J  10 101  ALA 101  101  ?    ?   ?   H . n 
J  10 102  ALA 102  102  ?    ?   ?   H . n 
J  10 103  ALA 103  103  ?    ?   ?   H . n 
J  10 104  ALA 104  104  ?    ?   ?   H . n 
J  10 105  ALA 105  105  ?    ?   ?   H . n 
J  10 106  ALA 106  106  ?    ?   ?   H . n 
J  10 107  ALA 107  107  ?    ?   ?   H . n 
J  10 108  ALA 108  108  ?    ?   ?   H . n 
J  10 109  ASP 109  109  109  ASP ASP H . n 
J  10 110  GLY 110  110  110  GLY GLY H . n 
J  10 111  MET 111  111  111  MET MET H . n 
J  10 112  ARG 112  112  112  ARG ARG H . n 
J  10 113  ALA 113  113  113  ALA ALA H . n 
J  10 114  PRO 114  114  114  PRO PRO H . n 
J  10 115  PHE 115  115  115  PHE PHE H . n 
J  10 116  GLY 116  116  116  GLY GLY H . n 
J  10 117  LYS 117  117  117  LYS LYS H . n 
J  10 118  PRO 118  118  118  PRO PRO H . n 
J  10 119  VAL 119  119  119  VAL VAL H . n 
J  10 120  GLY 120  120  120  GLY GLY H . n 
J  10 121  THR 121  121  121  THR THR H . n 
J  10 122  ALA 122  122  122  ALA ALA H . n 
J  10 123  ALA 123  123  123  ALA ALA H . n 
J  10 124  ARG 124  124  124  ARG ARG H . n 
J  10 125  VAL 125  125  125  VAL VAL H . n 
J  10 126  HIS 126  126  126  HIS HIS H . n 
J  10 127  GLY 127  127  127  GLY GLY H . n 
J  10 128  ALA 128  128  128  ALA ALA H . n 
J  10 129  ASN 129  129  129  ASN ASN H . n 
J  10 130  HIS 130  130  130  HIS HIS H . n 
J  10 131  ILE 131  131  131  ILE ILE H . n 
J  10 132  PHE 132  132  132  PHE PHE H . n 
J  10 133  ILE 133  133  133  ILE ILE H . n 
J  10 134  ALA 134  134  134  ALA ALA H . n 
J  10 135  TRP 135  135  135  TRP TRP H . n 
J  10 136  VAL 136  136  136  VAL VAL H . n 
J  10 137  ASN 137  137  137  ASN ASN H . n 
J  10 138  PRO 138  138  138  PRO PRO H . n 
J  10 139  ASP 139  139  139  ASP ASP H . n 
J  10 140  PRO 140  140  140  PRO PRO H . n 
J  10 141  ASN 141  141  141  ASN ASN H . n 
J  10 142  VAL 142  142  142  VAL VAL H . n 
J  10 143  GLU 143  143  143  GLU GLU H . n 
J  10 144  GLU 144  144  144  GLU GLU H . n 
J  10 145  ALA 145  145  145  ALA ALA H . n 
J  10 146  TRP 146  146  146  TRP TRP H . n 
J  10 147  ARG 147  147  147  ARG ARG H . n 
J  10 148  ARG 148  148  148  ARG ARG H . n 
J  10 149  ALA 149  149  149  ALA ALA H . n 
J  10 150  LYS 150  150  150  LYS LYS H . n 
J  10 151  MET 151  151  151  MET MET H . n 
J  10 152  LYS 152  152  152  LYS LYS H . n 
J  10 153  VAL 153  153  153  VAL VAL H . n 
J  10 154  THR 154  154  154  THR THR H . n 
J  10 155  PRO 155  155  155  PRO PRO H . n 
J  10 156  THR 156  156  156  THR THR H . n 
J  10 157  ILE 157  157  157  ILE ILE H . n 
J  10 158  ASN 158  158  158  ASN ASN H . n 
J  10 159  ILE 159  159  159  ILE ILE H . n 
J  10 160  ASP 160  160  160  ASP ASP H . n 
J  10 161  SER 161  161  161  SER SER H . n 
J  10 162  SER 162  162  162  SER SER H . n 
J  10 163  PRO 163  163  163  PRO PRO H . n 
J  10 164  ALA 164  164  164  ALA ALA H . n 
J  10 165  GLY 165  165  165  GLY GLY H . n 
J  10 166  ASN 166  166  166  ASN ASN H . n 
J  10 167  ALA 167  167  167  ALA ALA H . n 
K  11 1    MET 1    1    ?    ?   ?   I . n 
K  11 2    SER 2    2    ?    ?   ?   I . n 
K  11 3    VAL 3    3    ?    ?   ?   I . n 
K  11 4    ALA 4    4    4    ALA ALA I . n 
K  11 5    GLU 5    5    5    GLU GLU I . n 
K  11 6    PHE 6    6    6    PHE PHE I . n 
K  11 7    ASP 7    7    7    ASP ASP I . n 
K  11 8    ALA 8    8    8    ALA ALA I . n 
K  11 9    ASP 9    9    9    ASP ASP I . n 
K  11 10   VAL 10   10   10   VAL VAL I . n 
K  11 11   ILE 11   11   11   ILE ILE I . n 
K  11 12   VAL 12   12   12   VAL VAL I . n 
K  11 13   ASP 13   13   13   ASP ASP I . n 
K  11 14   ALA 14   14   14   ALA ALA I . n 
K  11 15   ARG 15   15   15   ARG ARG I . n 
K  11 16   ASP 16   16   16   ASP ASP I . n 
K  11 17   CYS 17   17   17   CYS CYS I . n 
K  11 18   ILE 18   18   18   ILE ILE I . n 
K  11 19   MET 19   19   19   MET MET I . n 
K  11 20   GLY 20   20   20   GLY GLY I . n 
K  11 21   ARG 21   21   21   ARG ARG I . n 
K  11 22   VAL 22   22   22   VAL VAL I . n 
K  11 23   ALA 23   23   23   ALA ALA I . n 
K  11 24   SER 24   24   24   SER SER I . n 
K  11 25   GLN 25   25   25   GLN GLN I . n 
K  11 26   VAL 26   26   26   VAL VAL I . n 
K  11 27   ALA 27   27   27   ALA ALA I . n 
K  11 28   GLU 28   28   28   GLU GLU I . n 
K  11 29   GLN 29   29   29   GLN GLN I . n 
K  11 30   ALA 30   30   30   ALA ALA I . n 
K  11 31   LEU 31   31   31   LEU LEU I . n 
K  11 32   ASP 32   32   32   ASP ASP I . n 
K  11 33   GLY 33   33   33   GLY GLY I . n 
K  11 34   GLU 34   34   34   GLU GLU I . n 
K  11 35   THR 35   35   35   THR THR I . n 
K  11 36   VAL 36   36   36   VAL VAL I . n 
K  11 37   ALA 37   37   37   ALA ALA I . n 
K  11 38   VAL 38   38   38   VAL VAL I . n 
K  11 39   VAL 39   39   39   VAL VAL I . n 
K  11 40   ASN 40   40   40   ASN ASN I . n 
K  11 41   ALA 41   41   41   ALA ALA I . n 
K  11 42   GLU 42   42   42   GLU GLU I . n 
K  11 43   ARG 43   43   43   ARG ARG I . n 
K  11 44   ALA 44   44   44   ALA ALA I . n 
K  11 45   VAL 45   45   45   VAL VAL I . n 
K  11 46   ILE 46   46   46   ILE ILE I . n 
K  11 47   THR 47   47   47   THR THR I . n 
K  11 48   GLY 48   48   48   GLY GLY I . n 
K  11 49   ARG 49   49   49   ARG ARG I . n 
K  11 50   GLU 50   50   50   GLU GLU I . n 
K  11 51   GLU 51   51   51   GLU GLU I . n 
K  11 52   GLN 52   52   52   GLN GLN I . n 
K  11 53   ILE 53   53   53   ILE ILE I . n 
K  11 54   VAL 54   54   54   VAL VAL I . n 
K  11 55   GLU 55   55   55   GLU GLU I . n 
K  11 56   LYS 56   56   56   LYS LYS I . n 
K  11 57   TYR 57   57   57   TYR TYR I . n 
K  11 58   GLU 58   58   58   GLU GLU I . n 
K  11 59   LYS 59   59   59   LYS LYS I . n 
K  11 60   ARG 60   60   60   ARG ARG I . n 
K  11 61   VAL 61   61   61   VAL VAL I . n 
K  11 62   ASP 62   62   62   ASP ASP I . n 
K  11 63   ILE 63   63   63   ILE ILE I . n 
K  11 64   GLY 64   64   64   GLY GLY I . n 
K  11 65   ASN 65   65   65   ASN ASN I . n 
K  11 66   ASP 66   66   66   ASP ASP I . n 
K  11 67   ASN 67   67   67   ASN ASN I . n 
K  11 68   GLY 68   68   68   GLY GLY I . n 
K  11 69   TYR 69   69   69   TYR TYR I . n 
K  11 70   PHE 70   70   70   PHE PHE I . n 
K  11 71   TYR 71   71   71   TYR TYR I . n 
K  11 72   PRO 72   72   72   PRO PRO I . n 
K  11 73   LYS 73   73   73   LYS LYS I . n 
K  11 74   ARG 74   74   74   ARG ARG I . n 
K  11 75   PRO 75   75   75   PRO PRO I . n 
K  11 76   ASP 76   76   76   ASP ASP I . n 
K  11 77   GLY 77   77   77   GLY GLY I . n 
K  11 78   ILE 78   78   78   ILE ILE I . n 
K  11 79   PHE 79   79   79   PHE PHE I . n 
K  11 80   LYS 80   80   80   LYS LYS I . n 
K  11 81   ARG 81   81   81   ARG ARG I . n 
K  11 82   THR 82   82   82   THR THR I . n 
K  11 83   ILE 83   83   83   ILE ILE I . n 
K  11 84   ARG 84   84   84   ARG ARG I . n 
K  11 85   GLY 85   85   85   GLY GLY I . n 
K  11 86   MET 86   86   86   MET MET I . n 
K  11 87   LEU 87   87   87   LEU LEU I . n 
K  11 88   PRO 88   88   88   PRO PRO I . n 
K  11 89   HIS 89   89   89   HIS HIS I . n 
K  11 90   LYS 90   90   90   LYS LYS I . n 
K  11 91   LYS 91   91   91   LYS LYS I . n 
K  11 92   GLN 92   92   92   GLN GLN I . n 
K  11 93   ARG 93   93   93   ARG ARG I . n 
K  11 94   GLY 94   94   94   GLY GLY I . n 
K  11 95   ARG 95   95   95   ARG ARG I . n 
K  11 96   GLU 96   96   96   GLU GLU I . n 
K  11 97   ALA 97   97   97   ALA ALA I . n 
K  11 98   PHE 98   98   98   PHE PHE I . n 
K  11 99   GLU 99   99   99   GLU GLU I . n 
K  11 100  SER 100  100  100  SER SER I . n 
K  11 101  VAL 101  101  101  VAL VAL I . n 
K  11 102  ARG 102  102  102  ARG ARG I . n 
K  11 103  VAL 103  103  103  VAL VAL I . n 
K  11 104  TYR 104  104  104  TYR TYR I . n 
K  11 105  LEU 105  105  105  LEU LEU I . n 
K  11 106  GLY 106  106  106  GLY GLY I . n 
K  11 107  ASN 107  107  107  ASN ASN I . n 
K  11 108  PRO 108  108  108  PRO PRO I . n 
K  11 109  TYR 109  109  109  TYR TYR I . n 
K  11 110  ASP 110  110  110  ASP ASP I . n 
K  11 111  GLU 111  111  111  GLU GLU I . n 
K  11 112  ASP 112  112  112  ASP ASP I . n 
K  11 113  GLY 113  113  113  GLY GLY I . n 
K  11 114  GLU 114  114  114  GLU GLU I . n 
K  11 115  VAL 115  115  115  VAL VAL I . n 
K  11 116  LEU 116  116  116  LEU LEU I . n 
K  11 117  ASP 117  117  117  ASP ASP I . n 
K  11 118  GLY 118  118  118  GLY GLY I . n 
K  11 119  THR 119  119  119  THR THR I . n 
K  11 120  SER 120  120  120  SER SER I . n 
K  11 121  LEU 121  121  121  LEU LEU I . n 
K  11 122  ASP 122  122  122  ASP ASP I . n 
K  11 123  ARG 123  123  123  ARG ARG I . n 
K  11 124  LEU 124  124  124  LEU LEU I . n 
K  11 125  SER 125  125  125  SER SER I . n 
K  11 126  ASN 126  126  126  ASN ASN I . n 
K  11 127  ILE 127  127  127  ILE ILE I . n 
K  11 128  LYS 128  128  128  LYS LYS I . n 
K  11 129  PHE 129  129  129  PHE PHE I . n 
K  11 130  VAL 130  130  130  VAL VAL I . n 
K  11 131  THR 131  131  131  THR THR I . n 
K  11 132  LEU 132  132  132  LEU LEU I . n 
K  11 133  GLY 133  133  133  GLY GLY I . n 
K  11 134  GLU 134  134  134  GLU GLU I . n 
K  11 135  ILE 135  135  135  ILE ILE I . n 
K  11 136  SER 136  136  136  SER SER I . n 
K  11 137  GLU 137  137  137  GLU GLU I . n 
K  11 138  THR 138  138  138  THR THR I . n 
K  11 139  LEU 139  139  139  LEU LEU I . n 
K  11 140  GLY 140  140  140  GLY GLY I . n 
K  11 141  ALA 141  141  141  ALA ALA I . n 
K  11 142  ASN 142  142  142  ASN ASN I . n 
K  11 143  LYS 143  143  143  LYS LYS I . n 
K  11 144  THR 144  144  144  THR THR I . n 
K  11 145  TRP 145  145  145  TRP TRP I . n 
L  12 1    MET 1    1    1    MET MET J . n 
L  12 2    GLU 2    2    2    GLU GLU J . n 
L  12 3    ALA 3    3    3    ALA ALA J . n 
L  12 4    LEU 4    4    4    LEU LEU J . n 
L  12 5    GLY 5    5    5    GLY GLY J . n 
L  12 6    ALA 6    6    6    ALA ALA J . n 
L  12 7    ASP 7    7    7    ASP ASP J . n 
L  12 8    VAL 8    8    8    VAL VAL J . n 
L  12 9    THR 9    9    9    THR THR J . n 
L  12 10   GLN 10   10   10   GLN GLN J . n 
L  12 11   GLY 11   11   11   GLY GLY J . n 
L  12 12   LEU 12   12   12   LEU LEU J . n 
L  12 13   GLU 13   13   13   GLU GLU J . n 
L  12 14   LYS 14   14   14   LYS LYS J . n 
L  12 15   GLY 15   15   15   GLY GLY J . n 
L  12 16   SER 16   16   16   SER SER J . n 
L  12 17   LEU 17   17   17   LEU LEU J . n 
L  12 18   ILE 18   18   18   ILE ILE J . n 
L  12 19   THR 19   19   19   THR THR J . n 
L  12 20   CYS 20   20   20   CYS CYS J . n 
L  12 21   ALA 21   21   21   ALA ALA J . n 
L  12 22   ASP 22   22   22   ASP ASP J . n 
L  12 23   ASN 23   23   23   ASN ASN J . n 
L  12 24   THR 24   24   24   THR THR J . n 
L  12 25   GLY 25   25   25   GLY GLY J . n 
L  12 26   ALA 26   26   26   ALA ALA J . n 
L  12 27   ARG 27   27   27   ARG ARG J . n 
L  12 28   GLU 28   28   28   GLU GLU J . n 
L  12 29   LEU 29   29   29   LEU LEU J . n 
L  12 30   LYS 30   30   30   LYS LYS J . n 
L  12 31   VAL 31   31   31   VAL VAL J . n 
L  12 32   ILE 32   32   32   ILE ILE J . n 
L  12 33   SER 33   33   33   SER SER J . n 
L  12 34   VAL 34   34   34   VAL VAL J . n 
L  12 35   HIS 35   35   35   HIS HIS J . n 
L  12 36   GLY 36   36   36   GLY GLY J . n 
L  12 37   TYR 37   37   37   TYR TYR J . n 
L  12 38   SER 38   38   38   SER SER J . n 
L  12 39   GLY 39   39   39   GLY GLY J . n 
L  12 40   THR 40   40   40   THR THR J . n 
L  12 41   LYS 41   41   41   LYS LYS J . n 
L  12 42   ASN 42   42   42   ASN ASN J . n 
L  12 43   ARG 43   43   43   ARG ARG J . n 
L  12 44   HIS 44   44   44   HIS HIS J . n 
L  12 45   PRO 45   45   45   PRO PRO J . n 
L  12 46   LYS 46   46   46   LYS LYS J . n 
L  12 47   ALA 47   47   47   ALA ALA J . n 
L  12 48   GLY 48   48   48   GLY GLY J . n 
L  12 49   LEU 49   49   49   LEU LEU J . n 
L  12 50   GLY 50   50   50   GLY GLY J . n 
L  12 51   ASP 51   51   51   ASP ASP J . n 
L  12 52   LYS 52   52   52   LYS LYS J . n 
L  12 53   ILE 53   53   53   ILE ILE J . n 
L  12 54   THR 54   54   54   THR THR J . n 
L  12 55   VAL 55   55   55   VAL VAL J . n 
L  12 56   SER 56   56   56   SER SER J . n 
L  12 57   VAL 57   57   57   VAL VAL J . n 
L  12 58   THR 58   58   58   THR THR J . n 
L  12 59   LYS 59   59   59   LYS LYS J . n 
L  12 60   GLY 60   60   60   GLY GLY J . n 
L  12 61   THR 61   61   61   THR THR J . n 
L  12 62   PRO 62   62   62   PRO PRO J . n 
L  12 63   GLU 63   63   63   GLU GLU J . n 
L  12 64   MET 64   64   64   MET MET J . n 
L  12 65   ARG 65   65   65   ARG ARG J . n 
L  12 66   ARG 66   66   66   ARG ARG J . n 
L  12 67   GLN 67   67   67   GLN GLN J . n 
L  12 68   VAL 68   68   68   VAL VAL J . n 
L  12 69   LEU 69   69   69   LEU LEU J . n 
L  12 70   GLU 70   70   70   GLU GLU J . n 
L  12 71   ALA 71   71   71   ALA ALA J . n 
L  12 72   VAL 72   72   72   VAL VAL J . n 
L  12 73   VAL 73   73   73   VAL VAL J . n 
L  12 74   VAL 74   74   74   VAL VAL J . n 
L  12 75   ARG 75   75   75   ARG ARG J . n 
L  12 76   GLN 76   76   76   GLN GLN J . n 
L  12 77   ARG 77   77   77   ARG ARG J . n 
L  12 78   LYS 78   78   78   LYS LYS J . n 
L  12 79   PRO 79   79   79   PRO PRO J . n 
L  12 80   ILE 80   80   80   ILE ILE J . n 
L  12 81   ARG 81   81   81   ARG ARG J . n 
L  12 82   ARG 82   82   82   ARG ARG J . n 
L  12 83   PRO 83   83   83   PRO PRO J . n 
L  12 84   ASP 84   84   84   ASP ASP J . n 
L  12 85   GLY 85   85   85   GLY GLY J . n 
L  12 86   THR 86   86   86   THR THR J . n 
L  12 87   ARG 87   87   87   ARG ARG J . n 
L  12 88   VAL 88   88   88   VAL VAL J . n 
L  12 89   LYS 89   89   89   LYS LYS J . n 
L  12 90   PHE 90   90   90   PHE PHE J . n 
L  12 91   GLU 91   91   91   GLU GLU J . n 
L  12 92   ASP 92   92   92   ASP ASP J . n 
L  12 93   ASN 93   93   93   ASN ASN J . n 
L  12 94   ALA 94   94   94   ALA ALA J . n 
L  12 95   ALA 95   95   95   ALA ALA J . n 
L  12 96   VAL 96   96   96   VAL VAL J . n 
L  12 97   ILE 97   97   97   ILE ILE J . n 
L  12 98   VAL 98   98   98   VAL VAL J . n 
L  12 99   ASP 99   99   99   ASP ASP J . n 
L  12 100  GLU 100  100  100  GLU GLU J . n 
L  12 101  ASN 101  101  101  ASN ASN J . n 
L  12 102  GLU 102  102  102  GLU GLU J . n 
L  12 103  ASP 103  103  103  ASP ASP J . n 
L  12 104  PRO 104  104  104  PRO PRO J . n 
L  12 105  ARG 105  105  105  ARG ARG J . n 
L  12 106  GLY 106  106  106  GLY GLY J . n 
L  12 107  THR 107  107  107  THR THR J . n 
L  12 108  GLU 108  108  108  GLU GLU J . n 
L  12 109  LEU 109  109  109  LEU LEU J . n 
L  12 110  LYS 110  110  110  LYS LYS J . n 
L  12 111  GLY 111  111  111  GLY GLY J . n 
L  12 112  PRO 112  112  112  PRO PRO J . n 
L  12 113  ILE 113  113  113  ILE ILE J . n 
L  12 114  ALA 114  114  114  ALA ALA J . n 
L  12 115  ARG 115  115  115  ARG ARG J . n 
L  12 116  GLU 116  116  116  GLU GLU J . n 
L  12 117  VAL 117  117  117  VAL VAL J . n 
L  12 118  ALA 118  118  118  ALA ALA J . n 
L  12 119  GLN 119  119  119  GLN GLN J . n 
L  12 120  ARG 120  120  120  ARG ARG J . n 
L  12 121  PHE 121  121  121  PHE PHE J . n 
L  12 122  GLY 122  122  122  GLY GLY J . n 
L  12 123  SER 123  123  123  SER SER J . n 
L  12 124  VAL 124  124  124  VAL VAL J . n 
L  12 125  ALA 125  125  125  ALA ALA J . n 
L  12 126  SER 126  126  126  SER SER J . n 
L  12 127  ALA 127  127  127  ALA ALA J . n 
L  12 128  ALA 128  128  128  ALA ALA J . n 
L  12 129  THR 129  129  129  THR THR J . n 
L  12 130  MET 130  130  130  MET MET J . n 
L  12 131  ILE 131  131  131  ILE ILE J . n 
L  12 132  VAL 132  132  132  VAL VAL J . n 
M  13 1    THR 1    1    1    THR THR K . n 
M  13 2    SER 2    2    2    SER SER K . n 
M  13 3    LYS 3    3    3    LYS LYS K . n 
M  13 4    LYS 4    4    4    LYS LYS K . n 
M  13 5    LYS 5    5    5    LYS LYS K . n 
M  13 6    ARG 6    6    6    ARG ARG K . n 
M  13 7    GLN 7    7    7    GLN GLN K . n 
M  13 8    ARG 8    8    8    ARG ARG K . n 
M  13 9    GLY 9    9    9    GLY GLY K . n 
M  13 10   SER 10   10   10   SER SER K . n 
M  13 11   ARG 11   11   11   ARG ARG K . n 
M  13 12   THR 12   12   12   THR THR K . n 
M  13 13   HIS 13   13   13   HIS HIS K . n 
M  13 14   GLY 14   14   14   GLY GLY K . n 
M  13 15   GLY 15   15   15   GLY GLY K . n 
M  13 16   GLY 16   16   16   GLY GLY K . n 
M  13 17   SER 17   17   17   SER SER K . n 
M  13 18   HIS 18   18   18   HIS HIS K . n 
M  13 19   LYS 19   19   19   LYS LYS K . n 
M  13 20   ASN 20   20   20   ASN ASN K . n 
M  13 21   ARG 21   21   21   ARG ARG K . n 
M  13 22   ARG 22   22   22   ARG ARG K . n 
M  13 23   GLY 23   23   23   GLY GLY K . n 
M  13 24   ALA 24   24   24   ALA ALA K . n 
M  13 25   GLY 25   25   25   GLY GLY K . n 
M  13 26   HIS 26   26   26   HIS HIS K . n 
M  13 27   ARG 27   27   27   ARG ARG K . n 
M  13 28   GLY 28   28   28   GLY GLY K . n 
M  13 29   GLY 29   29   29   GLY GLY K . n 
M  13 30   ARG 30   30   30   ARG ARG K . n 
M  13 31   GLY 31   31   31   GLY GLY K . n 
M  13 32   ASP 32   32   32   ASP ASP K . n 
M  13 33   ALA 33   33   33   ALA ALA K . n 
M  13 34   GLY 34   34   34   GLY GLY K . n 
M  13 35   ARG 35   35   35   ARG ARG K . n 
M  13 36   ASP 36   36   36   ASP ASP K . n 
M  13 37   LYS 37   37   37   LYS LYS K . n 
M  13 38   HIS 38   38   38   HIS HIS K . n 
M  13 39   GLU 39   39   39   GLU GLU K . n 
M  13 40   PHE 40   40   40   PHE PHE K . n 
M  13 41   HIS 41   41   41   HIS HIS K . n 
M  13 42   ASN 42   42   42   ASN ASN K . n 
M  13 43   HIS 43   43   43   HIS HIS K . n 
M  13 44   GLU 44   44   44   GLU GLU K . n 
M  13 45   PRO 45   45   45   PRO PRO K . n 
M  13 46   LEU 46   46   46   LEU LEU K . n 
M  13 47   GLY 47   47   47   GLY GLY K . n 
M  13 48   LYS 48   48   48   LYS LYS K . n 
M  13 49   SER 49   49   49   SER SER K . n 
M  13 50   GLY 50   50   50   GLY GLY K . n 
M  13 51   PHE 51   51   51   PHE PHE K . n 
M  13 52   LYS 52   52   52   LYS LYS K . n 
M  13 53   ARG 53   53   53   ARG ARG K . n 
M  13 54   PRO 54   54   54   PRO PRO K . n 
M  13 55   GLN 55   55   55   GLN GLN K . n 
M  13 56   LYS 56   56   56   LYS LYS K . n 
M  13 57   VAL 57   57   57   VAL VAL K . n 
M  13 58   GLN 58   58   58   GLN GLN K . n 
M  13 59   GLU 59   59   59   GLU GLU K . n 
M  13 60   GLU 60   60   60   GLU GLU K . n 
M  13 61   ALA 61   61   61   ALA ALA K . n 
M  13 62   ALA 62   62   62   ALA ALA K . n 
M  13 63   THR 63   63   63   THR THR K . n 
M  13 64   ILE 64   64   64   ILE ILE K . n 
M  13 65   ASP 65   65   65   ASP ASP K . n 
M  13 66   VAL 66   66   66   VAL VAL K . n 
M  13 67   ARG 67   67   67   ARG ARG K . n 
M  13 68   GLU 68   68   68   GLU GLU K . n 
M  13 69   ILE 69   69   69   ILE ILE K . n 
M  13 70   ASP 70   70   70   ASP ASP K . n 
M  13 71   GLU 71   71   71   GLU GLU K . n 
M  13 72   ASN 72   72   72   ASN ASN K . n 
M  13 73   VAL 73   73   73   VAL VAL K . n 
M  13 74   THR 74   74   74   THR THR K . n 
M  13 75   LEU 75   75   75   LEU LEU K . n 
M  13 76   LEU 76   76   76   LEU LEU K . n 
M  13 77   ALA 77   77   77   ALA ALA K . n 
M  13 78   ALA 78   78   78   ALA ALA K . n 
M  13 79   ASP 79   79   79   ASP ASP K . n 
M  13 80   ASP 80   80   80   ASP ASP K . n 
M  13 81   VAL 81   81   81   VAL VAL K . n 
M  13 82   ALA 82   82   82   ALA ALA K . n 
M  13 83   GLU 83   83   83   GLU ALA K . n 
M  13 84   VAL 84   84   ?    ?   ?   K . n 
M  13 85   GLU 85   85   ?    ?   ?   K . n 
M  13 86   ASP 86   86   ?    ?   ?   K . n 
M  13 87   GLY 87   87   ?    ?   ?   K . n 
M  13 88   GLY 88   88   ?    ?   ?   K . n 
M  13 89   PHE 89   89   89   PHE PHE K . n 
M  13 90   ARG 90   90   90   ARG ARG K . n 
M  13 91   VAL 91   91   91   VAL VAL K . n 
M  13 92   ASP 92   92   92   ASP ASP K . n 
M  13 93   VAL 93   93   93   VAL VAL K . n 
M  13 94   ARG 94   94   94   ARG ARG K . n 
M  13 95   ASP 95   95   95   ASP ASP K . n 
M  13 96   VAL 96   96   96   VAL VAL K . n 
M  13 97   VAL 97   97   97   VAL VAL K . n 
M  13 98   GLU 98   98   98   GLU GLU K . n 
M  13 99   GLU 99   99   99   GLU GLU K . n 
M  13 100  ALA 100  100  100  ALA ALA K . n 
M  13 101  ASP 101  101  101  ASP ASP K . n 
M  13 102  ASP 102  102  102  ASP ASP K . n 
M  13 103  ALA 103  103  103  ALA ALA K . n 
M  13 104  ASP 104  104  104  ASP ASP K . n 
M  13 105  TYR 105  105  105  TYR TYR K . n 
M  13 106  VAL 106  106  106  VAL VAL K . n 
M  13 107  LYS 107  107  107  LYS LYS K . n 
M  13 108  VAL 108  108  108  VAL VAL K . n 
M  13 109  LEU 109  109  109  LEU LEU K . n 
M  13 110  GLY 110  110  110  GLY GLY K . n 
M  13 111  ALA 111  111  111  ALA ALA K . n 
M  13 112  GLY 112  112  112  GLY GLY K . n 
M  13 113  GLN 113  113  113  GLN GLN K . n 
M  13 114  VAL 114  114  114  VAL VAL K . n 
M  13 115  ARG 115  115  115  ARG ARG K . n 
M  13 116  HIS 116  116  116  HIS HIS K . n 
M  13 117  GLU 117  117  117  GLU GLU K . n 
M  13 118  LEU 118  118  118  LEU LEU K . n 
M  13 119  THR 119  119  119  THR THR K . n 
M  13 120  LEU 120  120  120  LEU LEU K . n 
M  13 121  ILE 121  121  121  ILE ILE K . n 
M  13 122  ALA 122  122  122  ALA ALA K . n 
M  13 123  ASP 123  123  123  ASP ASP K . n 
M  13 124  ASP 124  124  124  ASP ASP K . n 
M  13 125  PHE 125  125  125  PHE PHE K . n 
M  13 126  SER 126  126  126  SER SER K . n 
M  13 127  GLU 127  127  127  GLU GLU K . n 
M  13 128  GLY 128  128  128  GLY GLY K . n 
M  13 129  ALA 129  129  129  ALA ALA K . n 
M  13 130  ARG 130  130  130  ARG ARG K . n 
M  13 131  GLU 131  131  131  GLU GLU K . n 
M  13 132  LYS 132  132  132  LYS LYS K . n 
M  13 133  VAL 133  133  133  VAL VAL K . n 
M  13 134  GLU 134  134  134  GLU GLU K . n 
M  13 135  GLY 135  135  135  GLY GLY K . n 
M  13 136  ALA 136  136  136  ALA ALA K . n 
M  13 137  GLY 137  137  137  GLY GLY K . n 
M  13 138  GLY 138  138  138  GLY GLY K . n 
M  13 139  SER 139  139  139  SER SER K . n 
M  13 140  VAL 140  140  140  VAL VAL K . n 
M  13 141  GLU 141  141  141  GLU GLU K . n 
M  13 142  LEU 142  142  142  LEU LEU K . n 
M  13 143  THR 143  143  143  THR THR K . n 
M  13 144  ASP 144  144  144  ASP ASP K . n 
M  13 145  LEU 145  145  145  LEU LEU K . n 
M  13 146  GLY 146  146  146  GLY GLY K . n 
M  13 147  GLU 147  147  147  GLU GLU K . n 
M  13 148  GLU 148  148  148  GLU GLU K . n 
M  13 149  ARG 149  149  149  ARG ARG K . n 
M  13 150  GLN 150  150  150  GLN GLN K . n 
M  13 151  ALA 151  151  ?    ?   ?   K . n 
M  13 152  GLU 152  152  ?    ?   ?   K . n 
M  13 153  ALA 153  153  ?    ?   ?   K . n 
M  13 154  GLU 154  154  ?    ?   ?   K . n 
M  13 155  GLU 155  155  ?    ?   ?   K . n 
M  13 156  THR 156  156  ?    ?   ?   K . n 
M  13 157  GLU 157  157  ?    ?   ?   K . n 
M  13 158  ASP 158  158  ?    ?   ?   K . n 
M  13 159  ALA 159  159  ?    ?   ?   K . n 
M  13 160  ASP 160  160  ?    ?   ?   K . n 
M  13 161  ALA 161  161  ?    ?   ?   K . n 
M  13 162  ASP 162  162  ?    ?   ?   K . n 
M  13 163  GLU 163  163  ?    ?   ?   K . n 
M  13 164  GLU 164  164  ?    ?   ?   K . n 
N  14 1    ALA 1    1    1    ALA ALA L . n 
N  14 2    ARG 2    2    2    ARG ARG L . n 
N  14 3    SER 3    3    3    SER SER L . n 
N  14 4    ALA 4    4    4    ALA ALA L . n 
N  14 5    TYR 5    5    5    TYR TYR L . n 
N  14 6    SER 6    6    6    SER SER L . n 
N  14 7    TYR 7    7    7    TYR TYR L . n 
N  14 8    ILE 8    8    8    ILE ILE L . n 
N  14 9    ARG 9    9    9    ARG ARG L . n 
N  14 10   GLU 10   10   10   GLU GLU L . n 
N  14 11   ALA 11   11   11   ALA ALA L . n 
N  14 12   TRP 12   12   12   TRP TRP L . n 
N  14 13   LYS 13   13   13   LYS LYS L . n 
N  14 14   ARG 14   14   14   ARG ARG L . n 
N  14 15   PRO 15   15   15   PRO PRO L . n 
N  14 16   LYS 16   16   16   LYS LYS L . n 
N  14 17   GLU 17   17   17   GLU GLU L . n 
N  14 18   GLY 18   18   18   GLY GLY L . n 
N  14 19   GLN 19   19   19   GLN GLN L . n 
N  14 20   ILE 20   20   20   ILE ILE L . n 
N  14 21   ALA 21   21   21   ALA ALA L . n 
N  14 22   GLU 22   22   22   GLU GLU L . n 
N  14 23   LEU 23   23   23   LEU LEU L . n 
N  14 24   MET 24   24   24   MET MET L . n 
N  14 25   TRP 25   25   25   TRP TRP L . n 
N  14 26   HIS 26   26   26   HIS HIS L . n 
N  14 27   ARG 27   27   27   ARG ARG L . n 
N  14 28   MET 28   28   28   MET MET L . n 
N  14 29   GLN 29   29   29   GLN GLN L . n 
N  14 30   GLU 30   30   30   GLU GLU L . n 
N  14 31   TRP 31   31   31   TRP TRP L . n 
N  14 32   ARG 32   32   32   ARG ARG L . n 
N  14 33   ASN 33   33   33   ASN ASN L . n 
N  14 34   GLU 34   34   34   GLU GLU L . n 
N  14 35   PRO 35   35   35   PRO PRO L . n 
N  14 36   ALA 36   36   36   ALA ALA L . n 
N  14 37   VAL 37   37   37   VAL VAL L . n 
N  14 38   VAL 38   38   38   VAL VAL L . n 
N  14 39   ARG 39   39   39   ARG ARG L . n 
N  14 40   ILE 40   40   40   ILE ILE L . n 
N  14 41   GLU 41   41   41   GLU GLU L . n 
N  14 42   ARG 42   42   42   ARG ARG L . n 
N  14 43   PRO 43   43   43   PRO PRO L . n 
N  14 44   THR 44   44   44   THR THR L . n 
N  14 45   ARG 45   45   45   ARG ARG L . n 
N  14 46   LEU 46   46   46   LEU LEU L . n 
N  14 47   ASP 47   47   47   ASP ASP L . n 
N  14 48   ARG 48   48   48   ARG ARG L . n 
N  14 49   ALA 49   49   49   ALA ALA L . n 
N  14 50   ARG 50   50   50   ARG ARG L . n 
N  14 51   SER 51   51   51   SER SER L . n 
N  14 52   LEU 52   52   52   LEU LEU L . n 
N  14 53   GLY 53   53   53   GLY GLY L . n 
N  14 54   TYR 54   54   54   TYR TYR L . n 
N  14 55   LYS 55   55   55   LYS LYS L . n 
N  14 56   ALA 56   56   56   ALA ALA L . n 
N  14 57   LYS 57   57   57   LYS LYS L . n 
N  14 58   GLN 58   58   58   GLN GLN L . n 
N  14 59   GLY 59   59   59   GLY GLY L . n 
N  14 60   ILE 60   60   60   ILE ILE L . n 
N  14 61   ILE 61   61   61   ILE ILE L . n 
N  14 62   VAL 62   62   62   VAL VAL L . n 
N  14 63   VAL 63   63   63   VAL VAL L . n 
N  14 64   ARG 64   64   64   ARG ARG L . n 
N  14 65   VAL 65   65   65   VAL VAL L . n 
N  14 66   ALA 66   66   66   ALA ALA L . n 
N  14 67   ILE 67   67   67   ILE ILE L . n 
N  14 68   ARG 68   68   68   ARG ARG L . n 
N  14 69   LYS 69   69   69   LYS LYS L . n 
N  14 70   GLY 70   70   70   GLY GLY L . n 
N  14 71   SER 71   71   71   SER SER L . n 
N  14 72   SER 72   72   72   SER SER L . n 
N  14 73   ARG 73   73   73   ARG ARG L . n 
N  14 74   ARG 74   74   74   ARG ARG L . n 
N  14 75   THR 75   75   75   THR THR L . n 
N  14 76   ARG 76   76   76   ARG ARG L . n 
N  14 77   PHE 77   77   77   PHE PHE L . n 
N  14 78   ASN 78   78   78   ASN ASN L . n 
N  14 79   LYS 79   79   79   LYS LYS L . n 
N  14 80   GLY 80   80   80   GLY GLY L . n 
N  14 81   ARG 81   81   81   ARG ARG L . n 
N  14 82   ARG 82   82   82   ARG ARG L . n 
N  14 83   SER 83   83   83   SER SER L . n 
N  14 84   LYS 84   84   84   LYS LYS L . n 
N  14 85   ARG 85   85   85   ARG ARG L . n 
N  14 86   MET 86   86   86   MET MET L . n 
N  14 87   MET 87   87   87   MET MET L . n 
N  14 88   VAL 88   88   88   VAL VAL L . n 
N  14 89   ASN 89   89   89   ASN ASN L . n 
N  14 90   ARG 90   90   90   ARG ARG L . n 
N  14 91   ILE 91   91   91   ILE ILE L . n 
N  14 92   THR 92   92   92   THR THR L . n 
N  14 93   ARG 93   93   93   ARG ARG L . n 
N  14 94   LYS 94   94   94   LYS LYS L . n 
N  14 95   LYS 95   95   95   LYS LYS L . n 
N  14 96   ASN 96   96   96   ASN ASN L . n 
N  14 97   ILE 97   97   97   ILE ILE L . n 
N  14 98   GLN 98   98   98   GLN GLN L . n 
N  14 99   ARG 99   99   99   ARG ARG L . n 
N  14 100  ILE 100  100  100  ILE ILE L . n 
N  14 101  ALA 101  101  101  ALA ALA L . n 
N  14 102  GLU 102  102  102  GLU GLU L . n 
N  14 103  GLU 103  103  103  GLU GLU L . n 
N  14 104  ARG 104  104  104  ARG ARG L . n 
N  14 105  ALA 105  105  105  ALA ALA L . n 
N  14 106  ASN 106  106  106  ASN ASN L . n 
N  14 107  ARG 107  107  107  ARG ARG L . n 
N  14 108  LYS 108  108  108  LYS LYS L . n 
N  14 109  PHE 109  109  109  PHE PHE L . n 
N  14 110  PRO 110  110  110  PRO PRO L . n 
N  14 111  ASN 111  111  111  ASN ASN L . n 
N  14 112  LEU 112  112  112  LEU LEU L . n 
N  14 113  ARG 113  113  113  ARG ARG L . n 
N  14 114  VAL 114  114  114  VAL VAL L . n 
N  14 115  LEU 115  115  115  LEU LEU L . n 
N  14 116  ASN 116  116  116  ASN ASN L . n 
N  14 117  SER 117  117  117  SER SER L . n 
N  14 118  TYR 118  118  118  TYR TYR L . n 
N  14 119  SER 119  119  119  SER SER L . n 
N  14 120  VAL 120  120  120  VAL VAL L . n 
N  14 121  GLY 121  121  121  GLY GLY L . n 
N  14 122  GLU 122  122  122  GLU GLU L . n 
N  14 123  ASP 123  123  123  ASP ASP L . n 
N  14 124  GLY 124  124  124  GLY GLY L . n 
N  14 125  ARG 125  125  125  ARG ARG L . n 
N  14 126  HIS 126  126  126  HIS HIS L . n 
N  14 127  LYS 127  127  127  LYS LYS L . n 
N  14 128  TRP 128  128  128  TRP TRP L . n 
N  14 129  HIS 129  129  129  HIS HIS L . n 
N  14 130  GLU 130  130  130  GLU GLU L . n 
N  14 131  VAL 131  131  131  VAL VAL L . n 
N  14 132  ILE 132  132  132  ILE ILE L . n 
N  14 133  LEU 133  133  133  LEU LEU L . n 
N  14 134  ILE 134  134  134  ILE ILE L . n 
N  14 135  ASP 135  135  135  ASP ASP L . n 
N  14 136  PRO 136  136  136  PRO PRO L . n 
N  14 137  ASP 137  137  137  ASP ASP L . n 
N  14 138  HIS 138  138  138  HIS HIS L . n 
N  14 139  PRO 139  139  139  PRO PRO L . n 
N  14 140  ALA 140  140  140  ALA ALA L . n 
N  14 141  ILE 141  141  141  ILE ILE L . n 
N  14 142  LYS 142  142  142  LYS LYS L . n 
N  14 143  SER 143  143  143  SER SER L . n 
N  14 144  ASP 144  144  144  ASP ASP L . n 
N  14 145  ASP 145  145  145  ASP ASP L . n 
N  14 146  GLN 146  146  146  GLN GLN L . n 
N  14 147  LEU 147  147  147  LEU LEU L . n 
N  14 148  SER 148  148  148  SER SER L . n 
N  14 149  TRP 149  149  149  TRP TRP L . n 
N  14 150  ILE 150  150  150  ILE ILE L . n 
N  14 151  SER 151  151  151  SER SER L . n 
N  14 152  ARG 152  152  152  ARG ARG L . n 
N  14 153  THR 153  153  153  THR THR L . n 
N  14 154  ARG 154  154  154  ARG ARG L . n 
N  14 155  HIS 155  155  155  HIS HIS L . n 
N  14 156  ARG 156  156  156  ARG ARG L . n 
N  14 157  LEU 157  157  157  LEU LEU L . n 
N  14 158  ARG 158  158  158  ARG ARG L . n 
N  14 159  THR 159  159  159  THR THR L . n 
N  14 160  PHE 160  160  160  PHE PHE L . n 
N  14 161  ARG 161  161  161  ARG ARG L . n 
N  14 162  GLY 162  162  162  GLY GLY L . n 
N  14 163  LEU 163  163  163  LEU LEU L . n 
N  14 164  THR 164  164  164  THR THR L . n 
N  14 165  SER 165  165  165  SER SER L . n 
N  14 166  ALA 166  166  166  ALA ALA L . n 
N  14 167  GLY 167  167  167  GLY GLY L . n 
N  14 168  ARG 168  168  168  ARG ARG L . n 
N  14 169  ARG 169  169  169  ARG ARG L . n 
N  14 170  CYS 170  170  170  CYS CYS L . n 
N  14 171  ARG 171  171  171  ARG ARG L . n 
N  14 172  GLY 172  172  172  GLY GLY L . n 
N  14 173  LEU 173  173  173  LEU LEU L . n 
N  14 174  ARG 174  174  174  ARG ARG L . n 
N  14 175  GLY 175  175  175  GLY GLY L . n 
N  14 176  GLN 176  176  176  GLN GLN L . n 
N  14 177  GLY 177  177  177  GLY GLY L . n 
N  14 178  LYS 178  178  178  LYS LYS L . n 
N  14 179  GLY 179  179  179  GLY GLY L . n 
N  14 180  SER 180  180  180  SER SER L . n 
N  14 181  GLU 181  181  181  GLU GLU L . n 
N  14 182  LYS 182  182  182  LYS LYS L . n 
N  14 183  VAL 183  183  183  VAL VAL L . n 
N  14 184  ARG 184  184  184  ARG ARG L . n 
N  14 185  PRO 185  185  185  PRO CPR L . n 
N  14 186  SER 186  186  186  SER SER L . n 
N  14 187  LEU 187  187  187  LEU LEU L . n 
N  14 188  ARG 188  188  188  ARG ARG L . n 
N  14 189  VAL 189  189  189  VAL VAL L . n 
N  14 190  ASN 190  190  190  ASN ASN L . n 
N  14 191  GLY 191  191  191  GLY GLY L . n 
N  14 192  ALA 192  192  192  ALA ALA L . n 
N  14 193  LYS 193  193  193  LYS LYS L . n 
N  14 194  ALA 194  194  194  ALA ALA L . n 
O  15 1    ALA 1    1    1    ALA ALA M . n 
O  15 2    THR 2    2    2    THR THR M . n 
O  15 3    GLY 3    3    3    GLY GLY M . n 
O  15 4    PRO 4    4    4    PRO PRO M . n 
O  15 5    ARG 5    5    5    ARG ARG M . n 
O  15 6    TYR 6    6    6    TYR TYR M . n 
O  15 7    LYS 7    7    7    LYS LYS M . n 
O  15 8    VAL 8    8    8    VAL VAL M . n 
O  15 9    PRO 9    9    9    PRO PRO M . n 
O  15 10   MET 10   10   10   MET MET M . n 
O  15 11   ARG 11   11   11   ARG ARG M . n 
O  15 12   ARG 12   12   12   ARG ARG M . n 
O  15 13   ARG 13   13   13   ARG ARG M . n 
O  15 14   ARG 14   14   14   ARG ARG M . n 
O  15 15   GLU 15   15   15   GLU GLU M . n 
O  15 16   ALA 16   16   16   ALA ALA M . n 
O  15 17   ARG 17   17   17   ARG ARG M . n 
O  15 18   THR 18   18   18   THR THR M . n 
O  15 19   ASP 19   19   19   ASP ASP M . n 
O  15 20   TYR 20   20   20   TYR TYR M . n 
O  15 21   HIS 21   21   21   HIS HIS M . n 
O  15 22   GLN 22   22   22   GLN GLN M . n 
O  15 23   ARG 23   23   23   ARG ARG M . n 
O  15 24   LEU 24   24   24   LEU LEU M . n 
O  15 25   ARG 25   25   25   ARG ARG M . n 
O  15 26   LEU 26   26   26   LEU LEU M . n 
O  15 27   LEU 27   27   27   LEU LEU M . n 
O  15 28   LYS 28   28   28   LYS LYS M . n 
O  15 29   SER 29   29   29   SER SER M . n 
O  15 30   GLY 30   30   30   GLY GLY M . n 
O  15 31   LYS 31   31   31   LYS LYS M . n 
O  15 32   PRO 32   32   32   PRO PRO M . n 
O  15 33   ARG 33   33   33   ARG ARG M . n 
O  15 34   LEU 34   34   34   LEU LEU M . n 
O  15 35   VAL 35   35   35   VAL VAL M . n 
O  15 36   ALA 36   36   36   ALA ALA M . n 
O  15 37   ARG 37   37   37   ARG ARG M . n 
O  15 38   LYS 38   38   38   LYS LYS M . n 
O  15 39   SER 39   39   39   SER SER M . n 
O  15 40   ASN 40   40   40   ASN ASN M . n 
O  15 41   LYS 41   41   41   LYS LYS M . n 
O  15 42   HIS 42   42   42   HIS HIS M . n 
O  15 43   VAL 43   43   43   VAL VAL M . n 
O  15 44   ARG 44   44   44   ARG ARG M . n 
O  15 45   ALA 45   45   45   ALA ALA M . n 
O  15 46   GLN 46   46   46   GLN GLN M . n 
O  15 47   LEU 47   47   47   LEU LEU M . n 
O  15 48   VAL 48   48   48   VAL VAL M . n 
O  15 49   THR 49   49   49   THR THR M . n 
O  15 50   LEU 50   50   50   LEU LEU M . n 
O  15 51   GLY 51   51   51   GLY GLY M . n 
O  15 52   PRO 52   52   52   PRO PRO M . n 
O  15 53   ASN 53   53   53   ASN ASN M . n 
O  15 54   GLY 54   54   54   GLY GLY M . n 
O  15 55   ASP 55   55   55   ASP ASP M . n 
O  15 56   ASP 56   56   56   ASP ASP M . n 
O  15 57   THR 57   57   57   THR THR M . n 
O  15 58   LEU 58   58   58   LEU LEU M . n 
O  15 59   ALA 59   59   59   ALA ALA M . n 
O  15 60   SER 60   60   60   SER SER M . n 
O  15 61   ALA 61   61   61   ALA ALA M . n 
O  15 62   HIS 62   62   62   HIS HIS M . n 
O  15 63   SER 63   63   63   SER SER M . n 
O  15 64   SER 64   64   64   SER SER M . n 
O  15 65   ASP 65   65   65   ASP ASP M . n 
O  15 66   LEU 66   66   66   LEU LEU M . n 
O  15 67   ALA 67   67   67   ALA ALA M . n 
O  15 68   GLU 68   68   68   GLU GLU M . n 
O  15 69   TYR 69   69   69   TYR TYR M . n 
O  15 70   GLY 70   70   70   GLY GLY M . n 
O  15 71   TRP 71   71   71   TRP TRP M . n 
O  15 72   GLU 72   72   72   GLU GLU M . n 
O  15 73   ALA 73   73   73   ALA ALA M . n 
O  15 74   PRO 74   74   74   PRO PRO M . n 
O  15 75   THR 75   75   75   THR THR M . n 
O  15 76   GLY 76   76   76   GLY GLY M . n 
O  15 77   ASN 77   77   77   ASN ASN M . n 
O  15 78   MET 78   78   78   MET MET M . n 
O  15 79   PRO 79   79   79   PRO PRO M . n 
O  15 80   SER 80   80   80   SER SER M . n 
O  15 81   ALA 81   81   81   ALA ALA M . n 
O  15 82   TYR 82   82   82   TYR TYR M . n 
O  15 83   LEU 83   83   83   LEU LEU M . n 
O  15 84   THR 84   84   84   THR THR M . n 
O  15 85   GLY 85   85   85   GLY GLY M . n 
O  15 86   LEU 86   86   86   LEU LEU M . n 
O  15 87   LEU 87   87   87   LEU LEU M . n 
O  15 88   ALA 88   88   88   ALA ALA M . n 
O  15 89   GLY 89   89   89   GLY GLY M . n 
O  15 90   LEU 90   90   90   LEU LEU M . n 
O  15 91   ARG 91   91   91   ARG ARG M . n 
O  15 92   ALA 92   92   92   ALA ALA M . n 
O  15 93   GLN 93   93   93   GLN GLN M . n 
O  15 94   GLU 94   94   94   GLU GLU M . n 
O  15 95   ALA 95   95   95   ALA ALA M . n 
O  15 96   GLY 96   96   96   GLY GLY M . n 
O  15 97   VAL 97   97   97   VAL VAL M . n 
O  15 98   GLU 98   98   98   GLU GLU M . n 
O  15 99   GLU 99   99   99   GLU GLU M . n 
O  15 100  ALA 100  100  100  ALA ALA M . n 
O  15 101  VAL 101  101  101  VAL VAL M . n 
O  15 102  LEU 102  102  102  LEU LEU M . n 
O  15 103  ASP 103  103  103  ASP ASP M . n 
O  15 104  ILE 104  104  104  ILE ILE M . n 
O  15 105  GLY 105  105  105  GLY GLY M . n 
O  15 106  LEU 106  106  106  LEU LEU M . n 
O  15 107  ASN 107  107  107  ASN ASN M . n 
O  15 108  SER 108  108  108  SER SER M . n 
O  15 109  PRO 109  109  109  PRO PRO M . n 
O  15 110  THR 110  110  110  THR THR M . n 
O  15 111  PRO 111  111  111  PRO PRO M . n 
O  15 112  GLY 112  112  112  GLY GLY M . n 
O  15 113  SER 113  113  113  SER SER M . n 
O  15 114  LYS 114  114  114  LYS LYS M . n 
O  15 115  VAL 115  115  115  VAL VAL M . n 
O  15 116  PHE 116  116  116  PHE PHE M . n 
O  15 117  ALA 117  117  117  ALA ALA M . n 
O  15 118  ILE 118  118  118  ILE ILE M . n 
O  15 119  GLN 119  119  119  GLN GLN M . n 
O  15 120  GLU 120  120  120  GLU GLU M . n 
O  15 121  GLY 121  121  121  GLY GLY M . n 
O  15 122  ALA 122  122  122  ALA ALA M . n 
O  15 123  ILE 123  123  123  ILE ILE M . n 
O  15 124  ASP 124  124  124  ASP ASP M . n 
O  15 125  ALA 125  125  125  ALA ALA M . n 
O  15 126  GLY 126  126  126  GLY GLY M . n 
O  15 127  LEU 127  127  127  LEU LEU M . n 
O  15 128  ASP 128  128  128  ASP ASP M . n 
O  15 129  ILE 129  129  129  ILE ILE M . n 
O  15 130  PRO 130  130  130  PRO PRO M . n 
O  15 131  HIS 131  131  131  HIS HIS M . n 
O  15 132  ASN 132  132  132  ASN ASN M . n 
O  15 133  ASP 133  133  133  ASP ASP M . n 
O  15 134  ASP 134  134  134  ASP ASP M . n 
O  15 135  VAL 135  135  135  VAL VAL M . n 
O  15 136  LEU 136  136  136  LEU LEU M . n 
O  15 137  ALA 137  137  137  ALA ALA M . n 
O  15 138  ASP 138  138  138  ASP ASP M . n 
O  15 139  TRP 139  139  139  TRP TRP M . n 
O  15 140  GLN 140  140  140  GLN GLN M . n 
O  15 141  ARG 141  141  141  ARG ARG M . n 
O  15 142  THR 142  142  142  THR THR M . n 
O  15 143  ARG 143  143  143  ARG ARG M . n 
O  15 144  GLY 144  144  144  GLY GLY M . n 
O  15 145  ALA 145  145  145  ALA ALA M . n 
O  15 146  HIS 146  146  146  HIS HIS M . n 
O  15 147  ILE 147  147  147  ILE ILE M . n 
O  15 148  ALA 148  148  148  ALA ALA M . n 
O  15 149  GLU 149  149  149  GLU GLU M . n 
O  15 150  TYR 150  150  150  TYR TYR M . n 
O  15 151  ASP 151  151  151  ASP ASP M . n 
O  15 152  GLU 152  152  152  GLU GLU M . n 
O  15 153  GLN 153  153  153  GLN GLN M . n 
O  15 154  LEU 154  154  154  LEU LEU M . n 
O  15 155  GLU 155  155  155  GLU GLU M . n 
O  15 156  GLU 156  156  156  GLU GLU M . n 
O  15 157  PRO 157  157  157  PRO PRO M . n 
O  15 158  LEU 158  158  158  LEU LEU M . n 
O  15 159  TYR 159  159  159  TYR TYR M . n 
O  15 160  SER 160  160  160  SER SER M . n 
O  15 161  GLY 161  161  161  GLY GLY M . n 
O  15 162  ASP 162  162  162  ASP ASP M . n 
O  15 163  PHE 163  163  163  PHE PHE M . n 
O  15 164  ASP 164  164  164  ASP ASP M . n 
O  15 165  ALA 165  165  165  ALA ALA M . n 
O  15 166  ALA 166  166  166  ALA ALA M . n 
O  15 167  ASP 167  167  167  ASP ASP M . n 
O  15 168  LEU 168  168  168  LEU LEU M . n 
O  15 169  PRO 169  169  169  PRO PRO M . n 
O  15 170  GLU 170  170  170  GLU GLU M . n 
O  15 171  HIS 171  171  171  HIS HIS M . n 
O  15 172  PHE 172  172  172  PHE PHE M . n 
O  15 173  ASP 173  173  173  ASP ASP M . n 
O  15 174  GLU 174  174  174  GLU GLU M . n 
O  15 175  LEU 175  175  175  LEU LEU M . n 
O  15 176  ARG 176  176  176  ARG ARG M . n 
O  15 177  GLU 177  177  177  GLU GLU M . n 
O  15 178  THR 178  178  178  THR THR M . n 
O  15 179  LEU 179  179  179  LEU LEU M . n 
O  15 180  LEU 180  180  180  LEU LEU M . n 
O  15 181  ASP 181  181  181  ASP ASP M . n 
O  15 182  GLY 182  182  182  GLY GLY M . n 
O  15 183  ASP 183  183  183  ASP ASP M . n 
O  15 184  ILE 184  184  184  ILE ILE M . n 
O  15 185  GLU 185  185  185  GLU GLU M . n 
O  15 186  LEU 186  186  186  LEU LEU M . n 
P  16 1    SER 1    1    1    SER SER N . n 
P  16 2    LYS 2    2    2    LYS LYS N . n 
P  16 3    THR 3    3    3    THR THR N . n 
P  16 4    ASN 4    4    4    ASN ASN N . n 
P  16 5    PRO 5    5    5    PRO PRO N . n 
P  16 6    ARG 6    6    6    ARG ARG N . n 
P  16 7    LEU 7    7    7    LEU LEU N . n 
P  16 8    SER 8    8    8    SER SER N . n 
P  16 9    SER 9    9    9    SER SER N . n 
P  16 10   LEU 10   10   10   LEU LEU N . n 
P  16 11   ILE 11   11   11   ILE ILE N . n 
P  16 12   ALA 12   12   12   ALA ALA N . n 
P  16 13   ASP 13   13   13   ASP ASP N . n 
P  16 14   LEU 14   14   14   LEU LEU N . n 
P  16 15   LYS 15   15   15   LYS LYS N . n 
P  16 16   SER 16   16   16   SER SER N . n 
P  16 17   ALA 17   17   17   ALA ALA N . n 
P  16 18   ALA 18   18   18   ALA ALA N . n 
P  16 19   ARG 19   19   19   ARG ARG N . n 
P  16 20   SER 20   20   20   SER SER N . n 
P  16 21   SER 21   21   21   SER SER N . n 
P  16 22   GLY 22   22   22   GLY GLY N . n 
P  16 23   GLY 23   23   23   GLY GLY N . n 
P  16 24   ALA 24   24   24   ALA ALA N . n 
P  16 25   VAL 25   25   25   VAL VAL N . n 
P  16 26   TRP 26   26   26   TRP TRP N . n 
P  16 27   GLY 27   27   27   GLY GLY N . n 
P  16 28   ASP 28   28   28   ASP ASP N . n 
P  16 29   VAL 29   29   29   VAL VAL N . n 
P  16 30   ALA 30   30   30   ALA ALA N . n 
P  16 31   GLU 31   31   31   GLU GLU N . n 
P  16 32   ARG 32   32   32   ARG ARG N . n 
P  16 33   LEU 33   33   33   LEU LEU N . n 
P  16 34   GLU 34   34   34   GLU GLU N . n 
P  16 35   LYS 35   35   35   LYS LYS N . n 
P  16 36   PRO 36   36   36   PRO PRO N . n 
P  16 37   ARG 37   37   37   ARG ARG N . n 
P  16 38   ARG 38   38   38   ARG ARG N . n 
P  16 39   THR 39   39   39   THR THR N . n 
P  16 40   HIS 40   40   40   HIS HIS N . n 
P  16 41   ALA 41   41   41   ALA ALA N . n 
P  16 42   GLU 42   42   42   GLU GLU N . n 
P  16 43   VAL 43   43   43   VAL VAL N . n 
P  16 44   ASN 44   44   44   ASN ASN N . n 
P  16 45   LEU 45   45   45   LEU LEU N . n 
P  16 46   GLY 46   46   46   GLY GLY N . n 
P  16 47   ARG 47   47   47   ARG ARG N . n 
P  16 48   ILE 48   48   48   ILE ILE N . n 
P  16 49   GLU 49   49   49   GLU GLU N . n 
P  16 50   ARG 50   50   50   ARG ARG N . n 
P  16 51   TYR 51   51   51   TYR TYR N . n 
P  16 52   ALA 52   52   52   ALA ALA N . n 
P  16 53   GLN 53   53   53   GLN GLN N . n 
P  16 54   GLU 54   54   54   GLU GLU N . n 
P  16 55   ASP 55   55   55   ASP ASP N . n 
P  16 56   GLU 56   56   56   GLU GLU N . n 
P  16 57   THR 57   57   57   THR THR N . n 
P  16 58   VAL 58   58   58   VAL VAL N . n 
P  16 59   VAL 59   59   59   VAL VAL N . n 
P  16 60   VAL 60   60   60   VAL VAL N . n 
P  16 61   PRO 61   61   61   PRO PRO N . n 
P  16 62   GLY 62   62   62   GLY GLY N . n 
P  16 63   LYS 63   63   63   LYS LYS N . n 
P  16 64   VAL 64   64   64   VAL VAL N . n 
P  16 65   LEU 65   65   65   LEU LEU N . n 
P  16 66   GLY 66   66   66   GLY GLY N . n 
P  16 67   SER 67   67   67   SER SER N . n 
P  16 68   GLY 68   68   68   GLY GLY N . n 
P  16 69   VAL 69   69   69   VAL VAL N . n 
P  16 70   LEU 70   70   70   LEU LEU N . n 
P  16 71   GLN 71   71   71   GLN GLN N . n 
P  16 72   LYS 72   72   72   LYS LYS N . n 
P  16 73   ASP 73   73   73   ASP ASP N . n 
P  16 74   VAL 74   74   74   VAL VAL N . n 
P  16 75   THR 75   75   75   THR THR N . n 
P  16 76   VAL 76   76   76   VAL VAL N . n 
P  16 77   ALA 77   77   77   ALA ALA N . n 
P  16 78   ALA 78   78   78   ALA ALA N . n 
P  16 79   VAL 79   79   79   VAL VAL N . n 
P  16 80   ASP 80   80   80   ASP ASP N . n 
P  16 81   PHE 81   81   81   PHE PHE N . n 
P  16 82   SER 82   82   82   SER SER N . n 
P  16 83   GLY 83   83   83   GLY GLY N . n 
P  16 84   THR 84   84   84   THR THR N . n 
P  16 85   ALA 85   85   85   ALA ALA N . n 
P  16 86   GLU 86   86   86   GLU GLU N . n 
P  16 87   THR 87   87   87   THR THR N . n 
P  16 88   LYS 88   88   88   LYS LYS N . n 
P  16 89   ILE 89   89   89   ILE ILE N . n 
P  16 90   ASP 90   90   90   ASP ASP N . n 
P  16 91   GLN 91   91   91   GLN GLN N . n 
P  16 92   VAL 92   92   92   VAL VAL N . n 
P  16 93   GLY 93   93   93   GLY GLY N . n 
P  16 94   GLU 94   94   94   GLU GLU N . n 
P  16 95   ALA 95   95   95   ALA ALA N . n 
P  16 96   VAL 96   96   96   VAL VAL N . n 
P  16 97   SER 97   97   97   SER SER N . n 
P  16 98   LEU 98   98   98   LEU LEU N . n 
P  16 99   GLU 99   99   99   GLU GLU N . n 
P  16 100  GLN 100  100  100  GLN GLN N . n 
P  16 101  ALA 101  101  101  ALA ALA N . n 
P  16 102  ILE 102  102  102  ILE ILE N . n 
P  16 103  GLU 103  103  103  GLU GLU N . n 
P  16 104  ASN 104  104  104  ASN ASN N . n 
P  16 105  ASN 105  105  105  ASN ASN N . n 
P  16 106  PRO 106  106  106  PRO PRO N . n 
P  16 107  GLU 107  107  107  GLU GLU N . n 
P  16 108  GLY 108  108  108  GLY GLY N . n 
P  16 109  SER 109  109  109  SER SER N . n 
P  16 110  HIS 110  110  110  HIS HIS N . n 
P  16 111  VAL 111  111  111  VAL VAL N . n 
P  16 112  ARG 112  112  112  ARG ARG N . n 
P  16 113  VAL 113  113  113  VAL VAL N . n 
P  16 114  ILE 114  114  114  ILE ILE N . n 
P  16 115  ARG 115  115  115  ARG ARG N . n 
Q  17 1    THR 1    1    1    THR THR O . n 
Q  17 2    ASP 2    2    2    ASP ASP O . n 
Q  17 3    LEU 3    3    3    LEU LEU O . n 
Q  17 4    SER 4    4    4    SER SER O . n 
Q  17 5    ALA 5    5    5    ALA ALA O . n 
Q  17 6    GLN 6    6    6    GLN GLN O . n 
Q  17 7    LYS 7    7    7    LYS LYS O . n 
Q  17 8    ARG 8    8    8    ARG ARG O . n 
Q  17 9    LEU 9    9    9    LEU LEU O . n 
Q  17 10   ALA 10   10   10   ALA ALA O . n 
Q  17 11   ALA 11   11   11   ALA ALA O . n 
Q  17 12   ASP 12   12   12   ASP ASP O . n 
Q  17 13   VAL 13   13   13   VAL VAL O . n 
Q  17 14   LEU 14   14   14   LEU LEU O . n 
Q  17 15   ASP 15   15   15   ASP ASP O . n 
Q  17 16   VAL 16   16   16   VAL VAL O . n 
Q  17 17   GLY 17   17   17   GLY GLY O . n 
Q  17 18   LYS 18   18   18   LYS LYS O . n 
Q  17 19   ASN 19   19   19   ASN ASN O . n 
Q  17 20   ARG 20   20   20   ARG ARG O . n 
Q  17 21   VAL 21   21   21   VAL VAL O . n 
Q  17 22   TRP 22   22   22   TRP TRP O . n 
Q  17 23   PHE 23   23   23   PHE PHE O . n 
Q  17 24   ASN 24   24   24   ASN ASN O . n 
Q  17 25   PRO 25   25   25   PRO PRO O . n 
Q  17 26   GLU 26   26   26   GLU GLU O . n 
Q  17 27   ARG 27   27   27   ARG ARG O . n 
Q  17 28   GLN 28   28   28   GLN GLN O . n 
Q  17 29   GLY 29   29   29   GLY GLY O . n 
Q  17 30   ASP 30   30   30   ASP ASP O . n 
Q  17 31   ILE 31   31   31   ILE ILE O . n 
Q  17 32   ALA 32   32   32   ALA ALA O . n 
Q  17 33   ASP 33   33   33   ASP ASP O . n 
Q  17 34   ALA 34   34   34   ALA ALA O . n 
Q  17 35   ILE 35   35   35   ILE ILE O . n 
Q  17 36   THR 36   36   36   THR THR O . n 
Q  17 37   ARG 37   37   37   ARG ARG O . n 
Q  17 38   GLU 38   38   38   GLU GLU O . n 
Q  17 39   ASP 39   39   39   ASP ASP O . n 
Q  17 40   VAL 40   40   40   VAL VAL O . n 
Q  17 41   ARG 41   41   41   ARG ARG O . n 
Q  17 42   GLU 42   42   42   GLU GLU O . n 
Q  17 43   LEU 43   43   43   LEU LEU O . n 
Q  17 44   VAL 44   44   44   VAL VAL O . n 
Q  17 45   ASP 45   45   45   ASP ASP O . n 
Q  17 46   GLU 46   46   46   GLU GLU O . n 
Q  17 47   GLY 47   47   47   GLY GLY O . n 
Q  17 48   ALA 48   48   48   ALA ALA O . n 
Q  17 49   ILE 49   49   49   ILE ILE O . n 
Q  17 50   GLN 50   50   50   GLN GLN O . n 
Q  17 51   ALA 51   51   51   ALA ALA O . n 
Q  17 52   LYS 52   52   52   LYS LYS O . n 
Q  17 53   ASP 53   53   53   ASP ASP O . n 
Q  17 54   LYS 54   54   54   LYS LYS O . n 
Q  17 55   LYS 55   55   55   LYS LYS O . n 
Q  17 56   GLY 56   56   56   GLY GLY O . n 
Q  17 57   ASN 57   57   57   ASN ASN O . n 
Q  17 58   SER 58   58   58   SER SER O . n 
Q  17 59   ARG 59   59   59   ARG ARG O . n 
Q  17 60   GLY 60   60   60   GLY GLY O . n 
Q  17 61   ARG 61   61   61   ARG ARG O . n 
Q  17 62   ALA 62   62   62   ALA ALA O . n 
Q  17 63   ARG 63   63   63   ARG ARG O . n 
Q  17 64   GLU 64   64   64   GLU GLU O . n 
Q  17 65   ARG 65   65   65   ARG ARG O . n 
Q  17 66   GLN 66   66   66   GLN GLN O . n 
Q  17 67   LYS 67   67   67   LYS LYS O . n 
Q  17 68   LYS 68   68   68   LYS LYS O . n 
Q  17 69   ARG 69   69   69   ARG ARG O . n 
Q  17 70   ALA 70   70   70   ALA ALA O . n 
Q  17 71   LYS 71   71   71   LYS LYS O . n 
Q  17 72   GLY 72   72   72   GLY GLY O . n 
Q  17 73   HIS 73   73   73   HIS HIS O . n 
Q  17 74   GLN 74   74   74   GLN GLN O . n 
Q  17 75   LYS 75   75   75   LYS LYS O . n 
Q  17 76   GLY 76   76   76   GLY GLY O . n 
Q  17 77   ALA 77   77   77   ALA ALA O . n 
Q  17 78   GLY 78   78   78   GLY GLY O . n 
Q  17 79   SER 79   79   79   SER SER O . n 
Q  17 80   ARG 80   80   80   ARG ARG O . n 
Q  17 81   LYS 81   81   81   LYS LYS O . n 
Q  17 82   GLY 82   82   82   GLY GLY O . n 
Q  17 83   LYS 83   83   83   LYS LYS O . n 
Q  17 84   ALA 84   84   84   ALA ALA O . n 
Q  17 85   GLY 85   85   85   GLY GLY O . n 
Q  17 86   ALA 86   86   86   ALA ALA O . n 
Q  17 87   ARG 87   87   87   ARG ARG O . n 
Q  17 88   GLN 88   88   88   GLN GLN O . n 
Q  17 89   ASN 89   89   89   ASN ASN O . n 
Q  17 90   SER 90   90   90   SER SER O . n 
Q  17 91   LYS 91   91   91   LYS LYS O . n 
Q  17 92   GLU 92   92   92   GLU GLU O . n 
Q  17 93   ASP 93   93   93   ASP ASP O . n 
Q  17 94   TRP 94   94   94   TRP TRP O . n 
Q  17 95   GLU 95   95   95   GLU GLU O . n 
Q  17 96   SER 96   96   96   SER SER O . n 
Q  17 97   ARG 97   97   97   ARG ARG O . n 
Q  17 98   ILE 98   98   98   ILE ILE O . n 
Q  17 99   ARG 99   99   99   ARG ARG O . n 
Q  17 100  ALA 100  100  100  ALA ALA O . n 
Q  17 101  GLN 101  101  101  GLN GLN O . n 
Q  17 102  ARG 102  102  102  ARG ARG O . n 
Q  17 103  THR 103  103  103  THR THR O . n 
Q  17 104  LYS 104  104  104  LYS LYS O . n 
Q  17 105  LEU 105  105  105  LEU LEU O . n 
Q  17 106  ARG 106  106  106  ARG ARG O . n 
Q  17 107  GLU 107  107  107  GLU GLU O . n 
Q  17 108  LEU 108  108  108  LEU LEU O . n 
Q  17 109  ARG 109  109  109  ARG ARG O . n 
Q  17 110  ASP 110  110  110  ASP ASP O . n 
Q  17 111  GLU 111  111  111  GLU GLU O . n 
Q  17 112  GLY 112  112  112  GLY GLY O . n 
Q  17 113  THR 113  113  113  THR THR O . n 
Q  17 114  LEU 114  114  114  LEU LEU O . n 
Q  17 115  SER 115  115  115  SER SER O . n 
Q  17 116  SER 116  116  116  SER SER O . n 
Q  17 117  SER 117  117  117  SER SER O . n 
Q  17 118  GLN 118  118  118  GLN GLN O . n 
Q  17 119  TYR 119  119  119  TYR TYR O . n 
Q  17 120  ARG 120  120  120  ARG ARG O . n 
Q  17 121  ASP 121  121  121  ASP ASP O . n 
Q  17 122  LEU 122  122  122  LEU LEU O . n 
Q  17 123  TYR 123  123  123  TYR TYR O . n 
Q  17 124  ASP 124  124  124  ASP ASP O . n 
Q  17 125  LYS 125  125  125  LYS LYS O . n 
Q  17 126  ALA 126  126  126  ALA ALA O . n 
Q  17 127  GLY 127  127  127  GLY GLY O . n 
Q  17 128  GLY 128  128  128  GLY GLY O . n 
Q  17 129  GLY 129  129  129  GLY GLY O . n 
Q  17 130  GLU 130  130  130  GLU GLU O . n 
Q  17 131  PHE 131  131  131  PHE PHE O . n 
Q  17 132  ASP 132  132  132  ASP ASP O . n 
Q  17 133  SER 133  133  133  SER SER O . n 
Q  17 134  VAL 134  134  134  VAL VAL O . n 
Q  17 135  ALA 135  135  135  ALA ALA O . n 
Q  17 136  ASP 136  136  136  ASP ASP O . n 
Q  17 137  LEU 137  137  137  LEU LEU O . n 
Q  17 138  GLU 138  138  138  GLU GLU O . n 
Q  17 139  ARG 139  139  139  ARG ARG O . n 
Q  17 140  TYR 140  140  140  TYR TYR O . n 
Q  17 141  ILE 141  141  141  ILE ILE O . n 
Q  17 142  ASP 142  142  142  ASP ASP O . n 
Q  17 143  ALA 143  143  143  ALA ALA O . n 
Q  17 144  ASN 144  144  ?    ?   ?   O . n 
Q  17 145  HIS 145  145  ?    ?   ?   O . n 
Q  17 146  GLY 146  146  ?    ?   ?   O . n 
Q  17 147  ASP 147  147  ?    ?   ?   O . n 
Q  17 148  ALA 148  148  ?    ?   ?   O . n 
R  18 1    PRO 1    1    1    PRO PRO P . n 
R  18 2    SER 2    2    2    SER SER P . n 
R  18 3    SER 3    3    3    SER SER P . n 
R  18 4    ASN 4    4    4    ASN ASN P . n 
R  18 5    GLY 5    5    5    GLY GLY P . n 
R  18 6    PRO 6    6    6    PRO PRO P . n 
R  18 7    LEU 7    7    7    LEU LEU P . n 
R  18 8    GLU 8    8    8    GLU GLU P . n 
R  18 9    GLY 9    9    9    GLY GLY P . n 
R  18 10   THR 10   10   10   THR THR P . n 
R  18 11   ARG 11   11   11   ARG ARG P . n 
R  18 12   GLY 12   12   12   GLY GLY P . n 
R  18 13   LYS 13   13   13   LYS LYS P . n 
R  18 14   LEU 14   14   14   LEU LEU P . n 
R  18 15   LYS 15   15   15   LYS LYS P . n 
R  18 16   ASN 16   16   16   ASN ASN P . n 
R  18 17   LYS 17   17   17   LYS LYS P . n 
R  18 18   PRO 18   18   18   PRO PRO P . n 
R  18 19   ARG 19   19   19   ARG ARG P . n 
R  18 20   ASP 20   20   20   ASP ASP P . n 
R  18 21   ARG 21   21   21   ARG ARG P . n 
R  18 22   GLY 22   22   22   GLY GLY P . n 
R  18 23   THR 23   23   23   THR THR P . n 
R  18 24   SER 24   24   24   SER SER P . n 
R  18 25   PRO 25   25   25   PRO PRO P . n 
R  18 26   PRO 26   26   26   PRO PRO P . n 
R  18 27   GLN 27   27   27   GLN GLN P . n 
R  18 28   ARG 28   28   28   ARG ARG P . n 
R  18 29   ALA 29   29   29   ALA ALA P . n 
R  18 30   VAL 30   30   30   VAL VAL P . n 
R  18 31   GLU 31   31   31   GLU GLU P . n 
R  18 32   GLU 32   32   32   GLU GLU P . n 
R  18 33   PHE 33   33   33   PHE PHE P . n 
R  18 34   ASP 34   34   34   ASP ASP P . n 
R  18 35   ASP 35   35   35   ASP ASP P . n 
R  18 36   GLY 36   36   36   GLY GLY P . n 
R  18 37   GLU 37   37   37   GLU GLU P . n 
R  18 38   LYS 38   38   38   LYS LYS P . n 
R  18 39   VAL 39   39   39   VAL VAL P . n 
R  18 40   HIS 40   40   40   HIS HIS P . n 
R  18 41   LEU 41   41   41   LEU LEU P . n 
R  18 42   LYS 42   42   42   LYS LYS P . n 
R  18 43   ILE 43   43   43   ILE ILE P . n 
R  18 44   ASP 44   44   44   ASP ASP P . n 
R  18 45   PRO 45   45   45   PRO PRO P . n 
R  18 46   SER 46   46   46   SER SER P . n 
R  18 47   VAL 47   47   47   VAL VAL P . n 
R  18 48   PRO 48   48   48   PRO PRO P . n 
R  18 49   ASN 49   49   49   ASN ASN P . n 
R  18 50   GLY 50   50   50   GLY GLY P . n 
R  18 51   ARG 51   51   51   ARG ARG P . n 
R  18 52   PHE 52   52   52   PHE PHE P . n 
R  18 53   HIS 53   53   53   HIS HIS P . n 
R  18 54   PRO 54   54   54   PRO PRO P . n 
R  18 55   ARG 55   55   55   ARG ARG P . n 
R  18 56   PHE 56   56   56   PHE PHE P . n 
R  18 57   ASP 57   57   57   ASP ASP P . n 
R  18 58   GLY 58   58   58   GLY GLY P . n 
R  18 59   GLN 59   59   59   GLN GLN P . n 
R  18 60   THR 60   60   60   THR THR P . n 
R  18 61   GLY 61   61   61   GLY GLY P . n 
R  18 62   THR 62   62   62   THR THR P . n 
R  18 63   VAL 63   63   63   VAL VAL P . n 
R  18 64   GLU 64   64   64   GLU GLU P . n 
R  18 65   GLY 65   65   65   GLY GLY P . n 
R  18 66   LYS 66   66   66   LYS LYS P . n 
R  18 67   GLN 67   67   67   GLN GLN P . n 
R  18 68   GLY 68   68   68   GLY GLY P . n 
R  18 69   ASP 69   69   69   ASP ASP P . n 
R  18 70   ALA 70   70   70   ALA ALA P . n 
R  18 71   TYR 71   71   71   TYR TYR P . n 
R  18 72   LYS 72   72   72   LYS LYS P . n 
R  18 73   VAL 73   73   73   VAL VAL P . n 
R  18 74   ASP 74   74   74   ASP ASP P . n 
R  18 75   ILE 75   75   75   ILE ILE P . n 
R  18 76   VAL 76   76   76   VAL VAL P . n 
R  18 77   ASP 77   77   77   ASP ASP P . n 
R  18 78   GLY 78   78   78   GLY GLY P . n 
R  18 79   GLY 79   79   79   GLY GLY P . n 
R  18 80   LYS 80   80   80   LYS LYS P . n 
R  18 81   GLU 81   81   81   GLU GLU P . n 
R  18 82   LYS 82   82   82   LYS LYS P . n 
R  18 83   THR 83   83   83   THR THR P . n 
R  18 84   ILE 84   84   84   ILE ILE P . n 
R  18 85   ILE 85   85   85   ILE ILE P . n 
R  18 86   VAL 86   86   86   VAL VAL P . n 
R  18 87   THR 87   87   87   THR THR P . n 
R  18 88   ALA 88   88   88   ALA ALA P . n 
R  18 89   ALA 89   89   89   ALA ALA P . n 
R  18 90   HIS 90   90   90   HIS HIS P . n 
R  18 91   LEU 91   91   91   LEU LEU P . n 
R  18 92   ARG 92   92   92   ARG ARG P . n 
R  18 93   ARG 93   93   93   ARG ARG P . n 
R  18 94   GLN 94   94   94   GLN GLN P . n 
R  18 95   GLU 95   95   95   GLU GLU P . n 
S  19 1    GLY 1    1    1    GLY GLY Q . n 
S  19 2    ILE 2    2    2    ILE ILE Q . n 
S  19 3    SER 3    3    3    SER SER Q . n 
S  19 4    TYR 4    4    4    TYR TYR Q . n 
S  19 5    SER 5    5    5    SER SER Q . n 
S  19 6    VAL 6    6    6    VAL VAL Q . n 
S  19 7    GLU 7    7    7    GLU GLU Q . n 
S  19 8    ALA 8    8    8    ALA ALA Q . n 
S  19 9    ASP 9    9    9    ASP ASP Q . n 
S  19 10   PRO 10   10   10   PRO PRO Q . n 
S  19 11   ASP 11   11   11   ASP ASP Q . n 
S  19 12   THR 12   12   12   THR THR Q . n 
S  19 13   THR 13   13   13   THR THR Q . n 
S  19 14   ALA 14   14   14   ALA ALA Q . n 
S  19 15   LYS 15   15   15   LYS LYS Q . n 
S  19 16   ALA 16   16   16   ALA ALA Q . n 
S  19 17   MET 17   17   17   MET MET Q . n 
S  19 18   LEU 18   18   18   LEU LEU Q . n 
S  19 19   ARG 19   19   19   ARG ARG Q . n 
S  19 20   GLU 20   20   20   GLU GLU Q . n 
S  19 21   ARG 21   21   21   ARG ARG Q . n 
S  19 22   GLN 22   22   22   GLN GLN Q . n 
S  19 23   MET 23   23   23   MET MET Q . n 
S  19 24   SER 24   24   24   SER SER Q . n 
S  19 25   PHE 25   25   25   PHE PHE Q . n 
S  19 26   LYS 26   26   26   LYS LYS Q . n 
S  19 27   HIS 27   27   27   HIS HIS Q . n 
S  19 28   SER 28   28   28   SER SER Q . n 
S  19 29   LYS 29   29   29   LYS LYS Q . n 
S  19 30   ALA 30   30   30   ALA ALA Q . n 
S  19 31   ILE 31   31   31   ILE ILE Q . n 
S  19 32   ALA 32   32   32   ALA ALA Q . n 
S  19 33   ARG 33   33   33   ARG ARG Q . n 
S  19 34   GLU 34   34   34   GLU GLU Q . n 
S  19 35   ILE 35   35   35   ILE ILE Q . n 
S  19 36   LYS 36   36   36   LYS LYS Q . n 
S  19 37   GLY 37   37   37   GLY GLY Q . n 
S  19 38   LYS 38   38   38   LYS LYS Q . n 
S  19 39   THR 39   39   39   THR THR Q . n 
S  19 40   ALA 40   40   40   ALA ALA Q . n 
S  19 41   GLY 41   41   41   GLY GLY Q . n 
S  19 42   GLU 42   42   42   GLU GLU Q . n 
S  19 43   ALA 43   43   43   ALA ALA Q . n 
S  19 44   VAL 44   44   44   VAL VAL Q . n 
S  19 45   ASP 45   45   45   ASP ASP Q . n 
S  19 46   TYR 46   46   46   TYR TYR Q . n 
S  19 47   LEU 47   47   47   LEU LEU Q . n 
S  19 48   GLU 48   48   48   GLU GLU Q . n 
S  19 49   ALA 49   49   49   ALA ALA Q . n 
S  19 50   VAL 50   50   50   VAL VAL Q . n 
S  19 51   ILE 51   51   51   ILE ILE Q . n 
S  19 52   GLU 52   52   52   GLU GLU Q . n 
S  19 53   GLY 53   53   53   GLY GLY Q . n 
S  19 54   ASP 54   54   54   ASP ASP Q . n 
S  19 55   GLN 55   55   55   GLN GLN Q . n 
S  19 56   PRO 56   56   56   PRO PRO Q . n 
S  19 57   VAL 57   57   57   VAL VAL Q . n 
S  19 58   PRO 58   58   58   PRO PRO Q . n 
S  19 59   PHE 59   59   59   PHE PHE Q . n 
S  19 60   LYS 60   60   60   LYS LYS Q . n 
S  19 61   GLN 61   61   61   GLN GLN Q . n 
S  19 62   HIS 62   62   62   HIS HIS Q . n 
S  19 63   ASN 63   63   63   ASN ASN Q . n 
S  19 64   SER 64   64   64   SER SER Q . n 
S  19 65   GLY 65   65   65   GLY GLY Q . n 
S  19 66   VAL 66   66   66   VAL VAL Q . n 
S  19 67   GLY 67   67   67   GLY GLY Q . n 
S  19 68   HIS 68   68   68   HIS HIS Q . n 
S  19 69   LYS 69   69   69   LYS LYS Q . n 
S  19 70   SER 70   70   70   SER SER Q . n 
S  19 71   LYS 71   71   71   LYS LYS Q . n 
S  19 72   VAL 72   72   72   VAL VAL Q . n 
S  19 73   ASP 73   73   73   ASP ASP Q . n 
S  19 74   GLY 74   74   74   GLY GLY Q . n 
S  19 75   TRP 75   75   75   TRP TRP Q . n 
S  19 76   ASP 76   76   76   ASP ASP Q . n 
S  19 77   ALA 77   77   77   ALA ALA Q . n 
S  19 78   GLY 78   78   78   GLY GLY Q . n 
S  19 79   ARG 79   79   79   ARG ARG Q . n 
S  19 80   TYR 80   80   80   TYR TYR Q . n 
S  19 81   PRO 81   81   81   PRO PRO Q . n 
S  19 82   GLU 82   82   82   GLU GLU Q . n 
S  19 83   LYS 83   83   83   LYS LYS Q . n 
S  19 84   ALA 84   84   84   ALA ALA Q . n 
S  19 85   SER 85   85   85   SER SER Q . n 
S  19 86   LYS 86   86   86   LYS LYS Q . n 
S  19 87   ALA 87   87   87   ALA ALA Q . n 
S  19 88   PHE 88   88   88   PHE PHE Q . n 
S  19 89   LEU 89   89   89   LEU LEU Q . n 
S  19 90   ASP 90   90   90   ASP ASP Q . n 
S  19 91   LEU 91   91   91   LEU LEU Q . n 
S  19 92   LEU 92   92   92   LEU LEU Q . n 
S  19 93   GLU 93   93   93   GLU GLU Q . n 
S  19 94   ASN 94   94   94   ASN ASN Q . n 
S  19 95   ALA 95   95   95   ALA ALA Q . n 
S  19 96   VAL 96   96   96   VAL VAL Q . n 
S  19 97   GLY 97   97   97   GLY GLY Q . n 
S  19 98   ASN 98   98   98   ASN ASN Q . n 
S  19 99   ALA 99   99   99   ALA ALA Q . n 
S  19 100  ASP 100  100  100  ASP ASP Q . n 
S  19 101  HIS 101  101  101  HIS HIS Q . n 
S  19 102  GLN 102  102  102  GLN GLN Q . n 
S  19 103  GLY 103  103  103  GLY GLY Q . n 
S  19 104  PHE 104  104  104  PHE PHE Q . n 
S  19 105  ASP 105  105  105  ASP ASP Q . n 
S  19 106  GLY 106  106  106  GLY GLY Q . n 
S  19 107  GLU 107  107  107  GLU GLU Q . n 
S  19 108  ALA 108  108  108  ALA ALA Q . n 
S  19 109  MET 109  109  109  MET MET Q . n 
S  19 110  THR 110  110  110  THR THR Q . n 
S  19 111  ILE 111  111  111  ILE ILE Q . n 
S  19 112  LYS 112  112  112  LYS LYS Q . n 
S  19 113  HIS 113  113  113  HIS HIS Q . n 
S  19 114  VAL 114  114  114  VAL VAL Q . n 
S  19 115  ALA 115  115  115  ALA ALA Q . n 
S  19 116  ALA 116  116  116  ALA ALA Q . n 
S  19 117  HIS 117  117  117  HIS HIS Q . n 
S  19 118  LYS 118  118  118  LYS LYS Q . n 
S  19 119  VAL 119  119  119  VAL VAL Q . n 
S  19 120  GLY 120  120  120  GLY GLY Q . n 
S  19 121  GLU 121  121  121  GLU GLU Q . n 
S  19 122  GLN 122  122  122  GLN GLN Q . n 
S  19 123  GLN 123  123  123  GLN GLN Q . n 
S  19 124  GLY 124  124  124  GLY GLY Q . n 
S  19 125  ARG 125  125  125  ARG ARG Q . n 
S  19 126  LYS 126  126  126  LYS LYS Q . n 
S  19 127  PRO 127  127  127  PRO PRO Q . n 
S  19 128  ARG 128  128  128  ARG ARG Q . n 
S  19 129  ALA 129  129  129  ALA ALA Q . n 
S  19 130  MET 130  130  130  MET MET Q . n 
S  19 131  GLY 131  131  131  GLY GLY Q . n 
S  19 132  ARG 132  132  132  ARG ARG Q . n 
S  19 133  ALA 133  133  133  ALA ALA Q . n 
S  19 134  SER 134  134  134  SER SER Q . n 
S  19 135  ALA 135  135  135  ALA ALA Q . n 
S  19 136  TRP 136  136  136  TRP TRP Q . n 
S  19 137  ASN 137  137  137  ASN ASN Q . n 
S  19 138  SER 138  138  138  SER SER Q . n 
S  19 139  PRO 139  139  139  PRO PRO Q . n 
S  19 140  GLN 140  140  140  GLN GLN Q . n 
S  19 141  VAL 141  141  141  VAL VAL Q . n 
S  19 142  ASP 142  142  142  ASP ASP Q . n 
S  19 143  VAL 143  143  143  VAL VAL Q . n 
S  19 144  GLU 144  144  144  GLU GLU Q . n 
S  19 145  LEU 145  145  145  LEU LEU Q . n 
S  19 146  ILE 146  146  146  ILE ILE Q . n 
S  19 147  LEU 147  147  147  LEU LEU Q . n 
S  19 148  GLU 148  148  148  GLU GLU Q . n 
S  19 149  GLU 149  149  149  GLU GLU Q . n 
S  19 150  PRO 150  150  150  PRO PRO Q . n 
S  19 151  GLU 151  151  ?    ?   ?   Q . n 
S  19 152  VAL 152  152  ?    ?   ?   Q . n 
S  19 153  GLU 153  153  ?    ?   ?   Q . n 
S  19 154  ASP 154  154  ?    ?   ?   Q . n 
T  20 1    SER 1    1    1    SER SER R . n 
T  20 2    TRP 2    2    2    TRP TRP R . n 
T  20 3    ASP 3    3    3    ASP ASP R . n 
T  20 4    VAL 4    4    4    VAL VAL R . n 
T  20 5    ILE 5    5    5    ILE ILE R . n 
T  20 6    LYS 6    6    6    LYS LYS R . n 
T  20 7    HIS 7    7    7    HIS HIS R . n 
T  20 8    PRO 8    8    8    PRO PRO R . n 
T  20 9    HIS 9    9    9    HIS HIS R . n 
T  20 10   VAL 10   10   10   VAL VAL R . n 
T  20 11   THR 11   11   11   THR THR R . n 
T  20 12   GLU 12   12   12   GLU GLU R . n 
T  20 13   LYS 13   13   13   LYS LYS R . n 
T  20 14   ALA 14   14   14   ALA ALA R . n 
T  20 15   MET 15   15   15   MET MET R . n 
T  20 16   ASN 16   16   16   ASN ASN R . n 
T  20 17   ASP 17   17   17   ASP ASP R . n 
T  20 18   MET 18   18   18   MET MET R . n 
T  20 19   ASP 19   19   19   ASP ASP R . n 
T  20 20   PHE 20   20   20   PHE PHE R . n 
T  20 21   GLN 21   21   21   GLN GLN R . n 
T  20 22   ASN 22   22   22   ASN ASN R . n 
T  20 23   LYS 23   23   23   LYS LYS R . n 
T  20 24   LEU 24   24   24   LEU LEU R . n 
T  20 25   GLN 25   25   25   GLN GLN R . n 
T  20 26   PHE 26   26   26   PHE PHE R . n 
T  20 27   ALA 27   27   27   ALA ALA R . n 
T  20 28   VAL 28   28   28   VAL VAL R . n 
T  20 29   ASP 29   29   29   ASP ASP R . n 
T  20 30   ASP 30   30   30   ASP ASP R . n 
T  20 31   ARG 31   31   31   ARG ARG R . n 
T  20 32   ALA 32   32   32   ALA ALA R . n 
T  20 33   SER 33   33   33   SER SER R . n 
T  20 34   LYS 34   34   34   LYS LYS R . n 
T  20 35   GLY 35   35   35   GLY GLY R . n 
T  20 36   GLU 36   36   36   GLU GLU R . n 
T  20 37   VAL 37   37   37   VAL VAL R . n 
T  20 38   ALA 38   38   38   ALA ALA R . n 
T  20 39   ASP 39   39   39   ASP ASP R . n 
T  20 40   ALA 40   40   40   ALA ALA R . n 
T  20 41   VAL 41   41   41   VAL VAL R . n 
T  20 42   GLU 42   42   42   GLU GLU R . n 
T  20 43   GLU 43   43   43   GLU GLU R . n 
T  20 44   GLN 44   44   44   GLN GLN R . n 
T  20 45   TYR 45   45   45   TYR TYR R . n 
T  20 46   ASP 46   46   46   ASP ASP R . n 
T  20 47   VAL 47   47   47   VAL VAL R . n 
T  20 48   THR 48   48   48   THR THR R . n 
T  20 49   VAL 49   49   49   VAL VAL R . n 
T  20 50   GLU 50   50   50   GLU GLU R . n 
T  20 51   GLN 51   51   51   GLN GLN R . n 
T  20 52   VAL 52   52   52   VAL VAL R . n 
T  20 53   ASN 53   53   53   ASN ASN R . n 
T  20 54   THR 54   54   54   THR THR R . n 
T  20 55   GLN 55   55   55   GLN GLN R . n 
T  20 56   ASN 56   56   56   ASN ASN R . n 
T  20 57   THR 57   57   57   THR THR R . n 
T  20 58   MET 58   58   58   MET MET R . n 
T  20 59   ASP 59   59   59   ASP ASP R . n 
T  20 60   GLY 60   60   60   GLY GLY R . n 
T  20 61   GLU 61   61   61   GLU GLU R . n 
T  20 62   LYS 62   62   62   LYS LYS R . n 
T  20 63   LYS 63   63   63   LYS LYS R . n 
T  20 64   ALA 64   64   64   ALA ALA R . n 
T  20 65   VAL 65   65   65   VAL VAL R . n 
T  20 66   VAL 66   66   66   VAL VAL R . n 
T  20 67   ARG 67   67   67   ARG ARG R . n 
T  20 68   LEU 68   68   68   LEU LEU R . n 
T  20 69   SER 69   69   69   SER SER R . n 
T  20 70   GLU 70   70   70   GLU GLU R . n 
T  20 71   ASP 71   71   71   ASP ASP R . n 
T  20 72   ASP 72   72   72   ASP ASP R . n 
T  20 73   ASP 73   73   73   ASP ASP R . n 
T  20 74   ALA 74   74   74   ALA ALA R . n 
T  20 75   GLN 75   75   75   GLN GLN R . n 
T  20 76   GLU 76   76   76   GLU GLU R . n 
T  20 77   VAL 77   77   77   VAL VAL R . n 
T  20 78   ALA 78   78   78   ALA ALA R . n 
T  20 79   SER 79   79   79   SER SER R . n 
T  20 80   ARG 80   80   80   ARG ARG R . n 
T  20 81   ILE 81   81   81   ILE ILE R . n 
T  20 82   GLY 82   82   ?    ?   ?   R . n 
T  20 83   VAL 83   83   ?    ?   ?   R . n 
T  20 84   PHE 84   84   ?    ?   ?   R . n 
U  21 1    SER 1    1    1    SER SER S . n 
U  21 2    LYS 2    2    2    LYS LYS S . n 
U  21 3    GLN 3    3    3    GLN GLN S . n 
U  21 4    PRO 4    4    4    PRO PRO S . n 
U  21 5    ASP 5    5    5    ASP ASP S . n 
U  21 6    LYS 6    6    6    LYS LYS S . n 
U  21 7    GLN 7    7    7    GLN GLN S . n 
U  21 8    ARG 8    8    8    ARG ARG S . n 
U  21 9    LYS 9    9    9    LYS LYS S . n 
U  21 10   SER 10   10   10   SER SER S . n 
U  21 11   GLN 11   11   11   GLN GLN S . n 
U  21 12   ARG 12   12   12   ARG ARG S . n 
U  21 13   ARG 13   13   13   ARG ARG S . n 
U  21 14   ALA 14   14   14   ALA ALA S . n 
U  21 15   PRO 15   15   15   PRO PRO S . n 
U  21 16   LEU 16   16   16   LEU LEU S . n 
U  21 17   HIS 17   17   17   HIS HIS S . n 
U  21 18   GLU 18   18   18   GLU GLU S . n 
U  21 19   ARG 19   19   19   ARG ARG S . n 
U  21 20   HIS 20   20   20   HIS HIS S . n 
U  21 21   LYS 21   21   21   LYS LYS S . n 
U  21 22   GLN 22   22   22   GLN GLN S . n 
U  21 23   VAL 23   23   23   VAL VAL S . n 
U  21 24   ARG 24   24   24   ARG ARG S . n 
U  21 25   ALA 25   25   25   ALA ALA S . n 
U  21 26   THR 26   26   26   THR THR S . n 
U  21 27   LEU 27   27   27   LEU LEU S . n 
U  21 28   SER 28   28   28   SER SER S . n 
U  21 29   ALA 29   29   29   ALA ALA S . n 
U  21 30   ASP 30   30   30   ASP ASP S . n 
U  21 31   LEU 31   31   31   LEU LEU S . n 
U  21 32   ARG 32   32   32   ARG ARG S . n 
U  21 33   GLU 33   33   33   GLU GLU S . n 
U  21 34   GLU 34   34   34   GLU GLU S . n 
U  21 35   TYR 35   35   35   TYR TYR S . n 
U  21 36   GLY 36   36   36   GLY GLY S . n 
U  21 37   GLN 37   37   37   GLN GLN S . n 
U  21 38   ARG 38   38   38   ARG ARG S . n 
U  21 39   ASN 39   39   39   ASN ASN S . n 
U  21 40   VAL 40   40   40   VAL VAL S . n 
U  21 41   ARG 41   41   41   ARG ARG S . n 
U  21 42   VAL 42   42   42   VAL VAL S . n 
U  21 43   ASN 43   43   43   ASN ASN S . n 
U  21 44   ALA 44   44   44   ALA ALA S . n 
U  21 45   GLY 45   45   45   GLY GLY S . n 
U  21 46   ASP 46   46   46   ASP ASP S . n 
U  21 47   THR 47   47   47   THR THR S . n 
U  21 48   VAL 48   48   48   VAL VAL S . n 
U  21 49   GLU 49   49   49   GLU GLU S . n 
U  21 50   VAL 50   50   50   VAL VAL S . n 
U  21 51   LEU 51   51   51   LEU LEU S . n 
U  21 52   ARG 52   52   52   ARG ARG S . n 
U  21 53   GLY 53   53   53   GLY GLY S . n 
U  21 54   ASP 54   54   54   ASP ASP S . n 
U  21 55   PHE 55   55   55   PHE PHE S . n 
U  21 56   ALA 56   56   56   ALA ALA S . n 
U  21 57   GLY 57   57   57   GLY GLY S . n 
U  21 58   GLU 58   58   58   GLU GLU S . n 
U  21 59   GLU 59   59   59   GLU GLU S . n 
U  21 60   GLY 60   60   60   GLY GLY S . n 
U  21 61   GLU 61   61   61   GLU GLU S . n 
U  21 62   VAL 62   62   62   VAL VAL S . n 
U  21 63   ILE 63   63   63   ILE ILE S . n 
U  21 64   ASN 64   64   64   ASN ASN S . n 
U  21 65   VAL 65   65   65   VAL VAL S . n 
U  21 66   ASP 66   66   66   ASP ASP S . n 
U  21 67   LEU 67   67   67   LEU LEU S . n 
U  21 68   ASP 68   68   68   ASP ASP S . n 
U  21 69   LYS 69   69   69   LYS LYS S . n 
U  21 70   ALA 70   70   70   ALA ALA S . n 
U  21 71   VAL 71   71   71   VAL VAL S . n 
U  21 72   ILE 72   72   72   ILE ILE S . n 
U  21 73   HIS 73   73   73   HIS HIS S . n 
U  21 74   VAL 74   74   74   VAL VAL S . n 
U  21 75   GLU 75   75   75   GLU GLU S . n 
U  21 76   ASP 76   76   76   ASP ASP S . n 
U  21 77   VAL 77   77   77   VAL VAL S . n 
U  21 78   THR 78   78   78   THR THR S . n 
U  21 79   LEU 79   79   79   LEU LEU S . n 
U  21 80   GLU 80   80   80   GLU GLU S . n 
U  21 81   LYS 81   81   81   LYS LYS S . n 
U  21 82   THR 82   82   82   THR THR S . n 
U  21 83   ASP 83   83   83   ASP ASP S . n 
U  21 84   GLY 84   84   84   GLY GLY S . n 
U  21 85   GLU 85   85   85   GLU GLU S . n 
U  21 86   GLU 86   86   86   GLU GLU S . n 
U  21 87   VAL 87   87   87   VAL VAL S . n 
U  21 88   PRO 88   88   88   PRO PRO S . n 
U  21 89   ARG 89   89   89   ARG ARG S . n 
U  21 90   PRO 90   90   90   PRO PRO S . n 
U  21 91   LEU 91   91   91   LEU LEU S . n 
U  21 92   ASP 92   92   92   ASP ASP S . n 
U  21 93   THR 93   93   93   THR THR S . n 
U  21 94   SER 94   94   94   SER SER S . n 
U  21 95   ASN 95   95   95   ASN ASN S . n 
U  21 96   VAL 96   96   96   VAL VAL S . n 
U  21 97   ARG 97   97   97   ARG ARG S . n 
U  21 98   VAL 98   98   98   VAL VAL S . n 
U  21 99   THR 99   99   99   THR THR S . n 
U  21 100  ASP 100  100  100  ASP ASP S . n 
U  21 101  LEU 101  101  101  LEU LEU S . n 
U  21 102  ASP 102  102  102  ASP ASP S . n 
U  21 103  LEU 103  103  103  LEU LEU S . n 
U  21 104  GLU 104  104  104  GLU GLU S . n 
U  21 105  ASP 105  105  105  ASP ASP S . n 
U  21 106  GLU 106  106  106  GLU GLU S . n 
U  21 107  LYS 107  107  107  LYS LYS S . n 
U  21 108  ARG 108  108  108  ARG ARG S . n 
U  21 109  GLU 109  109  109  GLU GLU S . n 
U  21 110  ALA 110  110  110  ALA ALA S . n 
U  21 111  ARG 111  111  111  ARG ARG S . n 
U  21 112  LEU 112  112  112  LEU LEU S . n 
U  21 113  GLU 113  113  113  GLU GLU S . n 
U  21 114  SER 114  114  114  SER SER S . n 
U  21 115  GLU 115  115  115  GLU GLU S . n 
U  21 116  ASP 116  116  116  ASP ASP S . n 
U  21 117  ASP 117  117  117  ASP ASP S . n 
U  21 118  SER 118  118  118  SER SER S . n 
U  21 119  ALA 119  119  119  ALA ALA S . n 
V  22 1    PRO 1    1    ?    ?   ?   T . n 
V  22 2    ARG 2    2    ?    ?   ?   T . n 
V  22 3    THR 3    3    ?    ?   ?   T . n 
V  22 4    ARG 4    4    4    ARG ARG T . n 
V  22 5    GLU 5    5    5    GLU GLU T . n 
V  22 6    CYS 6    6    6    CYS CYS T . n 
V  22 7    ASP 7    7    7    ASP ASP T . n 
V  22 8    TYR 8    8    8    TYR TYR T . n 
V  22 9    CYS 9    9    9    CYS CYS T . n 
V  22 10   GLY 10   10   10   GLY GLY T . n 
V  22 11   THR 11   11   11   THR THR T . n 
V  22 12   ASP 12   12   12   ASP ASP T . n 
V  22 13   ILE 13   13   13   ILE ILE T . n 
V  22 14   GLU 14   14   14   GLU GLU T . n 
V  22 15   PRO 15   15   15   PRO PRO T . n 
V  22 16   GLY 16   16   16   GLY GLY T . n 
V  22 17   THR 17   17   17   THR THR T . n 
V  22 18   GLY 18   18   18   GLY GLY T . n 
V  22 19   THR 19   19   19   THR THR T . n 
V  22 20   MET 20   20   20   MET MET T . n 
V  22 21   PHE 21   21   21   PHE PHE T . n 
V  22 22   VAL 22   22   22   VAL VAL T . n 
V  22 23   HIS 23   23   23   HIS HIS T . n 
V  22 24   LYS 24   24   24   LYS LYS T . n 
V  22 25   ASP 25   25   25   ASP ASP T . n 
V  22 26   GLY 26   26   26   GLY GLY T . n 
V  22 27   ALA 27   27   27   ALA ALA T . n 
V  22 28   THR 28   28   28   THR THR T . n 
V  22 29   THR 29   29   29   THR THR T . n 
V  22 30   HIS 30   30   30   HIS HIS T . n 
V  22 31   PHE 31   31   31   PHE PHE T . n 
V  22 32   CYS 32   32   32   CYS CYS T . n 
V  22 33   SER 33   33   33   SER SER T . n 
V  22 34   SER 34   34   34   SER SER T . n 
V  22 35   LYS 35   35   35   LYS LYS T . n 
V  22 36   CYS 36   36   36   CYS CYS T . n 
V  22 37   GLU 37   37   37   GLU GLU T . n 
V  22 38   ASN 38   38   38   ASN ASN T . n 
V  22 39   ASN 39   39   39   ASN ASN T . n 
V  22 40   ALA 40   40   40   ALA ALA T . n 
V  22 41   ASP 41   41   41   ASP ASP T . n 
V  22 42   LEU 42   42   42   LEU LEU T . n 
V  22 43   GLY 43   43   43   GLY GLY T . n 
V  22 44   ARG 44   44   44   ARG ARG T . n 
V  22 45   GLU 45   45   45   GLU GLU T . n 
V  22 46   ALA 46   46   46   ALA ALA T . n 
V  22 47   ARG 47   47   47   ARG ARG T . n 
V  22 48   ASN 48   48   48   ASN ASN T . n 
V  22 49   LEU 49   49   49   LEU LEU T . n 
V  22 50   GLU 50   50   50   GLU GLU T . n 
V  22 51   TRP 51   51   51   TRP TRP T . n 
V  22 52   THR 52   52   52   THR THR T . n 
V  22 53   ASP 53   53   53   ASP ASP T . n 
V  22 54   THR 54   54   54   THR THR T . n 
V  22 55   ALA 55   55   55   ALA ALA T . n 
V  22 56   ARG 56   56   56   ARG ARG T . n 
V  22 57   GLY 57   57   ?    ?   ?   T . n 
V  22 58   GLU 58   58   ?    ?   ?   T . n 
V  22 59   ALA 59   59   ?    ?   ?   T . n 
V  22 60   GLY 60   60   ?    ?   ?   T . n 
V  22 61   GLU 61   61   ?    ?   ?   T . n 
V  22 62   ALA 62   62   ?    ?   ?   T . n 
V  22 63   GLU 63   63   ?    ?   ?   T . n 
V  22 64   ASP 64   64   ?    ?   ?   T . n 
V  22 65   GLU 65   65   ?    ?   ?   T . n 
V  22 66   ALA 66   66   ?    ?   ?   T . n 
W  23 1    THR 1    1    1    THR THR U . n 
W  23 2    VAL 2    2    2    VAL VAL U . n 
W  23 3    LEU 3    3    3    LEU LEU U . n 
W  23 4    HIS 4    4    4    HIS HIS U . n 
W  23 5    VAL 5    5    5    VAL VAL U . n 
W  23 6    GLN 6    6    6    GLN GLN U . n 
W  23 7    GLU 7    7    7    GLU GLU U . n 
W  23 8    ILE 8    8    8    ILE ILE U . n 
W  23 9    ARG 9    9    9    ARG ARG U . n 
W  23 10   ASP 10   10   10   ASP ASP U . n 
W  23 11   MET 11   11   11   MET MET U . n 
W  23 12   THR 12   12   12   THR THR U . n 
W  23 13   PRO 13   13   13   PRO PRO U . n 
W  23 14   ALA 14   14   14   ALA ALA U . n 
W  23 15   GLU 15   15   15   GLU GLU U . n 
W  23 16   ARG 16   16   16   ARG ARG U . n 
W  23 17   GLU 17   17   17   GLU GLU U . n 
W  23 18   ALA 18   18   18   ALA ALA U . n 
W  23 19   GLU 19   19   19   GLU GLU U . n 
W  23 20   LEU 20   20   20   LEU LEU U . n 
W  23 21   ASP 21   21   21   ASP ASP U . n 
W  23 22   ASP 22   22   22   ASP ASP U . n 
W  23 23   LEU 23   23   23   LEU LEU U . n 
W  23 24   LYS 24   24   24   LYS LYS U . n 
W  23 25   THR 25   25   25   THR THR U . n 
W  23 26   GLU 26   26   26   GLU GLU U . n 
W  23 27   LEU 27   27   27   LEU LEU U . n 
W  23 28   LEU 28   28   28   LEU LEU U . n 
W  23 29   ASN 29   29   29   ASN ASN U . n 
W  23 30   ALA 30   30   30   ALA ALA U . n 
W  23 31   ARG 31   31   31   ARG ARG U . n 
W  23 32   ALA 32   32   32   ALA ALA U . n 
W  23 33   VAL 33   33   33   VAL VAL U . n 
W  23 34   GLN 34   34   34   GLN GLN U . n 
W  23 35   ALA 35   35   35   ALA ALA U . n 
W  23 36   ALA 36   36   36   ALA ALA U . n 
W  23 37   GLY 37   37   37   GLY GLY U . n 
W  23 38   GLY 38   38   38   GLY GLY U . n 
W  23 39   ALA 39   39   39   ALA ALA U . n 
W  23 40   PRO 40   40   40   PRO PRO U . n 
W  23 41   GLU 41   41   41   GLU GLU U . n 
W  23 42   ASN 42   42   42   ASN ASN U . n 
W  23 43   PRO 43   43   43   PRO PRO U . n 
W  23 44   GLY 44   44   44   GLY GLY U . n 
W  23 45   ARG 45   45   45   ARG ARG U . n 
W  23 46   ILE 46   46   46   ILE ILE U . n 
W  23 47   LYS 47   47   47   LYS LYS U . n 
W  23 48   GLU 48   48   48   GLU GLU U . n 
W  23 49   LEU 49   49   49   LEU LEU U . n 
W  23 50   ARG 50   50   50   ARG ARG U . n 
W  23 51   LYS 51   51   51   LYS LYS U . n 
W  23 52   ALA 52   52   52   ALA ALA U . n 
W  23 53   ILE 53   53   53   ILE ILE U . n 
W  23 54   ALA 54   54   54   ALA ALA U . n 
W  23 55   ARG 55   55   55   ARG ARG U . n 
W  23 56   ILE 56   56   56   ILE ILE U . n 
W  23 57   LYS 57   57   57   LYS LYS U . n 
W  23 58   THR 58   58   58   THR THR U . n 
W  23 59   ILE 59   59   59   ILE ILE U . n 
W  23 60   GLN 60   60   60   GLN GLN U . n 
W  23 61   GLY 61   61   61   GLY GLY U . n 
W  23 62   GLU 62   62   62   GLU GLU U . n 
W  23 63   GLU 63   63   63   GLU GLU U . n 
W  23 64   GLY 64   64   64   GLY GLY U . n 
W  23 65   ASP 65   65   65   ASP ASP U . n 
W  23 66   LEU 66   66   ?    ?   ?   U . n 
W  23 67   GLN 67   67   ?    ?   ?   U . n 
W  23 68   GLU 68   68   ?    ?   ?   U . n 
W  23 69   ASN 69   69   ?    ?   ?   U . n 
W  23 70   GLU 70   70   ?    ?   ?   U . n 
X  24 1    MET 1    1    1    MET MET V . n 
X  24 2    HIS 2    2    2    HIS HIS V . n 
X  24 3    ALA 3    3    3    ALA ALA V . n 
X  24 4    LEU 4    4    4    LEU LEU V . n 
X  24 5    VAL 5    5    5    VAL VAL V . n 
X  24 6    GLN 6    6    6    GLN GLN V . n 
X  24 7    LEU 7    7    7    LEU LEU V . n 
X  24 8    ARG 8    8    8    ARG ARG V . n 
X  24 9    GLY 9    9    9    GLY GLY V . n 
X  24 10   GLU 10   10   10   GLU GLU V . n 
X  24 11   VAL 11   11   11   VAL VAL V . n 
X  24 12   ASN 12   12   12   ASN ASN V . n 
X  24 13   MET 13   13   13   MET MET V . n 
X  24 14   HIS 14   14   14   HIS HIS V . n 
X  24 15   THR 15   15   15   THR THR V . n 
X  24 16   ASP 16   16   16   ASP ASP V . n 
X  24 17   ILE 17   17   17   ILE ILE V . n 
X  24 18   GLN 18   18   18   GLN GLN V . n 
X  24 19   ASP 19   19   19   ASP ASP V . n 
X  24 20   THR 20   20   20   THR THR V . n 
X  24 21   LEU 21   21   21   LEU LEU V . n 
X  24 22   GLU 22   22   22   GLU GLU V . n 
X  24 23   MET 23   23   23   MET MET V . n 
X  24 24   LEU 24   24   24   LEU LEU V . n 
X  24 25   ASN 25   25   25   ASN ASN V . n 
X  24 26   ILE 26   26   26   ILE ILE V . n 
X  24 27   HIS 27   27   27   HIS HIS V . n 
X  24 28   HIS 28   28   28   HIS HIS V . n 
X  24 29   VAL 29   29   29   VAL VAL V . n 
X  24 30   ASN 30   30   30   ASN ASN V . n 
X  24 31   HIS 31   31   31   HIS HIS V . n 
X  24 32   CYS 32   32   32   CYS CYS V . n 
X  24 33   THR 33   33   33   THR THR V . n 
X  24 34   LEU 34   34   34   LEU LEU V . n 
X  24 35   VAL 35   35   35   VAL VAL V . n 
X  24 36   PRO 36   36   36   PRO PRO V . n 
X  24 37   GLU 37   37   37   GLU GLU V . n 
X  24 38   THR 38   38   38   THR THR V . n 
X  24 39   ASP 39   39   39   ASP ASP V . n 
X  24 40   ALA 40   40   40   ALA ALA V . n 
X  24 41   TYR 41   41   41   TYR TYR V . n 
X  24 42   ARG 42   42   42   ARG ARG V . n 
X  24 43   GLY 43   43   43   GLY GLY V . n 
X  24 44   MET 44   44   44   MET MET V . n 
X  24 45   VAL 45   45   45   VAL VAL V . n 
X  24 46   ALA 46   46   46   ALA ALA V . n 
X  24 47   LYS 47   47   47   LYS LYS V . n 
X  24 48   VAL 48   48   48   VAL VAL V . n 
X  24 49   ASN 49   49   49   ASN ASN V . n 
X  24 50   ASP 50   50   50   ASP ASP V . n 
X  24 51   PHE 51   51   51   PHE PHE V . n 
X  24 52   VAL 52   52   52   VAL VAL V . n 
X  24 53   ALA 53   53   53   ALA ALA V . n 
X  24 54   PHE 54   54   54   PHE PHE V . n 
X  24 55   GLY 55   55   55   GLY GLY V . n 
X  24 56   GLU 56   56   56   GLU GLU V . n 
X  24 57   PRO 57   57   57   PRO PRO V . n 
X  24 58   SER 58   58   58   SER SER V . n 
X  24 59   GLN 59   59   59   GLN GLN V . n 
X  24 60   GLU 60   60   60   GLU GLU V . n 
X  24 61   THR 61   61   61   THR THR V . n 
X  24 62   LEU 62   62   62   LEU LEU V . n 
X  24 63   GLU 63   63   63   GLU GLU V . n 
X  24 64   THR 64   64   64   THR THR V . n 
X  24 65   VAL 65   65   65   VAL VAL V . n 
X  24 66   LEU 66   66   66   LEU LEU V . n 
X  24 67   ALA 67   67   67   ALA ALA V . n 
X  24 68   THR 68   68   68   THR THR V . n 
X  24 69   ARG 69   69   69   ARG ARG V . n 
X  24 70   ALA 70   70   70   ALA ALA V . n 
X  24 71   GLU 71   71   71   GLU GLU V . n 
X  24 72   PRO 72   72   72   PRO PRO V . n 
X  24 73   LEU 73   73   73   LEU LEU V . n 
X  24 74   GLU 74   74   74   GLU GLU V . n 
X  24 75   GLY 75   75   75   GLY GLY V . n 
X  24 76   ASP 76   76   76   ASP ASP V . n 
X  24 77   ALA 77   77   77   ALA ALA V . n 
X  24 78   ASP 78   78   78   ASP ASP V . n 
X  24 79   VAL 79   79   79   VAL VAL V . n 
X  24 80   ASP 80   80   80   ASP ASP V . n 
X  24 81   ASP 81   81   81   ASP ASP V . n 
X  24 82   GLU 82   82   82   GLU GLU V . n 
X  24 83   TRP 83   83   83   TRP TRP V . n 
X  24 84   VAL 84   84   84   VAL VAL V . n 
X  24 85   ALA 85   85   85   ALA ALA V . n 
X  24 86   GLU 86   86   86   GLU GLU V . n 
X  24 87   HIS 87   87   87   HIS HIS V . n 
X  24 88   THR 88   88   88   THR THR V . n 
X  24 89   ASP 89   89   89   ASP ASP V . n 
X  24 90   TYR 90   90   90   TYR TYR V . n 
X  24 91   ASP 91   91   91   ASP ASP V . n 
X  24 92   ASP 92   92   92   ASP ASP V . n 
X  24 93   ILE 93   93   93   ILE ILE V . n 
X  24 94   SER 94   94   94   SER SER V . n 
X  24 95   GLY 95   95   95   GLY GLY V . n 
X  24 96   LEU 96   96   96   LEU LEU V . n 
X  24 97   ALA 97   97   97   ALA ALA V . n 
X  24 98   PHE 98   98   98   PHE PHE V . n 
X  24 99   ALA 99   99   99   ALA ALA V . n 
X  24 100  LEU 100  100  100  LEU LEU V . n 
X  24 101  LEU 101  101  101  LEU LEU V . n 
X  24 102  SER 102  102  102  SER SER V . n 
X  24 103  GLU 103  103  103  GLU GLU V . n 
X  24 104  GLU 104  104  104  GLU GLU V . n 
X  24 105  THR 105  105  105  THR THR V . n 
X  24 106  THR 106  106  106  THR THR V . n 
X  24 107  LEU 107  107  107  LEU LEU V . n 
X  24 108  ARG 108  108  108  ARG ARG V . n 
X  24 109  GLU 109  109  109  GLU GLU V . n 
X  24 110  GLN 110  110  110  GLN GLN V . n 
X  24 111  GLY 111  111  111  GLY GLY V . n 
X  24 112  LEU 112  112  112  LEU LEU V . n 
X  24 113  SER 113  113  113  SER SER V . n 
X  24 114  PRO 114  114  114  PRO PRO V . n 
X  24 115  THR 115  115  115  THR THR V . n 
X  24 116  LEU 116  116  116  LEU LEU V . n 
X  24 117  ARG 117  117  117  ARG ARG V . n 
X  24 118  LEU 118  118  118  LEU LEU V . n 
X  24 119  HIS 119  119  119  HIS HIS V . n 
X  24 120  PRO 120  120  120  PRO PRO V . n 
X  24 121  PRO 121  121  121  PRO PRO V . n 
X  24 122  ARG 122  122  122  ARG ARG V . n 
X  24 123  GLY 123  123  123  GLY GLY V . n 
X  24 124  GLY 124  124  124  GLY GLY V . n 
X  24 125  HIS 125  125  125  HIS HIS V . n 
X  24 126  ASP 126  126  126  ASP ASP V . n 
X  24 127  GLY 127  127  127  GLY GLY V . n 
X  24 128  VAL 128  128  128  VAL VAL V . n 
X  24 129  LYS 129  129  129  LYS LYS V . n 
X  24 130  HIS 130  130  130  HIS HIS V . n 
X  24 131  PRO 131  131  131  PRO PRO V . n 
X  24 132  VAL 132  132  132  VAL VAL V . n 
X  24 133  LYS 133  133  133  LYS LYS V . n 
X  24 134  GLU 134  134  134  GLU GLU V . n 
X  24 135  GLY 135  135  135  GLY GLY V . n 
X  24 136  GLY 136  136  136  GLY GLY V . n 
X  24 137  GLN 137  137  137  GLN GLN V . n 
X  24 138  LEU 138  138  138  LEU LEU V . n 
X  24 139  GLY 139  139  139  GLY GLY V . n 
X  24 140  LYS 140  140  140  LYS LYS V . n 
X  24 141  HIS 141  141  141  HIS HIS V . n 
X  24 142  ASP 142  142  142  ASP ASP V . n 
X  24 143  THR 143  143  143  THR THR V . n 
X  24 144  GLU 144  144  144  GLU GLU V . n 
X  24 145  GLY 145  145  145  GLY GLY V . n 
X  24 146  ILE 146  146  146  ILE ILE V . n 
X  24 147  ASP 147  147  147  ASP ASP V . n 
X  24 148  ASP 148  148  148  ASP ASP V . n 
X  24 149  LEU 149  149  149  LEU LEU V . n 
X  24 150  LEU 150  150  150  LEU LEU V . n 
X  24 151  GLU 151  151  151  GLU GLU V . n 
X  24 152  ALA 152  152  152  ALA ALA V . n 
X  24 153  MET 153  153  153  MET MET V . n 
X  24 154  ARG 154  154  154  ARG ARG V . n 
Y  25 1    SER 1    1    ?    ?   ?   W . n 
Y  25 2    ALA 2    2    ?    ?   ?   W . n 
Y  25 3    SER 3    3    ?    ?   ?   W . n 
Y  25 4    ASP 4    4    ?    ?   ?   W . n 
Y  25 5    PHE 5    5    ?    ?   ?   W . n 
Y  25 6    GLU 6    6    ?    ?   ?   W . n 
Y  25 7    GLU 7    7    7    GLU GLU W . n 
Y  25 8    ARG 8    8    8    ARG ARG W . n 
Y  25 9    VAL 9    9    9    VAL VAL W . n 
Y  25 10   VAL 10   10   10   VAL VAL W . n 
Y  25 11   THR 11   11   11   THR THR W . n 
Y  25 12   ILE 12   12   12   ILE ILE W . n 
Y  25 13   PRO 13   13   13   PRO PRO W . n 
Y  25 14   LEU 14   14   14   LEU LEU W . n 
Y  25 15   ARG 15   15   15   ARG ARG W . n 
Y  25 16   ASP 16   16   16   ASP ASP W . n 
Y  25 17   ALA 17   17   17   ALA ALA W . n 
Y  25 18   ARG 18   18   18   ARG ARG W . n 
Y  25 19   ALA 19   19   19   ALA ALA W . n 
Y  25 20   GLU 20   20   20   GLU GLU W . n 
Y  25 21   PRO 21   21   21   PRO PRO W . n 
Y  25 22   ASN 22   22   22   ASN ASN W . n 
Y  25 23   HIS 23   23   23   HIS HIS W . n 
Y  25 24   LYS 24   24   24   LYS LYS W . n 
Y  25 25   ARG 25   25   25   ARG ARG W . n 
Y  25 26   ALA 26   26   26   ALA ALA W . n 
Y  25 27   ASP 27   27   27   ASP ASP W . n 
Y  25 28   LYS 28   28   28   LYS LYS W . n 
Y  25 29   ALA 29   29   29   ALA ALA W . n 
Y  25 30   MET 30   30   30   MET MET W . n 
Y  25 31   ILE 31   31   31   ILE ILE W . n 
Y  25 32   LEU 32   32   32   LEU LEU W . n 
Y  25 33   ILE 33   33   33   ILE ILE W . n 
Y  25 34   ARG 34   34   34   ARG ARG W . n 
Y  25 35   GLU 35   35   35   GLU GLU W . n 
Y  25 36   HIS 36   36   36   HIS HIS W . n 
Y  25 37   LEU 37   37   37   LEU LEU W . n 
Y  25 38   ALA 38   38   38   ALA ALA W . n 
Y  25 39   LYS 39   39   39   LYS LYS W . n 
Y  25 40   HIS 40   40   40   HIS HIS W . n 
Y  25 41   PHE 41   41   41   PHE PHE W . n 
Y  25 42   SER 42   42   42   SER SER W . n 
Y  25 43   VAL 43   43   43   VAL VAL W . n 
Y  25 44   ASP 44   44   44   ASP ASP W . n 
Y  25 45   GLU 45   45   45   GLU GLU W . n 
Y  25 46   ASP 46   46   46   ASP ASP W . n 
Y  25 47   ALA 47   47   47   ALA ALA W . n 
Y  25 48   VAL 48   48   48   VAL VAL W . n 
Y  25 49   ARG 49   49   49   ARG ARG W . n 
Y  25 50   LEU 50   50   50   LEU LEU W . n 
Y  25 51   ASP 51   51   51   ASP ASP W . n 
Y  25 52   PRO 52   52   52   PRO PRO W . n 
Y  25 53   SER 53   53   53   SER SER W . n 
Y  25 54   ILE 54   54   54   ILE ILE W . n 
Y  25 55   ASN 55   55   55   ASN ASN W . n 
Y  25 56   GLU 56   56   56   GLU GLU W . n 
Y  25 57   ALA 57   57   57   ALA ALA W . n 
Y  25 58   ALA 58   58   58   ALA ALA W . n 
Y  25 59   TRP 59   59   59   TRP TRP W . n 
Y  25 60   ALA 60   60   60   ALA ALA W . n 
Y  25 61   ARG 61   61   61   ARG ARG W . n 
Y  25 62   GLY 62   62   62   GLY GLY W . n 
Y  25 63   ARG 63   63   63   ARG ARG W . n 
Y  25 64   ALA 64   64   64   ALA ALA W . n 
Y  25 65   ASN 65   65   65   ASN ASN W . n 
Y  25 66   THR 66   66   66   THR THR W . n 
Y  25 67   PRO 67   67   67   PRO PRO W . n 
Y  25 68   SER 68   68   68   SER SER W . n 
Y  25 69   LYS 69   69   69   LYS LYS W . n 
Y  25 70   ILE 70   70   70   ILE ILE W . n 
Y  25 71   ARG 71   71   71   ARG ARG W . n 
Y  25 72   VAL 72   72   72   VAL VAL W . n 
Y  25 73   ARG 73   73   73   ARG ARG W . n 
Y  25 74   ALA 74   74   74   ALA ALA W . n 
Y  25 75   ALA 75   75   75   ALA ALA W . n 
Y  25 76   ARG 76   76   76   ARG ARG W . n 
Y  25 77   PHE 77   77   77   PHE PHE W . n 
Y  25 78   GLU 78   78   78   GLU GLU W . n 
Y  25 79   GLU 79   79   79   GLU GLU W . n 
Y  25 80   GLU 80   80   80   GLU GLU W . n 
Y  25 81   GLY 81   81   81   GLY GLY W . n 
Y  25 82   GLU 82   82   82   GLU GLU W . n 
Y  25 83   ALA 83   83   83   ALA ALA W . n 
Y  25 84   ILE 84   84   84   ILE ILE W . n 
Y  25 85   VAL 85   85   85   VAL VAL W . n 
Y  25 86   GLU 86   86   86   GLU GLU W . n 
Y  25 87   ALA 87   87   87   ALA ALA W . n 
Y  25 88   GLU 88   88   88   GLU GLU W . n 
Y  25 89   THR 89   89   ?    ?   ?   W . n 
Y  25 90   ALA 90   90   ?    ?   ?   W . n 
Y  25 91   GLU 91   91   ?    ?   ?   W . n 
Z  26 1    ALA 1    1    ?    ?   ?   X . n 
Z  26 2    ASP 2    2    ?    ?   ?   X . n 
Z  26 3    ASN 3    3    ?    ?   ?   X . n 
Z  26 4    GLU 4    4    ?    ?   ?   X . n 
Z  26 5    GLU 5    5    ?    ?   ?   X . n 
Z  26 6    ASP 6    6    ?    ?   ?   X . n 
Z  26 7    VAL 7    7    ?    ?   ?   X . n 
Z  26 8    GLU 8    8    ?    ?   ?   X . n 
Z  26 9    ALA 9    9    ?    ?   ?   X . n 
Z  26 10   GLU 10   10   ?    ?   ?   X . n 
Z  26 11   GLU 11   11   ?    ?   ?   X . n 
Z  26 12   GLU 12   12   ?    ?   ?   X . n 
Z  26 13   TYR 13   13   ?    ?   ?   X . n 
Z  26 14   THR 14   14   ?    ?   ?   X . n 
Z  26 15   GLU 15   15   ?    ?   ?   X . n 
Z  26 16   LEU 16   16   ?    ?   ?   X . n 
Z  26 17   THR 17   17   ?    ?   ?   X . n 
Z  26 18   ASP 18   18   ?    ?   ?   X . n 
Z  26 19   ILE 19   19   ?    ?   ?   X . n 
Z  26 20   SER 20   20   ?    ?   ?   X . n 
Z  26 21   GLY 21   21   ?    ?   ?   X . n 
Z  26 22   VAL 22   22   ?    ?   ?   X . n 
Z  26 23   GLY 23   23   ?    ?   ?   X . n 
Z  26 24   PRO 24   24   ?    ?   ?   X . n 
Z  26 25   SER 25   25   ?    ?   ?   X . n 
Z  26 26   LYS 26   26   ?    ?   ?   X . n 
Z  26 27   ALA 27   27   ?    ?   ?   X . n 
Z  26 28   GLU 28   28   ?    ?   ?   X . n 
Z  26 29   SER 29   29   ?    ?   ?   X . n 
Z  26 30   LEU 30   30   ?    ?   ?   X . n 
Z  26 31   ARG 31   31   ?    ?   ?   X . n 
Z  26 32   GLU 32   32   ?    ?   ?   X . n 
Z  26 33   ALA 33   33   ?    ?   ?   X . n 
Z  26 34   GLY 34   34   ?    ?   ?   X . n 
Z  26 35   PHE 35   35   ?    ?   ?   X . n 
Z  26 36   GLU 36   36   ?    ?   ?   X . n 
Z  26 37   SER 37   37   ?    ?   ?   X . n 
Z  26 38   VAL 38   38   ?    ?   ?   X . n 
Z  26 39   GLU 39   39   ?    ?   ?   X . n 
Z  26 40   ASP 40   40   ?    ?   ?   X . n 
Z  26 41   VAL 41   41   ?    ?   ?   X . n 
Z  26 42   ARG 42   42   ?    ?   ?   X . n 
Z  26 43   GLY 43   43   ?    ?   ?   X . n 
Z  26 44   ALA 44   44   ?    ?   ?   X . n 
Z  26 45   ASP 45   45   ?    ?   ?   X . n 
Z  26 46   GLN 46   46   ?    ?   ?   X . n 
Z  26 47   SER 47   47   ?    ?   ?   X . n 
Z  26 48   ALA 48   48   ?    ?   ?   X . n 
Z  26 49   LEU 49   49   ?    ?   ?   X . n 
Z  26 50   ALA 50   50   ?    ?   ?   X . n 
Z  26 51   ASP 51   51   ?    ?   ?   X . n 
Z  26 52   VAL 52   52   ?    ?   ?   X . n 
Z  26 53   SER 53   53   ?    ?   ?   X . n 
Z  26 54   GLY 54   54   ?    ?   ?   X . n 
Z  26 55   ILE 55   55   ?    ?   ?   X . n 
Z  26 56   GLY 56   56   ?    ?   ?   X . n 
Z  26 57   ASN 57   57   ?    ?   ?   X . n 
Z  26 58   ALA 58   58   ?    ?   ?   X . n 
Z  26 59   LEU 59   59   ?    ?   ?   X . n 
Z  26 60   ALA 60   60   ?    ?   ?   X . n 
Z  26 61   ALA 61   61   ?    ?   ?   X . n 
Z  26 62   ARG 62   62   ?    ?   ?   X . n 
Z  26 63   ILE 63   63   ?    ?   ?   X . n 
Z  26 64   LYS 64   64   ?    ?   ?   X . n 
Z  26 65   ALA 65   65   ?    ?   ?   X . n 
Z  26 66   ASP 66   66   ?    ?   ?   X . n 
Z  26 67   VAL 67   67   ?    ?   ?   X . n 
Z  26 68   GLY 68   68   ?    ?   ?   X . n 
Z  26 69   GLY 69   69   ?    ?   ?   X . n 
Z  26 70   LEU 70   70   ?    ?   ?   X . n 
Z  26 71   GLU 71   71   ?    ?   ?   X . n 
Z  26 72   VAL 72   72   ?    ?   ?   X . n 
Z  26 73   GLU 73   73   ?    ?   ?   X . n 
Z  26 74   SER 74   74   ?    ?   ?   X . n 
Z  26 75   GLU 75   75   ?    ?   ?   X . n 
Z  26 76   THR 76   76   ?    ?   ?   X . n 
Z  26 77   GLU 77   77   ?    ?   ?   X . n 
Z  26 78   ALA 78   78   ?    ?   ?   X . n 
Z  26 79   GLU 79   79   ?    ?   ?   X . n 
Z  26 80   VAL 80   80   ?    ?   ?   X . n 
Z  26 81   GLU 81   81   ?    ?   ?   X . n 
Z  26 82   GLU 82   82   ?    ?   ?   X . n 
Z  26 83   GLU 83   83   ?    ?   ?   X . n 
Z  26 84   GLY 84   84   ?    ?   ?   X . n 
Z  26 85   GLY 85   85   ?    ?   ?   X . n 
Z  26 86   GLU 86   86   ?    ?   ?   X . n 
Z  26 87   GLU 87   87   ?    ?   ?   X . n 
Z  26 88   ALA 88   88   ?    ?   ?   X . n 
Z  26 89   PRO 89   89   ?    ?   ?   X . n 
Z  26 90   ASP 90   90   ?    ?   ?   X . n 
Z  26 91   GLU 91   91   ?    ?   ?   X . n 
Z  26 92   ASP 92   92   ?    ?   ?   X . n 
Z  26 93   VAL 93   93   ?    ?   ?   X . n 
Z  26 94   GLU 94   94   ?    ?   ?   X . n 
Z  26 95   THR 95   95   95   THR THR X . n 
Z  26 96   GLU 96   96   96   GLU GLU X . n 
Z  26 97   LEU 97   97   97   LEU LEU X . n 
Z  26 98   GLN 98   98   98   GLN GLN X . n 
Z  26 99   ALA 99   99   99   ALA ALA X . n 
Z  26 100  ARG 100  100  100  ARG ARG X . n 
Z  26 101  GLY 101  101  101  GLY GLY X . n 
Z  26 102  LEU 102  102  102  LEU LEU X . n 
Z  26 103  THR 103  103  103  THR THR X . n 
Z  26 104  GLU 104  104  104  GLU GLU X . n 
Z  26 105  LYS 105  105  105  LYS LYS X . n 
Z  26 106  THR 106  106  106  THR THR X . n 
Z  26 107  PRO 107  107  107  PRO PRO X . n 
Z  26 108  ASP 108  108  108  ASP ASP X . n 
Z  26 109  LEU 109  109  109  LEU LEU X . n 
Z  26 110  SER 110  110  110  SER SER X . n 
Z  26 111  ASP 111  111  111  ASP ASP X . n 
Z  26 112  GLU 112  112  112  GLU GLU X . n 
Z  26 113  ASP 113  113  113  ASP ASP X . n 
Z  26 114  ALA 114  114  114  ALA ALA X . n 
Z  26 115  ARG 115  115  115  ARG ARG X . n 
Z  26 116  LEU 116  116  116  LEU LEU X . n 
Z  26 117  LEU 117  117  117  LEU LEU X . n 
Z  26 118  THR 118  118  118  THR THR X . n 
Z  26 119  GLN 119  119  119  GLN GLN X . n 
Z  26 120  ARG 120  120  120  ARG ARG X . n 
Z  26 121  HIS 121  121  121  HIS HIS X . n 
Z  26 122  ARG 122  122  122  ARG ARG X . n 
Z  26 123  VAL 123  123  123  VAL VAL X . n 
Z  26 124  GLY 124  124  124  GLY GLY X . n 
Z  26 125  LYS 125  125  125  LYS LYS X . n 
Z  26 126  PRO 126  126  126  PRO PRO X . n 
Z  26 127  GLN 127  127  127  GLN GLN X . n 
Z  26 128  PHE 128  128  128  PHE PHE X . n 
Z  26 129  ASN 129  129  129  ASN ASN X . n 
Z  26 130  ARG 130  130  130  ARG ARG X . n 
Z  26 131  GLN 131  131  131  GLN GLN X . n 
Z  26 132  ASP 132  132  132  ASP ASP X . n 
Z  26 133  HIS 133  133  133  HIS HIS X . n 
Z  26 134  HIS 134  134  134  HIS HIS X . n 
Z  26 135  LYS 135  135  135  LYS LYS X . n 
Z  26 136  LYS 136  136  136  LYS LYS X . n 
Z  26 137  LYS 137  137  137  LYS LYS X . n 
Z  26 138  ARG 138  138  138  ARG ARG X . n 
Z  26 139  VAL 139  139  139  VAL VAL X . n 
Z  26 140  SER 140  140  140  SER SER X . n 
Z  26 141  THR 141  141  141  THR THR X . n 
Z  26 142  SER 142  142  142  SER SER X . n 
Z  26 143  TRP 143  143  143  TRP TRP X . n 
Z  26 144  ARG 144  144  144  ARG ARG X . n 
Z  26 145  LYS 145  145  145  LYS LYS X . n 
Z  26 146  PRO 146  146  146  PRO PRO X . n 
Z  26 147  ARG 147  147  147  ARG ARG X . n 
Z  26 148  GLY 148  148  148  GLY GLY X . n 
Z  26 149  GLN 149  149  149  GLN GLN X . n 
Z  26 150  LEU 150  150  150  LEU LEU X . n 
Z  26 151  SER 151  151  151  SER SER X . n 
Z  26 152  LYS 152  152  152  LYS LYS X . n 
Z  26 153  GLN 153  153  153  GLN GLN X . n 
Z  26 154  ARG 154  154  154  ARG ARG X . n 
Z  26 155  ARG 155  155  155  ARG ARG X . n 
Z  26 156  GLY 156  156  156  GLY GLY X . n 
Z  26 157  ILE 157  157  157  ILE ILE X . n 
Z  26 158  LYS 158  158  158  LYS LYS X . n 
Z  26 159  GLY 159  159  159  GLY GLY X . n 
Z  26 160  LYS 160  160  160  LYS LYS X . n 
Z  26 161  GLY 161  161  161  GLY GLY X . n 
Z  26 162  ASP 162  162  162  ASP ASP X . n 
Z  26 163  THR 163  163  163  THR THR X . n 
Z  26 164  VAL 164  164  164  VAL VAL X . n 
Z  26 165  GLU 165  165  165  GLU GLU X . n 
Z  26 166  ALA 166  166  166  ALA ALA X . n 
Z  26 167  GLY 167  167  167  GLY GLY X . n 
Z  26 168  PHE 168  168  168  PHE PHE X . n 
Z  26 169  ARG 169  169  169  ARG ARG X . n 
Z  26 170  SER 170  170  170  SER SER X . n 
Z  26 171  PRO 171  171  171  PRO PRO X . n 
Z  26 172  THR 172  172  172  THR THR X . n 
Z  26 173  ALA 173  173  173  ALA ALA X . n 
Z  26 174  VAL 174  174  174  VAL VAL X . n 
Z  26 175  ARG 175  175  175  ARG ARG X . n 
Z  26 176  GLY 176  176  176  GLY GLY X . n 
Z  26 177  LYS 177  177  177  LYS LYS X . n 
Z  26 178  HIS 178  178  178  HIS HIS X . n 
Z  26 179  PRO 179  179  179  PRO PRO X . n 
Z  26 180  SER 180  180  180  SER SER X . n 
Z  26 181  GLY 181  181  181  GLY GLY X . n 
Z  26 182  PHE 182  182  182  PHE PHE X . n 
Z  26 183  GLU 183  183  183  GLU GLU X . n 
Z  26 184  GLU 184  184  184  GLU GLU X . n 
Z  26 185  VAL 185  185  185  VAL VAL X . n 
Z  26 186  ARG 186  186  186  ARG ARG X . n 
Z  26 187  VAL 187  187  187  VAL VAL X . n 
Z  26 188  HIS 188  188  188  HIS HIS X . n 
Z  26 189  ASN 189  189  189  ASN ASN X . n 
Z  26 190  VAL 190  190  190  VAL VAL X . n 
Z  26 191  ASP 191  191  191  ASP ASP X . n 
Z  26 192  ASP 192  192  192  ASP ASP X . n 
Z  26 193  LEU 193  193  193  LEU LEU X . n 
Z  26 194  GLU 194  194  194  GLU GLU X . n 
Z  26 195  GLY 195  195  195  GLY GLY X . n 
Z  26 196  VAL 196  196  196  VAL VAL X . n 
Z  26 197  ASP 197  197  197  ASP ASP X . n 
Z  26 198  GLY 198  198  198  GLY GLY X . n 
Z  26 199  ASP 199  199  199  ASP ASP X . n 
Z  26 200  THR 200  200  200  THR THR X . n 
Z  26 201  GLU 201  201  201  GLU GLU X . n 
Z  26 202  ALA 202  202  202  ALA ALA X . n 
Z  26 203  VAL 203  203  203  VAL VAL X . n 
Z  26 204  ARG 204  204  204  ARG ARG X . n 
Z  26 205  ILE 205  205  205  ILE ILE X . n 
Z  26 206  ALA 206  206  206  ALA ALA X . n 
Z  26 207  SER 207  207  207  SER SER X . n 
Z  26 208  LYS 208  208  208  LYS LYS X . n 
Z  26 209  VAL 209  209  209  VAL VAL X . n 
Z  26 210  GLY 210  210  210  GLY GLY X . n 
Z  26 211  ALA 211  211  211  ALA ALA X . n 
Z  26 212  ARG 212  212  212  ARG ARG X . n 
Z  26 213  LYS 213  213  213  LYS LYS X . n 
Z  26 214  ARG 214  214  214  ARG ARG X . n 
Z  26 215  GLU 215  215  215  GLU GLU X . n 
Z  26 216  ARG 216  216  216  ARG ARG X . n 
Z  26 217  ILE 217  217  217  ILE ILE X . n 
Z  26 218  GLU 218  218  218  GLU GLU X . n 
Z  26 219  GLU 219  219  219  GLU GLU X . n 
Z  26 220  GLU 220  220  220  GLU GLU X . n 
Z  26 221  ALA 221  221  221  ALA ALA X . n 
Z  26 222  GLU 222  222  222  GLU GLU X . n 
Z  26 223  ASP 223  223  223  ASP ASP X . n 
Z  26 224  ALA 224  224  224  ALA ALA X . n 
Z  26 225  GLY 225  225  225  GLY GLY X . n 
Z  26 226  ILE 226  226  226  ILE ILE X . n 
Z  26 227  ARG 227  227  227  ARG ARG X . n 
Z  26 228  VAL 228  228  228  VAL VAL X . n 
Z  26 229  LEU 229  229  229  LEU LEU X . n 
Z  26 230  ASN 230  230  230  ASN ASN X . n 
Z  26 231  PRO 231  231  231  PRO PRO X . n 
Z  26 232  THR 232  232  232  THR THR X . n 
Z  26 233  TYR 233  233  233  TYR TYR X . n 
Z  26 234  VAL 234  234  234  VAL VAL X . n 
Z  26 235  GLU 235  235  235  GLU GLU X . n 
Z  26 236  VAL 236  236  236  VAL VAL X . n 
Z  26 237  GLU 237  237  ?    ?   ?   X . n 
Z  26 238  VAL 238  238  ?    ?   ?   X . n 
Z  26 239  SER 239  239  ?    ?   ?   X . n 
Z  26 240  GLU 240  240  ?    ?   ?   X . n 
AA 27 1    ARG 1    10   10   ARG ARG Y . n 
AA 27 2    THR 2    11   11   THR THR Y . n 
AA 27 3    GLY 3    12   12   GLY GLY Y . n 
AA 27 4    ARG 4    13   13   ARG ARG Y . n 
AA 27 5    PHE 5    14   14   PHE PHE Y . n 
AA 27 6    GLY 6    15   15   GLY GLY Y . n 
AA 27 7    PRO 7    16   16   PRO PRO Y . n 
AA 27 8    ARG 8    17   17   ARG ARG Y . n 
AA 27 9    TYR 9    18   18   TYR TYR Y . n 
AA 27 10   GLY 10   19   19   GLY GLY Y . n 
AA 27 11   LEU 11   20   20   LEU LEU Y . n 
AA 27 12   LYS 12   21   21   LYS LYS Y . n 
AA 27 13   ILE 13   22   22   ILE ILE Y . n 
AA 27 14   ARG 14   23   23   ARG ARG Y . n 
AA 27 15   VAL 15   24   24   VAL VAL Y . n 
AA 27 16   ARG 16   25   25   ARG ARG Y . n 
AA 27 17   VAL 17   26   26   VAL VAL Y . n 
AA 27 18   ALA 18   27   27   ALA ALA Y . n 
AA 27 19   ASP 19   28   28   ASP ASP Y . n 
AA 27 20   VAL 20   29   29   VAL VAL Y . n 
AA 27 21   GLU 21   30   30   GLU GLU Y . n 
AA 27 22   ILE 22   31   31   ILE ILE Y . n 
AA 27 23   LYS 23   32   32   LYS LYS Y . n 
AA 27 24   HIS 24   33   33   HIS HIS Y . n 
AA 27 25   LYS 25   34   34   LYS LYS Y . n 
AA 27 26   LYS 26   35   35   LYS LYS Y . n 
AA 27 27   LYS 27   36   36   LYS LYS Y . n 
AA 27 28   HIS 28   37   37   HIS HIS Y . n 
AA 27 29   LYS 29   38   38   LYS LYS Y . n 
AA 27 30   CYS 30   39   39   CYS CYS Y . n 
AA 27 31   PRO 31   40   40   PRO PRO Y . n 
AA 27 32   VAL 32   41   41   VAL VAL Y . n 
AA 27 33   CYS 33   42   42   CYS CYS Y . n 
AA 27 34   GLY 34   43   43   GLY GLY Y . n 
AA 27 35   PHE 35   44   44   PHE PHE Y . n 
AA 27 36   LYS 36   45   45   LYS LYS Y . n 
AA 27 37   LYS 37   46   46   LYS LYS Y . n 
AA 27 38   LEU 38   47   47   LEU LEU Y . n 
AA 27 39   LYS 39   48   48   LYS LYS Y . n 
AA 27 40   ARG 40   49   49   ARG ARG Y . n 
AA 27 41   ALA 41   50   50   ALA ALA Y . n 
AA 27 42   GLY 42   51   51   GLY GLY Y . n 
AA 27 43   THR 43   52   52   THR THR Y . n 
AA 27 44   GLY 44   53   53   GLY GLY Y . n 
AA 27 45   ILE 45   54   54   ILE ILE Y . n 
AA 27 46   TRP 46   55   55   TRP TRP Y . n 
AA 27 47   MET 47   56   56   MET MET Y . n 
AA 27 48   CYS 48   57   57   CYS CYS Y . n 
AA 27 49   GLY 49   58   58   GLY GLY Y . n 
AA 27 50   HIS 50   59   59   HIS HIS Y . n 
AA 27 51   CYS 51   60   60   CYS CYS Y . n 
AA 27 52   GLY 52   61   61   GLY GLY Y . n 
AA 27 53   TYR 53   62   62   TYR TYR Y . n 
AA 27 54   LYS 54   63   63   LYS LYS Y . n 
AA 27 55   ILE 55   64   64   ILE ILE Y . n 
AA 27 56   ALA 56   65   65   ALA ALA Y . n 
AA 27 57   GLY 57   66   66   GLY GLY Y . n 
AA 27 58   GLY 58   67   67   GLY GLY Y . n 
AA 27 59   CYS 59   68   68   CYS CYS Y . n 
AA 27 60   TYR 60   69   69   TYR TYR Y . n 
AA 27 61   GLN 61   70   70   GLN GLN Y . n 
AA 27 62   PRO 62   71   71   PRO PRO Y . n 
AA 27 63   GLU 63   72   72   GLU GLU Y . n 
AA 27 64   THR 64   73   73   THR THR Y . n 
AA 27 65   VAL 65   74   74   VAL VAL Y . n 
AA 27 66   ALA 66   75   75   ALA ALA Y . n 
AA 27 67   GLY 67   76   76   GLY GLY Y . n 
AA 27 68   LYS 68   77   77   LYS LYS Y . n 
AA 27 69   ALA 69   78   78   ALA ALA Y . n 
AA 27 70   VAL 70   79   79   VAL VAL Y . n 
AA 27 71   MET 71   80   80   MET MET Y . n 
AA 27 72   LYS 72   81   81   LYS LYS Y . n 
AA 27 73   ALA 73   82   82   ALA ALA Y . n 
BA 28 1    THR 1    1    1    THR THR Z . n 
BA 28 2    GLY 2    2    2    GLY GLY Z . n 
BA 28 3    ALA 3    3    3    ALA ALA Z . n 
BA 28 4    GLY 4    4    4    GLY GLY Z . n 
BA 28 5    THR 5    5    5    THR THR Z . n 
BA 28 6    PRO 6    6    6    PRO PRO Z . n 
BA 28 7    SER 7    7    7    SER SER Z . n 
BA 28 8    GLN 8    8    8    GLN GLN Z . n 
BA 28 9    GLY 9    9    9    GLY GLY Z . n 
BA 28 10   LYS 10   10   10   LYS LYS Z . n 
BA 28 11   LYS 11   11   11   LYS LYS Z . n 
BA 28 12   ASN 12   12   12   ASN ASN Z . n 
BA 28 13   THR 13   13   13   THR THR Z . n 
BA 28 14   THR 14   14   14   THR THR Z . n 
BA 28 15   THR 15   15   15   THR THR Z . n 
BA 28 16   HIS 16   16   16   HIS HIS Z . n 
BA 28 17   THR 17   17   17   THR THR Z . n 
BA 28 18   LYS 18   18   18   LYS LYS Z . n 
BA 28 19   CYS 19   19   19   CYS CYS Z . n 
BA 28 20   ARG 20   20   20   ARG ARG Z . n 
BA 28 21   ARG 21   21   21   ARG ARG Z . n 
BA 28 22   CYS 22   22   22   CYS CYS Z . n 
BA 28 23   GLY 23   23   23   GLY GLY Z . n 
BA 28 24   GLU 24   24   24   GLU GLU Z . n 
BA 28 25   LYS 25   25   25   LYS LYS Z . n 
BA 28 26   SER 26   26   26   SER SER Z . n 
BA 28 27   TYR 27   27   27   TYR TYR Z . n 
BA 28 28   HIS 28   28   28   HIS HIS Z . n 
BA 28 29   THR 29   29   29   THR THR Z . n 
BA 28 30   LYS 30   30   30   LYS LYS Z . n 
BA 28 31   LYS 31   31   31   LYS LYS Z . n 
BA 28 32   LYS 32   32   32   LYS LYS Z . n 
BA 28 33   VAL 33   33   33   VAL VAL Z . n 
BA 28 34   CYS 34   34   34   CYS CYS Z . n 
BA 28 35   SER 35   35   35   SER SER Z . n 
BA 28 36   SER 36   36   36   SER SER Z . n 
BA 28 37   CYS 37   37   37   CYS CYS Z . n 
BA 28 38   GLY 38   38   38   GLY GLY Z . n 
BA 28 39   PHE 39   39   39   PHE PHE Z . n 
BA 28 40   GLY 40   40   40   GLY GLY Z . n 
BA 28 41   LYS 41   41   41   LYS LYS Z . n 
BA 28 42   SER 42   42   42   SER SER Z . n 
BA 28 43   ALA 43   43   43   ALA ALA Z . n 
BA 28 44   LYS 44   44   44   LYS LYS Z . n 
BA 28 45   ARG 45   45   45   ARG ARG Z . n 
BA 28 46   ARG 46   46   46   ARG ARG Z . n 
BA 28 47   ASP 47   47   47   ASP ASP Z . n 
BA 28 48   TYR 48   48   48   TYR TYR Z . n 
BA 28 49   GLU 49   49   49   GLU GLU Z . n 
BA 28 50   TRP 50   50   50   TRP TRP Z . n 
BA 28 51   GLN 51   51   51   GLN GLN Z . n 
BA 28 52   SER 52   52   52   SER SER Z . n 
BA 28 53   LYS 53   53   53   LYS LYS Z . n 
BA 28 54   ALA 54   54   54   ALA ALA Z . n 
BA 28 55   GLY 55   55   55   GLY GLY Z . n 
BA 28 56   GLU 56   56   56   GLU GLU Z . n 
CA 29 1    GLY 1    1    1    GLY GLY 1 . n 
CA 29 2    LYS 2    2    2    LYS LYS 1 . n 
CA 29 3    LYS 3    3    3    LYS LYS 1 . n 
CA 29 4    SER 4    4    4    SER SER 1 . n 
CA 29 5    LYS 5    5    5    LYS LYS 1 . n 
CA 29 6    ALA 6    6    6    ALA ALA 1 . n 
CA 29 7    THR 7    7    7    THR THR 1 . n 
CA 29 8    LYS 8    8    8    LYS LYS 1 . n 
CA 29 9    LYS 9    9    9    LYS LYS 1 . n 
CA 29 10   ARG 10   10   10   ARG ARG 1 . n 
CA 29 11   LEU 11   11   11   LEU LEU 1 . n 
CA 29 12   ALA 12   12   12   ALA ALA 1 . n 
CA 29 13   LYS 13   13   13   LYS LYS 1 . n 
CA 29 14   LEU 14   14   14   LEU LEU 1 . n 
CA 29 15   ASP 15   15   15   ASP ASP 1 . n 
CA 29 16   ASN 16   16   16   ASN ASN 1 . n 
CA 29 17   GLN 17   17   17   GLN GLN 1 . n 
CA 29 18   ASN 18   18   18   ASN ASN 1 . n 
CA 29 19   SER 19   19   19   SER SER 1 . n 
CA 29 20   ARG 20   20   20   ARG ARG 1 . n 
CA 29 21   VAL 21   21   21   VAL VAL 1 . n 
CA 29 22   PRO 22   22   22   PRO PRO 1 . n 
CA 29 23   ALA 23   23   23   ALA ALA 1 . n 
CA 29 24   TRP 24   24   24   TRP TRP 1 . n 
CA 29 25   VAL 25   25   25   VAL VAL 1 . n 
CA 29 26   MET 26   26   26   MET MET 1 . n 
CA 29 27   LEU 27   27   27   LEU LEU 1 . n 
CA 29 28   LYS 28   28   28   LYS LYS 1 . n 
CA 29 29   THR 29   29   29   THR THR 1 . n 
CA 29 30   ASP 30   30   30   ASP ASP 1 . n 
CA 29 31   GLU 31   31   31   GLU GLU 1 . n 
CA 29 32   VAL 32   33   ?    ?   ?   1 . n 
CA 29 33   GLN 33   34   ?    ?   ?   1 . n 
CA 29 34   ARG 34   35   35   ARG ARG 1 . n 
CA 29 35   ASN 35   36   36   ASN ASN 1 . n 
CA 29 36   HIS 36   37   37   HIS HIS 1 . n 
CA 29 37   LYS 37   38   38   LYS LYS 1 . n 
CA 29 38   ARG 38   39   39   ARG ARG 1 . n 
CA 29 39   ARG 39   40   40   ARG ARG 1 . n 
CA 29 40   HIS 40   41   41   HIS HIS 1 . n 
CA 29 41   TRP 41   42   42   TRP TRP 1 . n 
CA 29 42   ARG 42   43   43   ARG ARG 1 . n 
CA 29 43   ARG 43   44   44   ARG ARG 1 . n 
CA 29 44   ASN 44   45   45   ASN ASN 1 . n 
CA 29 45   ASP 45   46   46   ASP ASP 1 . n 
CA 29 46   THR 46   47   47   THR THR 1 . n 
CA 29 47   ASP 47   48   48   ASP ASP 1 . n 
CA 29 48   GLU 48   49   49   GLU GLU 1 . n 
DA 30 1    MET 1    1    1    MET MET 2 . n 
DA 30 2    GLN 2    2    2    GLN GLN 2 . n 
DA 30 3    MET 3    3    3    MET MET 2 . n 
DA 30 4    PRO 4    4    4    PRO PRO 2 . n 
DA 30 5    ARG 5    5    5    ARG ARG 2 . n 
DA 30 6    ARG 6    6    6    ARG ARG 2 . n 
DA 30 7    PHE 7    7    7    PHE PHE 2 . n 
DA 30 8    ASN 8    8    8    ASN ASN 2 . n 
DA 30 9    THR 9    9    9    THR THR 2 . n 
DA 30 10   TYR 10   10   10   TYR TYR 2 . n 
DA 30 11   CYS 11   11   11   CYS CYS 2 . n 
DA 30 12   PRO 12   12   12   PRO PRO 2 . n 
DA 30 13   HIS 13   13   13   HIS HIS 2 . n 
DA 30 14   CYS 14   14   14   CYS CYS 2 . n 
DA 30 15   ASN 15   15   15   ASN ASN 2 . n 
DA 30 16   GLU 16   16   16   GLU GLU 2 . n 
DA 30 17   HIS 17   17   17   HIS HIS 2 . n 
DA 30 18   GLN 18   18   18   GLN GLN 2 . n 
DA 30 19   GLU 19   19   19   GLU GLU 2 . n 
DA 30 20   HIS 20   20   20   HIS HIS 2 . n 
DA 30 21   GLU 21   21   21   GLU GLU 2 . n 
DA 30 22   VAL 22   22   22   VAL VAL 2 . n 
DA 30 23   GLU 23   23   23   GLU GLU 2 . n 
DA 30 24   LYS 24   24   24   LYS LYS 2 . n 
DA 30 25   VAL 25   25   25   VAL VAL 2 . n 
DA 30 26   ARG 26   26   26   ARG ARG 2 . n 
DA 30 27   SER 27   27   27   SER SER 2 . n 
DA 30 28   GLY 28   28   28   GLY GLY 2 . n 
DA 30 29   ARG 29   29   29   ARG ARG 2 . n 
DA 30 30   GLN 30   30   30   GLN GLN 2 . n 
DA 30 31   THR 31   31   31   THR THR 2 . n 
DA 30 32   GLY 32   32   32   GLY GLY 2 . n 
DA 30 33   MET 33   33   33   MET MET 2 . n 
DA 30 34   LYS 34   34   34   LYS LYS 2 . n 
DA 30 35   TRP 35   35   35   TRP TRP 2 . n 
DA 30 36   ILE 36   36   36   ILE ILE 2 . n 
DA 30 37   ASP 37   37   37   ASP ASP 2 . n 
DA 30 38   ARG 38   38   38   ARG ARG 2 . n 
DA 30 39   GLN 39   39   39   GLN GLN 2 . n 
DA 30 40   ARG 40   40   40   ARG ARG 2 . n 
DA 30 41   GLU 41   41   41   GLU GLU 2 . n 
DA 30 42   ARG 42   42   42   ARG ARG 2 . n 
DA 30 43   ASN 43   43   43   ASN ASN 2 . n 
DA 30 44   SER 44   44   44   SER SER 2 . n 
DA 30 45   GLY 45   45   45   GLY GLY 2 . n 
DA 30 46   ILE 46   46   46   ILE ILE 2 . n 
DA 30 47   GLY 47   47   47   GLY GLY 2 . n 
DA 30 48   ASN 48   48   48   ASN ASN 2 . n 
DA 30 49   ASP 49   49   49   ASP ASP 2 . n 
DA 30 50   GLY 50   50   50   GLY GLY 2 . n 
DA 30 51   LYS 51   51   51   LYS LYS 2 . n 
DA 30 52   PHE 52   52   52   PHE PHE 2 . n 
DA 30 53   SER 53   53   53   SER SER 2 . n 
DA 30 54   LYS 54   54   54   LYS LYS 2 . n 
DA 30 55   VAL 55   55   55   VAL VAL 2 . n 
DA 30 56   PRO 56   56   56   PRO PRO 2 . n 
DA 30 57   GLY 57   57   57   GLY GLY 2 . n 
DA 30 58   GLY 58   58   58   GLY GLY 2 . n 
DA 30 59   ASP 59   59   59   ASP ASP 2 . n 
DA 30 60   LYS 60   60   60   LYS LYS 2 . n 
DA 30 61   PRO 61   61   61   PRO PRO 2 . n 
DA 30 62   THR 62   62   62   THR THR 2 . n 
DA 30 63   LYS 63   63   63   LYS LYS 2 . n 
DA 30 64   LYS 64   64   64   LYS LYS 2 . n 
DA 30 65   THR 65   65   65   THR THR 2 . n 
DA 30 66   ASP 66   66   66   ASP ASP 2 . n 
DA 30 67   LEU 67   67   67   LEU LEU 2 . n 
DA 30 68   LYS 68   68   68   LYS LYS 2 . n 
DA 30 69   TYR 69   69   69   TYR TYR 2 . n 
DA 30 70   ARG 70   70   70   ARG ARG 2 . n 
DA 30 71   CYS 71   71   71   CYS CYS 2 . n 
DA 30 72   GLY 72   72   72   GLY GLY 2 . n 
DA 30 73   GLU 73   73   73   GLU GLU 2 . n 
DA 30 74   CYS 74   74   74   CYS CYS 2 . n 
DA 30 75   GLY 75   75   75   GLY GLY 2 . n 
DA 30 76   LYS 76   76   76   LYS LYS 2 . n 
DA 30 77   ALA 77   77   77   ALA ALA 2 . n 
DA 30 78   HIS 78   78   78   HIS HIS 2 . n 
DA 30 79   LEU 79   79   79   LEU LEU 2 . n 
DA 30 80   ARG 80   80   80   ARG ARG 2 . n 
DA 30 81   GLU 81   81   81   GLU GLU 2 . n 
DA 30 82   GLY 82   82   82   GLY GLY 2 . n 
DA 30 83   TRP 83   83   83   TRP TRP 2 . n 
DA 30 84   ARG 84   84   84   ARG ARG 2 . n 
DA 30 85   ALA 85   85   85   ALA ALA 2 . n 
DA 30 86   GLY 86   86   86   GLY GLY 2 . n 
DA 30 87   ARG 87   87   87   ARG ARG 2 . n 
DA 30 88   LEU 88   88   88   LEU LEU 2 . n 
DA 30 89   GLU 89   89   89   GLU GLU 2 . n 
DA 30 90   PHE 90   90   90   PHE PHE 2 . n 
DA 30 91   GLN 91   91   91   GLN GLN 2 . n 
DA 30 92   GLU 92   92   92   GLU GLU 2 . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
EA 31 MG  1    8001 1    MG  MG  0 . 
FA 31 MG  1    8002 2    MG  MG  0 . 
GA 31 MG  1    8003 3    MG  MG  0 . 
HA 31 MG  1    8004 4    MG  MG  0 . 
IA 31 MG  1    8005 5    MG  MG  0 . 
JA 31 MG  1    8006 6    MG  MG  0 . 
KA 31 MG  1    8007 7    MG  MG  0 . 
LA 31 MG  1    8008 8    MG  MG  0 . 
MA 31 MG  1    8009 9    MG  MG  0 . 
NA 31 MG  1    8010 10   MG  MG  0 . 
OA 31 MG  1    8011 11   MG  MG  0 . 
PA 31 MG  1    8012 12   MG  MG  0 . 
QA 31 MG  1    8013 13   MG  MG  0 . 
RA 31 MG  1    8014 14   MG  MG  0 . 
SA 31 MG  1    8015 15   MG  MG  0 . 
TA 31 MG  1    8016 16   MG  MG  0 . 
UA 31 MG  1    8017 17   MG  MG  0 . 
VA 31 MG  1    8018 18   MG  MG  0 . 
WA 31 MG  1    8019 19   MG  MG  0 . 
XA 31 MG  1    8020 20   MG  MG  0 . 
YA 31 MG  1    8021 21   MG  MG  0 . 
ZA 31 MG  1    8022 22   MG  MG  0 . 
AB 31 MG  1    8023 23   MG  MG  0 . 
BB 31 MG  1    8024 24   MG  MG  0 . 
CB 31 MG  1    8025 25   MG  MG  0 . 
DB 31 MG  1    8026 26   MG  MG  0 . 
EB 31 MG  1    8027 27   MG  MG  0 . 
FB 31 MG  1    8028 28   MG  MG  0 . 
GB 31 MG  1    8029 29   MG  MG  0 . 
HB 31 MG  1    8030 30   MG  MG  0 . 
IB 31 MG  1    8031 31   MG  MG  0 . 
JB 31 MG  1    8032 32   MG  MG  0 . 
KB 31 MG  1    8033 33   MG  MG  0 . 
LB 31 MG  1    8034 34   MG  MG  0 . 
MB 31 MG  1    8035 35   MG  MG  0 . 
NB 31 MG  1    8036 36   MG  MG  0 . 
OB 31 MG  1    8037 37   MG  MG  0 . 
PB 31 MG  1    8038 38   MG  MG  0 . 
QB 31 MG  1    8039 39   MG  MG  0 . 
RB 31 MG  1    8040 40   MG  MG  0 . 
SB 31 MG  1    8041 41   MG  MG  0 . 
TB 31 MG  1    8042 42   MG  MG  0 . 
UB 31 MG  1    8043 43   MG  MG  0 . 
VB 31 MG  1    8044 44   MG  MG  0 . 
WB 31 MG  1    8045 45   MG  MG  0 . 
XB 31 MG  1    8046 46   MG  MG  0 . 
YB 31 MG  1    8047 47   MG  MG  0 . 
ZB 31 MG  1    8048 48   MG  MG  0 . 
AC 31 MG  1    8049 49   MG  MG  0 . 
BC 31 MG  1    8050 50   MG  MG  0 . 
CC 31 MG  1    8051 51   MG  MG  0 . 
DC 31 MG  1    8052 52   MG  MG  0 . 
EC 31 MG  1    8053 53   MG  MG  0 . 
FC 31 MG  1    8054 54   MG  MG  0 . 
GC 31 MG  1    8056 56   MG  MG  0 . 
HC 31 MG  1    8057 57   MG  MG  0 . 
IC 31 MG  1    8058 58   MG  MG  0 . 
JC 31 MG  1    8059 59   MG  MG  0 . 
KC 31 MG  1    8060 60   MG  MG  0 . 
LC 31 MG  1    8061 61   MG  MG  0 . 
MC 31 MG  1    8062 62   MG  MG  0 . 
NC 31 MG  1    8063 63   MG  MG  0 . 
OC 31 MG  1    8064 64   MG  MG  0 . 
PC 31 MG  1    8066 66   MG  MG  0 . 
QC 31 MG  1    8067 67   MG  MG  0 . 
RC 31 MG  1    8068 68   MG  MG  0 . 
SC 31 MG  1    8070 70   MG  MG  0 . 
TC 31 MG  1    8071 71   MG  MG  0 . 
UC 31 MG  1    8072 72   MG  MG  0 . 
VC 31 MG  1    8074 74   MG  MG  0 . 
WC 31 MG  1    8075 75   MG  MG  0 . 
XC 31 MG  1    8076 76   MG  MG  0 . 
YC 31 MG  1    8077 77   MG  MG  0 . 
ZC 31 MG  1    8079 79   MG  MG  0 . 
AD 31 MG  1    8080 80   MG  MG  0 . 
BD 31 MG  1    8081 81   MG  MG  0 . 
CD 31 MG  1    8082 82   MG  MG  0 . 
DD 31 MG  1    8083 83   MG  MG  0 . 
ED 31 MG  1    8084 84   MG  MG  0 . 
FD 31 MG  1    8085 85   MG  MG  0 . 
GD 31 MG  1    8086 86   MG  MG  0 . 
HD 31 MG  1    8087 87   MG  MG  0 . 
ID 31 MG  1    8088 88   MG  MG  0 . 
JD 31 MG  1    8089 89   MG  MG  0 . 
KD 31 MG  1    8090 90   MG  MG  0 . 
LD 31 MG  1    8091 91   MG  MG  0 . 
MD 31 MG  1    8092 92   MG  MG  0 . 
ND 31 MG  1    8093 93   MG  MG  0 . 
OD 31 MG  1    8094 94   MG  MG  0 . 
PD 31 MG  1    8096 96   MG  MG  0 . 
QD 31 MG  1    8097 97   MG  MG  0 . 
RD 31 MG  1    8098 98   MG  MG  0 . 
SD 31 MG  1    8099 99   MG  MG  0 . 
TD 31 MG  1    8100 100  MG  MG  0 . 
UD 31 MG  1    8101 101  MG  MG  0 . 
VD 31 MG  1    8102 102  MG  MG  0 . 
WD 31 MG  1    8103 103  MG  MG  0 . 
XD 31 MG  1    8104 104  MG  MG  0 . 
YD 31 MG  1    8106 106  MG  MG  0 . 
ZD 31 MG  1    8107 107  MG  MG  0 . 
AE 31 MG  1    8108 108  MG  MG  0 . 
BE 31 MG  1    8110 110  MG  MG  0 . 
CE 31 MG  1    8111 111  MG  MG  0 . 
DE 31 MG  1    8112 112  MG  MG  0 . 
EE 31 MG  1    8113 113  MG  MG  0 . 
FE 31 MG  1    8114 114  MG  MG  0 . 
GE 31 MG  1    8115 115  MG  MG  0 . 
HE 31 MG  1    8116 116  MG  MG  0 . 
IE 31 MG  1    8117 117  MG  MG  0 . 
JE 32 K   1    8201 1    K   K   0 . 
KE 32 K   1    8202 2    K   K   0 . 
LE 33 NA  1    8301 1    NA  NA  0 . 
ME 33 NA  1    8302 2    NA  NA  0 . 
NE 33 NA  1    8303 3    NA  NA  0 . 
OE 33 NA  1    8305 5    NA  NA  0 . 
PE 33 NA  1    8306 6    NA  NA  0 . 
QE 33 NA  1    8307 7    NA  NA  0 . 
RE 33 NA  1    8308 8    NA  NA  0 . 
SE 33 NA  1    8310 10   NA  NA  0 . 
TE 33 NA  1    8311 11   NA  NA  0 . 
UE 33 NA  1    8313 13   NA  NA  0 . 
VE 33 NA  1    8314 14   NA  NA  0 . 
WE 33 NA  1    8315 15   NA  NA  0 . 
XE 33 NA  1    8316 16   NA  NA  0 . 
YE 33 NA  1    8317 17   NA  NA  0 . 
ZE 33 NA  1    8318 18   NA  NA  0 . 
AF 33 NA  1    8319 19   NA  NA  0 . 
BF 33 NA  1    8320 20   NA  NA  0 . 
CF 33 NA  1    8321 21   NA  NA  0 . 
DF 33 NA  1    8323 23   NA  NA  0 . 
EF 33 NA  1    8324 24   NA  NA  0 . 
FF 33 NA  1    8325 25   NA  NA  0 . 
GF 33 NA  1    8326 26   NA  NA  0 . 
HF 33 NA  1    8327 27   NA  NA  0 . 
IF 33 NA  1    8328 28   NA  NA  0 . 
JF 33 NA  1    8329 29   NA  NA  0 . 
KF 33 NA  1    8330 30   NA  NA  0 . 
LF 33 NA  1    8331 31   NA  NA  0 . 
MF 33 NA  1    8332 32   NA  NA  0 . 
NF 33 NA  1    8333 33   NA  NA  0 . 
OF 33 NA  1    8334 34   NA  NA  0 . 
PF 33 NA  1    8335 35   NA  NA  0 . 
QF 33 NA  1    8336 36   NA  NA  0 . 
RF 33 NA  1    8338 38   NA  NA  0 . 
SF 33 NA  1    8339 39   NA  NA  0 . 
TF 33 NA  1    8340 40   NA  NA  0 . 
UF 33 NA  1    8341 41   NA  NA  0 . 
VF 33 NA  1    8342 42   NA  NA  0 . 
WF 33 NA  1    8344 44   NA  NA  0 . 
XF 33 NA  1    8349 49   NA  NA  0 . 
YF 33 NA  1    8350 50   NA  NA  0 . 
ZF 33 NA  1    8352 52   NA  NA  0 . 
AG 33 NA  1    8353 53   NA  NA  0 . 
BG 33 NA  1    8354 54   NA  NA  0 . 
CG 33 NA  1    8355 55   NA  NA  0 . 
DG 33 NA  1    8356 56   NA  NA  0 . 
EG 33 NA  1    8357 57   NA  NA  0 . 
FG 33 NA  1    8358 58   NA  NA  0 . 
GG 33 NA  1    8359 59   NA  NA  0 . 
HG 33 NA  1    8360 60   NA  NA  0 . 
IG 33 NA  1    8361 61   NA  NA  0 . 
JG 33 NA  1    8362 62   NA  NA  0 . 
KG 33 NA  1    8363 63   NA  NA  0 . 
LG 33 NA  1    8364 64   NA  NA  0 . 
MG 33 NA  1    8365 65   NA  NA  0 . 
NG 33 NA  1    8366 66   NA  NA  0 . 
OG 33 NA  1    8367 67   NA  NA  0 . 
PG 33 NA  1    8368 68   NA  NA  0 . 
QG 33 NA  1    8369 69   NA  NA  0 . 
RG 33 NA  1    8370 70   NA  NA  0 . 
SG 33 NA  1    8371 71   NA  NA  0 . 
TG 33 NA  1    8372 72   NA  NA  0 . 
UG 33 NA  1    8373 73   NA  NA  0 . 
VG 33 NA  1    8374 74   NA  NA  0 . 
WG 33 NA  1    8375 75   NA  NA  0 . 
XG 33 NA  1    8376 76   NA  NA  0 . 
YG 33 NA  1    8377 77   NA  NA  0 . 
ZG 33 NA  1    8378 78   NA  NA  0 . 
AH 33 NA  1    8379 79   NA  NA  0 . 
BH 33 NA  1    8381 81   NA  NA  0 . 
CH 33 NA  1    8382 82   NA  NA  0 . 
DH 33 NA  1    8384 84   NA  NA  0 . 
EH 33 NA  1    8385 85   NA  NA  0 . 
FH 34 CL  1    8503 3    CL  CL  0 . 
GH 34 CL  1    8505 5    CL  CL  0 . 
HH 34 CL  1    8511 11   CL  CL  0 . 
IH 34 CL  1    8512 12   CL  CL  0 . 
JH 34 CL  1    8513 13   CL  CL  0 . 
KH 34 CL  1    8514 14   CL  CL  0 . 
LH 34 CL  1    8515 15   CL  CL  0 . 
MH 34 CL  1    8516 16   CL  CL  0 . 
NH 34 CL  1    8517 17   CL  CL  0 . 
OH 34 CL  1    8522 22   CL  CL  0 . 
PH 31 MG  1    8095 95   MG  MG  9 . 
QH 33 NA  1    8351 51   NA  NA  9 . 
RH 33 NA  1    8383 83   NA  NA  9 . 
SH 31 MG  1    8065 65   MG  MG  A . 
TH 31 MG  1    8105 105  MG  MG  A . 
UH 33 NA  1    8345 45   NA  NA  A . 
VH 34 CL  1    8509 9    CL  CL  A . 
WH 31 MG  1    8055 55   MG  MG  B . 
XH 34 CL  1    8519 19   CL  CL  B . 
YH 33 NA  1    8304 4    NA  NA  C . 
ZH 33 NA  1    8309 9    NA  NA  H . 
AI 33 NA  1    8322 22   NA  NA  H . 
BI 33 NA  1    8346 46   NA  NA  I . 
CI 34 CL  1    8501 1    CL  CL  I . 
DI 34 CL  1    8502 2    CL  CL  I . 
EI 34 CL  1    8521 21   CL  CL  I . 
FI 31 MG  1    8069 69   MG  MG  J . 
GI 33 NA  1    8380 80   NA  NA  K . 
HI 34 CL  1    8510 10   CL  CL  K . 
II 33 NA  1    8347 47   NA  NA  L . 
JI 34 CL  1    8518 18   CL  CL  L . 
KI 34 CL  1    8507 7    CL  CL  M . 
LI 35 CD  1    8405 5    CD  CD  N . 
MI 34 CL  1    8508 8    CL  CL  N . 
NI 33 NA  1    8348 48   NA  NA  P . 
OI 33 NA  1    8337 37   NA  NA  Q . 
PI 33 NA  1    8386 86   NA  NA  Q . 
QI 34 CL  1    8506 6    CL  CL  Q . 
RI 33 NA  1    8312 12   NA  NA  R . 
SI 31 MG  1    8073 73   MG  MG  S . 
TI 33 NA  1    8343 43   NA  NA  S . 
UI 35 CD  1    8401 1    CD  CD  T . 
VI 31 MG  1    8109 109  MG  MG  X . 
WI 34 CL  1    8520 20   CL  CL  X . 
XI 35 CD  1    8403 3    CD  CD  Y . 
YI 35 CD  1    8402 2    CD  CD  Z . 
ZI 31 MG  1    8078 78   MG  MG  2 . 
AJ 35 CD  1    8404 4    CD  CD  2 . 
BJ 34 CL  1    8504 4    CL  CL  2 . 
CJ 36 HOH 1    3001 1864 HOH HOH 0 . 
CJ 36 HOH 2    3002 1866 HOH HOH 0 . 
CJ 36 HOH 3    3003 1868 HOH HOH 0 . 
CJ 36 HOH 4    3004 1869 HOH HOH 0 . 
CJ 36 HOH 5    3005 1870 HOH HOH 0 . 
CJ 36 HOH 6    3006 1871 HOH HOH 0 . 
CJ 36 HOH 7    3007 1872 HOH HOH 0 . 
CJ 36 HOH 8    3008 1873 HOH HOH 0 . 
CJ 36 HOH 9    3009 1874 HOH HOH 0 . 
CJ 36 HOH 10   3010 1875 HOH HOH 0 . 
CJ 36 HOH 11   3011 1876 HOH HOH 0 . 
CJ 36 HOH 12   3012 1877 HOH HOH 0 . 
CJ 36 HOH 13   3013 1878 HOH HOH 0 . 
CJ 36 HOH 14   3014 1879 HOH HOH 0 . 
CJ 36 HOH 15   3015 1880 HOH HOH 0 . 
CJ 36 HOH 16   3016 1881 HOH HOH 0 . 
CJ 36 HOH 17   3017 1882 HOH HOH 0 . 
CJ 36 HOH 18   3018 1884 HOH HOH 0 . 
CJ 36 HOH 19   3019 1885 HOH HOH 0 . 
CJ 36 HOH 20   3020 1887 HOH HOH 0 . 
CJ 36 HOH 21   3021 1888 HOH HOH 0 . 
CJ 36 HOH 22   3022 1889 HOH HOH 0 . 
CJ 36 HOH 23   3023 1890 HOH HOH 0 . 
CJ 36 HOH 24   3024 1891 HOH HOH 0 . 
CJ 36 HOH 25   3025 1892 HOH HOH 0 . 
CJ 36 HOH 26   3026 1893 HOH HOH 0 . 
CJ 36 HOH 27   3027 1895 HOH HOH 0 . 
CJ 36 HOH 28   3028 1896 HOH HOH 0 . 
CJ 36 HOH 29   3029 1899 HOH HOH 0 . 
CJ 36 HOH 30   3030 1900 HOH HOH 0 . 
CJ 36 HOH 31   3031 1901 HOH HOH 0 . 
CJ 36 HOH 32   3032 1903 HOH HOH 0 . 
CJ 36 HOH 33   3033 1904 HOH HOH 0 . 
CJ 36 HOH 34   3034 1905 HOH HOH 0 . 
CJ 36 HOH 35   3035 1906 HOH HOH 0 . 
CJ 36 HOH 36   3036 1908 HOH HOH 0 . 
CJ 36 HOH 37   3037 1909 HOH HOH 0 . 
CJ 36 HOH 38   3038 1910 HOH HOH 0 . 
CJ 36 HOH 39   3039 1911 HOH HOH 0 . 
CJ 36 HOH 40   3040 1913 HOH HOH 0 . 
CJ 36 HOH 41   3041 1914 HOH HOH 0 . 
CJ 36 HOH 42   3042 1915 HOH HOH 0 . 
CJ 36 HOH 43   3043 1917 HOH HOH 0 . 
CJ 36 HOH 44   3044 1918 HOH HOH 0 . 
CJ 36 HOH 45   3045 1920 HOH HOH 0 . 
CJ 36 HOH 46   3046 1921 HOH HOH 0 . 
CJ 36 HOH 47   3047 1922 HOH HOH 0 . 
CJ 36 HOH 48   3048 1924 HOH HOH 0 . 
CJ 36 HOH 49   3049 1925 HOH HOH 0 . 
CJ 36 HOH 50   3050 1927 HOH HOH 0 . 
CJ 36 HOH 51   3051 1928 HOH HOH 0 . 
CJ 36 HOH 52   3052 1929 HOH HOH 0 . 
CJ 36 HOH 53   3053 1930 HOH HOH 0 . 
CJ 36 HOH 54   3054 1931 HOH HOH 0 . 
CJ 36 HOH 55   3055 1935 HOH HOH 0 . 
CJ 36 HOH 56   3056 1936 HOH HOH 0 . 
CJ 36 HOH 57   3057 1938 HOH HOH 0 . 
CJ 36 HOH 58   3058 1939 HOH HOH 0 . 
CJ 36 HOH 59   3059 1941 HOH HOH 0 . 
CJ 36 HOH 60   3060 1942 HOH HOH 0 . 
CJ 36 HOH 61   3061 1944 HOH HOH 0 . 
CJ 36 HOH 62   3062 1946 HOH HOH 0 . 
CJ 36 HOH 63   3063 1947 HOH HOH 0 . 
CJ 36 HOH 64   3064 1948 HOH HOH 0 . 
CJ 36 HOH 65   3065 1949 HOH HOH 0 . 
CJ 36 HOH 66   3066 1950 HOH HOH 0 . 
CJ 36 HOH 67   3067 1952 HOH HOH 0 . 
CJ 36 HOH 68   3068 1953 HOH HOH 0 . 
CJ 36 HOH 69   3069 1954 HOH HOH 0 . 
CJ 36 HOH 70   3070 1956 HOH HOH 0 . 
CJ 36 HOH 71   3071 1957 HOH HOH 0 . 
CJ 36 HOH 72   3072 1958 HOH HOH 0 . 
CJ 36 HOH 73   3073 1959 HOH HOH 0 . 
CJ 36 HOH 74   3074 1960 HOH HOH 0 . 
CJ 36 HOH 75   3075 1961 HOH HOH 0 . 
CJ 36 HOH 76   3076 1962 HOH HOH 0 . 
CJ 36 HOH 77   3077 1963 HOH HOH 0 . 
CJ 36 HOH 78   3078 1964 HOH HOH 0 . 
CJ 36 HOH 79   3079 1965 HOH HOH 0 . 
CJ 36 HOH 80   3080 1966 HOH HOH 0 . 
CJ 36 HOH 81   3081 1967 HOH HOH 0 . 
CJ 36 HOH 82   3082 1970 HOH HOH 0 . 
CJ 36 HOH 83   3083 1971 HOH HOH 0 . 
CJ 36 HOH 84   3084 1973 HOH HOH 0 . 
CJ 36 HOH 85   3085 1974 HOH HOH 0 . 
CJ 36 HOH 86   3086 1975 HOH HOH 0 . 
CJ 36 HOH 87   3087 1976 HOH HOH 0 . 
CJ 36 HOH 88   3088 1977 HOH HOH 0 . 
CJ 36 HOH 89   3089 1978 HOH HOH 0 . 
CJ 36 HOH 90   3090 1980 HOH HOH 0 . 
CJ 36 HOH 91   3091 1983 HOH HOH 0 . 
CJ 36 HOH 92   3092 1984 HOH HOH 0 . 
CJ 36 HOH 93   3093 1985 HOH HOH 0 . 
CJ 36 HOH 94   3094 1988 HOH HOH 0 . 
CJ 36 HOH 95   3095 1989 HOH HOH 0 . 
CJ 36 HOH 96   3096 1991 HOH HOH 0 . 
CJ 36 HOH 97   3097 1992 HOH HOH 0 . 
CJ 36 HOH 98   3098 1994 HOH HOH 0 . 
CJ 36 HOH 99   3099 1995 HOH HOH 0 . 
CJ 36 HOH 100  3100 1997 HOH HOH 0 . 
CJ 36 HOH 101  3101 1998 HOH HOH 0 . 
CJ 36 HOH 102  3102 1999 HOH HOH 0 . 
CJ 36 HOH 103  3103 2000 HOH HOH 0 . 
CJ 36 HOH 104  3104 2001 HOH HOH 0 . 
CJ 36 HOH 105  3105 2002 HOH HOH 0 . 
CJ 36 HOH 106  3106 2003 HOH HOH 0 . 
CJ 36 HOH 107  3107 2004 HOH HOH 0 . 
CJ 36 HOH 108  3108 2005 HOH HOH 0 . 
CJ 36 HOH 109  3109 2006 HOH HOH 0 . 
CJ 36 HOH 110  3110 2007 HOH HOH 0 . 
CJ 36 HOH 111  3111 2008 HOH HOH 0 . 
CJ 36 HOH 112  3112 2009 HOH HOH 0 . 
CJ 36 HOH 113  3113 2010 HOH HOH 0 . 
CJ 36 HOH 114  3114 2011 HOH HOH 0 . 
CJ 36 HOH 115  3115 2012 HOH HOH 0 . 
CJ 36 HOH 116  3116 2013 HOH HOH 0 . 
CJ 36 HOH 117  3117 2014 HOH HOH 0 . 
CJ 36 HOH 118  3118 2016 HOH HOH 0 . 
CJ 36 HOH 119  3119 2017 HOH HOH 0 . 
CJ 36 HOH 120  3120 2018 HOH HOH 0 . 
CJ 36 HOH 121  3121 2019 HOH HOH 0 . 
CJ 36 HOH 122  3122 2020 HOH HOH 0 . 
CJ 36 HOH 123  3123 2021 HOH HOH 0 . 
CJ 36 HOH 124  3124 2022 HOH HOH 0 . 
CJ 36 HOH 125  3125 2023 HOH HOH 0 . 
CJ 36 HOH 126  3126 2024 HOH HOH 0 . 
CJ 36 HOH 127  3127 2025 HOH HOH 0 . 
CJ 36 HOH 128  3128 2026 HOH HOH 0 . 
CJ 36 HOH 129  3129 2027 HOH HOH 0 . 
CJ 36 HOH 130  3130 2030 HOH HOH 0 . 
CJ 36 HOH 131  3131 2031 HOH HOH 0 . 
CJ 36 HOH 132  3132 2032 HOH HOH 0 . 
CJ 36 HOH 133  3133 2033 HOH HOH 0 . 
CJ 36 HOH 134  3134 2034 HOH HOH 0 . 
CJ 36 HOH 135  3135 2035 HOH HOH 0 . 
CJ 36 HOH 136  3136 2036 HOH HOH 0 . 
CJ 36 HOH 137  3137 2037 HOH HOH 0 . 
CJ 36 HOH 138  3138 2038 HOH HOH 0 . 
CJ 36 HOH 139  3139 2039 HOH HOH 0 . 
CJ 36 HOH 140  3140 2042 HOH HOH 0 . 
CJ 36 HOH 141  3141 2043 HOH HOH 0 . 
CJ 36 HOH 142  3142 2044 HOH HOH 0 . 
CJ 36 HOH 143  3143 2045 HOH HOH 0 . 
CJ 36 HOH 144  3144 2046 HOH HOH 0 . 
CJ 36 HOH 145  3145 2047 HOH HOH 0 . 
CJ 36 HOH 146  3146 2048 HOH HOH 0 . 
CJ 36 HOH 147  3147 2049 HOH HOH 0 . 
CJ 36 HOH 148  3148 2050 HOH HOH 0 . 
CJ 36 HOH 149  3149 2053 HOH HOH 0 . 
CJ 36 HOH 150  3150 2054 HOH HOH 0 . 
CJ 36 HOH 151  3151 2055 HOH HOH 0 . 
CJ 36 HOH 152  3152 2056 HOH HOH 0 . 
CJ 36 HOH 153  3153 2057 HOH HOH 0 . 
CJ 36 HOH 154  3154 2058 HOH HOH 0 . 
CJ 36 HOH 155  3155 2059 HOH HOH 0 . 
CJ 36 HOH 156  3156 2060 HOH HOH 0 . 
CJ 36 HOH 157  3157 2061 HOH HOH 0 . 
CJ 36 HOH 158  3158 2062 HOH HOH 0 . 
CJ 36 HOH 159  3159 2063 HOH HOH 0 . 
CJ 36 HOH 160  3160 2065 HOH HOH 0 . 
CJ 36 HOH 161  3161 2066 HOH HOH 0 . 
CJ 36 HOH 162  3162 2068 HOH HOH 0 . 
CJ 36 HOH 163  3163 2069 HOH HOH 0 . 
CJ 36 HOH 164  3164 2070 HOH HOH 0 . 
CJ 36 HOH 165  3165 2071 HOH HOH 0 . 
CJ 36 HOH 166  3166 2072 HOH HOH 0 . 
CJ 36 HOH 167  3167 2073 HOH HOH 0 . 
CJ 36 HOH 168  3168 2074 HOH HOH 0 . 
CJ 36 HOH 169  3169 2075 HOH HOH 0 . 
CJ 36 HOH 170  3170 2076 HOH HOH 0 . 
CJ 36 HOH 171  3171 2077 HOH HOH 0 . 
CJ 36 HOH 172  3172 2078 HOH HOH 0 . 
CJ 36 HOH 173  3173 2080 HOH HOH 0 . 
CJ 36 HOH 174  3174 2082 HOH HOH 0 . 
CJ 36 HOH 175  3175 2083 HOH HOH 0 . 
CJ 36 HOH 176  3176 2084 HOH HOH 0 . 
CJ 36 HOH 177  3177 2085 HOH HOH 0 . 
CJ 36 HOH 178  3178 2087 HOH HOH 0 . 
CJ 36 HOH 179  3179 2088 HOH HOH 0 . 
CJ 36 HOH 180  3180 2089 HOH HOH 0 . 
CJ 36 HOH 181  3181 2090 HOH HOH 0 . 
CJ 36 HOH 182  3182 2091 HOH HOH 0 . 
CJ 36 HOH 183  3183 2092 HOH HOH 0 . 
CJ 36 HOH 184  3184 2093 HOH HOH 0 . 
CJ 36 HOH 185  3185 2094 HOH HOH 0 . 
CJ 36 HOH 186  3186 2095 HOH HOH 0 . 
CJ 36 HOH 187  3187 2096 HOH HOH 0 . 
CJ 36 HOH 188  3188 2097 HOH HOH 0 . 
CJ 36 HOH 189  3189 2098 HOH HOH 0 . 
CJ 36 HOH 190  3190 2099 HOH HOH 0 . 
CJ 36 HOH 191  3191 2100 HOH HOH 0 . 
CJ 36 HOH 192  3192 2101 HOH HOH 0 . 
CJ 36 HOH 193  3193 2102 HOH HOH 0 . 
CJ 36 HOH 194  3194 2103 HOH HOH 0 . 
CJ 36 HOH 195  3195 2105 HOH HOH 0 . 
CJ 36 HOH 196  3196 2107 HOH HOH 0 . 
CJ 36 HOH 197  3197 2108 HOH HOH 0 . 
CJ 36 HOH 198  3198 2109 HOH HOH 0 . 
CJ 36 HOH 199  3199 2110 HOH HOH 0 . 
CJ 36 HOH 200  3200 2111 HOH HOH 0 . 
CJ 36 HOH 201  3201 2112 HOH HOH 0 . 
CJ 36 HOH 202  3202 2113 HOH HOH 0 . 
CJ 36 HOH 203  3203 2114 HOH HOH 0 . 
CJ 36 HOH 204  3204 2115 HOH HOH 0 . 
CJ 36 HOH 205  3205 2116 HOH HOH 0 . 
CJ 36 HOH 206  3206 2117 HOH HOH 0 . 
CJ 36 HOH 207  3207 2119 HOH HOH 0 . 
CJ 36 HOH 208  3208 2120 HOH HOH 0 . 
CJ 36 HOH 209  3209 2122 HOH HOH 0 . 
CJ 36 HOH 210  3210 2123 HOH HOH 0 . 
CJ 36 HOH 211  3211 2124 HOH HOH 0 . 
CJ 36 HOH 212  3212 2126 HOH HOH 0 . 
CJ 36 HOH 213  3213 2127 HOH HOH 0 . 
CJ 36 HOH 214  3214 2128 HOH HOH 0 . 
CJ 36 HOH 215  3215 2129 HOH HOH 0 . 
CJ 36 HOH 216  3216 2130 HOH HOH 0 . 
CJ 36 HOH 217  3217 2131 HOH HOH 0 . 
CJ 36 HOH 218  3218 2132 HOH HOH 0 . 
CJ 36 HOH 219  3219 2134 HOH HOH 0 . 
CJ 36 HOH 220  3220 2135 HOH HOH 0 . 
CJ 36 HOH 221  3221 2136 HOH HOH 0 . 
CJ 36 HOH 222  3222 2137 HOH HOH 0 . 
CJ 36 HOH 223  3223 2138 HOH HOH 0 . 
CJ 36 HOH 224  3224 2139 HOH HOH 0 . 
CJ 36 HOH 225  3225 2140 HOH HOH 0 . 
CJ 36 HOH 226  3226 2141 HOH HOH 0 . 
CJ 36 HOH 227  3227 2142 HOH HOH 0 . 
CJ 36 HOH 228  3228 2143 HOH HOH 0 . 
CJ 36 HOH 229  3229 2144 HOH HOH 0 . 
CJ 36 HOH 230  3230 2145 HOH HOH 0 . 
CJ 36 HOH 231  3231 2146 HOH HOH 0 . 
CJ 36 HOH 232  3232 2147 HOH HOH 0 . 
CJ 36 HOH 233  3233 2148 HOH HOH 0 . 
CJ 36 HOH 234  3234 2149 HOH HOH 0 . 
CJ 36 HOH 235  3235 2150 HOH HOH 0 . 
CJ 36 HOH 236  3236 2151 HOH HOH 0 . 
CJ 36 HOH 237  3237 2152 HOH HOH 0 . 
CJ 36 HOH 238  3238 2153 HOH HOH 0 . 
CJ 36 HOH 239  3239 2154 HOH HOH 0 . 
CJ 36 HOH 240  3240 2155 HOH HOH 0 . 
CJ 36 HOH 241  3241 2156 HOH HOH 0 . 
CJ 36 HOH 242  3242 2157 HOH HOH 0 . 
CJ 36 HOH 243  3243 2158 HOH HOH 0 . 
CJ 36 HOH 244  3244 2159 HOH HOH 0 . 
CJ 36 HOH 245  3245 2160 HOH HOH 0 . 
CJ 36 HOH 246  3246 2162 HOH HOH 0 . 
CJ 36 HOH 247  3247 2163 HOH HOH 0 . 
CJ 36 HOH 248  3248 2164 HOH HOH 0 . 
CJ 36 HOH 249  3249 2165 HOH HOH 0 . 
CJ 36 HOH 250  3250 2168 HOH HOH 0 . 
CJ 36 HOH 251  3251 2169 HOH HOH 0 . 
CJ 36 HOH 252  3252 2170 HOH HOH 0 . 
CJ 36 HOH 253  3253 2173 HOH HOH 0 . 
CJ 36 HOH 254  3254 2175 HOH HOH 0 . 
CJ 36 HOH 255  3255 2177 HOH HOH 0 . 
CJ 36 HOH 256  3256 2179 HOH HOH 0 . 
CJ 36 HOH 257  3257 2181 HOH HOH 0 . 
CJ 36 HOH 258  3258 2182 HOH HOH 0 . 
CJ 36 HOH 259  3259 2183 HOH HOH 0 . 
CJ 36 HOH 260  3260 2184 HOH HOH 0 . 
CJ 36 HOH 261  3261 2185 HOH HOH 0 . 
CJ 36 HOH 262  3262 2186 HOH HOH 0 . 
CJ 36 HOH 263  3263 2187 HOH HOH 0 . 
CJ 36 HOH 264  3264 2188 HOH HOH 0 . 
CJ 36 HOH 265  3265 2189 HOH HOH 0 . 
CJ 36 HOH 266  3266 2192 HOH HOH 0 . 
CJ 36 HOH 267  3267 2193 HOH HOH 0 . 
CJ 36 HOH 268  3268 2196 HOH HOH 0 . 
CJ 36 HOH 269  3269 2198 HOH HOH 0 . 
CJ 36 HOH 270  3270 2199 HOH HOH 0 . 
CJ 36 HOH 271  3271 2200 HOH HOH 0 . 
CJ 36 HOH 272  3272 2201 HOH HOH 0 . 
CJ 36 HOH 273  3273 2202 HOH HOH 0 . 
CJ 36 HOH 274  3274 2204 HOH HOH 0 . 
CJ 36 HOH 275  3275 2206 HOH HOH 0 . 
CJ 36 HOH 276  3276 2207 HOH HOH 0 . 
CJ 36 HOH 277  3277 2208 HOH HOH 0 . 
CJ 36 HOH 278  3278 2210 HOH HOH 0 . 
CJ 36 HOH 279  3279 2212 HOH HOH 0 . 
CJ 36 HOH 280  3280 2213 HOH HOH 0 . 
CJ 36 HOH 281  3281 2215 HOH HOH 0 . 
CJ 36 HOH 282  3282 2216 HOH HOH 0 . 
CJ 36 HOH 283  3283 2217 HOH HOH 0 . 
CJ 36 HOH 284  3284 2220 HOH HOH 0 . 
CJ 36 HOH 285  3285 2221 HOH HOH 0 . 
CJ 36 HOH 286  3286 2223 HOH HOH 0 . 
CJ 36 HOH 287  3287 2225 HOH HOH 0 . 
CJ 36 HOH 288  3288 2226 HOH HOH 0 . 
CJ 36 HOH 289  3289 2228 HOH HOH 0 . 
CJ 36 HOH 290  3290 2230 HOH HOH 0 . 
CJ 36 HOH 291  3291 2231 HOH HOH 0 . 
CJ 36 HOH 292  3292 2232 HOH HOH 0 . 
CJ 36 HOH 293  3293 2233 HOH HOH 0 . 
CJ 36 HOH 294  3294 2234 HOH HOH 0 . 
CJ 36 HOH 295  3295 2235 HOH HOH 0 . 
CJ 36 HOH 296  3296 2236 HOH HOH 0 . 
CJ 36 HOH 297  3297 2237 HOH HOH 0 . 
CJ 36 HOH 298  3298 2239 HOH HOH 0 . 
CJ 36 HOH 299  3299 2240 HOH HOH 0 . 
CJ 36 HOH 300  3300 2242 HOH HOH 0 . 
CJ 36 HOH 301  3301 2243 HOH HOH 0 . 
CJ 36 HOH 302  3302 2244 HOH HOH 0 . 
CJ 36 HOH 303  3303 2245 HOH HOH 0 . 
CJ 36 HOH 304  3304 2246 HOH HOH 0 . 
CJ 36 HOH 305  3305 2248 HOH HOH 0 . 
CJ 36 HOH 306  3306 2249 HOH HOH 0 . 
CJ 36 HOH 307  3307 2250 HOH HOH 0 . 
CJ 36 HOH 308  3308 2251 HOH HOH 0 . 
CJ 36 HOH 309  3309 2252 HOH HOH 0 . 
CJ 36 HOH 310  3310 2253 HOH HOH 0 . 
CJ 36 HOH 311  3311 2254 HOH HOH 0 . 
CJ 36 HOH 312  3312 2255 HOH HOH 0 . 
CJ 36 HOH 313  3313 2256 HOH HOH 0 . 
CJ 36 HOH 314  3314 2258 HOH HOH 0 . 
CJ 36 HOH 315  3315 2260 HOH HOH 0 . 
CJ 36 HOH 316  3316 2261 HOH HOH 0 . 
CJ 36 HOH 317  3317 2262 HOH HOH 0 . 
CJ 36 HOH 318  3318 2264 HOH HOH 0 . 
CJ 36 HOH 319  3319 2265 HOH HOH 0 . 
CJ 36 HOH 320  3320 2266 HOH HOH 0 . 
CJ 36 HOH 321  3321 2267 HOH HOH 0 . 
CJ 36 HOH 322  3322 2269 HOH HOH 0 . 
CJ 36 HOH 323  3323 2270 HOH HOH 0 . 
CJ 36 HOH 324  3324 2273 HOH HOH 0 . 
CJ 36 HOH 325  3325 2275 HOH HOH 0 . 
CJ 36 HOH 326  3326 2276 HOH HOH 0 . 
CJ 36 HOH 327  3327 2277 HOH HOH 0 . 
CJ 36 HOH 328  3328 2280 HOH HOH 0 . 
CJ 36 HOH 329  3329 2281 HOH HOH 0 . 
CJ 36 HOH 330  3330 2282 HOH HOH 0 . 
CJ 36 HOH 331  3331 2283 HOH HOH 0 . 
CJ 36 HOH 332  3332 2284 HOH HOH 0 . 
CJ 36 HOH 333  3333 2287 HOH HOH 0 . 
CJ 36 HOH 334  3334 2290 HOH HOH 0 . 
CJ 36 HOH 335  3335 2291 HOH HOH 0 . 
CJ 36 HOH 336  3336 2292 HOH HOH 0 . 
CJ 36 HOH 337  3337 2294 HOH HOH 0 . 
CJ 36 HOH 338  3338 2296 HOH HOH 0 . 
CJ 36 HOH 339  3339 2297 HOH HOH 0 . 
CJ 36 HOH 340  3340 2298 HOH HOH 0 . 
CJ 36 HOH 341  3341 2299 HOH HOH 0 . 
CJ 36 HOH 342  3342 2300 HOH HOH 0 . 
CJ 36 HOH 343  3343 2301 HOH HOH 0 . 
CJ 36 HOH 344  3344 2302 HOH HOH 0 . 
CJ 36 HOH 345  3345 2304 HOH HOH 0 . 
CJ 36 HOH 346  3346 2307 HOH HOH 0 . 
CJ 36 HOH 347  3347 2308 HOH HOH 0 . 
CJ 36 HOH 348  3348 2310 HOH HOH 0 . 
CJ 36 HOH 349  3349 2311 HOH HOH 0 . 
CJ 36 HOH 350  3350 2312 HOH HOH 0 . 
CJ 36 HOH 351  3351 2313 HOH HOH 0 . 
CJ 36 HOH 352  3352 2314 HOH HOH 0 . 
CJ 36 HOH 353  3353 2315 HOH HOH 0 . 
CJ 36 HOH 354  3354 2318 HOH HOH 0 . 
CJ 36 HOH 355  3355 2319 HOH HOH 0 . 
CJ 36 HOH 356  3356 2321 HOH HOH 0 . 
CJ 36 HOH 357  3357 2322 HOH HOH 0 . 
CJ 36 HOH 358  3358 2324 HOH HOH 0 . 
CJ 36 HOH 359  3359 2325 HOH HOH 0 . 
CJ 36 HOH 360  3360 2326 HOH HOH 0 . 
CJ 36 HOH 361  3361 2327 HOH HOH 0 . 
CJ 36 HOH 362  3362 2328 HOH HOH 0 . 
CJ 36 HOH 363  3363 2330 HOH HOH 0 . 
CJ 36 HOH 364  3364 2332 HOH HOH 0 . 
CJ 36 HOH 365  3365 2335 HOH HOH 0 . 
CJ 36 HOH 366  3366 2337 HOH HOH 0 . 
CJ 36 HOH 367  3367 2338 HOH HOH 0 . 
CJ 36 HOH 368  3368 2339 HOH HOH 0 . 
CJ 36 HOH 369  3369 2340 HOH HOH 0 . 
CJ 36 HOH 370  3370 2341 HOH HOH 0 . 
CJ 36 HOH 371  3371 2342 HOH HOH 0 . 
CJ 36 HOH 372  3372 2344 HOH HOH 0 . 
CJ 36 HOH 373  3373 2346 HOH HOH 0 . 
CJ 36 HOH 374  3374 2347 HOH HOH 0 . 
CJ 36 HOH 375  3375 2348 HOH HOH 0 . 
CJ 36 HOH 376  3376 2349 HOH HOH 0 . 
CJ 36 HOH 377  3377 2350 HOH HOH 0 . 
CJ 36 HOH 378  3378 2351 HOH HOH 0 . 
CJ 36 HOH 379  3379 2352 HOH HOH 0 . 
CJ 36 HOH 380  3380 2354 HOH HOH 0 . 
CJ 36 HOH 381  3381 2355 HOH HOH 0 . 
CJ 36 HOH 382  3382 2356 HOH HOH 0 . 
CJ 36 HOH 383  3383 2360 HOH HOH 0 . 
CJ 36 HOH 384  3384 2362 HOH HOH 0 . 
CJ 36 HOH 385  3385 2363 HOH HOH 0 . 
CJ 36 HOH 386  3386 2364 HOH HOH 0 . 
CJ 36 HOH 387  3387 2365 HOH HOH 0 . 
CJ 36 HOH 388  3388 2366 HOH HOH 0 . 
CJ 36 HOH 389  3389 2367 HOH HOH 0 . 
CJ 36 HOH 390  3390 2368 HOH HOH 0 . 
CJ 36 HOH 391  3391 2369 HOH HOH 0 . 
CJ 36 HOH 392  3392 2370 HOH HOH 0 . 
CJ 36 HOH 393  3393 2372 HOH HOH 0 . 
CJ 36 HOH 394  3394 2373 HOH HOH 0 . 
CJ 36 HOH 395  3395 2376 HOH HOH 0 . 
CJ 36 HOH 396  3396 2377 HOH HOH 0 . 
CJ 36 HOH 397  3397 2378 HOH HOH 0 . 
CJ 36 HOH 398  3398 2379 HOH HOH 0 . 
CJ 36 HOH 399  3399 2380 HOH HOH 0 . 
CJ 36 HOH 400  3400 2381 HOH HOH 0 . 
CJ 36 HOH 401  3401 2382 HOH HOH 0 . 
CJ 36 HOH 402  3402 2383 HOH HOH 0 . 
CJ 36 HOH 403  3403 2384 HOH HOH 0 . 
CJ 36 HOH 404  3404 2386 HOH HOH 0 . 
CJ 36 HOH 405  3405 2387 HOH HOH 0 . 
CJ 36 HOH 406  3406 2388 HOH HOH 0 . 
CJ 36 HOH 407  3407 2389 HOH HOH 0 . 
CJ 36 HOH 408  3408 2391 HOH HOH 0 . 
CJ 36 HOH 409  3409 2392 HOH HOH 0 . 
CJ 36 HOH 410  3410 2393 HOH HOH 0 . 
CJ 36 HOH 411  3411 2394 HOH HOH 0 . 
CJ 36 HOH 412  3412 2397 HOH HOH 0 . 
CJ 36 HOH 413  3413 2398 HOH HOH 0 . 
CJ 36 HOH 414  3414 2399 HOH HOH 0 . 
CJ 36 HOH 415  3415 2400 HOH HOH 0 . 
CJ 36 HOH 416  3416 2402 HOH HOH 0 . 
CJ 36 HOH 417  3417 2403 HOH HOH 0 . 
CJ 36 HOH 418  3418 2404 HOH HOH 0 . 
CJ 36 HOH 419  3419 2405 HOH HOH 0 . 
CJ 36 HOH 420  3420 2406 HOH HOH 0 . 
CJ 36 HOH 421  3421 2407 HOH HOH 0 . 
CJ 36 HOH 422  3422 2409 HOH HOH 0 . 
CJ 36 HOH 423  3423 2410 HOH HOH 0 . 
CJ 36 HOH 424  3424 2411 HOH HOH 0 . 
CJ 36 HOH 425  3425 2412 HOH HOH 0 . 
CJ 36 HOH 426  3426 2413 HOH HOH 0 . 
CJ 36 HOH 427  3427 2414 HOH HOH 0 . 
CJ 36 HOH 428  3428 2415 HOH HOH 0 . 
CJ 36 HOH 429  3429 2416 HOH HOH 0 . 
CJ 36 HOH 430  3430 2417 HOH HOH 0 . 
CJ 36 HOH 431  3431 2418 HOH HOH 0 . 
CJ 36 HOH 432  3432 2419 HOH HOH 0 . 
CJ 36 HOH 433  3433 2420 HOH HOH 0 . 
CJ 36 HOH 434  3434 2421 HOH HOH 0 . 
CJ 36 HOH 435  3435 2422 HOH HOH 0 . 
CJ 36 HOH 436  3436 2424 HOH HOH 0 . 
CJ 36 HOH 437  3437 2425 HOH HOH 0 . 
CJ 36 HOH 438  3438 2426 HOH HOH 0 . 
CJ 36 HOH 439  3439 2427 HOH HOH 0 . 
CJ 36 HOH 440  3440 2428 HOH HOH 0 . 
CJ 36 HOH 441  3441 2429 HOH HOH 0 . 
CJ 36 HOH 442  3442 2432 HOH HOH 0 . 
CJ 36 HOH 443  3443 2433 HOH HOH 0 . 
CJ 36 HOH 444  3444 2435 HOH HOH 0 . 
CJ 36 HOH 445  3445 2436 HOH HOH 0 . 
CJ 36 HOH 446  3446 2437 HOH HOH 0 . 
CJ 36 HOH 447  3447 2438 HOH HOH 0 . 
CJ 36 HOH 448  3448 2439 HOH HOH 0 . 
CJ 36 HOH 449  3449 2440 HOH HOH 0 . 
CJ 36 HOH 450  3450 2441 HOH HOH 0 . 
CJ 36 HOH 451  3451 2442 HOH HOH 0 . 
CJ 36 HOH 452  3452 2443 HOH HOH 0 . 
CJ 36 HOH 453  3453 2444 HOH HOH 0 . 
CJ 36 HOH 454  3454 2445 HOH HOH 0 . 
CJ 36 HOH 455  3455 2446 HOH HOH 0 . 
CJ 36 HOH 456  3456 2447 HOH HOH 0 . 
CJ 36 HOH 457  3457 2449 HOH HOH 0 . 
CJ 36 HOH 458  3458 2450 HOH HOH 0 . 
CJ 36 HOH 459  3459 2451 HOH HOH 0 . 
CJ 36 HOH 460  3460 2452 HOH HOH 0 . 
CJ 36 HOH 461  3461 2454 HOH HOH 0 . 
CJ 36 HOH 462  3462 2455 HOH HOH 0 . 
CJ 36 HOH 463  3463 2457 HOH HOH 0 . 
CJ 36 HOH 464  3464 2458 HOH HOH 0 . 
CJ 36 HOH 465  3465 2459 HOH HOH 0 . 
CJ 36 HOH 466  3466 2460 HOH HOH 0 . 
CJ 36 HOH 467  3467 2461 HOH HOH 0 . 
CJ 36 HOH 468  3468 2462 HOH HOH 0 . 
CJ 36 HOH 469  3469 2463 HOH HOH 0 . 
CJ 36 HOH 470  3470 2464 HOH HOH 0 . 
CJ 36 HOH 471  3471 2465 HOH HOH 0 . 
CJ 36 HOH 472  3472 2467 HOH HOH 0 . 
CJ 36 HOH 473  3473 2468 HOH HOH 0 . 
CJ 36 HOH 474  3474 2469 HOH HOH 0 . 
CJ 36 HOH 475  3475 2470 HOH HOH 0 . 
CJ 36 HOH 476  3476 2472 HOH HOH 0 . 
CJ 36 HOH 477  3477 2473 HOH HOH 0 . 
CJ 36 HOH 478  3478 2474 HOH HOH 0 . 
CJ 36 HOH 479  3479 2475 HOH HOH 0 . 
CJ 36 HOH 480  3480 2476 HOH HOH 0 . 
CJ 36 HOH 481  3481 2477 HOH HOH 0 . 
CJ 36 HOH 482  3482 2478 HOH HOH 0 . 
CJ 36 HOH 483  3483 2481 HOH HOH 0 . 
CJ 36 HOH 484  3484 2482 HOH HOH 0 . 
CJ 36 HOH 485  3485 2483 HOH HOH 0 . 
CJ 36 HOH 486  3486 2484 HOH HOH 0 . 
CJ 36 HOH 487  3487 2488 HOH HOH 0 . 
CJ 36 HOH 488  3488 2489 HOH HOH 0 . 
CJ 36 HOH 489  3489 2492 HOH HOH 0 . 
CJ 36 HOH 490  3490 2493 HOH HOH 0 . 
CJ 36 HOH 491  3491 2494 HOH HOH 0 . 
CJ 36 HOH 492  3492 2496 HOH HOH 0 . 
CJ 36 HOH 493  3493 2498 HOH HOH 0 . 
CJ 36 HOH 494  3494 2500 HOH HOH 0 . 
CJ 36 HOH 495  3495 2501 HOH HOH 0 . 
CJ 36 HOH 496  3496 2502 HOH HOH 0 . 
CJ 36 HOH 497  3497 2503 HOH HOH 0 . 
CJ 36 HOH 498  3498 2504 HOH HOH 0 . 
CJ 36 HOH 499  3499 2505 HOH HOH 0 . 
CJ 36 HOH 500  3500 2506 HOH HOH 0 . 
CJ 36 HOH 501  3501 2507 HOH HOH 0 . 
CJ 36 HOH 502  3502 2508 HOH HOH 0 . 
CJ 36 HOH 503  3503 2509 HOH HOH 0 . 
CJ 36 HOH 504  3504 2511 HOH HOH 0 . 
CJ 36 HOH 505  3505 2512 HOH HOH 0 . 
CJ 36 HOH 506  3506 2513 HOH HOH 0 . 
CJ 36 HOH 507  3507 2514 HOH HOH 0 . 
CJ 36 HOH 508  3508 2515 HOH HOH 0 . 
CJ 36 HOH 509  3509 2516 HOH HOH 0 . 
CJ 36 HOH 510  3510 2517 HOH HOH 0 . 
CJ 36 HOH 511  3511 2521 HOH HOH 0 . 
CJ 36 HOH 512  3512 2523 HOH HOH 0 . 
CJ 36 HOH 513  3513 2524 HOH HOH 0 . 
CJ 36 HOH 514  3514 2525 HOH HOH 0 . 
CJ 36 HOH 515  3515 2527 HOH HOH 0 . 
CJ 36 HOH 516  3516 2529 HOH HOH 0 . 
CJ 36 HOH 517  3517 2530 HOH HOH 0 . 
CJ 36 HOH 518  3518 2531 HOH HOH 0 . 
CJ 36 HOH 519  3519 2532 HOH HOH 0 . 
CJ 36 HOH 520  3520 2533 HOH HOH 0 . 
CJ 36 HOH 521  3521 2534 HOH HOH 0 . 
CJ 36 HOH 522  3522 2535 HOH HOH 0 . 
CJ 36 HOH 523  3523 2538 HOH HOH 0 . 
CJ 36 HOH 524  3524 2539 HOH HOH 0 . 
CJ 36 HOH 525  3525 2540 HOH HOH 0 . 
CJ 36 HOH 526  3526 2542 HOH HOH 0 . 
CJ 36 HOH 527  3527 2543 HOH HOH 0 . 
CJ 36 HOH 528  3528 2544 HOH HOH 0 . 
CJ 36 HOH 529  3529 2546 HOH HOH 0 . 
CJ 36 HOH 530  3530 2547 HOH HOH 0 . 
CJ 36 HOH 531  3531 2549 HOH HOH 0 . 
CJ 36 HOH 532  3532 2550 HOH HOH 0 . 
CJ 36 HOH 533  3533 2552 HOH HOH 0 . 
CJ 36 HOH 534  3534 2553 HOH HOH 0 . 
CJ 36 HOH 535  3535 2556 HOH HOH 0 . 
CJ 36 HOH 536  3536 2558 HOH HOH 0 . 
CJ 36 HOH 537  3537 2559 HOH HOH 0 . 
CJ 36 HOH 538  3538 2560 HOH HOH 0 . 
CJ 36 HOH 539  3539 2561 HOH HOH 0 . 
CJ 36 HOH 540  3540 2562 HOH HOH 0 . 
CJ 36 HOH 541  3541 2564 HOH HOH 0 . 
CJ 36 HOH 542  3542 2565 HOH HOH 0 . 
CJ 36 HOH 543  3543 2566 HOH HOH 0 . 
CJ 36 HOH 544  3544 2567 HOH HOH 0 . 
CJ 36 HOH 545  3545 2568 HOH HOH 0 . 
CJ 36 HOH 546  3546 2570 HOH HOH 0 . 
CJ 36 HOH 547  3547 2571 HOH HOH 0 . 
CJ 36 HOH 548  3548 2572 HOH HOH 0 . 
CJ 36 HOH 549  3549 2573 HOH HOH 0 . 
CJ 36 HOH 550  3550 2574 HOH HOH 0 . 
CJ 36 HOH 551  3551 2575 HOH HOH 0 . 
CJ 36 HOH 552  3552 2576 HOH HOH 0 . 
CJ 36 HOH 553  3553 2578 HOH HOH 0 . 
CJ 36 HOH 554  3554 2579 HOH HOH 0 . 
CJ 36 HOH 555  3555 2581 HOH HOH 0 . 
CJ 36 HOH 556  3556 2582 HOH HOH 0 . 
CJ 36 HOH 557  3557 2583 HOH HOH 0 . 
CJ 36 HOH 558  3558 2584 HOH HOH 0 . 
CJ 36 HOH 559  3559 2585 HOH HOH 0 . 
CJ 36 HOH 560  3560 2586 HOH HOH 0 . 
CJ 36 HOH 561  3561 2587 HOH HOH 0 . 
CJ 36 HOH 562  3562 2589 HOH HOH 0 . 
CJ 36 HOH 563  3563 2590 HOH HOH 0 . 
CJ 36 HOH 564  3564 2592 HOH HOH 0 . 
CJ 36 HOH 565  3565 2593 HOH HOH 0 . 
CJ 36 HOH 566  3566 2594 HOH HOH 0 . 
CJ 36 HOH 567  3567 2595 HOH HOH 0 . 
CJ 36 HOH 568  3568 2596 HOH HOH 0 . 
CJ 36 HOH 569  3569 2597 HOH HOH 0 . 
CJ 36 HOH 570  3570 2598 HOH HOH 0 . 
CJ 36 HOH 571  3571 2599 HOH HOH 0 . 
CJ 36 HOH 572  3572 2600 HOH HOH 0 . 
CJ 36 HOH 573  3573 2601 HOH HOH 0 . 
CJ 36 HOH 574  3574 2602 HOH HOH 0 . 
CJ 36 HOH 575  3575 2603 HOH HOH 0 . 
CJ 36 HOH 576  3576 2604 HOH HOH 0 . 
CJ 36 HOH 577  3577 2605 HOH HOH 0 . 
CJ 36 HOH 578  3578 2607 HOH HOH 0 . 
CJ 36 HOH 579  3579 2609 HOH HOH 0 . 
CJ 36 HOH 580  3580 2610 HOH HOH 0 . 
CJ 36 HOH 581  3581 2611 HOH HOH 0 . 
CJ 36 HOH 582  3582 2612 HOH HOH 0 . 
CJ 36 HOH 583  3583 2615 HOH HOH 0 . 
CJ 36 HOH 584  3584 2616 HOH HOH 0 . 
CJ 36 HOH 585  3585 2617 HOH HOH 0 . 
CJ 36 HOH 586  3586 2619 HOH HOH 0 . 
CJ 36 HOH 587  3587 2620 HOH HOH 0 . 
CJ 36 HOH 588  3588 2622 HOH HOH 0 . 
CJ 36 HOH 589  3589 2623 HOH HOH 0 . 
CJ 36 HOH 590  3590 2624 HOH HOH 0 . 
CJ 36 HOH 591  3591 2626 HOH HOH 0 . 
CJ 36 HOH 592  3592 2627 HOH HOH 0 . 
CJ 36 HOH 593  3593 2628 HOH HOH 0 . 
CJ 36 HOH 594  3594 2629 HOH HOH 0 . 
CJ 36 HOH 595  3595 2631 HOH HOH 0 . 
CJ 36 HOH 596  3596 2632 HOH HOH 0 . 
CJ 36 HOH 597  3597 2634 HOH HOH 0 . 
CJ 36 HOH 598  3598 2635 HOH HOH 0 . 
CJ 36 HOH 599  3599 2636 HOH HOH 0 . 
CJ 36 HOH 600  3600 2637 HOH HOH 0 . 
CJ 36 HOH 601  3601 2638 HOH HOH 0 . 
CJ 36 HOH 602  3602 2639 HOH HOH 0 . 
CJ 36 HOH 603  3603 2640 HOH HOH 0 . 
CJ 36 HOH 604  3604 2642 HOH HOH 0 . 
CJ 36 HOH 605  3605 2644 HOH HOH 0 . 
CJ 36 HOH 606  3606 2646 HOH HOH 0 . 
CJ 36 HOH 607  3607 2647 HOH HOH 0 . 
CJ 36 HOH 608  3608 2648 HOH HOH 0 . 
CJ 36 HOH 609  3609 2650 HOH HOH 0 . 
CJ 36 HOH 610  3610 2652 HOH HOH 0 . 
CJ 36 HOH 611  3611 2653 HOH HOH 0 . 
CJ 36 HOH 612  3612 2654 HOH HOH 0 . 
CJ 36 HOH 613  3613 2655 HOH HOH 0 . 
CJ 36 HOH 614  3614 2656 HOH HOH 0 . 
CJ 36 HOH 615  3615 2657 HOH HOH 0 . 
CJ 36 HOH 616  3616 2658 HOH HOH 0 . 
CJ 36 HOH 617  3617 2661 HOH HOH 0 . 
CJ 36 HOH 618  3618 2662 HOH HOH 0 . 
CJ 36 HOH 619  3619 2666 HOH HOH 0 . 
CJ 36 HOH 620  3620 2667 HOH HOH 0 . 
CJ 36 HOH 621  3621 2668 HOH HOH 0 . 
CJ 36 HOH 622  3622 2671 HOH HOH 0 . 
CJ 36 HOH 623  3623 2673 HOH HOH 0 . 
CJ 36 HOH 624  3624 2674 HOH HOH 0 . 
CJ 36 HOH 625  3625 2676 HOH HOH 0 . 
CJ 36 HOH 626  3626 2677 HOH HOH 0 . 
CJ 36 HOH 627  3627 2678 HOH HOH 0 . 
CJ 36 HOH 628  3628 2680 HOH HOH 0 . 
CJ 36 HOH 629  3629 2681 HOH HOH 0 . 
CJ 36 HOH 630  3630 2683 HOH HOH 0 . 
CJ 36 HOH 631  3631 2684 HOH HOH 0 . 
CJ 36 HOH 632  3632 2685 HOH HOH 0 . 
CJ 36 HOH 633  3633 2688 HOH HOH 0 . 
CJ 36 HOH 634  3634 2689 HOH HOH 0 . 
CJ 36 HOH 635  3635 2690 HOH HOH 0 . 
CJ 36 HOH 636  3636 2692 HOH HOH 0 . 
CJ 36 HOH 637  3637 2693 HOH HOH 0 . 
CJ 36 HOH 638  3638 2696 HOH HOH 0 . 
CJ 36 HOH 639  3639 2698 HOH HOH 0 . 
CJ 36 HOH 640  3640 2699 HOH HOH 0 . 
CJ 36 HOH 641  3641 2700 HOH HOH 0 . 
CJ 36 HOH 642  3642 2701 HOH HOH 0 . 
CJ 36 HOH 643  3643 2702 HOH HOH 0 . 
CJ 36 HOH 644  3644 2703 HOH HOH 0 . 
CJ 36 HOH 645  3645 2704 HOH HOH 0 . 
CJ 36 HOH 646  3646 2705 HOH HOH 0 . 
CJ 36 HOH 647  3647 2706 HOH HOH 0 . 
CJ 36 HOH 648  3648 2707 HOH HOH 0 . 
CJ 36 HOH 649  3649 2708 HOH HOH 0 . 
CJ 36 HOH 650  3650 2709 HOH HOH 0 . 
CJ 36 HOH 651  3651 2712 HOH HOH 0 . 
CJ 36 HOH 652  3652 2713 HOH HOH 0 . 
CJ 36 HOH 653  3653 2715 HOH HOH 0 . 
CJ 36 HOH 654  3654 2716 HOH HOH 0 . 
CJ 36 HOH 655  3655 2717 HOH HOH 0 . 
CJ 36 HOH 656  3656 2718 HOH HOH 0 . 
CJ 36 HOH 657  3657 2719 HOH HOH 0 . 
CJ 36 HOH 658  3658 2720 HOH HOH 0 . 
CJ 36 HOH 659  3659 2721 HOH HOH 0 . 
CJ 36 HOH 660  3660 2722 HOH HOH 0 . 
CJ 36 HOH 661  3661 2723 HOH HOH 0 . 
CJ 36 HOH 662  3662 2724 HOH HOH 0 . 
CJ 36 HOH 663  3663 2725 HOH HOH 0 . 
CJ 36 HOH 664  3664 2726 HOH HOH 0 . 
CJ 36 HOH 665  3665 2727 HOH HOH 0 . 
CJ 36 HOH 666  3666 2728 HOH HOH 0 . 
CJ 36 HOH 667  3667 2731 HOH HOH 0 . 
CJ 36 HOH 668  3668 2732 HOH HOH 0 . 
CJ 36 HOH 669  3669 2733 HOH HOH 0 . 
CJ 36 HOH 670  3670 2734 HOH HOH 0 . 
CJ 36 HOH 671  3671 2735 HOH HOH 0 . 
CJ 36 HOH 672  3672 2736 HOH HOH 0 . 
CJ 36 HOH 673  3673 2737 HOH HOH 0 . 
CJ 36 HOH 674  3674 2740 HOH HOH 0 . 
CJ 36 HOH 675  3675 2741 HOH HOH 0 . 
CJ 36 HOH 676  3676 2742 HOH HOH 0 . 
CJ 36 HOH 677  3677 2743 HOH HOH 0 . 
CJ 36 HOH 678  3678 2744 HOH HOH 0 . 
CJ 36 HOH 679  3679 2745 HOH HOH 0 . 
CJ 36 HOH 680  3680 2746 HOH HOH 0 . 
CJ 36 HOH 681  3681 2747 HOH HOH 0 . 
CJ 36 HOH 682  3682 2748 HOH HOH 0 . 
CJ 36 HOH 683  3683 2751 HOH HOH 0 . 
CJ 36 HOH 684  3684 2752 HOH HOH 0 . 
CJ 36 HOH 685  3685 2753 HOH HOH 0 . 
CJ 36 HOH 686  3686 2754 HOH HOH 0 . 
CJ 36 HOH 687  3687 2755 HOH HOH 0 . 
CJ 36 HOH 688  3688 2757 HOH HOH 0 . 
CJ 36 HOH 689  3689 2760 HOH HOH 0 . 
CJ 36 HOH 690  3690 2762 HOH HOH 0 . 
CJ 36 HOH 691  3691 2763 HOH HOH 0 . 
CJ 36 HOH 692  3692 2764 HOH HOH 0 . 
CJ 36 HOH 693  3693 2765 HOH HOH 0 . 
CJ 36 HOH 694  3694 2766 HOH HOH 0 . 
CJ 36 HOH 695  3695 2767 HOH HOH 0 . 
CJ 36 HOH 696  3696 2771 HOH HOH 0 . 
CJ 36 HOH 697  3697 2773 HOH HOH 0 . 
CJ 36 HOH 698  3698 2774 HOH HOH 0 . 
CJ 36 HOH 699  3699 2776 HOH HOH 0 . 
CJ 36 HOH 700  3700 2778 HOH HOH 0 . 
CJ 36 HOH 701  3701 2779 HOH HOH 0 . 
CJ 36 HOH 702  3702 2780 HOH HOH 0 . 
CJ 36 HOH 703  3703 2783 HOH HOH 0 . 
CJ 36 HOH 704  3704 2784 HOH HOH 0 . 
CJ 36 HOH 705  3705 2785 HOH HOH 0 . 
CJ 36 HOH 706  3706 2787 HOH HOH 0 . 
CJ 36 HOH 707  3707 2790 HOH HOH 0 . 
CJ 36 HOH 708  3708 2791 HOH HOH 0 . 
CJ 36 HOH 709  3709 2792 HOH HOH 0 . 
CJ 36 HOH 710  3710 2793 HOH HOH 0 . 
CJ 36 HOH 711  3711 2794 HOH HOH 0 . 
CJ 36 HOH 712  3712 2795 HOH HOH 0 . 
CJ 36 HOH 713  3713 2797 HOH HOH 0 . 
CJ 36 HOH 714  3714 2799 HOH HOH 0 . 
CJ 36 HOH 715  3715 2800 HOH HOH 0 . 
CJ 36 HOH 716  3716 2801 HOH HOH 0 . 
CJ 36 HOH 717  3717 2802 HOH HOH 0 . 
CJ 36 HOH 718  3718 2803 HOH HOH 0 . 
CJ 36 HOH 719  3719 2804 HOH HOH 0 . 
CJ 36 HOH 720  3720 2805 HOH HOH 0 . 
CJ 36 HOH 721  3721 2806 HOH HOH 0 . 
CJ 36 HOH 722  3722 2807 HOH HOH 0 . 
CJ 36 HOH 723  3723 2808 HOH HOH 0 . 
CJ 36 HOH 724  3724 2809 HOH HOH 0 . 
CJ 36 HOH 725  3725 2810 HOH HOH 0 . 
CJ 36 HOH 726  3726 2811 HOH HOH 0 . 
CJ 36 HOH 727  3727 2812 HOH HOH 0 . 
CJ 36 HOH 728  3728 2813 HOH HOH 0 . 
CJ 36 HOH 729  3729 2814 HOH HOH 0 . 
CJ 36 HOH 730  3730 2815 HOH HOH 0 . 
CJ 36 HOH 731  3731 2816 HOH HOH 0 . 
CJ 36 HOH 732  3732 2817 HOH HOH 0 . 
CJ 36 HOH 733  3733 2818 HOH HOH 0 . 
CJ 36 HOH 734  3734 2819 HOH HOH 0 . 
CJ 36 HOH 735  3735 2820 HOH HOH 0 . 
CJ 36 HOH 736  3736 2821 HOH HOH 0 . 
CJ 36 HOH 737  3737 2824 HOH HOH 0 . 
CJ 36 HOH 738  3738 2827 HOH HOH 0 . 
CJ 36 HOH 739  3739 2829 HOH HOH 0 . 
CJ 36 HOH 740  3740 2830 HOH HOH 0 . 
CJ 36 HOH 741  3741 2832 HOH HOH 0 . 
CJ 36 HOH 742  3742 2833 HOH HOH 0 . 
CJ 36 HOH 743  3743 2834 HOH HOH 0 . 
CJ 36 HOH 744  3744 2835 HOH HOH 0 . 
CJ 36 HOH 745  3745 2836 HOH HOH 0 . 
CJ 36 HOH 746  3746 2837 HOH HOH 0 . 
CJ 36 HOH 747  3747 2838 HOH HOH 0 . 
CJ 36 HOH 748  3748 2839 HOH HOH 0 . 
CJ 36 HOH 749  3749 2840 HOH HOH 0 . 
CJ 36 HOH 750  3750 2841 HOH HOH 0 . 
CJ 36 HOH 751  3751 2842 HOH HOH 0 . 
CJ 36 HOH 752  3752 2843 HOH HOH 0 . 
CJ 36 HOH 753  3753 2844 HOH HOH 0 . 
CJ 36 HOH 754  3754 2845 HOH HOH 0 . 
CJ 36 HOH 755  3755 2848 HOH HOH 0 . 
CJ 36 HOH 756  3756 2849 HOH HOH 0 . 
CJ 36 HOH 757  3757 2853 HOH HOH 0 . 
CJ 36 HOH 758  3758 2854 HOH HOH 0 . 
CJ 36 HOH 759  3759 2855 HOH HOH 0 . 
CJ 36 HOH 760  3760 2856 HOH HOH 0 . 
CJ 36 HOH 761  3761 2859 HOH HOH 0 . 
CJ 36 HOH 762  3762 2860 HOH HOH 0 . 
CJ 36 HOH 763  3763 2861 HOH HOH 0 . 
CJ 36 HOH 764  3764 2862 HOH HOH 0 . 
CJ 36 HOH 765  3765 2863 HOH HOH 0 . 
CJ 36 HOH 766  3766 2864 HOH HOH 0 . 
CJ 36 HOH 767  3767 2865 HOH HOH 0 . 
CJ 36 HOH 768  3768 2867 HOH HOH 0 . 
CJ 36 HOH 769  3769 2869 HOH HOH 0 . 
CJ 36 HOH 770  3770 2870 HOH HOH 0 . 
CJ 36 HOH 771  3771 2871 HOH HOH 0 . 
CJ 36 HOH 772  3772 2872 HOH HOH 0 . 
CJ 36 HOH 773  3773 2873 HOH HOH 0 . 
CJ 36 HOH 774  3774 2875 HOH HOH 0 . 
CJ 36 HOH 775  3775 2876 HOH HOH 0 . 
CJ 36 HOH 776  3776 2877 HOH HOH 0 . 
CJ 36 HOH 777  3777 2878 HOH HOH 0 . 
CJ 36 HOH 778  3778 2880 HOH HOH 0 . 
CJ 36 HOH 779  3779 2882 HOH HOH 0 . 
CJ 36 HOH 780  3780 2883 HOH HOH 0 . 
CJ 36 HOH 781  3781 2884 HOH HOH 0 . 
CJ 36 HOH 782  3782 2887 HOH HOH 0 . 
CJ 36 HOH 783  3783 2888 HOH HOH 0 . 
CJ 36 HOH 784  3784 2891 HOH HOH 0 . 
CJ 36 HOH 785  3785 2892 HOH HOH 0 . 
CJ 36 HOH 786  3786 2893 HOH HOH 0 . 
CJ 36 HOH 787  3787 2894 HOH HOH 0 . 
CJ 36 HOH 788  3788 2895 HOH HOH 0 . 
CJ 36 HOH 789  3789 2896 HOH HOH 0 . 
CJ 36 HOH 790  3790 2897 HOH HOH 0 . 
CJ 36 HOH 791  3791 2898 HOH HOH 0 . 
CJ 36 HOH 792  3792 2899 HOH HOH 0 . 
CJ 36 HOH 793  3793 2900 HOH HOH 0 . 
CJ 36 HOH 794  3794 2902 HOH HOH 0 . 
CJ 36 HOH 795  3795 2905 HOH HOH 0 . 
CJ 36 HOH 796  3796 2906 HOH HOH 0 . 
CJ 36 HOH 797  3797 2909 HOH HOH 0 . 
CJ 36 HOH 798  3798 2910 HOH HOH 0 . 
CJ 36 HOH 799  3799 2911 HOH HOH 0 . 
CJ 36 HOH 800  3800 2912 HOH HOH 0 . 
CJ 36 HOH 801  3801 2913 HOH HOH 0 . 
CJ 36 HOH 802  3802 2915 HOH HOH 0 . 
CJ 36 HOH 803  3803 2917 HOH HOH 0 . 
CJ 36 HOH 804  3804 2918 HOH HOH 0 . 
CJ 36 HOH 805  3805 2919 HOH HOH 0 . 
CJ 36 HOH 806  3806 2920 HOH HOH 0 . 
CJ 36 HOH 807  3807 2921 HOH HOH 0 . 
CJ 36 HOH 808  3808 2922 HOH HOH 0 . 
CJ 36 HOH 809  3809 2923 HOH HOH 0 . 
CJ 36 HOH 810  3810 2924 HOH HOH 0 . 
CJ 36 HOH 811  3811 2925 HOH HOH 0 . 
CJ 36 HOH 812  3812 2926 HOH HOH 0 . 
CJ 36 HOH 813  3813 2927 HOH HOH 0 . 
CJ 36 HOH 814  3814 2928 HOH HOH 0 . 
CJ 36 HOH 815  3815 2930 HOH HOH 0 . 
CJ 36 HOH 816  3816 2931 HOH HOH 0 . 
CJ 36 HOH 817  3817 2932 HOH HOH 0 . 
CJ 36 HOH 818  3818 2933 HOH HOH 0 . 
CJ 36 HOH 819  3819 2936 HOH HOH 0 . 
CJ 36 HOH 820  3820 2937 HOH HOH 0 . 
CJ 36 HOH 821  3821 2938 HOH HOH 0 . 
CJ 36 HOH 822  3822 2939 HOH HOH 0 . 
CJ 36 HOH 823  3823 2940 HOH HOH 0 . 
CJ 36 HOH 824  3824 2942 HOH HOH 0 . 
CJ 36 HOH 825  3825 2944 HOH HOH 0 . 
CJ 36 HOH 826  3826 2945 HOH HOH 0 . 
CJ 36 HOH 827  3827 2946 HOH HOH 0 . 
CJ 36 HOH 828  3828 2947 HOH HOH 0 . 
CJ 36 HOH 829  3829 2948 HOH HOH 0 . 
CJ 36 HOH 830  3830 2949 HOH HOH 0 . 
CJ 36 HOH 831  3831 2950 HOH HOH 0 . 
CJ 36 HOH 832  3832 2951 HOH HOH 0 . 
CJ 36 HOH 833  3833 2952 HOH HOH 0 . 
CJ 36 HOH 834  3834 2953 HOH HOH 0 . 
CJ 36 HOH 835  3835 2954 HOH HOH 0 . 
CJ 36 HOH 836  3836 2955 HOH HOH 0 . 
CJ 36 HOH 837  3837 2956 HOH HOH 0 . 
CJ 36 HOH 838  3838 2958 HOH HOH 0 . 
CJ 36 HOH 839  3839 2959 HOH HOH 0 . 
CJ 36 HOH 840  3840 2960 HOH HOH 0 . 
CJ 36 HOH 841  3841 2962 HOH HOH 0 . 
CJ 36 HOH 842  3842 2964 HOH HOH 0 . 
CJ 36 HOH 843  3843 2965 HOH HOH 0 . 
CJ 36 HOH 844  3844 2966 HOH HOH 0 . 
CJ 36 HOH 845  3845 2967 HOH HOH 0 . 
CJ 36 HOH 846  3846 2968 HOH HOH 0 . 
CJ 36 HOH 847  3847 2969 HOH HOH 0 . 
CJ 36 HOH 848  3848 2970 HOH HOH 0 . 
CJ 36 HOH 849  3849 2971 HOH HOH 0 . 
CJ 36 HOH 850  3850 2973 HOH HOH 0 . 
CJ 36 HOH 851  3851 2974 HOH HOH 0 . 
CJ 36 HOH 852  3852 2975 HOH HOH 0 . 
CJ 36 HOH 853  3853 2976 HOH HOH 0 . 
CJ 36 HOH 854  3854 2977 HOH HOH 0 . 
CJ 36 HOH 855  3855 2978 HOH HOH 0 . 
CJ 36 HOH 856  3856 2980 HOH HOH 0 . 
CJ 36 HOH 857  3857 2981 HOH HOH 0 . 
CJ 36 HOH 858  3858 2983 HOH HOH 0 . 
CJ 36 HOH 859  3859 2985 HOH HOH 0 . 
CJ 36 HOH 860  3860 2987 HOH HOH 0 . 
CJ 36 HOH 861  3861 2988 HOH HOH 0 . 
CJ 36 HOH 862  3862 2989 HOH HOH 0 . 
CJ 36 HOH 863  3863 2992 HOH HOH 0 . 
CJ 36 HOH 864  3864 2995 HOH HOH 0 . 
CJ 36 HOH 865  3865 2996 HOH HOH 0 . 
CJ 36 HOH 866  3866 2998 HOH HOH 0 . 
CJ 36 HOH 867  3867 3000 HOH HOH 0 . 
CJ 36 HOH 868  3868 3001 HOH HOH 0 . 
CJ 36 HOH 869  3869 3002 HOH HOH 0 . 
CJ 36 HOH 870  3870 3003 HOH HOH 0 . 
CJ 36 HOH 871  3871 3004 HOH HOH 0 . 
CJ 36 HOH 872  3872 3006 HOH HOH 0 . 
CJ 36 HOH 873  3873 3008 HOH HOH 0 . 
CJ 36 HOH 874  3874 3009 HOH HOH 0 . 
CJ 36 HOH 875  3875 3010 HOH HOH 0 . 
CJ 36 HOH 876  3876 3011 HOH HOH 0 . 
CJ 36 HOH 877  3877 3013 HOH HOH 0 . 
CJ 36 HOH 878  3878 3014 HOH HOH 0 . 
CJ 36 HOH 879  3879 3016 HOH HOH 0 . 
CJ 36 HOH 880  3880 3017 HOH HOH 0 . 
CJ 36 HOH 881  3881 3018 HOH HOH 0 . 
CJ 36 HOH 882  3882 3020 HOH HOH 0 . 
CJ 36 HOH 883  3883 3021 HOH HOH 0 . 
CJ 36 HOH 884  3884 3022 HOH HOH 0 . 
CJ 36 HOH 885  3885 3023 HOH HOH 0 . 
CJ 36 HOH 886  3886 3024 HOH HOH 0 . 
CJ 36 HOH 887  3887 3025 HOH HOH 0 . 
CJ 36 HOH 888  3888 3027 HOH HOH 0 . 
CJ 36 HOH 889  3889 3028 HOH HOH 0 . 
CJ 36 HOH 890  3890 3029 HOH HOH 0 . 
CJ 36 HOH 891  3891 3030 HOH HOH 0 . 
CJ 36 HOH 892  3892 3031 HOH HOH 0 . 
CJ 36 HOH 893  3893 3037 HOH HOH 0 . 
CJ 36 HOH 894  3894 3038 HOH HOH 0 . 
CJ 36 HOH 895  3895 3039 HOH HOH 0 . 
CJ 36 HOH 896  3896 3040 HOH HOH 0 . 
CJ 36 HOH 897  3897 3041 HOH HOH 0 . 
CJ 36 HOH 898  3898 3042 HOH HOH 0 . 
CJ 36 HOH 899  3899 3044 HOH HOH 0 . 
CJ 36 HOH 900  3900 3047 HOH HOH 0 . 
CJ 36 HOH 901  3901 3048 HOH HOH 0 . 
CJ 36 HOH 902  3902 3049 HOH HOH 0 . 
CJ 36 HOH 903  3903 3050 HOH HOH 0 . 
CJ 36 HOH 904  3904 3052 HOH HOH 0 . 
CJ 36 HOH 905  3905 3053 HOH HOH 0 . 
CJ 36 HOH 906  3906 3054 HOH HOH 0 . 
CJ 36 HOH 907  3907 3055 HOH HOH 0 . 
CJ 36 HOH 908  3908 3056 HOH HOH 0 . 
CJ 36 HOH 909  3909 3057 HOH HOH 0 . 
CJ 36 HOH 910  3910 3058 HOH HOH 0 . 
CJ 36 HOH 911  3911 3059 HOH HOH 0 . 
CJ 36 HOH 912  3912 3060 HOH HOH 0 . 
CJ 36 HOH 913  3913 3061 HOH HOH 0 . 
CJ 36 HOH 914  3914 3064 HOH HOH 0 . 
CJ 36 HOH 915  3915 3067 HOH HOH 0 . 
CJ 36 HOH 916  3916 3068 HOH HOH 0 . 
CJ 36 HOH 917  3917 3070 HOH HOH 0 . 
CJ 36 HOH 918  3918 3072 HOH HOH 0 . 
CJ 36 HOH 919  3919 3074 HOH HOH 0 . 
CJ 36 HOH 920  3920 3075 HOH HOH 0 . 
CJ 36 HOH 921  3921 3076 HOH HOH 0 . 
CJ 36 HOH 922  3922 3077 HOH HOH 0 . 
CJ 36 HOH 923  3923 3078 HOH HOH 0 . 
CJ 36 HOH 924  3924 3079 HOH HOH 0 . 
CJ 36 HOH 925  3925 3081 HOH HOH 0 . 
CJ 36 HOH 926  3926 3082 HOH HOH 0 . 
CJ 36 HOH 927  3927 3083 HOH HOH 0 . 
CJ 36 HOH 928  3928 3084 HOH HOH 0 . 
CJ 36 HOH 929  3929 3085 HOH HOH 0 . 
CJ 36 HOH 930  3930 3086 HOH HOH 0 . 
CJ 36 HOH 931  3931 3087 HOH HOH 0 . 
CJ 36 HOH 932  3932 3089 HOH HOH 0 . 
CJ 36 HOH 933  3933 3090 HOH HOH 0 . 
CJ 36 HOH 934  3934 3091 HOH HOH 0 . 
CJ 36 HOH 935  3935 3093 HOH HOH 0 . 
CJ 36 HOH 936  3936 3094 HOH HOH 0 . 
CJ 36 HOH 937  3937 3095 HOH HOH 0 . 
CJ 36 HOH 938  3938 3096 HOH HOH 0 . 
CJ 36 HOH 939  3939 3097 HOH HOH 0 . 
CJ 36 HOH 940  3940 3098 HOH HOH 0 . 
CJ 36 HOH 941  3941 3099 HOH HOH 0 . 
CJ 36 HOH 942  3942 3101 HOH HOH 0 . 
CJ 36 HOH 943  3943 3103 HOH HOH 0 . 
CJ 36 HOH 944  3944 3105 HOH HOH 0 . 
CJ 36 HOH 945  3945 3109 HOH HOH 0 . 
CJ 36 HOH 946  3946 3110 HOH HOH 0 . 
CJ 36 HOH 947  3947 3112 HOH HOH 0 . 
CJ 36 HOH 948  3948 3113 HOH HOH 0 . 
CJ 36 HOH 949  3949 3114 HOH HOH 0 . 
CJ 36 HOH 950  3950 3115 HOH HOH 0 . 
CJ 36 HOH 951  3951 3116 HOH HOH 0 . 
CJ 36 HOH 952  3952 3118 HOH HOH 0 . 
CJ 36 HOH 953  3953 3119 HOH HOH 0 . 
CJ 36 HOH 954  3954 3120 HOH HOH 0 . 
CJ 36 HOH 955  3955 3121 HOH HOH 0 . 
CJ 36 HOH 956  3956 3123 HOH HOH 0 . 
CJ 36 HOH 957  3957 3124 HOH HOH 0 . 
CJ 36 HOH 958  3958 3125 HOH HOH 0 . 
CJ 36 HOH 959  3959 3127 HOH HOH 0 . 
CJ 36 HOH 960  3960 3128 HOH HOH 0 . 
CJ 36 HOH 961  3961 3130 HOH HOH 0 . 
CJ 36 HOH 962  3962 3131 HOH HOH 0 . 
CJ 36 HOH 963  3963 3136 HOH HOH 0 . 
CJ 36 HOH 964  3964 3137 HOH HOH 0 . 
CJ 36 HOH 965  3965 3139 HOH HOH 0 . 
CJ 36 HOH 966  3966 3140 HOH HOH 0 . 
CJ 36 HOH 967  3967 3141 HOH HOH 0 . 
CJ 36 HOH 968  3968 3142 HOH HOH 0 . 
CJ 36 HOH 969  3969 3144 HOH HOH 0 . 
CJ 36 HOH 970  3970 3145 HOH HOH 0 . 
CJ 36 HOH 971  3971 3147 HOH HOH 0 . 
CJ 36 HOH 972  3972 3148 HOH HOH 0 . 
CJ 36 HOH 973  3973 3149 HOH HOH 0 . 
CJ 36 HOH 974  3974 3150 HOH HOH 0 . 
CJ 36 HOH 975  3975 3151 HOH HOH 0 . 
CJ 36 HOH 976  3976 3152 HOH HOH 0 . 
CJ 36 HOH 977  3977 3153 HOH HOH 0 . 
CJ 36 HOH 978  3978 3154 HOH HOH 0 . 
CJ 36 HOH 979  3979 3158 HOH HOH 0 . 
CJ 36 HOH 980  3980 3161 HOH HOH 0 . 
CJ 36 HOH 981  3981 3162 HOH HOH 0 . 
CJ 36 HOH 982  3982 3163 HOH HOH 0 . 
CJ 36 HOH 983  3983 3164 HOH HOH 0 . 
CJ 36 HOH 984  3984 3165 HOH HOH 0 . 
CJ 36 HOH 985  3985 3166 HOH HOH 0 . 
CJ 36 HOH 986  3986 3168 HOH HOH 0 . 
CJ 36 HOH 987  3987 3169 HOH HOH 0 . 
CJ 36 HOH 988  3988 3170 HOH HOH 0 . 
CJ 36 HOH 989  3989 3171 HOH HOH 0 . 
CJ 36 HOH 990  3990 3172 HOH HOH 0 . 
CJ 36 HOH 991  3991 3173 HOH HOH 0 . 
CJ 36 HOH 992  3992 3174 HOH HOH 0 . 
CJ 36 HOH 993  3993 3175 HOH HOH 0 . 
CJ 36 HOH 994  3994 3177 HOH HOH 0 . 
CJ 36 HOH 995  3995 3178 HOH HOH 0 . 
CJ 36 HOH 996  3996 3181 HOH HOH 0 . 
CJ 36 HOH 997  3997 3182 HOH HOH 0 . 
CJ 36 HOH 998  3998 3185 HOH HOH 0 . 
CJ 36 HOH 999  3999 3186 HOH HOH 0 . 
CJ 36 HOH 1000 4000 3187 HOH HOH 0 . 
CJ 36 HOH 1001 4001 3189 HOH HOH 0 . 
CJ 36 HOH 1002 4002 3190 HOH HOH 0 . 
CJ 36 HOH 1003 4003 3191 HOH HOH 0 . 
CJ 36 HOH 1004 4004 3192 HOH HOH 0 . 
CJ 36 HOH 1005 4005 3195 HOH HOH 0 . 
CJ 36 HOH 1006 4006 3197 HOH HOH 0 . 
CJ 36 HOH 1007 4007 3199 HOH HOH 0 . 
CJ 36 HOH 1008 4008 3200 HOH HOH 0 . 
CJ 36 HOH 1009 4009 3201 HOH HOH 0 . 
CJ 36 HOH 1010 4010 3202 HOH HOH 0 . 
CJ 36 HOH 1011 4011 3206 HOH HOH 0 . 
CJ 36 HOH 1012 4012 3208 HOH HOH 0 . 
CJ 36 HOH 1013 4013 3209 HOH HOH 0 . 
CJ 36 HOH 1014 4014 3210 HOH HOH 0 . 
CJ 36 HOH 1015 4015 3211 HOH HOH 0 . 
CJ 36 HOH 1016 4016 3212 HOH HOH 0 . 
CJ 36 HOH 1017 4017 3213 HOH HOH 0 . 
CJ 36 HOH 1018 4018 3214 HOH HOH 0 . 
CJ 36 HOH 1019 4019 3215 HOH HOH 0 . 
CJ 36 HOH 1020 4020 3216 HOH HOH 0 . 
CJ 36 HOH 1021 4021 3217 HOH HOH 0 . 
CJ 36 HOH 1022 4022 3218 HOH HOH 0 . 
CJ 36 HOH 1023 4023 3220 HOH HOH 0 . 
CJ 36 HOH 1024 4024 3222 HOH HOH 0 . 
CJ 36 HOH 1025 4025 3225 HOH HOH 0 . 
CJ 36 HOH 1026 4026 3226 HOH HOH 0 . 
CJ 36 HOH 1027 4027 3227 HOH HOH 0 . 
CJ 36 HOH 1028 4028 3229 HOH HOH 0 . 
CJ 36 HOH 1029 4029 3230 HOH HOH 0 . 
CJ 36 HOH 1030 4030 3231 HOH HOH 0 . 
CJ 36 HOH 1031 4031 3232 HOH HOH 0 . 
CJ 36 HOH 1032 4032 3233 HOH HOH 0 . 
CJ 36 HOH 1033 4033 3235 HOH HOH 0 . 
CJ 36 HOH 1034 4034 3237 HOH HOH 0 . 
CJ 36 HOH 1035 4035 3238 HOH HOH 0 . 
CJ 36 HOH 1036 4036 3239 HOH HOH 0 . 
CJ 36 HOH 1037 4037 3242 HOH HOH 0 . 
CJ 36 HOH 1038 4038 3246 HOH HOH 0 . 
CJ 36 HOH 1039 4039 3247 HOH HOH 0 . 
CJ 36 HOH 1040 4040 3248 HOH HOH 0 . 
CJ 36 HOH 1041 4041 3252 HOH HOH 0 . 
CJ 36 HOH 1042 4042 3253 HOH HOH 0 . 
CJ 36 HOH 1043 4043 3255 HOH HOH 0 . 
CJ 36 HOH 1044 4044 3256 HOH HOH 0 . 
CJ 36 HOH 1045 4045 3257 HOH HOH 0 . 
CJ 36 HOH 1046 4046 3258 HOH HOH 0 . 
CJ 36 HOH 1047 4047 3259 HOH HOH 0 . 
CJ 36 HOH 1048 4048 3260 HOH HOH 0 . 
CJ 36 HOH 1049 4049 3261 HOH HOH 0 . 
CJ 36 HOH 1050 4050 3262 HOH HOH 0 . 
CJ 36 HOH 1051 4051 3263 HOH HOH 0 . 
CJ 36 HOH 1052 4052 3264 HOH HOH 0 . 
CJ 36 HOH 1053 4053 3265 HOH HOH 0 . 
CJ 36 HOH 1054 4054 3266 HOH HOH 0 . 
CJ 36 HOH 1055 4055 3267 HOH HOH 0 . 
CJ 36 HOH 1056 4056 3268 HOH HOH 0 . 
CJ 36 HOH 1057 4057 3269 HOH HOH 0 . 
CJ 36 HOH 1058 4058 3270 HOH HOH 0 . 
CJ 36 HOH 1059 4059 3271 HOH HOH 0 . 
CJ 36 HOH 1060 4060 3275 HOH HOH 0 . 
CJ 36 HOH 1061 4061 3276 HOH HOH 0 . 
CJ 36 HOH 1062 4062 3277 HOH HOH 0 . 
CJ 36 HOH 1063 4063 3280 HOH HOH 0 . 
CJ 36 HOH 1064 4064 3281 HOH HOH 0 . 
CJ 36 HOH 1065 4065 3282 HOH HOH 0 . 
CJ 36 HOH 1066 4066 3283 HOH HOH 0 . 
CJ 36 HOH 1067 4067 3284 HOH HOH 0 . 
CJ 36 HOH 1068 4068 3285 HOH HOH 0 . 
CJ 36 HOH 1069 4069 3286 HOH HOH 0 . 
CJ 36 HOH 1070 4070 3287 HOH HOH 0 . 
CJ 36 HOH 1071 4071 3288 HOH HOH 0 . 
CJ 36 HOH 1072 4072 3289 HOH HOH 0 . 
CJ 36 HOH 1073 4073 3290 HOH HOH 0 . 
CJ 36 HOH 1074 4074 3291 HOH HOH 0 . 
CJ 36 HOH 1075 4075 3292 HOH HOH 0 . 
CJ 36 HOH 1076 4076 3293 HOH HOH 0 . 
CJ 36 HOH 1077 4077 3295 HOH HOH 0 . 
CJ 36 HOH 1078 4078 3296 HOH HOH 0 . 
CJ 36 HOH 1079 4079 3297 HOH HOH 0 . 
CJ 36 HOH 1080 4080 3298 HOH HOH 0 . 
CJ 36 HOH 1081 4081 3300 HOH HOH 0 . 
CJ 36 HOH 1082 4082 3301 HOH HOH 0 . 
CJ 36 HOH 1083 4083 3302 HOH HOH 0 . 
CJ 36 HOH 1084 4084 3304 HOH HOH 0 . 
CJ 36 HOH 1085 4085 3305 HOH HOH 0 . 
CJ 36 HOH 1086 4086 3307 HOH HOH 0 . 
CJ 36 HOH 1087 4087 3308 HOH HOH 0 . 
CJ 36 HOH 1088 4088 3309 HOH HOH 0 . 
CJ 36 HOH 1089 4089 3311 HOH HOH 0 . 
CJ 36 HOH 1090 4090 3313 HOH HOH 0 . 
CJ 36 HOH 1091 4091 3315 HOH HOH 0 . 
CJ 36 HOH 1092 4092 3316 HOH HOH 0 . 
CJ 36 HOH 1093 4093 3317 HOH HOH 0 . 
CJ 36 HOH 1094 4094 3318 HOH HOH 0 . 
CJ 36 HOH 1095 4095 3320 HOH HOH 0 . 
CJ 36 HOH 1096 4096 3321 HOH HOH 0 . 
CJ 36 HOH 1097 4097 3322 HOH HOH 0 . 
CJ 36 HOH 1098 4098 3323 HOH HOH 0 . 
CJ 36 HOH 1099 4099 3324 HOH HOH 0 . 
CJ 36 HOH 1100 4100 3325 HOH HOH 0 . 
CJ 36 HOH 1101 4101 3327 HOH HOH 0 . 
CJ 36 HOH 1102 4102 3329 HOH HOH 0 . 
CJ 36 HOH 1103 4103 3330 HOH HOH 0 . 
CJ 36 HOH 1104 4104 3331 HOH HOH 0 . 
CJ 36 HOH 1105 4105 3333 HOH HOH 0 . 
CJ 36 HOH 1106 4106 3334 HOH HOH 0 . 
CJ 36 HOH 1107 4107 3335 HOH HOH 0 . 
CJ 36 HOH 1108 4108 3336 HOH HOH 0 . 
CJ 36 HOH 1109 4109 3337 HOH HOH 0 . 
CJ 36 HOH 1110 4110 3341 HOH HOH 0 . 
CJ 36 HOH 1111 4111 3342 HOH HOH 0 . 
CJ 36 HOH 1112 4112 3343 HOH HOH 0 . 
CJ 36 HOH 1113 4113 3344 HOH HOH 0 . 
CJ 36 HOH 1114 4114 3345 HOH HOH 0 . 
CJ 36 HOH 1115 4115 3346 HOH HOH 0 . 
CJ 36 HOH 1116 4116 3350 HOH HOH 0 . 
CJ 36 HOH 1117 4117 3351 HOH HOH 0 . 
CJ 36 HOH 1118 4118 3353 HOH HOH 0 . 
CJ 36 HOH 1119 4119 3354 HOH HOH 0 . 
CJ 36 HOH 1120 4120 3355 HOH HOH 0 . 
CJ 36 HOH 1121 4121 3356 HOH HOH 0 . 
CJ 36 HOH 1122 4122 3357 HOH HOH 0 . 
CJ 36 HOH 1123 4123 3358 HOH HOH 0 . 
CJ 36 HOH 1124 4124 3361 HOH HOH 0 . 
CJ 36 HOH 1125 4125 3362 HOH HOH 0 . 
CJ 36 HOH 1126 4126 3363 HOH HOH 0 . 
CJ 36 HOH 1127 4127 3365 HOH HOH 0 . 
CJ 36 HOH 1128 4128 3366 HOH HOH 0 . 
CJ 36 HOH 1129 4129 3367 HOH HOH 0 . 
CJ 36 HOH 1130 4130 3368 HOH HOH 0 . 
CJ 36 HOH 1131 4131 3369 HOH HOH 0 . 
CJ 36 HOH 1132 4132 3372 HOH HOH 0 . 
CJ 36 HOH 1133 4133 3373 HOH HOH 0 . 
CJ 36 HOH 1134 4134 3375 HOH HOH 0 . 
CJ 36 HOH 1135 4135 3376 HOH HOH 0 . 
CJ 36 HOH 1136 4136 3378 HOH HOH 0 . 
CJ 36 HOH 1137 4137 3379 HOH HOH 0 . 
CJ 36 HOH 1138 4138 3380 HOH HOH 0 . 
CJ 36 HOH 1139 4139 3381 HOH HOH 0 . 
CJ 36 HOH 1140 4140 3382 HOH HOH 0 . 
CJ 36 HOH 1141 4141 3383 HOH HOH 0 . 
CJ 36 HOH 1142 4142 3384 HOH HOH 0 . 
CJ 36 HOH 1143 4143 3386 HOH HOH 0 . 
CJ 36 HOH 1144 4144 3387 HOH HOH 0 . 
CJ 36 HOH 1145 4145 3389 HOH HOH 0 . 
CJ 36 HOH 1146 4146 3390 HOH HOH 0 . 
CJ 36 HOH 1147 4147 3393 HOH HOH 0 . 
CJ 36 HOH 1148 4148 3394 HOH HOH 0 . 
CJ 36 HOH 1149 4149 3395 HOH HOH 0 . 
CJ 36 HOH 1150 4150 3396 HOH HOH 0 . 
CJ 36 HOH 1151 4151 3397 HOH HOH 0 . 
CJ 36 HOH 1152 4152 3398 HOH HOH 0 . 
CJ 36 HOH 1153 4153 3399 HOH HOH 0 . 
CJ 36 HOH 1154 4154 3400 HOH HOH 0 . 
CJ 36 HOH 1155 4155 3401 HOH HOH 0 . 
CJ 36 HOH 1156 4156 3402 HOH HOH 0 . 
CJ 36 HOH 1157 4157 3403 HOH HOH 0 . 
CJ 36 HOH 1158 4158 3404 HOH HOH 0 . 
CJ 36 HOH 1159 4159 3405 HOH HOH 0 . 
CJ 36 HOH 1160 4160 3406 HOH HOH 0 . 
CJ 36 HOH 1161 4161 3407 HOH HOH 0 . 
CJ 36 HOH 1162 4162 3408 HOH HOH 0 . 
CJ 36 HOH 1163 4163 3409 HOH HOH 0 . 
CJ 36 HOH 1164 4164 3410 HOH HOH 0 . 
CJ 36 HOH 1165 4165 3411 HOH HOH 0 . 
CJ 36 HOH 1166 4166 3412 HOH HOH 0 . 
CJ 36 HOH 1167 4167 3413 HOH HOH 0 . 
CJ 36 HOH 1168 4168 3414 HOH HOH 0 . 
CJ 36 HOH 1169 4169 3415 HOH HOH 0 . 
CJ 36 HOH 1170 4170 3417 HOH HOH 0 . 
CJ 36 HOH 1171 4171 3418 HOH HOH 0 . 
CJ 36 HOH 1172 4172 3420 HOH HOH 0 . 
CJ 36 HOH 1173 4173 3423 HOH HOH 0 . 
CJ 36 HOH 1174 4174 3424 HOH HOH 0 . 
CJ 36 HOH 1175 4175 3425 HOH HOH 0 . 
CJ 36 HOH 1176 4176 3426 HOH HOH 0 . 
CJ 36 HOH 1177 4177 3427 HOH HOH 0 . 
CJ 36 HOH 1178 4178 3429 HOH HOH 0 . 
CJ 36 HOH 1179 4179 3431 HOH HOH 0 . 
CJ 36 HOH 1180 4180 3432 HOH HOH 0 . 
CJ 36 HOH 1181 4181 3433 HOH HOH 0 . 
CJ 36 HOH 1182 4182 3434 HOH HOH 0 . 
CJ 36 HOH 1183 4183 3435 HOH HOH 0 . 
CJ 36 HOH 1184 4184 3436 HOH HOH 0 . 
CJ 36 HOH 1185 4185 3437 HOH HOH 0 . 
CJ 36 HOH 1186 4186 3438 HOH HOH 0 . 
CJ 36 HOH 1187 4187 3439 HOH HOH 0 . 
CJ 36 HOH 1188 4188 3440 HOH HOH 0 . 
CJ 36 HOH 1189 4189 3441 HOH HOH 0 . 
CJ 36 HOH 1190 4190 3444 HOH HOH 0 . 
CJ 36 HOH 1191 4191 3446 HOH HOH 0 . 
CJ 36 HOH 1192 4192 3447 HOH HOH 0 . 
CJ 36 HOH 1193 4193 3448 HOH HOH 0 . 
CJ 36 HOH 1194 4194 3449 HOH HOH 0 . 
CJ 36 HOH 1195 4195 3450 HOH HOH 0 . 
CJ 36 HOH 1196 4196 3451 HOH HOH 0 . 
CJ 36 HOH 1197 4197 3452 HOH HOH 0 . 
CJ 36 HOH 1198 4198 3453 HOH HOH 0 . 
CJ 36 HOH 1199 4199 3454 HOH HOH 0 . 
CJ 36 HOH 1200 4200 3455 HOH HOH 0 . 
CJ 36 HOH 1201 4201 3457 HOH HOH 0 . 
CJ 36 HOH 1202 4202 3460 HOH HOH 0 . 
CJ 36 HOH 1203 4203 3462 HOH HOH 0 . 
CJ 36 HOH 1204 4204 3464 HOH HOH 0 . 
CJ 36 HOH 1205 4205 3467 HOH HOH 0 . 
CJ 36 HOH 1206 4206 3468 HOH HOH 0 . 
CJ 36 HOH 1207 4207 3469 HOH HOH 0 . 
CJ 36 HOH 1208 4208 3470 HOH HOH 0 . 
CJ 36 HOH 1209 4209 3471 HOH HOH 0 . 
CJ 36 HOH 1210 4210 3473 HOH HOH 0 . 
CJ 36 HOH 1211 4211 3474 HOH HOH 0 . 
CJ 36 HOH 1212 4212 3475 HOH HOH 0 . 
CJ 36 HOH 1213 4213 3476 HOH HOH 0 . 
CJ 36 HOH 1214 4214 3479 HOH HOH 0 . 
CJ 36 HOH 1215 4215 3480 HOH HOH 0 . 
CJ 36 HOH 1216 4216 3481 HOH HOH 0 . 
CJ 36 HOH 1217 4217 3485 HOH HOH 0 . 
CJ 36 HOH 1218 4218 3486 HOH HOH 0 . 
CJ 36 HOH 1219 4219 3487 HOH HOH 0 . 
CJ 36 HOH 1220 4220 3489 HOH HOH 0 . 
CJ 36 HOH 1221 4221 3491 HOH HOH 0 . 
CJ 36 HOH 1222 4222 3493 HOH HOH 0 . 
CJ 36 HOH 1223 4223 3494 HOH HOH 0 . 
CJ 36 HOH 1224 4224 3495 HOH HOH 0 . 
CJ 36 HOH 1225 4225 3497 HOH HOH 0 . 
CJ 36 HOH 1226 4226 3498 HOH HOH 0 . 
CJ 36 HOH 1227 4227 3499 HOH HOH 0 . 
CJ 36 HOH 1228 4228 3500 HOH HOH 0 . 
CJ 36 HOH 1229 4229 3501 HOH HOH 0 . 
CJ 36 HOH 1230 4230 3503 HOH HOH 0 . 
CJ 36 HOH 1231 4231 3506 HOH HOH 0 . 
CJ 36 HOH 1232 4232 3509 HOH HOH 0 . 
CJ 36 HOH 1233 4233 3510 HOH HOH 0 . 
CJ 36 HOH 1234 4234 3512 HOH HOH 0 . 
CJ 36 HOH 1235 4235 3514 HOH HOH 0 . 
CJ 36 HOH 1236 4236 3515 HOH HOH 0 . 
CJ 36 HOH 1237 4237 3516 HOH HOH 0 . 
CJ 36 HOH 1238 4238 3518 HOH HOH 0 . 
CJ 36 HOH 1239 4239 3519 HOH HOH 0 . 
CJ 36 HOH 1240 4240 3521 HOH HOH 0 . 
CJ 36 HOH 1241 4241 3522 HOH HOH 0 . 
CJ 36 HOH 1242 4242 3524 HOH HOH 0 . 
CJ 36 HOH 1243 4243 3525 HOH HOH 0 . 
CJ 36 HOH 1244 4244 3526 HOH HOH 0 . 
CJ 36 HOH 1245 4245 3527 HOH HOH 0 . 
CJ 36 HOH 1246 4246 3528 HOH HOH 0 . 
CJ 36 HOH 1247 4247 3530 HOH HOH 0 . 
CJ 36 HOH 1248 4248 3531 HOH HOH 0 . 
CJ 36 HOH 1249 4249 3533 HOH HOH 0 . 
CJ 36 HOH 1250 4250 3536 HOH HOH 0 . 
CJ 36 HOH 1251 4251 3537 HOH HOH 0 . 
CJ 36 HOH 1252 4252 3540 HOH HOH 0 . 
CJ 36 HOH 1253 4253 3541 HOH HOH 0 . 
CJ 36 HOH 1254 4254 3542 HOH HOH 0 . 
CJ 36 HOH 1255 4255 3543 HOH HOH 0 . 
CJ 36 HOH 1256 4256 3544 HOH HOH 0 . 
CJ 36 HOH 1257 4257 3545 HOH HOH 0 . 
CJ 36 HOH 1258 4258 3546 HOH HOH 0 . 
CJ 36 HOH 1259 4259 3551 HOH HOH 0 . 
CJ 36 HOH 1260 4260 3552 HOH HOH 0 . 
CJ 36 HOH 1261 4261 3553 HOH HOH 0 . 
CJ 36 HOH 1262 4262 3555 HOH HOH 0 . 
CJ 36 HOH 1263 4263 3556 HOH HOH 0 . 
CJ 36 HOH 1264 4264 3557 HOH HOH 0 . 
CJ 36 HOH 1265 4265 3558 HOH HOH 0 . 
CJ 36 HOH 1266 4266 3559 HOH HOH 0 . 
CJ 36 HOH 1267 4267 3560 HOH HOH 0 . 
CJ 36 HOH 1268 4268 3561 HOH HOH 0 . 
CJ 36 HOH 1269 4269 3565 HOH HOH 0 . 
CJ 36 HOH 1270 4270 3566 HOH HOH 0 . 
CJ 36 HOH 1271 4271 3567 HOH HOH 0 . 
CJ 36 HOH 1272 4272 3568 HOH HOH 0 . 
CJ 36 HOH 1273 4273 3569 HOH HOH 0 . 
CJ 36 HOH 1274 4274 3570 HOH HOH 0 . 
CJ 36 HOH 1275 4275 3571 HOH HOH 0 . 
CJ 36 HOH 1276 4276 3574 HOH HOH 0 . 
CJ 36 HOH 1277 4277 3575 HOH HOH 0 . 
CJ 36 HOH 1278 4278 3576 HOH HOH 0 . 
CJ 36 HOH 1279 4279 3577 HOH HOH 0 . 
CJ 36 HOH 1280 4280 3578 HOH HOH 0 . 
CJ 36 HOH 1281 4281 3579 HOH HOH 0 . 
CJ 36 HOH 1282 4282 3581 HOH HOH 0 . 
CJ 36 HOH 1283 4283 3582 HOH HOH 0 . 
CJ 36 HOH 1284 4284 3584 HOH HOH 0 . 
CJ 36 HOH 1285 4285 3585 HOH HOH 0 . 
CJ 36 HOH 1286 4286 3586 HOH HOH 0 . 
CJ 36 HOH 1287 4287 3590 HOH HOH 0 . 
CJ 36 HOH 1288 4288 3591 HOH HOH 0 . 
CJ 36 HOH 1289 4289 3592 HOH HOH 0 . 
CJ 36 HOH 1290 4290 3593 HOH HOH 0 . 
CJ 36 HOH 1291 4291 3594 HOH HOH 0 . 
CJ 36 HOH 1292 4292 3596 HOH HOH 0 . 
CJ 36 HOH 1293 4293 3598 HOH HOH 0 . 
CJ 36 HOH 1294 4294 3599 HOH HOH 0 . 
CJ 36 HOH 1295 4295 3605 HOH HOH 0 . 
CJ 36 HOH 1296 4296 3606 HOH HOH 0 . 
CJ 36 HOH 1297 4297 3607 HOH HOH 0 . 
CJ 36 HOH 1298 4298 3608 HOH HOH 0 . 
CJ 36 HOH 1299 4299 3609 HOH HOH 0 . 
CJ 36 HOH 1300 4300 3610 HOH HOH 0 . 
CJ 36 HOH 1301 4301 3611 HOH HOH 0 . 
CJ 36 HOH 1302 4302 3612 HOH HOH 0 . 
CJ 36 HOH 1303 4303 3613 HOH HOH 0 . 
CJ 36 HOH 1304 4304 3616 HOH HOH 0 . 
CJ 36 HOH 1305 4305 3617 HOH HOH 0 . 
CJ 36 HOH 1306 4306 3618 HOH HOH 0 . 
CJ 36 HOH 1307 4307 3619 HOH HOH 0 . 
CJ 36 HOH 1308 4308 3620 HOH HOH 0 . 
CJ 36 HOH 1309 4309 3621 HOH HOH 0 . 
CJ 36 HOH 1310 4310 3622 HOH HOH 0 . 
CJ 36 HOH 1311 4311 3623 HOH HOH 0 . 
CJ 36 HOH 1312 4312 3624 HOH HOH 0 . 
CJ 36 HOH 1313 4313 3625 HOH HOH 0 . 
CJ 36 HOH 1314 4314 3626 HOH HOH 0 . 
CJ 36 HOH 1315 4315 3628 HOH HOH 0 . 
CJ 36 HOH 1316 4316 3629 HOH HOH 0 . 
CJ 36 HOH 1317 4317 3630 HOH HOH 0 . 
CJ 36 HOH 1318 4318 3631 HOH HOH 0 . 
CJ 36 HOH 1319 4319 3632 HOH HOH 0 . 
CJ 36 HOH 1320 4320 3633 HOH HOH 0 . 
CJ 36 HOH 1321 4321 3634 HOH HOH 0 . 
CJ 36 HOH 1322 4322 3635 HOH HOH 0 . 
CJ 36 HOH 1323 4323 3636 HOH HOH 0 . 
CJ 36 HOH 1324 4324 3637 HOH HOH 0 . 
CJ 36 HOH 1325 4325 3638 HOH HOH 0 . 
CJ 36 HOH 1326 4326 3639 HOH HOH 0 . 
CJ 36 HOH 1327 4327 3640 HOH HOH 0 . 
CJ 36 HOH 1328 4328 3641 HOH HOH 0 . 
CJ 36 HOH 1329 4329 3642 HOH HOH 0 . 
CJ 36 HOH 1330 4330 3643 HOH HOH 0 . 
CJ 36 HOH 1331 4331 3644 HOH HOH 0 . 
CJ 36 HOH 1332 4332 3645 HOH HOH 0 . 
CJ 36 HOH 1333 4333 3646 HOH HOH 0 . 
CJ 36 HOH 1334 4334 3647 HOH HOH 0 . 
CJ 36 HOH 1335 4335 3648 HOH HOH 0 . 
CJ 36 HOH 1336 4336 3650 HOH HOH 0 . 
CJ 36 HOH 1337 4337 3651 HOH HOH 0 . 
CJ 36 HOH 1338 4338 3652 HOH HOH 0 . 
CJ 36 HOH 1339 4339 3653 HOH HOH 0 . 
CJ 36 HOH 1340 4340 3654 HOH HOH 0 . 
CJ 36 HOH 1341 4341 3656 HOH HOH 0 . 
CJ 36 HOH 1342 4342 3657 HOH HOH 0 . 
CJ 36 HOH 1343 4343 3658 HOH HOH 0 . 
CJ 36 HOH 1344 4344 3659 HOH HOH 0 . 
CJ 36 HOH 1345 4345 3660 HOH HOH 0 . 
CJ 36 HOH 1346 4346 3661 HOH HOH 0 . 
CJ 36 HOH 1347 4347 3663 HOH HOH 0 . 
CJ 36 HOH 1348 4348 3664 HOH HOH 0 . 
CJ 36 HOH 1349 4349 3667 HOH HOH 0 . 
CJ 36 HOH 1350 4350 3668 HOH HOH 0 . 
CJ 36 HOH 1351 4351 3669 HOH HOH 0 . 
CJ 36 HOH 1352 4352 3670 HOH HOH 0 . 
CJ 36 HOH 1353 4353 3672 HOH HOH 0 . 
CJ 36 HOH 1354 4354 3673 HOH HOH 0 . 
CJ 36 HOH 1355 4355 3674 HOH HOH 0 . 
CJ 36 HOH 1356 4356 3675 HOH HOH 0 . 
CJ 36 HOH 1357 4357 3676 HOH HOH 0 . 
CJ 36 HOH 1358 4358 3677 HOH HOH 0 . 
CJ 36 HOH 1359 4359 3678 HOH HOH 0 . 
CJ 36 HOH 1360 4360 3679 HOH HOH 0 . 
CJ 36 HOH 1361 4361 3680 HOH HOH 0 . 
CJ 36 HOH 1362 4362 3681 HOH HOH 0 . 
CJ 36 HOH 1363 4363 3682 HOH HOH 0 . 
CJ 36 HOH 1364 4364 3683 HOH HOH 0 . 
CJ 36 HOH 1365 4365 3684 HOH HOH 0 . 
CJ 36 HOH 1366 4366 3685 HOH HOH 0 . 
CJ 36 HOH 1367 4367 3687 HOH HOH 0 . 
CJ 36 HOH 1368 4368 3688 HOH HOH 0 . 
CJ 36 HOH 1369 4369 3689 HOH HOH 0 . 
CJ 36 HOH 1370 4370 3691 HOH HOH 0 . 
CJ 36 HOH 1371 4371 3692 HOH HOH 0 . 
CJ 36 HOH 1372 4372 3695 HOH HOH 0 . 
CJ 36 HOH 1373 4373 3696 HOH HOH 0 . 
CJ 36 HOH 1374 4374 3697 HOH HOH 0 . 
CJ 36 HOH 1375 4375 3699 HOH HOH 0 . 
CJ 36 HOH 1376 4376 3701 HOH HOH 0 . 
CJ 36 HOH 1377 4377 3702 HOH HOH 0 . 
CJ 36 HOH 1378 4378 3703 HOH HOH 0 . 
CJ 36 HOH 1379 4379 3704 HOH HOH 0 . 
CJ 36 HOH 1380 4380 3706 HOH HOH 0 . 
CJ 36 HOH 1381 4381 3708 HOH HOH 0 . 
CJ 36 HOH 1382 4382 3710 HOH HOH 0 . 
CJ 36 HOH 1383 4383 3711 HOH HOH 0 . 
CJ 36 HOH 1384 4384 3712 HOH HOH 0 . 
CJ 36 HOH 1385 4385 3715 HOH HOH 0 . 
CJ 36 HOH 1386 4386 3717 HOH HOH 0 . 
CJ 36 HOH 1387 4387 3718 HOH HOH 0 . 
CJ 36 HOH 1388 4388 3721 HOH HOH 0 . 
CJ 36 HOH 1389 4389 3724 HOH HOH 0 . 
CJ 36 HOH 1390 4390 3725 HOH HOH 0 . 
CJ 36 HOH 1391 4391 3726 HOH HOH 0 . 
CJ 36 HOH 1392 4392 3727 HOH HOH 0 . 
CJ 36 HOH 1393 4393 3728 HOH HOH 0 . 
CJ 36 HOH 1394 4394 3729 HOH HOH 0 . 
CJ 36 HOH 1395 4395 3730 HOH HOH 0 . 
CJ 36 HOH 1396 4396 3731 HOH HOH 0 . 
CJ 36 HOH 1397 4397 3732 HOH HOH 0 . 
CJ 36 HOH 1398 4398 3733 HOH HOH 0 . 
CJ 36 HOH 1399 4399 3735 HOH HOH 0 . 
CJ 36 HOH 1400 4400 3736 HOH HOH 0 . 
CJ 36 HOH 1401 4401 3737 HOH HOH 0 . 
CJ 36 HOH 1402 4402 3738 HOH HOH 0 . 
CJ 36 HOH 1403 4403 3739 HOH HOH 0 . 
CJ 36 HOH 1404 4404 3740 HOH HOH 0 . 
CJ 36 HOH 1405 4405 3742 HOH HOH 0 . 
CJ 36 HOH 1406 4406 3743 HOH HOH 0 . 
CJ 36 HOH 1407 4407 3744 HOH HOH 0 . 
CJ 36 HOH 1408 4408 3746 HOH HOH 0 . 
CJ 36 HOH 1409 4409 3747 HOH HOH 0 . 
CJ 36 HOH 1410 4410 3749 HOH HOH 0 . 
CJ 36 HOH 1411 4411 3751 HOH HOH 0 . 
CJ 36 HOH 1412 4412 3752 HOH HOH 0 . 
CJ 36 HOH 1413 4413 3753 HOH HOH 0 . 
CJ 36 HOH 1414 4414 3754 HOH HOH 0 . 
CJ 36 HOH 1415 4415 3755 HOH HOH 0 . 
CJ 36 HOH 1416 4416 3756 HOH HOH 0 . 
CJ 36 HOH 1417 4417 3758 HOH HOH 0 . 
CJ 36 HOH 1418 4418 3759 HOH HOH 0 . 
CJ 36 HOH 1419 4419 3760 HOH HOH 0 . 
CJ 36 HOH 1420 4420 3761 HOH HOH 0 . 
CJ 36 HOH 1421 4421 3763 HOH HOH 0 . 
CJ 36 HOH 1422 4422 3764 HOH HOH 0 . 
CJ 36 HOH 1423 4423 3767 HOH HOH 0 . 
CJ 36 HOH 1424 4424 3768 HOH HOH 0 . 
CJ 36 HOH 1425 4425 3769 HOH HOH 0 . 
CJ 36 HOH 1426 4426 3770 HOH HOH 0 . 
CJ 36 HOH 1427 4427 3771 HOH HOH 0 . 
CJ 36 HOH 1428 4428 3773 HOH HOH 0 . 
CJ 36 HOH 1429 4429 3774 HOH HOH 0 . 
CJ 36 HOH 1430 4430 3775 HOH HOH 0 . 
CJ 36 HOH 1431 4431 3776 HOH HOH 0 . 
CJ 36 HOH 1432 4432 3778 HOH HOH 0 . 
CJ 36 HOH 1433 4433 3780 HOH HOH 0 . 
CJ 36 HOH 1434 4434 3781 HOH HOH 0 . 
CJ 36 HOH 1435 4435 3783 HOH HOH 0 . 
CJ 36 HOH 1436 4436 3786 HOH HOH 0 . 
CJ 36 HOH 1437 4437 3787 HOH HOH 0 . 
CJ 36 HOH 1438 4438 3788 HOH HOH 0 . 
CJ 36 HOH 1439 4439 3790 HOH HOH 0 . 
CJ 36 HOH 1440 4440 3791 HOH HOH 0 . 
CJ 36 HOH 1441 4441 3792 HOH HOH 0 . 
CJ 36 HOH 1442 4442 3794 HOH HOH 0 . 
CJ 36 HOH 1443 4443 3796 HOH HOH 0 . 
CJ 36 HOH 1444 4444 3798 HOH HOH 0 . 
CJ 36 HOH 1445 4445 3799 HOH HOH 0 . 
CJ 36 HOH 1446 4446 3800 HOH HOH 0 . 
CJ 36 HOH 1447 4447 3801 HOH HOH 0 . 
CJ 36 HOH 1448 4448 3802 HOH HOH 0 . 
CJ 36 HOH 1449 4449 3803 HOH HOH 0 . 
CJ 36 HOH 1450 4450 3804 HOH HOH 0 . 
CJ 36 HOH 1451 4451 3808 HOH HOH 0 . 
CJ 36 HOH 1452 4452 3809 HOH HOH 0 . 
CJ 36 HOH 1453 4453 3810 HOH HOH 0 . 
CJ 36 HOH 1454 4454 3811 HOH HOH 0 . 
CJ 36 HOH 1455 4455 3812 HOH HOH 0 . 
CJ 36 HOH 1456 4456 3813 HOH HOH 0 . 
CJ 36 HOH 1457 4457 3814 HOH HOH 0 . 
CJ 36 HOH 1458 4458 3815 HOH HOH 0 . 
CJ 36 HOH 1459 4459 3816 HOH HOH 0 . 
CJ 36 HOH 1460 4460 3817 HOH HOH 0 . 
CJ 36 HOH 1461 4461 3818 HOH HOH 0 . 
CJ 36 HOH 1462 4462 3819 HOH HOH 0 . 
CJ 36 HOH 1463 4463 3821 HOH HOH 0 . 
CJ 36 HOH 1464 4464 3822 HOH HOH 0 . 
CJ 36 HOH 1465 4465 3823 HOH HOH 0 . 
CJ 36 HOH 1466 4466 3825 HOH HOH 0 . 
CJ 36 HOH 1467 4467 3826 HOH HOH 0 . 
CJ 36 HOH 1468 4468 3828 HOH HOH 0 . 
CJ 36 HOH 1469 4469 3829 HOH HOH 0 . 
CJ 36 HOH 1470 4470 3830 HOH HOH 0 . 
CJ 36 HOH 1471 4471 3831 HOH HOH 0 . 
CJ 36 HOH 1472 4472 3832 HOH HOH 0 . 
CJ 36 HOH 1473 4473 3834 HOH HOH 0 . 
CJ 36 HOH 1474 4474 3835 HOH HOH 0 . 
CJ 36 HOH 1475 4475 3836 HOH HOH 0 . 
CJ 36 HOH 1476 4476 3837 HOH HOH 0 . 
CJ 36 HOH 1477 4477 3838 HOH HOH 0 . 
CJ 36 HOH 1478 4478 3840 HOH HOH 0 . 
CJ 36 HOH 1479 4479 3841 HOH HOH 0 . 
CJ 36 HOH 1480 4480 3842 HOH HOH 0 . 
CJ 36 HOH 1481 4481 3843 HOH HOH 0 . 
CJ 36 HOH 1482 4482 3844 HOH HOH 0 . 
CJ 36 HOH 1483 4483 3845 HOH HOH 0 . 
CJ 36 HOH 1484 4484 3846 HOH HOH 0 . 
CJ 36 HOH 1485 4485 3847 HOH HOH 0 . 
CJ 36 HOH 1486 4486 3849 HOH HOH 0 . 
CJ 36 HOH 1487 4487 3850 HOH HOH 0 . 
CJ 36 HOH 1488 4488 3852 HOH HOH 0 . 
CJ 36 HOH 1489 4489 3853 HOH HOH 0 . 
CJ 36 HOH 1490 4490 3854 HOH HOH 0 . 
CJ 36 HOH 1491 4491 3856 HOH HOH 0 . 
CJ 36 HOH 1492 4492 3858 HOH HOH 0 . 
CJ 36 HOH 1493 4493 3860 HOH HOH 0 . 
CJ 36 HOH 1494 4494 3864 HOH HOH 0 . 
CJ 36 HOH 1495 4495 3865 HOH HOH 0 . 
CJ 36 HOH 1496 4496 3867 HOH HOH 0 . 
CJ 36 HOH 1497 4497 3868 HOH HOH 0 . 
CJ 36 HOH 1498 4498 3869 HOH HOH 0 . 
CJ 36 HOH 1499 4499 3871 HOH HOH 0 . 
CJ 36 HOH 1500 4500 3872 HOH HOH 0 . 
CJ 36 HOH 1501 4501 3873 HOH HOH 0 . 
CJ 36 HOH 1502 4502 3874 HOH HOH 0 . 
CJ 36 HOH 1503 4503 3875 HOH HOH 0 . 
CJ 36 HOH 1504 4504 3876 HOH HOH 0 . 
CJ 36 HOH 1505 4505 3877 HOH HOH 0 . 
CJ 36 HOH 1506 4506 3879 HOH HOH 0 . 
CJ 36 HOH 1507 4507 3880 HOH HOH 0 . 
CJ 36 HOH 1508 4508 3882 HOH HOH 0 . 
CJ 36 HOH 1509 4509 3883 HOH HOH 0 . 
CJ 36 HOH 1510 4510 3884 HOH HOH 0 . 
CJ 36 HOH 1511 4511 3885 HOH HOH 0 . 
CJ 36 HOH 1512 4512 3886 HOH HOH 0 . 
CJ 36 HOH 1513 4513 3888 HOH HOH 0 . 
CJ 36 HOH 1514 4514 3889 HOH HOH 0 . 
CJ 36 HOH 1515 4515 3893 HOH HOH 0 . 
CJ 36 HOH 1516 4516 3895 HOH HOH 0 . 
CJ 36 HOH 1517 4517 3898 HOH HOH 0 . 
CJ 36 HOH 1518 4518 3902 HOH HOH 0 . 
CJ 36 HOH 1519 4519 3904 HOH HOH 0 . 
CJ 36 HOH 1520 4520 3906 HOH HOH 0 . 
CJ 36 HOH 1521 4521 3907 HOH HOH 0 . 
CJ 36 HOH 1522 4522 3908 HOH HOH 0 . 
CJ 36 HOH 1523 4523 3909 HOH HOH 0 . 
CJ 36 HOH 1524 4524 3910 HOH HOH 0 . 
CJ 36 HOH 1525 4525 3912 HOH HOH 0 . 
CJ 36 HOH 1526 4526 3913 HOH HOH 0 . 
CJ 36 HOH 1527 4527 3914 HOH HOH 0 . 
CJ 36 HOH 1528 4528 3915 HOH HOH 0 . 
CJ 36 HOH 1529 4529 3916 HOH HOH 0 . 
CJ 36 HOH 1530 4530 3918 HOH HOH 0 . 
CJ 36 HOH 1531 4531 3921 HOH HOH 0 . 
CJ 36 HOH 1532 4532 3922 HOH HOH 0 . 
CJ 36 HOH 1533 4533 3926 HOH HOH 0 . 
CJ 36 HOH 1534 4534 3927 HOH HOH 0 . 
CJ 36 HOH 1535 4535 3930 HOH HOH 0 . 
CJ 36 HOH 1536 4536 3931 HOH HOH 0 . 
CJ 36 HOH 1537 4537 3932 HOH HOH 0 . 
CJ 36 HOH 1538 4538 3933 HOH HOH 0 . 
CJ 36 HOH 1539 4539 3934 HOH HOH 0 . 
CJ 36 HOH 1540 4540 3935 HOH HOH 0 . 
CJ 36 HOH 1541 4541 3936 HOH HOH 0 . 
CJ 36 HOH 1542 4542 3937 HOH HOH 0 . 
CJ 36 HOH 1543 4543 3938 HOH HOH 0 . 
CJ 36 HOH 1544 4544 3941 HOH HOH 0 . 
CJ 36 HOH 1545 4545 3942 HOH HOH 0 . 
CJ 36 HOH 1546 4546 3943 HOH HOH 0 . 
CJ 36 HOH 1547 4547 3945 HOH HOH 0 . 
CJ 36 HOH 1548 4548 3946 HOH HOH 0 . 
CJ 36 HOH 1549 4549 3948 HOH HOH 0 . 
CJ 36 HOH 1550 4550 3950 HOH HOH 0 . 
CJ 36 HOH 1551 4551 3951 HOH HOH 0 . 
CJ 36 HOH 1552 4552 3952 HOH HOH 0 . 
CJ 36 HOH 1553 4553 3953 HOH HOH 0 . 
CJ 36 HOH 1554 4554 3954 HOH HOH 0 . 
CJ 36 HOH 1555 4555 3956 HOH HOH 0 . 
CJ 36 HOH 1556 4556 3957 HOH HOH 0 . 
CJ 36 HOH 1557 4557 3958 HOH HOH 0 . 
CJ 36 HOH 1558 4558 3959 HOH HOH 0 . 
CJ 36 HOH 1559 4559 3960 HOH HOH 0 . 
CJ 36 HOH 1560 4560 3961 HOH HOH 0 . 
CJ 36 HOH 1561 4561 3962 HOH HOH 0 . 
CJ 36 HOH 1562 4562 3963 HOH HOH 0 . 
CJ 36 HOH 1563 4563 3964 HOH HOH 0 . 
CJ 36 HOH 1564 4564 3965 HOH HOH 0 . 
CJ 36 HOH 1565 4565 3966 HOH HOH 0 . 
CJ 36 HOH 1566 4566 3967 HOH HOH 0 . 
CJ 36 HOH 1567 4567 3968 HOH HOH 0 . 
CJ 36 HOH 1568 4568 3974 HOH HOH 0 . 
CJ 36 HOH 1569 4569 3975 HOH HOH 0 . 
CJ 36 HOH 1570 4570 3976 HOH HOH 0 . 
CJ 36 HOH 1571 4571 3977 HOH HOH 0 . 
CJ 36 HOH 1572 4572 3979 HOH HOH 0 . 
CJ 36 HOH 1573 4573 3980 HOH HOH 0 . 
CJ 36 HOH 1574 4574 3981 HOH HOH 0 . 
CJ 36 HOH 1575 4575 3982 HOH HOH 0 . 
CJ 36 HOH 1576 4576 3983 HOH HOH 0 . 
CJ 36 HOH 1577 4577 3984 HOH HOH 0 . 
CJ 36 HOH 1578 4578 3985 HOH HOH 0 . 
CJ 36 HOH 1579 4579 3986 HOH HOH 0 . 
CJ 36 HOH 1580 4580 3987 HOH HOH 0 . 
CJ 36 HOH 1581 4581 3988 HOH HOH 0 . 
CJ 36 HOH 1582 4582 3989 HOH HOH 0 . 
CJ 36 HOH 1583 4583 3990 HOH HOH 0 . 
CJ 36 HOH 1584 4584 3992 HOH HOH 0 . 
CJ 36 HOH 1585 4585 3993 HOH HOH 0 . 
CJ 36 HOH 1586 4586 3994 HOH HOH 0 . 
CJ 36 HOH 1587 4587 3995 HOH HOH 0 . 
CJ 36 HOH 1588 4588 3997 HOH HOH 0 . 
CJ 36 HOH 1589 4589 3998 HOH HOH 0 . 
CJ 36 HOH 1590 4590 4000 HOH HOH 0 . 
CJ 36 HOH 1591 4591 4001 HOH HOH 0 . 
CJ 36 HOH 1592 4592 4002 HOH HOH 0 . 
CJ 36 HOH 1593 4593 4004 HOH HOH 0 . 
CJ 36 HOH 1594 4594 4005 HOH HOH 0 . 
CJ 36 HOH 1595 4595 4007 HOH HOH 0 . 
CJ 36 HOH 1596 4596 4008 HOH HOH 0 . 
CJ 36 HOH 1597 4597 4009 HOH HOH 0 . 
CJ 36 HOH 1598 4598 4010 HOH HOH 0 . 
CJ 36 HOH 1599 4599 4012 HOH HOH 0 . 
CJ 36 HOH 1600 4600 4013 HOH HOH 0 . 
CJ 36 HOH 1601 4601 4014 HOH HOH 0 . 
CJ 36 HOH 1602 4602 4015 HOH HOH 0 . 
CJ 36 HOH 1603 4603 4017 HOH HOH 0 . 
CJ 36 HOH 1604 4604 4018 HOH HOH 0 . 
CJ 36 HOH 1605 4605 4019 HOH HOH 0 . 
CJ 36 HOH 1606 4606 4020 HOH HOH 0 . 
CJ 36 HOH 1607 4607 4021 HOH HOH 0 . 
CJ 36 HOH 1608 4608 4022 HOH HOH 0 . 
CJ 36 HOH 1609 4609 4023 HOH HOH 0 . 
CJ 36 HOH 1610 4610 4024 HOH HOH 0 . 
CJ 36 HOH 1611 4611 4025 HOH HOH 0 . 
CJ 36 HOH 1612 4612 4027 HOH HOH 0 . 
CJ 36 HOH 1613 4613 4029 HOH HOH 0 . 
CJ 36 HOH 1614 4614 4030 HOH HOH 0 . 
CJ 36 HOH 1615 4615 4032 HOH HOH 0 . 
CJ 36 HOH 1616 4616 4034 HOH HOH 0 . 
CJ 36 HOH 1617 4617 4035 HOH HOH 0 . 
CJ 36 HOH 1618 4618 4036 HOH HOH 0 . 
CJ 36 HOH 1619 4619 4037 HOH HOH 0 . 
CJ 36 HOH 1620 4620 4040 HOH HOH 0 . 
CJ 36 HOH 1621 4621 4041 HOH HOH 0 . 
CJ 36 HOH 1622 4622 4042 HOH HOH 0 . 
CJ 36 HOH 1623 4623 4044 HOH HOH 0 . 
CJ 36 HOH 1624 4624 4045 HOH HOH 0 . 
CJ 36 HOH 1625 4625 4046 HOH HOH 0 . 
CJ 36 HOH 1626 4626 4047 HOH HOH 0 . 
CJ 36 HOH 1627 4627 4048 HOH HOH 0 . 
CJ 36 HOH 1628 4628 4049 HOH HOH 0 . 
CJ 36 HOH 1629 4629 4050 HOH HOH 0 . 
CJ 36 HOH 1630 4630 4051 HOH HOH 0 . 
CJ 36 HOH 1631 4631 4052 HOH HOH 0 . 
CJ 36 HOH 1632 4632 4054 HOH HOH 0 . 
CJ 36 HOH 1633 4633 4055 HOH HOH 0 . 
CJ 36 HOH 1634 4634 4058 HOH HOH 0 . 
CJ 36 HOH 1635 4635 4059 HOH HOH 0 . 
CJ 36 HOH 1636 4636 4060 HOH HOH 0 . 
CJ 36 HOH 1637 4637 4061 HOH HOH 0 . 
CJ 36 HOH 1638 4638 4062 HOH HOH 0 . 
CJ 36 HOH 1639 4639 4063 HOH HOH 0 . 
CJ 36 HOH 1640 4640 4065 HOH HOH 0 . 
CJ 36 HOH 1641 4641 4068 HOH HOH 0 . 
CJ 36 HOH 1642 4642 4070 HOH HOH 0 . 
CJ 36 HOH 1643 4643 4071 HOH HOH 0 . 
CJ 36 HOH 1644 4644 4072 HOH HOH 0 . 
CJ 36 HOH 1645 4645 4076 HOH HOH 0 . 
CJ 36 HOH 1646 4646 4079 HOH HOH 0 . 
CJ 36 HOH 1647 4647 4081 HOH HOH 0 . 
CJ 36 HOH 1648 4648 4082 HOH HOH 0 . 
CJ 36 HOH 1649 4649 4083 HOH HOH 0 . 
CJ 36 HOH 1650 4650 4084 HOH HOH 0 . 
CJ 36 HOH 1651 4651 4085 HOH HOH 0 . 
CJ 36 HOH 1652 4652 4086 HOH HOH 0 . 
CJ 36 HOH 1653 4653 4087 HOH HOH 0 . 
CJ 36 HOH 1654 4654 4088 HOH HOH 0 . 
CJ 36 HOH 1655 4655 4089 HOH HOH 0 . 
CJ 36 HOH 1656 4656 4090 HOH HOH 0 . 
CJ 36 HOH 1657 4657 4091 HOH HOH 0 . 
CJ 36 HOH 1658 4658 4092 HOH HOH 0 . 
CJ 36 HOH 1659 4659 4093 HOH HOH 0 . 
CJ 36 HOH 1660 4660 4094 HOH HOH 0 . 
CJ 36 HOH 1661 4661 4095 HOH HOH 0 . 
CJ 36 HOH 1662 4662 4096 HOH HOH 0 . 
CJ 36 HOH 1663 4663 4099 HOH HOH 0 . 
CJ 36 HOH 1664 4664 4100 HOH HOH 0 . 
CJ 36 HOH 1665 4665 4101 HOH HOH 0 . 
CJ 36 HOH 1666 4666 4102 HOH HOH 0 . 
CJ 36 HOH 1667 4667 4103 HOH HOH 0 . 
CJ 36 HOH 1668 4668 4104 HOH HOH 0 . 
CJ 36 HOH 1669 4669 4105 HOH HOH 0 . 
CJ 36 HOH 1670 4670 4106 HOH HOH 0 . 
CJ 36 HOH 1671 4671 4107 HOH HOH 0 . 
CJ 36 HOH 1672 4672 4110 HOH HOH 0 . 
CJ 36 HOH 1673 4673 4112 HOH HOH 0 . 
CJ 36 HOH 1674 4674 4113 HOH HOH 0 . 
CJ 36 HOH 1675 4675 4114 HOH HOH 0 . 
CJ 36 HOH 1676 4676 4115 HOH HOH 0 . 
CJ 36 HOH 1677 4677 4116 HOH HOH 0 . 
CJ 36 HOH 1678 4678 4118 HOH HOH 0 . 
CJ 36 HOH 1679 4679 4119 HOH HOH 0 . 
CJ 36 HOH 1680 4680 4120 HOH HOH 0 . 
CJ 36 HOH 1681 4681 4122 HOH HOH 0 . 
CJ 36 HOH 1682 4682 4123 HOH HOH 0 . 
CJ 36 HOH 1683 4683 4124 HOH HOH 0 . 
CJ 36 HOH 1684 4684 4125 HOH HOH 0 . 
CJ 36 HOH 1685 4685 4126 HOH HOH 0 . 
CJ 36 HOH 1686 4686 4127 HOH HOH 0 . 
CJ 36 HOH 1687 4687 4129 HOH HOH 0 . 
CJ 36 HOH 1688 4688 4130 HOH HOH 0 . 
CJ 36 HOH 1689 4689 4131 HOH HOH 0 . 
CJ 36 HOH 1690 4690 4133 HOH HOH 0 . 
CJ 36 HOH 1691 4691 4134 HOH HOH 0 . 
CJ 36 HOH 1692 4692 4136 HOH HOH 0 . 
CJ 36 HOH 1693 4693 4137 HOH HOH 0 . 
CJ 36 HOH 1694 4694 4138 HOH HOH 0 . 
CJ 36 HOH 1695 4695 4139 HOH HOH 0 . 
CJ 36 HOH 1696 4696 4141 HOH HOH 0 . 
CJ 36 HOH 1697 4697 4143 HOH HOH 0 . 
CJ 36 HOH 1698 4698 4144 HOH HOH 0 . 
CJ 36 HOH 1699 4699 4145 HOH HOH 0 . 
CJ 36 HOH 1700 4700 4146 HOH HOH 0 . 
CJ 36 HOH 1701 4701 4147 HOH HOH 0 . 
CJ 36 HOH 1702 4702 4148 HOH HOH 0 . 
CJ 36 HOH 1703 4703 4149 HOH HOH 0 . 
CJ 36 HOH 1704 4704 4150 HOH HOH 0 . 
CJ 36 HOH 1705 4705 4151 HOH HOH 0 . 
CJ 36 HOH 1706 4706 4152 HOH HOH 0 . 
CJ 36 HOH 1707 4707 4153 HOH HOH 0 . 
CJ 36 HOH 1708 4708 4155 HOH HOH 0 . 
CJ 36 HOH 1709 4709 4156 HOH HOH 0 . 
CJ 36 HOH 1710 4710 4157 HOH HOH 0 . 
CJ 36 HOH 1711 4711 4158 HOH HOH 0 . 
CJ 36 HOH 1712 4712 4159 HOH HOH 0 . 
CJ 36 HOH 1713 4713 4160 HOH HOH 0 . 
CJ 36 HOH 1714 4714 4161 HOH HOH 0 . 
CJ 36 HOH 1715 4715 4162 HOH HOH 0 . 
CJ 36 HOH 1716 4716 4164 HOH HOH 0 . 
CJ 36 HOH 1717 4717 4165 HOH HOH 0 . 
CJ 36 HOH 1718 4718 4166 HOH HOH 0 . 
CJ 36 HOH 1719 4719 4167 HOH HOH 0 . 
CJ 36 HOH 1720 4720 4168 HOH HOH 0 . 
CJ 36 HOH 1721 4721 4169 HOH HOH 0 . 
CJ 36 HOH 1722 4722 4170 HOH HOH 0 . 
CJ 36 HOH 1723 4723 4174 HOH HOH 0 . 
CJ 36 HOH 1724 4724 4175 HOH HOH 0 . 
CJ 36 HOH 1725 4725 4176 HOH HOH 0 . 
CJ 36 HOH 1726 4726 4177 HOH HOH 0 . 
CJ 36 HOH 1727 4727 4178 HOH HOH 0 . 
CJ 36 HOH 1728 4728 4179 HOH HOH 0 . 
CJ 36 HOH 1729 4729 4180 HOH HOH 0 . 
CJ 36 HOH 1730 4730 4181 HOH HOH 0 . 
CJ 36 HOH 1731 4731 4182 HOH HOH 0 . 
CJ 36 HOH 1732 4732 4184 HOH HOH 0 . 
CJ 36 HOH 1733 4733 4185 HOH HOH 0 . 
CJ 36 HOH 1734 4734 4186 HOH HOH 0 . 
CJ 36 HOH 1735 4735 4187 HOH HOH 0 . 
CJ 36 HOH 1736 4736 4188 HOH HOH 0 . 
CJ 36 HOH 1737 4737 4190 HOH HOH 0 . 
CJ 36 HOH 1738 4738 4192 HOH HOH 0 . 
CJ 36 HOH 1739 4739 4194 HOH HOH 0 . 
CJ 36 HOH 1740 4740 4197 HOH HOH 0 . 
CJ 36 HOH 1741 4741 4198 HOH HOH 0 . 
CJ 36 HOH 1742 4742 4201 HOH HOH 0 . 
CJ 36 HOH 1743 4743 4205 HOH HOH 0 . 
CJ 36 HOH 1744 4744 4206 HOH HOH 0 . 
CJ 36 HOH 1745 4745 4207 HOH HOH 0 . 
CJ 36 HOH 1746 4746 4208 HOH HOH 0 . 
CJ 36 HOH 1747 4747 4209 HOH HOH 0 . 
CJ 36 HOH 1748 4748 4210 HOH HOH 0 . 
CJ 36 HOH 1749 4749 4212 HOH HOH 0 . 
CJ 36 HOH 1750 4750 4213 HOH HOH 0 . 
CJ 36 HOH 1751 4751 4214 HOH HOH 0 . 
CJ 36 HOH 1752 4752 4215 HOH HOH 0 . 
CJ 36 HOH 1753 4753 4216 HOH HOH 0 . 
CJ 36 HOH 1754 4754 4217 HOH HOH 0 . 
CJ 36 HOH 1755 4755 4218 HOH HOH 0 . 
CJ 36 HOH 1756 4756 4219 HOH HOH 0 . 
CJ 36 HOH 1757 4757 4220 HOH HOH 0 . 
CJ 36 HOH 1758 4758 4221 HOH HOH 0 . 
CJ 36 HOH 1759 4759 4222 HOH HOH 0 . 
CJ 36 HOH 1760 4760 4224 HOH HOH 0 . 
CJ 36 HOH 1761 4761 4225 HOH HOH 0 . 
CJ 36 HOH 1762 4762 4227 HOH HOH 0 . 
CJ 36 HOH 1763 4763 4228 HOH HOH 0 . 
CJ 36 HOH 1764 4764 4229 HOH HOH 0 . 
CJ 36 HOH 1765 4765 4230 HOH HOH 0 . 
CJ 36 HOH 1766 4766 4231 HOH HOH 0 . 
CJ 36 HOH 1767 4767 4232 HOH HOH 0 . 
CJ 36 HOH 1768 4768 4234 HOH HOH 0 . 
CJ 36 HOH 1769 4769 4235 HOH HOH 0 . 
CJ 36 HOH 1770 4770 4236 HOH HOH 0 . 
CJ 36 HOH 1771 4771 4238 HOH HOH 0 . 
CJ 36 HOH 1772 4772 4239 HOH HOH 0 . 
CJ 36 HOH 1773 4773 4240 HOH HOH 0 . 
CJ 36 HOH 1774 4774 4241 HOH HOH 0 . 
CJ 36 HOH 1775 4775 4244 HOH HOH 0 . 
CJ 36 HOH 1776 4776 4246 HOH HOH 0 . 
CJ 36 HOH 1777 4777 4247 HOH HOH 0 . 
CJ 36 HOH 1778 4778 4248 HOH HOH 0 . 
CJ 36 HOH 1779 4779 4251 HOH HOH 0 . 
CJ 36 HOH 1780 4780 4252 HOH HOH 0 . 
CJ 36 HOH 1781 4781 4253 HOH HOH 0 . 
CJ 36 HOH 1782 4782 4254 HOH HOH 0 . 
CJ 36 HOH 1783 4783 4255 HOH HOH 0 . 
CJ 36 HOH 1784 4784 4256 HOH HOH 0 . 
CJ 36 HOH 1785 4785 4259 HOH HOH 0 . 
CJ 36 HOH 1786 4786 4260 HOH HOH 0 . 
CJ 36 HOH 1787 4787 4261 HOH HOH 0 . 
CJ 36 HOH 1788 4788 4262 HOH HOH 0 . 
CJ 36 HOH 1789 4789 4263 HOH HOH 0 . 
CJ 36 HOH 1790 4790 4264 HOH HOH 0 . 
CJ 36 HOH 1791 4791 4266 HOH HOH 0 . 
CJ 36 HOH 1792 4792 4267 HOH HOH 0 . 
CJ 36 HOH 1793 4793 4268 HOH HOH 0 . 
CJ 36 HOH 1794 4794 4269 HOH HOH 0 . 
CJ 36 HOH 1795 4795 4270 HOH HOH 0 . 
CJ 36 HOH 1796 4796 4271 HOH HOH 0 . 
CJ 36 HOH 1797 4797 4272 HOH HOH 0 . 
CJ 36 HOH 1798 4798 4274 HOH HOH 0 . 
CJ 36 HOH 1799 4799 4275 HOH HOH 0 . 
CJ 36 HOH 1800 4800 4277 HOH HOH 0 . 
CJ 36 HOH 1801 4801 4278 HOH HOH 0 . 
CJ 36 HOH 1802 4802 4279 HOH HOH 0 . 
CJ 36 HOH 1803 4803 4281 HOH HOH 0 . 
CJ 36 HOH 1804 4804 4282 HOH HOH 0 . 
CJ 36 HOH 1805 4805 4283 HOH HOH 0 . 
CJ 36 HOH 1806 4806 4284 HOH HOH 0 . 
CJ 36 HOH 1807 4807 4285 HOH HOH 0 . 
CJ 36 HOH 1808 4808 4287 HOH HOH 0 . 
CJ 36 HOH 1809 4809 4288 HOH HOH 0 . 
CJ 36 HOH 1810 4810 4289 HOH HOH 0 . 
CJ 36 HOH 1811 4811 4290 HOH HOH 0 . 
CJ 36 HOH 1812 4812 4291 HOH HOH 0 . 
CJ 36 HOH 1813 4813 4292 HOH HOH 0 . 
CJ 36 HOH 1814 4814 4293 HOH HOH 0 . 
CJ 36 HOH 1815 4815 4295 HOH HOH 0 . 
CJ 36 HOH 1816 4816 4296 HOH HOH 0 . 
CJ 36 HOH 1817 4817 4300 HOH HOH 0 . 
CJ 36 HOH 1818 4818 4302 HOH HOH 0 . 
CJ 36 HOH 1819 4819 4303 HOH HOH 0 . 
CJ 36 HOH 1820 4820 4305 HOH HOH 0 . 
CJ 36 HOH 1821 4821 4306 HOH HOH 0 . 
CJ 36 HOH 1822 4822 4307 HOH HOH 0 . 
CJ 36 HOH 1823 4823 4308 HOH HOH 0 . 
CJ 36 HOH 1824 4824 4309 HOH HOH 0 . 
CJ 36 HOH 1825 4825 4310 HOH HOH 0 . 
CJ 36 HOH 1826 4826 4313 HOH HOH 0 . 
CJ 36 HOH 1827 4827 4314 HOH HOH 0 . 
CJ 36 HOH 1828 4828 4315 HOH HOH 0 . 
CJ 36 HOH 1829 4829 4316 HOH HOH 0 . 
CJ 36 HOH 1830 4830 4319 HOH HOH 0 . 
CJ 36 HOH 1831 4831 4320 HOH HOH 0 . 
CJ 36 HOH 1832 4832 4321 HOH HOH 0 . 
CJ 36 HOH 1833 4833 4322 HOH HOH 0 . 
CJ 36 HOH 1834 4834 4323 HOH HOH 0 . 
CJ 36 HOH 1835 4835 4324 HOH HOH 0 . 
CJ 36 HOH 1836 4836 4325 HOH HOH 0 . 
CJ 36 HOH 1837 4837 4326 HOH HOH 0 . 
CJ 36 HOH 1838 4838 4328 HOH HOH 0 . 
CJ 36 HOH 1839 4839 4329 HOH HOH 0 . 
CJ 36 HOH 1840 4840 4330 HOH HOH 0 . 
CJ 36 HOH 1841 4841 4331 HOH HOH 0 . 
CJ 36 HOH 1842 4842 4332 HOH HOH 0 . 
CJ 36 HOH 1843 4843 4335 HOH HOH 0 . 
CJ 36 HOH 1844 4844 4336 HOH HOH 0 . 
CJ 36 HOH 1845 4845 4337 HOH HOH 0 . 
CJ 36 HOH 1846 4846 4338 HOH HOH 0 . 
CJ 36 HOH 1847 4847 4339 HOH HOH 0 . 
CJ 36 HOH 1848 4848 4340 HOH HOH 0 . 
CJ 36 HOH 1849 4849 4342 HOH HOH 0 . 
CJ 36 HOH 1850 4850 4343 HOH HOH 0 . 
CJ 36 HOH 1851 4851 4344 HOH HOH 0 . 
CJ 36 HOH 1852 4852 4345 HOH HOH 0 . 
CJ 36 HOH 1853 4853 4346 HOH HOH 0 . 
CJ 36 HOH 1854 4854 4347 HOH HOH 0 . 
CJ 36 HOH 1855 4855 4348 HOH HOH 0 . 
CJ 36 HOH 1856 4856 4349 HOH HOH 0 . 
CJ 36 HOH 1857 4857 4352 HOH HOH 0 . 
CJ 36 HOH 1858 4858 4354 HOH HOH 0 . 
CJ 36 HOH 1859 4859 4355 HOH HOH 0 . 
CJ 36 HOH 1860 4860 4356 HOH HOH 0 . 
CJ 36 HOH 1861 4861 4359 HOH HOH 0 . 
CJ 36 HOH 1862 4862 4361 HOH HOH 0 . 
CJ 36 HOH 1863 4863 4362 HOH HOH 0 . 
CJ 36 HOH 1864 4864 4364 HOH HOH 0 . 
CJ 36 HOH 1865 4865 4365 HOH HOH 0 . 
CJ 36 HOH 1866 4866 4366 HOH HOH 0 . 
CJ 36 HOH 1867 4867 4369 HOH HOH 0 . 
CJ 36 HOH 1868 4868 4371 HOH HOH 0 . 
CJ 36 HOH 1869 4869 4373 HOH HOH 0 . 
CJ 36 HOH 1870 4870 4374 HOH HOH 0 . 
CJ 36 HOH 1871 4871 4375 HOH HOH 0 . 
CJ 36 HOH 1872 4872 4377 HOH HOH 0 . 
CJ 36 HOH 1873 4873 4378 HOH HOH 0 . 
CJ 36 HOH 1874 4874 4379 HOH HOH 0 . 
CJ 36 HOH 1875 4875 4380 HOH HOH 0 . 
CJ 36 HOH 1876 4876 4383 HOH HOH 0 . 
CJ 36 HOH 1877 4877 4384 HOH HOH 0 . 
CJ 36 HOH 1878 4878 4385 HOH HOH 0 . 
CJ 36 HOH 1879 4879 4386 HOH HOH 0 . 
CJ 36 HOH 1880 4880 4387 HOH HOH 0 . 
CJ 36 HOH 1881 4881 4388 HOH HOH 0 . 
CJ 36 HOH 1882 4882 4389 HOH HOH 0 . 
CJ 36 HOH 1883 4883 4390 HOH HOH 0 . 
CJ 36 HOH 1884 4884 4392 HOH HOH 0 . 
CJ 36 HOH 1885 4885 4393 HOH HOH 0 . 
CJ 36 HOH 1886 4886 4395 HOH HOH 0 . 
CJ 36 HOH 1887 4887 4396 HOH HOH 0 . 
CJ 36 HOH 1888 4888 4397 HOH HOH 0 . 
CJ 36 HOH 1889 4889 4399 HOH HOH 0 . 
CJ 36 HOH 1890 4890 4401 HOH HOH 0 . 
CJ 36 HOH 1891 4891 4404 HOH HOH 0 . 
CJ 36 HOH 1892 4892 4405 HOH HOH 0 . 
CJ 36 HOH 1893 4893 4406 HOH HOH 0 . 
CJ 36 HOH 1894 4894 4407 HOH HOH 0 . 
CJ 36 HOH 1895 4895 4409 HOH HOH 0 . 
CJ 36 HOH 1896 4896 4410 HOH HOH 0 . 
CJ 36 HOH 1897 4897 4411 HOH HOH 0 . 
CJ 36 HOH 1898 4898 4412 HOH HOH 0 . 
CJ 36 HOH 1899 4899 4413 HOH HOH 0 . 
CJ 36 HOH 1900 4900 4414 HOH HOH 0 . 
CJ 36 HOH 1901 4901 4415 HOH HOH 0 . 
CJ 36 HOH 1902 4902 4416 HOH HOH 0 . 
CJ 36 HOH 1903 4903 4417 HOH HOH 0 . 
CJ 36 HOH 1904 4904 4418 HOH HOH 0 . 
CJ 36 HOH 1905 4905 4419 HOH HOH 0 . 
CJ 36 HOH 1906 4906 4421 HOH HOH 0 . 
CJ 36 HOH 1907 4907 4422 HOH HOH 0 . 
CJ 36 HOH 1908 4908 4423 HOH HOH 0 . 
CJ 36 HOH 1909 4909 4424 HOH HOH 0 . 
CJ 36 HOH 1910 4910 4425 HOH HOH 0 . 
CJ 36 HOH 1911 4911 4426 HOH HOH 0 . 
CJ 36 HOH 1912 4912 4427 HOH HOH 0 . 
CJ 36 HOH 1913 4913 4429 HOH HOH 0 . 
CJ 36 HOH 1914 4914 4430 HOH HOH 0 . 
CJ 36 HOH 1915 4915 4431 HOH HOH 0 . 
CJ 36 HOH 1916 4916 4432 HOH HOH 0 . 
CJ 36 HOH 1917 4917 4433 HOH HOH 0 . 
CJ 36 HOH 1918 4918 4434 HOH HOH 0 . 
CJ 36 HOH 1919 4919 4435 HOH HOH 0 . 
CJ 36 HOH 1920 4920 4436 HOH HOH 0 . 
CJ 36 HOH 1921 4921 4438 HOH HOH 0 . 
CJ 36 HOH 1922 4922 4439 HOH HOH 0 . 
CJ 36 HOH 1923 4923 4440 HOH HOH 0 . 
CJ 36 HOH 1924 4924 4441 HOH HOH 0 . 
CJ 36 HOH 1925 4925 4442 HOH HOH 0 . 
CJ 36 HOH 1926 4926 4443 HOH HOH 0 . 
CJ 36 HOH 1927 4927 4444 HOH HOH 0 . 
CJ 36 HOH 1928 4928 4445 HOH HOH 0 . 
CJ 36 HOH 1929 4929 4446 HOH HOH 0 . 
CJ 36 HOH 1930 4930 4447 HOH HOH 0 . 
CJ 36 HOH 1931 4931 4448 HOH HOH 0 . 
CJ 36 HOH 1932 4932 4449 HOH HOH 0 . 
CJ 36 HOH 1933 4933 4451 HOH HOH 0 . 
CJ 36 HOH 1934 4934 4452 HOH HOH 0 . 
CJ 36 HOH 1935 4935 4453 HOH HOH 0 . 
CJ 36 HOH 1936 4936 4455 HOH HOH 0 . 
CJ 36 HOH 1937 4937 4456 HOH HOH 0 . 
CJ 36 HOH 1938 4938 4457 HOH HOH 0 . 
CJ 36 HOH 1939 4939 4458 HOH HOH 0 . 
CJ 36 HOH 1940 4940 4459 HOH HOH 0 . 
CJ 36 HOH 1941 4941 4460 HOH HOH 0 . 
CJ 36 HOH 1942 4942 4461 HOH HOH 0 . 
CJ 36 HOH 1943 4943 4462 HOH HOH 0 . 
CJ 36 HOH 1944 4944 4464 HOH HOH 0 . 
CJ 36 HOH 1945 4945 4465 HOH HOH 0 . 
CJ 36 HOH 1946 4946 4466 HOH HOH 0 . 
CJ 36 HOH 1947 4947 4467 HOH HOH 0 . 
CJ 36 HOH 1948 4948 4468 HOH HOH 0 . 
CJ 36 HOH 1949 4949 4469 HOH HOH 0 . 
CJ 36 HOH 1950 4950 4470 HOH HOH 0 . 
CJ 36 HOH 1951 4951 4473 HOH HOH 0 . 
CJ 36 HOH 1952 4952 4474 HOH HOH 0 . 
CJ 36 HOH 1953 4953 4475 HOH HOH 0 . 
CJ 36 HOH 1954 4954 4476 HOH HOH 0 . 
CJ 36 HOH 1955 4955 4477 HOH HOH 0 . 
CJ 36 HOH 1956 4956 4478 HOH HOH 0 . 
CJ 36 HOH 1957 4957 4480 HOH HOH 0 . 
CJ 36 HOH 1958 4958 4481 HOH HOH 0 . 
CJ 36 HOH 1959 4959 4482 HOH HOH 0 . 
CJ 36 HOH 1960 4960 4484 HOH HOH 0 . 
CJ 36 HOH 1961 4961 4486 HOH HOH 0 . 
CJ 36 HOH 1962 4962 4487 HOH HOH 0 . 
CJ 36 HOH 1963 4963 4488 HOH HOH 0 . 
CJ 36 HOH 1964 4964 4489 HOH HOH 0 . 
CJ 36 HOH 1965 4965 4491 HOH HOH 0 . 
CJ 36 HOH 1966 4966 4492 HOH HOH 0 . 
CJ 36 HOH 1967 4967 4493 HOH HOH 0 . 
CJ 36 HOH 1968 4968 4495 HOH HOH 0 . 
CJ 36 HOH 1969 4969 4496 HOH HOH 0 . 
CJ 36 HOH 1970 4970 4497 HOH HOH 0 . 
CJ 36 HOH 1971 4971 4500 HOH HOH 0 . 
CJ 36 HOH 1972 4972 4501 HOH HOH 0 . 
CJ 36 HOH 1973 4973 4503 HOH HOH 0 . 
CJ 36 HOH 1974 4974 4504 HOH HOH 0 . 
CJ 36 HOH 1975 4975 4505 HOH HOH 0 . 
CJ 36 HOH 1976 4976 4506 HOH HOH 0 . 
CJ 36 HOH 1977 4977 4507 HOH HOH 0 . 
CJ 36 HOH 1978 4978 4508 HOH HOH 0 . 
CJ 36 HOH 1979 4979 4509 HOH HOH 0 . 
CJ 36 HOH 1980 4980 4510 HOH HOH 0 . 
CJ 36 HOH 1981 4981 4511 HOH HOH 0 . 
CJ 36 HOH 1982 4982 4512 HOH HOH 0 . 
CJ 36 HOH 1983 4983 4513 HOH HOH 0 . 
CJ 36 HOH 1984 4984 4515 HOH HOH 0 . 
CJ 36 HOH 1985 4985 4516 HOH HOH 0 . 
CJ 36 HOH 1986 4986 4517 HOH HOH 0 . 
CJ 36 HOH 1987 4987 4518 HOH HOH 0 . 
CJ 36 HOH 1988 4988 4519 HOH HOH 0 . 
CJ 36 HOH 1989 4989 4520 HOH HOH 0 . 
CJ 36 HOH 1990 4990 4521 HOH HOH 0 . 
CJ 36 HOH 1991 4991 4523 HOH HOH 0 . 
CJ 36 HOH 1992 4992 4525 HOH HOH 0 . 
CJ 36 HOH 1993 4993 4526 HOH HOH 0 . 
CJ 36 HOH 1994 4994 4528 HOH HOH 0 . 
CJ 36 HOH 1995 4995 4529 HOH HOH 0 . 
CJ 36 HOH 1996 4996 4530 HOH HOH 0 . 
CJ 36 HOH 1997 4997 4532 HOH HOH 0 . 
CJ 36 HOH 1998 4998 4533 HOH HOH 0 . 
CJ 36 HOH 1999 4999 4534 HOH HOH 0 . 
CJ 36 HOH 2000 5000 4535 HOH HOH 0 . 
CJ 36 HOH 2001 5001 4536 HOH HOH 0 . 
CJ 36 HOH 2002 5002 4537 HOH HOH 0 . 
CJ 36 HOH 2003 5003 4540 HOH HOH 0 . 
CJ 36 HOH 2004 5004 4542 HOH HOH 0 . 
CJ 36 HOH 2005 5005 4543 HOH HOH 0 . 
CJ 36 HOH 2006 5006 4545 HOH HOH 0 . 
CJ 36 HOH 2007 5007 4546 HOH HOH 0 . 
CJ 36 HOH 2008 5008 4548 HOH HOH 0 . 
CJ 36 HOH 2009 5009 4550 HOH HOH 0 . 
CJ 36 HOH 2010 5010 4551 HOH HOH 0 . 
CJ 36 HOH 2011 5011 4552 HOH HOH 0 . 
CJ 36 HOH 2012 5012 4553 HOH HOH 0 . 
CJ 36 HOH 2013 5013 4554 HOH HOH 0 . 
CJ 36 HOH 2014 5014 4555 HOH HOH 0 . 
CJ 36 HOH 2015 5015 4556 HOH HOH 0 . 
CJ 36 HOH 2016 5016 4557 HOH HOH 0 . 
CJ 36 HOH 2017 5017 4559 HOH HOH 0 . 
CJ 36 HOH 2018 5018 4560 HOH HOH 0 . 
CJ 36 HOH 2019 5019 4562 HOH HOH 0 . 
CJ 36 HOH 2020 5020 4564 HOH HOH 0 . 
CJ 36 HOH 2021 5021 4565 HOH HOH 0 . 
CJ 36 HOH 2022 5022 4566 HOH HOH 0 . 
CJ 36 HOH 2023 5023 4568 HOH HOH 0 . 
CJ 36 HOH 2024 5024 4570 HOH HOH 0 . 
CJ 36 HOH 2025 5025 4571 HOH HOH 0 . 
CJ 36 HOH 2026 5026 4573 HOH HOH 0 . 
CJ 36 HOH 2027 5027 4574 HOH HOH 0 . 
CJ 36 HOH 2028 5028 4576 HOH HOH 0 . 
CJ 36 HOH 2029 5029 4579 HOH HOH 0 . 
CJ 36 HOH 2030 5030 4580 HOH HOH 0 . 
CJ 36 HOH 2031 5031 4581 HOH HOH 0 . 
CJ 36 HOH 2032 5032 4582 HOH HOH 0 . 
CJ 36 HOH 2033 5033 4583 HOH HOH 0 . 
CJ 36 HOH 2034 5034 4585 HOH HOH 0 . 
CJ 36 HOH 2035 5035 4587 HOH HOH 0 . 
CJ 36 HOH 2036 5036 4588 HOH HOH 0 . 
CJ 36 HOH 2037 5037 4591 HOH HOH 0 . 
CJ 36 HOH 2038 5038 4592 HOH HOH 0 . 
CJ 36 HOH 2039 5039 4593 HOH HOH 0 . 
CJ 36 HOH 2040 5040 4594 HOH HOH 0 . 
CJ 36 HOH 2041 5041 4597 HOH HOH 0 . 
CJ 36 HOH 2042 5042 4598 HOH HOH 0 . 
CJ 36 HOH 2043 5043 4599 HOH HOH 0 . 
CJ 36 HOH 2044 5044 4600 HOH HOH 0 . 
CJ 36 HOH 2045 5045 4601 HOH HOH 0 . 
CJ 36 HOH 2046 5046 4602 HOH HOH 0 . 
CJ 36 HOH 2047 5047 4603 HOH HOH 0 . 
CJ 36 HOH 2048 5048 4605 HOH HOH 0 . 
CJ 36 HOH 2049 5049 4607 HOH HOH 0 . 
CJ 36 HOH 2050 5050 4609 HOH HOH 0 . 
CJ 36 HOH 2051 5051 4611 HOH HOH 0 . 
CJ 36 HOH 2052 5052 4613 HOH HOH 0 . 
CJ 36 HOH 2053 5053 4614 HOH HOH 0 . 
CJ 36 HOH 2054 5054 4615 HOH HOH 0 . 
CJ 36 HOH 2055 5055 4616 HOH HOH 0 . 
CJ 36 HOH 2056 5056 4617 HOH HOH 0 . 
CJ 36 HOH 2057 5057 4618 HOH HOH 0 . 
CJ 36 HOH 2058 5058 4620 HOH HOH 0 . 
CJ 36 HOH 2059 5059 4621 HOH HOH 0 . 
CJ 36 HOH 2060 5060 4622 HOH HOH 0 . 
CJ 36 HOH 2061 5061 4623 HOH HOH 0 . 
CJ 36 HOH 2062 5062 4625 HOH HOH 0 . 
CJ 36 HOH 2063 5063 4628 HOH HOH 0 . 
CJ 36 HOH 2064 5064 4629 HOH HOH 0 . 
CJ 36 HOH 2065 5065 4630 HOH HOH 0 . 
CJ 36 HOH 2066 5066 4631 HOH HOH 0 . 
CJ 36 HOH 2067 5067 4633 HOH HOH 0 . 
CJ 36 HOH 2068 5068 4634 HOH HOH 0 . 
CJ 36 HOH 2069 5069 4635 HOH HOH 0 . 
CJ 36 HOH 2070 5070 4636 HOH HOH 0 . 
CJ 36 HOH 2071 5071 4638 HOH HOH 0 . 
CJ 36 HOH 2072 5072 4639 HOH HOH 0 . 
CJ 36 HOH 2073 5073 4640 HOH HOH 0 . 
CJ 36 HOH 2074 5074 4643 HOH HOH 0 . 
CJ 36 HOH 2075 5075 4644 HOH HOH 0 . 
CJ 36 HOH 2076 5076 4645 HOH HOH 0 . 
CJ 36 HOH 2077 5077 4647 HOH HOH 0 . 
CJ 36 HOH 2078 5078 4648 HOH HOH 0 . 
CJ 36 HOH 2079 5079 4649 HOH HOH 0 . 
CJ 36 HOH 2080 5080 4651 HOH HOH 0 . 
CJ 36 HOH 2081 5081 4652 HOH HOH 0 . 
CJ 36 HOH 2082 5082 4653 HOH HOH 0 . 
CJ 36 HOH 2083 5083 4654 HOH HOH 0 . 
CJ 36 HOH 2084 5084 4655 HOH HOH 0 . 
CJ 36 HOH 2085 5085 4657 HOH HOH 0 . 
CJ 36 HOH 2086 5086 4658 HOH HOH 0 . 
CJ 36 HOH 2087 5087 4659 HOH HOH 0 . 
CJ 36 HOH 2088 5088 4660 HOH HOH 0 . 
CJ 36 HOH 2089 5089 4662 HOH HOH 0 . 
CJ 36 HOH 2090 5090 4663 HOH HOH 0 . 
CJ 36 HOH 2091 5091 4665 HOH HOH 0 . 
CJ 36 HOH 2092 5092 4666 HOH HOH 0 . 
CJ 36 HOH 2093 5093 4668 HOH HOH 0 . 
CJ 36 HOH 2094 5094 4669 HOH HOH 0 . 
CJ 36 HOH 2095 5095 4670 HOH HOH 0 . 
CJ 36 HOH 2096 5096 4671 HOH HOH 0 . 
CJ 36 HOH 2097 5097 4672 HOH HOH 0 . 
CJ 36 HOH 2098 5098 4674 HOH HOH 0 . 
CJ 36 HOH 2099 5099 4675 HOH HOH 0 . 
CJ 36 HOH 2100 5100 4677 HOH HOH 0 . 
CJ 36 HOH 2101 5101 4679 HOH HOH 0 . 
CJ 36 HOH 2102 5102 4683 HOH HOH 0 . 
CJ 36 HOH 2103 5103 4684 HOH HOH 0 . 
CJ 36 HOH 2104 5104 4685 HOH HOH 0 . 
CJ 36 HOH 2105 5105 4686 HOH HOH 0 . 
CJ 36 HOH 2106 5106 4689 HOH HOH 0 . 
CJ 36 HOH 2107 5107 4691 HOH HOH 0 . 
CJ 36 HOH 2108 5108 4692 HOH HOH 0 . 
CJ 36 HOH 2109 5109 4693 HOH HOH 0 . 
CJ 36 HOH 2110 5110 4694 HOH HOH 0 . 
CJ 36 HOH 2111 5111 4697 HOH HOH 0 . 
CJ 36 HOH 2112 5112 4699 HOH HOH 0 . 
CJ 36 HOH 2113 5113 4702 HOH HOH 0 . 
CJ 36 HOH 2114 5114 4703 HOH HOH 0 . 
CJ 36 HOH 2115 5115 4704 HOH HOH 0 . 
CJ 36 HOH 2116 5116 4705 HOH HOH 0 . 
CJ 36 HOH 2117 5117 4706 HOH HOH 0 . 
CJ 36 HOH 2118 5118 4708 HOH HOH 0 . 
CJ 36 HOH 2119 5119 4710 HOH HOH 0 . 
CJ 36 HOH 2120 5120 4711 HOH HOH 0 . 
CJ 36 HOH 2121 5121 4715 HOH HOH 0 . 
CJ 36 HOH 2122 5122 4717 HOH HOH 0 . 
CJ 36 HOH 2123 5123 4720 HOH HOH 0 . 
CJ 36 HOH 2124 5124 4721 HOH HOH 0 . 
CJ 36 HOH 2125 5125 4722 HOH HOH 0 . 
CJ 36 HOH 2126 5126 4723 HOH HOH 0 . 
CJ 36 HOH 2127 5127 4724 HOH HOH 0 . 
CJ 36 HOH 2128 5128 4725 HOH HOH 0 . 
CJ 36 HOH 2129 5129 4726 HOH HOH 0 . 
CJ 36 HOH 2130 5130 4727 HOH HOH 0 . 
CJ 36 HOH 2131 5131 4728 HOH HOH 0 . 
CJ 36 HOH 2132 5132 4729 HOH HOH 0 . 
CJ 36 HOH 2133 5133 4731 HOH HOH 0 . 
CJ 36 HOH 2134 5134 4732 HOH HOH 0 . 
CJ 36 HOH 2135 5135 4733 HOH HOH 0 . 
CJ 36 HOH 2136 5136 4734 HOH HOH 0 . 
CJ 36 HOH 2137 5137 4735 HOH HOH 0 . 
CJ 36 HOH 2138 5138 4736 HOH HOH 0 . 
CJ 36 HOH 2139 5139 4737 HOH HOH 0 . 
CJ 36 HOH 2140 5140 4738 HOH HOH 0 . 
CJ 36 HOH 2141 5141 4739 HOH HOH 0 . 
CJ 36 HOH 2142 5142 4740 HOH HOH 0 . 
CJ 36 HOH 2143 5143 4741 HOH HOH 0 . 
CJ 36 HOH 2144 5144 4743 HOH HOH 0 . 
CJ 36 HOH 2145 5145 4745 HOH HOH 0 . 
CJ 36 HOH 2146 5146 4748 HOH HOH 0 . 
CJ 36 HOH 2147 5147 4749 HOH HOH 0 . 
CJ 36 HOH 2148 5148 4750 HOH HOH 0 . 
CJ 36 HOH 2149 5149 4751 HOH HOH 0 . 
CJ 36 HOH 2150 5150 4752 HOH HOH 0 . 
CJ 36 HOH 2151 5151 4753 HOH HOH 0 . 
CJ 36 HOH 2152 5152 4754 HOH HOH 0 . 
CJ 36 HOH 2153 5153 4755 HOH HOH 0 . 
CJ 36 HOH 2154 5154 4756 HOH HOH 0 . 
CJ 36 HOH 2155 5155 4757 HOH HOH 0 . 
CJ 36 HOH 2156 5156 4758 HOH HOH 0 . 
CJ 36 HOH 2157 5157 4759 HOH HOH 0 . 
CJ 36 HOH 2158 5158 4762 HOH HOH 0 . 
CJ 36 HOH 2159 5159 4764 HOH HOH 0 . 
CJ 36 HOH 2160 5160 4765 HOH HOH 0 . 
CJ 36 HOH 2161 5161 4766 HOH HOH 0 . 
CJ 36 HOH 2162 5162 4767 HOH HOH 0 . 
CJ 36 HOH 2163 5163 4768 HOH HOH 0 . 
CJ 36 HOH 2164 5164 4769 HOH HOH 0 . 
CJ 36 HOH 2165 5165 4773 HOH HOH 0 . 
CJ 36 HOH 2166 5166 4774 HOH HOH 0 . 
CJ 36 HOH 2167 5167 4776 HOH HOH 0 . 
CJ 36 HOH 2168 5168 4777 HOH HOH 0 . 
CJ 36 HOH 2169 5169 4778 HOH HOH 0 . 
CJ 36 HOH 2170 5170 4779 HOH HOH 0 . 
CJ 36 HOH 2171 5171 4781 HOH HOH 0 . 
CJ 36 HOH 2172 5172 4782 HOH HOH 0 . 
CJ 36 HOH 2173 5173 4783 HOH HOH 0 . 
CJ 36 HOH 2174 5174 4784 HOH HOH 0 . 
CJ 36 HOH 2175 5175 4786 HOH HOH 0 . 
CJ 36 HOH 2176 5176 4787 HOH HOH 0 . 
CJ 36 HOH 2177 5177 4788 HOH HOH 0 . 
CJ 36 HOH 2178 5178 4789 HOH HOH 0 . 
CJ 36 HOH 2179 5179 4790 HOH HOH 0 . 
CJ 36 HOH 2180 5180 4793 HOH HOH 0 . 
CJ 36 HOH 2181 5181 4794 HOH HOH 0 . 
CJ 36 HOH 2182 5182 4795 HOH HOH 0 . 
CJ 36 HOH 2183 5183 4796 HOH HOH 0 . 
CJ 36 HOH 2184 5184 4798 HOH HOH 0 . 
CJ 36 HOH 2185 5185 4799 HOH HOH 0 . 
CJ 36 HOH 2186 5186 4800 HOH HOH 0 . 
CJ 36 HOH 2187 5187 4801 HOH HOH 0 . 
CJ 36 HOH 2188 5188 4802 HOH HOH 0 . 
CJ 36 HOH 2189 5189 4803 HOH HOH 0 . 
CJ 36 HOH 2190 5190 4805 HOH HOH 0 . 
CJ 36 HOH 2191 5191 4809 HOH HOH 0 . 
CJ 36 HOH 2192 5192 4811 HOH HOH 0 . 
CJ 36 HOH 2193 5193 4813 HOH HOH 0 . 
CJ 36 HOH 2194 5194 4814 HOH HOH 0 . 
CJ 36 HOH 2195 5195 4815 HOH HOH 0 . 
CJ 36 HOH 2196 5196 4816 HOH HOH 0 . 
CJ 36 HOH 2197 5197 4817 HOH HOH 0 . 
CJ 36 HOH 2198 5198 4820 HOH HOH 0 . 
CJ 36 HOH 2199 5199 4821 HOH HOH 0 . 
CJ 36 HOH 2200 5200 4822 HOH HOH 0 . 
CJ 36 HOH 2201 5201 4823 HOH HOH 0 . 
CJ 36 HOH 2202 5202 4824 HOH HOH 0 . 
CJ 36 HOH 2203 5203 4825 HOH HOH 0 . 
CJ 36 HOH 2204 5204 4827 HOH HOH 0 . 
CJ 36 HOH 2205 5205 4828 HOH HOH 0 . 
CJ 36 HOH 2206 5206 4829 HOH HOH 0 . 
CJ 36 HOH 2207 5207 4830 HOH HOH 0 . 
CJ 36 HOH 2208 5208 4831 HOH HOH 0 . 
CJ 36 HOH 2209 5209 4832 HOH HOH 0 . 
CJ 36 HOH 2210 5210 4833 HOH HOH 0 . 
CJ 36 HOH 2211 5211 4834 HOH HOH 0 . 
CJ 36 HOH 2212 5212 4835 HOH HOH 0 . 
CJ 36 HOH 2213 5213 4836 HOH HOH 0 . 
CJ 36 HOH 2214 5214 4837 HOH HOH 0 . 
CJ 36 HOH 2215 5215 4838 HOH HOH 0 . 
CJ 36 HOH 2216 5216 4839 HOH HOH 0 . 
CJ 36 HOH 2217 5217 4840 HOH HOH 0 . 
CJ 36 HOH 2218 5218 4841 HOH HOH 0 . 
CJ 36 HOH 2219 5219 4842 HOH HOH 0 . 
CJ 36 HOH 2220 5220 4843 HOH HOH 0 . 
CJ 36 HOH 2221 5221 4844 HOH HOH 0 . 
CJ 36 HOH 2222 5222 4845 HOH HOH 0 . 
CJ 36 HOH 2223 5223 4848 HOH HOH 0 . 
CJ 36 HOH 2224 5224 4849 HOH HOH 0 . 
CJ 36 HOH 2225 5225 4850 HOH HOH 0 . 
CJ 36 HOH 2226 5226 4851 HOH HOH 0 . 
CJ 36 HOH 2227 5227 4852 HOH HOH 0 . 
CJ 36 HOH 2228 5228 4853 HOH HOH 0 . 
CJ 36 HOH 2229 5229 4855 HOH HOH 0 . 
CJ 36 HOH 2230 5230 4856 HOH HOH 0 . 
CJ 36 HOH 2231 5231 4857 HOH HOH 0 . 
CJ 36 HOH 2232 5232 4858 HOH HOH 0 . 
CJ 36 HOH 2233 5233 4860 HOH HOH 0 . 
CJ 36 HOH 2234 5234 4861 HOH HOH 0 . 
CJ 36 HOH 2235 5235 4863 HOH HOH 0 . 
CJ 36 HOH 2236 5236 4864 HOH HOH 0 . 
CJ 36 HOH 2237 5237 4866 HOH HOH 0 . 
CJ 36 HOH 2238 5238 4867 HOH HOH 0 . 
CJ 36 HOH 2239 5239 4868 HOH HOH 0 . 
CJ 36 HOH 2240 5240 4871 HOH HOH 0 . 
CJ 36 HOH 2241 5241 4872 HOH HOH 0 . 
CJ 36 HOH 2242 5242 4873 HOH HOH 0 . 
CJ 36 HOH 2243 5243 4874 HOH HOH 0 . 
CJ 36 HOH 2244 5244 4875 HOH HOH 0 . 
CJ 36 HOH 2245 5245 4876 HOH HOH 0 . 
CJ 36 HOH 2246 5246 4878 HOH HOH 0 . 
CJ 36 HOH 2247 5247 4880 HOH HOH 0 . 
CJ 36 HOH 2248 5248 4881 HOH HOH 0 . 
CJ 36 HOH 2249 5249 4882 HOH HOH 0 . 
CJ 36 HOH 2250 5250 4883 HOH HOH 0 . 
CJ 36 HOH 2251 5251 4885 HOH HOH 0 . 
CJ 36 HOH 2252 5252 4888 HOH HOH 0 . 
CJ 36 HOH 2253 5253 4889 HOH HOH 0 . 
CJ 36 HOH 2254 5254 4890 HOH HOH 0 . 
CJ 36 HOH 2255 5255 4891 HOH HOH 0 . 
CJ 36 HOH 2256 5256 4894 HOH HOH 0 . 
CJ 36 HOH 2257 5257 4896 HOH HOH 0 . 
CJ 36 HOH 2258 5258 4897 HOH HOH 0 . 
CJ 36 HOH 2259 5259 4898 HOH HOH 0 . 
CJ 36 HOH 2260 5260 4900 HOH HOH 0 . 
CJ 36 HOH 2261 5261 4901 HOH HOH 0 . 
CJ 36 HOH 2262 5262 4903 HOH HOH 0 . 
CJ 36 HOH 2263 5263 4904 HOH HOH 0 . 
CJ 36 HOH 2264 5264 4905 HOH HOH 0 . 
CJ 36 HOH 2265 5265 4906 HOH HOH 0 . 
CJ 36 HOH 2266 5266 4907 HOH HOH 0 . 
CJ 36 HOH 2267 5267 4910 HOH HOH 0 . 
CJ 36 HOH 2268 5268 4911 HOH HOH 0 . 
CJ 36 HOH 2269 5269 4912 HOH HOH 0 . 
CJ 36 HOH 2270 5270 4914 HOH HOH 0 . 
CJ 36 HOH 2271 5271 4915 HOH HOH 0 . 
CJ 36 HOH 2272 5272 4916 HOH HOH 0 . 
CJ 36 HOH 2273 5273 4919 HOH HOH 0 . 
CJ 36 HOH 2274 5274 4920 HOH HOH 0 . 
CJ 36 HOH 2275 5275 4922 HOH HOH 0 . 
CJ 36 HOH 2276 5276 4924 HOH HOH 0 . 
CJ 36 HOH 2277 5277 4925 HOH HOH 0 . 
CJ 36 HOH 2278 5278 4926 HOH HOH 0 . 
CJ 36 HOH 2279 5279 4927 HOH HOH 0 . 
CJ 36 HOH 2280 5280 4928 HOH HOH 0 . 
CJ 36 HOH 2281 5281 4929 HOH HOH 0 . 
CJ 36 HOH 2282 5282 4930 HOH HOH 0 . 
CJ 36 HOH 2283 5283 4931 HOH HOH 0 . 
CJ 36 HOH 2284 5284 4934 HOH HOH 0 . 
CJ 36 HOH 2285 5285 4935 HOH HOH 0 . 
CJ 36 HOH 2286 5286 4936 HOH HOH 0 . 
CJ 36 HOH 2287 5287 4937 HOH HOH 0 . 
CJ 36 HOH 2288 5288 4938 HOH HOH 0 . 
CJ 36 HOH 2289 5289 4939 HOH HOH 0 . 
CJ 36 HOH 2290 5290 4940 HOH HOH 0 . 
CJ 36 HOH 2291 5291 4941 HOH HOH 0 . 
CJ 36 HOH 2292 5292 4942 HOH HOH 0 . 
CJ 36 HOH 2293 5293 4943 HOH HOH 0 . 
CJ 36 HOH 2294 5294 4945 HOH HOH 0 . 
CJ 36 HOH 2295 5295 4946 HOH HOH 0 . 
CJ 36 HOH 2296 5296 4947 HOH HOH 0 . 
CJ 36 HOH 2297 5297 4948 HOH HOH 0 . 
CJ 36 HOH 2298 5298 4949 HOH HOH 0 . 
CJ 36 HOH 2299 5299 4950 HOH HOH 0 . 
CJ 36 HOH 2300 5300 4951 HOH HOH 0 . 
CJ 36 HOH 2301 5301 4952 HOH HOH 0 . 
CJ 36 HOH 2302 5302 4953 HOH HOH 0 . 
CJ 36 HOH 2303 5303 4954 HOH HOH 0 . 
CJ 36 HOH 2304 5304 4955 HOH HOH 0 . 
CJ 36 HOH 2305 5305 4957 HOH HOH 0 . 
CJ 36 HOH 2306 5306 4958 HOH HOH 0 . 
CJ 36 HOH 2307 5307 4959 HOH HOH 0 . 
CJ 36 HOH 2308 5308 4960 HOH HOH 0 . 
CJ 36 HOH 2309 5309 4961 HOH HOH 0 . 
CJ 36 HOH 2310 5310 4962 HOH HOH 0 . 
CJ 36 HOH 2311 5311 4964 HOH HOH 0 . 
CJ 36 HOH 2312 5312 4965 HOH HOH 0 . 
CJ 36 HOH 2313 5313 4966 HOH HOH 0 . 
CJ 36 HOH 2314 5314 4968 HOH HOH 0 . 
CJ 36 HOH 2315 5315 4969 HOH HOH 0 . 
CJ 36 HOH 2316 5316 4972 HOH HOH 0 . 
CJ 36 HOH 2317 5317 4973 HOH HOH 0 . 
CJ 36 HOH 2318 5318 4976 HOH HOH 0 . 
CJ 36 HOH 2319 5319 4977 HOH HOH 0 . 
CJ 36 HOH 2320 5320 4978 HOH HOH 0 . 
CJ 36 HOH 2321 5321 4979 HOH HOH 0 . 
CJ 36 HOH 2322 5322 4980 HOH HOH 0 . 
CJ 36 HOH 2323 5323 4981 HOH HOH 0 . 
CJ 36 HOH 2324 5324 4982 HOH HOH 0 . 
CJ 36 HOH 2325 5325 4983 HOH HOH 0 . 
CJ 36 HOH 2326 5326 4984 HOH HOH 0 . 
CJ 36 HOH 2327 5327 4986 HOH HOH 0 . 
CJ 36 HOH 2328 5328 4987 HOH HOH 0 . 
CJ 36 HOH 2329 5329 4991 HOH HOH 0 . 
CJ 36 HOH 2330 5330 4992 HOH HOH 0 . 
CJ 36 HOH 2331 5331 4993 HOH HOH 0 . 
CJ 36 HOH 2332 5332 4994 HOH HOH 0 . 
CJ 36 HOH 2333 5333 4996 HOH HOH 0 . 
CJ 36 HOH 2334 5334 4998 HOH HOH 0 . 
CJ 36 HOH 2335 5335 5000 HOH HOH 0 . 
CJ 36 HOH 2336 5336 5001 HOH HOH 0 . 
CJ 36 HOH 2337 5337 5002 HOH HOH 0 . 
CJ 36 HOH 2338 5338 5003 HOH HOH 0 . 
CJ 36 HOH 2339 5339 5005 HOH HOH 0 . 
CJ 36 HOH 2340 5340 5006 HOH HOH 0 . 
CJ 36 HOH 2341 5341 5007 HOH HOH 0 . 
CJ 36 HOH 2342 5342 5009 HOH HOH 0 . 
CJ 36 HOH 2343 5343 5010 HOH HOH 0 . 
CJ 36 HOH 2344 5344 5011 HOH HOH 0 . 
CJ 36 HOH 2345 5345 5012 HOH HOH 0 . 
CJ 36 HOH 2346 5346 5013 HOH HOH 0 . 
CJ 36 HOH 2347 5347 5014 HOH HOH 0 . 
CJ 36 HOH 2348 5348 5015 HOH HOH 0 . 
CJ 36 HOH 2349 5349 5016 HOH HOH 0 . 
CJ 36 HOH 2350 5350 5018 HOH HOH 0 . 
CJ 36 HOH 2351 5351 5022 HOH HOH 0 . 
CJ 36 HOH 2352 5352 5023 HOH HOH 0 . 
CJ 36 HOH 2353 5353 5024 HOH HOH 0 . 
CJ 36 HOH 2354 5354 5027 HOH HOH 0 . 
CJ 36 HOH 2355 5355 5028 HOH HOH 0 . 
CJ 36 HOH 2356 5356 5032 HOH HOH 0 . 
CJ 36 HOH 2357 5357 5033 HOH HOH 0 . 
CJ 36 HOH 2358 5358 5034 HOH HOH 0 . 
CJ 36 HOH 2359 5359 5038 HOH HOH 0 . 
CJ 36 HOH 2360 5360 5039 HOH HOH 0 . 
CJ 36 HOH 2361 5361 5040 HOH HOH 0 . 
CJ 36 HOH 2362 5362 5041 HOH HOH 0 . 
CJ 36 HOH 2363 5363 5042 HOH HOH 0 . 
CJ 36 HOH 2364 5364 5043 HOH HOH 0 . 
CJ 36 HOH 2365 5365 5044 HOH HOH 0 . 
CJ 36 HOH 2366 5366 5045 HOH HOH 0 . 
CJ 36 HOH 2367 5367 5046 HOH HOH 0 . 
CJ 36 HOH 2368 5368 5047 HOH HOH 0 . 
CJ 36 HOH 2369 5369 5048 HOH HOH 0 . 
CJ 36 HOH 2370 5370 5049 HOH HOH 0 . 
CJ 36 HOH 2371 5371 5050 HOH HOH 0 . 
CJ 36 HOH 2372 5372 5051 HOH HOH 0 . 
CJ 36 HOH 2373 5373 5053 HOH HOH 0 . 
CJ 36 HOH 2374 5374 5054 HOH HOH 0 . 
CJ 36 HOH 2375 5375 5057 HOH HOH 0 . 
CJ 36 HOH 2376 5376 5059 HOH HOH 0 . 
CJ 36 HOH 2377 5377 5060 HOH HOH 0 . 
CJ 36 HOH 2378 5378 5062 HOH HOH 0 . 
CJ 36 HOH 2379 5379 5063 HOH HOH 0 . 
CJ 36 HOH 2380 5380 5066 HOH HOH 0 . 
CJ 36 HOH 2381 5381 5067 HOH HOH 0 . 
CJ 36 HOH 2382 5382 5068 HOH HOH 0 . 
CJ 36 HOH 2383 5383 5070 HOH HOH 0 . 
CJ 36 HOH 2384 5384 5072 HOH HOH 0 . 
CJ 36 HOH 2385 5385 5073 HOH HOH 0 . 
CJ 36 HOH 2386 5386 5074 HOH HOH 0 . 
CJ 36 HOH 2387 5387 5076 HOH HOH 0 . 
CJ 36 HOH 2388 5388 5077 HOH HOH 0 . 
CJ 36 HOH 2389 5389 5078 HOH HOH 0 . 
CJ 36 HOH 2390 5390 5081 HOH HOH 0 . 
CJ 36 HOH 2391 5391 5082 HOH HOH 0 . 
CJ 36 HOH 2392 5392 5085 HOH HOH 0 . 
CJ 36 HOH 2393 5393 5087 HOH HOH 0 . 
CJ 36 HOH 2394 5394 5088 HOH HOH 0 . 
CJ 36 HOH 2395 5395 5089 HOH HOH 0 . 
CJ 36 HOH 2396 5396 5090 HOH HOH 0 . 
CJ 36 HOH 2397 5397 5091 HOH HOH 0 . 
CJ 36 HOH 2398 5398 5092 HOH HOH 0 . 
CJ 36 HOH 2399 5399 5094 HOH HOH 0 . 
CJ 36 HOH 2400 5400 5095 HOH HOH 0 . 
CJ 36 HOH 2401 5401 5097 HOH HOH 0 . 
CJ 36 HOH 2402 5402 5098 HOH HOH 0 . 
CJ 36 HOH 2403 5403 5099 HOH HOH 0 . 
CJ 36 HOH 2404 5404 5100 HOH HOH 0 . 
CJ 36 HOH 2405 5405 5101 HOH HOH 0 . 
CJ 36 HOH 2406 5406 5103 HOH HOH 0 . 
CJ 36 HOH 2407 5407 5105 HOH HOH 0 . 
CJ 36 HOH 2408 5408 5107 HOH HOH 0 . 
CJ 36 HOH 2409 5409 5109 HOH HOH 0 . 
CJ 36 HOH 2410 5410 5110 HOH HOH 0 . 
CJ 36 HOH 2411 5411 5112 HOH HOH 0 . 
CJ 36 HOH 2412 5412 5113 HOH HOH 0 . 
CJ 36 HOH 2413 5413 5114 HOH HOH 0 . 
CJ 36 HOH 2414 5414 5115 HOH HOH 0 . 
CJ 36 HOH 2415 5415 5116 HOH HOH 0 . 
CJ 36 HOH 2416 5416 5117 HOH HOH 0 . 
CJ 36 HOH 2417 5417 5118 HOH HOH 0 . 
CJ 36 HOH 2418 5418 5119 HOH HOH 0 . 
CJ 36 HOH 2419 5419 5120 HOH HOH 0 . 
CJ 36 HOH 2420 5420 5121 HOH HOH 0 . 
CJ 36 HOH 2421 5421 5122 HOH HOH 0 . 
CJ 36 HOH 2422 5422 5123 HOH HOH 0 . 
CJ 36 HOH 2423 5423 5124 HOH HOH 0 . 
CJ 36 HOH 2424 5424 5125 HOH HOH 0 . 
CJ 36 HOH 2425 5425 5126 HOH HOH 0 . 
CJ 36 HOH 2426 5426 5128 HOH HOH 0 . 
CJ 36 HOH 2427 5427 5129 HOH HOH 0 . 
CJ 36 HOH 2428 5428 5130 HOH HOH 0 . 
CJ 36 HOH 2429 5429 5131 HOH HOH 0 . 
CJ 36 HOH 2430 5430 5134 HOH HOH 0 . 
CJ 36 HOH 2431 5431 5135 HOH HOH 0 . 
CJ 36 HOH 2432 5432 5139 HOH HOH 0 . 
CJ 36 HOH 2433 5433 5140 HOH HOH 0 . 
CJ 36 HOH 2434 5434 5141 HOH HOH 0 . 
CJ 36 HOH 2435 5435 5142 HOH HOH 0 . 
CJ 36 HOH 2436 5436 5143 HOH HOH 0 . 
CJ 36 HOH 2437 5437 5144 HOH HOH 0 . 
CJ 36 HOH 2438 5438 5145 HOH HOH 0 . 
CJ 36 HOH 2439 5439 5147 HOH HOH 0 . 
CJ 36 HOH 2440 5440 5148 HOH HOH 0 . 
CJ 36 HOH 2441 5441 5149 HOH HOH 0 . 
CJ 36 HOH 2442 5442 5150 HOH HOH 0 . 
CJ 36 HOH 2443 5443 5152 HOH HOH 0 . 
CJ 36 HOH 2444 5444 5153 HOH HOH 0 . 
CJ 36 HOH 2445 5445 5154 HOH HOH 0 . 
CJ 36 HOH 2446 5446 5155 HOH HOH 0 . 
CJ 36 HOH 2447 5447 5156 HOH HOH 0 . 
CJ 36 HOH 2448 5448 5157 HOH HOH 0 . 
CJ 36 HOH 2449 5449 5161 HOH HOH 0 . 
CJ 36 HOH 2450 5450 5162 HOH HOH 0 . 
CJ 36 HOH 2451 5451 5166 HOH HOH 0 . 
CJ 36 HOH 2452 5452 5167 HOH HOH 0 . 
CJ 36 HOH 2453 5453 5168 HOH HOH 0 . 
CJ 36 HOH 2454 5454 5169 HOH HOH 0 . 
CJ 36 HOH 2455 5455 5171 HOH HOH 0 . 
CJ 36 HOH 2456 5456 5172 HOH HOH 0 . 
CJ 36 HOH 2457 5457 5173 HOH HOH 0 . 
CJ 36 HOH 2458 5458 5176 HOH HOH 0 . 
CJ 36 HOH 2459 5459 5178 HOH HOH 0 . 
CJ 36 HOH 2460 5460 5180 HOH HOH 0 . 
CJ 36 HOH 2461 5461 5181 HOH HOH 0 . 
CJ 36 HOH 2462 5462 5182 HOH HOH 0 . 
CJ 36 HOH 2463 5463 5183 HOH HOH 0 . 
CJ 36 HOH 2464 5464 5184 HOH HOH 0 . 
CJ 36 HOH 2465 5465 5185 HOH HOH 0 . 
CJ 36 HOH 2466 5466 5186 HOH HOH 0 . 
CJ 36 HOH 2467 5467 5187 HOH HOH 0 . 
CJ 36 HOH 2468 5468 5188 HOH HOH 0 . 
CJ 36 HOH 2469 5469 5189 HOH HOH 0 . 
CJ 36 HOH 2470 5470 5190 HOH HOH 0 . 
CJ 36 HOH 2471 5471 5192 HOH HOH 0 . 
CJ 36 HOH 2472 5472 5193 HOH HOH 0 . 
CJ 36 HOH 2473 5473 5194 HOH HOH 0 . 
CJ 36 HOH 2474 5474 5195 HOH HOH 0 . 
CJ 36 HOH 2475 5475 5196 HOH HOH 0 . 
CJ 36 HOH 2476 5476 5197 HOH HOH 0 . 
CJ 36 HOH 2477 5477 5199 HOH HOH 0 . 
CJ 36 HOH 2478 5478 5200 HOH HOH 0 . 
CJ 36 HOH 2479 5479 5202 HOH HOH 0 . 
CJ 36 HOH 2480 5480 5205 HOH HOH 0 . 
CJ 36 HOH 2481 5481 5207 HOH HOH 0 . 
CJ 36 HOH 2482 5482 5209 HOH HOH 0 . 
CJ 36 HOH 2483 5483 5211 HOH HOH 0 . 
CJ 36 HOH 2484 5484 5213 HOH HOH 0 . 
CJ 36 HOH 2485 5485 5214 HOH HOH 0 . 
CJ 36 HOH 2486 5486 5215 HOH HOH 0 . 
CJ 36 HOH 2487 5487 5216 HOH HOH 0 . 
CJ 36 HOH 2488 5488 5217 HOH HOH 0 . 
CJ 36 HOH 2489 5489 5219 HOH HOH 0 . 
CJ 36 HOH 2490 5490 5220 HOH HOH 0 . 
CJ 36 HOH 2491 5491 5221 HOH HOH 0 . 
CJ 36 HOH 2492 5492 5223 HOH HOH 0 . 
CJ 36 HOH 2493 5493 5224 HOH HOH 0 . 
CJ 36 HOH 2494 5494 5225 HOH HOH 0 . 
CJ 36 HOH 2495 5495 5226 HOH HOH 0 . 
CJ 36 HOH 2496 5496 5228 HOH HOH 0 . 
CJ 36 HOH 2497 5497 5229 HOH HOH 0 . 
CJ 36 HOH 2498 5498 5230 HOH HOH 0 . 
CJ 36 HOH 2499 5499 5232 HOH HOH 0 . 
CJ 36 HOH 2500 5500 5235 HOH HOH 0 . 
CJ 36 HOH 2501 5501 5236 HOH HOH 0 . 
CJ 36 HOH 2502 5502 5238 HOH HOH 0 . 
CJ 36 HOH 2503 5503 5239 HOH HOH 0 . 
CJ 36 HOH 2504 5504 5242 HOH HOH 0 . 
CJ 36 HOH 2505 5505 5243 HOH HOH 0 . 
CJ 36 HOH 2506 5506 5244 HOH HOH 0 . 
CJ 36 HOH 2507 5507 5245 HOH HOH 0 . 
CJ 36 HOH 2508 5508 5246 HOH HOH 0 . 
CJ 36 HOH 2509 5509 5248 HOH HOH 0 . 
CJ 36 HOH 2510 5510 5251 HOH HOH 0 . 
CJ 36 HOH 2511 5511 5252 HOH HOH 0 . 
CJ 36 HOH 2512 5512 5253 HOH HOH 0 . 
CJ 36 HOH 2513 5513 5254 HOH HOH 0 . 
CJ 36 HOH 2514 5514 5257 HOH HOH 0 . 
CJ 36 HOH 2515 5515 5258 HOH HOH 0 . 
CJ 36 HOH 2516 5516 5259 HOH HOH 0 . 
CJ 36 HOH 2517 5517 5261 HOH HOH 0 . 
CJ 36 HOH 2518 5518 5263 HOH HOH 0 . 
CJ 36 HOH 2519 5519 5265 HOH HOH 0 . 
CJ 36 HOH 2520 5520 5266 HOH HOH 0 . 
CJ 36 HOH 2521 5521 5268 HOH HOH 0 . 
CJ 36 HOH 2522 5522 5269 HOH HOH 0 . 
CJ 36 HOH 2523 5523 5270 HOH HOH 0 . 
CJ 36 HOH 2524 5524 5271 HOH HOH 0 . 
CJ 36 HOH 2525 5525 5272 HOH HOH 0 . 
CJ 36 HOH 2526 5526 5273 HOH HOH 0 . 
CJ 36 HOH 2527 5527 5275 HOH HOH 0 . 
CJ 36 HOH 2528 5528 5276 HOH HOH 0 . 
CJ 36 HOH 2529 5529 5277 HOH HOH 0 . 
CJ 36 HOH 2530 5530 5278 HOH HOH 0 . 
CJ 36 HOH 2531 5531 5280 HOH HOH 0 . 
CJ 36 HOH 2532 5532 5282 HOH HOH 0 . 
CJ 36 HOH 2533 5533 5284 HOH HOH 0 . 
CJ 36 HOH 2534 5534 5285 HOH HOH 0 . 
CJ 36 HOH 2535 5535 5286 HOH HOH 0 . 
CJ 36 HOH 2536 5536 5287 HOH HOH 0 . 
CJ 36 HOH 2537 5537 5288 HOH HOH 0 . 
CJ 36 HOH 2538 5538 5289 HOH HOH 0 . 
CJ 36 HOH 2539 5539 5291 HOH HOH 0 . 
CJ 36 HOH 2540 5540 5292 HOH HOH 0 . 
CJ 36 HOH 2541 5541 5295 HOH HOH 0 . 
CJ 36 HOH 2542 5542 5296 HOH HOH 0 . 
CJ 36 HOH 2543 5543 5297 HOH HOH 0 . 
CJ 36 HOH 2544 5544 5299 HOH HOH 0 . 
CJ 36 HOH 2545 5545 5300 HOH HOH 0 . 
CJ 36 HOH 2546 5546 5301 HOH HOH 0 . 
CJ 36 HOH 2547 5547 5302 HOH HOH 0 . 
CJ 36 HOH 2548 5548 5303 HOH HOH 0 . 
CJ 36 HOH 2549 5549 5304 HOH HOH 0 . 
CJ 36 HOH 2550 5550 5305 HOH HOH 0 . 
CJ 36 HOH 2551 5551 5307 HOH HOH 0 . 
CJ 36 HOH 2552 5552 5309 HOH HOH 0 . 
CJ 36 HOH 2553 5553 5310 HOH HOH 0 . 
CJ 36 HOH 2554 5554 5313 HOH HOH 0 . 
CJ 36 HOH 2555 5555 5314 HOH HOH 0 . 
CJ 36 HOH 2556 5556 5315 HOH HOH 0 . 
CJ 36 HOH 2557 5557 5320 HOH HOH 0 . 
CJ 36 HOH 2558 5558 5322 HOH HOH 0 . 
CJ 36 HOH 2559 5559 5323 HOH HOH 0 . 
CJ 36 HOH 2560 5560 5324 HOH HOH 0 . 
CJ 36 HOH 2561 5561 5325 HOH HOH 0 . 
CJ 36 HOH 2562 5562 5326 HOH HOH 0 . 
CJ 36 HOH 2563 5563 5327 HOH HOH 0 . 
CJ 36 HOH 2564 5564 5328 HOH HOH 0 . 
CJ 36 HOH 2565 5565 5329 HOH HOH 0 . 
CJ 36 HOH 2566 5566 5330 HOH HOH 0 . 
CJ 36 HOH 2567 5567 5331 HOH HOH 0 . 
CJ 36 HOH 2568 5568 5332 HOH HOH 0 . 
CJ 36 HOH 2569 5569 5335 HOH HOH 0 . 
CJ 36 HOH 2570 5570 5336 HOH HOH 0 . 
CJ 36 HOH 2571 5571 5338 HOH HOH 0 . 
CJ 36 HOH 2572 5572 5339 HOH HOH 0 . 
CJ 36 HOH 2573 5573 5341 HOH HOH 0 . 
CJ 36 HOH 2574 5574 5342 HOH HOH 0 . 
CJ 36 HOH 2575 5575 5343 HOH HOH 0 . 
CJ 36 HOH 2576 5576 5344 HOH HOH 0 . 
CJ 36 HOH 2577 5577 5345 HOH HOH 0 . 
CJ 36 HOH 2578 5578 5346 HOH HOH 0 . 
CJ 36 HOH 2579 5579 5347 HOH HOH 0 . 
CJ 36 HOH 2580 5580 5348 HOH HOH 0 . 
CJ 36 HOH 2581 5581 5349 HOH HOH 0 . 
CJ 36 HOH 2582 5582 5350 HOH HOH 0 . 
CJ 36 HOH 2583 5583 5351 HOH HOH 0 . 
CJ 36 HOH 2584 5584 5352 HOH HOH 0 . 
CJ 36 HOH 2585 5585 5353 HOH HOH 0 . 
CJ 36 HOH 2586 5586 5354 HOH HOH 0 . 
CJ 36 HOH 2587 5587 5355 HOH HOH 0 . 
CJ 36 HOH 2588 5588 5359 HOH HOH 0 . 
CJ 36 HOH 2589 5589 5362 HOH HOH 0 . 
CJ 36 HOH 2590 5590 5363 HOH HOH 0 . 
CJ 36 HOH 2591 5591 5364 HOH HOH 0 . 
CJ 36 HOH 2592 5592 5365 HOH HOH 0 . 
CJ 36 HOH 2593 5593 5368 HOH HOH 0 . 
CJ 36 HOH 2594 5594 5369 HOH HOH 0 . 
CJ 36 HOH 2595 5595 5370 HOH HOH 0 . 
CJ 36 HOH 2596 5596 5371 HOH HOH 0 . 
CJ 36 HOH 2597 5597 5372 HOH HOH 0 . 
CJ 36 HOH 2598 5598 5373 HOH HOH 0 . 
CJ 36 HOH 2599 5599 5374 HOH HOH 0 . 
CJ 36 HOH 2600 5600 5375 HOH HOH 0 . 
CJ 36 HOH 2601 5601 5376 HOH HOH 0 . 
CJ 36 HOH 2602 5602 5377 HOH HOH 0 . 
CJ 36 HOH 2603 5603 5378 HOH HOH 0 . 
CJ 36 HOH 2604 5604 5380 HOH HOH 0 . 
CJ 36 HOH 2605 5605 5381 HOH HOH 0 . 
CJ 36 HOH 2606 5606 5382 HOH HOH 0 . 
CJ 36 HOH 2607 5607 5383 HOH HOH 0 . 
CJ 36 HOH 2608 5608 5384 HOH HOH 0 . 
CJ 36 HOH 2609 5609 5387 HOH HOH 0 . 
CJ 36 HOH 2610 5610 5388 HOH HOH 0 . 
CJ 36 HOH 2611 5611 5391 HOH HOH 0 . 
CJ 36 HOH 2612 5612 5392 HOH HOH 0 . 
CJ 36 HOH 2613 5613 5393 HOH HOH 0 . 
CJ 36 HOH 2614 5614 5394 HOH HOH 0 . 
CJ 36 HOH 2615 5615 5395 HOH HOH 0 . 
CJ 36 HOH 2616 5616 5396 HOH HOH 0 . 
CJ 36 HOH 2617 5617 5397 HOH HOH 0 . 
CJ 36 HOH 2618 5618 5399 HOH HOH 0 . 
CJ 36 HOH 2619 5619 5401 HOH HOH 0 . 
CJ 36 HOH 2620 5620 5402 HOH HOH 0 . 
CJ 36 HOH 2621 5621 5403 HOH HOH 0 . 
CJ 36 HOH 2622 5622 5405 HOH HOH 0 . 
CJ 36 HOH 2623 5623 5406 HOH HOH 0 . 
CJ 36 HOH 2624 5624 5407 HOH HOH 0 . 
CJ 36 HOH 2625 5625 5409 HOH HOH 0 . 
CJ 36 HOH 2626 5626 5410 HOH HOH 0 . 
CJ 36 HOH 2627 5627 5411 HOH HOH 0 . 
CJ 36 HOH 2628 5628 5412 HOH HOH 0 . 
CJ 36 HOH 2629 5629 5415 HOH HOH 0 . 
CJ 36 HOH 2630 5630 5417 HOH HOH 0 . 
CJ 36 HOH 2631 5631 5418 HOH HOH 0 . 
CJ 36 HOH 2632 5632 5419 HOH HOH 0 . 
CJ 36 HOH 2633 5633 5421 HOH HOH 0 . 
CJ 36 HOH 2634 5634 5422 HOH HOH 0 . 
CJ 36 HOH 2635 5635 5423 HOH HOH 0 . 
CJ 36 HOH 2636 5636 5424 HOH HOH 0 . 
CJ 36 HOH 2637 5637 5426 HOH HOH 0 . 
CJ 36 HOH 2638 5638 5428 HOH HOH 0 . 
CJ 36 HOH 2639 5639 5429 HOH HOH 0 . 
CJ 36 HOH 2640 5640 5431 HOH HOH 0 . 
CJ 36 HOH 2641 5641 5432 HOH HOH 0 . 
CJ 36 HOH 2642 5642 5433 HOH HOH 0 . 
CJ 36 HOH 2643 5643 5434 HOH HOH 0 . 
CJ 36 HOH 2644 5644 5435 HOH HOH 0 . 
CJ 36 HOH 2645 5645 5436 HOH HOH 0 . 
CJ 36 HOH 2646 5646 5437 HOH HOH 0 . 
CJ 36 HOH 2647 5647 5438 HOH HOH 0 . 
CJ 36 HOH 2648 5648 5441 HOH HOH 0 . 
CJ 36 HOH 2649 5649 5443 HOH HOH 0 . 
CJ 36 HOH 2650 5650 5444 HOH HOH 0 . 
CJ 36 HOH 2651 5651 5445 HOH HOH 0 . 
CJ 36 HOH 2652 5652 5446 HOH HOH 0 . 
CJ 36 HOH 2653 5653 5447 HOH HOH 0 . 
CJ 36 HOH 2654 5654 5448 HOH HOH 0 . 
CJ 36 HOH 2655 5655 5449 HOH HOH 0 . 
CJ 36 HOH 2656 5656 5450 HOH HOH 0 . 
CJ 36 HOH 2657 5657 5451 HOH HOH 0 . 
CJ 36 HOH 2658 5658 5452 HOH HOH 0 . 
CJ 36 HOH 2659 5659 5453 HOH HOH 0 . 
CJ 36 HOH 2660 5660 5454 HOH HOH 0 . 
CJ 36 HOH 2661 5661 5455 HOH HOH 0 . 
CJ 36 HOH 2662 5662 5456 HOH HOH 0 . 
CJ 36 HOH 2663 5663 5457 HOH HOH 0 . 
CJ 36 HOH 2664 5664 5459 HOH HOH 0 . 
CJ 36 HOH 2665 5665 5461 HOH HOH 0 . 
CJ 36 HOH 2666 5666 5462 HOH HOH 0 . 
CJ 36 HOH 2667 5667 5463 HOH HOH 0 . 
CJ 36 HOH 2668 5668 5464 HOH HOH 0 . 
CJ 36 HOH 2669 5669 5465 HOH HOH 0 . 
CJ 36 HOH 2670 5670 5467 HOH HOH 0 . 
CJ 36 HOH 2671 5671 5468 HOH HOH 0 . 
CJ 36 HOH 2672 5672 5469 HOH HOH 0 . 
CJ 36 HOH 2673 5673 5470 HOH HOH 0 . 
CJ 36 HOH 2674 5674 5472 HOH HOH 0 . 
CJ 36 HOH 2675 5675 5473 HOH HOH 0 . 
CJ 36 HOH 2676 5676 5474 HOH HOH 0 . 
CJ 36 HOH 2677 5677 5475 HOH HOH 0 . 
CJ 36 HOH 2678 5678 5476 HOH HOH 0 . 
CJ 36 HOH 2679 5679 5477 HOH HOH 0 . 
CJ 36 HOH 2680 5680 5479 HOH HOH 0 . 
CJ 36 HOH 2681 5681 5480 HOH HOH 0 . 
CJ 36 HOH 2682 5682 5481 HOH HOH 0 . 
CJ 36 HOH 2683 5683 5485 HOH HOH 0 . 
CJ 36 HOH 2684 5684 5486 HOH HOH 0 . 
CJ 36 HOH 2685 5685 5488 HOH HOH 0 . 
CJ 36 HOH 2686 5686 5489 HOH HOH 0 . 
CJ 36 HOH 2687 5687 5490 HOH HOH 0 . 
CJ 36 HOH 2688 5688 5492 HOH HOH 0 . 
CJ 36 HOH 2689 5689 5493 HOH HOH 0 . 
CJ 36 HOH 2690 5690 5494 HOH HOH 0 . 
CJ 36 HOH 2691 5691 5496 HOH HOH 0 . 
CJ 36 HOH 2692 5692 5497 HOH HOH 0 . 
CJ 36 HOH 2693 5693 5500 HOH HOH 0 . 
CJ 36 HOH 2694 5694 5501 HOH HOH 0 . 
CJ 36 HOH 2695 5695 5502 HOH HOH 0 . 
CJ 36 HOH 2696 5696 5503 HOH HOH 0 . 
CJ 36 HOH 2697 5697 5505 HOH HOH 0 . 
CJ 36 HOH 2698 5698 5506 HOH HOH 0 . 
CJ 36 HOH 2699 5699 5507 HOH HOH 0 . 
CJ 36 HOH 2700 5700 5508 HOH HOH 0 . 
CJ 36 HOH 2701 5701 5509 HOH HOH 0 . 
CJ 36 HOH 2702 5702 5510 HOH HOH 0 . 
CJ 36 HOH 2703 5703 5512 HOH HOH 0 . 
CJ 36 HOH 2704 5704 5513 HOH HOH 0 . 
CJ 36 HOH 2705 5705 5514 HOH HOH 0 . 
CJ 36 HOH 2706 5706 5515 HOH HOH 0 . 
CJ 36 HOH 2707 5707 5516 HOH HOH 0 . 
CJ 36 HOH 2708 5708 5520 HOH HOH 0 . 
CJ 36 HOH 2709 5709 5523 HOH HOH 0 . 
CJ 36 HOH 2710 5710 5524 HOH HOH 0 . 
CJ 36 HOH 2711 5711 5525 HOH HOH 0 . 
CJ 36 HOH 2712 5712 5526 HOH HOH 0 . 
CJ 36 HOH 2713 5713 5527 HOH HOH 0 . 
CJ 36 HOH 2714 5714 5532 HOH HOH 0 . 
CJ 36 HOH 2715 5715 5533 HOH HOH 0 . 
CJ 36 HOH 2716 5716 5536 HOH HOH 0 . 
CJ 36 HOH 2717 5717 5538 HOH HOH 0 . 
CJ 36 HOH 2718 5718 5539 HOH HOH 0 . 
CJ 36 HOH 2719 5719 5540 HOH HOH 0 . 
CJ 36 HOH 2720 5720 5542 HOH HOH 0 . 
CJ 36 HOH 2721 5721 5543 HOH HOH 0 . 
CJ 36 HOH 2722 5722 5544 HOH HOH 0 . 
CJ 36 HOH 2723 5723 5546 HOH HOH 0 . 
CJ 36 HOH 2724 5724 5547 HOH HOH 0 . 
CJ 36 HOH 2725 5725 5548 HOH HOH 0 . 
CJ 36 HOH 2726 5726 5549 HOH HOH 0 . 
CJ 36 HOH 2727 5727 5550 HOH HOH 0 . 
CJ 36 HOH 2728 5728 5551 HOH HOH 0 . 
CJ 36 HOH 2729 5729 5552 HOH HOH 0 . 
CJ 36 HOH 2730 5730 5554 HOH HOH 0 . 
CJ 36 HOH 2731 5731 5555 HOH HOH 0 . 
CJ 36 HOH 2732 5732 5556 HOH HOH 0 . 
CJ 36 HOH 2733 5733 5557 HOH HOH 0 . 
CJ 36 HOH 2734 5734 5559 HOH HOH 0 . 
CJ 36 HOH 2735 5735 5560 HOH HOH 0 . 
CJ 36 HOH 2736 5736 5562 HOH HOH 0 . 
CJ 36 HOH 2737 5737 5563 HOH HOH 0 . 
CJ 36 HOH 2738 5738 5565 HOH HOH 0 . 
CJ 36 HOH 2739 5739 5566 HOH HOH 0 . 
CJ 36 HOH 2740 5740 5567 HOH HOH 0 . 
CJ 36 HOH 2741 5741 5568 HOH HOH 0 . 
CJ 36 HOH 2742 5742 5569 HOH HOH 0 . 
CJ 36 HOH 2743 5743 5570 HOH HOH 0 . 
CJ 36 HOH 2744 5744 5571 HOH HOH 0 . 
CJ 36 HOH 2745 5745 5573 HOH HOH 0 . 
CJ 36 HOH 2746 5746 5574 HOH HOH 0 . 
CJ 36 HOH 2747 5747 5575 HOH HOH 0 . 
CJ 36 HOH 2748 5748 5577 HOH HOH 0 . 
CJ 36 HOH 2749 5749 5579 HOH HOH 0 . 
CJ 36 HOH 2750 5750 5580 HOH HOH 0 . 
CJ 36 HOH 2751 5751 5581 HOH HOH 0 . 
CJ 36 HOH 2752 5752 5582 HOH HOH 0 . 
CJ 36 HOH 2753 5753 5584 HOH HOH 0 . 
CJ 36 HOH 2754 5754 5585 HOH HOH 0 . 
CJ 36 HOH 2755 5755 5587 HOH HOH 0 . 
CJ 36 HOH 2756 5756 5588 HOH HOH 0 . 
CJ 36 HOH 2757 5757 5589 HOH HOH 0 . 
CJ 36 HOH 2758 5758 5593 HOH HOH 0 . 
CJ 36 HOH 2759 5759 5595 HOH HOH 0 . 
CJ 36 HOH 2760 5760 5596 HOH HOH 0 . 
CJ 36 HOH 2761 5761 5598 HOH HOH 0 . 
CJ 36 HOH 2762 5762 5601 HOH HOH 0 . 
CJ 36 HOH 2763 5763 5602 HOH HOH 0 . 
CJ 36 HOH 2764 5764 5603 HOH HOH 0 . 
CJ 36 HOH 2765 5765 5604 HOH HOH 0 . 
CJ 36 HOH 2766 5766 5605 HOH HOH 0 . 
CJ 36 HOH 2767 5767 5606 HOH HOH 0 . 
CJ 36 HOH 2768 5768 5607 HOH HOH 0 . 
CJ 36 HOH 2769 5769 5608 HOH HOH 0 . 
CJ 36 HOH 2770 5770 5609 HOH HOH 0 . 
CJ 36 HOH 2771 5771 5610 HOH HOH 0 . 
CJ 36 HOH 2772 5772 5611 HOH HOH 0 . 
CJ 36 HOH 2773 5773 5612 HOH HOH 0 . 
CJ 36 HOH 2774 5774 5613 HOH HOH 0 . 
CJ 36 HOH 2775 5775 5615 HOH HOH 0 . 
CJ 36 HOH 2776 5776 5617 HOH HOH 0 . 
CJ 36 HOH 2777 5777 5619 HOH HOH 0 . 
CJ 36 HOH 2778 5778 5623 HOH HOH 0 . 
CJ 36 HOH 2779 5779 5624 HOH HOH 0 . 
CJ 36 HOH 2780 5780 5625 HOH HOH 0 . 
CJ 36 HOH 2781 5781 5626 HOH HOH 0 . 
CJ 36 HOH 2782 5782 5629 HOH HOH 0 . 
CJ 36 HOH 2783 5783 5630 HOH HOH 0 . 
CJ 36 HOH 2784 5784 5633 HOH HOH 0 . 
CJ 36 HOH 2785 5785 5634 HOH HOH 0 . 
CJ 36 HOH 2786 5786 5635 HOH HOH 0 . 
CJ 36 HOH 2787 5787 5636 HOH HOH 0 . 
CJ 36 HOH 2788 5788 5637 HOH HOH 0 . 
CJ 36 HOH 2789 5789 5642 HOH HOH 0 . 
CJ 36 HOH 2790 5790 5643 HOH HOH 0 . 
CJ 36 HOH 2791 5791 5644 HOH HOH 0 . 
CJ 36 HOH 2792 5792 5645 HOH HOH 0 . 
CJ 36 HOH 2793 5793 5647 HOH HOH 0 . 
CJ 36 HOH 2794 5794 5649 HOH HOH 0 . 
CJ 36 HOH 2795 5795 5651 HOH HOH 0 . 
CJ 36 HOH 2796 5796 5652 HOH HOH 0 . 
CJ 36 HOH 2797 5797 5653 HOH HOH 0 . 
CJ 36 HOH 2798 5798 5654 HOH HOH 0 . 
CJ 36 HOH 2799 5799 5655 HOH HOH 0 . 
CJ 36 HOH 2800 5800 5657 HOH HOH 0 . 
CJ 36 HOH 2801 5801 5658 HOH HOH 0 . 
CJ 36 HOH 2802 5802 5659 HOH HOH 0 . 
CJ 36 HOH 2803 5803 5660 HOH HOH 0 . 
CJ 36 HOH 2804 5804 5662 HOH HOH 0 . 
CJ 36 HOH 2805 5805 5664 HOH HOH 0 . 
CJ 36 HOH 2806 5806 5666 HOH HOH 0 . 
CJ 36 HOH 2807 5807 5667 HOH HOH 0 . 
CJ 36 HOH 2808 5808 5668 HOH HOH 0 . 
CJ 36 HOH 2809 5809 5669 HOH HOH 0 . 
CJ 36 HOH 2810 5810 5670 HOH HOH 0 . 
CJ 36 HOH 2811 5811 5672 HOH HOH 0 . 
CJ 36 HOH 2812 5812 5673 HOH HOH 0 . 
CJ 36 HOH 2813 5813 5674 HOH HOH 0 . 
CJ 36 HOH 2814 5814 5675 HOH HOH 0 . 
CJ 36 HOH 2815 5815 5676 HOH HOH 0 . 
CJ 36 HOH 2816 5816 5677 HOH HOH 0 . 
CJ 36 HOH 2817 5817 5678 HOH HOH 0 . 
CJ 36 HOH 2818 5818 5679 HOH HOH 0 . 
CJ 36 HOH 2819 5819 5680 HOH HOH 0 . 
CJ 36 HOH 2820 5820 5681 HOH HOH 0 . 
CJ 36 HOH 2821 5821 5682 HOH HOH 0 . 
CJ 36 HOH 2822 5822 5683 HOH HOH 0 . 
CJ 36 HOH 2823 5823 5685 HOH HOH 0 . 
CJ 36 HOH 2824 5824 5687 HOH HOH 0 . 
CJ 36 HOH 2825 5825 5688 HOH HOH 0 . 
CJ 36 HOH 2826 5826 5689 HOH HOH 0 . 
CJ 36 HOH 2827 5827 5692 HOH HOH 0 . 
CJ 36 HOH 2828 5828 5693 HOH HOH 0 . 
CJ 36 HOH 2829 5829 5694 HOH HOH 0 . 
CJ 36 HOH 2830 5830 5695 HOH HOH 0 . 
CJ 36 HOH 2831 5831 5697 HOH HOH 0 . 
CJ 36 HOH 2832 5832 5698 HOH HOH 0 . 
CJ 36 HOH 2833 5833 5699 HOH HOH 0 . 
CJ 36 HOH 2834 5834 5700 HOH HOH 0 . 
CJ 36 HOH 2835 5835 5701 HOH HOH 0 . 
CJ 36 HOH 2836 5836 5703 HOH HOH 0 . 
CJ 36 HOH 2837 5837 5704 HOH HOH 0 . 
CJ 36 HOH 2838 5838 5705 HOH HOH 0 . 
CJ 36 HOH 2839 5839 5708 HOH HOH 0 . 
CJ 36 HOH 2840 5840 5709 HOH HOH 0 . 
CJ 36 HOH 2841 5841 5710 HOH HOH 0 . 
CJ 36 HOH 2842 5842 5711 HOH HOH 0 . 
CJ 36 HOH 2843 5843 5712 HOH HOH 0 . 
CJ 36 HOH 2844 5844 5713 HOH HOH 0 . 
CJ 36 HOH 2845 5845 5714 HOH HOH 0 . 
CJ 36 HOH 2846 5846 5716 HOH HOH 0 . 
CJ 36 HOH 2847 5847 5717 HOH HOH 0 . 
CJ 36 HOH 2848 5848 5718 HOH HOH 0 . 
CJ 36 HOH 2849 5849 5720 HOH HOH 0 . 
CJ 36 HOH 2850 5850 5721 HOH HOH 0 . 
CJ 36 HOH 2851 5851 5722 HOH HOH 0 . 
CJ 36 HOH 2852 5852 5723 HOH HOH 0 . 
CJ 36 HOH 2853 5853 5724 HOH HOH 0 . 
CJ 36 HOH 2854 5854 5726 HOH HOH 0 . 
CJ 36 HOH 2855 5855 5731 HOH HOH 0 . 
CJ 36 HOH 2856 5856 5732 HOH HOH 0 . 
CJ 36 HOH 2857 5857 5733 HOH HOH 0 . 
CJ 36 HOH 2858 5858 5734 HOH HOH 0 . 
CJ 36 HOH 2859 5859 5735 HOH HOH 0 . 
CJ 36 HOH 2860 5860 5736 HOH HOH 0 . 
CJ 36 HOH 2861 5861 5738 HOH HOH 0 . 
CJ 36 HOH 2862 5862 5739 HOH HOH 0 . 
CJ 36 HOH 2863 5863 5740 HOH HOH 0 . 
CJ 36 HOH 2864 5864 5741 HOH HOH 0 . 
CJ 36 HOH 2865 5865 5742 HOH HOH 0 . 
CJ 36 HOH 2866 5866 5743 HOH HOH 0 . 
CJ 36 HOH 2867 5867 5744 HOH HOH 0 . 
CJ 36 HOH 2868 5868 5745 HOH HOH 0 . 
CJ 36 HOH 2869 5869 5746 HOH HOH 0 . 
CJ 36 HOH 2870 5870 5748 HOH HOH 0 . 
CJ 36 HOH 2871 5871 5749 HOH HOH 0 . 
CJ 36 HOH 2872 5872 5753 HOH HOH 0 . 
CJ 36 HOH 2873 5873 5755 HOH HOH 0 . 
CJ 36 HOH 2874 5874 5756 HOH HOH 0 . 
CJ 36 HOH 2875 5875 5757 HOH HOH 0 . 
CJ 36 HOH 2876 5876 5761 HOH HOH 0 . 
CJ 36 HOH 2877 5877 5762 HOH HOH 0 . 
CJ 36 HOH 2878 5878 5764 HOH HOH 0 . 
CJ 36 HOH 2879 5879 5765 HOH HOH 0 . 
CJ 36 HOH 2880 5880 5768 HOH HOH 0 . 
CJ 36 HOH 2881 5881 5770 HOH HOH 0 . 
CJ 36 HOH 2882 5882 5771 HOH HOH 0 . 
CJ 36 HOH 2883 5883 5772 HOH HOH 0 . 
CJ 36 HOH 2884 5884 5773 HOH HOH 0 . 
CJ 36 HOH 2885 5885 5774 HOH HOH 0 . 
CJ 36 HOH 2886 5886 5775 HOH HOH 0 . 
CJ 36 HOH 2887 5887 5776 HOH HOH 0 . 
CJ 36 HOH 2888 5888 5777 HOH HOH 0 . 
CJ 36 HOH 2889 5889 5779 HOH HOH 0 . 
CJ 36 HOH 2890 5890 5781 HOH HOH 0 . 
CJ 36 HOH 2891 5891 5782 HOH HOH 0 . 
CJ 36 HOH 2892 5892 5783 HOH HOH 0 . 
CJ 36 HOH 2893 5893 5784 HOH HOH 0 . 
CJ 36 HOH 2894 5894 5785 HOH HOH 0 . 
CJ 36 HOH 2895 5895 5786 HOH HOH 0 . 
CJ 36 HOH 2896 5896 5787 HOH HOH 0 . 
CJ 36 HOH 2897 5897 5788 HOH HOH 0 . 
CJ 36 HOH 2898 5898 5789 HOH HOH 0 . 
CJ 36 HOH 2899 5899 5790 HOH HOH 0 . 
CJ 36 HOH 2900 5900 5791 HOH HOH 0 . 
CJ 36 HOH 2901 5901 5792 HOH HOH 0 . 
CJ 36 HOH 2902 5902 5793 HOH HOH 0 . 
CJ 36 HOH 2903 5903 5794 HOH HOH 0 . 
CJ 36 HOH 2904 5904 5796 HOH HOH 0 . 
CJ 36 HOH 2905 5905 5797 HOH HOH 0 . 
CJ 36 HOH 2906 5906 5798 HOH HOH 0 . 
CJ 36 HOH 2907 5907 5799 HOH HOH 0 . 
CJ 36 HOH 2908 5908 5800 HOH HOH 0 . 
CJ 36 HOH 2909 5909 5801 HOH HOH 0 . 
CJ 36 HOH 2910 5910 5802 HOH HOH 0 . 
CJ 36 HOH 2911 5911 5803 HOH HOH 0 . 
CJ 36 HOH 2912 5912 5804 HOH HOH 0 . 
CJ 36 HOH 2913 5913 5805 HOH HOH 0 . 
CJ 36 HOH 2914 5914 5806 HOH HOH 0 . 
CJ 36 HOH 2915 5915 5807 HOH HOH 0 . 
CJ 36 HOH 2916 5916 5808 HOH HOH 0 . 
CJ 36 HOH 2917 5917 5809 HOH HOH 0 . 
CJ 36 HOH 2918 5918 5811 HOH HOH 0 . 
CJ 36 HOH 2919 5919 5812 HOH HOH 0 . 
CJ 36 HOH 2920 5920 5813 HOH HOH 0 . 
CJ 36 HOH 2921 5921 5815 HOH HOH 0 . 
CJ 36 HOH 2922 5922 5818 HOH HOH 0 . 
CJ 36 HOH 2923 5923 5819 HOH HOH 0 . 
CJ 36 HOH 2924 5924 5820 HOH HOH 0 . 
CJ 36 HOH 2925 5925 5823 HOH HOH 0 . 
CJ 36 HOH 2926 5926 5824 HOH HOH 0 . 
CJ 36 HOH 2927 5927 5825 HOH HOH 0 . 
CJ 36 HOH 2928 5928 5826 HOH HOH 0 . 
CJ 36 HOH 2929 5929 5827 HOH HOH 0 . 
CJ 36 HOH 2930 5930 5829 HOH HOH 0 . 
CJ 36 HOH 2931 5931 5830 HOH HOH 0 . 
CJ 36 HOH 2932 5932 5831 HOH HOH 0 . 
CJ 36 HOH 2933 5933 5832 HOH HOH 0 . 
CJ 36 HOH 2934 5934 5833 HOH HOH 0 . 
CJ 36 HOH 2935 5935 5834 HOH HOH 0 . 
CJ 36 HOH 2936 5936 5835 HOH HOH 0 . 
CJ 36 HOH 2937 5937 5838 HOH HOH 0 . 
CJ 36 HOH 2938 5938 5839 HOH HOH 0 . 
CJ 36 HOH 2939 5939 5841 HOH HOH 0 . 
CJ 36 HOH 2940 5940 5843 HOH HOH 0 . 
CJ 36 HOH 2941 5941 5844 HOH HOH 0 . 
CJ 36 HOH 2942 5942 5845 HOH HOH 0 . 
CJ 36 HOH 2943 5943 5846 HOH HOH 0 . 
CJ 36 HOH 2944 5944 5847 HOH HOH 0 . 
CJ 36 HOH 2945 5945 5848 HOH HOH 0 . 
CJ 36 HOH 2946 5946 5850 HOH HOH 0 . 
CJ 36 HOH 2947 5947 5852 HOH HOH 0 . 
CJ 36 HOH 2948 5948 5854 HOH HOH 0 . 
CJ 36 HOH 2949 5949 5856 HOH HOH 0 . 
CJ 36 HOH 2950 5950 5857 HOH HOH 0 . 
CJ 36 HOH 2951 5951 5859 HOH HOH 0 . 
CJ 36 HOH 2952 5952 5860 HOH HOH 0 . 
CJ 36 HOH 2953 5953 5863 HOH HOH 0 . 
CJ 36 HOH 2954 5954 5867 HOH HOH 0 . 
CJ 36 HOH 2955 5955 5868 HOH HOH 0 . 
CJ 36 HOH 2956 5956 5869 HOH HOH 0 . 
CJ 36 HOH 2957 5957 5872 HOH HOH 0 . 
CJ 36 HOH 2958 5958 5874 HOH HOH 0 . 
CJ 36 HOH 2959 5959 5875 HOH HOH 0 . 
CJ 36 HOH 2960 5960 5876 HOH HOH 0 . 
CJ 36 HOH 2961 5961 5877 HOH HOH 0 . 
CJ 36 HOH 2962 5962 5878 HOH HOH 0 . 
CJ 36 HOH 2963 5963 5879 HOH HOH 0 . 
CJ 36 HOH 2964 5964 5880 HOH HOH 0 . 
CJ 36 HOH 2965 5965 5881 HOH HOH 0 . 
CJ 36 HOH 2966 5966 5882 HOH HOH 0 . 
CJ 36 HOH 2967 5967 5883 HOH HOH 0 . 
CJ 36 HOH 2968 5968 5884 HOH HOH 0 . 
CJ 36 HOH 2969 5969 5886 HOH HOH 0 . 
CJ 36 HOH 2970 5970 5887 HOH HOH 0 . 
CJ 36 HOH 2971 5971 5889 HOH HOH 0 . 
CJ 36 HOH 2972 5972 5890 HOH HOH 0 . 
CJ 36 HOH 2973 5973 5893 HOH HOH 0 . 
CJ 36 HOH 2974 5974 5894 HOH HOH 0 . 
CJ 36 HOH 2975 5975 5895 HOH HOH 0 . 
CJ 36 HOH 2976 5976 5896 HOH HOH 0 . 
CJ 36 HOH 2977 5977 5898 HOH HOH 0 . 
CJ 36 HOH 2978 5978 5900 HOH HOH 0 . 
CJ 36 HOH 2979 5979 5901 HOH HOH 0 . 
CJ 36 HOH 2980 5980 5902 HOH HOH 0 . 
CJ 36 HOH 2981 5981 5905 HOH HOH 0 . 
CJ 36 HOH 2982 5982 5906 HOH HOH 0 . 
CJ 36 HOH 2983 5983 5909 HOH HOH 0 . 
CJ 36 HOH 2984 5984 5910 HOH HOH 0 . 
CJ 36 HOH 2985 5985 5911 HOH HOH 0 . 
CJ 36 HOH 2986 5986 5912 HOH HOH 0 . 
CJ 36 HOH 2987 5987 5914 HOH HOH 0 . 
CJ 36 HOH 2988 5988 5916 HOH HOH 0 . 
CJ 36 HOH 2989 5989 5917 HOH HOH 0 . 
CJ 36 HOH 2990 5990 5918 HOH HOH 0 . 
CJ 36 HOH 2991 5991 5920 HOH HOH 0 . 
CJ 36 HOH 2992 5992 5921 HOH HOH 0 . 
CJ 36 HOH 2993 5993 5922 HOH HOH 0 . 
CJ 36 HOH 2994 5994 5924 HOH HOH 0 . 
CJ 36 HOH 2995 5995 5925 HOH HOH 0 . 
CJ 36 HOH 2996 5996 5926 HOH HOH 0 . 
CJ 36 HOH 2997 5997 5927 HOH HOH 0 . 
CJ 36 HOH 2998 5998 5928 HOH HOH 0 . 
CJ 36 HOH 2999 5999 5930 HOH HOH 0 . 
CJ 36 HOH 3000 6000 5931 HOH HOH 0 . 
CJ 36 HOH 3001 6001 5932 HOH HOH 0 . 
CJ 36 HOH 3002 6002 5933 HOH HOH 0 . 
CJ 36 HOH 3003 6003 5935 HOH HOH 0 . 
CJ 36 HOH 3004 6004 5937 HOH HOH 0 . 
CJ 36 HOH 3005 6005 5938 HOH HOH 0 . 
CJ 36 HOH 3006 6006 5939 HOH HOH 0 . 
CJ 36 HOH 3007 6007 5941 HOH HOH 0 . 
CJ 36 HOH 3008 6008 5944 HOH HOH 0 . 
CJ 36 HOH 3009 6009 5945 HOH HOH 0 . 
CJ 36 HOH 3010 6010 5946 HOH HOH 0 . 
CJ 36 HOH 3011 6011 5947 HOH HOH 0 . 
CJ 36 HOH 3012 6012 5948 HOH HOH 0 . 
CJ 36 HOH 3013 6013 5951 HOH HOH 0 . 
CJ 36 HOH 3014 6014 5953 HOH HOH 0 . 
CJ 36 HOH 3015 6015 5954 HOH HOH 0 . 
CJ 36 HOH 3016 6016 5955 HOH HOH 0 . 
CJ 36 HOH 3017 6017 5956 HOH HOH 0 . 
CJ 36 HOH 3018 6018 5957 HOH HOH 0 . 
CJ 36 HOH 3019 6019 5958 HOH HOH 0 . 
CJ 36 HOH 3020 6020 5959 HOH HOH 0 . 
CJ 36 HOH 3021 6021 5960 HOH HOH 0 . 
CJ 36 HOH 3022 6022 5962 HOH HOH 0 . 
CJ 36 HOH 3023 6023 5963 HOH HOH 0 . 
CJ 36 HOH 3024 6024 5964 HOH HOH 0 . 
CJ 36 HOH 3025 6025 5965 HOH HOH 0 . 
CJ 36 HOH 3026 6026 5967 HOH HOH 0 . 
CJ 36 HOH 3027 6027 5968 HOH HOH 0 . 
CJ 36 HOH 3028 6028 5969 HOH HOH 0 . 
CJ 36 HOH 3029 6029 5970 HOH HOH 0 . 
CJ 36 HOH 3030 6030 5972 HOH HOH 0 . 
CJ 36 HOH 3031 6031 5973 HOH HOH 0 . 
CJ 36 HOH 3032 6032 5974 HOH HOH 0 . 
CJ 36 HOH 3033 6033 5975 HOH HOH 0 . 
CJ 36 HOH 3034 6034 5976 HOH HOH 0 . 
CJ 36 HOH 3035 6035 5977 HOH HOH 0 . 
CJ 36 HOH 3036 6036 5978 HOH HOH 0 . 
CJ 36 HOH 3037 6037 5980 HOH HOH 0 . 
CJ 36 HOH 3038 6038 5982 HOH HOH 0 . 
CJ 36 HOH 3039 6039 5984 HOH HOH 0 . 
CJ 36 HOH 3040 6040 5985 HOH HOH 0 . 
CJ 36 HOH 3041 6041 5986 HOH HOH 0 . 
CJ 36 HOH 3042 6042 5987 HOH HOH 0 . 
CJ 36 HOH 3043 6043 5988 HOH HOH 0 . 
CJ 36 HOH 3044 6044 5989 HOH HOH 0 . 
CJ 36 HOH 3045 6045 5991 HOH HOH 0 . 
CJ 36 HOH 3046 6046 5992 HOH HOH 0 . 
CJ 36 HOH 3047 6047 5993 HOH HOH 0 . 
CJ 36 HOH 3048 6048 5994 HOH HOH 0 . 
CJ 36 HOH 3049 6049 5995 HOH HOH 0 . 
CJ 36 HOH 3050 6050 5997 HOH HOH 0 . 
CJ 36 HOH 3051 6051 5999 HOH HOH 0 . 
CJ 36 HOH 3052 6052 6000 HOH HOH 0 . 
CJ 36 HOH 3053 6053 6002 HOH HOH 0 . 
CJ 36 HOH 3054 6054 6003 HOH HOH 0 . 
CJ 36 HOH 3055 6055 6004 HOH HOH 0 . 
CJ 36 HOH 3056 6056 6005 HOH HOH 0 . 
CJ 36 HOH 3057 6057 6009 HOH HOH 0 . 
CJ 36 HOH 3058 6058 6010 HOH HOH 0 . 
CJ 36 HOH 3059 6059 6011 HOH HOH 0 . 
CJ 36 HOH 3060 6060 6012 HOH HOH 0 . 
CJ 36 HOH 3061 6061 6013 HOH HOH 0 . 
CJ 36 HOH 3062 6062 6014 HOH HOH 0 . 
CJ 36 HOH 3063 6063 6016 HOH HOH 0 . 
CJ 36 HOH 3064 6064 6018 HOH HOH 0 . 
CJ 36 HOH 3065 6065 6019 HOH HOH 0 . 
CJ 36 HOH 3066 6066 6020 HOH HOH 0 . 
CJ 36 HOH 3067 6067 6021 HOH HOH 0 . 
CJ 36 HOH 3068 6068 6022 HOH HOH 0 . 
CJ 36 HOH 3069 6069 6024 HOH HOH 0 . 
CJ 36 HOH 3070 6070 6025 HOH HOH 0 . 
CJ 36 HOH 3071 6071 6026 HOH HOH 0 . 
CJ 36 HOH 3072 6072 6028 HOH HOH 0 . 
CJ 36 HOH 3073 6073 6029 HOH HOH 0 . 
CJ 36 HOH 3074 6074 6031 HOH HOH 0 . 
CJ 36 HOH 3075 6075 6032 HOH HOH 0 . 
CJ 36 HOH 3076 6076 6033 HOH HOH 0 . 
CJ 36 HOH 3077 6077 6034 HOH HOH 0 . 
CJ 36 HOH 3078 6078 6035 HOH HOH 0 . 
CJ 36 HOH 3079 6079 6036 HOH HOH 0 . 
CJ 36 HOH 3080 6080 6037 HOH HOH 0 . 
CJ 36 HOH 3081 6081 6039 HOH HOH 0 . 
CJ 36 HOH 3082 6082 6040 HOH HOH 0 . 
CJ 36 HOH 3083 6083 6041 HOH HOH 0 . 
CJ 36 HOH 3084 6084 6042 HOH HOH 0 . 
CJ 36 HOH 3085 6085 6043 HOH HOH 0 . 
CJ 36 HOH 3086 6086 6045 HOH HOH 0 . 
CJ 36 HOH 3087 6087 6047 HOH HOH 0 . 
CJ 36 HOH 3088 6088 6048 HOH HOH 0 . 
CJ 36 HOH 3089 6089 6049 HOH HOH 0 . 
CJ 36 HOH 3090 6090 6050 HOH HOH 0 . 
CJ 36 HOH 3091 6091 6055 HOH HOH 0 . 
CJ 36 HOH 3092 6092 6057 HOH HOH 0 . 
CJ 36 HOH 3093 6093 6058 HOH HOH 0 . 
CJ 36 HOH 3094 6094 6059 HOH HOH 0 . 
CJ 36 HOH 3095 6095 6060 HOH HOH 0 . 
CJ 36 HOH 3096 6096 6061 HOH HOH 0 . 
CJ 36 HOH 3097 6097 6062 HOH HOH 0 . 
CJ 36 HOH 3098 6098 6063 HOH HOH 0 . 
CJ 36 HOH 3099 6099 6065 HOH HOH 0 . 
CJ 36 HOH 3100 6100 6066 HOH HOH 0 . 
CJ 36 HOH 3101 6101 6068 HOH HOH 0 . 
CJ 36 HOH 3102 6102 6070 HOH HOH 0 . 
CJ 36 HOH 3103 6103 6073 HOH HOH 0 . 
CJ 36 HOH 3104 6104 6074 HOH HOH 0 . 
CJ 36 HOH 3105 6105 6075 HOH HOH 0 . 
CJ 36 HOH 3106 6106 6076 HOH HOH 0 . 
CJ 36 HOH 3107 6107 6077 HOH HOH 0 . 
CJ 36 HOH 3108 6108 6078 HOH HOH 0 . 
CJ 36 HOH 3109 6109 6079 HOH HOH 0 . 
CJ 36 HOH 3110 6110 6080 HOH HOH 0 . 
CJ 36 HOH 3111 6111 6081 HOH HOH 0 . 
CJ 36 HOH 3112 6112 6082 HOH HOH 0 . 
CJ 36 HOH 3113 6113 6083 HOH HOH 0 . 
CJ 36 HOH 3114 6114 6084 HOH HOH 0 . 
CJ 36 HOH 3115 6115 6085 HOH HOH 0 . 
CJ 36 HOH 3116 6116 6086 HOH HOH 0 . 
CJ 36 HOH 3117 6117 6087 HOH HOH 0 . 
CJ 36 HOH 3118 6118 6088 HOH HOH 0 . 
CJ 36 HOH 3119 6119 6090 HOH HOH 0 . 
CJ 36 HOH 3120 6120 6093 HOH HOH 0 . 
CJ 36 HOH 3121 6121 6094 HOH HOH 0 . 
CJ 36 HOH 3122 6122 6095 HOH HOH 0 . 
CJ 36 HOH 3123 6123 6096 HOH HOH 0 . 
CJ 36 HOH 3124 6124 6098 HOH HOH 0 . 
CJ 36 HOH 3125 6125 6101 HOH HOH 0 . 
CJ 36 HOH 3126 6126 6102 HOH HOH 0 . 
CJ 36 HOH 3127 6127 6103 HOH HOH 0 . 
CJ 36 HOH 3128 6128 6104 HOH HOH 0 . 
CJ 36 HOH 3129 6129 6105 HOH HOH 0 . 
CJ 36 HOH 3130 6130 6106 HOH HOH 0 . 
CJ 36 HOH 3131 6131 6107 HOH HOH 0 . 
CJ 36 HOH 3132 6132 6108 HOH HOH 0 . 
CJ 36 HOH 3133 6133 6112 HOH HOH 0 . 
CJ 36 HOH 3134 6134 6113 HOH HOH 0 . 
CJ 36 HOH 3135 6135 6114 HOH HOH 0 . 
CJ 36 HOH 3136 6136 6117 HOH HOH 0 . 
CJ 36 HOH 3137 6137 6118 HOH HOH 0 . 
CJ 36 HOH 3138 6138 6119 HOH HOH 0 . 
CJ 36 HOH 3139 6139 6120 HOH HOH 0 . 
CJ 36 HOH 3140 6140 6121 HOH HOH 0 . 
CJ 36 HOH 3141 6141 6122 HOH HOH 0 . 
CJ 36 HOH 3142 6142 6123 HOH HOH 0 . 
CJ 36 HOH 3143 6143 6124 HOH HOH 0 . 
CJ 36 HOH 3144 6144 6125 HOH HOH 0 . 
CJ 36 HOH 3145 6145 6126 HOH HOH 0 . 
CJ 36 HOH 3146 6146 6128 HOH HOH 0 . 
CJ 36 HOH 3147 6147 6129 HOH HOH 0 . 
CJ 36 HOH 3148 6148 6131 HOH HOH 0 . 
CJ 36 HOH 3149 6149 6132 HOH HOH 0 . 
CJ 36 HOH 3150 6150 6133 HOH HOH 0 . 
CJ 36 HOH 3151 6151 6134 HOH HOH 0 . 
CJ 36 HOH 3152 6152 6135 HOH HOH 0 . 
CJ 36 HOH 3153 6153 6137 HOH HOH 0 . 
CJ 36 HOH 3154 6154 6138 HOH HOH 0 . 
CJ 36 HOH 3155 6155 6141 HOH HOH 0 . 
CJ 36 HOH 3156 6156 6143 HOH HOH 0 . 
CJ 36 HOH 3157 6157 6145 HOH HOH 0 . 
CJ 36 HOH 3158 6158 6148 HOH HOH 0 . 
CJ 36 HOH 3159 6159 6149 HOH HOH 0 . 
CJ 36 HOH 3160 6160 6151 HOH HOH 0 . 
CJ 36 HOH 3161 6161 6152 HOH HOH 0 . 
CJ 36 HOH 3162 6162 6154 HOH HOH 0 . 
CJ 36 HOH 3163 6163 6155 HOH HOH 0 . 
CJ 36 HOH 3164 6164 6157 HOH HOH 0 . 
CJ 36 HOH 3165 6165 6159 HOH HOH 0 . 
CJ 36 HOH 3166 6166 6160 HOH HOH 0 . 
CJ 36 HOH 3167 6167 6161 HOH HOH 0 . 
CJ 36 HOH 3168 6168 6162 HOH HOH 0 . 
CJ 36 HOH 3169 6169 6163 HOH HOH 0 . 
CJ 36 HOH 3170 6170 6164 HOH HOH 0 . 
CJ 36 HOH 3171 6171 6167 HOH HOH 0 . 
CJ 36 HOH 3172 6172 6169 HOH HOH 0 . 
CJ 36 HOH 3173 6173 6170 HOH HOH 0 . 
CJ 36 HOH 3174 6174 6171 HOH HOH 0 . 
CJ 36 HOH 3175 6175 6172 HOH HOH 0 . 
CJ 36 HOH 3176 6176 6173 HOH HOH 0 . 
CJ 36 HOH 3177 6177 6174 HOH HOH 0 . 
CJ 36 HOH 3178 6178 6175 HOH HOH 0 . 
CJ 36 HOH 3179 6179 6176 HOH HOH 0 . 
CJ 36 HOH 3180 6180 6180 HOH HOH 0 . 
CJ 36 HOH 3181 6181 6181 HOH HOH 0 . 
CJ 36 HOH 3182 6182 6183 HOH HOH 0 . 
CJ 36 HOH 3183 6183 6184 HOH HOH 0 . 
CJ 36 HOH 3184 6184 6185 HOH HOH 0 . 
CJ 36 HOH 3185 6185 6186 HOH HOH 0 . 
CJ 36 HOH 3186 6186 6187 HOH HOH 0 . 
CJ 36 HOH 3187 6187 6188 HOH HOH 0 . 
CJ 36 HOH 3188 6188 6191 HOH HOH 0 . 
CJ 36 HOH 3189 6189 6193 HOH HOH 0 . 
CJ 36 HOH 3190 6190 6195 HOH HOH 0 . 
CJ 36 HOH 3191 6191 6196 HOH HOH 0 . 
CJ 36 HOH 3192 6192 6197 HOH HOH 0 . 
CJ 36 HOH 3193 6193 6199 HOH HOH 0 . 
CJ 36 HOH 3194 6194 6200 HOH HOH 0 . 
CJ 36 HOH 3195 6195 6202 HOH HOH 0 . 
CJ 36 HOH 3196 6196 6203 HOH HOH 0 . 
CJ 36 HOH 3197 6197 6204 HOH HOH 0 . 
CJ 36 HOH 3198 6198 6205 HOH HOH 0 . 
CJ 36 HOH 3199 6199 6208 HOH HOH 0 . 
CJ 36 HOH 3200 6200 6211 HOH HOH 0 . 
CJ 36 HOH 3201 6201 6212 HOH HOH 0 . 
CJ 36 HOH 3202 6202 6214 HOH HOH 0 . 
CJ 36 HOH 3203 6203 6218 HOH HOH 0 . 
CJ 36 HOH 3204 6204 6219 HOH HOH 0 . 
CJ 36 HOH 3205 6205 6222 HOH HOH 0 . 
CJ 36 HOH 3206 6206 6223 HOH HOH 0 . 
CJ 36 HOH 3207 6207 6224 HOH HOH 0 . 
CJ 36 HOH 3208 6208 6225 HOH HOH 0 . 
CJ 36 HOH 3209 6209 6226 HOH HOH 0 . 
CJ 36 HOH 3210 6210 6227 HOH HOH 0 . 
CJ 36 HOH 3211 6211 6228 HOH HOH 0 . 
CJ 36 HOH 3212 6212 6229 HOH HOH 0 . 
CJ 36 HOH 3213 6213 6231 HOH HOH 0 . 
CJ 36 HOH 3214 6214 6232 HOH HOH 0 . 
CJ 36 HOH 3215 6215 6233 HOH HOH 0 . 
CJ 36 HOH 3216 6216 6235 HOH HOH 0 . 
CJ 36 HOH 3217 6217 6236 HOH HOH 0 . 
CJ 36 HOH 3218 6218 6240 HOH HOH 0 . 
CJ 36 HOH 3219 6219 6241 HOH HOH 0 . 
CJ 36 HOH 3220 6220 6243 HOH HOH 0 . 
CJ 36 HOH 3221 6221 6244 HOH HOH 0 . 
CJ 36 HOH 3222 6222 6245 HOH HOH 0 . 
CJ 36 HOH 3223 6223 6246 HOH HOH 0 . 
CJ 36 HOH 3224 6224 6248 HOH HOH 0 . 
CJ 36 HOH 3225 6225 6249 HOH HOH 0 . 
CJ 36 HOH 3226 6226 6253 HOH HOH 0 . 
CJ 36 HOH 3227 6227 6254 HOH HOH 0 . 
CJ 36 HOH 3228 6228 6255 HOH HOH 0 . 
CJ 36 HOH 3229 6229 6257 HOH HOH 0 . 
CJ 36 HOH 3230 6230 6258 HOH HOH 0 . 
CJ 36 HOH 3231 6231 6259 HOH HOH 0 . 
CJ 36 HOH 3232 6232 6261 HOH HOH 0 . 
CJ 36 HOH 3233 6233 6263 HOH HOH 0 . 
CJ 36 HOH 3234 6234 6264 HOH HOH 0 . 
CJ 36 HOH 3235 6235 6265 HOH HOH 0 . 
CJ 36 HOH 3236 6236 6266 HOH HOH 0 . 
CJ 36 HOH 3237 6237 6267 HOH HOH 0 . 
CJ 36 HOH 3238 6238 6269 HOH HOH 0 . 
CJ 36 HOH 3239 6239 6270 HOH HOH 0 . 
CJ 36 HOH 3240 6240 6271 HOH HOH 0 . 
CJ 36 HOH 3241 6241 6272 HOH HOH 0 . 
CJ 36 HOH 3242 6242 6274 HOH HOH 0 . 
CJ 36 HOH 3243 6243 6275 HOH HOH 0 . 
CJ 36 HOH 3244 6244 6277 HOH HOH 0 . 
CJ 36 HOH 3245 6245 6278 HOH HOH 0 . 
CJ 36 HOH 3246 6246 6279 HOH HOH 0 . 
CJ 36 HOH 3247 6247 6280 HOH HOH 0 . 
CJ 36 HOH 3248 6248 6281 HOH HOH 0 . 
CJ 36 HOH 3249 6249 6282 HOH HOH 0 . 
CJ 36 HOH 3250 6250 6283 HOH HOH 0 . 
CJ 36 HOH 3251 6251 6284 HOH HOH 0 . 
CJ 36 HOH 3252 6252 6285 HOH HOH 0 . 
CJ 36 HOH 3253 6253 6287 HOH HOH 0 . 
CJ 36 HOH 3254 6254 6288 HOH HOH 0 . 
CJ 36 HOH 3255 6255 6290 HOH HOH 0 . 
CJ 36 HOH 3256 6256 6291 HOH HOH 0 . 
CJ 36 HOH 3257 6257 6293 HOH HOH 0 . 
CJ 36 HOH 3258 6258 6294 HOH HOH 0 . 
CJ 36 HOH 3259 6259 6295 HOH HOH 0 . 
CJ 36 HOH 3260 6260 6297 HOH HOH 0 . 
CJ 36 HOH 3261 6261 6300 HOH HOH 0 . 
CJ 36 HOH 3262 6262 6301 HOH HOH 0 . 
CJ 36 HOH 3263 6263 6303 HOH HOH 0 . 
CJ 36 HOH 3264 6264 6304 HOH HOH 0 . 
CJ 36 HOH 3265 6265 6305 HOH HOH 0 . 
CJ 36 HOH 3266 6266 6306 HOH HOH 0 . 
CJ 36 HOH 3267 6267 6307 HOH HOH 0 . 
CJ 36 HOH 3268 6268 6309 HOH HOH 0 . 
CJ 36 HOH 3269 6269 6310 HOH HOH 0 . 
CJ 36 HOH 3270 6270 6311 HOH HOH 0 . 
CJ 36 HOH 3271 6271 6316 HOH HOH 0 . 
CJ 36 HOH 3272 6272 6318 HOH HOH 0 . 
CJ 36 HOH 3273 6273 6319 HOH HOH 0 . 
CJ 36 HOH 3274 6274 6321 HOH HOH 0 . 
CJ 36 HOH 3275 6275 6322 HOH HOH 0 . 
CJ 36 HOH 3276 6276 6323 HOH HOH 0 . 
CJ 36 HOH 3277 6277 6324 HOH HOH 0 . 
CJ 36 HOH 3278 6278 6327 HOH HOH 0 . 
CJ 36 HOH 3279 6279 6328 HOH HOH 0 . 
CJ 36 HOH 3280 6280 6329 HOH HOH 0 . 
CJ 36 HOH 3281 6281 6330 HOH HOH 0 . 
CJ 36 HOH 3282 6282 6331 HOH HOH 0 . 
CJ 36 HOH 3283 6283 6332 HOH HOH 0 . 
CJ 36 HOH 3284 6284 6333 HOH HOH 0 . 
CJ 36 HOH 3285 6285 6334 HOH HOH 0 . 
CJ 36 HOH 3286 6286 6335 HOH HOH 0 . 
CJ 36 HOH 3287 6287 6336 HOH HOH 0 . 
CJ 36 HOH 3288 6288 6337 HOH HOH 0 . 
CJ 36 HOH 3289 6289 6338 HOH HOH 0 . 
CJ 36 HOH 3290 6290 6340 HOH HOH 0 . 
CJ 36 HOH 3291 6291 6342 HOH HOH 0 . 
CJ 36 HOH 3292 6292 6343 HOH HOH 0 . 
CJ 36 HOH 3293 6293 6345 HOH HOH 0 . 
CJ 36 HOH 3294 6294 6347 HOH HOH 0 . 
CJ 36 HOH 3295 6295 6348 HOH HOH 0 . 
CJ 36 HOH 3296 6296 6349 HOH HOH 0 . 
CJ 36 HOH 3297 6297 6350 HOH HOH 0 . 
CJ 36 HOH 3298 6298 6351 HOH HOH 0 . 
CJ 36 HOH 3299 6299 6353 HOH HOH 0 . 
CJ 36 HOH 3300 6300 6354 HOH HOH 0 . 
CJ 36 HOH 3301 6301 6355 HOH HOH 0 . 
CJ 36 HOH 3302 6302 6356 HOH HOH 0 . 
CJ 36 HOH 3303 6303 6358 HOH HOH 0 . 
CJ 36 HOH 3304 6304 6360 HOH HOH 0 . 
CJ 36 HOH 3305 6305 6361 HOH HOH 0 . 
CJ 36 HOH 3306 6306 6362 HOH HOH 0 . 
CJ 36 HOH 3307 6307 6363 HOH HOH 0 . 
CJ 36 HOH 3308 6308 6364 HOH HOH 0 . 
CJ 36 HOH 3309 6309 6365 HOH HOH 0 . 
CJ 36 HOH 3310 6310 6366 HOH HOH 0 . 
CJ 36 HOH 3311 6311 6367 HOH HOH 0 . 
CJ 36 HOH 3312 6312 6369 HOH HOH 0 . 
CJ 36 HOH 3313 6313 6370 HOH HOH 0 . 
CJ 36 HOH 3314 6314 6371 HOH HOH 0 . 
CJ 36 HOH 3315 6315 6375 HOH HOH 0 . 
CJ 36 HOH 3316 6316 6376 HOH HOH 0 . 
CJ 36 HOH 3317 6317 6377 HOH HOH 0 . 
CJ 36 HOH 3318 6318 6378 HOH HOH 0 . 
CJ 36 HOH 3319 6319 6379 HOH HOH 0 . 
CJ 36 HOH 3320 6320 6381 HOH HOH 0 . 
CJ 36 HOH 3321 6321 6382 HOH HOH 0 . 
CJ 36 HOH 3322 6322 6383 HOH HOH 0 . 
CJ 36 HOH 3323 6323 6385 HOH HOH 0 . 
CJ 36 HOH 3324 6324 6386 HOH HOH 0 . 
CJ 36 HOH 3325 6325 6387 HOH HOH 0 . 
CJ 36 HOH 3326 6326 6388 HOH HOH 0 . 
CJ 36 HOH 3327 6327 6389 HOH HOH 0 . 
CJ 36 HOH 3328 6328 6390 HOH HOH 0 . 
CJ 36 HOH 3329 6329 6393 HOH HOH 0 . 
CJ 36 HOH 3330 6330 6394 HOH HOH 0 . 
CJ 36 HOH 3331 6331 6395 HOH HOH 0 . 
CJ 36 HOH 3332 6332 6397 HOH HOH 0 . 
CJ 36 HOH 3333 6333 6398 HOH HOH 0 . 
CJ 36 HOH 3334 6334 6400 HOH HOH 0 . 
CJ 36 HOH 3335 6335 6401 HOH HOH 0 . 
CJ 36 HOH 3336 6336 6404 HOH HOH 0 . 
CJ 36 HOH 3337 6337 6405 HOH HOH 0 . 
CJ 36 HOH 3338 6338 6406 HOH HOH 0 . 
CJ 36 HOH 3339 6339 6407 HOH HOH 0 . 
CJ 36 HOH 3340 6340 6408 HOH HOH 0 . 
CJ 36 HOH 3341 6341 6409 HOH HOH 0 . 
CJ 36 HOH 3342 6342 6410 HOH HOH 0 . 
CJ 36 HOH 3343 6343 6411 HOH HOH 0 . 
CJ 36 HOH 3344 6344 6414 HOH HOH 0 . 
CJ 36 HOH 3345 6345 6415 HOH HOH 0 . 
CJ 36 HOH 3346 6346 6416 HOH HOH 0 . 
CJ 36 HOH 3347 6347 6417 HOH HOH 0 . 
CJ 36 HOH 3348 6348 6419 HOH HOH 0 . 
CJ 36 HOH 3349 6349 6420 HOH HOH 0 . 
CJ 36 HOH 3350 6350 6421 HOH HOH 0 . 
CJ 36 HOH 3351 6351 6422 HOH HOH 0 . 
CJ 36 HOH 3352 6352 6423 HOH HOH 0 . 
CJ 36 HOH 3353 6353 6424 HOH HOH 0 . 
CJ 36 HOH 3354 6354 6425 HOH HOH 0 . 
CJ 36 HOH 3355 6355 6426 HOH HOH 0 . 
CJ 36 HOH 3356 6356 6427 HOH HOH 0 . 
CJ 36 HOH 3357 6357 6428 HOH HOH 0 . 
CJ 36 HOH 3358 6358 6430 HOH HOH 0 . 
CJ 36 HOH 3359 6359 6431 HOH HOH 0 . 
CJ 36 HOH 3360 6360 6433 HOH HOH 0 . 
CJ 36 HOH 3361 6361 6434 HOH HOH 0 . 
CJ 36 HOH 3362 6362 6435 HOH HOH 0 . 
CJ 36 HOH 3363 6363 6436 HOH HOH 0 . 
CJ 36 HOH 3364 6364 6438 HOH HOH 0 . 
CJ 36 HOH 3365 6365 6441 HOH HOH 0 . 
CJ 36 HOH 3366 6366 6443 HOH HOH 0 . 
CJ 36 HOH 3367 6367 6444 HOH HOH 0 . 
CJ 36 HOH 3368 6368 6445 HOH HOH 0 . 
CJ 36 HOH 3369 6369 6446 HOH HOH 0 . 
CJ 36 HOH 3370 6370 6447 HOH HOH 0 . 
CJ 36 HOH 3371 6371 6449 HOH HOH 0 . 
CJ 36 HOH 3372 6372 6450 HOH HOH 0 . 
CJ 36 HOH 3373 6373 6451 HOH HOH 0 . 
CJ 36 HOH 3374 6374 6452 HOH HOH 0 . 
CJ 36 HOH 3375 6375 6453 HOH HOH 0 . 
CJ 36 HOH 3376 6376 6454 HOH HOH 0 . 
CJ 36 HOH 3377 6377 6455 HOH HOH 0 . 
CJ 36 HOH 3378 6378 6458 HOH HOH 0 . 
CJ 36 HOH 3379 6379 6460 HOH HOH 0 . 
CJ 36 HOH 3380 6380 6461 HOH HOH 0 . 
CJ 36 HOH 3381 6381 6462 HOH HOH 0 . 
CJ 36 HOH 3382 6382 6463 HOH HOH 0 . 
CJ 36 HOH 3383 6383 6465 HOH HOH 0 . 
CJ 36 HOH 3384 6384 6466 HOH HOH 0 . 
CJ 36 HOH 3385 6385 6467 HOH HOH 0 . 
CJ 36 HOH 3386 6386 6471 HOH HOH 0 . 
CJ 36 HOH 3387 6387 6472 HOH HOH 0 . 
CJ 36 HOH 3388 6388 6473 HOH HOH 0 . 
CJ 36 HOH 3389 6389 6475 HOH HOH 0 . 
CJ 36 HOH 3390 6390 6477 HOH HOH 0 . 
CJ 36 HOH 3391 6391 6480 HOH HOH 0 . 
CJ 36 HOH 3392 6392 6481 HOH HOH 0 . 
CJ 36 HOH 3393 6393 6483 HOH HOH 0 . 
CJ 36 HOH 3394 6394 6485 HOH HOH 0 . 
CJ 36 HOH 3395 6395 6487 HOH HOH 0 . 
CJ 36 HOH 3396 6396 6488 HOH HOH 0 . 
CJ 36 HOH 3397 6397 6489 HOH HOH 0 . 
CJ 36 HOH 3398 6398 6490 HOH HOH 0 . 
CJ 36 HOH 3399 6399 6491 HOH HOH 0 . 
CJ 36 HOH 3400 6400 6492 HOH HOH 0 . 
CJ 36 HOH 3401 6401 6494 HOH HOH 0 . 
CJ 36 HOH 3402 6402 6495 HOH HOH 0 . 
CJ 36 HOH 3403 6403 6496 HOH HOH 0 . 
CJ 36 HOH 3404 6404 6499 HOH HOH 0 . 
CJ 36 HOH 3405 6405 6500 HOH HOH 0 . 
CJ 36 HOH 3406 6406 6501 HOH HOH 0 . 
CJ 36 HOH 3407 6407 6503 HOH HOH 0 . 
CJ 36 HOH 3408 6408 6504 HOH HOH 0 . 
CJ 36 HOH 3409 6409 6505 HOH HOH 0 . 
CJ 36 HOH 3410 6410 6506 HOH HOH 0 . 
CJ 36 HOH 3411 6411 6508 HOH HOH 0 . 
CJ 36 HOH 3412 6412 6509 HOH HOH 0 . 
CJ 36 HOH 3413 6413 6510 HOH HOH 0 . 
CJ 36 HOH 3414 6414 6512 HOH HOH 0 . 
CJ 36 HOH 3415 6415 6515 HOH HOH 0 . 
CJ 36 HOH 3416 6416 6516 HOH HOH 0 . 
CJ 36 HOH 3417 6417 6517 HOH HOH 0 . 
CJ 36 HOH 3418 6418 6518 HOH HOH 0 . 
CJ 36 HOH 3419 6419 6520 HOH HOH 0 . 
CJ 36 HOH 3420 6420 6521 HOH HOH 0 . 
CJ 36 HOH 3421 6421 6522 HOH HOH 0 . 
CJ 36 HOH 3422 6422 6523 HOH HOH 0 . 
CJ 36 HOH 3423 6423 6524 HOH HOH 0 . 
CJ 36 HOH 3424 6424 6526 HOH HOH 0 . 
CJ 36 HOH 3425 6425 6527 HOH HOH 0 . 
CJ 36 HOH 3426 6426 6528 HOH HOH 0 . 
CJ 36 HOH 3427 6427 6529 HOH HOH 0 . 
CJ 36 HOH 3428 6428 6530 HOH HOH 0 . 
CJ 36 HOH 3429 6429 6531 HOH HOH 0 . 
CJ 36 HOH 3430 6430 6533 HOH HOH 0 . 
CJ 36 HOH 3431 6431 6534 HOH HOH 0 . 
CJ 36 HOH 3432 6432 6535 HOH HOH 0 . 
CJ 36 HOH 3433 6433 6537 HOH HOH 0 . 
CJ 36 HOH 3434 6434 6538 HOH HOH 0 . 
CJ 36 HOH 3435 6435 6539 HOH HOH 0 . 
CJ 36 HOH 3436 6436 6540 HOH HOH 0 . 
CJ 36 HOH 3437 6437 6541 HOH HOH 0 . 
CJ 36 HOH 3438 6438 6543 HOH HOH 0 . 
CJ 36 HOH 3439 6439 6544 HOH HOH 0 . 
CJ 36 HOH 3440 6440 6547 HOH HOH 0 . 
CJ 36 HOH 3441 6441 6548 HOH HOH 0 . 
CJ 36 HOH 3442 6442 6549 HOH HOH 0 . 
CJ 36 HOH 3443 6443 6550 HOH HOH 0 . 
CJ 36 HOH 3444 6444 6551 HOH HOH 0 . 
CJ 36 HOH 3445 6445 6552 HOH HOH 0 . 
CJ 36 HOH 3446 6446 6556 HOH HOH 0 . 
CJ 36 HOH 3447 6447 6557 HOH HOH 0 . 
CJ 36 HOH 3448 6448 6560 HOH HOH 0 . 
CJ 36 HOH 3449 6449 6561 HOH HOH 0 . 
CJ 36 HOH 3450 6450 6562 HOH HOH 0 . 
CJ 36 HOH 3451 6451 6563 HOH HOH 0 . 
CJ 36 HOH 3452 6452 6565 HOH HOH 0 . 
CJ 36 HOH 3453 6453 6566 HOH HOH 0 . 
CJ 36 HOH 3454 6454 6567 HOH HOH 0 . 
CJ 36 HOH 3455 6455 6568 HOH HOH 0 . 
CJ 36 HOH 3456 6456 6569 HOH HOH 0 . 
CJ 36 HOH 3457 6457 6570 HOH HOH 0 . 
CJ 36 HOH 3458 6458 6572 HOH HOH 0 . 
CJ 36 HOH 3459 6459 6573 HOH HOH 0 . 
CJ 36 HOH 3460 6460 6574 HOH HOH 0 . 
CJ 36 HOH 3461 6461 6575 HOH HOH 0 . 
CJ 36 HOH 3462 6462 6576 HOH HOH 0 . 
CJ 36 HOH 3463 6463 6577 HOH HOH 0 . 
CJ 36 HOH 3464 6464 6579 HOH HOH 0 . 
CJ 36 HOH 3465 6465 6580 HOH HOH 0 . 
CJ 36 HOH 3466 6466 6582 HOH HOH 0 . 
CJ 36 HOH 3467 6467 6583 HOH HOH 0 . 
CJ 36 HOH 3468 6468 6584 HOH HOH 0 . 
CJ 36 HOH 3469 6469 6586 HOH HOH 0 . 
CJ 36 HOH 3470 6470 6587 HOH HOH 0 . 
CJ 36 HOH 3471 6471 6591 HOH HOH 0 . 
CJ 36 HOH 3472 6472 6592 HOH HOH 0 . 
CJ 36 HOH 3473 6473 6595 HOH HOH 0 . 
CJ 36 HOH 3474 6474 6596 HOH HOH 0 . 
CJ 36 HOH 3475 6475 6598 HOH HOH 0 . 
CJ 36 HOH 3476 6476 6600 HOH HOH 0 . 
CJ 36 HOH 3477 6477 6601 HOH HOH 0 . 
CJ 36 HOH 3478 6478 6602 HOH HOH 0 . 
CJ 36 HOH 3479 6479 6604 HOH HOH 0 . 
CJ 36 HOH 3480 6480 6606 HOH HOH 0 . 
CJ 36 HOH 3481 6481 6607 HOH HOH 0 . 
CJ 36 HOH 3482 6482 6608 HOH HOH 0 . 
CJ 36 HOH 3483 6483 6609 HOH HOH 0 . 
CJ 36 HOH 3484 6484 6610 HOH HOH 0 . 
CJ 36 HOH 3485 6485 6611 HOH HOH 0 . 
CJ 36 HOH 3486 6486 6612 HOH HOH 0 . 
CJ 36 HOH 3487 6487 6614 HOH HOH 0 . 
CJ 36 HOH 3488 6488 6615 HOH HOH 0 . 
CJ 36 HOH 3489 6489 6619 HOH HOH 0 . 
CJ 36 HOH 3490 6490 6620 HOH HOH 0 . 
CJ 36 HOH 3491 6491 6624 HOH HOH 0 . 
CJ 36 HOH 3492 6492 6625 HOH HOH 0 . 
CJ 36 HOH 3493 6493 6626 HOH HOH 0 . 
CJ 36 HOH 3494 6494 6629 HOH HOH 0 . 
CJ 36 HOH 3495 6495 6632 HOH HOH 0 . 
CJ 36 HOH 3496 6496 6633 HOH HOH 0 . 
CJ 36 HOH 3497 6497 6634 HOH HOH 0 . 
CJ 36 HOH 3498 6498 6635 HOH HOH 0 . 
CJ 36 HOH 3499 6499 6636 HOH HOH 0 . 
CJ 36 HOH 3500 6500 6637 HOH HOH 0 . 
CJ 36 HOH 3501 6501 6639 HOH HOH 0 . 
CJ 36 HOH 3502 6502 6640 HOH HOH 0 . 
CJ 36 HOH 3503 6503 6641 HOH HOH 0 . 
CJ 36 HOH 3504 6504 6642 HOH HOH 0 . 
CJ 36 HOH 3505 6505 6643 HOH HOH 0 . 
CJ 36 HOH 3506 6506 6644 HOH HOH 0 . 
CJ 36 HOH 3507 6507 6645 HOH HOH 0 . 
CJ 36 HOH 3508 6508 6647 HOH HOH 0 . 
CJ 36 HOH 3509 6509 6648 HOH HOH 0 . 
CJ 36 HOH 3510 6510 6649 HOH HOH 0 . 
CJ 36 HOH 3511 6511 6650 HOH HOH 0 . 
CJ 36 HOH 3512 6512 6651 HOH HOH 0 . 
CJ 36 HOH 3513 6513 6652 HOH HOH 0 . 
CJ 36 HOH 3514 6514 6654 HOH HOH 0 . 
CJ 36 HOH 3515 6515 6655 HOH HOH 0 . 
CJ 36 HOH 3516 6516 6656 HOH HOH 0 . 
CJ 36 HOH 3517 6517 6657 HOH HOH 0 . 
CJ 36 HOH 3518 6518 6660 HOH HOH 0 . 
CJ 36 HOH 3519 6519 6662 HOH HOH 0 . 
CJ 36 HOH 3520 6520 6663 HOH HOH 0 . 
CJ 36 HOH 3521 6521 6664 HOH HOH 0 . 
CJ 36 HOH 3522 6522 6666 HOH HOH 0 . 
CJ 36 HOH 3523 6523 6667 HOH HOH 0 . 
CJ 36 HOH 3524 6524 6668 HOH HOH 0 . 
CJ 36 HOH 3525 6525 6672 HOH HOH 0 . 
CJ 36 HOH 3526 6526 6673 HOH HOH 0 . 
CJ 36 HOH 3527 6527 6674 HOH HOH 0 . 
CJ 36 HOH 3528 6528 6675 HOH HOH 0 . 
CJ 36 HOH 3529 6529 6676 HOH HOH 0 . 
CJ 36 HOH 3530 6530 6677 HOH HOH 0 . 
CJ 36 HOH 3531 6531 6678 HOH HOH 0 . 
CJ 36 HOH 3532 6532 6680 HOH HOH 0 . 
CJ 36 HOH 3533 6533 6681 HOH HOH 0 . 
CJ 36 HOH 3534 6534 6683 HOH HOH 0 . 
CJ 36 HOH 3535 6535 6684 HOH HOH 0 . 
CJ 36 HOH 3536 6536 6685 HOH HOH 0 . 
CJ 36 HOH 3537 6537 6686 HOH HOH 0 . 
CJ 36 HOH 3538 6538 6688 HOH HOH 0 . 
CJ 36 HOH 3539 6539 6689 HOH HOH 0 . 
CJ 36 HOH 3540 6540 6691 HOH HOH 0 . 
CJ 36 HOH 3541 6541 6692 HOH HOH 0 . 
CJ 36 HOH 3542 6542 6693 HOH HOH 0 . 
CJ 36 HOH 3543 6543 6695 HOH HOH 0 . 
CJ 36 HOH 3544 6544 6696 HOH HOH 0 . 
CJ 36 HOH 3545 6545 6698 HOH HOH 0 . 
CJ 36 HOH 3546 6546 6699 HOH HOH 0 . 
CJ 36 HOH 3547 6547 6701 HOH HOH 0 . 
CJ 36 HOH 3548 6548 6708 HOH HOH 0 . 
CJ 36 HOH 3549 6549 6709 HOH HOH 0 . 
CJ 36 HOH 3550 6550 6710 HOH HOH 0 . 
CJ 36 HOH 3551 6551 6712 HOH HOH 0 . 
CJ 36 HOH 3552 6552 6713 HOH HOH 0 . 
CJ 36 HOH 3553 6553 6714 HOH HOH 0 . 
CJ 36 HOH 3554 6554 6715 HOH HOH 0 . 
CJ 36 HOH 3555 6555 6717 HOH HOH 0 . 
CJ 36 HOH 3556 6556 6718 HOH HOH 0 . 
CJ 36 HOH 3557 6557 6720 HOH HOH 0 . 
CJ 36 HOH 3558 6558 6721 HOH HOH 0 . 
CJ 36 HOH 3559 6559 6722 HOH HOH 0 . 
CJ 36 HOH 3560 6560 6723 HOH HOH 0 . 
CJ 36 HOH 3561 6561 6724 HOH HOH 0 . 
CJ 36 HOH 3562 6562 6725 HOH HOH 0 . 
CJ 36 HOH 3563 6563 6726 HOH HOH 0 . 
CJ 36 HOH 3564 6564 6727 HOH HOH 0 . 
CJ 36 HOH 3565 6565 6728 HOH HOH 0 . 
CJ 36 HOH 3566 6566 6729 HOH HOH 0 . 
CJ 36 HOH 3567 6567 6730 HOH HOH 0 . 
CJ 36 HOH 3568 6568 6731 HOH HOH 0 . 
CJ 36 HOH 3569 6569 6732 HOH HOH 0 . 
CJ 36 HOH 3570 6570 6733 HOH HOH 0 . 
CJ 36 HOH 3571 6571 6734 HOH HOH 0 . 
CJ 36 HOH 3572 6572 6735 HOH HOH 0 . 
CJ 36 HOH 3573 6573 6736 HOH HOH 0 . 
CJ 36 HOH 3574 6574 6737 HOH HOH 0 . 
CJ 36 HOH 3575 6575 6738 HOH HOH 0 . 
CJ 36 HOH 3576 6576 6739 HOH HOH 0 . 
CJ 36 HOH 3577 6577 6740 HOH HOH 0 . 
CJ 36 HOH 3578 6578 6742 HOH HOH 0 . 
CJ 36 HOH 3579 6579 6743 HOH HOH 0 . 
CJ 36 HOH 3580 6580 6744 HOH HOH 0 . 
CJ 36 HOH 3581 6581 6745 HOH HOH 0 . 
CJ 36 HOH 3582 6582 6747 HOH HOH 0 . 
CJ 36 HOH 3583 6583 6748 HOH HOH 0 . 
CJ 36 HOH 3584 6584 6750 HOH HOH 0 . 
CJ 36 HOH 3585 6585 6751 HOH HOH 0 . 
CJ 36 HOH 3586 6586 6753 HOH HOH 0 . 
CJ 36 HOH 3587 6587 6755 HOH HOH 0 . 
CJ 36 HOH 3588 6588 6756 HOH HOH 0 . 
CJ 36 HOH 3589 6589 6757 HOH HOH 0 . 
CJ 36 HOH 3590 6590 6758 HOH HOH 0 . 
CJ 36 HOH 3591 6591 6759 HOH HOH 0 . 
CJ 36 HOH 3592 6592 6760 HOH HOH 0 . 
CJ 36 HOH 3593 6593 6761 HOH HOH 0 . 
CJ 36 HOH 3594 6594 6763 HOH HOH 0 . 
CJ 36 HOH 3595 6595 6764 HOH HOH 0 . 
CJ 36 HOH 3596 6596 6765 HOH HOH 0 . 
CJ 36 HOH 3597 6597 6766 HOH HOH 0 . 
CJ 36 HOH 3598 6598 6767 HOH HOH 0 . 
CJ 36 HOH 3599 6599 6768 HOH HOH 0 . 
CJ 36 HOH 3600 6600 6769 HOH HOH 0 . 
CJ 36 HOH 3601 6601 6770 HOH HOH 0 . 
CJ 36 HOH 3602 6602 6774 HOH HOH 0 . 
CJ 36 HOH 3603 6603 6775 HOH HOH 0 . 
CJ 36 HOH 3604 6604 6776 HOH HOH 0 . 
CJ 36 HOH 3605 6605 6777 HOH HOH 0 . 
CJ 36 HOH 3606 6606 6778 HOH HOH 0 . 
CJ 36 HOH 3607 6607 6781 HOH HOH 0 . 
CJ 36 HOH 3608 6608 6782 HOH HOH 0 . 
CJ 36 HOH 3609 6609 6785 HOH HOH 0 . 
CJ 36 HOH 3610 6610 6786 HOH HOH 0 . 
CJ 36 HOH 3611 6611 6787 HOH HOH 0 . 
CJ 36 HOH 3612 6612 6788 HOH HOH 0 . 
CJ 36 HOH 3613 6613 6789 HOH HOH 0 . 
CJ 36 HOH 3614 6614 6790 HOH HOH 0 . 
CJ 36 HOH 3615 6615 6791 HOH HOH 0 . 
CJ 36 HOH 3616 6616 6792 HOH HOH 0 . 
CJ 36 HOH 3617 6617 6793 HOH HOH 0 . 
CJ 36 HOH 3618 6618 6794 HOH HOH 0 . 
CJ 36 HOH 3619 6619 6797 HOH HOH 0 . 
CJ 36 HOH 3620 6620 6801 HOH HOH 0 . 
CJ 36 HOH 3621 6621 6802 HOH HOH 0 . 
CJ 36 HOH 3622 6622 6803 HOH HOH 0 . 
CJ 36 HOH 3623 6623 6805 HOH HOH 0 . 
CJ 36 HOH 3624 6624 6808 HOH HOH 0 . 
CJ 36 HOH 3625 6625 6809 HOH HOH 0 . 
CJ 36 HOH 3626 6626 6811 HOH HOH 0 . 
CJ 36 HOH 3627 6627 6812 HOH HOH 0 . 
CJ 36 HOH 3628 6628 6813 HOH HOH 0 . 
CJ 36 HOH 3629 6629 6814 HOH HOH 0 . 
CJ 36 HOH 3630 6630 6815 HOH HOH 0 . 
CJ 36 HOH 3631 6631 6816 HOH HOH 0 . 
CJ 36 HOH 3632 6632 6817 HOH HOH 0 . 
CJ 36 HOH 3633 6633 6818 HOH HOH 0 . 
CJ 36 HOH 3634 6634 6820 HOH HOH 0 . 
CJ 36 HOH 3635 6635 6821 HOH HOH 0 . 
CJ 36 HOH 3636 6636 6823 HOH HOH 0 . 
CJ 36 HOH 3637 6637 6824 HOH HOH 0 . 
CJ 36 HOH 3638 6638 6825 HOH HOH 0 . 
CJ 36 HOH 3639 6639 6826 HOH HOH 0 . 
CJ 36 HOH 3640 6640 6828 HOH HOH 0 . 
CJ 36 HOH 3641 6641 6829 HOH HOH 0 . 
CJ 36 HOH 3642 6642 6830 HOH HOH 0 . 
CJ 36 HOH 3643 6643 6831 HOH HOH 0 . 
CJ 36 HOH 3644 6644 6832 HOH HOH 0 . 
CJ 36 HOH 3645 6645 6834 HOH HOH 0 . 
CJ 36 HOH 3646 6646 6837 HOH HOH 0 . 
CJ 36 HOH 3647 6647 6838 HOH HOH 0 . 
CJ 36 HOH 3648 6648 6839 HOH HOH 0 . 
CJ 36 HOH 3649 6649 6840 HOH HOH 0 . 
CJ 36 HOH 3650 6650 6841 HOH HOH 0 . 
CJ 36 HOH 3651 6651 6842 HOH HOH 0 . 
CJ 36 HOH 3652 6652 6843 HOH HOH 0 . 
CJ 36 HOH 3653 6653 6844 HOH HOH 0 . 
CJ 36 HOH 3654 6654 6845 HOH HOH 0 . 
CJ 36 HOH 3655 6655 6846 HOH HOH 0 . 
CJ 36 HOH 3656 6656 6847 HOH HOH 0 . 
CJ 36 HOH 3657 6657 6850 HOH HOH 0 . 
CJ 36 HOH 3658 6658 6851 HOH HOH 0 . 
CJ 36 HOH 3659 6659 6852 HOH HOH 0 . 
CJ 36 HOH 3660 6660 6853 HOH HOH 0 . 
CJ 36 HOH 3661 6661 6854 HOH HOH 0 . 
CJ 36 HOH 3662 6662 6855 HOH HOH 0 . 
CJ 36 HOH 3663 6663 6856 HOH HOH 0 . 
CJ 36 HOH 3664 6664 6857 HOH HOH 0 . 
CJ 36 HOH 3665 6665 6859 HOH HOH 0 . 
CJ 36 HOH 3666 6666 6860 HOH HOH 0 . 
CJ 36 HOH 3667 6667 6861 HOH HOH 0 . 
CJ 36 HOH 3668 6668 6862 HOH HOH 0 . 
CJ 36 HOH 3669 6669 6864 HOH HOH 0 . 
CJ 36 HOH 3670 6670 6865 HOH HOH 0 . 
CJ 36 HOH 3671 6671 6868 HOH HOH 0 . 
CJ 36 HOH 3672 6672 6870 HOH HOH 0 . 
CJ 36 HOH 3673 6673 6872 HOH HOH 0 . 
CJ 36 HOH 3674 6674 6873 HOH HOH 0 . 
CJ 36 HOH 3675 6675 6874 HOH HOH 0 . 
CJ 36 HOH 3676 6676 6875 HOH HOH 0 . 
CJ 36 HOH 3677 6677 6876 HOH HOH 0 . 
CJ 36 HOH 3678 6678 6878 HOH HOH 0 . 
CJ 36 HOH 3679 6679 6880 HOH HOH 0 . 
CJ 36 HOH 3680 6680 6882 HOH HOH 0 . 
CJ 36 HOH 3681 6681 6883 HOH HOH 0 . 
CJ 36 HOH 3682 6682 6884 HOH HOH 0 . 
CJ 36 HOH 3683 6683 6885 HOH HOH 0 . 
CJ 36 HOH 3684 6684 6888 HOH HOH 0 . 
CJ 36 HOH 3685 6685 6890 HOH HOH 0 . 
CJ 36 HOH 3686 6686 6891 HOH HOH 0 . 
CJ 36 HOH 3687 6687 6892 HOH HOH 0 . 
CJ 36 HOH 3688 6688 6894 HOH HOH 0 . 
CJ 36 HOH 3689 6689 6895 HOH HOH 0 . 
CJ 36 HOH 3690 6690 6896 HOH HOH 0 . 
CJ 36 HOH 3691 6691 6897 HOH HOH 0 . 
CJ 36 HOH 3692 6692 6898 HOH HOH 0 . 
CJ 36 HOH 3693 6693 6900 HOH HOH 0 . 
CJ 36 HOH 3694 6694 6902 HOH HOH 0 . 
CJ 36 HOH 3695 6695 6903 HOH HOH 0 . 
CJ 36 HOH 3696 6696 6905 HOH HOH 0 . 
CJ 36 HOH 3697 6697 6907 HOH HOH 0 . 
CJ 36 HOH 3698 6698 6908 HOH HOH 0 . 
CJ 36 HOH 3699 6699 6910 HOH HOH 0 . 
CJ 36 HOH 3700 6700 6911 HOH HOH 0 . 
CJ 36 HOH 3701 6701 6912 HOH HOH 0 . 
CJ 36 HOH 3702 6702 6914 HOH HOH 0 . 
CJ 36 HOH 3703 6703 6915 HOH HOH 0 . 
CJ 36 HOH 3704 6704 6916 HOH HOH 0 . 
CJ 36 HOH 3705 6705 6917 HOH HOH 0 . 
CJ 36 HOH 3706 6706 6918 HOH HOH 0 . 
CJ 36 HOH 3707 6707 6919 HOH HOH 0 . 
CJ 36 HOH 3708 6708 6920 HOH HOH 0 . 
CJ 36 HOH 3709 6709 6921 HOH HOH 0 . 
CJ 36 HOH 3710 6710 6922 HOH HOH 0 . 
CJ 36 HOH 3711 6711 6923 HOH HOH 0 . 
CJ 36 HOH 3712 6712 6924 HOH HOH 0 . 
CJ 36 HOH 3713 6713 6925 HOH HOH 0 . 
CJ 36 HOH 3714 6714 6927 HOH HOH 0 . 
CJ 36 HOH 3715 6715 6928 HOH HOH 0 . 
CJ 36 HOH 3716 6716 6929 HOH HOH 0 . 
CJ 36 HOH 3717 6717 6930 HOH HOH 0 . 
CJ 36 HOH 3718 6718 6933 HOH HOH 0 . 
CJ 36 HOH 3719 6719 6934 HOH HOH 0 . 
CJ 36 HOH 3720 6720 6935 HOH HOH 0 . 
CJ 36 HOH 3721 6721 6938 HOH HOH 0 . 
CJ 36 HOH 3722 6722 6941 HOH HOH 0 . 
CJ 36 HOH 3723 6723 6942 HOH HOH 0 . 
CJ 36 HOH 3724 6724 6943 HOH HOH 0 . 
CJ 36 HOH 3725 6725 6944 HOH HOH 0 . 
CJ 36 HOH 3726 6726 6945 HOH HOH 0 . 
CJ 36 HOH 3727 6727 6947 HOH HOH 0 . 
CJ 36 HOH 3728 6728 6948 HOH HOH 0 . 
CJ 36 HOH 3729 6729 6949 HOH HOH 0 . 
CJ 36 HOH 3730 6730 6950 HOH HOH 0 . 
CJ 36 HOH 3731 6731 6951 HOH HOH 0 . 
CJ 36 HOH 3732 6732 6952 HOH HOH 0 . 
CJ 36 HOH 3733 6733 6953 HOH HOH 0 . 
CJ 36 HOH 3734 6734 6954 HOH HOH 0 . 
CJ 36 HOH 3735 6735 6955 HOH HOH 0 . 
CJ 36 HOH 3736 6736 6957 HOH HOH 0 . 
CJ 36 HOH 3737 6737 6959 HOH HOH 0 . 
CJ 36 HOH 3738 6738 6961 HOH HOH 0 . 
CJ 36 HOH 3739 6739 6962 HOH HOH 0 . 
CJ 36 HOH 3740 6740 6963 HOH HOH 0 . 
CJ 36 HOH 3741 6741 6964 HOH HOH 0 . 
CJ 36 HOH 3742 6742 6965 HOH HOH 0 . 
CJ 36 HOH 3743 6743 6966 HOH HOH 0 . 
CJ 36 HOH 3744 6744 6967 HOH HOH 0 . 
CJ 36 HOH 3745 6745 6968 HOH HOH 0 . 
CJ 36 HOH 3746 6746 6970 HOH HOH 0 . 
CJ 36 HOH 3747 6747 6971 HOH HOH 0 . 
CJ 36 HOH 3748 6748 6973 HOH HOH 0 . 
CJ 36 HOH 3749 6749 6974 HOH HOH 0 . 
CJ 36 HOH 3750 6750 6975 HOH HOH 0 . 
CJ 36 HOH 3751 6751 6976 HOH HOH 0 . 
CJ 36 HOH 3752 6752 6977 HOH HOH 0 . 
CJ 36 HOH 3753 6753 6978 HOH HOH 0 . 
CJ 36 HOH 3754 6754 6979 HOH HOH 0 . 
CJ 36 HOH 3755 6755 6980 HOH HOH 0 . 
CJ 36 HOH 3756 6756 6981 HOH HOH 0 . 
CJ 36 HOH 3757 6757 6983 HOH HOH 0 . 
CJ 36 HOH 3758 6758 6984 HOH HOH 0 . 
CJ 36 HOH 3759 6759 6985 HOH HOH 0 . 
CJ 36 HOH 3760 6760 6986 HOH HOH 0 . 
CJ 36 HOH 3761 6761 6987 HOH HOH 0 . 
CJ 36 HOH 3762 6762 6989 HOH HOH 0 . 
CJ 36 HOH 3763 6763 6990 HOH HOH 0 . 
CJ 36 HOH 3764 6764 6991 HOH HOH 0 . 
CJ 36 HOH 3765 6765 6992 HOH HOH 0 . 
CJ 36 HOH 3766 6766 6993 HOH HOH 0 . 
CJ 36 HOH 3767 6767 6995 HOH HOH 0 . 
CJ 36 HOH 3768 6768 6996 HOH HOH 0 . 
CJ 36 HOH 3769 6769 6997 HOH HOH 0 . 
CJ 36 HOH 3770 6770 6998 HOH HOH 0 . 
CJ 36 HOH 3771 6771 6999 HOH HOH 0 . 
CJ 36 HOH 3772 6772 7000 HOH HOH 0 . 
CJ 36 HOH 3773 6773 7001 HOH HOH 0 . 
CJ 36 HOH 3774 6774 7002 HOH HOH 0 . 
CJ 36 HOH 3775 6775 7005 HOH HOH 0 . 
CJ 36 HOH 3776 6776 7006 HOH HOH 0 . 
CJ 36 HOH 3777 6777 7007 HOH HOH 0 . 
CJ 36 HOH 3778 6778 7008 HOH HOH 0 . 
CJ 36 HOH 3779 6779 7009 HOH HOH 0 . 
CJ 36 HOH 3780 6780 7010 HOH HOH 0 . 
CJ 36 HOH 3781 6781 7012 HOH HOH 0 . 
CJ 36 HOH 3782 6782 7013 HOH HOH 0 . 
CJ 36 HOH 3783 6783 7014 HOH HOH 0 . 
CJ 36 HOH 3784 6784 7015 HOH HOH 0 . 
CJ 36 HOH 3785 6785 7017 HOH HOH 0 . 
CJ 36 HOH 3786 6786 7021 HOH HOH 0 . 
CJ 36 HOH 3787 6787 7022 HOH HOH 0 . 
CJ 36 HOH 3788 6788 7023 HOH HOH 0 . 
CJ 36 HOH 3789 6789 7024 HOH HOH 0 . 
CJ 36 HOH 3790 6790 7025 HOH HOH 0 . 
CJ 36 HOH 3791 6791 7026 HOH HOH 0 . 
CJ 36 HOH 3792 6792 7027 HOH HOH 0 . 
CJ 36 HOH 3793 6793 7028 HOH HOH 0 . 
CJ 36 HOH 3794 6794 7030 HOH HOH 0 . 
CJ 36 HOH 3795 6795 7032 HOH HOH 0 . 
CJ 36 HOH 3796 6796 7033 HOH HOH 0 . 
CJ 36 HOH 3797 6797 7034 HOH HOH 0 . 
CJ 36 HOH 3798 6798 7035 HOH HOH 0 . 
CJ 36 HOH 3799 6799 7036 HOH HOH 0 . 
CJ 36 HOH 3800 6800 7037 HOH HOH 0 . 
CJ 36 HOH 3801 6801 7038 HOH HOH 0 . 
CJ 36 HOH 3802 6802 7039 HOH HOH 0 . 
CJ 36 HOH 3803 6803 7040 HOH HOH 0 . 
CJ 36 HOH 3804 6804 7041 HOH HOH 0 . 
CJ 36 HOH 3805 6805 7043 HOH HOH 0 . 
CJ 36 HOH 3806 6806 7044 HOH HOH 0 . 
CJ 36 HOH 3807 6807 7045 HOH HOH 0 . 
CJ 36 HOH 3808 6808 7047 HOH HOH 0 . 
CJ 36 HOH 3809 6809 7048 HOH HOH 0 . 
CJ 36 HOH 3810 6810 7049 HOH HOH 0 . 
CJ 36 HOH 3811 6811 7050 HOH HOH 0 . 
CJ 36 HOH 3812 6812 7051 HOH HOH 0 . 
CJ 36 HOH 3813 6813 7052 HOH HOH 0 . 
CJ 36 HOH 3814 6814 7053 HOH HOH 0 . 
CJ 36 HOH 3815 6815 7054 HOH HOH 0 . 
CJ 36 HOH 3816 6816 7055 HOH HOH 0 . 
CJ 36 HOH 3817 6817 7056 HOH HOH 0 . 
CJ 36 HOH 3818 6818 7057 HOH HOH 0 . 
CJ 36 HOH 3819 6819 7059 HOH HOH 0 . 
CJ 36 HOH 3820 6820 7060 HOH HOH 0 . 
CJ 36 HOH 3821 6821 7062 HOH HOH 0 . 
CJ 36 HOH 3822 6822 7063 HOH HOH 0 . 
CJ 36 HOH 3823 6823 7065 HOH HOH 0 . 
CJ 36 HOH 3824 6824 7066 HOH HOH 0 . 
CJ 36 HOH 3825 6825 7067 HOH HOH 0 . 
CJ 36 HOH 3826 6826 7068 HOH HOH 0 . 
CJ 36 HOH 3827 6827 7069 HOH HOH 0 . 
CJ 36 HOH 3828 6828 7071 HOH HOH 0 . 
CJ 36 HOH 3829 6829 7072 HOH HOH 0 . 
CJ 36 HOH 3830 6830 7074 HOH HOH 0 . 
CJ 36 HOH 3831 6831 7076 HOH HOH 0 . 
CJ 36 HOH 3832 6832 7078 HOH HOH 0 . 
CJ 36 HOH 3833 6833 7079 HOH HOH 0 . 
CJ 36 HOH 3834 6834 7080 HOH HOH 0 . 
CJ 36 HOH 3835 6835 7081 HOH HOH 0 . 
CJ 36 HOH 3836 6836 7082 HOH HOH 0 . 
CJ 36 HOH 3837 6837 7085 HOH HOH 0 . 
CJ 36 HOH 3838 6838 7086 HOH HOH 0 . 
CJ 36 HOH 3839 6839 7087 HOH HOH 0 . 
CJ 36 HOH 3840 6840 7090 HOH HOH 0 . 
CJ 36 HOH 3841 6841 7091 HOH HOH 0 . 
CJ 36 HOH 3842 6842 7092 HOH HOH 0 . 
CJ 36 HOH 3843 6843 7094 HOH HOH 0 . 
CJ 36 HOH 3844 6844 7095 HOH HOH 0 . 
CJ 36 HOH 3845 6845 7096 HOH HOH 0 . 
CJ 36 HOH 3846 6846 7097 HOH HOH 0 . 
CJ 36 HOH 3847 6847 7098 HOH HOH 0 . 
CJ 36 HOH 3848 6848 7099 HOH HOH 0 . 
CJ 36 HOH 3849 6849 7100 HOH HOH 0 . 
CJ 36 HOH 3850 6850 7101 HOH HOH 0 . 
CJ 36 HOH 3851 6851 7102 HOH HOH 0 . 
CJ 36 HOH 3852 6852 7104 HOH HOH 0 . 
CJ 36 HOH 3853 6853 7105 HOH HOH 0 . 
CJ 36 HOH 3854 6854 7108 HOH HOH 0 . 
CJ 36 HOH 3855 6855 7109 HOH HOH 0 . 
CJ 36 HOH 3856 6856 7112 HOH HOH 0 . 
CJ 36 HOH 3857 6857 7113 HOH HOH 0 . 
CJ 36 HOH 3858 6858 7114 HOH HOH 0 . 
CJ 36 HOH 3859 6859 7116 HOH HOH 0 . 
CJ 36 HOH 3860 6860 7117 HOH HOH 0 . 
CJ 36 HOH 3861 6861 7118 HOH HOH 0 . 
CJ 36 HOH 3862 6862 7119 HOH HOH 0 . 
CJ 36 HOH 3863 6863 7120 HOH HOH 0 . 
CJ 36 HOH 3864 6864 7122 HOH HOH 0 . 
CJ 36 HOH 3865 6865 7124 HOH HOH 0 . 
CJ 36 HOH 3866 6866 7125 HOH HOH 0 . 
CJ 36 HOH 3867 6867 7126 HOH HOH 0 . 
CJ 36 HOH 3868 6868 7127 HOH HOH 0 . 
CJ 36 HOH 3869 6869 7128 HOH HOH 0 . 
CJ 36 HOH 3870 6870 7129 HOH HOH 0 . 
CJ 36 HOH 3871 6871 7130 HOH HOH 0 . 
CJ 36 HOH 3872 6872 7132 HOH HOH 0 . 
CJ 36 HOH 3873 6873 7133 HOH HOH 0 . 
CJ 36 HOH 3874 6874 7134 HOH HOH 0 . 
CJ 36 HOH 3875 6875 7135 HOH HOH 0 . 
CJ 36 HOH 3876 6876 7136 HOH HOH 0 . 
CJ 36 HOH 3877 6877 7137 HOH HOH 0 . 
CJ 36 HOH 3878 6878 7138 HOH HOH 0 . 
CJ 36 HOH 3879 6879 7140 HOH HOH 0 . 
CJ 36 HOH 3880 6880 7142 HOH HOH 0 . 
CJ 36 HOH 3881 6881 7144 HOH HOH 0 . 
CJ 36 HOH 3882 6882 7147 HOH HOH 0 . 
CJ 36 HOH 3883 6883 7150 HOH HOH 0 . 
CJ 36 HOH 3884 6884 7152 HOH HOH 0 . 
CJ 36 HOH 3885 6885 7153 HOH HOH 0 . 
CJ 36 HOH 3886 6886 7154 HOH HOH 0 . 
CJ 36 HOH 3887 6887 7155 HOH HOH 0 . 
CJ 36 HOH 3888 6888 7158 HOH HOH 0 . 
CJ 36 HOH 3889 6889 7159 HOH HOH 0 . 
CJ 36 HOH 3890 6890 7160 HOH HOH 0 . 
CJ 36 HOH 3891 6891 7162 HOH HOH 0 . 
CJ 36 HOH 3892 6892 7163 HOH HOH 0 . 
CJ 36 HOH 3893 6893 7165 HOH HOH 0 . 
CJ 36 HOH 3894 6894 7166 HOH HOH 0 . 
CJ 36 HOH 3895 6895 7168 HOH HOH 0 . 
CJ 36 HOH 3896 6896 7170 HOH HOH 0 . 
CJ 36 HOH 3897 6897 7171 HOH HOH 0 . 
CJ 36 HOH 3898 6898 7172 HOH HOH 0 . 
CJ 36 HOH 3899 6899 7173 HOH HOH 0 . 
CJ 36 HOH 3900 6900 7174 HOH HOH 0 . 
CJ 36 HOH 3901 6901 7175 HOH HOH 0 . 
CJ 36 HOH 3902 6902 7178 HOH HOH 0 . 
CJ 36 HOH 3903 6903 7179 HOH HOH 0 . 
CJ 36 HOH 3904 6904 7180 HOH HOH 0 . 
CJ 36 HOH 3905 6905 7182 HOH HOH 0 . 
CJ 36 HOH 3906 6906 7184 HOH HOH 0 . 
CJ 36 HOH 3907 6907 7185 HOH HOH 0 . 
CJ 36 HOH 3908 6908 7187 HOH HOH 0 . 
CJ 36 HOH 3909 6909 7188 HOH HOH 0 . 
CJ 36 HOH 3910 6910 7189 HOH HOH 0 . 
CJ 36 HOH 3911 6911 7190 HOH HOH 0 . 
CJ 36 HOH 3912 6912 7191 HOH HOH 0 . 
CJ 36 HOH 3913 6913 7193 HOH HOH 0 . 
CJ 36 HOH 3914 6914 7194 HOH HOH 0 . 
CJ 36 HOH 3915 6915 7196 HOH HOH 0 . 
CJ 36 HOH 3916 6916 7197 HOH HOH 0 . 
CJ 36 HOH 3917 6917 7198 HOH HOH 0 . 
CJ 36 HOH 3918 6918 7199 HOH HOH 0 . 
CJ 36 HOH 3919 6919 7200 HOH HOH 0 . 
CJ 36 HOH 3920 6920 7201 HOH HOH 0 . 
CJ 36 HOH 3921 6921 7202 HOH HOH 0 . 
CJ 36 HOH 3922 6922 7203 HOH HOH 0 . 
CJ 36 HOH 3923 6923 7204 HOH HOH 0 . 
CJ 36 HOH 3924 6924 7205 HOH HOH 0 . 
CJ 36 HOH 3925 6925 7206 HOH HOH 0 . 
CJ 36 HOH 3926 6926 7207 HOH HOH 0 . 
CJ 36 HOH 3927 6927 7209 HOH HOH 0 . 
CJ 36 HOH 3928 6928 7210 HOH HOH 0 . 
CJ 36 HOH 3929 6929 7211 HOH HOH 0 . 
CJ 36 HOH 3930 6930 7212 HOH HOH 0 . 
CJ 36 HOH 3931 6931 7214 HOH HOH 0 . 
CJ 36 HOH 3932 6932 7215 HOH HOH 0 . 
CJ 36 HOH 3933 6933 7216 HOH HOH 0 . 
CJ 36 HOH 3934 6934 7217 HOH HOH 0 . 
CJ 36 HOH 3935 6935 7219 HOH HOH 0 . 
CJ 36 HOH 3936 6936 7220 HOH HOH 0 . 
CJ 36 HOH 3937 6937 7221 HOH HOH 0 . 
CJ 36 HOH 3938 6938 7222 HOH HOH 0 . 
CJ 36 HOH 3939 6939 7224 HOH HOH 0 . 
CJ 36 HOH 3940 6940 7226 HOH HOH 0 . 
CJ 36 HOH 3941 6941 7227 HOH HOH 0 . 
CJ 36 HOH 3942 6942 7230 HOH HOH 0 . 
CJ 36 HOH 3943 6943 7231 HOH HOH 0 . 
CJ 36 HOH 3944 6944 7232 HOH HOH 0 . 
CJ 36 HOH 3945 6945 7233 HOH HOH 0 . 
CJ 36 HOH 3946 6946 7235 HOH HOH 0 . 
CJ 36 HOH 3947 6947 7237 HOH HOH 0 . 
CJ 36 HOH 3948 6948 7238 HOH HOH 0 . 
CJ 36 HOH 3949 6949 7241 HOH HOH 0 . 
CJ 36 HOH 3950 6950 7242 HOH HOH 0 . 
CJ 36 HOH 3951 6951 7243 HOH HOH 0 . 
CJ 36 HOH 3952 6952 7248 HOH HOH 0 . 
CJ 36 HOH 3953 6953 7250 HOH HOH 0 . 
CJ 36 HOH 3954 6954 7251 HOH HOH 0 . 
CJ 36 HOH 3955 6955 7252 HOH HOH 0 . 
CJ 36 HOH 3956 6956 7253 HOH HOH 0 . 
CJ 36 HOH 3957 6957 7254 HOH HOH 0 . 
CJ 36 HOH 3958 6958 7255 HOH HOH 0 . 
CJ 36 HOH 3959 6959 7256 HOH HOH 0 . 
CJ 36 HOH 3960 6960 7257 HOH HOH 0 . 
CJ 36 HOH 3961 6961 7258 HOH HOH 0 . 
CJ 36 HOH 3962 6962 7259 HOH HOH 0 . 
CJ 36 HOH 3963 6963 7260 HOH HOH 0 . 
CJ 36 HOH 3964 6964 7261 HOH HOH 0 . 
CJ 36 HOH 3965 6965 7262 HOH HOH 0 . 
CJ 36 HOH 3966 6966 7264 HOH HOH 0 . 
CJ 36 HOH 3967 6967 7265 HOH HOH 0 . 
CJ 36 HOH 3968 6968 7266 HOH HOH 0 . 
CJ 36 HOH 3969 6969 7269 HOH HOH 0 . 
CJ 36 HOH 3970 6970 7271 HOH HOH 0 . 
CJ 36 HOH 3971 6971 7272 HOH HOH 0 . 
CJ 36 HOH 3972 6972 7275 HOH HOH 0 . 
CJ 36 HOH 3973 6973 7276 HOH HOH 0 . 
CJ 36 HOH 3974 6974 7278 HOH HOH 0 . 
CJ 36 HOH 3975 6975 7280 HOH HOH 0 . 
CJ 36 HOH 3976 6976 7283 HOH HOH 0 . 
CJ 36 HOH 3977 6977 7284 HOH HOH 0 . 
CJ 36 HOH 3978 6978 7285 HOH HOH 0 . 
CJ 36 HOH 3979 6979 7286 HOH HOH 0 . 
CJ 36 HOH 3980 6980 7288 HOH HOH 0 . 
CJ 36 HOH 3981 6981 7290 HOH HOH 0 . 
CJ 36 HOH 3982 6982 7291 HOH HOH 0 . 
CJ 36 HOH 3983 6983 7293 HOH HOH 0 . 
CJ 36 HOH 3984 6984 7295 HOH HOH 0 . 
CJ 36 HOH 3985 6985 7296 HOH HOH 0 . 
CJ 36 HOH 3986 6986 7297 HOH HOH 0 . 
CJ 36 HOH 3987 6987 7298 HOH HOH 0 . 
CJ 36 HOH 3988 6988 7299 HOH HOH 0 . 
CJ 36 HOH 3989 6989 7300 HOH HOH 0 . 
CJ 36 HOH 3990 6990 7301 HOH HOH 0 . 
CJ 36 HOH 3991 6991 7302 HOH HOH 0 . 
CJ 36 HOH 3992 6992 7304 HOH HOH 0 . 
CJ 36 HOH 3993 6993 7305 HOH HOH 0 . 
CJ 36 HOH 3994 6994 7308 HOH HOH 0 . 
CJ 36 HOH 3995 6995 7309 HOH HOH 0 . 
CJ 36 HOH 3996 6996 7310 HOH HOH 0 . 
CJ 36 HOH 3997 6997 7311 HOH HOH 0 . 
CJ 36 HOH 3998 6998 7312 HOH HOH 0 . 
CJ 36 HOH 3999 6999 7313 HOH HOH 0 . 
CJ 36 HOH 4000 7000 7314 HOH HOH 0 . 
CJ 36 HOH 4001 7001 7316 HOH HOH 0 . 
CJ 36 HOH 4002 7002 7317 HOH HOH 0 . 
CJ 36 HOH 4003 7003 7318 HOH HOH 0 . 
CJ 36 HOH 4004 7004 7319 HOH HOH 0 . 
CJ 36 HOH 4005 7005 7320 HOH HOH 0 . 
CJ 36 HOH 4006 7006 7321 HOH HOH 0 . 
CJ 36 HOH 4007 7007 7323 HOH HOH 0 . 
CJ 36 HOH 4008 7008 7324 HOH HOH 0 . 
CJ 36 HOH 4009 7009 7326 HOH HOH 0 . 
CJ 36 HOH 4010 7010 7327 HOH HOH 0 . 
CJ 36 HOH 4011 7011 7329 HOH HOH 0 . 
CJ 36 HOH 4012 7012 7330 HOH HOH 0 . 
CJ 36 HOH 4013 7013 7331 HOH HOH 0 . 
CJ 36 HOH 4014 7014 7332 HOH HOH 0 . 
CJ 36 HOH 4015 7015 7333 HOH HOH 0 . 
CJ 36 HOH 4016 7016 7334 HOH HOH 0 . 
CJ 36 HOH 4017 7017 7335 HOH HOH 0 . 
CJ 36 HOH 4018 7018 7336 HOH HOH 0 . 
CJ 36 HOH 4019 7019 7337 HOH HOH 0 . 
CJ 36 HOH 4020 7020 7338 HOH HOH 0 . 
CJ 36 HOH 4021 7021 7339 HOH HOH 0 . 
CJ 36 HOH 4022 7022 7340 HOH HOH 0 . 
CJ 36 HOH 4023 7023 7341 HOH HOH 0 . 
CJ 36 HOH 4024 7024 7342 HOH HOH 0 . 
CJ 36 HOH 4025 7025 7343 HOH HOH 0 . 
CJ 36 HOH 4026 7026 7344 HOH HOH 0 . 
CJ 36 HOH 4027 7027 7346 HOH HOH 0 . 
CJ 36 HOH 4028 7028 7348 HOH HOH 0 . 
CJ 36 HOH 4029 7029 7350 HOH HOH 0 . 
CJ 36 HOH 4030 7030 7351 HOH HOH 0 . 
CJ 36 HOH 4031 7031 7352 HOH HOH 0 . 
CJ 36 HOH 4032 7032 7353 HOH HOH 0 . 
CJ 36 HOH 4033 7033 7355 HOH HOH 0 . 
CJ 36 HOH 4034 7034 7356 HOH HOH 0 . 
CJ 36 HOH 4035 7035 7357 HOH HOH 0 . 
CJ 36 HOH 4036 7036 7358 HOH HOH 0 . 
CJ 36 HOH 4037 7037 7359 HOH HOH 0 . 
CJ 36 HOH 4038 7038 7360 HOH HOH 0 . 
CJ 36 HOH 4039 7039 7362 HOH HOH 0 . 
CJ 36 HOH 4040 7040 7363 HOH HOH 0 . 
CJ 36 HOH 4041 7041 7364 HOH HOH 0 . 
CJ 36 HOH 4042 7042 7365 HOH HOH 0 . 
CJ 36 HOH 4043 7043 7366 HOH HOH 0 . 
CJ 36 HOH 4044 7044 7367 HOH HOH 0 . 
CJ 36 HOH 4045 7045 7368 HOH HOH 0 . 
CJ 36 HOH 4046 7046 7369 HOH HOH 0 . 
CJ 36 HOH 4047 7047 7371 HOH HOH 0 . 
CJ 36 HOH 4048 7048 7372 HOH HOH 0 . 
CJ 36 HOH 4049 7049 7373 HOH HOH 0 . 
CJ 36 HOH 4050 7050 7380 HOH HOH 0 . 
CJ 36 HOH 4051 7051 7382 HOH HOH 0 . 
CJ 36 HOH 4052 7052 7383 HOH HOH 0 . 
CJ 36 HOH 4053 7053 7385 HOH HOH 0 . 
CJ 36 HOH 4054 7054 7386 HOH HOH 0 . 
CJ 36 HOH 4055 7055 7388 HOH HOH 0 . 
CJ 36 HOH 4056 7056 7389 HOH HOH 0 . 
CJ 36 HOH 4057 7057 7391 HOH HOH 0 . 
CJ 36 HOH 4058 7058 7392 HOH HOH 0 . 
CJ 36 HOH 4059 7059 7393 HOH HOH 0 . 
CJ 36 HOH 4060 7060 7394 HOH HOH 0 . 
CJ 36 HOH 4061 7061 7395 HOH HOH 0 . 
CJ 36 HOH 4062 7062 7397 HOH HOH 0 . 
CJ 36 HOH 4063 7063 7398 HOH HOH 0 . 
CJ 36 HOH 4064 7064 7399 HOH HOH 0 . 
CJ 36 HOH 4065 7065 7401 HOH HOH 0 . 
CJ 36 HOH 4066 7066 7402 HOH HOH 0 . 
CJ 36 HOH 4067 7067 7403 HOH HOH 0 . 
CJ 36 HOH 4068 7068 7405 HOH HOH 0 . 
CJ 36 HOH 4069 7069 7406 HOH HOH 0 . 
CJ 36 HOH 4070 7070 7407 HOH HOH 0 . 
CJ 36 HOH 4071 7071 7408 HOH HOH 0 . 
CJ 36 HOH 4072 7072 7409 HOH HOH 0 . 
CJ 36 HOH 4073 7073 7410 HOH HOH 0 . 
CJ 36 HOH 4074 7074 7412 HOH HOH 0 . 
CJ 36 HOH 4075 7075 7414 HOH HOH 0 . 
CJ 36 HOH 4076 7076 7415 HOH HOH 0 . 
CJ 36 HOH 4077 7077 7416 HOH HOH 0 . 
CJ 36 HOH 4078 7078 7417 HOH HOH 0 . 
CJ 36 HOH 4079 7079 7418 HOH HOH 0 . 
CJ 36 HOH 4080 7080 7420 HOH HOH 0 . 
CJ 36 HOH 4081 7081 7421 HOH HOH 0 . 
CJ 36 HOH 4082 7082 7422 HOH HOH 0 . 
CJ 36 HOH 4083 7083 7423 HOH HOH 0 . 
CJ 36 HOH 4084 7084 7424 HOH HOH 0 . 
CJ 36 HOH 4085 7085 7429 HOH HOH 0 . 
CJ 36 HOH 4086 7086 7430 HOH HOH 0 . 
CJ 36 HOH 4087 7087 7431 HOH HOH 0 . 
CJ 36 HOH 4088 7088 7432 HOH HOH 0 . 
CJ 36 HOH 4089 7089 7433 HOH HOH 0 . 
CJ 36 HOH 4090 7090 7434 HOH HOH 0 . 
CJ 36 HOH 4091 7091 7435 HOH HOH 0 . 
CJ 36 HOH 4092 7092 7437 HOH HOH 0 . 
CJ 36 HOH 4093 7093 7439 HOH HOH 0 . 
CJ 36 HOH 4094 7094 7440 HOH HOH 0 . 
CJ 36 HOH 4095 7095 7441 HOH HOH 0 . 
CJ 36 HOH 4096 7096 7442 HOH HOH 0 . 
CJ 36 HOH 4097 7097 7443 HOH HOH 0 . 
CJ 36 HOH 4098 7098 7444 HOH HOH 0 . 
CJ 36 HOH 4099 7099 7445 HOH HOH 0 . 
CJ 36 HOH 4100 7100 7446 HOH HOH 0 . 
CJ 36 HOH 4101 7101 7447 HOH HOH 0 . 
CJ 36 HOH 4102 7102 7448 HOH HOH 0 . 
CJ 36 HOH 4103 7103 7449 HOH HOH 0 . 
CJ 36 HOH 4104 7104 7450 HOH HOH 0 . 
CJ 36 HOH 4105 7105 7451 HOH HOH 0 . 
CJ 36 HOH 4106 7106 7452 HOH HOH 0 . 
CJ 36 HOH 4107 7107 7453 HOH HOH 0 . 
CJ 36 HOH 4108 7108 7454 HOH HOH 0 . 
CJ 36 HOH 4109 7109 7455 HOH HOH 0 . 
CJ 36 HOH 4110 7110 7456 HOH HOH 0 . 
CJ 36 HOH 4111 7111 7457 HOH HOH 0 . 
CJ 36 HOH 4112 7112 7458 HOH HOH 0 . 
CJ 36 HOH 4113 7113 7459 HOH HOH 0 . 
CJ 36 HOH 4114 7114 7460 HOH HOH 0 . 
CJ 36 HOH 4115 7115 7461 HOH HOH 0 . 
CJ 36 HOH 4116 7116 7463 HOH HOH 0 . 
CJ 36 HOH 4117 7117 7464 HOH HOH 0 . 
CJ 36 HOH 4118 7118 7466 HOH HOH 0 . 
CJ 36 HOH 4119 7119 7467 HOH HOH 0 . 
CJ 36 HOH 4120 7120 7468 HOH HOH 0 . 
CJ 36 HOH 4121 7121 7469 HOH HOH 0 . 
CJ 36 HOH 4122 7122 7472 HOH HOH 0 . 
CJ 36 HOH 4123 7123 7473 HOH HOH 0 . 
CJ 36 HOH 4124 7124 7476 HOH HOH 0 . 
CJ 36 HOH 4125 7125 7478 HOH HOH 0 . 
CJ 36 HOH 4126 7126 7479 HOH HOH 0 . 
CJ 36 HOH 4127 7127 7480 HOH HOH 0 . 
CJ 36 HOH 4128 7128 7482 HOH HOH 0 . 
CJ 36 HOH 4129 7129 7483 HOH HOH 0 . 
CJ 36 HOH 4130 7130 7484 HOH HOH 0 . 
CJ 36 HOH 4131 7131 7485 HOH HOH 0 . 
CJ 36 HOH 4132 7132 7486 HOH HOH 0 . 
CJ 36 HOH 4133 7133 7487 HOH HOH 0 . 
CJ 36 HOH 4134 7134 7489 HOH HOH 0 . 
CJ 36 HOH 4135 7135 7490 HOH HOH 0 . 
CJ 36 HOH 4136 7136 7491 HOH HOH 0 . 
CJ 36 HOH 4137 7137 7493 HOH HOH 0 . 
CJ 36 HOH 4138 7138 7495 HOH HOH 0 . 
CJ 36 HOH 4139 7139 7496 HOH HOH 0 . 
CJ 36 HOH 4140 7140 7497 HOH HOH 0 . 
CJ 36 HOH 4141 7141 7498 HOH HOH 0 . 
CJ 36 HOH 4142 7142 7499 HOH HOH 0 . 
CJ 36 HOH 4143 7143 7504 HOH HOH 0 . 
CJ 36 HOH 4144 7144 7506 HOH HOH 0 . 
CJ 36 HOH 4145 7145 7507 HOH HOH 0 . 
CJ 36 HOH 4146 7146 7508 HOH HOH 0 . 
CJ 36 HOH 4147 7147 7509 HOH HOH 0 . 
CJ 36 HOH 4148 7148 7510 HOH HOH 0 . 
CJ 36 HOH 4149 7149 7511 HOH HOH 0 . 
CJ 36 HOH 4150 7150 7512 HOH HOH 0 . 
CJ 36 HOH 4151 7151 7513 HOH HOH 0 . 
CJ 36 HOH 4152 7152 7514 HOH HOH 0 . 
CJ 36 HOH 4153 7153 7515 HOH HOH 0 . 
CJ 36 HOH 4154 7154 7516 HOH HOH 0 . 
CJ 36 HOH 4155 7155 7517 HOH HOH 0 . 
CJ 36 HOH 4156 7156 7518 HOH HOH 0 . 
CJ 36 HOH 4157 7157 7520 HOH HOH 0 . 
CJ 36 HOH 4158 7158 7522 HOH HOH 0 . 
CJ 36 HOH 4159 7159 7523 HOH HOH 0 . 
CJ 36 HOH 4160 7160 7524 HOH HOH 0 . 
CJ 36 HOH 4161 7161 7525 HOH HOH 0 . 
CJ 36 HOH 4162 7162 7526 HOH HOH 0 . 
CJ 36 HOH 4163 7163 7528 HOH HOH 0 . 
CJ 36 HOH 4164 7164 7529 HOH HOH 0 . 
CJ 36 HOH 4165 7165 7530 HOH HOH 0 . 
CJ 36 HOH 4166 7166 7532 HOH HOH 0 . 
CJ 36 HOH 4167 7167 7533 HOH HOH 0 . 
CJ 36 HOH 4168 7168 7534 HOH HOH 0 . 
CJ 36 HOH 4169 7169 7536 HOH HOH 0 . 
CJ 36 HOH 4170 7170 7537 HOH HOH 0 . 
CJ 36 HOH 4171 7171 7538 HOH HOH 0 . 
CJ 36 HOH 4172 7172 7540 HOH HOH 0 . 
CJ 36 HOH 4173 7173 7541 HOH HOH 0 . 
CJ 36 HOH 4174 7174 7547 HOH HOH 0 . 
CJ 36 HOH 4175 7175 7548 HOH HOH 0 . 
CJ 36 HOH 4176 7176 7550 HOH HOH 0 . 
CJ 36 HOH 4177 7177 7553 HOH HOH 0 . 
CJ 36 HOH 4178 7178 7554 HOH HOH 0 . 
CJ 36 HOH 4179 7179 7557 HOH HOH 0 . 
CJ 36 HOH 4180 7180 7558 HOH HOH 0 . 
CJ 36 HOH 4181 7181 7559 HOH HOH 0 . 
CJ 36 HOH 4182 7182 7560 HOH HOH 0 . 
CJ 36 HOH 4183 7183 7562 HOH HOH 0 . 
CJ 36 HOH 4184 7184 7563 HOH HOH 0 . 
CJ 36 HOH 4185 7185 7564 HOH HOH 0 . 
CJ 36 HOH 4186 7186 7566 HOH HOH 0 . 
CJ 36 HOH 4187 7187 7567 HOH HOH 0 . 
CJ 36 HOH 4188 7188 7570 HOH HOH 0 . 
CJ 36 HOH 4189 7189 7571 HOH HOH 0 . 
CJ 36 HOH 4190 7190 7573 HOH HOH 0 . 
CJ 36 HOH 4191 7191 7574 HOH HOH 0 . 
CJ 36 HOH 4192 7192 7578 HOH HOH 0 . 
CJ 36 HOH 4193 7193 7579 HOH HOH 0 . 
CJ 36 HOH 4194 7194 7581 HOH HOH 0 . 
CJ 36 HOH 4195 7195 7582 HOH HOH 0 . 
CJ 36 HOH 4196 7196 7583 HOH HOH 0 . 
CJ 36 HOH 4197 7197 7584 HOH HOH 0 . 
CJ 36 HOH 4198 7198 7585 HOH HOH 0 . 
CJ 36 HOH 4199 7199 7586 HOH HOH 0 . 
CJ 36 HOH 4200 7200 7587 HOH HOH 0 . 
CJ 36 HOH 4201 7201 7588 HOH HOH 0 . 
CJ 36 HOH 4202 7202 7589 HOH HOH 0 . 
CJ 36 HOH 4203 7203 7591 HOH HOH 0 . 
CJ 36 HOH 4204 7204 7592 HOH HOH 0 . 
CJ 36 HOH 4205 7205 7593 HOH HOH 0 . 
CJ 36 HOH 4206 7206 7594 HOH HOH 0 . 
CJ 36 HOH 4207 7207 7595 HOH HOH 0 . 
CJ 36 HOH 4208 7208 7596 HOH HOH 0 . 
CJ 36 HOH 4209 7209 7598 HOH HOH 0 . 
CJ 36 HOH 4210 7210 7599 HOH HOH 0 . 
CJ 36 HOH 4211 7211 7600 HOH HOH 0 . 
CJ 36 HOH 4212 7212 7601 HOH HOH 0 . 
CJ 36 HOH 4213 7213 7602 HOH HOH 0 . 
CJ 36 HOH 4214 7214 7604 HOH HOH 0 . 
CJ 36 HOH 4215 7215 7605 HOH HOH 0 . 
CJ 36 HOH 4216 7216 7608 HOH HOH 0 . 
CJ 36 HOH 4217 7217 7609 HOH HOH 0 . 
CJ 36 HOH 4218 7218 7610 HOH HOH 0 . 
CJ 36 HOH 4219 7219 7612 HOH HOH 0 . 
CJ 36 HOH 4220 7220 7614 HOH HOH 0 . 
CJ 36 HOH 4221 7221 7615 HOH HOH 0 . 
CJ 36 HOH 4222 7222 7616 HOH HOH 0 . 
CJ 36 HOH 4223 7223 7618 HOH HOH 0 . 
CJ 36 HOH 4224 7224 7619 HOH HOH 0 . 
CJ 36 HOH 4225 7225 7620 HOH HOH 0 . 
CJ 36 HOH 4226 7226 7621 HOH HOH 0 . 
CJ 36 HOH 4227 7227 7622 HOH HOH 0 . 
CJ 36 HOH 4228 7228 7623 HOH HOH 0 . 
CJ 36 HOH 4229 7229 7624 HOH HOH 0 . 
CJ 36 HOH 4230 7230 7626 HOH HOH 0 . 
CJ 36 HOH 4231 7231 7627 HOH HOH 0 . 
CJ 36 HOH 4232 7232 7628 HOH HOH 0 . 
CJ 36 HOH 4233 7233 7629 HOH HOH 0 . 
CJ 36 HOH 4234 7234 7630 HOH HOH 0 . 
CJ 36 HOH 4235 7235 7632 HOH HOH 0 . 
CJ 36 HOH 4236 7236 7633 HOH HOH 0 . 
CJ 36 HOH 4237 7237 7634 HOH HOH 0 . 
CJ 36 HOH 4238 7238 7635 HOH HOH 0 . 
CJ 36 HOH 4239 7239 7638 HOH HOH 0 . 
CJ 36 HOH 4240 7240 7639 HOH HOH 0 . 
CJ 36 HOH 4241 7241 7640 HOH HOH 0 . 
CJ 36 HOH 4242 7242 7642 HOH HOH 0 . 
CJ 36 HOH 4243 7243 7643 HOH HOH 0 . 
CJ 36 HOH 4244 7244 7644 HOH HOH 0 . 
CJ 36 HOH 4245 7245 7645 HOH HOH 0 . 
CJ 36 HOH 4246 7246 7646 HOH HOH 0 . 
CJ 36 HOH 4247 7247 7647 HOH HOH 0 . 
CJ 36 HOH 4248 7248 7648 HOH HOH 0 . 
CJ 36 HOH 4249 7249 7649 HOH HOH 0 . 
CJ 36 HOH 4250 7250 7651 HOH HOH 0 . 
CJ 36 HOH 4251 7251 7652 HOH HOH 0 . 
CJ 36 HOH 4252 7252 7654 HOH HOH 0 . 
CJ 36 HOH 4253 7253 7655 HOH HOH 0 . 
CJ 36 HOH 4254 7254 7656 HOH HOH 0 . 
CJ 36 HOH 4255 7255 7657 HOH HOH 0 . 
CJ 36 HOH 4256 7256 7659 HOH HOH 0 . 
CJ 36 HOH 4257 7257 7660 HOH HOH 0 . 
CJ 36 HOH 4258 7258 7661 HOH HOH 0 . 
CJ 36 HOH 4259 7259 7662 HOH HOH 0 . 
CJ 36 HOH 4260 7260 7663 HOH HOH 0 . 
CJ 36 HOH 4261 7261 7664 HOH HOH 0 . 
CJ 36 HOH 4262 7262 7665 HOH HOH 0 . 
CJ 36 HOH 4263 7263 7666 HOH HOH 0 . 
CJ 36 HOH 4264 7264 7667 HOH HOH 0 . 
CJ 36 HOH 4265 7265 7668 HOH HOH 0 . 
CJ 36 HOH 4266 7266 7669 HOH HOH 0 . 
CJ 36 HOH 4267 7267 7671 HOH HOH 0 . 
CJ 36 HOH 4268 7268 7672 HOH HOH 0 . 
CJ 36 HOH 4269 7269 7675 HOH HOH 0 . 
CJ 36 HOH 4270 7270 7676 HOH HOH 0 . 
CJ 36 HOH 4271 7271 7677 HOH HOH 0 . 
CJ 36 HOH 4272 7272 7679 HOH HOH 0 . 
CJ 36 HOH 4273 7273 7680 HOH HOH 0 . 
CJ 36 HOH 4274 7274 7683 HOH HOH 0 . 
CJ 36 HOH 4275 7275 7686 HOH HOH 0 . 
CJ 36 HOH 4276 7276 7687 HOH HOH 0 . 
CJ 36 HOH 4277 7277 7688 HOH HOH 0 . 
CJ 36 HOH 4278 7278 7689 HOH HOH 0 . 
CJ 36 HOH 4279 7279 7690 HOH HOH 0 . 
CJ 36 HOH 4280 7280 7691 HOH HOH 0 . 
CJ 36 HOH 4281 7281 7692 HOH HOH 0 . 
CJ 36 HOH 4282 7282 7693 HOH HOH 0 . 
CJ 36 HOH 4283 7283 7694 HOH HOH 0 . 
CJ 36 HOH 4284 7284 7695 HOH HOH 0 . 
CJ 36 HOH 4285 7285 7696 HOH HOH 0 . 
CJ 36 HOH 4286 7286 7698 HOH HOH 0 . 
CJ 36 HOH 4287 7287 7700 HOH HOH 0 . 
CJ 36 HOH 4288 7288 7701 HOH HOH 0 . 
CJ 36 HOH 4289 7289 7702 HOH HOH 0 . 
CJ 36 HOH 4290 7290 7703 HOH HOH 0 . 
CJ 36 HOH 4291 7291 7704 HOH HOH 0 . 
CJ 36 HOH 4292 7292 7705 HOH HOH 0 . 
CJ 36 HOH 4293 7293 7706 HOH HOH 0 . 
CJ 36 HOH 4294 7294 7707 HOH HOH 0 . 
CJ 36 HOH 4295 7295 7708 HOH HOH 0 . 
CJ 36 HOH 4296 7296 7709 HOH HOH 0 . 
CJ 36 HOH 4297 7297 7710 HOH HOH 0 . 
CJ 36 HOH 4298 7298 7711 HOH HOH 0 . 
CJ 36 HOH 4299 7299 7712 HOH HOH 0 . 
CJ 36 HOH 4300 7300 7715 HOH HOH 0 . 
CJ 36 HOH 4301 7301 7717 HOH HOH 0 . 
CJ 36 HOH 4302 7302 7718 HOH HOH 0 . 
CJ 36 HOH 4303 7303 7719 HOH HOH 0 . 
CJ 36 HOH 4304 7304 7720 HOH HOH 0 . 
CJ 36 HOH 4305 7305 7721 HOH HOH 0 . 
CJ 36 HOH 4306 7306 7722 HOH HOH 0 . 
CJ 36 HOH 4307 7307 7723 HOH HOH 0 . 
CJ 36 HOH 4308 7308 7724 HOH HOH 0 . 
CJ 36 HOH 4309 7309 7725 HOH HOH 0 . 
CJ 36 HOH 4310 7310 7726 HOH HOH 0 . 
CJ 36 HOH 4311 7311 7727 HOH HOH 0 . 
CJ 36 HOH 4312 7312 7728 HOH HOH 0 . 
CJ 36 HOH 4313 7313 7729 HOH HOH 0 . 
CJ 36 HOH 4314 7314 7730 HOH HOH 0 . 
CJ 36 HOH 4315 7315 7731 HOH HOH 0 . 
CJ 36 HOH 4316 7316 7732 HOH HOH 0 . 
CJ 36 HOH 4317 7317 7733 HOH HOH 0 . 
CJ 36 HOH 4318 7318 7734 HOH HOH 0 . 
CJ 36 HOH 4319 7319 7735 HOH HOH 0 . 
CJ 36 HOH 4320 7320 7736 HOH HOH 0 . 
CJ 36 HOH 4321 7321 7737 HOH HOH 0 . 
CJ 36 HOH 4322 7322 7738 HOH HOH 0 . 
CJ 36 HOH 4323 7323 7739 HOH HOH 0 . 
CJ 36 HOH 4324 7324 7740 HOH HOH 0 . 
CJ 36 HOH 4325 7325 7741 HOH HOH 0 . 
CJ 36 HOH 4326 7326 7742 HOH HOH 0 . 
CJ 36 HOH 4327 7327 7743 HOH HOH 0 . 
CJ 36 HOH 4328 7328 7744 HOH HOH 0 . 
CJ 36 HOH 4329 7329 7745 HOH HOH 0 . 
CJ 36 HOH 4330 7330 7746 HOH HOH 0 . 
CJ 36 HOH 4331 7331 7747 HOH HOH 0 . 
CJ 36 HOH 4332 7332 7748 HOH HOH 0 . 
CJ 36 HOH 4333 7333 7749 HOH HOH 0 . 
CJ 36 HOH 4334 7334 7750 HOH HOH 0 . 
CJ 36 HOH 4335 7335 7751 HOH HOH 0 . 
CJ 36 HOH 4336 7336 7753 HOH HOH 0 . 
CJ 36 HOH 4337 7337 7754 HOH HOH 0 . 
CJ 36 HOH 4338 7338 7755 HOH HOH 0 . 
CJ 36 HOH 4339 7339 7756 HOH HOH 0 . 
CJ 36 HOH 4340 7340 7757 HOH HOH 0 . 
CJ 36 HOH 4341 7341 7758 HOH HOH 0 . 
CJ 36 HOH 4342 7342 7759 HOH HOH 0 . 
CJ 36 HOH 4343 7343 7760 HOH HOH 0 . 
CJ 36 HOH 4344 7344 7761 HOH HOH 0 . 
CJ 36 HOH 4345 7345 7762 HOH HOH 0 . 
CJ 36 HOH 4346 7346 7763 HOH HOH 0 . 
CJ 36 HOH 4347 7347 7765 HOH HOH 0 . 
CJ 36 HOH 4348 7348 7766 HOH HOH 0 . 
CJ 36 HOH 4349 7349 7767 HOH HOH 0 . 
CJ 36 HOH 4350 7350 7768 HOH HOH 0 . 
CJ 36 HOH 4351 7351 7769 HOH HOH 0 . 
CJ 36 HOH 4352 7352 7770 HOH HOH 0 . 
CJ 36 HOH 4353 7353 7771 HOH HOH 0 . 
CJ 36 HOH 4354 7354 7772 HOH HOH 0 . 
CJ 36 HOH 4355 7355 7774 HOH HOH 0 . 
CJ 36 HOH 4356 7356 7775 HOH HOH 0 . 
CJ 36 HOH 4357 7357 7776 HOH HOH 0 . 
CJ 36 HOH 4358 7358 7777 HOH HOH 0 . 
CJ 36 HOH 4359 7359 7778 HOH HOH 0 . 
CJ 36 HOH 4360 7360 7779 HOH HOH 0 . 
CJ 36 HOH 4361 7361 7780 HOH HOH 0 . 
CJ 36 HOH 4362 7362 7781 HOH HOH 0 . 
CJ 36 HOH 4363 7363 7782 HOH HOH 0 . 
CJ 36 HOH 4364 7364 7783 HOH HOH 0 . 
CJ 36 HOH 4365 7365 7784 HOH HOH 0 . 
CJ 36 HOH 4366 7366 7786 HOH HOH 0 . 
CJ 36 HOH 4367 7367 7787 HOH HOH 0 . 
CJ 36 HOH 4368 7368 7788 HOH HOH 0 . 
CJ 36 HOH 4369 7369 7789 HOH HOH 0 . 
CJ 36 HOH 4370 7370 7790 HOH HOH 0 . 
CJ 36 HOH 4371 7371 7793 HOH HOH 0 . 
CJ 36 HOH 4372 7372 7794 HOH HOH 0 . 
CJ 36 HOH 4373 7373 7795 HOH HOH 0 . 
CJ 36 HOH 4374 7374 7796 HOH HOH 0 . 
CJ 36 HOH 4375 7375 7797 HOH HOH 0 . 
CJ 36 HOH 4376 7376 7798 HOH HOH 0 . 
CJ 36 HOH 4377 7377 7799 HOH HOH 0 . 
CJ 36 HOH 4378 7378 7800 HOH HOH 0 . 
CJ 36 HOH 4379 7379 7801 HOH HOH 0 . 
CJ 36 HOH 4380 7380 7802 HOH HOH 0 . 
CJ 36 HOH 4381 7381 7803 HOH HOH 0 . 
CJ 36 HOH 4382 7382 7804 HOH HOH 0 . 
CJ 36 HOH 4383 7383 7805 HOH HOH 0 . 
CJ 36 HOH 4384 7384 7806 HOH HOH 0 . 
CJ 36 HOH 4385 7385 7807 HOH HOH 0 . 
CJ 36 HOH 4386 7386 7808 HOH HOH 0 . 
CJ 36 HOH 4387 7387 7809 HOH HOH 0 . 
CJ 36 HOH 4388 7388 7811 HOH HOH 0 . 
CJ 36 HOH 4389 7389 7812 HOH HOH 0 . 
CJ 36 HOH 4390 7390 7813 HOH HOH 0 . 
CJ 36 HOH 4391 7391 7814 HOH HOH 0 . 
CJ 36 HOH 4392 7392 7815 HOH HOH 0 . 
CJ 36 HOH 4393 7393 7816 HOH HOH 0 . 
CJ 36 HOH 4394 7394 7817 HOH HOH 0 . 
CJ 36 HOH 4395 7395 7818 HOH HOH 0 . 
CJ 36 HOH 4396 7396 7819 HOH HOH 0 . 
CJ 36 HOH 4397 7397 7820 HOH HOH 0 . 
CJ 36 HOH 4398 7398 7821 HOH HOH 0 . 
CJ 36 HOH 4399 7399 7822 HOH HOH 0 . 
CJ 36 HOH 4400 7400 7823 HOH HOH 0 . 
CJ 36 HOH 4401 7401 7824 HOH HOH 0 . 
CJ 36 HOH 4402 7402 7825 HOH HOH 0 . 
CJ 36 HOH 4403 7403 7826 HOH HOH 0 . 
CJ 36 HOH 4404 7404 7827 HOH HOH 0 . 
CJ 36 HOH 4405 7405 7828 HOH HOH 0 . 
CJ 36 HOH 4406 7406 7829 HOH HOH 0 . 
CJ 36 HOH 4407 7407 7830 HOH HOH 0 . 
CJ 36 HOH 4408 7408 7831 HOH HOH 0 . 
CJ 36 HOH 4409 7409 7832 HOH HOH 0 . 
CJ 36 HOH 4410 7410 7834 HOH HOH 0 . 
CJ 36 HOH 4411 7411 7835 HOH HOH 0 . 
CJ 36 HOH 4412 7412 7836 HOH HOH 0 . 
CJ 36 HOH 4413 7413 7837 HOH HOH 0 . 
CJ 36 HOH 4414 7414 7838 HOH HOH 0 . 
CJ 36 HOH 4415 7415 7839 HOH HOH 0 . 
CJ 36 HOH 4416 7416 7840 HOH HOH 0 . 
CJ 36 HOH 4417 7417 7841 HOH HOH 0 . 
CJ 36 HOH 4418 7418 7842 HOH HOH 0 . 
CJ 36 HOH 4419 7419 7843 HOH HOH 0 . 
CJ 36 HOH 4420 7420 7844 HOH HOH 0 . 
CJ 36 HOH 4421 7421 7845 HOH HOH 0 . 
CJ 36 HOH 4422 7422 7846 HOH HOH 0 . 
CJ 36 HOH 4423 7423 7847 HOH HOH 0 . 
CJ 36 HOH 4424 7424 7848 HOH HOH 0 . 
CJ 36 HOH 4425 7425 7849 HOH HOH 0 . 
CJ 36 HOH 4426 7426 7850 HOH HOH 0 . 
CJ 36 HOH 4427 7427 7851 HOH HOH 0 . 
CJ 36 HOH 4428 7428 7852 HOH HOH 0 . 
CJ 36 HOH 4429 7429 7853 HOH HOH 0 . 
CJ 36 HOH 4430 7430 7856 HOH HOH 0 . 
CJ 36 HOH 4431 7431 7858 HOH HOH 0 . 
CJ 36 HOH 4432 7432 7859 HOH HOH 0 . 
CJ 36 HOH 4433 7433 7860 HOH HOH 0 . 
CJ 36 HOH 4434 7434 7861 HOH HOH 0 . 
CJ 36 HOH 4435 7435 7862 HOH HOH 0 . 
CJ 36 HOH 4436 7436 7864 HOH HOH 0 . 
CJ 36 HOH 4437 7437 7865 HOH HOH 0 . 
CJ 36 HOH 4438 7438 7866 HOH HOH 0 . 
CJ 36 HOH 4439 7439 7867 HOH HOH 0 . 
CJ 36 HOH 4440 7440 7869 HOH HOH 0 . 
CJ 36 HOH 4441 7441 7870 HOH HOH 0 . 
CJ 36 HOH 4442 7442 7872 HOH HOH 0 . 
CJ 36 HOH 4443 7443 7873 HOH HOH 0 . 
CJ 36 HOH 4444 7444 7874 HOH HOH 0 . 
CJ 36 HOH 4445 7445 7876 HOH HOH 0 . 
CJ 36 HOH 4446 7446 7877 HOH HOH 0 . 
CJ 36 HOH 4447 7447 7880 HOH HOH 0 . 
CJ 36 HOH 4448 7448 7881 HOH HOH 0 . 
CJ 36 HOH 4449 7449 7882 HOH HOH 0 . 
CJ 36 HOH 4450 7450 7883 HOH HOH 0 . 
CJ 36 HOH 4451 7451 7884 HOH HOH 0 . 
CJ 36 HOH 4452 7452 7885 HOH HOH 0 . 
CJ 36 HOH 4453 7453 7886 HOH HOH 0 . 
CJ 36 HOH 4454 7454 7888 HOH HOH 0 . 
CJ 36 HOH 4455 7455 7889 HOH HOH 0 . 
CJ 36 HOH 4456 7456 7891 HOH HOH 0 . 
CJ 36 HOH 4457 7457 7893 HOH HOH 0 . 
CJ 36 HOH 4458 7458 7894 HOH HOH 0 . 
CJ 36 HOH 4459 7459 7896 HOH HOH 0 . 
CJ 36 HOH 4460 7460 7897 HOH HOH 0 . 
CJ 36 HOH 4461 7461 7898 HOH HOH 0 . 
CJ 36 HOH 4462 8523 1    HOH HOH 0 . 
CJ 36 HOH 4463 8524 2    HOH HOH 0 . 
CJ 36 HOH 4464 8525 3    HOH HOH 0 . 
CJ 36 HOH 4465 8526 5    HOH HOH 0 . 
CJ 36 HOH 4466 8527 6    HOH HOH 0 . 
CJ 36 HOH 4467 8528 7    HOH HOH 0 . 
CJ 36 HOH 4468 8529 8    HOH HOH 0 . 
CJ 36 HOH 4469 8530 9    HOH HOH 0 . 
CJ 36 HOH 4470 8531 10   HOH HOH 0 . 
CJ 36 HOH 4471 8532 11   HOH HOH 0 . 
CJ 36 HOH 4472 8533 12   HOH HOH 0 . 
CJ 36 HOH 4473 8534 14   HOH HOH 0 . 
CJ 36 HOH 4474 8535 15   HOH HOH 0 . 
CJ 36 HOH 4475 8536 16   HOH HOH 0 . 
CJ 36 HOH 4476 8537 17   HOH HOH 0 . 
CJ 36 HOH 4477 8538 19   HOH HOH 0 . 
CJ 36 HOH 4478 8539 20   HOH HOH 0 . 
CJ 36 HOH 4479 8540 21   HOH HOH 0 . 
CJ 36 HOH 4480 8541 22   HOH HOH 0 . 
CJ 36 HOH 4481 8542 25   HOH HOH 0 . 
CJ 36 HOH 4482 8543 26   HOH HOH 0 . 
CJ 36 HOH 4483 8544 27   HOH HOH 0 . 
CJ 36 HOH 4484 8545 29   HOH HOH 0 . 
CJ 36 HOH 4485 8546 30   HOH HOH 0 . 
CJ 36 HOH 4486 8547 31   HOH HOH 0 . 
CJ 36 HOH 4487 8548 32   HOH HOH 0 . 
CJ 36 HOH 4488 8549 33   HOH HOH 0 . 
CJ 36 HOH 4489 8550 34   HOH HOH 0 . 
CJ 36 HOH 4490 8551 35   HOH HOH 0 . 
CJ 36 HOH 4491 8552 36   HOH HOH 0 . 
CJ 36 HOH 4492 8553 37   HOH HOH 0 . 
CJ 36 HOH 4493 8554 38   HOH HOH 0 . 
CJ 36 HOH 4494 8555 39   HOH HOH 0 . 
CJ 36 HOH 4495 8556 40   HOH HOH 0 . 
CJ 36 HOH 4496 8557 41   HOH HOH 0 . 
CJ 36 HOH 4497 8558 44   HOH HOH 0 . 
CJ 36 HOH 4498 8559 45   HOH HOH 0 . 
CJ 36 HOH 4499 8560 46   HOH HOH 0 . 
CJ 36 HOH 4500 8561 47   HOH HOH 0 . 
CJ 36 HOH 4501 8562 48   HOH HOH 0 . 
CJ 36 HOH 4502 8563 49   HOH HOH 0 . 
CJ 36 HOH 4503 8564 50   HOH HOH 0 . 
CJ 36 HOH 4504 8565 51   HOH HOH 0 . 
CJ 36 HOH 4505 8566 52   HOH HOH 0 . 
CJ 36 HOH 4506 8567 54   HOH HOH 0 . 
CJ 36 HOH 4507 8568 58   HOH HOH 0 . 
CJ 36 HOH 4508 8569 60   HOH HOH 0 . 
CJ 36 HOH 4509 8570 61   HOH HOH 0 . 
CJ 36 HOH 4510 8571 62   HOH HOH 0 . 
CJ 36 HOH 4511 8572 63   HOH HOH 0 . 
CJ 36 HOH 4512 8573 64   HOH HOH 0 . 
CJ 36 HOH 4513 8574 65   HOH HOH 0 . 
CJ 36 HOH 4514 8575 67   HOH HOH 0 . 
CJ 36 HOH 4515 8576 68   HOH HOH 0 . 
CJ 36 HOH 4516 8577 69   HOH HOH 0 . 
CJ 36 HOH 4517 8578 70   HOH HOH 0 . 
CJ 36 HOH 4518 8579 71   HOH HOH 0 . 
CJ 36 HOH 4519 8580 73   HOH HOH 0 . 
CJ 36 HOH 4520 8581 74   HOH HOH 0 . 
CJ 36 HOH 4521 8582 75   HOH HOH 0 . 
CJ 36 HOH 4522 8583 76   HOH HOH 0 . 
CJ 36 HOH 4523 8584 78   HOH HOH 0 . 
CJ 36 HOH 4524 8585 79   HOH HOH 0 . 
CJ 36 HOH 4525 8586 80   HOH HOH 0 . 
CJ 36 HOH 4526 8587 81   HOH HOH 0 . 
CJ 36 HOH 4527 8588 83   HOH HOH 0 . 
CJ 36 HOH 4528 8589 84   HOH HOH 0 . 
CJ 36 HOH 4529 8590 85   HOH HOH 0 . 
CJ 36 HOH 4530 8591 87   HOH HOH 0 . 
CJ 36 HOH 4531 8592 88   HOH HOH 0 . 
CJ 36 HOH 4532 8593 89   HOH HOH 0 . 
CJ 36 HOH 4533 8594 91   HOH HOH 0 . 
CJ 36 HOH 4534 8595 93   HOH HOH 0 . 
CJ 36 HOH 4535 8596 94   HOH HOH 0 . 
CJ 36 HOH 4536 8597 95   HOH HOH 0 . 
CJ 36 HOH 4537 8598 96   HOH HOH 0 . 
CJ 36 HOH 4538 8599 97   HOH HOH 0 . 
CJ 36 HOH 4539 8600 99   HOH HOH 0 . 
CJ 36 HOH 4540 8601 101  HOH HOH 0 . 
CJ 36 HOH 4541 8602 102  HOH HOH 0 . 
CJ 36 HOH 4542 8603 103  HOH HOH 0 . 
CJ 36 HOH 4543 8604 104  HOH HOH 0 . 
CJ 36 HOH 4544 8605 105  HOH HOH 0 . 
CJ 36 HOH 4545 8606 106  HOH HOH 0 . 
CJ 36 HOH 4546 8607 107  HOH HOH 0 . 
CJ 36 HOH 4547 8608 108  HOH HOH 0 . 
CJ 36 HOH 4548 8609 109  HOH HOH 0 . 
CJ 36 HOH 4549 8610 110  HOH HOH 0 . 
CJ 36 HOH 4550 8611 111  HOH HOH 0 . 
CJ 36 HOH 4551 8612 112  HOH HOH 0 . 
CJ 36 HOH 4552 8613 113  HOH HOH 0 . 
CJ 36 HOH 4553 8614 114  HOH HOH 0 . 
CJ 36 HOH 4554 8615 116  HOH HOH 0 . 
CJ 36 HOH 4555 8616 117  HOH HOH 0 . 
CJ 36 HOH 4556 8617 118  HOH HOH 0 . 
CJ 36 HOH 4557 8618 121  HOH HOH 0 . 
CJ 36 HOH 4558 8619 123  HOH HOH 0 . 
CJ 36 HOH 4559 8620 126  HOH HOH 0 . 
CJ 36 HOH 4560 8621 127  HOH HOH 0 . 
CJ 36 HOH 4561 8622 129  HOH HOH 0 . 
CJ 36 HOH 4562 8623 130  HOH HOH 0 . 
CJ 36 HOH 4563 8624 132  HOH HOH 0 . 
CJ 36 HOH 4564 8625 136  HOH HOH 0 . 
CJ 36 HOH 4565 8626 137  HOH HOH 0 . 
CJ 36 HOH 4566 8627 138  HOH HOH 0 . 
CJ 36 HOH 4567 8628 139  HOH HOH 0 . 
CJ 36 HOH 4568 8629 141  HOH HOH 0 . 
CJ 36 HOH 4569 8630 142  HOH HOH 0 . 
CJ 36 HOH 4570 8631 144  HOH HOH 0 . 
CJ 36 HOH 4571 8632 145  HOH HOH 0 . 
CJ 36 HOH 4572 8633 146  HOH HOH 0 . 
CJ 36 HOH 4573 8634 149  HOH HOH 0 . 
CJ 36 HOH 4574 8635 150  HOH HOH 0 . 
CJ 36 HOH 4575 8636 152  HOH HOH 0 . 
CJ 36 HOH 4576 8637 153  HOH HOH 0 . 
CJ 36 HOH 4577 8638 154  HOH HOH 0 . 
CJ 36 HOH 4578 8639 155  HOH HOH 0 . 
CJ 36 HOH 4579 8640 156  HOH HOH 0 . 
CJ 36 HOH 4580 8641 158  HOH HOH 0 . 
CJ 36 HOH 4581 8642 159  HOH HOH 0 . 
CJ 36 HOH 4582 8643 160  HOH HOH 0 . 
CJ 36 HOH 4583 8644 161  HOH HOH 0 . 
CJ 36 HOH 4584 8645 162  HOH HOH 0 . 
CJ 36 HOH 4585 8646 164  HOH HOH 0 . 
CJ 36 HOH 4586 8647 165  HOH HOH 0 . 
CJ 36 HOH 4587 8648 166  HOH HOH 0 . 
CJ 36 HOH 4588 8649 167  HOH HOH 0 . 
CJ 36 HOH 4589 8650 168  HOH HOH 0 . 
CJ 36 HOH 4590 8651 170  HOH HOH 0 . 
CJ 36 HOH 4591 8652 171  HOH HOH 0 . 
CJ 36 HOH 4592 8653 172  HOH HOH 0 . 
CJ 36 HOH 4593 8654 173  HOH HOH 0 . 
CJ 36 HOH 4594 8655 174  HOH HOH 0 . 
CJ 36 HOH 4595 8656 175  HOH HOH 0 . 
CJ 36 HOH 4596 8657 176  HOH HOH 0 . 
CJ 36 HOH 4597 8658 178  HOH HOH 0 . 
CJ 36 HOH 4598 8659 180  HOH HOH 0 . 
CJ 36 HOH 4599 8660 181  HOH HOH 0 . 
CJ 36 HOH 4600 8661 182  HOH HOH 0 . 
CJ 36 HOH 4601 8662 183  HOH HOH 0 . 
CJ 36 HOH 4602 8663 184  HOH HOH 0 . 
CJ 36 HOH 4603 8664 185  HOH HOH 0 . 
CJ 36 HOH 4604 8665 186  HOH HOH 0 . 
CJ 36 HOH 4605 8666 187  HOH HOH 0 . 
CJ 36 HOH 4606 8667 188  HOH HOH 0 . 
CJ 36 HOH 4607 8668 189  HOH HOH 0 . 
CJ 36 HOH 4608 8669 190  HOH HOH 0 . 
CJ 36 HOH 4609 8670 192  HOH HOH 0 . 
CJ 36 HOH 4610 8671 193  HOH HOH 0 . 
CJ 36 HOH 4611 8672 195  HOH HOH 0 . 
CJ 36 HOH 4612 8673 196  HOH HOH 0 . 
CJ 36 HOH 4613 8674 197  HOH HOH 0 . 
CJ 36 HOH 4614 8675 198  HOH HOH 0 . 
CJ 36 HOH 4615 8676 199  HOH HOH 0 . 
CJ 36 HOH 4616 8677 201  HOH HOH 0 . 
CJ 36 HOH 4617 8678 203  HOH HOH 0 . 
CJ 36 HOH 4618 8679 204  HOH HOH 0 . 
CJ 36 HOH 4619 8680 205  HOH HOH 0 . 
CJ 36 HOH 4620 8681 206  HOH HOH 0 . 
CJ 36 HOH 4621 8682 207  HOH HOH 0 . 
CJ 36 HOH 4622 8683 208  HOH HOH 0 . 
CJ 36 HOH 4623 8684 209  HOH HOH 0 . 
CJ 36 HOH 4624 8685 210  HOH HOH 0 . 
CJ 36 HOH 4625 8686 212  HOH HOH 0 . 
CJ 36 HOH 4626 8687 213  HOH HOH 0 . 
CJ 36 HOH 4627 8688 214  HOH HOH 0 . 
CJ 36 HOH 4628 8689 216  HOH HOH 0 . 
CJ 36 HOH 4629 8690 217  HOH HOH 0 . 
CJ 36 HOH 4630 8691 218  HOH HOH 0 . 
CJ 36 HOH 4631 8692 219  HOH HOH 0 . 
CJ 36 HOH 4632 8693 220  HOH HOH 0 . 
CJ 36 HOH 4633 8694 221  HOH HOH 0 . 
CJ 36 HOH 4634 8695 222  HOH HOH 0 . 
CJ 36 HOH 4635 8696 224  HOH HOH 0 . 
CJ 36 HOH 4636 8697 225  HOH HOH 0 . 
CJ 36 HOH 4637 8698 226  HOH HOH 0 . 
CJ 36 HOH 4638 8699 227  HOH HOH 0 . 
CJ 36 HOH 4639 8700 228  HOH HOH 0 . 
CJ 36 HOH 4640 8701 229  HOH HOH 0 . 
CJ 36 HOH 4641 8702 230  HOH HOH 0 . 
CJ 36 HOH 4642 8703 231  HOH HOH 0 . 
CJ 36 HOH 4643 8704 232  HOH HOH 0 . 
CJ 36 HOH 4644 8705 233  HOH HOH 0 . 
CJ 36 HOH 4645 8706 234  HOH HOH 0 . 
CJ 36 HOH 4646 8707 235  HOH HOH 0 . 
CJ 36 HOH 4647 8708 236  HOH HOH 0 . 
CJ 36 HOH 4648 8709 237  HOH HOH 0 . 
CJ 36 HOH 4649 8710 238  HOH HOH 0 . 
CJ 36 HOH 4650 8711 240  HOH HOH 0 . 
CJ 36 HOH 4651 8712 241  HOH HOH 0 . 
CJ 36 HOH 4652 8713 242  HOH HOH 0 . 
CJ 36 HOH 4653 8714 243  HOH HOH 0 . 
CJ 36 HOH 4654 8715 244  HOH HOH 0 . 
CJ 36 HOH 4655 8716 248  HOH HOH 0 . 
CJ 36 HOH 4656 8717 249  HOH HOH 0 . 
CJ 36 HOH 4657 8718 251  HOH HOH 0 . 
CJ 36 HOH 4658 8719 252  HOH HOH 0 . 
CJ 36 HOH 4659 8720 253  HOH HOH 0 . 
CJ 36 HOH 4660 8721 254  HOH HOH 0 . 
CJ 36 HOH 4661 8722 255  HOH HOH 0 . 
CJ 36 HOH 4662 8723 256  HOH HOH 0 . 
CJ 36 HOH 4663 8724 257  HOH HOH 0 . 
CJ 36 HOH 4664 8725 258  HOH HOH 0 . 
CJ 36 HOH 4665 8726 259  HOH HOH 0 . 
CJ 36 HOH 4666 8727 261  HOH HOH 0 . 
CJ 36 HOH 4667 8728 262  HOH HOH 0 . 
CJ 36 HOH 4668 8729 263  HOH HOH 0 . 
CJ 36 HOH 4669 8730 264  HOH HOH 0 . 
CJ 36 HOH 4670 8731 266  HOH HOH 0 . 
CJ 36 HOH 4671 8732 268  HOH HOH 0 . 
CJ 36 HOH 4672 8733 270  HOH HOH 0 . 
CJ 36 HOH 4673 8734 271  HOH HOH 0 . 
CJ 36 HOH 4674 8735 272  HOH HOH 0 . 
CJ 36 HOH 4675 8736 273  HOH HOH 0 . 
CJ 36 HOH 4676 8737 274  HOH HOH 0 . 
CJ 36 HOH 4677 8738 275  HOH HOH 0 . 
CJ 36 HOH 4678 8739 276  HOH HOH 0 . 
CJ 36 HOH 4679 8740 277  HOH HOH 0 . 
CJ 36 HOH 4680 8741 279  HOH HOH 0 . 
CJ 36 HOH 4681 8742 280  HOH HOH 0 . 
CJ 36 HOH 4682 8743 281  HOH HOH 0 . 
CJ 36 HOH 4683 8744 282  HOH HOH 0 . 
CJ 36 HOH 4684 8745 283  HOH HOH 0 . 
CJ 36 HOH 4685 8746 284  HOH HOH 0 . 
CJ 36 HOH 4686 8747 285  HOH HOH 0 . 
CJ 36 HOH 4687 8748 287  HOH HOH 0 . 
CJ 36 HOH 4688 8749 288  HOH HOH 0 . 
CJ 36 HOH 4689 8750 289  HOH HOH 0 . 
CJ 36 HOH 4690 8751 290  HOH HOH 0 . 
CJ 36 HOH 4691 8752 291  HOH HOH 0 . 
CJ 36 HOH 4692 8753 294  HOH HOH 0 . 
CJ 36 HOH 4693 8754 295  HOH HOH 0 . 
CJ 36 HOH 4694 8755 296  HOH HOH 0 . 
CJ 36 HOH 4695 8756 297  HOH HOH 0 . 
CJ 36 HOH 4696 8757 298  HOH HOH 0 . 
CJ 36 HOH 4697 8758 299  HOH HOH 0 . 
CJ 36 HOH 4698 8759 300  HOH HOH 0 . 
CJ 36 HOH 4699 8760 302  HOH HOH 0 . 
CJ 36 HOH 4700 8761 303  HOH HOH 0 . 
CJ 36 HOH 4701 8762 305  HOH HOH 0 . 
CJ 36 HOH 4702 8763 307  HOH HOH 0 . 
CJ 36 HOH 4703 8764 308  HOH HOH 0 . 
CJ 36 HOH 4704 8765 310  HOH HOH 0 . 
CJ 36 HOH 4705 8766 312  HOH HOH 0 . 
CJ 36 HOH 4706 8767 313  HOH HOH 0 . 
CJ 36 HOH 4707 8768 314  HOH HOH 0 . 
CJ 36 HOH 4708 8769 315  HOH HOH 0 . 
CJ 36 HOH 4709 8770 316  HOH HOH 0 . 
CJ 36 HOH 4710 8771 317  HOH HOH 0 . 
CJ 36 HOH 4711 8772 318  HOH HOH 0 . 
CJ 36 HOH 4712 8773 319  HOH HOH 0 . 
CJ 36 HOH 4713 8774 320  HOH HOH 0 . 
CJ 36 HOH 4714 8775 322  HOH HOH 0 . 
CJ 36 HOH 4715 8776 323  HOH HOH 0 . 
CJ 36 HOH 4716 8777 324  HOH HOH 0 . 
CJ 36 HOH 4717 8778 325  HOH HOH 0 . 
CJ 36 HOH 4718 8779 326  HOH HOH 0 . 
CJ 36 HOH 4719 8780 329  HOH HOH 0 . 
CJ 36 HOH 4720 8781 330  HOH HOH 0 . 
CJ 36 HOH 4721 8782 331  HOH HOH 0 . 
CJ 36 HOH 4722 8783 332  HOH HOH 0 . 
CJ 36 HOH 4723 8784 333  HOH HOH 0 . 
CJ 36 HOH 4724 8785 334  HOH HOH 0 . 
CJ 36 HOH 4725 8786 335  HOH HOH 0 . 
CJ 36 HOH 4726 8787 336  HOH HOH 0 . 
CJ 36 HOH 4727 8788 337  HOH HOH 0 . 
CJ 36 HOH 4728 8789 338  HOH HOH 0 . 
CJ 36 HOH 4729 8790 339  HOH HOH 0 . 
CJ 36 HOH 4730 8791 342  HOH HOH 0 . 
CJ 36 HOH 4731 8792 344  HOH HOH 0 . 
CJ 36 HOH 4732 8793 345  HOH HOH 0 . 
CJ 36 HOH 4733 8794 346  HOH HOH 0 . 
CJ 36 HOH 4734 8795 347  HOH HOH 0 . 
CJ 36 HOH 4735 8796 348  HOH HOH 0 . 
CJ 36 HOH 4736 8797 349  HOH HOH 0 . 
CJ 36 HOH 4737 8798 350  HOH HOH 0 . 
CJ 36 HOH 4738 8799 351  HOH HOH 0 . 
CJ 36 HOH 4739 8800 355  HOH HOH 0 . 
CJ 36 HOH 4740 8801 356  HOH HOH 0 . 
CJ 36 HOH 4741 8802 357  HOH HOH 0 . 
CJ 36 HOH 4742 8803 358  HOH HOH 0 . 
CJ 36 HOH 4743 8804 359  HOH HOH 0 . 
CJ 36 HOH 4744 8805 360  HOH HOH 0 . 
CJ 36 HOH 4745 8806 361  HOH HOH 0 . 
CJ 36 HOH 4746 8807 362  HOH HOH 0 . 
CJ 36 HOH 4747 8808 363  HOH HOH 0 . 
CJ 36 HOH 4748 8809 364  HOH HOH 0 . 
CJ 36 HOH 4749 8810 365  HOH HOH 0 . 
CJ 36 HOH 4750 8811 366  HOH HOH 0 . 
CJ 36 HOH 4751 8812 367  HOH HOH 0 . 
CJ 36 HOH 4752 8813 368  HOH HOH 0 . 
CJ 36 HOH 4753 8814 369  HOH HOH 0 . 
CJ 36 HOH 4754 8815 371  HOH HOH 0 . 
CJ 36 HOH 4755 8816 372  HOH HOH 0 . 
CJ 36 HOH 4756 8817 373  HOH HOH 0 . 
CJ 36 HOH 4757 8818 375  HOH HOH 0 . 
CJ 36 HOH 4758 8819 376  HOH HOH 0 . 
CJ 36 HOH 4759 8820 377  HOH HOH 0 . 
CJ 36 HOH 4760 8821 378  HOH HOH 0 . 
CJ 36 HOH 4761 8822 379  HOH HOH 0 . 
CJ 36 HOH 4762 8823 380  HOH HOH 0 . 
CJ 36 HOH 4763 8824 381  HOH HOH 0 . 
CJ 36 HOH 4764 8825 384  HOH HOH 0 . 
CJ 36 HOH 4765 8826 385  HOH HOH 0 . 
CJ 36 HOH 4766 8827 386  HOH HOH 0 . 
CJ 36 HOH 4767 8828 387  HOH HOH 0 . 
CJ 36 HOH 4768 8829 388  HOH HOH 0 . 
CJ 36 HOH 4769 8830 390  HOH HOH 0 . 
CJ 36 HOH 4770 8831 391  HOH HOH 0 . 
CJ 36 HOH 4771 8832 392  HOH HOH 0 . 
CJ 36 HOH 4772 8833 393  HOH HOH 0 . 
CJ 36 HOH 4773 8834 394  HOH HOH 0 . 
CJ 36 HOH 4774 8835 397  HOH HOH 0 . 
CJ 36 HOH 4775 8836 399  HOH HOH 0 . 
CJ 36 HOH 4776 8837 400  HOH HOH 0 . 
CJ 36 HOH 4777 8838 402  HOH HOH 0 . 
CJ 36 HOH 4778 8839 403  HOH HOH 0 . 
CJ 36 HOH 4779 8840 404  HOH HOH 0 . 
CJ 36 HOH 4780 8841 405  HOH HOH 0 . 
CJ 36 HOH 4781 8842 406  HOH HOH 0 . 
CJ 36 HOH 4782 8843 407  HOH HOH 0 . 
CJ 36 HOH 4783 8844 409  HOH HOH 0 . 
CJ 36 HOH 4784 8845 410  HOH HOH 0 . 
CJ 36 HOH 4785 8846 411  HOH HOH 0 . 
CJ 36 HOH 4786 8847 412  HOH HOH 0 . 
CJ 36 HOH 4787 8848 413  HOH HOH 0 . 
CJ 36 HOH 4788 8849 414  HOH HOH 0 . 
CJ 36 HOH 4789 8850 415  HOH HOH 0 . 
CJ 36 HOH 4790 8851 416  HOH HOH 0 . 
CJ 36 HOH 4791 8852 417  HOH HOH 0 . 
CJ 36 HOH 4792 8853 418  HOH HOH 0 . 
CJ 36 HOH 4793 8854 419  HOH HOH 0 . 
CJ 36 HOH 4794 8855 420  HOH HOH 0 . 
CJ 36 HOH 4795 8856 422  HOH HOH 0 . 
CJ 36 HOH 4796 8857 425  HOH HOH 0 . 
CJ 36 HOH 4797 8858 426  HOH HOH 0 . 
CJ 36 HOH 4798 8859 427  HOH HOH 0 . 
CJ 36 HOH 4799 8860 428  HOH HOH 0 . 
CJ 36 HOH 4800 8861 429  HOH HOH 0 . 
CJ 36 HOH 4801 8862 430  HOH HOH 0 . 
CJ 36 HOH 4802 8863 431  HOH HOH 0 . 
CJ 36 HOH 4803 8864 432  HOH HOH 0 . 
CJ 36 HOH 4804 8865 433  HOH HOH 0 . 
CJ 36 HOH 4805 8866 434  HOH HOH 0 . 
CJ 36 HOH 4806 8867 435  HOH HOH 0 . 
CJ 36 HOH 4807 8868 437  HOH HOH 0 . 
CJ 36 HOH 4808 8869 438  HOH HOH 0 . 
CJ 36 HOH 4809 8870 439  HOH HOH 0 . 
CJ 36 HOH 4810 8871 441  HOH HOH 0 . 
CJ 36 HOH 4811 8872 442  HOH HOH 0 . 
CJ 36 HOH 4812 8873 443  HOH HOH 0 . 
CJ 36 HOH 4813 8874 445  HOH HOH 0 . 
CJ 36 HOH 4814 8875 446  HOH HOH 0 . 
CJ 36 HOH 4815 8876 447  HOH HOH 0 . 
CJ 36 HOH 4816 8877 448  HOH HOH 0 . 
CJ 36 HOH 4817 8878 451  HOH HOH 0 . 
CJ 36 HOH 4818 8879 452  HOH HOH 0 . 
CJ 36 HOH 4819 8880 453  HOH HOH 0 . 
CJ 36 HOH 4820 8881 454  HOH HOH 0 . 
CJ 36 HOH 4821 8882 455  HOH HOH 0 . 
CJ 36 HOH 4822 8883 456  HOH HOH 0 . 
CJ 36 HOH 4823 8884 457  HOH HOH 0 . 
CJ 36 HOH 4824 8885 459  HOH HOH 0 . 
CJ 36 HOH 4825 8886 461  HOH HOH 0 . 
CJ 36 HOH 4826 8887 462  HOH HOH 0 . 
CJ 36 HOH 4827 8888 463  HOH HOH 0 . 
CJ 36 HOH 4828 8889 464  HOH HOH 0 . 
CJ 36 HOH 4829 8890 465  HOH HOH 0 . 
CJ 36 HOH 4830 8891 467  HOH HOH 0 . 
CJ 36 HOH 4831 8892 469  HOH HOH 0 . 
CJ 36 HOH 4832 8893 470  HOH HOH 0 . 
CJ 36 HOH 4833 8894 471  HOH HOH 0 . 
CJ 36 HOH 4834 8895 472  HOH HOH 0 . 
CJ 36 HOH 4835 8896 473  HOH HOH 0 . 
CJ 36 HOH 4836 8897 474  HOH HOH 0 . 
CJ 36 HOH 4837 8898 475  HOH HOH 0 . 
CJ 36 HOH 4838 8899 476  HOH HOH 0 . 
CJ 36 HOH 4839 8900 477  HOH HOH 0 . 
CJ 36 HOH 4840 8901 478  HOH HOH 0 . 
CJ 36 HOH 4841 8902 479  HOH HOH 0 . 
CJ 36 HOH 4842 8903 480  HOH HOH 0 . 
CJ 36 HOH 4843 8904 481  HOH HOH 0 . 
CJ 36 HOH 4844 8905 482  HOH HOH 0 . 
CJ 36 HOH 4845 8906 483  HOH HOH 0 . 
CJ 36 HOH 4846 8907 484  HOH HOH 0 . 
CJ 36 HOH 4847 8908 485  HOH HOH 0 . 
CJ 36 HOH 4848 8909 487  HOH HOH 0 . 
CJ 36 HOH 4849 8910 488  HOH HOH 0 . 
CJ 36 HOH 4850 8911 489  HOH HOH 0 . 
CJ 36 HOH 4851 8912 492  HOH HOH 0 . 
CJ 36 HOH 4852 8913 493  HOH HOH 0 . 
CJ 36 HOH 4853 8914 494  HOH HOH 0 . 
CJ 36 HOH 4854 8915 495  HOH HOH 0 . 
CJ 36 HOH 4855 8916 496  HOH HOH 0 . 
CJ 36 HOH 4856 8917 497  HOH HOH 0 . 
CJ 36 HOH 4857 8918 499  HOH HOH 0 . 
CJ 36 HOH 4858 8919 500  HOH HOH 0 . 
CJ 36 HOH 4859 8920 501  HOH HOH 0 . 
CJ 36 HOH 4860 8921 502  HOH HOH 0 . 
CJ 36 HOH 4861 8922 503  HOH HOH 0 . 
CJ 36 HOH 4862 8923 505  HOH HOH 0 . 
CJ 36 HOH 4863 8924 506  HOH HOH 0 . 
CJ 36 HOH 4864 8925 508  HOH HOH 0 . 
CJ 36 HOH 4865 8926 509  HOH HOH 0 . 
CJ 36 HOH 4866 8927 511  HOH HOH 0 . 
CJ 36 HOH 4867 8928 512  HOH HOH 0 . 
CJ 36 HOH 4868 8929 514  HOH HOH 0 . 
CJ 36 HOH 4869 8930 515  HOH HOH 0 . 
CJ 36 HOH 4870 8931 516  HOH HOH 0 . 
CJ 36 HOH 4871 8932 517  HOH HOH 0 . 
CJ 36 HOH 4872 8933 518  HOH HOH 0 . 
CJ 36 HOH 4873 8934 519  HOH HOH 0 . 
CJ 36 HOH 4874 8935 520  HOH HOH 0 . 
CJ 36 HOH 4875 8936 521  HOH HOH 0 . 
CJ 36 HOH 4876 8937 522  HOH HOH 0 . 
CJ 36 HOH 4877 8938 523  HOH HOH 0 . 
CJ 36 HOH 4878 8939 524  HOH HOH 0 . 
CJ 36 HOH 4879 8940 526  HOH HOH 0 . 
CJ 36 HOH 4880 8941 527  HOH HOH 0 . 
CJ 36 HOH 4881 8942 528  HOH HOH 0 . 
CJ 36 HOH 4882 8943 529  HOH HOH 0 . 
CJ 36 HOH 4883 8944 530  HOH HOH 0 . 
CJ 36 HOH 4884 8945 531  HOH HOH 0 . 
CJ 36 HOH 4885 8946 532  HOH HOH 0 . 
CJ 36 HOH 4886 8947 534  HOH HOH 0 . 
CJ 36 HOH 4887 8948 535  HOH HOH 0 . 
CJ 36 HOH 4888 8949 537  HOH HOH 0 . 
CJ 36 HOH 4889 8950 539  HOH HOH 0 . 
CJ 36 HOH 4890 8951 540  HOH HOH 0 . 
CJ 36 HOH 4891 8952 541  HOH HOH 0 . 
CJ 36 HOH 4892 8953 542  HOH HOH 0 . 
CJ 36 HOH 4893 8954 543  HOH HOH 0 . 
CJ 36 HOH 4894 8955 544  HOH HOH 0 . 
CJ 36 HOH 4895 8956 545  HOH HOH 0 . 
CJ 36 HOH 4896 8957 546  HOH HOH 0 . 
CJ 36 HOH 4897 8958 547  HOH HOH 0 . 
CJ 36 HOH 4898 8959 548  HOH HOH 0 . 
CJ 36 HOH 4899 8960 549  HOH HOH 0 . 
CJ 36 HOH 4900 8961 550  HOH HOH 0 . 
CJ 36 HOH 4901 8962 551  HOH HOH 0 . 
CJ 36 HOH 4902 8963 552  HOH HOH 0 . 
CJ 36 HOH 4903 8964 554  HOH HOH 0 . 
CJ 36 HOH 4904 8965 555  HOH HOH 0 . 
CJ 36 HOH 4905 8966 556  HOH HOH 0 . 
CJ 36 HOH 4906 8967 557  HOH HOH 0 . 
CJ 36 HOH 4907 8968 558  HOH HOH 0 . 
CJ 36 HOH 4908 8969 560  HOH HOH 0 . 
CJ 36 HOH 4909 8970 561  HOH HOH 0 . 
CJ 36 HOH 4910 8971 562  HOH HOH 0 . 
CJ 36 HOH 4911 8972 563  HOH HOH 0 . 
CJ 36 HOH 4912 8973 564  HOH HOH 0 . 
CJ 36 HOH 4913 8974 565  HOH HOH 0 . 
CJ 36 HOH 4914 8975 566  HOH HOH 0 . 
CJ 36 HOH 4915 8976 567  HOH HOH 0 . 
CJ 36 HOH 4916 8977 568  HOH HOH 0 . 
CJ 36 HOH 4917 8978 569  HOH HOH 0 . 
CJ 36 HOH 4918 8979 570  HOH HOH 0 . 
CJ 36 HOH 4919 8980 571  HOH HOH 0 . 
CJ 36 HOH 4920 8981 572  HOH HOH 0 . 
CJ 36 HOH 4921 8982 573  HOH HOH 0 . 
CJ 36 HOH 4922 8983 574  HOH HOH 0 . 
CJ 36 HOH 4923 8984 575  HOH HOH 0 . 
CJ 36 HOH 4924 8985 576  HOH HOH 0 . 
CJ 36 HOH 4925 8986 577  HOH HOH 0 . 
CJ 36 HOH 4926 8987 578  HOH HOH 0 . 
CJ 36 HOH 4927 8988 579  HOH HOH 0 . 
CJ 36 HOH 4928 8989 580  HOH HOH 0 . 
CJ 36 HOH 4929 8990 583  HOH HOH 0 . 
CJ 36 HOH 4930 8991 589  HOH HOH 0 . 
CJ 36 HOH 4931 8992 590  HOH HOH 0 . 
CJ 36 HOH 4932 8993 592  HOH HOH 0 . 
CJ 36 HOH 4933 8994 593  HOH HOH 0 . 
CJ 36 HOH 4934 8995 595  HOH HOH 0 . 
CJ 36 HOH 4935 8996 596  HOH HOH 0 . 
CJ 36 HOH 4936 8997 597  HOH HOH 0 . 
CJ 36 HOH 4937 8998 598  HOH HOH 0 . 
CJ 36 HOH 4938 8999 599  HOH HOH 0 . 
CJ 36 HOH 4939 9000 600  HOH HOH 0 . 
CJ 36 HOH 4940 9001 601  HOH HOH 0 . 
CJ 36 HOH 4941 9002 602  HOH HOH 0 . 
CJ 36 HOH 4942 9003 603  HOH HOH 0 . 
CJ 36 HOH 4943 9004 604  HOH HOH 0 . 
CJ 36 HOH 4944 9005 605  HOH HOH 0 . 
CJ 36 HOH 4945 9006 606  HOH HOH 0 . 
CJ 36 HOH 4946 9007 608  HOH HOH 0 . 
CJ 36 HOH 4947 9008 609  HOH HOH 0 . 
CJ 36 HOH 4948 9009 610  HOH HOH 0 . 
CJ 36 HOH 4949 9010 612  HOH HOH 0 . 
CJ 36 HOH 4950 9011 613  HOH HOH 0 . 
CJ 36 HOH 4951 9012 614  HOH HOH 0 . 
CJ 36 HOH 4952 9013 615  HOH HOH 0 . 
CJ 36 HOH 4953 9014 616  HOH HOH 0 . 
CJ 36 HOH 4954 9015 617  HOH HOH 0 . 
CJ 36 HOH 4955 9016 618  HOH HOH 0 . 
CJ 36 HOH 4956 9017 619  HOH HOH 0 . 
CJ 36 HOH 4957 9018 620  HOH HOH 0 . 
CJ 36 HOH 4958 9019 621  HOH HOH 0 . 
CJ 36 HOH 4959 9020 623  HOH HOH 0 . 
CJ 36 HOH 4960 9021 624  HOH HOH 0 . 
CJ 36 HOH 4961 9022 625  HOH HOH 0 . 
CJ 36 HOH 4962 9023 627  HOH HOH 0 . 
CJ 36 HOH 4963 9024 628  HOH HOH 0 . 
CJ 36 HOH 4964 9025 629  HOH HOH 0 . 
CJ 36 HOH 4965 9026 630  HOH HOH 0 . 
CJ 36 HOH 4966 9027 631  HOH HOH 0 . 
CJ 36 HOH 4967 9028 632  HOH HOH 0 . 
CJ 36 HOH 4968 9029 633  HOH HOH 0 . 
CJ 36 HOH 4969 9030 634  HOH HOH 0 . 
CJ 36 HOH 4970 9031 638  HOH HOH 0 . 
CJ 36 HOH 4971 9032 640  HOH HOH 0 . 
CJ 36 HOH 4972 9033 642  HOH HOH 0 . 
CJ 36 HOH 4973 9034 643  HOH HOH 0 . 
CJ 36 HOH 4974 9035 645  HOH HOH 0 . 
CJ 36 HOH 4975 9036 646  HOH HOH 0 . 
CJ 36 HOH 4976 9037 647  HOH HOH 0 . 
CJ 36 HOH 4977 9038 648  HOH HOH 0 . 
CJ 36 HOH 4978 9039 649  HOH HOH 0 . 
CJ 36 HOH 4979 9040 650  HOH HOH 0 . 
CJ 36 HOH 4980 9041 653  HOH HOH 0 . 
CJ 36 HOH 4981 9042 654  HOH HOH 0 . 
CJ 36 HOH 4982 9043 655  HOH HOH 0 . 
CJ 36 HOH 4983 9044 656  HOH HOH 0 . 
CJ 36 HOH 4984 9045 657  HOH HOH 0 . 
CJ 36 HOH 4985 9046 658  HOH HOH 0 . 
CJ 36 HOH 4986 9047 659  HOH HOH 0 . 
CJ 36 HOH 4987 9048 660  HOH HOH 0 . 
CJ 36 HOH 4988 9049 661  HOH HOH 0 . 
CJ 36 HOH 4989 9050 662  HOH HOH 0 . 
CJ 36 HOH 4990 9051 663  HOH HOH 0 . 
CJ 36 HOH 4991 9052 664  HOH HOH 0 . 
CJ 36 HOH 4992 9053 665  HOH HOH 0 . 
CJ 36 HOH 4993 9054 669  HOH HOH 0 . 
CJ 36 HOH 4994 9055 671  HOH HOH 0 . 
CJ 36 HOH 4995 9056 672  HOH HOH 0 . 
CJ 36 HOH 4996 9057 674  HOH HOH 0 . 
CJ 36 HOH 4997 9058 675  HOH HOH 0 . 
CJ 36 HOH 4998 9059 676  HOH HOH 0 . 
CJ 36 HOH 4999 9060 677  HOH HOH 0 . 
CJ 36 HOH 5000 9061 678  HOH HOH 0 . 
CJ 36 HOH 5001 9062 679  HOH HOH 0 . 
CJ 36 HOH 5002 9063 680  HOH HOH 0 . 
CJ 36 HOH 5003 9064 681  HOH HOH 0 . 
CJ 36 HOH 5004 9065 682  HOH HOH 0 . 
CJ 36 HOH 5005 9066 683  HOH HOH 0 . 
CJ 36 HOH 5006 9067 684  HOH HOH 0 . 
CJ 36 HOH 5007 9068 685  HOH HOH 0 . 
CJ 36 HOH 5008 9069 686  HOH HOH 0 . 
CJ 36 HOH 5009 9070 688  HOH HOH 0 . 
CJ 36 HOH 5010 9071 690  HOH HOH 0 . 
CJ 36 HOH 5011 9072 691  HOH HOH 0 . 
CJ 36 HOH 5012 9073 693  HOH HOH 0 . 
CJ 36 HOH 5013 9074 694  HOH HOH 0 . 
CJ 36 HOH 5014 9075 695  HOH HOH 0 . 
CJ 36 HOH 5015 9076 696  HOH HOH 0 . 
CJ 36 HOH 5016 9077 697  HOH HOH 0 . 
CJ 36 HOH 5017 9078 698  HOH HOH 0 . 
CJ 36 HOH 5018 9079 699  HOH HOH 0 . 
CJ 36 HOH 5019 9080 700  HOH HOH 0 . 
CJ 36 HOH 5020 9081 701  HOH HOH 0 . 
CJ 36 HOH 5021 9082 702  HOH HOH 0 . 
CJ 36 HOH 5022 9083 703  HOH HOH 0 . 
CJ 36 HOH 5023 9084 704  HOH HOH 0 . 
CJ 36 HOH 5024 9085 706  HOH HOH 0 . 
CJ 36 HOH 5025 9086 707  HOH HOH 0 . 
CJ 36 HOH 5026 9087 708  HOH HOH 0 . 
CJ 36 HOH 5027 9088 709  HOH HOH 0 . 
CJ 36 HOH 5028 9089 710  HOH HOH 0 . 
CJ 36 HOH 5029 9090 711  HOH HOH 0 . 
CJ 36 HOH 5030 9091 712  HOH HOH 0 . 
CJ 36 HOH 5031 9092 713  HOH HOH 0 . 
CJ 36 HOH 5032 9093 714  HOH HOH 0 . 
CJ 36 HOH 5033 9094 715  HOH HOH 0 . 
CJ 36 HOH 5034 9095 716  HOH HOH 0 . 
CJ 36 HOH 5035 9096 717  HOH HOH 0 . 
CJ 36 HOH 5036 9097 718  HOH HOH 0 . 
CJ 36 HOH 5037 9098 720  HOH HOH 0 . 
CJ 36 HOH 5038 9099 722  HOH HOH 0 . 
CJ 36 HOH 5039 9100 723  HOH HOH 0 . 
CJ 36 HOH 5040 9101 724  HOH HOH 0 . 
CJ 36 HOH 5041 9102 725  HOH HOH 0 . 
CJ 36 HOH 5042 9103 727  HOH HOH 0 . 
CJ 36 HOH 5043 9104 728  HOH HOH 0 . 
CJ 36 HOH 5044 9105 729  HOH HOH 0 . 
CJ 36 HOH 5045 9106 730  HOH HOH 0 . 
CJ 36 HOH 5046 9107 731  HOH HOH 0 . 
CJ 36 HOH 5047 9108 732  HOH HOH 0 . 
CJ 36 HOH 5048 9109 733  HOH HOH 0 . 
CJ 36 HOH 5049 9110 735  HOH HOH 0 . 
CJ 36 HOH 5050 9111 736  HOH HOH 0 . 
CJ 36 HOH 5051 9112 739  HOH HOH 0 . 
CJ 36 HOH 5052 9113 740  HOH HOH 0 . 
CJ 36 HOH 5053 9114 741  HOH HOH 0 . 
CJ 36 HOH 5054 9115 742  HOH HOH 0 . 
CJ 36 HOH 5055 9116 743  HOH HOH 0 . 
CJ 36 HOH 5056 9117 744  HOH HOH 0 . 
CJ 36 HOH 5057 9118 745  HOH HOH 0 . 
CJ 36 HOH 5058 9119 746  HOH HOH 0 . 
CJ 36 HOH 5059 9120 747  HOH HOH 0 . 
CJ 36 HOH 5060 9121 748  HOH HOH 0 . 
CJ 36 HOH 5061 9122 749  HOH HOH 0 . 
CJ 36 HOH 5062 9123 751  HOH HOH 0 . 
CJ 36 HOH 5063 9124 752  HOH HOH 0 . 
CJ 36 HOH 5064 9125 753  HOH HOH 0 . 
CJ 36 HOH 5065 9126 754  HOH HOH 0 . 
CJ 36 HOH 5066 9127 755  HOH HOH 0 . 
CJ 36 HOH 5067 9128 756  HOH HOH 0 . 
CJ 36 HOH 5068 9129 757  HOH HOH 0 . 
CJ 36 HOH 5069 9130 758  HOH HOH 0 . 
CJ 36 HOH 5070 9131 759  HOH HOH 0 . 
CJ 36 HOH 5071 9132 760  HOH HOH 0 . 
CJ 36 HOH 5072 9133 761  HOH HOH 0 . 
CJ 36 HOH 5073 9134 762  HOH HOH 0 . 
CJ 36 HOH 5074 9135 763  HOH HOH 0 . 
CJ 36 HOH 5075 9136 764  HOH HOH 0 . 
CJ 36 HOH 5076 9137 765  HOH HOH 0 . 
CJ 36 HOH 5077 9138 767  HOH HOH 0 . 
CJ 36 HOH 5078 9139 769  HOH HOH 0 . 
CJ 36 HOH 5079 9140 770  HOH HOH 0 . 
CJ 36 HOH 5080 9141 771  HOH HOH 0 . 
CJ 36 HOH 5081 9142 775  HOH HOH 0 . 
CJ 36 HOH 5082 9143 777  HOH HOH 0 . 
CJ 36 HOH 5083 9144 778  HOH HOH 0 . 
CJ 36 HOH 5084 9145 780  HOH HOH 0 . 
CJ 36 HOH 5085 9146 781  HOH HOH 0 . 
CJ 36 HOH 5086 9147 783  HOH HOH 0 . 
CJ 36 HOH 5087 9148 784  HOH HOH 0 . 
CJ 36 HOH 5088 9149 785  HOH HOH 0 . 
CJ 36 HOH 5089 9150 786  HOH HOH 0 . 
CJ 36 HOH 5090 9151 787  HOH HOH 0 . 
CJ 36 HOH 5091 9152 788  HOH HOH 0 . 
CJ 36 HOH 5092 9153 789  HOH HOH 0 . 
CJ 36 HOH 5093 9154 790  HOH HOH 0 . 
CJ 36 HOH 5094 9155 791  HOH HOH 0 . 
CJ 36 HOH 5095 9156 792  HOH HOH 0 . 
CJ 36 HOH 5096 9157 793  HOH HOH 0 . 
CJ 36 HOH 5097 9158 794  HOH HOH 0 . 
CJ 36 HOH 5098 9159 795  HOH HOH 0 . 
CJ 36 HOH 5099 9160 796  HOH HOH 0 . 
CJ 36 HOH 5100 9161 797  HOH HOH 0 . 
CJ 36 HOH 5101 9162 798  HOH HOH 0 . 
CJ 36 HOH 5102 9163 800  HOH HOH 0 . 
CJ 36 HOH 5103 9164 801  HOH HOH 0 . 
CJ 36 HOH 5104 9165 802  HOH HOH 0 . 
CJ 36 HOH 5105 9166 803  HOH HOH 0 . 
CJ 36 HOH 5106 9167 805  HOH HOH 0 . 
CJ 36 HOH 5107 9168 806  HOH HOH 0 . 
CJ 36 HOH 5108 9169 807  HOH HOH 0 . 
CJ 36 HOH 5109 9170 809  HOH HOH 0 . 
CJ 36 HOH 5110 9171 810  HOH HOH 0 . 
CJ 36 HOH 5111 9172 811  HOH HOH 0 . 
CJ 36 HOH 5112 9173 812  HOH HOH 0 . 
CJ 36 HOH 5113 9174 813  HOH HOH 0 . 
CJ 36 HOH 5114 9175 814  HOH HOH 0 . 
CJ 36 HOH 5115 9176 815  HOH HOH 0 . 
CJ 36 HOH 5116 9177 816  HOH HOH 0 . 
CJ 36 HOH 5117 9178 817  HOH HOH 0 . 
CJ 36 HOH 5118 9179 818  HOH HOH 0 . 
CJ 36 HOH 5119 9180 819  HOH HOH 0 . 
CJ 36 HOH 5120 9181 820  HOH HOH 0 . 
CJ 36 HOH 5121 9182 821  HOH HOH 0 . 
CJ 36 HOH 5122 9183 822  HOH HOH 0 . 
CJ 36 HOH 5123 9184 825  HOH HOH 0 . 
CJ 36 HOH 5124 9185 826  HOH HOH 0 . 
CJ 36 HOH 5125 9186 827  HOH HOH 0 . 
CJ 36 HOH 5126 9187 831  HOH HOH 0 . 
CJ 36 HOH 5127 9188 832  HOH HOH 0 . 
CJ 36 HOH 5128 9189 833  HOH HOH 0 . 
CJ 36 HOH 5129 9190 834  HOH HOH 0 . 
CJ 36 HOH 5130 9191 835  HOH HOH 0 . 
CJ 36 HOH 5131 9192 836  HOH HOH 0 . 
CJ 36 HOH 5132 9193 837  HOH HOH 0 . 
CJ 36 HOH 5133 9194 838  HOH HOH 0 . 
CJ 36 HOH 5134 9195 839  HOH HOH 0 . 
CJ 36 HOH 5135 9196 840  HOH HOH 0 . 
CJ 36 HOH 5136 9197 841  HOH HOH 0 . 
CJ 36 HOH 5137 9198 842  HOH HOH 0 . 
CJ 36 HOH 5138 9199 843  HOH HOH 0 . 
CJ 36 HOH 5139 9200 844  HOH HOH 0 . 
CJ 36 HOH 5140 9201 846  HOH HOH 0 . 
CJ 36 HOH 5141 9202 848  HOH HOH 0 . 
CJ 36 HOH 5142 9203 849  HOH HOH 0 . 
CJ 36 HOH 5143 9204 850  HOH HOH 0 . 
CJ 36 HOH 5144 9205 851  HOH HOH 0 . 
CJ 36 HOH 5145 9206 852  HOH HOH 0 . 
CJ 36 HOH 5146 9207 856  HOH HOH 0 . 
CJ 36 HOH 5147 9208 857  HOH HOH 0 . 
CJ 36 HOH 5148 9209 858  HOH HOH 0 . 
CJ 36 HOH 5149 9210 859  HOH HOH 0 . 
CJ 36 HOH 5150 9211 860  HOH HOH 0 . 
CJ 36 HOH 5151 9212 861  HOH HOH 0 . 
CJ 36 HOH 5152 9213 862  HOH HOH 0 . 
CJ 36 HOH 5153 9214 863  HOH HOH 0 . 
CJ 36 HOH 5154 9215 866  HOH HOH 0 . 
CJ 36 HOH 5155 9216 867  HOH HOH 0 . 
CJ 36 HOH 5156 9217 868  HOH HOH 0 . 
CJ 36 HOH 5157 9218 869  HOH HOH 0 . 
CJ 36 HOH 5158 9219 870  HOH HOH 0 . 
CJ 36 HOH 5159 9220 871  HOH HOH 0 . 
CJ 36 HOH 5160 9221 872  HOH HOH 0 . 
CJ 36 HOH 5161 9222 873  HOH HOH 0 . 
CJ 36 HOH 5162 9223 875  HOH HOH 0 . 
CJ 36 HOH 5163 9224 876  HOH HOH 0 . 
CJ 36 HOH 5164 9225 877  HOH HOH 0 . 
CJ 36 HOH 5165 9226 878  HOH HOH 0 . 
CJ 36 HOH 5166 9227 879  HOH HOH 0 . 
CJ 36 HOH 5167 9228 880  HOH HOH 0 . 
CJ 36 HOH 5168 9229 881  HOH HOH 0 . 
CJ 36 HOH 5169 9230 883  HOH HOH 0 . 
CJ 36 HOH 5170 9231 884  HOH HOH 0 . 
CJ 36 HOH 5171 9232 885  HOH HOH 0 . 
CJ 36 HOH 5172 9233 886  HOH HOH 0 . 
CJ 36 HOH 5173 9234 888  HOH HOH 0 . 
CJ 36 HOH 5174 9235 889  HOH HOH 0 . 
CJ 36 HOH 5175 9236 890  HOH HOH 0 . 
CJ 36 HOH 5176 9237 891  HOH HOH 0 . 
CJ 36 HOH 5177 9238 894  HOH HOH 0 . 
CJ 36 HOH 5178 9239 895  HOH HOH 0 . 
CJ 36 HOH 5179 9240 896  HOH HOH 0 . 
CJ 36 HOH 5180 9241 897  HOH HOH 0 . 
CJ 36 HOH 5181 9242 898  HOH HOH 0 . 
CJ 36 HOH 5182 9243 899  HOH HOH 0 . 
CJ 36 HOH 5183 9244 900  HOH HOH 0 . 
CJ 36 HOH 5184 9245 901  HOH HOH 0 . 
CJ 36 HOH 5185 9246 903  HOH HOH 0 . 
CJ 36 HOH 5186 9247 904  HOH HOH 0 . 
CJ 36 HOH 5187 9248 905  HOH HOH 0 . 
CJ 36 HOH 5188 9249 906  HOH HOH 0 . 
CJ 36 HOH 5189 9250 908  HOH HOH 0 . 
CJ 36 HOH 5190 9251 909  HOH HOH 0 . 
CJ 36 HOH 5191 9252 910  HOH HOH 0 . 
CJ 36 HOH 5192 9253 912  HOH HOH 0 . 
CJ 36 HOH 5193 9254 913  HOH HOH 0 . 
CJ 36 HOH 5194 9255 916  HOH HOH 0 . 
CJ 36 HOH 5195 9256 917  HOH HOH 0 . 
CJ 36 HOH 5196 9257 918  HOH HOH 0 . 
CJ 36 HOH 5197 9258 919  HOH HOH 0 . 
CJ 36 HOH 5198 9259 920  HOH HOH 0 . 
CJ 36 HOH 5199 9260 923  HOH HOH 0 . 
CJ 36 HOH 5200 9261 925  HOH HOH 0 . 
CJ 36 HOH 5201 9262 928  HOH HOH 0 . 
CJ 36 HOH 5202 9263 929  HOH HOH 0 . 
CJ 36 HOH 5203 9264 931  HOH HOH 0 . 
CJ 36 HOH 5204 9265 932  HOH HOH 0 . 
CJ 36 HOH 5205 9266 934  HOH HOH 0 . 
CJ 36 HOH 5206 9267 939  HOH HOH 0 . 
CJ 36 HOH 5207 9268 940  HOH HOH 0 . 
CJ 36 HOH 5208 9269 942  HOH HOH 0 . 
CJ 36 HOH 5209 9270 944  HOH HOH 0 . 
CJ 36 HOH 5210 9271 945  HOH HOH 0 . 
CJ 36 HOH 5211 9272 946  HOH HOH 0 . 
CJ 36 HOH 5212 9273 947  HOH HOH 0 . 
CJ 36 HOH 5213 9274 949  HOH HOH 0 . 
CJ 36 HOH 5214 9275 950  HOH HOH 0 . 
CJ 36 HOH 5215 9276 951  HOH HOH 0 . 
CJ 36 HOH 5216 9277 952  HOH HOH 0 . 
CJ 36 HOH 5217 9278 953  HOH HOH 0 . 
CJ 36 HOH 5218 9279 954  HOH HOH 0 . 
CJ 36 HOH 5219 9280 955  HOH HOH 0 . 
CJ 36 HOH 5220 9281 956  HOH HOH 0 . 
CJ 36 HOH 5221 9282 957  HOH HOH 0 . 
CJ 36 HOH 5222 9283 958  HOH HOH 0 . 
CJ 36 HOH 5223 9284 959  HOH HOH 0 . 
CJ 36 HOH 5224 9285 961  HOH HOH 0 . 
CJ 36 HOH 5225 9286 962  HOH HOH 0 . 
CJ 36 HOH 5226 9287 963  HOH HOH 0 . 
CJ 36 HOH 5227 9288 964  HOH HOH 0 . 
CJ 36 HOH 5228 9289 965  HOH HOH 0 . 
CJ 36 HOH 5229 9290 966  HOH HOH 0 . 
CJ 36 HOH 5230 9291 967  HOH HOH 0 . 
CJ 36 HOH 5231 9292 968  HOH HOH 0 . 
CJ 36 HOH 5232 9293 969  HOH HOH 0 . 
CJ 36 HOH 5233 9294 970  HOH HOH 0 . 
CJ 36 HOH 5234 9295 971  HOH HOH 0 . 
CJ 36 HOH 5235 9296 974  HOH HOH 0 . 
CJ 36 HOH 5236 9297 975  HOH HOH 0 . 
CJ 36 HOH 5237 9298 976  HOH HOH 0 . 
CJ 36 HOH 5238 9299 977  HOH HOH 0 . 
CJ 36 HOH 5239 9300 978  HOH HOH 0 . 
CJ 36 HOH 5240 9301 979  HOH HOH 0 . 
CJ 36 HOH 5241 9302 980  HOH HOH 0 . 
CJ 36 HOH 5242 9303 983  HOH HOH 0 . 
CJ 36 HOH 5243 9304 984  HOH HOH 0 . 
CJ 36 HOH 5244 9305 985  HOH HOH 0 . 
CJ 36 HOH 5245 9306 987  HOH HOH 0 . 
CJ 36 HOH 5246 9307 989  HOH HOH 0 . 
CJ 36 HOH 5247 9308 990  HOH HOH 0 . 
CJ 36 HOH 5248 9309 993  HOH HOH 0 . 
CJ 36 HOH 5249 9310 994  HOH HOH 0 . 
CJ 36 HOH 5250 9311 996  HOH HOH 0 . 
CJ 36 HOH 5251 9312 997  HOH HOH 0 . 
CJ 36 HOH 5252 9313 999  HOH HOH 0 . 
CJ 36 HOH 5253 9314 1000 HOH HOH 0 . 
CJ 36 HOH 5254 9315 1001 HOH HOH 0 . 
CJ 36 HOH 5255 9316 1002 HOH HOH 0 . 
CJ 36 HOH 5256 9317 1003 HOH HOH 0 . 
CJ 36 HOH 5257 9318 1005 HOH HOH 0 . 
CJ 36 HOH 5258 9319 1008 HOH HOH 0 . 
CJ 36 HOH 5259 9320 1009 HOH HOH 0 . 
CJ 36 HOH 5260 9321 1010 HOH HOH 0 . 
CJ 36 HOH 5261 9322 1011 HOH HOH 0 . 
CJ 36 HOH 5262 9323 1012 HOH HOH 0 . 
CJ 36 HOH 5263 9324 1013 HOH HOH 0 . 
CJ 36 HOH 5264 9325 1014 HOH HOH 0 . 
CJ 36 HOH 5265 9326 1015 HOH HOH 0 . 
CJ 36 HOH 5266 9327 1016 HOH HOH 0 . 
CJ 36 HOH 5267 9328 1021 HOH HOH 0 . 
CJ 36 HOH 5268 9329 1022 HOH HOH 0 . 
CJ 36 HOH 5269 9330 1023 HOH HOH 0 . 
CJ 36 HOH 5270 9331 1024 HOH HOH 0 . 
CJ 36 HOH 5271 9332 1025 HOH HOH 0 . 
CJ 36 HOH 5272 9333 1027 HOH HOH 0 . 
CJ 36 HOH 5273 9334 1028 HOH HOH 0 . 
CJ 36 HOH 5274 9335 1029 HOH HOH 0 . 
CJ 36 HOH 5275 9336 1030 HOH HOH 0 . 
CJ 36 HOH 5276 9337 1032 HOH HOH 0 . 
CJ 36 HOH 5277 9338 1034 HOH HOH 0 . 
CJ 36 HOH 5278 9339 1035 HOH HOH 0 . 
CJ 36 HOH 5279 9340 1036 HOH HOH 0 . 
CJ 36 HOH 5280 9341 1037 HOH HOH 0 . 
CJ 36 HOH 5281 9342 1038 HOH HOH 0 . 
CJ 36 HOH 5282 9343 1040 HOH HOH 0 . 
CJ 36 HOH 5283 9344 1042 HOH HOH 0 . 
CJ 36 HOH 5284 9345 1043 HOH HOH 0 . 
CJ 36 HOH 5285 9346 1044 HOH HOH 0 . 
CJ 36 HOH 5286 9347 1045 HOH HOH 0 . 
CJ 36 HOH 5287 9348 1046 HOH HOH 0 . 
CJ 36 HOH 5288 9349 1050 HOH HOH 0 . 
CJ 36 HOH 5289 9350 1052 HOH HOH 0 . 
CJ 36 HOH 5290 9351 1055 HOH HOH 0 . 
CJ 36 HOH 5291 9352 1057 HOH HOH 0 . 
CJ 36 HOH 5292 9353 1058 HOH HOH 0 . 
CJ 36 HOH 5293 9354 1059 HOH HOH 0 . 
CJ 36 HOH 5294 9355 1060 HOH HOH 0 . 
CJ 36 HOH 5295 9356 1061 HOH HOH 0 . 
CJ 36 HOH 5296 9357 1062 HOH HOH 0 . 
CJ 36 HOH 5297 9358 1063 HOH HOH 0 . 
CJ 36 HOH 5298 9359 1064 HOH HOH 0 . 
CJ 36 HOH 5299 9360 1065 HOH HOH 0 . 
CJ 36 HOH 5300 9361 1067 HOH HOH 0 . 
CJ 36 HOH 5301 9362 1070 HOH HOH 0 . 
CJ 36 HOH 5302 9363 1071 HOH HOH 0 . 
CJ 36 HOH 5303 9364 1072 HOH HOH 0 . 
CJ 36 HOH 5304 9365 1073 HOH HOH 0 . 
CJ 36 HOH 5305 9366 1075 HOH HOH 0 . 
CJ 36 HOH 5306 9367 1077 HOH HOH 0 . 
CJ 36 HOH 5307 9368 1078 HOH HOH 0 . 
CJ 36 HOH 5308 9369 1079 HOH HOH 0 . 
CJ 36 HOH 5309 9370 1080 HOH HOH 0 . 
CJ 36 HOH 5310 9371 1081 HOH HOH 0 . 
CJ 36 HOH 5311 9372 1082 HOH HOH 0 . 
CJ 36 HOH 5312 9373 1083 HOH HOH 0 . 
CJ 36 HOH 5313 9374 1084 HOH HOH 0 . 
CJ 36 HOH 5314 9375 1085 HOH HOH 0 . 
CJ 36 HOH 5315 9376 1086 HOH HOH 0 . 
CJ 36 HOH 5316 9377 1087 HOH HOH 0 . 
CJ 36 HOH 5317 9378 1088 HOH HOH 0 . 
CJ 36 HOH 5318 9379 1089 HOH HOH 0 . 
CJ 36 HOH 5319 9380 1090 HOH HOH 0 . 
CJ 36 HOH 5320 9381 1091 HOH HOH 0 . 
CJ 36 HOH 5321 9382 1092 HOH HOH 0 . 
CJ 36 HOH 5322 9383 1093 HOH HOH 0 . 
CJ 36 HOH 5323 9384 1094 HOH HOH 0 . 
CJ 36 HOH 5324 9385 1095 HOH HOH 0 . 
CJ 36 HOH 5325 9386 1096 HOH HOH 0 . 
CJ 36 HOH 5326 9387 1097 HOH HOH 0 . 
CJ 36 HOH 5327 9388 1098 HOH HOH 0 . 
CJ 36 HOH 5328 9389 1100 HOH HOH 0 . 
CJ 36 HOH 5329 9390 1101 HOH HOH 0 . 
CJ 36 HOH 5330 9391 1103 HOH HOH 0 . 
CJ 36 HOH 5331 9392 1104 HOH HOH 0 . 
CJ 36 HOH 5332 9393 1105 HOH HOH 0 . 
CJ 36 HOH 5333 9394 1106 HOH HOH 0 . 
CJ 36 HOH 5334 9395 1107 HOH HOH 0 . 
CJ 36 HOH 5335 9396 1108 HOH HOH 0 . 
CJ 36 HOH 5336 9397 1109 HOH HOH 0 . 
CJ 36 HOH 5337 9398 1110 HOH HOH 0 . 
CJ 36 HOH 5338 9399 1111 HOH HOH 0 . 
CJ 36 HOH 5339 9400 1112 HOH HOH 0 . 
CJ 36 HOH 5340 9401 1113 HOH HOH 0 . 
CJ 36 HOH 5341 9402 1114 HOH HOH 0 . 
CJ 36 HOH 5342 9403 1115 HOH HOH 0 . 
CJ 36 HOH 5343 9404 1116 HOH HOH 0 . 
CJ 36 HOH 5344 9405 1117 HOH HOH 0 . 
CJ 36 HOH 5345 9406 1119 HOH HOH 0 . 
CJ 36 HOH 5346 9407 1122 HOH HOH 0 . 
CJ 36 HOH 5347 9408 1125 HOH HOH 0 . 
CJ 36 HOH 5348 9409 1126 HOH HOH 0 . 
CJ 36 HOH 5349 9410 1127 HOH HOH 0 . 
CJ 36 HOH 5350 9411 1128 HOH HOH 0 . 
CJ 36 HOH 5351 9412 1129 HOH HOH 0 . 
CJ 36 HOH 5352 9413 1130 HOH HOH 0 . 
CJ 36 HOH 5353 9414 1131 HOH HOH 0 . 
CJ 36 HOH 5354 9415 1134 HOH HOH 0 . 
CJ 36 HOH 5355 9416 1135 HOH HOH 0 . 
CJ 36 HOH 5356 9417 1138 HOH HOH 0 . 
CJ 36 HOH 5357 9418 1142 HOH HOH 0 . 
CJ 36 HOH 5358 9419 1143 HOH HOH 0 . 
CJ 36 HOH 5359 9420 1144 HOH HOH 0 . 
CJ 36 HOH 5360 9421 1145 HOH HOH 0 . 
CJ 36 HOH 5361 9422 1146 HOH HOH 0 . 
CJ 36 HOH 5362 9423 1147 HOH HOH 0 . 
CJ 36 HOH 5363 9424 1148 HOH HOH 0 . 
CJ 36 HOH 5364 9425 1149 HOH HOH 0 . 
CJ 36 HOH 5365 9426 1150 HOH HOH 0 . 
CJ 36 HOH 5366 9427 1151 HOH HOH 0 . 
CJ 36 HOH 5367 9428 1152 HOH HOH 0 . 
CJ 36 HOH 5368 9429 1153 HOH HOH 0 . 
CJ 36 HOH 5369 9430 1155 HOH HOH 0 . 
CJ 36 HOH 5370 9431 1156 HOH HOH 0 . 
CJ 36 HOH 5371 9432 1157 HOH HOH 0 . 
CJ 36 HOH 5372 9433 1158 HOH HOH 0 . 
CJ 36 HOH 5373 9434 1160 HOH HOH 0 . 
CJ 36 HOH 5374 9435 1161 HOH HOH 0 . 
CJ 36 HOH 5375 9436 1162 HOH HOH 0 . 
CJ 36 HOH 5376 9437 1164 HOH HOH 0 . 
CJ 36 HOH 5377 9438 1166 HOH HOH 0 . 
CJ 36 HOH 5378 9439 1167 HOH HOH 0 . 
CJ 36 HOH 5379 9440 1168 HOH HOH 0 . 
CJ 36 HOH 5380 9441 1169 HOH HOH 0 . 
CJ 36 HOH 5381 9442 1170 HOH HOH 0 . 
CJ 36 HOH 5382 9443 1171 HOH HOH 0 . 
CJ 36 HOH 5383 9444 1172 HOH HOH 0 . 
CJ 36 HOH 5384 9445 1173 HOH HOH 0 . 
CJ 36 HOH 5385 9446 1174 HOH HOH 0 . 
CJ 36 HOH 5386 9447 1175 HOH HOH 0 . 
CJ 36 HOH 5387 9448 1176 HOH HOH 0 . 
CJ 36 HOH 5388 9449 1177 HOH HOH 0 . 
CJ 36 HOH 5389 9450 1178 HOH HOH 0 . 
CJ 36 HOH 5390 9451 1179 HOH HOH 0 . 
CJ 36 HOH 5391 9452 1180 HOH HOH 0 . 
CJ 36 HOH 5392 9453 1181 HOH HOH 0 . 
CJ 36 HOH 5393 9454 1182 HOH HOH 0 . 
CJ 36 HOH 5394 9455 1183 HOH HOH 0 . 
CJ 36 HOH 5395 9456 1184 HOH HOH 0 . 
CJ 36 HOH 5396 9457 1186 HOH HOH 0 . 
CJ 36 HOH 5397 9458 1187 HOH HOH 0 . 
CJ 36 HOH 5398 9459 1189 HOH HOH 0 . 
CJ 36 HOH 5399 9460 1190 HOH HOH 0 . 
CJ 36 HOH 5400 9461 1191 HOH HOH 0 . 
CJ 36 HOH 5401 9462 1192 HOH HOH 0 . 
CJ 36 HOH 5402 9463 1194 HOH HOH 0 . 
CJ 36 HOH 5403 9464 1195 HOH HOH 0 . 
CJ 36 HOH 5404 9465 1196 HOH HOH 0 . 
CJ 36 HOH 5405 9466 1199 HOH HOH 0 . 
CJ 36 HOH 5406 9467 1201 HOH HOH 0 . 
CJ 36 HOH 5407 9468 1202 HOH HOH 0 . 
CJ 36 HOH 5408 9469 1203 HOH HOH 0 . 
CJ 36 HOH 5409 9470 1204 HOH HOH 0 . 
CJ 36 HOH 5410 9471 1205 HOH HOH 0 . 
CJ 36 HOH 5411 9472 1206 HOH HOH 0 . 
CJ 36 HOH 5412 9473 1207 HOH HOH 0 . 
CJ 36 HOH 5413 9474 1208 HOH HOH 0 . 
CJ 36 HOH 5414 9475 1210 HOH HOH 0 . 
CJ 36 HOH 5415 9476 1211 HOH HOH 0 . 
CJ 36 HOH 5416 9477 1212 HOH HOH 0 . 
CJ 36 HOH 5417 9478 1213 HOH HOH 0 . 
CJ 36 HOH 5418 9479 1214 HOH HOH 0 . 
CJ 36 HOH 5419 9480 1217 HOH HOH 0 . 
CJ 36 HOH 5420 9481 1218 HOH HOH 0 . 
CJ 36 HOH 5421 9482 1219 HOH HOH 0 . 
CJ 36 HOH 5422 9483 1221 HOH HOH 0 . 
CJ 36 HOH 5423 9484 1222 HOH HOH 0 . 
CJ 36 HOH 5424 9485 1223 HOH HOH 0 . 
CJ 36 HOH 5425 9486 1224 HOH HOH 0 . 
CJ 36 HOH 5426 9487 1225 HOH HOH 0 . 
CJ 36 HOH 5427 9488 1227 HOH HOH 0 . 
CJ 36 HOH 5428 9489 1229 HOH HOH 0 . 
CJ 36 HOH 5429 9490 1230 HOH HOH 0 . 
CJ 36 HOH 5430 9491 1231 HOH HOH 0 . 
CJ 36 HOH 5431 9492 1232 HOH HOH 0 . 
CJ 36 HOH 5432 9493 1233 HOH HOH 0 . 
CJ 36 HOH 5433 9494 1235 HOH HOH 0 . 
CJ 36 HOH 5434 9495 1237 HOH HOH 0 . 
CJ 36 HOH 5435 9496 1239 HOH HOH 0 . 
CJ 36 HOH 5436 9497 1241 HOH HOH 0 . 
CJ 36 HOH 5437 9498 1244 HOH HOH 0 . 
CJ 36 HOH 5438 9499 1245 HOH HOH 0 . 
CJ 36 HOH 5439 9500 1246 HOH HOH 0 . 
CJ 36 HOH 5440 9501 1247 HOH HOH 0 . 
CJ 36 HOH 5441 9502 1248 HOH HOH 0 . 
CJ 36 HOH 5442 9503 1249 HOH HOH 0 . 
CJ 36 HOH 5443 9504 1250 HOH HOH 0 . 
CJ 36 HOH 5444 9505 1251 HOH HOH 0 . 
CJ 36 HOH 5445 9506 1252 HOH HOH 0 . 
CJ 36 HOH 5446 9507 1253 HOH HOH 0 . 
CJ 36 HOH 5447 9508 1255 HOH HOH 0 . 
CJ 36 HOH 5448 9509 1256 HOH HOH 0 . 
CJ 36 HOH 5449 9510 1258 HOH HOH 0 . 
CJ 36 HOH 5450 9511 1260 HOH HOH 0 . 
CJ 36 HOH 5451 9512 1261 HOH HOH 0 . 
CJ 36 HOH 5452 9513 1262 HOH HOH 0 . 
CJ 36 HOH 5453 9514 1263 HOH HOH 0 . 
CJ 36 HOH 5454 9515 1264 HOH HOH 0 . 
CJ 36 HOH 5455 9516 1265 HOH HOH 0 . 
CJ 36 HOH 5456 9517 1267 HOH HOH 0 . 
CJ 36 HOH 5457 9518 1268 HOH HOH 0 . 
CJ 36 HOH 5458 9519 1270 HOH HOH 0 . 
CJ 36 HOH 5459 9520 1271 HOH HOH 0 . 
CJ 36 HOH 5460 9521 1272 HOH HOH 0 . 
CJ 36 HOH 5461 9522 1273 HOH HOH 0 . 
CJ 36 HOH 5462 9523 1274 HOH HOH 0 . 
CJ 36 HOH 5463 9524 1275 HOH HOH 0 . 
CJ 36 HOH 5464 9525 1277 HOH HOH 0 . 
CJ 36 HOH 5465 9526 1278 HOH HOH 0 . 
CJ 36 HOH 5466 9527 1279 HOH HOH 0 . 
CJ 36 HOH 5467 9528 1281 HOH HOH 0 . 
CJ 36 HOH 5468 9529 1282 HOH HOH 0 . 
CJ 36 HOH 5469 9530 1283 HOH HOH 0 . 
CJ 36 HOH 5470 9531 1284 HOH HOH 0 . 
CJ 36 HOH 5471 9532 1285 HOH HOH 0 . 
CJ 36 HOH 5472 9533 1286 HOH HOH 0 . 
CJ 36 HOH 5473 9534 1287 HOH HOH 0 . 
CJ 36 HOH 5474 9535 1288 HOH HOH 0 . 
CJ 36 HOH 5475 9536 1289 HOH HOH 0 . 
CJ 36 HOH 5476 9537 1290 HOH HOH 0 . 
CJ 36 HOH 5477 9538 1291 HOH HOH 0 . 
CJ 36 HOH 5478 9539 1292 HOH HOH 0 . 
CJ 36 HOH 5479 9540 1296 HOH HOH 0 . 
CJ 36 HOH 5480 9541 1297 HOH HOH 0 . 
CJ 36 HOH 5481 9542 1298 HOH HOH 0 . 
CJ 36 HOH 5482 9543 1299 HOH HOH 0 . 
CJ 36 HOH 5483 9544 1300 HOH HOH 0 . 
CJ 36 HOH 5484 9545 1302 HOH HOH 0 . 
CJ 36 HOH 5485 9546 1303 HOH HOH 0 . 
CJ 36 HOH 5486 9547 1304 HOH HOH 0 . 
CJ 36 HOH 5487 9548 1305 HOH HOH 0 . 
CJ 36 HOH 5488 9549 1308 HOH HOH 0 . 
CJ 36 HOH 5489 9550 1309 HOH HOH 0 . 
CJ 36 HOH 5490 9551 1311 HOH HOH 0 . 
CJ 36 HOH 5491 9552 1312 HOH HOH 0 . 
CJ 36 HOH 5492 9553 1313 HOH HOH 0 . 
CJ 36 HOH 5493 9554 1315 HOH HOH 0 . 
CJ 36 HOH 5494 9555 1318 HOH HOH 0 . 
CJ 36 HOH 5495 9556 1319 HOH HOH 0 . 
CJ 36 HOH 5496 9557 1320 HOH HOH 0 . 
CJ 36 HOH 5497 9558 1321 HOH HOH 0 . 
CJ 36 HOH 5498 9559 1322 HOH HOH 0 . 
CJ 36 HOH 5499 9560 1323 HOH HOH 0 . 
CJ 36 HOH 5500 9561 1325 HOH HOH 0 . 
CJ 36 HOH 5501 9562 1326 HOH HOH 0 . 
CJ 36 HOH 5502 9563 1327 HOH HOH 0 . 
CJ 36 HOH 5503 9564 1328 HOH HOH 0 . 
CJ 36 HOH 5504 9565 1330 HOH HOH 0 . 
CJ 36 HOH 5505 9566 1331 HOH HOH 0 . 
CJ 36 HOH 5506 9567 1332 HOH HOH 0 . 
CJ 36 HOH 5507 9568 1333 HOH HOH 0 . 
CJ 36 HOH 5508 9569 1335 HOH HOH 0 . 
CJ 36 HOH 5509 9570 1336 HOH HOH 0 . 
CJ 36 HOH 5510 9571 1337 HOH HOH 0 . 
CJ 36 HOH 5511 9572 1338 HOH HOH 0 . 
CJ 36 HOH 5512 9573 1339 HOH HOH 0 . 
CJ 36 HOH 5513 9574 1340 HOH HOH 0 . 
CJ 36 HOH 5514 9575 1341 HOH HOH 0 . 
CJ 36 HOH 5515 9576 1342 HOH HOH 0 . 
CJ 36 HOH 5516 9577 1343 HOH HOH 0 . 
CJ 36 HOH 5517 9578 1344 HOH HOH 0 . 
CJ 36 HOH 5518 9579 1345 HOH HOH 0 . 
CJ 36 HOH 5519 9580 1346 HOH HOH 0 . 
CJ 36 HOH 5520 9581 1347 HOH HOH 0 . 
CJ 36 HOH 5521 9582 1348 HOH HOH 0 . 
CJ 36 HOH 5522 9583 1349 HOH HOH 0 . 
CJ 36 HOH 5523 9584 1350 HOH HOH 0 . 
CJ 36 HOH 5524 9585 1351 HOH HOH 0 . 
CJ 36 HOH 5525 9586 1352 HOH HOH 0 . 
CJ 36 HOH 5526 9587 1353 HOH HOH 0 . 
CJ 36 HOH 5527 9588 1354 HOH HOH 0 . 
CJ 36 HOH 5528 9589 1355 HOH HOH 0 . 
CJ 36 HOH 5529 9590 1357 HOH HOH 0 . 
CJ 36 HOH 5530 9591 1358 HOH HOH 0 . 
CJ 36 HOH 5531 9592 1359 HOH HOH 0 . 
CJ 36 HOH 5532 9593 1362 HOH HOH 0 . 
CJ 36 HOH 5533 9594 1363 HOH HOH 0 . 
CJ 36 HOH 5534 9595 1364 HOH HOH 0 . 
CJ 36 HOH 5535 9596 1365 HOH HOH 0 . 
CJ 36 HOH 5536 9597 1366 HOH HOH 0 . 
CJ 36 HOH 5537 9598 1367 HOH HOH 0 . 
CJ 36 HOH 5538 9599 1368 HOH HOH 0 . 
CJ 36 HOH 5539 9600 1369 HOH HOH 0 . 
CJ 36 HOH 5540 9601 1370 HOH HOH 0 . 
CJ 36 HOH 5541 9602 1371 HOH HOH 0 . 
CJ 36 HOH 5542 9603 1374 HOH HOH 0 . 
CJ 36 HOH 5543 9604 1375 HOH HOH 0 . 
CJ 36 HOH 5544 9605 1378 HOH HOH 0 . 
CJ 36 HOH 5545 9606 1379 HOH HOH 0 . 
CJ 36 HOH 5546 9607 1380 HOH HOH 0 . 
CJ 36 HOH 5547 9608 1381 HOH HOH 0 . 
CJ 36 HOH 5548 9609 1382 HOH HOH 0 . 
CJ 36 HOH 5549 9610 1383 HOH HOH 0 . 
CJ 36 HOH 5550 9611 1384 HOH HOH 0 . 
CJ 36 HOH 5551 9612 1385 HOH HOH 0 . 
CJ 36 HOH 5552 9613 1386 HOH HOH 0 . 
CJ 36 HOH 5553 9614 1388 HOH HOH 0 . 
CJ 36 HOH 5554 9615 1389 HOH HOH 0 . 
CJ 36 HOH 5555 9616 1390 HOH HOH 0 . 
CJ 36 HOH 5556 9617 1392 HOH HOH 0 . 
CJ 36 HOH 5557 9618 1393 HOH HOH 0 . 
CJ 36 HOH 5558 9619 1394 HOH HOH 0 . 
CJ 36 HOH 5559 9620 1395 HOH HOH 0 . 
CJ 36 HOH 5560 9621 1396 HOH HOH 0 . 
CJ 36 HOH 5561 9622 1397 HOH HOH 0 . 
CJ 36 HOH 5562 9623 1398 HOH HOH 0 . 
CJ 36 HOH 5563 9624 1399 HOH HOH 0 . 
CJ 36 HOH 5564 9625 1400 HOH HOH 0 . 
CJ 36 HOH 5565 9626 1401 HOH HOH 0 . 
CJ 36 HOH 5566 9627 1402 HOH HOH 0 . 
CJ 36 HOH 5567 9628 1403 HOH HOH 0 . 
CJ 36 HOH 5568 9629 1404 HOH HOH 0 . 
CJ 36 HOH 5569 9630 1407 HOH HOH 0 . 
CJ 36 HOH 5570 9631 1408 HOH HOH 0 . 
CJ 36 HOH 5571 9632 1409 HOH HOH 0 . 
CJ 36 HOH 5572 9633 1410 HOH HOH 0 . 
CJ 36 HOH 5573 9634 1411 HOH HOH 0 . 
CJ 36 HOH 5574 9635 1412 HOH HOH 0 . 
CJ 36 HOH 5575 9636 1414 HOH HOH 0 . 
CJ 36 HOH 5576 9637 1415 HOH HOH 0 . 
CJ 36 HOH 5577 9638 1418 HOH HOH 0 . 
CJ 36 HOH 5578 9639 1419 HOH HOH 0 . 
CJ 36 HOH 5579 9640 1420 HOH HOH 0 . 
CJ 36 HOH 5580 9641 1421 HOH HOH 0 . 
CJ 36 HOH 5581 9642 1423 HOH HOH 0 . 
CJ 36 HOH 5582 9643 1424 HOH HOH 0 . 
CJ 36 HOH 5583 9644 1425 HOH HOH 0 . 
CJ 36 HOH 5584 9645 1426 HOH HOH 0 . 
CJ 36 HOH 5585 9646 1427 HOH HOH 0 . 
CJ 36 HOH 5586 9647 1429 HOH HOH 0 . 
CJ 36 HOH 5587 9648 1430 HOH HOH 0 . 
CJ 36 HOH 5588 9649 1431 HOH HOH 0 . 
CJ 36 HOH 5589 9650 1432 HOH HOH 0 . 
CJ 36 HOH 5590 9651 1435 HOH HOH 0 . 
CJ 36 HOH 5591 9652 1438 HOH HOH 0 . 
CJ 36 HOH 5592 9653 1439 HOH HOH 0 . 
CJ 36 HOH 5593 9654 1440 HOH HOH 0 . 
CJ 36 HOH 5594 9655 1442 HOH HOH 0 . 
CJ 36 HOH 5595 9656 1443 HOH HOH 0 . 
CJ 36 HOH 5596 9657 1444 HOH HOH 0 . 
CJ 36 HOH 5597 9658 1445 HOH HOH 0 . 
CJ 36 HOH 5598 9659 1446 HOH HOH 0 . 
CJ 36 HOH 5599 9660 1448 HOH HOH 0 . 
CJ 36 HOH 5600 9661 1451 HOH HOH 0 . 
CJ 36 HOH 5601 9662 1452 HOH HOH 0 . 
CJ 36 HOH 5602 9663 1453 HOH HOH 0 . 
CJ 36 HOH 5603 9664 1455 HOH HOH 0 . 
CJ 36 HOH 5604 9665 1456 HOH HOH 0 . 
CJ 36 HOH 5605 9666 1457 HOH HOH 0 . 
CJ 36 HOH 5606 9667 1459 HOH HOH 0 . 
CJ 36 HOH 5607 9668 1460 HOH HOH 0 . 
CJ 36 HOH 5608 9669 1461 HOH HOH 0 . 
CJ 36 HOH 5609 9670 1462 HOH HOH 0 . 
CJ 36 HOH 5610 9671 1463 HOH HOH 0 . 
CJ 36 HOH 5611 9672 1464 HOH HOH 0 . 
CJ 36 HOH 5612 9673 1465 HOH HOH 0 . 
CJ 36 HOH 5613 9674 1467 HOH HOH 0 . 
CJ 36 HOH 5614 9675 1468 HOH HOH 0 . 
CJ 36 HOH 5615 9676 1469 HOH HOH 0 . 
CJ 36 HOH 5616 9677 1470 HOH HOH 0 . 
CJ 36 HOH 5617 9678 1471 HOH HOH 0 . 
CJ 36 HOH 5618 9679 1472 HOH HOH 0 . 
CJ 36 HOH 5619 9680 1473 HOH HOH 0 . 
CJ 36 HOH 5620 9681 1474 HOH HOH 0 . 
CJ 36 HOH 5621 9682 1475 HOH HOH 0 . 
CJ 36 HOH 5622 9683 1476 HOH HOH 0 . 
CJ 36 HOH 5623 9684 1477 HOH HOH 0 . 
CJ 36 HOH 5624 9685 1478 HOH HOH 0 . 
CJ 36 HOH 5625 9686 1480 HOH HOH 0 . 
CJ 36 HOH 5626 9687 1481 HOH HOH 0 . 
CJ 36 HOH 5627 9688 1482 HOH HOH 0 . 
CJ 36 HOH 5628 9689 1483 HOH HOH 0 . 
CJ 36 HOH 5629 9690 1485 HOH HOH 0 . 
CJ 36 HOH 5630 9691 1486 HOH HOH 0 . 
CJ 36 HOH 5631 9692 1487 HOH HOH 0 . 
CJ 36 HOH 5632 9693 1488 HOH HOH 0 . 
CJ 36 HOH 5633 9694 1490 HOH HOH 0 . 
CJ 36 HOH 5634 9695 1491 HOH HOH 0 . 
CJ 36 HOH 5635 9696 1493 HOH HOH 0 . 
CJ 36 HOH 5636 9697 1494 HOH HOH 0 . 
CJ 36 HOH 5637 9698 1495 HOH HOH 0 . 
CJ 36 HOH 5638 9699 1496 HOH HOH 0 . 
CJ 36 HOH 5639 9700 1497 HOH HOH 0 . 
CJ 36 HOH 5640 9701 1498 HOH HOH 0 . 
CJ 36 HOH 5641 9702 1499 HOH HOH 0 . 
CJ 36 HOH 5642 9703 1500 HOH HOH 0 . 
CJ 36 HOH 5643 9704 1501 HOH HOH 0 . 
CJ 36 HOH 5644 9705 1502 HOH HOH 0 . 
CJ 36 HOH 5645 9706 1503 HOH HOH 0 . 
CJ 36 HOH 5646 9707 1505 HOH HOH 0 . 
CJ 36 HOH 5647 9708 1506 HOH HOH 0 . 
CJ 36 HOH 5648 9709 1507 HOH HOH 0 . 
CJ 36 HOH 5649 9710 1508 HOH HOH 0 . 
CJ 36 HOH 5650 9711 1510 HOH HOH 0 . 
CJ 36 HOH 5651 9712 1511 HOH HOH 0 . 
CJ 36 HOH 5652 9713 1512 HOH HOH 0 . 
CJ 36 HOH 5653 9714 1513 HOH HOH 0 . 
CJ 36 HOH 5654 9715 1514 HOH HOH 0 . 
CJ 36 HOH 5655 9716 1515 HOH HOH 0 . 
CJ 36 HOH 5656 9717 1516 HOH HOH 0 . 
CJ 36 HOH 5657 9718 1518 HOH HOH 0 . 
CJ 36 HOH 5658 9719 1519 HOH HOH 0 . 
CJ 36 HOH 5659 9720 1520 HOH HOH 0 . 
CJ 36 HOH 5660 9721 1521 HOH HOH 0 . 
CJ 36 HOH 5661 9722 1522 HOH HOH 0 . 
CJ 36 HOH 5662 9723 1523 HOH HOH 0 . 
CJ 36 HOH 5663 9724 1525 HOH HOH 0 . 
CJ 36 HOH 5664 9725 1526 HOH HOH 0 . 
CJ 36 HOH 5665 9726 1527 HOH HOH 0 . 
CJ 36 HOH 5666 9727 1529 HOH HOH 0 . 
CJ 36 HOH 5667 9728 1530 HOH HOH 0 . 
CJ 36 HOH 5668 9729 1531 HOH HOH 0 . 
CJ 36 HOH 5669 9730 1532 HOH HOH 0 . 
CJ 36 HOH 5670 9731 1533 HOH HOH 0 . 
CJ 36 HOH 5671 9732 1534 HOH HOH 0 . 
CJ 36 HOH 5672 9733 1535 HOH HOH 0 . 
CJ 36 HOH 5673 9734 1537 HOH HOH 0 . 
CJ 36 HOH 5674 9735 1539 HOH HOH 0 . 
CJ 36 HOH 5675 9736 1540 HOH HOH 0 . 
CJ 36 HOH 5676 9737 1541 HOH HOH 0 . 
CJ 36 HOH 5677 9738 1542 HOH HOH 0 . 
CJ 36 HOH 5678 9739 1543 HOH HOH 0 . 
CJ 36 HOH 5679 9740 1544 HOH HOH 0 . 
CJ 36 HOH 5680 9741 1545 HOH HOH 0 . 
CJ 36 HOH 5681 9742 1546 HOH HOH 0 . 
CJ 36 HOH 5682 9743 1547 HOH HOH 0 . 
CJ 36 HOH 5683 9744 1548 HOH HOH 0 . 
CJ 36 HOH 5684 9745 1549 HOH HOH 0 . 
CJ 36 HOH 5685 9746 1550 HOH HOH 0 . 
CJ 36 HOH 5686 9747 1551 HOH HOH 0 . 
CJ 36 HOH 5687 9748 1552 HOH HOH 0 . 
CJ 36 HOH 5688 9749 1553 HOH HOH 0 . 
CJ 36 HOH 5689 9750 1554 HOH HOH 0 . 
CJ 36 HOH 5690 9751 1555 HOH HOH 0 . 
CJ 36 HOH 5691 9752 1556 HOH HOH 0 . 
CJ 36 HOH 5692 9753 1557 HOH HOH 0 . 
CJ 36 HOH 5693 9754 1558 HOH HOH 0 . 
CJ 36 HOH 5694 9755 1560 HOH HOH 0 . 
CJ 36 HOH 5695 9756 1561 HOH HOH 0 . 
CJ 36 HOH 5696 9757 1562 HOH HOH 0 . 
CJ 36 HOH 5697 9758 1564 HOH HOH 0 . 
CJ 36 HOH 5698 9759 1565 HOH HOH 0 . 
CJ 36 HOH 5699 9760 1566 HOH HOH 0 . 
CJ 36 HOH 5700 9761 1567 HOH HOH 0 . 
CJ 36 HOH 5701 9762 1568 HOH HOH 0 . 
CJ 36 HOH 5702 9763 1570 HOH HOH 0 . 
CJ 36 HOH 5703 9764 1572 HOH HOH 0 . 
CJ 36 HOH 5704 9765 1573 HOH HOH 0 . 
CJ 36 HOH 5705 9766 1574 HOH HOH 0 . 
CJ 36 HOH 5706 9767 1575 HOH HOH 0 . 
CJ 36 HOH 5707 9768 1576 HOH HOH 0 . 
CJ 36 HOH 5708 9769 1577 HOH HOH 0 . 
CJ 36 HOH 5709 9770 1578 HOH HOH 0 . 
CJ 36 HOH 5710 9771 1579 HOH HOH 0 . 
CJ 36 HOH 5711 9772 1580 HOH HOH 0 . 
CJ 36 HOH 5712 9773 1582 HOH HOH 0 . 
CJ 36 HOH 5713 9774 1583 HOH HOH 0 . 
CJ 36 HOH 5714 9775 1584 HOH HOH 0 . 
CJ 36 HOH 5715 9776 1585 HOH HOH 0 . 
CJ 36 HOH 5716 9777 1586 HOH HOH 0 . 
CJ 36 HOH 5717 9778 1587 HOH HOH 0 . 
CJ 36 HOH 5718 9779 1588 HOH HOH 0 . 
CJ 36 HOH 5719 9780 1590 HOH HOH 0 . 
CJ 36 HOH 5720 9781 1591 HOH HOH 0 . 
CJ 36 HOH 5721 9782 1592 HOH HOH 0 . 
CJ 36 HOH 5722 9783 1593 HOH HOH 0 . 
CJ 36 HOH 5723 9784 1594 HOH HOH 0 . 
CJ 36 HOH 5724 9785 1595 HOH HOH 0 . 
CJ 36 HOH 5725 9786 1598 HOH HOH 0 . 
CJ 36 HOH 5726 9787 1599 HOH HOH 0 . 
CJ 36 HOH 5727 9788 1600 HOH HOH 0 . 
CJ 36 HOH 5728 9789 1601 HOH HOH 0 . 
CJ 36 HOH 5729 9790 1602 HOH HOH 0 . 
CJ 36 HOH 5730 9791 1603 HOH HOH 0 . 
CJ 36 HOH 5731 9792 1604 HOH HOH 0 . 
CJ 36 HOH 5732 9793 1605 HOH HOH 0 . 
CJ 36 HOH 5733 9794 1606 HOH HOH 0 . 
CJ 36 HOH 5734 9795 1608 HOH HOH 0 . 
CJ 36 HOH 5735 9796 1609 HOH HOH 0 . 
CJ 36 HOH 5736 9797 1610 HOH HOH 0 . 
CJ 36 HOH 5737 9798 1611 HOH HOH 0 . 
CJ 36 HOH 5738 9799 1612 HOH HOH 0 . 
CJ 36 HOH 5739 9800 1613 HOH HOH 0 . 
CJ 36 HOH 5740 9801 1614 HOH HOH 0 . 
CJ 36 HOH 5741 9802 1615 HOH HOH 0 . 
CJ 36 HOH 5742 9803 1616 HOH HOH 0 . 
CJ 36 HOH 5743 9804 1617 HOH HOH 0 . 
CJ 36 HOH 5744 9805 1618 HOH HOH 0 . 
CJ 36 HOH 5745 9806 1619 HOH HOH 0 . 
CJ 36 HOH 5746 9807 1620 HOH HOH 0 . 
CJ 36 HOH 5747 9808 1621 HOH HOH 0 . 
CJ 36 HOH 5748 9809 1622 HOH HOH 0 . 
CJ 36 HOH 5749 9810 1624 HOH HOH 0 . 
CJ 36 HOH 5750 9811 1625 HOH HOH 0 . 
CJ 36 HOH 5751 9812 1626 HOH HOH 0 . 
CJ 36 HOH 5752 9813 1627 HOH HOH 0 . 
CJ 36 HOH 5753 9814 1628 HOH HOH 0 . 
CJ 36 HOH 5754 9815 1630 HOH HOH 0 . 
CJ 36 HOH 5755 9816 1631 HOH HOH 0 . 
CJ 36 HOH 5756 9817 1632 HOH HOH 0 . 
CJ 36 HOH 5757 9818 1633 HOH HOH 0 . 
CJ 36 HOH 5758 9819 1634 HOH HOH 0 . 
CJ 36 HOH 5759 9820 1635 HOH HOH 0 . 
CJ 36 HOH 5760 9821 1636 HOH HOH 0 . 
CJ 36 HOH 5761 9822 1637 HOH HOH 0 . 
CJ 36 HOH 5762 9823 1638 HOH HOH 0 . 
CJ 36 HOH 5763 9824 1640 HOH HOH 0 . 
CJ 36 HOH 5764 9825 1641 HOH HOH 0 . 
CJ 36 HOH 5765 9826 1642 HOH HOH 0 . 
CJ 36 HOH 5766 9827 1643 HOH HOH 0 . 
CJ 36 HOH 5767 9828 1644 HOH HOH 0 . 
CJ 36 HOH 5768 9829 1645 HOH HOH 0 . 
CJ 36 HOH 5769 9830 1646 HOH HOH 0 . 
CJ 36 HOH 5770 9831 1647 HOH HOH 0 . 
CJ 36 HOH 5771 9832 1649 HOH HOH 0 . 
CJ 36 HOH 5772 9833 1650 HOH HOH 0 . 
CJ 36 HOH 5773 9834 1651 HOH HOH 0 . 
CJ 36 HOH 5774 9835 1653 HOH HOH 0 . 
CJ 36 HOH 5775 9836 1654 HOH HOH 0 . 
CJ 36 HOH 5776 9837 1658 HOH HOH 0 . 
CJ 36 HOH 5777 9838 1659 HOH HOH 0 . 
CJ 36 HOH 5778 9839 1660 HOH HOH 0 . 
CJ 36 HOH 5779 9840 1661 HOH HOH 0 . 
CJ 36 HOH 5780 9841 1662 HOH HOH 0 . 
CJ 36 HOH 5781 9842 1663 HOH HOH 0 . 
CJ 36 HOH 5782 9843 1665 HOH HOH 0 . 
CJ 36 HOH 5783 9844 1666 HOH HOH 0 . 
CJ 36 HOH 5784 9845 1667 HOH HOH 0 . 
CJ 36 HOH 5785 9846 1668 HOH HOH 0 . 
CJ 36 HOH 5786 9847 1669 HOH HOH 0 . 
CJ 36 HOH 5787 9848 1670 HOH HOH 0 . 
CJ 36 HOH 5788 9849 1671 HOH HOH 0 . 
CJ 36 HOH 5789 9850 1672 HOH HOH 0 . 
CJ 36 HOH 5790 9851 1673 HOH HOH 0 . 
CJ 36 HOH 5791 9852 1674 HOH HOH 0 . 
CJ 36 HOH 5792 9853 1676 HOH HOH 0 . 
CJ 36 HOH 5793 9854 1677 HOH HOH 0 . 
CJ 36 HOH 5794 9855 1678 HOH HOH 0 . 
CJ 36 HOH 5795 9856 1679 HOH HOH 0 . 
CJ 36 HOH 5796 9857 1682 HOH HOH 0 . 
CJ 36 HOH 5797 9858 1683 HOH HOH 0 . 
CJ 36 HOH 5798 9859 1686 HOH HOH 0 . 
CJ 36 HOH 5799 9860 1688 HOH HOH 0 . 
CJ 36 HOH 5800 9861 1689 HOH HOH 0 . 
CJ 36 HOH 5801 9862 1691 HOH HOH 0 . 
CJ 36 HOH 5802 9863 1693 HOH HOH 0 . 
CJ 36 HOH 5803 9864 1694 HOH HOH 0 . 
CJ 36 HOH 5804 9865 1695 HOH HOH 0 . 
CJ 36 HOH 5805 9866 1696 HOH HOH 0 . 
CJ 36 HOH 5806 9867 1697 HOH HOH 0 . 
CJ 36 HOH 5807 9868 1698 HOH HOH 0 . 
CJ 36 HOH 5808 9869 1700 HOH HOH 0 . 
CJ 36 HOH 5809 9870 1702 HOH HOH 0 . 
CJ 36 HOH 5810 9871 1704 HOH HOH 0 . 
CJ 36 HOH 5811 9872 1705 HOH HOH 0 . 
CJ 36 HOH 5812 9873 1706 HOH HOH 0 . 
CJ 36 HOH 5813 9874 1707 HOH HOH 0 . 
CJ 36 HOH 5814 9875 1708 HOH HOH 0 . 
CJ 36 HOH 5815 9876 1709 HOH HOH 0 . 
CJ 36 HOH 5816 9877 1710 HOH HOH 0 . 
CJ 36 HOH 5817 9878 1712 HOH HOH 0 . 
CJ 36 HOH 5818 9879 1713 HOH HOH 0 . 
CJ 36 HOH 5819 9880 1716 HOH HOH 0 . 
CJ 36 HOH 5820 9881 1717 HOH HOH 0 . 
CJ 36 HOH 5821 9882 1718 HOH HOH 0 . 
CJ 36 HOH 5822 9883 1719 HOH HOH 0 . 
CJ 36 HOH 5823 9884 1720 HOH HOH 0 . 
CJ 36 HOH 5824 9885 1721 HOH HOH 0 . 
CJ 36 HOH 5825 9886 1722 HOH HOH 0 . 
CJ 36 HOH 5826 9887 1723 HOH HOH 0 . 
CJ 36 HOH 5827 9888 1724 HOH HOH 0 . 
CJ 36 HOH 5828 9889 1725 HOH HOH 0 . 
CJ 36 HOH 5829 9890 1726 HOH HOH 0 . 
CJ 36 HOH 5830 9891 1727 HOH HOH 0 . 
CJ 36 HOH 5831 9892 1728 HOH HOH 0 . 
CJ 36 HOH 5832 9893 1729 HOH HOH 0 . 
CJ 36 HOH 5833 9894 1730 HOH HOH 0 . 
CJ 36 HOH 5834 9895 1731 HOH HOH 0 . 
CJ 36 HOH 5835 9896 1732 HOH HOH 0 . 
CJ 36 HOH 5836 9897 1733 HOH HOH 0 . 
CJ 36 HOH 5837 9898 1734 HOH HOH 0 . 
CJ 36 HOH 5838 9899 1735 HOH HOH 0 . 
CJ 36 HOH 5839 9900 1736 HOH HOH 0 . 
CJ 36 HOH 5840 9901 1737 HOH HOH 0 . 
CJ 36 HOH 5841 9902 1738 HOH HOH 0 . 
CJ 36 HOH 5842 9903 1739 HOH HOH 0 . 
CJ 36 HOH 5843 9904 1740 HOH HOH 0 . 
CJ 36 HOH 5844 9905 1741 HOH HOH 0 . 
CJ 36 HOH 5845 9906 1742 HOH HOH 0 . 
CJ 36 HOH 5846 9907 1743 HOH HOH 0 . 
CJ 36 HOH 5847 9908 1744 HOH HOH 0 . 
CJ 36 HOH 5848 9909 1746 HOH HOH 0 . 
CJ 36 HOH 5849 9910 1747 HOH HOH 0 . 
CJ 36 HOH 5850 9911 1748 HOH HOH 0 . 
CJ 36 HOH 5851 9912 1749 HOH HOH 0 . 
CJ 36 HOH 5852 9913 1751 HOH HOH 0 . 
CJ 36 HOH 5853 9914 1752 HOH HOH 0 . 
CJ 36 HOH 5854 9915 1755 HOH HOH 0 . 
CJ 36 HOH 5855 9916 1756 HOH HOH 0 . 
CJ 36 HOH 5856 9917 1757 HOH HOH 0 . 
CJ 36 HOH 5857 9918 1759 HOH HOH 0 . 
CJ 36 HOH 5858 9919 1761 HOH HOH 0 . 
CJ 36 HOH 5859 9920 1763 HOH HOH 0 . 
CJ 36 HOH 5860 9921 1766 HOH HOH 0 . 
CJ 36 HOH 5861 9922 1767 HOH HOH 0 . 
CJ 36 HOH 5862 9923 1768 HOH HOH 0 . 
CJ 36 HOH 5863 9924 1769 HOH HOH 0 . 
CJ 36 HOH 5864 9925 1770 HOH HOH 0 . 
CJ 36 HOH 5865 9926 1771 HOH HOH 0 . 
CJ 36 HOH 5866 9927 1772 HOH HOH 0 . 
CJ 36 HOH 5867 9928 1774 HOH HOH 0 . 
CJ 36 HOH 5868 9929 1775 HOH HOH 0 . 
CJ 36 HOH 5869 9930 1776 HOH HOH 0 . 
CJ 36 HOH 5870 9931 1777 HOH HOH 0 . 
CJ 36 HOH 5871 9932 1780 HOH HOH 0 . 
CJ 36 HOH 5872 9933 1781 HOH HOH 0 . 
CJ 36 HOH 5873 9934 1782 HOH HOH 0 . 
CJ 36 HOH 5874 9935 1783 HOH HOH 0 . 
CJ 36 HOH 5875 9936 1784 HOH HOH 0 . 
CJ 36 HOH 5876 9937 1785 HOH HOH 0 . 
CJ 36 HOH 5877 9938 1786 HOH HOH 0 . 
CJ 36 HOH 5878 9939 1787 HOH HOH 0 . 
CJ 36 HOH 5879 9940 1788 HOH HOH 0 . 
CJ 36 HOH 5880 9941 1789 HOH HOH 0 . 
CJ 36 HOH 5881 9942 1790 HOH HOH 0 . 
CJ 36 HOH 5882 9943 1791 HOH HOH 0 . 
CJ 36 HOH 5883 9944 1792 HOH HOH 0 . 
CJ 36 HOH 5884 9945 1793 HOH HOH 0 . 
CJ 36 HOH 5885 9946 1794 HOH HOH 0 . 
CJ 36 HOH 5886 9947 1797 HOH HOH 0 . 
CJ 36 HOH 5887 9948 1798 HOH HOH 0 . 
CJ 36 HOH 5888 9949 1800 HOH HOH 0 . 
CJ 36 HOH 5889 9950 1801 HOH HOH 0 . 
CJ 36 HOH 5890 9951 1802 HOH HOH 0 . 
CJ 36 HOH 5891 9952 1804 HOH HOH 0 . 
CJ 36 HOH 5892 9953 1805 HOH HOH 0 . 
CJ 36 HOH 5893 9954 1806 HOH HOH 0 . 
CJ 36 HOH 5894 9955 1807 HOH HOH 0 . 
CJ 36 HOH 5895 9956 1808 HOH HOH 0 . 
CJ 36 HOH 5896 9957 1809 HOH HOH 0 . 
CJ 36 HOH 5897 9958 1810 HOH HOH 0 . 
CJ 36 HOH 5898 9959 1811 HOH HOH 0 . 
CJ 36 HOH 5899 9960 1813 HOH HOH 0 . 
CJ 36 HOH 5900 9961 1814 HOH HOH 0 . 
CJ 36 HOH 5901 9962 1816 HOH HOH 0 . 
CJ 36 HOH 5902 9963 1817 HOH HOH 0 . 
CJ 36 HOH 5903 9964 1818 HOH HOH 0 . 
CJ 36 HOH 5904 9965 1819 HOH HOH 0 . 
CJ 36 HOH 5905 9966 1820 HOH HOH 0 . 
CJ 36 HOH 5906 9967 1821 HOH HOH 0 . 
CJ 36 HOH 5907 9968 1823 HOH HOH 0 . 
CJ 36 HOH 5908 9969 1824 HOH HOH 0 . 
CJ 36 HOH 5909 9970 1826 HOH HOH 0 . 
CJ 36 HOH 5910 9971 1827 HOH HOH 0 . 
CJ 36 HOH 5911 9972 1828 HOH HOH 0 . 
CJ 36 HOH 5912 9973 1831 HOH HOH 0 . 
CJ 36 HOH 5913 9974 1832 HOH HOH 0 . 
CJ 36 HOH 5914 9975 1833 HOH HOH 0 . 
CJ 36 HOH 5915 9976 1834 HOH HOH 0 . 
CJ 36 HOH 5916 9977 1836 HOH HOH 0 . 
CJ 36 HOH 5917 9978 1837 HOH HOH 0 . 
CJ 36 HOH 5918 9979 1839 HOH HOH 0 . 
CJ 36 HOH 5919 9980 1842 HOH HOH 0 . 
CJ 36 HOH 5920 9981 1843 HOH HOH 0 . 
CJ 36 HOH 5921 9982 1844 HOH HOH 0 . 
CJ 36 HOH 5922 9983 1845 HOH HOH 0 . 
CJ 36 HOH 5923 9984 1846 HOH HOH 0 . 
CJ 36 HOH 5924 9985 1847 HOH HOH 0 . 
CJ 36 HOH 5925 9986 1848 HOH HOH 0 . 
CJ 36 HOH 5926 9987 1849 HOH HOH 0 . 
CJ 36 HOH 5927 9988 1850 HOH HOH 0 . 
CJ 36 HOH 5928 9989 1851 HOH HOH 0 . 
CJ 36 HOH 5929 9990 1853 HOH HOH 0 . 
CJ 36 HOH 5930 9991 1854 HOH HOH 0 . 
CJ 36 HOH 5931 9992 1855 HOH HOH 0 . 
CJ 36 HOH 5932 9993 1856 HOH HOH 0 . 
CJ 36 HOH 5933 9994 1857 HOH HOH 0 . 
CJ 36 HOH 5934 9995 1858 HOH HOH 0 . 
CJ 36 HOH 5935 9996 1859 HOH HOH 0 . 
CJ 36 HOH 5936 9997 1860 HOH HOH 0 . 
CJ 36 HOH 5937 9998 1862 HOH HOH 0 . 
CJ 36 HOH 5938 9999 1863 HOH HOH 0 . 
DJ 36 HOH 1    8384 120  HOH HOH 9 . 
DJ 36 HOH 2    8385 194  HOH HOH 9 . 
DJ 36 HOH 3    8386 466  HOH HOH 9 . 
DJ 36 HOH 4    8387 504  HOH HOH 9 . 
DJ 36 HOH 5    8388 622  HOH HOH 9 . 
DJ 36 HOH 6    8389 737  HOH HOH 9 . 
DJ 36 HOH 7    8390 1051 HOH HOH 9 . 
DJ 36 HOH 8    8391 1068 HOH HOH 9 . 
DJ 36 HOH 9    8392 1137 HOH HOH 9 . 
DJ 36 HOH 10   8393 1140 HOH HOH 9 . 
DJ 36 HOH 11   8394 1197 HOH HOH 9 . 
DJ 36 HOH 12   8395 1220 HOH HOH 9 . 
DJ 36 HOH 13   8396 1228 HOH HOH 9 . 
DJ 36 HOH 14   8397 1307 HOH HOH 9 . 
DJ 36 HOH 15   8398 1361 HOH HOH 9 . 
DJ 36 HOH 16   8399 1377 HOH HOH 9 . 
DJ 36 HOH 17   8400 1391 HOH HOH 9 . 
DJ 36 HOH 18   8401 1441 HOH HOH 9 . 
DJ 36 HOH 19   8402 1450 HOH HOH 9 . 
DJ 36 HOH 20   8403 1569 HOH HOH 9 . 
DJ 36 HOH 21   8404 1867 HOH HOH 9 . 
DJ 36 HOH 22   8405 1982 HOH HOH 9 . 
DJ 36 HOH 23   8406 1987 HOH HOH 9 . 
DJ 36 HOH 24   8407 2118 HOH HOH 9 . 
DJ 36 HOH 25   8408 2167 HOH HOH 9 . 
DJ 36 HOH 26   8409 2274 HOH HOH 9 . 
DJ 36 HOH 27   8410 2278 HOH HOH 9 . 
DJ 36 HOH 28   8411 2285 HOH HOH 9 . 
DJ 36 HOH 29   8412 2295 HOH HOH 9 . 
DJ 36 HOH 30   8413 2305 HOH HOH 9 . 
DJ 36 HOH 31   8414 2320 HOH HOH 9 . 
DJ 36 HOH 32   8415 2343 HOH HOH 9 . 
DJ 36 HOH 33   8416 2357 HOH HOH 9 . 
DJ 36 HOH 34   8417 2358 HOH HOH 9 . 
DJ 36 HOH 35   8418 2395 HOH HOH 9 . 
DJ 36 HOH 36   8419 2423 HOH HOH 9 . 
DJ 36 HOH 37   8420 2430 HOH HOH 9 . 
DJ 36 HOH 38   8421 2487 HOH HOH 9 . 
DJ 36 HOH 39   8422 2497 HOH HOH 9 . 
DJ 36 HOH 40   8423 2522 HOH HOH 9 . 
DJ 36 HOH 41   8424 2536 HOH HOH 9 . 
DJ 36 HOH 42   8425 2537 HOH HOH 9 . 
DJ 36 HOH 43   8426 2577 HOH HOH 9 . 
DJ 36 HOH 44   8427 2660 HOH HOH 9 . 
DJ 36 HOH 45   8428 2663 HOH HOH 9 . 
DJ 36 HOH 46   8429 2710 HOH HOH 9 . 
DJ 36 HOH 47   8430 2730 HOH HOH 9 . 
DJ 36 HOH 48   8431 2772 HOH HOH 9 . 
DJ 36 HOH 49   8432 2796 HOH HOH 9 . 
DJ 36 HOH 50   8433 2881 HOH HOH 9 . 
DJ 36 HOH 51   8434 2984 HOH HOH 9 . 
DJ 36 HOH 52   8435 3005 HOH HOH 9 . 
DJ 36 HOH 53   8436 3167 HOH HOH 9 . 
DJ 36 HOH 54   8437 3241 HOH HOH 9 . 
DJ 36 HOH 55   8438 3340 HOH HOH 9 . 
DJ 36 HOH 56   8439 3445 HOH HOH 9 . 
DJ 36 HOH 57   8440 3472 HOH HOH 9 . 
DJ 36 HOH 58   8441 3502 HOH HOH 9 . 
DJ 36 HOH 59   8442 3535 HOH HOH 9 . 
DJ 36 HOH 60   8443 3547 HOH HOH 9 . 
DJ 36 HOH 61   8444 3714 HOH HOH 9 . 
DJ 36 HOH 62   8445 3797 HOH HOH 9 . 
DJ 36 HOH 63   8446 3870 HOH HOH 9 . 
DJ 36 HOH 64   8447 3894 HOH HOH 9 . 
DJ 36 HOH 65   8448 3911 HOH HOH 9 . 
DJ 36 HOH 66   8449 3970 HOH HOH 9 . 
DJ 36 HOH 67   8450 3978 HOH HOH 9 . 
DJ 36 HOH 68   8451 4028 HOH HOH 9 . 
DJ 36 HOH 69   8452 4078 HOH HOH 9 . 
DJ 36 HOH 70   8453 4108 HOH HOH 9 . 
DJ 36 HOH 71   8454 4250 HOH HOH 9 . 
DJ 36 HOH 72   8455 4351 HOH HOH 9 . 
DJ 36 HOH 73   8456 4382 HOH HOH 9 . 
DJ 36 HOH 74   8457 4454 HOH HOH 9 . 
DJ 36 HOH 75   8458 4558 HOH HOH 9 . 
DJ 36 HOH 76   8459 4586 HOH HOH 9 . 
DJ 36 HOH 77   8460 4590 HOH HOH 9 . 
DJ 36 HOH 78   8461 4627 HOH HOH 9 . 
DJ 36 HOH 79   8462 4707 HOH HOH 9 . 
DJ 36 HOH 80   8463 4791 HOH HOH 9 . 
DJ 36 HOH 81   8464 4902 HOH HOH 9 . 
DJ 36 HOH 82   8465 4918 HOH HOH 9 . 
DJ 36 HOH 83   8466 4932 HOH HOH 9 . 
DJ 36 HOH 84   8467 4974 HOH HOH 9 . 
DJ 36 HOH 85   8468 4975 HOH HOH 9 . 
DJ 36 HOH 86   8469 5019 HOH HOH 9 . 
DJ 36 HOH 87   8470 5174 HOH HOH 9 . 
DJ 36 HOH 88   8471 5233 HOH HOH 9 . 
DJ 36 HOH 89   8472 5298 HOH HOH 9 . 
DJ 36 HOH 90   8473 5321 HOH HOH 9 . 
DJ 36 HOH 91   8474 5385 HOH HOH 9 . 
DJ 36 HOH 92   8475 5558 HOH HOH 9 . 
DJ 36 HOH 93   8476 5727 HOH HOH 9 . 
DJ 36 HOH 94   8477 5759 HOH HOH 9 . 
DJ 36 HOH 95   8478 5767 HOH HOH 9 . 
DJ 36 HOH 96   8479 5822 HOH HOH 9 . 
DJ 36 HOH 97   8480 5851 HOH HOH 9 . 
DJ 36 HOH 98   8481 5983 HOH HOH 9 . 
DJ 36 HOH 99   8482 5990 HOH HOH 9 . 
DJ 36 HOH 100  8483 6053 HOH HOH 9 . 
DJ 36 HOH 101  8484 6064 HOH HOH 9 . 
DJ 36 HOH 102  8485 6156 HOH HOH 9 . 
DJ 36 HOH 103  8486 6192 HOH HOH 9 . 
DJ 36 HOH 104  8487 6206 HOH HOH 9 . 
DJ 36 HOH 105  8488 6276 HOH HOH 9 . 
DJ 36 HOH 106  8489 6374 HOH HOH 9 . 
DJ 36 HOH 107  8490 6392 HOH HOH 9 . 
DJ 36 HOH 108  8491 6412 HOH HOH 9 . 
DJ 36 HOH 109  8492 6474 HOH HOH 9 . 
DJ 36 HOH 110  8493 6546 HOH HOH 9 . 
DJ 36 HOH 111  8494 6578 HOH HOH 9 . 
DJ 36 HOH 112  8495 6581 HOH HOH 9 . 
DJ 36 HOH 113  8496 6669 HOH HOH 9 . 
DJ 36 HOH 114  8497 6700 HOH HOH 9 . 
DJ 36 HOH 115  8498 6798 HOH HOH 9 . 
DJ 36 HOH 116  8499 6806 HOH HOH 9 . 
DJ 36 HOH 117  8500 6827 HOH HOH 9 . 
DJ 36 HOH 118  8501 6867 HOH HOH 9 . 
DJ 36 HOH 119  8502 6901 HOH HOH 9 . 
DJ 36 HOH 120  8503 7073 HOH HOH 9 . 
DJ 36 HOH 121  8504 7111 HOH HOH 9 . 
DJ 36 HOH 122  8505 7164 HOH HOH 9 . 
DJ 36 HOH 123  8506 7218 HOH HOH 9 . 
DJ 36 HOH 124  8507 7289 HOH HOH 9 . 
DJ 36 HOH 125  8508 7294 HOH HOH 9 . 
DJ 36 HOH 126  8509 7361 HOH HOH 9 . 
DJ 36 HOH 127  8510 7426 HOH HOH 9 . 
DJ 36 HOH 128  8511 7474 HOH HOH 9 . 
DJ 36 HOH 129  8512 7519 HOH HOH 9 . 
DJ 36 HOH 130  8513 7531 HOH HOH 9 . 
DJ 36 HOH 131  8514 7568 HOH HOH 9 . 
DJ 36 HOH 132  8515 7637 HOH HOH 9 . 
DJ 36 HOH 133  8516 7685 HOH HOH 9 . 
DJ 36 HOH 134  8517 7713 HOH HOH 9 . 
DJ 36 HOH 135  8518 7892 HOH HOH 9 . 
EJ 36 HOH 1    8510 13   HOH HOH A . 
EJ 36 HOH 2    8511 18   HOH HOH A . 
EJ 36 HOH 3    8512 23   HOH HOH A . 
EJ 36 HOH 4    8513 43   HOH HOH A . 
EJ 36 HOH 5    8514 77   HOH HOH A . 
EJ 36 HOH 6    8515 202  HOH HOH A . 
EJ 36 HOH 7    8516 250  HOH HOH A . 
EJ 36 HOH 8    8517 260  HOH HOH A . 
EJ 36 HOH 9    8518 265  HOH HOH A . 
EJ 36 HOH 10   8519 278  HOH HOH A . 
EJ 36 HOH 11   8520 292  HOH HOH A . 
EJ 36 HOH 12   8521 306  HOH HOH A . 
EJ 36 HOH 13   8522 389  HOH HOH A . 
EJ 36 HOH 14   8523 396  HOH HOH A . 
EJ 36 HOH 15   8524 449  HOH HOH A . 
EJ 36 HOH 16   8525 491  HOH HOH A . 
EJ 36 HOH 17   8526 582  HOH HOH A . 
EJ 36 HOH 18   8527 607  HOH HOH A . 
EJ 36 HOH 19   8528 635  HOH HOH A . 
EJ 36 HOH 20   8529 666  HOH HOH A . 
EJ 36 HOH 21   8530 829  HOH HOH A . 
EJ 36 HOH 22   8531 830  HOH HOH A . 
EJ 36 HOH 23   8532 854  HOH HOH A . 
EJ 36 HOH 24   8533 927  HOH HOH A . 
EJ 36 HOH 25   8534 1017 HOH HOH A . 
EJ 36 HOH 26   8535 1054 HOH HOH A . 
EJ 36 HOH 27   8536 1066 HOH HOH A . 
EJ 36 HOH 28   8537 1076 HOH HOH A . 
EJ 36 HOH 29   8538 1188 HOH HOH A . 
EJ 36 HOH 30   8539 1259 HOH HOH A . 
EJ 36 HOH 31   8540 1276 HOH HOH A . 
EJ 36 HOH 32   8541 1301 HOH HOH A . 
EJ 36 HOH 33   8542 1373 HOH HOH A . 
EJ 36 HOH 34   8543 1437 HOH HOH A . 
EJ 36 HOH 35   8544 1509 HOH HOH A . 
EJ 36 HOH 36   8545 1517 HOH HOH A . 
EJ 36 HOH 37   8546 1745 HOH HOH A . 
EJ 36 HOH 38   8547 1764 HOH HOH A . 
EJ 36 HOH 39   8548 1883 HOH HOH A . 
EJ 36 HOH 40   8549 1902 HOH HOH A . 
EJ 36 HOH 41   8550 2125 HOH HOH A . 
EJ 36 HOH 42   8551 2172 HOH HOH A . 
EJ 36 HOH 43   8552 2191 HOH HOH A . 
EJ 36 HOH 44   8553 2279 HOH HOH A . 
EJ 36 HOH 45   8554 2329 HOH HOH A . 
EJ 36 HOH 46   8555 2431 HOH HOH A . 
EJ 36 HOH 47   8556 2580 HOH HOH A . 
EJ 36 HOH 48   8557 2618 HOH HOH A . 
EJ 36 HOH 49   8558 2643 HOH HOH A . 
EJ 36 HOH 50   8559 2675 HOH HOH A . 
EJ 36 HOH 51   8560 2908 HOH HOH A . 
EJ 36 HOH 52   8561 2993 HOH HOH A . 
EJ 36 HOH 53   8562 3007 HOH HOH A . 
EJ 36 HOH 54   8563 3019 HOH HOH A . 
EJ 36 HOH 55   8564 3036 HOH HOH A . 
EJ 36 HOH 56   8565 3069 HOH HOH A . 
EJ 36 HOH 57   8566 3156 HOH HOH A . 
EJ 36 HOH 58   8567 3203 HOH HOH A . 
EJ 36 HOH 59   8568 3204 HOH HOH A . 
EJ 36 HOH 60   8569 3374 HOH HOH A . 
EJ 36 HOH 61   8570 3377 HOH HOH A . 
EJ 36 HOH 62   8571 3459 HOH HOH A . 
EJ 36 HOH 63   8572 3484 HOH HOH A . 
EJ 36 HOH 64   8573 3496 HOH HOH A . 
EJ 36 HOH 65   8574 3523 HOH HOH A . 
EJ 36 HOH 66   8575 3548 HOH HOH A . 
EJ 36 HOH 67   8576 3602 HOH HOH A . 
EJ 36 HOH 68   8577 3762 HOH HOH A . 
EJ 36 HOH 69   8578 3777 HOH HOH A . 
EJ 36 HOH 70   8579 3827 HOH HOH A . 
EJ 36 HOH 71   8580 3891 HOH HOH A . 
EJ 36 HOH 72   8581 3896 HOH HOH A . 
EJ 36 HOH 73   8582 3901 HOH HOH A . 
EJ 36 HOH 74   8583 4026 HOH HOH A . 
EJ 36 HOH 75   8584 4033 HOH HOH A . 
EJ 36 HOH 76   8585 4053 HOH HOH A . 
EJ 36 HOH 77   8586 4073 HOH HOH A . 
EJ 36 HOH 78   8587 4097 HOH HOH A . 
EJ 36 HOH 79   8588 4204 HOH HOH A . 
EJ 36 HOH 80   8589 4245 HOH HOH A . 
EJ 36 HOH 81   8590 4286 HOH HOH A . 
EJ 36 HOH 82   8591 4437 HOH HOH A . 
EJ 36 HOH 83   8592 4502 HOH HOH A . 
EJ 36 HOH 84   8593 4549 HOH HOH A . 
EJ 36 HOH 85   8594 4567 HOH HOH A . 
EJ 36 HOH 86   8595 4589 HOH HOH A . 
EJ 36 HOH 87   8596 4780 HOH HOH A . 
EJ 36 HOH 88   8597 4870 HOH HOH A . 
EJ 36 HOH 89   8598 4877 HOH HOH A . 
EJ 36 HOH 90   8599 4884 HOH HOH A . 
EJ 36 HOH 91   8600 4933 HOH HOH A . 
EJ 36 HOH 92   8601 5133 HOH HOH A . 
EJ 36 HOH 93   8602 5222 HOH HOH A . 
EJ 36 HOH 94   8603 5306 HOH HOH A . 
EJ 36 HOH 95   8604 5482 HOH HOH A . 
EJ 36 HOH 96   8605 5534 HOH HOH A . 
EJ 36 HOH 97   8606 5628 HOH HOH A . 
EJ 36 HOH 98   8607 5671 HOH HOH A . 
EJ 36 HOH 99   8608 5706 HOH HOH A . 
EJ 36 HOH 100  8609 6046 HOH HOH A . 
EJ 36 HOH 101  8610 6136 HOH HOH A . 
EJ 36 HOH 102  8611 6339 HOH HOH A . 
EJ 36 HOH 103  8612 6402 HOH HOH A . 
EJ 36 HOH 104  8613 6469 HOH HOH A . 
EJ 36 HOH 105  8614 6599 HOH HOH A . 
EJ 36 HOH 106  8615 6746 HOH HOH A . 
EJ 36 HOH 107  8616 6780 HOH HOH A . 
EJ 36 HOH 108  8617 6879 HOH HOH A . 
EJ 36 HOH 109  8618 6886 HOH HOH A . 
EJ 36 HOH 110  8619 7019 HOH HOH A . 
EJ 36 HOH 111  8620 7110 HOH HOH A . 
EJ 36 HOH 112  8621 7249 HOH HOH A . 
EJ 36 HOH 113  8622 7267 HOH HOH A . 
EJ 36 HOH 114  8623 7273 HOH HOH A . 
EJ 36 HOH 115  8624 7306 HOH HOH A . 
EJ 36 HOH 116  8625 7315 HOH HOH A . 
EJ 36 HOH 117  8626 7411 HOH HOH A . 
EJ 36 HOH 118  8627 7427 HOH HOH A . 
EJ 36 HOH 119  8628 7603 HOH HOH A . 
EJ 36 HOH 120  8629 7714 HOH HOH A . 
EJ 36 HOH 121  8630 7752 HOH HOH A . 
EJ 36 HOH 122  8631 7773 HOH HOH A . 
EJ 36 HOH 123  8632 7792 HOH HOH A . 
EJ 36 HOH 124  8633 7810 HOH HOH A . 
EJ 36 HOH 125  8634 7868 HOH HOH A . 
EJ 36 HOH 126  8635 7887 HOH HOH A . 
FJ 36 HOH 1    8520 55   HOH HOH B . 
FJ 36 HOH 2    8521 56   HOH HOH B . 
FJ 36 HOH 3    8522 140  HOH HOH B . 
FJ 36 HOH 4    8523 147  HOH HOH B . 
FJ 36 HOH 5    8524 169  HOH HOH B . 
FJ 36 HOH 6    8525 179  HOH HOH B . 
FJ 36 HOH 7    8526 343  HOH HOH B . 
FJ 36 HOH 8    8527 460  HOH HOH B . 
FJ 36 HOH 9    8528 689  HOH HOH B . 
FJ 36 HOH 10   8529 738  HOH HOH B . 
FJ 36 HOH 11   8530 779  HOH HOH B . 
FJ 36 HOH 12   8531 824  HOH HOH B . 
FJ 36 HOH 13   8532 882  HOH HOH B . 
FJ 36 HOH 14   8533 972  HOH HOH B . 
FJ 36 HOH 15   8534 986  HOH HOH B . 
FJ 36 HOH 16   8535 1004 HOH HOH B . 
FJ 36 HOH 17   8536 1033 HOH HOH B . 
FJ 36 HOH 18   8537 1121 HOH HOH B . 
FJ 36 HOH 19   8538 1136 HOH HOH B . 
FJ 36 HOH 20   8539 1139 HOH HOH B . 
FJ 36 HOH 21   8540 1185 HOH HOH B . 
FJ 36 HOH 22   8541 1209 HOH HOH B . 
FJ 36 HOH 23   8542 1236 HOH HOH B . 
FJ 36 HOH 24   8543 1254 HOH HOH B . 
FJ 36 HOH 25   8544 1294 HOH HOH B . 
FJ 36 HOH 26   8545 1376 HOH HOH B . 
FJ 36 HOH 27   8546 1447 HOH HOH B . 
FJ 36 HOH 28   8547 1524 HOH HOH B . 
FJ 36 HOH 29   8548 1581 HOH HOH B . 
FJ 36 HOH 30   8549 1690 HOH HOH B . 
FJ 36 HOH 31   8550 1714 HOH HOH B . 
FJ 36 HOH 32   8551 1779 HOH HOH B . 
FJ 36 HOH 33   8552 1923 HOH HOH B . 
FJ 36 HOH 34   8553 1955 HOH HOH B . 
FJ 36 HOH 35   8554 1996 HOH HOH B . 
FJ 36 HOH 36   8555 2268 HOH HOH B . 
FJ 36 HOH 37   8556 2286 HOH HOH B . 
FJ 36 HOH 38   8557 2345 HOH HOH B . 
FJ 36 HOH 39   8558 2390 HOH HOH B . 
FJ 36 HOH 40   8559 2528 HOH HOH B . 
FJ 36 HOH 41   8560 2548 HOH HOH B . 
FJ 36 HOH 42   8561 2557 HOH HOH B . 
FJ 36 HOH 43   8562 2613 HOH HOH B . 
FJ 36 HOH 44   8563 2649 HOH HOH B . 
FJ 36 HOH 45   8564 2694 HOH HOH B . 
FJ 36 HOH 46   8565 2782 HOH HOH B . 
FJ 36 HOH 47   8566 2831 HOH HOH B . 
FJ 36 HOH 48   8567 2889 HOH HOH B . 
FJ 36 HOH 49   8568 2907 HOH HOH B . 
FJ 36 HOH 50   8569 2941 HOH HOH B . 
FJ 36 HOH 51   8570 2997 HOH HOH B . 
FJ 36 HOH 52   8571 3108 HOH HOH B . 
FJ 36 HOH 53   8572 3179 HOH HOH B . 
FJ 36 HOH 54   8573 3223 HOH HOH B . 
FJ 36 HOH 55   8574 3278 HOH HOH B . 
FJ 36 HOH 56   8575 3326 HOH HOH B . 
FJ 36 HOH 57   8576 3511 HOH HOH B . 
FJ 36 HOH 58   8577 3517 HOH HOH B . 
FJ 36 HOH 59   8578 3529 HOH HOH B . 
FJ 36 HOH 60   8579 3554 HOH HOH B . 
FJ 36 HOH 61   8580 3587 HOH HOH B . 
FJ 36 HOH 62   8581 3627 HOH HOH B . 
FJ 36 HOH 63   8582 3655 HOH HOH B . 
FJ 36 HOH 64   8583 3693 HOH HOH B . 
FJ 36 HOH 65   8584 3713 HOH HOH B . 
FJ 36 HOH 66   8585 3719 HOH HOH B . 
FJ 36 HOH 67   8586 3765 HOH HOH B . 
FJ 36 HOH 68   8587 3848 HOH HOH B . 
FJ 36 HOH 69   8588 3866 HOH HOH B . 
FJ 36 HOH 70   8589 3923 HOH HOH B . 
FJ 36 HOH 71   8590 4067 HOH HOH B . 
FJ 36 HOH 72   8591 4111 HOH HOH B . 
FJ 36 HOH 73   8592 4117 HOH HOH B . 
FJ 36 HOH 74   8593 4121 HOH HOH B . 
FJ 36 HOH 75   8594 4128 HOH HOH B . 
FJ 36 HOH 76   8595 4243 HOH HOH B . 
FJ 36 HOH 77   8596 4249 HOH HOH B . 
FJ 36 HOH 78   8597 4304 HOH HOH B . 
FJ 36 HOH 79   8598 4327 HOH HOH B . 
FJ 36 HOH 80   8599 4357 HOH HOH B . 
FJ 36 HOH 81   8600 4370 HOH HOH B . 
FJ 36 HOH 82   8601 4402 HOH HOH B . 
FJ 36 HOH 83   8602 4483 HOH HOH B . 
FJ 36 HOH 84   8603 4531 HOH HOH B . 
FJ 36 HOH 85   8604 4538 HOH HOH B . 
FJ 36 HOH 86   8605 4544 HOH HOH B . 
FJ 36 HOH 87   8606 4612 HOH HOH B . 
FJ 36 HOH 88   8607 4673 HOH HOH B . 
FJ 36 HOH 89   8608 4730 HOH HOH B . 
FJ 36 HOH 90   8609 4804 HOH HOH B . 
FJ 36 HOH 91   8610 4810 HOH HOH B . 
FJ 36 HOH 92   8611 4887 HOH HOH B . 
FJ 36 HOH 93   8612 4899 HOH HOH B . 
FJ 36 HOH 94   8613 5008 HOH HOH B . 
FJ 36 HOH 95   8614 5020 HOH HOH B . 
FJ 36 HOH 96   8615 5127 HOH HOH B . 
FJ 36 HOH 97   8616 5132 HOH HOH B . 
FJ 36 HOH 98   8617 5136 HOH HOH B . 
FJ 36 HOH 99   8618 5151 HOH HOH B . 
FJ 36 HOH 100  8619 5204 HOH HOH B . 
FJ 36 HOH 101  8620 5366 HOH HOH B . 
FJ 36 HOH 102  8621 5367 HOH HOH B . 
FJ 36 HOH 103  8622 5379 HOH HOH B . 
FJ 36 HOH 104  8623 5400 HOH HOH B . 
FJ 36 HOH 105  8624 5430 HOH HOH B . 
FJ 36 HOH 106  8625 5491 HOH HOH B . 
FJ 36 HOH 107  8626 5561 HOH HOH B . 
FJ 36 HOH 108  8627 5592 HOH HOH B . 
FJ 36 HOH 109  8628 5621 HOH HOH B . 
FJ 36 HOH 110  8629 5754 HOH HOH B . 
FJ 36 HOH 111  8630 5778 HOH HOH B . 
FJ 36 HOH 112  8631 5816 HOH HOH B . 
FJ 36 HOH 113  8632 5908 HOH HOH B . 
FJ 36 HOH 114  8633 5936 HOH HOH B . 
FJ 36 HOH 115  8634 5943 HOH HOH B . 
FJ 36 HOH 116  8635 6023 HOH HOH B . 
FJ 36 HOH 117  8636 6052 HOH HOH B . 
FJ 36 HOH 118  8637 6089 HOH HOH B . 
FJ 36 HOH 119  8638 6116 HOH HOH B . 
FJ 36 HOH 120  8639 6210 HOH HOH B . 
FJ 36 HOH 121  8640 6216 HOH HOH B . 
FJ 36 HOH 122  8641 6221 HOH HOH B . 
FJ 36 HOH 123  8642 6230 HOH HOH B . 
FJ 36 HOH 124  8643 6234 HOH HOH B . 
FJ 36 HOH 125  8644 6296 HOH HOH B . 
FJ 36 HOH 126  8645 6396 HOH HOH B . 
FJ 36 HOH 127  8646 6418 HOH HOH B . 
FJ 36 HOH 128  8647 6432 HOH HOH B . 
FJ 36 HOH 129  8648 6459 HOH HOH B . 
FJ 36 HOH 130  8649 6542 HOH HOH B . 
FJ 36 HOH 131  8650 6588 HOH HOH B . 
FJ 36 HOH 132  8651 6889 HOH HOH B . 
FJ 36 HOH 133  8652 6906 HOH HOH B . 
FJ 36 HOH 134  8653 6940 HOH HOH B . 
FJ 36 HOH 135  8654 6946 HOH HOH B . 
FJ 36 HOH 136  8655 7088 HOH HOH B . 
FJ 36 HOH 137  8656 7123 HOH HOH B . 
FJ 36 HOH 138  8657 7139 HOH HOH B . 
FJ 36 HOH 139  8658 7141 HOH HOH B . 
FJ 36 HOH 140  8659 7148 HOH HOH B . 
FJ 36 HOH 141  8660 7157 HOH HOH B . 
FJ 36 HOH 142  8661 7268 HOH HOH B . 
FJ 36 HOH 143  8662 7384 HOH HOH B . 
FJ 36 HOH 144  8663 7428 HOH HOH B . 
FJ 36 HOH 145  8664 7492 HOH HOH B . 
FJ 36 HOH 146  8665 7494 HOH HOH B . 
FJ 36 HOH 147  8666 7551 HOH HOH B . 
FJ 36 HOH 148  8667 7611 HOH HOH B . 
FJ 36 HOH 149  8668 7791 HOH HOH B . 
FJ 36 HOH 150  8669 7895 HOH HOH B . 
GJ 36 HOH 1    8305 66   HOH HOH C . 
GJ 36 HOH 2    8306 133  HOH HOH C . 
GJ 36 HOH 3    8307 134  HOH HOH C . 
GJ 36 HOH 4    8308 135  HOH HOH C . 
GJ 36 HOH 5    8309 143  HOH HOH C . 
GJ 36 HOH 6    8310 215  HOH HOH C . 
GJ 36 HOH 7    8311 223  HOH HOH C . 
GJ 36 HOH 8    8312 286  HOH HOH C . 
GJ 36 HOH 9    8313 327  HOH HOH C . 
GJ 36 HOH 10   8314 328  HOH HOH C . 
GJ 36 HOH 11   8315 401  HOH HOH C . 
GJ 36 HOH 12   8316 421  HOH HOH C . 
GJ 36 HOH 13   8317 424  HOH HOH C . 
GJ 36 HOH 14   8318 458  HOH HOH C . 
GJ 36 HOH 15   8319 587  HOH HOH C . 
GJ 36 HOH 16   8320 637  HOH HOH C . 
GJ 36 HOH 17   8321 652  HOH HOH C . 
GJ 36 HOH 18   8322 721  HOH HOH C . 
GJ 36 HOH 19   8323 726  HOH HOH C . 
GJ 36 HOH 20   8324 823  HOH HOH C . 
GJ 36 HOH 21   8325 828  HOH HOH C . 
GJ 36 HOH 22   8326 892  HOH HOH C . 
GJ 36 HOH 23   8327 926  HOH HOH C . 
GJ 36 HOH 24   8328 930  HOH HOH C . 
GJ 36 HOH 25   8329 937  HOH HOH C . 
GJ 36 HOH 26   8330 941  HOH HOH C . 
GJ 36 HOH 27   8331 948  HOH HOH C . 
GJ 36 HOH 28   8332 981  HOH HOH C . 
GJ 36 HOH 29   8333 995  HOH HOH C . 
GJ 36 HOH 30   8334 998  HOH HOH C . 
GJ 36 HOH 31   8335 1019 HOH HOH C . 
GJ 36 HOH 32   8336 1026 HOH HOH C . 
GJ 36 HOH 33   8337 1133 HOH HOH C . 
GJ 36 HOH 34   8338 1193 HOH HOH C . 
GJ 36 HOH 35   8339 1198 HOH HOH C . 
GJ 36 HOH 36   8340 1269 HOH HOH C . 
GJ 36 HOH 37   8341 1329 HOH HOH C . 
GJ 36 HOH 38   8342 1360 HOH HOH C . 
GJ 36 HOH 39   8343 1416 HOH HOH C . 
GJ 36 HOH 40   8344 1563 HOH HOH C . 
GJ 36 HOH 41   8345 1648 HOH HOH C . 
GJ 36 HOH 42   8346 1687 HOH HOH C . 
GJ 36 HOH 43   8347 1692 HOH HOH C . 
GJ 36 HOH 44   8348 1699 HOH HOH C . 
GJ 36 HOH 45   8349 1815 HOH HOH C . 
GJ 36 HOH 46   8350 1825 HOH HOH C . 
GJ 36 HOH 47   8351 1830 HOH HOH C . 
GJ 36 HOH 48   8352 1894 HOH HOH C . 
GJ 36 HOH 49   8353 1907 HOH HOH C . 
GJ 36 HOH 50   8354 1919 HOH HOH C . 
GJ 36 HOH 51   8355 1979 HOH HOH C . 
GJ 36 HOH 52   8356 2028 HOH HOH C . 
GJ 36 HOH 53   8357 2040 HOH HOH C . 
GJ 36 HOH 54   8358 2051 HOH HOH C . 
GJ 36 HOH 55   8359 2064 HOH HOH C . 
GJ 36 HOH 56   8360 2241 HOH HOH C . 
GJ 36 HOH 57   8361 2293 HOH HOH C . 
GJ 36 HOH 58   8362 2396 HOH HOH C . 
GJ 36 HOH 59   8363 2490 HOH HOH C . 
GJ 36 HOH 60   8364 2518 HOH HOH C . 
GJ 36 HOH 61   8365 2669 HOH HOH C . 
GJ 36 HOH 62   8366 2686 HOH HOH C . 
GJ 36 HOH 63   8367 2711 HOH HOH C . 
GJ 36 HOH 64   8368 2759 HOH HOH C . 
GJ 36 HOH 65   8369 2770 HOH HOH C . 
GJ 36 HOH 66   8370 2822 HOH HOH C . 
GJ 36 HOH 67   8371 2866 HOH HOH C . 
GJ 36 HOH 68   8372 2903 HOH HOH C . 
GJ 36 HOH 69   8373 2963 HOH HOH C . 
GJ 36 HOH 70   8374 2972 HOH HOH C . 
GJ 36 HOH 71   8375 2986 HOH HOH C . 
GJ 36 HOH 72   8376 3033 HOH HOH C . 
GJ 36 HOH 73   8377 3043 HOH HOH C . 
GJ 36 HOH 74   8378 3046 HOH HOH C . 
GJ 36 HOH 75   8379 3065 HOH HOH C . 
GJ 36 HOH 76   8380 3073 HOH HOH C . 
GJ 36 HOH 77   8381 3100 HOH HOH C . 
GJ 36 HOH 78   8382 3122 HOH HOH C . 
GJ 36 HOH 79   8383 3126 HOH HOH C . 
GJ 36 HOH 80   8384 3133 HOH HOH C . 
GJ 36 HOH 81   8385 3159 HOH HOH C . 
GJ 36 HOH 82   8386 3207 HOH HOH C . 
GJ 36 HOH 83   8387 3249 HOH HOH C . 
GJ 36 HOH 84   8388 3250 HOH HOH C . 
GJ 36 HOH 85   8389 3272 HOH HOH C . 
GJ 36 HOH 86   8390 3332 HOH HOH C . 
GJ 36 HOH 87   8391 3391 HOH HOH C . 
GJ 36 HOH 88   8392 3549 HOH HOH C . 
GJ 36 HOH 89   8393 3562 HOH HOH C . 
GJ 36 HOH 90   8394 3588 HOH HOH C . 
GJ 36 HOH 91   8395 3662 HOH HOH C . 
GJ 36 HOH 92   8396 3666 HOH HOH C . 
GJ 36 HOH 93   8397 3698 HOH HOH C . 
GJ 36 HOH 94   8398 3779 HOH HOH C . 
GJ 36 HOH 95   8399 3782 HOH HOH C . 
GJ 36 HOH 96   8400 3887 HOH HOH C . 
GJ 36 HOH 97   8401 3917 HOH HOH C . 
GJ 36 HOH 98   8402 3924 HOH HOH C . 
GJ 36 HOH 99   8403 3925 HOH HOH C . 
GJ 36 HOH 100  8404 3929 HOH HOH C . 
GJ 36 HOH 101  8405 3999 HOH HOH C . 
GJ 36 HOH 102  8406 4142 HOH HOH C . 
GJ 36 HOH 103  8407 4318 HOH HOH C . 
GJ 36 HOH 104  8408 4358 HOH HOH C . 
GJ 36 HOH 105  8409 4494 HOH HOH C . 
GJ 36 HOH 106  8410 4569 HOH HOH C . 
GJ 36 HOH 107  8411 4596 HOH HOH C . 
GJ 36 HOH 108  8412 4626 HOH HOH C . 
GJ 36 HOH 109  8413 4641 HOH HOH C . 
GJ 36 HOH 110  8414 4664 HOH HOH C . 
GJ 36 HOH 111  8415 4687 HOH HOH C . 
GJ 36 HOH 112  8416 4690 HOH HOH C . 
GJ 36 HOH 113  8417 4700 HOH HOH C . 
GJ 36 HOH 114  8418 4719 HOH HOH C . 
GJ 36 HOH 115  8419 4775 HOH HOH C . 
GJ 36 HOH 116  8420 4988 HOH HOH C . 
GJ 36 HOH 117  8421 5025 HOH HOH C . 
GJ 36 HOH 118  8422 5031 HOH HOH C . 
GJ 36 HOH 119  8423 5064 HOH HOH C . 
GJ 36 HOH 120  8424 5065 HOH HOH C . 
GJ 36 HOH 121  8425 5079 HOH HOH C . 
GJ 36 HOH 122  8426 5086 HOH HOH C . 
GJ 36 HOH 123  8427 5158 HOH HOH C . 
GJ 36 HOH 124  8428 5165 HOH HOH C . 
GJ 36 HOH 125  8429 5175 HOH HOH C . 
GJ 36 HOH 126  8430 5218 HOH HOH C . 
GJ 36 HOH 127  8431 5237 HOH HOH C . 
GJ 36 HOH 128  8432 5255 HOH HOH C . 
GJ 36 HOH 129  8433 5487 HOH HOH C . 
GJ 36 HOH 130  8434 5519 HOH HOH C . 
GJ 36 HOH 131  8435 5531 HOH HOH C . 
GJ 36 HOH 132  8436 5535 HOH HOH C . 
GJ 36 HOH 133  8437 5578 HOH HOH C . 
GJ 36 HOH 134  8438 5631 HOH HOH C . 
GJ 36 HOH 135  8439 5730 HOH HOH C . 
GJ 36 HOH 136  8440 5810 HOH HOH C . 
GJ 36 HOH 137  8441 5855 HOH HOH C . 
GJ 36 HOH 138  8442 5892 HOH HOH C . 
GJ 36 HOH 139  8443 6056 HOH HOH C . 
GJ 36 HOH 140  8444 6097 HOH HOH C . 
GJ 36 HOH 141  8445 6144 HOH HOH C . 
GJ 36 HOH 142  8446 6237 HOH HOH C . 
GJ 36 HOH 143  8447 6251 HOH HOH C . 
GJ 36 HOH 144  8448 6262 HOH HOH C . 
GJ 36 HOH 145  8449 6325 HOH HOH C . 
GJ 36 HOH 146  8450 6502 HOH HOH C . 
GJ 36 HOH 147  8451 6507 HOH HOH C . 
GJ 36 HOH 148  8452 6593 HOH HOH C . 
GJ 36 HOH 149  8453 6631 HOH HOH C . 
GJ 36 HOH 150  8454 6670 HOH HOH C . 
GJ 36 HOH 151  8455 6804 HOH HOH C . 
GJ 36 HOH 152  8456 6819 HOH HOH C . 
GJ 36 HOH 153  8457 6849 HOH HOH C . 
GJ 36 HOH 154  8458 6994 HOH HOH C . 
GJ 36 HOH 155  8459 7042 HOH HOH C . 
GJ 36 HOH 156  8460 7070 HOH HOH C . 
GJ 36 HOH 157  8461 7089 HOH HOH C . 
GJ 36 HOH 158  8462 7146 HOH HOH C . 
GJ 36 HOH 159  8463 7192 HOH HOH C . 
GJ 36 HOH 160  8464 7195 HOH HOH C . 
GJ 36 HOH 161  8465 7223 HOH HOH C . 
GJ 36 HOH 162  8466 7228 HOH HOH C . 
GJ 36 HOH 163  8467 7245 HOH HOH C . 
GJ 36 HOH 164  8468 7287 HOH HOH C . 
GJ 36 HOH 165  8469 7387 HOH HOH C . 
GJ 36 HOH 166  8470 7436 HOH HOH C . 
GJ 36 HOH 167  8471 7488 HOH HOH C . 
GJ 36 HOH 168  8472 7569 HOH HOH C . 
GJ 36 HOH 169  8473 7576 HOH HOH C . 
GJ 36 HOH 170  8474 7641 HOH HOH C . 
GJ 36 HOH 171  8475 7650 HOH HOH C . 
GJ 36 HOH 172  8476 7684 HOH HOH C . 
HJ 36 HOH 1    293  293  HOH HOH D . 
HJ 36 HOH 2    1154 1154 HOH HOH D . 
HJ 36 HOH 3    1492 1492 HOH HOH D . 
HJ 36 HOH 4    1655 1655 HOH HOH D . 
HJ 36 HOH 5    1796 1796 HOH HOH D . 
HJ 36 HOH 6    1897 1897 HOH HOH D . 
HJ 36 HOH 7    2195 2195 HOH HOH D . 
HJ 36 HOH 8    2768 2768 HOH HOH D . 
HJ 36 HOH 9    3066 3066 HOH HOH D . 
HJ 36 HOH 10   3092 3092 HOH HOH D . 
HJ 36 HOH 11   3279 3279 HOH HOH D . 
HJ 36 HOH 12   3349 3349 HOH HOH D . 
HJ 36 HOH 13   3359 3359 HOH HOH D . 
HJ 36 HOH 14   3572 3572 HOH HOH D . 
HJ 36 HOH 15   3723 3723 HOH HOH D . 
HJ 36 HOH 16   3839 3839 HOH HOH D . 
HJ 36 HOH 17   3862 3862 HOH HOH D . 
HJ 36 HOH 18   4057 4057 HOH HOH D . 
HJ 36 HOH 19   4069 4069 HOH HOH D . 
HJ 36 HOH 20   4233 4233 HOH HOH D . 
HJ 36 HOH 21   4688 4688 HOH HOH D . 
HJ 36 HOH 22   4886 4886 HOH HOH D . 
HJ 36 HOH 23   5146 5146 HOH HOH D . 
HJ 36 HOH 24   5198 5198 HOH HOH D . 
HJ 36 HOH 25   5210 5210 HOH HOH D . 
HJ 36 HOH 26   5234 5234 HOH HOH D . 
HJ 36 HOH 27   5484 5484 HOH HOH D . 
HJ 36 HOH 28   5495 5495 HOH HOH D . 
HJ 36 HOH 29   5576 5576 HOH HOH D . 
HJ 36 HOH 30   5583 5583 HOH HOH D . 
HJ 36 HOH 31   5728 5728 HOH HOH D . 
HJ 36 HOH 32   5828 5828 HOH HOH D . 
HJ 36 HOH 33   5858 5858 HOH HOH D . 
HJ 36 HOH 34   5950 5950 HOH HOH D . 
HJ 36 HOH 35   6007 6007 HOH HOH D . 
HJ 36 HOH 36   6165 6165 HOH HOH D . 
HJ 36 HOH 37   6326 6326 HOH HOH D . 
HJ 36 HOH 38   6380 6380 HOH HOH D . 
HJ 36 HOH 39   6555 6555 HOH HOH D . 
HJ 36 HOH 40   6716 6716 HOH HOH D . 
HJ 36 HOH 41   6752 6752 HOH HOH D . 
HJ 36 HOH 42   6848 6848 HOH HOH D . 
HJ 36 HOH 43   6936 6936 HOH HOH D . 
HJ 36 HOH 44   7345 7345 HOH HOH D . 
HJ 36 HOH 45   7400 7400 HOH HOH D . 
HJ 36 HOH 46   7475 7475 HOH HOH D . 
HJ 36 HOH 47   7477 7477 HOH HOH D . 
HJ 36 HOH 48   7500 7500 HOH HOH D . 
HJ 36 HOH 49   7502 7502 HOH HOH D . 
HJ 36 HOH 50   7580 7580 HOH HOH D . 
HJ 36 HOH 51   7597 7597 HOH HOH D . 
HJ 36 HOH 52   7625 7625 HOH HOH D . 
HJ 36 HOH 53   7636 7636 HOH HOH D . 
IJ 36 HOH 1    915  915  HOH HOH E . 
IJ 36 HOH 2    1053 1053 HOH HOH E . 
IJ 36 HOH 3    1306 1306 HOH HOH E . 
IJ 36 HOH 4    1750 1750 HOH HOH E . 
IJ 36 HOH 5    1861 1861 HOH HOH E . 
IJ 36 HOH 6    2227 2227 HOH HOH E . 
IJ 36 HOH 7    2401 2401 HOH HOH E . 
IJ 36 HOH 8    2769 2769 HOH HOH E . 
IJ 36 HOH 9    2781 2781 HOH HOH E . 
IJ 36 HOH 10   2789 2789 HOH HOH E . 
IJ 36 HOH 11   2857 2857 HOH HOH E . 
IJ 36 HOH 12   3134 3134 HOH HOH E . 
IJ 36 HOH 13   3388 3388 HOH HOH E . 
IJ 36 HOH 14   3478 3478 HOH HOH E . 
IJ 36 HOH 15   3707 3707 HOH HOH E . 
IJ 36 HOH 16   3745 3745 HOH HOH E . 
IJ 36 HOH 17   3881 3881 HOH HOH E . 
IJ 36 HOH 18   3940 3940 HOH HOH E . 
IJ 36 HOH 19   4098 4098 HOH HOH E . 
IJ 36 HOH 20   4154 4154 HOH HOH E . 
IJ 36 HOH 21   4191 4191 HOH HOH E . 
IJ 36 HOH 22   4572 4572 HOH HOH E . 
IJ 36 HOH 23   4761 4761 HOH HOH E . 
IJ 36 HOH 24   4917 4917 HOH HOH E . 
IJ 36 HOH 25   5206 5206 HOH HOH E . 
IJ 36 HOH 26   5240 5240 HOH HOH E . 
IJ 36 HOH 27   5281 5281 HOH HOH E . 
IJ 36 HOH 28   5404 5404 HOH HOH E . 
IJ 36 HOH 29   5715 5715 HOH HOH E . 
IJ 36 HOH 30   5751 5751 HOH HOH E . 
IJ 36 HOH 31   5864 5864 HOH HOH E . 
IJ 36 HOH 32   5899 5899 HOH HOH E . 
IJ 36 HOH 33   5919 5919 HOH HOH E . 
IJ 36 HOH 34   6017 6017 HOH HOH E . 
IJ 36 HOH 35   6054 6054 HOH HOH E . 
IJ 36 HOH 36   6341 6341 HOH HOH E . 
IJ 36 HOH 37   6399 6399 HOH HOH E . 
IJ 36 HOH 38   6457 6457 HOH HOH E . 
IJ 36 HOH 39   6476 6476 HOH HOH E . 
IJ 36 HOH 40   6772 6772 HOH HOH E . 
IJ 36 HOH 41   6887 6887 HOH HOH E . 
IJ 36 HOH 42   6931 6931 HOH HOH E . 
IJ 36 HOH 43   7046 7046 HOH HOH E . 
IJ 36 HOH 44   7544 7544 HOH HOH E . 
IJ 36 HOH 45   7565 7565 HOH HOH E . 
IJ 36 HOH 46   7590 7590 HOH HOH E . 
JJ 36 HOH 1    304  304  HOH HOH F . 
JJ 36 HOH 2    2456 2456 HOH HOH F . 
JJ 36 HOH 3    2466 2466 HOH HOH F . 
JJ 36 HOH 4    2563 2563 HOH HOH F . 
JJ 36 HOH 5    2630 2630 HOH HOH F . 
JJ 36 HOH 6    2695 2695 HOH HOH F . 
JJ 36 HOH 7    2750 2750 HOH HOH F . 
JJ 36 HOH 8    3111 3111 HOH HOH F . 
JJ 36 HOH 9    3303 3303 HOH HOH F . 
JJ 36 HOH 10   3461 3461 HOH HOH F . 
JJ 36 HOH 11   4016 4016 HOH HOH F . 
JJ 36 HOH 12   4682 4682 HOH HOH F . 
JJ 36 HOH 13   4807 4807 HOH HOH F . 
JJ 36 HOH 14   4995 4995 HOH HOH F . 
JJ 36 HOH 15   4999 4999 HOH HOH F . 
JJ 36 HOH 16   5163 5163 HOH HOH F . 
JJ 36 HOH 17   5413 5413 HOH HOH F . 
JJ 36 HOH 18   5498 5498 HOH HOH F . 
JJ 36 HOH 19   5522 5522 HOH HOH F . 
JJ 36 HOH 20   5691 5691 HOH HOH F . 
JJ 36 HOH 21   5719 5719 HOH HOH F . 
JJ 36 HOH 22   5897 5897 HOH HOH F . 
JJ 36 HOH 23   5966 5966 HOH HOH F . 
JJ 36 HOH 24   6403 6403 HOH HOH F . 
JJ 36 HOH 25   6617 6617 HOH HOH F . 
JJ 36 HOH 26   6800 6800 HOH HOH F . 
JJ 36 HOH 27   6909 6909 HOH HOH F . 
JJ 36 HOH 28   6926 6926 HOH HOH F . 
KJ 36 HOH 1    692  692  HOH HOH G . 
KJ 36 HOH 2    2209 2209 HOH HOH G . 
KJ 36 HOH 3    2214 2214 HOH HOH G . 
KJ 36 HOH 4    2218 2218 HOH HOH G . 
KJ 36 HOH 5    2569 2569 HOH HOH G . 
KJ 36 HOH 6    2994 2994 HOH HOH G . 
KJ 36 HOH 7    3117 3117 HOH HOH G . 
KJ 36 HOH 8    3513 3513 HOH HOH G . 
KJ 36 HOH 9    3903 3903 HOH HOH G . 
KJ 36 HOH 10   3972 3972 HOH HOH G . 
KJ 36 HOH 11   4173 4173 HOH HOH G . 
KJ 36 HOH 12   4499 4499 HOH HOH G . 
KJ 36 HOH 13   4619 4619 HOH HOH G . 
KJ 36 HOH 14   4714 4714 HOH HOH G . 
KJ 36 HOH 15   5661 5661 HOH HOH G . 
KJ 36 HOH 16   5923 5923 HOH HOH G . 
KJ 36 HOH 17   6201 6201 HOH HOH G . 
KJ 36 HOH 18   6464 6464 HOH HOH G . 
KJ 36 HOH 19   6833 6833 HOH HOH G . 
KJ 36 HOH 20   7244 7244 HOH HOH G . 
KJ 36 HOH 21   7246 7246 HOH HOH G . 
LJ 36 HOH 1    8323 92   HOH HOH H . 
LJ 36 HOH 2    8324 124  HOH HOH H . 
LJ 36 HOH 3    8325 668  HOH HOH H . 
LJ 36 HOH 4    8326 673  HOH HOH H . 
LJ 36 HOH 5    8327 687  HOH HOH H . 
LJ 36 HOH 6    8328 887  HOH HOH H . 
LJ 36 HOH 7    8329 1428 HOH HOH H . 
LJ 36 HOH 8    8330 1607 HOH HOH H . 
LJ 36 HOH 9    8331 1639 HOH HOH H . 
LJ 36 HOH 10   8332 1681 HOH HOH H . 
LJ 36 HOH 11   8333 1912 HOH HOH H . 
LJ 36 HOH 12   8334 1981 HOH HOH H . 
LJ 36 HOH 13   8335 2161 HOH HOH H . 
LJ 36 HOH 14   8336 2194 HOH HOH H . 
LJ 36 HOH 15   8337 2205 HOH HOH H . 
LJ 36 HOH 16   8338 2353 HOH HOH H . 
LJ 36 HOH 17   8339 2408 HOH HOH H . 
LJ 36 HOH 18   8340 2541 HOH HOH H . 
LJ 36 HOH 19   8341 2679 HOH HOH H . 
LJ 36 HOH 20   8342 2687 HOH HOH H . 
LJ 36 HOH 21   8343 2934 HOH HOH H . 
LJ 36 HOH 22   8344 2990 HOH HOH H . 
LJ 36 HOH 23   8345 3102 HOH HOH H . 
LJ 36 HOH 24   8346 3129 HOH HOH H . 
LJ 36 HOH 25   8347 3135 HOH HOH H . 
LJ 36 HOH 26   8348 3157 HOH HOH H . 
LJ 36 HOH 27   8349 3176 HOH HOH H . 
LJ 36 HOH 28   8350 3236 HOH HOH H . 
LJ 36 HOH 29   8351 3722 HOH HOH H . 
LJ 36 HOH 30   8352 3789 HOH HOH H . 
LJ 36 HOH 31   8353 3996 HOH HOH H . 
LJ 36 HOH 32   8354 4237 HOH HOH H . 
LJ 36 HOH 33   8355 4273 HOH HOH H . 
LJ 36 HOH 34   8356 4333 HOH HOH H . 
LJ 36 HOH 35   8357 4498 HOH HOH H . 
LJ 36 HOH 36   8358 4760 HOH HOH H . 
LJ 36 HOH 37   8359 4963 HOH HOH H . 
LJ 36 HOH 38   8360 5035 HOH HOH H . 
LJ 36 HOH 39   8361 5037 HOH HOH H . 
LJ 36 HOH 40   8362 5111 HOH HOH H . 
LJ 36 HOH 41   8363 5170 HOH HOH H . 
LJ 36 HOH 42   8364 5177 HOH HOH H . 
LJ 36 HOH 43   8365 5312 HOH HOH H . 
LJ 36 HOH 44   8366 5466 HOH HOH H . 
LJ 36 HOH 45   8367 5594 HOH HOH H . 
LJ 36 HOH 46   8368 5622 HOH HOH H . 
LJ 36 HOH 47   8369 5646 HOH HOH H . 
LJ 36 HOH 48   8370 5690 HOH HOH H . 
LJ 36 HOH 49   8371 5702 HOH HOH H . 
LJ 36 HOH 50   8372 5707 HOH HOH H . 
LJ 36 HOH 51   8373 5821 HOH HOH H . 
LJ 36 HOH 52   8374 5873 HOH HOH H . 
LJ 36 HOH 53   8375 5913 HOH HOH H . 
LJ 36 HOH 54   8376 5915 HOH HOH H . 
LJ 36 HOH 55   8377 6130 HOH HOH H . 
LJ 36 HOH 56   8378 6238 HOH HOH H . 
LJ 36 HOH 57   8379 6268 HOH HOH H . 
LJ 36 HOH 58   8380 6292 HOH HOH H . 
LJ 36 HOH 59   8381 6298 HOH HOH H . 
LJ 36 HOH 60   8382 6308 HOH HOH H . 
LJ 36 HOH 61   8383 6314 HOH HOH H . 
LJ 36 HOH 62   8384 6571 HOH HOH H . 
LJ 36 HOH 63   8385 6659 HOH HOH H . 
LJ 36 HOH 64   8386 6773 HOH HOH H . 
LJ 36 HOH 65   8387 6822 HOH HOH H . 
LJ 36 HOH 66   8388 6932 HOH HOH H . 
LJ 36 HOH 67   8389 7011 HOH HOH H . 
LJ 36 HOH 68   8390 7183 HOH HOH H . 
LJ 36 HOH 69   8391 7229 HOH HOH H . 
LJ 36 HOH 70   8392 7347 HOH HOH H . 
LJ 36 HOH 71   8393 7374 HOH HOH H . 
LJ 36 HOH 72   8394 7501 HOH HOH H . 
LJ 36 HOH 73   8395 7670 HOH HOH H . 
LJ 36 HOH 74   8396 7682 HOH HOH H . 
MJ 36 HOH 1    247  247  HOH HOH I . 
MJ 36 HOH 2    267  267  HOH HOH I . 
MJ 36 HOH 3    383  383  HOH HOH I . 
MJ 36 HOH 4    982  982  HOH HOH I . 
MJ 36 HOH 5    1018 1018 HOH HOH I . 
MJ 36 HOH 6    1123 1123 HOH HOH I . 
MJ 36 HOH 7    1405 1405 HOH HOH I . 
MJ 36 HOH 8    1596 1596 HOH HOH I . 
MJ 36 HOH 9    1652 1652 HOH HOH I . 
MJ 36 HOH 10   1829 1829 HOH HOH I . 
MJ 36 HOH 11   1886 1886 HOH HOH I . 
MJ 36 HOH 12   2219 2219 HOH HOH I . 
MJ 36 HOH 13   2238 2238 HOH HOH I . 
MJ 36 HOH 14   2333 2333 HOH HOH I . 
MJ 36 HOH 15   2664 2664 HOH HOH I . 
MJ 36 HOH 16   2828 2828 HOH HOH I . 
MJ 36 HOH 17   2858 2858 HOH HOH I . 
MJ 36 HOH 18   2886 2886 HOH HOH I . 
MJ 36 HOH 19   3338 3338 HOH HOH I . 
MJ 36 HOH 20   3422 3422 HOH HOH I . 
MJ 36 HOH 21   3615 3615 HOH HOH I . 
MJ 36 HOH 22   3694 3694 HOH HOH I . 
MJ 36 HOH 23   3705 3705 HOH HOH I . 
MJ 36 HOH 24   3750 3750 HOH HOH I . 
MJ 36 HOH 25   3772 3772 HOH HOH I . 
MJ 36 HOH 26   3795 3795 HOH HOH I . 
MJ 36 HOH 27   4038 4038 HOH HOH I . 
MJ 36 HOH 28   4193 4193 HOH HOH I . 
MJ 36 HOH 29   4199 4199 HOH HOH I . 
MJ 36 HOH 30   4367 4367 HOH HOH I . 
MJ 36 HOH 31   4561 4561 HOH HOH I . 
MJ 36 HOH 32   4650 4650 HOH HOH I . 
MJ 36 HOH 33   4712 4712 HOH HOH I . 
MJ 36 HOH 34   4746 4746 HOH HOH I . 
MJ 36 HOH 35   4908 4908 HOH HOH I . 
MJ 36 HOH 36   5036 5036 HOH HOH I . 
MJ 36 HOH 37   5061 5061 HOH HOH I . 
MJ 36 HOH 38   5249 5249 HOH HOH I . 
MJ 36 HOH 39   5290 5290 HOH HOH I . 
MJ 36 HOH 40   5361 5361 HOH HOH I . 
MJ 36 HOH 41   5590 5590 HOH HOH I . 
MJ 36 HOH 42   5750 5750 HOH HOH I . 
MJ 36 HOH 43   5758 5758 HOH HOH I . 
MJ 36 HOH 44   5907 5907 HOH HOH I . 
MJ 36 HOH 45   6256 6256 HOH HOH I . 
MJ 36 HOH 46   6706 6706 HOH HOH I . 
MJ 36 HOH 47   6807 6807 HOH HOH I . 
MJ 36 HOH 48   6835 6835 HOH HOH I . 
MJ 36 HOH 49   6836 6836 HOH HOH I . 
MJ 36 HOH 50   6869 6869 HOH HOH I . 
MJ 36 HOH 51   7003 7003 HOH HOH I . 
MJ 36 HOH 52   7004 7004 HOH HOH I . 
MJ 36 HOH 53   7282 7282 HOH HOH I . 
MJ 36 HOH 54   7377 7377 HOH HOH I . 
MJ 36 HOH 55   7546 7546 HOH HOH I . 
MJ 36 HOH 56   7556 7556 HOH HOH I . 
NJ 36 HOH 1    408  408  HOH HOH J . 
NJ 36 HOH 2    581  581  HOH HOH J . 
NJ 36 HOH 3    782  782  HOH HOH J . 
NJ 36 HOH 4    992  992  HOH HOH J . 
NJ 36 HOH 5    1163 1163 HOH HOH J . 
NJ 36 HOH 6    1216 1216 HOH HOH J . 
NJ 36 HOH 7    1334 1334 HOH HOH J . 
NJ 36 HOH 8    1387 1387 HOH HOH J . 
NJ 36 HOH 9    1433 1433 HOH HOH J . 
NJ 36 HOH 10   1454 1454 HOH HOH J . 
NJ 36 HOH 11   1762 1762 HOH HOH J . 
NJ 36 HOH 12   1765 1765 HOH HOH J . 
NJ 36 HOH 13   1799 1799 HOH HOH J . 
NJ 36 HOH 14   1841 1841 HOH HOH J . 
NJ 36 HOH 15   1986 1986 HOH HOH J . 
NJ 36 HOH 16   2121 2121 HOH HOH J . 
NJ 36 HOH 17   2247 2247 HOH HOH J . 
NJ 36 HOH 18   2499 2499 HOH HOH J . 
NJ 36 HOH 19   2591 2591 HOH HOH J . 
NJ 36 HOH 20   2659 2659 HOH HOH J . 
NJ 36 HOH 21   2777 2777 HOH HOH J . 
NJ 36 HOH 22   2914 2914 HOH HOH J . 
NJ 36 HOH 23   3160 3160 HOH HOH J . 
NJ 36 HOH 24   3385 3385 HOH HOH J . 
NJ 36 HOH 25   3442 3442 HOH HOH J . 
NJ 36 HOH 26   3492 3492 HOH HOH J . 
NJ 36 HOH 27   3709 3709 HOH HOH J . 
NJ 36 HOH 28   3919 3919 HOH HOH J . 
NJ 36 HOH 29   3955 3955 HOH HOH J . 
NJ 36 HOH 30   4003 4003 HOH HOH J . 
NJ 36 HOH 31   4066 4066 HOH HOH J . 
NJ 36 HOH 32   4172 4172 HOH HOH J . 
NJ 36 HOH 33   4183 4183 HOH HOH J . 
NJ 36 HOH 34   4747 4747 HOH HOH J . 
NJ 36 HOH 35   4854 4854 HOH HOH J . 
NJ 36 HOH 36   5017 5017 HOH HOH J . 
NJ 36 HOH 37   5029 5029 HOH HOH J . 
NJ 36 HOH 38   5264 5264 HOH HOH J . 
NJ 36 HOH 39   5283 5283 HOH HOH J . 
NJ 36 HOH 40   5358 5358 HOH HOH J . 
NJ 36 HOH 41   5632 5632 HOH HOH J . 
NJ 36 HOH 42   5638 5638 HOH HOH J . 
NJ 36 HOH 43   5696 5696 HOH HOH J . 
NJ 36 HOH 44   5729 5729 HOH HOH J . 
NJ 36 HOH 45   5780 5780 HOH HOH J . 
NJ 36 HOH 46   6030 6030 HOH HOH J . 
NJ 36 HOH 47   6100 6100 HOH HOH J . 
NJ 36 HOH 48   6115 6115 HOH HOH J . 
NJ 36 HOH 49   6313 6313 HOH HOH J . 
NJ 36 HOH 50   6344 6344 HOH HOH J . 
NJ 36 HOH 51   6456 6456 HOH HOH J . 
NJ 36 HOH 52   6493 6493 HOH HOH J . 
NJ 36 HOH 53   6513 6513 HOH HOH J . 
NJ 36 HOH 54   6646 6646 HOH HOH J . 
NJ 36 HOH 55   6707 6707 HOH HOH J . 
NJ 36 HOH 56   6972 6972 HOH HOH J . 
NJ 36 HOH 57   7064 7064 HOH HOH J . 
NJ 36 HOH 58   7075 7075 HOH HOH J . 
NJ 36 HOH 59   7143 7143 HOH HOH J . 
NJ 36 HOH 60   7169 7169 HOH HOH J . 
NJ 36 HOH 61   7438 7438 HOH HOH J . 
NJ 36 HOH 62   7871 7871 HOH HOH J . 
OJ 36 HOH 1    8511 42   HOH HOH K . 
OJ 36 HOH 2    8512 177  HOH HOH K . 
OJ 36 HOH 3    8513 200  HOH HOH K . 
OJ 36 HOH 4    8514 269  HOH HOH K . 
OJ 36 HOH 5    8515 353  HOH HOH K . 
OJ 36 HOH 6    8516 374  HOH HOH K . 
OJ 36 HOH 7    8517 490  HOH HOH K . 
OJ 36 HOH 8    8518 750  HOH HOH K . 
OJ 36 HOH 9    8519 766  HOH HOH K . 
OJ 36 HOH 10   8520 799  HOH HOH K . 
OJ 36 HOH 11   8521 893  HOH HOH K . 
OJ 36 HOH 12   8522 907  HOH HOH K . 
OJ 36 HOH 13   8523 1039 HOH HOH K . 
OJ 36 HOH 14   8524 1132 HOH HOH K . 
OJ 36 HOH 15   8525 1200 HOH HOH K . 
OJ 36 HOH 16   8526 1754 HOH HOH K . 
OJ 36 HOH 17   8527 1773 HOH HOH K . 
OJ 36 HOH 18   8528 1940 HOH HOH K . 
OJ 36 HOH 19   8529 2029 HOH HOH K . 
OJ 36 HOH 20   8530 2166 HOH HOH K . 
OJ 36 HOH 21   8531 2203 HOH HOH K . 
OJ 36 HOH 22   8532 2289 HOH HOH K . 
OJ 36 HOH 23   8533 2614 HOH HOH K . 
OJ 36 HOH 24   8534 2670 HOH HOH K . 
OJ 36 HOH 25   8535 2798 HOH HOH K . 
OJ 36 HOH 26   8536 3032 HOH HOH K . 
OJ 36 HOH 27   8537 3080 HOH HOH K . 
OJ 36 HOH 28   8538 3132 HOH HOH K . 
OJ 36 HOH 29   8539 3306 HOH HOH K . 
OJ 36 HOH 30   8540 3392 HOH HOH K . 
OJ 36 HOH 31   8541 3507 HOH HOH K . 
OJ 36 HOH 32   8542 3766 HOH HOH K . 
OJ 36 HOH 33   8543 3793 HOH HOH K . 
OJ 36 HOH 34   8544 3807 HOH HOH K . 
OJ 36 HOH 35   8545 3855 HOH HOH K . 
OJ 36 HOH 36   8546 3949 HOH HOH K . 
OJ 36 HOH 37   8547 4075 HOH HOH K . 
OJ 36 HOH 38   8548 4080 HOH HOH K . 
OJ 36 HOH 39   8549 4163 HOH HOH K . 
OJ 36 HOH 40   8550 4311 HOH HOH K . 
OJ 36 HOH 41   8551 4312 HOH HOH K . 
OJ 36 HOH 42   8552 4353 HOH HOH K . 
OJ 36 HOH 43   8553 4360 HOH HOH K . 
OJ 36 HOH 44   8554 4376 HOH HOH K . 
OJ 36 HOH 45   8555 4463 HOH HOH K . 
OJ 36 HOH 46   8556 4698 HOH HOH K . 
OJ 36 HOH 47   8557 4812 HOH HOH K . 
OJ 36 HOH 48   8558 4967 HOH HOH K . 
OJ 36 HOH 49   8559 4970 HOH HOH K . 
OJ 36 HOH 50   8560 5201 HOH HOH K . 
OJ 36 HOH 51   8561 5274 HOH HOH K . 
OJ 36 HOH 52   8562 5398 HOH HOH K . 
OJ 36 HOH 53   8563 5553 HOH HOH K . 
OJ 36 HOH 54   8564 5599 HOH HOH K . 
OJ 36 HOH 55   8565 5614 HOH HOH K . 
OJ 36 HOH 56   8566 5795 HOH HOH K . 
OJ 36 HOH 57   8567 5871 HOH HOH K . 
OJ 36 HOH 58   8568 5929 HOH HOH K . 
OJ 36 HOH 59   8569 5949 HOH HOH K . 
OJ 36 HOH 60   8570 5971 HOH HOH K . 
OJ 36 HOH 61   8571 6153 HOH HOH K . 
OJ 36 HOH 62   8572 6166 HOH HOH K . 
OJ 36 HOH 63   8573 6209 HOH HOH K . 
OJ 36 HOH 64   8574 6242 HOH HOH K . 
OJ 36 HOH 65   8575 6260 HOH HOH K . 
OJ 36 HOH 66   8576 6273 HOH HOH K . 
OJ 36 HOH 67   8577 6440 HOH HOH K . 
OJ 36 HOH 68   8578 6468 HOH HOH K . 
OJ 36 HOH 69   8579 6545 HOH HOH K . 
OJ 36 HOH 70   8580 6605 HOH HOH K . 
OJ 36 HOH 71   8581 6627 HOH HOH K . 
OJ 36 HOH 72   8582 6658 HOH HOH K . 
OJ 36 HOH 73   8583 7016 HOH HOH K . 
OJ 36 HOH 74   8584 7107 HOH HOH K . 
OJ 36 HOH 75   8585 7121 HOH HOH K . 
OJ 36 HOH 76   8586 7279 HOH HOH K . 
OJ 36 HOH 77   8587 7425 HOH HOH K . 
OJ 36 HOH 78   8588 7471 HOH HOH K . 
OJ 36 HOH 79   8589 7606 HOH HOH K . 
OJ 36 HOH 80   8590 7681 HOH HOH K . 
PJ 36 HOH 1    8519 57   HOH HOH L . 
PJ 36 HOH 2    8520 90   HOH HOH L . 
PJ 36 HOH 3    8521 98   HOH HOH L . 
PJ 36 HOH 4    8522 115  HOH HOH L . 
PJ 36 HOH 5    8523 128  HOH HOH L . 
PJ 36 HOH 6    8524 309  HOH HOH L . 
PJ 36 HOH 7    8525 436  HOH HOH L . 
PJ 36 HOH 8    8526 444  HOH HOH L . 
PJ 36 HOH 9    8527 450  HOH HOH L . 
PJ 36 HOH 10   8528 486  HOH HOH L . 
PJ 36 HOH 11   8529 498  HOH HOH L . 
PJ 36 HOH 12   8530 507  HOH HOH L . 
PJ 36 HOH 13   8531 525  HOH HOH L . 
PJ 36 HOH 14   8532 533  HOH HOH L . 
PJ 36 HOH 15   8533 594  HOH HOH L . 
PJ 36 HOH 16   8534 734  HOH HOH L . 
PJ 36 HOH 17   8535 847  HOH HOH L . 
PJ 36 HOH 18   8536 935  HOH HOH L . 
PJ 36 HOH 19   8537 936  HOH HOH L . 
PJ 36 HOH 20   8538 938  HOH HOH L . 
PJ 36 HOH 21   8539 973  HOH HOH L . 
PJ 36 HOH 22   8540 991  HOH HOH L . 
PJ 36 HOH 23   8541 1031 HOH HOH L . 
PJ 36 HOH 24   8542 1165 HOH HOH L . 
PJ 36 HOH 25   8543 1238 HOH HOH L . 
PJ 36 HOH 26   8544 1280 HOH HOH L . 
PJ 36 HOH 27   8545 1293 HOH HOH L . 
PJ 36 HOH 28   8546 1372 HOH HOH L . 
PJ 36 HOH 29   8547 1489 HOH HOH L . 
PJ 36 HOH 30   8548 1629 HOH HOH L . 
PJ 36 HOH 31   8549 1656 HOH HOH L . 
PJ 36 HOH 32   8550 1685 HOH HOH L . 
PJ 36 HOH 33   8551 1822 HOH HOH L . 
PJ 36 HOH 34   8552 1852 HOH HOH L . 
PJ 36 HOH 35   8553 1916 HOH HOH L . 
PJ 36 HOH 36   8554 1933 HOH HOH L . 
PJ 36 HOH 37   8555 1951 HOH HOH L . 
PJ 36 HOH 38   8556 2041 HOH HOH L . 
PJ 36 HOH 39   8557 2079 HOH HOH L . 
PJ 36 HOH 40   8558 2081 HOH HOH L . 
PJ 36 HOH 41   8559 2174 HOH HOH L . 
PJ 36 HOH 42   8560 2211 HOH HOH L . 
PJ 36 HOH 43   8561 2263 HOH HOH L . 
PJ 36 HOH 44   8562 2303 HOH HOH L . 
PJ 36 HOH 45   8563 2306 HOH HOH L . 
PJ 36 HOH 46   8564 2316 HOH HOH L . 
PJ 36 HOH 47   8565 2371 HOH HOH L . 
PJ 36 HOH 48   8566 2554 HOH HOH L . 
PJ 36 HOH 49   8567 2608 HOH HOH L . 
PJ 36 HOH 50   8568 2651 HOH HOH L . 
PJ 36 HOH 51   8569 2739 HOH HOH L . 
PJ 36 HOH 52   8570 2775 HOH HOH L . 
PJ 36 HOH 53   8571 2788 HOH HOH L . 
PJ 36 HOH 54   8572 2850 HOH HOH L . 
PJ 36 HOH 55   8573 2929 HOH HOH L . 
PJ 36 HOH 56   8574 2961 HOH HOH L . 
PJ 36 HOH 57   8575 3015 HOH HOH L . 
PJ 36 HOH 58   8576 3045 HOH HOH L . 
PJ 36 HOH 59   8577 3107 HOH HOH L . 
PJ 36 HOH 60   8578 3155 HOH HOH L . 
PJ 36 HOH 61   8579 3196 HOH HOH L . 
PJ 36 HOH 62   8580 3198 HOH HOH L . 
PJ 36 HOH 63   8581 3219 HOH HOH L . 
PJ 36 HOH 64   8582 3234 HOH HOH L . 
PJ 36 HOH 65   8583 3244 HOH HOH L . 
PJ 36 HOH 66   8584 3245 HOH HOH L . 
PJ 36 HOH 67   8585 3339 HOH HOH L . 
PJ 36 HOH 68   8586 3347 HOH HOH L . 
PJ 36 HOH 69   8587 3443 HOH HOH L . 
PJ 36 HOH 70   8588 3463 HOH HOH L . 
PJ 36 HOH 71   8589 3589 HOH HOH L . 
PJ 36 HOH 72   8590 3603 HOH HOH L . 
PJ 36 HOH 73   8591 3686 HOH HOH L . 
PJ 36 HOH 74   8592 3690 HOH HOH L . 
PJ 36 HOH 75   8593 3720 HOH HOH L . 
PJ 36 HOH 76   8594 3824 HOH HOH L . 
PJ 36 HOH 77   8595 3833 HOH HOH L . 
PJ 36 HOH 78   8596 3857 HOH HOH L . 
PJ 36 HOH 79   8597 3890 HOH HOH L . 
PJ 36 HOH 80   8598 3900 HOH HOH L . 
PJ 36 HOH 81   8599 4196 HOH HOH L . 
PJ 36 HOH 82   8600 4211 HOH HOH L . 
PJ 36 HOH 83   8601 4226 HOH HOH L . 
PJ 36 HOH 84   8602 4265 HOH HOH L . 
PJ 36 HOH 85   8603 4298 HOH HOH L . 
PJ 36 HOH 86   8604 4334 HOH HOH L . 
PJ 36 HOH 87   8605 4420 HOH HOH L . 
PJ 36 HOH 88   8606 4577 HOH HOH L . 
PJ 36 HOH 89   8607 4610 HOH HOH L . 
PJ 36 HOH 90   8608 4696 HOH HOH L . 
PJ 36 HOH 91   8609 4716 HOH HOH L . 
PJ 36 HOH 92   8610 4846 HOH HOH L . 
PJ 36 HOH 93   8611 4847 HOH HOH L . 
PJ 36 HOH 94   8612 5102 HOH HOH L . 
PJ 36 HOH 95   8613 5159 HOH HOH L . 
PJ 36 HOH 96   8614 5250 HOH HOH L . 
PJ 36 HOH 97   8615 5294 HOH HOH L . 
PJ 36 HOH 98   8616 5340 HOH HOH L . 
PJ 36 HOH 99   8617 5360 HOH HOH L . 
PJ 36 HOH 100  8618 5439 HOH HOH L . 
PJ 36 HOH 101  8619 5442 HOH HOH L . 
PJ 36 HOH 102  8620 5483 HOH HOH L . 
PJ 36 HOH 103  8621 5504 HOH HOH L . 
PJ 36 HOH 104  8622 5686 HOH HOH L . 
PJ 36 HOH 105  8623 5769 HOH HOH L . 
PJ 36 HOH 106  8624 5842 HOH HOH L . 
PJ 36 HOH 107  8625 5942 HOH HOH L . 
PJ 36 HOH 108  8626 5961 HOH HOH L . 
PJ 36 HOH 109  8627 6198 HOH HOH L . 
PJ 36 HOH 110  8628 6220 HOH HOH L . 
PJ 36 HOH 111  8629 6250 HOH HOH L . 
PJ 36 HOH 112  8630 6368 HOH HOH L . 
PJ 36 HOH 113  8631 6484 HOH HOH L . 
PJ 36 HOH 114  8632 6536 HOH HOH L . 
PJ 36 HOH 115  8633 6671 HOH HOH L . 
PJ 36 HOH 116  8634 6702 HOH HOH L . 
PJ 36 HOH 117  8635 6704 HOH HOH L . 
PJ 36 HOH 118  8636 6719 HOH HOH L . 
PJ 36 HOH 119  8637 6960 HOH HOH L . 
PJ 36 HOH 120  8638 7058 HOH HOH L . 
PJ 36 HOH 121  8639 7208 HOH HOH L . 
PJ 36 HOH 122  8640 7281 HOH HOH L . 
PJ 36 HOH 123  8641 7419 HOH HOH L . 
PJ 36 HOH 124  8642 7613 HOH HOH L . 
PJ 36 HOH 125  8643 7833 HOH HOH L . 
PJ 36 HOH 126  8644 7854 HOH HOH L . 
PJ 36 HOH 127  8645 7855 HOH HOH L . 
QJ 36 HOH 1    8508 125  HOH HOH M . 
QJ 36 HOH 2    8509 553  HOH HOH M . 
QJ 36 HOH 3    8510 588  HOH HOH M . 
QJ 36 HOH 4    8511 670  HOH HOH M . 
QJ 36 HOH 5    8512 853  HOH HOH M . 
QJ 36 HOH 6    8513 922  HOH HOH M . 
QJ 36 HOH 7    8514 1056 HOH HOH M . 
QJ 36 HOH 8    8515 1310 HOH HOH M . 
QJ 36 HOH 9    8516 1538 HOH HOH M . 
QJ 36 HOH 10   8517 1934 HOH HOH M . 
QJ 36 HOH 11   8518 1968 HOH HOH M . 
QJ 36 HOH 12   8519 2052 HOH HOH M . 
QJ 36 HOH 13   8520 2180 HOH HOH M . 
QJ 36 HOH 14   8521 2385 HOH HOH M . 
QJ 36 HOH 15   8522 2480 HOH HOH M . 
QJ 36 HOH 16   8523 2665 HOH HOH M . 
QJ 36 HOH 17   8524 2714 HOH HOH M . 
QJ 36 HOH 18   8525 2874 HOH HOH M . 
QJ 36 HOH 19   8526 2904 HOH HOH M . 
QJ 36 HOH 20   8527 2957 HOH HOH M . 
QJ 36 HOH 21   8528 3051 HOH HOH M . 
QJ 36 HOH 22   8529 3251 HOH HOH M . 
QJ 36 HOH 23   8530 3364 HOH HOH M . 
QJ 36 HOH 24   8531 3371 HOH HOH M . 
QJ 36 HOH 25   8532 3490 HOH HOH M . 
QJ 36 HOH 26   8533 3505 HOH HOH M . 
QJ 36 HOH 27   8534 3534 HOH HOH M . 
QJ 36 HOH 28   8535 3863 HOH HOH M . 
QJ 36 HOH 29   8536 4109 HOH HOH M . 
QJ 36 HOH 30   8537 4257 HOH HOH M . 
QJ 36 HOH 31   8538 4363 HOH HOH M . 
QJ 36 HOH 32   8539 4391 HOH HOH M . 
QJ 36 HOH 33   8540 4394 HOH HOH M . 
QJ 36 HOH 34   8541 4398 HOH HOH M . 
QJ 36 HOH 35   8542 4604 HOH HOH M . 
QJ 36 HOH 36   8543 4624 HOH HOH M . 
QJ 36 HOH 37   8544 4678 HOH HOH M . 
QJ 36 HOH 38   8545 4695 HOH HOH M . 
QJ 36 HOH 39   8546 4701 HOH HOH M . 
QJ 36 HOH 40   8547 4713 HOH HOH M . 
QJ 36 HOH 41   8548 4806 HOH HOH M . 
QJ 36 HOH 42   8549 5071 HOH HOH M . 
QJ 36 HOH 43   8550 5096 HOH HOH M . 
QJ 36 HOH 44   8551 5137 HOH HOH M . 
QJ 36 HOH 45   8552 5317 HOH HOH M . 
QJ 36 HOH 46   8553 5408 HOH HOH M . 
QJ 36 HOH 47   8554 5528 HOH HOH M . 
QJ 36 HOH 48   8555 5537 HOH HOH M . 
QJ 36 HOH 49   8556 5572 HOH HOH M . 
QJ 36 HOH 50   8557 5627 HOH HOH M . 
QJ 36 HOH 51   8558 6069 HOH HOH M . 
QJ 36 HOH 52   8559 6189 HOH HOH M . 
QJ 36 HOH 53   8560 6239 HOH HOH M . 
QJ 36 HOH 54   8561 6437 HOH HOH M . 
QJ 36 HOH 55   8562 6448 HOH HOH M . 
QJ 36 HOH 56   8563 6497 HOH HOH M . 
QJ 36 HOH 57   8564 6665 HOH HOH M . 
QJ 36 HOH 58   8565 6762 HOH HOH M . 
QJ 36 HOH 59   8566 6783 HOH HOH M . 
QJ 36 HOH 60   8567 6795 HOH HOH M . 
QJ 36 HOH 61   8568 6913 HOH HOH M . 
QJ 36 HOH 62   8569 6988 HOH HOH M . 
QJ 36 HOH 63   8570 7103 HOH HOH M . 
QJ 36 HOH 64   8571 7167 HOH HOH M . 
QJ 36 HOH 65   8572 7307 HOH HOH M . 
QJ 36 HOH 66   8573 7390 HOH HOH M . 
QJ 36 HOH 67   8574 7404 HOH HOH M . 
QJ 36 HOH 68   8575 7552 HOH HOH M . 
QJ 36 HOH 69   8576 7678 HOH HOH M . 
QJ 36 HOH 70   8577 7857 HOH HOH M . 
RJ 36 HOH 1    510  510  HOH HOH N . 
RJ 36 HOH 2    1484 1484 HOH HOH N . 
RJ 36 HOH 3    1623 1623 HOH HOH N . 
RJ 36 HOH 4    1937 1937 HOH HOH N . 
RJ 36 HOH 5    2176 2176 HOH HOH N . 
RJ 36 HOH 6    2336 2336 HOH HOH N . 
RJ 36 HOH 7    2823 2823 HOH HOH N . 
RJ 36 HOH 8    3062 3062 HOH HOH N . 
RJ 36 HOH 9    3240 3240 HOH HOH N . 
RJ 36 HOH 10   3352 3352 HOH HOH N . 
RJ 36 HOH 11   3360 3360 HOH HOH N . 
RJ 36 HOH 12   4171 4171 HOH HOH N . 
RJ 36 HOH 13   4258 4258 HOH HOH N . 
RJ 36 HOH 14   4297 4297 HOH HOH N . 
RJ 36 HOH 15   4490 4490 HOH HOH N . 
RJ 36 HOH 16   4656 4656 HOH HOH N . 
RJ 36 HOH 17   4676 4676 HOH HOH N . 
RJ 36 HOH 18   4770 4770 HOH HOH N . 
RJ 36 HOH 19   4826 4826 HOH HOH N . 
RJ 36 HOH 20   5083 5083 HOH HOH N . 
RJ 36 HOH 21   5104 5104 HOH HOH N . 
RJ 36 HOH 22   5191 5191 HOH HOH N . 
RJ 36 HOH 23   5541 5541 HOH HOH N . 
RJ 36 HOH 24   5650 5650 HOH HOH N . 
RJ 36 HOH 25   6006 6006 HOH HOH N . 
RJ 36 HOH 26   6044 6044 HOH HOH N . 
RJ 36 HOH 27   6111 6111 HOH HOH N . 
RJ 36 HOH 28   6142 6142 HOH HOH N . 
RJ 36 HOH 29   6147 6147 HOH HOH N . 
RJ 36 HOH 30   6194 6194 HOH HOH N . 
RJ 36 HOH 31   6252 6252 HOH HOH N . 
RJ 36 HOH 32   6442 6442 HOH HOH N . 
RJ 36 HOH 33   6661 6661 HOH HOH N . 
RJ 36 HOH 34   6754 6754 HOH HOH N . 
RJ 36 HOH 35   6799 6799 HOH HOH N . 
RJ 36 HOH 36   6810 6810 HOH HOH N . 
RJ 36 HOH 37   6939 6939 HOH HOH N . 
RJ 36 HOH 38   7061 7061 HOH HOH N . 
RJ 36 HOH 39   7077 7077 HOH HOH N . 
RJ 36 HOH 40   7481 7481 HOH HOH N . 
RJ 36 HOH 41   7521 7521 HOH HOH N . 
RJ 36 HOH 42   7543 7543 HOH HOH N . 
RJ 36 HOH 43   7674 7674 HOH HOH N . 
SJ 36 HOH 1    149  82   HOH HOH O . 
SJ 36 HOH 2    150  311  HOH HOH O . 
SJ 36 HOH 3    151  340  HOH HOH O . 
SJ 36 HOH 4    152  584  HOH HOH O . 
SJ 36 HOH 5    153  641  HOH HOH O . 
SJ 36 HOH 6    154  773  HOH HOH O . 
SJ 36 HOH 7    155  804  HOH HOH O . 
SJ 36 HOH 8    156  1048 HOH HOH O . 
SJ 36 HOH 9    157  1226 HOH HOH O . 
SJ 36 HOH 10   158  1406 HOH HOH O . 
SJ 36 HOH 11   159  1458 HOH HOH O . 
SJ 36 HOH 12   160  1528 HOH HOH O . 
SJ 36 HOH 13   161  1715 HOH HOH O . 
SJ 36 HOH 14   162  1778 HOH HOH O . 
SJ 36 HOH 15   163  1865 HOH HOH O . 
SJ 36 HOH 16   164  1926 HOH HOH O . 
SJ 36 HOH 17   165  1932 HOH HOH O . 
SJ 36 HOH 18   166  2133 HOH HOH O . 
SJ 36 HOH 19   167  2178 HOH HOH O . 
SJ 36 HOH 20   168  2495 HOH HOH O . 
SJ 36 HOH 21   169  2520 HOH HOH O . 
SJ 36 HOH 22   170  2633 HOH HOH O . 
SJ 36 HOH 23   171  2641 HOH HOH O . 
SJ 36 HOH 24   172  3221 HOH HOH O . 
SJ 36 HOH 25   173  3319 HOH HOH O . 
SJ 36 HOH 26   174  3748 HOH HOH O . 
SJ 36 HOH 27   175  3757 HOH HOH O . 
SJ 36 HOH 28   176  3969 HOH HOH O . 
SJ 36 HOH 29   177  4043 HOH HOH O . 
SJ 36 HOH 30   178  4077 HOH HOH O . 
SJ 36 HOH 31   179  4299 HOH HOH O . 
SJ 36 HOH 32   180  4372 HOH HOH O . 
SJ 36 HOH 33   181  4563 HOH HOH O . 
SJ 36 HOH 34   182  4637 HOH HOH O . 
SJ 36 HOH 35   183  4661 HOH HOH O . 
SJ 36 HOH 36   184  4744 HOH HOH O . 
SJ 36 HOH 37   185  4763 HOH HOH O . 
SJ 36 HOH 38   186  4818 HOH HOH O . 
SJ 36 HOH 39   187  5004 HOH HOH O . 
SJ 36 HOH 40   188  5262 HOH HOH O . 
SJ 36 HOH 41   189  5319 HOH HOH O . 
SJ 36 HOH 42   190  5414 HOH HOH O . 
SJ 36 HOH 43   191  5440 HOH HOH O . 
SJ 36 HOH 44   192  5478 HOH HOH O . 
SJ 36 HOH 45   193  5511 HOH HOH O . 
SJ 36 HOH 46   194  5521 HOH HOH O . 
SJ 36 HOH 47   195  5597 HOH HOH O . 
SJ 36 HOH 48   196  5725 HOH HOH O . 
SJ 36 HOH 49   197  5836 HOH HOH O . 
SJ 36 HOH 50   198  5891 HOH HOH O . 
SJ 36 HOH 51   199  6001 HOH HOH O . 
SJ 36 HOH 52   200  6051 HOH HOH O . 
SJ 36 HOH 53   201  6072 HOH HOH O . 
SJ 36 HOH 54   202  6099 HOH HOH O . 
SJ 36 HOH 55   203  6315 HOH HOH O . 
SJ 36 HOH 56   204  6486 HOH HOH O . 
SJ 36 HOH 57   205  6525 HOH HOH O . 
SJ 36 HOH 58   206  6585 HOH HOH O . 
SJ 36 HOH 59   207  6687 HOH HOH O . 
SJ 36 HOH 60   208  6904 HOH HOH O . 
SJ 36 HOH 61   209  7156 HOH HOH O . 
SJ 36 HOH 62   210  7186 HOH HOH O . 
SJ 36 HOH 63   211  7381 HOH HOH O . 
SJ 36 HOH 64   212  7503 HOH HOH O . 
SJ 36 HOH 65   213  7545 HOH HOH O . 
SJ 36 HOH 66   214  7575 HOH HOH O . 
SJ 36 HOH 67   215  7699 HOH HOH O . 
SJ 36 HOH 68   216  7890 HOH HOH O . 
TJ 36 HOH 1    245  245  HOH HOH P . 
TJ 36 HOH 2    1242 1242 HOH HOH P . 
TJ 36 HOH 3    1295 1295 HOH HOH P . 
TJ 36 HOH 4    1356 1356 HOH HOH P . 
TJ 36 HOH 5    1479 1479 HOH HOH P . 
TJ 36 HOH 6    1571 1571 HOH HOH P . 
TJ 36 HOH 7    1795 1795 HOH HOH P . 
TJ 36 HOH 8    2309 2309 HOH HOH P . 
TJ 36 HOH 9    2588 2588 HOH HOH P . 
TJ 36 HOH 10   2847 2847 HOH HOH P . 
TJ 36 HOH 11   2999 2999 HOH HOH P . 
TJ 36 HOH 12   3224 3224 HOH HOH P . 
TJ 36 HOH 13   3294 3294 HOH HOH P . 
TJ 36 HOH 14   3458 3458 HOH HOH P . 
TJ 36 HOH 15   3488 3488 HOH HOH P . 
TJ 36 HOH 16   3550 3550 HOH HOH P . 
TJ 36 HOH 17   3595 3595 HOH HOH P . 
TJ 36 HOH 18   3671 3671 HOH HOH P . 
TJ 36 HOH 19   3700 3700 HOH HOH P . 
TJ 36 HOH 20   3971 3971 HOH HOH P . 
TJ 36 HOH 21   4350 4350 HOH HOH P . 
TJ 36 HOH 22   4709 4709 HOH HOH P . 
TJ 36 HOH 23   4785 4785 HOH HOH P . 
TJ 36 HOH 24   4792 4792 HOH HOH P . 
TJ 36 HOH 25   4808 4808 HOH HOH P . 
TJ 36 HOH 26   4923 4923 HOH HOH P . 
TJ 36 HOH 27   4956 4956 HOH HOH P . 
TJ 36 HOH 28   5227 5227 HOH HOH P . 
TJ 36 HOH 29   5247 5247 HOH HOH P . 
TJ 36 HOH 30   5427 5427 HOH HOH P . 
TJ 36 HOH 31   5518 5518 HOH HOH P . 
TJ 36 HOH 32   5620 5620 HOH HOH P . 
TJ 36 HOH 33   5641 5641 HOH HOH P . 
TJ 36 HOH 34   5665 5665 HOH HOH P . 
TJ 36 HOH 35   5840 5840 HOH HOH P . 
TJ 36 HOH 36   5853 5853 HOH HOH P . 
TJ 36 HOH 37   5870 5870 HOH HOH P . 
TJ 36 HOH 38   5903 5903 HOH HOH P . 
TJ 36 HOH 39   5998 5998 HOH HOH P . 
TJ 36 HOH 40   6092 6092 HOH HOH P . 
TJ 36 HOH 41   6110 6110 HOH HOH P . 
TJ 36 HOH 42   6213 6213 HOH HOH P . 
TJ 36 HOH 43   6286 6286 HOH HOH P . 
TJ 36 HOH 44   6470 6470 HOH HOH P . 
TJ 36 HOH 45   6559 6559 HOH HOH P . 
TJ 36 HOH 46   6597 6597 HOH HOH P . 
TJ 36 HOH 47   6982 6982 HOH HOH P . 
TJ 36 HOH 48   7115 7115 HOH HOH P . 
TJ 36 HOH 49   7161 7161 HOH HOH P . 
TJ 36 HOH 50   7270 7270 HOH HOH P . 
TJ 36 HOH 51   7328 7328 HOH HOH P . 
TJ 36 HOH 52   7505 7505 HOH HOH P . 
TJ 36 HOH 53   7617 7617 HOH HOH P . 
UJ 36 HOH 1    8507 24   HOH HOH Q . 
UJ 36 HOH 2    8508 382  HOH HOH Q . 
UJ 36 HOH 3    8509 423  HOH HOH Q . 
UJ 36 HOH 4    8510 559  HOH HOH Q . 
UJ 36 HOH 5    8511 591  HOH HOH Q . 
UJ 36 HOH 6    8512 667  HOH HOH Q . 
UJ 36 HOH 7    8513 1215 HOH HOH Q . 
UJ 36 HOH 8    8514 1316 HOH HOH Q . 
UJ 36 HOH 9    8515 1317 HOH HOH Q . 
UJ 36 HOH 10   8516 1417 HOH HOH Q . 
UJ 36 HOH 11   8517 1434 HOH HOH Q . 
UJ 36 HOH 12   8518 1664 HOH HOH Q . 
UJ 36 HOH 13   8519 1701 HOH HOH Q . 
UJ 36 HOH 14   8520 1753 HOH HOH Q . 
UJ 36 HOH 15   8521 2015 HOH HOH Q . 
UJ 36 HOH 16   8522 2067 HOH HOH Q . 
UJ 36 HOH 17   8523 2106 HOH HOH Q . 
UJ 36 HOH 18   8524 2222 HOH HOH Q . 
UJ 36 HOH 19   8525 2224 HOH HOH Q . 
UJ 36 HOH 20   8526 2259 HOH HOH Q . 
UJ 36 HOH 21   8527 2434 HOH HOH Q . 
UJ 36 HOH 22   8528 2879 HOH HOH Q . 
UJ 36 HOH 23   8529 2943 HOH HOH Q . 
UJ 36 HOH 24   8530 3034 HOH HOH Q . 
UJ 36 HOH 25   8531 3180 HOH HOH Q . 
UJ 36 HOH 26   8532 3184 HOH HOH Q . 
UJ 36 HOH 27   8533 3193 HOH HOH Q . 
UJ 36 HOH 28   8534 3273 HOH HOH Q . 
UJ 36 HOH 29   8535 3328 HOH HOH Q . 
UJ 36 HOH 30   8536 3421 HOH HOH Q . 
UJ 36 HOH 31   8537 3504 HOH HOH Q . 
UJ 36 HOH 32   8538 3508 HOH HOH Q . 
UJ 36 HOH 33   8539 3532 HOH HOH Q . 
UJ 36 HOH 34   8540 3539 HOH HOH Q . 
UJ 36 HOH 35   8541 3859 HOH HOH Q . 
UJ 36 HOH 36   8542 3878 HOH HOH Q . 
UJ 36 HOH 37   8543 3905 HOH HOH Q . 
UJ 36 HOH 38   8544 3973 HOH HOH Q . 
UJ 36 HOH 39   8545 3991 HOH HOH Q . 
UJ 36 HOH 40   8546 4011 HOH HOH Q . 
UJ 36 HOH 41   8547 4223 HOH HOH Q . 
UJ 36 HOH 42   8548 4608 HOH HOH Q . 
UJ 36 HOH 43   8549 4819 HOH HOH Q . 
UJ 36 HOH 44   8550 4865 HOH HOH Q . 
UJ 36 HOH 45   8551 4893 HOH HOH Q . 
UJ 36 HOH 46   8552 4990 HOH HOH Q . 
UJ 36 HOH 47   8553 4997 HOH HOH Q . 
UJ 36 HOH 48   8554 5069 HOH HOH Q . 
UJ 36 HOH 49   8555 5075 HOH HOH Q . 
UJ 36 HOH 50   8556 5106 HOH HOH Q . 
UJ 36 HOH 51   8557 5357 HOH HOH Q . 
UJ 36 HOH 52   8558 5386 HOH HOH Q . 
UJ 36 HOH 53   8559 5471 HOH HOH Q . 
UJ 36 HOH 54   8560 5591 HOH HOH Q . 
UJ 36 HOH 55   8561 5684 HOH HOH Q . 
UJ 36 HOH 56   8562 5760 HOH HOH Q . 
UJ 36 HOH 57   8563 5766 HOH HOH Q . 
UJ 36 HOH 58   8564 5814 HOH HOH Q . 
UJ 36 HOH 59   8565 5996 HOH HOH Q . 
UJ 36 HOH 60   8566 6038 HOH HOH Q . 
UJ 36 HOH 61   8567 6346 HOH HOH Q . 
UJ 36 HOH 62   8568 6372 HOH HOH Q . 
UJ 36 HOH 63   8569 6439 HOH HOH Q . 
UJ 36 HOH 64   8570 6478 HOH HOH Q . 
UJ 36 HOH 65   8571 6558 HOH HOH Q . 
UJ 36 HOH 66   8572 6616 HOH HOH Q . 
UJ 36 HOH 67   8573 6618 HOH HOH Q . 
UJ 36 HOH 68   8574 6628 HOH HOH Q . 
UJ 36 HOH 69   8575 6682 HOH HOH Q . 
UJ 36 HOH 70   8576 6779 HOH HOH Q . 
UJ 36 HOH 71   8577 7029 HOH HOH Q . 
UJ 36 HOH 72   8578 7181 HOH HOH Q . 
UJ 36 HOH 73   8579 7234 HOH HOH Q . 
UJ 36 HOH 74   8580 7274 HOH HOH Q . 
UJ 36 HOH 75   8581 7375 HOH HOH Q . 
UJ 36 HOH 76   8582 7396 HOH HOH Q . 
UJ 36 HOH 77   8583 7413 HOH HOH Q . 
UJ 36 HOH 78   8584 7535 HOH HOH Q . 
UJ 36 HOH 79   8585 7555 HOH HOH Q . 
UJ 36 HOH 80   8586 7631 HOH HOH Q . 
UJ 36 HOH 81   8587 7785 HOH HOH Q . 
VJ 36 HOH 1    8313 4    HOH HOH R . 
VJ 36 HOH 2    8314 86   HOH HOH R . 
VJ 36 HOH 3    8315 157  HOH HOH R . 
VJ 36 HOH 4    8316 924  HOH HOH R . 
VJ 36 HOH 5    8317 1504 HOH HOH R . 
VJ 36 HOH 6    8318 1657 HOH HOH R . 
VJ 36 HOH 7    8319 1758 HOH HOH R . 
VJ 36 HOH 8    8320 2190 HOH HOH R . 
VJ 36 HOH 9    8321 2334 HOH HOH R . 
VJ 36 HOH 10   8322 2519 HOH HOH R . 
VJ 36 HOH 11   8323 2625 HOH HOH R . 
VJ 36 HOH 12   8324 2672 HOH HOH R . 
VJ 36 HOH 13   8325 2901 HOH HOH R . 
VJ 36 HOH 14   8326 3146 HOH HOH R . 
VJ 36 HOH 15   8327 3228 HOH HOH R . 
VJ 36 HOH 16   8328 3243 HOH HOH R . 
VJ 36 HOH 17   8329 3430 HOH HOH R . 
VJ 36 HOH 18   8330 3563 HOH HOH R . 
VJ 36 HOH 19   8331 3649 HOH HOH R . 
VJ 36 HOH 20   8332 3944 HOH HOH R . 
VJ 36 HOH 21   8333 4472 HOH HOH R . 
VJ 36 HOH 22   8334 4527 HOH HOH R . 
VJ 36 HOH 23   8335 4895 HOH HOH R . 
VJ 36 HOH 24   8336 5267 HOH HOH R . 
VJ 36 HOH 25   8337 6511 HOH HOH R . 
VJ 36 HOH 26   8338 6594 HOH HOH R . 
VJ 36 HOH 27   8339 6771 HOH HOH R . 
VJ 36 HOH 28   8340 6969 HOH HOH R . 
VJ 36 HOH 29   8341 7106 HOH HOH R . 
VJ 36 HOH 30   8342 7263 HOH HOH R . 
VJ 36 HOH 31   8343 7716 HOH HOH R . 
VJ 36 HOH 32   8344 7764 HOH HOH R . 
WJ 36 HOH 1    191  191  HOH HOH S . 
WJ 36 HOH 2    644  644  HOH HOH S . 
WJ 36 HOH 3    772  772  HOH HOH S . 
WJ 36 HOH 4    921  921  HOH HOH S . 
WJ 36 HOH 5    1124 1124 HOH HOH S . 
WJ 36 HOH 6    2331 2331 HOH HOH S . 
WJ 36 HOH 7    2510 2510 HOH HOH S . 
WJ 36 HOH 8    2526 2526 HOH HOH S . 
WJ 36 HOH 9    2868 2868 HOH HOH S . 
WJ 36 HOH 10   2885 2885 HOH HOH S . 
WJ 36 HOH 11   3035 3035 HOH HOH S . 
WJ 36 HOH 12   3254 3254 HOH HOH S . 
WJ 36 HOH 13   3784 3784 HOH HOH S . 
WJ 36 HOH 14   3851 3851 HOH HOH S . 
WJ 36 HOH 15   4056 4056 HOH HOH S . 
WJ 36 HOH 16   4403 4403 HOH HOH S . 
WJ 36 HOH 17   4584 4584 HOH HOH S . 
WJ 36 HOH 18   4606 4606 HOH HOH S . 
WJ 36 HOH 19   4772 4772 HOH HOH S . 
WJ 36 HOH 20   4913 4913 HOH HOH S . 
WJ 36 HOH 21   5058 5058 HOH HOH S . 
WJ 36 HOH 22   5160 5160 HOH HOH S . 
WJ 36 HOH 23   5241 5241 HOH HOH S . 
WJ 36 HOH 24   5545 5545 HOH HOH S . 
WJ 36 HOH 25   5837 5837 HOH HOH S . 
WJ 36 HOH 26   6109 6109 HOH HOH S . 
WJ 36 HOH 27   6217 6217 HOH HOH S . 
WJ 36 HOH 28   6320 6320 HOH HOH S . 
WJ 36 HOH 29   6384 6384 HOH HOH S . 
WJ 36 HOH 30   6498 6498 HOH HOH S . 
WJ 36 HOH 31   6519 6519 HOH HOH S . 
WJ 36 HOH 32   6653 6653 HOH HOH S . 
WJ 36 HOH 33   6703 6703 HOH HOH S . 
WJ 36 HOH 34   6711 6711 HOH HOH S . 
WJ 36 HOH 35   7031 7031 HOH HOH S . 
WJ 36 HOH 36   7379 7379 HOH HOH S . 
WJ 36 HOH 37   7462 7462 HOH HOH S . 
WJ 36 HOH 38   7470 7470 HOH HOH S . 
WJ 36 HOH 39   7653 7653 HOH HOH S . 
XJ 36 HOH 1    151  151  HOH HOH T . 
XJ 36 HOH 2    774  774  HOH HOH T . 
XJ 36 HOH 3    1102 1102 HOH HOH T . 
XJ 36 HOH 4    1257 1257 HOH HOH T . 
XJ 36 HOH 5    1703 1703 HOH HOH T . 
XJ 36 HOH 6    1711 1711 HOH HOH T . 
XJ 36 HOH 7    2453 2453 HOH HOH T . 
XJ 36 HOH 8    3104 3104 HOH HOH T . 
XJ 36 HOH 9    3194 3194 HOH HOH T . 
XJ 36 HOH 10   3564 3564 HOH HOH T . 
XJ 36 HOH 11   3805 3805 HOH HOH T . 
XJ 36 HOH 12   4195 4195 HOH HOH T . 
XJ 36 HOH 13   4381 4381 HOH HOH T . 
XJ 36 HOH 14   4632 4632 HOH HOH T . 
XJ 36 HOH 15   5334 5334 HOH HOH T . 
XJ 36 HOH 16   5529 5529 HOH HOH T . 
XJ 36 HOH 17   5600 5600 HOH HOH T . 
XJ 36 HOH 18   6067 6067 HOH HOH T . 
XJ 36 HOH 19   6215 6215 HOH HOH T . 
XJ 36 HOH 20   6532 6532 HOH HOH T . 
XJ 36 HOH 21   6603 6603 HOH HOH T . 
XJ 36 HOH 22   6621 6621 HOH HOH T . 
XJ 36 HOH 23   6796 6796 HOH HOH T . 
XJ 36 HOH 24   7131 7131 HOH HOH T . 
XJ 36 HOH 25   7349 7349 HOH HOH T . 
YJ 36 HOH 1    341  341  HOH HOH U . 
YJ 36 HOH 2    874  874  HOH HOH U . 
YJ 36 HOH 3    1680 1680 HOH HOH U . 
YJ 36 HOH 4    2271 2271 HOH HOH U . 
YJ 36 HOH 5    2551 2551 HOH HOH U . 
YJ 36 HOH 6    2682 2682 HOH HOH U . 
YJ 36 HOH 7    2761 2761 HOH HOH U . 
YJ 36 HOH 8    2786 2786 HOH HOH U . 
YJ 36 HOH 9    2826 2826 HOH HOH U . 
YJ 36 HOH 10   4428 4428 HOH HOH U . 
YJ 36 HOH 11   5260 5260 HOH HOH U . 
YJ 36 HOH 12   6622 6622 HOH HOH U . 
YJ 36 HOH 13   7083 7083 HOH HOH U . 
YJ 36 HOH 14   7247 7247 HOH HOH U . 
YJ 36 HOH 15   7325 7325 HOH HOH U . 
ZJ 36 HOH 1    321  321  HOH HOH V . 
ZJ 36 HOH 2    705  705  HOH HOH V . 
ZJ 36 HOH 3    768  768  HOH HOH V . 
ZJ 36 HOH 4    808  808  HOH HOH V . 
ZJ 36 HOH 5    914  914  HOH HOH V . 
ZJ 36 HOH 6    943  943  HOH HOH V . 
ZJ 36 HOH 7    1099 1099 HOH HOH V . 
ZJ 36 HOH 8    1266 1266 HOH HOH V . 
ZJ 36 HOH 9    1436 1436 HOH HOH V . 
ZJ 36 HOH 10   1466 1466 HOH HOH V . 
ZJ 36 HOH 11   1675 1675 HOH HOH V . 
ZJ 36 HOH 12   1760 1760 HOH HOH V . 
ZJ 36 HOH 13   1990 1990 HOH HOH V . 
ZJ 36 HOH 14   2229 2229 HOH HOH V . 
ZJ 36 HOH 15   2359 2359 HOH HOH V . 
ZJ 36 HOH 16   2374 2374 HOH HOH V . 
ZJ 36 HOH 17   2729 2729 HOH HOH V . 
ZJ 36 HOH 18   2749 2749 HOH HOH V . 
ZJ 36 HOH 19   2756 2756 HOH HOH V . 
ZJ 36 HOH 20   2935 2935 HOH HOH V . 
ZJ 36 HOH 21   3071 3071 HOH HOH V . 
ZJ 36 HOH 22   3312 3312 HOH HOH V . 
ZJ 36 HOH 23   3483 3483 HOH HOH V . 
ZJ 36 HOH 24   3520 3520 HOH HOH V . 
ZJ 36 HOH 25   3580 3580 HOH HOH V . 
ZJ 36 HOH 26   3583 3583 HOH HOH V . 
ZJ 36 HOH 27   3734 3734 HOH HOH V . 
ZJ 36 HOH 28   3741 3741 HOH HOH V . 
ZJ 36 HOH 29   3899 3899 HOH HOH V . 
ZJ 36 HOH 30   3920 3920 HOH HOH V . 
ZJ 36 HOH 31   4031 4031 HOH HOH V . 
ZJ 36 HOH 32   4203 4203 HOH HOH V . 
ZJ 36 HOH 33   4276 4276 HOH HOH V . 
ZJ 36 HOH 34   4301 4301 HOH HOH V . 
ZJ 36 HOH 35   4471 4471 HOH HOH V . 
ZJ 36 HOH 36   4578 4578 HOH HOH V . 
ZJ 36 HOH 37   4681 4681 HOH HOH V . 
ZJ 36 HOH 38   4718 4718 HOH HOH V . 
ZJ 36 HOH 39   4771 4771 HOH HOH V . 
ZJ 36 HOH 40   4859 4859 HOH HOH V . 
ZJ 36 HOH 41   4944 4944 HOH HOH V . 
ZJ 36 HOH 42   4971 4971 HOH HOH V . 
ZJ 36 HOH 43   5084 5084 HOH HOH V . 
ZJ 36 HOH 44   5093 5093 HOH HOH V . 
ZJ 36 HOH 45   5390 5390 HOH HOH V . 
ZJ 36 HOH 46   5420 5420 HOH HOH V . 
ZJ 36 HOH 47   5425 5425 HOH HOH V . 
ZJ 36 HOH 48   5458 5458 HOH HOH V . 
ZJ 36 HOH 49   5460 5460 HOH HOH V . 
ZJ 36 HOH 50   5640 5640 HOH HOH V . 
ZJ 36 HOH 51   5763 5763 HOH HOH V . 
ZJ 36 HOH 52   5817 5817 HOH HOH V . 
ZJ 36 HOH 53   5862 5862 HOH HOH V . 
ZJ 36 HOH 54   5904 5904 HOH HOH V . 
ZJ 36 HOH 55   5934 5934 HOH HOH V . 
ZJ 36 HOH 56   6015 6015 HOH HOH V . 
ZJ 36 HOH 57   6182 6182 HOH HOH V . 
ZJ 36 HOH 58   6373 6373 HOH HOH V . 
ZJ 36 HOH 59   6679 6679 HOH HOH V . 
ZJ 36 HOH 60   6690 6690 HOH HOH V . 
ZJ 36 HOH 61   6694 6694 HOH HOH V . 
ZJ 36 HOH 62   6784 6784 HOH HOH V . 
ZJ 36 HOH 63   6871 6871 HOH HOH V . 
ZJ 36 HOH 64   6877 6877 HOH HOH V . 
ZJ 36 HOH 65   7093 7093 HOH HOH V . 
ZJ 36 HOH 66   7539 7539 HOH HOH V . 
ZJ 36 HOH 67   7673 7673 HOH HOH V . 
AK 36 HOH 1    1049 1049 HOH HOH W . 
AK 36 HOH 2    1449 1449 HOH HOH W . 
AK 36 HOH 3    2171 2171 HOH HOH W . 
AK 36 HOH 4    2479 2479 HOH HOH W . 
AK 36 HOH 5    2645 2645 HOH HOH W . 
AK 36 HOH 6    2982 2982 HOH HOH W . 
AK 36 HOH 7    3348 3348 HOH HOH W . 
AK 36 HOH 8    3419 3419 HOH HOH W . 
AK 36 HOH 9    3820 3820 HOH HOH W . 
AK 36 HOH 10   3861 3861 HOH HOH W . 
AK 36 HOH 11   4132 4132 HOH HOH W . 
AK 36 HOH 12   4522 4522 HOH HOH W . 
AK 36 HOH 13   4862 4862 HOH HOH W . 
AK 36 HOH 14   5080 5080 HOH HOH W . 
AK 36 HOH 15   5356 5356 HOH HOH W . 
AK 36 HOH 16   5564 5564 HOH HOH W . 
AK 36 HOH 17   5849 5849 HOH HOH W . 
AK 36 HOH 18   6091 6091 HOH HOH W . 
AK 36 HOH 19   6177 6177 HOH HOH W . 
AK 36 HOH 20   6178 6178 HOH HOH W . 
AK 36 HOH 21   6179 6179 HOH HOH W . 
AK 36 HOH 22   6514 6514 HOH HOH W . 
AK 36 HOH 23   6590 6590 HOH HOH W . 
AK 36 HOH 24   6623 6623 HOH HOH W . 
AK 36 HOH 25   6705 6705 HOH HOH W . 
AK 36 HOH 26   6893 6893 HOH HOH W . 
AK 36 HOH 27   7020 7020 HOH HOH W . 
AK 36 HOH 28   7303 7303 HOH HOH W . 
AK 36 HOH 29   7542 7542 HOH HOH W . 
BK 36 HOH 1    8521 59   HOH HOH X . 
BK 36 HOH 2    8522 100  HOH HOH X . 
BK 36 HOH 3    8523 148  HOH HOH X . 
BK 36 HOH 4    8524 163  HOH HOH X . 
BK 36 HOH 5    8525 239  HOH HOH X . 
BK 36 HOH 6    8526 301  HOH HOH X . 
BK 36 HOH 7    8527 398  HOH HOH X . 
BK 36 HOH 8    8528 611  HOH HOH X . 
BK 36 HOH 9    8529 651  HOH HOH X . 
BK 36 HOH 10   8530 776  HOH HOH X . 
BK 36 HOH 11   8531 845  HOH HOH X . 
BK 36 HOH 12   8532 865  HOH HOH X . 
BK 36 HOH 13   8533 960  HOH HOH X . 
BK 36 HOH 14   8534 1007 HOH HOH X . 
BK 36 HOH 15   8535 1118 HOH HOH X . 
BK 36 HOH 16   8536 1120 HOH HOH X . 
BK 36 HOH 17   8537 1240 HOH HOH X . 
BK 36 HOH 18   8538 1559 HOH HOH X . 
BK 36 HOH 19   8539 1597 HOH HOH X . 
BK 36 HOH 20   8540 1684 HOH HOH X . 
BK 36 HOH 21   8541 1835 HOH HOH X . 
BK 36 HOH 22   8542 1945 HOH HOH X . 
BK 36 HOH 23   8543 1969 HOH HOH X . 
BK 36 HOH 24   8544 2288 HOH HOH X . 
BK 36 HOH 25   8545 2323 HOH HOH X . 
BK 36 HOH 26   8546 2361 HOH HOH X . 
BK 36 HOH 27   8547 2486 HOH HOH X . 
BK 36 HOH 28   8548 2825 HOH HOH X . 
BK 36 HOH 29   8549 2851 HOH HOH X . 
BK 36 HOH 30   8550 2991 HOH HOH X . 
BK 36 HOH 31   8551 3026 HOH HOH X . 
BK 36 HOH 32   8552 3088 HOH HOH X . 
BK 36 HOH 33   8553 3299 HOH HOH X . 
BK 36 HOH 34   8554 3310 HOH HOH X . 
BK 36 HOH 35   8555 3314 HOH HOH X . 
BK 36 HOH 36   8556 3428 HOH HOH X . 
BK 36 HOH 37   8557 3456 HOH HOH X . 
BK 36 HOH 38   8558 3482 HOH HOH X . 
BK 36 HOH 39   8559 3573 HOH HOH X . 
BK 36 HOH 40   8560 3604 HOH HOH X . 
BK 36 HOH 41   8561 3806 HOH HOH X . 
BK 36 HOH 42   8562 3892 HOH HOH X . 
BK 36 HOH 43   8563 3939 HOH HOH X . 
BK 36 HOH 44   8564 3947 HOH HOH X . 
BK 36 HOH 45   8565 4064 HOH HOH X . 
BK 36 HOH 46   8566 4140 HOH HOH X . 
BK 36 HOH 47   8567 4280 HOH HOH X . 
BK 36 HOH 48   8568 4317 HOH HOH X . 
BK 36 HOH 49   8569 4341 HOH HOH X . 
BK 36 HOH 50   8570 4368 HOH HOH X . 
BK 36 HOH 51   8571 4408 HOH HOH X . 
BK 36 HOH 52   8572 4524 HOH HOH X . 
BK 36 HOH 53   8573 4541 HOH HOH X . 
BK 36 HOH 54   8574 4547 HOH HOH X . 
BK 36 HOH 55   8575 4646 HOH HOH X . 
BK 36 HOH 56   8576 4879 HOH HOH X . 
BK 36 HOH 57   8577 4892 HOH HOH X . 
BK 36 HOH 58   8578 4909 HOH HOH X . 
BK 36 HOH 59   8579 5021 HOH HOH X . 
BK 36 HOH 60   8580 5056 HOH HOH X . 
BK 36 HOH 61   8581 5138 HOH HOH X . 
BK 36 HOH 62   8582 5164 HOH HOH X . 
BK 36 HOH 63   8583 5256 HOH HOH X . 
BK 36 HOH 64   8584 5308 HOH HOH X . 
BK 36 HOH 65   8585 5499 HOH HOH X . 
BK 36 HOH 66   8586 5530 HOH HOH X . 
BK 36 HOH 67   8587 5648 HOH HOH X . 
BK 36 HOH 68   8588 5865 HOH HOH X . 
BK 36 HOH 69   8589 5888 HOH HOH X . 
BK 36 HOH 70   8590 5940 HOH HOH X . 
BK 36 HOH 71   8591 5952 HOH HOH X . 
BK 36 HOH 72   8592 5981 HOH HOH X . 
BK 36 HOH 73   8593 6071 HOH HOH X . 
BK 36 HOH 74   8594 6127 HOH HOH X . 
BK 36 HOH 75   8595 6139 HOH HOH X . 
BK 36 HOH 76   8596 6207 HOH HOH X . 
BK 36 HOH 77   8597 6247 HOH HOH X . 
BK 36 HOH 78   8598 6352 HOH HOH X . 
BK 36 HOH 79   8599 6357 HOH HOH X . 
BK 36 HOH 80   8600 6413 HOH HOH X . 
BK 36 HOH 81   8601 6479 HOH HOH X . 
BK 36 HOH 82   8602 6482 HOH HOH X . 
BK 36 HOH 83   8603 6553 HOH HOH X . 
BK 36 HOH 84   8604 6554 HOH HOH X . 
BK 36 HOH 85   8605 6564 HOH HOH X . 
BK 36 HOH 86   8606 6589 HOH HOH X . 
BK 36 HOH 87   8607 6613 HOH HOH X . 
BK 36 HOH 88   8608 6630 HOH HOH X . 
BK 36 HOH 89   8609 6749 HOH HOH X . 
BK 36 HOH 90   8610 6866 HOH HOH X . 
BK 36 HOH 91   8611 6881 HOH HOH X . 
BK 36 HOH 92   8612 6899 HOH HOH X . 
BK 36 HOH 93   8613 6958 HOH HOH X . 
BK 36 HOH 94   8614 7018 HOH HOH X . 
BK 36 HOH 95   8615 7277 HOH HOH X . 
BK 36 HOH 96   8616 7376 HOH HOH X . 
BK 36 HOH 97   8617 7378 HOH HOH X . 
BK 36 HOH 98   8618 7561 HOH HOH X . 
BK 36 HOH 99   8619 7863 HOH HOH X . 
CK 36 HOH 1    8404 53   HOH HOH Y . 
CK 36 HOH 2    8405 395  HOH HOH Y . 
CK 36 HOH 3    8406 585  HOH HOH Y . 
CK 36 HOH 4    8407 1840 HOH HOH Y . 
CK 36 HOH 5    8408 2257 HOH HOH Y . 
CK 36 HOH 6    8409 2272 HOH HOH Y . 
CK 36 HOH 7    8410 2375 HOH HOH Y . 
CK 36 HOH 8    8411 2448 HOH HOH Y . 
CK 36 HOH 9    8412 2606 HOH HOH Y . 
CK 36 HOH 10   8413 2738 HOH HOH Y . 
CK 36 HOH 11   8414 2758 HOH HOH Y . 
CK 36 HOH 12   8415 3188 HOH HOH Y . 
CK 36 HOH 13   8416 3466 HOH HOH Y . 
CK 36 HOH 14   8417 3477 HOH HOH Y . 
CK 36 HOH 15   8418 3716 HOH HOH Y . 
CK 36 HOH 16   8419 3897 HOH HOH Y . 
CK 36 HOH 17   8420 4006 HOH HOH Y . 
CK 36 HOH 18   8421 4400 HOH HOH Y . 
CK 36 HOH 19   8422 4742 HOH HOH Y . 
CK 36 HOH 20   8423 4921 HOH HOH Y . 
CK 36 HOH 21   8424 5030 HOH HOH Y . 
CK 36 HOH 22   8425 5108 HOH HOH Y . 
CK 36 HOH 23   8426 5179 HOH HOH Y . 
CK 36 HOH 24   8427 5311 HOH HOH Y . 
CK 36 HOH 25   8428 5337 HOH HOH Y . 
CK 36 HOH 26   8429 5517 HOH HOH Y . 
CK 36 HOH 27   8430 5656 HOH HOH Y . 
CK 36 HOH 28   8431 5752 HOH HOH Y . 
CK 36 HOH 29   8432 5979 HOH HOH Y . 
CK 36 HOH 30   8433 6008 HOH HOH Y . 
CK 36 HOH 31   8434 6168 HOH HOH Y . 
CK 36 HOH 32   8435 6190 HOH HOH Y . 
CK 36 HOH 33   8436 6299 HOH HOH Y . 
CK 36 HOH 34   8437 6317 HOH HOH Y . 
CK 36 HOH 35   8438 6697 HOH HOH Y . 
CK 36 HOH 36   8439 7239 HOH HOH Y . 
CK 36 HOH 37   8440 7354 HOH HOH Y . 
CK 36 HOH 38   8441 7527 HOH HOH Y . 
CK 36 HOH 39   8442 7607 HOH HOH Y . 
DK 36 HOH 1    8403 28   HOH HOH Z . 
DK 36 HOH 2    8404 119  HOH HOH Z . 
DK 36 HOH 3    8405 122  HOH HOH Z . 
DK 36 HOH 4    8406 211  HOH HOH Z . 
DK 36 HOH 5    8407 246  HOH HOH Z . 
DK 36 HOH 6    8408 354  HOH HOH Z . 
DK 36 HOH 7    8409 370  HOH HOH Z . 
DK 36 HOH 8    8410 440  HOH HOH Z . 
DK 36 HOH 9    8411 513  HOH HOH Z . 
DK 36 HOH 10   8412 586  HOH HOH Z . 
DK 36 HOH 11   8413 639  HOH HOH Z . 
DK 36 HOH 12   8414 855  HOH HOH Z . 
DK 36 HOH 13   8415 902  HOH HOH Z . 
DK 36 HOH 14   8416 933  HOH HOH Z . 
DK 36 HOH 15   8417 988  HOH HOH Z . 
DK 36 HOH 16   8418 1020 HOH HOH Z . 
DK 36 HOH 17   8419 1041 HOH HOH Z . 
DK 36 HOH 18   8420 1159 HOH HOH Z . 
DK 36 HOH 19   8421 1243 HOH HOH Z . 
DK 36 HOH 20   8422 1314 HOH HOH Z . 
DK 36 HOH 21   8423 1422 HOH HOH Z . 
DK 36 HOH 22   8424 1803 HOH HOH Z . 
DK 36 HOH 23   8425 1838 HOH HOH Z . 
DK 36 HOH 24   8426 2086 HOH HOH Z . 
DK 36 HOH 25   8427 2545 HOH HOH Z . 
DK 36 HOH 26   8428 2846 HOH HOH Z . 
DK 36 HOH 27   8429 2852 HOH HOH Z . 
DK 36 HOH 28   8430 2979 HOH HOH Z . 
DK 36 HOH 29   8431 3205 HOH HOH Z . 
DK 36 HOH 30   8432 3370 HOH HOH Z . 
DK 36 HOH 31   8433 3416 HOH HOH Z . 
DK 36 HOH 32   8434 3601 HOH HOH Z . 
DK 36 HOH 33   8435 4039 HOH HOH Z . 
DK 36 HOH 34   8436 4074 HOH HOH Z . 
DK 36 HOH 35   8437 4200 HOH HOH Z . 
DK 36 HOH 36   8438 4242 HOH HOH Z . 
DK 36 HOH 37   8439 4514 HOH HOH Z . 
DK 36 HOH 38   8440 4539 HOH HOH Z . 
DK 36 HOH 39   8441 5026 HOH HOH Z . 
DK 36 HOH 40   8442 5052 HOH HOH Z . 
DK 36 HOH 41   8443 5055 HOH HOH Z . 
DK 36 HOH 42   8444 5231 HOH HOH Z . 
DK 36 HOH 43   8445 5279 HOH HOH Z . 
DK 36 HOH 44   8446 5333 HOH HOH Z . 
DK 36 HOH 45   8447 5389 HOH HOH Z . 
DK 36 HOH 46   8448 5586 HOH HOH Z . 
DK 36 HOH 47   8449 5663 HOH HOH Z . 
DK 36 HOH 48   8450 6140 HOH HOH Z . 
DK 36 HOH 49   8451 6146 HOH HOH Z . 
DK 36 HOH 50   8452 6638 HOH HOH Z . 
DK 36 HOH 51   8453 6858 HOH HOH Z . 
DK 36 HOH 52   8454 7145 HOH HOH Z . 
DK 36 HOH 53   8455 7292 HOH HOH Z . 
EK 36 HOH 1    131  131  HOH HOH 1 . 
EK 36 HOH 2    352  352  HOH HOH 1 . 
EK 36 HOH 3    468  468  HOH HOH 1 . 
EK 36 HOH 4    719  719  HOH HOH 1 . 
EK 36 HOH 5    1006 1006 HOH HOH 1 . 
EK 36 HOH 6    1413 1413 HOH HOH 1 . 
EK 36 HOH 7    1972 1972 HOH HOH 1 . 
EK 36 HOH 8    2485 2485 HOH HOH 1 . 
EK 36 HOH 9    2555 2555 HOH HOH 1 . 
EK 36 HOH 10   2691 2691 HOH HOH 1 . 
EK 36 HOH 11   2697 2697 HOH HOH 1 . 
EK 36 HOH 12   2890 2890 HOH HOH 1 . 
EK 36 HOH 13   3012 3012 HOH HOH 1 . 
EK 36 HOH 14   3138 3138 HOH HOH 1 . 
EK 36 HOH 15   3143 3143 HOH HOH 1 . 
EK 36 HOH 16   3600 3600 HOH HOH 1 . 
EK 36 HOH 17   3614 3614 HOH HOH 1 . 
EK 36 HOH 18   3665 3665 HOH HOH 1 . 
EK 36 HOH 19   4135 4135 HOH HOH 1 . 
EK 36 HOH 20   4202 4202 HOH HOH 1 . 
EK 36 HOH 21   4479 4479 HOH HOH 1 . 
EK 36 HOH 22   4575 4575 HOH HOH 1 . 
EK 36 HOH 23   4595 4595 HOH HOH 1 . 
EK 36 HOH 24   5203 5203 HOH HOH 1 . 
EK 36 HOH 25   5293 5293 HOH HOH 1 . 
EK 36 HOH 26   5416 5416 HOH HOH 1 . 
EK 36 HOH 27   5616 5616 HOH HOH 1 . 
EK 36 HOH 28   5639 5639 HOH HOH 1 . 
EK 36 HOH 29   5747 5747 HOH HOH 1 . 
EK 36 HOH 30   5861 5861 HOH HOH 1 . 
EK 36 HOH 31   6158 6158 HOH HOH 1 . 
EK 36 HOH 32   6289 6289 HOH HOH 1 . 
EK 36 HOH 33   6312 6312 HOH HOH 1 . 
EK 36 HOH 34   6391 6391 HOH HOH 1 . 
EK 36 HOH 35   6863 6863 HOH HOH 1 . 
EK 36 HOH 36   7177 7177 HOH HOH 1 . 
EK 36 HOH 37   7213 7213 HOH HOH 1 . 
EK 36 HOH 38   7225 7225 HOH HOH 1 . 
EK 36 HOH 39   7658 7658 HOH HOH 1 . 
EK 36 HOH 40   7875 7875 HOH HOH 1 . 
FK 36 HOH 1    8505 72   HOH HOH 2 . 
FK 36 HOH 2    8506 536  HOH HOH 2 . 
FK 36 HOH 3    8507 538  HOH HOH 2 . 
FK 36 HOH 4    8508 636  HOH HOH 2 . 
FK 36 HOH 5    8509 911  HOH HOH 2 . 
FK 36 HOH 6    8510 1047 HOH HOH 2 . 
FK 36 HOH 7    8511 1069 HOH HOH 2 . 
FK 36 HOH 8    8512 1074 HOH HOH 2 . 
FK 36 HOH 9    8513 1141 HOH HOH 2 . 
FK 36 HOH 10   8514 1234 HOH HOH 2 . 
FK 36 HOH 11   8515 1324 HOH HOH 2 . 
FK 36 HOH 12   8516 1536 HOH HOH 2 . 
FK 36 HOH 13   8517 1589 HOH HOH 2 . 
FK 36 HOH 14   8518 1812 HOH HOH 2 . 
FK 36 HOH 15   8519 1898 HOH HOH 2 . 
FK 36 HOH 16   8520 1943 HOH HOH 2 . 
FK 36 HOH 17   8521 1993 HOH HOH 2 . 
FK 36 HOH 18   8522 2104 HOH HOH 2 . 
FK 36 HOH 19   8523 2197 HOH HOH 2 . 
FK 36 HOH 20   8524 2317 HOH HOH 2 . 
FK 36 HOH 21   8525 2471 HOH HOH 2 . 
FK 36 HOH 22   8526 2491 HOH HOH 2 . 
FK 36 HOH 23   8527 2621 HOH HOH 2 . 
FK 36 HOH 24   8528 2916 HOH HOH 2 . 
FK 36 HOH 25   8529 3063 HOH HOH 2 . 
FK 36 HOH 26   8530 3106 HOH HOH 2 . 
FK 36 HOH 27   8531 3183 HOH HOH 2 . 
FK 36 HOH 28   8532 3274 HOH HOH 2 . 
FK 36 HOH 29   8533 3465 HOH HOH 2 . 
FK 36 HOH 30   8534 3538 HOH HOH 2 . 
FK 36 HOH 31   8535 3597 HOH HOH 2 . 
FK 36 HOH 32   8536 3785 HOH HOH 2 . 
FK 36 HOH 33   8537 4189 HOH HOH 2 . 
FK 36 HOH 34   8538 4294 HOH HOH 2 . 
FK 36 HOH 35   8539 4450 HOH HOH 2 . 
FK 36 HOH 36   8540 4485 HOH HOH 2 . 
FK 36 HOH 37   8541 4642 HOH HOH 2 . 
FK 36 HOH 38   8542 4667 HOH HOH 2 . 
FK 36 HOH 39   8543 4680 HOH HOH 2 . 
FK 36 HOH 40   8544 4797 HOH HOH 2 . 
FK 36 HOH 41   8545 4869 HOH HOH 2 . 
FK 36 HOH 42   8546 4985 HOH HOH 2 . 
FK 36 HOH 43   8547 5208 HOH HOH 2 . 
FK 36 HOH 44   8548 5212 HOH HOH 2 . 
FK 36 HOH 45   8549 5316 HOH HOH 2 . 
FK 36 HOH 46   8550 5318 HOH HOH 2 . 
FK 36 HOH 47   8551 5618 HOH HOH 2 . 
FK 36 HOH 48   8552 5737 HOH HOH 2 . 
FK 36 HOH 49   8553 5866 HOH HOH 2 . 
FK 36 HOH 50   8554 5885 HOH HOH 2 . 
FK 36 HOH 51   8555 6027 HOH HOH 2 . 
FK 36 HOH 52   8556 6150 HOH HOH 2 . 
FK 36 HOH 53   8557 6302 HOH HOH 2 . 
FK 36 HOH 54   8558 6359 HOH HOH 2 . 
FK 36 HOH 55   8559 6429 HOH HOH 2 . 
FK 36 HOH 56   8560 6741 HOH HOH 2 . 
FK 36 HOH 57   8561 6937 HOH HOH 2 . 
FK 36 HOH 58   8562 6956 HOH HOH 2 . 
FK 36 HOH 59   8563 7084 HOH HOH 2 . 
FK 36 HOH 60   8564 7149 HOH HOH 2 . 
FK 36 HOH 61   8565 7151 HOH HOH 2 . 
FK 36 HOH 62   8566 7176 HOH HOH 2 . 
FK 36 HOH 63   8567 7236 HOH HOH 2 . 
FK 36 HOH 64   8568 7322 HOH HOH 2 . 
FK 36 HOH 65   8569 7370 HOH HOH 2 . 
FK 36 HOH 66   8570 7465 HOH HOH 2 . 
FK 36 HOH 67   8571 7549 HOH HOH 2 . 
FK 36 HOH 68   8572 7572 HOH HOH 2 . 
FK 36 HOH 69   8573 7577 HOH HOH 2 . 
FK 36 HOH 70   8574 7697 HOH HOH 2 . 
FK 36 HOH 71   8575 7878 HOH HOH 2 . 
FK 36 HOH 72   8576 7879 HOH HOH 2 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 0 U   10   ? P   ? A U   9    P   
2  1 Y 1 0 U   10   ? OP1 ? A U   9    OP1 
3  1 Y 1 0 U   10   ? OP2 ? A U   9    OP2 
4  1 Y 1 0 A   128  ? P   ? A A   127  P   
5  1 Y 1 0 A   128  ? OP1 ? A A   127  OP1 
6  1 Y 1 0 A   128  ? OP2 ? A A   127  OP2 
7  1 Y 1 0 G   716  ? P   ? A G   715  P   
8  1 Y 1 0 G   716  ? OP1 ? A G   715  OP1 
9  1 Y 1 0 G   716  ? OP2 ? A G   715  OP2 
10 1 Y 1 0 C   999  ? P   ? A C   998  P   
11 1 Y 1 0 C   999  ? OP1 ? A C   998  OP1 
12 1 Y 1 0 C   999  ? OP2 ? A C   998  OP2 
13 1 Y 1 0 U   1561 ? P   ? A U   1560 P   
14 1 Y 1 0 U   1561 ? OP1 ? A U   1560 OP1 
15 1 Y 1 0 U   1561 ? OP2 ? A U   1560 OP2 
16 1 Y 1 0 U   1964 ? P   ? A U   1963 P   
17 1 Y 1 0 U   1964 ? OP1 ? A U   1963 OP1 
18 1 Y 1 0 U   1964 ? OP2 ? A U   1963 OP2 
19 1 Y 1 0 G   2237 ? P   ? A G   2236 P   
20 1 Y 1 0 G   2237 ? OP1 ? A G   2236 OP1 
21 1 Y 1 0 G   2237 ? OP2 ? A G   2236 OP2 
22 1 Y 1 0 G   2344 ? P   ? A G   2343 P   
23 1 Y 1 0 G   2344 ? OP1 ? A G   2343 OP1 
24 1 Y 1 0 G   2344 ? OP2 ? A G   2343 OP2 
25 1 Y 1 0 G   2667 ? P   ? A G   2666 P   
26 1 Y 1 0 G   2667 ? OP1 ? A G   2666 OP1 
27 1 Y 1 0 G   2667 ? OP2 ? A G   2666 OP2 
28 1 Y 1 K GLU 83   ? CG  ? M GLU 83   CG  
29 1 Y 1 K GLU 83   ? CD  ? M GLU 83   CD  
30 1 Y 1 K GLU 83   ? OE1 ? M GLU 83   OE1 
31 1 Y 1 K GLU 83   ? OE2 ? M GLU 83   OE2 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
_cell.entry_id           1JJ2 
_cell.length_a           211.660 
_cell.length_b           299.670 
_cell.length_c           573.770 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JJ2 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
_exptl.entry_id          1JJ2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.13 
_exptl_crystal.density_percent_sol   60.74 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_details    
'PEG 6000, KCL, NH4CL, MGCL2, CDCL2, POTASSIUM ACETATE, TRIS-MES, pH 5.8, VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 6000'          ? ? ? 
1 2 1 KCl                 ? ? ? 
1 3 1 NH4Cl               ? ? ? 
1 4 1 MgCl2               ? ? ? 
1 5 1 CdCl2               ? ? ? 
1 6 1 'POTASSIUM ACETATE' ? ? ? 
1 7 1 TRIS-MES            ? ? ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 'IMAGE PLATE' MARRESEARCH 2000-02-25 ? 
2 CCD           CUSTOM-MADE 2000-04-01 ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9 1.0 
2 1.0 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'NSLS BEAMLINE X25'  NSLS X25   ? 0.9 
2 SYNCHROTRON 'APS BEAMLINE 19-ID' APS  19-ID ? 1.0 
# 
_reflns.entry_id                     1JJ2 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             90 
_reflns.d_resolution_high            2.40 
_reflns.number_obs                   666819 
_reflns.number_all                   666819 
_reflns.percent_possible_obs         95.6 
_reflns.pdbx_Rmerge_I_obs            0.086 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        26.6000 
_reflns.B_iso_Wilson_estimate        47.70 
_reflns.pdbx_redundancy              9.100 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.50 
_reflns_shell.percent_possible_all   73.5 
_reflns_shell.Rmerge_I_obs           0.691 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1JJ2 
_refine.ls_number_reflns_obs                     629712 
_refine.ls_number_reflns_all                     698195 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             15.0 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    90.2 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.189 
_refine.ls_R_factor_R_free                       0.222 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  6187 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        28801 
_refine_hist.pdbx_number_atoms_nucleic_acid   61617 
_refine_hist.pdbx_number_atoms_ligand         232 
_refine_hist.number_atoms_solvent             7893 
_refine_hist.number_atoms_total               98543 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        15.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.0052 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.10   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 15.60  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.39   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_database_PDB_matrix.entry_id          1JJ2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1JJ2 
_struct.title                     
'Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JJ2 
_struct_keywords.pdbx_keywords   RIBOSOME 
_struct_keywords.text            'RIBOSOME ASSEMBLY, RNA-RNA, PROTEIN-RNA, PROTEIN-PROTEIN, RIBOSOME' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 23 ? 
X  N N 24 ? 
Y  N N 25 ? 
Z  N N 26 ? 
AA N N 27 ? 
BA N N 28 ? 
CA N N 29 ? 
DA N N 30 ? 
EA N N 31 ? 
FA N N 31 ? 
GA N N 31 ? 
HA N N 31 ? 
IA N N 31 ? 
JA N N 31 ? 
KA N N 31 ? 
LA N N 31 ? 
MA N N 31 ? 
NA N N 31 ? 
OA N N 31 ? 
PA N N 31 ? 
QA N N 31 ? 
RA N N 31 ? 
SA N N 31 ? 
TA N N 31 ? 
UA N N 31 ? 
VA N N 31 ? 
WA N N 31 ? 
XA N N 31 ? 
YA N N 31 ? 
ZA N N 31 ? 
AB N N 31 ? 
BB N N 31 ? 
CB N N 31 ? 
DB N N 31 ? 
EB N N 31 ? 
FB N N 31 ? 
GB N N 31 ? 
HB N N 31 ? 
IB N N 31 ? 
JB N N 31 ? 
KB N N 31 ? 
LB N N 31 ? 
MB N N 31 ? 
NB N N 31 ? 
OB N N 31 ? 
PB N N 31 ? 
QB N N 31 ? 
RB N N 31 ? 
SB N N 31 ? 
TB N N 31 ? 
UB N N 31 ? 
VB N N 31 ? 
WB N N 31 ? 
XB N N 31 ? 
YB N N 31 ? 
ZB N N 31 ? 
AC N N 31 ? 
BC N N 31 ? 
CC N N 31 ? 
DC N N 31 ? 
EC N N 31 ? 
FC N N 31 ? 
GC N N 31 ? 
HC N N 31 ? 
IC N N 31 ? 
JC N N 31 ? 
KC N N 31 ? 
LC N N 31 ? 
MC N N 31 ? 
NC N N 31 ? 
OC N N 31 ? 
PC N N 31 ? 
QC N N 31 ? 
RC N N 31 ? 
SC N N 31 ? 
TC N N 31 ? 
UC N N 31 ? 
VC N N 31 ? 
WC N N 31 ? 
XC N N 31 ? 
YC N N 31 ? 
ZC N N 31 ? 
AD N N 31 ? 
BD N N 31 ? 
CD N N 31 ? 
DD N N 31 ? 
ED N N 31 ? 
FD N N 31 ? 
GD N N 31 ? 
HD N N 31 ? 
ID N N 31 ? 
JD N N 31 ? 
KD N N 31 ? 
LD N N 31 ? 
MD N N 31 ? 
ND N N 31 ? 
OD N N 31 ? 
PD N N 31 ? 
QD N N 31 ? 
RD N N 31 ? 
SD N N 31 ? 
TD N N 31 ? 
UD N N 31 ? 
VD N N 31 ? 
WD N N 31 ? 
XD N N 31 ? 
YD N N 31 ? 
ZD N N 31 ? 
AE N N 31 ? 
BE N N 31 ? 
CE N N 31 ? 
DE N N 31 ? 
EE N N 31 ? 
FE N N 31 ? 
GE N N 31 ? 
HE N N 31 ? 
IE N N 31 ? 
JE N N 32 ? 
KE N N 32 ? 
LE N N 33 ? 
ME N N 33 ? 
NE N N 33 ? 
OE N N 33 ? 
PE N N 33 ? 
QE N N 33 ? 
RE N N 33 ? 
SE N N 33 ? 
TE N N 33 ? 
UE N N 33 ? 
VE N N 33 ? 
WE N N 33 ? 
XE N N 33 ? 
YE N N 33 ? 
ZE N N 33 ? 
AF N N 33 ? 
BF N N 33 ? 
CF N N 33 ? 
DF N N 33 ? 
EF N N 33 ? 
FF N N 33 ? 
GF N N 33 ? 
HF N N 33 ? 
IF N N 33 ? 
JF N N 33 ? 
KF N N 33 ? 
LF N N 33 ? 
MF N N 33 ? 
NF N N 33 ? 
OF N N 33 ? 
PF N N 33 ? 
QF N N 33 ? 
RF N N 33 ? 
SF N N 33 ? 
TF N N 33 ? 
UF N N 33 ? 
VF N N 33 ? 
WF N N 33 ? 
XF N N 33 ? 
YF N N 33 ? 
ZF N N 33 ? 
AG N N 33 ? 
BG N N 33 ? 
CG N N 33 ? 
DG N N 33 ? 
EG N N 33 ? 
FG N N 33 ? 
GG N N 33 ? 
HG N N 33 ? 
IG N N 33 ? 
JG N N 33 ? 
KG N N 33 ? 
LG N N 33 ? 
MG N N 33 ? 
NG N N 33 ? 
OG N N 33 ? 
PG N N 33 ? 
QG N N 33 ? 
RG N N 33 ? 
SG N N 33 ? 
TG N N 33 ? 
UG N N 33 ? 
VG N N 33 ? 
WG N N 33 ? 
XG N N 33 ? 
YG N N 33 ? 
ZG N N 33 ? 
AH N N 33 ? 
BH N N 33 ? 
CH N N 33 ? 
DH N N 33 ? 
EH N N 33 ? 
FH N N 34 ? 
GH N N 34 ? 
HH N N 34 ? 
IH N N 34 ? 
JH N N 34 ? 
KH N N 34 ? 
LH N N 34 ? 
MH N N 34 ? 
NH N N 34 ? 
OH N N 34 ? 
PH N N 31 ? 
QH N N 33 ? 
RH N N 33 ? 
SH N N 31 ? 
TH N N 31 ? 
UH N N 33 ? 
VH N N 34 ? 
WH N N 31 ? 
XH N N 34 ? 
YH N N 33 ? 
ZH N N 33 ? 
AI N N 33 ? 
BI N N 33 ? 
CI N N 34 ? 
DI N N 34 ? 
EI N N 34 ? 
FI N N 31 ? 
GI N N 33 ? 
HI N N 34 ? 
II N N 33 ? 
JI N N 34 ? 
KI N N 34 ? 
LI N N 35 ? 
MI N N 34 ? 
NI N N 33 ? 
OI N N 33 ? 
PI N N 33 ? 
QI N N 34 ? 
RI N N 33 ? 
SI N N 31 ? 
TI N N 33 ? 
UI N N 35 ? 
VI N N 31 ? 
WI N N 34 ? 
XI N N 35 ? 
YI N N 35 ? 
ZI N N 31 ? 
AJ N N 35 ? 
BJ N N 34 ? 
CJ N N 36 ? 
DJ N N 36 ? 
EJ N N 36 ? 
FJ N N 36 ? 
GJ N N 36 ? 
HJ N N 36 ? 
IJ N N 36 ? 
JJ N N 36 ? 
KJ N N 36 ? 
LJ N N 36 ? 
MJ N N 36 ? 
NJ N N 36 ? 
OJ N N 36 ? 
PJ N N 36 ? 
QJ N N 36 ? 
RJ N N 36 ? 
SJ N N 36 ? 
TJ N N 36 ? 
UJ N N 36 ? 
VJ N N 36 ? 
WJ N N 36 ? 
XJ N N 36 ? 
YJ N N 36 ? 
ZJ N N 36 ? 
AK N N 36 ? 
BK N N 36 ? 
CK N N 36 ? 
DK N N 36 ? 
EK N N 36 ? 
FK N N 36 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.pdbx_db_accession 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1  GB  3377779 AF034620   1  2597 
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUUG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
? 
2  GB  3377779 AF034620   2  5658 
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
? 
3  UNP P20276  RL2_HALMA  3  1    
;GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDEL
QVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVG
GGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
? 
4  UNP P20279  RL3_HALMA  4  1    
;PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMR
AVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPD
VMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLG
PWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVPFFRPAVRPND
QPRLDPEVRYVSNESNQG
;
? 
5  UNP P12735  RL4_HALMA  5  1    
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
? 
6  UNP P14124  RL5_HALMA  6  1    
;SSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMA
EEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPA
DAVAFIESTYDVEVSE
;
? 
7  UNP P14135  RL6_HALMA  7  1    
;PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGW
EYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVR
VFQDGVYITRKPNRGDA
;
? 
8  UNP P12743  RL7A_HALMA 8  1    
;PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQ
DDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
;
? 
9  UNP P15825  RLA0_HALMA 9  1    
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
? 
10 UNP P29198  RL13_HALMA 11 1    
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
? 
11 UNP P22450  RL14_HALMA 12 1    
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
? 
12 UNP P12737  RL15_HALMA 13 1    
;TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADD
VAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDAD
ADEE
;
? 
13 UNP P14123  RL18_HALMA 15 1    
;ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPS
AYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYS
GDFDAADLPEHFDELRETLLDGDIEL
;
? 
14 UNP P12733  R18E_HALMA 16 1    
;SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVD
FSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
? 
15 UNP P14119  RL19_HALMA 17 1    
;TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSR
KGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
? 
16 UNP P12734  RL21_HALMA 18 1    
;PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGK
EKTIIVTAAHLRRQE
;
? 
17 UNP P10970  RL22_HALMA 19 1    
;GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRY
PEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
? 
18 UNP P12732  RL23_HALMA 20 1    
;SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASR
IGVF
;
? 
19 UNP P10972  RL24_HALMA 21 1    
;SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLE
KTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
? 
20 UNP P14116  R24E_HALMA 22 1    PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA ? 
21 UNP P10971  RL29_HALMA 23 1    TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE ? 
22 UNP P14121  RL30_HALMA 24 1    
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
? 
23 UNP P18138  RL31_HALMA 25 1    
;SASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEE
GEAIVEAETAE
;
? 
24 UNP P12736  RL32_HALMA 26 1    
;ADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAEV
EEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGK
GDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVSE

;
? 
25 UNP P32410  RL37_HALMA 28 1    TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE ? 
26 UNP P22452  RL39_HALMA 29 1    GKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE ? 
27 UNP P32411  RL44_HALMA 30 1    
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
? 
28 PDB 1JJ2    1JJ2       10 ?    ? ? 
29 PDB 1JJ2    1JJ2       14 ?    ? ? 
30 PDB 1JJ2    1JJ2       27 ?    ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1JJ2 0 1 ? 2922 ? 3377779 2597 ? 5518 ? 2  2923 
2  2  1JJ2 9 1 ? 122  ? 3377779 5658 ? 5779 ? 1  122  
3  3  1JJ2 A 1 ? 239  ? P20276  1    ? 239  ? 1  239  
4  4  1JJ2 B 1 ? 337  ? P20279  1    ? 338  ? 1  337  
5  5  1JJ2 C 1 ? 246  ? P12735  1    ? 246  ? 1  246  
6  6  1JJ2 D 1 ? 176  ? P14124  1    ? 176  ? 1  176  
7  7  1JJ2 E 1 ? 177  ? P14135  1    ? 177  ? 1  177  
8  8  1JJ2 F 1 ? 119  ? P12743  1    ? 119  ? 1  119  
9  9  1JJ2 G 1 ? 348  ? P15825  1    ? 348  ? 1  348  
10 10 1JJ2 I 1 ? 145  ? P29198  1    ? 145  ? 1  145  
11 11 1JJ2 J 1 ? 132  ? P22450  1    ? 132  ? 1  132  
12 12 1JJ2 K 1 ? 164  ? P12737  1    ? 164  ? 1  164  
13 13 1JJ2 M 1 ? 186  ? P14123  1    ? 186  ? 1  186  
14 14 1JJ2 N 1 ? 115  ? P12733  1    ? 115  ? 1  115  
15 15 1JJ2 O 1 ? 148  ? P14119  1    ? 148  ? 1  148  
16 16 1JJ2 P 1 ? 95   ? P12734  1    ? 95   ? 1  95   
17 17 1JJ2 Q 1 ? 154  ? P10970  1    ? 154  ? 1  154  
18 18 1JJ2 R 1 ? 84   ? P12732  1    ? 84   ? 1  84   
19 19 1JJ2 S 1 ? 119  ? P10972  1    ? 119  ? 1  119  
20 20 1JJ2 T 1 ? 66   ? P14116  1    ? 66   ? 1  66   
21 21 1JJ2 U 1 ? 70   ? P10971  1    ? 70   ? 1  70   
22 22 1JJ2 V 1 ? 154  ? P14121  1    ? 154  ? 1  154  
23 23 1JJ2 W 1 ? 91   ? P18138  1    ? 91   ? 1  91   
24 24 1JJ2 X 1 ? 240  ? P12736  1    ? 240  ? 1  240  
25 25 1JJ2 Z 1 ? 56   ? P32410  1    ? 56   ? 1  56   
26 26 1JJ2 1 1 ? 47   ? P22452  1    ? 49   ? 1  48   
27 27 1JJ2 2 1 ? 92   ? P32411  1    ? 92   ? 1  92   
28 28 1JJ2 H 1 ? 167  ? 1JJ2    1    ? 167  ? 1  167  
29 29 1JJ2 L 1 ? 194  ? 1JJ2    1    ? 194  ? 1  194  
30 30 1JJ2 Y 1 ? 73   ? 1JJ2    10   ? 82   ? 10 82   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  1JJ2 C   0 559 ? GB  3377779 U   3155 conflict 560 1 
4  1JJ2 ?   B ?   ? UNP P20279  PRO 310  deletion ?   2 
4  1JJ2 ARG B 310 ? UNP P20279  PHE 311  conflict 310 3 
15 1JJ2 LYS O 71  ? UNP P14119  TYR 71   conflict 71  4 
26 1JJ2 ?   1 ?   ? UNP P22452  ARG 31   deletion ?   5 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   30-meric 
_pdbx_struct_assembly.oligomeric_count     30 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      
;A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA,IA,JA,KA,LA,MA,NA,OA,PA,QA,RA,SA,TA,UA,VA,WA,XA,YA,ZA,AB,BB,CB,DB,EB,FB,GB,HB,IB,JB,KB,LB,MB,NB,OB,PB,QB,RB,SB,TB,UB,VB,WB,XB,YB,ZB,AC,BC,CC,DC,EC,FC,GC,HC,IC,JC,KC,LC,MC,NC,OC,PC,QC,RC,SC,TC,UC,VC,WC,XC,YC,ZC,AD,BD,CD,DD,ED,FD,GD,HD,ID,JD,KD,LD,MD,ND,OD,PD,QD,RD,SD,TD,UD,VD,WD,XD,YD,ZD,AE,BE,CE,DE,EE,FE,GE,HE,IE,JE,KE,LE,ME,NE,OE,PE,QE,RE,SE,TE,UE,VE,WE,XE,YE,ZE,AF,BF,CF,DF,EF,FF,GF,HF,IF,JF,KF,LF,MF,NF,OF,PF,QF,RF,SF,TF,UF,VF,WF,XF,YF,ZF,AG,BG,CG,DG,EG,FG,GG,HG,IG,JG,KG,LG,MG,NG,OG,PG,QG,RG,SG,TG,UG,VG,WG,XG,YG,ZG,AH,BH,CH,DH,EH,FH,GH,HH,IH,JH,KH,LH,MH,NH,OH,PH,QH,RH,SH,TH,UH,VH,WH,XH,YH,ZH,AI,BI,CI,DI,EI,FI,GI,HI,II,JI,KI,LI,MI,NI,OI,PI,QI,RI,SI,TI,UI,VI,WI,XI,YI,ZI,AJ,BJ,CJ,DJ,EJ,FJ,GJ,HJ,IJ,JJ,KJ,LJ,MJ,NJ,OJ,PJ,QJ,RJ,SJ,TJ,UJ,VJ,WJ,XJ,YJ,ZJ,AK,BK,CK,DK,EK,FK
;
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id                    1 
_struct_biol.details               ? 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ILE C  4   ? ARG C  11  ? ILE A 4   ARG A 11  1 ? 8  
HELX_P HELX_P2   2   GLY C  12  ? GLY C  12  ? GLY A 12  GLY A 12  5 ? 1  
HELX_P HELX_P3   3   THR C  13  ? ARG C  17  ? THR A 13  ARG A 17  5 ? 5  
HELX_P HELX_P4   4   PRO C  19  ? TYR C  23  ? PRO A 19  TYR A 23  5 ? 5  
HELX_P HELX_P5   5   GLY C  163 ? LYS C  167 ? GLY A 163 LYS A 167 5 ? 5  
HELX_P HELX_P6   6   LYS C  171 ? LYS C  180 ? LYS A 171 LYS A 180 1 ? 10 
HELX_P HELX_P7   7   ARG C  190 ? MET C  194 ? ARG A 190 MET A 194 5 ? 5  
HELX_P HELX_P8   8   ASN C  195 ? HIS C  199 ? ASN A 195 HIS A 199 5 ? 5  
HELX_P HELX_P9   9   GLU D  108 ? THR D  112 ? GLU B 108 THR B 112 5 ? 5  
HELX_P HELX_P10  10  ASP D  120 ? GLY D  135 ? ASP B 120 GLY B 135 1 ? 16 
HELX_P HELX_P11  11  VAL D  147 ? VAL D  151 ? VAL B 147 VAL B 151 5 ? 5  
HELX_P HELX_P12  12  SER D  170 ? GLY D  185 ? SER B 170 GLY B 185 1 ? 16 
HELX_P HELX_P13  13  ALA D  189 ? PHE D  194 ? ALA B 189 PHE B 194 1 ? 6  
HELX_P HELX_P14  14  GLY D  213 ? GLY D  219 ? GLY B 213 GLY B 219 1 ? 7  
HELX_P HELX_P15  15  LYS D  224 ? GLN D  230 ? LYS B 224 GLN B 230 5 ? 7  
HELX_P HELX_P16  16  PRO E  19  ? THR E  24  ? PRO C 19  THR C 24  5 ? 6  
HELX_P HELX_P17  17  ARG E  27  ? ASN E  41  ? ARG C 27  ASN C 41  1 ? 15 
HELX_P HELX_P18  18  ASN E  103 ? THR E  118 ? ASN C 103 THR C 118 1 ? 16 
HELX_P HELX_P19  19  ASP E  120 ? ARG E  127 ? ASP C 120 ARG C 127 1 ? 8  
HELX_P HELX_P20  20  ASP E  142 ? LEU E  147 ? ASP C 142 LEU C 147 5 ? 6  
HELX_P HELX_P21  21  LYS E  149 ? LEU E  160 ? LYS C 149 LEU C 160 1 ? 12 
HELX_P HELX_P22  22  VAL E  162 ? ASP E  170 ? VAL C 162 ASP C 170 1 ? 9  
HELX_P HELX_P23  23  GLY E  177 ? GLY E  183 ? GLY C 177 GLY C 183 5 ? 7  
HELX_P HELX_P24  24  ASN E  219 ? ALA E  224 ? ASN C 219 ALA C 224 1 ? 6  
HELX_P HELX_P25  25  PRO E  225 ? ALA E  228 ? PRO C 225 ALA C 228 5 ? 4  
HELX_P HELX_P26  26  GLU E  237 ? ALA E  244 ? GLU C 237 ALA C 244 1 ? 8  
HELX_P HELX_P27  27  ALA F  37  ? GLY F  46  ? ALA D 37  GLY D 46  1 ? 10 
HELX_P HELX_P28  28  ASP F  77  ? LEU F  88  ? ASP D 77  LEU D 88  1 ? 12 
HELX_P HELX_P29  29  PRO F  89  ? ALA F  91  ? PRO D 89  ALA D 91  5 ? 3  
HELX_P HELX_P30  30  GLY F  138 ? LYS F  143 ? GLY D 138 LYS D 143 5 ? 6  
HELX_P HELX_P31  31  ASN F  158 ? SER F  168 ? ASN D 158 SER D 168 1 ? 11 
HELX_P HELX_P32  32  ASN G  55  ? THR G  77  ? ASN E 55  THR E 77  1 ? 23 
HELX_P HELX_P33  33  ASN G  106 ? GLU G  110 ? ASN E 106 GLU E 110 5 ? 5  
HELX_P HELX_P34  34  ASP G  137 ? LEU G  151 ? ASP E 137 LEU E 151 1 ? 15 
HELX_P HELX_P35  35  PRO H  9   ? GLY H  27  ? PRO F 9   GLY F 27  1 ? 19 
HELX_P HELX_P36  36  GLY H  32  ? GLY H  43  ? GLY F 32  GLY F 43  1 ? 12 
HELX_P HELX_P37  37  PRO H  56  ? VAL H  60  ? PRO F 56  VAL F 60  5 ? 5  
HELX_P HELX_P38  38  HIS H  62  ? GLU H  69  ? HIS F 62  GLU F 69  1 ? 8  
HELX_P HELX_P39  39  GLN H  79  ? ALA H  87  ? GLN F 79  ALA F 87  1 ? 9  
HELX_P HELX_P40  40  ALA H  104 ? LEU H  118 ? ALA F 104 LEU F 118 1 ? 15 
HELX_P HELX_P41  41  PRO I  13  ? SER I  29  ? PRO G 13  SER G 29  1 ? 17 
HELX_P HELX_P42  42  ARG I  63  ? ASP I  72  ? ARG G 63  ASP G 72  1 ? 10 
HELX_P HELX_P43  43  PRO J  2   ? TYR J  6   ? PRO H 2   TYR H 6   5 ? 5  
HELX_P HELX_P44  44  HIS J  58  ? ARG J  70  ? HIS H 58  ARG H 70  1 ? 13 
HELX_P HELX_P45  45  ASN J  141 ? LYS J  150 ? ASN H 141 LYS H 150 1 ? 10 
HELX_P HELX_P46  46  ILE K  18  ? LEU K  31  ? ILE I 18  LEU I 31  1 ? 14 
HELX_P HELX_P47  47  ASN K  40  ? ARG K  43  ? ASN I 40  ARG I 43  5 ? 4  
HELX_P HELX_P48  48  ARG K  49  ? ILE K  63  ? ARG I 49  ILE I 63  1 ? 15 
HELX_P HELX_P49  49  ARG K  74  ? GLY K  85  ? ARG I 74  GLY I 85  1 ? 12 
HELX_P HELX_P50  50  LYS K  91  ? SER K  100 ? LYS I 91  SER I 100 1 ? 10 
HELX_P HELX_P51  51  ASP K  122 ? ASN K  126 ? ASP I 122 ASN I 126 5 ? 5  
HELX_P HELX_P52  52  LEU K  132 ? GLY K  140 ? LEU I 132 GLY I 140 1 ? 9  
HELX_P HELX_P53  53  GLU L  116 ? ALA L  118 ? GLU J 116 ALA J 118 5 ? 3  
HELX_P HELX_P54  54  PHE L  121 ? SER L  126 ? PHE J 121 SER J 126 1 ? 6  
HELX_P HELX_P55  55  LYS M  3   ? GLN M  7   ? LYS K 3   GLN K 7   5 ? 5  
HELX_P HELX_P56  56  GLY M  23  ? GLY M  28  ? GLY K 23  GLY K 28  5 ? 6  
HELX_P HELX_P57  57  PRO M  54  ? GLN M  58  ? PRO K 54  GLN K 58  5 ? 5  
HELX_P HELX_P58  58  VAL M  66  ? ASN M  72  ? VAL K 66  ASN K 72  1 ? 7  
HELX_P HELX_P59  59  ARG M  94  ? VAL M  96  ? ARG K 94  VAL K 96  5 ? 3  
HELX_P HELX_P60  60  SER M  126 ? ALA M  136 ? SER K 126 ALA K 136 1 ? 11 
HELX_P HELX_P61  61  ALA N  4   ? ARG N  14  ? ALA L 4   ARG L 14  1 ? 11 
HELX_P HELX_P62  62  GLU N  17  ? ARG N  32  ? GLU L 17  ARG L 32  1 ? 16 
HELX_P HELX_P63  63  ARG N  45  ? GLY N  53  ? ARG L 45  GLY L 53  1 ? 9  
HELX_P HELX_P64  64  ARG N  82  ? MET N  86  ? ARG L 82  MET L 86  5 ? 5  
HELX_P HELX_P65  65  ASN N  96  ? PHE N  109 ? ASN L 96  PHE L 109 1 ? 14 
HELX_P HELX_P66  66  LEU N  147 ? ARG N  152 ? LEU L 147 ARG L 152 5 ? 6  
HELX_P HELX_P67  67  ARG N  152 ? ARG N  156 ? ARG L 152 ARG L 156 5 ? 5  
HELX_P HELX_P68  68  LEU N  157 ? GLY N  162 ? LEU L 157 GLY L 162 5 ? 6  
HELX_P HELX_P69  69  THR N  164 ? ARG N  171 ? THR L 164 ARG L 171 1 ? 8  
HELX_P HELX_P70  70  MET O  10  ? GLU O  15  ? MET M 10  GLU M 15  1 ? 6  
HELX_P HELX_P71  71  ASP O  19  ? SER O  29  ? ASP M 19  SER M 29  1 ? 11 
HELX_P HELX_P72  72  SER O  64  ? GLY O  70  ? SER M 64  GLY M 70  5 ? 7  
HELX_P HELX_P73  73  ASN O  77  ? ALA O  95  ? ASN M 77  ALA M 95  1 ? 19 
HELX_P HELX_P74  74  SER O  113 ? ALA O  125 ? SER M 113 ALA M 125 1 ? 13 
HELX_P HELX_P75  75  ASN O  132 ? LEU O  136 ? ASN M 132 LEU M 136 5 ? 5  
HELX_P HELX_P76  76  TRP O  139 ? GLY O  144 ? TRP M 139 GLY M 144 1 ? 6  
HELX_P HELX_P77  77  GLY O  144 ? GLN O  153 ? GLY M 144 GLN M 153 1 ? 10 
HELX_P HELX_P78  78  LEU O  168 ? LEU O  180 ? LEU M 168 LEU M 180 1 ? 13 
HELX_P HELX_P79  79  ASN P  4   ? SER P  21  ? ASN N 4   SER N 21  1 ? 18 
HELX_P HELX_P80  80  ALA P  24  ? LYS P  35  ? ALA N 24  LYS N 35  1 ? 12 
HELX_P HELX_P81  81  PRO P  36  ? HIS P  40  ? PRO N 36  HIS N 40  5 ? 5  
HELX_P HELX_P82  82  LEU P  45  ? ALA P  52  ? LEU N 45  ALA N 52  1 ? 8  
HELX_P HELX_P83  83  SER P  82  ? GLY P  93  ? SER N 82  GLY N 93  1 ? 12 
HELX_P HELX_P84  84  LEU P  98  ? ASN P  105 ? LEU N 98  ASN N 105 1 ? 8  
HELX_P HELX_P85  85  LEU Q  3   ? LEU Q  14  ? LEU O 3   LEU O 14  1 ? 12 
HELX_P HELX_P86  86  GLY Q  17  ? ASN Q  19  ? GLY O 17  ASN O 19  5 ? 3  
HELX_P HELX_P87  87  ARG Q  27  ? ASP Q  33  ? ARG O 27  ASP O 33  1 ? 7  
HELX_P HELX_P88  88  THR Q  36  ? GLU Q  46  ? THR O 36  GLU O 46  1 ? 11 
HELX_P HELX_P89  89  ARG Q  59  ? LYS Q  71  ? ARG O 59  LYS O 71  1 ? 13 
HELX_P HELX_P90  90  GLY Q  76  ? ARG Q  80  ? GLY O 76  ARG O 80  5 ? 5  
HELX_P HELX_P91  91  LYS Q  83  ? GLN Q  88  ? LYS O 83  GLN O 88  1 ? 6  
HELX_P HELX_P92  92  ASN Q  89  ? GLU Q  111 ? ASN O 89  GLU O 111 1 ? 23 
HELX_P HELX_P93  93  SER Q  115 ? GLY Q  128 ? SER O 115 GLY O 128 1 ? 14 
HELX_P HELX_P94  94  SER Q  133 ? ASP Q  142 ? SER O 133 ASP O 142 1 ? 10 
HELX_P HELX_P95  95  PRO R  25  ? VAL R  30  ? PRO P 25  VAL P 30  5 ? 6  
HELX_P HELX_P96  96  HIS R  53  ? ASP R  57  ? HIS P 53  ASP P 57  5 ? 5  
HELX_P HELX_P97  97  THR R  87  ? ALA R  89  ? THR P 87  ALA P 89  5 ? 3  
HELX_P HELX_P98  98  ASP S  9   ? ASP S  11  ? ASP Q 9   ASP Q 11  5 ? 3  
HELX_P HELX_P99  99  SER S  24  ? LYS S  36  ? SER Q 24  LYS Q 36  1 ? 13 
HELX_P HELX_P100 100 THR S  39  ? GLU S  52  ? THR Q 39  GLU Q 52  1 ? 14 
HELX_P HELX_P101 101 PRO S  81  ? HIS S  101 ? PRO Q 81  HIS Q 101 1 ? 21 
HELX_P HELX_P102 102 ASP S  105 ? MET S  109 ? ASP Q 105 MET Q 109 5 ? 5  
HELX_P HELX_P103 103 ALA S  129 ? GLY S  131 ? ALA Q 129 GLY Q 131 5 ? 3  
HELX_P HELX_P104 104 THR T  11  ? ASN T  22  ? THR R 11  ASN R 22  1 ? 12 
HELX_P HELX_P105 105 SER T  33  ? ASP T  46  ? SER R 33  ASP R 46  1 ? 14 
HELX_P HELX_P106 106 ASP T  73  ? ARG T  80  ? ASP R 73  ARG R 80  1 ? 8  
HELX_P HELX_P107 107 GLN U  3   ? ARG U  13  ? GLN S 3   ARG S 13  1 ? 11 
HELX_P HELX_P108 108 PRO U  15  ? ARG U  19  ? PRO S 15  ARG S 19  5 ? 5  
HELX_P HELX_P109 109 ARG U  19  ? GLN U  22  ? ARG S 19  GLN S 22  5 ? 4  
HELX_P HELX_P110 110 SER U  28  ? GLY U  36  ? SER S 28  GLY S 36  1 ? 9  
HELX_P HELX_P111 111 ASP U  92  ? SER U  94  ? ASP S 92  SER S 94  5 ? 3  
HELX_P HELX_P112 112 ASP U  105 ? SER U  114 ? ASP S 105 SER S 114 1 ? 10 
HELX_P HELX_P113 113 SER V  33  ? LEU V  42  ? SER T 33  LEU T 42  1 ? 10 
HELX_P HELX_P114 114 GLU V  45  ? LEU V  49  ? GLU T 45  LEU T 49  5 ? 5  
HELX_P HELX_P115 115 HIS W  4   ? ASP W  10  ? HIS U 4   ASP U 10  1 ? 7  
HELX_P HELX_P116 116 THR W  12  ? ALA W  36  ? THR U 12  ALA U 36  1 ? 25 
HELX_P HELX_P117 117 PRO W  43  ? GLY W  64  ? PRO U 43  GLY U 64  1 ? 22 
HELX_P HELX_P118 118 HIS X  14  ? LEU X  24  ? HIS V 14  LEU V 24  1 ? 11 
HELX_P HELX_P119 119 THR X  38  ? ASN X  49  ? THR V 38  ASN V 49  1 ? 12 
HELX_P HELX_P120 120 SER X  58  ? ALA X  70  ? SER V 58  ALA V 70  1 ? 13 
HELX_P HELX_P121 121 ASP X  80  ? THR X  88  ? ASP V 80  THR V 88  1 ? 9  
HELX_P HELX_P122 122 ASP X  92  ? SER X  102 ? ASP V 92  SER V 102 1 ? 11 
HELX_P HELX_P123 123 VAL X  132 ? GLY X  135 ? VAL V 132 GLY V 135 5 ? 4  
HELX_P HELX_P124 124 ASP X  142 ? MET X  153 ? ASP V 142 MET V 153 1 ? 12 
HELX_P HELX_P125 125 ARG Y  15  ? GLU Y  20  ? ARG W 15  GLU W 20  5 ? 6  
HELX_P HELX_P126 126 PRO Y  21  ? HIS Y  23  ? PRO W 21  HIS W 23  5 ? 3  
HELX_P HELX_P127 127 LYS Y  24  ? PHE Y  41  ? LYS W 24  PHE W 41  1 ? 18 
HELX_P HELX_P128 128 ASP Y  44  ? ASP Y  46  ? ASP W 44  ASP W 46  5 ? 3  
HELX_P HELX_P129 129 ASP Y  51  ? TRP Y  59  ? ASP W 51  TRP W 59  1 ? 9  
HELX_P HELX_P130 130 SER Z  110 ? GLY Z  124 ? SER X 110 GLY X 124 1 ? 15 
HELX_P HELX_P131 131 GLU Z  165 ? ARG Z  169 ? GLU X 165 ARG X 169 5 ? 5  
HELX_P HELX_P132 132 VAL Z  190 ? GLU Z  194 ? VAL X 190 GLU X 194 5 ? 5  
HELX_P HELX_P133 133 GLY Z  210 ? ALA Z  224 ? GLY X 210 ALA X 224 1 ? 15 
HELX_P HELX_P134 134 ARG AA 1   ? GLY AA 6   ? ARG Y 10  GLY Y 15  5 ? 6  
HELX_P HELX_P135 135 GLY AA 10  ? LYS AA 26  ? GLY Y 19  LYS Y 35  1 ? 17 
HELX_P HELX_P136 136 THR AA 64  ? ALA AA 73  ? THR Y 73  ALA Y 82  1 ? 10 
HELX_P HELX_P137 137 GLY BA 4   ? GLY BA 9   ? GLY Z 4   GLY Z 9   5 ? 6  
HELX_P HELX_P138 138 TYR BA 48  ? SER BA 52  ? TYR Z 48  SER Z 52  5 ? 5  
HELX_P HELX_P139 139 SER CA 4   ? ASN CA 18  ? SER 1 4   ASN 1 18  1 ? 15 
HELX_P HELX_P140 140 PRO CA 22  ? ASP CA 30  ? PRO 1 22  ASP 1 30  1 ? 9  
HELX_P HELX_P141 141 LYS DA 34  ? SER DA 44  ? LYS 2 34  SER 2 44  1 ? 11 
HELX_P HELX_P142 142 ASP DA 49  ? LYS DA 54  ? ASP 2 49  LYS 2 54  5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1    metalc ? ? A  G   27   OP1   ? ? ? 1_555 PA MG  .    MG  ? ? 0 G   28   0 MG  8012 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
metalc2    metalc ? ? A  C   39   "O2'" ? ? ? 1_555 QE NA  .    NA  ? ? 0 C   40   0 NA  8307 1_555 ? ? ? ? ? ? ? 2.897 ? ? 
metalc3    metalc ? ? A  C   39   O2    ? ? ? 1_555 QE NA  .    NA  ? ? 0 C   40   0 NA  8307 1_555 ? ? ? ? ? ? ? 2.647 ? ? 
metalc4    metalc ? ? A  G   55   O6    ? ? ? 1_555 IF NA  .    NA  ? ? 0 G   56   0 NA  8328 1_555 ? ? ? ? ? ? ? 2.658 ? ? 
metalc5    metalc ? ? A  A   58   N3    ? ? ? 1_555 IF NA  .    NA  ? ? 0 A   59   0 NA  8328 1_555 ? ? ? ? ? ? ? 2.948 ? ? 
metalc6    metalc ? ? A  G   60   N7    ? ? ? 1_555 IF NA  .    NA  ? ? 0 G   61   0 NA  8328 1_555 ? ? ? ? ? ? ? 2.847 ? ? 
metalc7    metalc ? ? A  U   107  O2    ? ? ? 1_555 JF NA  .    NA  ? ? 0 U   108  0 NA  8329 1_555 ? ? ? ? ? ? ? 2.722 ? ? 
metalc8    metalc ? ? A  U   114  OP2   ? ? ? 1_555 QB MG  .    MG  ? ? 0 U   115  0 MG  8039 1_555 ? ? ? ? ? ? ? 1.939 ? ? 
metalc9    metalc ? ? A  C   140  "O4'" ? ? ? 1_555 KF NA  .    NA  ? ? 0 C   141  0 NA  8330 1_555 ? ? ? ? ? ? ? 2.693 ? ? 
metalc10   metalc ? ? A  C   140  O2    ? ? ? 1_555 KF NA  .    NA  ? ? 0 C   141  0 NA  8330 1_555 ? ? ? ? ? ? ? 2.687 ? ? 
metalc11   metalc ? ? A  G   141  O6    ? ? ? 1_555 KF NA  .    NA  ? ? 0 G   142  0 NA  8330 1_555 ? ? ? ? ? ? ? 2.971 ? ? 
metalc12   metalc ? ? A  U   145  O4    ? ? ? 1_555 EF NA  .    NA  ? ? 0 U   146  0 NA  8324 1_555 ? ? ? ? ? ? ? 2.777 ? ? 
metalc13   metalc ? ? A  C   161  OP1   ? ? ? 1_555 FC MG  .    MG  ? ? 0 C   162  0 MG  8054 1_555 ? ? ? ? ? ? ? 2.055 ? ? 
metalc14   metalc ? ? A  C   161  OP2   ? ? ? 1_555 KE K   .    K   ? ? 0 C   162  0 K   8202 1_555 ? ? ? ? ? ? ? 3.123 ? ? 
metalc15   metalc ? ? A  U   162  O4    ? ? ? 1_555 KE K   .    K   ? ? 0 U   163  0 K   8202 1_555 ? ? ? ? ? ? ? 2.847 ? ? 
metalc16   metalc ? ? A  A   164  N7    ? ? ? 1_555 ZC MG  .    MG  ? ? 0 A   165  0 MG  8079 1_555 ? ? ? ? ? ? ? 2.200 ? ? 
metalc17   metalc ? ? A  A   164  OP2   ? ? ? 1_555 WE NA  .    NA  ? ? 0 A   165  0 NA  8315 1_555 ? ? ? ? ? ? ? 2.649 ? ? 
metalc18   metalc ? ? A  A   165  OP1   ? ? ? 1_555 SC MG  .    MG  ? ? 0 A   166  0 MG  8070 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
metalc19   metalc ? ? A  A   165  "O3'" ? ? ? 1_555 WE NA  .    NA  ? ? 0 A   166  0 NA  8315 1_555 ? ? ? ? ? ? ? 2.679 ? ? 
metalc20   metalc ? ? A  A   165  "O2'" ? ? ? 1_555 WE NA  .    NA  ? ? 0 A   166  0 NA  8315 1_555 ? ? ? ? ? ? ? 2.921 ? ? 
metalc21   metalc ? ? A  A   166  OP1   ? ? ? 1_555 ZC MG  .    MG  ? ? 0 A   167  0 MG  8079 1_555 ? ? ? ? ? ? ? 1.820 ? ? 
metalc22   metalc ? ? A  A   166  OP1   ? ? ? 1_555 WE NA  .    NA  ? ? 0 A   167  0 NA  8315 1_555 ? ? ? ? ? ? ? 2.864 ? ? 
metalc23   metalc ? ? A  C   167  OP2   ? ? ? 1_555 ZC MG  .    MG  ? ? 0 C   168  0 MG  8079 1_555 ? ? ? ? ? ? ? 2.080 ? ? 
metalc24   metalc ? ? A  U   169  O2    ? ? ? 1_555 LF NA  .    NA  ? ? 0 U   170  0 NA  8331 1_555 ? ? ? ? ? ? ? 2.611 ? ? 
metalc25   metalc ? ? A  U   171  O4    ? ? ? 1_555 KE K   .    K   ? ? 0 U   172  0 K   8202 1_555 ? ? ? ? ? ? ? 2.965 ? ? 
metalc26   metalc ? ? A  G   174  OP2   ? ? ? 1_555 KC MG  .    MG  ? ? 0 G   175  0 MG  8060 1_555 ? ? ? ? ? ? ? 2.183 ? ? 
metalc27   metalc ? ? A  A   186  N1    ? ? ? 1_555 DE MG  .    MG  ? ? 0 A   187  0 MG  8112 1_555 ? ? ? ? ? ? ? 2.699 ? ? 
metalc28   metalc ? ? A  G   195  OP1   ? ? ? 1_555 SB MG  .    MG  ? ? 0 G   196  0 MG  8041 1_555 ? ? ? ? ? ? ? 2.346 ? ? 
metalc29   metalc ? ? A  G   195  N7    ? ? ? 1_555 VG NA  .    NA  ? ? 0 G   196  0 NA  8374 1_555 ? ? ? ? ? ? ? 2.950 ? ? 
metalc30   metalc ? ? A  C   196  N3    ? ? ? 1_555 DH NA  .    NA  ? ? 0 C   197  0 NA  8384 1_555 ? ? ? ? ? ? ? 2.507 ? ? 
metalc31   metalc ? ? A  C   217  "O2'" ? ? ? 1_555 LF NA  .    NA  ? ? 0 C   218  0 NA  8331 1_555 ? ? ? ? ? ? ? 2.851 ? ? 
metalc32   metalc ? ? A  G   218  O6    ? ? ? 1_555 SC MG  .    MG  ? ? 0 G   219  0 MG  8070 1_555 ? ? ? ? ? ? ? 2.544 ? ? 
metalc33   metalc ? ? A  G   220  O6    ? ? ? 1_555 LF NA  .    NA  ? ? 0 G   221  0 NA  8331 1_555 ? ? ? ? ? ? ? 2.914 ? ? 
metalc34   metalc ? ? A  A   226  "O2'" ? ? ? 1_555 SB MG  .    MG  ? ? 0 A   227  0 MG  8041 1_555 ? ? ? ? ? ? ? 2.530 ? ? 
metalc35   metalc ? ? A  C   227  "O4'" ? ? ? 1_555 SB MG  .    MG  ? ? 0 C   228  0 MG  8041 1_555 ? ? ? ? ? ? ? 2.541 ? ? 
metalc36   metalc ? ? A  C   239  OP1   ? ? ? 1_555 EB MG  .    MG  ? ? 0 C   240  0 MG  8027 1_555 ? ? ? ? ? ? ? 1.985 ? ? 
metalc37   metalc ? ? A  G   268  O6    ? ? ? 1_555 EB MG  .    MG  ? ? 0 G   269  0 MG  8027 1_555 ? ? ? ? ? ? ? 1.976 ? ? 
metalc38   metalc ? ? A  U   307  O4    ? ? ? 1_555 TI NA  .    NA  ? ? 0 U   308  S NA  8343 1_555 ? ? ? ? ? ? ? 2.885 ? ? 
metalc39   metalc ? ? A  U   334  O2    ? ? ? 1_555 TI NA  .    NA  ? ? 0 U   335  S NA  8343 1_555 ? ? ? ? ? ? ? 2.984 ? ? 
metalc40   metalc ? ? A  C   341  O2    ? ? ? 1_555 TI NA  .    NA  ? ? 0 C   342  S NA  8343 1_555 ? ? ? ? ? ? ? 2.844 ? ? 
metalc41   metalc ? ? A  G   385  O6    ? ? ? 1_555 MF NA  .    NA  ? ? 0 G   386  0 NA  8332 1_555 ? ? ? ? ? ? ? 2.999 ? ? 
metalc42   metalc ? ? A  G   386  O6    ? ? ? 1_555 MF NA  .    NA  ? ? 0 G   387  0 NA  8332 1_555 ? ? ? ? ? ? ? 2.431 ? ? 
metalc43   metalc ? ? A  U   391  OP2   ? ? ? 1_555 RB MG  .    MG  ? ? 0 U   392  0 MG  8040 1_555 ? ? ? ? ? ? ? 2.196 ? ? 
metalc44   metalc ? ? A  C   398  O2    ? ? ? 1_555 MG NA  .    NA  ? ? 0 C   399  0 NA  8365 1_555 ? ? ? ? ? ? ? 2.892 ? ? 
metalc45   metalc ? ? A  U   401  O4    ? ? ? 1_555 MF NA  .    NA  ? ? 0 U   402  0 NA  8332 1_555 ? ? ? ? ? ? ? 2.766 ? ? 
metalc46   metalc ? ? A  A   414  "O2'" ? ? ? 1_555 VG NA  .    NA  ? ? 0 A   415  0 NA  8374 1_555 ? ? ? ? ? ? ? 2.938 ? ? 
metalc47   metalc ? ? A  A   441  N1    ? ? ? 1_555 QE NA  .    NA  ? ? 0 A   442  0 NA  8307 1_555 ? ? ? ? ? ? ? 2.980 ? ? 
metalc48   metalc ? ? A  C   442  O2    ? ? ? 1_555 QE NA  .    NA  ? ? 0 C   443  0 NA  8307 1_555 ? ? ? ? ? ? ? 2.776 ? ? 
metalc49   metalc ? ? A  A   452  "O2'" ? ? ? 1_555 HG NA  .    NA  ? ? 0 A   453  0 NA  8360 1_555 ? ? ? ? ? ? ? 2.986 ? ? 
metalc50   metalc ? ? A  G   455  O6    ? ? ? 1_555 HA MG  .    MG  ? ? 0 G   456  0 MG  8004 1_555 ? ? ? ? ? ? ? 2.058 ? ? 
metalc51   metalc ? ? A  G   455  OP2   ? ? ? 1_555 UA MG  .    MG  ? ? 0 G   456  0 MG  8017 1_555 ? ? ? ? ? ? ? 2.069 ? ? 
metalc52   metalc ? ? A  A   458  OP1   ? ? ? 1_555 HA MG  .    MG  ? ? 0 A   459  0 MG  8004 1_555 ? ? ? ? ? ? ? 1.948 ? ? 
metalc53   metalc ? ? A  G   463  O6    ? ? ? 1_555 OG NA  .    NA  ? ? 0 G   464  0 NA  8367 1_555 ? ? ? ? ? ? ? 2.918 ? ? 
metalc54   metalc ? ? A  G   470  O6    ? ? ? 1_555 EC MG  .    MG  ? ? 0 G   471  0 MG  8053 1_555 ? ? ? ? ? ? ? 2.181 ? ? 
metalc55   metalc ? ? A  G   474  OP2   ? ? ? 1_555 OG NA  .    NA  ? ? 0 G   475  0 NA  8367 1_555 ? ? ? ? ? ? ? 2.787 ? ? 
metalc56   metalc ? ? A  C   477  OP1   ? ? ? 1_555 HG NA  .    NA  ? ? 0 C   478  0 NA  8360 1_555 ? ? ? ? ? ? ? 2.896 ? ? 
metalc57   metalc ? ? A  G   478  OP2   ? ? ? 1_555 HG NA  .    NA  ? ? 0 G   479  0 NA  8360 1_555 ? ? ? ? ? ? ? 2.858 ? ? 
metalc58   metalc ? ? A  A   515  OP1   ? ? ? 1_555 JD MG  .    MG  ? ? 0 A   516  0 MG  8089 1_555 ? ? ? ? ? ? ? 2.043 ? ? 
metalc59   metalc ? ? A  U   516  OP2   ? ? ? 1_555 JD MG  .    MG  ? ? 0 U   517  0 MG  8089 1_555 ? ? ? ? ? ? ? 2.156 ? ? 
metalc60   metalc ? ? A  G   517  N7    ? ? ? 1_555 JD MG  .    MG  ? ? 0 G   518  0 MG  8089 1_555 ? ? ? ? ? ? ? 2.650 ? ? 
metalc61   metalc ? ? A  A   531  OP1   ? ? ? 1_555 GD MG  .    MG  ? ? 0 A   532  0 MG  8086 1_555 ? ? ? ? ? ? ? 2.363 ? ? 
metalc62   metalc ? ? A  U   532  OP1   ? ? ? 1_555 GD MG  .    MG  ? ? 0 U   533  0 MG  8086 1_555 ? ? ? ? ? ? ? 2.070 ? ? 
metalc63   metalc ? ? A  G   543  O6    ? ? ? 1_555 NG NA  .    NA  ? ? 0 G   544  0 NA  8366 1_555 ? ? ? ? ? ? ? 2.940 ? ? 
metalc64   metalc ? ? A  G   544  O6    ? ? ? 1_555 NG NA  .    NA  ? ? 0 G   545  0 NA  8366 1_555 ? ? ? ? ? ? ? 2.466 ? ? 
metalc65   metalc ? ? A  U   622  O4    ? ? ? 1_555 PF NA  .    NA  ? ? 0 U   623  0 NA  8335 1_555 ? ? ? ? ? ? ? 2.795 ? ? 
metalc66   metalc ? ? A  U   622  "O2'" ? ? ? 1_555 YF NA  .    NA  ? ? 0 U   623  0 NA  8350 1_555 ? ? ? ? ? ? ? 2.800 ? ? 
metalc67   metalc ? ? A  G   626  O6    ? ? ? 1_555 FA MG  .    MG  ? ? 0 G   627  0 MG  8002 1_555 ? ? ? ? ? ? ? 2.096 ? ? 
metalc68   metalc ? ? A  A   629  "O2'" ? ? ? 1_555 OE NA  .    NA  ? ? 0 A   630  0 NA  8305 1_555 ? ? ? ? ? ? ? 2.659 ? ? 
metalc69   metalc ? ? A  A   629  N3    ? ? ? 1_555 OE NA  .    NA  ? ? 0 A   630  0 NA  8305 1_555 ? ? ? ? ? ? ? 2.721 ? ? 
metalc70   metalc ? ? A  A   630  "O2'" ? ? ? 1_555 OE NA  .    NA  ? ? 0 A   631  0 NA  8305 1_555 ? ? ? ? ? ? ? 2.896 ? ? 
metalc71   metalc ? ? A  C   632  OP1   ? ? ? 1_555 XG NA  .    NA  ? ? 0 C   633  0 NA  8376 1_555 ? ? ? ? ? ? ? 2.503 ? ? 
metalc72   metalc ? ? A  G   640  OP2   ? ? ? 1_555 CC MG  .    MG  ? ? 0 G   641  0 MG  8051 1_555 ? ? ? ? ? ? ? 2.055 ? ? 
metalc73   metalc ? ? A  A   642  OP2   ? ? ? 1_555 NE NA  .    NA  ? ? 0 A   643  0 NA  8303 1_555 ? ? ? ? ? ? ? 2.873 ? ? 
metalc74   metalc ? ? A  G   680  "O3'" ? ? ? 1_555 UF NA  .    NA  ? ? 0 G   681  0 NA  8341 1_555 ? ? ? ? ? ? ? 2.931 ? ? 
metalc75   metalc ? ? A  A   681  OP2   ? ? ? 1_555 HD MG  .    MG  ? ? 0 A   682  0 MG  8087 1_555 ? ? ? ? ? ? ? 1.958 ? ? 
metalc76   metalc ? ? A  G   682  OP2   ? ? ? 1_555 HD MG  .    MG  ? ? 0 G   683  0 MG  8087 1_555 ? ? ? ? ? ? ? 1.957 ? ? 
metalc77   metalc ? ? A  G   682  N7    ? ? ? 1_555 UF NA  .    NA  ? ? 0 G   683  0 NA  8341 1_555 ? ? ? ? ? ? ? 2.799 ? ? 
metalc78   metalc ? ? A  G   682  O6    ? ? ? 1_555 UF NA  .    NA  ? ? 0 G   683  0 NA  8341 1_555 ? ? ? ? ? ? ? 2.705 ? ? 
metalc79   metalc ? ? A  C   768  "O4'" ? ? ? 1_555 BG NA  .    NA  ? ? 0 C   769  0 NA  8354 1_555 ? ? ? ? ? ? ? 2.995 ? ? 
metalc80   metalc ? ? A  A   775  "O3'" ? ? ? 1_555 FF NA  .    NA  ? ? 0 A   776  0 NA  8325 1_555 ? ? ? ? ? ? ? 2.601 ? ? 
metalc81   metalc ? ? A  A   775  "O2'" ? ? ? 1_555 FF NA  .    NA  ? ? 0 A   776  0 NA  8325 1_555 ? ? ? ? ? ? ? 2.760 ? ? 
metalc82   metalc ? ? A  U   776  OP2   ? ? ? 1_555 IB MG  .    MG  ? ? 0 U   777  0 MG  8031 1_555 ? ? ? ? ? ? ? 1.963 ? ? 
metalc83   metalc ? ? A  U   776  OP2   ? ? ? 1_555 FF NA  .    NA  ? ? 0 U   777  0 NA  8325 1_555 ? ? ? ? ? ? ? 2.880 ? ? 
metalc84   metalc ? ? A  C   777  OP2   ? ? ? 1_555 IB MG  .    MG  ? ? 0 C   778  0 MG  8031 1_555 ? ? ? ? ? ? ? 2.210 ? ? 
metalc85   metalc ? ? A  U   778  O4    ? ? ? 1_555 FF NA  .    NA  ? ? 0 U   779  0 NA  8325 1_555 ? ? ? ? ? ? ? 2.767 ? ? 
metalc86   metalc ? ? A  U   814  O4    ? ? ? 1_555 PG NA  .    NA  ? ? 0 U   815  0 NA  8368 1_555 ? ? ? ? ? ? ? 2.803 ? ? 
metalc87   metalc ? ? A  G   815  O6    ? ? ? 1_555 UB MG  .    MG  ? ? 0 G   816  0 MG  8043 1_555 ? ? ? ? ? ? ? 2.276 ? ? 
metalc88   metalc ? ? A  G   816  O6    ? ? ? 1_555 UB MG  .    MG  ? ? 0 G   817  0 MG  8043 1_555 ? ? ? ? ? ? ? 2.516 ? ? 
metalc89   metalc ? ? A  G   816  O6    ? ? ? 1_555 YD MG  .    MG  ? ? 0 G   817  0 MG  8106 1_555 ? ? ? ? ? ? ? 2.280 ? ? 
metalc90   metalc ? ? A  U   820  OP2   ? ? ? 1_555 JA MG  .    MG  ? ? 0 U   821  0 MG  8006 1_555 ? ? ? ? ? ? ? 2.017 ? ? 
metalc91   metalc ? ? A  C   821  OP2   ? ? ? 1_555 JA MG  .    MG  ? ? 0 C   822  0 MG  8006 1_555 ? ? ? ? ? ? ? 1.898 ? ? 
metalc92   metalc ? ? A  G   823  N7    ? ? ? 1_555 OA MG  .    MG  ? ? 0 G   824  0 MG  8011 1_555 ? ? ? ? ? ? ? 2.106 ? ? 
metalc93   metalc ? ? A  U   831  OP2   ? ? ? 1_555 KA MG  .    MG  ? ? 0 U   832  0 MG  8007 1_555 ? ? ? ? ? ? ? 2.002 ? ? 
metalc94   metalc ? ? A  G   835  OP1   ? ? ? 1_555 NA MG  .    MG  ? ? 0 G   836  0 MG  8010 1_555 ? ? ? ? ? ? ? 1.953 ? ? 
metalc95   metalc ? ? A  G   835  "O3'" ? ? ? 1_555 CF NA  .    NA  ? ? 0 G   836  0 NA  8321 1_555 ? ? ? ? ? ? ? 2.676 ? ? 
metalc96   metalc ? ? A  U   836  OP1   ? ? ? 1_555 CF NA  .    NA  ? ? 0 U   837  0 NA  8321 1_555 ? ? ? ? ? ? ? 2.932 ? ? 
metalc97   metalc ? ? A  A   843  OP1   ? ? ? 1_555 SA MG  .    MG  ? ? 0 A   844  0 MG  8015 1_555 ? ? ? ? ? ? ? 1.930 ? ? 
metalc98   metalc ? ? A  G   853  OP1   ? ? ? 1_555 JA MG  .    MG  ? ? 0 G   854  0 MG  8006 1_555 ? ? ? ? ? ? ? 1.938 ? ? 
metalc99   metalc ? ? A  G   853  N7    ? ? ? 1_555 OA MG  .    MG  ? ? 0 G   854  0 MG  8011 1_555 ? ? ? ? ? ? ? 2.222 ? ? 
metalc100  metalc ? ? A  G   853  OP1   ? ? ? 1_555 HF NA  .    NA  ? ? 0 G   854  0 NA  8327 1_555 ? ? ? ? ? ? ? 2.718 ? ? 
metalc101  metalc ? ? A  G   862  O6    ? ? ? 1_555 QD MG  .    MG  ? ? 0 G   863  0 MG  8097 1_555 ? ? ? ? ? ? ? 2.344 ? ? 
metalc102  metalc ? ? A  U   863  O4    ? ? ? 1_555 QD MG  .    MG  ? ? 0 U   864  0 MG  8097 1_555 ? ? ? ? ? ? ? 2.507 ? ? 
metalc103  metalc ? ? A  A   875  OP2   ? ? ? 1_555 GA MG  .    MG  ? ? 0 A   876  0 MG  8003 1_555 ? ? ? ? ? ? ? 2.092 ? ? 
metalc104  metalc ? ? A  G   876  OP2   ? ? ? 1_555 GA MG  .    MG  ? ? 0 G   877  0 MG  8003 1_555 ? ? ? ? ? ? ? 2.125 ? ? 
metalc105  metalc ? ? A  G   876  OP1   ? ? ? 1_555 QA MG  .    MG  ? ? 0 G   877  0 MG  8013 1_555 ? ? ? ? ? ? ? 1.958 ? ? 
metalc106  metalc ? ? A  C   879  OP1   ? ? ? 1_555 YC MG  .    MG  ? ? 0 C   880  0 MG  8077 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
metalc107  metalc ? ? A  U   882  OP2   ? ? ? 1_555 YC MG  .    MG  ? ? 0 U   883  0 MG  8077 1_555 ? ? ? ? ? ? ? 2.047 ? ? 
metalc108  metalc ? ? A  G   891  N7    ? ? ? 1_555 VF NA  .    NA  ? ? 0 G   892  0 NA  8342 1_555 ? ? ? ? ? ? ? 2.800 ? ? 
metalc109  metalc ? ? A  C   895  "O2'" ? ? ? 1_555 XE NA  .    NA  ? ? 0 C   896  0 NA  8316 1_555 ? ? ? ? ? ? ? 2.923 ? ? 
metalc110  metalc ? ? A  A   896  "O4'" ? ? ? 1_555 XE NA  .    NA  ? ? 0 A   897  0 NA  8316 1_555 ? ? ? ? ? ? ? 2.928 ? ? 
metalc111  metalc ? ? A  G   900  OP1   ? ? ? 1_555 YF NA  .    NA  ? ? 0 G   901  0 NA  8350 1_555 ? ? ? ? ? ? ? 2.805 ? ? 
metalc112  metalc ? ? A  U   902  OP1   ? ? ? 1_555 BE MG  .    MG  ? ? 0 U   903  0 MG  8110 1_555 ? ? ? ? ? ? ? 2.393 ? ? 
metalc113  metalc ? ? A  U   902  O4    ? ? ? 1_555 ZG NA  .    NA  ? ? 0 U   903  0 NA  8378 1_555 ? ? ? ? ? ? ? 2.646 ? ? 
metalc114  metalc ? ? A  U   903  O4    ? ? ? 1_555 NE NA  .    NA  ? ? 0 U   904  0 NA  8303 1_555 ? ? ? ? ? ? ? 2.876 ? ? 
metalc115  metalc ? ? A  A   906  "O2'" ? ? ? 1_555 WC MG  .    MG  ? ? 0 A   907  0 MG  8075 1_555 ? ? ? ? ? ? ? 2.734 ? ? 
metalc116  metalc ? ? A  A   906  N7    ? ? ? 1_555 RD MG  .    MG  ? ? 0 A   907  0 MG  8098 1_555 ? ? ? ? ? ? ? 2.566 ? ? 
metalc117  metalc ? ? A  A   907  "O4'" ? ? ? 1_555 WC MG  .    MG  ? ? 0 A   908  0 MG  8075 1_555 ? ? ? ? ? ? ? 2.625 ? ? 
metalc118  metalc ? ? A  A   913  "O3'" ? ? ? 1_555 XF NA  .    NA  ? ? 0 A   914  0 NA  8349 1_555 ? ? ? ? ? ? ? 2.791 ? ? 
metalc119  metalc ? ? A  C   914  OP2   ? ? ? 1_555 XF NA  .    NA  ? ? 0 C   915  0 NA  8349 1_555 ? ? ? ? ? ? ? 2.938 ? ? 
metalc120  metalc ? ? A  G   917  OP1   ? ? ? 1_555 LD MG  .    MG  ? ? 0 G   918  0 MG  8091 1_555 ? ? ? ? ? ? ? 2.144 ? ? 
metalc121  metalc ? ? A  U   918  OP1   ? ? ? 1_555 LA MG  .    MG  ? ? 0 U   919  0 MG  8008 1_555 ? ? ? ? ? ? ? 2.156 ? ? 
metalc122  metalc ? ? A  C   919  N3    ? ? ? 1_555 DG NA  .    NA  ? ? 0 C   920  0 NA  8356 1_555 ? ? ? ? ? ? ? 2.862 ? ? 
metalc123  metalc ? ? A  A   921  OP1   ? ? ? 1_555 GG NA  .    NA  ? ? 0 A   922  0 NA  8359 1_555 ? ? ? ? ? ? ? 2.797 ? ? 
metalc124  metalc ? ? A  G   923  O6    ? ? ? 1_555 TG NA  .    NA  ? ? 0 G   924  0 NA  8372 1_555 ? ? ? ? ? ? ? 2.969 ? ? 
metalc125  metalc ? ? A  G   940  O6    ? ? ? 1_555 EG NA  .    NA  ? ? 0 G   941  0 NA  8357 1_555 ? ? ? ? ? ? ? 2.814 ? ? 
metalc126  metalc ? ? A  U   941  O4    ? ? ? 1_555 EG NA  .    NA  ? ? 0 U   942  0 NA  8357 1_555 ? ? ? ? ? ? ? 2.497 ? ? 
metalc127  metalc ? ? A  U   953  OP1   ? ? ? 1_555 UC MG  .    MG  ? ? 0 U   954  0 MG  8072 1_555 ? ? ? ? ? ? ? 2.233 ? ? 
metalc128  metalc ? ? A  G   955  OP2   ? ? ? 1_555 NB MG  .    MG  ? ? 0 G   956  0 MG  8036 1_555 ? ? ? ? ? ? ? 2.002 ? ? 
metalc129  metalc ? ? A  G   1023 O6    ? ? ? 1_555 EG NA  .    NA  ? ? 0 G   1024 0 NA  8357 1_555 ? ? ? ? ? ? ? 2.457 ? ? 
metalc130  metalc ? ? A  A   1039 "O2'" ? ? ? 1_555 AG NA  .    NA  ? ? 0 A   1040 0 NA  8353 1_555 ? ? ? ? ? ? ? 2.802 ? ? 
metalc131  metalc ? ? A  G   1044 OP2   ? ? ? 1_555 XF NA  .    NA  ? ? 0 G   1045 0 NA  8349 1_555 ? ? ? ? ? ? ? 2.243 ? ? 
metalc132  metalc ? ? A  C   1068 OP2   ? ? ? 1_555 LE NA  .    NA  ? ? 0 C   1069 0 NA  8301 1_555 ? ? ? ? ? ? ? 2.151 ? ? 
metalc133  metalc ? ? A  A   1069 "O2'" ? ? ? 1_555 ND MG  .    MG  ? ? 0 A   1070 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.938 ? ? 
metalc134  metalc ? ? A  G   1070 OP1   ? ? ? 1_555 ND MG  .    MG  ? ? 0 G   1071 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.583 ? ? 
metalc135  metalc ? ? A  G   1071 N7    ? ? ? 1_555 LE NA  .    NA  ? ? 0 G   1072 0 NA  8301 1_555 ? ? ? ? ? ? ? 2.385 ? ? 
metalc136  metalc ? ? A  G   1076 N7    ? ? ? 1_555 EH NA  .    NA  ? ? 0 G   1077 0 NA  8385 1_555 ? ? ? ? ? ? ? 2.368 ? ? 
metalc137  metalc ? ? A  A   1078 OP1   ? ? ? 1_555 EH NA  .    NA  ? ? 0 A   1079 0 NA  8385 1_555 ? ? ? ? ? ? ? 2.574 ? ? 
metalc138  metalc ? ? A  U   1095 OP2   ? ? ? 1_555 OD MG  .    MG  ? ? 0 U   1096 0 MG  8094 1_555 ? ? ? ? ? ? ? 2.258 ? ? 
metalc139  metalc ? ? A  A   1097 OP2   ? ? ? 1_555 YB MG  .    MG  ? ? 0 A   1098 0 MG  8047 1_555 ? ? ? ? ? ? ? 1.952 ? ? 
metalc140  metalc ? ? A  A   1105 OP2   ? ? ? 1_555 ZD MG  .    MG  ? ? 0 A   1106 0 MG  8107 1_555 ? ? ? ? ? ? ? 2.159 ? ? 
metalc141  metalc ? ? A  A   1106 OP2   ? ? ? 1_555 ZD MG  .    MG  ? ? 0 A   1107 0 MG  8107 1_555 ? ? ? ? ? ? ? 1.843 ? ? 
metalc142  metalc ? ? A  G   1118 "O2'" ? ? ? 1_555 ME NA  .    NA  ? ? 0 G   1119 0 NA  8302 1_555 ? ? ? ? ? ? ? 2.835 ? ? 
metalc143  metalc ? ? A  G   1118 O6    ? ? ? 1_555 CG NA  .    NA  ? ? 0 G   1119 0 NA  8355 1_555 ? ? ? ? ? ? ? 2.846 ? ? 
metalc144  metalc ? ? A  U   1119 OP2   ? ? ? 1_555 CB MG  .    MG  ? ? 0 U   1120 0 MG  8025 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc145  metalc ? ? A  U   1119 OP2   ? ? ? 1_555 ME NA  .    NA  ? ? 0 U   1120 0 NA  8302 1_555 ? ? ? ? ? ? ? 2.941 ? ? 
metalc146  metalc ? ? A  G   1120 OP2   ? ? ? 1_555 CB MG  .    MG  ? ? 0 G   1121 0 MG  8025 1_555 ? ? ? ? ? ? ? 2.112 ? ? 
metalc147  metalc ? ? A  G   1120 O6    ? ? ? 1_555 ME NA  .    NA  ? ? 0 G   1121 0 NA  8302 1_555 ? ? ? ? ? ? ? 2.905 ? ? 
metalc148  metalc ? ? A  U   1124 OP1   ? ? ? 1_555 DC MG  .    MG  ? ? 0 U   1125 0 MG  8052 1_555 ? ? ? ? ? ? ? 2.165 ? ? 
metalc149  metalc ? ? A  A   1132 "O3'" ? ? ? 1_555 ZH NA  .    NA  ? ? 0 A   1133 H NA  8309 1_555 ? ? ? ? ? ? ? 2.794 ? ? 
metalc150  metalc ? ? A  G   1133 OP1   ? ? ? 1_555 ZH NA  .    NA  ? ? 0 G   1134 H NA  8309 1_555 ? ? ? ? ? ? ? 2.952 ? ? 
metalc151  metalc ? ? A  C   1256 OP2   ? ? ? 1_555 OD MG  .    MG  ? ? 0 C   1257 0 MG  8094 1_555 ? ? ? ? ? ? ? 2.227 ? ? 
metalc152  metalc ? ? A  A   1285 OP1   ? ? ? 1_555 VC MG  .    MG  ? ? 0 A   1286 0 MG  8074 1_555 ? ? ? ? ? ? ? 1.866 ? ? 
metalc153  metalc ? ? A  A   1286 OP1   ? ? ? 1_555 VC MG  .    MG  ? ? 0 A   1287 0 MG  8074 1_555 ? ? ? ? ? ? ? 2.192 ? ? 
metalc154  metalc ? ? A  A   1290 OP1   ? ? ? 1_555 VA MG  .    MG  ? ? 0 A   1291 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.061 ? ? 
metalc155  metalc ? ? A  G   1291 OP2   ? ? ? 1_555 VA MG  .    MG  ? ? 0 G   1292 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
metalc156  metalc ? ? A  U   1292 OP2   ? ? ? 1_555 YG NA  .    NA  ? ? 0 U   1293 0 NA  8377 1_555 ? ? ? ? ? ? ? 2.748 ? ? 
metalc157  metalc ? ? A  G   1294 O6    ? ? ? 1_555 YG NA  .    NA  ? ? 0 G   1295 0 NA  8377 1_555 ? ? ? ? ? ? ? 2.723 ? ? 
metalc158  metalc ? ? A  A   1295 OP1   ? ? ? 1_555 AG NA  .    NA  ? ? 0 A   1296 0 NA  8353 1_555 ? ? ? ? ? ? ? 2.757 ? ? 
metalc159  metalc ? ? A  U   1308 O2    ? ? ? 1_555 TB MG  .    MG  ? ? 0 U   1309 0 MG  8042 1_555 ? ? ? ? ? ? ? 2.383 ? ? 
metalc160  metalc ? ? A  U   1345 O2    ? ? ? 1_555 TB MG  .    MG  ? ? 0 U   1346 0 MG  8042 1_555 ? ? ? ? ? ? ? 2.502 ? ? 
metalc161  metalc ? ? A  A   1356 N7    ? ? ? 1_555 BE MG  .    MG  ? ? 0 A   1357 0 MG  8110 1_555 ? ? ? ? ? ? ? 2.579 ? ? 
metalc162  metalc ? ? A  U   1358 "O2'" ? ? ? 1_555 KG NA  .    NA  ? ? 0 U   1359 0 NA  8363 1_555 ? ? ? ? ? ? ? 2.997 ? ? 
metalc163  metalc ? ? A  C   1359 OP1   ? ? ? 1_555 KG NA  .    NA  ? ? 0 C   1360 0 NA  8363 1_555 ? ? ? ? ? ? ? 2.528 ? ? 
metalc164  metalc ? ? A  A   1368 OP2   ? ? ? 1_555 LC MG  .    MG  ? ? 0 A   1369 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.170 ? ? 
metalc165  metalc ? ? A  A   1380 N7    ? ? ? 1_555 BB MG  .    MG  ? ? 0 A   1381 0 MG  8024 1_555 ? ? ? ? ? ? ? 2.290 ? ? 
metalc166  metalc ? ? A  C   1393 O2    ? ? ? 1_555 RE NA  .    NA  ? ? 0 C   1394 0 NA  8308 1_555 ? ? ? ? ? ? ? 2.162 ? ? 
metalc167  metalc ? ? A  G   1415 "O3'" ? ? ? 1_555 YE NA  .    NA  ? ? 0 G   1416 0 NA  8317 1_555 ? ? ? ? ? ? ? 2.369 ? ? 
metalc168  metalc ? ? A  G   1416 OP1   ? ? ? 1_555 YE NA  .    NA  ? ? 0 G   1417 0 NA  8317 1_555 ? ? ? ? ? ? ? 2.721 ? ? 
metalc169  metalc ? ? A  C   1419 OP1   ? ? ? 1_555 BD MG  .    MG  ? ? 0 C   1420 0 MG  8081 1_555 ? ? ? ? ? ? ? 2.259 ? ? 
metalc170  metalc ? ? A  C   1420 OP2   ? ? ? 1_555 BD MG  .    MG  ? ? 0 C   1421 0 MG  8081 1_555 ? ? ? ? ? ? ? 2.087 ? ? 
metalc171  metalc ? ? A  U   1431 O4    ? ? ? 1_555 RE NA  .    NA  ? ? 0 U   1432 0 NA  8308 1_555 ? ? ? ? ? ? ? 2.516 ? ? 
metalc172  metalc ? ? A  A   1436 OP2   ? ? ? 1_555 CD MG  .    MG  ? ? 0 A   1437 0 MG  8082 1_555 ? ? ? ? ? ? ? 2.966 ? ? 
metalc173  metalc ? ? A  G   1437 OP1   ? ? ? 1_555 BD MG  .    MG  ? ? 0 G   1438 0 MG  8081 1_555 ? ? ? ? ? ? ? 2.127 ? ? 
metalc174  metalc ? ? A  A   1447 OP2   ? ? ? 1_555 FB MG  .    MG  ? ? 0 A   1448 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
metalc175  metalc ? ? A  G   1483 OP2   ? ? ? 1_555 MB MG  .    MG  ? ? 0 G   1484 0 MG  8035 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
metalc176  metalc ? ? A  G   1488 OP2   ? ? ? 1_555 MC MG  .    MG  ? ? 0 G   1489 0 MG  8062 1_555 ? ? ? ? ? ? ? 2.465 ? ? 
metalc177  metalc ? ? A  G   1490 O6    ? ? ? 1_555 MC MG  .    MG  ? ? 0 G   1491 0 MG  8062 1_555 ? ? ? ? ? ? ? 2.051 ? ? 
metalc178  metalc ? ? A  U   1502 OP1   ? ? ? 1_555 GB MG  .    MG  ? ? 0 U   1503 0 MG  8029 1_555 ? ? ? ? ? ? ? 1.889 ? ? 
metalc179  metalc ? ? A  A   1503 OP1   ? ? ? 1_555 TA MG  .    MG  ? ? 0 A   1504 0 MG  8016 1_555 ? ? ? ? ? ? ? 2.179 ? ? 
metalc180  metalc ? ? A  G   1575 O6    ? ? ? 1_555 UG NA  .    NA  ? ? 0 G   1576 0 NA  8373 1_555 ? ? ? ? ? ? ? 2.756 ? ? 
metalc181  metalc ? ? A  G   1618 O6    ? ? ? 1_555 UG NA  .    NA  ? ? 0 G   1619 0 NA  8373 1_555 ? ? ? ? ? ? ? 2.880 ? ? 
metalc182  metalc ? ? A  U   1676 O4    ? ? ? 1_555 FB MG  .    MG  ? ? 0 U   1677 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.067 ? ? 
metalc183  metalc ? ? A  A   1677 OP1   ? ? ? 1_555 TA MG  .    MG  ? ? 0 A   1678 0 MG  8016 1_555 ? ? ? ? ? ? ? 1.990 ? ? 
metalc184  metalc ? ? A  C   1678 OP2   ? ? ? 1_555 TA MG  .    MG  ? ? 0 C   1679 0 MG  8016 1_555 ? ? ? ? ? ? ? 1.858 ? ? 
metalc185  metalc ? ? A  C   1678 OP1   ? ? ? 1_555 GB MG  .    MG  ? ? 0 C   1679 0 MG  8029 1_555 ? ? ? ? ? ? ? 2.072 ? ? 
metalc186  metalc ? ? A  A   1683 OP2   ? ? ? 1_555 AD MG  .    MG  ? ? 0 A   1684 0 MG  8080 1_555 ? ? ? ? ? ? ? 2.096 ? ? 
metalc187  metalc ? ? A  A   1688 OP1   ? ? ? 1_555 SA MG  .    MG  ? ? 0 A   1689 0 MG  8015 1_555 ? ? ? ? ? ? ? 2.154 ? ? 
metalc188  metalc ? ? A  G   1705 O6    ? ? ? 1_555 QF NA  .    NA  ? ? 0 G   1706 0 NA  8336 1_555 ? ? ? ? ? ? ? 2.397 ? ? 
metalc189  metalc ? ? A  G   1706 O6    ? ? ? 1_555 QF NA  .    NA  ? ? 0 G   1707 0 NA  8336 1_555 ? ? ? ? ? ? ? 2.519 ? ? 
metalc190  metalc ? ? A  U   1723 OP2   ? ? ? 1_555 AD MG  .    MG  ? ? 0 U   1724 0 MG  8080 1_555 ? ? ? ? ? ? ? 2.131 ? ? 
metalc191  metalc ? ? A  U   1723 O2    ? ? ? 1_555 RE NA  .    NA  ? ? 0 U   1724 0 NA  8308 1_555 ? ? ? ? ? ? ? 2.360 ? ? 
metalc192  metalc ? ? A  A   1735 OP1   ? ? ? 1_555 CF NA  .    NA  ? ? 0 A   1736 0 NA  8321 1_555 ? ? ? ? ? ? ? 2.972 ? ? 
metalc193  metalc ? ? A  U   1739 O4    ? ? ? 1_555 TF NA  .    NA  ? ? 0 U   1740 0 NA  8340 1_555 ? ? ? ? ? ? ? 2.746 ? ? 
metalc194  metalc ? ? A  U   1740 O4    ? ? ? 1_555 TF NA  .    NA  ? ? 0 U   1741 0 NA  8340 1_555 ? ? ? ? ? ? ? 2.967 ? ? 
metalc195  metalc ? ? A  A   1741 OP2   ? ? ? 1_555 ED MG  .    MG  ? ? 0 A   1742 0 MG  8084 1_555 ? ? ? ? ? ? ? 1.919 ? ? 
metalc196  metalc ? ? A  A   1746 OP2   ? ? ? 1_555 KB MG  .    MG  ? ? 0 A   1747 0 MG  8033 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
metalc197  metalc ? ? A  U   1747 OP1   ? ? ? 1_555 HB MG  .    MG  ? ? 0 U   1748 0 MG  8030 1_555 ? ? ? ? ? ? ? 2.224 ? ? 
metalc198  metalc ? ? A  U   1747 OP2   ? ? ? 1_555 KB MG  .    MG  ? ? 0 U   1748 0 MG  8033 1_555 ? ? ? ? ? ? ? 2.038 ? ? 
metalc199  metalc ? ? A  U   1748 OP2   ? ? ? 1_555 HB MG  .    MG  ? ? 0 U   1749 0 MG  8030 1_555 ? ? ? ? ? ? ? 1.958 ? ? 
metalc200  metalc ? ? A  U   1748 O4    ? ? ? 1_555 KB MG  .    MG  ? ? 0 U   1749 0 MG  8033 1_555 ? ? ? ? ? ? ? 2.162 ? ? 
metalc201  metalc ? ? A  A   1753 OP2   ? ? ? 1_555 DD MG  .    MG  ? ? 0 A   1754 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.205 ? ? 
metalc202  metalc ? ? A  G   1793 N7    ? ? ? 1_555 XB MG  .    MG  ? ? 0 G   1794 0 MG  8046 1_555 ? ? ? ? ? ? ? 2.620 ? ? 
metalc203  metalc ? ? A  C   1829 OP1   ? ? ? 1_555 XA MG  .    MG  ? ? 0 C   1830 0 MG  8020 1_555 ? ? ? ? ? ? ? 1.955 ? ? 
metalc204  metalc ? ? A  U   1830 "O2'" ? ? ? 1_555 HF NA  .    NA  ? ? 0 U   1831 0 NA  8327 1_555 ? ? ? ? ? ? ? 2.647 ? ? 
metalc205  metalc ? ? A  G   1831 OP2   ? ? ? 1_555 RG NA  .    NA  ? ? 0 G   1832 0 NA  8370 1_555 ? ? ? ? ? ? ? 2.688 ? ? 
metalc206  metalc ? ? A  A   1835 OP1   ? ? ? 1_555 IA MG  .    MG  ? ? 0 A   1836 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.029 ? ? 
metalc207  metalc ? ? A  U   1837 OP1   ? ? ? 1_555 IA MG  .    MG  ? ? 0 U   1838 0 MG  8005 1_555 ? ? ? ? ? ? ? 1.935 ? ? 
metalc208  metalc ? ? A  A   1838 OP2   ? ? ? 1_555 IA MG  .    MG  ? ? 0 A   1839 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.135 ? ? 
metalc209  metalc ? ? A  A   1838 OP1   ? ? ? 1_555 KA MG  .    MG  ? ? 0 A   1839 0 MG  8007 1_555 ? ? ? ? ? ? ? 2.021 ? ? 
metalc210  metalc ? ? A  A   1839 OP2   ? ? ? 1_555 KA MG  .    MG  ? ? 0 A   1840 0 MG  8007 1_555 ? ? ? ? ? ? ? 2.218 ? ? 
metalc211  metalc ? ? A  A   1839 "O2'" ? ? ? 1_555 IE MG  .    MG  ? ? 0 A   1840 0 MG  8117 1_555 ? ? ? ? ? ? ? 2.538 ? ? 
metalc212  metalc ? ? A  A   1839 "O3'" ? ? ? 1_555 IE MG  .    MG  ? ? 0 A   1840 0 MG  8117 1_555 ? ? ? ? ? ? ? 2.297 ? ? 
metalc213  metalc ? ? A  C   1840 OP2   ? ? ? 1_555 IE MG  .    MG  ? ? 0 C   1841 0 MG  8117 1_555 ? ? ? ? ? ? ? 2.992 ? ? 
metalc214  metalc ? ? A  C   1843 OP2   ? ? ? 1_555 MD MG  .    MG  ? ? 0 C   1844 0 MG  8092 1_555 ? ? ? ? ? ? ? 2.106 ? ? 
metalc215  metalc ? ? A  A   1844 OP1   ? ? ? 1_555 QC MG  .    MG  ? ? 0 A   1845 0 MG  8067 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc216  metalc ? ? A  U   1845 OP2   ? ? ? 1_555 QC MG  .    MG  ? ? 0 U   1846 0 MG  8067 1_555 ? ? ? ? ? ? ? 2.411 ? ? 
metalc217  metalc ? ? A  G   1847 O6    ? ? ? 1_555 PD MG  .    MG  ? ? 0 G   1848 0 MG  8096 1_555 ? ? ? ? ? ? ? 2.514 ? ? 
metalc218  metalc ? ? A  G   1848 O6    ? ? ? 1_555 PD MG  .    MG  ? ? 0 G   1849 0 MG  8096 1_555 ? ? ? ? ? ? ? 2.240 ? ? 
metalc219  metalc ? ? A  U   1849 O4    ? ? ? 1_555 HE MG  .    MG  ? ? 0 U   1850 0 MG  8116 1_555 ? ? ? ? ? ? ? 2.476 ? ? 
metalc220  metalc ? ? A  C   1871 "O3'" ? ? ? 1_555 PC MG  .    MG  ? ? 0 C   1872 0 MG  8066 1_555 ? ? ? ? ? ? ? 2.496 ? ? 
metalc221  metalc ? ? A  G   1872 OP2   ? ? ? 1_555 PC MG  .    MG  ? ? 0 G   1873 0 MG  8066 1_555 ? ? ? ? ? ? ? 1.815 ? ? 
metalc222  metalc ? ? A  U   1882 OP1   ? ? ? 1_555 HC MG  .    MG  ? ? 0 U   1883 0 MG  8057 1_555 ? ? ? ? ? ? ? 2.481 ? ? 
metalc223  metalc ? ? A  G   1883 O6    ? ? ? 1_555 QC MG  .    MG  ? ? 0 G   1884 0 MG  8067 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc224  metalc ? ? A  C   1893 O2    ? ? ? 1_555 NF NA  .    NA  ? ? 0 C   1894 0 NA  8333 1_555 ? ? ? ? ? ? ? 2.538 ? ? 
metalc225  metalc ? ? A  C   1893 O2    ? ? ? 1_555 OF NA  .    NA  ? ? 0 C   1894 0 NA  8334 1_555 ? ? ? ? ? ? ? 2.718 ? ? 
metalc226  metalc ? ? A  G   1895 N7    ? ? ? 1_555 OF NA  .    NA  ? ? 0 G   1896 0 NA  8334 1_555 ? ? ? ? ? ? ? 2.798 ? ? 
metalc227  metalc ? ? A  G   1895 O6    ? ? ? 1_555 OF NA  .    NA  ? ? 0 G   1896 0 NA  8334 1_555 ? ? ? ? ? ? ? 2.703 ? ? 
metalc228  metalc ? ? A  U   1896 O4    ? ? ? 1_555 NF NA  .    NA  ? ? 0 U   1897 0 NA  8333 1_555 ? ? ? ? ? ? ? 2.620 ? ? 
metalc229  metalc ? ? A  G   1897 O6    ? ? ? 1_555 NF NA  .    NA  ? ? 0 G   1898 0 NA  8333 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc230  metalc ? ? A  U   1938 O4    ? ? ? 1_555 NF NA  .    NA  ? ? 0 U   1939 0 NA  8333 1_555 ? ? ? ? ? ? ? 2.859 ? ? 
metalc231  metalc ? ? A  G   1978 OP2   ? ? ? 1_555 WB MG  .    MG  ? ? 0 G   1979 0 MG  8045 1_555 ? ? ? ? ? ? ? 1.983 ? ? 
metalc232  metalc ? ? A  A   2009 OP2   ? ? ? 1_555 GF NA  .    NA  ? ? 0 A   2010 0 NA  8326 1_555 ? ? ? ? ? ? ? 2.729 ? ? 
metalc233  metalc ? ? A  A   2010 OP1   ? ? ? 1_555 WA MG  .    MG  ? ? 0 A   2011 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.944 ? ? 
metalc234  metalc ? ? A  A   2010 OP2   ? ? ? 1_555 WA MG  .    MG  ? ? 0 A   2011 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.204 ? ? 
metalc235  metalc ? ? A  U   2011 "O2'" ? ? ? 1_555 HC MG  .    MG  ? ? 0 U   2012 0 MG  8057 1_555 ? ? ? ? ? ? ? 2.348 ? ? 
metalc236  metalc ? ? A  U   2011 "O3'" ? ? ? 1_555 HC MG  .    MG  ? ? 0 U   2012 0 MG  8057 1_555 ? ? ? ? ? ? ? 3.058 ? ? 
metalc237  metalc ? ? A  U   2011 O4    ? ? ? 1_555 GF NA  .    NA  ? ? 0 U   2012 0 NA  8326 1_555 ? ? ? ? ? ? ? 2.457 ? ? 
metalc238  metalc ? ? A  G   2012 OP2   ? ? ? 1_555 HC MG  .    MG  ? ? 0 G   2013 0 MG  8057 1_555 ? ? ? ? ? ? ? 3.101 ? ? 
metalc239  metalc ? ? A  G   2012 OP2   ? ? ? 1_555 IC MG  .    MG  ? ? 0 G   2013 0 MG  8058 1_555 ? ? ? ? ? ? ? 2.197 ? ? 
metalc240  metalc ? ? A  A   2021 N7    ? ? ? 1_555 IE MG  .    MG  ? ? 0 A   2022 0 MG  8117 1_555 ? ? ? ? ? ? ? 2.536 ? ? 
metalc241  metalc ? ? A  C   2047 OP1   ? ? ? 1_555 VB MG  .    MG  ? ? 0 C   2048 0 MG  8044 1_555 ? ? ? ? ? ? ? 2.418 ? ? 
metalc242  metalc ? ? A  U   2056 O4    ? ? ? 1_555 LG NA  .    NA  ? ? 0 U   2057 0 NA  8364 1_555 ? ? ? ? ? ? ? 2.780 ? ? 
metalc243  metalc ? ? A  G   2057 O6    ? ? ? 1_555 LG NA  .    NA  ? ? 0 G   2058 0 NA  8364 1_555 ? ? ? ? ? ? ? 2.777 ? ? 
metalc244  metalc ? ? A  G   2079 O6    ? ? ? 1_555 TD MG  .    MG  ? ? 0 G   2080 0 MG  8100 1_555 ? ? ? ? ? ? ? 3.128 ? ? 
metalc245  metalc ? ? A  A   2088 OP1   ? ? ? 1_555 VB MG  .    MG  ? ? 0 A   2089 0 MG  8044 1_555 ? ? ? ? ? ? ? 2.505 ? ? 
metalc246  metalc ? ? A  G   2093 N7    ? ? ? 1_555 PE NA  .    NA  ? ? 0 G   2094 0 NA  8306 1_555 ? ? ? ? ? ? ? 2.799 ? ? 
metalc247  metalc ? ? A  G   2096 OP2   ? ? ? 1_555 ZA MG  .    MG  ? ? 0 G   2097 0 MG  8022 1_555 ? ? ? ? ? ? ? 2.013 ? ? 
metalc248  metalc ? ? A  G   2101 OP2   ? ? ? 1_555 RA MG  .    MG  ? ? 0 G   2102 0 MG  8014 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc249  metalc ? ? A  G   2101 "O5'" ? ? ? 1_555 RA MG  .    MG  ? ? 0 G   2102 0 MG  8014 1_555 ? ? ? ? ? ? ? 3.015 ? ? 
metalc250  metalc ? ? A  G   2101 O6    ? ? ? 1_555 JE K   .    K   ? ? 0 G   2102 0 K   8201 1_555 ? ? ? ? ? ? ? 2.776 ? ? 
metalc251  metalc ? ? A  G   2101 N7    ? ? ? 1_555 JE K   .    K   ? ? 0 G   2102 0 K   8201 1_555 ? ? ? ? ? ? ? 3.350 ? ? 
metalc252  metalc ? ? A  A   2102 OP2   ? ? ? 1_555 KD MG  .    MG  ? ? 0 A   2103 0 MG  8090 1_555 ? ? ? ? ? ? ? 2.503 ? ? 
metalc253  metalc ? ? A  C   2103 OP1   ? ? ? 1_555 XD MG  .    MG  ? ? 0 C   2104 0 MG  8104 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc254  metalc ? ? A  C   2104 OP2   ? ? ? 1_555 XD MG  .    MG  ? ? 0 C   2105 0 MG  8104 1_555 ? ? ? ? ? ? ? 2.606 ? ? 
metalc255  metalc ? ? A  U   2108 OP2   ? ? ? 1_555 GG NA  .    NA  ? ? 0 U   2109 0 NA  8359 1_555 ? ? ? ? ? ? ? 2.655 ? ? 
metalc256  metalc ? ? A  G   2109 OP2   ? ? ? 1_555 JG NA  .    NA  ? ? 0 G   2110 0 NA  8362 1_555 ? ? ? ? ? ? ? 2.769 ? ? 
metalc257  metalc ? ? A  G   2110 OP1   ? ? ? 1_555 JG NA  .    NA  ? ? 0 G   2111 0 NA  8362 1_555 ? ? ? ? ? ? ? 2.933 ? ? 
metalc258  metalc ? ? A  A   2111 N7    ? ? ? 1_555 EE MG  .    MG  ? ? 0 A   2112 0 MG  8113 1_555 ? ? ? ? ? ? ? 2.497 ? ? 
metalc259  metalc ? ? A  A   2111 N3    ? ? ? 1_555 DF NA  .    NA  ? ? 0 A   2112 0 NA  8323 1_555 ? ? ? ? ? ? ? 2.730 ? ? 
metalc260  metalc ? ? A  U   2114 OP1   ? ? ? 1_555 JB MG  .    MG  ? ? 0 U   2115 0 MG  8032 1_555 ? ? ? ? ? ? ? 1.931 ? ? 
metalc261  metalc ? ? A  C   2247 OP2   ? ? ? 1_555 BC MG  .    MG  ? ? 0 C   2248 0 MG  8050 1_555 ? ? ? ? ? ? ? 2.344 ? ? 
metalc262  metalc ? ? A  U   2275 OP1   ? ? ? 1_555 FC MG  .    MG  ? ? 0 U   2276 0 MG  8054 1_555 ? ? ? ? ? ? ? 1.995 ? ? 
metalc263  metalc ? ? A  U   2276 O4    ? ? ? 1_555 OC MG  .    MG  ? ? 0 U   2277 0 MG  8064 1_555 ? ? ? ? ? ? ? 2.710 ? ? 
metalc264  metalc ? ? A  U   2277 O4    ? ? ? 1_555 OC MG  .    MG  ? ? 0 U   2278 0 MG  8064 1_555 ? ? ? ? ? ? ? 2.648 ? ? 
metalc265  metalc ? ? A  U   2277 OP1   ? ? ? 1_555 DG NA  .    NA  ? ? 0 U   2278 0 NA  8356 1_555 ? ? ? ? ? ? ? 2.771 ? ? 
metalc266  metalc ? ? A  C   2280 OP2   ? ? ? 1_555 UD MG  .    MG  ? ? 0 C   2281 0 MG  8101 1_555 ? ? ? ? ? ? ? 2.272 ? ? 
metalc267  metalc ? ? A  U   2281 O4    ? ? ? 1_555 UD MG  .    MG  ? ? 0 U   2282 0 MG  8101 1_555 ? ? ? ? ? ? ? 2.464 ? ? 
metalc268  metalc ? ? A  A   2301 OP1   ? ? ? 1_555 LB MG  .    MG  ? ? 0 A   2302 0 MG  8034 1_555 ? ? ? ? ? ? ? 1.991 ? ? 
metalc269  metalc ? ? A  A   2302 OP1   ? ? ? 1_555 LB MG  .    MG  ? ? 0 A   2303 0 MG  8034 1_555 ? ? ? ? ? ? ? 2.023 ? ? 
metalc270  metalc ? ? A  G   2303 OP2   ? ? ? 1_555 YA MG  .    MG  ? ? 0 G   2304 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.102 ? ? 
metalc271  metalc ? ? A  G   2398 O6    ? ? ? 1_555 UE NA  .    NA  ? ? 0 G   2399 0 NA  8313 1_555 ? ? ? ? ? ? ? 2.499 ? ? 
metalc272  metalc ? ? A  G   2420 OP1   ? ? ? 1_555 AC MG  .    MG  ? ? 0 G   2421 0 MG  8049 1_555 ? ? ? ? ? ? ? 2.270 ? ? 
metalc273  metalc ? ? A  U   2421 "O3'" ? ? ? 1_555 AC MG  .    MG  ? ? 0 U   2422 0 MG  8049 1_555 ? ? ? ? ? ? ? 3.028 ? ? 
metalc274  metalc ? ? A  C   2422 OP1   ? ? ? 1_555 AC MG  .    MG  ? ? 0 C   2423 0 MG  8049 1_555 ? ? ? ? ? ? ? 2.598 ? ? 
metalc275  metalc ? ? A  A   2429 N1    ? ? ? 1_555 FE MG  .    MG  ? ? 0 A   2430 0 MG  8114 1_555 ? ? ? ? ? ? ? 2.675 ? ? 
metalc276  metalc ? ? A  A   2433 N3    ? ? ? 1_555 VD MG  .    MG  ? ? 0 A   2434 0 MG  8102 1_555 ? ? ? ? ? ? ? 2.608 ? ? 
metalc277  metalc ? ? A  U   2457 O2    ? ? ? 1_555 VD MG  .    MG  ? ? 0 U   2458 0 MG  8102 1_555 ? ? ? ? ? ? ? 2.615 ? ? 
metalc278  metalc ? ? A  C   2463 OP1   ? ? ? 1_555 LA MG  .    MG  ? ? 0 C   2464 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.013 ? ? 
metalc279  metalc ? ? A  A   2464 OP1   ? ? ? 1_555 LA MG  .    MG  ? ? 0 A   2465 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.192 ? ? 
metalc280  metalc ? ? A  G   2465 OP2   ? ? ? 1_555 AF NA  .    NA  ? ? 0 G   2466 0 NA  8319 1_555 ? ? ? ? ? ? ? 2.499 ? ? 
metalc281  metalc ? ? A  G   2470 O6    ? ? ? 1_555 OC MG  .    MG  ? ? 0 G   2471 0 MG  8064 1_555 ? ? ? ? ? ? ? 2.722 ? ? 
metalc282  metalc ? ? A  C   2474 N4    ? ? ? 1_555 DF NA  .    NA  ? ? 0 C   2475 0 NA  8323 1_555 ? ? ? ? ? ? ? 2.800 ? ? 
metalc283  metalc ? ? A  G   2481 N7    ? ? ? 1_555 JE K   .    K   ? ? 0 G   2482 0 K   8201 1_555 ? ? ? ? ? ? ? 2.969 ? ? 
metalc284  metalc ? ? A  G   2481 O6    ? ? ? 1_555 JE K   .    K   ? ? 0 G   2482 0 K   8201 1_555 ? ? ? ? ? ? ? 2.932 ? ? 
metalc285  metalc ? ? A  A   2482 OP2   ? ? ? 1_555 EA MG  .    MG  ? ? 0 A   2483 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.081 ? ? 
metalc286  metalc ? ? A  A   2482 OP1   ? ? ? 1_555 FA MG  .    MG  ? ? 0 A   2483 0 MG  8002 1_555 ? ? ? ? ? ? ? 1.924 ? ? 
metalc287  metalc ? ? A  U   2491 O4    ? ? ? 1_555 SG NA  .    NA  ? ? 0 U   2492 0 NA  8371 1_555 ? ? ? ? ? ? ? 2.921 ? ? 
metalc288  metalc ? ? A  G   2523 N7    ? ? ? 1_555 TE NA  .    NA  ? ? 0 G   2524 0 NA  8311 1_555 ? ? ? ? ? ? ? 2.813 ? ? 
metalc289  metalc ? ? A  G   2524 O6    ? ? ? 1_555 TE NA  .    NA  ? ? 0 G   2525 0 NA  8311 1_555 ? ? ? ? ? ? ? 2.198 ? ? 
metalc290  metalc ? ? A  G   2528 O6    ? ? ? 1_555 SG NA  .    NA  ? ? 0 G   2529 0 NA  8371 1_555 ? ? ? ? ? ? ? 2.606 ? ? 
metalc291  metalc ? ? A  C   2532 OP2   ? ? ? 1_555 EA MG  .    MG  ? ? 0 C   2533 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.052 ? ? 
metalc292  metalc ? ? A  C   2533 OP2   ? ? ? 1_555 EA MG  .    MG  ? ? 0 C   2534 0 MG  8001 1_555 ? ? ? ? ? ? ? 1.912 ? ? 
metalc293  metalc ? ? A  C   2533 OP1   ? ? ? 1_555 FA MG  .    MG  ? ? 0 C   2534 0 MG  8002 1_555 ? ? ? ? ? ? ? 2.150 ? ? 
metalc294  metalc ? ? A  C   2535 "O4'" ? ? ? 1_555 JE K   .    K   ? ? 0 C   2536 0 K   8201 1_555 ? ? ? ? ? ? ? 3.265 ? ? 
metalc295  metalc ? ? A  C   2535 O2    ? ? ? 1_555 JE K   .    K   ? ? 0 C   2536 0 K   8201 1_555 ? ? ? ? ? ? ? 3.226 ? ? 
metalc296  metalc ? ? A  G   2536 OP2   ? ? ? 1_555 RA MG  .    MG  ? ? 0 G   2537 0 MG  8014 1_555 ? ? ? ? ? ? ? 1.908 ? ? 
metalc297  metalc ? ? A  A   2537 OP1   ? ? ? 1_555 XG NA  .    NA  ? ? 0 A   2538 0 NA  8376 1_555 ? ? ? ? ? ? ? 2.839 ? ? 
metalc298  metalc ? ? A  A   2537 "O5'" ? ? ? 1_555 XG NA  .    NA  ? ? 0 A   2538 0 NA  8376 1_555 ? ? ? ? ? ? ? 2.917 ? ? 
metalc299  metalc ? ? A  U   2538 OP2   ? ? ? 1_555 XG NA  .    NA  ? ? 0 U   2539 0 NA  8376 1_555 ? ? ? ? ? ? ? 2.919 ? ? 
metalc300  metalc ? ? A  G   2539 OP1   ? ? ? 1_555 ZA MG  .    MG  ? ? 0 G   2540 0 MG  8022 1_555 ? ? ? ? ? ? ? 2.087 ? ? 
metalc301  metalc ? ? A  G   2539 O6    ? ? ? 1_555 ID MG  .    MG  ? ? 0 G   2540 0 MG  8088 1_555 ? ? ? ? ? ? ? 2.686 ? ? 
metalc302  metalc ? ? A  G   2539 O6    ? ? ? 1_555 SF NA  .    NA  ? ? 0 G   2540 0 NA  8339 1_555 ? ? ? ? ? ? ? 2.617 ? ? 
metalc303  metalc ? ? A  G   2542 O6    ? ? ? 1_555 BF NA  .    NA  ? ? 0 G   2543 0 NA  8320 1_555 ? ? ? ? ? ? ? 2.870 ? ? 
metalc304  metalc ? ? A  A   2552 OP2   ? ? ? 1_555 OB MG  .    MG  ? ? 0 A   2553 0 MG  8037 1_555 ? ? ? ? ? ? ? 2.196 ? ? 
metalc305  metalc ? ? A  A   2567 OP2   ? ? ? 1_555 RC MG  .    MG  ? ? 0 A   2568 0 MG  8068 1_555 ? ? ? ? ? ? ? 2.153 ? ? 
metalc306  metalc ? ? A  G   2577 OP2   ? ? ? 1_555 WD MG  .    MG  ? ? 0 G   2578 0 MG  8103 1_555 ? ? ? ? ? ? ? 2.274 ? ? 
metalc307  metalc ? ? A  G   2578 OP2   ? ? ? 1_555 WD MG  .    MG  ? ? 0 G   2579 0 MG  8103 1_555 ? ? ? ? ? ? ? 2.886 ? ? 
metalc308  metalc ? ? A  G   2578 O6    ? ? ? 1_555 SE NA  .    NA  ? ? 0 G   2579 0 NA  8310 1_555 ? ? ? ? ? ? ? 2.677 ? ? 
metalc309  metalc ? ? A  G   2584 OP1   ? ? ? 1_555 KB MG  .    MG  ? ? 0 G   2585 0 MG  8033 1_555 ? ? ? ? ? ? ? 2.148 ? ? 
metalc310  metalc ? ? A  G   2584 O6    ? ? ? 1_555 BH NA  .    NA  ? ? 0 G   2585 0 NA  8381 1_555 ? ? ? ? ? ? ? 2.920 ? ? 
metalc311  metalc ? ? A  U   2585 O4    ? ? ? 1_555 BH NA  .    NA  ? ? 0 U   2586 0 NA  8381 1_555 ? ? ? ? ? ? ? 2.253 ? ? 
metalc312  metalc ? ? A  G   2591 O6    ? ? ? 1_555 BH NA  .    NA  ? ? 0 G   2592 0 NA  8381 1_555 ? ? ? ? ? ? ? 2.608 ? ? 
metalc313  metalc ? ? A  U   2606 "O2'" ? ? ? 1_555 VE NA  .    NA  ? ? 0 U   2607 0 NA  8314 1_555 ? ? ? ? ? ? ? 2.543 ? ? 
metalc314  metalc ? ? A  U   2606 O2    ? ? ? 1_555 VE NA  .    NA  ? ? 0 U   2607 0 NA  8314 1_555 ? ? ? ? ? ? ? 2.683 ? ? 
metalc315  metalc ? ? A  C   2607 OP1   ? ? ? 1_555 DB MG  .    MG  ? ? 0 C   2608 0 MG  8026 1_555 ? ? ? ? ? ? ? 2.003 ? ? 
metalc316  metalc ? ? A  G   2608 OP1   ? ? ? 1_555 DB MG  .    MG  ? ? 0 G   2609 0 MG  8026 1_555 ? ? ? ? ? ? ? 1.976 ? ? 
metalc317  metalc ? ? A  G   2608 N7    ? ? ? 1_555 CE MG  .    MG  ? ? 0 G   2609 0 MG  8111 1_555 ? ? ? ? ? ? ? 2.434 ? ? 
metalc318  metalc ? ? A  U   2609 OP2   ? ? ? 1_555 DB MG  .    MG  ? ? 0 U   2610 0 MG  8026 1_555 ? ? ? ? ? ? ? 1.924 ? ? 
metalc319  metalc ? ? A  G   2610 OP1   ? ? ? 1_555 MA MG  .    MG  ? ? 0 G   2611 0 MG  8009 1_555 ? ? ? ? ? ? ? 1.941 ? ? 
metalc320  metalc ? ? A  G   2610 "O2'" ? ? ? 1_555 ID MG  .    MG  ? ? 0 G   2611 0 MG  8088 1_555 ? ? ? ? ? ? ? 2.475 ? ? 
metalc321  metalc ? ? A  G   2610 OP1   ? ? ? 1_555 FG NA  .    NA  ? ? 0 G   2611 0 NA  8358 1_555 ? ? ? ? ? ? ? 2.826 ? ? 
metalc322  metalc ? ? A  A   2611 OP1   ? ? ? 1_555 MA MG  .    MG  ? ? 0 A   2612 0 MG  8009 1_555 ? ? ? ? ? ? ? 2.001 ? ? 
metalc323  metalc ? ? A  A   2611 "O2'" ? ? ? 1_555 SD MG  .    MG  ? ? 0 A   2612 0 MG  8099 1_555 ? ? ? ? ? ? ? 2.602 ? ? 
metalc324  metalc ? ? A  U   2614 OP1   ? ? ? 1_555 NA MG  .    MG  ? ? 0 U   2615 0 MG  8010 1_555 ? ? ? ? ? ? ? 2.056 ? ? 
metalc325  metalc ? ? A  U   2614 O4    ? ? ? 1_555 BF NA  .    NA  ? ? 0 U   2615 0 NA  8320 1_555 ? ? ? ? ? ? ? 2.940 ? ? 
metalc326  metalc ? ? A  G   2616 OP2   ? ? ? 1_555 AB MG  .    MG  ? ? 0 G   2617 0 MG  8023 1_555 ? ? ? ? ? ? ? 2.095 ? ? 
metalc327  metalc ? ? A  G   2616 "O3'" ? ? ? 1_555 FD MG  .    MG  ? ? 0 G   2617 0 MG  8085 1_555 ? ? ? ? ? ? ? 3.113 ? ? 
metalc328  metalc ? ? A  G   2617 OP2   ? ? ? 1_555 AB MG  .    MG  ? ? 0 G   2618 0 MG  8023 1_555 ? ? ? ? ? ? ? 1.965 ? ? 
metalc329  metalc ? ? A  G   2617 OP1   ? ? ? 1_555 JC MG  .    MG  ? ? 0 G   2618 0 MG  8059 1_555 ? ? ? ? ? ? ? 2.138 ? ? 
metalc330  metalc ? ? A  G   2617 OP1   ? ? ? 1_555 FD MG  .    MG  ? ? 0 G   2618 0 MG  8085 1_555 ? ? ? ? ? ? ? 2.485 ? ? 
metalc331  metalc ? ? A  G   2622 OP1   ? ? ? 1_555 QA MG  .    MG  ? ? 0 G   2623 0 MG  8013 1_555 ? ? ? ? ? ? ? 1.965 ? ? 
metalc332  metalc ? ? A  A   2623 OP1   ? ? ? 1_555 GA MG  .    MG  ? ? 0 A   2624 0 MG  8003 1_555 ? ? ? ? ? ? ? 2.014 ? ? 
metalc333  metalc ? ? A  U   2644 "O2'" ? ? ? 1_555 SF NA  .    NA  ? ? 0 U   2645 0 NA  8339 1_555 ? ? ? ? ? ? ? 2.928 ? ? 
metalc334  metalc ? ? A  U   2644 O2    ? ? ? 1_555 SF NA  .    NA  ? ? 0 U   2645 0 NA  8339 1_555 ? ? ? ? ? ? ? 2.924 ? ? 
metalc335  metalc ? ? A  A   2648 N1    ? ? ? 1_555 PE NA  .    NA  ? ? 0 A   2649 0 NA  8306 1_555 ? ? ? ? ? ? ? 2.860 ? ? 
metalc336  metalc ? ? A  U   2649 OP1   ? ? ? 1_555 LC MG  .    MG  ? ? 0 U   2650 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.065 ? ? 
metalc337  metalc ? ? A  U   2658 "O3'" ? ? ? 1_555 RF NA  .    NA  ? ? 0 U   2659 0 NA  8338 1_555 ? ? ? ? ? ? ? 2.434 ? ? 
metalc338  metalc ? ? A  G   2659 OP1   ? ? ? 1_555 RF NA  .    NA  ? ? 0 G   2660 0 NA  8338 1_555 ? ? ? ? ? ? ? 2.616 ? ? 
metalc339  metalc ? ? A  U   2662 O2    ? ? ? 1_555 WF NA  .    NA  ? ? 0 U   2663 0 NA  8344 1_555 ? ? ? ? ? ? ? 2.620 ? ? 
metalc340  metalc ? ? A  A   2745 OP2   ? ? ? 1_555 ZB MG  .    MG  ? ? 0 A   2746 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.274 ? ? 
metalc341  metalc ? ? A  G   2749 OP2   ? ? ? 1_555 ZB MG  .    MG  ? ? 0 G   2750 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc342  metalc ? ? A  A   2756 OP1   ? ? ? 1_555 GC MG  .    MG  ? ? 0 A   2757 0 MG  8056 1_555 ? ? ? ? ? ? ? 2.026 ? ? 
metalc343  metalc ? ? A  G   2771 O6    ? ? ? 1_555 CH NA  .    NA  ? ? 0 G   2772 0 NA  8382 1_555 ? ? ? ? ? ? ? 2.666 ? ? 
metalc344  metalc ? ? A  G   2772 O6    ? ? ? 1_555 CH NA  .    NA  ? ? 0 G   2773 0 NA  8382 1_555 ? ? ? ? ? ? ? 2.257 ? ? 
metalc345  metalc ? ? A  A   2810 "O3'" ? ? ? 1_555 WF NA  .    NA  ? ? 0 A   2811 0 NA  8344 1_555 ? ? ? ? ? ? ? 2.708 ? ? 
metalc346  metalc ? ? A  A   2810 "O2'" ? ? ? 1_555 WF NA  .    NA  ? ? 0 A   2811 0 NA  8344 1_555 ? ? ? ? ? ? ? 2.682 ? ? 
metalc347  metalc ? ? A  A   2815 "O2'" ? ? ? 1_555 WF NA  .    NA  ? ? 0 A   2816 0 NA  8344 1_555 ? ? ? ? ? ? ? 2.790 ? ? 
metalc348  metalc ? ? A  G   2816 OP2   ? ? ? 1_555 WF NA  .    NA  ? ? 0 G   2817 0 NA  8344 1_555 ? ? ? ? ? ? ? 2.872 ? ? 
metalc349  metalc ? ? CJ HOH .    O     ? ? ? 1_555 KG NA  .    NA  ? ? 0 HOH 3002 0 NA  8363 1_555 ? ? ? ? ? ? ? 2.800 ? ? 
metalc350  metalc ? ? CJ HOH .    O     ? ? ? 1_555 TE NA  .    NA  ? ? 0 HOH 3101 0 NA  8311 1_555 ? ? ? ? ? ? ? 2.372 ? ? 
metalc351  metalc ? ? CJ HOH .    O     ? ? ? 1_555 YD MG  .    MG  ? ? 0 HOH 3127 0 MG  8106 1_555 ? ? ? ? ? ? ? 2.389 ? ? 
metalc352  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ZC MG  .    MG  ? ? 0 HOH 3138 0 MG  8079 1_555 ? ? ? ? ? ? ? 2.221 ? ? 
metalc353  metalc ? ? CJ HOH .    O     ? ? ? 1_555 IA MG  .    MG  ? ? 0 HOH 3139 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.013 ? ? 
metalc354  metalc ? ? CJ HOH .    O     ? ? ? 1_555 VA MG  .    MG  ? ? 0 HOH 3140 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.181 ? ? 
metalc355  metalc ? ? CJ HOH .    O     ? ? ? 1_555 KD MG  .    MG  ? ? 0 HOH 3141 0 MG  8090 1_555 ? ? ? ? ? ? ? 2.393 ? ? 
metalc356  metalc ? ? CJ HOH .    O     ? ? ? 1_555 EA MG  .    MG  ? ? 0 HOH 3142 0 MG  8001 1_555 ? ? ? ? ? ? ? 2.208 ? ? 
metalc357  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ZC MG  .    MG  ? ? 0 HOH 3143 0 MG  8079 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc358  metalc ? ? CJ HOH .    O     ? ? ? 1_555 JA MG  .    MG  ? ? 0 HOH 3144 0 MG  8006 1_555 ? ? ? ? ? ? ? 2.105 ? ? 
metalc359  metalc ? ? CJ HOH .    O     ? ? ? 1_555 SA MG  .    MG  ? ? 0 HOH 3148 0 MG  8015 1_555 ? ? ? ? ? ? ? 2.017 ? ? 
metalc360  metalc ? ? CJ HOH .    O     ? ? ? 1_555 YC MG  .    MG  ? ? 0 HOH 3149 0 MG  8077 1_555 ? ? ? ? ? ? ? 2.149 ? ? 
metalc361  metalc ? ? CJ HOH .    O     ? ? ? 1_555 DC MG  .    MG  ? ? 0 HOH 3150 0 MG  8052 1_555 ? ? ? ? ? ? ? 2.066 ? ? 
metalc362  metalc ? ? CJ HOH .    O     ? ? ? 1_555 PB MG  .    MG  ? ? 0 HOH 3152 0 MG  8038 1_555 ? ? ? ? ? ? ? 1.973 ? ? 
metalc363  metalc ? ? CJ HOH .    O     ? ? ? 1_555 AB MG  .    MG  ? ? 0 HOH 3154 0 MG  8023 1_555 ? ? ? ? ? ? ? 2.229 ? ? 
metalc364  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ZC MG  .    MG  ? ? 0 HOH 3155 0 MG  8079 1_555 ? ? ? ? ? ? ? 2.116 ? ? 
metalc365  metalc ? ? CJ HOH .    O     ? ? ? 1_555 LA MG  .    MG  ? ? 0 HOH 3156 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.090 ? ? 
metalc366  metalc ? ? CJ HOH .    O     ? ? ? 1_555 MC MG  .    MG  ? ? 0 HOH 3159 0 MG  8062 1_555 ? ? ? ? ? ? ? 2.143 ? ? 
metalc367  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ED MG  .    MG  ? ? 0 HOH 3161 0 MG  8084 1_555 ? ? ? ? ? ? ? 1.887 ? ? 
metalc368  metalc ? ? CJ HOH .    O     ? ? ? 1_555 WC MG  .    MG  ? ? 0 HOH 3163 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.128 ? ? 
metalc369  metalc ? ? CJ HOH .    O     ? ? ? 1_555 YA MG  .    MG  ? ? 0 HOH 3164 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.028 ? ? 
metalc370  metalc ? ? CJ HOH .    O     ? ? ? 1_555 YA MG  .    MG  ? ? 0 HOH 3165 0 MG  8021 1_555 ? ? ? ? ? ? ? 2.146 ? ? 
metalc371  metalc ? ? CJ HOH .    O     ? ? ? 1_555 HB MG  .    MG  ? ? 0 HOH 3166 0 MG  8030 1_555 ? ? ? ? ? ? ? 2.139 ? ? 
metalc372  metalc ? ? CJ HOH .    O     ? ? ? 1_555 QA MG  .    MG  ? ? 0 HOH 3168 0 MG  8013 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc373  metalc ? ? CJ HOH .    O     ? ? ? 1_555 LB MG  .    MG  ? ? 0 HOH 3169 0 MG  8034 1_555 ? ? ? ? ? ? ? 2.111 ? ? 
metalc374  metalc ? ? CJ HOH .    O     ? ? ? 1_555 MD MG  .    MG  ? ? 0 HOH 3171 0 MG  8092 1_555 ? ? ? ? ? ? ? 2.138 ? ? 
metalc375  metalc ? ? CJ HOH .    O     ? ? ? 1_555 XG NA  .    NA  ? ? 0 HOH 3173 0 NA  8376 1_555 ? ? ? ? ? ? ? 2.722 ? ? 
metalc376  metalc ? ? CJ HOH .    O     ? ? ? 1_555 OB MG  .    MG  ? ? 0 HOH 3175 0 MG  8037 1_555 ? ? ? ? ? ? ? 2.115 ? ? 
metalc377  metalc ? ? CJ HOH .    O     ? ? ? 1_555 PB MG  .    MG  ? ? 0 HOH 3176 0 MG  8038 1_555 ? ? ? ? ? ? ? 1.987 ? ? 
metalc378  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ND MG  .    MG  ? ? 0 HOH 3177 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.305 ? ? 
metalc379  metalc ? ? CJ HOH .    O     ? ? ? 1_555 QA MG  .    MG  ? ? 0 HOH 3181 0 MG  8013 1_555 ? ? ? ? ? ? ? 1.964 ? ? 
metalc380  metalc ? ? CJ HOH .    O     ? ? ? 1_555 TB MG  .    MG  ? ? 0 HOH 3184 0 MG  8042 1_555 ? ? ? ? ? ? ? 2.463 ? ? 
metalc381  metalc ? ? CJ HOH .    O     ? ? ? 1_555 RA MG  .    MG  ? ? 0 HOH 3186 0 MG  8014 1_555 ? ? ? ? ? ? ? 2.156 ? ? 
metalc382  metalc ? ? CJ HOH .    O     ? ? ? 1_555 MD MG  .    MG  ? ? 0 HOH 3187 0 MG  8092 1_555 ? ? ? ? ? ? ? 2.442 ? ? 
metalc383  metalc ? ? CJ HOH .    O     ? ? ? 1_555 PD MG  .    MG  ? ? 0 HOH 3190 0 MG  8096 1_555 ? ? ? ? ? ? ? 2.366 ? ? 
metalc384  metalc ? ? CJ HOH .    O     ? ? ? 1_555 HE MG  .    MG  ? ? 0 HOH 3190 0 MG  8116 1_555 ? ? ? ? ? ? ? 2.446 ? ? 
metalc385  metalc ? ? CJ HOH .    O     ? ? ? 1_555 GA MG  .    MG  ? ? 0 HOH 3193 0 MG  8003 1_555 ? ? ? ? ? ? ? 2.236 ? ? 
metalc386  metalc ? ? CJ HOH .    O     ? ? ? 1_555 SD MG  .    MG  ? ? 0 HOH 3194 0 MG  8099 1_555 ? ? ? ? ? ? ? 2.278 ? ? 
metalc387  metalc ? ? CJ HOH .    O     ? ? ? 1_555 GC MG  .    MG  ? ? 0 HOH 3195 0 MG  8056 1_555 ? ? ? ? ? ? ? 2.009 ? ? 
metalc388  metalc ? ? CJ HOH .    O     ? ? ? 1_555 NB MG  .    MG  ? ? 0 HOH 3197 0 MG  8036 1_555 ? ? ? ? ? ? ? 2.132 ? ? 
metalc389  metalc ? ? CJ HOH .    O     ? ? ? 1_555 PB MG  .    MG  ? ? 0 HOH 3198 0 MG  8038 1_555 ? ? ? ? ? ? ? 2.095 ? ? 
metalc390  metalc ? ? CJ HOH .    O     ? ? ? 1_555 QD MG  .    MG  ? ? 0 HOH 3199 0 MG  8097 1_555 ? ? ? ? ? ? ? 1.990 ? ? 
metalc391  metalc ? ? CJ HOH .    O     ? ? ? 1_555 PB MG  .    MG  ? ? 0 HOH 3200 0 MG  8038 1_555 ? ? ? ? ? ? ? 2.079 ? ? 
metalc392  metalc ? ? CJ HOH .    O     ? ? ? 1_555 HD MG  .    MG  ? ? 0 HOH 3204 0 MG  8087 1_555 ? ? ? ? ? ? ? 2.394 ? ? 
metalc393  metalc ? ? CJ HOH .    O     ? ? ? 1_555 FB MG  .    MG  ? ? 0 HOH 3205 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.061 ? ? 
metalc394  metalc ? ? CJ HOH .    O     ? ? ? 1_555 SD MG  .    MG  ? ? 0 HOH 3206 0 MG  8099 1_555 ? ? ? ? ? ? ? 2.142 ? ? 
metalc395  metalc ? ? CJ HOH .    O     ? ? ? 1_555 UG NA  .    NA  ? ? 0 HOH 3207 0 NA  8373 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc396  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ND MG  .    MG  ? ? 0 HOH 3209 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.274 ? ? 
metalc397  metalc ? ? CJ HOH .    O     ? ? ? 1_555 RD MG  .    MG  ? ? 0 HOH 3211 0 MG  8098 1_555 ? ? ? ? ? ? ? 2.494 ? ? 
metalc398  metalc ? ? CJ HOH .    O     ? ? ? 1_555 BH NA  .    NA  ? ? 0 HOH 3218 0 NA  8381 1_555 ? ? ? ? ? ? ? 2.358 ? ? 
metalc399  metalc ? ? CJ HOH .    O     ? ? ? 1_555 CE MG  .    MG  ? ? 0 HOH 3224 0 MG  8111 1_555 ? ? ? ? ? ? ? 2.415 ? ? 
metalc400  metalc ? ? CJ HOH .    O     ? ? ? 1_555 FB MG  .    MG  ? ? 0 HOH 3226 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.223 ? ? 
metalc401  metalc ? ? CJ HOH .    O     ? ? ? 1_555 PD MG  .    MG  ? ? 0 HOH 3227 0 MG  8096 1_555 ? ? ? ? ? ? ? 2.301 ? ? 
metalc402  metalc ? ? CJ HOH .    O     ? ? ? 1_555 DD MG  .    MG  ? ? 0 HOH 3234 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.132 ? ? 
metalc403  metalc ? ? CJ HOH .    O     ? ? ? 1_555 FB MG  .    MG  ? ? 0 HOH 3238 0 MG  8028 1_555 ? ? ? ? ? ? ? 2.122 ? ? 
metalc404  metalc ? ? CJ HOH .    O     ? ? ? 1_555 AH NA  .    NA  ? ? 0 HOH 3241 0 NA  8379 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc405  metalc ? ? CJ HOH .    O     ? ? ? 1_555 MB MG  .    MG  ? ? 0 HOH 3243 0 MG  8035 1_555 ? ? ? ? ? ? ? 2.242 ? ? 
metalc406  metalc ? ? CJ HOH .    O     ? ? ? 1_555 CE MG  .    MG  ? ? 0 HOH 3248 0 MG  8111 1_555 ? ? ? ? ? ? ? 2.250 ? ? 
metalc407  metalc ? ? CJ HOH .    O     ? ? ? 1_555 JC MG  .    MG  ? ? 0 HOH 3249 0 MG  8059 1_555 ? ? ? ? ? ? ? 2.127 ? ? 
metalc408  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ND MG  .    MG  ? ? 0 HOH 3250 0 MG  8093 1_555 ? ? ? ? ? ? ? 2.292 ? ? 
metalc409  metalc ? ? CJ HOH .    O     ? ? ? 1_555 DE MG  .    MG  ? ? 0 HOH 3254 0 MG  8112 1_555 ? ? ? ? ? ? ? 2.191 ? ? 
metalc410  metalc ? ? CJ HOH .    O     ? ? ? 1_555 GD MG  .    MG  ? ? 0 HOH 3260 0 MG  8086 1_555 ? ? ? ? ? ? ? 2.452 ? ? 
metalc411  metalc ? ? CJ HOH .    O     ? ? ? 1_555 MA MG  .    MG  ? ? 0 HOH 3267 0 MG  8009 1_555 ? ? ? ? ? ? ? 1.974 ? ? 
metalc412  metalc ? ? CJ HOH .    O     ? ? ? 1_555 TA MG  .    MG  ? ? 0 HOH 3273 0 MG  8016 1_555 ? ? ? ? ? ? ? 2.154 ? ? 
metalc413  metalc ? ? CJ HOH .    O     ? ? ? 1_555 RD MG  .    MG  ? ? 0 HOH 3275 0 MG  8098 1_555 ? ? ? ? ? ? ? 2.266 ? ? 
metalc414  metalc ? ? CJ HOH .    O     ? ? ? 1_555 OI NA  .    NA  ? ? 0 HOH 3276 Q NA  8337 1_555 ? ? ? ? ? ? ? 2.517 ? ? 
metalc415  metalc ? ? CJ HOH .    O     ? ? ? 1_555 RC MG  .    MG  ? ? 0 HOH 3279 0 MG  8068 1_555 ? ? ? ? ? ? ? 2.307 ? ? 
metalc416  metalc ? ? CJ HOH .    O     ? ? ? 1_555 EE MG  .    MG  ? ? 0 HOH 3280 0 MG  8113 1_555 ? ? ? ? ? ? ? 2.450 ? ? 
metalc417  metalc ? ? CJ HOH .    O     ? ? ? 1_555 JA MG  .    MG  ? ? 0 HOH 3281 0 MG  8006 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc418  metalc ? ? CJ HOH .    O     ? ? ? 1_555 WH MG  .    MG  ? ? 0 HOH 3285 B MG  8055 1_555 ? ? ? ? ? ? ? 2.021 ? ? 
metalc419  metalc ? ? CJ HOH .    O     ? ? ? 1_555 IC MG  .    MG  ? ? 0 HOH 3291 0 MG  8058 1_555 ? ? ? ? ? ? ? 2.113 ? ? 
metalc420  metalc ? ? CJ HOH .    O     ? ? ? 1_555 DE MG  .    MG  ? ? 0 HOH 3295 0 MG  8112 1_555 ? ? ? ? ? ? ? 2.196 ? ? 
metalc421  metalc ? ? CJ HOH .    O     ? ? ? 1_555 LB MG  .    MG  ? ? 0 HOH 3297 0 MG  8034 1_555 ? ? ? ? ? ? ? 2.259 ? ? 
metalc422  metalc ? ? CJ HOH .    O     ? ? ? 1_555 HA MG  .    MG  ? ? 0 HOH 3309 0 MG  8004 1_555 ? ? ? ? ? ? ? 1.911 ? ? 
metalc423  metalc ? ? CJ HOH .    O     ? ? ? 1_555 FD MG  .    MG  ? ? 0 HOH 3314 0 MG  8085 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc424  metalc ? ? CJ HOH .    O     ? ? ? 1_555 JB MG  .    MG  ? ? 0 HOH 3315 0 MG  8032 1_555 ? ? ? ? ? ? ? 2.208 ? ? 
metalc425  metalc ? ? CJ HOH .    O     ? ? ? 1_555 RB MG  .    MG  ? ? 0 HOH 3316 0 MG  8040 1_555 ? ? ? ? ? ? ? 2.335 ? ? 
metalc426  metalc ? ? CJ HOH .    O     ? ? ? 1_555 WH MG  .    MG  ? ? 0 HOH 3321 B MG  8055 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc427  metalc ? ? CJ HOH .    O     ? ? ? 1_555 KB MG  .    MG  ? ? 0 HOH 3342 0 MG  8033 1_555 ? ? ? ? ? ? ? 2.187 ? ? 
metalc428  metalc ? ? CJ HOH .    O     ? ? ? 1_555 AB MG  .    MG  ? ? 0 HOH 3346 0 MG  8023 1_555 ? ? ? ? ? ? ? 2.251 ? ? 
metalc429  metalc ? ? CJ HOH .    O     ? ? ? 1_555 NG NA  .    NA  ? ? 0 HOH 3347 0 NA  8366 1_555 ? ? ? ? ? ? ? 2.735 ? ? 
metalc430  metalc ? ? CJ HOH .    O     ? ? ? 1_555 PD MG  .    MG  ? ? 0 HOH 3360 0 MG  8096 1_555 ? ? ? ? ? ? ? 2.343 ? ? 
metalc431  metalc ? ? CJ HOH .    O     ? ? ? 1_555 UE NA  .    NA  ? ? 0 HOH 3361 0 NA  8313 1_555 ? ? ? ? ? ? ? 2.237 ? ? 
metalc432  metalc ? ? CJ HOH .    O     ? ? ? 1_555 NA MG  .    MG  ? ? 0 HOH 3365 0 MG  8010 1_555 ? ? ? ? ? ? ? 1.969 ? ? 
metalc433  metalc ? ? CJ HOH .    O     ? ? ? 1_555 HE MG  .    MG  ? ? 0 HOH 3391 0 MG  8116 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc434  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ZA MG  .    MG  ? ? 0 HOH 3396 0 MG  8022 1_555 ? ? ? ? ? ? ? 2.178 ? ? 
metalc435  metalc ? ? CJ HOH .    O     ? ? ? 1_555 EB MG  .    MG  ? ? 0 HOH 3399 0 MG  8027 1_555 ? ? ? ? ? ? ? 2.303 ? ? 
metalc436  metalc ? ? CJ HOH .    O     ? ? ? 1_555 PG NA  .    NA  ? ? 0 HOH 3411 0 NA  8368 1_555 ? ? ? ? ? ? ? 2.767 ? ? 
metalc437  metalc ? ? CJ HOH .    O     ? ? ? 1_555 WC MG  .    MG  ? ? 0 HOH 3443 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc438  metalc ? ? CJ HOH .    O     ? ? ? 1_555 EE MG  .    MG  ? ? 0 HOH 3451 0 MG  8113 1_555 ? ? ? ? ? ? ? 2.403 ? ? 
metalc439  metalc ? ? CJ HOH .    O     ? ? ? 1_555 BE MG  .    MG  ? ? 0 HOH 3453 0 MG  8110 1_555 ? ? ? ? ? ? ? 2.237 ? ? 
metalc440  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ZE NA  .    NA  ? ? 0 HOH 3457 0 NA  8318 1_555 ? ? ? ? ? ? ? 2.262 ? ? 
metalc441  metalc ? ? CJ HOH .    O     ? ? ? 1_555 UA MG  .    MG  ? ? 0 HOH 3471 0 MG  8017 1_555 ? ? ? ? ? ? ? 1.924 ? ? 
metalc442  metalc ? ? CJ HOH .    O     ? ? ? 1_555 MC MG  .    MG  ? ? 0 HOH 3485 0 MG  8062 1_555 ? ? ? ? ? ? ? 2.257 ? ? 
metalc443  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ZI MG  .    MG  ? ? 0 HOH 3486 2 MG  8078 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc444  metalc ? ? CJ HOH .    O     ? ? ? 1_555 OA MG  .    MG  ? ? 0 HOH 3487 0 MG  8011 1_555 ? ? ? ? ? ? ? 1.907 ? ? 
metalc445  metalc ? ? CJ HOH .    O     ? ? ? 1_555 QB MG  .    MG  ? ? 0 HOH 3493 0 MG  8039 1_555 ? ? ? ? ? ? ? 2.173 ? ? 
metalc446  metalc ? ? CJ HOH .    O     ? ? ? 1_555 SH MG  .    MG  ? ? 0 HOH 3497 A MG  8065 1_555 ? ? ? ? ? ? ? 1.975 ? ? 
metalc447  metalc ? ? CJ HOH .    O     ? ? ? 1_555 GC MG  .    MG  ? ? 0 HOH 3502 0 MG  8056 1_555 ? ? ? ? ? ? ? 2.223 ? ? 
metalc448  metalc ? ? CJ HOH .    O     ? ? ? 1_555 GD MG  .    MG  ? ? 0 HOH 3503 0 MG  8086 1_555 ? ? ? ? ? ? ? 2.287 ? ? 
metalc449  metalc ? ? CJ HOH .    O     ? ? ? 1_555 UC MG  .    MG  ? ? 0 HOH 3524 0 MG  8072 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc450  metalc ? ? CJ HOH .    O     ? ? ? 1_555 EB MG  .    MG  ? ? 0 HOH 3542 0 MG  8027 1_555 ? ? ? ? ? ? ? 2.090 ? ? 
metalc451  metalc ? ? CJ HOH .    O     ? ? ? 1_555 JC MG  .    MG  ? ? 0 HOH 3578 0 MG  8059 1_555 ? ? ? ? ? ? ? 2.209 ? ? 
metalc452  metalc ? ? CJ HOH .    O     ? ? ? 1_555 OE NA  .    NA  ? ? 0 HOH 3616 0 NA  8305 1_555 ? ? ? ? ? ? ? 2.733 ? ? 
metalc453  metalc ? ? CJ HOH .    O     ? ? ? 1_555 BD MG  .    MG  ? ? 0 HOH 3625 0 MG  8081 1_555 ? ? ? ? ? ? ? 2.002 ? ? 
metalc454  metalc ? ? CJ HOH .    O     ? ? ? 1_555 RG NA  .    NA  ? ? 0 HOH 3629 0 NA  8370 1_555 ? ? ? ? ? ? ? 2.485 ? ? 
metalc455  metalc ? ? CJ HOH .    O     ? ? ? 1_555 CC MG  .    MG  ? ? 0 HOH 3630 0 MG  8051 1_555 ? ? ? ? ? ? ? 2.449 ? ? 
metalc456  metalc ? ? CJ HOH .    O     ? ? ? 1_555 SB MG  .    MG  ? ? 0 HOH 3635 0 MG  8041 1_555 ? ? ? ? ? ? ? 2.248 ? ? 
metalc457  metalc ? ? CJ HOH .    O     ? ? ? 1_555 TC MG  .    MG  ? ? 0 HOH 3639 0 MG  8071 1_555 ? ? ? ? ? ? ? 2.039 ? ? 
metalc458  metalc ? ? CJ HOH .    O     ? ? ? 1_555 EF NA  .    NA  ? ? 0 HOH 3656 0 NA  8324 1_555 ? ? ? ? ? ? ? 2.809 ? ? 
metalc459  metalc ? ? CJ HOH .    O     ? ? ? 1_555 WA MG  .    MG  ? ? 0 HOH 3678 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.184 ? ? 
metalc460  metalc ? ? CJ HOH .    O     ? ? ? 1_555 DD MG  .    MG  ? ? 0 HOH 3679 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.110 ? ? 
metalc461  metalc ? ? CJ HOH .    O     ? ? ? 1_555 EB MG  .    MG  ? ? 0 HOH 3683 0 MG  8027 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc462  metalc ? ? CJ HOH .    O     ? ? ? 1_555 RA MG  .    MG  ? ? 0 HOH 3691 0 MG  8014 1_555 ? ? ? ? ? ? ? 2.142 ? ? 
metalc463  metalc ? ? CJ HOH .    O     ? ? ? 1_555 CB MG  .    MG  ? ? 0 HOH 3696 0 MG  8025 1_555 ? ? ? ? ? ? ? 2.344 ? ? 
metalc464  metalc ? ? CJ HOH .    O     ? ? ? 1_555 NC MG  .    MG  ? ? 0 HOH 3708 0 MG  8063 1_555 ? ? ? ? ? ? ? 2.057 ? ? 
metalc465  metalc ? ? CJ HOH .    O     ? ? ? 1_555 JB MG  .    MG  ? ? 0 HOH 3717 0 MG  8032 1_555 ? ? ? ? ? ? ? 2.153 ? ? 
metalc466  metalc ? ? CJ HOH .    O     ? ? ? 1_555 SB MG  .    MG  ? ? 0 HOH 3728 0 MG  8041 1_555 ? ? ? ? ? ? ? 2.298 ? ? 
metalc467  metalc ? ? CJ HOH .    O     ? ? ? 1_555 FI MG  .    MG  ? ? 0 HOH 3768 J MG  8069 1_555 ? ? ? ? ? ? ? 2.376 ? ? 
metalc468  metalc ? ? CJ HOH .    O     ? ? ? 1_555 TD MG  .    MG  ? ? 0 HOH 3778 0 MG  8100 1_555 ? ? ? ? ? ? ? 2.175 ? ? 
metalc469  metalc ? ? CJ HOH .    O     ? ? ? 1_555 AF NA  .    NA  ? ? 0 HOH 3788 0 NA  8319 1_555 ? ? ? ? ? ? ? 2.480 ? ? 
metalc470  metalc ? ? CJ HOH .    O     ? ? ? 1_555 GE MG  .    MG  ? ? 0 HOH 3814 0 MG  8115 1_555 ? ? ? ? ? ? ? 1.861 ? ? 
metalc471  metalc ? ? CJ HOH .    O     ? ? ? 1_555 OA MG  .    MG  ? ? 0 HOH 3819 0 MG  8011 1_555 ? ? ? ? ? ? ? 1.995 ? ? 
metalc472  metalc ? ? CJ HOH .    O     ? ? ? 1_555 SF NA  .    NA  ? ? 0 HOH 3822 0 NA  8339 1_555 ? ? ? ? ? ? ? 2.955 ? ? 
metalc473  metalc ? ? CJ HOH .    O     ? ? ? 1_555 FA MG  .    MG  ? ? 0 HOH 3854 0 MG  8002 1_555 ? ? ? ? ? ? ? 1.937 ? ? 
metalc474  metalc ? ? CJ HOH .    O     ? ? ? 1_555 OA MG  .    MG  ? ? 0 HOH 3956 0 MG  8011 1_555 ? ? ? ? ? ? ? 1.971 ? ? 
metalc475  metalc ? ? CJ HOH .    O     ? ? ? 1_555 AH NA  .    NA  ? ? 0 HOH 3960 0 NA  8379 1_555 ? ? ? ? ? ? ? 2.664 ? ? 
metalc476  metalc ? ? CJ HOH .    O     ? ? ? 1_555 DF NA  .    NA  ? ? 0 HOH 4012 0 NA  8323 1_555 ? ? ? ? ? ? ? 2.184 ? ? 
metalc477  metalc ? ? CJ HOH .    O     ? ? ? 1_555 AD MG  .    MG  ? ? 0 HOH 4025 0 MG  8080 1_555 ? ? ? ? ? ? ? 2.430 ? ? 
metalc478  metalc ? ? CJ HOH .    O     ? ? ? 1_555 SE NA  .    NA  ? ? 0 HOH 4037 0 NA  8310 1_555 ? ? ? ? ? ? ? 2.887 ? ? 
metalc479  metalc ? ? CJ HOH .    O     ? ? ? 1_555 OA MG  .    MG  ? ? 0 HOH 4061 0 MG  8011 1_555 ? ? ? ? ? ? ? 2.154 ? ? 
metalc480  metalc ? ? CJ HOH .    O     ? ? ? 1_555 OG NA  .    NA  ? ? 0 HOH 4135 0 NA  8367 1_555 ? ? ? ? ? ? ? 2.913 ? ? 
metalc481  metalc ? ? CJ HOH .    O     ? ? ? 1_555 TE NA  .    NA  ? ? 0 HOH 4188 0 NA  8311 1_555 ? ? ? ? ? ? ? 2.546 ? ? 
metalc482  metalc ? ? CJ HOH .    O     ? ? ? 1_555 OE NA  .    NA  ? ? 0 HOH 4235 0 NA  8305 1_555 ? ? ? ? ? ? ? 2.542 ? ? 
metalc483  metalc ? ? CJ HOH .    O     ? ? ? 1_555 CG NA  .    NA  ? ? 0 HOH 4346 0 NA  8355 1_555 ? ? ? ? ? ? ? 2.179 ? ? 
metalc484  metalc ? ? CJ HOH .    O     ? ? ? 1_555 BG NA  .    NA  ? ? 0 HOH 4354 0 NA  8354 1_555 ? ? ? ? ? ? ? 2.359 ? ? 
metalc485  metalc ? ? CJ HOH .    O     ? ? ? 1_555 RC MG  .    MG  ? ? 0 HOH 4357 0 MG  8068 1_555 ? ? ? ? ? ? ? 2.046 ? ? 
metalc486  metalc ? ? CJ HOH .    O     ? ? ? 1_555 XG NA  .    NA  ? ? 0 HOH 4393 0 NA  8376 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc487  metalc ? ? CJ HOH .    O     ? ? ? 1_555 LB MG  .    MG  ? ? 0 HOH 4404 0 MG  8034 1_555 ? ? ? ? ? ? ? 2.024 ? ? 
metalc488  metalc ? ? CJ HOH .    O     ? ? ? 1_555 AG NA  .    NA  ? ? 0 HOH 4412 0 NA  8353 1_555 ? ? ? ? ? ? ? 2.519 ? ? 
metalc489  metalc ? ? CJ HOH .    O     ? ? ? 1_555 IG NA  .    NA  ? ? 0 HOH 4440 0 NA  8361 1_555 ? ? ? ? ? ? ? 2.581 ? ? 
metalc490  metalc ? ? CJ HOH .    O     ? ? ? 1_555 WC MG  .    MG  ? ? 0 HOH 4472 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.385 ? ? 
metalc491  metalc ? ? CJ HOH .    O     ? ? ? 1_555 LE NA  .    NA  ? ? 0 HOH 4505 0 NA  8301 1_555 ? ? ? ? ? ? ? 2.453 ? ? 
metalc492  metalc ? ? CJ HOH .    O     ? ? ? 1_555 DH NA  .    NA  ? ? 0 HOH 4553 0 NA  8384 1_555 ? ? ? ? ? ? ? 2.722 ? ? 
metalc493  metalc ? ? CJ HOH .    O     ? ? ? 1_555 QB MG  .    MG  ? ? 0 HOH 4637 0 MG  8039 1_555 ? ? ? ? ? ? ? 2.440 ? ? 
metalc494  metalc ? ? CJ HOH .    O     ? ? ? 1_555 UE NA  .    NA  ? ? 0 HOH 4655 0 NA  8313 1_555 ? ? ? ? ? ? ? 2.260 ? ? 
metalc495  metalc ? ? CJ HOH .    O     ? ? ? 1_555 IF NA  .    NA  ? ? 0 HOH 4752 0 NA  8328 1_555 ? ? ? ? ? ? ? 2.654 ? ? 
metalc496  metalc ? ? CJ HOH .    O     ? ? ? 1_555 CD MG  .    MG  ? ? 0 HOH 4780 0 MG  8082 1_555 ? ? ? ? ? ? ? 2.491 ? ? 
metalc497  metalc ? ? CJ HOH .    O     ? ? ? 1_555 OF NA  .    NA  ? ? 0 HOH 4786 0 NA  8334 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc498  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ZF NA  .    NA  ? ? 0 HOH 4794 0 NA  8352 1_555 ? ? ? ? ? ? ? 2.939 ? ? 
metalc499  metalc ? ? CJ HOH .    O     ? ? ? 1_555 QF NA  .    NA  ? ? 0 HOH 4876 0 NA  8336 1_555 ? ? ? ? ? ? ? 2.245 ? ? 
metalc500  metalc ? ? CJ HOH .    O     ? ? ? 1_555 BE MG  .    MG  ? ? 0 HOH 4939 0 MG  8110 1_555 ? ? ? ? ? ? ? 2.141 ? ? 
metalc501  metalc ? ? CJ HOH .    O     ? ? ? 1_555 TD MG  .    MG  ? ? 0 HOH 5047 0 MG  8100 1_555 ? ? ? ? ? ? ? 2.126 ? ? 
metalc502  metalc ? ? CJ HOH .    O     ? ? ? 1_555 QD MG  .    MG  ? ? 0 HOH 5094 0 MG  8097 1_555 ? ? ? ? ? ? ? 2.406 ? ? 
metalc503  metalc ? ? CJ HOH .    O     ? ? ? 1_555 CE MG  .    MG  ? ? 0 HOH 5142 0 MG  8111 1_555 ? ? ? ? ? ? ? 2.262 ? ? 
metalc504  metalc ? ? CJ HOH .    O     ? ? ? 1_555 EC MG  .    MG  ? ? 0 HOH 5156 0 MG  8053 1_555 ? ? ? ? ? ? ? 2.228 ? ? 
metalc505  metalc ? ? CJ HOH .    O     ? ? ? 1_555 VF NA  .    NA  ? ? 0 HOH 5167 0 NA  8342 1_555 ? ? ? ? ? ? ? 2.696 ? ? 
metalc506  metalc ? ? CJ HOH .    O     ? ? ? 1_555 CE MG  .    MG  ? ? 0 HOH 5289 0 MG  8111 1_555 ? ? ? ? ? ? ? 2.345 ? ? 
metalc507  metalc ? ? CJ HOH .    O     ? ? ? 1_555 BI NA  .    NA  ? ? 0 HOH 5298 I NA  8346 1_555 ? ? ? ? ? ? ? 2.742 ? ? 
metalc508  metalc ? ? CJ HOH .    O     ? ? ? 1_555 OE NA  .    NA  ? ? 0 HOH 5327 0 NA  8305 1_555 ? ? ? ? ? ? ? 2.460 ? ? 
metalc509  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ZB MG  .    MG  ? ? 0 HOH 5419 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.265 ? ? 
metalc510  metalc ? ? CJ HOH .    O     ? ? ? 1_555 OI NA  .    NA  ? ? 0 HOH 5461 Q NA  8337 1_555 ? ? ? ? ? ? ? 2.536 ? ? 
metalc511  metalc ? ? CJ HOH .    O     ? ? ? 1_555 HG NA  .    NA  ? ? 0 HOH 5499 0 NA  8360 1_555 ? ? ? ? ? ? ? 2.849 ? ? 
metalc512  metalc ? ? CJ HOH .    O     ? ? ? 1_555 BE MG  .    MG  ? ? 0 HOH 5576 0 MG  8110 1_555 ? ? ? ? ? ? ? 2.272 ? ? 
metalc513  metalc ? ? CJ HOH .    O     ? ? ? 1_555 FI MG  .    MG  ? ? 0 HOH 5589 J MG  8069 1_555 ? ? ? ? ? ? ? 2.464 ? ? 
metalc514  metalc ? ? CJ HOH .    O     ? ? ? 1_555 AF NA  .    NA  ? ? 0 HOH 5591 0 NA  8319 1_555 ? ? ? ? ? ? ? 2.392 ? ? 
metalc515  metalc ? ? CJ HOH .    O     ? ? ? 1_555 TC MG  .    MG  ? ? 0 HOH 5598 0 MG  8071 1_555 ? ? ? ? ? ? ? 2.167 ? ? 
metalc516  metalc ? ? CJ HOH .    O     ? ? ? 1_555 EE MG  .    MG  ? ? 0 HOH 5676 0 MG  8113 1_555 ? ? ? ? ? ? ? 2.208 ? ? 
metalc517  metalc ? ? CJ HOH .    O     ? ? ? 1_555 RC MG  .    MG  ? ? 0 HOH 5768 0 MG  8068 1_555 ? ? ? ? ? ? ? 2.413 ? ? 
metalc518  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ZB MG  .    MG  ? ? 0 HOH 5807 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.230 ? ? 
metalc519  metalc ? ? CJ HOH .    O     ? ? ? 1_555 VF NA  .    NA  ? ? 0 HOH 5813 0 NA  8342 1_555 ? ? ? ? ? ? ? 2.839 ? ? 
metalc520  metalc ? ? CJ HOH .    O     ? ? ? 1_555 YB MG  .    MG  ? ? 0 HOH 5816 0 MG  8047 1_555 ? ? ? ? ? ? ? 2.240 ? ? 
metalc521  metalc ? ? CJ HOH .    O     ? ? ? 1_555 EG NA  .    NA  ? ? 0 HOH 5820 0 NA  8357 1_555 ? ? ? ? ? ? ? 2.408 ? ? 
metalc522  metalc ? ? CJ HOH .    O     ? ? ? 1_555 XE NA  .    NA  ? ? 0 HOH 5860 0 NA  8316 1_555 ? ? ? ? ? ? ? 2.128 ? ? 
metalc523  metalc ? ? CJ HOH .    O     ? ? ? 1_555 YG NA  .    NA  ? ? 0 HOH 5888 0 NA  8377 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc524  metalc ? ? CJ HOH .    O     ? ? ? 1_555 DD MG  .    MG  ? ? 0 HOH 5901 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.015 ? ? 
metalc525  metalc ? ? CJ HOH .    O     ? ? ? 1_555 WH MG  .    MG  ? ? 0 HOH 5963 B MG  8055 1_555 ? ? ? ? ? ? ? 2.411 ? ? 
metalc526  metalc ? ? CJ HOH .    O     ? ? ? 1_555 IF NA  .    NA  ? ? 0 HOH 6022 0 NA  8328 1_555 ? ? ? ? ? ? ? 2.741 ? ? 
metalc527  metalc ? ? CJ HOH .    O     ? ? ? 1_555 QG NA  .    NA  ? ? 0 HOH 6119 0 NA  8369 1_555 ? ? ? ? ? ? ? 2.790 ? ? 
metalc528  metalc ? ? CJ HOH .    O     ? ? ? 1_555 JF NA  .    NA  ? ? 0 HOH 6124 0 NA  8329 1_555 ? ? ? ? ? ? ? 2.847 ? ? 
metalc529  metalc ? ? CJ HOH .    O     ? ? ? 1_555 GE MG  .    MG  ? ? 0 HOH 6147 0 MG  8115 1_555 ? ? ? ? ? ? ? 2.260 ? ? 
metalc530  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ZF NA  .    NA  ? ? 0 HOH 6151 0 NA  8352 1_555 ? ? ? ? ? ? ? 2.846 ? ? 
metalc531  metalc ? ? CJ HOH .    O     ? ? ? 1_555 YF NA  .    NA  ? ? 0 HOH 6504 0 NA  8350 1_555 ? ? ? ? ? ? ? 2.925 ? ? 
metalc532  metalc ? ? CJ HOH .    O     ? ? ? 1_555 NC MG  .    MG  ? ? 0 HOH 6551 0 MG  8063 1_555 ? ? ? ? ? ? ? 1.904 ? ? 
metalc533  metalc ? ? CJ HOH .    O     ? ? ? 1_555 MF NA  .    NA  ? ? 0 HOH 6620 0 NA  8332 1_555 ? ? ? ? ? ? ? 2.847 ? ? 
metalc534  metalc ? ? CJ HOH .    O     ? ? ? 1_555 BH NA  .    NA  ? ? 0 HOH 6622 0 NA  8381 1_555 ? ? ? ? ? ? ? 2.841 ? ? 
metalc535  metalc ? ? CJ HOH .    O     ? ? ? 1_555 WA MG  .    MG  ? ? 0 HOH 6783 0 MG  8019 1_555 ? ? ? ? ? ? ? 1.996 ? ? 
metalc536  metalc ? ? CJ HOH .    O     ? ? ? 1_555 UG NA  .    NA  ? ? 0 HOH 6850 0 NA  8373 1_555 ? ? ? ? ? ? ? 2.718 ? ? 
metalc537  metalc ? ? CJ HOH .    O     ? ? ? 1_555 IG NA  .    NA  ? ? 0 HOH 6886 0 NA  8361 1_555 ? ? ? ? ? ? ? 2.635 ? ? 
metalc538  metalc ? ? CJ HOH .    O     ? ? ? 1_555 QF NA  .    NA  ? ? 0 HOH 6898 0 NA  8336 1_555 ? ? ? ? ? ? ? 2.717 ? ? 
metalc539  metalc ? ? CJ HOH .    O     ? ? ? 1_555 YD MG  .    MG  ? ? 0 HOH 6962 0 MG  8106 1_555 ? ? ? ? ? ? ? 2.466 ? ? 
metalc540  metalc ? ? CJ HOH .    O     ? ? ? 1_555 UB MG  .    MG  ? ? 0 HOH 6967 0 MG  8043 1_555 ? ? ? ? ? ? ? 2.367 ? ? 
metalc541  metalc ? ? CJ HOH .    O     ? ? ? 1_555 TC MG  .    MG  ? ? 0 HOH 6971 0 MG  8071 1_555 ? ? ? ? ? ? ? 2.021 ? ? 
metalc542  metalc ? ? CJ HOH .    O     ? ? ? 1_555 MA MG  .    MG  ? ? 0 HOH 6979 0 MG  8009 1_555 ? ? ? ? ? ? ? 2.015 ? ? 
metalc543  metalc ? ? CJ HOH .    O     ? ? ? 1_555 FG NA  .    NA  ? ? 0 HOH 6979 0 NA  8358 1_555 ? ? ? ? ? ? ? 2.627 ? ? 
metalc544  metalc ? ? CJ HOH .    O     ? ? ? 1_555 NC MG  .    MG  ? ? 0 HOH 6986 0 MG  8063 1_555 ? ? ? ? ? ? ? 2.005 ? ? 
metalc545  metalc ? ? CJ HOH .    O     ? ? ? 1_555 VA MG  .    MG  ? ? 0 HOH 7017 0 MG  8018 1_555 ? ? ? ? ? ? ? 1.923 ? ? 
metalc546  metalc ? ? CJ HOH .    O     ? ? ? 1_555 AE MG  .    MG  ? ? 0 HOH 7046 0 MG  8108 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc547  metalc ? ? CJ HOH .    O     ? ? ? 1_555 TC MG  .    MG  ? ? 0 HOH 7112 0 MG  8071 1_555 ? ? ? ? ? ? ? 1.967 ? ? 
metalc548  metalc ? ? CJ HOH .    O     ? ? ? 1_555 BG NA  .    NA  ? ? 0 HOH 7149 0 NA  8354 1_555 ? ? ? ? ? ? ? 2.980 ? ? 
metalc549  metalc ? ? CJ HOH .    O     ? ? ? 1_555 FF NA  .    NA  ? ? 0 HOH 7218 0 NA  8325 1_555 ? ? ? ? ? ? ? 2.252 ? ? 
metalc550  metalc ? ? CJ HOH .    O     ? ? ? 1_555 EH NA  .    NA  ? ? 0 HOH 7238 0 NA  8385 1_555 ? ? ? ? ? ? ? 2.592 ? ? 
metalc551  metalc ? ? CJ HOH .    O     ? ? ? 1_555 QF NA  .    NA  ? ? 0 HOH 7245 0 NA  8336 1_555 ? ? ? ? ? ? ? 2.548 ? ? 
metalc552  metalc ? ? CJ HOH .    O     ? ? ? 1_555 WH MG  .    MG  ? ? 0 HOH 7269 B MG  8055 1_555 ? ? ? ? ? ? ? 2.158 ? ? 
metalc553  metalc ? ? CJ HOH .    O     ? ? ? 1_555 RA MG  .    MG  ? ? 0 HOH 7303 0 MG  8014 1_555 ? ? ? ? ? ? ? 2.051 ? ? 
metalc554  metalc ? ? CJ HOH .    O     ? ? ? 1_555 FA MG  .    MG  ? ? 0 HOH 7305 0 MG  8002 1_555 ? ? ? ? ? ? ? 2.071 ? ? 
metalc555  metalc ? ? CJ HOH .    O     ? ? ? 1_555 FA MG  .    MG  ? ? 0 HOH 7306 0 MG  8002 1_555 ? ? ? ? ? ? ? 2.246 ? ? 
metalc556  metalc ? ? CJ HOH .    O     ? ? ? 1_555 XD MG  .    MG  ? ? 0 HOH 7308 0 MG  8104 1_555 ? ? ? ? ? ? ? 2.422 ? ? 
metalc557  metalc ? ? CJ HOH .    O     ? ? ? 1_555 NC MG  .    MG  ? ? 0 HOH 7311 0 MG  8063 1_555 ? ? ? ? ? ? ? 2.229 ? ? 
metalc558  metalc ? ? CJ HOH .    O     ? ? ? 1_555 HA MG  .    MG  ? ? 0 HOH 7312 0 MG  8004 1_555 ? ? ? ? ? ? ? 2.050 ? ? 
metalc559  metalc ? ? CJ HOH .    O     ? ? ? 1_555 UA MG  .    MG  ? ? 0 HOH 7313 0 MG  8017 1_555 ? ? ? ? ? ? ? 2.064 ? ? 
metalc560  metalc ? ? CJ HOH .    O     ? ? ? 1_555 HB MG  .    MG  ? ? 0 HOH 7314 0 MG  8030 1_555 ? ? ? ? ? ? ? 1.938 ? ? 
metalc561  metalc ? ? CJ HOH .    O     ? ? ? 1_555 HB MG  .    MG  ? ? 0 HOH 7315 0 MG  8030 1_555 ? ? ? ? ? ? ? 2.049 ? ? 
metalc562  metalc ? ? CJ HOH .    O     ? ? ? 1_555 XA MG  .    MG  ? ? 0 HOH 7316 0 MG  8020 1_555 ? ? ? ? ? ? ? 2.016 ? ? 
metalc563  metalc ? ? CJ HOH .    O     ? ? ? 1_555 KA MG  .    MG  ? ? 0 HOH 7317 0 MG  8007 1_555 ? ? ? ? ? ? ? 2.177 ? ? 
metalc564  metalc ? ? CJ HOH .    O     ? ? ? 1_555 FC MG  .    MG  ? ? 0 HOH 7318 0 MG  8054 1_555 ? ? ? ? ? ? ? 1.974 ? ? 
metalc565  metalc ? ? CJ HOH .    O     ? ? ? 1_555 YA MG  .    MG  ? ? 0 HOH 7319 0 MG  8021 1_555 ? ? ? ? ? ? ? 1.784 ? ? 
metalc566  metalc ? ? CJ HOH .    O     ? ? ? 1_555 YA MG  .    MG  ? ? 0 HOH 7320 0 MG  8021 1_555 ? ? ? ? ? ? ? 1.870 ? ? 
metalc567  metalc ? ? CJ HOH .    O     ? ? ? 1_555 LA MG  .    MG  ? ? 0 HOH 7321 0 MG  8008 1_555 ? ? ? ? ? ? ? 1.982 ? ? 
metalc568  metalc ? ? CJ HOH .    O     ? ? ? 1_555 MA MG  .    MG  ? ? 0 HOH 7322 0 MG  8009 1_555 ? ? ? ? ? ? ? 2.333 ? ? 
metalc569  metalc ? ? CJ HOH .    O     ? ? ? 1_555 MA MG  .    MG  ? ? 0 HOH 7323 0 MG  8009 1_555 ? ? ? ? ? ? ? 1.873 ? ? 
metalc570  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ZA MG  .    MG  ? ? 0 HOH 7324 0 MG  8022 1_555 ? ? ? ? ? ? ? 2.039 ? ? 
metalc571  metalc ? ? CJ HOH .    O     ? ? ? 1_555 HB MG  .    MG  ? ? 0 HOH 7325 0 MG  8030 1_555 ? ? ? ? ? ? ? 2.167 ? ? 
metalc572  metalc ? ? CJ HOH .    O     ? ? ? 1_555 JC MG  .    MG  ? ? 0 HOH 7326 0 MG  8059 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc573  metalc ? ? CJ HOH .    O     ? ? ? 1_555 EA MG  .    MG  ? ? 0 HOH 7327 0 MG  8001 1_555 ? ? ? ? ? ? ? 1.995 ? ? 
metalc574  metalc ? ? CJ HOH .    O     ? ? ? 1_555 IA MG  .    MG  ? ? 0 HOH 7328 0 MG  8005 1_555 ? ? ? ? ? ? ? 1.972 ? ? 
metalc575  metalc ? ? CJ HOH .    O     ? ? ? 1_555 IA MG  .    MG  ? ? 0 HOH 7329 0 MG  8005 1_555 ? ? ? ? ? ? ? 2.056 ? ? 
metalc576  metalc ? ? CJ HOH .    O     ? ? ? 1_555 TA MG  .    MG  ? ? 0 HOH 7330 0 MG  8016 1_555 ? ? ? ? ? ? ? 2.128 ? ? 
metalc577  metalc ? ? CJ HOH .    O     ? ? ? 1_555 TA MG  .    MG  ? ? 0 HOH 7331 0 MG  8016 1_555 ? ? ? ? ? ? ? 1.967 ? ? 
metalc578  metalc ? ? CJ HOH .    O     ? ? ? 1_555 WA MG  .    MG  ? ? 0 HOH 7332 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.150 ? ? 
metalc579  metalc ? ? CJ HOH .    O     ? ? ? 1_555 WA MG  .    MG  ? ? 0 HOH 7333 0 MG  8019 1_555 ? ? ? ? ? ? ? 2.222 ? ? 
metalc580  metalc ? ? CJ HOH .    O     ? ? ? 1_555 WA MG  .    MG  ? ? 0 HOH 7334 0 MG  8019 1_555 ? ? ? ? ? ? ? 1.984 ? ? 
metalc581  metalc ? ? CJ HOH .    O     ? ? ? 1_555 XA MG  .    MG  ? ? 0 HOH 7335 0 MG  8020 1_555 ? ? ? ? ? ? ? 1.848 ? ? 
metalc582  metalc ? ? CJ HOH .    O     ? ? ? 1_555 SA MG  .    MG  ? ? 0 HOH 7337 0 MG  8015 1_555 ? ? ? ? ? ? ? 2.017 ? ? 
metalc583  metalc ? ? CJ HOH .    O     ? ? ? 1_555 FG NA  .    NA  ? ? 0 HOH 7338 0 NA  8358 1_555 ? ? ? ? ? ? ? 2.700 ? ? 
metalc584  metalc ? ? CJ HOH .    O     ? ? ? 1_555 AB MG  .    MG  ? ? 0 HOH 7339 0 MG  8023 1_555 ? ? ? ? ? ? ? 1.999 ? ? 
metalc585  metalc ? ? CJ HOH .    O     ? ? ? 1_555 AB MG  .    MG  ? ? 0 HOH 7340 0 MG  8023 1_555 ? ? ? ? ? ? ? 1.943 ? ? 
metalc586  metalc ? ? CJ HOH .    O     ? ? ? 1_555 CB MG  .    MG  ? ? 0 HOH 7341 0 MG  8025 1_555 ? ? ? ? ? ? ? 1.979 ? ? 
metalc587  metalc ? ? CJ HOH .    O     ? ? ? 1_555 CB MG  .    MG  ? ? 0 HOH 7342 0 MG  8025 1_555 ? ? ? ? ? ? ? 1.956 ? ? 
metalc588  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ME NA  .    NA  ? ? 0 HOH 7342 0 NA  8302 1_555 ? ? ? ? ? ? ? 2.976 ? ? 
metalc589  metalc ? ? CJ HOH .    O     ? ? ? 1_555 DB MG  .    MG  ? ? 0 HOH 7343 0 MG  8026 1_555 ? ? ? ? ? ? ? 2.168 ? ? 
metalc590  metalc ? ? CJ HOH .    O     ? ? ? 1_555 DB MG  .    MG  ? ? 0 HOH 7344 0 MG  8026 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
metalc591  metalc ? ? CJ HOH .    O     ? ? ? 1_555 GB MG  .    MG  ? ? 0 HOH 7347 0 MG  8029 1_555 ? ? ? ? ? ? ? 1.909 ? ? 
metalc592  metalc ? ? CJ HOH .    O     ? ? ? 1_555 GB MG  .    MG  ? ? 0 HOH 7348 0 MG  8029 1_555 ? ? ? ? ? ? ? 2.152 ? ? 
metalc593  metalc ? ? CJ HOH .    O     ? ? ? 1_555 GB MG  .    MG  ? ? 0 HOH 7349 0 MG  8029 1_555 ? ? ? ? ? ? ? 2.083 ? ? 
metalc594  metalc ? ? CJ HOH .    O     ? ? ? 1_555 GB MG  .    MG  ? ? 0 HOH 7350 0 MG  8029 1_555 ? ? ? ? ? ? ? 1.924 ? ? 
metalc595  metalc ? ? CJ HOH .    O     ? ? ? 1_555 IB MG  .    MG  ? ? 0 HOH 7352 0 MG  8031 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
metalc596  metalc ? ? CJ HOH .    O     ? ? ? 1_555 IB MG  .    MG  ? ? 0 HOH 7353 0 MG  8031 1_555 ? ? ? ? ? ? ? 2.087 ? ? 
metalc597  metalc ? ? CJ HOH .    O     ? ? ? 1_555 IB MG  .    MG  ? ? 0 HOH 7354 0 MG  8031 1_555 ? ? ? ? ? ? ? 1.922 ? ? 
metalc598  metalc ? ? CJ HOH .    O     ? ? ? 1_555 LB MG  .    MG  ? ? 0 HOH 7355 0 MG  8034 1_555 ? ? ? ? ? ? ? 1.884 ? ? 
metalc599  metalc ? ? CJ HOH .    O     ? ? ? 1_555 MB MG  .    MG  ? ? 0 HOH 7356 0 MG  8035 1_555 ? ? ? ? ? ? ? 2.418 ? ? 
metalc600  metalc ? ? CJ HOH .    O     ? ? ? 1_555 MB MG  .    MG  ? ? 0 HOH 7357 0 MG  8035 1_555 ? ? ? ? ? ? ? 2.117 ? ? 
metalc601  metalc ? ? CJ HOH .    O     ? ? ? 1_555 NB MG  .    MG  ? ? 0 HOH 7358 0 MG  8036 1_555 ? ? ? ? ? ? ? 2.228 ? ? 
metalc602  metalc ? ? CJ HOH .    O     ? ? ? 1_555 NB MG  .    MG  ? ? 0 HOH 7359 0 MG  8036 1_555 ? ? ? ? ? ? ? 1.906 ? ? 
metalc603  metalc ? ? CJ HOH .    O     ? ? ? 1_555 NB MG  .    MG  ? ? 0 HOH 7360 0 MG  8036 1_555 ? ? ? ? ? ? ? 1.963 ? ? 
metalc604  metalc ? ? CJ HOH .    O     ? ? ? 1_555 PB MG  .    MG  ? ? 0 HOH 7362 0 MG  8038 1_555 ? ? ? ? ? ? ? 1.997 ? ? 
metalc605  metalc ? ? CJ HOH .    O     ? ? ? 1_555 QB MG  .    MG  ? ? 0 HOH 7363 0 MG  8039 1_555 ? ? ? ? ? ? ? 1.973 ? ? 
metalc606  metalc ? ? CJ HOH .    O     ? ? ? 1_555 QB MG  .    MG  ? ? 0 HOH 7364 0 MG  8039 1_555 ? ? ? ? ? ? ? 2.284 ? ? 
metalc607  metalc ? ? CJ HOH .    O     ? ? ? 1_555 TB MG  .    MG  ? ? 0 HOH 7365 0 MG  8042 1_555 ? ? ? ? ? ? ? 2.342 ? ? 
metalc608  metalc ? ? CJ HOH .    O     ? ? ? 1_555 WB MG  .    MG  ? ? 0 HOH 7366 0 MG  8045 1_555 ? ? ? ? ? ? ? 2.115 ? ? 
metalc609  metalc ? ? CJ HOH .    O     ? ? ? 1_555 CC MG  .    MG  ? ? 0 HOH 7367 0 MG  8051 1_555 ? ? ? ? ? ? ? 2.088 ? ? 
metalc610  metalc ? ? CJ HOH .    O     ? ? ? 1_555 CC MG  .    MG  ? ? 0 HOH 7368 0 MG  8051 1_555 ? ? ? ? ? ? ? 2.290 ? ? 
metalc611  metalc ? ? CJ HOH .    O     ? ? ? 1_555 FC MG  .    MG  ? ? 0 HOH 7369 0 MG  8054 1_555 ? ? ? ? ? ? ? 2.172 ? ? 
metalc612  metalc ? ? CJ HOH .    O     ? ? ? 1_555 FC MG  .    MG  ? ? 0 HOH 7370 0 MG  8054 1_555 ? ? ? ? ? ? ? 2.040 ? ? 
metalc613  metalc ? ? CJ HOH .    O     ? ? ? 1_555 IC MG  .    MG  ? ? 0 HOH 7371 0 MG  8058 1_555 ? ? ? ? ? ? ? 1.997 ? ? 
metalc614  metalc ? ? CJ HOH .    O     ? ? ? 1_555 IC MG  .    MG  ? ? 0 HOH 7372 0 MG  8058 1_555 ? ? ? ? ? ? ? 2.084 ? ? 
metalc615  metalc ? ? CJ HOH .    O     ? ? ? 1_555 KC MG  .    MG  ? ? 0 HOH 7373 0 MG  8060 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc616  metalc ? ? CJ HOH .    O     ? ? ? 1_555 KC MG  .    MG  ? ? 0 HOH 7374 0 MG  8060 1_555 ? ? ? ? ? ? ? 1.907 ? ? 
metalc617  metalc ? ? CJ HOH .    O     ? ? ? 1_555 KC MG  .    MG  ? ? 0 HOH 7375 0 MG  8060 1_555 ? ? ? ? ? ? ? 2.201 ? ? 
metalc618  metalc ? ? CJ HOH .    O     ? ? ? 1_555 LC MG  .    MG  ? ? 0 HOH 7376 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.101 ? ? 
metalc619  metalc ? ? CJ HOH .    O     ? ? ? 1_555 LC MG  .    MG  ? ? 0 HOH 7377 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.267 ? ? 
metalc620  metalc ? ? CJ HOH .    O     ? ? ? 1_555 LC MG  .    MG  ? ? 0 HOH 7378 0 MG  8061 1_555 ? ? ? ? ? ? ? 2.123 ? ? 
metalc621  metalc ? ? CJ HOH .    O     ? ? ? 1_555 VC MG  .    MG  ? ? 0 HOH 7381 0 MG  8074 1_555 ? ? ? ? ? ? ? 2.089 ? ? 
metalc622  metalc ? ? CJ HOH .    O     ? ? ? 1_555 VC MG  .    MG  ? ? 0 HOH 7382 0 MG  8074 1_555 ? ? ? ? ? ? ? 1.888 ? ? 
metalc623  metalc ? ? CJ HOH .    O     ? ? ? 1_555 WC MG  .    MG  ? ? 0 HOH 7383 0 MG  8075 1_555 ? ? ? ? ? ? ? 2.456 ? ? 
metalc624  metalc ? ? CJ HOH .    O     ? ? ? 1_555 UC MG  .    MG  ? ? 0 HOH 7384 0 MG  8072 1_555 ? ? ? ? ? ? ? 2.196 ? ? 
metalc625  metalc ? ? CJ HOH .    O     ? ? ? 1_555 TC MG  .    MG  ? ? 0 HOH 7385 0 MG  8071 1_555 ? ? ? ? ? ? ? 1.974 ? ? 
metalc626  metalc ? ? CJ HOH .    O     ? ? ? 1_555 NC MG  .    MG  ? ? 0 HOH 7387 0 MG  8063 1_555 ? ? ? ? ? ? ? 2.029 ? ? 
metalc627  metalc ? ? CJ HOH .    O     ? ? ? 1_555 GC MG  .    MG  ? ? 0 HOH 7388 0 MG  8056 1_555 ? ? ? ? ? ? ? 2.100 ? ? 
metalc628  metalc ? ? CJ HOH .    O     ? ? ? 1_555 XC MG  .    MG  ? ? 0 HOH 7390 0 MG  8076 1_555 ? ? ? ? ? ? ? 2.202 ? ? 
metalc629  metalc ? ? CJ HOH .    O     ? ? ? 1_555 YC MG  .    MG  ? ? 0 HOH 7391 0 MG  8077 1_555 ? ? ? ? ? ? ? 2.018 ? ? 
metalc630  metalc ? ? CJ HOH .    O     ? ? ? 1_555 YC MG  .    MG  ? ? 0 HOH 7392 0 MG  8077 1_555 ? ? ? ? ? ? ? 2.029 ? ? 
metalc631  metalc ? ? CJ HOH .    O     ? ? ? 1_555 AD MG  .    MG  ? ? 0 HOH 7393 0 MG  8080 1_555 ? ? ? ? ? ? ? 2.076 ? ? 
metalc632  metalc ? ? CJ HOH .    O     ? ? ? 1_555 DD MG  .    MG  ? ? 0 HOH 7394 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.072 ? ? 
metalc633  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ED MG  .    MG  ? ? 0 HOH 7395 0 MG  8084 1_555 ? ? ? ? ? ? ? 1.904 ? ? 
metalc634  metalc ? ? CJ HOH .    O     ? ? ? 1_555 GD MG  .    MG  ? ? 0 HOH 7396 0 MG  8086 1_555 ? ? ? ? ? ? ? 2.101 ? ? 
metalc635  metalc ? ? CJ HOH .    O     ? ? ? 1_555 GD MG  .    MG  ? ? 0 HOH 7397 0 MG  8086 1_555 ? ? ? ? ? ? ? 2.206 ? ? 
metalc636  metalc ? ? CJ HOH .    O     ? ? ? 1_555 LD MG  .    MG  ? ? 0 HOH 7399 0 MG  8091 1_555 ? ? ? ? ? ? ? 2.422 ? ? 
metalc637  metalc ? ? CJ HOH .    O     ? ? ? 1_555 LA MG  .    MG  ? ? 0 HOH 7404 0 MG  8008 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
metalc638  metalc ? ? CJ HOH .    O     ? ? ? 1_555 PA MG  .    MG  ? ? 0 HOH 7405 0 MG  8012 1_555 ? ? ? ? ? ? ? 2.206 ? ? 
metalc639  metalc ? ? CJ HOH .    O     ? ? ? 1_555 VA MG  .    MG  ? ? 0 HOH 7406 0 MG  8018 1_555 ? ? ? ? ? ? ? 2.069 ? ? 
metalc640  metalc ? ? CJ HOH .    O     ? ? ? 1_555 BB MG  .    MG  ? ? 0 HOH 7407 0 MG  8024 1_555 ? ? ? ? ? ? ? 1.920 ? ? 
metalc641  metalc ? ? CJ HOH .    O     ? ? ? 1_555 CB MG  .    MG  ? ? 0 HOH 7409 0 MG  8025 1_555 ? ? ? ? ? ? ? 2.046 ? ? 
metalc642  metalc ? ? CJ HOH .    O     ? ? ? 1_555 MB MG  .    MG  ? ? 0 HOH 7411 0 MG  8035 1_555 ? ? ? ? ? ? ? 1.938 ? ? 
metalc643  metalc ? ? CJ HOH .    O     ? ? ? 1_555 MB MG  .    MG  ? ? 0 HOH 7412 0 MG  8035 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc644  metalc ? ? CJ HOH .    O     ? ? ? 1_555 OB MG  .    MG  ? ? 0 HOH 7413 0 MG  8037 1_555 ? ? ? ? ? ? ? 2.147 ? ? 
metalc645  metalc ? ? CJ HOH .    O     ? ? ? 1_555 RB MG  .    MG  ? ? 0 HOH 7415 0 MG  8040 1_555 ? ? ? ? ? ? ? 1.971 ? ? 
metalc646  metalc ? ? CJ HOH .    O     ? ? ? 1_555 RB MG  .    MG  ? ? 0 HOH 7416 0 MG  8040 1_555 ? ? ? ? ? ? ? 2.091 ? ? 
metalc647  metalc ? ? CJ HOH .    O     ? ? ? 1_555 WB MG  .    MG  ? ? 0 HOH 7420 0 MG  8045 1_555 ? ? ? ? ? ? ? 2.353 ? ? 
metalc648  metalc ? ? CJ HOH .    O     ? ? ? 1_555 XB MG  .    MG  ? ? 0 HOH 7421 0 MG  8046 1_555 ? ? ? ? ? ? ? 2.008 ? ? 
metalc649  metalc ? ? CJ HOH .    O     ? ? ? 1_555 XB MG  .    MG  ? ? 0 HOH 7422 0 MG  8046 1_555 ? ? ? ? ? ? ? 2.343 ? ? 
metalc650  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ZB MG  .    MG  ? ? 0 HOH 7423 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.482 ? ? 
metalc651  metalc ? ? CJ HOH .    O     ? ? ? 1_555 AC MG  .    MG  ? ? 0 HOH 7424 0 MG  8049 1_555 ? ? ? ? ? ? ? 2.372 ? ? 
metalc652  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ZD MG  .    MG  ? ? 0 HOH 7426 0 MG  8107 1_555 ? ? ? ? ? ? ? 2.122 ? ? 
metalc653  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ZD MG  .    MG  ? ? 0 HOH 7427 0 MG  8107 1_555 ? ? ? ? ? ? ? 2.107 ? ? 
metalc654  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ZD MG  .    MG  ? ? 0 HOH 7428 0 MG  8107 1_555 ? ? ? ? ? ? ? 1.961 ? ? 
metalc655  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ZD MG  .    MG  ? ? 0 HOH 7429 0 MG  8107 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc656  metalc ? ? CJ HOH .    O     ? ? ? 1_555 AE MG  .    MG  ? ? 0 HOH 7431 0 MG  8108 1_555 ? ? ? ? ? ? ? 2.347 ? ? 
metalc657  metalc ? ? CJ HOH .    O     ? ? ? 1_555 AE MG  .    MG  ? ? 0 HOH 7433 0 MG  8108 1_555 ? ? ? ? ? ? ? 2.363 ? ? 
metalc658  metalc ? ? CJ HOH .    O     ? ? ? 1_555 YB MG  .    MG  ? ? 0 HOH 7436 0 MG  8047 1_555 ? ? ? ? ? ? ? 1.893 ? ? 
metalc659  metalc ? ? CJ HOH .    O     ? ? ? 1_555 DC MG  .    MG  ? ? 0 HOH 7438 0 MG  8052 1_555 ? ? ? ? ? ? ? 2.358 ? ? 
metalc660  metalc ? ? CJ HOH .    O     ? ? ? 1_555 NC MG  .    MG  ? ? 0 HOH 7440 0 MG  8063 1_555 ? ? ? ? ? ? ? 2.343 ? ? 
metalc661  metalc ? ? CJ HOH .    O     ? ? ? 1_555 RC MG  .    MG  ? ? 0 HOH 7441 0 MG  8068 1_555 ? ? ? ? ? ? ? 2.345 ? ? 
metalc662  metalc ? ? CJ HOH .    O     ? ? ? 1_555 UC MG  .    MG  ? ? 0 HOH 7442 0 MG  8072 1_555 ? ? ? ? ? ? ? 2.167 ? ? 
metalc663  metalc ? ? CJ HOH .    O     ? ? ? 1_555 VC MG  .    MG  ? ? 0 HOH 7443 0 MG  8074 1_555 ? ? ? ? ? ? ? 2.124 ? ? 
metalc664  metalc ? ? CJ HOH .    O     ? ? ? 1_555 VC MG  .    MG  ? ? 0 HOH 7444 0 MG  8074 1_555 ? ? ? ? ? ? ? 2.065 ? ? 
metalc665  metalc ? ? CJ HOH .    O     ? ? ? 1_555 XC MG  .    MG  ? ? 0 HOH 7446 0 MG  8076 1_555 ? ? ? ? ? ? ? 2.039 ? ? 
metalc666  metalc ? ? CJ HOH .    O     ? ? ? 1_555 AD MG  .    MG  ? ? 0 HOH 7447 0 MG  8080 1_555 ? ? ? ? ? ? ? 2.118 ? ? 
metalc667  metalc ? ? CJ HOH .    O     ? ? ? 1_555 DD MG  .    MG  ? ? 0 HOH 7448 0 MG  8083 1_555 ? ? ? ? ? ? ? 2.339 ? ? 
metalc668  metalc ? ? CJ HOH .    O     ? ? ? 1_555 JD MG  .    MG  ? ? 0 HOH 7449 0 MG  8089 1_555 ? ? ? ? ? ? ? 2.409 ? ? 
metalc669  metalc ? ? CJ HOH .    O     ? ? ? 1_555 JD MG  .    MG  ? ? 0 HOH 7450 0 MG  8089 1_555 ? ? ? ? ? ? ? 2.185 ? ? 
metalc670  metalc ? ? CJ HOH .    O     ? ? ? 1_555 MD MG  .    MG  ? ? 0 HOH 7451 0 MG  8092 1_555 ? ? ? ? ? ? ? 2.202 ? ? 
metalc671  metalc ? ? CJ HOH .    O     ? ? ? 1_555 OD MG  .    MG  ? ? 0 HOH 7452 0 MG  8094 1_555 ? ? ? ? ? ? ? 2.099 ? ? 
metalc672  metalc ? ? CJ HOH .    O     ? ? ? 1_555 WD MG  .    MG  ? ? 0 HOH 7453 0 MG  8103 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
metalc673  metalc ? ? CJ HOH .    O     ? ? ? 1_555 CD MG  .    MG  ? ? 0 HOH 7455 0 MG  8082 1_555 ? ? ? ? ? ? ? 2.148 ? ? 
metalc674  metalc ? ? CJ HOH .    O     ? ? ? 1_555 UF NA  .    NA  ? ? 0 HOH 7456 0 NA  8341 1_555 ? ? ? ? ? ? ? 2.766 ? ? 
metalc675  metalc ? ? CJ HOH .    O     ? ? ? 1_555 ZB MG  .    MG  ? ? 0 HOH 7459 0 MG  8048 1_555 ? ? ? ? ? ? ? 2.037 ? ? 
metalc676  metalc ? ? CJ HOH .    O     ? ? ? 1_555 VD MG  .    MG  ? ? 0 HOH 7460 0 MG  8102 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc677  metalc ? ? EA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8001 0 HOH 8694 1_555 ? ? ? ? ? ? ? 2.080 ? ? 
metalc678  metalc ? ? GA MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? 0 MG  8003 A HOH 8512 1_555 ? ? ? ? ? ? ? 2.121 ? ? 
metalc679  metalc ? ? GA MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? 0 MG  8003 A HOH 8535 1_555 ? ? ? ? ? ? ? 2.364 ? ? 
metalc680  metalc ? ? HA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8004 0 HOH 8567 1_555 ? ? ? ? ? ? ? 1.981 ? ? 
metalc681  metalc ? ? HA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8004 0 HOH 9303 1_555 ? ? ? ? ? ? ? 2.048 ? ? 
metalc682  metalc ? ? JA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8006 0 HOH 9335 1_555 ? ? ? ? ? ? ? 1.947 ? ? 
metalc683  metalc ? ? KA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8007 0 HOH 8528 1_555 ? ? ? ? ? ? ? 2.184 ? ? 
metalc684  metalc ? ? KA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8007 0 HOH 9884 1_555 ? ? ? ? ? ? ? 2.148 ? ? 
metalc685  metalc ? ? NA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8010 0 HOH 8881 1_555 ? ? ? ? ? ? ? 2.215 ? ? 
metalc686  metalc ? ? NA MG  .    MG    ? ? ? 1_555 D  GLN 230  OE1 ? ? 0 MG  8010 B GLN 230  1_555 ? ? ? ? ? ? ? 2.142 ? ? 
metalc687  metalc ? ? NA MG  .    MG    ? ? ? 1_555 FJ HOH .    O   ? ? 0 MG  8010 B HOH 8526 1_555 ? ? ? ? ? ? ? 2.049 ? ? 
metalc688  metalc ? ? PA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8012 0 HOH 8559 1_555 ? ? ? ? ? ? ? 2.012 ? ? 
metalc689  metalc ? ? PA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8012 0 HOH 9158 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
metalc690  metalc ? ? PA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8012 0 HOH 9751 1_555 ? ? ? ? ? ? ? 2.495 ? ? 
metalc691  metalc ? ? QA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8013 0 HOH 8541 1_555 ? ? ? ? ? ? ? 2.195 ? ? 
metalc692  metalc ? ? QA MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? 0 MG  8013 A HOH 8630 1_555 ? ? ? ? ? ? ? 2.123 ? ? 
metalc693  metalc ? ? RA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8014 0 HOH 8553 1_555 ? ? ? ? ? ? ? 2.243 ? ? 
metalc694  metalc ? ? SA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8015 0 HOH 8526 1_555 ? ? ? ? ? ? ? 1.915 ? ? 
metalc695  metalc ? ? SA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8015 0 HOH 8544 1_555 ? ? ? ? ? ? ? 2.162 ? ? 
metalc696  metalc ? ? UA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8017 0 HOH 8933 1_555 ? ? ? ? ? ? ? 2.069 ? ? 
metalc697  metalc ? ? UA MG  .    MG    ? ? ? 1_555 GJ HOH .    O   ? ? 0 MG  8017 C HOH 8358 1_555 ? ? ? ? ? ? ? 2.089 ? ? 
metalc698  metalc ? ? UA MG  .    MG    ? ? ? 1_555 GJ HOH .    O   ? ? 0 MG  8017 C HOH 8466 1_555 ? ? ? ? ? ? ? 2.154 ? ? 
metalc699  metalc ? ? VA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8018 0 HOH 9744 1_555 ? ? ? ? ? ? ? 2.215 ? ? 
metalc700  metalc ? ? XA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8020 0 HOH 8641 1_555 ? ? ? ? ? ? ? 2.041 ? ? 
metalc701  metalc ? ? XA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8020 0 HOH 8644 1_555 ? ? ? ? ? ? ? 2.122 ? ? 
metalc702  metalc ? ? XA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8020 0 HOH 8715 1_555 ? ? ? ? ? ? ? 2.112 ? ? 
metalc703  metalc ? ? YA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8021 0 HOH 9489 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc704  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8022 0 HOH 8630 1_555 ? ? ? ? ? ? ? 2.106 ? ? 
metalc705  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8022 0 HOH 8976 1_555 ? ? ? ? ? ? ? 2.106 ? ? 
metalc706  metalc ? ? BB MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8024 0 HOH 9462 1_555 ? ? ? ? ? ? ? 2.586 ? ? 
metalc707  metalc ? ? DB MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8026 0 HOH 8912 1_555 ? ? ? ? ? ? ? 2.304 ? ? 
metalc708  metalc ? ? EB MG  .    MG    ? ? ? 1_555 PJ HOH .    O   ? ? 0 MG  8027 L HOH 8643 1_555 ? ? ? ? ? ? ? 1.851 ? ? 
metalc709  metalc ? ? FB MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8028 0 HOH 9097 1_555 ? ? ? ? ? ? ? 2.443 ? ? 
metalc710  metalc ? ? FB MG  .    MG    ? ? ? 1_555 VJ HOH .    O   ? ? 0 MG  8028 R HOH 8344 1_555 ? ? ? ? ? ? ? 2.289 ? ? 
metalc711  metalc ? ? IB MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8031 0 HOH 9801 1_555 ? ? ? ? ? ? ? 2.116 ? ? 
metalc712  metalc ? ? JB MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8032 0 HOH 9515 1_555 ? ? ? ? ? ? ? 2.069 ? ? 
metalc713  metalc ? ? JB MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? 0 MG  8032 A HOH 8551 1_555 ? ? ? ? ? ? ? 2.255 ? ? 
metalc714  metalc ? ? JB MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? 0 MG  8032 A HOH 8631 1_555 ? ? ? ? ? ? ? 2.174 ? ? 
metalc715  metalc ? ? KB MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8033 0 HOH 9201 1_555 ? ? ? ? ? ? ? 2.260 ? ? 
metalc716  metalc ? ? NB MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8036 0 HOH 8886 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc717  metalc ? ? OB MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8037 0 HOH 8598 1_555 ? ? ? ? ? ? ? 2.442 ? ? 
metalc718  metalc ? ? OB MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8037 0 HOH 9659 1_555 ? ? ? ? ? ? ? 2.111 ? ? 
metalc719  metalc ? ? OB MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8037 0 HOH 9734 1_555 ? ? ? ? ? ? ? 2.179 ? ? 
metalc720  metalc ? ? PB MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8038 0 HOH 8802 1_555 ? ? ? ? ? ? ? 2.087 ? ? 
metalc721  metalc ? ? QB MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8039 0 HOH 9434 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc722  metalc ? ? RB MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8040 0 HOH 9216 1_555 ? ? ? ? ? ? ? 2.305 ? ? 
metalc723  metalc ? ? TB MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8042 0 HOH 8955 1_555 ? ? ? ? ? ? ? 2.668 ? ? 
metalc724  metalc ? ? UB MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8043 0 HOH 9339 1_555 ? ? ? ? ? ? ? 2.281 ? ? 
metalc725  metalc ? ? VB MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8044 0 HOH 9821 1_555 ? ? ? ? ? ? ? 2.522 ? ? 
metalc726  metalc ? ? VB MG  .    MG    ? ? ? 1_555 S  GLY 65   O   ? ? 0 MG  8044 Q GLY 65   1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc727  metalc ? ? VB MG  .    MG    ? ? ? 1_555 UJ HOH .    O   ? ? 0 MG  8044 Q HOH 8587 1_555 ? ? ? ? ? ? ? 2.358 ? ? 
metalc728  metalc ? ? YB MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8047 0 HOH 9653 1_555 ? ? ? ? ? ? ? 2.464 ? ? 
metalc729  metalc ? ? DC MG  .    MG    ? ? ? 1_555 B  G   92   OP1 ? ? 0 MG  8052 9 G   92   1_555 ? ? ? ? ? ? ? 2.760 ? ? 
metalc730  metalc ? ? DC MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8052 9 HOH 8389 1_555 ? ? ? ? ? ? ? 2.534 ? ? 
metalc731  metalc ? ? DC MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 0 MG  8052 9 HOH 8416 1_555 ? ? ? ? ? ? ? 2.251 ? ? 
metalc732  metalc ? ? EC MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8053 0 HOH 8723 1_555 ? ? ? ? ? ? ? 2.481 ? ? 
metalc733  metalc ? ? EC MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8053 0 HOH 8761 1_555 ? ? ? ? ? ? ? 2.221 ? ? 
metalc734  metalc ? ? EC MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8053 0 HOH 9564 1_555 ? ? ? ? ? ? ? 2.499 ? ? 
metalc735  metalc ? ? FC MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8054 0 HOH 8951 1_555 ? ? ? ? ? ? ? 2.122 ? ? 
metalc736  metalc ? ? GC MG  .    MG    ? ? ? 1_555 D  ASN 335  O   ? ? 0 MG  8056 B ASN 335  1_555 ? ? ? ? ? ? ? 2.095 ? ? 
metalc737  metalc ? ? GC MG  .    MG    ? ? ? 1_555 FJ HOH .    O   ? ? 0 MG  8056 B HOH 8543 1_555 ? ? ? ? ? ? ? 2.087 ? ? 
metalc738  metalc ? ? HC MG  .    MG    ? ? ? 1_555 C  GLN 207  O   ? ? 0 MG  8057 A GLN 207  1_555 ? ? ? ? ? ? ? 2.701 ? ? 
metalc739  metalc ? ? HC MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? 0 MG  8057 A HOH 8634 1_555 ? ? ? ? ? ? ? 2.644 ? ? 
metalc740  metalc ? ? IC MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? 0 MG  8058 A HOH 8632 1_555 ? ? ? ? ? ? ? 2.070 ? ? 
metalc741  metalc ? ? IC MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? 0 MG  8058 A HOH 8634 1_555 ? ? ? ? ? ? ? 2.131 ? ? 
metalc742  metalc ? ? JC MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8059 0 HOH 8558 1_555 ? ? ? ? ? ? ? 2.394 ? ? 
metalc743  metalc ? ? JC MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8059 0 HOH 8562 1_555 ? ? ? ? ? ? ? 2.352 ? ? 
metalc744  metalc ? ? KC MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8060 0 HOH 8687 1_555 ? ? ? ? ? ? ? 1.984 ? ? 
metalc745  metalc ? ? LC MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8061 0 HOH 9344 1_555 ? ? ? ? ? ? ? 2.296 ? ? 
metalc746  metalc ? ? MC MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8062 0 HOH 8915 1_555 ? ? ? ? ? ? ? 2.259 ? ? 
metalc747  metalc ? ? OC MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8064 0 HOH 9111 1_555 ? ? ? ? ? ? ? 2.729 ? ? 
metalc748  metalc ? ? PC MG  .    MG    ? ? ? 1_555 C  ASP 26   OD1 ? ? 0 MG  8066 A ASP 26   1_555 ? ? ? ? ? ? ? 2.745 ? ? 
metalc749  metalc ? ? PC MG  .    MG    ? ? ? 1_555 C  ASP 26   OD2 ? ? 0 MG  8066 A ASP 26   1_555 ? ? ? ? ? ? ? 2.183 ? ? 
metalc750  metalc ? ? PC MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? 0 MG  8066 A HOH 8563 1_555 ? ? ? ? ? ? ? 3.102 ? ? 
metalc751  metalc ? ? QC MG  .    MG    ? ? ? 1_555 C  ASN 188  O   ? ? 0 MG  8067 A ASN 188  1_555 ? ? ? ? ? ? ? 2.393 ? ? 
metalc752  metalc ? ? RC MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8068 0 HOH 9259 1_555 ? ? ? ? ? ? ? 2.215 ? ? 
metalc753  metalc ? ? SC MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8070 0 HOH 8642 1_555 ? ? ? ? ? ? ? 2.556 ? ? 
metalc754  metalc ? ? UC MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8072 0 HOH 9756 1_555 ? ? ? ? ? ? ? 1.919 ? ? 
metalc755  metalc ? ? XC MG  .    MG    ? ? ? 1_555 EK HOH .    O   ? ? 0 MG  8076 1 HOH 7875 1_555 ? ? ? ? ? ? ? 2.133 ? ? 
metalc756  metalc ? ? YC MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8077 0 HOH 8760 1_555 ? ? ? ? ? ? ? 2.179 ? ? 
metalc757  metalc ? ? BD MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8081 0 HOH 9133 1_555 ? ? ? ? ? ? ? 2.778 ? ? 
metalc758  metalc ? ? CD MG  .    MG    ? ? ? 1_555 SJ HOH .    O   ? ? 0 MG  8082 O HOH 216  1_555 ? ? ? ? ? ? ? 2.809 ? ? 
metalc759  metalc ? ? ED MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8084 0 HOH 8769 1_555 ? ? ? ? ? ? ? 2.226 ? ? 
metalc760  metalc ? ? ED MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8084 0 HOH 8893 1_555 ? ? ? ? ? ? ? 2.076 ? ? 
metalc761  metalc ? ? ED MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8084 0 HOH 9276 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc762  metalc ? ? FD MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8085 0 HOH 8558 1_555 ? ? ? ? ? ? ? 2.558 ? ? 
metalc763  metalc ? ? FD MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8085 0 HOH 9123 1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc764  metalc ? ? ID MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8088 0 HOH 8584 1_555 ? ? ? ? ? ? ? 2.341 ? ? 
metalc765  metalc ? ? ID MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8088 0 HOH 8816 1_555 ? ? ? ? ? ? ? 2.394 ? ? 
metalc766  metalc ? ? ID MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8088 0 HOH 9568 1_555 ? ? ? ? ? ? ? 2.604 ? ? 
metalc767  metalc ? ? LD MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8091 0 HOH 8612 1_555 ? ? ? ? ? ? ? 2.430 ? ? 
metalc768  metalc ? ? LD MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8091 0 HOH 9066 1_555 ? ? ? ? ? ? ? 2.472 ? ? 
metalc769  metalc ? ? LD MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8091 0 HOH 9850 1_555 ? ? ? ? ? ? ? 2.403 ? ? 
metalc770  metalc ? ? ND MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8093 0 HOH 9207 1_555 ? ? ? ? ? ? ? 2.725 ? ? 
metalc771  metalc ? ? QD MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8097 0 HOH 9865 1_555 ? ? ? ? ? ? ? 2.521 ? ? 
metalc772  metalc ? ? RD MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8098 0 HOH 9468 1_555 ? ? ? ? ? ? ? 2.374 ? ? 
metalc773  metalc ? ? RD MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8098 0 HOH 9897 1_555 ? ? ? ? ? ? ? 2.564 ? ? 
metalc774  metalc ? ? RD MG  .    MG    ? ? ? 1_555 BK HOH .    O   ? ? 0 MG  8098 X HOH 8570 1_555 ? ? ? ? ? ? ? 2.586 ? ? 
metalc775  metalc ? ? SD MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8099 0 HOH 9539 1_555 ? ? ? ? ? ? ? 2.598 ? ? 
metalc776  metalc ? ? VD MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8102 0 HOH 8772 1_555 ? ? ? ? ? ? ? 2.520 ? ? 
metalc777  metalc ? ? VD MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8102 0 HOH 9416 1_555 ? ? ? ? ? ? ? 2.822 ? ? 
metalc778  metalc ? ? VD MG  .    MG    ? ? ? 1_555 FK HOH .    O   ? ? 0 MG  8102 2 HOH 8522 1_555 ? ? ? ? ? ? ? 2.684 ? ? 
metalc779  metalc ? ? YD MG  .    MG    ? ? ? 1_555 SJ HOH .    O   ? ? 0 MG  8106 O HOH 189  1_555 ? ? ? ? ? ? ? 2.811 ? ? 
metalc780  metalc ? ? BE MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8110 0 HOH 9028 1_555 ? ? ? ? ? ? ? 2.558 ? ? 
metalc781  metalc ? ? CE MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8111 0 HOH 9825 1_555 ? ? ? ? ? ? ? 2.260 ? ? 
metalc782  metalc ? ? DE MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8112 0 HOH 8648 1_555 ? ? ? ? ? ? ? 2.479 ? ? 
metalc783  metalc ? ? DE MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8112 0 HOH 8851 1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc784  metalc ? ? DE MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8112 0 HOH 9088 1_555 ? ? ? ? ? ? ? 2.408 ? ? 
metalc785  metalc ? ? EE MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8113 0 HOH 9111 1_555 ? ? ? ? ? ? ? 2.552 ? ? 
metalc786  metalc ? ? FE MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8114 0 HOH 8869 1_555 ? ? ? ? ? ? ? 2.655 ? ? 
metalc787  metalc ? ? FE MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8114 0 HOH 8969 1_555 ? ? ? ? ? ? ? 2.391 ? ? 
metalc788  metalc ? ? GE MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? 0 MG  8115 A HOH 8555 1_555 ? ? ? ? ? ? ? 2.671 ? ? 
metalc789  metalc ? ? GE MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? 0 MG  8115 A HOH 8635 1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc790  metalc ? ? HE MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? 0 MG  8116 A HOH 8555 1_555 ? ? ? ? ? ? ? 2.490 ? ? 
metalc791  metalc ? ? IE MG  .    MG    ? ? ? 1_555 CJ HOH .    O   ? ? 0 MG  8117 0 HOH 8744 1_555 ? ? ? ? ? ? ? 2.635 ? ? 
metalc792  metalc ? ? KE K   .    K     ? ? ? 1_555 CJ HOH .    O   ? ? 0 K   8202 0 HOH 8535 1_555 ? ? ? ? ? ? ? 2.797 ? ? 
metalc793  metalc ? ? KE K   .    K     ? ? ? 1_555 CJ HOH .    O   ? ? 0 K   8202 0 HOH 8631 1_555 ? ? ? ? ? ? ? 2.929 ? ? 
metalc794  metalc ? ? KE K   .    K     ? ? ? 1_555 CJ HOH .    O   ? ? 0 K   8202 0 HOH 8665 1_555 ? ? ? ? ? ? ? 2.977 ? ? 
metalc795  metalc ? ? LE NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8301 0 HOH 9691 1_555 ? ? ? ? ? ? ? 2.731 ? ? 
metalc796  metalc ? ? PE NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8306 0 HOH 8646 1_555 ? ? ? ? ? ? ? 2.908 ? ? 
metalc797  metalc ? ? RE NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8308 0 HOH 9937 1_555 ? ? ? ? ? ? ? 2.487 ? ? 
metalc798  metalc ? ? TE NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8311 0 HOH 8701 1_555 ? ? ? ? ? ? ? 2.730 ? ? 
metalc799  metalc ? ? UE NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8313 0 HOH 9478 1_555 ? ? ? ? ? ? ? 2.525 ? ? 
metalc800  metalc ? ? VE NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8314 0 HOH 8852 1_555 ? ? ? ? ? ? ? 2.342 ? ? 
metalc801  metalc ? ? VE NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8314 0 HOH 9654 1_555 ? ? ? ? ? ? ? 2.485 ? ? 
metalc802  metalc ? ? WE NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8315 0 HOH 9210 1_555 ? ? ? ? ? ? ? 2.831 ? ? 
metalc803  metalc ? ? YE NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8317 0 HOH 8797 1_555 ? ? ? ? ? ? ? 2.355 ? ? 
metalc804  metalc ? ? YE NA  .    NA    ? ? ? 1_555 CA TRP 41   O   ? ? 0 NA  8317 1 TRP 42   1_555 ? ? ? ? ? ? ? 2.624 ? ? 
metalc805  metalc ? ? YE NA  .    NA    ? ? ? 1_555 EK HOH .    O   ? ? 0 NA  8317 1 HOH 4135 1_555 ? ? ? ? ? ? ? 2.472 ? ? 
metalc806  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8318 0 HOH 8731 1_555 ? ? ? ? ? ? ? 2.915 ? ? 
metalc807  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8318 0 HOH 9988 1_555 ? ? ? ? ? ? ? 2.837 ? ? 
metalc808  metalc ? ? AF NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8319 0 HOH 8580 1_555 ? ? ? ? ? ? ? 2.730 ? ? 
metalc809  metalc ? ? AF NA  .    NA    ? ? ? 1_555 M  ASP 36   O   ? ? 0 NA  8319 K ASP 36   1_555 ? ? ? ? ? ? ? 2.348 ? ? 
metalc810  metalc ? ? AF NA  .    NA    ? ? ? 1_555 OJ HOH .    O   ? ? 0 NA  8319 K HOH 8536 1_555 ? ? ? ? ? ? ? 2.736 ? ? 
metalc811  metalc ? ? BF NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8320 0 HOH 8577 1_555 ? ? ? ? ? ? ? 2.880 ? ? 
metalc812  metalc ? ? BF NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8320 0 HOH 8607 1_555 ? ? ? ? ? ? ? 2.753 ? ? 
metalc813  metalc ? ? BF NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8320 0 HOH 9267 1_555 ? ? ? ? ? ? ? 2.551 ? ? 
metalc814  metalc ? ? CF NA  .    NA    ? ? ? 1_555 D  ARG 229  O   ? ? 0 NA  8321 B ARG 229  1_555 ? ? ? ? ? ? ? 2.571 ? ? 
metalc815  metalc ? ? EF NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8324 0 HOH 9012 1_555 ? ? ? ? ? ? ? 2.881 ? ? 
metalc816  metalc ? ? FF NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8325 0 HOH 9146 1_555 ? ? ? ? ? ? ? 2.252 ? ? 
metalc817  metalc ? ? FF NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8325 0 HOH 9801 1_555 ? ? ? ? ? ? ? 2.457 ? ? 
metalc818  metalc ? ? HF NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8327 0 HOH 8557 1_555 ? ? ? ? ? ? ? 2.596 ? ? 
metalc819  metalc ? ? HF NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8327 0 HOH 9255 1_555 ? ? ? ? ? ? ? 2.842 ? ? 
metalc820  metalc ? ? HF NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8327 0 HOH 9728 1_555 ? ? ? ? ? ? ? 2.829 ? ? 
metalc821  metalc ? ? KF NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8330 0 HOH 8754 1_555 ? ? ? ? ? ? ? 2.732 ? ? 
metalc822  metalc ? ? LF NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8331 0 HOH 8821 1_555 ? ? ? ? ? ? ? 2.856 ? ? 
metalc823  metalc ? ? PF NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8335 0 HOH 9397 1_555 ? ? ? ? ? ? ? 2.700 ? ? 
metalc824  metalc ? ? QF NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8336 0 HOH 9449 1_555 ? ? ? ? ? ? ? 2.343 ? ? 
metalc825  metalc ? ? RF NA  .    NA    ? ? ? 1_555 S  VAL 72   O   ? ? 0 NA  8338 Q VAL 72   1_555 ? ? ? ? ? ? ? 2.307 ? ? 
metalc826  metalc ? ? RF NA  .    NA    ? ? ? 1_555 S  TRP 75   O   ? ? 0 NA  8338 Q TRP 75   1_555 ? ? ? ? ? ? ? 2.357 ? ? 
metalc827  metalc ? ? RF NA  .    NA    ? ? ? 1_555 UJ HOH .    O   ? ? 0 NA  8338 Q HOH 8514 1_555 ? ? ? ? ? ? ? 2.442 ? ? 
metalc828  metalc ? ? RF NA  .    NA    ? ? ? 1_555 UJ HOH .    O   ? ? 0 NA  8338 Q HOH 8525 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc829  metalc ? ? SF NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8339 0 HOH 9552 1_555 ? ? ? ? ? ? ? 2.926 ? ? 
metalc830  metalc ? ? WF NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8344 0 HOH 8743 1_555 ? ? ? ? ? ? ? 2.540 ? ? 
metalc831  metalc ? ? ZF NA  .    NA    ? ? ? 1_555 B  U   82   OP1 ? ? 0 NA  8352 9 U   82   1_555 ? ? ? ? ? ? ? 2.933 ? ? 
metalc832  metalc ? ? AG NA  .    NA    ? ? ? 1_555 M  GLY 14   O   ? ? 0 NA  8353 K GLY 14   1_555 ? ? ? ? ? ? ? 2.895 ? ? 
metalc833  metalc ? ? AG NA  .    NA    ? ? ? 1_555 OJ HOH .    O   ? ? 0 NA  8353 K HOH 8514 1_555 ? ? ? ? ? ? ? 2.752 ? ? 
metalc834  metalc ? ? DG NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8356 0 HOH 8973 1_555 ? ? ? ? ? ? ? 2.954 ? ? 
metalc835  metalc ? ? FG NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8358 0 HOH 9004 1_555 ? ? ? ? ? ? ? 2.622 ? ? 
metalc836  metalc ? ? IG NA  .    NA    ? ? ? 1_555 D  GLN 230  O   ? ? 0 NA  8361 B GLN 230  1_555 ? ? ? ? ? ? ? 2.752 ? ? 
metalc837  metalc ? ? LG NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8364 0 HOH 9115 1_555 ? ? ? ? ? ? ? 2.640 ? ? 
metalc838  metalc ? ? LG NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8364 0 HOH 9342 1_555 ? ? ? ? ? ? ? 2.784 ? ? 
metalc839  metalc ? ? MG NA  .    NA    ? ? ? 1_555 N  LYS 193  O   ? ? 0 NA  8365 L LYS 193  1_555 ? ? ? ? ? ? ? 2.757 ? ? 
metalc840  metalc ? ? NG NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8366 0 HOH 9409 1_555 ? ? ? ? ? ? ? 2.607 ? ? 
metalc841  metalc ? ? OG NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8367 0 HOH 9353 1_555 ? ? ? ? ? ? ? 2.549 ? ? 
metalc842  metalc ? ? OG NA  .    NA    ? ? ? 1_555 E  ARG 55   O   ? ? 0 NA  8367 C ARG 55   1_555 ? ? ? ? ? ? ? 2.897 ? ? 
metalc843  metalc ? ? OG NA  .    NA    ? ? ? 1_555 GJ HOH .    O   ? ? 0 NA  8367 C HOH 8386 1_555 ? ? ? ? ? ? ? 2.657 ? ? 
metalc844  metalc ? ? QG NA  .    NA    ? ? ? 1_555 FK HOH .    O   ? ? 0 NA  8369 2 HOH 8543 1_555 ? ? ? ? ? ? ? 2.720 ? ? 
metalc845  metalc ? ? RG NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8370 0 HOH 8624 1_555 ? ? ? ? ? ? ? 2.838 ? ? 
metalc846  metalc ? ? SG NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8371 0 HOH 9147 1_555 ? ? ? ? ? ? ? 2.971 ? ? 
metalc847  metalc ? ? ZG NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8378 0 HOH 9732 1_555 ? ? ? ? ? ? ? 2.794 ? ? 
metalc848  metalc ? ? ZG NA  .    NA    ? ? ? 1_555 OJ HOH .    O   ? ? 0 NA  8378 K HOH 8531 1_555 ? ? ? ? ? ? ? 2.649 ? ? 
metalc849  metalc ? ? ZG NA  .    NA    ? ? ? 1_555 OJ HOH .    O   ? ? 0 NA  8378 K HOH 8550 1_555 ? ? ? ? ? ? ? 2.688 ? ? 
metalc850  metalc ? ? BH NA  .    NA    ? ? ? 1_555 CJ HOH .    O   ? ? 0 NA  8381 0 HOH 8850 1_555 ? ? ? ? ? ? ? 2.520 ? ? 
metalc851  metalc ? ? CJ HOH .    O     ? ? ? 1_555 BI NA  .    NA  ? ? 0 HOH 9003 I NA  8346 1_555 ? ? ? ? ? ? ? 2.743 ? ? 
metalc852  metalc ? ? CJ HOH .    O     ? ? ? 1_555 SH MG  .    MG  ? ? 0 HOH 9450 A MG  8065 1_555 ? ? ? ? ? ? ? 2.166 ? ? 
metalc853  metalc ? ? CJ HOH .    O     ? ? ? 1_555 FI MG  .    MG  ? ? 0 HOH 9947 J MG  8069 1_555 ? ? ? ? ? ? ? 2.572 ? ? 
metalc854  metalc ? ? B  C   40   N3    ? ? ? 1_555 QH NA  .    NA  ? ? 9 C   40   9 NA  8351 1_555 ? ? ? ? ? ? ? 2.528 ? ? 
metalc855  metalc ? ? B  C   40   O2    ? ? ? 1_555 QH NA  .    NA  ? ? 9 C   40   9 NA  8351 1_555 ? ? ? ? ? ? ? 2.871 ? ? 
metalc856  metalc ? ? B  A   56   OP2   ? ? ? 1_555 PH MG  .    MG  ? ? 9 A   56   9 MG  8095 1_555 ? ? ? ? ? ? ? 2.172 ? ? 
metalc857  metalc ? ? B  A   57   OP2   ? ? ? 1_555 PH MG  .    MG  ? ? 9 A   57   9 MG  8095 1_555 ? ? ? ? ? ? ? 2.600 ? ? 
metalc858  metalc ? ? PH MG  .    MG    ? ? ? 1_555 DJ HOH .    O   ? ? 9 MG  8095 9 HOH 8509 1_555 ? ? ? ? ? ? ? 2.300 ? ? 
metalc859  metalc ? ? QH NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 9 NA  8351 9 HOH 8405 1_555 ? ? ? ? ? ? ? 2.573 ? ? 
metalc860  metalc ? ? RH NA  .    NA    ? ? ? 1_555 DJ HOH .    O   ? ? 9 NA  8383 9 HOH 8509 1_555 ? ? ? ? ? ? ? 2.883 ? ? 
metalc861  metalc ? ? C  PHE 201  O     ? ? ? 1_555 UH NA  .    NA  ? ? A PHE 201  A NA  8345 1_555 ? ? ? ? ? ? ? 2.405 ? ? 
metalc862  metalc ? ? C  HIS 208  O     ? ? ? 1_555 UH NA  .    NA  ? ? A HIS 208  A NA  8345 1_555 ? ? ? ? ? ? ? 2.534 ? ? 
metalc863  metalc ? ? SH MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? A MG  8065 A HOH 8523 1_555 ? ? ? ? ? ? ? 2.185 ? ? 
metalc864  metalc ? ? SH MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? A MG  8065 A HOH 8552 1_555 ? ? ? ? ? ? ? 2.151 ? ? 
metalc865  metalc ? ? SH MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? A MG  8065 A HOH 8603 1_555 ? ? ? ? ? ? ? 2.274 ? ? 
metalc866  metalc ? ? SH MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? A MG  8065 A HOH 8633 1_555 ? ? ? ? ? ? ? 2.110 ? ? 
metalc867  metalc ? ? TH MG  .    MG    ? ? ? 1_555 EJ HOH .    O   ? ? A MG  8105 A HOH 8629 1_555 ? ? ? ? ? ? ? 2.981 ? ? 
metalc868  metalc ? ? TH MG  .    MG    ? ? ? 1_555 AA ARG 4    NH1 ? ? A MG  8105 Y ARG 13   1_555 ? ? ? ? ? ? ? 2.970 ? ? 
metalc869  metalc ? ? TH MG  .    MG    ? ? ? 1_555 CK HOH .    O   ? ? A MG  8105 Y HOH 8421 1_555 ? ? ? ? ? ? ? 3.028 ? ? 
metalc870  metalc ? ? UH NA  .    NA    ? ? ? 1_555 EJ HOH .    O   ? ? A NA  8345 A HOH 8558 1_555 ? ? ? ? ? ? ? 2.692 ? ? 
metalc871  metalc ? ? UH NA  .    NA    ? ? ? 1_555 EJ HOH .    O   ? ? A NA  8345 A HOH 8602 1_555 ? ? ? ? ? ? ? 2.220 ? ? 
metalc872  metalc ? ? WH MG  .    MG    ? ? ? 1_555 FJ HOH .    O   ? ? B MG  8055 B HOH 8668 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc873  metalc ? ? E  ASP 45   OD1   ? ? ? 1_555 YH NA  .    NA  ? ? C ASP 45   C NA  8304 1_555 ? ? ? ? ? ? ? 2.576 ? ? 
metalc874  metalc ? ? E  THR 94   O     ? ? ? 1_555 YH NA  .    NA  ? ? C THR 94   C NA  8304 1_555 ? ? ? ? ? ? ? 2.961 ? ? 
metalc875  metalc ? ? E  LYS 96   O     ? ? ? 1_555 YH NA  .    NA  ? ? C LYS 96   C NA  8304 1_555 ? ? ? ? ? ? ? 2.647 ? ? 
metalc876  metalc ? ? J  LYS 150  O     ? ? ? 1_555 ZH NA  .    NA  ? ? H LYS 150  H NA  8309 1_555 ? ? ? ? ? ? ? 2.799 ? ? 
metalc877  metalc ? ? J  VAL 153  O     ? ? ? 1_555 ZH NA  .    NA  ? ? H VAL 153  H NA  8309 1_555 ? ? ? ? ? ? ? 2.788 ? ? 
metalc878  metalc ? ? J  PRO 155  O     ? ? ? 1_555 ZH NA  .    NA  ? ? H PRO 155  H NA  8309 1_555 ? ? ? ? ? ? ? 2.677 ? ? 
metalc879  metalc ? ? K  ARG 60   O     ? ? ? 1_555 BI NA  .    NA  ? ? I ARG 60   I NA  8346 1_555 ? ? ? ? ? ? ? 2.766 ? ? 
metalc880  metalc ? ? K  VAL 61   O     ? ? ? 1_555 BI NA  .    NA  ? ? I VAL 61   I NA  8346 1_555 ? ? ? ? ? ? ? 2.788 ? ? 
metalc881  metalc ? ? K  ILE 63   O     ? ? ? 1_555 BI NA  .    NA  ? ? I ILE 63   I NA  8346 1_555 ? ? ? ? ? ? ? 2.503 ? ? 
metalc882  metalc ? ? K  TYR 69   O     ? ? ? 1_555 BI NA  .    NA  ? ? I TYR 69   I NA  8346 1_555 ? ? ? ? ? ? ? 2.360 ? ? 
metalc883  metalc ? ? L  ASN 42   OD1   ? ? ? 1_555 FI MG  .    MG  ? ? J ASN 42   J MG  8069 1_555 ? ? ? ? ? ? ? 2.531 ? ? 
metalc884  metalc ? ? NJ HOH .    O     ? ? ? 1_555 FI MG  .    MG  ? ? J HOH 2121 J MG  8069 1_555 ? ? ? ? ? ? ? 1.976 ? ? 
metalc885  metalc ? ? NJ HOH .    O     ? ? ? 1_555 FI MG  .    MG  ? ? J HOH 7871 J MG  8069 1_555 ? ? ? ? ? ? ? 2.078 ? ? 
metalc886  metalc ? ? M  GLY 28   O     ? ? ? 1_555 GI NA  .    NA  ? ? K GLY 28   K NA  8380 1_555 ? ? ? ? ? ? ? 2.974 ? ? 
metalc887  metalc ? ? M  GLY 29   O     ? ? ? 1_555 GI NA  .    NA  ? ? K GLY 29   K NA  8380 1_555 ? ? ? ? ? ? ? 2.984 ? ? 
metalc888  metalc ? ? M  ALA 33   O     ? ? ? 1_555 GI NA  .    NA  ? ? K ALA 33   K NA  8380 1_555 ? ? ? ? ? ? ? 2.657 ? ? 
metalc889  metalc ? ? GI NA  .    NA    ? ? ? 1_555 OJ HOH .    O   ? ? K NA  8380 K HOH 8588 1_555 ? ? ? ? ? ? ? 2.351 ? ? 
metalc890  metalc ? ? N  ASN 106  OD1   ? ? ? 1_555 II NA  .    NA  ? ? L ASN 106  L NA  8347 1_555 ? ? ? ? ? ? ? 2.406 ? ? 
metalc891  metalc ? ? N  ASN 106  O     ? ? ? 1_555 II NA  .    NA  ? ? L ASN 106  L NA  8347 1_555 ? ? ? ? ? ? ? 2.729 ? ? 
metalc892  metalc ? ? N  PHE 109  O     ? ? ? 1_555 II NA  .    NA  ? ? L PHE 109  L NA  8347 1_555 ? ? ? ? ? ? ? 2.681 ? ? 
metalc893  metalc ? ? N  LEU 112  O     ? ? ? 1_555 II NA  .    NA  ? ? L LEU 112  L NA  8347 1_555 ? ? ? ? ? ? ? 2.564 ? ? 
metalc894  metalc ? ? II NA  .    NA    ? ? ? 1_555 PJ HOH .    O   ? ? L NA  8347 L HOH 8629 1_555 ? ? ? ? ? ? ? 2.487 ? ? 
metalc895  metalc ? ? P  HIS 40   ND1   ? ? ? 1_555 LI CD  .    CD  ? ? N HIS 40   N CD  8405 1_555 ? ? ? ? ? ? ? 2.577 ? ? 
metalc896  metalc ? ? RJ HOH .    O     ? ? ? 1_555 LI CD  .    CD  ? ? N HOH 5650 N CD  8405 1_555 ? ? ? ? ? ? ? 2.677 ? ? 
metalc897  metalc ? ? R  ASP 20   O     ? ? ? 1_555 NI NA  .    NA  ? ? P ASP 20   P NA  8348 1_555 ? ? ? ? ? ? ? 2.530 ? ? 
metalc898  metalc ? ? R  GLY 22   O     ? ? ? 1_555 NI NA  .    NA  ? ? P GLY 22   P NA  8348 1_555 ? ? ? ? ? ? ? 2.369 ? ? 
metalc899  metalc ? ? R  SER 24   OG    ? ? ? 1_555 NI NA  .    NA  ? ? P SER 24   P NA  8348 1_555 ? ? ? ? ? ? ? 2.945 ? ? 
metalc900  metalc ? ? R  SER 46   OG    ? ? ? 1_555 NI NA  .    NA  ? ? P SER 46   P NA  8348 1_555 ? ? ? ? ? ? ? 2.592 ? ? 
metalc901  metalc ? ? TJ HOH .    O     ? ? ? 1_555 NI NA  .    NA  ? ? P HOH 1795 P NA  8348 1_555 ? ? ? ? ? ? ? 2.568 ? ? 
metalc902  metalc ? ? TJ HOH .    O     ? ? ? 1_555 NI NA  .    NA  ? ? P HOH 5427 P NA  8348 1_555 ? ? ? ? ? ? ? 2.867 ? ? 
metalc903  metalc ? ? S  ASN 63   OD1   ? ? ? 1_555 PI NA  .    NA  ? ? Q ASN 63   Q NA  8386 1_555 ? ? ? ? ? ? ? 2.946 ? ? 
metalc904  metalc ? ? S  SER 70   O     ? ? ? 1_555 OI NA  .    NA  ? ? Q SER 70   Q NA  8337 1_555 ? ? ? ? ? ? ? 2.557 ? ? 
metalc905  metalc ? ? S  VAL 72   O     ? ? ? 1_555 OI NA  .    NA  ? ? Q VAL 72   Q NA  8337 1_555 ? ? ? ? ? ? ? 2.887 ? ? 
metalc906  metalc ? ? OI NA  .    NA    ? ? ? 1_555 UJ HOH .    O   ? ? Q NA  8337 Q HOH 8525 1_555 ? ? ? ? ? ? ? 2.696 ? ? 
metalc907  metalc ? ? T  HIS 7    NE2   ? ? ? 1_555 RI NA  .    NA  ? ? R HIS 7    R NA  8312 1_555 ? ? ? ? ? ? ? 2.438 ? ? 
metalc908  metalc ? ? T  GLU 61   OE2   ? ? ? 1_555 RI NA  .    NA  ? ? R GLU 61   R NA  8312 1_555 ? ? ? ? ? ? ? 2.281 ? ? 
metalc909  metalc ? ? T  GLU 61   OE1   ? ? ? 1_555 RI NA  .    NA  ? ? R GLU 61   R NA  8312 1_555 ? ? ? ? ? ? ? 2.652 ? ? 
metalc910  metalc ? ? RI NA  .    NA    ? ? ? 1_555 VJ HOH .    O   ? ? R NA  8312 R HOH 8322 1_555 ? ? ? ? ? ? ? 2.389 ? ? 
metalc911  metalc ? ? U  GLN 37   OE1   ? ? ? 1_555 SI MG  .    MG  ? ? S GLN 37   S MG  8073 1_555 ? ? ? ? ? ? ? 2.810 ? ? 
metalc912  metalc ? ? U  SER 94   OG    ? ? ? 1_555 TI NA  .    NA  ? ? S SER 94   S NA  8343 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc913  metalc ? ? U  ASN 95   OD1   ? ? ? 1_555 TI NA  .    NA  ? ? S ASN 95   S NA  8343 1_555 ? ? ? ? ? ? ? 2.579 ? ? 
metalc914  metalc ? ? U  ARG 111  O     ? ? ? 1_555 SI MG  .    MG  ? ? S ARG 111  S MG  8073 1_555 ? ? ? ? ? ? ? 2.814 ? ? 
metalc915  metalc ? ? U  LEU 112  O     ? ? ? 1_555 SI MG  .    MG  ? ? S LEU 112  S MG  8073 1_555 ? ? ? ? ? ? ? 2.617 ? ? 
metalc916  metalc ? ? U  SER 114  O     ? ? ? 1_555 SI MG  .    MG  ? ? S SER 114  S MG  8073 1_555 ? ? ? ? ? ? ? 2.300 ? ? 
metalc917  metalc ? ? U  ASP 117  O     ? ? ? 1_555 SI MG  .    MG  ? ? S ASP 117  S MG  8073 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc918  metalc ? ? WJ HOH .    O     ? ? ? 1_555 TI NA  .    NA  ? ? S HOH 1124 S NA  8343 1_555 ? ? ? ? ? ? ? 2.445 ? ? 
metalc919  metalc ? ? WJ HOH .    O     ? ? ? 1_555 SI MG  .    MG  ? ? S HOH 2868 S MG  8073 1_555 ? ? ? ? ? ? ? 2.834 ? ? 
metalc920  metalc ? ? V  CYS 6    SG    ? ? ? 1_555 UI CD  .    CD  ? ? T CYS 6    T CD  8401 1_555 ? ? ? ? ? ? ? 2.612 ? ? 
metalc921  metalc ? ? V  CYS 9    SG    ? ? ? 1_555 UI CD  .    CD  ? ? T CYS 9    T CD  8401 1_555 ? ? ? ? ? ? ? 2.660 ? ? 
metalc922  metalc ? ? V  CYS 32   SG    ? ? ? 1_555 UI CD  .    CD  ? ? T CYS 32   T CD  8401 1_555 ? ? ? ? ? ? ? 2.489 ? ? 
metalc923  metalc ? ? V  CYS 36   SG    ? ? ? 1_555 UI CD  .    CD  ? ? T CYS 36   T CD  8401 1_555 ? ? ? ? ? ? ? 2.481 ? ? 
metalc924  metalc ? ? Z  HIS 133  O     ? ? ? 1_555 VI MG  .    MG  ? ? X HIS 133  X MG  8109 1_555 ? ? ? ? ? ? ? 2.238 ? ? 
metalc925  metalc ? ? Z  LYS 136  O     ? ? ? 1_555 VI MG  .    MG  ? ? X LYS 136  X MG  8109 1_555 ? ? ? ? ? ? ? 2.573 ? ? 
metalc926  metalc ? ? Z  VAL 139  O     ? ? ? 1_555 VI MG  .    MG  ? ? X VAL 139  X MG  8109 1_555 ? ? ? ? ? ? ? 2.383 ? ? 
metalc927  metalc ? ? VI MG  .    MG    ? ? ? 1_555 BK HOH .    O   ? ? X MG  8109 X HOH 8562 1_555 ? ? ? ? ? ? ? 2.597 ? ? 
metalc928  metalc ? ? VI MG  .    MG    ? ? ? 1_555 BK HOH .    O   ? ? X MG  8109 X HOH 8584 1_555 ? ? ? ? ? ? ? 2.503 ? ? 
metalc929  metalc ? ? VI MG  .    MG    ? ? ? 1_555 BK HOH .    O   ? ? X MG  8109 X HOH 8619 1_555 ? ? ? ? ? ? ? 2.248 ? ? 
metalc930  metalc ? ? AA CYS 30   SG    ? ? ? 1_555 XI CD  .    CD  ? ? Y CYS 39   Y CD  8403 1_555 ? ? ? ? ? ? ? 2.539 ? ? 
metalc931  metalc ? ? AA CYS 33   SG    ? ? ? 1_555 XI CD  .    CD  ? ? Y CYS 42   Y CD  8403 1_555 ? ? ? ? ? ? ? 2.768 ? ? 
metalc932  metalc ? ? AA CYS 48   SG    ? ? ? 1_555 XI CD  .    CD  ? ? Y CYS 57   Y CD  8403 1_555 ? ? ? ? ? ? ? 2.482 ? ? 
metalc933  metalc ? ? AA CYS 51   SG    ? ? ? 1_555 XI CD  .    CD  ? ? Y CYS 60   Y CD  8403 1_555 ? ? ? ? ? ? ? 2.361 ? ? 
metalc934  metalc ? ? BA CYS 19   SG    ? ? ? 1_555 YI CD  .    CD  ? ? Z CYS 19   Z CD  8402 1_555 ? ? ? ? ? ? ? 2.527 ? ? 
metalc935  metalc ? ? BA CYS 22   SG    ? ? ? 1_555 YI CD  .    CD  ? ? Z CYS 22   Z CD  8402 1_555 ? ? ? ? ? ? ? 2.477 ? ? 
metalc936  metalc ? ? BA CYS 34   SG    ? ? ? 1_555 YI CD  .    CD  ? ? Z CYS 34   Z CD  8402 1_555 ? ? ? ? ? ? ? 2.514 ? ? 
metalc937  metalc ? ? BA CYS 37   SG    ? ? ? 1_555 YI CD  .    CD  ? ? Z CYS 37   Z CD  8402 1_555 ? ? ? ? ? ? ? 2.402 ? ? 
metalc938  metalc ? ? DA CYS 11   SG    ? ? ? 1_555 AJ CD  .    CD  ? ? 2 CYS 11   2 CD  8404 1_555 ? ? ? ? ? ? ? 2.510 ? ? 
metalc939  metalc ? ? DA CYS 14   SG    ? ? ? 1_555 AJ CD  .    CD  ? ? 2 CYS 14   2 CD  8404 1_555 ? ? ? ? ? ? ? 2.903 ? ? 
metalc940  metalc ? ? DA GLY 45   O     ? ? ? 1_555 ZI MG  .    MG  ? ? 2 GLY 45   2 MG  8078 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc941  metalc ? ? DA GLY 47   O     ? ? ? 1_555 ZI MG  .    MG  ? ? 2 GLY 47   2 MG  8078 1_555 ? ? ? ? ? ? ? 2.454 ? ? 
metalc942  metalc ? ? DA ASP 49   OD1   ? ? ? 1_555 ZI MG  .    MG  ? ? 2 ASP 49   2 MG  8078 1_555 ? ? ? ? ? ? ? 2.622 ? ? 
metalc943  metalc ? ? DA ASP 49   OD2   ? ? ? 1_555 ZI MG  .    MG  ? ? 2 ASP 49   2 MG  8078 1_555 ? ? ? ? ? ? ? 3.093 ? ? 
metalc944  metalc ? ? DA CYS 71   SG    ? ? ? 1_555 AJ CD  .    CD  ? ? 2 CYS 71   2 CD  8404 1_555 ? ? ? ? ? ? ? 2.425 ? ? 
metalc945  metalc ? ? DA CYS 74   SG    ? ? ? 1_555 AJ CD  .    CD  ? ? 2 CYS 74   2 CD  8404 1_555 ? ? ? ? ? ? ? 2.608 ? ? 
metalc946  metalc ? ? ZI MG  .    MG    ? ? ? 1_555 FK HOH .    O   ? ? 2 MG  8078 2 HOH 8575 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc947  metalc ? ? ZI MG  .    MG    ? ? ? 1_555 FK HOH .    O   ? ? 2 MG  8078 2 HOH 8576 1_555 ? ? ? ? ? ? ? 2.207 ? ? 
hydrog1    hydrog ? ? A  U   11   O4    ? ? ? 1_555 A  G   530  N2  ? ? 0 U   12   0 G   531  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? ? 
? 
hydrog2    hydrog ? ? A  G   12   N1    ? ? ? 1_555 A  C   529  N3  ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog3    hydrog ? ? A  G   12   N2    ? ? ? 1_555 A  C   529  O2  ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog4    hydrog ? ? A  G   12   O6    ? ? ? 1_555 A  C   529  N4  ? ? 0 G   13   0 C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog5    hydrog ? ? A  C   13   N3    ? ? ? 1_555 A  G   528  N1  ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog6    hydrog ? ? A  C   13   N4    ? ? ? 1_555 A  G   528  O6  ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog7    hydrog ? ? A  C   13   O2    ? ? ? 1_555 A  G   528  N2  ? ? 0 C   14   0 G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog8    hydrog ? ? A  C   14   N3    ? ? ? 1_555 A  G   527  N1  ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog9    hydrog ? ? A  C   14   N4    ? ? ? 1_555 A  G   527  O6  ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog10   hydrog ? ? A  C   14   O2    ? ? ? 1_555 A  G   527  N2  ? ? 0 C   15   0 G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog11   hydrog ? ? A  A   15   N1    ? ? ? 1_555 A  U   526  N3  ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog12   hydrog ? ? A  A   15   N6    ? ? ? 1_555 A  U   526  O4  ? ? 0 A   16   0 U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog13   hydrog ? ? A  G   16   N1    ? ? ? 1_555 A  U   525  O2  ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog14   hydrog ? ? A  G   16   O6    ? ? ? 1_555 A  U   525  N3  ? ? 0 G   17   0 U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog15   hydrog ? ? A  C   17   N3    ? ? ? 1_555 A  G   524  N1  ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog16   hydrog ? ? A  C   17   N4    ? ? ? 1_555 A  G   524  O6  ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog17   hydrog ? ? A  C   17   O2    ? ? ? 1_555 A  G   524  N2  ? ? 0 C   18   0 G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog18   hydrog ? ? A  U   18   N3    ? ? ? 1_555 A  A   523  N1  ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog19   hydrog ? ? A  U   18   O4    ? ? ? 1_555 A  A   523  N6  ? ? 0 U   19   0 A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog20   hydrog ? ? A  G   19   N1    ? ? ? 1_555 A  C   522  N3  ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog21   hydrog ? ? A  G   19   N2    ? ? ? 1_555 A  C   522  O2  ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog22   hydrog ? ? A  G   19   O6    ? ? ? 1_555 A  C   522  N4  ? ? 0 G   20   0 C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog23   hydrog ? ? A  G   20   N1    ? ? ? 1_555 A  U   521  O2  ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog24   hydrog ? ? A  G   20   O6    ? ? ? 1_555 A  U   521  N3  ? ? 0 G   21   0 U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog25   hydrog ? ? A  U   21   O2    ? ? ? 1_555 A  A   520  N6  ? ? 0 U   22   0 A   521  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     ? 
? 
hydrog26   hydrog ? ? A  G   22   N2    ? ? ? 1_555 A  A   519  N7  ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog27   hydrog ? ? A  G   22   N3    ? ? ? 1_555 A  A   519  N6  ? ? 0 G   23   0 A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog28   hydrog ? ? A  G   23   N2    ? ? ? 1_555 A  A   518  N7  ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog29   hydrog ? ? A  G   23   N3    ? ? ? 1_555 A  A   518  N6  ? ? 0 G   24   0 A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog30   hydrog ? ? A  A   24   N6    ? ? ? 1_555 A  G   517  N3  ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog31   hydrog ? ? A  A   24   N7    ? ? ? 1_555 A  G   517  N2  ? ? 0 A   25   0 G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog32   hydrog ? ? A  U   25   N3    ? ? ? 1_555 A  U   516  O2  ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ?     
? ? 
hydrog33   hydrog ? ? A  U   25   O4    ? ? ? 1_555 A  U   516  N3  ? ? 0 U   26   0 U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ?     
? ? 
hydrog34   hydrog ? ? A  U   26   N3    ? ? ? 1_555 A  A   515  N1  ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog35   hydrog ? ? A  U   26   O4    ? ? ? 1_555 A  A   515  N6  ? ? 0 U   27   0 A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog36   hydrog ? ? A  G   27   N1    ? ? ? 1_555 A  C   479  N3  ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog37   hydrog ? ? A  G   27   N2    ? ? ? 1_555 A  C   479  O2  ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog38   hydrog ? ? A  G   27   O6    ? ? ? 1_555 A  C   479  N4  ? ? 0 G   28   0 C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog39   hydrog ? ? A  C   28   N3    ? ? ? 1_555 A  G   478  N1  ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog40   hydrog ? ? A  C   28   N4    ? ? ? 1_555 A  G   478  O6  ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog41   hydrog ? ? A  C   28   O2    ? ? ? 1_555 A  G   478  N2  ? ? 0 C   29   0 G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog42   hydrog ? ? A  U   29   N3    ? ? ? 1_555 A  A   452  N7  ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog43   hydrog ? ? A  U   29   O2    ? ? ? 1_555 A  A   452  N6  ? ? 0 U   30   0 A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog44   hydrog ? ? A  G   31   N1    ? ? ? 1_555 A  C   450  N3  ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog45   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  C   450  O2  ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog46   hydrog ? ? A  G   31   O6    ? ? ? 1_555 A  C   450  N4  ? ? 0 G   32   0 C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog47   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  A   454  N1  ? ? 0 G   32   0 A   455  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog48   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  G   455  N3  ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ?     
? ? 
hydrog49   hydrog ? ? A  G   31   N3    ? ? ? 1_555 A  G   455  N2  ? ? 0 G   32   0 G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ?     
? ? 
hydrog50   hydrog ? ? A  G   32   N1    ? ? ? 1_555 A  C   449  N3  ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog51   hydrog ? ? A  G   32   N2    ? ? ? 1_555 A  C   449  O2  ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog52   hydrog ? ? A  G   32   O6    ? ? ? 1_555 A  C   449  N4  ? ? 0 G   33   0 C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog53   hydrog ? ? A  C   33   N3    ? ? ? 1_555 A  G   447  N1  ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog54   hydrog ? ? A  C   33   N4    ? ? ? 1_555 A  G   447  O6  ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog55   hydrog ? ? A  C   33   O2    ? ? ? 1_555 A  G   447  N2  ? ? 0 C   34   0 G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog56   hydrog ? ? A  U   34   N3    ? ? ? 1_555 A  A   446  N1  ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog57   hydrog ? ? A  U   34   O4    ? ? ? 1_555 A  A   446  N6  ? ? 0 U   35   0 A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog58   hydrog ? ? A  C   35   N3    ? ? ? 1_555 A  G   445  N1  ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog59   hydrog ? ? A  C   35   N4    ? ? ? 1_555 A  G   445  O6  ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog60   hydrog ? ? A  C   35   O2    ? ? ? 1_555 A  G   445  N2  ? ? 0 C   36   0 G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog61   hydrog ? ? A  C   35   O2    ? ? ? 1_555 A  A   673  N6  ? ? 0 C   36   0 A   674  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? 
? 
hydrog62   hydrog ? ? A  A   36   N1    ? ? ? 1_555 A  U   444  N3  ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog63   hydrog ? ? A  A   36   N6    ? ? ? 1_555 A  U   444  O4  ? ? 0 A   37   0 U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog64   hydrog ? ? A  G   37   N1    ? ? ? 1_555 A  C   443  N3  ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog65   hydrog ? ? A  G   37   N2    ? ? ? 1_555 A  C   443  O2  ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog66   hydrog ? ? A  G   37   O6    ? ? ? 1_555 A  C   443  N4  ? ? 0 G   38   0 C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog67   hydrog ? ? A  G   38   N1    ? ? ? 1_555 A  C   442  N3  ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog68   hydrog ? ? A  G   38   N2    ? ? ? 1_555 A  C   442  O2  ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog69   hydrog ? ? A  G   38   O6    ? ? ? 1_555 A  C   442  N4  ? ? 0 G   39   0 C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog70   hydrog ? ? A  C   39   N4    ? ? ? 1_555 A  A   440  N1  ? ? 0 C   40   0 A   441  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? 
? 
hydrog71   hydrog ? ? A  C   39   O2    ? ? ? 1_555 A  A   441  N6  ? ? 0 C   40   0 A   442  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? 
? 
hydrog72   hydrog ? ? A  G   40   N2    ? ? ? 1_555 A  A   150  N1  ? ? 0 G   41   0 A   151  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog73   hydrog ? ? A  G   40   N1    ? ? ? 1_555 A  C   439  N3  ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog74   hydrog ? ? A  G   40   N2    ? ? ? 1_555 A  C   439  O2  ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog75   hydrog ? ? A  G   40   O6    ? ? ? 1_555 A  C   439  N4  ? ? 0 G   41   0 C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog76   hydrog ? ? A  C   41   N3    ? ? ? 1_555 A  G   148  N1  ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog77   hydrog ? ? A  C   41   N4    ? ? ? 1_555 A  G   148  O6  ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog78   hydrog ? ? A  C   41   O2    ? ? ? 1_555 A  G   148  N2  ? ? 0 C   42   0 G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog79   hydrog ? ? A  U   42   N3    ? ? ? 1_555 A  A   147  N1  ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog80   hydrog ? ? A  U   42   O4    ? ? ? 1_555 A  A   147  N6  ? ? 0 U   43   0 A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog81   hydrog ? ? A  G   43   N2    ? ? ? 1_555 A  A   44   N1  ? ? 0 G   44   0 A   45   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog82   hydrog ? ? A  A   44   N6    ? ? ? 1_555 A  U   114  O4  ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     ? 
? 
hydrog83   hydrog ? ? A  A   44   N7    ? ? ? 1_555 A  U   114  N3  ? ? 0 A   45   0 U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     ? 
? 
hydrog84   hydrog ? ? A  G   46   N2    ? ? ? 1_555 A  A   112  N7  ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog85   hydrog ? ? A  G   46   N3    ? ? ? 1_555 A  A   112  N6  ? ? 0 G   47   0 A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog86   hydrog ? ? A  A   47   N6    ? ? ? 1_555 A  A   113  N7  ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ?     
? ? 
hydrog87   hydrog ? ? A  A   47   N7    ? ? ? 1_555 A  A   113  N6  ? ? 0 A   48   0 A   114  1_555 ? ? ? ? ? ? TYPE_2_PAIR ?     
? ? 
hydrog88   hydrog ? ? A  A   48   N6    ? ? ? 1_555 A  G   111  N3  ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog89   hydrog ? ? A  A   48   N7    ? ? ? 1_555 A  G   111  N2  ? ? 0 A   49   0 G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog90   hydrog ? ? A  G   49   N1    ? ? ? 1_555 A  C   110  N3  ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog91   hydrog ? ? A  G   49   N2    ? ? ? 1_555 A  C   110  O2  ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog92   hydrog ? ? A  G   49   O6    ? ? ? 1_555 A  C   110  N4  ? ? 0 G   50   0 C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog93   hydrog ? ? A  G   50   N1    ? ? ? 1_555 A  C   109  N3  ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog94   hydrog ? ? A  G   50   N2    ? ? ? 1_555 A  C   109  O2  ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog95   hydrog ? ? A  G   50   O6    ? ? ? 1_555 A  C   109  N4  ? ? 0 G   51   0 C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog96   hydrog ? ? A  G   50   N2    ? ? ? 1_555 A  U   120  O2  ? ? 0 G   51   0 U   121  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? ? 
? 
hydrog97   hydrog ? ? A  A   51   N1    ? ? ? 1_555 A  U   108  N3  ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog98   hydrog ? ? A  A   51   N6    ? ? ? 1_555 A  U   108  O4  ? ? 0 A   52   0 U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog99   hydrog ? ? A  C   52   N3    ? ? ? 1_555 A  G   65   N1  ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog100  hydrog ? ? A  C   52   N4    ? ? ? 1_555 A  G   65   O6  ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog101  hydrog ? ? A  C   52   O2    ? ? ? 1_555 A  G   65   N2  ? ? 0 C   53   0 G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog102  hydrog ? ? A  G   53   N1    ? ? ? 1_555 A  C   64   N3  ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog103  hydrog ? ? A  G   53   N2    ? ? ? 1_555 A  C   64   O2  ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog104  hydrog ? ? A  G   53   O6    ? ? ? 1_555 A  C   64   N4  ? ? 0 G   54   0 C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog105  hydrog ? ? A  G   53   N2    ? ? ? 1_555 A  A   68   N3  ? ? 0 G   54   0 A   69   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog106  hydrog ? ? A  U   54   N3    ? ? ? 1_555 A  G   63   O6  ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog107  hydrog ? ? A  U   54   O2    ? ? ? 1_555 A  G   63   N1  ? ? 0 U   55   0 G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog108  hydrog ? ? A  G   55   O6    ? ? ? 1_555 A  C   61   N4  ? ? 0 G   56   0 C   62   1_555 ? ? ? ? ? ? 'G-C PAIR' ?     ? 
? 
hydrog109  hydrog ? ? A  G   55   N1    ? ? ? 1_555 A  G   83   O6  ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ?     
? ? 
hydrog110  hydrog ? ? A  G   55   N2    ? ? ? 1_555 A  G   83   N7  ? ? 0 G   56   0 G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ?     
? ? 
hydrog111  hydrog ? ? A  C   56   N3    ? ? ? 1_555 A  G   88   N1  ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog112  hydrog ? ? A  C   56   N4    ? ? ? 1_555 A  G   88   O6  ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog113  hydrog ? ? A  C   56   O2    ? ? ? 1_555 A  G   88   N2  ? ? 0 C   57   0 G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog114  hydrog ? ? A  C   57   N3    ? ? ? 1_555 A  G   87   N1  ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog115  hydrog ? ? A  C   57   N4    ? ? ? 1_555 A  G   87   O6  ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog116  hydrog ? ? A  C   57   O2    ? ? ? 1_555 A  G   87   N2  ? ? 0 C   58   0 G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog117  hydrog ? ? A  A   58   N3    ? ? ? 1_555 A  A   59   N6  ? ? 0 A   59   0 A   60   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? ? 
? 
hydrog118  hydrog ? ? A  A   58   N1    ? ? ? 1_555 A  C   84   N4  ? ? 0 A   59   0 C   85   1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? ? 
? 
hydrog119  hydrog ? ? A  A   59   N1    ? ? ? 1_555 A  A   85   N6  ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ?     
? ? 
hydrog120  hydrog ? ? A  A   59   N6    ? ? ? 1_555 A  A   85   N1  ? ? 0 A   60   0 A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ?     
? ? 
hydrog121  hydrog ? ? A  G   60   N1    ? ? ? 1_555 A  C   84   N3  ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog122  hydrog ? ? A  G   60   N2    ? ? ? 1_555 A  C   84   O2  ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog123  hydrog ? ? A  G   60   O6    ? ? ? 1_555 A  C   84   N4  ? ? 0 G   61   0 C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog124  hydrog ? ? A  C   61   N3    ? ? ? 1_555 A  G   83   N1  ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog125  hydrog ? ? A  C   61   N4    ? ? ? 1_555 A  G   83   O6  ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog126  hydrog ? ? A  C   61   O2    ? ? ? 1_555 A  G   83   N2  ? ? 0 C   62   0 G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog127  hydrog ? ? A  U   62   N3    ? ? ? 1_555 A  A   69   N7  ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     ? 
? 
hydrog128  hydrog ? ? A  U   62   O4    ? ? ? 1_555 A  A   69   N6  ? ? 0 U   63   0 A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     ? 
? 
hydrog129  hydrog ? ? A  G   65   N2    ? ? ? 1_555 A  A   66   N1  ? ? 0 G   66   0 A   67   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog130  hydrog ? ? A  G   70   N1    ? ? ? 1_555 A  A   105  N1  ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ?     
? ? 
hydrog131  hydrog ? ? A  G   70   O6    ? ? ? 1_555 A  A   105  N6  ? ? 0 G   71   0 A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ?     
? ? 
hydrog132  hydrog ? ? A  G   70   N1    ? ? ? 1_555 A  U   106  O2  ? ? 0 G   71   0 U   107  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? ? 
? 
hydrog133  hydrog ? ? A  C   71   N3    ? ? ? 1_555 A  G   104  N1  ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog134  hydrog ? ? A  C   71   N4    ? ? ? 1_555 A  G   104  O6  ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog135  hydrog ? ? A  C   71   O2    ? ? ? 1_555 A  G   104  N2  ? ? 0 C   72   0 G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog136  hydrog ? ? A  C   72   N3    ? ? ? 1_555 A  G   103  N1  ? ? 0 C   73   0 G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog137  hydrog ? ? A  C   72   N4    ? ? ? 1_555 A  G   103  O6  ? ? 0 C   73   0 G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog138  hydrog ? ? A  C   72   O2    ? ? ? 1_555 A  G   103  N2  ? ? 0 C   73   0 G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog139  hydrog ? ? A  A   73   N1    ? ? ? 1_555 A  U   102  N3  ? ? 0 A   74   0 U   103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog140  hydrog ? ? A  A   73   N6    ? ? ? 1_555 A  U   102  O4  ? ? 0 A   74   0 U   103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog141  hydrog ? ? A  U   74   N3    ? ? ? 1_555 A  A   101  N1  ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog142  hydrog ? ? A  U   74   O4    ? ? ? 1_555 A  A   101  N6  ? ? 0 U   75   0 A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog143  hydrog ? ? A  G   75   N1    ? ? ? 1_555 A  C   100  N3  ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog144  hydrog ? ? A  G   75   N2    ? ? ? 1_555 A  C   100  O2  ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog145  hydrog ? ? A  G   75   O6    ? ? ? 1_555 A  C   100  N4  ? ? 0 G   76   0 C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog146  hydrog ? ? A  G   76   N1    ? ? ? 1_555 A  C   99   N3  ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog147  hydrog ? ? A  G   76   N2    ? ? ? 1_555 A  C   99   O2  ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog148  hydrog ? ? A  G   76   O6    ? ? ? 1_555 A  C   99   N4  ? ? 0 G   77   0 C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog149  hydrog ? ? A  G   77   N2    ? ? ? 1_555 A  A   98   N7  ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog150  hydrog ? ? A  G   77   N3    ? ? ? 1_555 A  A   98   N6  ? ? 0 G   78   0 A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog151  hydrog ? ? A  G   78   N2    ? ? ? 1_555 A  A   97   N7  ? ? 0 G   79   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog152  hydrog ? ? A  A   79   N3    ? ? ? 1_555 A  G   93   N2  ? ? 0 A   80   0 G   94   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog153  hydrog ? ? A  A   79   N6    ? ? ? 1_555 A  G   96   N3  ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog154  hydrog ? ? A  A   79   N7    ? ? ? 1_555 A  G   96   N2  ? ? 0 A   80   0 G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog155  hydrog ? ? A  G   80   N1    ? ? ? 1_555 A  C   92   N3  ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog156  hydrog ? ? A  G   80   N2    ? ? ? 1_555 A  C   92   O2  ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog157  hydrog ? ? A  G   80   O6    ? ? ? 1_555 A  C   92   N4  ? ? 0 G   81   0 C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog158  hydrog ? ? A  G   80   N2    ? ? ? 1_555 A  A   97   N3  ? ? 0 G   81   0 A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog159  hydrog ? ? A  C   81   N3    ? ? ? 1_555 A  G   91   N1  ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog160  hydrog ? ? A  C   81   N4    ? ? ? 1_555 A  G   91   O6  ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog161  hydrog ? ? A  C   81   O2    ? ? ? 1_555 A  G   91   N2  ? ? 0 C   82   0 G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog162  hydrog ? ? A  C   82   N3    ? ? ? 1_555 A  G   90   N1  ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog163  hydrog ? ? A  C   82   N4    ? ? ? 1_555 A  G   90   O6  ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog164  hydrog ? ? A  C   82   O2    ? ? ? 1_555 A  G   90   N2  ? ? 0 C   83   0 G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog165  hydrog ? ? A  G   115  N1    ? ? ? 1_555 A  C   123  N3  ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog166  hydrog ? ? A  G   115  N2    ? ? ? 1_555 A  C   123  O2  ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog167  hydrog ? ? A  G   115  O6    ? ? ? 1_555 A  C   123  N4  ? ? 0 G   116  0 C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog168  hydrog ? ? A  A   116  N1    ? ? ? 1_555 A  U   122  N3  ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog169  hydrog ? ? A  A   116  N6    ? ? ? 1_555 A  U   122  O4  ? ? 0 A   117  0 U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog170  hydrog ? ? A  G   117  N1    ? ? ? 1_555 A  C   121  N3  ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog171  hydrog ? ? A  G   117  N2    ? ? ? 1_555 A  C   121  O2  ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog172  hydrog ? ? A  G   117  O6    ? ? ? 1_555 A  C   121  N4  ? ? 0 G   118  0 C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog173  hydrog ? ? A  U   124  N3    ? ? ? 1_555 A  A   128  N1  ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog174  hydrog ? ? A  U   124  O4    ? ? ? 1_555 A  A   128  N6  ? ? 0 U   125  0 A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog175  hydrog ? ? A  C   129  N4    ? ? ? 1_555 A  A   143  N7  ? ? 0 C   130  0 A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? 
? 
hydrog176  hydrog ? ? A  A   130  N6    ? ? ? 1_555 A  G   146  N7  ? ? 0 A   131  0 G   147  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog177  hydrog ? ? A  A   131  N1    ? ? ? 1_555 A  U   145  N3  ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog178  hydrog ? ? A  A   131  N6    ? ? ? 1_555 A  U   145  O4  ? ? 0 A   132  0 U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog179  hydrog ? ? A  U   132  N3    ? ? ? 1_555 A  A   144  N1  ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog180  hydrog ? ? A  U   132  O4    ? ? ? 1_555 A  A   144  N6  ? ? 0 U   133  0 A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog181  hydrog ? ? A  U   133  O4    ? ? ? 1_555 A  C   140  N4  ? ? 0 U   134  0 C   141  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? ? 
? 
hydrog182  hydrog ? ? A  U   133  N3    ? ? ? 1_555 A  A   143  N1  ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog183  hydrog ? ? A  U   133  O4    ? ? ? 1_555 A  A   143  N6  ? ? 0 U   134  0 A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog184  hydrog ? ? A  G   134  N1    ? ? ? 1_555 A  C   142  N3  ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog185  hydrog ? ? A  G   134  N2    ? ? ? 1_555 A  C   142  O2  ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog186  hydrog ? ? A  G   134  O6    ? ? ? 1_555 A  C   142  N4  ? ? 0 G   135  0 C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog187  hydrog ? ? A  C   135  N3    ? ? ? 1_555 A  G   141  N1  ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog188  hydrog ? ? A  C   135  N4    ? ? ? 1_555 A  G   141  O6  ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog189  hydrog ? ? A  C   135  O2    ? ? ? 1_555 A  G   141  N2  ? ? 0 C   136  0 G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog190  hydrog ? ? A  U   136  O2    ? ? ? 1_555 A  G   139  N1  ? ? 0 U   137  0 G   140  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? ? 
? 
hydrog191  hydrog ? ? A  C   140  O2    ? ? ? 1_555 A  C   142  N4  ? ? 0 C   141  0 C   143  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? ? 
? 
hydrog192  hydrog ? ? A  C   140  N3    ? ? ? 1_555 A  A   143  N6  ? ? 0 C   141  0 A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? 
? 
hydrog193  hydrog ? ? A  A   151  N1    ? ? ? 1_555 A  G   184  N1  ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ?     
? ? 
hydrog194  hydrog ? ? A  A   151  N6    ? ? ? 1_555 A  G   184  O6  ? ? 0 A   152  0 G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ?     
? ? 
hydrog195  hydrog ? ? A  C   152  N3    ? ? ? 1_555 A  G   183  N1  ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog196  hydrog ? ? A  C   152  N4    ? ? ? 1_555 A  G   183  O6  ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog197  hydrog ? ? A  C   152  O2    ? ? ? 1_555 A  G   183  N2  ? ? 0 C   153  0 G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog198  hydrog ? ? A  C   153  N3    ? ? ? 1_555 A  G   181  N1  ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog199  hydrog ? ? A  C   153  N4    ? ? ? 1_555 A  G   181  O6  ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog200  hydrog ? ? A  C   153  O2    ? ? ? 1_555 A  G   181  N2  ? ? 0 C   154  0 G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog201  hydrog ? ? A  C   154  N3    ? ? ? 1_555 A  G   180  N1  ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog202  hydrog ? ? A  C   154  N4    ? ? ? 1_555 A  G   180  O6  ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog203  hydrog ? ? A  C   154  O2    ? ? ? 1_555 A  G   180  N2  ? ? 0 C   155  0 G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog204  hydrog ? ? A  C   155  N3    ? ? ? 1_555 A  G   179  N1  ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog205  hydrog ? ? A  C   155  N4    ? ? ? 1_555 A  G   179  O6  ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog206  hydrog ? ? A  C   155  O2    ? ? ? 1_555 A  G   179  N2  ? ? 0 C   156  0 G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog207  hydrog ? ? A  G   156  N1    ? ? ? 1_555 A  C   178  N3  ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog208  hydrog ? ? A  G   156  N2    ? ? ? 1_555 A  C   178  O2  ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog209  hydrog ? ? A  G   156  O6    ? ? ? 1_555 A  C   178  N4  ? ? 0 G   157  0 C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog210  hydrog ? ? A  G   156  N2    ? ? ? 1_555 A  A   1469 N1  ? ? 0 G   157  0 A   1470 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog211  hydrog ? ? A  A   157  N1    ? ? ? 1_555 A  U   177  N3  ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog212  hydrog ? ? A  A   157  N6    ? ? ? 1_555 A  U   177  O4  ? ? 0 A   158  0 U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog213  hydrog ? ? A  G   158  N2    ? ? ? 1_555 A  A   176  N7  ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog214  hydrog ? ? A  G   158  N3    ? ? ? 1_555 A  A   176  N6  ? ? 0 G   159  0 A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog215  hydrog ? ? A  A   159  N6    ? ? ? 1_555 A  U   175  O2  ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog216  hydrog ? ? A  A   159  N7    ? ? ? 1_555 A  U   175  N3  ? ? 0 A   160  0 U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog217  hydrog ? ? A  A   160  N6    ? ? ? 1_555 A  A   173  N7  ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ?     
? ? 
hydrog218  hydrog ? ? A  A   160  N7    ? ? ? 1_555 A  A   173  N6  ? ? 0 A   161  0 A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ?     
? ? 
hydrog219  hydrog ? ? A  A   160  N3    ? ? ? 1_555 A  G   891  N2  ? ? 0 A   161  0 G   892  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog220  hydrog ? ? A  C   161  N4    ? ? ? 1_555 A  C   172  O2  ? ? 0 C   162  0 C   173  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? ? 
? 
hydrog221  hydrog ? ? A  C   161  O2    ? ? ? 1_555 A  C   892  N4  ? ? 0 C   162  0 C   893  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? ? 
? 
hydrog222  hydrog ? ? A  U   162  N3    ? ? ? 1_555 A  U   171  O2  ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ?     
? ? 
hydrog223  hydrog ? ? A  U   162  O4    ? ? ? 1_555 A  U   171  N3  ? ? 0 U   163  0 U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ?     
? ? 
hydrog224  hydrog ? ? A  G   163  N1    ? ? ? 1_555 A  C   170  N3  ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog225  hydrog ? ? A  G   163  N2    ? ? ? 1_555 A  C   170  O2  ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog226  hydrog ? ? A  G   163  O6    ? ? ? 1_555 A  C   170  N4  ? ? 0 G   164  0 C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog227  hydrog ? ? A  G   163  N2    ? ? ? 1_555 A  A   221  N3  ? ? 0 G   164  0 A   222  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog228  hydrog ? ? A  A   164  N3    ? ? ? 1_555 A  G   220  N2  ? ? 0 A   165  0 G   221  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog229  hydrog ? ? A  A   165  N1    ? ? ? 1_555 A  G   923  N2  ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ?     
? ? 
hydrog230  hydrog ? ? A  A   165  N6    ? ? ? 1_555 A  G   923  N3  ? ? 0 A   166  0 G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ?     
? ? 
hydrog231  hydrog ? ? A  C   167  N3    ? ? ? 1_555 A  G   218  N1  ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog232  hydrog ? ? A  C   167  N4    ? ? ? 1_555 A  G   218  O6  ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog233  hydrog ? ? A  C   167  O2    ? ? ? 1_555 A  G   218  N2  ? ? 0 C   168  0 G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog234  hydrog ? ? A  U   169  N3    ? ? ? 1_555 A  G   220  O6  ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ?     
? ? 
hydrog235  hydrog ? ? A  U   169  O4    ? ? ? 1_555 A  G   220  N1  ? ? 0 U   170  0 G   221  1_555 ? ? ? ? ? ? TYPE_27_PAIR ?     
? ? 
hydrog236  hydrog ? ? A  C   170  O2    ? ? ? 1_555 A  G   220  N1  ? ? 0 C   171  0 G   221  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     ? 
? 
hydrog237  hydrog ? ? A  G   174  N2    ? ? ? 1_555 A  U   175  O4  ? ? 0 G   175  0 U   176  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? ? 
? 
hydrog238  hydrog ? ? A  G   184  N2    ? ? ? 1_555 A  A   438  N1  ? ? 0 G   185  0 A   439  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog239  hydrog ? ? A  G   189  N2    ? ? ? 1_555 A  A   434  N7  ? ? 0 G   190  0 A   435  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog240  hydrog ? ? A  A   190  N6    ? ? ? 1_555 A  A   235  N3  ? ? 0 A   191  0 A   236  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? ? 
? 
hydrog241  hydrog ? ? A  A   190  N6    ? ? ? 1_555 A  U   433  O2  ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog242  hydrog ? ? A  A   190  N7    ? ? ? 1_555 A  U   433  N3  ? ? 0 A   191  0 U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog243  hydrog ? ? A  A   191  N6    ? ? ? 1_555 A  G   202  N3  ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog244  hydrog ? ? A  A   191  N7    ? ? ? 1_555 A  G   202  N2  ? ? 0 A   192  0 G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog245  hydrog ? ? A  A   192  N3    ? ? ? 1_555 A  G   412  N2  ? ? 0 A   193  0 G   413  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog246  hydrog ? ? A  A   193  N1    ? ? ? 1_555 A  U   201  N3  ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog247  hydrog ? ? A  A   193  N6    ? ? ? 1_555 A  U   201  O4  ? ? 0 A   194  0 U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog248  hydrog ? ? A  C   194  N3    ? ? ? 1_555 A  G   200  N1  ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog249  hydrog ? ? A  C   194  N4    ? ? ? 1_555 A  G   200  O6  ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog250  hydrog ? ? A  C   194  O2    ? ? ? 1_555 A  G   200  N2  ? ? 0 C   195  0 G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog251  hydrog ? ? A  G   195  N2    ? ? ? 1_555 A  A   198  N7  ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog252  hydrog ? ? A  G   195  N3    ? ? ? 1_555 A  A   198  N6  ? ? 0 G   196  0 A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog253  hydrog ? ? A  G   195  N1    ? ? ? 1_555 A  U   424  O2  ? ? 0 G   196  0 U   425  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? ? 
? 
hydrog254  hydrog ? ? A  A   197  N1    ? ? ? 1_555 A  G   415  N2  ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ?     
? ? 
hydrog255  hydrog ? ? A  A   197  N6    ? ? ? 1_555 A  G   415  N3  ? ? 0 A   198  0 G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ?     
? ? 
hydrog256  hydrog ? ? A  A   203  N1    ? ? ? 1_555 A  A   435  N6  ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ?     
? ? 
hydrog257  hydrog ? ? A  A   203  N6    ? ? ? 1_555 A  A   435  N1  ? ? 0 A   204  0 A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ?     
? ? 
hydrog258  hydrog ? ? A  U   204  N3    ? ? ? 1_555 A  A   436  N1  ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog259  hydrog ? ? A  U   204  O2    ? ? ? 1_555 A  A   436  N6  ? ? 0 U   205  0 A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? ? 
hydrog260  hydrog ? ? A  G   205  N1    ? ? ? 1_555 A  U   232  O2  ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog261  hydrog ? ? A  G   205  O6    ? ? ? 1_555 A  U   232  N3  ? ? 0 G   206  0 U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog262  hydrog ? ? A  U   206  N3    ? ? ? 1_555 A  A   231  N1  ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog263  hydrog ? ? A  U   206  O4    ? ? ? 1_555 A  A   231  N6  ? ? 0 U   207  0 A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog264  hydrog ? ? A  C   207  N3    ? ? ? 1_555 A  G   230  N1  ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog265  hydrog ? ? A  C   207  N4    ? ? ? 1_555 A  G   230  O6  ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog266  hydrog ? ? A  C   207  O2    ? ? ? 1_555 A  G   230  N2  ? ? 0 C   208  0 G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog267  hydrog ? ? A  G   208  N1    ? ? ? 1_555 A  C   229  N3  ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog268  hydrog ? ? A  G   208  N2    ? ? ? 1_555 A  C   229  O2  ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog269  hydrog ? ? A  G   208  O6    ? ? ? 1_555 A  C   229  N4  ? ? 0 G   209  0 C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog270  hydrog ? ? A  U   209  N3    ? ? ? 1_555 A  G   228  O6  ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog271  hydrog ? ? A  U   209  O2    ? ? ? 1_555 A  G   228  N1  ? ? 0 U   210  0 G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog272  hydrog ? ? A  U   210  O2    ? ? ? 1_555 A  C   227  N4  ? ? 0 U   211  0 C   228  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? ? 
? 
hydrog273  hydrog ? ? A  A   211  N6    ? ? ? 1_555 A  A   226  N7  ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ?     
? ? 
hydrog274  hydrog ? ? A  A   211  N7    ? ? ? 1_555 A  A   226  N6  ? ? 0 A   212  0 A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ?     
? ? 
hydrog275  hydrog ? ? A  G   212  N2    ? ? ? 1_555 A  U   213  O4  ? ? 0 G   213  0 U   214  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? ? 
? 
hydrog276  hydrog ? ? A  U   213  N3    ? ? ? 1_555 A  A   225  N7  ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog277  hydrog ? ? A  U   213  O2    ? ? ? 1_555 A  A   225  N6  ? ? 0 U   214  0 A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog278  hydrog ? ? A  A   214  N6    ? ? ? 1_555 A  G   224  N3  ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog279  hydrog ? ? A  A   214  N7    ? ? ? 1_555 A  G   224  N2  ? ? 0 A   215  0 G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog280  hydrog ? ? A  A   215  N1    ? ? ? 1_555 A  U   223  N3  ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog281  hydrog ? ? A  A   215  N6    ? ? ? 1_555 A  U   223  O4  ? ? 0 A   216  0 U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog282  hydrog ? ? A  C   216  N3    ? ? ? 1_555 A  G   222  N1  ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog283  hydrog ? ? A  C   216  N4    ? ? ? 1_555 A  G   222  O6  ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog284  hydrog ? ? A  C   216  O2    ? ? ? 1_555 A  G   222  N2  ? ? 0 C   217  0 G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog285  hydrog ? ? A  C   217  O2    ? ? ? 1_555 A  A   221  N6  ? ? 0 C   218  0 A   222  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? 
? 
hydrog286  hydrog ? ? A  G   230  N2    ? ? ? 1_555 A  A   665  N3  ? ? 0 G   231  0 A   666  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog287  hydrog ? ? A  G   236  N1    ? ? ? 1_555 A  C   432  N3  ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog288  hydrog ? ? A  G   236  N2    ? ? ? 1_555 A  C   432  O2  ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog289  hydrog ? ? A  G   236  O6    ? ? ? 1_555 A  C   432  N4  ? ? 0 G   237  0 C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog290  hydrog ? ? A  C   237  N3    ? ? ? 1_555 A  G   431  N1  ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog291  hydrog ? ? A  C   237  N4    ? ? ? 1_555 A  G   431  O6  ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog292  hydrog ? ? A  C   237  O2    ? ? ? 1_555 A  G   431  N2  ? ? 0 C   238  0 G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog293  hydrog ? ? A  C   238  N3    ? ? ? 1_555 A  G   430  N1  ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog294  hydrog ? ? A  C   238  N4    ? ? ? 1_555 A  G   430  O6  ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog295  hydrog ? ? A  C   238  O2    ? ? ? 1_555 A  G   430  N2  ? ? 0 C   239  0 G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog296  hydrog ? ? A  C   239  N3    ? ? ? 1_555 A  G   378  N1  ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog297  hydrog ? ? A  C   239  N4    ? ? ? 1_555 A  G   378  O6  ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog298  hydrog ? ? A  C   239  O2    ? ? ? 1_555 A  G   378  N2  ? ? 0 C   240  0 G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog299  hydrog ? ? A  A   240  N6    ? ? ? 1_555 A  U   269  O2  ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog300  hydrog ? ? A  A   240  N7    ? ? ? 1_555 A  U   269  N3  ? ? 0 A   241  0 U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog301  hydrog ? ? A  A   241  N6    ? ? ? 1_555 A  G   268  N3  ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog302  hydrog ? ? A  A   241  N7    ? ? ? 1_555 A  G   268  N2  ? ? 0 A   242  0 G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog303  hydrog ? ? A  A   242  N6    ? ? ? 1_555 A  U   267  O2  ? ? 0 A   243  0 U   268  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     ? 
? 
hydrog304  hydrog ? ? A  A   242  N3    ? ? ? 1_555 A  G   273  N2  ? ? 0 A   243  0 G   274  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog305  hydrog ? ? A  C   243  N3    ? ? ? 1_555 A  G   266  N1  ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog306  hydrog ? ? A  C   243  N4    ? ? ? 1_555 A  G   266  O6  ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog307  hydrog ? ? A  C   243  O2    ? ? ? 1_555 A  G   266  N2  ? ? 0 C   244  0 G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog308  hydrog ? ? A  C   244  N3    ? ? ? 1_555 A  G   265  N1  ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog309  hydrog ? ? A  C   244  N4    ? ? ? 1_555 A  G   265  O6  ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog310  hydrog ? ? A  C   244  O2    ? ? ? 1_555 A  G   265  N2  ? ? 0 C   245  0 G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog311  hydrog ? ? A  G   245  N2    ? ? ? 1_555 A  U   264  O4  ? ? 0 G   246  0 U   265  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? ? 
? 
hydrog312  hydrog ? ? A  A   246  N6    ? ? ? 1_555 A  G   263  N3  ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog313  hydrog ? ? A  A   246  N7    ? ? ? 1_555 A  G   263  N2  ? ? 0 A   247  0 G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog314  hydrog ? ? A  A   247  N1    ? ? ? 1_555 A  U   264  N3  ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog315  hydrog ? ? A  A   247  N6    ? ? ? 1_555 A  U   264  O4  ? ? 0 A   248  0 U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog316  hydrog ? ? A  G   248  N1    ? ? ? 1_555 A  C   259  N3  ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog317  hydrog ? ? A  G   248  N2    ? ? ? 1_555 A  C   259  O2  ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog318  hydrog ? ? A  G   248  O6    ? ? ? 1_555 A  C   259  N4  ? ? 0 G   249  0 C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog319  hydrog ? ? A  C   249  N3    ? ? ? 1_555 A  G   258  N1  ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog320  hydrog ? ? A  C   249  N4    ? ? ? 1_555 A  G   258  O6  ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog321  hydrog ? ? A  C   249  O2    ? ? ? 1_555 A  G   258  N2  ? ? 0 C   250  0 G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog322  hydrog ? ? A  C   250  N3    ? ? ? 1_555 A  G   257  N1  ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog323  hydrog ? ? A  C   250  N4    ? ? ? 1_555 A  G   257  O6  ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog324  hydrog ? ? A  C   250  O2    ? ? ? 1_555 A  G   257  N2  ? ? 0 C   251  0 G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog325  hydrog ? ? A  C   251  N3    ? ? ? 1_555 A  G   256  N1  ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog326  hydrog ? ? A  C   251  N4    ? ? ? 1_555 A  G   256  O6  ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog327  hydrog ? ? A  C   251  O2    ? ? ? 1_555 A  G   256  N2  ? ? 0 C   252  0 G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog328  hydrog ? ? A  U   252  O2    ? ? ? 1_555 A  C   255  N4  ? ? 0 U   253  0 C   256  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? ? 
? 
hydrog329  hydrog ? ? A  C   270  N4    ? ? ? 1_555 A  A   377  N1  ? ? 0 C   271  0 A   378  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? 
? 
hydrog330  hydrog ? ? A  G   272  N1    ? ? ? 1_555 A  C   376  N3  ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog331  hydrog ? ? A  G   272  N2    ? ? ? 1_555 A  C   376  O2  ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog332  hydrog ? ? A  G   272  O6    ? ? ? 1_555 A  C   376  N4  ? ? 0 G   273  0 C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog333  hydrog ? ? A  G   273  N1    ? ? ? 1_555 A  C   375  N3  ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog334  hydrog ? ? A  G   273  N2    ? ? ? 1_555 A  C   375  O2  ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog335  hydrog ? ? A  G   273  O6    ? ? ? 1_555 A  C   375  N4  ? ? 0 G   274  0 C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog336  hydrog ? ? A  G   274  N1    ? ? ? 1_555 A  U   373  O2  ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog337  hydrog ? ? A  G   274  O6    ? ? ? 1_555 A  U   373  N3  ? ? 0 G   275  0 U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog338  hydrog ? ? A  C   275  N3    ? ? ? 1_555 A  G   372  N1  ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog339  hydrog ? ? A  C   275  N4    ? ? ? 1_555 A  G   372  O6  ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog340  hydrog ? ? A  C   275  O2    ? ? ? 1_555 A  G   372  N2  ? ? 0 C   276  0 G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog341  hydrog ? ? A  U   276  N3    ? ? ? 1_555 A  A   371  N1  ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog342  hydrog ? ? A  U   276  O4    ? ? ? 1_555 A  A   371  N6  ? ? 0 U   277  0 A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog343  hydrog ? ? A  A   277  N1    ? ? ? 1_555 A  U   370  N3  ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog344  hydrog ? ? A  A   277  N6    ? ? ? 1_555 A  U   370  O4  ? ? 0 A   278  0 U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog345  hydrog ? ? A  C   278  N3    ? ? ? 1_555 A  G   369  N1  ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog346  hydrog ? ? A  C   278  N4    ? ? ? 1_555 A  G   369  O6  ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog347  hydrog ? ? A  C   278  O2    ? ? ? 1_555 A  G   369  N2  ? ? 0 C   279  0 G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog348  hydrog ? ? A  C   279  N3    ? ? ? 1_555 A  G   368  N1  ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog349  hydrog ? ? A  C   279  N4    ? ? ? 1_555 A  G   368  O6  ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog350  hydrog ? ? A  C   279  O2    ? ? ? 1_555 A  G   368  N2  ? ? 0 C   280  0 G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog351  hydrog ? ? A  U   280  O2    ? ? ? 1_555 A  C   367  N4  ? ? 0 U   281  0 C   368  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? ? 
? 
hydrog352  hydrog ? ? A  C   281  O2    ? ? ? 1_555 A  C   367  N4  ? ? 0 C   282  0 C   368  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? ? 
? 
hydrog353  hydrog ? ? A  A   284  N6    ? ? ? 1_555 A  G   366  N3  ? ? 0 A   285  0 G   367  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog354  hydrog ? ? A  U   285  N3    ? ? ? 1_555 A  U   365  O2  ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ?     
? ? 
hydrog355  hydrog ? ? A  U   285  O4    ? ? ? 1_555 A  U   365  N3  ? ? 0 U   286  0 U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ?     
? ? 
hydrog356  hydrog ? ? A  C   286  N3    ? ? ? 1_555 A  G   364  N1  ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog357  hydrog ? ? A  C   286  N4    ? ? ? 1_555 A  G   364  O6  ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog358  hydrog ? ? A  C   286  O2    ? ? ? 1_555 A  G   364  N2  ? ? 0 C   287  0 G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog359  hydrog ? ? A  G   288  N1    ? ? ? 1_555 A  A   362  N1  ? ? 0 G   289  0 A   363  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog360  hydrog ? ? A  C   289  N3    ? ? ? 1_555 A  G   361  N1  ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog361  hydrog ? ? A  C   289  N4    ? ? ? 1_555 A  G   361  O6  ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog362  hydrog ? ? A  C   289  O2    ? ? ? 1_555 A  G   361  N2  ? ? 0 C   290  0 G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog363  hydrog ? ? A  C   290  N3    ? ? ? 1_555 A  C   360  N4  ? ? 0 C   291  0 C   361  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? ? 
? 
hydrog364  hydrog ? ? A  G   291  N2    ? ? ? 1_555 A  A   359  N7  ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog365  hydrog ? ? A  G   291  N3    ? ? ? 1_555 A  A   359  N6  ? ? 0 G   292  0 A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog366  hydrog ? ? A  A   292  N6    ? ? ? 1_555 A  U   358  O2  ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog367  hydrog ? ? A  A   292  N7    ? ? ? 1_555 A  U   358  N3  ? ? 0 A   293  0 U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog368  hydrog ? ? A  C   294  N4    ? ? ? 1_555 A  C   355  O2  ? ? 0 C   295  0 C   356  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? ? 
? 
hydrog369  hydrog ? ? A  G   295  N1    ? ? ? 1_555 A  C   354  N3  ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog370  hydrog ? ? A  G   295  N2    ? ? ? 1_555 A  C   354  O2  ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog371  hydrog ? ? A  G   295  O6    ? ? ? 1_555 A  C   354  N4  ? ? 0 G   296  0 C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog372  hydrog ? ? A  U   296  N3    ? ? ? 1_555 A  A   353  N1  ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog373  hydrog ? ? A  U   296  O4    ? ? ? 1_555 A  A   353  N6  ? ? 0 U   297  0 A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog374  hydrog ? ? A  C   297  N3    ? ? ? 1_555 A  G   352  N1  ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog375  hydrog ? ? A  C   297  N4    ? ? ? 1_555 A  G   352  O6  ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog376  hydrog ? ? A  C   297  O2    ? ? ? 1_555 A  G   352  N2  ? ? 0 C   298  0 G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog377  hydrog ? ? A  U   298  N3    ? ? ? 1_555 A  A   351  N1  ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog378  hydrog ? ? A  U   298  O4    ? ? ? 1_555 A  A   351  N6  ? ? 0 U   299  0 A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog379  hydrog ? ? A  C   299  N3    ? ? ? 1_555 A  G   350  N1  ? ? 0 C   300  0 G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog380  hydrog ? ? A  C   299  N4    ? ? ? 1_555 A  G   350  O6  ? ? 0 C   300  0 G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog381  hydrog ? ? A  C   299  O2    ? ? ? 1_555 A  G   350  N2  ? ? 0 C   300  0 G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog382  hydrog ? ? A  G   300  N1    ? ? ? 1_555 A  C   349  N3  ? ? 0 G   301  0 C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog383  hydrog ? ? A  G   300  N2    ? ? ? 1_555 A  C   349  O2  ? ? 0 G   301  0 C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog384  hydrog ? ? A  G   300  O6    ? ? ? 1_555 A  C   349  N4  ? ? 0 G   301  0 C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog385  hydrog ? ? A  A   301  N1    ? ? ? 1_555 A  U   348  N3  ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog386  hydrog ? ? A  A   301  N6    ? ? ? 1_555 A  U   348  O4  ? ? 0 A   302  0 U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog387  hydrog ? ? A  C   302  N3    ? ? ? 1_555 A  C   347  N4  ? ? 0 C   303  0 C   348  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? ? 
? 
hydrog388  hydrog ? ? A  G   303  N2    ? ? ? 1_555 A  A   346  N7  ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog389  hydrog ? ? A  G   303  N3    ? ? ? 1_555 A  A   346  N6  ? ? 0 G   304  0 A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog390  hydrog ? ? A  A   304  N6    ? ? ? 1_555 A  G   344  O6  ? ? 0 A   305  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog391  hydrog ? ? A  A   305  N6    ? ? ? 1_555 A  G   344  O6  ? ? 0 A   306  0 G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog392  hydrog ? ? A  G   306  N1    ? ? ? 1_555 A  C   322  N3  ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog393  hydrog ? ? A  G   306  N2    ? ? ? 1_555 A  C   322  O2  ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog394  hydrog ? ? A  G   306  O6    ? ? ? 1_555 A  C   322  N4  ? ? 0 G   307  0 C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog395  hydrog ? ? A  U   307  N3    ? ? ? 1_555 A  A   338  N1  ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog396  hydrog ? ? A  U   307  O4    ? ? ? 1_555 A  A   338  N6  ? ? 0 U   308  0 A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog397  hydrog ? ? A  C   308  N3    ? ? ? 1_555 A  G   321  N1  ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog398  hydrog ? ? A  C   308  N4    ? ? ? 1_555 A  G   321  O6  ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog399  hydrog ? ? A  C   308  O2    ? ? ? 1_555 A  G   321  N2  ? ? 0 C   309  0 G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog400  hydrog ? ? A  U   309  N3    ? ? ? 1_555 A  A   320  N1  ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog401  hydrog ? ? A  U   309  O4    ? ? ? 1_555 A  A   320  N6  ? ? 0 U   310  0 A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog402  hydrog ? ? A  C   310  N3    ? ? ? 1_555 A  G   319  N1  ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog403  hydrog ? ? A  C   310  N4    ? ? ? 1_555 A  G   319  O6  ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog404  hydrog ? ? A  C   310  O2    ? ? ? 1_555 A  G   319  N2  ? ? 0 C   311  0 G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog405  hydrog ? ? A  U   311  N3    ? ? ? 1_555 A  A   318  N1  ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog406  hydrog ? ? A  U   311  O4    ? ? ? 1_555 A  A   318  N6  ? ? 0 U   312  0 A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog407  hydrog ? ? A  U   312  N3    ? ? ? 1_555 A  A   316  N7  ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog408  hydrog ? ? A  U   312  O2    ? ? ? 1_555 A  A   316  N6  ? ? 0 U   313  0 A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog409  hydrog ? ? A  G   313  N2    ? ? ? 1_555 A  A   336  N1  ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ?     
? ? 
hydrog410  hydrog ? ? A  G   313  N3    ? ? ? 1_555 A  A   336  N6  ? ? 0 G   314  0 A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ?     
? ? 
hydrog411  hydrog ? ? A  G   314  N2    ? ? ? 1_555 A  G   335  N3  ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ?     
? ? 
hydrog412  hydrog ? ? A  G   314  N3    ? ? ? 1_555 A  G   335  N2  ? ? 0 G   315  0 G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ?     
? ? 
hydrog413  hydrog ? ? A  A   315  N6    ? ? ? 1_555 A  U   1313 O2  ? ? 0 A   316  0 U   1314 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     ? 
? 
hydrog414  hydrog ? ? A  G   323  N1    ? ? ? 1_555 A  C   340  N3  ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog415  hydrog ? ? A  G   323  N2    ? ? ? 1_555 A  C   340  O2  ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog416  hydrog ? ? A  G   323  O6    ? ? ? 1_555 A  C   340  N4  ? ? 0 G   324  0 C   341  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog417  hydrog ? ? A  U   324  N3    ? ? ? 1_555 A  A   339  N1  ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog418  hydrog ? ? A  U   324  O4    ? ? ? 1_555 A  A   339  N6  ? ? 0 U   325  0 A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog419  hydrog ? ? A  G   325  N1    ? ? ? 1_555 A  C   329  N3  ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog420  hydrog ? ? A  G   325  N2    ? ? ? 1_555 A  C   329  O2  ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog421  hydrog ? ? A  G   325  O6    ? ? ? 1_555 A  C   329  N4  ? ? 0 G   326  0 C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog422  hydrog ? ? A  A   328  N3    ? ? ? 1_555 A  U   345  N3  ? ? 0 A   329  0 U   346  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     ? 
? 
hydrog423  hydrog ? ? A  A   330  N6    ? ? ? 1_555 A  G   344  N3  ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog424  hydrog ? ? A  A   330  N7    ? ? ? 1_555 A  G   344  N2  ? ? 0 A   331  0 G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog425  hydrog ? ? A  G   331  N1    ? ? ? 1_555 A  C   343  N3  ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog426  hydrog ? ? A  G   331  N2    ? ? ? 1_555 A  C   343  O2  ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog427  hydrog ? ? A  G   331  O6    ? ? ? 1_555 A  C   343  N4  ? ? 0 G   332  0 C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog428  hydrog ? ? A  G   332  N1    ? ? ? 1_555 A  C   342  N3  ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog429  hydrog ? ? A  G   332  N2    ? ? ? 1_555 A  C   342  O2  ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog430  hydrog ? ? A  G   332  O6    ? ? ? 1_555 A  C   342  N4  ? ? 0 G   333  0 C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog431  hydrog ? ? A  G   333  N1    ? ? ? 1_555 A  C   341  N3  ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog432  hydrog ? ? A  G   333  N2    ? ? ? 1_555 A  C   341  O2  ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog433  hydrog ? ? A  G   333  O6    ? ? ? 1_555 A  C   341  N4  ? ? 0 G   334  0 C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog434  hydrog ? ? A  U   334  N3    ? ? ? 1_555 A  A   338  N7  ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog435  hydrog ? ? A  U   334  O2    ? ? ? 1_555 A  A   338  N6  ? ? 0 U   335  0 A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog436  hydrog ? ? A  G   357  N2    ? ? ? 1_555 A  U   358  O4  ? ? 0 G   358  0 U   359  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? ? 
? 
hydrog437  hydrog ? ? A  A   379  N6    ? ? ? 1_555 A  A   407  N7  ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ?     
? ? 
hydrog438  hydrog ? ? A  A   379  N7    ? ? ? 1_555 A  A   407  N6  ? ? 0 A   380  0 A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ?     
? ? 
hydrog439  hydrog ? ? A  A   379  N6    ? ? ? 1_555 A  U   408  O4  ? ? 0 A   380  0 U   409  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     ? 
? 
hydrog440  hydrog ? ? A  G   380  N2    ? ? ? 1_555 A  U   381  O4  ? ? 0 G   381  0 U   382  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? ? 
? 
hydrog441  hydrog ? ? A  U   381  N3    ? ? ? 1_555 A  A   406  N7  ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog442  hydrog ? ? A  U   381  O2    ? ? ? 1_555 A  A   406  N6  ? ? 0 U   382  0 A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog443  hydrog ? ? A  A   382  N6    ? ? ? 1_555 A  G   405  N3  ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog444  hydrog ? ? A  A   382  N7    ? ? ? 1_555 A  G   405  N2  ? ? 0 A   383  0 G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog445  hydrog ? ? A  G   383  N1    ? ? ? 1_555 A  C   404  N3  ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog446  hydrog ? ? A  G   383  N2    ? ? ? 1_555 A  C   404  O2  ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog447  hydrog ? ? A  G   383  O6    ? ? ? 1_555 A  C   404  N4  ? ? 0 G   384  0 C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog448  hydrog ? ? A  C   384  N3    ? ? ? 1_555 A  G   403  N1  ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog449  hydrog ? ? A  C   384  N4    ? ? ? 1_555 A  G   403  O6  ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog450  hydrog ? ? A  C   384  O2    ? ? ? 1_555 A  G   403  N2  ? ? 0 C   385  0 G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog451  hydrog ? ? A  G   385  N1    ? ? ? 1_555 A  C   402  N3  ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog452  hydrog ? ? A  G   385  N2    ? ? ? 1_555 A  C   402  O2  ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog453  hydrog ? ? A  G   385  O6    ? ? ? 1_555 A  C   402  N4  ? ? 0 G   386  0 C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog454  hydrog ? ? A  G   386  N1    ? ? ? 1_555 A  U   401  O2  ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog455  hydrog ? ? A  G   386  O6    ? ? ? 1_555 A  U   401  N3  ? ? 0 G   387  0 U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog456  hydrog ? ? A  G   387  N1    ? ? ? 1_555 A  C   400  N3  ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog457  hydrog ? ? A  G   387  N2    ? ? ? 1_555 A  C   400  O2  ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog458  hydrog ? ? A  G   387  O6    ? ? ? 1_555 A  C   400  N4  ? ? 0 G   388  0 C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog459  hydrog ? ? A  G   388  N1    ? ? ? 1_555 A  C   399  N3  ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog460  hydrog ? ? A  G   388  N2    ? ? ? 1_555 A  C   399  O2  ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog461  hydrog ? ? A  G   388  O6    ? ? ? 1_555 A  C   399  N4  ? ? 0 G   389  0 C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog462  hydrog ? ? A  G   389  N1    ? ? ? 1_555 A  C   398  N3  ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog463  hydrog ? ? A  G   389  N2    ? ? ? 1_555 A  C   398  O2  ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog464  hydrog ? ? A  G   389  O6    ? ? ? 1_555 A  C   398  N4  ? ? 0 G   390  0 C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog465  hydrog ? ? A  U   390  N3    ? ? ? 1_555 A  U   397  O4  ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ?     
? ? 
hydrog466  hydrog ? ? A  U   390  O2    ? ? ? 1_555 A  U   397  N3  ? ? 0 U   391  0 U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ?     
? ? 
hydrog467  hydrog ? ? A  G   393  N3    ? ? ? 1_555 A  G   416  N2  ? ? 0 G   394  0 G   417  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? ? 
? 
hydrog468  hydrog ? ? A  A   394  N1    ? ? ? 1_555 A  C   2442 N4  ? ? 0 A   395  0 C   2443 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? ? 
? 
hydrog469  hydrog ? ? A  U   395  O4    ? ? ? 1_555 A  G   2441 N2  ? ? 0 U   396  0 G   2442 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? ? 
? 
hydrog470  hydrog ? ? A  A   406  N6    ? ? ? 1_555 A  A   428  N1  ? ? 0 A   407  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? ? 
? 
hydrog471  hydrog ? ? A  A   407  N1    ? ? ? 1_555 A  A   428  N6  ? ? 0 A   408  0 A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? ? 
? 
hydrog472  hydrog ? ? A  A   407  N6    ? ? ? 1_555 A  A   429  N1  ? ? 0 A   408  0 A   430  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? ? 
? 
hydrog473  hydrog ? ? A  C   411  N3    ? ? ? 1_555 A  G   427  N1  ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog474  hydrog ? ? A  C   411  N4    ? ? ? 1_555 A  G   427  O6  ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog475  hydrog ? ? A  C   411  O2    ? ? ? 1_555 A  G   427  N2  ? ? 0 C   412  0 G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog476  hydrog ? ? A  G   412  N1    ? ? ? 1_555 A  C   426  N3  ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog477  hydrog ? ? A  G   412  N2    ? ? ? 1_555 A  C   426  O2  ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog478  hydrog ? ? A  G   412  O6    ? ? ? 1_555 A  C   426  N4  ? ? 0 G   413  0 C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog479  hydrog ? ? A  C   413  N3    ? ? ? 1_555 A  G   425  N1  ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog480  hydrog ? ? A  C   413  N4    ? ? ? 1_555 A  G   425  O6  ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog481  hydrog ? ? A  C   413  O2    ? ? ? 1_555 A  G   425  N2  ? ? 0 C   414  0 G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog482  hydrog ? ? A  A   414  N1    ? ? ? 1_555 A  U   424  N3  ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog483  hydrog ? ? A  A   414  N6    ? ? ? 1_555 A  U   424  O4  ? ? 0 A   415  0 U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog484  hydrog ? ? A  G   415  N1    ? ? ? 1_555 A  C   423  N3  ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog485  hydrog ? ? A  G   415  N2    ? ? ? 1_555 A  C   423  O2  ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog486  hydrog ? ? A  G   415  O6    ? ? ? 1_555 A  C   423  N4  ? ? 0 G   416  0 C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog487  hydrog ? ? A  C   417  N3    ? ? ? 1_555 A  G   2448 N1  ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog488  hydrog ? ? A  C   417  N4    ? ? ? 1_555 A  G   2448 O6  ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog489  hydrog ? ? A  C   417  O2    ? ? ? 1_555 A  G   2448 N2  ? ? 0 C   418  0 G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog490  hydrog ? ? A  A   418  N3    ? ? ? 1_555 A  C   1919 N4  ? ? 0 A   419  0 C   1920 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? ? 
? 
hydrog491  hydrog ? ? A  A   418  N1    ? ? ? 1_555 A  U   2447 N3  ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog492  hydrog ? ? A  A   418  N6    ? ? ? 1_555 A  U   2447 O4  ? ? 0 A   419  0 U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog493  hydrog ? ? A  U   419  N3    ? ? ? 1_555 A  A   2446 N1  ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog494  hydrog ? ? A  U   419  O4    ? ? ? 1_555 A  A   2446 N6  ? ? 0 U   420  0 A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog495  hydrog ? ? A  C   420  N3    ? ? ? 1_555 A  G   2445 N1  ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog496  hydrog ? ? A  C   420  N4    ? ? ? 1_555 A  G   2445 O6  ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog497  hydrog ? ? A  C   420  O2    ? ? ? 1_555 A  G   2445 N2  ? ? 0 C   421  0 G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog498  hydrog ? ? A  G   421  N1    ? ? ? 1_555 A  U   2444 O2  ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog499  hydrog ? ? A  G   421  O6    ? ? ? 1_555 A  U   2444 N3  ? ? 0 G   422  0 U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog500  hydrog ? ? A  A   422  N1    ? ? ? 1_555 A  U   2443 N3  ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog501  hydrog ? ? A  A   422  N6    ? ? ? 1_555 A  U   2443 O4  ? ? 0 A   423  0 U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog502  hydrog ? ? A  A   440  N3    ? ? ? 1_555 A  A   441  N6  ? ? 0 A   441  0 A   442  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? ? 
? 
hydrog503  hydrog ? ? A  A   448  N3    ? ? ? 1_555 A  G   1348 N2  ? ? 0 A   449  0 G   1349 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog504  hydrog ? ? A  G   451  N2    ? ? ? 1_555 A  A   459  N1  ? ? 0 G   452  0 A   460  1_555 ? ? ? ? ? ? TYPE_10_PAIR ?     
? ? 
hydrog505  hydrog ? ? A  G   451  N3    ? ? ? 1_555 A  A   459  N6  ? ? 0 G   452  0 A   460  1_555 ? ? ? ? ? ? TYPE_10_PAIR ?     
? ? 
hydrog506  hydrog ? ? A  U   453  N3    ? ? ? 1_555 A  U   1361 O2  ? ? 0 U   454  0 U   1362 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? ? 
? 
hydrog507  hydrog ? ? A  A   454  N1    ? ? ? 1_555 A  A   459  N6  ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ?     
? ? 
hydrog508  hydrog ? ? A  A   454  N6    ? ? ? 1_555 A  A   459  N7  ? ? 0 A   455  0 A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ?     
? ? 
hydrog509  hydrog ? ? A  G   457  N2    ? ? ? 1_555 A  A   462  N3  ? ? 0 G   458  0 A   463  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog510  hydrog ? ? A  A   462  N6    ? ? ? 1_555 A  A   476  N7  ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ?     
? ? 
hydrog511  hydrog ? ? A  A   462  N7    ? ? ? 1_555 A  A   476  N6  ? ? 0 A   463  0 A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ?     
? ? 
hydrog512  hydrog ? ? A  G   463  N2    ? ? ? 1_555 A  U   464  O4  ? ? 0 G   464  0 U   465  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? ? 
? 
hydrog513  hydrog ? ? A  U   464  N3    ? ? ? 1_555 A  A   475  N7  ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog514  hydrog ? ? A  U   464  O2    ? ? ? 1_555 A  A   475  N6  ? ? 0 U   465  0 A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog515  hydrog ? ? A  A   465  N6    ? ? ? 1_555 A  G   474  N3  ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog516  hydrog ? ? A  A   465  N7    ? ? ? 1_555 A  G   474  N2  ? ? 0 A   466  0 G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog517  hydrog ? ? A  G   466  N1    ? ? ? 1_555 A  C   473  N3  ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog518  hydrog ? ? A  G   466  N2    ? ? ? 1_555 A  C   473  O2  ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog519  hydrog ? ? A  G   466  O6    ? ? ? 1_555 A  C   473  N4  ? ? 0 G   467  0 C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog520  hydrog ? ? A  U   467  N3    ? ? ? 1_555 A  A   472  N1  ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog521  hydrog ? ? A  U   467  O4    ? ? ? 1_555 A  A   472  N6  ? ? 0 U   468  0 A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog522  hydrog ? ? A  G   468  N2    ? ? ? 1_555 A  A   471  N7  ? ? 0 G   469  0 A   472  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog523  hydrog ? ? A  G   470  N2    ? ? ? 1_555 A  C   773  O2  ? ? 0 G   471  0 C   774  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     ? 
? 
hydrog524  hydrog ? ? A  U   480  N3    ? ? ? 1_555 A  A   484  N7  ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog525  hydrog ? ? A  U   480  O2    ? ? ? 1_555 A  A   484  N6  ? ? 0 U   481  0 A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog526  hydrog ? ? A  G   481  N2    ? ? ? 1_555 A  A   485  N7  ? ? 0 G   482  0 A   486  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog527  hydrog ? ? A  C   482  N4    ? ? ? 1_555 A  A   506  N7  ? ? 0 C   483  0 A   507  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? 
? 
hydrog528  hydrog ? ? A  A   484  N1    ? ? ? 1_555 A  A   508  N6  ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ?     
? ? 
hydrog529  hydrog ? ? A  A   484  N6    ? ? ? 1_555 A  A   508  N1  ? ? 0 A   485  0 A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ?     
? ? 
hydrog530  hydrog ? ? A  A   485  N1    ? ? ? 1_555 A  A   510  N6  ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ?     
? ? 
hydrog531  hydrog ? ? A  A   485  N6    ? ? ? 1_555 A  A   510  N1  ? ? 0 A   486  0 A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ?     
? ? 
hydrog532  hydrog ? ? A  G   486  N3    ? ? ? 1_555 A  G   511  N2  ? ? 0 G   487  0 G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? ? 
? 
hydrog533  hydrog ? ? A  G   486  N1    ? ? ? 1_555 A  C   514  N3  ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog534  hydrog ? ? A  G   486  N2    ? ? ? 1_555 A  C   514  O2  ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog535  hydrog ? ? A  G   486  O6    ? ? ? 1_555 A  C   514  N4  ? ? 0 G   487  0 C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog536  hydrog ? ? A  U   487  O2    ? ? ? 1_555 A  G   502  N1  ? ? 0 U   488  0 G   503  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? ? 
? 
hydrog537  hydrog ? ? A  A   488  N6    ? ? ? 1_555 A  G   502  N3  ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog538  hydrog ? ? A  A   488  N7    ? ? ? 1_555 A  G   502  N2  ? ? 0 A   489  0 G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog539  hydrog ? ? A  C   489  N4    ? ? ? 1_555 A  A   501  N1  ? ? 0 C   490  0 A   502  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? 
? 
hydrog540  hydrog ? ? A  C   490  N3    ? ? ? 1_555 A  G   500  N1  ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog541  hydrog ? ? A  C   490  N4    ? ? ? 1_555 A  G   500  O6  ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog542  hydrog ? ? A  C   490  O2    ? ? ? 1_555 A  G   500  N2  ? ? 0 C   491  0 G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog543  hydrog ? ? A  C   490  N4    ? ? ? 1_555 A  A   501  N1  ? ? 0 C   491  0 A   502  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? 
? 
hydrog544  hydrog ? ? A  C   491  N3    ? ? ? 1_555 A  G   499  N1  ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog545  hydrog ? ? A  C   491  N4    ? ? ? 1_555 A  G   499  O6  ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog546  hydrog ? ? A  C   491  O2    ? ? ? 1_555 A  G   499  N2  ? ? 0 C   492  0 G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog547  hydrog ? ? A  U   492  N3    ? ? ? 1_555 A  G   498  O6  ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog548  hydrog ? ? A  U   492  O2    ? ? ? 1_555 A  G   498  N1  ? ? 0 U   493  0 G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog549  hydrog ? ? A  C   493  O2    ? ? ? 1_555 A  A   497  N6  ? ? 0 C   494  0 A   498  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? 
? 
hydrog550  hydrog ? ? A  G   503  N1    ? ? ? 1_555 A  G   511  O6  ? ? 0 G   504  0 G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? ? 
? 
hydrog551  hydrog ? ? A  C   504  O2    ? ? ? 1_555 A  A   508  N6  ? ? 0 C   505  0 A   509  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? 
? 
hydrog552  hydrog ? ? A  G   505  N2    ? ? ? 1_555 A  A   510  N7  ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog553  hydrog ? ? A  G   505  N3    ? ? ? 1_555 A  A   510  N6  ? ? 0 G   506  0 A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog554  hydrog ? ? A  A   520  N3    ? ? ? 1_555 A  G   1363 N2  ? ? 0 A   521  0 G   1364 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog555  hydrog ? ? A  A   531  N3    ? ? ? 1_555 A  G   2659 N2  ? ? 0 A   532  0 G   2660 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog556  hydrog ? ? A  G   534  N7    ? ? ? 1_555 A  G   2081 N1  ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ?     
? ? 
hydrog557  hydrog ? ? A  G   534  O6    ? ? ? 1_555 A  G   2081 N2  ? ? 0 G   535  0 G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ?     
? ? 
hydrog558  hydrog ? ? A  A   535  N3    ? ? ? 1_555 A  G   2074 N2  ? ? 0 A   536  0 G   2075 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog559  hydrog ? ? A  G   536  N1    ? ? ? 1_555 A  U   2058 O2  ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog560  hydrog ? ? A  G   536  O6    ? ? ? 1_555 A  U   2058 N3  ? ? 0 G   537  0 U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog561  hydrog ? ? A  C   537  N4    ? ? ? 1_555 A  A   2059 N3  ? ? 0 C   538  0 A   2060 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? 
? 
hydrog562  hydrog ? ? A  G   538  N1    ? ? ? 1_555 A  C   616  N3  ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog563  hydrog ? ? A  G   538  N2    ? ? ? 1_555 A  C   616  O2  ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog564  hydrog ? ? A  G   538  O6    ? ? ? 1_555 A  C   616  N4  ? ? 0 G   539  0 C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog565  hydrog ? ? A  A   539  N1    ? ? ? 1_555 A  U   615  N3  ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog566  hydrog ? ? A  A   539  N6    ? ? ? 1_555 A  U   615  O4  ? ? 0 A   540  0 U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog567  hydrog ? ? A  C   540  N3    ? ? ? 1_555 A  G   614  N1  ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog568  hydrog ? ? A  C   540  N4    ? ? ? 1_555 A  G   614  O6  ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog569  hydrog ? ? A  C   540  O2    ? ? ? 1_555 A  G   614  N2  ? ? 0 C   541  0 G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog570  hydrog ? ? A  A   541  N1    ? ? ? 1_555 A  U   613  N3  ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog571  hydrog ? ? A  A   541  N6    ? ? ? 1_555 A  U   613  O4  ? ? 0 A   542  0 U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog572  hydrog ? ? A  G   542  N1    ? ? ? 1_555 A  C   612  N3  ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog573  hydrog ? ? A  G   542  N2    ? ? ? 1_555 A  C   612  O2  ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog574  hydrog ? ? A  G   542  O6    ? ? ? 1_555 A  C   612  N4  ? ? 0 G   543  0 C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog575  hydrog ? ? A  G   543  N1    ? ? ? 1_555 A  U   611  O2  ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog576  hydrog ? ? A  G   543  O6    ? ? ? 1_555 A  U   611  N3  ? ? 0 G   544  0 U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog577  hydrog ? ? A  G   544  N1    ? ? ? 1_555 A  U   610  O2  ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog578  hydrog ? ? A  G   544  O6    ? ? ? 1_555 A  U   610  N3  ? ? 0 G   545  0 U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog579  hydrog ? ? A  C   545  N3    ? ? ? 1_555 A  G   609  N1  ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog580  hydrog ? ? A  C   545  N4    ? ? ? 1_555 A  G   609  O6  ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog581  hydrog ? ? A  C   545  O2    ? ? ? 1_555 A  G   609  N2  ? ? 0 C   546  0 G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog582  hydrog ? ? A  A   546  N1    ? ? ? 1_555 A  U   608  N3  ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog583  hydrog ? ? A  A   546  N6    ? ? ? 1_555 A  U   608  O4  ? ? 0 A   547  0 U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog584  hydrog ? ? A  U   547  N3    ? ? ? 1_555 A  A   607  N1  ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog585  hydrog ? ? A  U   547  O4    ? ? ? 1_555 A  A   607  N6  ? ? 0 U   548  0 A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog586  hydrog ? ? A  A   551  N3    ? ? ? 1_555 A  G   1322 N2  ? ? 0 A   552  0 G   1323 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog587  hydrog ? ? A  G   552  N1    ? ? ? 1_555 A  C   605  N3  ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog588  hydrog ? ? A  G   552  N2    ? ? ? 1_555 A  C   605  O2  ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog589  hydrog ? ? A  G   552  O6    ? ? ? 1_555 A  C   605  N4  ? ? 0 G   553  0 C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog590  hydrog ? ? A  G   553  N1    ? ? ? 1_555 A  C   604  N3  ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog591  hydrog ? ? A  G   553  N2    ? ? ? 1_555 A  C   604  O2  ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog592  hydrog ? ? A  G   553  O6    ? ? ? 1_555 A  C   604  N4  ? ? 0 G   554  0 C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog593  hydrog ? ? A  U   554  N3    ? ? ? 1_555 A  A   601  N1  ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog594  hydrog ? ? A  U   554  O4    ? ? ? 1_555 A  A   601  N6  ? ? 0 U   555  0 A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog595  hydrog ? ? A  C   555  N3    ? ? ? 1_555 A  G   600  N1  ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog596  hydrog ? ? A  C   555  N4    ? ? ? 1_555 A  G   600  O6  ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog597  hydrog ? ? A  C   555  O2    ? ? ? 1_555 A  G   600  N2  ? ? 0 C   556  0 G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog598  hydrog ? ? A  C   556  N3    ? ? ? 1_555 A  G   599  N1  ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog599  hydrog ? ? A  C   556  N4    ? ? ? 1_555 A  G   599  O6  ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog600  hydrog ? ? A  C   556  O2    ? ? ? 1_555 A  G   599  N2  ? ? 0 C   557  0 G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog601  hydrog ? ? A  C   557  N3    ? ? ? 1_555 A  G   598  N1  ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog602  hydrog ? ? A  C   557  N4    ? ? ? 1_555 A  G   598  O6  ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog603  hydrog ? ? A  C   557  O2    ? ? ? 1_555 A  G   598  N2  ? ? 0 C   558  0 G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog604  hydrog ? ? A  U   558  O4    ? ? ? 1_555 A  C   597  N4  ? ? 0 U   559  0 C   598  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? ? 
? 
hydrog605  hydrog ? ? A  C   559  N4    ? ? ? 1_555 A  A   596  N1  ? ? 0 C   560  0 A   597  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? 
? 
hydrog606  hydrog ? ? A  G   560  N1    ? ? ? 1_555 A  C   595  N3  ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog607  hydrog ? ? A  G   560  N2    ? ? ? 1_555 A  C   595  O2  ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog608  hydrog ? ? A  G   560  O6    ? ? ? 1_555 A  C   595  N4  ? ? 0 G   561  0 C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog609  hydrog ? ? A  A   561  N1    ? ? ? 1_555 A  U   594  N3  ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog610  hydrog ? ? A  A   561  N6    ? ? ? 1_555 A  U   594  O4  ? ? 0 A   562  0 U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog611  hydrog ? ? A  C   562  O2    ? ? ? 1_555 A  C   593  N4  ? ? 0 C   563  0 C   594  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? ? 
? 
hydrog612  hydrog ? ? A  A   565  N6    ? ? ? 1_555 A  G   591  N3  ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog613  hydrog ? ? A  A   565  N7    ? ? ? 1_555 A  G   591  N2  ? ? 0 A   566  0 G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog614  hydrog ? ? A  A   565  N3    ? ? ? 1_555 A  G   1092 N2  ? ? 0 A   566  0 G   1093 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog615  hydrog ? ? A  U   566  N3    ? ? ? 1_555 A  A   590  N1  ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog616  hydrog ? ? A  U   566  O4    ? ? ? 1_555 A  A   590  N6  ? ? 0 U   567  0 A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog617  hydrog ? ? A  G   567  N2    ? ? ? 1_555 A  A   589  N7  ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog618  hydrog ? ? A  G   567  N3    ? ? ? 1_555 A  A   589  N6  ? ? 0 G   568  0 A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog619  hydrog ? ? A  A   568  N6    ? ? ? 1_555 A  U   588  O2  ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog620  hydrog ? ? A  A   568  N7    ? ? ? 1_555 A  U   588  N3  ? ? 0 A   569  0 U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog621  hydrog ? ? A  C   570  N4    ? ? ? 1_555 A  C   585  O2  ? ? 0 C   571  0 C   586  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? ? 
? 
hydrog622  hydrog ? ? A  G   571  N1    ? ? ? 1_555 A  C   584  N3  ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog623  hydrog ? ? A  G   571  N2    ? ? ? 1_555 A  C   584  O2  ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog624  hydrog ? ? A  G   571  O6    ? ? ? 1_555 A  C   584  N4  ? ? 0 G   572  0 C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog625  hydrog ? ? A  A   572  N1    ? ? ? 1_555 A  U   583  N3  ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog626  hydrog ? ? A  A   572  N6    ? ? ? 1_555 A  U   583  O4  ? ? 0 A   573  0 U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog627  hydrog ? ? A  C   573  N3    ? ? ? 1_555 A  G   582  N1  ? ? 0 C   574  0 G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog628  hydrog ? ? A  C   573  N4    ? ? ? 1_555 A  G   582  O6  ? ? 0 C   574  0 G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog629  hydrog ? ? A  C   573  O2    ? ? ? 1_555 A  G   582  N2  ? ? 0 C   574  0 G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog630  hydrog ? ? A  G   574  N1    ? ? ? 1_555 A  C   581  N3  ? ? 0 G   575  0 C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog631  hydrog ? ? A  G   574  N2    ? ? ? 1_555 A  C   581  O2  ? ? 0 G   575  0 C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog632  hydrog ? ? A  G   574  O6    ? ? ? 1_555 A  C   581  N4  ? ? 0 G   575  0 C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog633  hydrog ? ? A  C   575  N3    ? ? ? 1_555 A  G   580  N1  ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog634  hydrog ? ? A  C   575  N4    ? ? ? 1_555 A  G   580  O6  ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog635  hydrog ? ? A  C   575  O2    ? ? ? 1_555 A  G   580  N2  ? ? 0 C   576  0 G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog636  hydrog ? ? A  G   576  N2    ? ? ? 1_555 A  A   579  N7  ? ? 0 G   577  0 A   580  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog637  hydrog ? ? A  G   578  N2    ? ? ? 1_555 A  U   1110 O2  ? ? 0 G   579  0 U   1111 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? ? 
? 
hydrog638  hydrog ? ? A  A   579  N3    ? ? ? 1_555 A  G   1109 N2  ? ? 0 A   580  0 G   1110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog639  hydrog ? ? A  G   587  N2    ? ? ? 1_555 A  U   588  O4  ? ? 0 G   588  0 U   589  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? ? 
? 
hydrog640  hydrog ? ? A  G   603  N1    ? ? ? 1_555 A  G   606  O6  ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ?     
? ? 
hydrog641  hydrog ? ? A  G   603  N2    ? ? ? 1_555 A  G   606  N7  ? ? 0 G   604  0 G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ?     
? ? 
hydrog642  hydrog ? ? A  U   618  N3    ? ? ? 1_555 A  A   2073 N1  ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog643  hydrog ? ? A  U   618  O4    ? ? ? 1_555 A  A   2073 N6  ? ? 0 U   619  0 A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog644  hydrog ? ? A  A   619  N6    ? ? ? 1_555 A  A   634  N1  ? ? 0 A   620  0 A   635  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? ? 
? 
hydrog645  hydrog ? ? A  C   620  N3    ? ? ? 1_555 A  G   633  N1  ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog646  hydrog ? ? A  C   620  N4    ? ? ? 1_555 A  G   633  O6  ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog647  hydrog ? ? A  C   620  O2    ? ? ? 1_555 A  G   633  N2  ? ? 0 C   621  0 G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog648  hydrog ? ? A  G   621  N1    ? ? ? 1_555 A  C   632  N3  ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog649  hydrog ? ? A  G   621  N2    ? ? ? 1_555 A  C   632  O2  ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog650  hydrog ? ? A  G   621  O6    ? ? ? 1_555 A  C   632  N4  ? ? 0 G   622  0 C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog651  hydrog ? ? A  U   622  N3    ? ? ? 1_555 A  A   631  N1  ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog652  hydrog ? ? A  U   622  O4    ? ? ? 1_555 A  A   631  N6  ? ? 0 U   623  0 A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog653  hydrog ? ? A  U   623  N3    ? ? ? 1_555 A  A   627  N7  ? ? 0 U   624  0 A   628  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     ? 
? 
hydrog654  hydrog ? ? A  U   624  O2    ? ? ? 1_555 A  C   2070 N4  ? ? 0 U   625  0 C   2071 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? ? 
? 
hydrog655  hydrog ? ? A  U   625  O2    ? ? ? 1_555 A  A   1080 N6  ? ? 0 U   626  0 A   1081 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     ? 
? 
hydrog656  hydrog ? ? A  A   628  N1    ? ? ? 1_555 A  G   2069 N2  ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ?     
? ? 
hydrog657  hydrog ? ? A  A   628  N6    ? ? ? 1_555 A  G   2069 N3  ? ? 0 A   629  0 G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ?     
? ? 
hydrog658  hydrog ? ? A  G   635  N1    ? ? ? 1_555 A  C   1364 N3  ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog659  hydrog ? ? A  G   635  N2    ? ? ? 1_555 A  C   1364 O2  ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog660  hydrog ? ? A  G   635  O6    ? ? ? 1_555 A  C   1364 N4  ? ? 0 G   636  0 C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog661  hydrog ? ? A  C   636  N3    ? ? ? 1_555 A  G   1363 N1  ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog662  hydrog ? ? A  C   636  N4    ? ? ? 1_555 A  G   1363 O6  ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog663  hydrog ? ? A  C   636  O2    ? ? ? 1_555 A  G   1363 N2  ? ? 0 C   637  0 G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog664  hydrog ? ? A  C   637  N3    ? ? ? 1_555 A  G   1362 N1  ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog665  hydrog ? ? A  C   637  N4    ? ? ? 1_555 A  G   1362 O6  ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog666  hydrog ? ? A  C   637  O2    ? ? ? 1_555 A  G   1362 N2  ? ? 0 C   638  0 G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog667  hydrog ? ? A  A   638  N1    ? ? ? 1_555 A  U   1361 N3  ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog668  hydrog ? ? A  A   638  N6    ? ? ? 1_555 A  U   1361 O4  ? ? 0 A   639  0 U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog669  hydrog ? ? A  G   639  N1    ? ? ? 1_555 A  C   1360 N3  ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog670  hydrog ? ? A  G   639  N2    ? ? ? 1_555 A  C   1360 O2  ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog671  hydrog ? ? A  G   639  O6    ? ? ? 1_555 A  C   1360 N4  ? ? 0 G   640  0 C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog672  hydrog ? ? A  G   640  N1    ? ? ? 1_555 A  C   1359 N3  ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog673  hydrog ? ? A  G   640  N2    ? ? ? 1_555 A  C   1359 O2  ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog674  hydrog ? ? A  G   640  O6    ? ? ? 1_555 A  C   1359 N4  ? ? 0 G   641  0 C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog675  hydrog ? ? A  G   641  N2    ? ? ? 1_555 A  A   1357 N7  ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog676  hydrog ? ? A  G   641  N3    ? ? ? 1_555 A  A   1357 N6  ? ? 0 G   642  0 A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog677  hydrog ? ? A  A   642  N3    ? ? ? 1_555 A  G   901  N2  ? ? 0 A   643  0 G   902  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog678  hydrog ? ? A  A   642  N6    ? ? ? 1_555 A  A   1354 N7  ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ?     
? ? 
hydrog679  hydrog ? ? A  A   642  N7    ? ? ? 1_555 A  A   1354 N6  ? ? 0 A   643  0 A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ?     
? ? 
hydrog680  hydrog ? ? A  G   643  N1    ? ? ? 1_555 A  U   902  O2  ? ? 0 G   644  0 U   903  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? ? 
? 
hydrog681  hydrog ? ? A  U   644  N3    ? ? ? 1_555 A  A   760  N3  ? ? 0 U   645  0 A   761  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     ? 
? 
hydrog682  hydrog ? ? A  G   645  N1    ? ? ? 1_555 A  C   758  N3  ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog683  hydrog ? ? A  G   645  N2    ? ? ? 1_555 A  C   758  O2  ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog684  hydrog ? ? A  G   645  O6    ? ? ? 1_555 A  C   758  N4  ? ? 0 G   646  0 C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog685  hydrog ? ? A  U   646  N3    ? ? ? 1_555 A  A   757  N1  ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog686  hydrog ? ? A  U   646  O4    ? ? ? 1_555 A  A   757  N6  ? ? 0 U   647  0 A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog687  hydrog ? ? A  G   647  N1    ? ? ? 1_555 A  C   756  N3  ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog688  hydrog ? ? A  G   647  N2    ? ? ? 1_555 A  C   756  O2  ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog689  hydrog ? ? A  G   647  O6    ? ? ? 1_555 A  C   756  N4  ? ? 0 G   648  0 C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog690  hydrog ? ? A  U   648  N3    ? ? ? 1_555 A  A   755  N1  ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog691  hydrog ? ? A  U   648  O4    ? ? ? 1_555 A  A   755  N6  ? ? 0 U   649  0 A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog692  hydrog ? ? A  C   649  N3    ? ? ? 1_555 A  G   754  N1  ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog693  hydrog ? ? A  C   649  N4    ? ? ? 1_555 A  G   754  O6  ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog694  hydrog ? ? A  C   649  O2    ? ? ? 1_555 A  G   754  N2  ? ? 0 C   650  0 G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog695  hydrog ? ? A  U   650  N3    ? ? ? 1_555 A  G   753  O6  ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog696  hydrog ? ? A  U   650  O2    ? ? ? 1_555 A  G   753  N1  ? ? 0 U   651  0 G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog697  hydrog ? ? A  G   651  N1    ? ? ? 1_555 A  U   752  O2  ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog698  hydrog ? ? A  G   651  O6    ? ? ? 1_555 A  U   752  N3  ? ? 0 G   652  0 U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog699  hydrog ? ? A  C   652  N3    ? ? ? 1_555 A  G   751  N1  ? ? 0 C   653  0 G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog700  hydrog ? ? A  C   652  N4    ? ? ? 1_555 A  G   751  O6  ? ? 0 C   653  0 G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog701  hydrog ? ? A  C   652  O2    ? ? ? 1_555 A  G   751  N2  ? ? 0 C   653  0 G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog702  hydrog ? ? A  A   653  N1    ? ? ? 1_555 A  U   750  N3  ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog703  hydrog ? ? A  A   653  N6    ? ? ? 1_555 A  U   750  O4  ? ? 0 A   654  0 U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog704  hydrog ? ? A  U   654  N3    ? ? ? 1_555 A  A   749  N1  ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog705  hydrog ? ? A  U   654  O4    ? ? ? 1_555 A  A   749  N6  ? ? 0 U   655  0 A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog706  hydrog ? ? A  G   655  N1    ? ? ? 1_555 A  C   748  N3  ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog707  hydrog ? ? A  G   655  N2    ? ? ? 1_555 A  C   748  O2  ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog708  hydrog ? ? A  G   655  O6    ? ? ? 1_555 A  C   748  N4  ? ? 0 G   656  0 C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog709  hydrog ? ? A  G   656  N1    ? ? ? 1_555 A  C   747  N3  ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog710  hydrog ? ? A  G   656  N2    ? ? ? 1_555 A  C   747  O2  ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog711  hydrog ? ? A  G   656  O6    ? ? ? 1_555 A  C   747  N4  ? ? 0 G   657  0 C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog712  hydrog ? ? A  C   657  N3    ? ? ? 1_555 A  G   746  N1  ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog713  hydrog ? ? A  C   657  N4    ? ? ? 1_555 A  G   746  O6  ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog714  hydrog ? ? A  C   657  O2    ? ? ? 1_555 A  G   746  N2  ? ? 0 C   658  0 G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog715  hydrog ? ? A  G   660  N1    ? ? ? 1_555 A  C   684  N3  ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog716  hydrog ? ? A  G   660  N2    ? ? ? 1_555 A  C   684  O2  ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog717  hydrog ? ? A  G   660  O6    ? ? ? 1_555 A  C   684  N4  ? ? 0 G   661  0 C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog718  hydrog ? ? A  U   661  N3    ? ? ? 1_555 A  G   683  O6  ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog719  hydrog ? ? A  U   661  O2    ? ? ? 1_555 A  G   683  N1  ? ? 0 U   662  0 G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? ? 
hydrog720  hydrog ? ? A  C   662  N3    ? ? ? 1_555 A  G   682  N1  ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog721  hydrog ? ? A  C   662  N4    ? ? ? 1_555 A  G   682  O6  ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog722  hydrog ? ? A  C   662  O2    ? ? ? 1_555 A  G   682  N2  ? ? 0 C   663  0 G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog723  hydrog ? ? A  U   663  N3    ? ? ? 1_555 A  A   681  N7  ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog724  hydrog ? ? A  U   663  O2    ? ? ? 1_555 A  A   681  N6  ? ? 0 U   664  0 A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? ? 
hydrog725  hydrog ? ? A  A   665  N6    ? ? ? 1_555 A  G   679  N3  ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog726  hydrog ? ? A  A   665  N7    ? ? ? 1_555 A  G   679  N2  ? ? 0 A   666  0 G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog727  hydrog ? ? A  C   666  N3    ? ? ? 1_555 A  G   678  N1  ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog728  hydrog ? ? A  C   666  N4    ? ? ? 1_555 A  G   678  O6  ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog729  hydrog ? ? A  C   666  O2    ? ? ? 1_555 A  G   678  N2  ? ? 0 C   667  0 G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog730  hydrog ? ? A  C   667  N3    ? ? ? 1_555 A  G   677  N1  ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog731  hydrog ? ? A  C   667  N4    ? ? ? 1_555 A  G   677  O6  ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog732  hydrog ? ? A  C   667  O2    ? ? ? 1_555 A  G   677  N2  ? ? 0 C   668  0 G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog733  hydrog ? ? A  G   668  N1    ? ? ? 1_555 A  C   676  N3  ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog734  hydrog ? ? A  G   668  N2    ? ? ? 1_555 A  C   676  O2  ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog735  hydrog ? ? A  G   668  O6    ? ? ? 1_555 A  C   676  N4  ? ? 0 G   669  0 C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog736  hydrog ? ? A  G   669  N1    ? ? ? 1_555 A  C   675  N3  ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog737  hydrog ? ? A  G   669  N2    ? ? ? 1_555 A  C   675  O2  ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog738  hydrog ? ? A  G   669  O6    ? ? ? 1_555 A  C   675  N4  ? ? 0 G   670  0 C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog739  hydrog ? ? A  G   688  N1    ? ? ? 1_555 A  C   695  N3  ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog740  hydrog ? ? A  G   688  N2    ? ? ? 1_555 A  C   695  O2  ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog741  hydrog ? ? A  G   688  O6    ? ? ? 1_555 A  C   695  N4  ? ? 0 G   689  0 C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog742  hydrog ? ? A  G   689  N1    ? ? ? 1_555 A  C   694  N3  ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog743  hydrog ? ? A  G   689  N2    ? ? ? 1_555 A  C   694  O2  ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog744  hydrog ? ? A  G   689  O6    ? ? ? 1_555 A  C   694  N4  ? ? 0 G   690  0 C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog745  hydrog ? ? A  G   690  N2    ? ? ? 1_555 A  A   693  N7  ? ? 0 G   691  0 A   694  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? 
? 
hydrog746  hydrog ? ? A  A   691  N1    ? ? ? 1_555 A  G   2452 N2  ? ? 0 A   692  0 G   2453 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog747  hydrog ? ? A  A   697  N3    ? ? ? 1_555 A  G   741  N2  ? ? 0 A   698  0 G   742  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? ? 
? 
hydrog748  hydrog ? ? A  C   698  N3    ? ? ? 1_555 A  G   726  N1  ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog749  hydrog ? ? A  C   698  N4    ? ? ? 1_555 A  G   726  O6  ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog750  hydrog ? ? A  C   698  O2    ? ? ? 1_555 A  G   726  N2  ? ? 0 C   699  0 G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog751  hydrog ? ? A  G   701  N1    ? ? ? 1_555 A  C   725  N3  ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog752  hydrog ? ? A  G   701  N2    ? ? ? 1_555 A  C   725  O2  ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog753  hydrog ? ? A  G   701  O6    ? ? ? 1_555 A  C   725  N4  ? ? 0 G   702  0 C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog754  hydrog ? ? A  G   701  N7    ? ? ? 1_555 A  G   743  N2  ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ?     
? ? 
hydrog755  hydrog ? ? A  G   701  O6    ? ? ? 1_555 A  G   743  N1  ? ? 0 G   702  0 G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ?     
? ? 
hydrog756  hydrog ? ? A  G   702  N1    ? ? ? 1_555 A  C   724  N3  ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog757  hydrog ? ? A  G   702  N2    ? ? ? 1_555 A  C   724  O2  ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog758  hydrog ? ? A  G   702  O6    ? ? ? 1_555 A  C   724  N4  ? ? 0 G   703  0 C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog759  hydrog ? ? A  C   703  N3    ? ? ? 1_555 A  G   723  N1  ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog760  hydrog ? ? A  C   703  N4    ? ? ? 1_555 A  G   723  O6  ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog761  hydrog ? ? A  C   703  O2    ? ? ? 1_555 A  G   723  N2  ? ? 0 C   704  0 G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog762  hydrog ? ? A  C   704  N3    ? ? ? 1_555 A  G   722  N1  ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog763  hydrog ? ? A  C   704  N4    ? ? ? 1_555 A  G   722  O6  ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog764  hydrog ? ? A  C   704  O2    ? ? ? 1_555 A  G   722  N2  ? ? 0 C   705  0 G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog765  hydrog ? ? A  G   705  N2    ? ? ? 1_555 A  G   721  O6  ? ? 0 G   706  0 G   722  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? ? 
? 
hydrog766  hydrog ? ? A  C   706  N3    ? ? ? 1_555 A  A   720  N6  ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ?     
? ? 
hydrog767  hydrog ? ? A  C   706  N4    ? ? ? 1_555 A  A   720  N7  ? ? 0 C   707  0 A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ?     
? ? 
hydrog768  hydrog ? ? A  A   707  N6    ? ? ? 1_555 A  G   719  N3  ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog769  hydrog ? ? A  A   707  N7    ? ? ? 1_555 A  G   719  N2  ? ? 0 A   708  0 G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     
? ? 
hydrog770  hydrog ? ? A  G   708  N1    ? ? ? 1_555 A  C   718  N3  ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog771  hydrog ? ? A  G   708  N2    ? ? ? 1_555 A  C   718  O2  ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog772  hydrog ? ? A  G   708  O6    ? ? ? 1_555 A  C   718  N4  ? ? 0 G   709  0 C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog773  hydrog ? ? A  G   709  N1    ? ? ? 1_555 A  C   717  N3  ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog774  hydrog ? ? A  G   709  N2    ? ? ? 1_555 A  C   717  O2  ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog775  hydrog ? ? A  G   709  O6    ? ? ? 1_555 A  C   717  N4  ? ? 0 G   710  0 C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog776  hydrog ? ? A  G   710  N1    ? ? ? 1_555 A  C   716  N3  ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog777  hydrog ? ? A  G   710  N2    ? ? ? 1_555 A  C   716  O2  ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog778  hydrog ? ? A  G   710  O6    ? ? ? 1_555 A  C   716  N4  ? ? 0 G   711  0 C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog779  hydrog ? ? A  C   711  N3    ? ? ? 1_555 A  G   715  N1  ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog780  hydrog ? ? A  C   711  N4    ? ? ? 1_555 A  G   715  O6  ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog781  hydrog ? ? A  C   711  O2    ? ? ? 1_555 A  G   715  N2  ? ? 0 C   712  0 G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog782  hydrog ? ? A  C   725  N4    ? ? ? 1_555 A  G   743  O6  ? ? 0 C   726  0 G   744  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     ? 
? 
hydrog783  hydrog ? ? A  C   727  N3    ? ? ? 1_555 A  G   742  N1  ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog784  hydrog ? ? A  C   727  N4    ? ? ? 1_555 A  G   742  O6  ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog785  hydrog ? ? A  C   727  O2    ? ? ? 1_555 A  G   742  N2  ? ? 0 C   728  0 G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? ? 
hydrog786  hydrog ? ? A  C   728  N3    ? ? ? 1_555 A  G   741  N1  ? ? 0 C   729  0 G   742  1_555 ? ? ? ? ?