data_1JJB
# 
_entry.id   1JJB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1JJB         
RCSB  RCSB013838   
WWPDB D_1000013838 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2ACE 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7) FROM TORPEDO CALIFORNICA' unspecified 
PDB 1VXR 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JJB 
_pdbx_database_status.recvd_initial_deposition_date   2001-07-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Koellner, G.'  1 
'Steiner, T.'   2 
'Millard, C.B.' 3 
'Silman, I.'    4 
'Sussman, J.L.' 5 
# 
_citation.id                        primary 
_citation.title                     
'A neutral molecule in a cation-binding site: specific binding of a PEG-SH to acetylcholinesterase from Torpedo californica.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            320 
_citation.page_first                721 
_citation.page_last                 725 
_citation.year                      2002 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12095250 
_citation.pdbx_database_id_DOI      '10.1016/S0022-2836(02)00475-8' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Koellner, G.'  1 
primary 'Steiner, T.'   2 
primary 'Millard, C.B.' 3 
primary 'Silman, I.'    4 
primary 'Sussman, J.L.' 5 
# 
_cell.entry_id           1JJB 
_cell.length_a           111.200 
_cell.length_b           111.200 
_cell.length_c           137.119 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JJB 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE                  60193.977 1   3.1.1.7 ? ? ? 
2 non-polymer man N-ACETYL-D-GLUCOSAMINE                221.208   2   ?       ? ? ? 
3 non-polymer syn '1-DEOXY-1-THIO-HEPTAETHYLENE GLYCOL' 342.449   1   ?       ? ? ? 
4 water       nat water                                 18.015    623 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEM
WNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQE
APGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRR
RAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGV
NKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNVICP
LMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTGNPN
EPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEM
WNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQE
APGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRR
RAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGV
NKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNVICP
LMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTGNPN
EPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNAT
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLU n 
1 3   LEU n 
1 4   LEU n 
1 5   VAL n 
1 6   ASN n 
1 7   THR n 
1 8   LYS n 
1 9   SER n 
1 10  GLY n 
1 11  LYS n 
1 12  VAL n 
1 13  MET n 
1 14  GLY n 
1 15  THR n 
1 16  ARG n 
1 17  VAL n 
1 18  PRO n 
1 19  VAL n 
1 20  LEU n 
1 21  SER n 
1 22  SER n 
1 23  HIS n 
1 24  ILE n 
1 25  SER n 
1 26  ALA n 
1 27  PHE n 
1 28  LEU n 
1 29  GLY n 
1 30  ILE n 
1 31  PRO n 
1 32  PHE n 
1 33  ALA n 
1 34  GLU n 
1 35  PRO n 
1 36  PRO n 
1 37  VAL n 
1 38  GLY n 
1 39  ASN n 
1 40  MET n 
1 41  ARG n 
1 42  PHE n 
1 43  ARG n 
1 44  ARG n 
1 45  PRO n 
1 46  GLU n 
1 47  PRO n 
1 48  LYS n 
1 49  LYS n 
1 50  PRO n 
1 51  TRP n 
1 52  SER n 
1 53  GLY n 
1 54  VAL n 
1 55  TRP n 
1 56  ASN n 
1 57  ALA n 
1 58  SER n 
1 59  THR n 
1 60  TYR n 
1 61  PRO n 
1 62  ASN n 
1 63  ASN n 
1 64  CYS n 
1 65  GLN n 
1 66  GLN n 
1 67  TYR n 
1 68  VAL n 
1 69  ASP n 
1 70  GLU n 
1 71  GLN n 
1 72  PHE n 
1 73  PRO n 
1 74  GLY n 
1 75  PHE n 
1 76  SER n 
1 77  GLY n 
1 78  SER n 
1 79  GLU n 
1 80  MET n 
1 81  TRP n 
1 82  ASN n 
1 83  PRO n 
1 84  ASN n 
1 85  ARG n 
1 86  GLU n 
1 87  MET n 
1 88  SER n 
1 89  GLU n 
1 90  ASP n 
1 91  CYS n 
1 92  LEU n 
1 93  TYR n 
1 94  LEU n 
1 95  ASN n 
1 96  ILE n 
1 97  TRP n 
1 98  VAL n 
1 99  PRO n 
1 100 SER n 
1 101 PRO n 
1 102 ARG n 
1 103 PRO n 
1 104 LYS n 
1 105 SER n 
1 106 THR n 
1 107 THR n 
1 108 VAL n 
1 109 MET n 
1 110 VAL n 
1 111 TRP n 
1 112 ILE n 
1 113 TYR n 
1 114 GLY n 
1 115 GLY n 
1 116 GLY n 
1 117 PHE n 
1 118 TYR n 
1 119 SER n 
1 120 GLY n 
1 121 SER n 
1 122 SER n 
1 123 THR n 
1 124 LEU n 
1 125 ASP n 
1 126 VAL n 
1 127 TYR n 
1 128 ASN n 
1 129 GLY n 
1 130 LYS n 
1 131 TYR n 
1 132 LEU n 
1 133 ALA n 
1 134 TYR n 
1 135 THR n 
1 136 GLU n 
1 137 GLU n 
1 138 VAL n 
1 139 VAL n 
1 140 LEU n 
1 141 VAL n 
1 142 SER n 
1 143 LEU n 
1 144 SER n 
1 145 TYR n 
1 146 ARG n 
1 147 VAL n 
1 148 GLY n 
1 149 ALA n 
1 150 PHE n 
1 151 GLY n 
1 152 PHE n 
1 153 LEU n 
1 154 ALA n 
1 155 LEU n 
1 156 HIS n 
1 157 GLY n 
1 158 SER n 
1 159 GLN n 
1 160 GLU n 
1 161 ALA n 
1 162 PRO n 
1 163 GLY n 
1 164 ASN n 
1 165 VAL n 
1 166 GLY n 
1 167 LEU n 
1 168 LEU n 
1 169 ASP n 
1 170 GLN n 
1 171 ARG n 
1 172 MET n 
1 173 ALA n 
1 174 LEU n 
1 175 GLN n 
1 176 TRP n 
1 177 VAL n 
1 178 HIS n 
1 179 ASP n 
1 180 ASN n 
1 181 ILE n 
1 182 GLN n 
1 183 PHE n 
1 184 PHE n 
1 185 GLY n 
1 186 GLY n 
1 187 ASP n 
1 188 PRO n 
1 189 LYS n 
1 190 THR n 
1 191 VAL n 
1 192 THR n 
1 193 ILE n 
1 194 PHE n 
1 195 GLY n 
1 196 GLU n 
1 197 SER n 
1 198 ALA n 
1 199 GLY n 
1 200 GLY n 
1 201 ALA n 
1 202 SER n 
1 203 VAL n 
1 204 GLY n 
1 205 MET n 
1 206 HIS n 
1 207 ILE n 
1 208 LEU n 
1 209 SER n 
1 210 PRO n 
1 211 GLY n 
1 212 SER n 
1 213 ARG n 
1 214 ASP n 
1 215 LEU n 
1 216 PHE n 
1 217 ARG n 
1 218 ARG n 
1 219 ALA n 
1 220 ILE n 
1 221 LEU n 
1 222 GLN n 
1 223 SER n 
1 224 GLY n 
1 225 SER n 
1 226 PRO n 
1 227 ASN n 
1 228 CYS n 
1 229 PRO n 
1 230 TRP n 
1 231 ALA n 
1 232 SER n 
1 233 VAL n 
1 234 SER n 
1 235 VAL n 
1 236 ALA n 
1 237 GLU n 
1 238 GLY n 
1 239 ARG n 
1 240 ARG n 
1 241 ARG n 
1 242 ALA n 
1 243 VAL n 
1 244 GLU n 
1 245 LEU n 
1 246 GLY n 
1 247 ARG n 
1 248 ASN n 
1 249 LEU n 
1 250 ASN n 
1 251 CYS n 
1 252 ASN n 
1 253 LEU n 
1 254 ASN n 
1 255 SER n 
1 256 ASP n 
1 257 GLU n 
1 258 GLU n 
1 259 LEU n 
1 260 ILE n 
1 261 HIS n 
1 262 CYS n 
1 263 LEU n 
1 264 ARG n 
1 265 GLU n 
1 266 LYS n 
1 267 LYS n 
1 268 PRO n 
1 269 GLN n 
1 270 GLU n 
1 271 LEU n 
1 272 ILE n 
1 273 ASP n 
1 274 VAL n 
1 275 GLU n 
1 276 TRP n 
1 277 ASN n 
1 278 VAL n 
1 279 LEU n 
1 280 PRO n 
1 281 PHE n 
1 282 ASP n 
1 283 SER n 
1 284 ILE n 
1 285 PHE n 
1 286 ARG n 
1 287 PHE n 
1 288 SER n 
1 289 PHE n 
1 290 VAL n 
1 291 PRO n 
1 292 VAL n 
1 293 ILE n 
1 294 ASP n 
1 295 GLY n 
1 296 GLU n 
1 297 PHE n 
1 298 PHE n 
1 299 PRO n 
1 300 THR n 
1 301 SER n 
1 302 LEU n 
1 303 GLU n 
1 304 SER n 
1 305 MET n 
1 306 LEU n 
1 307 ASN n 
1 308 SER n 
1 309 GLY n 
1 310 ASN n 
1 311 PHE n 
1 312 LYS n 
1 313 LYS n 
1 314 THR n 
1 315 GLN n 
1 316 ILE n 
1 317 LEU n 
1 318 LEU n 
1 319 GLY n 
1 320 VAL n 
1 321 ASN n 
1 322 LYS n 
1 323 ASP n 
1 324 GLU n 
1 325 GLY n 
1 326 SER n 
1 327 PHE n 
1 328 PHE n 
1 329 LEU n 
1 330 LEU n 
1 331 TYR n 
1 332 GLY n 
1 333 ALA n 
1 334 PRO n 
1 335 GLY n 
1 336 PHE n 
1 337 SER n 
1 338 LYS n 
1 339 ASP n 
1 340 SER n 
1 341 GLU n 
1 342 SER n 
1 343 LYS n 
1 344 ILE n 
1 345 SER n 
1 346 ARG n 
1 347 GLU n 
1 348 ASP n 
1 349 PHE n 
1 350 MET n 
1 351 SER n 
1 352 GLY n 
1 353 VAL n 
1 354 LYS n 
1 355 LEU n 
1 356 SER n 
1 357 VAL n 
1 358 PRO n 
1 359 HIS n 
1 360 ALA n 
1 361 ASN n 
1 362 ASP n 
1 363 LEU n 
1 364 GLY n 
1 365 LEU n 
1 366 ASP n 
1 367 ALA n 
1 368 VAL n 
1 369 THR n 
1 370 LEU n 
1 371 GLN n 
1 372 TYR n 
1 373 THR n 
1 374 ASP n 
1 375 TRP n 
1 376 MET n 
1 377 ASP n 
1 378 ASP n 
1 379 ASN n 
1 380 ASN n 
1 381 GLY n 
1 382 ILE n 
1 383 LYS n 
1 384 ASN n 
1 385 ARG n 
1 386 ASP n 
1 387 GLY n 
1 388 LEU n 
1 389 ASP n 
1 390 ASP n 
1 391 ILE n 
1 392 VAL n 
1 393 GLY n 
1 394 ASP n 
1 395 HIS n 
1 396 ASN n 
1 397 VAL n 
1 398 ILE n 
1 399 CYS n 
1 400 PRO n 
1 401 LEU n 
1 402 MET n 
1 403 HIS n 
1 404 PHE n 
1 405 VAL n 
1 406 ASN n 
1 407 LYS n 
1 408 TYR n 
1 409 THR n 
1 410 LYS n 
1 411 PHE n 
1 412 GLY n 
1 413 ASN n 
1 414 GLY n 
1 415 THR n 
1 416 TYR n 
1 417 LEU n 
1 418 TYR n 
1 419 PHE n 
1 420 PHE n 
1 421 ASN n 
1 422 HIS n 
1 423 ARG n 
1 424 ALA n 
1 425 SER n 
1 426 ASN n 
1 427 LEU n 
1 428 VAL n 
1 429 TRP n 
1 430 PRO n 
1 431 GLU n 
1 432 TRP n 
1 433 MET n 
1 434 GLY n 
1 435 VAL n 
1 436 ILE n 
1 437 HIS n 
1 438 GLY n 
1 439 TYR n 
1 440 GLU n 
1 441 ILE n 
1 442 GLU n 
1 443 PHE n 
1 444 VAL n 
1 445 PHE n 
1 446 GLY n 
1 447 LEU n 
1 448 PRO n 
1 449 LEU n 
1 450 VAL n 
1 451 LYS n 
1 452 GLU n 
1 453 LEU n 
1 454 ASN n 
1 455 TYR n 
1 456 THR n 
1 457 ALA n 
1 458 GLU n 
1 459 GLU n 
1 460 GLU n 
1 461 ALA n 
1 462 LEU n 
1 463 SER n 
1 464 ARG n 
1 465 ARG n 
1 466 ILE n 
1 467 MET n 
1 468 HIS n 
1 469 TYR n 
1 470 TRP n 
1 471 ALA n 
1 472 THR n 
1 473 PHE n 
1 474 ALA n 
1 475 LYS n 
1 476 THR n 
1 477 GLY n 
1 478 ASN n 
1 479 PRO n 
1 480 ASN n 
1 481 GLU n 
1 482 PRO n 
1 483 HIS n 
1 484 SER n 
1 485 GLN n 
1 486 GLU n 
1 487 SER n 
1 488 LYS n 
1 489 TRP n 
1 490 PRO n 
1 491 LEU n 
1 492 PHE n 
1 493 THR n 
1 494 THR n 
1 495 LYS n 
1 496 GLU n 
1 497 GLN n 
1 498 LYS n 
1 499 PHE n 
1 500 ILE n 
1 501 ASP n 
1 502 LEU n 
1 503 ASN n 
1 504 THR n 
1 505 GLU n 
1 506 PRO n 
1 507 MET n 
1 508 LYS n 
1 509 VAL n 
1 510 HIS n 
1 511 GLN n 
1 512 ARG n 
1 513 LEU n 
1 514 ARG n 
1 515 VAL n 
1 516 GLN n 
1 517 MET n 
1 518 CYS n 
1 519 VAL n 
1 520 PHE n 
1 521 TRP n 
1 522 ASN n 
1 523 GLN n 
1 524 PHE n 
1 525 LEU n 
1 526 PRO n 
1 527 LYS n 
1 528 LEU n 
1 529 LEU n 
1 530 ASN n 
1 531 ALA n 
1 532 THR n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Torpedo californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      Torpedo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     'PACIFIC ELECTRIC RAY' 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    'ELECTRIC ORGAN' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEM
WNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQE
APGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRR
RAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGV
NKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNVICP
LMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTGNPN
EPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSSSGTSSSKGIIFYVLFSILYL
IF
;
_struct_ref.pdbx_align_begin           25 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1JJB 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 532 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  25 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  556 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       4 
_struct_ref_seq.pdbx_auth_seq_align_end       535 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                       ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                              ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                             ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                 ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                            ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                            ? 'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE                ? 'C8 H15 N O6'    221.208 
PE7 non-polymer         . '1-DEOXY-1-THIO-HEPTAETHYLENE GLYCOL' ? 'C14 H30 O7 S'   342.449 
PHE 'L-peptide linking' y PHENYLALANINE                         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                              ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1JJB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.06 
_exptl_crystal.density_percent_sol   69.73 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_details    '34% PEG 200, 0.05M MES, pH 5.8, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-07-23 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'ENRAF-NONIUS FR571' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
# 
_reflns.entry_id                     1JJB 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   41349 
_reflns.number_all                   67047 
_reflns.percent_possible_obs         94.1 
_reflns.pdbx_Rmerge_I_obs            0.043 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.9 
_reflns.B_iso_Wilson_estimate        32.8 
_reflns.pdbx_redundancy              5.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   93.0 
_reflns_shell.Rmerge_I_obs           0.23 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        7.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1JJB 
_refine.ls_number_reflns_obs                     41332 
_refine.ls_number_reflns_all                     67047 
_refine.pdbx_ls_sigma_I                          1.0 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_data_cutoff_high_absF               2903806.56 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             19.89 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    94.1 
_refine.ls_R_factor_obs                          0.178 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.178 
_refine.ls_R_factor_R_free                       0.224 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_number_reflns_R_free                  4165 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               34.6 
_refine.aniso_B[1][1]                            6.31 
_refine.aniso_B[2][2]                            6.31 
_refine.aniso_B[3][3]                            -12.62 
_refine.aniso_B[1][2]                            4.13 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.378 
_refine.solvent_model_param_bsol                 80.70 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1JJB 
_refine_analyze.Luzzati_coordinate_error_obs    0.23 
_refine_analyze.Luzzati_sigma_a_obs             0.26 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.29 
_refine_analyze.Luzzati_sigma_a_free            0.29 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4201 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         50 
_refine_hist.number_atoms_solvent             623 
_refine_hist.number_atoms_total               4874 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        19.89 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.7  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.81  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        0.66  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.14  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        6.49  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       7.60  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.44 
_refine_ls_shell.number_reflns_R_work             5928 
_refine_ls_shell.R_factor_R_work                  0.245 
_refine_ls_shell.percent_reflns_obs               91.7 
_refine_ls_shell.R_factor_R_free                  0.273 
_refine_ls_shell.R_factor_R_free_error            0.010 
_refine_ls_shell.percent_reflns_R_free            10.6 
_refine_ls_shell.number_reflns_R_free             702 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1JJB 
_struct.title                     
'A neutral molecule in cation-binding site: Specific binding of PEG-SH to Acetylcholinesterase from Torpedo californica' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JJB 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;PEG (polyethylene), SERINE HYDROLASE, ALPHA/BETA HYDROLASE, NEUROTRANSMITTER CLEAVAGE, CATALYTIC TRIAD, GLYCOSYLATED PROTEIN, HYDROLASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 37  ? ARG A 41  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  2  PHE A 75  ? MET A 80  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  3  LEU A 124 ? ASN A 128 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  4  GLY A 129 ? GLU A 137 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  5  VAL A 147 ? LEU A 153 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P6  6  ASN A 164 ? ILE A 181 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  7  GLN A 182 ? PHE A 184 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  8  SER A 197 ? SER A 209 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  9  SER A 209 ? ASP A 214 ? SER A 212 ASP A 217 1 ? 6  
HELX_P HELX_P10 10 VAL A 235 ? LEU A 249 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P11 11 SER A 255 ? LYS A 266 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 12 LYS A 267 ? GLU A 275 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 13 TRP A 276 ? LEU A 279 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 14 SER A 301 ? GLY A 309 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 15 GLY A 325 ? ALA A 333 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 16 SER A 345 ? VAL A 357 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 17 ASN A 361 ? THR A 373 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P18 18 ASN A 380 ? VAL A 397 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 19 VAL A 397 ? LYS A 410 ? VAL A 400 LYS A 413 1 ? 14 
HELX_P HELX_P20 20 PRO A 430 ? GLY A 434 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 21 GLU A 440 ? PHE A 445 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 22 GLY A 446 ? ASN A 454 ? GLY A 449 ASN A 457 5 ? 9  
HELX_P HELX_P23 23 THR A 456 ? GLY A 477 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P24 24 ARG A 514 ? GLN A 523 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P25 25 GLN A 523 ? ALA A 531 ? GLN A 526 ALA A 534 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 64  SG  ? ? ? 1_555 A CYS 91  SG ? ? A CYS 67  A CYS 94   1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf2 disulf ? ? A CYS 251 SG  ? ? ? 1_555 A CYS 262 SG ? ? A CYS 254 A CYS 265  1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf3 disulf ? ? A CYS 399 SG  ? ? ? 1_555 A CYS 518 SG ? ? A CYS 402 A CYS 521  1_555 ? ? ? ? ? ? ? 2.032 ? 
covale1 covale ? ? A ASN 56  ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 59  A NAG 9010 1_555 ? ? ? ? ? ? ? 1.455 ? 
covale2 covale ? ? A ASN 413 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 416 A NAG 9020 1_555 ? ? ? ? ? ? ? 1.452 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           100 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    101 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.09 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
C 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 4   ? THR A 7   ? LEU A 7   THR A 10  
A 2  GLY A 10  ? MET A 13  ? GLY A 13  MET A 16  
A 3  VAL A 54  ? ASN A 56  ? VAL A 57  ASN A 59  
B 1  THR A 15  ? VAL A 19  ? THR A 18  VAL A 22  
B 2  SER A 22  ? PRO A 31  ? SER A 25  PRO A 34  
B 3  TYR A 93  ? VAL A 98  ? TYR A 96  VAL A 101 
B 4  VAL A 139 ? SER A 142 ? VAL A 142 SER A 145 
B 5  THR A 106 ? ILE A 112 ? THR A 109 ILE A 115 
B 6  GLY A 186 ? GLU A 196 ? GLY A 189 GLU A 199 
B 7  ARG A 218 ? GLN A 222 ? ARG A 221 GLN A 225 
B 8  GLN A 315 ? ASN A 321 ? GLN A 318 ASN A 324 
B 9  GLY A 414 ? PHE A 420 ? GLY A 417 PHE A 423 
B 10 LYS A 498 ? LEU A 502 ? LYS A 501 LEU A 505 
B 11 VAL A 509 ? GLN A 511 ? VAL A 512 GLN A 514 
C 1  VAL A 233 ? SER A 234 ? VAL A 236 SER A 237 
C 2  VAL A 292 ? ILE A 293 ? VAL A 295 ILE A 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 5   ? N VAL A 8   O VAL A 12  ? O VAL A 15  
A 2  3  N MET A 13  ? N MET A 16  O TRP A 55  ? O TRP A 58  
B 1  2  N VAL A 17  ? N VAL A 20  O ILE A 24  ? O ILE A 27  
B 2  3  N PHE A 27  ? N PHE A 30  O ILE A 96  ? O ILE A 99  
B 3  4  N TRP A 97  ? N TRP A 100 O LEU A 140 ? O LEU A 143 
B 4  5  O VAL A 141 ? O VAL A 144 N TRP A 111 ? N TRP A 114 
B 5  6  N VAL A 110 ? N VAL A 113 O THR A 192 ? O THR A 195 
B 6  7  N GLY A 195 ? N GLY A 198 O GLN A 222 ? O GLN A 225 
B 7  8  N LEU A 221 ? N LEU A 224 O LEU A 317 ? O LEU A 320 
B 8  9  N VAL A 320 ? N VAL A 323 O PHE A 420 ? O PHE A 423 
B 9  10 N PHE A 419 ? N PHE A 422 O LEU A 502 ? O LEU A 505 
B 10 11 N PHE A 499 ? N PHE A 502 O HIS A 510 ? O HIS A 513 
C 1  2  N VAL A 233 ? N VAL A 236 O ILE A 293 ? O ILE A 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NAG A 9010' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NAG A 9020' 
AC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE PE7 A 999'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  ASN A 56  ? ASN A 59   . ? 1_555 ? 
2  AC1 5  SER A 58  ? SER A 61   . ? 1_555 ? 
3  AC1 5  THR A 59  ? THR A 62   . ? 1_555 ? 
4  AC1 5  HOH E .   ? HOH A 1427 . ? 1_555 ? 
5  AC1 5  HOH E .   ? HOH A 1526 . ? 1_555 ? 
6  AC2 5  ASN A 413 ? ASN A 416  . ? 1_555 ? 
7  AC2 5  HOH E .   ? HOH A 1233 . ? 1_555 ? 
8  AC2 5  HOH E .   ? HOH A 1311 . ? 1_555 ? 
9  AC2 5  HOH E .   ? HOH A 1325 . ? 1_555 ? 
10 AC2 5  HOH E .   ? HOH A 1594 . ? 3_564 ? 
11 AC3 12 TYR A 118 ? TYR A 121  . ? 1_555 ? 
12 AC3 12 PRO A 188 ? PRO A 191  . ? 2_665 ? 
13 AC3 12 LYS A 189 ? LYS A 192  . ? 2_665 ? 
14 AC3 12 GLU A 196 ? GLU A 199  . ? 1_555 ? 
15 AC3 12 TRP A 276 ? TRP A 279  . ? 1_555 ? 
16 AC3 12 PHE A 327 ? PHE A 330  . ? 1_555 ? 
17 AC3 12 TYR A 331 ? TYR A 334  . ? 1_555 ? 
18 AC3 12 HOH E .   ? HOH A 1380 . ? 1_555 ? 
19 AC3 12 HOH E .   ? HOH A 1394 . ? 1_555 ? 
20 AC3 12 HOH E .   ? HOH A 1479 . ? 1_555 ? 
21 AC3 12 HOH E .   ? HOH A 1574 . ? 1_555 ? 
22 AC3 12 HOH E .   ? HOH A 1618 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1JJB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1JJB 
_atom_sites.fract_transf_matrix[1][1]   0.008993 
_atom_sites.fract_transf_matrix[1][2]   0.005192 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010384 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007293 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? -13.453 87.305 34.790 1.00 45.78 ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 1   ? -12.702 87.742 36.001 1.00 45.09 ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 1   ? -11.552 86.795 36.312 1.00 44.48 ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 1   ? -11.608 85.604 36.007 1.00 44.49 ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 1   ? -13.633 87.814 37.215 1.00 45.15 ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 1   ? -12.912 88.174 38.385 1.00 45.24 ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 2   ? -10.514 87.344 36.930 1.00 43.92 ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 2   ? -9.333  86.583 37.307 1.00 42.84 ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 2   ? -9.641  85.622 38.458 1.00 41.67 ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 2   ? -8.907  84.660 38.684 1.00 41.78 ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 2   ? -8.223  87.552 37.720 1.00 43.81 ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 2   ? -6.908  86.895 38.088 1.00 46.37 ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 2   ? -5.797  87.907 38.280 1.00 46.99 ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 2   ? -5.966  88.828 39.099 1.00 47.92 ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 2   ? -4.753  87.786 37.611 1.00 49.11 ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 3   ? -10.728 85.882 39.179 1.00 39.36 ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 3   ? -11.104 85.039 40.304 1.00 37.76 ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 3   ? -12.138 83.986 39.932 1.00 37.10 ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 3   ? -12.610 83.239 40.785 1.00 37.55 ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 3   ? -11.627 85.902 41.453 1.00 36.78 ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 3   ? -10.630 86.948 41.962 1.00 36.07 ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 3   ? -11.246 87.731 43.114 1.00 34.95 ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 3   ? -9.346  86.259 42.408 1.00 35.61 ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 4   ? -12.488 83.921 38.657 1.00 36.30 ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 4   ? -13.459 82.941 38.201 1.00 36.03 ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 4   ? -12.764 81.941 37.284 1.00 35.26 ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 4   ? -12.154 82.324 36.289 1.00 34.63 ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 4   ? -14.600 83.636 37.454 1.00 36.92 ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 4   ? -15.671 82.727 36.844 1.00 38.74 ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 4   ? -16.414 81.969 37.942 1.00 38.83 ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 4   ? -16.645 83.579 36.036 1.00 40.02 ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 5   ? -12.850 80.661 37.630 1.00 34.55 ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 5   ? -12.223 79.619 36.829 1.00 34.45 ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 5   ? -13.194 78.485 36.533 1.00 34.94 ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 5   ? -13.862 77.968 37.429 1.00 35.02 ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 5   ? -10.982 79.039 37.539 1.00 34.57 ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 5   ? -10.389 77.903 36.712 1.00 33.30 ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 5   ? -9.948  80.136 37.752 1.00 33.70 ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 6   ? -13.268 78.097 35.266 1.00 35.36 ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 6   ? -14.157 77.019 34.875 1.00 36.67 ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 6   ? -13.370 75.720 34.761 1.00 35.81 ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 6   ? -12.545 75.555 33.865 1.00 37.09 ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 6   ? -14.845 77.354 33.544 1.00 38.70 ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 6   ? -15.924 76.344 33.173 1.00 42.11 ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 6   ? -16.706 75.904 34.027 1.00 43.76 ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 6   ? -15.981 75.981 31.894 1.00 43.93 ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 7   ? -13.621 74.800 35.683 1.00 34.27 ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 7   ? -12.932 73.520 35.676 1.00 33.07 ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 7   ? -13.863 72.443 35.140 1.00 32.99 ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 7   ? -15.059 72.682 34.948 1.00 32.72 ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 7   ? -12.503 73.108 37.091 1.00 32.51 ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 7   ? -13.653 72.664 37.818 1.00 32.52 ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 7   ? -11.869 74.290 37.828 1.00 31.37 ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 8   ? -13.306 71.257 34.907 1.00 32.41 ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 8   ? -14.066 70.123 34.408 1.00 32.22 ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 8   ? -15.122 69.671 35.417 1.00 33.11 ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 8   ? -16.017 68.900 35.081 1.00 33.26 ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 8   ? -13.120 68.965 34.091 1.00 32.29 ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 8   ? -12.097 69.291 33.001 1.00 31.89 ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 8   ? -11.055 68.196 32.868 1.00 30.91 ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 8   ? -10.075 68.507 31.747 1.00 30.62 ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 8   ? -8.897  67.604 31.783 1.00 30.00 ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 9   ? -15.015 70.148 36.653 1.00 33.69 ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 9   ? -15.981 69.790 37.689 1.00 34.38 ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 9   ? -17.024 70.893 37.869 1.00 34.24 ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 9   ? -18.053 70.690 38.514 1.00 33.90 ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 9   ? -15.267 69.544 39.021 1.00 35.50 ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 9   ? -14.388 68.435 38.933 1.00 37.81 ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 10  ? -16.750 72.056 37.289 1.00 34.14 ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 10  ? -17.664 73.179 37.400 1.00 34.59 ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 10  ? -16.911 74.480 37.610 1.00 35.13 ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 10  ? -15.679 74.485 37.696 1.00 34.85 ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 11  ? -17.649 75.583 37.701 1.00 35.74 ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 11  ? -17.044 76.897 37.892 1.00 36.39 ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 11  ? -16.703 77.147 39.351 1.00 36.11 ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 11  ? -17.403 76.693 40.255 1.00 35.83 ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 11  ? -17.986 77.990 37.384 1.00 37.97 ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 11  ? -18.444 77.762 35.953 1.00 40.70 ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 11  ? -19.283 78.914 35.418 1.00 42.51 ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 11  ? -19.776 78.612 34.002 1.00 44.11 ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 11  ? -20.482 79.777 33.388 1.00 46.33 ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 12  ? -15.618 77.879 39.567 1.00 35.98 ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 12  ? -15.151 78.192 40.905 1.00 36.19 ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 12  ? -14.849 79.683 41.020 1.00 35.83 ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 12  ? -14.325 80.289 40.084 1.00 35.12 ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 12  ? -13.865 77.392 41.236 1.00 36.65 ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 12  ? -13.314 77.818 42.578 1.00 37.44 ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 12  ? -14.169 75.906 41.249 1.00 37.21 ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 13  ? -15.185 80.265 42.168 1.00 35.61 ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 13  ? -14.941 81.683 42.411 1.00 35.92 ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 13  ? -13.966 81.837 43.569 1.00 35.22 ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 13  ? -14.257 81.443 44.700 1.00 34.26 ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 13  ? -16.251 82.405 42.746 1.00 38.05 ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 13  ? -16.110 83.910 43.000 1.00 40.39 ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 13  ? -15.564 84.830 41.540 1.00 45.90 ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 13  ? -17.151 85.106 40.713 1.00 44.75 ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 14  ? -12.809 82.416 43.280 1.00 34.46 ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 14  ? -11.814 82.611 44.312 1.00 35.46 ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 14  ? -11.926 83.959 44.994 1.00 35.67 ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 14  ? -12.955 84.632 44.912 1.00 35.13 ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 15  ? -10.849 84.353 45.664 1.00 36.38 ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 15  ? -10.797 85.616 46.383 1.00 36.87 ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 15  ? -9.403  86.216 46.294 1.00 37.42 ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 15  ? -8.408  85.490 46.270 1.00 37.16 ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 15  ? -11.143 85.419 47.871 1.00 37.04 ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 15  ? -10.988 86.661 48.563 1.00 38.20 ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 15  ? -10.221 84.379 48.502 1.00 36.96 ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 16  ? -9.330  87.541 46.241 1.00 38.19 ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 16  ? -8.039  88.209 46.170 1.00 38.65 ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 16  ? -7.500  88.326 47.592 1.00 37.91 ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 16  ? -8.230  88.687 48.511 1.00 38.18 ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 16  ? -8.179  89.599 45.549 1.00 40.71 ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 16  ? -6.865  90.127 45.006 1.00 44.12 ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 16  ? -6.959  91.552 44.497 1.00 46.70 ? 19   ARG A CD  1 
ATOM   115  N NE  . ARG A 1 16  ? -5.831  91.859 43.617 1.00 49.86 ? 19   ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 16  ? -5.363  93.082 43.380 1.00 51.54 ? 19   ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 16  ? -5.905  94.141 43.980 1.00 51.42 ? 19   ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 16  ? -4.334  93.244 42.553 1.00 52.64 ? 19   ARG A NH2 1 
ATOM   119  N N   . VAL A 1 17  ? -6.229  88.002 47.781 1.00 36.82 ? 20   VAL A N   1 
ATOM   120  C CA  . VAL A 1 17  ? -5.646  88.076 49.109 1.00 35.59 ? 20   VAL A CA  1 
ATOM   121  C C   . VAL A 1 17  ? -4.349  88.868 49.088 1.00 34.48 ? 20   VAL A C   1 
ATOM   122  O O   . VAL A 1 17  ? -3.565  88.773 48.146 1.00 34.07 ? 20   VAL A O   1 
ATOM   123  C CB  . VAL A 1 17  ? -5.364  86.659 49.685 1.00 36.11 ? 20   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 17  ? -6.620  85.806 49.605 1.00 35.55 ? 20   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 17  ? -4.222  85.998 48.929 1.00 35.96 ? 20   VAL A CG2 1 
ATOM   126  N N   . PRO A 1 18  ? -4.115  89.675 50.129 1.00 34.00 ? 21   PRO A N   1 
ATOM   127  C CA  . PRO A 1 18  ? -2.899  90.482 50.217 1.00 34.09 ? 21   PRO A CA  1 
ATOM   128  C C   . PRO A 1 18  ? -1.706  89.610 50.604 1.00 34.22 ? 21   PRO A C   1 
ATOM   129  O O   . PRO A 1 18  ? -1.860  88.591 51.282 1.00 34.17 ? 21   PRO A O   1 
ATOM   130  C CB  . PRO A 1 18  ? -3.250  91.499 51.295 1.00 33.99 ? 21   PRO A CB  1 
ATOM   131  C CG  . PRO A 1 18  ? -4.091  90.681 52.232 1.00 33.59 ? 21   PRO A CG  1 
ATOM   132  C CD  . PRO A 1 18  ? -4.999  89.931 51.280 1.00 34.07 ? 21   PRO A CD  1 
ATOM   133  N N   . VAL A 1 19  ? -0.519  90.012 50.167 1.00 34.21 ? 22   VAL A N   1 
ATOM   134  C CA  . VAL A 1 19  ? 0.694   89.273 50.474 1.00 34.16 ? 22   VAL A CA  1 
ATOM   135  C C   . VAL A 1 19  ? 1.919   90.140 50.194 1.00 35.35 ? 22   VAL A C   1 
ATOM   136  O O   . VAL A 1 19  ? 2.167   90.535 49.053 1.00 35.18 ? 22   VAL A O   1 
ATOM   137  C CB  . VAL A 1 19  ? 0.773   87.953 49.644 1.00 33.57 ? 22   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 19  ? 0.591   88.248 48.162 1.00 31.84 ? 22   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 19  ? 2.102   87.254 49.887 1.00 31.88 ? 22   VAL A CG2 1 
ATOM   140  N N   . LEU A 1 20  ? 2.673   90.437 51.250 1.00 36.41 ? 23   LEU A N   1 
ATOM   141  C CA  . LEU A 1 20  ? 3.880   91.249 51.150 1.00 37.70 ? 23   LEU A CA  1 
ATOM   142  C C   . LEU A 1 20  ? 3.674   92.542 50.350 1.00 39.08 ? 23   LEU A C   1 
ATOM   143  O O   . LEU A 1 20  ? 4.435   92.850 49.431 1.00 38.96 ? 23   LEU A O   1 
ATOM   144  C CB  . LEU A 1 20  ? 5.009   90.412 50.540 1.00 37.26 ? 23   LEU A CB  1 
ATOM   145  C CG  . LEU A 1 20  ? 5.364   89.161 51.354 1.00 37.74 ? 23   LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 20  ? 6.466   88.377 50.658 1.00 37.29 ? 23   LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 20  ? 5.800   89.570 52.758 1.00 37.34 ? 23   LEU A CD2 1 
ATOM   148  N N   . SER A 1 21  ? 2.631   93.285 50.715 1.00 40.29 ? 24   SER A N   1 
ATOM   149  C CA  . SER A 1 21  ? 2.287   94.558 50.082 1.00 41.73 ? 24   SER A CA  1 
ATOM   150  C C   . SER A 1 21  ? 1.788   94.431 48.644 1.00 41.49 ? 24   SER A C   1 
ATOM   151  O O   . SER A 1 21  ? 1.777   95.409 47.896 1.00 42.03 ? 24   SER A O   1 
ATOM   152  C CB  . SER A 1 21  ? 3.481   95.518 50.122 1.00 42.66 ? 24   SER A CB  1 
ATOM   153  O OG  . SER A 1 21  ? 4.408   95.218 49.094 1.00 45.18 ? 24   SER A OG  1 
ATOM   154  N N   . SER A 1 22  ? 1.376   93.225 48.263 1.00 41.19 ? 25   SER A N   1 
ATOM   155  C CA  . SER A 1 22  ? 0.848   92.965 46.927 1.00 39.84 ? 25   SER A CA  1 
ATOM   156  C C   . SER A 1 22  ? -0.393  92.077 47.057 1.00 39.42 ? 25   SER A C   1 
ATOM   157  O O   . SER A 1 22  ? -0.979  91.974 48.135 1.00 38.62 ? 25   SER A O   1 
ATOM   158  C CB  . SER A 1 22  ? 1.903   92.277 46.059 1.00 39.80 ? 25   SER A CB  1 
ATOM   159  O OG  . SER A 1 22  ? 1.423   92.096 44.738 1.00 40.69 ? 25   SER A OG  1 
ATOM   160  N N   . HIS A 1 23  ? -0.797  91.432 45.969 1.00 39.16 ? 26   HIS A N   1 
ATOM   161  C CA  . HIS A 1 23  ? -1.975  90.574 46.013 1.00 39.27 ? 26   HIS A CA  1 
ATOM   162  C C   . HIS A 1 23  ? -1.844  89.410 45.041 1.00 38.59 ? 26   HIS A C   1 
ATOM   163  O O   . HIS A 1 23  ? -1.082  89.481 44.076 1.00 38.18 ? 26   HIS A O   1 
ATOM   164  C CB  . HIS A 1 23  ? -3.235  91.371 45.634 1.00 41.12 ? 26   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 23  ? -3.548  92.513 46.554 1.00 43.21 ? 26   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 23  ? -4.064  92.335 47.820 1.00 44.58 ? 26   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 23  ? -3.446  93.853 46.378 1.00 44.29 ? 26   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 23  ? -4.270  93.514 48.382 1.00 44.37 ? 26   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 23  ? -3.903  94.452 47.528 1.00 44.66 ? 26   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 24  ? -2.586  88.338 45.313 1.00 37.21 ? 27   ILE A N   1 
ATOM   171  C CA  . ILE A 1 24  ? -2.626  87.170 44.439 1.00 36.99 ? 27   ILE A CA  1 
ATOM   172  C C   . ILE A 1 24  ? -4.002  86.546 44.597 1.00 36.08 ? 27   ILE A C   1 
ATOM   173  O O   . ILE A 1 24  ? -4.787  86.982 45.441 1.00 36.30 ? 27   ILE A O   1 
ATOM   174  C CB  . ILE A 1 24  ? -1.549  86.103 44.771 1.00 37.28 ? 27   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 24  ? -1.792  85.506 46.149 1.00 38.08 ? 27   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 24  ? -0.161  86.715 44.682 1.00 37.99 ? 27   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 24  ? -0.853  84.363 46.457 1.00 39.78 ? 27   ILE A CD1 1 
ATOM   178  N N   . SER A 1 25  ? -4.297  85.533 43.791 1.00 34.98 ? 28   SER A N   1 
ATOM   179  C CA  . SER A 1 25  ? -5.598  84.877 43.847 1.00 34.04 ? 28   SER A CA  1 
ATOM   180  C C   . SER A 1 25  ? -5.562  83.633 44.720 1.00 33.63 ? 28   SER A C   1 
ATOM   181  O O   . SER A 1 25  ? -4.563  82.914 44.754 1.00 33.64 ? 28   SER A O   1 
ATOM   182  C CB  . SER A 1 25  ? -6.055  84.484 42.440 1.00 34.10 ? 28   SER A CB  1 
ATOM   183  O OG  . SER A 1 25  ? -6.076  85.602 41.571 1.00 34.22 ? 28   SER A OG  1 
ATOM   184  N N   . ALA A 1 26  ? -6.662  83.376 45.416 1.00 32.40 ? 29   ALA A N   1 
ATOM   185  C CA  . ALA A 1 26  ? -6.755  82.203 46.269 1.00 32.15 ? 29   ALA A CA  1 
ATOM   186  C C   . ALA A 1 26  ? -8.071  81.470 46.039 1.00 32.05 ? 29   ALA A C   1 
ATOM   187  O O   . ALA A 1 26  ? -9.151  82.067 46.068 1.00 32.22 ? 29   ALA A O   1 
ATOM   188  C CB  . ALA A 1 26  ? -6.626  82.602 47.741 1.00 31.24 ? 29   ALA A CB  1 
ATOM   189  N N   . PHE A 1 27  ? -7.972  80.173 45.790 1.00 31.43 ? 30   PHE A N   1 
ATOM   190  C CA  . PHE A 1 27  ? -9.152  79.349 45.586 1.00 31.03 ? 30   PHE A CA  1 
ATOM   191  C C   . PHE A 1 27  ? -9.125  78.325 46.703 1.00 30.95 ? 30   PHE A C   1 
ATOM   192  O O   . PHE A 1 27  ? -8.466  77.288 46.609 1.00 31.15 ? 30   PHE A O   1 
ATOM   193  C CB  . PHE A 1 27  ? -9.101  78.678 44.220 1.00 30.89 ? 30   PHE A CB  1 
ATOM   194  C CG  . PHE A 1 27  ? -9.096  79.649 43.080 1.00 30.21 ? 30   PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 27  ? -7.911  80.252 42.670 1.00 29.74 ? 30   PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 27  ? -10.283 79.974 42.425 1.00 30.06 ? 30   PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 27  ? -7.903  81.166 41.620 1.00 30.33 ? 30   PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 27  ? -10.292 80.885 41.375 1.00 29.72 ? 30   PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 27  ? -9.096  81.484 40.970 1.00 30.54 ? 30   PHE A CZ  1 
ATOM   200  N N   . LEU A 1 28  ? -9.841  78.644 47.772 1.00 30.77 ? 31   LEU A N   1 
ATOM   201  C CA  . LEU A 1 28  ? -9.880  77.806 48.949 1.00 30.42 ? 31   LEU A CA  1 
ATOM   202  C C   . LEU A 1 28  ? -11.104 76.917 49.040 1.00 30.32 ? 31   LEU A C   1 
ATOM   203  O O   . LEU A 1 28  ? -12.208 77.312 48.658 1.00 30.02 ? 31   LEU A O   1 
ATOM   204  C CB  . LEU A 1 28  ? -9.805  78.695 50.191 1.00 30.46 ? 31   LEU A CB  1 
ATOM   205  C CG  . LEU A 1 28  ? -8.745  79.799 50.120 1.00 31.22 ? 31   LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 28  ? -8.826  80.665 51.376 1.00 30.11 ? 31   LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 28  ? -7.353  79.175 49.969 1.00 30.11 ? 31   LEU A CD2 1 
ATOM   208  N N   . GLY A 1 29  ? -10.886 75.708 49.552 1.00 29.87 ? 32   GLY A N   1 
ATOM   209  C CA  . GLY A 1 29  ? -11.969 74.759 49.736 1.00 29.10 ? 32   GLY A CA  1 
ATOM   210  C C   . GLY A 1 29  ? -12.628 74.170 48.506 1.00 28.68 ? 32   GLY A C   1 
ATOM   211  O O   . GLY A 1 29  ? -13.848 74.002 48.486 1.00 29.32 ? 32   GLY A O   1 
ATOM   212  N N   . ILE A 1 30  ? -11.848 73.860 47.477 1.00 28.47 ? 33   ILE A N   1 
ATOM   213  C CA  . ILE A 1 30  ? -12.417 73.253 46.280 1.00 28.29 ? 33   ILE A CA  1 
ATOM   214  C C   . ILE A 1 30  ? -12.553 71.760 46.563 1.00 28.28 ? 33   ILE A C   1 
ATOM   215  O O   . ILE A 1 30  ? -11.595 71.115 46.977 1.00 28.70 ? 33   ILE A O   1 
ATOM   216  C CB  . ILE A 1 30  ? -11.503 73.419 45.049 1.00 28.55 ? 33   ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 30  ? -11.304 74.904 44.731 1.00 28.34 ? 33   ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 30  ? -12.107 72.668 43.865 1.00 28.18 ? 33   ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 30  ? -10.334 75.167 43.598 1.00 26.74 ? 33   ILE A CD1 1 
ATOM   220  N N   . PRO A 1 31  ? -13.747 71.192 46.350 1.00 28.32 ? 34   PRO A N   1 
ATOM   221  C CA  . PRO A 1 31  ? -13.930 69.760 46.607 1.00 28.03 ? 34   PRO A CA  1 
ATOM   222  C C   . PRO A 1 31  ? -13.370 68.912 45.466 1.00 27.77 ? 34   PRO A C   1 
ATOM   223  O O   . PRO A 1 31  ? -13.501 69.271 44.300 1.00 27.84 ? 34   PRO A O   1 
ATOM   224  C CB  . PRO A 1 31  ? -15.444 69.635 46.733 1.00 28.90 ? 34   PRO A CB  1 
ATOM   225  C CG  . PRO A 1 31  ? -15.926 70.637 45.709 1.00 28.61 ? 34   PRO A CG  1 
ATOM   226  C CD  . PRO A 1 31  ? -15.020 71.830 45.962 1.00 27.98 ? 34   PRO A CD  1 
ATOM   227  N N   . PHE A 1 32  ? -12.735 67.794 45.796 1.00 27.38 ? 35   PHE A N   1 
ATOM   228  C CA  . PHE A 1 32  ? -12.189 66.926 44.759 1.00 28.24 ? 35   PHE A CA  1 
ATOM   229  C C   . PHE A 1 32  ? -12.730 65.505 44.917 1.00 29.04 ? 35   PHE A C   1 
ATOM   230  O O   . PHE A 1 32  ? -12.467 64.628 44.093 1.00 29.60 ? 35   PHE A O   1 
ATOM   231  C CB  . PHE A 1 32  ? -10.650 66.937 44.804 1.00 26.78 ? 35   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 32  ? -10.065 66.401 46.088 1.00 26.16 ? 35   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 32  ? -10.036 65.027 46.340 1.00 25.63 ? 35   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 32  ? -9.537  67.267 47.040 1.00 24.81 ? 35   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 32  ? -9.487  64.523 47.521 1.00 25.01 ? 35   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 32  ? -8.985  66.774 48.231 1.00 25.40 ? 35   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 32  ? -8.960  65.399 48.470 1.00 25.40 ? 35   PHE A CZ  1 
ATOM   238  N N   . ALA A 1 33  ? -13.504 65.295 45.976 1.00 29.29 ? 36   ALA A N   1 
ATOM   239  C CA  . ALA A 1 33  ? -14.090 63.994 46.258 1.00 30.18 ? 36   ALA A CA  1 
ATOM   240  C C   . ALA A 1 33  ? -15.467 64.156 46.884 1.00 31.29 ? 36   ALA A C   1 
ATOM   241  O O   . ALA A 1 33  ? -15.802 65.219 47.409 1.00 31.64 ? 36   ALA A O   1 
ATOM   242  C CB  . ALA A 1 33  ? -13.203 63.230 47.217 1.00 29.46 ? 36   ALA A CB  1 
ATOM   243  N N   . GLU A 1 34  ? -16.263 63.096 46.823 1.00 31.58 ? 37   GLU A N   1 
ATOM   244  C CA  . GLU A 1 34  ? -17.577 63.111 47.439 1.00 32.01 ? 37   GLU A CA  1 
ATOM   245  C C   . GLU A 1 34  ? -17.317 62.980 48.935 1.00 31.71 ? 37   GLU A C   1 
ATOM   246  O O   . GLU A 1 34  ? -16.362 62.321 49.347 1.00 31.25 ? 37   GLU A O   1 
ATOM   247  C CB  . GLU A 1 34  ? -18.410 61.919 46.960 1.00 32.55 ? 37   GLU A CB  1 
ATOM   248  C CG  . GLU A 1 34  ? -18.995 62.079 45.568 1.00 34.91 ? 37   GLU A CG  1 
ATOM   249  C CD  . GLU A 1 34  ? -20.039 63.178 45.513 1.00 35.67 ? 37   GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 34  ? -21.049 63.066 46.239 1.00 37.56 ? 37   GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 34  ? -19.852 64.152 44.754 1.00 35.53 ? 37   GLU A OE2 1 
ATOM   252  N N   . PRO A 1 35  ? -18.145 63.624 49.769 1.00 31.60 ? 38   PRO A N   1 
ATOM   253  C CA  . PRO A 1 35  ? -17.940 63.521 51.216 1.00 31.84 ? 38   PRO A CA  1 
ATOM   254  C C   . PRO A 1 35  ? -17.933 62.048 51.622 1.00 32.35 ? 38   PRO A C   1 
ATOM   255  O O   . PRO A 1 35  ? -18.862 61.310 51.300 1.00 32.16 ? 38   PRO A O   1 
ATOM   256  C CB  . PRO A 1 35  ? -19.139 64.272 51.780 1.00 31.43 ? 38   PRO A CB  1 
ATOM   257  C CG  . PRO A 1 35  ? -19.352 65.348 50.760 1.00 31.84 ? 38   PRO A CG  1 
ATOM   258  C CD  . PRO A 1 35  ? -19.208 64.594 49.453 1.00 31.70 ? 38   PRO A CD  1 
ATOM   259  N N   . PRO A 1 36  ? -16.871 61.598 52.314 1.00 32.66 ? 39   PRO A N   1 
ATOM   260  C CA  . PRO A 1 36  ? -16.786 60.197 52.740 1.00 32.78 ? 39   PRO A CA  1 
ATOM   261  C C   . PRO A 1 36  ? -17.530 59.959 54.049 1.00 33.41 ? 39   PRO A C   1 
ATOM   262  O O   . PRO A 1 36  ? -16.944 59.511 55.035 1.00 32.97 ? 39   PRO A O   1 
ATOM   263  C CB  . PRO A 1 36  ? -15.282 59.976 52.874 1.00 32.67 ? 39   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 36  ? -14.811 61.303 53.393 1.00 32.84 ? 39   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 36  ? -15.591 62.299 52.544 1.00 32.36 ? 39   PRO A CD  1 
ATOM   266  N N   . VAL A 1 37  ? -18.826 60.249 54.044 1.00 34.11 ? 40   VAL A N   1 
ATOM   267  C CA  . VAL A 1 37  ? -19.650 60.099 55.237 1.00 34.74 ? 40   VAL A CA  1 
ATOM   268  C C   . VAL A 1 37  ? -20.617 58.912 55.199 1.00 34.90 ? 40   VAL A C   1 
ATOM   269  O O   . VAL A 1 37  ? -20.777 58.248 54.174 1.00 35.42 ? 40   VAL A O   1 
ATOM   270  C CB  . VAL A 1 37  ? -20.456 61.381 55.484 1.00 34.67 ? 40   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 37  ? -19.511 62.563 55.620 1.00 34.86 ? 40   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 37  ? -21.419 61.611 54.332 1.00 34.70 ? 40   VAL A CG2 1 
ATOM   273  N N   . GLY A 1 38  ? -21.256 58.656 56.335 1.00 35.00 ? 41   GLY A N   1 
ATOM   274  C CA  . GLY A 1 38  ? -22.202 57.560 56.434 1.00 35.11 ? 41   GLY A CA  1 
ATOM   275  C C   . GLY A 1 38  ? -21.599 56.227 56.045 1.00 35.80 ? 41   GLY A C   1 
ATOM   276  O O   . GLY A 1 38  ? -20.572 55.811 56.591 1.00 35.60 ? 41   GLY A O   1 
ATOM   277  N N   . ASN A 1 39  ? -22.238 55.551 55.097 1.00 35.53 ? 42   ASN A N   1 
ATOM   278  C CA  . ASN A 1 39  ? -21.757 54.255 54.643 1.00 35.84 ? 42   ASN A CA  1 
ATOM   279  C C   . ASN A 1 39  ? -20.465 54.395 53.837 1.00 35.62 ? 42   ASN A C   1 
ATOM   280  O O   . ASN A 1 39  ? -19.868 53.401 53.436 1.00 34.49 ? 42   ASN A O   1 
ATOM   281  C CB  . ASN A 1 39  ? -22.837 53.561 53.804 1.00 36.45 ? 42   ASN A CB  1 
ATOM   282  N N   . MET A 1 40  ? -20.033 55.632 53.606 1.00 36.28 ? 43   MET A N   1 
ATOM   283  C CA  . MET A 1 40  ? -18.804 55.876 52.854 1.00 37.10 ? 43   MET A CA  1 
ATOM   284  C C   . MET A 1 40  ? -17.560 55.892 53.741 1.00 35.66 ? 43   MET A C   1 
ATOM   285  O O   . MET A 1 40  ? -16.436 55.829 53.236 1.00 35.67 ? 43   MET A O   1 
ATOM   286  C CB  . MET A 1 40  ? -18.897 57.199 52.084 1.00 40.31 ? 43   MET A CB  1 
ATOM   287  C CG  . MET A 1 40  ? -19.901 57.192 50.937 1.00 43.91 ? 43   MET A CG  1 
ATOM   288  S SD  . MET A 1 40  ? -19.460 55.994 49.664 1.00 49.38 ? 43   MET A SD  1 
ATOM   289  C CE  . MET A 1 40  ? -20.426 54.535 50.181 1.00 48.25 ? 43   MET A CE  1 
ATOM   290  N N   . ARG A 1 41  ? -17.753 55.976 55.056 1.00 34.16 ? 44   ARG A N   1 
ATOM   291  C CA  . ARG A 1 41  ? -16.619 55.988 55.980 1.00 33.09 ? 44   ARG A CA  1 
ATOM   292  C C   . ARG A 1 41  ? -15.788 54.719 55.786 1.00 32.67 ? 44   ARG A C   1 
ATOM   293  O O   . ARG A 1 41  ? -16.336 53.619 55.655 1.00 32.84 ? 44   ARG A O   1 
ATOM   294  C CB  . ARG A 1 41  ? -17.100 56.082 57.435 1.00 32.39 ? 44   ARG A CB  1 
ATOM   295  C CG  . ARG A 1 41  ? -15.964 56.089 58.466 1.00 31.27 ? 44   ARG A CG  1 
ATOM   296  C CD  . ARG A 1 41  ? -16.481 56.028 59.902 1.00 30.53 ? 44   ARG A CD  1 
ATOM   297  N NE  . ARG A 1 41  ? -17.183 57.244 60.307 1.00 29.04 ? 44   ARG A NE  1 
ATOM   298  C CZ  . ARG A 1 41  ? -17.883 57.360 61.431 1.00 28.09 ? 44   ARG A CZ  1 
ATOM   299  N NH1 . ARG A 1 41  ? -17.981 56.330 62.263 1.00 27.54 ? 44   ARG A NH1 1 
ATOM   300  N NH2 . ARG A 1 41  ? -18.469 58.511 61.735 1.00 27.54 ? 44   ARG A NH2 1 
ATOM   301  N N   . PHE A 1 42  ? -14.470 54.892 55.761 1.00 31.84 ? 45   PHE A N   1 
ATOM   302  C CA  . PHE A 1 42  ? -13.503 53.809 55.573 1.00 31.51 ? 45   PHE A CA  1 
ATOM   303  C C   . PHE A 1 42  ? -13.375 53.379 54.118 1.00 32.13 ? 45   PHE A C   1 
ATOM   304  O O   . PHE A 1 42  ? -12.432 52.667 53.764 1.00 32.16 ? 45   PHE A O   1 
ATOM   305  C CB  . PHE A 1 42  ? -13.859 52.571 56.410 1.00 31.24 ? 45   PHE A CB  1 
ATOM   306  C CG  . PHE A 1 42  ? -14.037 52.849 57.877 1.00 30.57 ? 45   PHE A CG  1 
ATOM   307  C CD1 . PHE A 1 42  ? -13.090 53.581 58.585 1.00 29.94 ? 45   PHE A CD1 1 
ATOM   308  C CD2 . PHE A 1 42  ? -15.148 52.352 58.556 1.00 30.20 ? 45   PHE A CD2 1 
ATOM   309  C CE1 . PHE A 1 42  ? -13.245 53.816 59.947 1.00 29.68 ? 45   PHE A CE1 1 
ATOM   310  C CE2 . PHE A 1 42  ? -15.313 52.580 59.920 1.00 30.35 ? 45   PHE A CE2 1 
ATOM   311  C CZ  . PHE A 1 42  ? -14.359 53.314 60.617 1.00 30.05 ? 45   PHE A CZ  1 
ATOM   312  N N   . ARG A 1 43  ? -14.312 53.801 53.274 1.00 32.75 ? 46   ARG A N   1 
ATOM   313  C CA  . ARG A 1 43  ? -14.267 53.419 51.863 1.00 34.39 ? 46   ARG A CA  1 
ATOM   314  C C   . ARG A 1 43  ? -13.329 54.262 51.009 1.00 34.15 ? 46   ARG A C   1 
ATOM   315  O O   . ARG A 1 43  ? -12.978 55.392 51.369 1.00 33.37 ? 46   ARG A O   1 
ATOM   316  C CB  . ARG A 1 43  ? -15.669 53.464 51.237 1.00 36.19 ? 46   ARG A CB  1 
ATOM   317  C CG  . ARG A 1 43  ? -16.620 52.383 51.730 1.00 38.97 ? 46   ARG A CG  1 
ATOM   318  C CD  . ARG A 1 43  ? -17.863 52.298 50.848 1.00 40.40 ? 46   ARG A CD  1 
ATOM   319  N NE  . ARG A 1 43  ? -17.541 51.867 49.488 1.00 42.26 ? 46   ARG A NE  1 
ATOM   320  N N   . ARG A 1 44  ? -12.930 53.696 49.872 1.00 34.42 ? 47   ARG A N   1 
ATOM   321  C CA  . ARG A 1 44  ? -12.064 54.390 48.930 1.00 35.87 ? 47   ARG A CA  1 
ATOM   322  C C   . ARG A 1 44  ? -12.784 55.669 48.513 1.00 35.14 ? 47   ARG A C   1 
ATOM   323  O O   . ARG A 1 44  ? -14.013 55.705 48.443 1.00 34.66 ? 47   ARG A O   1 
ATOM   324  C CB  . ARG A 1 44  ? -11.812 53.529 47.690 1.00 38.19 ? 47   ARG A CB  1 
ATOM   325  C CG  . ARG A 1 44  ? -11.007 52.260 47.934 1.00 42.91 ? 47   ARG A CG  1 
ATOM   326  C CD  . ARG A 1 44  ? -11.001 51.382 46.678 1.00 46.59 ? 47   ARG A CD  1 
ATOM   327  N NE  . ARG A 1 44  ? -10.453 50.047 46.917 1.00 49.81 ? 47   ARG A NE  1 
ATOM   328  C CZ  . ARG A 1 44  ? -9.157  49.777 47.046 1.00 51.49 ? 47   ARG A CZ  1 
ATOM   329  N NH1 . ARG A 1 44  ? -8.261  50.754 46.958 1.00 52.81 ? 47   ARG A NH1 1 
ATOM   330  N NH2 . ARG A 1 44  ? -8.754  48.529 47.259 1.00 52.15 ? 47   ARG A NH2 1 
ATOM   331  N N   . PRO A 1 45  ? -12.029 56.736 48.230 1.00 34.39 ? 48   PRO A N   1 
ATOM   332  C CA  . PRO A 1 45  ? -12.685 57.976 47.828 1.00 34.46 ? 48   PRO A CA  1 
ATOM   333  C C   . PRO A 1 45  ? -13.433 57.843 46.501 1.00 35.42 ? 48   PRO A C   1 
ATOM   334  O O   . PRO A 1 45  ? -13.137 56.979 45.671 1.00 34.69 ? 48   PRO A O   1 
ATOM   335  C CB  . PRO A 1 45  ? -11.527 58.960 47.749 1.00 33.73 ? 48   PRO A CB  1 
ATOM   336  C CG  . PRO A 1 45  ? -10.393 58.093 47.291 1.00 33.26 ? 48   PRO A CG  1 
ATOM   337  C CD  . PRO A 1 45  ? -10.563 56.873 48.169 1.00 34.08 ? 48   PRO A CD  1 
ATOM   338  N N   . GLU A 1 46  ? -14.413 58.714 46.320 1.00 36.40 ? 49   GLU A N   1 
ATOM   339  C CA  . GLU A 1 46  ? -15.220 58.737 45.119 1.00 37.33 ? 49   GLU A CA  1 
ATOM   340  C C   . GLU A 1 46  ? -15.067 60.132 44.526 1.00 35.89 ? 49   GLU A C   1 
ATOM   341  O O   . GLU A 1 46  ? -15.095 61.124 45.252 1.00 35.18 ? 49   GLU A O   1 
ATOM   342  C CB  . GLU A 1 46  ? -16.672 58.458 45.498 1.00 40.23 ? 49   GLU A CB  1 
ATOM   343  C CG  . GLU A 1 46  ? -17.648 58.417 44.352 1.00 45.26 ? 49   GLU A CG  1 
ATOM   344  C CD  . GLU A 1 46  ? -18.974 57.797 44.769 1.00 48.40 ? 49   GLU A CD  1 
ATOM   345  O OE1 . GLU A 1 46  ? -18.962 56.606 45.169 1.00 49.12 ? 49   GLU A OE1 1 
ATOM   346  O OE2 . GLU A 1 46  ? -20.016 58.495 44.703 1.00 49.70 ? 49   GLU A OE2 1 
ATOM   347  N N   . PRO A 1 47  ? -14.886 60.227 43.202 1.00 35.18 ? 50   PRO A N   1 
ATOM   348  C CA  . PRO A 1 47  ? -14.730 61.535 42.562 1.00 34.82 ? 50   PRO A CA  1 
ATOM   349  C C   . PRO A 1 47  ? -15.942 62.443 42.759 1.00 34.56 ? 50   PRO A C   1 
ATOM   350  O O   . PRO A 1 47  ? -17.090 61.997 42.704 1.00 34.46 ? 50   PRO A O   1 
ATOM   351  C CB  . PRO A 1 47  ? -14.478 61.176 41.095 1.00 34.58 ? 50   PRO A CB  1 
ATOM   352  C CG  . PRO A 1 47  ? -15.196 59.881 40.931 1.00 35.31 ? 50   PRO A CG  1 
ATOM   353  C CD  . PRO A 1 47  ? -14.866 59.144 42.203 1.00 35.41 ? 50   PRO A CD  1 
ATOM   354  N N   . LYS A 1 48  ? -15.675 63.719 43.008 1.00 34.32 ? 51   LYS A N   1 
ATOM   355  C CA  . LYS A 1 48  ? -16.732 64.697 43.229 1.00 34.40 ? 51   LYS A CA  1 
ATOM   356  C C   . LYS A 1 48  ? -17.627 64.827 41.999 1.00 34.61 ? 51   LYS A C   1 
ATOM   357  O O   . LYS A 1 48  ? -17.140 65.038 40.888 1.00 34.72 ? 51   LYS A O   1 
ATOM   358  C CB  . LYS A 1 48  ? -16.115 66.056 43.567 1.00 33.46 ? 51   LYS A CB  1 
ATOM   359  C CG  . LYS A 1 48  ? -17.118 67.184 43.762 1.00 33.45 ? 51   LYS A CG  1 
ATOM   360  C CD  . LYS A 1 48  ? -17.986 66.984 44.995 1.00 32.61 ? 51   LYS A CD  1 
ATOM   361  C CE  . LYS A 1 48  ? -18.912 68.179 45.193 1.00 32.51 ? 51   LYS A CE  1 
ATOM   362  N NZ  . LYS A 1 48  ? -19.728 68.073 46.439 1.00 32.73 ? 51   LYS A NZ  1 
ATOM   363  N N   . LYS A 1 49  ? -18.935 64.691 42.200 1.00 34.38 ? 52   LYS A N   1 
ATOM   364  C CA  . LYS A 1 49  ? -19.885 64.813 41.102 1.00 34.42 ? 52   LYS A CA  1 
ATOM   365  C C   . LYS A 1 49  ? -19.878 66.274 40.663 1.00 34.76 ? 52   LYS A C   1 
ATOM   366  O O   . LYS A 1 49  ? -19.981 67.180 41.492 1.00 34.47 ? 52   LYS A O   1 
ATOM   367  C CB  . LYS A 1 49  ? -21.286 64.405 41.565 1.00 34.32 ? 52   LYS A CB  1 
ATOM   368  N N   . PRO A 1 50  ? -19.730 66.524 39.353 1.00 35.10 ? 53   PRO A N   1 
ATOM   369  C CA  . PRO A 1 50  ? -19.710 67.894 38.830 1.00 35.69 ? 53   PRO A CA  1 
ATOM   370  C C   . PRO A 1 50  ? -20.916 68.701 39.298 1.00 36.05 ? 53   PRO A C   1 
ATOM   371  O O   . PRO A 1 50  ? -22.017 68.164 39.442 1.00 35.94 ? 53   PRO A O   1 
ATOM   372  C CB  . PRO A 1 50  ? -19.694 67.680 37.323 1.00 35.52 ? 53   PRO A CB  1 
ATOM   373  C CG  . PRO A 1 50  ? -18.901 66.408 37.195 1.00 35.70 ? 53   PRO A CG  1 
ATOM   374  C CD  . PRO A 1 50  ? -19.518 65.550 38.270 1.00 34.61 ? 53   PRO A CD  1 
ATOM   375  N N   . TRP A 1 51  ? -20.706 69.991 39.533 1.00 36.30 ? 54   TRP A N   1 
ATOM   376  C CA  . TRP A 1 51  ? -21.778 70.853 40.007 1.00 37.33 ? 54   TRP A CA  1 
ATOM   377  C C   . TRP A 1 51  ? -22.093 71.975 39.025 1.00 38.69 ? 54   TRP A C   1 
ATOM   378  O O   . TRP A 1 51  ? -21.234 72.399 38.250 1.00 38.80 ? 54   TRP A O   1 
ATOM   379  C CB  . TRP A 1 51  ? -21.391 71.448 41.365 1.00 35.90 ? 54   TRP A CB  1 
ATOM   380  C CG  . TRP A 1 51  ? -20.191 72.342 41.294 1.00 35.20 ? 54   TRP A CG  1 
ATOM   381  C CD1 . TRP A 1 51  ? -20.168 73.652 40.913 1.00 34.81 ? 54   TRP A CD1 1 
ATOM   382  C CD2 . TRP A 1 51  ? -18.826 71.969 41.528 1.00 34.62 ? 54   TRP A CD2 1 
ATOM   383  N NE1 . TRP A 1 51  ? -18.877 74.117 40.888 1.00 35.10 ? 54   TRP A NE1 1 
ATOM   384  C CE2 . TRP A 1 51  ? -18.032 73.104 41.260 1.00 34.83 ? 54   TRP A CE2 1 
ATOM   385  C CE3 . TRP A 1 51  ? -18.197 70.784 41.934 1.00 34.70 ? 54   TRP A CE3 1 
ATOM   386  C CZ2 . TRP A 1 51  ? -16.637 73.091 41.383 1.00 34.59 ? 54   TRP A CZ2 1 
ATOM   387  C CZ3 . TRP A 1 51  ? -16.810 70.771 42.057 1.00 34.15 ? 54   TRP A CZ3 1 
ATOM   388  C CH2 . TRP A 1 51  ? -16.047 71.919 41.781 1.00 34.23 ? 54   TRP A CH2 1 
ATOM   389  N N   . SER A 1 52  ? -23.340 72.439 39.045 1.00 39.51 ? 55   SER A N   1 
ATOM   390  C CA  . SER A 1 52  ? -23.744 73.542 38.182 1.00 40.35 ? 55   SER A CA  1 
ATOM   391  C C   . SER A 1 52  ? -23.661 74.785 39.061 1.00 39.85 ? 55   SER A C   1 
ATOM   392  O O   . SER A 1 52  ? -23.657 74.677 40.289 1.00 40.55 ? 55   SER A O   1 
ATOM   393  C CB  . SER A 1 52  ? -25.174 73.343 37.667 1.00 40.36 ? 55   SER A CB  1 
ATOM   394  O OG  . SER A 1 52  ? -26.102 73.351 38.737 1.00 43.44 ? 55   SER A OG  1 
ATOM   395  N N   . GLY A 1 53  ? -23.593 75.960 38.447 1.00 39.60 ? 56   GLY A N   1 
ATOM   396  C CA  . GLY A 1 53  ? -23.484 77.175 39.233 1.00 38.11 ? 56   GLY A CA  1 
ATOM   397  C C   . GLY A 1 53  ? -22.025 77.465 39.539 1.00 37.95 ? 56   GLY A C   1 
ATOM   398  O O   . GLY A 1 53  ? -21.126 76.876 38.929 1.00 37.61 ? 56   GLY A O   1 
ATOM   399  N N   . VAL A 1 54  ? -21.780 78.362 40.487 1.00 36.95 ? 57   VAL A N   1 
ATOM   400  C CA  . VAL A 1 54  ? -20.416 78.730 40.849 1.00 35.95 ? 57   VAL A CA  1 
ATOM   401  C C   . VAL A 1 54  ? -20.088 78.349 42.283 1.00 35.56 ? 57   VAL A C   1 
ATOM   402  O O   . VAL A 1 54  ? -20.785 78.749 43.216 1.00 35.12 ? 57   VAL A O   1 
ATOM   403  C CB  . VAL A 1 54  ? -20.190 80.246 40.685 1.00 35.88 ? 57   VAL A CB  1 
ATOM   404  C CG1 . VAL A 1 54  ? -18.759 80.609 41.072 1.00 35.61 ? 57   VAL A CG1 1 
ATOM   405  C CG2 . VAL A 1 54  ? -20.481 80.656 39.247 1.00 35.73 ? 57   VAL A CG2 1 
ATOM   406  N N   . TRP A 1 55  ? -19.025 77.571 42.457 1.00 35.00 ? 58   TRP A N   1 
ATOM   407  C CA  . TRP A 1 55  ? -18.619 77.156 43.788 1.00 34.52 ? 58   TRP A CA  1 
ATOM   408  C C   . TRP A 1 55  ? -17.845 78.296 44.435 1.00 34.95 ? 58   TRP A C   1 
ATOM   409  O O   . TRP A 1 55  ? -16.895 78.815 43.853 1.00 34.74 ? 58   TRP A O   1 
ATOM   410  C CB  . TRP A 1 55  ? -17.752 75.896 43.712 1.00 33.23 ? 58   TRP A CB  1 
ATOM   411  C CG  . TRP A 1 55  ? -17.381 75.355 45.064 1.00 31.83 ? 58   TRP A CG  1 
ATOM   412  C CD1 . TRP A 1 55  ? -16.447 75.861 45.923 1.00 30.97 ? 58   TRP A CD1 1 
ATOM   413  C CD2 . TRP A 1 55  ? -17.991 74.250 45.741 1.00 30.71 ? 58   TRP A CD2 1 
ATOM   414  N NE1 . TRP A 1 55  ? -16.442 75.145 47.093 1.00 30.32 ? 58   TRP A NE1 1 
ATOM   415  C CE2 . TRP A 1 55  ? -17.379 74.149 47.010 1.00 30.07 ? 58   TRP A CE2 1 
ATOM   416  C CE3 . TRP A 1 55  ? -18.998 73.335 45.399 1.00 30.47 ? 58   TRP A CE3 1 
ATOM   417  C CZ2 . TRP A 1 55  ? -17.741 73.168 47.945 1.00 29.82 ? 58   TRP A CZ2 1 
ATOM   418  C CZ3 . TRP A 1 55  ? -19.360 72.357 46.329 1.00 30.92 ? 58   TRP A CZ3 1 
ATOM   419  C CH2 . TRP A 1 55  ? -18.730 72.284 47.589 1.00 30.35 ? 58   TRP A CH2 1 
ATOM   420  N N   . ASN A 1 56  ? -18.262 78.695 45.632 1.00 36.36 ? 59   ASN A N   1 
ATOM   421  C CA  . ASN A 1 56  ? -17.592 79.780 46.345 1.00 38.05 ? 59   ASN A CA  1 
ATOM   422  C C   . ASN A 1 56  ? -16.349 79.237 47.051 1.00 36.73 ? 59   ASN A C   1 
ATOM   423  O O   . ASN A 1 56  ? -16.456 78.526 48.050 1.00 36.20 ? 59   ASN A O   1 
ATOM   424  C CB  . ASN A 1 56  ? -18.544 80.413 47.369 1.00 41.85 ? 59   ASN A CB  1 
ATOM   425  C CG  . ASN A 1 56  ? -17.956 81.650 48.027 1.00 46.85 ? 59   ASN A CG  1 
ATOM   426  O OD1 . ASN A 1 56  ? -16.881 81.588 48.617 1.00 46.98 ? 59   ASN A OD1 1 
ATOM   427  N ND2 . ASN A 1 56  ? -18.656 82.777 47.920 1.00 52.40 ? 59   ASN A ND2 1 
ATOM   428  N N   . ALA A 1 57  ? -15.176 79.575 46.519 1.00 35.18 ? 60   ALA A N   1 
ATOM   429  C CA  . ALA A 1 57  ? -13.906 79.123 47.076 1.00 34.64 ? 60   ALA A CA  1 
ATOM   430  C C   . ALA A 1 57  ? -13.156 80.291 47.688 1.00 34.77 ? 60   ALA A C   1 
ATOM   431  O O   . ALA A 1 57  ? -11.993 80.534 47.357 1.00 34.83 ? 60   ALA A O   1 
ATOM   432  C CB  . ALA A 1 57  ? -13.056 78.487 45.984 1.00 33.82 ? 60   ALA A CB  1 
ATOM   433  N N   . SER A 1 58  ? -13.821 81.011 48.582 1.00 34.43 ? 61   SER A N   1 
ATOM   434  C CA  . SER A 1 58  ? -13.216 82.167 49.228 1.00 34.57 ? 61   SER A CA  1 
ATOM   435  C C   . SER A 1 58  ? -12.826 81.881 50.674 1.00 34.49 ? 61   SER A C   1 
ATOM   436  O O   . SER A 1 58  ? -12.130 82.678 51.303 1.00 34.87 ? 61   SER A O   1 
ATOM   437  C CB  . SER A 1 58  ? -14.188 83.346 49.191 1.00 34.03 ? 61   SER A CB  1 
ATOM   438  O OG  . SER A 1 58  ? -15.356 83.050 49.937 1.00 33.45 ? 61   SER A OG  1 
ATOM   439  N N   . THR A 1 59  ? -13.270 80.745 51.202 1.00 34.54 ? 62   THR A N   1 
ATOM   440  C CA  . THR A 1 59  ? -12.957 80.400 52.582 1.00 34.92 ? 62   THR A CA  1 
ATOM   441  C C   . THR A 1 59  ? -12.391 78.998 52.744 1.00 33.91 ? 62   THR A C   1 
ATOM   442  O O   . THR A 1 59  ? -12.748 78.081 52.007 1.00 33.56 ? 62   THR A O   1 
ATOM   443  C CB  . THR A 1 59  ? -14.206 80.505 53.472 1.00 36.10 ? 62   THR A CB  1 
ATOM   444  O OG1 . THR A 1 59  ? -15.166 79.527 53.060 1.00 36.88 ? 62   THR A OG1 1 
ATOM   445  C CG2 . THR A 1 59  ? -14.827 81.889 53.354 1.00 37.02 ? 62   THR A CG2 1 
ATOM   446  N N   . TYR A 1 60  ? -11.506 78.844 53.723 1.00 33.10 ? 63   TYR A N   1 
ATOM   447  C CA  . TYR A 1 60  ? -10.900 77.551 54.009 1.00 31.97 ? 63   TYR A CA  1 
ATOM   448  C C   . TYR A 1 60  ? -11.982 76.529 54.338 1.00 30.78 ? 63   TYR A C   1 
ATOM   449  O O   . TYR A 1 60  ? -13.042 76.877 54.857 1.00 31.24 ? 63   TYR A O   1 
ATOM   450  C CB  . TYR A 1 60  ? -9.949  77.650 55.202 1.00 31.94 ? 63   TYR A CB  1 
ATOM   451  C CG  . TYR A 1 60  ? -8.536  78.053 54.865 1.00 32.96 ? 63   TYR A CG  1 
ATOM   452  C CD1 . TYR A 1 60  ? -7.877  77.509 53.760 1.00 32.89 ? 63   TYR A CD1 1 
ATOM   453  C CD2 . TYR A 1 60  ? -7.820  78.908 55.705 1.00 33.44 ? 63   TYR A CD2 1 
ATOM   454  C CE1 . TYR A 1 60  ? -6.538  77.800 53.505 1.00 33.34 ? 63   TYR A CE1 1 
ATOM   455  C CE2 . TYR A 1 60  ? -6.481  79.206 55.459 1.00 34.06 ? 63   TYR A CE2 1 
ATOM   456  C CZ  . TYR A 1 60  ? -5.847  78.648 54.360 1.00 34.47 ? 63   TYR A CZ  1 
ATOM   457  O OH  . TYR A 1 60  ? -4.523  78.937 54.123 1.00 35.05 ? 63   TYR A OH  1 
ATOM   458  N N   . PRO A 1 61  ? -11.722 75.249 54.041 1.00 29.61 ? 64   PRO A N   1 
ATOM   459  C CA  . PRO A 1 61  ? -12.680 74.175 54.312 1.00 28.98 ? 64   PRO A CA  1 
ATOM   460  C C   . PRO A 1 61  ? -12.505 73.619 55.724 1.00 28.82 ? 64   PRO A C   1 
ATOM   461  O O   . PRO A 1 61  ? -11.616 74.045 56.464 1.00 27.88 ? 64   PRO A O   1 
ATOM   462  C CB  . PRO A 1 61  ? -12.321 73.143 53.256 1.00 29.07 ? 64   PRO A CB  1 
ATOM   463  C CG  . PRO A 1 61  ? -10.818 73.253 53.232 1.00 28.61 ? 64   PRO A CG  1 
ATOM   464  C CD  . PRO A 1 61  ? -10.591 74.750 53.234 1.00 28.72 ? 64   PRO A CD  1 
ATOM   465  N N   . ASN A 1 62  ? -13.356 72.667 56.092 1.00 28.74 ? 65   ASN A N   1 
ATOM   466  C CA  . ASN A 1 62  ? -13.256 72.037 57.398 1.00 29.57 ? 65   ASN A CA  1 
ATOM   467  C C   . ASN A 1 62  ? -12.017 71.138 57.410 1.00 29.03 ? 65   ASN A C   1 
ATOM   468  O O   . ASN A 1 62  ? -11.506 70.753 56.356 1.00 28.04 ? 65   ASN A O   1 
ATOM   469  C CB  . ASN A 1 62  ? -14.494 71.174 57.684 1.00 31.35 ? 65   ASN A CB  1 
ATOM   470  C CG  . ASN A 1 62  ? -15.783 71.981 57.720 1.00 33.31 ? 65   ASN A CG  1 
ATOM   471  O OD1 . ASN A 1 62  ? -15.854 73.039 58.345 1.00 34.38 ? 65   ASN A OD1 1 
ATOM   472  N ND2 . ASN A 1 62  ? -16.814 71.472 57.058 1.00 34.79 ? 65   ASN A ND2 1 
ATOM   473  N N   . ASN A 1 63  ? -11.534 70.815 58.604 1.00 28.10 ? 66   ASN A N   1 
ATOM   474  C CA  . ASN A 1 63  ? -10.385 69.929 58.748 1.00 28.02 ? 66   ASN A CA  1 
ATOM   475  C C   . ASN A 1 63  ? -10.975 68.550 59.018 1.00 27.65 ? 66   ASN A C   1 
ATOM   476  O O   . ASN A 1 63  ? -12.084 68.447 59.545 1.00 27.15 ? 66   ASN A O   1 
ATOM   477  C CB  . ASN A 1 63  ? -9.518  70.352 59.939 1.00 27.92 ? 66   ASN A CB  1 
ATOM   478  C CG  . ASN A 1 63  ? -8.951  71.756 59.788 1.00 28.87 ? 66   ASN A CG  1 
ATOM   479  O OD1 . ASN A 1 63  ? -8.864  72.505 60.762 1.00 28.57 ? 66   ASN A OD1 1 
ATOM   480  N ND2 . ASN A 1 63  ? -8.550  72.113 58.570 1.00 28.24 ? 66   ASN A ND2 1 
ATOM   481  N N   . CYS A 1 64  ? -10.247 67.498 58.654 1.00 27.26 ? 67   CYS A N   1 
ATOM   482  C CA  . CYS A 1 64  ? -10.727 66.141 58.882 1.00 27.33 ? 67   CYS A CA  1 
ATOM   483  C C   . CYS A 1 64  ? -10.750 65.835 60.375 1.00 27.50 ? 67   CYS A C   1 
ATOM   484  O O   . CYS A 1 64  ? -10.009 66.439 61.155 1.00 27.22 ? 67   CYS A O   1 
ATOM   485  C CB  . CYS A 1 64  ? -9.838  65.121 58.159 1.00 26.49 ? 67   CYS A CB  1 
ATOM   486  S SG  . CYS A 1 64  ? -9.892  65.212 56.339 1.00 27.28 ? 67   CYS A SG  1 
ATOM   487  N N   . GLN A 1 65  ? -11.613 64.901 60.765 1.00 27.57 ? 68   GLN A N   1 
ATOM   488  C CA  . GLN A 1 65  ? -11.735 64.500 62.162 1.00 27.95 ? 68   GLN A CA  1 
ATOM   489  C C   . GLN A 1 65  ? -10.402 63.929 62.635 1.00 28.09 ? 68   GLN A C   1 
ATOM   490  O O   . GLN A 1 65  ? -9.829  63.054 61.980 1.00 28.11 ? 68   GLN A O   1 
ATOM   491  C CB  . GLN A 1 65  ? -12.845 63.455 62.310 1.00 28.35 ? 68   GLN A CB  1 
ATOM   492  C CG  . GLN A 1 65  ? -14.251 64.014 62.146 1.00 28.28 ? 68   GLN A CG  1 
ATOM   493  C CD  . GLN A 1 65  ? -14.703 64.833 63.350 1.00 30.45 ? 68   GLN A CD  1 
ATOM   494  O OE1 . GLN A 1 65  ? -15.818 65.364 63.373 1.00 32.47 ? 68   GLN A OE1 1 
ATOM   495  N NE2 . GLN A 1 65  ? -13.845 64.937 64.355 1.00 29.37 ? 68   GLN A NE2 1 
ATOM   496  N N   . GLN A 1 66  ? -9.916  64.415 63.775 1.00 27.31 ? 69   GLN A N   1 
ATOM   497  C CA  . GLN A 1 66  ? -8.630  63.963 64.292 1.00 27.50 ? 69   GLN A CA  1 
ATOM   498  C C   . GLN A 1 66  ? -8.416  64.234 65.780 1.00 27.89 ? 69   GLN A C   1 
ATOM   499  O O   . GLN A 1 66  ? -9.137  65.019 66.408 1.00 27.78 ? 69   GLN A O   1 
ATOM   500  C CB  . GLN A 1 66  ? -7.510  64.662 63.524 1.00 26.86 ? 69   GLN A CB  1 
ATOM   501  C CG  . GLN A 1 66  ? -7.606  66.188 63.633 1.00 25.99 ? 69   GLN A CG  1 
ATOM   502  C CD  . GLN A 1 66  ? -6.691  66.908 62.673 1.00 26.05 ? 69   GLN A CD  1 
ATOM   503  O OE1 . GLN A 1 66  ? -5.508  67.135 62.960 1.00 26.47 ? 69   GLN A OE1 1 
ATOM   504  N NE2 . GLN A 1 66  ? -7.229  67.262 61.510 1.00 25.48 ? 69   GLN A NE2 1 
ATOM   505  N N   . TYR A 1 67  ? -7.398  63.576 66.322 1.00 27.56 ? 70   TYR A N   1 
ATOM   506  C CA  . TYR A 1 67  ? -7.007  63.745 67.712 1.00 28.05 ? 70   TYR A CA  1 
ATOM   507  C C   . TYR A 1 67  ? -6.482  65.170 67.811 1.00 27.90 ? 70   TYR A C   1 
ATOM   508  O O   . TYR A 1 67  ? -5.768  65.622 66.919 1.00 27.36 ? 70   TYR A O   1 
ATOM   509  C CB  . TYR A 1 67  ? -5.878  62.775 68.051 1.00 27.87 ? 70   TYR A CB  1 
ATOM   510  C CG  . TYR A 1 67  ? -5.188  63.067 69.362 1.00 28.48 ? 70   TYR A CG  1 
ATOM   511  C CD1 . TYR A 1 67  ? -5.716  62.609 70.572 1.00 28.26 ? 70   TYR A CD1 1 
ATOM   512  C CD2 . TYR A 1 67  ? -4.001  63.799 69.395 1.00 28.26 ? 70   TYR A CD2 1 
ATOM   513  C CE1 . TYR A 1 67  ? -5.073  62.871 71.782 1.00 28.25 ? 70   TYR A CE1 1 
ATOM   514  C CE2 . TYR A 1 67  ? -3.353  64.069 70.597 1.00 28.19 ? 70   TYR A CE2 1 
ATOM   515  C CZ  . TYR A 1 67  ? -3.894  63.601 71.784 1.00 28.57 ? 70   TYR A CZ  1 
ATOM   516  O OH  . TYR A 1 67  ? -3.253  63.862 72.973 1.00 29.87 ? 70   TYR A OH  1 
ATOM   517  N N   . VAL A 1 68  ? -6.836  65.877 68.880 1.00 27.78 ? 71   VAL A N   1 
ATOM   518  C CA  . VAL A 1 68  ? -6.372  67.247 69.061 1.00 27.89 ? 71   VAL A CA  1 
ATOM   519  C C   . VAL A 1 68  ? -5.442  67.319 70.263 1.00 29.09 ? 71   VAL A C   1 
ATOM   520  O O   . VAL A 1 68  ? -5.808  66.926 71.372 1.00 29.74 ? 71   VAL A O   1 
ATOM   521  C CB  . VAL A 1 68  ? -7.558  68.212 69.259 1.00 27.64 ? 71   VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? -7.061  69.594 69.667 1.00 26.96 ? 71   VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? -8.358  68.304 67.968 1.00 27.12 ? 71   VAL A CG2 1 
ATOM   524  N N   . ASP A 1 69  ? -4.231  67.815 70.041 1.00 30.21 ? 72   ASP A N   1 
ATOM   525  C CA  . ASP A 1 69  ? -3.252  67.920 71.117 1.00 30.93 ? 72   ASP A CA  1 
ATOM   526  C C   . ASP A 1 69  ? -3.619  68.995 72.133 1.00 31.77 ? 72   ASP A C   1 
ATOM   527  O O   . ASP A 1 69  ? -3.717  70.166 71.793 1.00 32.89 ? 72   ASP A O   1 
ATOM   528  C CB  . ASP A 1 69  ? -1.870  68.192 70.527 1.00 30.45 ? 72   ASP A CB  1 
ATOM   529  C CG  . ASP A 1 69  ? -0.836  68.524 71.583 1.00 30.39 ? 72   ASP A CG  1 
ATOM   530  O OD1 . ASP A 1 69  ? -0.978  68.069 72.736 1.00 30.35 ? 72   ASP A OD1 1 
ATOM   531  O OD2 . ASP A 1 69  ? 0.133   69.233 71.248 1.00 30.66 ? 72   ASP A OD2 1 
ATOM   532  N N   . GLU A 1 70  ? -3.823  68.582 73.381 1.00 33.06 ? 73   GLU A N   1 
ATOM   533  C CA  . GLU A 1 70  ? -4.179  69.494 74.465 1.00 34.55 ? 73   GLU A CA  1 
ATOM   534  C C   . GLU A 1 70  ? -3.130  69.510 75.580 1.00 35.05 ? 73   GLU A C   1 
ATOM   535  O O   . GLU A 1 70  ? -3.381  70.015 76.673 1.00 35.29 ? 73   GLU A O   1 
ATOM   536  C CB  . GLU A 1 70  ? -5.529  69.096 75.064 1.00 35.12 ? 73   GLU A CB  1 
ATOM   537  C CG  . GLU A 1 70  ? -6.719  69.400 74.193 1.00 37.43 ? 73   GLU A CG  1 
ATOM   538  C CD  . GLU A 1 70  ? -8.024  68.955 74.826 1.00 40.12 ? 73   GLU A CD  1 
ATOM   539  O OE1 . GLU A 1 70  ? -8.213  69.176 76.044 1.00 41.37 ? 73   GLU A OE1 1 
ATOM   540  O OE2 . GLU A 1 70  ? -8.871  68.394 74.102 1.00 42.03 ? 73   GLU A OE2 1 
ATOM   541  N N   . GLN A 1 71  ? -1.957  68.958 75.308 1.00 35.76 ? 74   GLN A N   1 
ATOM   542  C CA  . GLN A 1 71  ? -0.898  68.921 76.308 1.00 36.91 ? 74   GLN A CA  1 
ATOM   543  C C   . GLN A 1 71  ? -0.507  70.290 76.868 1.00 36.76 ? 74   GLN A C   1 
ATOM   544  O O   . GLN A 1 71  ? -0.178  70.408 78.047 1.00 37.42 ? 74   GLN A O   1 
ATOM   545  C CB  . GLN A 1 71  ? 0.341   68.240 75.728 1.00 37.42 ? 74   GLN A CB  1 
ATOM   546  C CG  . GLN A 1 71  ? 0.486   66.794 76.141 1.00 40.22 ? 74   GLN A CG  1 
ATOM   547  C CD  . GLN A 1 71  ? 0.667   66.637 77.643 1.00 41.05 ? 74   GLN A CD  1 
ATOM   548  O OE1 . GLN A 1 71  ? 1.559   67.245 78.242 1.00 42.01 ? 74   GLN A OE1 1 
ATOM   549  N NE2 . GLN A 1 71  ? -0.176  65.821 78.256 1.00 41.19 ? 74   GLN A NE2 1 
ATOM   550  N N   . PHE A 1 72  ? -0.543  71.321 76.028 1.00 36.09 ? 75   PHE A N   1 
ATOM   551  C CA  . PHE A 1 72  ? -0.162  72.663 76.457 1.00 35.32 ? 75   PHE A CA  1 
ATOM   552  C C   . PHE A 1 72  ? -1.183  73.711 76.013 1.00 36.21 ? 75   PHE A C   1 
ATOM   553  O O   . PHE A 1 72  ? -0.918  74.529 75.131 1.00 35.49 ? 75   PHE A O   1 
ATOM   554  C CB  . PHE A 1 72  ? 1.225   72.991 75.897 1.00 33.29 ? 75   PHE A CB  1 
ATOM   555  C CG  . PHE A 1 72  ? 2.282   71.998 76.300 1.00 31.79 ? 75   PHE A CG  1 
ATOM   556  C CD1 . PHE A 1 72  ? 2.718   71.923 77.623 1.00 30.28 ? 75   PHE A CD1 1 
ATOM   557  C CD2 . PHE A 1 72  ? 2.817   71.114 75.371 1.00 30.65 ? 75   PHE A CD2 1 
ATOM   558  C CE1 . PHE A 1 72  ? 3.667   70.982 78.010 1.00 29.82 ? 75   PHE A CE1 1 
ATOM   559  C CE2 . PHE A 1 72  ? 3.770   70.167 75.750 1.00 30.05 ? 75   PHE A CE2 1 
ATOM   560  C CZ  . PHE A 1 72  ? 4.195   70.100 77.070 1.00 29.48 ? 75   PHE A CZ  1 
ATOM   561  N N   . PRO A 1 73  ? -2.370  73.702 76.637 1.00 37.34 ? 76   PRO A N   1 
ATOM   562  C CA  . PRO A 1 73  ? -3.442  74.645 76.310 1.00 37.85 ? 76   PRO A CA  1 
ATOM   563  C C   . PRO A 1 73  ? -2.976  76.095 76.214 1.00 38.47 ? 76   PRO A C   1 
ATOM   564  O O   . PRO A 1 73  ? -2.451  76.655 77.180 1.00 39.24 ? 76   PRO A O   1 
ATOM   565  C CB  . PRO A 1 73  ? -4.437  74.429 77.445 1.00 37.40 ? 76   PRO A CB  1 
ATOM   566  C CG  . PRO A 1 73  ? -4.279  72.965 77.733 1.00 37.34 ? 76   PRO A CG  1 
ATOM   567  C CD  . PRO A 1 73  ? -2.777  72.811 77.740 1.00 37.27 ? 76   PRO A CD  1 
ATOM   568  N N   . GLY A 1 74  ? -3.168  76.696 75.043 1.00 38.43 ? 77   GLY A N   1 
ATOM   569  C CA  . GLY A 1 74  ? -2.778  78.081 74.850 1.00 38.35 ? 77   GLY A CA  1 
ATOM   570  C C   . GLY A 1 74  ? -1.377  78.291 74.301 1.00 38.03 ? 77   GLY A C   1 
ATOM   571  O O   . GLY A 1 74  ? -1.075  79.346 73.736 1.00 39.06 ? 77   GLY A O   1 
ATOM   572  N N   . PHE A 1 75  ? -0.518  77.293 74.467 1.00 36.36 ? 78   PHE A N   1 
ATOM   573  C CA  . PHE A 1 75  ? 0.852   77.382 73.988 1.00 34.70 ? 78   PHE A CA  1 
ATOM   574  C C   . PHE A 1 75  ? 0.846   77.365 72.464 1.00 34.35 ? 78   PHE A C   1 
ATOM   575  O O   . PHE A 1 75  ? 0.348   76.431 71.842 1.00 34.86 ? 78   PHE A O   1 
ATOM   576  C CB  . PHE A 1 75  ? 1.663   76.208 74.543 1.00 33.46 ? 78   PHE A CB  1 
ATOM   577  C CG  . PHE A 1 75  ? 3.136   76.313 74.290 1.00 32.27 ? 78   PHE A CG  1 
ATOM   578  C CD1 . PHE A 1 75  ? 3.861   77.398 74.768 1.00 31.79 ? 78   PHE A CD1 1 
ATOM   579  C CD2 . PHE A 1 75  ? 3.802   75.323 73.578 1.00 31.62 ? 78   PHE A CD2 1 
ATOM   580  C CE1 . PHE A 1 75  ? 5.227   77.494 74.540 1.00 31.12 ? 78   PHE A CE1 1 
ATOM   581  C CE2 . PHE A 1 75  ? 5.161   75.409 73.346 1.00 31.03 ? 78   PHE A CE2 1 
ATOM   582  C CZ  . PHE A 1 75  ? 5.878   76.497 73.827 1.00 31.35 ? 78   PHE A CZ  1 
ATOM   583  N N   . SER A 1 76  ? 1.398   78.406 71.860 1.00 34.57 ? 79   SER A N   1 
ATOM   584  C CA  . SER A 1 76  ? 1.429   78.507 70.404 1.00 34.19 ? 79   SER A CA  1 
ATOM   585  C C   . SER A 1 76  ? 2.296   77.416 69.782 1.00 33.68 ? 79   SER A C   1 
ATOM   586  O O   . SER A 1 76  ? 2.062   76.996 68.646 1.00 33.79 ? 79   SER A O   1 
ATOM   587  C CB  . SER A 1 76  ? 1.964   79.876 69.986 1.00 33.43 ? 79   SER A CB  1 
ATOM   588  O OG  . SER A 1 76  ? 3.332   79.996 70.330 1.00 34.26 ? 79   SER A OG  1 
ATOM   589  N N   . GLY A 1 77  ? 3.294   76.961 70.533 1.00 32.57 ? 80   GLY A N   1 
ATOM   590  C CA  . GLY A 1 77  ? 4.185   75.934 70.030 1.00 32.25 ? 80   GLY A CA  1 
ATOM   591  C C   . GLY A 1 77  ? 3.471   74.672 69.587 1.00 32.36 ? 80   GLY A C   1 
ATOM   592  O O   . GLY A 1 77  ? 3.836   74.070 68.576 1.00 31.81 ? 80   GLY A O   1 
ATOM   593  N N   . SER A 1 78  ? 2.450   74.273 70.340 1.00 32.05 ? 81   SER A N   1 
ATOM   594  C CA  . SER A 1 78  ? 1.698   73.065 70.022 1.00 32.66 ? 81   SER A CA  1 
ATOM   595  C C   . SER A 1 78  ? 0.378   73.330 69.301 1.00 32.37 ? 81   SER A C   1 
ATOM   596  O O   . SER A 1 78  ? -0.031  72.547 68.448 1.00 31.99 ? 81   SER A O   1 
ATOM   597  C CB  . SER A 1 78  ? 1.433   72.258 71.298 1.00 32.21 ? 81   SER A CB  1 
ATOM   598  O OG  . SER A 1 78  ? 0.791   73.053 72.276 1.00 32.95 ? 81   SER A OG  1 
ATOM   599  N N   . GLU A 1 79  ? -0.284  74.435 69.627 1.00 32.60 ? 82   GLU A N   1 
ATOM   600  C CA  . GLU A 1 79  ? -1.557  74.738 68.991 1.00 33.29 ? 82   GLU A CA  1 
ATOM   601  C C   . GLU A 1 79  ? -1.458  75.161 67.532 1.00 32.36 ? 82   GLU A C   1 
ATOM   602  O O   . GLU A 1 79  ? -2.448  75.107 66.803 1.00 31.31 ? 82   GLU A O   1 
ATOM   603  C CB  . GLU A 1 79  ? -2.323  75.773 69.816 1.00 35.32 ? 82   GLU A CB  1 
ATOM   604  C CG  . GLU A 1 79  ? -2.734  75.198 71.156 1.00 38.98 ? 82   GLU A CG  1 
ATOM   605  C CD  . GLU A 1 79  ? -3.581  76.135 71.969 1.00 42.07 ? 82   GLU A CD  1 
ATOM   606  O OE1 . GLU A 1 79  ? -3.239  77.339 72.032 1.00 44.95 ? 82   GLU A OE1 1 
ATOM   607  O OE2 . GLU A 1 79  ? -4.579  75.665 72.560 1.00 42.96 ? 82   GLU A OE2 1 
ATOM   608  N N   . MET A 1 80  ? -0.263  75.552 67.099 1.00 31.75 ? 83   MET A N   1 
ATOM   609  C CA  . MET A 1 80  ? -0.065  75.944 65.708 1.00 31.46 ? 83   MET A CA  1 
ATOM   610  C C   . MET A 1 80  ? -0.222  74.724 64.803 1.00 31.48 ? 83   MET A C   1 
ATOM   611  O O   . MET A 1 80  ? -0.249  74.852 63.580 1.00 31.00 ? 83   MET A O   1 
ATOM   612  C CB  . MET A 1 80  ? 1.329   76.542 65.502 1.00 31.91 ? 83   MET A CB  1 
ATOM   613  C CG  . MET A 1 80  ? 2.466   75.564 65.740 1.00 34.23 ? 83   MET A CG  1 
ATOM   614  S SD  . MET A 1 80  ? 4.063   76.193 65.163 1.00 36.79 ? 83   MET A SD  1 
ATOM   615  C CE  . MET A 1 80  ? 4.823   76.599 66.708 1.00 38.94 ? 83   MET A CE  1 
ATOM   616  N N   . TRP A 1 81  ? -0.320  73.540 65.408 1.00 31.22 ? 84   TRP A N   1 
ATOM   617  C CA  . TRP A 1 81  ? -0.474  72.307 64.644 1.00 31.05 ? 84   TRP A CA  1 
ATOM   618  C C   . TRP A 1 81  ? -1.891  71.737 64.704 1.00 30.68 ? 84   TRP A C   1 
ATOM   619  O O   . TRP A 1 81  ? -2.252  70.892 63.889 1.00 31.22 ? 84   TRP A O   1 
ATOM   620  C CB  . TRP A 1 81  ? 0.526   71.248 65.129 1.00 30.37 ? 84   TRP A CB  1 
ATOM   621  C CG  . TRP A 1 81  ? 1.961   71.701 65.069 1.00 29.95 ? 84   TRP A CG  1 
ATOM   622  C CD1 . TRP A 1 81  ? 2.757   72.044 66.124 1.00 29.45 ? 84   TRP A CD1 1 
ATOM   623  C CD2 . TRP A 1 81  ? 2.759   71.887 63.889 1.00 29.58 ? 84   TRP A CD2 1 
ATOM   624  N NE1 . TRP A 1 81  ? 3.998   72.433 65.676 1.00 30.04 ? 84   TRP A NE1 1 
ATOM   625  C CE2 . TRP A 1 81  ? 4.027   72.346 64.309 1.00 29.66 ? 84   TRP A CE2 1 
ATOM   626  C CE3 . TRP A 1 81  ? 2.524   71.711 62.518 1.00 29.40 ? 84   TRP A CE3 1 
ATOM   627  C CZ2 . TRP A 1 81  ? 5.059   72.633 63.407 1.00 29.95 ? 84   TRP A CZ2 1 
ATOM   628  C CZ3 . TRP A 1 81  ? 3.551   71.997 61.619 1.00 29.70 ? 84   TRP A CZ3 1 
ATOM   629  C CH2 . TRP A 1 81  ? 4.802   72.453 62.070 1.00 29.81 ? 84   TRP A CH2 1 
ATOM   630  N N   . ASN A 1 82  ? -2.689  72.191 65.667 1.00 30.84 ? 85   ASN A N   1 
ATOM   631  C CA  . ASN A 1 82  ? -4.062  71.709 65.806 1.00 30.56 ? 85   ASN A CA  1 
ATOM   632  C C   . ASN A 1 82  ? -4.944  72.261 64.696 1.00 30.20 ? 85   ASN A C   1 
ATOM   633  O O   . ASN A 1 82  ? -4.641  73.297 64.105 1.00 28.99 ? 85   ASN A O   1 
ATOM   634  C CB  . ASN A 1 82  ? -4.671  72.138 67.148 1.00 32.01 ? 85   ASN A CB  1 
ATOM   635  C CG  . ASN A 1 82  ? -4.040  71.440 68.337 1.00 33.58 ? 85   ASN A CG  1 
ATOM   636  O OD1 . ASN A 1 82  ? -3.766  70.238 68.298 1.00 35.96 ? 85   ASN A OD1 1 
ATOM   637  N ND2 . ASN A 1 82  ? -3.826  72.188 69.409 1.00 33.51 ? 85   ASN A ND2 1 
ATOM   638  N N   . PRO A 1 83  ? -6.051  71.571 64.392 1.00 29.80 ? 86   PRO A N   1 
ATOM   639  C CA  . PRO A 1 83  ? -6.917  72.093 63.336 1.00 30.49 ? 86   PRO A CA  1 
ATOM   640  C C   . PRO A 1 83  ? -7.415  73.485 63.742 1.00 31.55 ? 86   PRO A C   1 
ATOM   641  O O   . PRO A 1 83  ? -7.735  73.722 64.911 1.00 31.92 ? 86   PRO A O   1 
ATOM   642  C CB  . PRO A 1 83  ? -8.033  71.049 63.252 1.00 29.76 ? 86   PRO A CB  1 
ATOM   643  C CG  . PRO A 1 83  ? -8.060  70.439 64.611 1.00 29.39 ? 86   PRO A CG  1 
ATOM   644  C CD  . PRO A 1 83  ? -6.597  70.329 64.965 1.00 29.71 ? 86   PRO A CD  1 
ATOM   645  N N   . ASN A 1 84  ? -7.452  74.406 62.785 1.00 31.51 ? 87   ASN A N   1 
ATOM   646  C CA  . ASN A 1 84  ? -7.892  75.765 63.057 1.00 32.42 ? 87   ASN A CA  1 
ATOM   647  C C   . ASN A 1 84  ? -9.251  76.046 62.425 1.00 33.54 ? 87   ASN A C   1 
ATOM   648  O O   . ASN A 1 84  ? -9.669  77.194 62.297 1.00 34.24 ? 87   ASN A O   1 
ATOM   649  C CB  . ASN A 1 84  ? -6.840  76.755 62.551 1.00 32.37 ? 87   ASN A CB  1 
ATOM   650  C CG  . ASN A 1 84  ? -6.555  76.603 61.072 1.00 33.16 ? 87   ASN A CG  1 
ATOM   651  O OD1 . ASN A 1 84  ? -6.842  75.568 60.465 1.00 33.00 ? 87   ASN A OD1 1 
ATOM   652  N ND2 . ASN A 1 84  ? -5.969  77.637 60.482 1.00 34.11 ? 87   ASN A ND2 1 
ATOM   653  N N   . ARG A 1 85  ? -9.932  74.977 62.031 1.00 34.13 ? 88   ARG A N   1 
ATOM   654  C CA  . ARG A 1 85  ? -11.260 75.057 61.431 1.00 34.46 ? 88   ARG A CA  1 
ATOM   655  C C   . ARG A 1 85  ? -12.061 73.961 62.101 1.00 33.84 ? 88   ARG A C   1 
ATOM   656  O O   . ARG A 1 85  ? -11.477 73.072 62.719 1.00 34.72 ? 88   ARG A O   1 
ATOM   657  C CB  . ARG A 1 85  ? -11.190 74.779 59.926 1.00 35.26 ? 88   ARG A CB  1 
ATOM   658  C CG  . ARG A 1 85  ? -10.547 75.882 59.134 1.00 37.03 ? 88   ARG A CG  1 
ATOM   659  C CD  . ARG A 1 85  ? -11.515 77.027 58.954 1.00 38.98 ? 88   ARG A CD  1 
ATOM   660  N NE  . ARG A 1 85  ? -10.810 78.294 58.852 1.00 41.81 ? 88   ARG A NE  1 
ATOM   661  C CZ  . ARG A 1 85  ? -11.355 79.411 58.392 1.00 43.53 ? 88   ARG A CZ  1 
ATOM   662  N NH1 . ARG A 1 85  ? -12.620 79.414 57.989 1.00 44.41 ? 88   ARG A NH1 1 
ATOM   663  N NH2 . ARG A 1 85  ? -10.628 80.520 58.328 1.00 44.06 ? 88   ARG A NH2 1 
ATOM   664  N N   . GLU A 1 86  ? -13.384 74.018 61.997 1.00 32.74 ? 89   GLU A N   1 
ATOM   665  C CA  . GLU A 1 86  ? -14.207 72.978 62.595 1.00 32.49 ? 89   GLU A CA  1 
ATOM   666  C C   . GLU A 1 86  ? -13.831 71.666 61.924 1.00 31.19 ? 89   GLU A C   1 
ATOM   667  O O   . GLU A 1 86  ? -13.480 71.647 60.747 1.00 30.64 ? 89   GLU A O   1 
ATOM   668  C CB  . GLU A 1 86  ? -15.696 73.253 62.365 1.00 33.57 ? 89   GLU A CB  1 
ATOM   669  C CG  . GLU A 1 86  ? -16.266 74.374 63.218 1.00 36.49 ? 89   GLU A CG  1 
ATOM   670  N N   . MET A 1 87  ? -13.891 70.573 62.670 1.00 29.87 ? 90   MET A N   1 
ATOM   671  C CA  . MET A 1 87  ? -13.567 69.278 62.098 1.00 30.21 ? 90   MET A CA  1 
ATOM   672  C C   . MET A 1 87  ? -14.835 68.650 61.544 1.00 30.10 ? 90   MET A C   1 
ATOM   673  O O   . MET A 1 87  ? -15.940 68.934 62.012 1.00 29.75 ? 90   MET A O   1 
ATOM   674  C CB  . MET A 1 87  ? -12.950 68.348 63.152 1.00 30.33 ? 90   MET A CB  1 
ATOM   675  C CG  . MET A 1 87  ? -11.601 68.810 63.680 1.00 30.54 ? 90   MET A CG  1 
ATOM   676  S SD  . MET A 1 87  ? -10.859 67.598 64.786 1.00 32.17 ? 90   MET A SD  1 
ATOM   677  C CE  . MET A 1 87  ? -11.816 67.896 66.287 1.00 30.31 ? 90   MET A CE  1 
ATOM   678  N N   . SER A 1 88  ? -14.670 67.793 60.547 1.00 29.79 ? 91   SER A N   1 
ATOM   679  C CA  . SER A 1 88  ? -15.805 67.123 59.939 1.00 29.59 ? 91   SER A CA  1 
ATOM   680  C C   . SER A 1 88  ? -15.315 66.011 59.030 1.00 29.03 ? 91   SER A C   1 
ATOM   681  O O   . SER A 1 88  ? -14.207 66.080 58.505 1.00 27.96 ? 91   SER A O   1 
ATOM   682  C CB  . SER A 1 88  ? -16.624 68.126 59.122 1.00 29.19 ? 91   SER A CB  1 
ATOM   683  O OG  . SER A 1 88  ? -17.682 67.480 58.439 1.00 30.48 ? 91   SER A OG  1 
ATOM   684  N N   . GLU A 1 89  ? -16.137 64.984 58.846 1.00 28.38 ? 92   GLU A N   1 
ATOM   685  C CA  . GLU A 1 89  ? -15.750 63.902 57.959 1.00 28.76 ? 92   GLU A CA  1 
ATOM   686  C C   . GLU A 1 89  ? -15.835 64.417 56.533 1.00 28.89 ? 92   GLU A C   1 
ATOM   687  O O   . GLU A 1 89  ? -15.238 63.849 55.620 1.00 29.16 ? 92   GLU A O   1 
ATOM   688  C CB  . GLU A 1 89  ? -16.653 62.687 58.158 1.00 28.62 ? 92   GLU A CB  1 
ATOM   689  C CG  . GLU A 1 89  ? -16.263 61.876 59.379 1.00 28.77 ? 92   GLU A CG  1 
ATOM   690  C CD  . GLU A 1 89  ? -17.063 60.603 59.522 1.00 28.58 ? 92   GLU A CD  1 
ATOM   691  O OE1 . GLU A 1 89  ? -18.199 60.667 60.037 1.00 29.23 ? 92   GLU A OE1 1 
ATOM   692  O OE2 . GLU A 1 89  ? -16.556 59.540 59.112 1.00 28.06 ? 92   GLU A OE2 1 
ATOM   693  N N   . ASP A 1 90  ? -16.586 65.500 56.351 1.00 29.02 ? 93   ASP A N   1 
ATOM   694  C CA  . ASP A 1 90  ? -16.725 66.133 55.041 1.00 29.70 ? 93   ASP A CA  1 
ATOM   695  C C   . ASP A 1 90  ? -15.526 67.066 55.009 1.00 29.27 ? 93   ASP A C   1 
ATOM   696  O O   . ASP A 1 90  ? -15.638 68.242 55.355 1.00 28.88 ? 93   ASP A O   1 
ATOM   697  C CB  . ASP A 1 90  ? -18.017 66.947 54.981 1.00 30.70 ? 93   ASP A CB  1 
ATOM   698  C CG  . ASP A 1 90  ? -18.238 67.593 53.629 1.00 32.35 ? 93   ASP A CG  1 
ATOM   699  O OD1 . ASP A 1 90  ? -17.282 67.653 52.823 1.00 32.60 ? 93   ASP A OD1 1 
ATOM   700  O OD2 . ASP A 1 90  ? -19.374 68.052 53.376 1.00 34.12 ? 93   ASP A OD2 1 
ATOM   701  N N   . CYS A 1 91  ? -14.382 66.537 54.591 1.00 28.72 ? 94   CYS A N   1 
ATOM   702  C CA  . CYS A 1 91  ? -13.149 67.316 54.600 1.00 28.15 ? 94   CYS A CA  1 
ATOM   703  C C   . CYS A 1 91  ? -12.244 67.136 53.391 1.00 28.01 ? 94   CYS A C   1 
ATOM   704  O O   . CYS A 1 91  ? -11.096 67.571 53.418 1.00 28.71 ? 94   CYS A O   1 
ATOM   705  C CB  . CYS A 1 91  ? -12.358 66.954 55.860 1.00 27.38 ? 94   CYS A CB  1 
ATOM   706  S SG  . CYS A 1 91  ? -11.885 65.187 55.920 1.00 26.66 ? 94   CYS A SG  1 
ATOM   707  N N   . LEU A 1 92  ? -12.728 66.497 52.334 1.00 27.25 ? 95   LEU A N   1 
ATOM   708  C CA  . LEU A 1 92  ? -11.863 66.314 51.181 1.00 27.35 ? 95   LEU A CA  1 
ATOM   709  C C   . LEU A 1 92  ? -11.901 67.500 50.229 1.00 27.41 ? 95   LEU A C   1 
ATOM   710  O O   . LEU A 1 92  ? -12.694 67.539 49.288 1.00 27.28 ? 95   LEU A O   1 
ATOM   711  C CB  . LEU A 1 92  ? -12.211 65.014 50.452 1.00 26.77 ? 95   LEU A CB  1 
ATOM   712  C CG  . LEU A 1 92  ? -11.996 63.767 51.321 1.00 27.07 ? 95   LEU A CG  1 
ATOM   713  C CD1 . LEU A 1 92  ? -12.095 62.515 50.457 1.00 25.32 ? 95   LEU A CD1 1 
ATOM   714  C CD2 . LEU A 1 92  ? -10.626 63.839 52.005 1.00 25.91 ? 95   LEU A CD2 1 
ATOM   715  N N   . TYR A 1 93  ? -11.029 68.470 50.495 1.00 27.38 ? 96   TYR A N   1 
ATOM   716  C CA  . TYR A 1 93  ? -10.929 69.676 49.682 1.00 27.39 ? 96   TYR A CA  1 
ATOM   717  C C   . TYR A 1 93  ? -9.476  70.071 49.456 1.00 27.26 ? 96   TYR A C   1 
ATOM   718  O O   . TYR A 1 93  ? -8.575  69.604 50.156 1.00 27.51 ? 96   TYR A O   1 
ATOM   719  C CB  . TYR A 1 93  ? -11.649 70.844 50.362 1.00 28.57 ? 96   TYR A CB  1 
ATOM   720  C CG  . TYR A 1 93  ? -13.097 70.581 50.674 1.00 28.70 ? 96   TYR A CG  1 
ATOM   721  C CD1 . TYR A 1 93  ? -13.463 69.825 51.788 1.00 29.14 ? 96   TYR A CD1 1 
ATOM   722  C CD2 . TYR A 1 93  ? -14.104 71.058 49.835 1.00 28.60 ? 96   TYR A CD2 1 
ATOM   723  C CE1 . TYR A 1 93  ? -14.802 69.546 52.059 1.00 29.56 ? 96   TYR A CE1 1 
ATOM   724  C CE2 . TYR A 1 93  ? -15.444 70.782 50.093 1.00 29.26 ? 96   TYR A CE2 1 
ATOM   725  C CZ  . TYR A 1 93  ? -15.784 70.026 51.203 1.00 29.86 ? 96   TYR A CZ  1 
ATOM   726  O OH  . TYR A 1 93  ? -17.103 69.732 51.447 1.00 31.63 ? 96   TYR A OH  1 
ATOM   727  N N   . LEU A 1 94  ? -9.246  70.936 48.478 1.00 26.69 ? 97   LEU A N   1 
ATOM   728  C CA  . LEU A 1 94  ? -7.897  71.392 48.197 1.00 26.64 ? 97   LEU A CA  1 
ATOM   729  C C   . LEU A 1 94  ? -7.897  72.904 48.038 1.00 26.75 ? 97   LEU A C   1 
ATOM   730  O O   . LEU A 1 94  ? -8.938  73.511 47.775 1.00 27.17 ? 97   LEU A O   1 
ATOM   731  C CB  . LEU A 1 94  ? -7.331  70.687 46.953 1.00 26.34 ? 97   LEU A CB  1 
ATOM   732  C CG  . LEU A 1 94  ? -8.063  70.706 45.609 1.00 26.67 ? 97   LEU A CG  1 
ATOM   733  C CD1 . LEU A 1 94  ? -7.902  72.065 44.942 1.00 26.74 ? 97   LEU A CD1 1 
ATOM   734  C CD2 . LEU A 1 94  ? -7.490  69.615 44.713 1.00 25.99 ? 97   LEU A CD2 1 
ATOM   735  N N   . ASN A 1 95  ? -6.729  73.508 48.217 1.00 26.33 ? 98   ASN A N   1 
ATOM   736  C CA  . ASN A 1 95  ? -6.582  74.953 48.132 1.00 26.24 ? 98   ASN A CA  1 
ATOM   737  C C   . ASN A 1 95  ? -5.534  75.309 47.084 1.00 26.76 ? 98   ASN A C   1 
ATOM   738  O O   . ASN A 1 95  ? -4.505  74.640 46.993 1.00 27.07 ? 98   ASN A O   1 
ATOM   739  C CB  . ASN A 1 95  ? -6.159  75.500 49.501 1.00 25.12 ? 98   ASN A CB  1 
ATOM   740  C CG  . ASN A 1 95  ? -7.019  74.958 50.638 1.00 26.33 ? 98   ASN A CG  1 
ATOM   741  O OD1 . ASN A 1 95  ? -8.224  75.201 50.690 1.00 27.14 ? 98   ASN A OD1 1 
ATOM   742  N ND2 . ASN A 1 95  ? -6.399  74.216 51.554 1.00 24.34 ? 98   ASN A ND2 1 
ATOM   743  N N   . ILE A 1 96  ? -5.789  76.363 46.307 1.00 26.77 ? 99   ILE A N   1 
ATOM   744  C CA  . ILE A 1 96  ? -4.856  76.795 45.265 1.00 27.39 ? 99   ILE A CA  1 
ATOM   745  C C   . ILE A 1 96  ? -4.515  78.293 45.333 1.00 28.13 ? 99   ILE A C   1 
ATOM   746  O O   . ILE A 1 96  ? -5.406  79.142 45.385 1.00 28.54 ? 99   ILE A O   1 
ATOM   747  C CB  . ILE A 1 96  ? -5.426  76.531 43.850 1.00 27.04 ? 99   ILE A CB  1 
ATOM   748  C CG1 . ILE A 1 96  ? -5.986  75.110 43.753 1.00 27.23 ? 99   ILE A CG1 1 
ATOM   749  C CG2 . ILE A 1 96  ? -4.331  76.731 42.810 1.00 26.35 ? 99   ILE A CG2 1 
ATOM   750  C CD1 . ILE A 1 96  ? -6.671  74.812 42.417 1.00 26.46 ? 99   ILE A CD1 1 
ATOM   751  N N   . TRP A 1 97  ? -3.225  78.611 45.326 1.00 28.45 ? 100  TRP A N   1 
ATOM   752  C CA  . TRP A 1 97  ? -2.775  79.999 45.343 1.00 29.40 ? 100  TRP A CA  1 
ATOM   753  C C   . TRP A 1 97  ? -2.198  80.276 43.974 1.00 29.98 ? 100  TRP A C   1 
ATOM   754  O O   . TRP A 1 97  ? -1.257  79.610 43.542 1.00 29.66 ? 100  TRP A O   1 
ATOM   755  C CB  . TRP A 1 97  ? -1.713  80.219 46.419 1.00 30.16 ? 100  TRP A CB  1 
ATOM   756  C CG  . TRP A 1 97  ? -2.310  80.386 47.778 1.00 30.71 ? 100  TRP A CG  1 
ATOM   757  C CD1 . TRP A 1 97  ? -2.823  81.531 48.313 1.00 31.28 ? 100  TRP A CD1 1 
ATOM   758  C CD2 . TRP A 1 97  ? -2.509  79.362 48.755 1.00 31.13 ? 100  TRP A CD2 1 
ATOM   759  N NE1 . TRP A 1 97  ? -3.332  81.285 49.565 1.00 31.63 ? 100  TRP A NE1 1 
ATOM   760  C CE2 . TRP A 1 97  ? -3.152  79.961 49.862 1.00 31.39 ? 100  TRP A CE2 1 
ATOM   761  C CE3 . TRP A 1 97  ? -2.208  77.996 48.804 1.00 31.68 ? 100  TRP A CE3 1 
ATOM   762  C CZ2 . TRP A 1 97  ? -3.500  79.241 51.008 1.00 31.79 ? 100  TRP A CZ2 1 
ATOM   763  C CZ3 . TRP A 1 97  ? -2.556  77.276 49.949 1.00 33.25 ? 100  TRP A CZ3 1 
ATOM   764  C CH2 . TRP A 1 97  ? -3.195  77.904 51.034 1.00 32.64 ? 100  TRP A CH2 1 
ATOM   765  N N   . VAL A 1 98  ? -2.769  81.260 43.289 1.00 30.63 ? 101  VAL A N   1 
ATOM   766  C CA  . VAL A 1 98  ? -2.336  81.594 41.941 1.00 31.54 ? 101  VAL A CA  1 
ATOM   767  C C   . VAL A 1 98  ? -1.751  82.989 41.797 1.00 31.64 ? 101  VAL A C   1 
ATOM   768  O O   . VAL A 1 98  ? -2.350  83.978 42.217 1.00 31.67 ? 101  VAL A O   1 
ATOM   769  C CB  . VAL A 1 98  ? -3.510  81.458 40.945 1.00 31.24 ? 101  VAL A CB  1 
ATOM   770  C CG1 . VAL A 1 98  ? -3.045  81.779 39.532 1.00 31.18 ? 101  VAL A CG1 1 
ATOM   771  C CG2 . VAL A 1 98  ? -4.080  80.058 41.014 1.00 31.54 ? 101  VAL A CG2 1 
ATOM   772  N N   . PRO A 1 99  ? -0.565  83.083 41.188 1.00 32.20 ? 102  PRO A N   1 
ATOM   773  C CA  . PRO A 1 99  ? 0.072   84.387 40.996 1.00 32.84 ? 102  PRO A CA  1 
ATOM   774  C C   . PRO A 1 99  ? -0.880  85.303 40.227 1.00 34.24 ? 102  PRO A C   1 
ATOM   775  O O   . PRO A 1 99  ? -1.778  84.827 39.521 1.00 34.16 ? 102  PRO A O   1 
ATOM   776  C CB  . PRO A 1 99  ? 1.315   84.041 40.181 1.00 31.98 ? 102  PRO A CB  1 
ATOM   777  C CG  . PRO A 1 99  ? 1.653   82.650 40.660 1.00 31.52 ? 102  PRO A CG  1 
ATOM   778  C CD  . PRO A 1 99  ? 0.294   81.995 40.686 1.00 31.80 ? 102  PRO A CD  1 
ATOM   779  N N   . SER A 1 100 ? -0.696  86.611 40.374 1.00 34.79 ? 103  SER A N   1 
ATOM   780  C CA  . SER A 1 100 ? -1.529  87.569 39.662 1.00 35.77 ? 103  SER A CA  1 
ATOM   781  C C   . SER A 1 100 ? -0.640  88.580 38.952 1.00 35.57 ? 103  SER A C   1 
ATOM   782  O O   . SER A 1 100 ? 0.266   89.144 39.554 1.00 36.35 ? 103  SER A O   1 
ATOM   783  C CB  . SER A 1 100 ? -2.459  88.297 40.626 1.00 36.63 ? 103  SER A CB  1 
ATOM   784  O OG  . SER A 1 100 ? -3.323  89.155 39.907 1.00 37.43 ? 103  SER A OG  1 
ATOM   785  N N   . PRO A 1 101 ? -0.878  88.813 37.653 1.00 36.06 ? 104  PRO A N   1 
ATOM   786  C CA  . PRO A 1 101 ? -1.917  88.190 36.824 1.00 35.85 ? 104  PRO A CA  1 
ATOM   787  C C   . PRO A 1 101 ? -1.741  86.680 36.672 1.00 35.55 ? 104  PRO A C   1 
ATOM   788  O O   . PRO A 1 101 ? -0.629  86.155 36.794 1.00 35.22 ? 104  PRO A O   1 
ATOM   789  C CB  . PRO A 1 101 ? -1.778  88.928 35.494 1.00 36.22 ? 104  PRO A CB  1 
ATOM   790  C CG  . PRO A 1 101 ? -0.308  89.242 35.443 1.00 36.72 ? 104  PRO A CG  1 
ATOM   791  C CD  . PRO A 1 101 ? -0.040  89.722 36.849 1.00 35.41 ? 104  PRO A CD  1 
ATOM   792  N N   . ARG A 1 102 ? -2.848  85.994 36.402 1.00 35.55 ? 105  ARG A N   1 
ATOM   793  C CA  . ARG A 1 102 ? -2.852  84.541 36.239 1.00 35.90 ? 105  ARG A CA  1 
ATOM   794  C C   . ARG A 1 102 ? -1.835  84.063 35.211 1.00 35.93 ? 105  ARG A C   1 
ATOM   795  O O   . ARG A 1 102 ? -1.807  84.545 34.081 1.00 36.61 ? 105  ARG A O   1 
ATOM   796  C CB  . ARG A 1 102 ? -4.243  84.054 35.817 1.00 35.21 ? 105  ARG A CB  1 
ATOM   797  C CG  . ARG A 1 102 ? -4.385  82.534 35.810 1.00 35.67 ? 105  ARG A CG  1 
ATOM   798  C CD  . ARG A 1 102 ? -5.696  82.081 35.178 1.00 34.62 ? 105  ARG A CD  1 
ATOM   799  N NE  . ARG A 1 102 ? -6.866  82.658 35.834 1.00 35.05 ? 105  ARG A NE  1 
ATOM   800  C CZ  . ARG A 1 102 ? -8.112  82.493 35.403 1.00 35.02 ? 105  ARG A CZ  1 
ATOM   801  N NH1 . ARG A 1 102 ? -8.344  81.765 34.319 1.00 35.99 ? 105  ARG A NH1 1 
ATOM   802  N NH2 . ARG A 1 102 ? -9.123  83.072 36.036 1.00 34.27 ? 105  ARG A NH2 1 
ATOM   803  N N   . PRO A 1 103 ? -0.977  83.106 35.594 1.00 36.13 ? 106  PRO A N   1 
ATOM   804  C CA  . PRO A 1 103 ? 0.023   82.593 34.655 1.00 35.51 ? 106  PRO A CA  1 
ATOM   805  C C   . PRO A 1 103 ? -0.663  81.761 33.576 1.00 35.47 ? 106  PRO A C   1 
ATOM   806  O O   . PRO A 1 103 ? -1.838  81.413 33.707 1.00 35.67 ? 106  PRO A O   1 
ATOM   807  C CB  . PRO A 1 103 ? 0.932   81.755 35.546 1.00 35.34 ? 106  PRO A CB  1 
ATOM   808  C CG  . PRO A 1 103 ? -0.007  81.242 36.579 1.00 35.96 ? 106  PRO A CG  1 
ATOM   809  C CD  . PRO A 1 103 ? -0.843  82.459 36.911 1.00 36.18 ? 106  PRO A CD  1 
ATOM   810  N N   . LYS A 1 104 ? 0.063   81.455 32.508 1.00 35.17 ? 107  LYS A N   1 
ATOM   811  C CA  . LYS A 1 104 ? -0.499  80.661 31.425 1.00 35.53 ? 107  LYS A CA  1 
ATOM   812  C C   . LYS A 1 104 ? -0.180  79.178 31.607 1.00 35.43 ? 107  LYS A C   1 
ATOM   813  O O   . LYS A 1 104 ? -1.027  78.323 31.377 1.00 35.58 ? 107  LYS A O   1 
ATOM   814  C CB  . LYS A 1 104 ? 0.046   81.134 30.073 1.00 36.21 ? 107  LYS A CB  1 
ATOM   815  C CG  . LYS A 1 104 ? -0.154  82.613 29.795 1.00 36.30 ? 107  LYS A CG  1 
ATOM   816  C CD  . LYS A 1 104 ? -1.615  82.999 29.890 1.00 37.36 ? 107  LYS A CD  1 
ATOM   817  C CE  . LYS A 1 104 ? -1.804  84.497 29.697 1.00 37.52 ? 107  LYS A CE  1 
ATOM   818  N NZ  . LYS A 1 104 ? -3.243  84.868 29.776 1.00 38.62 ? 107  LYS A NZ  1 
ATOM   819  N N   . SER A 1 105 ? 1.044   78.874 32.018 1.00 35.40 ? 108  SER A N   1 
ATOM   820  C CA  . SER A 1 105 ? 1.446   77.484 32.202 1.00 35.62 ? 108  SER A CA  1 
ATOM   821  C C   . SER A 1 105 ? 2.716   77.413 33.043 1.00 35.25 ? 108  SER A C   1 
ATOM   822  O O   . SER A 1 105 ? 3.792   77.104 32.531 1.00 35.04 ? 108  SER A O   1 
ATOM   823  C CB  . SER A 1 105 ? 1.688   76.836 30.838 1.00 35.08 ? 108  SER A CB  1 
ATOM   824  O OG  . SER A 1 105 ? 2.022   75.469 30.977 1.00 35.36 ? 108  SER A OG  1 
ATOM   825  N N   . THR A 1 106 ? 2.581   77.689 34.336 1.00 34.53 ? 109  THR A N   1 
ATOM   826  C CA  . THR A 1 106 ? 3.730   77.686 35.229 1.00 34.59 ? 109  THR A CA  1 
ATOM   827  C C   . THR A 1 106 ? 3.845   76.471 36.156 1.00 34.37 ? 109  THR A C   1 
ATOM   828  O O   . THR A 1 106 ? 2.906   75.683 36.310 1.00 34.38 ? 109  THR A O   1 
ATOM   829  C CB  . THR A 1 106 ? 3.746   78.950 36.098 1.00 34.43 ? 109  THR A CB  1 
ATOM   830  O OG1 . THR A 1 106 ? 5.040   79.095 36.692 1.00 37.91 ? 109  THR A OG1 1 
ATOM   831  C CG2 . THR A 1 106 ? 2.711   78.853 37.204 1.00 33.80 ? 109  THR A CG2 1 
ATOM   832  N N   . THR A 1 107 ? 5.015   76.349 36.777 1.00 33.56 ? 110  THR A N   1 
ATOM   833  C CA  . THR A 1 107 ? 5.321   75.267 37.698 1.00 32.81 ? 110  THR A CA  1 
ATOM   834  C C   . THR A 1 107 ? 4.296   75.146 38.817 1.00 31.94 ? 110  THR A C   1 
ATOM   835  O O   . THR A 1 107 ? 3.849   76.146 39.380 1.00 31.99 ? 110  THR A O   1 
ATOM   836  C CB  . THR A 1 107 ? 6.703   75.472 38.333 1.00 33.20 ? 110  THR A CB  1 
ATOM   837  O OG1 . THR A 1 107 ? 7.693   75.539 37.301 1.00 33.83 ? 110  THR A OG1 1 
ATOM   838  C CG2 . THR A 1 107 ? 7.031   74.324 39.280 1.00 33.23 ? 110  THR A CG2 1 
ATOM   839  N N   . VAL A 1 108 ? 3.944   73.908 39.137 1.00 30.86 ? 111  VAL A N   1 
ATOM   840  C CA  . VAL A 1 108 ? 2.973   73.614 40.181 1.00 29.82 ? 111  VAL A CA  1 
ATOM   841  C C   . VAL A 1 108 ? 3.623   72.836 41.331 1.00 29.45 ? 111  VAL A C   1 
ATOM   842  O O   . VAL A 1 108 ? 4.441   71.943 41.105 1.00 29.66 ? 111  VAL A O   1 
ATOM   843  C CB  . VAL A 1 108 ? 1.812   72.760 39.614 1.00 30.48 ? 111  VAL A CB  1 
ATOM   844  C CG1 . VAL A 1 108 ? 0.809   72.426 40.722 1.00 29.81 ? 111  VAL A CG1 1 
ATOM   845  C CG2 . VAL A 1 108 ? 1.139   73.497 38.460 1.00 29.46 ? 111  VAL A CG2 1 
ATOM   846  N N   . MET A 1 109 ? 3.257   73.183 42.561 1.00 28.56 ? 112  MET A N   1 
ATOM   847  C CA  . MET A 1 109 ? 3.767   72.503 43.746 1.00 27.26 ? 112  MET A CA  1 
ATOM   848  C C   . MET A 1 109 ? 2.565   72.126 44.599 1.00 26.28 ? 112  MET A C   1 
ATOM   849  O O   . MET A 1 109 ? 1.747   72.982 44.943 1.00 26.98 ? 112  MET A O   1 
ATOM   850  C CB  . MET A 1 109 ? 4.716   73.416 44.532 1.00 27.46 ? 112  MET A CB  1 
ATOM   851  C CG  . MET A 1 109 ? 6.022   73.709 43.799 1.00 27.44 ? 112  MET A CG  1 
ATOM   852  S SD  . MET A 1 109 ? 7.192   74.742 44.725 1.00 28.49 ? 112  MET A SD  1 
ATOM   853  C CE  . MET A 1 109 ? 7.855   73.554 45.909 1.00 27.14 ? 112  MET A CE  1 
ATOM   854  N N   . VAL A 1 110 ? 2.447   70.840 44.916 1.00 25.36 ? 113  VAL A N   1 
ATOM   855  C CA  . VAL A 1 110 ? 1.340   70.343 45.722 1.00 23.93 ? 113  VAL A CA  1 
ATOM   856  C C   . VAL A 1 110 ? 1.851   69.901 47.084 1.00 24.00 ? 113  VAL A C   1 
ATOM   857  O O   . VAL A 1 110 ? 2.703   69.014 47.185 1.00 23.76 ? 113  VAL A O   1 
ATOM   858  C CB  . VAL A 1 110 ? 0.638   69.143 45.043 1.00 24.22 ? 113  VAL A CB  1 
ATOM   859  C CG1 . VAL A 1 110 ? -0.585  68.721 45.865 1.00 21.91 ? 113  VAL A CG1 1 
ATOM   860  C CG2 . VAL A 1 110 ? 0.228   69.512 43.624 1.00 22.43 ? 113  VAL A CG2 1 
ATOM   861  N N   . TRP A 1 111 ? 1.312   70.516 48.131 1.00 23.50 ? 114  TRP A N   1 
ATOM   862  C CA  . TRP A 1 111 ? 1.724   70.218 49.496 1.00 23.24 ? 114  TRP A CA  1 
ATOM   863  C C   . TRP A 1 111 ? 0.867   69.163 50.179 1.00 23.07 ? 114  TRP A C   1 
ATOM   864  O O   . TRP A 1 111 ? -0.363  69.217 50.137 1.00 22.54 ? 114  TRP A O   1 
ATOM   865  C CB  . TRP A 1 111 ? 1.724   71.511 50.323 1.00 22.91 ? 114  TRP A CB  1 
ATOM   866  C CG  . TRP A 1 111 ? 1.972   71.311 51.791 1.00 23.12 ? 114  TRP A CG  1 
ATOM   867  C CD1 . TRP A 1 111 ? 1.049   71.388 52.799 1.00 22.98 ? 114  TRP A CD1 1 
ATOM   868  C CD2 . TRP A 1 111 ? 3.222   71.014 52.416 1.00 23.06 ? 114  TRP A CD2 1 
ATOM   869  N NE1 . TRP A 1 111 ? 1.650   71.160 54.013 1.00 22.68 ? 114  TRP A NE1 1 
ATOM   870  C CE2 . TRP A 1 111 ? 2.985   70.927 53.807 1.00 23.67 ? 114  TRP A CE2 1 
ATOM   871  C CE3 . TRP A 1 111 ? 4.522   70.813 51.939 1.00 23.11 ? 114  TRP A CE3 1 
ATOM   872  C CZ2 . TRP A 1 111 ? 4.005   70.648 54.726 1.00 23.14 ? 114  TRP A CZ2 1 
ATOM   873  C CZ3 . TRP A 1 111 ? 5.534   70.537 52.850 1.00 23.11 ? 114  TRP A CZ3 1 
ATOM   874  C CH2 . TRP A 1 111 ? 5.269   70.458 54.229 1.00 22.90 ? 114  TRP A CH2 1 
ATOM   875  N N   . ILE A 1 112 ? 1.538   68.203 50.810 1.00 23.44 ? 115  ILE A N   1 
ATOM   876  C CA  . ILE A 1 112 ? 0.872   67.124 51.529 1.00 22.90 ? 115  ILE A CA  1 
ATOM   877  C C   . ILE A 1 112 ? 1.288   67.221 52.989 1.00 22.52 ? 115  ILE A C   1 
ATOM   878  O O   . ILE A 1 112 ? 2.439   66.948 53.338 1.00 21.41 ? 115  ILE A O   1 
ATOM   879  C CB  . ILE A 1 112 ? 1.282   65.745 50.976 1.00 23.62 ? 115  ILE A CB  1 
ATOM   880  C CG1 . ILE A 1 112 ? 0.971   65.678 49.474 1.00 23.91 ? 115  ILE A CG1 1 
ATOM   881  C CG2 . ILE A 1 112 ? 0.559   64.645 51.750 1.00 22.03 ? 115  ILE A CG2 1 
ATOM   882  C CD1 . ILE A 1 112 ? 1.362   64.361 48.810 1.00 25.15 ? 115  ILE A CD1 1 
ATOM   883  N N   . TYR A 1 113 ? 0.346   67.599 53.848 1.00 22.95 ? 116  TYR A N   1 
ATOM   884  C CA  . TYR A 1 113 ? 0.654   67.764 55.262 1.00 22.78 ? 116  TYR A CA  1 
ATOM   885  C C   . TYR A 1 113 ? 1.011   66.489 56.016 1.00 22.87 ? 116  TYR A C   1 
ATOM   886  O O   . TYR A 1 113 ? 0.614   65.385 55.637 1.00 22.73 ? 116  TYR A O   1 
ATOM   887  C CB  . TYR A 1 113 ? -0.495  68.497 55.974 1.00 22.86 ? 116  TYR A CB  1 
ATOM   888  C CG  . TYR A 1 113 ? -1.846  67.804 55.970 1.00 22.43 ? 116  TYR A CG  1 
ATOM   889  C CD1 . TYR A 1 113 ? -2.059  66.621 56.687 1.00 23.40 ? 116  TYR A CD1 1 
ATOM   890  C CD2 . TYR A 1 113 ? -2.926  68.358 55.294 1.00 22.21 ? 116  TYR A CD2 1 
ATOM   891  C CE1 . TYR A 1 113 ? -3.319  66.017 56.730 1.00 22.79 ? 116  TYR A CE1 1 
ATOM   892  C CE2 . TYR A 1 113 ? -4.189  67.764 55.328 1.00 21.38 ? 116  TYR A CE2 1 
ATOM   893  C CZ  . TYR A 1 113 ? -4.381  66.598 56.045 1.00 22.71 ? 116  TYR A CZ  1 
ATOM   894  O OH  . TYR A 1 113 ? -5.632  66.010 56.075 1.00 22.38 ? 116  TYR A OH  1 
ATOM   895  N N   . GLY A 1 114 ? 1.788   66.663 57.082 1.00 23.05 ? 117  GLY A N   1 
ATOM   896  C CA  . GLY A 1 114 ? 2.184   65.545 57.915 1.00 22.38 ? 117  GLY A CA  1 
ATOM   897  C C   . GLY A 1 114 ? 1.295   65.500 59.144 1.00 22.54 ? 117  GLY A C   1 
ATOM   898  O O   . GLY A 1 114 ? 0.271   66.189 59.204 1.00 21.97 ? 117  GLY A O   1 
ATOM   899  N N   . GLY A 1 115 ? 1.689   64.698 60.127 1.00 22.76 ? 118  GLY A N   1 
ATOM   900  C CA  . GLY A 1 115 ? 0.910   64.564 61.343 1.00 22.64 ? 118  GLY A CA  1 
ATOM   901  C C   . GLY A 1 115 ? 0.773   63.107 61.768 1.00 23.30 ? 118  GLY A C   1 
ATOM   902  O O   . GLY A 1 115 ? -0.230  62.726 62.374 1.00 23.80 ? 118  GLY A O   1 
ATOM   903  N N   . GLY A 1 116 ? 1.776   62.292 61.436 1.00 22.91 ? 119  GLY A N   1 
ATOM   904  C CA  . GLY A 1 116 ? 1.770   60.884 61.807 1.00 23.04 ? 119  GLY A CA  1 
ATOM   905  C C   . GLY A 1 116 ? 0.607   60.064 61.279 1.00 23.66 ? 119  GLY A C   1 
ATOM   906  O O   . GLY A 1 116 ? 0.307   58.997 61.810 1.00 24.55 ? 119  GLY A O   1 
ATOM   907  N N   . PHE A 1 117 ? -0.045  60.556 60.231 1.00 23.69 ? 120  PHE A N   1 
ATOM   908  C CA  . PHE A 1 117 ? -1.185  59.871 59.634 1.00 23.38 ? 120  PHE A CA  1 
ATOM   909  C C   . PHE A 1 117 ? -2.378  59.858 60.585 1.00 23.68 ? 120  PHE A C   1 
ATOM   910  O O   . PHE A 1 117 ? -3.410  59.261 60.278 1.00 24.09 ? 120  PHE A O   1 
ATOM   911  C CB  . PHE A 1 117 ? -0.818  58.427 59.248 1.00 22.55 ? 120  PHE A CB  1 
ATOM   912  C CG  . PHE A 1 117 ? 0.137   58.325 58.081 1.00 21.99 ? 120  PHE A CG  1 
ATOM   913  C CD1 . PHE A 1 117 ? -0.224  58.797 56.823 1.00 21.38 ? 120  PHE A CD1 1 
ATOM   914  C CD2 . PHE A 1 117 ? 1.404   57.763 58.246 1.00 21.09 ? 120  PHE A CD2 1 
ATOM   915  C CE1 . PHE A 1 117 ? 0.663   58.713 55.742 1.00 22.06 ? 120  PHE A CE1 1 
ATOM   916  C CE2 . PHE A 1 117 ? 2.302   57.674 57.175 1.00 21.23 ? 120  PHE A CE2 1 
ATOM   917  C CZ  . PHE A 1 117 ? 1.933   58.149 55.919 1.00 21.36 ? 120  PHE A CZ  1 
ATOM   918  N N   . TYR A 1 118 ? -2.248  60.516 61.734 1.00 23.80 ? 121  TYR A N   1 
ATOM   919  C CA  . TYR A 1 118 ? -3.349  60.550 62.698 1.00 24.72 ? 121  TYR A CA  1 
ATOM   920  C C   . TYR A 1 118 ? -3.892  61.959 62.887 1.00 25.32 ? 121  TYR A C   1 
ATOM   921  O O   . TYR A 1 118 ? -4.875  62.163 63.605 1.00 25.37 ? 121  TYR A O   1 
ATOM   922  C CB  . TYR A 1 118 ? -2.892  60.006 64.057 1.00 24.65 ? 121  TYR A CB  1 
ATOM   923  C CG  . TYR A 1 118 ? -1.990  60.945 64.830 1.00 24.84 ? 121  TYR A CG  1 
ATOM   924  C CD1 . TYR A 1 118 ? -2.525  61.967 65.622 1.00 25.19 ? 121  TYR A CD1 1 
ATOM   925  C CD2 . TYR A 1 118 ? -0.602  60.826 64.754 1.00 24.45 ? 121  TYR A CD2 1 
ATOM   926  C CE1 . TYR A 1 118 ? -1.696  62.846 66.320 1.00 25.23 ? 121  TYR A CE1 1 
ATOM   927  C CE2 . TYR A 1 118 ? 0.234   61.693 65.441 1.00 25.38 ? 121  TYR A CE2 1 
ATOM   928  C CZ  . TYR A 1 118 ? -0.317  62.701 66.223 1.00 26.70 ? 121  TYR A CZ  1 
ATOM   929  O OH  . TYR A 1 118 ? 0.516   63.557 66.911 1.00 28.03 ? 121  TYR A OH  1 
ATOM   930  N N   . SER A 1 119 ? -3.243  62.929 62.250 1.00 25.04 ? 122  SER A N   1 
ATOM   931  C CA  . SER A 1 119 ? -3.648  64.320 62.368 1.00 25.35 ? 122  SER A CA  1 
ATOM   932  C C   . SER A 1 119 ? -3.130  65.123 61.191 1.00 25.66 ? 122  SER A C   1 
ATOM   933  O O   . SER A 1 119 ? -2.426  64.590 60.328 1.00 25.07 ? 122  SER A O   1 
ATOM   934  C CB  . SER A 1 119 ? -3.085  64.920 63.656 1.00 25.99 ? 122  SER A CB  1 
ATOM   935  O OG  . SER A 1 119 ? -1.664  64.929 63.626 1.00 25.37 ? 122  SER A OG  1 
ATOM   936  N N   . GLY A 1 120 ? -3.475  66.409 61.170 1.00 26.10 ? 123  GLY A N   1 
ATOM   937  C CA  . GLY A 1 120 ? -3.028  67.280 60.098 1.00 26.35 ? 123  GLY A CA  1 
ATOM   938  C C   . GLY A 1 120 ? -4.145  68.057 59.426 1.00 26.64 ? 123  GLY A C   1 
ATOM   939  O O   . GLY A 1 120 ? -5.276  67.585 59.341 1.00 26.17 ? 123  GLY A O   1 
ATOM   940  N N   . SER A 1 121 ? -3.814  69.252 58.945 1.00 26.60 ? 124  SER A N   1 
ATOM   941  C CA  . SER A 1 121 ? -4.771  70.124 58.271 1.00 27.01 ? 124  SER A CA  1 
ATOM   942  C C   . SER A 1 121 ? -4.026  70.896 57.189 1.00 26.86 ? 124  SER A C   1 
ATOM   943  O O   . SER A 1 121 ? -2.851  71.209 57.339 1.00 27.65 ? 124  SER A O   1 
ATOM   944  C CB  . SER A 1 121 ? -5.386  71.124 59.262 1.00 26.73 ? 124  SER A CB  1 
ATOM   945  O OG  . SER A 1 121 ? -6.009  70.473 60.359 1.00 27.75 ? 124  SER A OG  1 
ATOM   946  N N   . SER A 1 122 ? -4.706  71.207 56.099 1.00 26.95 ? 125  SER A N   1 
ATOM   947  C CA  . SER A 1 122 ? -4.076  71.949 55.014 1.00 27.70 ? 125  SER A CA  1 
ATOM   948  C C   . SER A 1 122 ? -4.195  73.446 55.263 1.00 28.22 ? 125  SER A C   1 
ATOM   949  O O   . SER A 1 122 ? -3.544  74.250 54.597 1.00 28.59 ? 125  SER A O   1 
ATOM   950  C CB  . SER A 1 122 ? -4.766  71.622 53.691 1.00 27.23 ? 125  SER A CB  1 
ATOM   951  O OG  . SER A 1 122 ? -6.124  72.039 53.727 1.00 27.29 ? 125  SER A OG  1 
ATOM   952  N N   . THR A 1 123 ? -5.017  73.799 56.245 1.00 28.59 ? 126  THR A N   1 
ATOM   953  C CA  . THR A 1 123 ? -5.314  75.186 56.574 1.00 28.63 ? 126  THR A CA  1 
ATOM   954  C C   . THR A 1 123 ? -4.461  75.867 57.642 1.00 29.05 ? 126  THR A C   1 
ATOM   955  O O   . THR A 1 123 ? -4.721  77.013 57.995 1.00 29.22 ? 126  THR A O   1 
ATOM   956  C CB  . THR A 1 123 ? -6.787  75.296 56.992 1.00 28.97 ? 126  THR A CB  1 
ATOM   957  O OG1 . THR A 1 123 ? -7.012  74.481 58.151 1.00 29.26 ? 126  THR A OG1 1 
ATOM   958  C CG2 . THR A 1 123 ? -7.697  74.801 55.869 1.00 28.43 ? 126  THR A CG2 1 
ATOM   959  N N   . LEU A 1 124 ? -3.451  75.179 58.162 1.00 29.38 ? 127  LEU A N   1 
ATOM   960  C CA  . LEU A 1 124 ? -2.596  75.775 59.185 1.00 30.14 ? 127  LEU A CA  1 
ATOM   961  C C   . LEU A 1 124 ? -1.897  77.038 58.670 1.00 30.56 ? 127  LEU A C   1 
ATOM   962  O O   . LEU A 1 124 ? -1.587  77.141 57.483 1.00 30.33 ? 127  LEU A O   1 
ATOM   963  C CB  . LEU A 1 124 ? -1.546  74.760 59.645 1.00 30.28 ? 127  LEU A CB  1 
ATOM   964  C CG  . LEU A 1 124 ? -2.088  73.444 60.214 1.00 30.24 ? 127  LEU A CG  1 
ATOM   965  C CD1 . LEU A 1 124 ? -0.934  72.597 60.746 1.00 29.30 ? 127  LEU A CD1 1 
ATOM   966  C CD2 . LEU A 1 124 ? -3.080  73.746 61.324 1.00 29.35 ? 127  LEU A CD2 1 
ATOM   967  N N   . ASP A 1 125 ? -1.641  77.995 59.560 1.00 31.20 ? 128  ASP A N   1 
ATOM   968  C CA  . ASP A 1 125 ? -0.970  79.233 59.156 1.00 31.11 ? 128  ASP A CA  1 
ATOM   969  C C   . ASP A 1 125 ? 0.402   78.968 58.546 1.00 30.44 ? 128  ASP A C   1 
ATOM   970  O O   . ASP A 1 125 ? 0.789   79.633 57.583 1.00 30.53 ? 128  ASP A O   1 
ATOM   971  C CB  . ASP A 1 125 ? -0.811  80.195 60.339 1.00 32.26 ? 128  ASP A CB  1 
ATOM   972  C CG  . ASP A 1 125 ? -2.141  80.698 60.873 1.00 33.95 ? 128  ASP A CG  1 
ATOM   973  O OD1 . ASP A 1 125 ? -3.098  80.842 60.083 1.00 35.02 ? 128  ASP A OD1 1 
ATOM   974  O OD2 . ASP A 1 125 ? -2.226  80.967 62.089 1.00 36.45 ? 128  ASP A OD2 1 
ATOM   975  N N   . VAL A 1 126 ? 1.142   78.009 59.101 1.00 29.55 ? 129  VAL A N   1 
ATOM   976  C CA  . VAL A 1 126 ? 2.468   77.693 58.571 1.00 28.67 ? 129  VAL A CA  1 
ATOM   977  C C   . VAL A 1 126 ? 2.418   77.093 57.177 1.00 28.56 ? 129  VAL A C   1 
ATOM   978  O O   . VAL A 1 126 ? 3.457   76.956 56.532 1.00 28.55 ? 129  VAL A O   1 
ATOM   979  C CB  . VAL A 1 126 ? 3.256   76.701 59.461 1.00 28.59 ? 129  VAL A CB  1 
ATOM   980  C CG1 . VAL A 1 126 ? 3.898   77.433 60.603 1.00 28.54 ? 129  VAL A CG1 1 
ATOM   981  C CG2 . VAL A 1 126 ? 2.336   75.594 59.958 1.00 27.05 ? 129  VAL A CG2 1 
ATOM   982  N N   . TYR A 1 127 ? 1.226   76.718 56.714 1.00 28.23 ? 130  TYR A N   1 
ATOM   983  C CA  . TYR A 1 127 ? 1.099   76.145 55.374 1.00 28.27 ? 130  TYR A CA  1 
ATOM   984  C C   . TYR A 1 127 ? 0.504   77.142 54.380 1.00 29.06 ? 130  TYR A C   1 
ATOM   985  O O   . TYR A 1 127 ? 0.182   76.768 53.250 1.00 29.78 ? 130  TYR A O   1 
ATOM   986  C CB  . TYR A 1 127 ? 0.218   74.884 55.372 1.00 26.88 ? 130  TYR A CB  1 
ATOM   987  C CG  . TYR A 1 127 ? 0.668   73.749 56.272 1.00 26.15 ? 130  TYR A CG  1 
ATOM   988  C CD1 . TYR A 1 127 ? 2.004   73.610 56.662 1.00 25.78 ? 130  TYR A CD1 1 
ATOM   989  C CD2 . TYR A 1 127 ? -0.250  72.796 56.718 1.00 25.62 ? 130  TYR A CD2 1 
ATOM   990  C CE1 . TYR A 1 127 ? 2.410   72.546 57.477 1.00 25.80 ? 130  TYR A CE1 1 
ATOM   991  C CE2 . TYR A 1 127 ? 0.142   71.732 57.526 1.00 25.62 ? 130  TYR A CE2 1 
ATOM   992  C CZ  . TYR A 1 127 ? 1.468   71.610 57.902 1.00 25.29 ? 130  TYR A CZ  1 
ATOM   993  O OH  . TYR A 1 127 ? 1.842   70.544 58.685 1.00 24.51 ? 130  TYR A OH  1 
ATOM   994  N N   . ASN A 1 128 ? 0.343   78.400 54.790 1.00 29.29 ? 131  ASN A N   1 
ATOM   995  C CA  . ASN A 1 128 ? -0.216  79.410 53.889 1.00 29.22 ? 131  ASN A CA  1 
ATOM   996  C C   . ASN A 1 128 ? 0.671   79.492 52.646 1.00 28.26 ? 131  ASN A C   1 
ATOM   997  O O   . ASN A 1 128 ? 1.834   79.882 52.734 1.00 27.57 ? 131  ASN A O   1 
ATOM   998  C CB  . ASN A 1 128 ? -0.262  80.774 54.573 1.00 30.02 ? 131  ASN A CB  1 
ATOM   999  C CG  . ASN A 1 128 ? -1.217  81.732 53.888 1.00 32.02 ? 131  ASN A CG  1 
ATOM   1000 O OD1 . ASN A 1 128 ? -1.328  81.756 52.658 1.00 31.28 ? 131  ASN A OD1 1 
ATOM   1001 N ND2 . ASN A 1 128 ? -1.911  82.538 54.686 1.00 34.60 ? 131  ASN A ND2 1 
ATOM   1002 N N   . GLY A 1 129 ? 0.116   79.143 51.488 1.00 28.03 ? 132  GLY A N   1 
ATOM   1003 C CA  . GLY A 1 129 ? 0.909   79.146 50.271 1.00 27.98 ? 132  GLY A CA  1 
ATOM   1004 C C   . GLY A 1 129 ? 1.076   80.437 49.496 1.00 28.58 ? 132  GLY A C   1 
ATOM   1005 O O   . GLY A 1 129 ? 1.748   80.451 48.463 1.00 28.18 ? 132  GLY A O   1 
ATOM   1006 N N   . LYS A 1 130 ? 0.498   81.528 49.981 1.00 29.64 ? 133  LYS A N   1 
ATOM   1007 C CA  . LYS A 1 130 ? 0.600   82.792 49.260 1.00 30.73 ? 133  LYS A CA  1 
ATOM   1008 C C   . LYS A 1 130 ? 2.018   83.353 49.165 1.00 30.84 ? 133  LYS A C   1 
ATOM   1009 O O   . LYS A 1 130 ? 2.399   83.886 48.121 1.00 31.46 ? 133  LYS A O   1 
ATOM   1010 C CB  . LYS A 1 130 ? -0.337  83.835 49.878 1.00 31.34 ? 133  LYS A CB  1 
ATOM   1011 C CG  . LYS A 1 130 ? 0.083   84.341 51.244 1.00 32.51 ? 133  LYS A CG  1 
ATOM   1012 C CD  . LYS A 1 130 ? -0.941  85.316 51.781 1.00 33.21 ? 133  LYS A CD  1 
ATOM   1013 C CE  . LYS A 1 130 ? -0.487  85.930 53.093 1.00 34.52 ? 133  LYS A CE  1 
ATOM   1014 N NZ  . LYS A 1 130 ? -1.508  86.887 53.612 1.00 35.33 ? 133  LYS A NZ  1 
ATOM   1015 N N   . TYR A 1 131 ? 2.804   83.225 50.232 1.00 30.66 ? 134  TYR A N   1 
ATOM   1016 C CA  . TYR A 1 131 ? 4.170   83.747 50.224 1.00 31.16 ? 134  TYR A CA  1 
ATOM   1017 C C   . TYR A 1 131 ? 5.027   83.062 49.168 1.00 31.70 ? 134  TYR A C   1 
ATOM   1018 O O   . TYR A 1 131 ? 5.764   83.716 48.426 1.00 32.24 ? 134  TYR A O   1 
ATOM   1019 C CB  . TYR A 1 131 ? 4.825   83.578 51.598 1.00 30.94 ? 134  TYR A CB  1 
ATOM   1020 C CG  . TYR A 1 131 ? 4.029   84.192 52.723 1.00 31.63 ? 134  TYR A CG  1 
ATOM   1021 C CD1 . TYR A 1 131 ? 3.837   85.575 52.797 1.00 31.48 ? 134  TYR A CD1 1 
ATOM   1022 C CD2 . TYR A 1 131 ? 3.421   83.389 53.688 1.00 31.29 ? 134  TYR A CD2 1 
ATOM   1023 C CE1 . TYR A 1 131 ? 3.049   86.139 53.801 1.00 32.00 ? 134  TYR A CE1 1 
ATOM   1024 C CE2 . TYR A 1 131 ? 2.638   83.939 54.694 1.00 31.34 ? 134  TYR A CE2 1 
ATOM   1025 C CZ  . TYR A 1 131 ? 2.452   85.311 54.744 1.00 32.23 ? 134  TYR A CZ  1 
ATOM   1026 O OH  . TYR A 1 131 ? 1.645   85.844 55.720 1.00 33.75 ? 134  TYR A OH  1 
ATOM   1027 N N   . LEU A 1 132 ? 4.922   81.742 49.102 1.00 31.55 ? 135  LEU A N   1 
ATOM   1028 C CA  . LEU A 1 132 ? 5.686   80.955 48.148 1.00 31.57 ? 135  LEU A CA  1 
ATOM   1029 C C   . LEU A 1 132 ? 5.135   81.153 46.739 1.00 32.44 ? 135  LEU A C   1 
ATOM   1030 O O   . LEU A 1 132 ? 5.893   81.328 45.786 1.00 33.17 ? 135  LEU A O   1 
ATOM   1031 C CB  . LEU A 1 132 ? 5.627   79.479 48.554 1.00 31.59 ? 135  LEU A CB  1 
ATOM   1032 C CG  . LEU A 1 132 ? 6.376   78.403 47.768 1.00 31.56 ? 135  LEU A CG  1 
ATOM   1033 C CD1 . LEU A 1 132 ? 7.841   78.787 47.568 1.00 30.74 ? 135  LEU A CD1 1 
ATOM   1034 C CD2 . LEU A 1 132 ? 6.259   77.090 48.541 1.00 31.33 ? 135  LEU A CD2 1 
ATOM   1035 N N   . ALA A 1 133 ? 3.813   81.130 46.604 1.00 32.99 ? 136  ALA A N   1 
ATOM   1036 C CA  . ALA A 1 133 ? 3.193   81.312 45.298 1.00 33.38 ? 136  ALA A CA  1 
ATOM   1037 C C   . ALA A 1 133 ? 3.589   82.673 44.725 1.00 34.48 ? 136  ALA A C   1 
ATOM   1038 O O   . ALA A 1 133 ? 3.965   82.793 43.555 1.00 35.06 ? 136  ALA A O   1 
ATOM   1039 C CB  . ALA A 1 133 ? 1.678   81.214 45.420 1.00 31.68 ? 136  ALA A CB  1 
ATOM   1040 N N   . TYR A 1 134 ? 3.515   83.698 45.565 1.00 35.06 ? 137  TYR A N   1 
ATOM   1041 C CA  . TYR A 1 134 ? 3.851   85.050 45.146 1.00 35.52 ? 137  TYR A CA  1 
ATOM   1042 C C   . TYR A 1 134 ? 5.336   85.284 44.896 1.00 35.23 ? 137  TYR A C   1 
ATOM   1043 O O   . TYR A 1 134 ? 5.715   85.858 43.877 1.00 34.93 ? 137  TYR A O   1 
ATOM   1044 C CB  . TYR A 1 134 ? 3.334   86.053 46.180 1.00 36.01 ? 137  TYR A CB  1 
ATOM   1045 C CG  . TYR A 1 134 ? 3.898   87.442 46.017 1.00 37.08 ? 137  TYR A CG  1 
ATOM   1046 C CD1 . TYR A 1 134 ? 3.404   88.308 45.038 1.00 38.02 ? 137  TYR A CD1 1 
ATOM   1047 C CD2 . TYR A 1 134 ? 4.948   87.884 46.823 1.00 37.26 ? 137  TYR A CD2 1 
ATOM   1048 C CE1 . TYR A 1 134 ? 3.949   89.583 44.864 1.00 38.90 ? 137  TYR A CE1 1 
ATOM   1049 C CE2 . TYR A 1 134 ? 5.496   89.151 46.661 1.00 38.23 ? 137  TYR A CE2 1 
ATOM   1050 C CZ  . TYR A 1 134 ? 4.995   89.995 45.680 1.00 39.02 ? 137  TYR A CZ  1 
ATOM   1051 O OH  . TYR A 1 134 ? 5.548   91.243 45.515 1.00 40.44 ? 137  TYR A OH  1 
ATOM   1052 N N   . THR A 1 135 ? 6.178   84.834 45.818 1.00 35.32 ? 138  THR A N   1 
ATOM   1053 C CA  . THR A 1 135 ? 7.616   85.044 45.685 1.00 35.27 ? 138  THR A CA  1 
ATOM   1054 C C   . THR A 1 135 ? 8.273   84.284 44.537 1.00 35.61 ? 138  THR A C   1 
ATOM   1055 O O   . THR A 1 135 ? 9.095   84.842 43.814 1.00 35.71 ? 138  THR A O   1 
ATOM   1056 C CB  . THR A 1 135 ? 8.343   84.686 46.993 1.00 34.94 ? 138  THR A CB  1 
ATOM   1057 O OG1 . THR A 1 135 ? 7.794   85.463 48.061 1.00 34.28 ? 138  THR A OG1 1 
ATOM   1058 C CG2 . THR A 1 135 ? 9.830   84.986 46.881 1.00 34.73 ? 138  THR A CG2 1 
ATOM   1059 N N   . GLU A 1 136 ? 7.910   83.018 44.360 1.00 35.33 ? 139  GLU A N   1 
ATOM   1060 C CA  . GLU A 1 136 ? 8.508   82.218 43.300 1.00 35.17 ? 139  GLU A CA  1 
ATOM   1061 C C   . GLU A 1 136 ? 7.637   82.099 42.050 1.00 35.56 ? 139  GLU A C   1 
ATOM   1062 O O   . GLU A 1 136 ? 8.040   81.489 41.063 1.00 35.75 ? 139  GLU A O   1 
ATOM   1063 C CB  . GLU A 1 136 ? 8.852   80.829 43.834 1.00 34.50 ? 139  GLU A CB  1 
ATOM   1064 C CG  . GLU A 1 136 ? 9.940   80.829 44.897 1.00 34.73 ? 139  GLU A CG  1 
ATOM   1065 C CD  . GLU A 1 136 ? 11.284  81.299 44.369 1.00 35.16 ? 139  GLU A CD  1 
ATOM   1066 O OE1 . GLU A 1 136 ? 11.698  80.836 43.287 1.00 35.41 ? 139  GLU A OE1 1 
ATOM   1067 O OE2 . GLU A 1 136 ? 11.938  82.121 45.040 1.00 36.40 ? 139  GLU A OE2 1 
ATOM   1068 N N   . GLU A 1 137 ? 6.444   82.679 42.098 1.00 35.60 ? 140  GLU A N   1 
ATOM   1069 C CA  . GLU A 1 137 ? 5.532   82.644 40.961 1.00 35.93 ? 140  GLU A CA  1 
ATOM   1070 C C   . GLU A 1 137 ? 5.183   81.232 40.498 1.00 34.35 ? 140  GLU A C   1 
ATOM   1071 O O   . GLU A 1 137 ? 5.292   80.899 39.316 1.00 33.99 ? 140  GLU A O   1 
ATOM   1072 C CB  . GLU A 1 137 ? 6.120   83.445 39.798 1.00 38.28 ? 140  GLU A CB  1 
ATOM   1073 C CG  . GLU A 1 137 ? 6.386   84.894 40.159 1.00 42.68 ? 140  GLU A CG  1 
ATOM   1074 C CD  . GLU A 1 137 ? 6.840   85.721 38.975 1.00 44.94 ? 140  GLU A CD  1 
ATOM   1075 O OE1 . GLU A 1 137 ? 7.903   85.403 38.396 1.00 45.60 ? 140  GLU A OE1 1 
ATOM   1076 O OE2 . GLU A 1 137 ? 6.128   86.691 38.629 1.00 46.77 ? 140  GLU A OE2 1 
ATOM   1077 N N   . VAL A 1 138 ? 4.770   80.402 41.445 1.00 32.41 ? 141  VAL A N   1 
ATOM   1078 C CA  . VAL A 1 138 ? 4.368   79.043 41.134 1.00 30.39 ? 141  VAL A CA  1 
ATOM   1079 C C   . VAL A 1 138 ? 2.925   78.919 41.585 1.00 30.02 ? 141  VAL A C   1 
ATOM   1080 O O   . VAL A 1 138 ? 2.457   79.706 42.410 1.00 29.71 ? 141  VAL A O   1 
ATOM   1081 C CB  . VAL A 1 138 ? 5.208   77.990 41.907 1.00 30.56 ? 141  VAL A CB  1 
ATOM   1082 C CG1 . VAL A 1 138 ? 6.674   78.069 41.492 1.00 28.97 ? 141  VAL A CG1 1 
ATOM   1083 C CG2 . VAL A 1 138 ? 5.062   78.208 43.409 1.00 29.36 ? 141  VAL A CG2 1 
ATOM   1084 N N   . VAL A 1 139 ? 2.208   77.955 41.022 1.00 29.02 ? 142  VAL A N   1 
ATOM   1085 C CA  . VAL A 1 139 ? 0.841   77.720 41.444 1.00 27.94 ? 142  VAL A CA  1 
ATOM   1086 C C   . VAL A 1 139 ? 0.999   76.744 42.604 1.00 27.87 ? 142  VAL A C   1 
ATOM   1087 O O   . VAL A 1 139 ? 1.486   75.634 42.413 1.00 27.37 ? 142  VAL A O   1 
ATOM   1088 C CB  . VAL A 1 139 ? 0.007   77.069 40.328 1.00 27.91 ? 142  VAL A CB  1 
ATOM   1089 C CG1 . VAL A 1 139 ? -1.317  76.583 40.887 1.00 28.02 ? 142  VAL A CG1 1 
ATOM   1090 C CG2 . VAL A 1 139 ? -0.236  78.075 39.209 1.00 27.94 ? 142  VAL A CG2 1 
ATOM   1091 N N   . LEU A 1 140 ? 0.621   77.162 43.808 1.00 28.12 ? 143  LEU A N   1 
ATOM   1092 C CA  . LEU A 1 140 ? 0.758   76.293 44.971 1.00 27.92 ? 143  LEU A CA  1 
ATOM   1093 C C   . LEU A 1 140 ? -0.555  75.667 45.420 1.00 27.50 ? 143  LEU A C   1 
ATOM   1094 O O   . LEU A 1 140 ? -1.534  76.364 45.704 1.00 27.52 ? 143  LEU A O   1 
ATOM   1095 C CB  . LEU A 1 140 ? 1.373   77.051 46.150 1.00 28.47 ? 143  LEU A CB  1 
ATOM   1096 C CG  . LEU A 1 140 ? 1.785   76.059 47.242 1.00 29.98 ? 143  LEU A CG  1 
ATOM   1097 C CD1 . LEU A 1 140 ? 3.299   75.964 47.286 1.00 30.66 ? 143  LEU A CD1 1 
ATOM   1098 C CD2 . LEU A 1 140 ? 1.223   76.469 48.579 1.00 29.94 ? 143  LEU A CD2 1 
ATOM   1099 N N   . VAL A 1 141 ? -0.562  74.342 45.496 1.00 27.02 ? 144  VAL A N   1 
ATOM   1100 C CA  . VAL A 1 141 ? -1.748  73.609 45.915 1.00 26.07 ? 144  VAL A CA  1 
ATOM   1101 C C   . VAL A 1 141 ? -1.500  72.848 47.210 1.00 25.85 ? 144  VAL A C   1 
ATOM   1102 O O   . VAL A 1 141 ? -0.424  72.281 47.413 1.00 25.80 ? 144  VAL A O   1 
ATOM   1103 C CB  . VAL A 1 141 ? -2.171  72.559 44.856 1.00 26.64 ? 144  VAL A CB  1 
ATOM   1104 C CG1 . VAL A 1 141 ? -3.401  71.793 45.342 1.00 25.36 ? 144  VAL A CG1 1 
ATOM   1105 C CG2 . VAL A 1 141 ? -2.442  73.234 43.517 1.00 26.03 ? 144  VAL A CG2 1 
ATOM   1106 N N   . SER A 1 142 ? -2.487  72.855 48.095 1.00 25.21 ? 145  SER A N   1 
ATOM   1107 C CA  . SER A 1 142 ? -2.385  72.082 49.322 1.00 25.36 ? 145  SER A CA  1 
ATOM   1108 C C   . SER A 1 142 ? -3.628  71.202 49.344 1.00 24.76 ? 145  SER A C   1 
ATOM   1109 O O   . SER A 1 142 ? -4.758  71.692 49.258 1.00 24.01 ? 145  SER A O   1 
ATOM   1110 C CB  . SER A 1 142 ? -2.324  72.979 50.568 1.00 25.58 ? 145  SER A CB  1 
ATOM   1111 O OG  . SER A 1 142 ? -3.461  73.815 50.688 1.00 28.16 ? 145  SER A OG  1 
ATOM   1112 N N   . LEU A 1 143 ? -3.417  69.894 49.417 1.00 24.19 ? 146  LEU A N   1 
ATOM   1113 C CA  . LEU A 1 143 ? -4.533  68.956 49.442 1.00 23.47 ? 146  LEU A CA  1 
ATOM   1114 C C   . LEU A 1 143 ? -4.825  68.525 50.874 1.00 23.31 ? 146  LEU A C   1 
ATOM   1115 O O   . LEU A 1 143 ? -4.177  68.979 51.814 1.00 23.31 ? 146  LEU A O   1 
ATOM   1116 C CB  . LEU A 1 143 ? -4.205  67.733 48.571 1.00 22.31 ? 146  LEU A CB  1 
ATOM   1117 C CG  . LEU A 1 143 ? -2.862  67.017 48.784 1.00 21.93 ? 146  LEU A CG  1 
ATOM   1118 C CD1 . LEU A 1 143 ? -2.851  66.278 50.127 1.00 21.41 ? 146  LEU A CD1 1 
ATOM   1119 C CD2 . LEU A 1 143 ? -2.634  66.023 47.639 1.00 20.95 ? 146  LEU A CD2 1 
ATOM   1120 N N   . SER A 1 144 ? -5.813  67.655 51.037 1.00 23.59 ? 147  SER A N   1 
ATOM   1121 C CA  . SER A 1 144 ? -6.162  67.149 52.352 1.00 23.96 ? 147  SER A CA  1 
ATOM   1122 C C   . SER A 1 144 ? -6.474  65.673 52.190 1.00 23.86 ? 147  SER A C   1 
ATOM   1123 O O   . SER A 1 144 ? -6.662  65.194 51.075 1.00 24.47 ? 147  SER A O   1 
ATOM   1124 C CB  . SER A 1 144 ? -7.377  67.889 52.921 1.00 24.33 ? 147  SER A CB  1 
ATOM   1125 O OG  . SER A 1 144 ? -8.553  67.619 52.175 1.00 25.97 ? 147  SER A OG  1 
ATOM   1126 N N   . TYR A 1 145 ? -6.498  64.946 53.299 1.00 23.81 ? 148  TYR A N   1 
ATOM   1127 C CA  . TYR A 1 145 ? -6.797  63.526 53.256 1.00 23.22 ? 148  TYR A CA  1 
ATOM   1128 C C   . TYR A 1 145 ? -7.216  63.031 54.627 1.00 22.79 ? 148  TYR A C   1 
ATOM   1129 O O   . TYR A 1 145 ? -6.810  63.585 55.649 1.00 23.43 ? 148  TYR A O   1 
ATOM   1130 C CB  . TYR A 1 145 ? -5.591  62.724 52.749 1.00 23.26 ? 148  TYR A CB  1 
ATOM   1131 C CG  . TYR A 1 145 ? -4.333  62.873 53.579 1.00 23.97 ? 148  TYR A CG  1 
ATOM   1132 C CD1 . TYR A 1 145 ? -3.481  63.970 53.404 1.00 23.54 ? 148  TYR A CD1 1 
ATOM   1133 C CD2 . TYR A 1 145 ? -3.996  61.921 54.544 1.00 24.01 ? 148  TYR A CD2 1 
ATOM   1134 C CE1 . TYR A 1 145 ? -2.321  64.116 54.170 1.00 23.70 ? 148  TYR A CE1 1 
ATOM   1135 C CE2 . TYR A 1 145 ? -2.837  62.058 55.320 1.00 24.57 ? 148  TYR A CE2 1 
ATOM   1136 C CZ  . TYR A 1 145 ? -2.006  63.158 55.127 1.00 24.51 ? 148  TYR A CZ  1 
ATOM   1137 O OH  . TYR A 1 145 ? -0.871  63.301 55.896 1.00 24.36 ? 148  TYR A OH  1 
ATOM   1138 N N   . ARG A 1 146 ? -8.048  61.998 54.644 1.00 22.44 ? 149  ARG A N   1 
ATOM   1139 C CA  . ARG A 1 146 ? -8.516  61.431 55.901 1.00 22.38 ? 149  ARG A CA  1 
ATOM   1140 C C   . ARG A 1 146 ? -7.351  60.843 56.685 1.00 22.33 ? 149  ARG A C   1 
ATOM   1141 O O   . ARG A 1 146 ? -6.463  60.203 56.113 1.00 21.90 ? 149  ARG A O   1 
ATOM   1142 C CB  . ARG A 1 146 ? -9.548  60.333 55.642 1.00 21.95 ? 149  ARG A CB  1 
ATOM   1143 C CG  . ARG A 1 146 ? -10.909 60.832 55.187 1.00 21.26 ? 149  ARG A CG  1 
ATOM   1144 C CD  . ARG A 1 146 ? -11.772 59.668 54.699 1.00 20.71 ? 149  ARG A CD  1 
ATOM   1145 N NE  . ARG A 1 146 ? -11.431 59.265 53.334 1.00 20.92 ? 149  ARG A NE  1 
ATOM   1146 C CZ  . ARG A 1 146 ? -11.958 58.213 52.714 1.00 22.22 ? 149  ARG A CZ  1 
ATOM   1147 N NH1 . ARG A 1 146 ? -12.849 57.450 53.344 1.00 22.33 ? 149  ARG A NH1 1 
ATOM   1148 N NH2 . ARG A 1 146 ? -11.609 57.928 51.463 1.00 21.51 ? 149  ARG A NH2 1 
ATOM   1149 N N   . VAL A 1 147 ? -7.363  61.070 57.995 1.00 21.82 ? 150  VAL A N   1 
ATOM   1150 C CA  . VAL A 1 147 ? -6.331  60.554 58.875 1.00 22.10 ? 150  VAL A CA  1 
ATOM   1151 C C   . VAL A 1 147 ? -6.973  59.659 59.933 1.00 22.60 ? 150  VAL A C   1 
ATOM   1152 O O   . VAL A 1 147 ? -8.204  59.533 60.001 1.00 21.81 ? 150  VAL A O   1 
ATOM   1153 C CB  . VAL A 1 147 ? -5.558  61.700 59.579 1.00 22.27 ? 150  VAL A CB  1 
ATOM   1154 C CG1 . VAL A 1 147 ? -4.784  62.503 58.554 1.00 21.83 ? 150  VAL A CG1 1 
ATOM   1155 C CG2 . VAL A 1 147 ? -6.521  62.601 60.343 1.00 21.51 ? 150  VAL A CG2 1 
ATOM   1156 N N   . GLY A 1 148 ? -6.134  59.041 60.758 1.00 22.50 ? 151  GLY A N   1 
ATOM   1157 C CA  . GLY A 1 148 ? -6.642  58.164 61.793 1.00 23.49 ? 151  GLY A CA  1 
ATOM   1158 C C   . GLY A 1 148 ? -7.384  56.987 61.190 1.00 24.11 ? 151  GLY A C   1 
ATOM   1159 O O   . GLY A 1 148 ? -7.167  56.632 60.026 1.00 23.96 ? 151  GLY A O   1 
ATOM   1160 N N   . ALA A 1 149 ? -8.263  56.378 61.979 1.00 24.40 ? 152  ALA A N   1 
ATOM   1161 C CA  . ALA A 1 149 ? -9.038  55.233 61.516 1.00 24.26 ? 152  ALA A CA  1 
ATOM   1162 C C   . ALA A 1 149 ? -9.809  55.598 60.250 1.00 24.34 ? 152  ALA A C   1 
ATOM   1163 O O   . ALA A 1 149 ? -9.928  54.792 59.325 1.00 24.59 ? 152  ALA A O   1 
ATOM   1164 C CB  . ALA A 1 149 ? -10.007 54.789 62.608 1.00 23.73 ? 152  ALA A CB  1 
ATOM   1165 N N   . PHE A 1 150 ? -10.320 56.824 60.217 1.00 23.96 ? 153  PHE A N   1 
ATOM   1166 C CA  . PHE A 1 150 ? -11.096 57.310 59.081 1.00 24.43 ? 153  PHE A CA  1 
ATOM   1167 C C   . PHE A 1 150 ? -10.370 57.143 57.760 1.00 23.69 ? 153  PHE A C   1 
ATOM   1168 O O   . PHE A 1 150 ? -10.991 56.883 56.732 1.00 23.26 ? 153  PHE A O   1 
ATOM   1169 C CB  . PHE A 1 150 ? -11.452 58.783 59.298 1.00 25.25 ? 153  PHE A CB  1 
ATOM   1170 C CG  . PHE A 1 150 ? -12.200 59.029 60.576 1.00 26.92 ? 153  PHE A CG  1 
ATOM   1171 C CD1 . PHE A 1 150 ? -13.568 58.758 60.662 1.00 27.37 ? 153  PHE A CD1 1 
ATOM   1172 C CD2 . PHE A 1 150 ? -11.529 59.471 61.714 1.00 25.91 ? 153  PHE A CD2 1 
ATOM   1173 C CE1 . PHE A 1 150 ? -14.258 58.920 61.864 1.00 27.48 ? 153  PHE A CE1 1 
ATOM   1174 C CE2 . PHE A 1 150 ? -12.203 59.638 62.920 1.00 27.06 ? 153  PHE A CE2 1 
ATOM   1175 C CZ  . PHE A 1 150 ? -13.571 59.361 62.999 1.00 28.17 ? 153  PHE A CZ  1 
ATOM   1176 N N   . GLY A 1 151 ? -9.050  57.275 57.787 1.00 23.38 ? 154  GLY A N   1 
ATOM   1177 C CA  . GLY A 1 151 ? -8.302  57.146 56.555 1.00 23.30 ? 154  GLY A CA  1 
ATOM   1178 C C   . GLY A 1 151 ? -7.432  55.914 56.452 1.00 23.45 ? 154  GLY A C   1 
ATOM   1179 O O   . GLY A 1 151 ? -6.982  55.564 55.358 1.00 23.32 ? 154  GLY A O   1 
ATOM   1180 N N   . PHE A 1 152 ? -7.207  55.227 57.566 1.00 23.08 ? 155  PHE A N   1 
ATOM   1181 C CA  . PHE A 1 152 ? -6.337  54.073 57.506 1.00 23.59 ? 155  PHE A CA  1 
ATOM   1182 C C   . PHE A 1 152 ? -6.762  52.789 58.211 1.00 23.83 ? 155  PHE A C   1 
ATOM   1183 O O   . PHE A 1 152 ? -5.950  51.880 58.368 1.00 23.59 ? 155  PHE A O   1 
ATOM   1184 C CB  . PHE A 1 152 ? -4.943  54.506 57.961 1.00 23.21 ? 155  PHE A CB  1 
ATOM   1185 C CG  . PHE A 1 152 ? -4.342  55.563 57.090 1.00 22.44 ? 155  PHE A CG  1 
ATOM   1186 C CD1 . PHE A 1 152 ? -3.753  55.227 55.873 1.00 23.17 ? 155  PHE A CD1 1 
ATOM   1187 C CD2 . PHE A 1 152 ? -4.427  56.903 57.445 1.00 23.18 ? 155  PHE A CD2 1 
ATOM   1188 C CE1 . PHE A 1 152 ? -3.259  56.212 55.019 1.00 23.48 ? 155  PHE A CE1 1 
ATOM   1189 C CE2 . PHE A 1 152 ? -3.936  57.901 56.597 1.00 23.65 ? 155  PHE A CE2 1 
ATOM   1190 C CZ  . PHE A 1 152 ? -3.351  57.552 55.379 1.00 23.18 ? 155  PHE A CZ  1 
ATOM   1191 N N   . LEU A 1 153 ? -8.018  52.697 58.636 1.00 24.93 ? 156  LEU A N   1 
ATOM   1192 C CA  . LEU A 1 153 ? -8.474  51.464 59.271 1.00 26.62 ? 156  LEU A CA  1 
ATOM   1193 C C   . LEU A 1 153 ? -8.325  50.417 58.174 1.00 27.58 ? 156  LEU A C   1 
ATOM   1194 O O   . LEU A 1 153 ? -8.842  50.606 57.077 1.00 27.96 ? 156  LEU A O   1 
ATOM   1195 C CB  . LEU A 1 153 ? -9.940  51.563 59.679 1.00 27.20 ? 156  LEU A CB  1 
ATOM   1196 C CG  . LEU A 1 153 ? -10.455 50.280 60.340 1.00 27.57 ? 156  LEU A CG  1 
ATOM   1197 C CD1 . LEU A 1 153 ? -10.240 50.373 61.842 1.00 27.57 ? 156  LEU A CD1 1 
ATOM   1198 C CD2 . LEU A 1 153 ? -11.936 50.084 60.030 1.00 27.82 ? 156  LEU A CD2 1 
ATOM   1199 N N   . ALA A 1 154 ? -7.635  49.316 58.456 1.00 28.29 ? 157  ALA A N   1 
ATOM   1200 C CA  . ALA A 1 154 ? -7.415  48.305 57.426 1.00 29.69 ? 157  ALA A CA  1 
ATOM   1201 C C   . ALA A 1 154 ? -7.880  46.884 57.731 1.00 31.01 ? 157  ALA A C   1 
ATOM   1202 O O   . ALA A 1 154 ? -7.335  46.208 58.605 1.00 31.60 ? 157  ALA A O   1 
ATOM   1203 C CB  . ALA A 1 154 ? -5.933  48.281 57.048 1.00 27.89 ? 157  ALA A CB  1 
ATOM   1204 N N   . LEU A 1 155 ? -8.883  46.432 56.990 1.00 31.90 ? 158  LEU A N   1 
ATOM   1205 C CA  . LEU A 1 155 ? -9.404  45.078 57.138 1.00 33.65 ? 158  LEU A CA  1 
ATOM   1206 C C   . LEU A 1 155 ? -9.230  44.420 55.777 1.00 34.79 ? 158  LEU A C   1 
ATOM   1207 O O   . LEU A 1 155 ? -10.191 44.235 55.035 1.00 35.22 ? 158  LEU A O   1 
ATOM   1208 C CB  . LEU A 1 155 ? -10.881 45.110 57.549 1.00 32.90 ? 158  LEU A CB  1 
ATOM   1209 C CG  . LEU A 1 155 ? -11.122 45.450 59.027 1.00 32.84 ? 158  LEU A CG  1 
ATOM   1210 C CD1 . LEU A 1 155 ? -12.599 45.671 59.295 1.00 31.52 ? 158  LEU A CD1 1 
ATOM   1211 C CD2 . LEU A 1 155 ? -10.574 44.315 59.896 1.00 31.55 ? 158  LEU A CD2 1 
ATOM   1212 N N   . HIS A 1 156 ? -7.982  44.092 55.456 1.00 36.68 ? 159  HIS A N   1 
ATOM   1213 C CA  . HIS A 1 156 ? -7.634  43.489 54.176 1.00 38.45 ? 159  HIS A CA  1 
ATOM   1214 C C   . HIS A 1 156 ? -8.545  42.332 53.829 1.00 39.98 ? 159  HIS A C   1 
ATOM   1215 O O   . HIS A 1 156 ? -8.766  41.430 54.641 1.00 40.82 ? 159  HIS A O   1 
ATOM   1216 C CB  . HIS A 1 156 ? -6.184  43.009 54.183 1.00 38.50 ? 159  HIS A CB  1 
ATOM   1217 C CG  . HIS A 1 156 ? -5.677  42.617 52.829 1.00 39.80 ? 159  HIS A CG  1 
ATOM   1218 N ND1 . HIS A 1 156 ? -5.599  43.508 51.779 1.00 39.55 ? 159  HIS A ND1 1 
ATOM   1219 C CD2 . HIS A 1 156 ? -5.234  41.430 52.350 1.00 39.70 ? 159  HIS A CD2 1 
ATOM   1220 C CE1 . HIS A 1 156 ? -5.131  42.886 50.711 1.00 39.74 ? 159  HIS A CE1 1 
ATOM   1221 N NE2 . HIS A 1 156 ? -4.902  41.624 51.031 1.00 40.56 ? 159  HIS A NE2 1 
ATOM   1222 N N   . GLY A 1 157 ? -9.070  42.366 52.610 1.00 41.07 ? 160  GLY A N   1 
ATOM   1223 C CA  . GLY A 1 157 ? -9.972  41.327 52.160 1.00 41.57 ? 160  GLY A CA  1 
ATOM   1224 C C   . GLY A 1 157 ? -11.334 41.929 51.899 1.00 42.10 ? 160  GLY A C   1 
ATOM   1225 O O   . GLY A 1 157 ? -12.027 41.533 50.963 1.00 42.31 ? 160  GLY A O   1 
ATOM   1226 N N   . SER A 1 158 ? -11.719 42.898 52.725 1.00 42.65 ? 161  SER A N   1 
ATOM   1227 C CA  . SER A 1 158 ? -13.010 43.554 52.565 1.00 43.31 ? 161  SER A CA  1 
ATOM   1228 C C   . SER A 1 158 ? -12.833 44.786 51.697 1.00 43.49 ? 161  SER A C   1 
ATOM   1229 O O   . SER A 1 158 ? -11.751 45.375 51.651 1.00 43.98 ? 161  SER A O   1 
ATOM   1230 C CB  . SER A 1 158 ? -13.577 43.978 53.920 1.00 43.86 ? 161  SER A CB  1 
ATOM   1231 O OG  . SER A 1 158 ? -13.023 45.213 54.337 1.00 45.44 ? 161  SER A OG  1 
ATOM   1232 N N   . GLN A 1 159 ? -13.897 45.172 51.005 1.00 43.27 ? 162  GLN A N   1 
ATOM   1233 C CA  . GLN A 1 159 ? -13.849 46.344 50.150 1.00 43.12 ? 162  GLN A CA  1 
ATOM   1234 C C   . GLN A 1 159 ? -14.536 47.508 50.849 1.00 41.86 ? 162  GLN A C   1 
ATOM   1235 O O   . GLN A 1 159 ? -14.631 48.607 50.304 1.00 41.46 ? 162  GLN A O   1 
ATOM   1236 C CB  . GLN A 1 159 ? -14.519 46.045 48.807 1.00 45.18 ? 162  GLN A CB  1 
ATOM   1237 C CG  . GLN A 1 159 ? -13.763 45.027 47.951 1.00 47.37 ? 162  GLN A CG  1 
ATOM   1238 C CD  . GLN A 1 159 ? -12.306 45.419 47.722 1.00 49.37 ? 162  GLN A CD  1 
ATOM   1239 O OE1 . GLN A 1 159 ? -12.006 46.562 47.363 1.00 50.00 ? 162  GLN A OE1 1 
ATOM   1240 N NE2 . GLN A 1 159 ? -11.395 44.466 47.922 1.00 49.92 ? 162  GLN A NE2 1 
ATOM   1241 N N   . GLU A 1 160 ? -15.005 47.256 52.067 1.00 40.98 ? 163  GLU A N   1 
ATOM   1242 C CA  . GLU A 1 160 ? -15.674 48.272 52.868 1.00 40.31 ? 163  GLU A CA  1 
ATOM   1243 C C   . GLU A 1 160 ? -14.672 49.060 53.710 1.00 39.03 ? 163  GLU A C   1 
ATOM   1244 O O   . GLU A 1 160 ? -14.920 50.211 54.063 1.00 39.22 ? 163  GLU A O   1 
ATOM   1245 C CB  . GLU A 1 160 ? -16.717 47.623 53.775 1.00 42.17 ? 163  GLU A CB  1 
ATOM   1246 C CG  . GLU A 1 160 ? -17.884 47.025 53.020 1.00 44.21 ? 163  GLU A CG  1 
ATOM   1247 C CD  . GLU A 1 160 ? -18.516 48.027 52.076 1.00 45.87 ? 163  GLU A CD  1 
ATOM   1248 O OE1 . GLU A 1 160 ? -18.882 49.129 52.539 1.00 46.80 ? 163  GLU A OE1 1 
ATOM   1249 O OE2 . GLU A 1 160 ? -18.643 47.716 50.871 1.00 46.89 ? 163  GLU A OE2 1 
ATOM   1250 N N   . ALA A 1 161 ? -13.549 48.425 54.033 1.00 37.17 ? 164  ALA A N   1 
ATOM   1251 C CA  . ALA A 1 161 ? -12.485 49.055 54.814 1.00 36.36 ? 164  ALA A CA  1 
ATOM   1252 C C   . ALA A 1 161 ? -11.177 48.381 54.404 1.00 35.15 ? 164  ALA A C   1 
ATOM   1253 O O   . ALA A 1 161 ? -10.553 47.668 55.196 1.00 36.25 ? 164  ALA A O   1 
ATOM   1254 C CB  . ALA A 1 161 ? -12.739 48.869 56.316 1.00 35.40 ? 164  ALA A CB  1 
ATOM   1255 N N   . PRO A 1 162 ? -10.749 48.601 53.151 1.00 33.36 ? 165  PRO A N   1 
ATOM   1256 C CA  . PRO A 1 162 ? -9.528  48.038 52.569 1.00 32.19 ? 165  PRO A CA  1 
ATOM   1257 C C   . PRO A 1 162 ? -8.217  48.579 53.120 1.00 31.52 ? 165  PRO A C   1 
ATOM   1258 O O   . PRO A 1 162 ? -7.191  47.903 53.049 1.00 31.84 ? 165  PRO A O   1 
ATOM   1259 C CB  . PRO A 1 162 ? -9.683  48.360 51.087 1.00 31.72 ? 165  PRO A CB  1 
ATOM   1260 C CG  . PRO A 1 162 ? -10.347 49.697 51.132 1.00 31.76 ? 165  PRO A CG  1 
ATOM   1261 C CD  . PRO A 1 162 ? -11.417 49.492 52.183 1.00 32.29 ? 165  PRO A CD  1 
ATOM   1262 N N   . GLY A 1 163 ? -8.252  49.794 53.659 1.00 30.11 ? 166  GLY A N   1 
ATOM   1263 C CA  . GLY A 1 163 ? -7.040  50.407 54.170 1.00 29.07 ? 166  GLY A CA  1 
ATOM   1264 C C   . GLY A 1 163 ? -6.458  51.330 53.110 1.00 28.56 ? 166  GLY A C   1 
ATOM   1265 O O   . GLY A 1 163 ? -6.859  51.276 51.946 1.00 28.09 ? 166  GLY A O   1 
ATOM   1266 N N   . ASN A 1 164 ? -5.522  52.184 53.514 1.00 27.77 ? 167  ASN A N   1 
ATOM   1267 C CA  . ASN A 1 164 ? -4.869  53.129 52.611 1.00 27.37 ? 167  ASN A CA  1 
ATOM   1268 C C   . ASN A 1 164 ? -5.790  54.131 51.918 1.00 26.77 ? 167  ASN A C   1 
ATOM   1269 O O   . ASN A 1 164 ? -5.353  54.819 51.000 1.00 26.40 ? 167  ASN A O   1 
ATOM   1270 C CB  . ASN A 1 164 ? -4.082  52.386 51.523 1.00 27.91 ? 167  ASN A CB  1 
ATOM   1271 C CG  . ASN A 1 164 ? -2.958  51.542 52.082 1.00 28.64 ? 167  ASN A CG  1 
ATOM   1272 O OD1 . ASN A 1 164 ? -2.330  51.905 53.077 1.00 28.35 ? 167  ASN A OD1 1 
ATOM   1273 N ND2 . ASN A 1 164 ? -2.685  50.411 51.433 1.00 27.40 ? 167  ASN A ND2 1 
ATOM   1274 N N   . VAL A 1 165 ? -7.046  54.243 52.343 1.00 26.54 ? 168  VAL A N   1 
ATOM   1275 C CA  . VAL A 1 165 ? -7.941  55.171 51.656 1.00 25.86 ? 168  VAL A CA  1 
ATOM   1276 C C   . VAL A 1 165 ? -7.483  56.613 51.795 1.00 25.13 ? 168  VAL A C   1 
ATOM   1277 O O   . VAL A 1 165 ? -7.773  57.452 50.941 1.00 25.35 ? 168  VAL A O   1 
ATOM   1278 C CB  . VAL A 1 165 ? -9.429  54.997 52.111 1.00 26.17 ? 168  VAL A CB  1 
ATOM   1279 C CG1 . VAL A 1 165 ? -9.858  53.551 51.872 1.00 25.26 ? 168  VAL A CG1 1 
ATOM   1280 C CG2 . VAL A 1 165 ? -9.615  55.380 53.573 1.00 25.07 ? 168  VAL A CG2 1 
ATOM   1281 N N   . GLY A 1 166 ? -6.740  56.895 52.859 1.00 25.43 ? 169  GLY A N   1 
ATOM   1282 C CA  . GLY A 1 166 ? -6.218  58.235 53.053 1.00 24.26 ? 169  GLY A CA  1 
ATOM   1283 C C   . GLY A 1 166 ? -5.206  58.531 51.956 1.00 24.02 ? 169  GLY A C   1 
ATOM   1284 O O   . GLY A 1 166 ? -5.092  59.665 51.494 1.00 24.00 ? 169  GLY A O   1 
ATOM   1285 N N   . LEU A 1 167 ? -4.466  57.507 51.536 1.00 23.48 ? 170  LEU A N   1 
ATOM   1286 C CA  . LEU A 1 167 ? -3.477  57.671 50.473 1.00 23.35 ? 170  LEU A CA  1 
ATOM   1287 C C   . LEU A 1 167 ? -4.197  57.856 49.141 1.00 23.76 ? 170  LEU A C   1 
ATOM   1288 O O   . LEU A 1 167 ? -3.711  58.573 48.258 1.00 23.86 ? 170  LEU A O   1 
ATOM   1289 C CB  . LEU A 1 167 ? -2.550  56.454 50.399 1.00 21.72 ? 170  LEU A CB  1 
ATOM   1290 C CG  . LEU A 1 167 ? -1.458  56.357 51.468 1.00 21.94 ? 170  LEU A CG  1 
ATOM   1291 C CD1 . LEU A 1 167 ? -0.747  55.014 51.383 1.00 19.73 ? 170  LEU A CD1 1 
ATOM   1292 C CD2 . LEU A 1 167 ? -0.462  57.496 51.268 1.00 21.23 ? 170  LEU A CD2 1 
ATOM   1293 N N   . LEU A 1 168 ? -5.351  57.204 49.002 1.00 23.39 ? 171  LEU A N   1 
ATOM   1294 C CA  . LEU A 1 168 ? -6.155  57.311 47.788 1.00 24.07 ? 171  LEU A CA  1 
ATOM   1295 C C   . LEU A 1 168 ? -6.809  58.700 47.720 1.00 24.63 ? 171  LEU A C   1 
ATOM   1296 O O   . LEU A 1 168 ? -7.071  59.207 46.628 1.00 23.77 ? 171  LEU A O   1 
ATOM   1297 C CB  . LEU A 1 168 ? -7.218  56.207 47.749 1.00 24.03 ? 171  LEU A CB  1 
ATOM   1298 C CG  . LEU A 1 168 ? -6.651  54.789 47.598 1.00 24.29 ? 171  LEU A CG  1 
ATOM   1299 C CD1 . LEU A 1 168 ? -7.779  53.768 47.641 1.00 24.00 ? 171  LEU A CD1 1 
ATOM   1300 C CD2 . LEU A 1 168 ? -5.886  54.679 46.278 1.00 24.22 ? 171  LEU A CD2 1 
ATOM   1301 N N   . ASP A 1 169 ? -7.077  59.306 48.881 1.00 25.01 ? 172  ASP A N   1 
ATOM   1302 C CA  . ASP A 1 169 ? -7.630  60.664 48.919 1.00 24.68 ? 172  ASP A CA  1 
ATOM   1303 C C   . ASP A 1 169 ? -6.573  61.567 48.278 1.00 24.28 ? 172  ASP A C   1 
ATOM   1304 O O   . ASP A 1 169 ? -6.878  62.405 47.428 1.00 24.72 ? 172  ASP A O   1 
ATOM   1305 C CB  . ASP A 1 169 ? -7.849  61.157 50.358 1.00 25.14 ? 172  ASP A CB  1 
ATOM   1306 C CG  . ASP A 1 169 ? -8.967  60.431 51.079 1.00 26.24 ? 172  ASP A CG  1 
ATOM   1307 O OD1 . ASP A 1 169 ? -9.820  59.811 50.407 1.00 25.28 ? 172  ASP A OD1 1 
ATOM   1308 O OD2 . ASP A 1 169 ? -8.997  60.501 52.334 1.00 27.19 ? 172  ASP A OD2 1 
ATOM   1309 N N   . GLN A 1 170 ? -5.325  61.390 48.704 1.00 23.87 ? 173  GLN A N   1 
ATOM   1310 C CA  . GLN A 1 170 ? -4.212  62.184 48.184 1.00 23.94 ? 173  GLN A CA  1 
ATOM   1311 C C   . GLN A 1 170 ? -4.092  62.018 46.679 1.00 24.15 ? 173  GLN A C   1 
ATOM   1312 O O   . GLN A 1 170 ? -3.930  62.994 45.946 1.00 25.15 ? 173  GLN A O   1 
ATOM   1313 C CB  . GLN A 1 170 ? -2.894  61.763 48.843 1.00 23.14 ? 173  GLN A CB  1 
ATOM   1314 C CG  . GLN A 1 170 ? -2.771  62.107 50.318 1.00 22.82 ? 173  GLN A CG  1 
ATOM   1315 C CD  . GLN A 1 170 ? -1.509  61.516 50.935 1.00 24.08 ? 173  GLN A CD  1 
ATOM   1316 O OE1 . GLN A 1 170 ? -0.562  61.173 50.220 1.00 24.18 ? 173  GLN A OE1 1 
ATOM   1317 N NE2 . GLN A 1 170 ? -1.486  61.404 52.263 1.00 22.51 ? 173  GLN A NE2 1 
ATOM   1318 N N   . ARG A 1 171 ? -4.175  60.775 46.221 1.00 24.67 ? 174  ARG A N   1 
ATOM   1319 C CA  . ARG A 1 171 ? -4.074  60.482 44.795 1.00 24.93 ? 174  ARG A CA  1 
ATOM   1320 C C   . ARG A 1 171 ? -5.191  61.171 44.010 1.00 24.76 ? 174  ARG A C   1 
ATOM   1321 O O   . ARG A 1 171 ? -4.944  61.765 42.964 1.00 24.99 ? 174  ARG A O   1 
ATOM   1322 C CB  . ARG A 1 171 ? -4.133  58.965 44.554 1.00 24.05 ? 174  ARG A CB  1 
ATOM   1323 C CG  . ARG A 1 171 ? -4.049  58.566 43.082 1.00 24.93 ? 174  ARG A CG  1 
ATOM   1324 C CD  . ARG A 1 171 ? -4.232  57.067 42.888 1.00 24.91 ? 174  ARG A CD  1 
ATOM   1325 N NE  . ARG A 1 171 ? -3.086  56.296 43.361 1.00 24.14 ? 174  ARG A NE  1 
ATOM   1326 C CZ  . ARG A 1 171 ? -3.072  54.969 43.465 1.00 25.05 ? 174  ARG A CZ  1 
ATOM   1327 N NH1 . ARG A 1 171 ? -4.144  54.261 43.133 1.00 24.46 ? 174  ARG A NH1 1 
ATOM   1328 N NH2 . ARG A 1 171 ? -1.981  54.343 43.887 1.00 25.43 ? 174  ARG A NH2 1 
ATOM   1329 N N   . MET A 1 172 ? -6.419  61.096 44.511 1.00 25.55 ? 175  MET A N   1 
ATOM   1330 C CA  . MET A 1 172 ? -7.532  61.720 43.810 1.00 26.61 ? 175  MET A CA  1 
ATOM   1331 C C   . MET A 1 172 ? -7.332  63.227 43.689 1.00 26.29 ? 175  MET A C   1 
ATOM   1332 O O   . MET A 1 172 ? -7.729  63.830 42.695 1.00 26.29 ? 175  MET A O   1 
ATOM   1333 C CB  . MET A 1 172 ? -8.857  61.413 44.508 1.00 27.69 ? 175  MET A CB  1 
ATOM   1334 C CG  . MET A 1 172 ? -10.071 61.808 43.678 1.00 30.51 ? 175  MET A CG  1 
ATOM   1335 S SD  . MET A 1 172 ? -11.545 60.841 44.062 1.00 33.75 ? 175  MET A SD  1 
ATOM   1336 C CE  . MET A 1 172 ? -11.776 61.294 45.633 1.00 33.53 ? 175  MET A CE  1 
ATOM   1337 N N   . ALA A 1 173 ? -6.714  63.833 44.699 1.00 26.37 ? 176  ALA A N   1 
ATOM   1338 C CA  . ALA A 1 173 ? -6.447  65.265 44.665 1.00 26.04 ? 176  ALA A CA  1 
ATOM   1339 C C   . ALA A 1 173 ? -5.390  65.501 43.585 1.00 26.00 ? 176  ALA A C   1 
ATOM   1340 O O   . ALA A 1 173 ? -5.447  66.484 42.839 1.00 25.78 ? 176  ALA A O   1 
ATOM   1341 C CB  . ALA A 1 173 ? -5.943  65.743 46.024 1.00 25.86 ? 176  ALA A CB  1 
ATOM   1342 N N   . LEU A 1 174 ? -4.429  64.587 43.495 1.00 25.75 ? 177  LEU A N   1 
ATOM   1343 C CA  . LEU A 1 174 ? -3.380  64.701 42.486 1.00 26.17 ? 177  LEU A CA  1 
ATOM   1344 C C   . LEU A 1 174 ? -3.983  64.495 41.094 1.00 25.99 ? 177  LEU A C   1 
ATOM   1345 O O   . LEU A 1 174 ? -3.536  65.093 40.117 1.00 25.88 ? 177  LEU A O   1 
ATOM   1346 C CB  . LEU A 1 174 ? -2.271  63.669 42.739 1.00 25.26 ? 177  LEU A CB  1 
ATOM   1347 C CG  . LEU A 1 174 ? -1.403  63.887 43.981 1.00 26.24 ? 177  LEU A CG  1 
ATOM   1348 C CD1 . LEU A 1 174 ? -0.320  62.813 44.045 1.00 26.07 ? 177  LEU A CD1 1 
ATOM   1349 C CD2 . LEU A 1 174 ? -0.770  65.279 43.935 1.00 25.68 ? 177  LEU A CD2 1 
ATOM   1350 N N   . GLN A 1 175 ? -4.997  63.638 41.011 1.00 26.53 ? 178  GLN A N   1 
ATOM   1351 C CA  . GLN A 1 175 ? -5.665  63.377 39.737 1.00 26.75 ? 178  GLN A CA  1 
ATOM   1352 C C   . GLN A 1 175 ? -6.409  64.641 39.319 1.00 26.55 ? 178  GLN A C   1 
ATOM   1353 O O   . GLN A 1 175 ? -6.420  65.000 38.145 1.00 26.46 ? 178  GLN A O   1 
ATOM   1354 C CB  . GLN A 1 175 ? -6.665  62.221 39.872 1.00 26.93 ? 178  GLN A CB  1 
ATOM   1355 C CG  . GLN A 1 175 ? -7.369  61.851 38.566 1.00 27.40 ? 178  GLN A CG  1 
ATOM   1356 C CD  . GLN A 1 175 ? -6.415  61.264 37.543 1.00 28.95 ? 178  GLN A CD  1 
ATOM   1357 O OE1 . GLN A 1 175 ? -5.817  60.215 37.772 1.00 29.66 ? 178  GLN A OE1 1 
ATOM   1358 N NE2 . GLN A 1 175 ? -6.264  61.942 36.409 1.00 28.88 ? 178  GLN A NE2 1 
ATOM   1359 N N   . TRP A 1 176 ? -7.026  65.311 40.289 1.00 25.82 ? 179  TRP A N   1 
ATOM   1360 C CA  . TRP A 1 176 ? -7.775  66.532 40.012 1.00 26.29 ? 179  TRP A CA  1 
ATOM   1361 C C   . TRP A 1 176 ? -6.832  67.629 39.517 1.00 27.11 ? 179  TRP A C   1 
ATOM   1362 O O   . TRP A 1 176 ? -7.150  68.348 38.564 1.00 27.08 ? 179  TRP A O   1 
ATOM   1363 C CB  . TRP A 1 176 ? -8.505  67.006 41.265 1.00 24.48 ? 179  TRP A CB  1 
ATOM   1364 C CG  . TRP A 1 176 ? -9.589  67.988 40.975 1.00 25.72 ? 179  TRP A CG  1 
ATOM   1365 C CD1 . TRP A 1 176 ? -10.901 67.709 40.720 1.00 24.49 ? 179  TRP A CD1 1 
ATOM   1366 C CD2 . TRP A 1 176 ? -9.459  69.415 40.897 1.00 25.47 ? 179  TRP A CD2 1 
ATOM   1367 N NE1 . TRP A 1 176 ? -11.596 68.871 40.494 1.00 24.60 ? 179  TRP A NE1 1 
ATOM   1368 C CE2 . TRP A 1 176 ? -10.737 69.934 40.596 1.00 25.22 ? 179  TRP A CE2 1 
ATOM   1369 C CE3 . TRP A 1 176 ? -8.386  70.304 41.052 1.00 26.07 ? 179  TRP A CE3 1 
ATOM   1370 C CZ2 . TRP A 1 176 ? -10.976 71.308 40.449 1.00 25.41 ? 179  TRP A CZ2 1 
ATOM   1371 C CZ3 . TRP A 1 176 ? -8.623  71.677 40.904 1.00 26.59 ? 179  TRP A CZ3 1 
ATOM   1372 C CH2 . TRP A 1 176 ? -9.910  72.161 40.606 1.00 25.97 ? 179  TRP A CH2 1 
ATOM   1373 N N   . VAL A 1 177 ? -5.674  67.758 40.168 1.00 27.41 ? 180  VAL A N   1 
ATOM   1374 C CA  . VAL A 1 177 ? -4.681  68.754 39.771 1.00 27.61 ? 180  VAL A CA  1 
ATOM   1375 C C   . VAL A 1 177 ? -4.224  68.444 38.346 1.00 28.04 ? 180  VAL A C   1 
ATOM   1376 O O   . VAL A 1 177 ? -4.139  69.328 37.493 1.00 27.76 ? 180  VAL A O   1 
ATOM   1377 C CB  . VAL A 1 177 ? -3.462  68.730 40.723 1.00 28.22 ? 180  VAL A CB  1 
ATOM   1378 C CG1 . VAL A 1 177 ? -2.284  69.483 40.115 1.00 28.12 ? 180  VAL A CG1 1 
ATOM   1379 C CG2 . VAL A 1 177 ? -3.845  69.357 42.042 1.00 28.57 ? 180  VAL A CG2 1 
ATOM   1380 N N   . HIS A 1 178 ? -3.934  67.175 38.094 1.00 28.37 ? 181  HIS A N   1 
ATOM   1381 C CA  . HIS A 1 178 ? -3.509  66.747 36.770 1.00 28.04 ? 181  HIS A CA  1 
ATOM   1382 C C   . HIS A 1 178 ? -4.538  67.169 35.720 1.00 28.03 ? 181  HIS A C   1 
ATOM   1383 O O   . HIS A 1 178 ? -4.186  67.718 34.677 1.00 28.49 ? 181  HIS A O   1 
ATOM   1384 C CB  . HIS A 1 178 ? -3.361  65.226 36.745 1.00 28.17 ? 181  HIS A CB  1 
ATOM   1385 C CG  . HIS A 1 178 ? -3.087  64.663 35.385 1.00 29.11 ? 181  HIS A CG  1 
ATOM   1386 N ND1 . HIS A 1 178 ? -1.812  64.515 34.883 1.00 29.61 ? 181  HIS A ND1 1 
ATOM   1387 C CD2 . HIS A 1 178 ? -3.927  64.206 34.424 1.00 28.59 ? 181  HIS A CD2 1 
ATOM   1388 C CE1 . HIS A 1 178 ? -1.877  63.988 33.672 1.00 29.30 ? 181  HIS A CE1 1 
ATOM   1389 N NE2 . HIS A 1 178 ? -3.148  63.792 33.370 1.00 29.42 ? 181  HIS A NE2 1 
ATOM   1390 N N   . ASP A 1 179 ? -5.812  66.913 36.002 1.00 27.10 ? 182  ASP A N   1 
ATOM   1391 C CA  . ASP A 1 179 ? -6.885  67.235 35.063 1.00 27.14 ? 182  ASP A CA  1 
ATOM   1392 C C   . ASP A 1 179 ? -7.379  68.680 35.011 1.00 27.11 ? 182  ASP A C   1 
ATOM   1393 O O   . ASP A 1 179 ? -7.926  69.100 33.992 1.00 28.16 ? 182  ASP A O   1 
ATOM   1394 C CB  . ASP A 1 179 ? -8.108  66.355 35.329 1.00 27.05 ? 182  ASP A CB  1 
ATOM   1395 C CG  . ASP A 1 179 ? -7.787  64.881 35.305 1.00 27.44 ? 182  ASP A CG  1 
ATOM   1396 O OD1 . ASP A 1 179 ? -6.884  64.472 34.546 1.00 28.68 ? 182  ASP A OD1 1 
ATOM   1397 O OD2 . ASP A 1 179 ? -8.457  64.125 36.036 1.00 27.74 ? 182  ASP A OD2 1 
ATOM   1398 N N   . ASN A 1 180 ? -7.191  69.446 36.079 1.00 26.44 ? 183  ASN A N   1 
ATOM   1399 C CA  . ASN A 1 180 ? -7.720  70.805 36.098 1.00 26.94 ? 183  ASN A CA  1 
ATOM   1400 C C   . ASN A 1 180 ? -6.775  71.970 36.348 1.00 27.39 ? 183  ASN A C   1 
ATOM   1401 O O   . ASN A 1 180 ? -7.154  73.124 36.124 1.00 27.95 ? 183  ASN A O   1 
ATOM   1402 C CB  . ASN A 1 180 ? -8.844  70.883 37.133 1.00 25.89 ? 183  ASN A CB  1 
ATOM   1403 C CG  . ASN A 1 180 ? -10.020 70.001 36.782 1.00 26.33 ? 183  ASN A CG  1 
ATOM   1404 O OD1 . ASN A 1 180 ? -10.799 70.321 35.889 1.00 25.76 ? 183  ASN A OD1 1 
ATOM   1405 N ND2 . ASN A 1 180 ? -10.150 68.876 37.479 1.00 25.83 ? 183  ASN A ND2 1 
ATOM   1406 N N   . ILE A 1 181 ? -5.557  71.699 36.804 1.00 27.26 ? 184  ILE A N   1 
ATOM   1407 C CA  . ILE A 1 181 ? -4.652  72.797 37.111 1.00 27.23 ? 184  ILE A CA  1 
ATOM   1408 C C   . ILE A 1 181 ? -4.346  73.702 35.922 1.00 27.53 ? 184  ILE A C   1 
ATOM   1409 O O   . ILE A 1 181 ? -3.978  74.860 36.105 1.00 27.67 ? 184  ILE A O   1 
ATOM   1410 C CB  . ILE A 1 181 ? -3.335  72.284 37.765 1.00 26.59 ? 184  ILE A CB  1 
ATOM   1411 C CG1 . ILE A 1 181 ? -2.787  73.364 38.700 1.00 25.75 ? 184  ILE A CG1 1 
ATOM   1412 C CG2 . ILE A 1 181 ? -2.303  71.915 36.708 1.00 25.15 ? 184  ILE A CG2 1 
ATOM   1413 C CD1 . ILE A 1 181 ? -3.726  73.708 39.846 1.00 24.53 ? 184  ILE A CD1 1 
ATOM   1414 N N   . GLN A 1 182 ? -4.519  73.188 34.707 1.00 27.74 ? 185  GLN A N   1 
ATOM   1415 C CA  . GLN A 1 182 ? -4.255  73.982 33.509 1.00 27.85 ? 185  GLN A CA  1 
ATOM   1416 C C   . GLN A 1 182 ? -5.157  75.219 33.450 1.00 27.95 ? 185  GLN A C   1 
ATOM   1417 O O   . GLN A 1 182 ? -4.750  76.272 32.960 1.00 27.47 ? 185  GLN A O   1 
ATOM   1418 C CB  . GLN A 1 182 ? -4.468  73.134 32.249 1.00 28.02 ? 185  GLN A CB  1 
ATOM   1419 C CG  . GLN A 1 182 ? -5.924  72.835 31.929 1.00 29.18 ? 185  GLN A CG  1 
ATOM   1420 C CD  . GLN A 1 182 ? -6.089  71.762 30.858 1.00 30.05 ? 185  GLN A CD  1 
ATOM   1421 O OE1 . GLN A 1 182 ? -5.916  70.572 31.122 1.00 30.38 ? 185  GLN A OE1 1 
ATOM   1422 N NE2 . GLN A 1 182 ? -6.420  72.182 29.643 1.00 30.61 ? 185  GLN A NE2 1 
ATOM   1423 N N   . PHE A 1 183 ? -6.377  75.095 33.965 1.00 27.96 ? 186  PHE A N   1 
ATOM   1424 C CA  . PHE A 1 183 ? -7.326  76.211 33.940 1.00 28.40 ? 186  PHE A CA  1 
ATOM   1425 C C   . PHE A 1 183 ? -6.968  77.307 34.941 1.00 28.92 ? 186  PHE A C   1 
ATOM   1426 O O   . PHE A 1 183 ? -7.496  78.420 34.875 1.00 29.30 ? 186  PHE A O   1 
ATOM   1427 C CB  . PHE A 1 183 ? -8.743  75.688 34.190 1.00 27.09 ? 186  PHE A CB  1 
ATOM   1428 C CG  . PHE A 1 183 ? -9.146  74.589 33.244 1.00 27.45 ? 186  PHE A CG  1 
ATOM   1429 C CD1 . PHE A 1 183 ? -9.209  74.825 31.874 1.00 26.57 ? 186  PHE A CD1 1 
ATOM   1430 C CD2 . PHE A 1 183 ? -9.413  73.306 33.716 1.00 26.64 ? 186  PHE A CD2 1 
ATOM   1431 C CE1 . PHE A 1 183 ? -9.530  73.802 30.988 1.00 27.42 ? 186  PHE A CE1 1 
ATOM   1432 C CE2 . PHE A 1 183 ? -9.735  72.275 32.837 1.00 27.11 ? 186  PHE A CE2 1 
ATOM   1433 C CZ  . PHE A 1 183 ? -9.794  72.522 31.472 1.00 26.83 ? 186  PHE A CZ  1 
ATOM   1434 N N   . PHE A 1 184 ? -6.059  76.995 35.858 1.00 28.55 ? 187  PHE A N   1 
ATOM   1435 C CA  . PHE A 1 184 ? -5.634  77.968 36.849 1.00 28.07 ? 187  PHE A CA  1 
ATOM   1436 C C   . PHE A 1 184 ? -4.288  78.535 36.451 1.00 27.73 ? 187  PHE A C   1 
ATOM   1437 O O   . PHE A 1 184 ? -3.681  79.285 37.206 1.00 28.10 ? 187  PHE A O   1 
ATOM   1438 C CB  . PHE A 1 184 ? -5.535  77.328 38.238 1.00 27.26 ? 187  PHE A CB  1 
ATOM   1439 C CG  . PHE A 1 184 ? -6.860  76.887 38.798 1.00 27.59 ? 187  PHE A CG  1 
ATOM   1440 C CD1 . PHE A 1 184 ? -7.397  75.647 38.464 1.00 27.51 ? 187  PHE A CD1 1 
ATOM   1441 C CD2 . PHE A 1 184 ? -7.572  77.712 39.666 1.00 27.56 ? 187  PHE A CD2 1 
ATOM   1442 C CE1 . PHE A 1 184 ? -8.624  75.233 38.990 1.00 27.33 ? 187  PHE A CE1 1 
ATOM   1443 C CE2 . PHE A 1 184 ? -8.801  77.308 40.197 1.00 27.89 ? 187  PHE A CE2 1 
ATOM   1444 C CZ  . PHE A 1 184 ? -9.327  76.065 39.858 1.00 26.87 ? 187  PHE A CZ  1 
ATOM   1445 N N   . GLY A 1 185 ? -3.824  78.169 35.258 1.00 27.54 ? 188  GLY A N   1 
ATOM   1446 C CA  . GLY A 1 185 ? -2.543  78.659 34.776 1.00 26.87 ? 188  GLY A CA  1 
ATOM   1447 C C   . GLY A 1 185 ? -1.374  77.760 35.135 1.00 27.06 ? 188  GLY A C   1 
ATOM   1448 O O   . GLY A 1 185 ? -0.211  78.106 34.900 1.00 26.45 ? 188  GLY A O   1 
ATOM   1449 N N   . GLY A 1 186 ? -1.684  76.602 35.706 1.00 27.36 ? 189  GLY A N   1 
ATOM   1450 C CA  . GLY A 1 186 ? -0.646  75.670 36.095 1.00 27.71 ? 189  GLY A CA  1 
ATOM   1451 C C   . GLY A 1 186 ? -0.381  74.669 34.996 1.00 28.19 ? 189  GLY A C   1 
ATOM   1452 O O   . GLY A 1 186 ? -1.276  74.359 34.214 1.00 28.90 ? 189  GLY A O   1 
ATOM   1453 N N   . ASP A 1 187 ? 0.854   74.179 34.931 1.00 28.54 ? 190  ASP A N   1 
ATOM   1454 C CA  . ASP A 1 187 ? 1.259   73.194 33.932 1.00 28.83 ? 190  ASP A CA  1 
ATOM   1455 C C   . ASP A 1 187 ? 1.209   71.807 34.567 1.00 28.84 ? 190  ASP A C   1 
ATOM   1456 O O   . ASP A 1 187 ? 2.015   71.487 35.436 1.00 29.01 ? 190  ASP A O   1 
ATOM   1457 C CB  . ASP A 1 187 ? 2.674   73.506 33.440 1.00 29.12 ? 190  ASP A CB  1 
ATOM   1458 C CG  . ASP A 1 187 ? 3.235   72.425 32.550 1.00 29.20 ? 190  ASP A CG  1 
ATOM   1459 O OD1 . ASP A 1 187 ? 2.444   71.608 32.037 1.00 30.65 ? 190  ASP A OD1 1 
ATOM   1460 O OD2 . ASP A 1 187 ? 4.467   72.396 32.357 1.00 29.70 ? 190  ASP A OD2 1 
ATOM   1461 N N   . PRO A 1 188 ? 0.261   70.964 34.130 1.00 29.26 ? 191  PRO A N   1 
ATOM   1462 C CA  . PRO A 1 188 ? 0.102   69.608 34.665 1.00 29.80 ? 191  PRO A CA  1 
ATOM   1463 C C   . PRO A 1 188 ? 1.270   68.654 34.435 1.00 30.62 ? 191  PRO A C   1 
ATOM   1464 O O   . PRO A 1 188 ? 1.351   67.609 35.076 1.00 31.13 ? 191  PRO A O   1 
ATOM   1465 C CB  . PRO A 1 188 ? -1.188  69.129 34.002 1.00 29.56 ? 191  PRO A CB  1 
ATOM   1466 C CG  . PRO A 1 188 ? -1.138  69.808 32.663 1.00 28.66 ? 191  PRO A CG  1 
ATOM   1467 C CD  . PRO A 1 188 ? -0.690  71.209 33.029 1.00 29.22 ? 191  PRO A CD  1 
ATOM   1468 N N   . LYS A 1 189 ? 2.176   69.003 33.530 1.00 31.69 ? 192  LYS A N   1 
ATOM   1469 C CA  . LYS A 1 189 ? 3.314   68.131 33.272 1.00 32.73 ? 192  LYS A CA  1 
ATOM   1470 C C   . LYS A 1 189 ? 4.531   68.538 34.093 1.00 32.30 ? 192  LYS A C   1 
ATOM   1471 O O   . LYS A 1 189 ? 5.603   67.940 33.978 1.00 32.46 ? 192  LYS A O   1 
ATOM   1472 C CB  . LYS A 1 189 ? 3.656   68.123 31.779 1.00 34.61 ? 192  LYS A CB  1 
ATOM   1473 C CG  . LYS A 1 189 ? 3.882   69.489 31.177 1.00 38.40 ? 192  LYS A CG  1 
ATOM   1474 C CD  . LYS A 1 189 ? 3.936   69.411 29.650 1.00 40.88 ? 192  LYS A CD  1 
ATOM   1475 C CE  . LYS A 1 189 ? 3.809   70.792 29.024 1.00 42.38 ? 192  LYS A CE  1 
ATOM   1476 N NZ  . LYS A 1 189 ? 2.494   71.422 29.360 1.00 43.96 ? 192  LYS A NZ  1 
ATOM   1477 N N   . THR A 1 190 ? 4.360   69.552 34.930 1.00 31.04 ? 193  THR A N   1 
ATOM   1478 C CA  . THR A 1 190 ? 5.450   70.017 35.771 1.00 31.29 ? 193  THR A CA  1 
ATOM   1479 C C   . THR A 1 190 ? 4.954   70.189 37.205 1.00 30.46 ? 193  THR A C   1 
ATOM   1480 O O   . THR A 1 190 ? 5.040   71.271 37.793 1.00 30.69 ? 193  THR A O   1 
ATOM   1481 C CB  . THR A 1 190 ? 6.020   71.348 35.249 1.00 31.41 ? 193  THR A CB  1 
ATOM   1482 O OG1 . THR A 1 190 ? 6.338   71.212 33.858 1.00 33.07 ? 193  THR A OG1 1 
ATOM   1483 C CG2 . THR A 1 190 ? 7.285   71.714 36.001 1.00 31.22 ? 193  THR A CG2 1 
ATOM   1484 N N   . VAL A 1 191 ? 4.428   69.105 37.761 1.00 28.84 ? 194  VAL A N   1 
ATOM   1485 C CA  . VAL A 1 191 ? 3.917   69.125 39.118 1.00 27.12 ? 194  VAL A CA  1 
ATOM   1486 C C   . VAL A 1 191 ? 4.906   68.471 40.073 1.00 27.28 ? 194  VAL A C   1 
ATOM   1487 O O   . VAL A 1 191 ? 5.396   67.366 39.828 1.00 27.83 ? 194  VAL A O   1 
ATOM   1488 C CB  . VAL A 1 191 ? 2.562   68.385 39.210 1.00 27.10 ? 194  VAL A CB  1 
ATOM   1489 C CG1 . VAL A 1 191 ? 2.082   68.340 40.650 1.00 25.50 ? 194  VAL A CG1 1 
ATOM   1490 C CG2 . VAL A 1 191 ? 1.528   69.082 38.318 1.00 25.66 ? 194  VAL A CG2 1 
ATOM   1491 N N   . THR A 1 192 ? 5.216   69.177 41.151 1.00 26.70 ? 195  THR A N   1 
ATOM   1492 C CA  . THR A 1 192 ? 6.119   68.665 42.165 1.00 26.22 ? 195  THR A CA  1 
ATOM   1493 C C   . THR A 1 192 ? 5.297   68.444 43.416 1.00 26.00 ? 195  THR A C   1 
ATOM   1494 O O   . THR A 1 192 ? 4.610   69.359 43.874 1.00 26.53 ? 195  THR A O   1 
ATOM   1495 C CB  . THR A 1 192 ? 7.240   69.674 42.522 1.00 25.55 ? 195  THR A CB  1 
ATOM   1496 O OG1 . THR A 1 192 ? 8.161   69.783 41.434 1.00 26.59 ? 195  THR A OG1 1 
ATOM   1497 C CG2 . THR A 1 192 ? 7.992   69.217 43.764 1.00 25.37 ? 195  THR A CG2 1 
ATOM   1498 N N   . ILE A 1 193 ? 5.331   67.234 43.957 1.00 25.06 ? 196  ILE A N   1 
ATOM   1499 C CA  . ILE A 1 193 ? 4.607   66.995 45.191 1.00 24.94 ? 196  ILE A CA  1 
ATOM   1500 C C   . ILE A 1 193 ? 5.624   67.046 46.325 1.00 24.85 ? 196  ILE A C   1 
ATOM   1501 O O   . ILE A 1 193 ? 6.714   66.477 46.220 1.00 24.44 ? 196  ILE A O   1 
ATOM   1502 C CB  . ILE A 1 193 ? 3.884   65.623 45.216 1.00 24.81 ? 196  ILE A CB  1 
ATOM   1503 C CG1 . ILE A 1 193 ? 4.880   64.484 44.996 1.00 24.21 ? 196  ILE A CG1 1 
ATOM   1504 C CG2 . ILE A 1 193 ? 2.775   65.603 44.169 1.00 25.33 ? 196  ILE A CG2 1 
ATOM   1505 C CD1 . ILE A 1 193 ? 4.266   63.104 45.207 1.00 23.15 ? 196  ILE A CD1 1 
ATOM   1506 N N   . PHE A 1 194 ? 5.291   67.768 47.388 1.00 24.72 ? 197  PHE A N   1 
ATOM   1507 C CA  . PHE A 1 194 ? 6.185   67.845 48.528 1.00 24.76 ? 197  PHE A CA  1 
ATOM   1508 C C   . PHE A 1 194 ? 5.400   67.769 49.827 1.00 24.93 ? 197  PHE A C   1 
ATOM   1509 O O   . PHE A 1 194 ? 4.220   68.119 49.879 1.00 25.45 ? 197  PHE A O   1 
ATOM   1510 C CB  . PHE A 1 194 ? 7.084   69.101 48.452 1.00 24.79 ? 197  PHE A CB  1 
ATOM   1511 C CG  . PHE A 1 194 ? 6.373   70.422 48.656 1.00 24.82 ? 197  PHE A CG  1 
ATOM   1512 C CD1 . PHE A 1 194 ? 5.247   70.761 47.918 1.00 24.94 ? 197  PHE A CD1 1 
ATOM   1513 C CD2 . PHE A 1 194 ? 6.898   71.365 49.540 1.00 24.85 ? 197  PHE A CD2 1 
ATOM   1514 C CE1 . PHE A 1 194 ? 4.655   72.026 48.054 1.00 25.47 ? 197  PHE A CE1 1 
ATOM   1515 C CE2 . PHE A 1 194 ? 6.317   72.632 49.685 1.00 25.08 ? 197  PHE A CE2 1 
ATOM   1516 C CZ  . PHE A 1 194 ? 5.194   72.963 48.940 1.00 24.62 ? 197  PHE A CZ  1 
ATOM   1517 N N   . GLY A 1 195 ? 6.047   67.258 50.866 1.00 25.21 ? 198  GLY A N   1 
ATOM   1518 C CA  . GLY A 1 195 ? 5.384   67.117 52.148 1.00 24.33 ? 198  GLY A CA  1 
ATOM   1519 C C   . GLY A 1 195 ? 6.389   66.860 53.247 1.00 24.48 ? 198  GLY A C   1 
ATOM   1520 O O   . GLY A 1 195 ? 7.538   66.498 52.981 1.00 24.06 ? 198  GLY A O   1 
ATOM   1521 N N   . GLU A 1 196 ? 5.957   67.040 54.490 1.00 24.25 ? 199  GLU A N   1 
ATOM   1522 C CA  . GLU A 1 196 ? 6.839   66.852 55.628 1.00 24.63 ? 199  GLU A CA  1 
ATOM   1523 C C   . GLU A 1 196 ? 6.329   65.754 56.560 1.00 24.80 ? 199  GLU A C   1 
ATOM   1524 O O   . GLU A 1 196 ? 5.121   65.589 56.749 1.00 24.13 ? 199  GLU A O   1 
ATOM   1525 C CB  . GLU A 1 196 ? 6.982   68.187 56.374 1.00 24.34 ? 199  GLU A CB  1 
ATOM   1526 C CG  . GLU A 1 196 ? 7.929   68.183 57.562 1.00 24.15 ? 199  GLU A CG  1 
ATOM   1527 C CD  . GLU A 1 196 ? 7.257   67.728 58.837 1.00 25.93 ? 199  GLU A CD  1 
ATOM   1528 O OE1 . GLU A 1 196 ? 6.009   67.654 58.849 1.00 26.25 ? 199  GLU A OE1 1 
ATOM   1529 O OE2 . GLU A 1 196 ? 7.969   67.456 59.830 1.00 26.38 ? 199  GLU A OE2 1 
ATOM   1530 N N   . SER A 1 197 ? 7.265   65.003 57.132 1.00 24.58 ? 200  SER A N   1 
ATOM   1531 C CA  . SER A 1 197 ? 6.938   63.918 58.045 1.00 25.20 ? 200  SER A CA  1 
ATOM   1532 C C   . SER A 1 197 ? 6.025   62.903 57.336 1.00 24.14 ? 200  SER A C   1 
ATOM   1533 O O   . SER A 1 197 ? 6.390   62.380 56.284 1.00 24.68 ? 200  SER A O   1 
ATOM   1534 C CB  . SER A 1 197 ? 6.270   64.487 59.294 1.00 26.40 ? 200  SER A CB  1 
ATOM   1535 O OG  . SER A 1 197 ? 6.426   63.593 60.384 1.00 31.19 ? 200  SER A OG  1 
ATOM   1536 N N   . ALA A 1 198 ? 4.849   62.620 57.886 1.00 23.18 ? 201  ALA A N   1 
ATOM   1537 C CA  . ALA A 1 198 ? 3.945   61.670 57.232 1.00 23.11 ? 201  ALA A CA  1 
ATOM   1538 C C   . ALA A 1 198 ? 3.663   62.125 55.798 1.00 23.32 ? 201  ALA A C   1 
ATOM   1539 O O   . ALA A 1 198 ? 3.358   61.307 54.920 1.00 22.00 ? 201  ALA A O   1 
ATOM   1540 C CB  . ALA A 1 198 ? 2.638   61.544 58.015 1.00 22.76 ? 201  ALA A CB  1 
ATOM   1541 N N   . GLY A 1 199 ? 3.758   63.435 55.570 1.00 23.18 ? 202  GLY A N   1 
ATOM   1542 C CA  . GLY A 1 199 ? 3.544   63.974 54.240 1.00 22.84 ? 202  GLY A CA  1 
ATOM   1543 C C   . GLY A 1 199 ? 4.732   63.614 53.365 1.00 23.56 ? 202  GLY A C   1 
ATOM   1544 O O   . GLY A 1 199 ? 4.593   63.420 52.156 1.00 24.44 ? 202  GLY A O   1 
ATOM   1545 N N   . GLY A 1 200 ? 5.911   63.534 53.977 1.00 23.28 ? 203  GLY A N   1 
ATOM   1546 C CA  . GLY A 1 200 ? 7.104   63.169 53.237 1.00 23.53 ? 203  GLY A CA  1 
ATOM   1547 C C   . GLY A 1 200 ? 7.063   61.678 52.948 1.00 24.19 ? 203  GLY A C   1 
ATOM   1548 O O   . GLY A 1 200 ? 7.457   61.226 51.870 1.00 24.45 ? 203  GLY A O   1 
ATOM   1549 N N   . ALA A 1 201 ? 6.594   60.903 53.921 1.00 23.65 ? 204  ALA A N   1 
ATOM   1550 C CA  . ALA A 1 201 ? 6.472   59.464 53.734 1.00 24.07 ? 204  ALA A CA  1 
ATOM   1551 C C   . ALA A 1 201 ? 5.471   59.250 52.588 1.00 24.37 ? 204  ALA A C   1 
ATOM   1552 O O   . ALA A 1 201 ? 5.695   58.419 51.698 1.00 25.00 ? 204  ALA A O   1 
ATOM   1553 C CB  . ALA A 1 201 ? 5.962   58.804 55.017 1.00 21.97 ? 204  ALA A CB  1 
ATOM   1554 N N   . SER A 1 202 ? 4.380   60.018 52.611 1.00 22.88 ? 205  SER A N   1 
ATOM   1555 C CA  . SER A 1 202 ? 3.353   59.926 51.576 1.00 23.14 ? 205  SER A CA  1 
ATOM   1556 C C   . SER A 1 202 ? 3.943   60.188 50.187 1.00 23.12 ? 205  SER A C   1 
ATOM   1557 O O   . SER A 1 202 ? 3.662   59.444 49.238 1.00 22.75 ? 205  SER A O   1 
ATOM   1558 C CB  . SER A 1 202 ? 2.213   60.920 51.852 1.00 22.67 ? 205  SER A CB  1 
ATOM   1559 O OG  . SER A 1 202 ? 1.459   60.536 52.993 1.00 21.55 ? 205  SER A OG  1 
ATOM   1560 N N   . VAL A 1 203 ? 4.747   61.243 50.064 1.00 21.77 ? 206  VAL A N   1 
ATOM   1561 C CA  . VAL A 1 203 ? 5.372   61.554 48.787 1.00 22.20 ? 206  VAL A CA  1 
ATOM   1562 C C   . VAL A 1 203 ? 6.154   60.322 48.310 1.00 22.15 ? 206  VAL A C   1 
ATOM   1563 O O   . VAL A 1 203 ? 6.027   59.908 47.166 1.00 23.30 ? 206  VAL A O   1 
ATOM   1564 C CB  . VAL A 1 203 ? 6.333   62.770 48.905 1.00 22.75 ? 206  VAL A CB  1 
ATOM   1565 C CG1 . VAL A 1 203 ? 7.231   62.845 47.687 1.00 22.12 ? 206  VAL A CG1 1 
ATOM   1566 C CG2 . VAL A 1 203 ? 5.532   64.069 49.035 1.00 22.31 ? 206  VAL A CG2 1 
ATOM   1567 N N   . GLY A 1 204 ? 6.952   59.732 49.194 1.00 22.58 ? 207  GLY A N   1 
ATOM   1568 C CA  . GLY A 1 204 ? 7.717   58.551 48.826 1.00 22.52 ? 207  GLY A CA  1 
ATOM   1569 C C   . GLY A 1 204 ? 6.826   57.376 48.449 1.00 23.08 ? 207  GLY A C   1 
ATOM   1570 O O   . GLY A 1 204 ? 7.184   56.556 47.601 1.00 22.97 ? 207  GLY A O   1 
ATOM   1571 N N   . MET A 1 205 ? 5.657   57.287 49.071 1.00 23.17 ? 208  MET A N   1 
ATOM   1572 C CA  . MET A 1 205 ? 4.739   56.195 48.770 1.00 24.31 ? 208  MET A CA  1 
ATOM   1573 C C   . MET A 1 205 ? 4.102   56.359 47.386 1.00 25.01 ? 208  MET A C   1 
ATOM   1574 O O   . MET A 1 205 ? 3.783   55.375 46.715 1.00 25.91 ? 208  MET A O   1 
ATOM   1575 C CB  . MET A 1 205 ? 3.664   56.106 49.852 1.00 23.18 ? 208  MET A CB  1 
ATOM   1576 C CG  . MET A 1 205 ? 4.237   55.814 51.227 1.00 23.47 ? 208  MET A CG  1 
ATOM   1577 S SD  . MET A 1 205 ? 2.994   55.756 52.524 1.00 24.26 ? 208  MET A SD  1 
ATOM   1578 C CE  . MET A 1 205 ? 3.795   54.691 53.707 1.00 23.00 ? 208  MET A CE  1 
ATOM   1579 N N   . HIS A 1 206 ? 3.919   57.600 46.955 1.00 24.81 ? 209  HIS A N   1 
ATOM   1580 C CA  . HIS A 1 206 ? 3.341   57.840 45.644 1.00 25.18 ? 209  HIS A CA  1 
ATOM   1581 C C   . HIS A 1 206 ? 4.417   57.572 44.603 1.00 25.02 ? 209  HIS A C   1 
ATOM   1582 O O   . HIS A 1 206 ? 4.119   57.242 43.458 1.00 24.83 ? 209  HIS A O   1 
ATOM   1583 C CB  . HIS A 1 206 ? 2.813   59.275 45.539 1.00 25.25 ? 209  HIS A CB  1 
ATOM   1584 C CG  . HIS A 1 206 ? 1.578   59.520 46.352 1.00 25.71 ? 209  HIS A CG  1 
ATOM   1585 N ND1 . HIS A 1 206 ? 0.418   58.794 46.178 1.00 26.10 ? 209  HIS A ND1 1 
ATOM   1586 C CD2 . HIS A 1 206 ? 1.320   60.409 47.342 1.00 25.41 ? 209  HIS A CD2 1 
ATOM   1587 C CE1 . HIS A 1 206 ? -0.502  59.225 47.025 1.00 25.99 ? 209  HIS A CE1 1 
ATOM   1588 N NE2 . HIS A 1 206 ? 0.020   60.205 47.742 1.00 26.28 ? 209  HIS A NE2 1 
ATOM   1589 N N   . ILE A 1 207 ? 5.676   57.709 45.008 1.00 24.90 ? 210  ILE A N   1 
ATOM   1590 C CA  . ILE A 1 207 ? 6.785   57.434 44.104 1.00 24.59 ? 210  ILE A CA  1 
ATOM   1591 C C   . ILE A 1 207 ? 6.848   55.928 43.866 1.00 24.51 ? 210  ILE A C   1 
ATOM   1592 O O   . ILE A 1 207 ? 7.170   55.484 42.769 1.00 24.89 ? 210  ILE A O   1 
ATOM   1593 C CB  . ILE A 1 207 ? 8.130   57.928 44.691 1.00 24.66 ? 210  ILE A CB  1 
ATOM   1594 C CG1 . ILE A 1 207 ? 8.229   59.445 44.524 1.00 23.62 ? 210  ILE A CG1 1 
ATOM   1595 C CG2 . ILE A 1 207 ? 9.313   57.228 44.000 1.00 24.40 ? 210  ILE A CG2 1 
ATOM   1596 C CD1 . ILE A 1 207 ? 9.453   60.057 45.157 1.00 23.03 ? 210  ILE A CD1 1 
ATOM   1597 N N   . LEU A 1 208 ? 6.518   55.150 44.894 1.00 24.58 ? 211  LEU A N   1 
ATOM   1598 C CA  . LEU A 1 208 ? 6.538   53.692 44.799 1.00 25.20 ? 211  LEU A CA  1 
ATOM   1599 C C   . LEU A 1 208 ? 5.299   53.103 44.137 1.00 25.41 ? 211  LEU A C   1 
ATOM   1600 O O   . LEU A 1 208 ? 5.401   52.255 43.254 1.00 26.29 ? 211  LEU A O   1 
ATOM   1601 C CB  . LEU A 1 208 ? 6.678   53.065 46.188 1.00 25.34 ? 211  LEU A CB  1 
ATOM   1602 C CG  . LEU A 1 208 ? 7.975   53.275 46.964 1.00 26.56 ? 211  LEU A CG  1 
ATOM   1603 C CD1 . LEU A 1 208 ? 7.814   52.710 48.373 1.00 26.78 ? 211  LEU A CD1 1 
ATOM   1604 C CD2 . LEU A 1 208 ? 9.125   52.596 46.240 1.00 26.86 ? 211  LEU A CD2 1 
ATOM   1605 N N   . SER A 1 209 ? 4.127   53.549 44.570 1.00 26.22 ? 212  SER A N   1 
ATOM   1606 C CA  . SER A 1 209 ? 2.865   53.034 44.045 1.00 26.66 ? 212  SER A CA  1 
ATOM   1607 C C   . SER A 1 209 ? 2.636   53.289 42.553 1.00 27.30 ? 212  SER A C   1 
ATOM   1608 O O   . SER A 1 209 ? 2.519   54.438 42.115 1.00 27.88 ? 212  SER A O   1 
ATOM   1609 C CB  . SER A 1 209 ? 1.703   53.615 44.847 1.00 26.13 ? 212  SER A CB  1 
ATOM   1610 O OG  . SER A 1 209 ? 0.470   53.051 44.443 1.00 26.50 ? 212  SER A OG  1 
ATOM   1611 N N   . PRO A 1 210 ? 2.552   52.208 41.756 1.00 27.41 ? 213  PRO A N   1 
ATOM   1612 C CA  . PRO A 1 210 ? 2.335   52.265 40.307 1.00 27.85 ? 213  PRO A CA  1 
ATOM   1613 C C   . PRO A 1 210 ? 1.140   53.136 39.924 1.00 27.87 ? 213  PRO A C   1 
ATOM   1614 O O   . PRO A 1 210 ? 1.175   53.840 38.917 1.00 27.64 ? 213  PRO A O   1 
ATOM   1615 C CB  . PRO A 1 210 ? 2.107   50.801 39.936 1.00 28.08 ? 213  PRO A CB  1 
ATOM   1616 C CG  . PRO A 1 210 ? 2.940   50.069 40.940 1.00 27.63 ? 213  PRO A CG  1 
ATOM   1617 C CD  . PRO A 1 210 ? 2.634   50.808 42.215 1.00 27.07 ? 213  PRO A CD  1 
ATOM   1618 N N   . GLY A 1 211 ? 0.088   53.079 40.736 1.00 28.04 ? 214  GLY A N   1 
ATOM   1619 C CA  . GLY A 1 211 ? -1.109  53.855 40.461 1.00 28.11 ? 214  GLY A CA  1 
ATOM   1620 C C   . GLY A 1 211 ? -0.995  55.350 40.703 1.00 28.71 ? 214  GLY A C   1 
ATOM   1621 O O   . GLY A 1 211 ? -1.905  56.098 40.336 1.00 28.85 ? 214  GLY A O   1 
ATOM   1622 N N   . SER A 1 212 ? 0.112   55.792 41.301 1.00 28.40 ? 215  SER A N   1 
ATOM   1623 C CA  . SER A 1 212 ? 0.317   57.213 41.596 1.00 28.47 ? 215  SER A CA  1 
ATOM   1624 C C   . SER A 1 212 ? 1.412   57.872 40.761 1.00 28.81 ? 215  SER A C   1 
ATOM   1625 O O   . SER A 1 212 ? 1.334   59.063 40.452 1.00 28.86 ? 215  SER A O   1 
ATOM   1626 C CB  . SER A 1 212 ? 0.664   57.409 43.084 1.00 28.54 ? 215  SER A CB  1 
ATOM   1627 O OG  . SER A 1 212 ? -0.436  57.129 43.934 1.00 27.40 ? 215  SER A OG  1 
ATOM   1628 N N   . ARG A 1 213 ? 2.429   57.092 40.404 1.00 28.83 ? 216  ARG A N   1 
ATOM   1629 C CA  . ARG A 1 213 ? 3.577   57.575 39.639 1.00 29.25 ? 216  ARG A CA  1 
ATOM   1630 C C   . ARG A 1 213 ? 3.314   58.566 38.505 1.00 29.38 ? 216  ARG A C   1 
ATOM   1631 O O   . ARG A 1 213 ? 3.999   59.584 38.392 1.00 29.08 ? 216  ARG A O   1 
ATOM   1632 C CB  . ARG A 1 213 ? 4.354   56.389 39.056 1.00 29.51 ? 216  ARG A CB  1 
ATOM   1633 C CG  . ARG A 1 213 ? 4.792   55.356 40.072 1.00 29.43 ? 216  ARG A CG  1 
ATOM   1634 C CD  . ARG A 1 213 ? 5.591   54.248 39.407 1.00 28.94 ? 216  ARG A CD  1 
ATOM   1635 N NE  . ARG A 1 213 ? 5.896   53.178 40.351 1.00 29.73 ? 216  ARG A NE  1 
ATOM   1636 C CZ  . ARG A 1 213 ? 6.450   52.016 40.020 1.00 29.42 ? 216  ARG A CZ  1 
ATOM   1637 N NH1 . ARG A 1 213 ? 6.771   51.763 38.755 1.00 29.24 ? 216  ARG A NH1 1 
ATOM   1638 N NH2 . ARG A 1 213 ? 6.681   51.106 40.958 1.00 29.14 ? 216  ARG A NH2 1 
ATOM   1639 N N   . ASP A 1 214 ? 2.333   58.267 37.662 1.00 29.06 ? 217  ASP A N   1 
ATOM   1640 C CA  . ASP A 1 214 ? 2.045   59.119 36.517 1.00 29.10 ? 217  ASP A CA  1 
ATOM   1641 C C   . ASP A 1 214 ? 1.415   60.469 36.836 1.00 29.07 ? 217  ASP A C   1 
ATOM   1642 O O   . ASP A 1 214 ? 1.319   61.323 35.956 1.00 29.28 ? 217  ASP A O   1 
ATOM   1643 C CB  . ASP A 1 214 ? 1.138   58.378 35.525 1.00 29.40 ? 217  ASP A CB  1 
ATOM   1644 C CG  . ASP A 1 214 ? 1.707   57.031 35.085 1.00 29.46 ? 217  ASP A CG  1 
ATOM   1645 O OD1 . ASP A 1 214 ? 2.851   56.688 35.457 1.00 29.51 ? 217  ASP A OD1 1 
ATOM   1646 O OD2 . ASP A 1 214 ? 0.999   56.309 34.356 1.00 29.65 ? 217  ASP A OD2 1 
ATOM   1647 N N   . LEU A 1 215 ? 1.000   60.679 38.080 1.00 27.96 ? 218  LEU A N   1 
ATOM   1648 C CA  . LEU A 1 215 ? 0.339   61.928 38.434 1.00 27.78 ? 218  LEU A CA  1 
ATOM   1649 C C   . LEU A 1 215 ? 1.211   63.112 38.834 1.00 27.92 ? 218  LEU A C   1 
ATOM   1650 O O   . LEU A 1 215 ? 0.688   64.169 39.177 1.00 28.97 ? 218  LEU A O   1 
ATOM   1651 C CB  . LEU A 1 215 ? -0.693  61.668 39.526 1.00 27.77 ? 218  LEU A CB  1 
ATOM   1652 C CG  . LEU A 1 215 ? -1.764  60.653 39.122 1.00 28.00 ? 218  LEU A CG  1 
ATOM   1653 C CD1 . LEU A 1 215 ? -2.664  60.382 40.311 1.00 28.40 ? 218  LEU A CD1 1 
ATOM   1654 C CD2 . LEU A 1 215 ? -2.564  61.183 37.935 1.00 27.59 ? 218  LEU A CD2 1 
ATOM   1655 N N   . PHE A 1 216 ? 2.527   62.956 38.800 1.00 27.14 ? 219  PHE A N   1 
ATOM   1656 C CA  . PHE A 1 216 ? 3.400   64.066 39.152 1.00 26.54 ? 219  PHE A CA  1 
ATOM   1657 C C   . PHE A 1 216 ? 4.744   63.931 38.451 1.00 26.94 ? 219  PHE A C   1 
ATOM   1658 O O   . PHE A 1 216 ? 5.096   62.854 37.963 1.00 27.05 ? 219  PHE A O   1 
ATOM   1659 C CB  . PHE A 1 216 ? 3.588   64.167 40.678 1.00 25.42 ? 219  PHE A CB  1 
ATOM   1660 C CG  . PHE A 1 216 ? 4.229   62.962 41.297 1.00 24.11 ? 219  PHE A CG  1 
ATOM   1661 C CD1 . PHE A 1 216 ? 3.476   61.818 41.571 1.00 23.93 ? 219  PHE A CD1 1 
ATOM   1662 C CD2 . PHE A 1 216 ? 5.591   62.954 41.573 1.00 22.38 ? 219  PHE A CD2 1 
ATOM   1663 C CE1 . PHE A 1 216 ? 4.075   60.677 42.113 1.00 23.41 ? 219  PHE A CE1 1 
ATOM   1664 C CE2 . PHE A 1 216 ? 6.203   61.822 42.113 1.00 23.63 ? 219  PHE A CE2 1 
ATOM   1665 C CZ  . PHE A 1 216 ? 5.442   60.678 42.384 1.00 23.03 ? 219  PHE A CZ  1 
ATOM   1666 N N   . ARG A 1 217 ? 5.488   65.032 38.413 1.00 26.35 ? 220  ARG A N   1 
ATOM   1667 C CA  . ARG A 1 217 ? 6.780   65.087 37.744 1.00 26.62 ? 220  ARG A CA  1 
ATOM   1668 C C   . ARG A 1 217 ? 7.973   64.810 38.657 1.00 26.64 ? 220  ARG A C   1 
ATOM   1669 O O   . ARG A 1 217 ? 8.788   63.931 38.376 1.00 26.88 ? 220  ARG A O   1 
ATOM   1670 C CB  . ARG A 1 217 ? 6.936   66.469 37.092 1.00 26.91 ? 220  ARG A CB  1 
ATOM   1671 C CG  . ARG A 1 217 ? 8.228   66.712 36.327 1.00 28.91 ? 220  ARG A CG  1 
ATOM   1672 C CD  . ARG A 1 217 ? 8.388   65.734 35.181 1.00 30.75 ? 220  ARG A CD  1 
ATOM   1673 N NE  . ARG A 1 217 ? 9.463   66.111 34.262 1.00 32.22 ? 220  ARG A NE  1 
ATOM   1674 C CZ  . ARG A 1 217 ? 9.340   66.997 33.276 1.00 32.02 ? 220  ARG A CZ  1 
ATOM   1675 N NH1 . ARG A 1 217 ? 8.184   67.619 33.066 1.00 31.53 ? 220  ARG A NH1 1 
ATOM   1676 N NH2 . ARG A 1 217 ? 10.373  67.245 32.482 1.00 31.17 ? 220  ARG A NH2 1 
ATOM   1677 N N   . ARG A 1 218 ? 8.069   65.575 39.741 1.00 26.44 ? 221  ARG A N   1 
ATOM   1678 C CA  . ARG A 1 218 ? 9.167   65.469 40.696 1.00 26.35 ? 221  ARG A CA  1 
ATOM   1679 C C   . ARG A 1 218 ? 8.642   65.446 42.119 1.00 25.85 ? 221  ARG A C   1 
ATOM   1680 O O   . ARG A 1 218 ? 7.463   65.711 42.352 1.00 25.27 ? 221  ARG A O   1 
ATOM   1681 C CB  . ARG A 1 218 ? 10.113  66.657 40.535 1.00 27.25 ? 221  ARG A CB  1 
ATOM   1682 C CG  . ARG A 1 218 ? 11.091  66.516 39.406 1.00 30.79 ? 221  ARG A CG  1 
ATOM   1683 C CD  . ARG A 1 218 ? 11.970  67.752 39.308 1.00 30.42 ? 221  ARG A CD  1 
ATOM   1684 N NE  . ARG A 1 218 ? 11.315  68.805 38.555 1.00 31.28 ? 221  ARG A NE  1 
ATOM   1685 C CZ  . ARG A 1 218 ? 11.350  68.904 37.231 1.00 30.82 ? 221  ARG A CZ  1 
ATOM   1686 N NH1 . ARG A 1 218 ? 12.019  68.012 36.516 1.00 29.31 ? 221  ARG A NH1 1 
ATOM   1687 N NH2 . ARG A 1 218 ? 10.705  69.891 36.624 1.00 31.09 ? 221  ARG A NH2 1 
ATOM   1688 N N   . ALA A 1 219 ? 9.531   65.164 43.070 1.00 24.98 ? 222  ALA A N   1 
ATOM   1689 C CA  . ALA A 1 219 ? 9.135   65.070 44.473 1.00 25.43 ? 222  ALA A CA  1 
ATOM   1690 C C   . ALA A 1 219 ? 10.145  65.626 45.467 1.00 25.64 ? 222  ALA A C   1 
ATOM   1691 O O   . ALA A 1 219 ? 11.359  65.570 45.244 1.00 26.15 ? 222  ALA A O   1 
ATOM   1692 C CB  . ALA A 1 219 ? 8.838   63.608 44.825 1.00 23.55 ? 222  ALA A CB  1 
ATOM   1693 N N   . ILE A 1 220 ? 9.617   66.153 46.569 1.00 25.16 ? 223  ILE A N   1 
ATOM   1694 C CA  . ILE A 1 220 ? 10.419  66.696 47.657 1.00 24.81 ? 223  ILE A CA  1 
ATOM   1695 C C   . ILE A 1 220 ? 9.945   66.023 48.946 1.00 24.81 ? 223  ILE A C   1 
ATOM   1696 O O   . ILE A 1 220 ? 8.744   65.989 49.226 1.00 25.29 ? 223  ILE A O   1 
ATOM   1697 C CB  . ILE A 1 220 ? 10.233  68.223 47.799 1.00 24.65 ? 223  ILE A CB  1 
ATOM   1698 C CG1 . ILE A 1 220 ? 10.764  68.930 46.548 1.00 24.69 ? 223  ILE A CG1 1 
ATOM   1699 C CG2 . ILE A 1 220 ? 10.952  68.722 49.058 1.00 23.79 ? 223  ILE A CG2 1 
ATOM   1700 C CD1 . ILE A 1 220 ? 10.591  70.439 46.573 1.00 24.51 ? 223  ILE A CD1 1 
ATOM   1701 N N   . LEU A 1 221 ? 10.880  65.482 49.720 1.00 23.88 ? 224  LEU A N   1 
ATOM   1702 C CA  . LEU A 1 221 ? 10.541  64.808 50.974 1.00 24.00 ? 224  LEU A CA  1 
ATOM   1703 C C   . LEU A 1 221 ? 11.230  65.483 52.154 1.00 24.74 ? 224  LEU A C   1 
ATOM   1704 O O   . LEU A 1 221 ? 12.456  65.559 52.203 1.00 25.15 ? 224  LEU A O   1 
ATOM   1705 C CB  . LEU A 1 221 ? 10.956  63.325 50.929 1.00 22.63 ? 224  LEU A CB  1 
ATOM   1706 C CG  . LEU A 1 221 ? 10.311  62.423 49.870 1.00 21.73 ? 224  LEU A CG  1 
ATOM   1707 C CD1 . LEU A 1 221 ? 10.937  62.689 48.505 1.00 20.81 ? 224  LEU A CD1 1 
ATOM   1708 C CD2 . LEU A 1 221 ? 10.494  60.965 50.267 1.00 19.95 ? 224  LEU A CD2 1 
ATOM   1709 N N   . GLN A 1 222 ? 10.441  65.962 53.109 1.00 25.27 ? 225  GLN A N   1 
ATOM   1710 C CA  . GLN A 1 222 ? 10.994  66.631 54.277 1.00 24.79 ? 225  GLN A CA  1 
ATOM   1711 C C   . GLN A 1 222 ? 10.750  65.829 55.553 1.00 24.97 ? 225  GLN A C   1 
ATOM   1712 O O   . GLN A 1 222 ? 9.607   65.571 55.935 1.00 25.00 ? 225  GLN A O   1 
ATOM   1713 C CB  . GLN A 1 222 ? 10.382  68.028 54.404 1.00 24.89 ? 225  GLN A CB  1 
ATOM   1714 C CG  . GLN A 1 222 ? 10.473  68.829 53.114 1.00 24.80 ? 225  GLN A CG  1 
ATOM   1715 C CD  . GLN A 1 222 ? 9.748   70.163 53.170 1.00 24.26 ? 225  GLN A CD  1 
ATOM   1716 O OE1 . GLN A 1 222 ? 9.450   70.757 52.136 1.00 24.93 ? 225  GLN A OE1 1 
ATOM   1717 N NE2 . GLN A 1 222 ? 9.473   70.645 54.373 1.00 24.79 ? 225  GLN A NE2 1 
ATOM   1718 N N   . SER A 1 223 ? 11.840  65.417 56.192 1.00 24.65 ? 226  SER A N   1 
ATOM   1719 C CA  . SER A 1 223 ? 11.775  64.663 57.437 1.00 24.50 ? 226  SER A CA  1 
ATOM   1720 C C   . SER A 1 223 ? 10.847  63.464 57.372 1.00 24.03 ? 226  SER A C   1 
ATOM   1721 O O   . SER A 1 223 ? 10.040  63.251 58.270 1.00 24.17 ? 226  SER A O   1 
ATOM   1722 C CB  . SER A 1 223 ? 11.336  65.587 58.579 1.00 24.26 ? 226  SER A CB  1 
ATOM   1723 O OG  . SER A 1 223 ? 12.235  66.677 58.721 1.00 24.17 ? 226  SER A OG  1 
ATOM   1724 N N   . GLY A 1 224 ? 10.957  62.678 56.311 1.00 24.65 ? 227  GLY A N   1 
ATOM   1725 C CA  . GLY A 1 224 ? 10.108  61.510 56.193 1.00 24.39 ? 227  GLY A CA  1 
ATOM   1726 C C   . GLY A 1 224 ? 10.366  60.745 54.914 1.00 25.30 ? 227  GLY A C   1 
ATOM   1727 O O   . GLY A 1 224 ? 10.762  61.328 53.906 1.00 25.48 ? 227  GLY A O   1 
ATOM   1728 N N   . SER A 1 225 ? 10.161  59.433 54.965 1.00 24.78 ? 228  SER A N   1 
ATOM   1729 C CA  . SER A 1 225 ? 10.348  58.574 53.811 1.00 26.26 ? 228  SER A CA  1 
ATOM   1730 C C   . SER A 1 225 ? 9.372   57.410 53.965 1.00 26.30 ? 228  SER A C   1 
ATOM   1731 O O   . SER A 1 225 ? 8.972   57.066 55.076 1.00 26.67 ? 228  SER A O   1 
ATOM   1732 C CB  . SER A 1 225 ? 11.803  58.086 53.711 1.00 26.21 ? 228  SER A CB  1 
ATOM   1733 O OG  . SER A 1 225 ? 12.176  57.321 54.831 1.00 28.95 ? 228  SER A OG  1 
ATOM   1734 N N   . PRO A 1 226 ? 8.979   56.786 52.848 1.00 26.60 ? 229  PRO A N   1 
ATOM   1735 C CA  . PRO A 1 226 ? 8.029   55.668 52.869 1.00 26.68 ? 229  PRO A CA  1 
ATOM   1736 C C   . PRO A 1 226 ? 8.386   54.475 53.755 1.00 27.00 ? 229  PRO A C   1 
ATOM   1737 O O   . PRO A 1 226 ? 7.495   53.812 54.293 1.00 27.22 ? 229  PRO A O   1 
ATOM   1738 C CB  . PRO A 1 226 ? 7.913   55.299 51.390 1.00 26.02 ? 229  PRO A CB  1 
ATOM   1739 C CG  . PRO A 1 226 ? 9.297   55.584 50.873 1.00 25.46 ? 229  PRO A CG  1 
ATOM   1740 C CD  . PRO A 1 226 ? 9.616   56.914 51.523 1.00 26.34 ? 229  PRO A CD  1 
ATOM   1741 N N   . ASN A 1 227 ? 9.682   54.219 53.916 1.00 26.68 ? 230  ASN A N   1 
ATOM   1742 C CA  . ASN A 1 227 ? 10.164  53.097 54.712 1.00 26.01 ? 230  ASN A CA  1 
ATOM   1743 C C   . ASN A 1 227 ? 10.330  53.371 56.206 1.00 26.13 ? 230  ASN A C   1 
ATOM   1744 O O   . ASN A 1 227 ? 10.900  52.546 56.918 1.00 26.77 ? 230  ASN A O   1 
ATOM   1745 C CB  . ASN A 1 227 ? 11.497  52.593 54.144 1.00 25.58 ? 230  ASN A CB  1 
ATOM   1746 C CG  . ASN A 1 227 ? 12.590  53.656 54.182 1.00 26.51 ? 230  ASN A CG  1 
ATOM   1747 O OD1 . ASN A 1 227 ? 12.387  54.788 53.740 1.00 25.41 ? 230  ASN A OD1 1 
ATOM   1748 N ND2 . ASN A 1 227 ? 13.758  53.290 54.702 1.00 26.30 ? 230  ASN A ND2 1 
ATOM   1749 N N   . CYS A 1 228 ? 9.855   54.514 56.693 1.00 25.49 ? 231  CYS A N   1 
ATOM   1750 C CA  . CYS A 1 228 ? 9.975   54.800 58.124 1.00 25.19 ? 231  CYS A CA  1 
ATOM   1751 C C   . CYS A 1 228 ? 9.244   53.705 58.915 1.00 25.47 ? 231  CYS A C   1 
ATOM   1752 O O   . CYS A 1 228 ? 8.166   53.248 58.521 1.00 24.74 ? 231  CYS A O   1 
ATOM   1753 C CB  . CYS A 1 228 ? 9.398   56.180 58.452 1.00 25.50 ? 231  CYS A CB  1 
ATOM   1754 S SG  . CYS A 1 228 ? 10.457  57.563 57.941 1.00 25.70 ? 231  CYS A SG  1 
ATOM   1755 N N   . PRO A 1 229 ? 9.823   53.277 60.047 1.00 25.11 ? 232  PRO A N   1 
ATOM   1756 C CA  . PRO A 1 229 ? 9.227   52.226 60.877 1.00 24.52 ? 232  PRO A CA  1 
ATOM   1757 C C   . PRO A 1 229 ? 7.810   52.498 61.385 1.00 24.69 ? 232  PRO A C   1 
ATOM   1758 O O   . PRO A 1 229 ? 7.078   51.568 61.724 1.00 23.86 ? 232  PRO A O   1 
ATOM   1759 C CB  . PRO A 1 229 ? 10.252  52.060 62.006 1.00 24.26 ? 232  PRO A CB  1 
ATOM   1760 C CG  . PRO A 1 229 ? 10.816  53.443 62.156 1.00 24.22 ? 232  PRO A CG  1 
ATOM   1761 C CD  . PRO A 1 229 ? 10.994  53.883 60.716 1.00 24.90 ? 232  PRO A CD  1 
ATOM   1762 N N   . TRP A 1 230 ? 7.429   53.772 61.429 1.00 24.58 ? 233  TRP A N   1 
ATOM   1763 C CA  . TRP A 1 230 ? 6.104   54.179 61.893 1.00 24.09 ? 233  TRP A CA  1 
ATOM   1764 C C   . TRP A 1 230 ? 5.120   54.437 60.747 1.00 24.65 ? 233  TRP A C   1 
ATOM   1765 O O   . TRP A 1 230 ? 3.918   54.568 60.978 1.00 25.34 ? 233  TRP A O   1 
ATOM   1766 C CB  . TRP A 1 230 ? 6.220   55.468 62.716 1.00 23.61 ? 233  TRP A CB  1 
ATOM   1767 C CG  . TRP A 1 230 ? 6.980   56.562 61.995 1.00 23.28 ? 233  TRP A CG  1 
ATOM   1768 C CD1 . TRP A 1 230 ? 8.321   56.837 62.096 1.00 23.55 ? 233  TRP A CD1 1 
ATOM   1769 C CD2 . TRP A 1 230 ? 6.461   57.466 61.006 1.00 22.92 ? 233  TRP A CD2 1 
ATOM   1770 N NE1 . TRP A 1 230 ? 8.665   57.851 61.231 1.00 23.41 ? 233  TRP A NE1 1 
ATOM   1771 C CE2 . TRP A 1 230 ? 7.545   58.255 60.550 1.00 23.68 ? 233  TRP A CE2 1 
ATOM   1772 C CE3 . TRP A 1 230 ? 5.187   57.685 60.460 1.00 23.46 ? 233  TRP A CE3 1 
ATOM   1773 C CZ2 . TRP A 1 230 ? 7.391   59.250 59.568 1.00 23.41 ? 233  TRP A CZ2 1 
ATOM   1774 C CZ3 . TRP A 1 230 ? 5.033   58.674 59.486 1.00 23.19 ? 233  TRP A CZ3 1 
ATOM   1775 C CH2 . TRP A 1 230 ? 6.134   59.443 59.050 1.00 23.50 ? 233  TRP A CH2 1 
ATOM   1776 N N   . ALA A 1 231 ? 5.628   54.494 59.520 1.00 24.89 ? 234  ALA A N   1 
ATOM   1777 C CA  . ALA A 1 231 ? 4.805   54.809 58.349 1.00 25.07 ? 234  ALA A CA  1 
ATOM   1778 C C   . ALA A 1 231 ? 3.926   53.721 57.738 1.00 25.46 ? 234  ALA A C   1 
ATOM   1779 O O   . ALA A 1 231 ? 3.099   54.022 56.879 1.00 25.39 ? 234  ALA A O   1 
ATOM   1780 C CB  . ALA A 1 231 ? 5.684   55.416 57.265 1.00 24.40 ? 234  ALA A CB  1 
ATOM   1781 N N   . SER A 1 232 ? 4.099   52.467 58.145 1.00 26.09 ? 235  SER A N   1 
ATOM   1782 C CA  . SER A 1 232 ? 3.256   51.399 57.607 1.00 26.55 ? 235  SER A CA  1 
ATOM   1783 C C   . SER A 1 232 ? 3.243   50.156 58.490 1.00 27.39 ? 235  SER A C   1 
ATOM   1784 O O   . SER A 1 232 ? 4.088   49.997 59.367 1.00 28.09 ? 235  SER A O   1 
ATOM   1785 C CB  . SER A 1 232 ? 3.702   51.015 56.190 1.00 25.94 ? 235  SER A CB  1 
ATOM   1786 O OG  . SER A 1 232 ? 4.971   50.390 56.199 1.00 24.97 ? 235  SER A OG  1 
ATOM   1787 N N   . VAL A 1 233 ? 2.267   49.285 58.255 1.00 27.99 ? 236  VAL A N   1 
ATOM   1788 C CA  . VAL A 1 233 ? 2.136   48.040 59.004 1.00 28.64 ? 236  VAL A CA  1 
ATOM   1789 C C   . VAL A 1 233 ? 1.711   46.943 58.032 1.00 29.27 ? 236  VAL A C   1 
ATOM   1790 O O   . VAL A 1 233 ? 1.303   47.232 56.902 1.00 29.08 ? 236  VAL A O   1 
ATOM   1791 C CB  . VAL A 1 233 ? 1.059   48.137 60.124 1.00 28.46 ? 236  VAL A CB  1 
ATOM   1792 C CG1 . VAL A 1 233 ? 1.434   49.212 61.126 1.00 27.84 ? 236  VAL A CG1 1 
ATOM   1793 C CG2 . VAL A 1 233 ? -0.306  48.422 59.517 1.00 28.01 ? 236  VAL A CG2 1 
ATOM   1794 N N   . SER A 1 234 ? 1.812   45.691 58.469 1.00 28.57 ? 237  SER A N   1 
ATOM   1795 C CA  . SER A 1 234 ? 1.412   44.561 57.638 1.00 28.91 ? 237  SER A CA  1 
ATOM   1796 C C   . SER A 1 234 ? -0.112  44.474 57.686 1.00 28.77 ? 237  SER A C   1 
ATOM   1797 O O   . SER A 1 234 ? -0.740  45.107 58.538 1.00 28.73 ? 237  SER A O   1 
ATOM   1798 C CB  . SER A 1 234 ? 2.018   43.263 58.181 1.00 29.01 ? 237  SER A CB  1 
ATOM   1799 O OG  . SER A 1 234 ? 1.538   42.988 59.489 1.00 29.05 ? 237  SER A OG  1 
ATOM   1800 N N   . VAL A 1 235 ? -0.709  43.697 56.786 1.00 28.92 ? 238  VAL A N   1 
ATOM   1801 C CA  . VAL A 1 235 ? -2.164  43.566 56.778 1.00 29.49 ? 238  VAL A CA  1 
ATOM   1802 C C   . VAL A 1 235 ? -2.657  42.854 58.030 1.00 29.42 ? 238  VAL A C   1 
ATOM   1803 O O   . VAL A 1 235 ? -3.779  43.089 58.482 1.00 29.77 ? 238  VAL A O   1 
ATOM   1804 C CB  . VAL A 1 235 ? -2.674  42.804 55.531 1.00 30.09 ? 238  VAL A CB  1 
ATOM   1805 C CG1 . VAL A 1 235 ? -2.287  43.563 54.271 1.00 29.27 ? 238  VAL A CG1 1 
ATOM   1806 C CG2 . VAL A 1 235 ? -2.115  41.391 55.507 1.00 30.84 ? 238  VAL A CG2 1 
ATOM   1807 N N   . ALA A 1 236 ? -1.812  41.992 58.590 1.00 29.32 ? 239  ALA A N   1 
ATOM   1808 C CA  . ALA A 1 236 ? -2.158  41.257 59.806 1.00 29.55 ? 239  ALA A CA  1 
ATOM   1809 C C   . ALA A 1 236 ? -2.213  42.210 61.004 1.00 29.19 ? 239  ALA A C   1 
ATOM   1810 O O   . ALA A 1 236 ? -3.141  42.153 61.813 1.00 29.66 ? 239  ALA A O   1 
ATOM   1811 C CB  . ALA A 1 236 ? -1.131  40.145 60.062 1.00 28.85 ? 239  ALA A CB  1 
ATOM   1812 N N   . GLU A 1 237 ? -1.218  43.086 61.118 1.00 29.09 ? 240  GLU A N   1 
ATOM   1813 C CA  . GLU A 1 237 ? -1.187  44.045 62.218 1.00 28.36 ? 240  GLU A CA  1 
ATOM   1814 C C   . GLU A 1 237 ? -2.325  45.049 62.053 1.00 27.99 ? 240  GLU A C   1 
ATOM   1815 O O   . GLU A 1 237 ? -2.967  45.440 63.032 1.00 27.30 ? 240  GLU A O   1 
ATOM   1816 C CB  . GLU A 1 237 ? 0.165   44.766 62.260 1.00 28.42 ? 240  GLU A CB  1 
ATOM   1817 C CG  . GLU A 1 237 ? 0.277   45.862 63.326 1.00 29.62 ? 240  GLU A CG  1 
ATOM   1818 C CD  . GLU A 1 237 ? -0.025  45.369 64.739 1.00 30.56 ? 240  GLU A CD  1 
ATOM   1819 O OE1 . GLU A 1 237 ? -0.215  44.146 64.931 1.00 31.88 ? 240  GLU A OE1 1 
ATOM   1820 O OE2 . GLU A 1 237 ? -0.072  46.207 65.663 1.00 30.05 ? 240  GLU A OE2 1 
ATOM   1821 N N   . GLY A 1 238 ? -2.577  45.452 60.807 1.00 28.00 ? 241  GLY A N   1 
ATOM   1822 C CA  . GLY A 1 238 ? -3.649  46.394 60.532 1.00 28.40 ? 241  GLY A CA  1 
ATOM   1823 C C   . GLY A 1 238 ? -4.987  45.821 60.955 1.00 28.84 ? 241  GLY A C   1 
ATOM   1824 O O   . GLY A 1 238 ? -5.818  46.507 61.555 1.00 28.58 ? 241  GLY A O   1 
ATOM   1825 N N   . ARG A 1 239 ? -5.189  44.547 60.636 1.00 29.44 ? 242  ARG A N   1 
ATOM   1826 C CA  . ARG A 1 239 ? -6.410  43.835 60.982 1.00 29.86 ? 242  ARG A CA  1 
ATOM   1827 C C   . ARG A 1 239 ? -6.525  43.693 62.497 1.00 29.86 ? 242  ARG A C   1 
ATOM   1828 O O   . ARG A 1 239 ? -7.595  43.913 63.069 1.00 30.39 ? 242  ARG A O   1 
ATOM   1829 C CB  . ARG A 1 239 ? -6.403  42.458 60.309 1.00 30.59 ? 242  ARG A CB  1 
ATOM   1830 C CG  . ARG A 1 239 ? -7.491  41.495 60.767 1.00 31.12 ? 242  ARG A CG  1 
ATOM   1831 C CD  . ARG A 1 239 ? -7.567  40.300 59.815 1.00 31.40 ? 242  ARG A CD  1 
ATOM   1832 N NE  . ARG A 1 239 ? -8.147  40.680 58.527 1.00 30.07 ? 242  ARG A NE  1 
ATOM   1833 C CZ  . ARG A 1 239 ? -9.449  40.850 58.324 1.00 29.85 ? 242  ARG A CZ  1 
ATOM   1834 N NH1 . ARG A 1 239 ? -10.304 40.662 59.323 1.00 29.14 ? 242  ARG A NH1 1 
ATOM   1835 N NH2 . ARG A 1 239 ? -9.895  41.232 57.133 1.00 29.37 ? 242  ARG A NH2 1 
ATOM   1836 N N   . ARG A 1 240 ? -5.422  43.331 63.148 1.00 29.50 ? 243  ARG A N   1 
ATOM   1837 C CA  . ARG A 1 240 ? -5.422  43.184 64.597 1.00 29.60 ? 243  ARG A CA  1 
ATOM   1838 C C   . ARG A 1 240 ? -5.845  44.484 65.284 1.00 29.41 ? 243  ARG A C   1 
ATOM   1839 O O   . ARG A 1 240 ? -6.654  44.472 66.212 1.00 29.81 ? 243  ARG A O   1 
ATOM   1840 C CB  . ARG A 1 240 ? -4.033  42.794 65.101 1.00 30.77 ? 243  ARG A CB  1 
ATOM   1841 C CG  . ARG A 1 240 ? -3.998  42.514 66.604 1.00 31.67 ? 243  ARG A CG  1 
ATOM   1842 C CD  . ARG A 1 240 ? -2.577  42.457 67.143 1.00 31.94 ? 243  ARG A CD  1 
ATOM   1843 N NE  . ARG A 1 240 ? -1.966  43.782 67.235 1.00 32.39 ? 243  ARG A NE  1 
ATOM   1844 C CZ  . ARG A 1 240 ? -2.352  44.730 68.087 1.00 32.40 ? 243  ARG A CZ  1 
ATOM   1845 N NH1 . ARG A 1 240 ? -3.345  44.509 68.935 1.00 31.81 ? 243  ARG A NH1 1 
ATOM   1846 N NH2 . ARG A 1 240 ? -1.736  45.903 68.097 1.00 33.09 ? 243  ARG A NH2 1 
ATOM   1847 N N   . ARG A 1 241 ? -5.299  45.606 64.826 1.00 29.14 ? 244  ARG A N   1 
ATOM   1848 C CA  . ARG A 1 241 ? -5.624  46.902 65.416 1.00 28.31 ? 244  ARG A CA  1 
ATOM   1849 C C   . ARG A 1 241 ? -7.067  47.318 65.181 1.00 28.66 ? 244  ARG A C   1 
ATOM   1850 O O   . ARG A 1 241 ? -7.693  47.906 66.063 1.00 29.04 ? 244  ARG A O   1 
ATOM   1851 C CB  . ARG A 1 241 ? -4.684  47.986 64.882 1.00 27.36 ? 244  ARG A CB  1 
ATOM   1852 C CG  . ARG A 1 241 ? -3.230  47.732 65.210 1.00 26.33 ? 244  ARG A CG  1 
ATOM   1853 C CD  . ARG A 1 241 ? -2.354  48.887 64.785 1.00 26.30 ? 244  ARG A CD  1 
ATOM   1854 N NE  . ARG A 1 241 ? -0.943  48.582 64.968 1.00 25.78 ? 244  ARG A NE  1 
ATOM   1855 C CZ  . ARG A 1 241 ? 0.042   49.448 64.766 1.00 27.12 ? 244  ARG A CZ  1 
ATOM   1856 N NH1 . ARG A 1 241 ? -0.226  50.688 64.374 1.00 27.23 ? 244  ARG A NH1 1 
ATOM   1857 N NH2 . ARG A 1 241 ? 1.300   49.071 64.948 1.00 26.89 ? 244  ARG A NH2 1 
ATOM   1858 N N   . ALA A 1 242 ? -7.596  47.021 63.997 1.00 29.00 ? 245  ALA A N   1 
ATOM   1859 C CA  . ALA A 1 242 ? -8.978  47.374 63.679 1.00 29.47 ? 245  ALA A CA  1 
ATOM   1860 C C   . ALA A 1 242 ? -9.927  46.599 64.594 1.00 29.96 ? 245  ALA A C   1 
ATOM   1861 O O   . ALA A 1 242 ? -10.906 47.152 65.099 1.00 29.84 ? 245  ALA A O   1 
ATOM   1862 C CB  . ALA A 1 242 ? -9.282  47.063 62.208 1.00 30.06 ? 245  ALA A CB  1 
ATOM   1863 N N   . VAL A 1 243 ? -9.630  45.318 64.803 1.00 30.09 ? 246  VAL A N   1 
ATOM   1864 C CA  . VAL A 1 243 ? -10.449 44.483 65.673 1.00 30.49 ? 246  VAL A CA  1 
ATOM   1865 C C   . VAL A 1 243 ? -10.332 44.984 67.109 1.00 31.44 ? 246  VAL A C   1 
ATOM   1866 O O   . VAL A 1 243 ? -11.321 45.023 67.845 1.00 31.96 ? 246  VAL A O   1 
ATOM   1867 C CB  . VAL A 1 243 ? -10.003 43.004 65.628 1.00 30.82 ? 246  VAL A CB  1 
ATOM   1868 C CG1 . VAL A 1 243 ? -10.805 42.193 66.636 1.00 29.41 ? 246  VAL A CG1 1 
ATOM   1869 C CG2 . VAL A 1 243 ? -10.190 42.436 64.216 1.00 29.58 ? 246  VAL A CG2 1 
ATOM   1870 N N   . GLU A 1 244 ? -9.119  45.366 67.505 1.00 31.49 ? 247  GLU A N   1 
ATOM   1871 C CA  . GLU A 1 244 ? -8.886  45.876 68.848 1.00 31.19 ? 247  GLU A CA  1 
ATOM   1872 C C   . GLU A 1 244 ? -9.654  47.183 69.028 1.00 30.84 ? 247  GLU A C   1 
ATOM   1873 O O   . GLU A 1 244 ? -10.129 47.490 70.125 1.00 30.90 ? 247  GLU A O   1 
ATOM   1874 C CB  . GLU A 1 244 ? -7.389  46.102 69.075 1.00 32.12 ? 247  GLU A CB  1 
ATOM   1875 C CG  . GLU A 1 244 ? -7.003  46.460 70.504 1.00 34.11 ? 247  GLU A CG  1 
ATOM   1876 C CD  . GLU A 1 244 ? -7.478  45.430 71.529 1.00 35.86 ? 247  GLU A CD  1 
ATOM   1877 O OE1 . GLU A 1 244 ? -7.584  44.233 71.173 1.00 35.29 ? 247  GLU A OE1 1 
ATOM   1878 O OE2 . GLU A 1 244 ? -7.733  45.820 72.694 1.00 35.68 ? 247  GLU A OE2 1 
ATOM   1879 N N   . LEU A 1 245 ? -9.785  47.955 67.951 1.00 30.51 ? 248  LEU A N   1 
ATOM   1880 C CA  . LEU A 1 245 ? -10.525 49.213 68.031 1.00 30.36 ? 248  LEU A CA  1 
ATOM   1881 C C   . LEU A 1 245 ? -11.983 48.870 68.302 1.00 30.80 ? 248  LEU A C   1 
ATOM   1882 O O   . LEU A 1 245 ? -12.622 49.468 69.167 1.00 30.05 ? 248  LEU A O   1 
ATOM   1883 C CB  . LEU A 1 245 ? -10.430 50.005 66.724 1.00 29.83 ? 248  LEU A CB  1 
ATOM   1884 C CG  . LEU A 1 245 ? -11.152 51.362 66.768 1.00 30.01 ? 248  LEU A CG  1 
ATOM   1885 C CD1 . LEU A 1 245 ? -10.419 52.284 67.733 1.00 29.84 ? 248  LEU A CD1 1 
ATOM   1886 C CD2 . LEU A 1 245 ? -11.205 51.990 65.384 1.00 29.48 ? 248  LEU A CD2 1 
ATOM   1887 N N   . GLY A 1 246 ? -12.501 47.897 67.556 1.00 31.01 ? 249  GLY A N   1 
ATOM   1888 C CA  . GLY A 1 246 ? -13.875 47.483 67.746 1.00 31.87 ? 249  GLY A CA  1 
ATOM   1889 C C   . GLY A 1 246 ? -14.083 46.959 69.156 1.00 32.68 ? 249  GLY A C   1 
ATOM   1890 O O   . GLY A 1 246 ? -15.123 47.197 69.771 1.00 31.92 ? 249  GLY A O   1 
ATOM   1891 N N   . ARG A 1 247 ? -13.085 46.248 69.673 1.00 33.20 ? 250  ARG A N   1 
ATOM   1892 C CA  . ARG A 1 247 ? -13.166 45.699 71.019 1.00 34.33 ? 250  ARG A CA  1 
ATOM   1893 C C   . ARG A 1 247 ? -13.254 46.818 72.067 1.00 34.93 ? 250  ARG A C   1 
ATOM   1894 O O   . ARG A 1 247 ? -13.899 46.659 73.105 1.00 35.48 ? 250  ARG A O   1 
ATOM   1895 C CB  . ARG A 1 247 ? -11.956 44.800 71.285 1.00 35.57 ? 250  ARG A CB  1 
ATOM   1896 C CG  . ARG A 1 247 ? -12.007 44.071 72.610 1.00 37.48 ? 250  ARG A CG  1 
ATOM   1897 C CD  . ARG A 1 247 ? -10.811 43.148 72.800 1.00 39.43 ? 250  ARG A CD  1 
ATOM   1898 N NE  . ARG A 1 247 ? -10.919 41.923 72.010 1.00 42.74 ? 250  ARG A NE  1 
ATOM   1899 C CZ  . ARG A 1 247 ? -10.294 41.702 70.855 1.00 44.57 ? 250  ARG A CZ  1 
ATOM   1900 N NH1 . ARG A 1 247 ? -9.495  42.627 70.326 1.00 45.06 ? 250  ARG A NH1 1 
ATOM   1901 N NH2 . ARG A 1 247 ? -10.469 40.545 70.226 1.00 44.39 ? 250  ARG A NH2 1 
ATOM   1902 N N   . ASN A 1 248 ? -12.614 47.952 71.788 1.00 34.69 ? 251  ASN A N   1 
ATOM   1903 C CA  . ASN A 1 248 ? -12.630 49.104 72.695 1.00 34.17 ? 251  ASN A CA  1 
ATOM   1904 C C   . ASN A 1 248 ? -13.977 49.832 72.678 1.00 34.74 ? 251  ASN A C   1 
ATOM   1905 O O   . ASN A 1 248 ? -14.279 50.624 73.576 1.00 33.79 ? 251  ASN A O   1 
ATOM   1906 C CB  . ASN A 1 248 ? -11.528 50.098 72.300 1.00 34.10 ? 251  ASN A CB  1 
ATOM   1907 C CG  . ASN A 1 248 ? -10.213 49.829 73.004 1.00 33.39 ? 251  ASN A CG  1 
ATOM   1908 O OD1 . ASN A 1 248 ? -9.931  50.414 74.043 1.00 34.17 ? 251  ASN A OD1 1 
ATOM   1909 N ND2 . ASN A 1 248 ? -9.407  48.937 72.445 1.00 32.80 ? 251  ASN A ND2 1 
ATOM   1910 N N   . LEU A 1 249 ? -14.781 49.566 71.651 1.00 35.40 ? 252  LEU A N   1 
ATOM   1911 C CA  . LEU A 1 249 ? -16.080 50.213 71.506 1.00 36.67 ? 252  LEU A CA  1 
ATOM   1912 C C   . LEU A 1 249 ? -17.253 49.243 71.632 1.00 37.73 ? 252  LEU A C   1 
ATOM   1913 O O   . LEU A 1 249 ? -18.374 49.547 71.218 1.00 37.19 ? 252  LEU A O   1 
ATOM   1914 C CB  . LEU A 1 249 ? -16.136 50.954 70.168 1.00 36.13 ? 252  LEU A CB  1 
ATOM   1915 C CG  . LEU A 1 249 ? -15.072 52.057 70.077 1.00 36.58 ? 252  LEU A CG  1 
ATOM   1916 C CD1 . LEU A 1 249 ? -15.010 52.623 68.673 1.00 35.97 ? 252  LEU A CD1 1 
ATOM   1917 C CD2 . LEU A 1 249 ? -15.387 53.152 71.088 1.00 36.49 ? 252  LEU A CD2 1 
ATOM   1918 N N   . ASN A 1 250 ? -16.975 48.078 72.212 1.00 39.11 ? 253  ASN A N   1 
ATOM   1919 C CA  . ASN A 1 250 ? -17.986 47.052 72.440 1.00 40.49 ? 253  ASN A CA  1 
ATOM   1920 C C   . ASN A 1 250 ? -18.665 46.613 71.149 1.00 40.36 ? 253  ASN A C   1 
ATOM   1921 O O   . ASN A 1 250 ? -19.875 46.418 71.112 1.00 41.01 ? 253  ASN A O   1 
ATOM   1922 C CB  . ASN A 1 250 ? -19.036 47.585 73.418 1.00 42.39 ? 253  ASN A CB  1 
ATOM   1923 C CG  . ASN A 1 250 ? -18.419 48.382 74.561 1.00 44.28 ? 253  ASN A CG  1 
ATOM   1924 O OD1 . ASN A 1 250 ? -17.558 47.881 75.295 1.00 44.90 ? 253  ASN A OD1 1 
ATOM   1925 N ND2 . ASN A 1 250 ? -18.857 49.633 74.715 1.00 45.13 ? 253  ASN A ND2 1 
ATOM   1926 N N   . CYS A 1 251 ? -17.881 46.455 70.091 1.00 39.82 ? 254  CYS A N   1 
ATOM   1927 C CA  . CYS A 1 251 ? -18.426 46.050 68.807 1.00 39.72 ? 254  CYS A CA  1 
ATOM   1928 C C   . CYS A 1 251 ? -18.537 44.545 68.663 1.00 40.54 ? 254  CYS A C   1 
ATOM   1929 O O   . CYS A 1 251 ? -17.839 43.791 69.345 1.00 40.76 ? 254  CYS A O   1 
ATOM   1930 C CB  . CYS A 1 251 ? -17.551 46.567 67.667 1.00 38.65 ? 254  CYS A CB  1 
ATOM   1931 S SG  . CYS A 1 251 ? -17.715 48.330 67.252 1.00 38.15 ? 254  CYS A SG  1 
ATOM   1932 N N   . ASN A 1 252 ? -19.420 44.117 67.764 1.00 41.17 ? 255  ASN A N   1 
ATOM   1933 C CA  . ASN A 1 252 ? -19.597 42.700 67.476 1.00 41.51 ? 255  ASN A CA  1 
ATOM   1934 C C   . ASN A 1 252 ? -18.382 42.359 66.612 1.00 41.28 ? 255  ASN A C   1 
ATOM   1935 O O   . ASN A 1 252 ? -18.170 42.970 65.563 1.00 40.80 ? 255  ASN A O   1 
ATOM   1936 C CB  . ASN A 1 252 ? -20.891 42.480 66.689 1.00 42.57 ? 255  ASN A CB  1 
ATOM   1937 C CG  . ASN A 1 252 ? -21.140 41.018 66.372 1.00 43.40 ? 255  ASN A CG  1 
ATOM   1938 O OD1 . ASN A 1 252 ? -20.317 40.356 65.734 1.00 43.82 ? 255  ASN A OD1 1 
ATOM   1939 N ND2 . ASN A 1 252 ? -22.281 40.507 66.816 1.00 43.94 ? 255  ASN A ND2 1 
ATOM   1940 N N   . LEU A 1 253 ? -17.581 41.396 67.051 1.00 41.38 ? 256  LEU A N   1 
ATOM   1941 C CA  . LEU A 1 253 ? -16.374 41.038 66.315 1.00 42.11 ? 256  LEU A CA  1 
ATOM   1942 C C   . LEU A 1 253 ? -16.468 39.727 65.537 1.00 42.97 ? 256  LEU A C   1 
ATOM   1943 O O   . LEU A 1 253 ? -15.447 39.155 65.148 1.00 43.06 ? 256  LEU A O   1 
ATOM   1944 C CB  . LEU A 1 253 ? -15.190 40.978 67.288 1.00 41.59 ? 256  LEU A CB  1 
ATOM   1945 C CG  . LEU A 1 253 ? -15.103 42.150 68.274 1.00 41.28 ? 256  LEU A CG  1 
ATOM   1946 C CD1 . LEU A 1 253 ? -13.892 41.967 69.177 1.00 40.15 ? 256  LEU A CD1 1 
ATOM   1947 C CD2 . LEU A 1 253 ? -15.020 43.472 67.510 1.00 40.65 ? 256  LEU A CD2 1 
ATOM   1948 N N   . ASN A 1 254 ? -17.691 39.263 65.298 1.00 43.70 ? 257  ASN A N   1 
ATOM   1949 C CA  . ASN A 1 254 ? -17.908 38.014 64.573 1.00 44.09 ? 257  ASN A CA  1 
ATOM   1950 C C   . ASN A 1 254 ? -17.429 38.042 63.126 1.00 43.28 ? 257  ASN A C   1 
ATOM   1951 O O   . ASN A 1 254 ? -16.991 37.026 62.594 1.00 43.40 ? 257  ASN A O   1 
ATOM   1952 C CB  . ASN A 1 254 ? -19.393 37.651 64.595 1.00 46.11 ? 257  ASN A CB  1 
ATOM   1953 C CG  . ASN A 1 254 ? -19.869 37.219 65.968 1.00 48.04 ? 257  ASN A CG  1 
ATOM   1954 O OD1 . ASN A 1 254 ? -21.070 37.028 66.186 1.00 49.50 ? 257  ASN A OD1 1 
ATOM   1955 N ND2 . ASN A 1 254 ? -18.933 37.053 66.902 1.00 47.94 ? 257  ASN A ND2 1 
ATOM   1956 N N   . SER A 1 255 ? -17.524 39.199 62.483 1.00 42.38 ? 258  SER A N   1 
ATOM   1957 C CA  . SER A 1 255 ? -17.101 39.318 61.094 1.00 41.29 ? 258  SER A CA  1 
ATOM   1958 C C   . SER A 1 255 ? -16.740 40.751 60.740 1.00 40.40 ? 258  SER A C   1 
ATOM   1959 O O   . SER A 1 255 ? -17.138 41.689 61.429 1.00 40.00 ? 258  SER A O   1 
ATOM   1960 C CB  . SER A 1 255 ? -18.222 38.852 60.166 1.00 41.27 ? 258  SER A CB  1 
ATOM   1961 O OG  . SER A 1 255 ? -19.329 39.737 60.233 1.00 41.53 ? 258  SER A OG  1 
ATOM   1962 N N   . ASP A 1 256 ? -15.990 40.916 59.655 1.00 39.94 ? 259  ASP A N   1 
ATOM   1963 C CA  . ASP A 1 256 ? -15.604 42.248 59.210 1.00 39.59 ? 259  ASP A CA  1 
ATOM   1964 C C   . ASP A 1 256 ? -16.871 43.074 59.003 1.00 39.41 ? 259  ASP A C   1 
ATOM   1965 O O   . ASP A 1 256 ? -16.915 44.260 59.327 1.00 39.52 ? 259  ASP A O   1 
ATOM   1966 C CB  . ASP A 1 256 ? -14.812 42.175 57.899 1.00 38.96 ? 259  ASP A CB  1 
ATOM   1967 C CG  . ASP A 1 256 ? -13.432 41.551 58.075 1.00 39.15 ? 259  ASP A CG  1 
ATOM   1968 O OD1 . ASP A 1 256 ? -12.980 41.381 59.229 1.00 38.84 ? 259  ASP A OD1 1 
ATOM   1969 O OD2 . ASP A 1 256 ? -12.790 41.243 57.049 1.00 39.53 ? 259  ASP A OD2 1 
ATOM   1970 N N   . GLU A 1 257 ? -17.906 42.433 58.472 1.00 39.44 ? 260  GLU A N   1 
ATOM   1971 C CA  . GLU A 1 257 ? -19.177 43.103 58.223 1.00 40.00 ? 260  GLU A CA  1 
ATOM   1972 C C   . GLU A 1 257 ? -19.744 43.667 59.525 1.00 39.80 ? 260  GLU A C   1 
ATOM   1973 O O   . GLU A 1 257 ? -20.178 44.823 59.577 1.00 39.55 ? 260  GLU A O   1 
ATOM   1974 C CB  . GLU A 1 257 ? -20.178 42.122 57.604 1.00 40.86 ? 260  GLU A CB  1 
ATOM   1975 C CG  . GLU A 1 257 ? -19.644 41.362 56.385 1.00 42.21 ? 260  GLU A CG  1 
ATOM   1976 C CD  . GLU A 1 257 ? -18.493 40.418 56.730 1.00 42.18 ? 260  GLU A CD  1 
ATOM   1977 N N   . GLU A 1 258 ? -19.740 42.842 60.570 1.00 39.25 ? 261  GLU A N   1 
ATOM   1978 C CA  . GLU A 1 258 ? -20.243 43.247 61.880 1.00 39.19 ? 261  GLU A CA  1 
ATOM   1979 C C   . GLU A 1 258 ? -19.388 44.375 62.459 1.00 37.62 ? 261  GLU A C   1 
ATOM   1980 O O   . GLU A 1 258 ? -19.911 45.397 62.906 1.00 36.45 ? 261  GLU A O   1 
ATOM   1981 C CB  . GLU A 1 258 ? -20.230 42.059 62.851 1.00 41.21 ? 261  GLU A CB  1 
ATOM   1982 C CG  . GLU A 1 258 ? -21.344 41.033 62.662 1.00 45.55 ? 261  GLU A CG  1 
ATOM   1983 C CD  . GLU A 1 258 ? -22.721 41.572 63.041 1.00 48.34 ? 261  GLU A CD  1 
ATOM   1984 O OE1 . GLU A 1 258 ? -22.846 42.250 64.086 1.00 49.61 ? 261  GLU A OE1 1 
ATOM   1985 O OE2 . GLU A 1 258 ? -23.687 41.306 62.298 1.00 50.32 ? 261  GLU A OE2 1 
ATOM   1986 N N   . LEU A 1 259 ? -18.071 44.175 62.447 1.00 36.28 ? 262  LEU A N   1 
ATOM   1987 C CA  . LEU A 1 259 ? -17.123 45.157 62.969 1.00 34.99 ? 262  LEU A CA  1 
ATOM   1988 C C   . LEU A 1 259 ? -17.250 46.500 62.255 1.00 34.82 ? 262  LEU A C   1 
ATOM   1989 O O   . LEU A 1 259 ? -17.438 47.537 62.892 1.00 34.06 ? 262  LEU A O   1 
ATOM   1990 C CB  . LEU A 1 259 ? -15.691 44.626 62.827 1.00 33.97 ? 262  LEU A CB  1 
ATOM   1991 C CG  . LEU A 1 259 ? -14.523 45.519 63.268 1.00 32.93 ? 262  LEU A CG  1 
ATOM   1992 C CD1 . LEU A 1 259 ? -14.787 46.103 64.649 1.00 31.93 ? 262  LEU A CD1 1 
ATOM   1993 C CD2 . LEU A 1 259 ? -13.243 44.695 63.271 1.00 31.78 ? 262  LEU A CD2 1 
ATOM   1994 N N   . ILE A 1 260 ? -17.158 46.469 60.929 1.00 35.01 ? 263  ILE A N   1 
ATOM   1995 C CA  . ILE A 1 260 ? -17.250 47.679 60.125 1.00 35.62 ? 263  ILE A CA  1 
ATOM   1996 C C   . ILE A 1 260 ? -18.573 48.402 60.329 1.00 36.06 ? 263  ILE A C   1 
ATOM   1997 O O   . ILE A 1 260 ? -18.602 49.623 60.464 1.00 36.21 ? 263  ILE A O   1 
ATOM   1998 C CB  . ILE A 1 260 ? -17.092 47.365 58.620 1.00 35.89 ? 263  ILE A CB  1 
ATOM   1999 C CG1 . ILE A 1 260 ? -15.683 46.840 58.340 1.00 35.42 ? 263  ILE A CG1 1 
ATOM   2000 C CG2 . ILE A 1 260 ? -17.367 48.610 57.794 1.00 35.47 ? 263  ILE A CG2 1 
ATOM   2001 C CD1 . ILE A 1 260 ? -15.469 46.444 56.895 1.00 35.18 ? 263  ILE A CD1 1 
ATOM   2002 N N   . HIS A 1 261 ? -19.668 47.652 60.347 1.00 36.76 ? 264  HIS A N   1 
ATOM   2003 C CA  . HIS A 1 261 ? -20.977 48.262 60.526 1.00 37.50 ? 264  HIS A CA  1 
ATOM   2004 C C   . HIS A 1 261 ? -21.073 48.987 61.857 1.00 37.32 ? 264  HIS A C   1 
ATOM   2005 O O   . HIS A 1 261 ? -21.686 50.047 61.953 1.00 37.55 ? 264  HIS A O   1 
ATOM   2006 C CB  . HIS A 1 261 ? -22.083 47.210 60.434 1.00 39.34 ? 264  HIS A CB  1 
ATOM   2007 C CG  . HIS A 1 261 ? -23.419 47.714 60.876 1.00 41.37 ? 264  HIS A CG  1 
ATOM   2008 N ND1 . HIS A 1 261 ? -23.814 47.711 62.197 1.00 42.97 ? 264  HIS A ND1 1 
ATOM   2009 C CD2 . HIS A 1 261 ? -24.420 48.308 60.185 1.00 42.70 ? 264  HIS A CD2 1 
ATOM   2010 C CE1 . HIS A 1 261 ? -25.000 48.285 62.302 1.00 43.39 ? 264  HIS A CE1 1 
ATOM   2011 N NE2 . HIS A 1 261 ? -25.390 48.657 61.095 1.00 44.16 ? 264  HIS A NE2 1 
ATOM   2012 N N   . CYS A 1 262 ? -20.468 48.403 62.884 1.00 36.80 ? 265  CYS A N   1 
ATOM   2013 C CA  . CYS A 1 262 ? -20.470 48.992 64.216 1.00 36.19 ? 265  CYS A CA  1 
ATOM   2014 C C   . CYS A 1 262 ? -19.636 50.275 64.238 1.00 35.26 ? 265  CYS A C   1 
ATOM   2015 O O   . CYS A 1 262 ? -20.068 51.302 64.760 1.00 34.16 ? 265  CYS A O   1 
ATOM   2016 C CB  . CYS A 1 262 ? -19.910 47.980 65.215 1.00 36.34 ? 265  CYS A CB  1 
ATOM   2017 S SG  . CYS A 1 262 ? -19.702 48.552 66.936 1.00 39.02 ? 265  CYS A SG  1 
ATOM   2018 N N   . LEU A 1 263 ? -18.440 50.212 63.660 1.00 34.83 ? 266  LEU A N   1 
ATOM   2019 C CA  . LEU A 1 263 ? -17.563 51.376 63.634 1.00 34.57 ? 266  LEU A CA  1 
ATOM   2020 C C   . LEU A 1 263 ? -18.203 52.527 62.865 1.00 34.95 ? 266  LEU A C   1 
ATOM   2021 O O   . LEU A 1 263 ? -17.909 53.693 63.121 1.00 34.41 ? 266  LEU A O   1 
ATOM   2022 C CB  . LEU A 1 263 ? -16.210 51.008 63.016 1.00 32.55 ? 266  LEU A CB  1 
ATOM   2023 C CG  . LEU A 1 263 ? -15.357 50.036 63.838 1.00 31.96 ? 266  LEU A CG  1 
ATOM   2024 C CD1 . LEU A 1 263 ? -14.119 49.639 63.057 1.00 30.93 ? 266  LEU A CD1 1 
ATOM   2025 C CD2 . LEU A 1 263 ? -14.971 50.684 65.160 1.00 31.16 ? 266  LEU A CD2 1 
ATOM   2026 N N   . ARG A 1 264 ? -19.091 52.199 61.931 1.00 35.68 ? 267  ARG A N   1 
ATOM   2027 C CA  . ARG A 1 264 ? -19.756 53.228 61.141 1.00 36.40 ? 267  ARG A CA  1 
ATOM   2028 C C   . ARG A 1 264 ? -20.868 53.952 61.884 1.00 36.61 ? 267  ARG A C   1 
ATOM   2029 O O   . ARG A 1 264 ? -21.218 55.075 61.531 1.00 37.03 ? 267  ARG A O   1 
ATOM   2030 C CB  . ARG A 1 264 ? -20.293 52.638 59.835 1.00 36.01 ? 267  ARG A CB  1 
ATOM   2031 C CG  . ARG A 1 264 ? -19.238 52.580 58.749 1.00 36.45 ? 267  ARG A CG  1 
ATOM   2032 C CD  . ARG A 1 264 ? -19.745 51.928 57.487 1.00 36.39 ? 267  ARG A CD  1 
ATOM   2033 N NE  . ARG A 1 264 ? -18.706 51.900 56.466 1.00 38.00 ? 267  ARG A NE  1 
ATOM   2034 C CZ  . ARG A 1 264 ? -18.737 51.128 55.383 1.00 39.14 ? 267  ARG A CZ  1 
ATOM   2035 N NH1 . ARG A 1 264 ? -19.763 50.310 55.175 1.00 39.01 ? 267  ARG A NH1 1 
ATOM   2036 N NH2 . ARG A 1 264 ? -17.738 51.171 54.507 1.00 39.19 ? 267  ARG A NH2 1 
ATOM   2037 N N   . GLU A 1 265 ? -21.423 53.321 62.911 1.00 37.28 ? 268  GLU A N   1 
ATOM   2038 C CA  . GLU A 1 265 ? -22.486 53.959 63.678 1.00 38.58 ? 268  GLU A CA  1 
ATOM   2039 C C   . GLU A 1 265 ? -21.916 54.843 64.781 1.00 38.64 ? 268  GLU A C   1 
ATOM   2040 O O   . GLU A 1 265 ? -22.635 55.652 65.368 1.00 39.54 ? 268  GLU A O   1 
ATOM   2041 C CB  . GLU A 1 265 ? -23.427 52.911 64.288 1.00 38.94 ? 268  GLU A CB  1 
ATOM   2042 C CG  . GLU A 1 265 ? -24.295 52.185 63.262 1.00 40.44 ? 268  GLU A CG  1 
ATOM   2043 C CD  . GLU A 1 265 ? -25.105 53.141 62.391 1.00 40.20 ? 268  GLU A CD  1 
ATOM   2044 N N   . LYS A 1 266 ? -20.624 54.688 65.057 1.00 38.16 ? 269  LYS A N   1 
ATOM   2045 C CA  . LYS A 1 266 ? -19.970 55.480 66.089 1.00 38.22 ? 269  LYS A CA  1 
ATOM   2046 C C   . LYS A 1 266 ? -19.733 56.904 65.610 1.00 38.11 ? 269  LYS A C   1 
ATOM   2047 O O   . LYS A 1 266 ? -19.532 57.148 64.420 1.00 38.64 ? 269  LYS A O   1 
ATOM   2048 C CB  . LYS A 1 266 ? -18.623 54.859 66.466 1.00 38.17 ? 269  LYS A CB  1 
ATOM   2049 C CG  . LYS A 1 266 ? -18.700 53.427 66.961 1.00 39.32 ? 269  LYS A CG  1 
ATOM   2050 C CD  . LYS A 1 266 ? -19.501 53.322 68.252 1.00 39.18 ? 269  LYS A CD  1 
ATOM   2051 C CE  . LYS A 1 266 ? -19.606 51.876 68.718 1.00 39.88 ? 269  LYS A CE  1 
ATOM   2052 N NZ  . LYS A 1 266 ? -20.315 51.759 70.027 1.00 40.64 ? 269  LYS A NZ  1 
ATOM   2053 N N   . LYS A 1 267 ? -19.772 57.849 66.540 1.00 38.19 ? 270  LYS A N   1 
ATOM   2054 C CA  . LYS A 1 267 ? -19.510 59.239 66.202 1.00 37.93 ? 270  LYS A CA  1 
ATOM   2055 C C   . LYS A 1 267 ? -17.992 59.355 66.055 1.00 36.95 ? 270  LYS A C   1 
ATOM   2056 O O   . LYS A 1 267 ? -17.241 58.588 66.661 1.00 36.71 ? 270  LYS A O   1 
ATOM   2057 C CB  . LYS A 1 267 ? -20.010 60.169 67.313 1.00 38.50 ? 270  LYS A CB  1 
ATOM   2058 C CG  . LYS A 1 267 ? -21.524 60.228 67.431 1.00 39.44 ? 270  LYS A CG  1 
ATOM   2059 C CD  . LYS A 1 267 ? -21.959 61.145 68.568 1.00 40.34 ? 270  LYS A CD  1 
ATOM   2060 N N   . PRO A 1 268 ? -17.521 60.308 65.244 1.00 35.75 ? 271  PRO A N   1 
ATOM   2061 C CA  . PRO A 1 268 ? -16.080 60.480 65.049 1.00 35.35 ? 271  PRO A CA  1 
ATOM   2062 C C   . PRO A 1 268 ? -15.269 60.482 66.344 1.00 34.13 ? 271  PRO A C   1 
ATOM   2063 O O   . PRO A 1 268 ? -14.309 59.730 66.481 1.00 33.25 ? 271  PRO A O   1 
ATOM   2064 C CB  . PRO A 1 268 ? -15.997 61.811 64.304 1.00 36.04 ? 271  PRO A CB  1 
ATOM   2065 C CG  . PRO A 1 268 ? -17.241 61.780 63.464 1.00 35.99 ? 271  PRO A CG  1 
ATOM   2066 C CD  . PRO A 1 268 ? -18.281 61.286 64.447 1.00 35.38 ? 271  PRO A CD  1 
ATOM   2067 N N   . GLN A 1 269 ? -15.670 61.317 67.295 1.00 33.92 ? 272  GLN A N   1 
ATOM   2068 C CA  . GLN A 1 269 ? -14.960 61.425 68.565 1.00 34.27 ? 272  GLN A CA  1 
ATOM   2069 C C   . GLN A 1 269 ? -14.894 60.133 69.393 1.00 33.70 ? 272  GLN A C   1 
ATOM   2070 O O   . GLN A 1 269 ? -14.027 59.990 70.253 1.00 33.76 ? 272  GLN A O   1 
ATOM   2071 C CB  . GLN A 1 269 ? -15.570 62.554 69.399 1.00 34.81 ? 272  GLN A CB  1 
ATOM   2072 C CG  . GLN A 1 269 ? -14.682 63.021 70.544 1.00 36.73 ? 272  GLN A CG  1 
ATOM   2073 C CD  . GLN A 1 269 ? -13.275 63.383 70.081 1.00 37.49 ? 272  GLN A CD  1 
ATOM   2074 O OE1 . GLN A 1 269 ? -13.099 64.149 69.127 1.00 36.18 ? 272  GLN A OE1 1 
ATOM   2075 N NE2 . GLN A 1 269 ? -12.265 62.834 70.762 1.00 37.48 ? 272  GLN A NE2 1 
ATOM   2076 N N   . GLU A 1 270 ? -15.802 59.195 69.147 1.00 33.23 ? 273  GLU A N   1 
ATOM   2077 C CA  . GLU A 1 270 ? -15.786 57.932 69.888 1.00 32.64 ? 273  GLU A CA  1 
ATOM   2078 C C   . GLU A 1 270 ? -14.616 57.072 69.430 1.00 31.75 ? 273  GLU A C   1 
ATOM   2079 O O   . GLU A 1 270 ? -13.999 56.368 70.229 1.00 31.14 ? 273  GLU A O   1 
ATOM   2080 C CB  . GLU A 1 270 ? -17.096 57.166 69.687 1.00 32.65 ? 273  GLU A CB  1 
ATOM   2081 C CG  . GLU A 1 270 ? -18.301 57.847 70.310 1.00 34.85 ? 273  GLU A CG  1 
ATOM   2082 C CD  . GLU A 1 270 ? -19.592 57.081 70.069 1.00 36.30 ? 273  GLU A CD  1 
ATOM   2083 O OE1 . GLU A 1 270 ? -19.739 55.964 70.614 1.00 35.62 ? 273  GLU A OE1 1 
ATOM   2084 O OE2 . GLU A 1 270 ? -20.456 57.600 69.329 1.00 37.37 ? 273  GLU A OE2 1 
ATOM   2085 N N   . LEU A 1 271 ? -14.328 57.122 68.133 1.00 30.72 ? 274  LEU A N   1 
ATOM   2086 C CA  . LEU A 1 271 ? -13.223 56.368 67.568 1.00 30.89 ? 274  LEU A CA  1 
ATOM   2087 C C   . LEU A 1 271 ? -11.915 57.012 68.034 1.00 30.35 ? 274  LEU A C   1 
ATOM   2088 O O   . LEU A 1 271 ? -10.974 56.328 68.435 1.00 30.17 ? 274  LEU A O   1 
ATOM   2089 C CB  . LEU A 1 271 ? -13.305 56.388 66.038 1.00 31.65 ? 274  LEU A CB  1 
ATOM   2090 C CG  . LEU A 1 271 ? -13.999 55.236 65.292 1.00 33.40 ? 274  LEU A CG  1 
ATOM   2091 C CD1 . LEU A 1 271 ? -15.279 54.807 65.991 1.00 33.23 ? 274  LEU A CD1 1 
ATOM   2092 C CD2 . LEU A 1 271 ? -14.294 55.680 63.868 1.00 33.25 ? 274  LEU A CD2 1 
ATOM   2093 N N   . ILE A 1 272 ? -11.876 58.338 67.996 1.00 29.56 ? 275  ILE A N   1 
ATOM   2094 C CA  . ILE A 1 272 ? -10.694 59.083 68.399 1.00 29.42 ? 275  ILE A CA  1 
ATOM   2095 C C   . ILE A 1 272 ? -10.350 58.924 69.883 1.00 29.19 ? 275  ILE A C   1 
ATOM   2096 O O   . ILE A 1 272 ? -9.179  58.900 70.245 1.00 28.29 ? 275  ILE A O   1 
ATOM   2097 C CB  . ILE A 1 272 ? -10.863 60.581 68.062 1.00 29.08 ? 275  ILE A CB  1 
ATOM   2098 C CG1 . ILE A 1 272 ? -10.979 60.752 66.547 1.00 27.90 ? 275  ILE A CG1 1 
ATOM   2099 C CG2 . ILE A 1 272 ? -9.679  61.390 68.594 1.00 28.48 ? 275  ILE A CG2 1 
ATOM   2100 C CD1 . ILE A 1 272 ? -11.317 62.162 66.116 1.00 26.41 ? 275  ILE A CD1 1 
ATOM   2101 N N   . ASP A 1 273 ? -11.360 58.806 70.737 1.00 29.31 ? 276  ASP A N   1 
ATOM   2102 C CA  . ASP A 1 273 ? -11.115 58.651 72.171 1.00 30.38 ? 276  ASP A CA  1 
ATOM   2103 C C   . ASP A 1 273 ? -10.368 57.372 72.572 1.00 30.35 ? 276  ASP A C   1 
ATOM   2104 O O   . ASP A 1 273 ? -9.751  57.323 73.639 1.00 31.15 ? 276  ASP A O   1 
ATOM   2105 C CB  . ASP A 1 273 ? -12.430 58.695 72.954 1.00 31.64 ? 276  ASP A CB  1 
ATOM   2106 C CG  . ASP A 1 273 ? -12.989 60.093 73.087 1.00 33.41 ? 276  ASP A CG  1 
ATOM   2107 O OD1 . ASP A 1 273 ? -12.217 61.076 72.977 1.00 34.82 ? 276  ASP A OD1 1 
ATOM   2108 O OD2 . ASP A 1 273 ? -14.206 60.206 73.323 1.00 34.64 ? 276  ASP A OD2 1 
ATOM   2109 N N   . VAL A 1 274 ? -10.422 56.344 71.727 1.00 29.27 ? 277  VAL A N   1 
ATOM   2110 C CA  . VAL A 1 274 ? -9.773  55.072 72.033 1.00 28.47 ? 277  VAL A CA  1 
ATOM   2111 C C   . VAL A 1 274 ? -8.718  54.687 71.003 1.00 28.32 ? 277  VAL A C   1 
ATOM   2112 O O   . VAL A 1 274 ? -8.148  53.600 71.067 1.00 28.68 ? 277  VAL A O   1 
ATOM   2113 C CB  . VAL A 1 274 ? -10.821 53.929 72.108 1.00 28.57 ? 277  VAL A CB  1 
ATOM   2114 C CG1 . VAL A 1 274 ? -11.793 54.184 73.248 1.00 28.39 ? 277  VAL A CG1 1 
ATOM   2115 C CG2 . VAL A 1 274 ? -11.587 53.839 70.790 1.00 27.62 ? 277  VAL A CG2 1 
ATOM   2116 N N   . GLU A 1 275 ? -8.466  55.587 70.060 1.00 27.65 ? 278  GLU A N   1 
ATOM   2117 C CA  . GLU A 1 275 ? -7.503  55.366 68.987 1.00 27.19 ? 278  GLU A CA  1 
ATOM   2118 C C   . GLU A 1 275 ? -6.124  54.870 69.446 1.00 27.69 ? 278  GLU A C   1 
ATOM   2119 O O   . GLU A 1 275 ? -5.546  53.959 68.843 1.00 26.90 ? 278  GLU A O   1 
ATOM   2120 C CB  . GLU A 1 275 ? -7.340  56.666 68.195 1.00 27.12 ? 278  GLU A CB  1 
ATOM   2121 C CG  . GLU A 1 275 ? -6.449  56.570 66.973 1.00 27.55 ? 278  GLU A CG  1 
ATOM   2122 C CD  . GLU A 1 275 ? -6.223  57.919 66.302 1.00 28.06 ? 278  GLU A CD  1 
ATOM   2123 O OE1 . GLU A 1 275 ? -7.177  58.727 66.228 1.00 27.54 ? 278  GLU A OE1 1 
ATOM   2124 O OE2 . GLU A 1 275 ? -5.092  58.167 65.835 1.00 29.22 ? 278  GLU A OE2 1 
ATOM   2125 N N   . TRP A 1 276 ? -5.597  55.464 70.511 1.00 27.85 ? 279  TRP A N   1 
ATOM   2126 C CA  . TRP A 1 276 ? -4.277  55.092 70.999 1.00 28.21 ? 279  TRP A CA  1 
ATOM   2127 C C   . TRP A 1 276 ? -4.223  53.803 71.810 1.00 28.88 ? 279  TRP A C   1 
ATOM   2128 O O   . TRP A 1 276 ? -3.138  53.332 72.157 1.00 29.44 ? 279  TRP A O   1 
ATOM   2129 C CB  . TRP A 1 276 ? -3.682  56.241 71.821 1.00 28.65 ? 279  TRP A CB  1 
ATOM   2130 C CG  . TRP A 1 276 ? -3.604  57.528 71.062 1.00 28.68 ? 279  TRP A CG  1 
ATOM   2131 C CD1 . TRP A 1 276 ? -4.566  58.493 70.986 1.00 29.47 ? 279  TRP A CD1 1 
ATOM   2132 C CD2 . TRP A 1 276 ? -2.526  57.970 70.228 1.00 28.94 ? 279  TRP A CD2 1 
ATOM   2133 N NE1 . TRP A 1 276 ? -4.155  59.510 70.156 1.00 29.55 ? 279  TRP A NE1 1 
ATOM   2134 C CE2 . TRP A 1 276 ? -2.906  59.214 69.677 1.00 29.81 ? 279  TRP A CE2 1 
ATOM   2135 C CE3 . TRP A 1 276 ? -1.275  57.435 69.891 1.00 29.42 ? 279  TRP A CE3 1 
ATOM   2136 C CZ2 . TRP A 1 276 ? -2.076  59.935 68.805 1.00 30.38 ? 279  TRP A CZ2 1 
ATOM   2137 C CZ3 . TRP A 1 276 ? -0.449  58.151 69.022 1.00 28.75 ? 279  TRP A CZ3 1 
ATOM   2138 C CH2 . TRP A 1 276 ? -0.856  59.387 68.491 1.00 29.11 ? 279  TRP A CH2 1 
ATOM   2139 N N   . ASN A 1 277 ? -5.378  53.213 72.100 1.00 28.83 ? 280  ASN A N   1 
ATOM   2140 C CA  . ASN A 1 277 ? -5.390  51.984 72.886 1.00 29.21 ? 280  ASN A CA  1 
ATOM   2141 C C   . ASN A 1 277 ? -5.026  50.725 72.096 1.00 29.27 ? 280  ASN A C   1 
ATOM   2142 O O   . ASN A 1 277 ? -4.749  49.682 72.684 1.00 29.77 ? 280  ASN A O   1 
ATOM   2143 C CB  . ASN A 1 277 ? -6.759  51.788 73.549 1.00 28.84 ? 280  ASN A CB  1 
ATOM   2144 C CG  . ASN A 1 277 ? -7.145  52.953 74.457 1.00 30.16 ? 280  ASN A CG  1 
ATOM   2145 O OD1 . ASN A 1 277 ? -6.282  53.686 74.950 1.00 30.13 ? 280  ASN A OD1 1 
ATOM   2146 N ND2 . ASN A 1 277 ? -8.447  53.116 74.695 1.00 28.79 ? 280  ASN A ND2 1 
ATOM   2147 N N   . VAL A 1 278 ? -5.002  50.821 70.770 1.00 29.43 ? 281  VAL A N   1 
ATOM   2148 C CA  . VAL A 1 278 ? -4.709  49.653 69.940 1.00 29.01 ? 281  VAL A CA  1 
ATOM   2149 C C   . VAL A 1 278 ? -3.235  49.399 69.638 1.00 29.28 ? 281  VAL A C   1 
ATOM   2150 O O   . VAL A 1 278 ? -2.898  48.382 69.031 1.00 28.46 ? 281  VAL A O   1 
ATOM   2151 C CB  . VAL A 1 278 ? -5.488  49.714 68.590 1.00 29.10 ? 281  VAL A CB  1 
ATOM   2152 C CG1 . VAL A 1 278 ? -6.970  49.945 68.861 1.00 28.05 ? 281  VAL A CG1 1 
ATOM   2153 C CG2 . VAL A 1 278 ? -4.924  50.816 67.693 1.00 28.42 ? 281  VAL A CG2 1 
ATOM   2154 N N   . LEU A 1 279 ? -2.355  50.310 70.050 1.00 29.21 ? 282  LEU A N   1 
ATOM   2155 C CA  . LEU A 1 279 ? -0.927  50.120 69.802 1.00 29.40 ? 282  LEU A CA  1 
ATOM   2156 C C   . LEU A 1 279 ? -0.443  48.841 70.487 1.00 29.93 ? 282  LEU A C   1 
ATOM   2157 O O   . LEU A 1 279 ? -0.792  48.561 71.630 1.00 30.23 ? 282  LEU A O   1 
ATOM   2158 C CB  . LEU A 1 279 ? -0.119  51.330 70.296 1.00 28.66 ? 282  LEU A CB  1 
ATOM   2159 C CG  . LEU A 1 279 ? -0.202  52.600 69.427 1.00 28.33 ? 282  LEU A CG  1 
ATOM   2160 C CD1 . LEU A 1 279 ? 0.594   53.716 70.080 1.00 26.49 ? 282  LEU A CD1 1 
ATOM   2161 C CD2 . LEU A 1 279 ? 0.335   52.318 68.019 1.00 26.79 ? 282  LEU A CD2 1 
ATOM   2162 N N   . PRO A 1 280 ? 0.375   48.046 69.790 1.00 30.28 ? 283  PRO A N   1 
ATOM   2163 C CA  . PRO A 1 280 ? 0.879   46.798 70.369 1.00 30.81 ? 283  PRO A CA  1 
ATOM   2164 C C   . PRO A 1 280 ? 1.935   46.950 71.466 1.00 31.16 ? 283  PRO A C   1 
ATOM   2165 O O   . PRO A 1 280 ? 2.055   46.082 72.326 1.00 32.29 ? 283  PRO A O   1 
ATOM   2166 C CB  . PRO A 1 280 ? 1.414   46.053 69.148 1.00 30.09 ? 283  PRO A CB  1 
ATOM   2167 C CG  . PRO A 1 280 ? 1.957   47.171 68.311 1.00 30.30 ? 283  PRO A CG  1 
ATOM   2168 C CD  . PRO A 1 280 ? 0.871   48.230 68.413 1.00 30.20 ? 283  PRO A CD  1 
ATOM   2169 N N   . PHE A 1 281 ? 2.698   48.040 71.445 1.00 30.94 ? 284  PHE A N   1 
ATOM   2170 C CA  . PHE A 1 281 ? 3.738   48.239 72.452 1.00 30.28 ? 284  PHE A CA  1 
ATOM   2171 C C   . PHE A 1 281 ? 3.662   49.576 73.168 1.00 29.66 ? 284  PHE A C   1 
ATOM   2172 O O   . PHE A 1 281 ? 2.948   50.486 72.753 1.00 29.43 ? 284  PHE A O   1 
ATOM   2173 C CB  . PHE A 1 281 ? 5.130   48.167 71.820 1.00 30.67 ? 284  PHE A CB  1 
ATOM   2174 C CG  . PHE A 1 281 ? 5.364   46.955 70.978 1.00 31.91 ? 284  PHE A CG  1 
ATOM   2175 C CD1 . PHE A 1 281 ? 5.333   45.684 71.538 1.00 32.18 ? 284  PHE A CD1 1 
ATOM   2176 C CD2 . PHE A 1 281 ? 5.654   47.089 69.624 1.00 32.20 ? 284  PHE A CD2 1 
ATOM   2177 C CE1 . PHE A 1 281 ? 5.592   44.559 70.763 1.00 33.54 ? 284  PHE A CE1 1 
ATOM   2178 C CE2 . PHE A 1 281 ? 5.915   45.976 68.836 1.00 33.29 ? 284  PHE A CE2 1 
ATOM   2179 C CZ  . PHE A 1 281 ? 5.886   44.705 69.405 1.00 33.81 ? 284  PHE A CZ  1 
ATOM   2180 N N   . ASP A 1 282 ? 4.423   49.671 74.255 1.00 28.90 ? 285  ASP A N   1 
ATOM   2181 C CA  . ASP A 1 282 ? 4.546   50.898 75.024 1.00 27.75 ? 285  ASP A CA  1 
ATOM   2182 C C   . ASP A 1 282 ? 5.611   51.593 74.184 1.00 27.71 ? 285  ASP A C   1 
ATOM   2183 O O   . ASP A 1 282 ? 6.770   51.169 74.160 1.00 27.67 ? 285  ASP A O   1 
ATOM   2184 C CB  . ASP A 1 282 ? 5.086   50.585 76.415 1.00 28.42 ? 285  ASP A CB  1 
ATOM   2185 C CG  . ASP A 1 282 ? 5.153   51.807 77.303 1.00 28.56 ? 285  ASP A CG  1 
ATOM   2186 O OD1 . ASP A 1 282 ? 4.654   52.873 76.891 1.00 28.02 ? 285  ASP A OD1 1 
ATOM   2187 O OD2 . ASP A 1 282 ? 5.702   51.693 78.419 1.00 29.72 ? 285  ASP A OD2 1 
ATOM   2188 N N   . SER A 1 283 ? 5.232   52.653 73.488 1.00 26.33 ? 286  SER A N   1 
ATOM   2189 C CA  . SER A 1 283 ? 6.184   53.297 72.610 1.00 26.09 ? 286  SER A CA  1 
ATOM   2190 C C   . SER A 1 283 ? 5.970   54.775 72.356 1.00 26.15 ? 286  SER A C   1 
ATOM   2191 O O   . SER A 1 283 ? 5.032   55.394 72.864 1.00 25.66 ? 286  SER A O   1 
ATOM   2192 C CB  . SER A 1 283 ? 6.141   52.589 71.264 1.00 26.85 ? 286  SER A CB  1 
ATOM   2193 O OG  . SER A 1 283 ? 4.821   52.666 70.732 1.00 26.89 ? 286  SER A OG  1 
ATOM   2194 N N   . ILE A 1 284 ? 6.880   55.322 71.556 1.00 25.37 ? 287  ILE A N   1 
ATOM   2195 C CA  . ILE A 1 284 ? 6.816   56.707 71.118 1.00 25.16 ? 287  ILE A CA  1 
ATOM   2196 C C   . ILE A 1 284 ? 7.119   56.647 69.627 1.00 24.50 ? 287  ILE A C   1 
ATOM   2197 O O   . ILE A 1 284 ? 7.777   55.718 69.155 1.00 24.55 ? 287  ILE A O   1 
ATOM   2198 C CB  . ILE A 1 284 ? 7.847   57.618 71.823 1.00 24.77 ? 287  ILE A CB  1 
ATOM   2199 C CG1 . ILE A 1 284 ? 9.258   57.068 71.632 1.00 24.38 ? 287  ILE A CG1 1 
ATOM   2200 C CG2 . ILE A 1 284 ? 7.483   57.770 73.289 1.00 24.00 ? 287  ILE A CG2 1 
ATOM   2201 C CD1 . ILE A 1 284 ? 10.329  57.994 72.169 1.00 24.97 ? 287  ILE A CD1 1 
ATOM   2202 N N   . PHE A 1 285 ? 6.627   57.631 68.891 1.00 24.31 ? 288  PHE A N   1 
ATOM   2203 C CA  . PHE A 1 285 ? 6.812   57.688 67.449 1.00 24.07 ? 288  PHE A CA  1 
ATOM   2204 C C   . PHE A 1 285 ? 6.181   56.477 66.763 1.00 24.16 ? 288  PHE A C   1 
ATOM   2205 O O   . PHE A 1 285 ? 6.741   55.921 65.818 1.00 25.06 ? 288  PHE A O   1 
ATOM   2206 C CB  . PHE A 1 285 ? 8.295   57.783 67.075 1.00 23.05 ? 288  PHE A CB  1 
ATOM   2207 C CG  . PHE A 1 285 ? 8.572   58.786 65.983 1.00 23.14 ? 288  PHE A CG  1 
ATOM   2208 C CD1 . PHE A 1 285 ? 7.783   58.815 64.832 1.00 21.93 ? 288  PHE A CD1 1 
ATOM   2209 C CD2 . PHE A 1 285 ? 9.592   59.723 66.120 1.00 22.36 ? 288  PHE A CD2 1 
ATOM   2210 C CE1 . PHE A 1 285 ? 8.001   59.764 63.836 1.00 23.07 ? 288  PHE A CE1 1 
ATOM   2211 C CE2 . PHE A 1 285 ? 9.820   60.676 65.130 1.00 22.87 ? 288  PHE A CE2 1 
ATOM   2212 C CZ  . PHE A 1 285 ? 9.019   60.698 63.982 1.00 23.10 ? 288  PHE A CZ  1 
ATOM   2213 N N   . ARG A 1 286 ? 5.020   56.069 67.265 1.00 23.99 ? 289  ARG A N   1 
ATOM   2214 C CA  . ARG A 1 286 ? 4.256   54.959 66.700 1.00 24.44 ? 289  ARG A CA  1 
ATOM   2215 C C   . ARG A 1 286 ? 2.809   55.421 66.708 1.00 24.71 ? 289  ARG A C   1 
ATOM   2216 O O   . ARG A 1 286 ? 2.320   55.945 67.706 1.00 24.81 ? 289  ARG A O   1 
ATOM   2217 C CB  . ARG A 1 286 ? 4.418   53.680 67.527 1.00 23.55 ? 289  ARG A CB  1 
ATOM   2218 C CG  . ARG A 1 286 ? 5.801   53.049 67.432 1.00 22.43 ? 289  ARG A CG  1 
ATOM   2219 C CD  . ARG A 1 286 ? 6.145   52.672 65.997 1.00 22.83 ? 289  ARG A CD  1 
ATOM   2220 N NE  . ARG A 1 286 ? 7.418   51.957 65.923 1.00 22.79 ? 289  ARG A NE  1 
ATOM   2221 C CZ  . ARG A 1 286 ? 8.610   52.535 65.808 1.00 22.88 ? 289  ARG A CZ  1 
ATOM   2222 N NH1 . ARG A 1 286 ? 8.715   53.858 65.741 1.00 22.53 ? 289  ARG A NH1 1 
ATOM   2223 N NH2 . ARG A 1 286 ? 9.703   51.786 65.771 1.00 21.85 ? 289  ARG A NH2 1 
ATOM   2224 N N   . PHE A 1 287 ? 2.131   55.239 65.583 1.00 25.25 ? 290  PHE A N   1 
ATOM   2225 C CA  . PHE A 1 287 ? 0.759   55.688 65.453 1.00 26.04 ? 290  PHE A CA  1 
ATOM   2226 C C   . PHE A 1 287 ? -0.136  54.528 65.065 1.00 26.06 ? 290  PHE A C   1 
ATOM   2227 O O   . PHE A 1 287 ? 0.275   53.630 64.336 1.00 26.80 ? 290  PHE A O   1 
ATOM   2228 C CB  . PHE A 1 287 ? 0.718   56.814 64.420 1.00 26.34 ? 290  PHE A CB  1 
ATOM   2229 C CG  . PHE A 1 287 ? 1.823   57.814 64.601 1.00 25.85 ? 290  PHE A CG  1 
ATOM   2230 C CD1 . PHE A 1 287 ? 1.856   58.636 65.722 1.00 25.88 ? 290  PHE A CD1 1 
ATOM   2231 C CD2 . PHE A 1 287 ? 2.871   57.887 63.689 1.00 26.11 ? 290  PHE A CD2 1 
ATOM   2232 C CE1 . PHE A 1 287 ? 2.916   59.513 65.938 1.00 25.35 ? 290  PHE A CE1 1 
ATOM   2233 C CE2 . PHE A 1 287 ? 3.939   58.763 63.896 1.00 26.03 ? 290  PHE A CE2 1 
ATOM   2234 C CZ  . PHE A 1 287 ? 3.960   59.575 65.022 1.00 25.42 ? 290  PHE A CZ  1 
ATOM   2235 N N   . SER A 1 288 ? -1.366  54.568 65.557 1.00 26.51 ? 291  SER A N   1 
ATOM   2236 C CA  . SER A 1 288 ? -2.337  53.499 65.344 1.00 26.96 ? 291  SER A CA  1 
ATOM   2237 C C   . SER A 1 288 ? -2.748  53.140 63.922 1.00 26.56 ? 291  SER A C   1 
ATOM   2238 O O   . SER A 1 288 ? -2.585  51.997 63.498 1.00 26.85 ? 291  SER A O   1 
ATOM   2239 C CB  . SER A 1 288 ? -3.591  53.791 66.169 1.00 26.42 ? 291  SER A CB  1 
ATOM   2240 O OG  . SER A 1 288 ? -3.272  53.785 67.548 1.00 27.73 ? 291  SER A OG  1 
ATOM   2241 N N   . PHE A 1 289 ? -3.285  54.104 63.187 1.00 25.63 ? 292  PHE A N   1 
ATOM   2242 C CA  . PHE A 1 289 ? -3.747  53.821 61.838 1.00 24.79 ? 292  PHE A CA  1 
ATOM   2243 C C   . PHE A 1 289 ? -2.908  54.462 60.755 1.00 24.23 ? 292  PHE A C   1 
ATOM   2244 O O   . PHE A 1 289 ? -2.969  55.670 60.519 1.00 24.02 ? 292  PHE A O   1 
ATOM   2245 C CB  . PHE A 1 289 ? -5.213  54.222 61.747 1.00 24.58 ? 292  PHE A CB  1 
ATOM   2246 C CG  . PHE A 1 289 ? -6.064  53.501 62.746 1.00 25.17 ? 292  PHE A CG  1 
ATOM   2247 C CD1 . PHE A 1 289 ? -6.360  52.152 62.570 1.00 25.15 ? 292  PHE A CD1 1 
ATOM   2248 C CD2 . PHE A 1 289 ? -6.459  54.128 63.922 1.00 24.81 ? 292  PHE A CD2 1 
ATOM   2249 C CE1 . PHE A 1 289 ? -7.027  51.436 63.557 1.00 25.83 ? 292  PHE A CE1 1 
ATOM   2250 C CE2 . PHE A 1 289 ? -7.125  53.424 64.914 1.00 25.46 ? 292  PHE A CE2 1 
ATOM   2251 C CZ  . PHE A 1 289 ? -7.409  52.071 64.733 1.00 25.48 ? 292  PHE A CZ  1 
ATOM   2252 N N   . VAL A 1 290 ? -2.128  53.614 60.094 1.00 23.13 ? 293  VAL A N   1 
ATOM   2253 C CA  . VAL A 1 290 ? -1.217  54.035 59.050 1.00 23.06 ? 293  VAL A CA  1 
ATOM   2254 C C   . VAL A 1 290 ? -1.342  53.137 57.822 1.00 24.10 ? 293  VAL A C   1 
ATOM   2255 O O   . VAL A 1 290 ? -2.053  52.133 57.846 1.00 24.57 ? 293  VAL A O   1 
ATOM   2256 C CB  . VAL A 1 290 ? 0.234   53.970 59.574 1.00 22.99 ? 293  VAL A CB  1 
ATOM   2257 C CG1 . VAL A 1 290 ? 0.390   54.869 60.791 1.00 21.67 ? 293  VAL A CG1 1 
ATOM   2258 C CG2 . VAL A 1 290 ? 0.591   52.531 59.941 1.00 21.24 ? 293  VAL A CG2 1 
ATOM   2259 N N   . PRO A 1 291 ? -0.663  53.500 56.721 1.00 24.38 ? 294  PRO A N   1 
ATOM   2260 C CA  . PRO A 1 291 ? -0.708  52.705 55.490 1.00 24.81 ? 294  PRO A CA  1 
ATOM   2261 C C   . PRO A 1 291 ? -0.345  51.238 55.721 1.00 26.18 ? 294  PRO A C   1 
ATOM   2262 O O   . PRO A 1 291 ? 0.482   50.928 56.582 1.00 26.06 ? 294  PRO A O   1 
ATOM   2263 C CB  . PRO A 1 291 ? 0.309   53.410 54.600 1.00 23.47 ? 294  PRO A CB  1 
ATOM   2264 C CG  . PRO A 1 291 ? 0.104   54.841 54.967 1.00 23.88 ? 294  PRO A CG  1 
ATOM   2265 C CD  . PRO A 1 291 ? 0.017   54.788 56.482 1.00 23.91 ? 294  PRO A CD  1 
ATOM   2266 N N   . VAL A 1 292 ? -0.974  50.344 54.960 1.00 26.88 ? 295  VAL A N   1 
ATOM   2267 C CA  . VAL A 1 292 ? -0.699  48.911 55.058 1.00 27.78 ? 295  VAL A CA  1 
ATOM   2268 C C   . VAL A 1 292 ? -0.104  48.384 53.763 1.00 27.90 ? 295  VAL A C   1 
ATOM   2269 O O   . VAL A 1 292 ? -0.481  48.821 52.675 1.00 27.88 ? 295  VAL A O   1 
ATOM   2270 C CB  . VAL A 1 292 ? -1.972  48.077 55.328 1.00 28.53 ? 295  VAL A CB  1 
ATOM   2271 C CG1 . VAL A 1 292 ? -2.398  48.235 56.764 1.00 30.00 ? 295  VAL A CG1 1 
ATOM   2272 C CG2 . VAL A 1 292 ? -3.091  48.505 54.376 1.00 28.57 ? 295  VAL A CG2 1 
ATOM   2273 N N   . ILE A 1 293 ? 0.831   47.449 53.884 1.00 28.04 ? 296  ILE A N   1 
ATOM   2274 C CA  . ILE A 1 293 ? 1.445   46.841 52.711 1.00 28.77 ? 296  ILE A CA  1 
ATOM   2275 C C   . ILE A 1 293 ? 0.380   45.833 52.277 1.00 30.17 ? 296  ILE A C   1 
ATOM   2276 O O   . ILE A 1 293 ? 0.328   44.700 52.762 1.00 30.69 ? 296  ILE A O   1 
ATOM   2277 C CB  . ILE A 1 293 ? 2.772   46.150 53.095 1.00 28.23 ? 296  ILE A CB  1 
ATOM   2278 C CG1 . ILE A 1 293 ? 3.630   47.126 53.913 1.00 27.16 ? 296  ILE A CG1 1 
ATOM   2279 C CG2 . ILE A 1 293 ? 3.537   45.725 51.844 1.00 28.16 ? 296  ILE A CG2 1 
ATOM   2280 C CD1 . ILE A 1 293 ? 3.847   48.481 53.237 1.00 24.44 ? 296  ILE A CD1 1 
ATOM   2281 N N   . ASP A 1 294 ? -0.479  46.276 51.365 1.00 30.97 ? 297  ASP A N   1 
ATOM   2282 C CA  . ASP A 1 294 ? -1.618  45.495 50.894 1.00 32.19 ? 297  ASP A CA  1 
ATOM   2283 C C   . ASP A 1 294 ? -1.444  44.643 49.645 1.00 33.15 ? 297  ASP A C   1 
ATOM   2284 O O   . ASP A 1 294 ? -2.265  43.767 49.387 1.00 33.65 ? 297  ASP A O   1 
ATOM   2285 C CB  . ASP A 1 294 ? -2.789  46.446 50.662 1.00 31.26 ? 297  ASP A CB  1 
ATOM   2286 C CG  . ASP A 1 294 ? -2.475  47.487 49.604 1.00 31.14 ? 297  ASP A CG  1 
ATOM   2287 O OD1 . ASP A 1 294 ? -1.300  47.578 49.189 1.00 29.72 ? 297  ASP A OD1 1 
ATOM   2288 O OD2 . ASP A 1 294 ? -3.396  48.217 49.188 1.00 32.49 ? 297  ASP A OD2 1 
ATOM   2289 N N   . GLY A 1 295 ? -0.404  44.898 48.861 1.00 34.04 ? 298  GLY A N   1 
ATOM   2290 C CA  . GLY A 1 295 ? -0.219  44.123 47.647 1.00 34.63 ? 298  GLY A CA  1 
ATOM   2291 C C   . GLY A 1 295 ? -1.013  44.734 46.503 1.00 35.48 ? 298  GLY A C   1 
ATOM   2292 O O   . GLY A 1 295 ? -1.190  44.121 45.448 1.00 35.73 ? 298  GLY A O   1 
ATOM   2293 N N   . GLU A 1 296 ? -1.505  45.949 46.721 1.00 35.30 ? 299  GLU A N   1 
ATOM   2294 C CA  . GLU A 1 296 ? -2.274  46.671 45.715 1.00 35.67 ? 299  GLU A CA  1 
ATOM   2295 C C   . GLU A 1 296 ? -1.653  48.055 45.551 1.00 33.73 ? 299  GLU A C   1 
ATOM   2296 O O   . GLU A 1 296 ? -0.974  48.320 44.563 1.00 33.40 ? 299  GLU A O   1 
ATOM   2297 C CB  . GLU A 1 296 ? -3.738  46.775 46.149 1.00 38.94 ? 299  GLU A CB  1 
ATOM   2298 C CG  . GLU A 1 296 ? -4.480  45.444 46.081 1.00 45.38 ? 299  GLU A CG  1 
ATOM   2299 C CD  . GLU A 1 296 ? -5.863  45.489 46.716 1.00 49.42 ? 299  GLU A CD  1 
ATOM   2300 O OE1 . GLU A 1 296 ? -6.677  46.372 46.337 1.00 51.09 ? 299  GLU A OE1 1 
ATOM   2301 O OE2 . GLU A 1 296 ? -6.135  44.630 47.592 1.00 50.94 ? 299  GLU A OE2 1 
ATOM   2302 N N   . PHE A 1 297 ? -1.881  48.933 46.524 1.00 31.90 ? 300  PHE A N   1 
ATOM   2303 C CA  . PHE A 1 297 ? -1.301  50.265 46.479 1.00 30.45 ? 300  PHE A CA  1 
ATOM   2304 C C   . PHE A 1 297 ? 0.216   50.048 46.435 1.00 30.45 ? 300  PHE A C   1 
ATOM   2305 O O   . PHE A 1 297 ? 0.941   50.718 45.695 1.00 30.22 ? 300  PHE A O   1 
ATOM   2306 C CB  . PHE A 1 297 ? -1.715  51.065 47.720 1.00 28.68 ? 300  PHE A CB  1 
ATOM   2307 C CG  . PHE A 1 297 ? -1.349  52.520 47.647 1.00 27.95 ? 300  PHE A CG  1 
ATOM   2308 C CD1 . PHE A 1 297 ? -0.042  52.938 47.894 1.00 27.07 ? 300  PHE A CD1 1 
ATOM   2309 C CD2 . PHE A 1 297 ? -2.302  53.471 47.287 1.00 26.66 ? 300  PHE A CD2 1 
ATOM   2310 C CE1 . PHE A 1 297 ? 0.310   54.280 47.779 1.00 26.17 ? 300  PHE A CE1 1 
ATOM   2311 C CE2 . PHE A 1 297 ? -1.962  54.813 47.170 1.00 25.66 ? 300  PHE A CE2 1 
ATOM   2312 C CZ  . PHE A 1 297 ? -0.653  55.218 47.415 1.00 25.70 ? 300  PHE A CZ  1 
ATOM   2313 N N   . PHE A 1 298 ? 0.677   49.091 47.234 1.00 30.04 ? 301  PHE A N   1 
ATOM   2314 C CA  . PHE A 1 298 ? 2.082   48.706 47.281 1.00 29.72 ? 301  PHE A CA  1 
ATOM   2315 C C   . PHE A 1 298 ? 2.055   47.254 46.792 1.00 30.26 ? 301  PHE A C   1 
ATOM   2316 O O   . PHE A 1 298 ? 1.544   46.375 47.488 1.00 30.06 ? 301  PHE A O   1 
ATOM   2317 C CB  . PHE A 1 298 ? 2.612   48.762 48.721 1.00 28.92 ? 301  PHE A CB  1 
ATOM   2318 C CG  . PHE A 1 298 ? 2.511   50.125 49.362 1.00 28.18 ? 301  PHE A CG  1 
ATOM   2319 C CD1 . PHE A 1 298 ? 3.356   51.161 48.970 1.00 27.25 ? 301  PHE A CD1 1 
ATOM   2320 C CD2 . PHE A 1 298 ? 1.567   50.372 50.359 1.00 27.72 ? 301  PHE A CD2 1 
ATOM   2321 C CE1 . PHE A 1 298 ? 3.264   52.422 49.562 1.00 27.48 ? 301  PHE A CE1 1 
ATOM   2322 C CE2 . PHE A 1 298 ? 1.465   51.633 50.960 1.00 27.53 ? 301  PHE A CE2 1 
ATOM   2323 C CZ  . PHE A 1 298 ? 2.316   52.661 50.561 1.00 27.01 ? 301  PHE A CZ  1 
ATOM   2324 N N   . PRO A 1 299 ? 2.582   46.986 45.583 1.00 30.60 ? 302  PRO A N   1 
ATOM   2325 C CA  . PRO A 1 299 ? 2.585   45.616 45.047 1.00 30.98 ? 302  PRO A CA  1 
ATOM   2326 C C   . PRO A 1 299 ? 3.315   44.578 45.905 1.00 31.20 ? 302  PRO A C   1 
ATOM   2327 O O   . PRO A 1 299 ? 2.854   43.444 46.030 1.00 30.97 ? 302  PRO A O   1 
ATOM   2328 C CB  . PRO A 1 299 ? 3.199   45.786 43.654 1.00 31.20 ? 302  PRO A CB  1 
ATOM   2329 C CG  . PRO A 1 299 ? 4.054   47.017 43.795 1.00 31.46 ? 302  PRO A CG  1 
ATOM   2330 C CD  . PRO A 1 299 ? 3.183   47.926 44.621 1.00 30.93 ? 302  PRO A CD  1 
ATOM   2331 N N   . THR A 1 300 ? 4.450   44.963 46.484 1.00 31.19 ? 303  THR A N   1 
ATOM   2332 C CA  . THR A 1 300 ? 5.218   44.067 47.348 1.00 31.34 ? 303  THR A CA  1 
ATOM   2333 C C   . THR A 1 300 ? 5.829   44.889 48.473 1.00 30.78 ? 303  THR A C   1 
ATOM   2334 O O   . THR A 1 300 ? 5.578   46.088 48.575 1.00 31.57 ? 303  THR A O   1 
ATOM   2335 C CB  . THR A 1 300 ? 6.356   43.354 46.582 1.00 31.99 ? 303  THR A CB  1 
ATOM   2336 O OG1 . THR A 1 300 ? 7.352   44.306 46.189 1.00 33.62 ? 303  THR A OG1 1 
ATOM   2337 C CG2 . THR A 1 300 ? 5.816   42.679 45.340 1.00 33.60 ? 303  THR A CG2 1 
ATOM   2338 N N   . SER A 1 301 ? 6.629   44.252 49.316 1.00 30.34 ? 304  SER A N   1 
ATOM   2339 C CA  . SER A 1 301 ? 7.264   44.954 50.426 1.00 30.19 ? 304  SER A CA  1 
ATOM   2340 C C   . SER A 1 301 ? 8.006   46.174 49.892 1.00 29.91 ? 304  SER A C   1 
ATOM   2341 O O   . SER A 1 301 ? 8.481   46.169 48.754 1.00 29.83 ? 304  SER A O   1 
ATOM   2342 C CB  . SER A 1 301 ? 8.251   44.035 51.146 1.00 29.86 ? 304  SER A CB  1 
ATOM   2343 O OG  . SER A 1 301 ? 9.385   43.788 50.333 1.00 30.66 ? 304  SER A OG  1 
ATOM   2344 N N   . LEU A 1 302 ? 8.113   47.214 50.712 1.00 29.71 ? 305  LEU A N   1 
ATOM   2345 C CA  . LEU A 1 302 ? 8.795   48.430 50.289 1.00 29.88 ? 305  LEU A CA  1 
ATOM   2346 C C   . LEU A 1 302 ? 10.267  48.173 49.986 1.00 30.55 ? 305  LEU A C   1 
ATOM   2347 O O   . LEU A 1 302 ? 10.822  48.732 49.034 1.00 30.21 ? 305  LEU A O   1 
ATOM   2348 C CB  . LEU A 1 302 ? 8.665   49.506 51.364 1.00 29.02 ? 305  LEU A CB  1 
ATOM   2349 C CG  . LEU A 1 302 ? 7.232   49.839 51.782 1.00 29.80 ? 305  LEU A CG  1 
ATOM   2350 C CD1 . LEU A 1 302 ? 7.248   50.980 52.786 1.00 29.38 ? 305  LEU A CD1 1 
ATOM   2351 C CD2 . LEU A 1 302 ? 6.408   50.211 50.561 1.00 28.88 ? 305  LEU A CD2 1 
ATOM   2352 N N   . GLU A 1 303 ? 10.886  47.314 50.793 1.00 30.73 ? 306  GLU A N   1 
ATOM   2353 C CA  . GLU A 1 303 ? 12.294  46.977 50.631 1.00 31.38 ? 306  GLU A CA  1 
ATOM   2354 C C   . GLU A 1 303 ? 12.583  46.308 49.288 1.00 31.32 ? 306  GLU A C   1 
ATOM   2355 O O   . GLU A 1 303 ? 13.520  46.696 48.591 1.00 31.00 ? 306  GLU A O   1 
ATOM   2356 C CB  . GLU A 1 303 ? 12.742  46.070 51.781 1.00 32.65 ? 306  GLU A CB  1 
ATOM   2357 C CG  . GLU A 1 303 ? 14.233  45.762 51.815 1.00 34.71 ? 306  GLU A CG  1 
ATOM   2358 C CD  . GLU A 1 303 ? 15.103  47.008 51.748 1.00 36.94 ? 306  GLU A CD  1 
ATOM   2359 O OE1 . GLU A 1 303 ? 14.674  48.082 52.227 1.00 38.36 ? 306  GLU A OE1 1 
ATOM   2360 O OE2 . GLU A 1 303 ? 16.231  46.912 51.225 1.00 38.01 ? 306  GLU A OE2 1 
ATOM   2361 N N   . SER A 1 304 ? 11.784  45.306 48.921 1.00 31.40 ? 307  SER A N   1 
ATOM   2362 C CA  . SER A 1 304 ? 11.988  44.618 47.648 1.00 31.82 ? 307  SER A CA  1 
ATOM   2363 C C   . SER A 1 304 ? 11.697  45.562 46.480 1.00 31.16 ? 307  SER A C   1 
ATOM   2364 O O   . SER A 1 304 ? 12.289  45.433 45.410 1.00 31.19 ? 307  SER A O   1 
ATOM   2365 C CB  . SER A 1 304 ? 11.104  43.369 47.549 1.00 31.54 ? 307  SER A CB  1 
ATOM   2366 O OG  . SER A 1 304 ? 9.729   43.700 47.559 1.00 34.26 ? 307  SER A OG  1 
ATOM   2367 N N   . MET A 1 305 ? 10.786  46.508 46.686 1.00 30.38 ? 308  MET A N   1 
ATOM   2368 C CA  . MET A 1 305 ? 10.469  47.479 45.645 1.00 30.81 ? 308  MET A CA  1 
ATOM   2369 C C   . MET A 1 305 ? 11.666  48.402 45.458 1.00 30.94 ? 308  MET A C   1 
ATOM   2370 O O   . MET A 1 305 ? 12.042  48.728 44.336 1.00 32.03 ? 308  MET A O   1 
ATOM   2371 C CB  . MET A 1 305 ? 9.232   48.309 46.019 1.00 29.87 ? 308  MET A CB  1 
ATOM   2372 C CG  . MET A 1 305 ? 7.914   47.561 45.875 1.00 29.70 ? 308  MET A CG  1 
ATOM   2373 S SD  . MET A 1 305 ? 6.452   48.606 46.136 1.00 30.07 ? 308  MET A SD  1 
ATOM   2374 C CE  . MET A 1 305 ? 6.396   49.476 44.551 1.00 29.63 ? 308  MET A CE  1 
ATOM   2375 N N   . LEU A 1 306 ? 12.268  48.818 46.565 1.00 31.39 ? 309  LEU A N   1 
ATOM   2376 C CA  . LEU A 1 306 ? 13.427  49.695 46.512 1.00 32.22 ? 309  LEU A CA  1 
ATOM   2377 C C   . LEU A 1 306 ? 14.641  48.997 45.895 1.00 33.63 ? 309  LEU A C   1 
ATOM   2378 O O   . LEU A 1 306 ? 15.430  49.624 45.179 1.00 33.67 ? 309  LEU A O   1 
ATOM   2379 C CB  . LEU A 1 306 ? 13.775  50.188 47.920 1.00 31.17 ? 309  LEU A CB  1 
ATOM   2380 C CG  . LEU A 1 306 ? 12.834  51.220 48.547 1.00 30.45 ? 309  LEU A CG  1 
ATOM   2381 C CD1 . LEU A 1 306 ? 13.261  51.484 49.979 1.00 30.02 ? 309  LEU A CD1 1 
ATOM   2382 C CD2 . LEU A 1 306 ? 12.860  52.511 47.735 1.00 29.32 ? 309  LEU A CD2 1 
ATOM   2383 N N   . ASN A 1 307 ? 14.790  47.701 46.168 1.00 34.24 ? 310  ASN A N   1 
ATOM   2384 C CA  . ASN A 1 307 ? 15.921  46.945 45.636 1.00 35.05 ? 310  ASN A CA  1 
ATOM   2385 C C   . ASN A 1 307 ? 15.841  46.647 44.154 1.00 34.71 ? 310  ASN A C   1 
ATOM   2386 O O   . ASN A 1 307 ? 16.862  46.654 43.466 1.00 34.62 ? 310  ASN A O   1 
ATOM   2387 C CB  . ASN A 1 307 ? 16.095  45.630 46.392 1.00 36.47 ? 310  ASN A CB  1 
ATOM   2388 C CG  . ASN A 1 307 ? 16.853  45.812 47.677 1.00 38.28 ? 310  ASN A CG  1 
ATOM   2389 O OD1 . ASN A 1 307 ? 17.916  46.427 47.689 1.00 39.30 ? 310  ASN A OD1 1 
ATOM   2390 N ND2 . ASN A 1 307 ? 16.317  45.278 48.770 1.00 39.96 ? 310  ASN A ND2 1 
ATOM   2391 N N   . SER A 1 308 ? 14.634  46.384 43.663 1.00 34.16 ? 311  SER A N   1 
ATOM   2392 C CA  . SER A 1 308 ? 14.444  46.071 42.254 1.00 33.84 ? 311  SER A CA  1 
ATOM   2393 C C   . SER A 1 308 ? 14.259  47.315 41.392 1.00 33.58 ? 311  SER A C   1 
ATOM   2394 O O   . SER A 1 308 ? 14.183  47.218 40.169 1.00 34.00 ? 311  SER A O   1 
ATOM   2395 C CB  . SER A 1 308 ? 13.232  45.155 42.081 1.00 34.46 ? 311  SER A CB  1 
ATOM   2396 O OG  . SER A 1 308 ? 12.044  45.783 42.539 1.00 36.38 ? 311  SER A OG  1 
ATOM   2397 N N   . GLY A 1 309 ? 14.187  48.483 42.020 1.00 33.04 ? 312  GLY A N   1 
ATOM   2398 C CA  . GLY A 1 309 ? 13.991  49.700 41.250 1.00 32.04 ? 312  GLY A CA  1 
ATOM   2399 C C   . GLY A 1 309 ? 12.545  49.835 40.791 1.00 31.50 ? 312  GLY A C   1 
ATOM   2400 O O   . GLY A 1 309 ? 12.253  50.491 39.789 1.00 31.26 ? 312  GLY A O   1 
ATOM   2401 N N   . ASN A 1 310 ? 11.635  49.207 41.528 1.00 30.12 ? 313  ASN A N   1 
ATOM   2402 C CA  . ASN A 1 310 ? 10.220  49.258 41.205 1.00 29.78 ? 313  ASN A CA  1 
ATOM   2403 C C   . ASN A 1 310 ? 9.642   50.574 41.742 1.00 30.15 ? 313  ASN A C   1 
ATOM   2404 O O   . ASN A 1 310 ? 9.011   50.611 42.803 1.00 30.22 ? 313  ASN A O   1 
ATOM   2405 C CB  . ASN A 1 310 ? 9.507   48.062 41.840 1.00 29.48 ? 313  ASN A CB  1 
ATOM   2406 C CG  . ASN A 1 310 ? 8.112   47.853 41.289 1.00 30.07 ? 313  ASN A CG  1 
ATOM   2407 O OD1 . ASN A 1 310 ? 7.659   48.594 40.420 1.00 30.55 ? 313  ASN A OD1 1 
ATOM   2408 N ND2 . ASN A 1 310 ? 7.422   46.832 41.790 1.00 29.67 ? 313  ASN A ND2 1 
ATOM   2409 N N   . PHE A 1 311 ? 9.877   51.661 41.013 1.00 29.92 ? 314  PHE A N   1 
ATOM   2410 C CA  . PHE A 1 311 ? 9.378   52.968 41.421 1.00 29.46 ? 314  PHE A CA  1 
ATOM   2411 C C   . PHE A 1 311 ? 9.624   54.040 40.366 1.00 29.53 ? 314  PHE A C   1 
ATOM   2412 O O   . PHE A 1 311 ? 10.419  53.851 39.442 1.00 28.70 ? 314  PHE A O   1 
ATOM   2413 C CB  . PHE A 1 311 ? 10.000  53.382 42.768 1.00 29.35 ? 314  PHE A CB  1 
ATOM   2414 C CG  . PHE A 1 311 ? 11.513  53.289 42.816 1.00 28.59 ? 314  PHE A CG  1 
ATOM   2415 C CD1 . PHE A 1 311 ? 12.312  54.254 42.201 1.00 27.59 ? 314  PHE A CD1 1 
ATOM   2416 C CD2 . PHE A 1 311 ? 12.135  52.248 43.511 1.00 28.46 ? 314  PHE A CD2 1 
ATOM   2417 C CE1 . PHE A 1 311 ? 13.705  54.187 42.281 1.00 26.53 ? 314  PHE A CE1 1 
ATOM   2418 C CE2 . PHE A 1 311 ? 13.529  52.171 43.598 1.00 26.34 ? 314  PHE A CE2 1 
ATOM   2419 C CZ  . PHE A 1 311 ? 14.314  53.140 42.984 1.00 26.67 ? 314  PHE A CZ  1 
ATOM   2420 N N   . LYS A 1 312 ? 8.926   55.164 40.501 1.00 29.25 ? 315  LYS A N   1 
ATOM   2421 C CA  . LYS A 1 312 ? 9.069   56.253 39.549 1.00 28.91 ? 315  LYS A CA  1 
ATOM   2422 C C   . LYS A 1 312 ? 10.491  56.782 39.579 1.00 29.14 ? 315  LYS A C   1 
ATOM   2423 O O   . LYS A 1 312 ? 11.069  56.992 40.644 1.00 29.27 ? 315  LYS A O   1 
ATOM   2424 C CB  . LYS A 1 312 ? 8.100   57.386 39.877 1.00 27.87 ? 315  LYS A CB  1 
ATOM   2425 C CG  . LYS A 1 312 ? 8.095   58.500 38.846 1.00 26.84 ? 315  LYS A CG  1 
ATOM   2426 C CD  . LYS A 1 312 ? 7.410   59.751 39.391 1.00 26.64 ? 315  LYS A CD  1 
ATOM   2427 C CE  . LYS A 1 312 ? 7.307   60.833 38.332 1.00 25.67 ? 315  LYS A CE  1 
ATOM   2428 N NZ  . LYS A 1 312 ? 6.394   60.417 37.227 1.00 23.99 ? 315  LYS A NZ  1 
ATOM   2429 N N   . LYS A 1 313 ? 11.054  56.997 38.400 1.00 28.96 ? 316  LYS A N   1 
ATOM   2430 C CA  . LYS A 1 313 ? 12.407  57.502 38.298 1.00 29.37 ? 316  LYS A CA  1 
ATOM   2431 C C   . LYS A 1 313 ? 12.364  58.936 37.805 1.00 28.98 ? 316  LYS A C   1 
ATOM   2432 O O   . LYS A 1 313 ? 11.892  59.224 36.709 1.00 29.25 ? 316  LYS A O   1 
ATOM   2433 C CB  . LYS A 1 313 ? 13.209  56.599 37.370 1.00 30.74 ? 316  LYS A CB  1 
ATOM   2434 C CG  . LYS A 1 313 ? 13.261  55.195 37.931 1.00 32.56 ? 316  LYS A CG  1 
ATOM   2435 C CD  . LYS A 1 313 ? 13.899  54.212 37.004 1.00 34.97 ? 316  LYS A CD  1 
ATOM   2436 C CE  . LYS A 1 313 ? 13.892  52.844 37.650 1.00 35.68 ? 316  LYS A CE  1 
ATOM   2437 N NZ  . LYS A 1 313 ? 12.497  52.409 37.925 1.00 36.85 ? 316  LYS A NZ  1 
ATOM   2438 N N   . THR A 1 314 ? 12.844  59.836 38.650 1.00 28.20 ? 317  THR A N   1 
ATOM   2439 C CA  . THR A 1 314 ? 12.845  61.250 38.348 1.00 28.17 ? 317  THR A CA  1 
ATOM   2440 C C   . THR A 1 314 ? 13.835  61.895 39.316 1.00 27.96 ? 317  THR A C   1 
ATOM   2441 O O   . THR A 1 314 ? 14.683  61.203 39.881 1.00 27.76 ? 317  THR A O   1 
ATOM   2442 C CB  . THR A 1 314 ? 11.409  61.821 38.535 1.00 27.81 ? 317  THR A CB  1 
ATOM   2443 O OG1 . THR A 1 314 ? 11.394  63.218 38.228 1.00 29.07 ? 317  THR A OG1 1 
ATOM   2444 C CG2 . THR A 1 314 ? 10.924  61.597 39.959 1.00 27.12 ? 317  THR A CG2 1 
ATOM   2445 N N   . GLN A 1 315 ? 13.745  63.207 39.505 1.00 27.66 ? 318  GLN A N   1 
ATOM   2446 C CA  . GLN A 1 315 ? 14.650  63.888 40.427 1.00 27.73 ? 318  GLN A CA  1 
ATOM   2447 C C   . GLN A 1 315 ? 13.942  64.021 41.773 1.00 27.68 ? 318  GLN A C   1 
ATOM   2448 O O   . GLN A 1 315 ? 12.714  64.060 41.828 1.00 28.06 ? 318  GLN A O   1 
ATOM   2449 C CB  . GLN A 1 315 ? 15.010  65.291 39.913 1.00 26.89 ? 318  GLN A CB  1 
ATOM   2450 C CG  . GLN A 1 315 ? 15.531  65.357 38.480 1.00 27.56 ? 318  GLN A CG  1 
ATOM   2451 C CD  . GLN A 1 315 ? 14.424  65.209 37.443 1.00 27.95 ? 318  GLN A CD  1 
ATOM   2452 O OE1 . GLN A 1 315 ? 13.320  65.725 37.626 1.00 26.39 ? 318  GLN A OE1 1 
ATOM   2453 N NE2 . GLN A 1 315 ? 14.720  64.514 36.341 1.00 27.33 ? 318  GLN A NE2 1 
ATOM   2454 N N   . ILE A 1 316 ? 14.708  64.073 42.856 1.00 27.55 ? 319  ILE A N   1 
ATOM   2455 C CA  . ILE A 1 316 ? 14.119  64.230 44.177 1.00 27.81 ? 319  ILE A CA  1 
ATOM   2456 C C   . ILE A 1 316 ? 14.995  65.125 45.037 1.00 27.65 ? 319  ILE A C   1 
ATOM   2457 O O   . ILE A 1 316 ? 16.218  65.123 44.907 1.00 28.73 ? 319  ILE A O   1 
ATOM   2458 C CB  . ILE A 1 316 ? 13.944  62.877 44.923 1.00 27.70 ? 319  ILE A CB  1 
ATOM   2459 C CG1 . ILE A 1 316 ? 15.310  62.237 45.180 1.00 28.06 ? 319  ILE A CG1 1 
ATOM   2460 C CG2 . ILE A 1 316 ? 13.042  61.951 44.131 1.00 27.88 ? 319  ILE A CG2 1 
ATOM   2461 C CD1 . ILE A 1 316 ? 15.251  60.986 46.038 1.00 26.27 ? 319  ILE A CD1 1 
ATOM   2462 N N   . LEU A 1 317 ? 14.354  65.901 45.902 1.00 27.16 ? 320  LEU A N   1 
ATOM   2463 C CA  . LEU A 1 317 ? 15.053  66.785 46.822 1.00 27.44 ? 320  LEU A CA  1 
ATOM   2464 C C   . LEU A 1 317 ? 14.472  66.429 48.190 1.00 27.44 ? 320  LEU A C   1 
ATOM   2465 O O   . LEU A 1 317 ? 13.255  66.455 48.382 1.00 27.72 ? 320  LEU A O   1 
ATOM   2466 C CB  . LEU A 1 317 ? 14.787  68.251 46.461 1.00 27.68 ? 320  LEU A CB  1 
ATOM   2467 C CG  . LEU A 1 317 ? 15.588  69.299 47.244 1.00 28.94 ? 320  LEU A CG  1 
ATOM   2468 C CD1 . LEU A 1 317 ? 15.756  70.564 46.404 1.00 28.19 ? 320  LEU A CD1 1 
ATOM   2469 C CD2 . LEU A 1 317 ? 14.891  69.606 48.558 1.00 28.39 ? 320  LEU A CD2 1 
ATOM   2470 N N   . LEU A 1 318 ? 15.336  66.061 49.129 1.00 26.91 ? 321  LEU A N   1 
ATOM   2471 C CA  . LEU A 1 318 ? 14.869  65.667 50.449 1.00 26.75 ? 321  LEU A CA  1 
ATOM   2472 C C   . LEU A 1 318 ? 15.915  65.934 51.523 1.00 26.94 ? 321  LEU A C   1 
ATOM   2473 O O   . LEU A 1 318 ? 17.082  66.188 51.221 1.00 27.63 ? 321  LEU A O   1 
ATOM   2474 C CB  . LEU A 1 318 ? 14.494  64.178 50.445 1.00 25.15 ? 321  LEU A CB  1 
ATOM   2475 C CG  . LEU A 1 318 ? 15.623  63.143 50.338 1.00 24.89 ? 321  LEU A CG  1 
ATOM   2476 C CD1 . LEU A 1 318 ? 15.020  61.748 50.348 1.00 24.08 ? 321  LEU A CD1 1 
ATOM   2477 C CD2 . LEU A 1 318 ? 16.433  63.354 49.073 1.00 23.09 ? 321  LEU A CD2 1 
ATOM   2478 N N   . GLY A 1 319 ? 15.491  65.869 52.780 1.00 26.43 ? 322  GLY A N   1 
ATOM   2479 C CA  . GLY A 1 319 ? 16.413  66.122 53.866 1.00 26.81 ? 322  GLY A CA  1 
ATOM   2480 C C   . GLY A 1 319 ? 15.780  65.969 55.231 1.00 26.89 ? 322  GLY A C   1 
ATOM   2481 O O   . GLY A 1 319 ? 14.614  65.588 55.347 1.00 27.64 ? 322  GLY A O   1 
ATOM   2482 N N   . VAL A 1 320 ? 16.550  66.285 56.267 1.00 26.58 ? 323  VAL A N   1 
ATOM   2483 C CA  . VAL A 1 320 ? 16.083  66.156 57.635 1.00 26.02 ? 323  VAL A CA  1 
ATOM   2484 C C   . VAL A 1 320 ? 16.551  67.319 58.494 1.00 26.42 ? 323  VAL A C   1 
ATOM   2485 O O   . VAL A 1 320 ? 17.397  68.103 58.077 1.00 26.50 ? 323  VAL A O   1 
ATOM   2486 C CB  . VAL A 1 320 ? 16.629  64.864 58.267 1.00 25.88 ? 323  VAL A CB  1 
ATOM   2487 C CG1 . VAL A 1 320 ? 16.182  63.656 57.463 1.00 24.85 ? 323  VAL A CG1 1 
ATOM   2488 C CG2 . VAL A 1 320 ? 18.146  64.925 58.317 1.00 24.57 ? 323  VAL A CG2 1 
ATOM   2489 N N   . ASN A 1 321 ? 15.990  67.423 59.694 1.00 26.53 ? 324  ASN A N   1 
ATOM   2490 C CA  . ASN A 1 321 ? 16.388  68.463 60.634 1.00 27.14 ? 324  ASN A CA  1 
ATOM   2491 C C   . ASN A 1 321 ? 17.340  67.821 61.649 1.00 27.52 ? 324  ASN A C   1 
ATOM   2492 O O   . ASN A 1 321 ? 17.391  66.593 61.792 1.00 27.34 ? 324  ASN A O   1 
ATOM   2493 C CB  . ASN A 1 321 ? 15.171  69.051 61.361 1.00 26.79 ? 324  ASN A CB  1 
ATOM   2494 C CG  . ASN A 1 321 ? 14.207  69.754 60.421 1.00 27.17 ? 324  ASN A CG  1 
ATOM   2495 O OD1 . ASN A 1 321 ? 14.526  70.010 59.255 1.00 27.01 ? 324  ASN A OD1 1 
ATOM   2496 N ND2 . ASN A 1 321 ? 13.020  70.080 60.929 1.00 26.58 ? 324  ASN A ND2 1 
ATOM   2497 N N   . LYS A 1 322 ? 18.081  68.655 62.362 1.00 27.91 ? 325  LYS A N   1 
ATOM   2498 C CA  . LYS A 1 322 ? 19.046  68.177 63.336 1.00 28.07 ? 325  LYS A CA  1 
ATOM   2499 C C   . LYS A 1 322 ? 18.484  67.401 64.525 1.00 28.04 ? 325  LYS A C   1 
ATOM   2500 O O   . LYS A 1 322 ? 19.073  66.401 64.937 1.00 28.07 ? 325  LYS A O   1 
ATOM   2501 C CB  . LYS A 1 322 ? 19.877  69.352 63.845 1.00 29.14 ? 325  LYS A CB  1 
ATOM   2502 C CG  . LYS A 1 322 ? 21.023  68.959 64.762 1.00 30.55 ? 325  LYS A CG  1 
ATOM   2503 C CD  . LYS A 1 322 ? 21.835  70.185 65.145 1.00 32.57 ? 325  LYS A CD  1 
ATOM   2504 C CE  . LYS A 1 322 ? 22.994  69.812 66.038 1.00 34.21 ? 325  LYS A CE  1 
ATOM   2505 N NZ  . LYS A 1 322 ? 22.516  69.196 67.311 1.00 37.47 ? 325  LYS A NZ  1 
ATOM   2506 N N   . ASP A 1 323 ? 17.353  67.838 65.073 1.00 27.40 ? 326  ASP A N   1 
ATOM   2507 C CA  . ASP A 1 323 ? 16.786  67.164 66.240 1.00 27.26 ? 326  ASP A CA  1 
ATOM   2508 C C   . ASP A 1 323 ? 15.345  66.675 66.052 1.00 27.86 ? 326  ASP A C   1 
ATOM   2509 O O   . ASP A 1 323 ? 14.420  67.109 66.746 1.00 28.12 ? 326  ASP A O   1 
ATOM   2510 C CB  . ASP A 1 323 ? 16.884  68.108 67.443 1.00 26.76 ? 326  ASP A CB  1 
ATOM   2511 C CG  . ASP A 1 323 ? 18.288  68.681 67.616 1.00 26.46 ? 326  ASP A CG  1 
ATOM   2512 O OD1 . ASP A 1 323 ? 19.209  67.929 67.989 1.00 25.55 ? 326  ASP A OD1 1 
ATOM   2513 O OD2 . ASP A 1 323 ? 18.479  69.886 67.356 1.00 27.78 ? 326  ASP A OD2 1 
ATOM   2514 N N   . GLU A 1 324 ? 15.172  65.750 65.117 1.00 27.66 ? 327  GLU A N   1 
ATOM   2515 C CA  . GLU A 1 324 ? 13.868  65.183 64.806 1.00 28.04 ? 327  GLU A CA  1 
ATOM   2516 C C   . GLU A 1 324 ? 13.183  64.527 66.005 1.00 28.52 ? 327  GLU A C   1 
ATOM   2517 O O   . GLU A 1 324 ? 11.957  64.598 66.138 1.00 28.81 ? 327  GLU A O   1 
ATOM   2518 C CB  . GLU A 1 324 ? 14.013  64.143 63.689 1.00 28.01 ? 327  GLU A CB  1 
ATOM   2519 C CG  . GLU A 1 324 ? 14.617  64.685 62.409 1.00 27.97 ? 327  GLU A CG  1 
ATOM   2520 C CD  . GLU A 1 324 ? 13.612  65.436 61.561 1.00 28.50 ? 327  GLU A CD  1 
ATOM   2521 O OE1 . GLU A 1 324 ? 12.553  65.828 62.095 1.00 29.46 ? 327  GLU A OE1 1 
ATOM   2522 O OE2 . GLU A 1 324 ? 13.884  65.643 60.361 1.00 28.69 ? 327  GLU A OE2 1 
ATOM   2523 N N   . GLY A 1 325 ? 13.969  63.905 66.882 1.00 28.12 ? 328  GLY A N   1 
ATOM   2524 C CA  . GLY A 1 325 ? 13.391  63.209 68.020 1.00 28.21 ? 328  GLY A CA  1 
ATOM   2525 C C   . GLY A 1 325 ? 12.870  63.946 69.248 1.00 28.12 ? 328  GLY A C   1 
ATOM   2526 O O   . GLY A 1 325 ? 12.009  63.409 69.950 1.00 27.93 ? 328  GLY A O   1 
ATOM   2527 N N   . SER A 1 326 ? 13.353  65.157 69.514 1.00 27.51 ? 329  SER A N   1 
ATOM   2528 C CA  . SER A 1 326 ? 12.939  65.890 70.714 1.00 26.95 ? 329  SER A CA  1 
ATOM   2529 C C   . SER A 1 326 ? 11.437  66.010 71.003 1.00 27.33 ? 329  SER A C   1 
ATOM   2530 O O   . SER A 1 326 ? 11.019  65.851 72.152 1.00 27.34 ? 329  SER A O   1 
ATOM   2531 C CB  . SER A 1 326 ? 13.583  67.284 70.740 1.00 26.82 ? 329  SER A CB  1 
ATOM   2532 O OG  . SER A 1 326 ? 13.179  68.086 69.646 1.00 26.19 ? 329  SER A OG  1 
ATOM   2533 N N   . PHE A 1 327 ? 10.625  66.284 69.986 1.00 26.90 ? 330  PHE A N   1 
ATOM   2534 C CA  . PHE A 1 327 ? 9.178   66.424 70.182 1.00 26.89 ? 330  PHE A CA  1 
ATOM   2535 C C   . PHE A 1 327 ? 8.559   65.189 70.839 1.00 26.92 ? 330  PHE A C   1 
ATOM   2536 O O   . PHE A 1 327 ? 7.761   65.288 71.781 1.00 26.33 ? 330  PHE A O   1 
ATOM   2537 C CB  . PHE A 1 327 ? 8.479   66.634 68.836 1.00 28.26 ? 330  PHE A CB  1 
ATOM   2538 C CG  . PHE A 1 327 ? 7.609   67.851 68.780 1.00 29.68 ? 330  PHE A CG  1 
ATOM   2539 C CD1 . PHE A 1 327 ? 6.723   68.144 69.814 1.00 30.64 ? 330  PHE A CD1 1 
ATOM   2540 C CD2 . PHE A 1 327 ? 7.665   68.705 67.683 1.00 30.10 ? 330  PHE A CD2 1 
ATOM   2541 C CE1 . PHE A 1 327 ? 5.903   69.272 69.759 1.00 30.95 ? 330  PHE A CE1 1 
ATOM   2542 C CE2 . PHE A 1 327 ? 6.852   69.836 67.614 1.00 32.14 ? 330  PHE A CE2 1 
ATOM   2543 C CZ  . PHE A 1 327 ? 5.966   70.122 68.656 1.00 32.20 ? 330  PHE A CZ  1 
ATOM   2544 N N   . PHE A 1 328 ? 8.941   64.022 70.330 1.00 25.82 ? 331  PHE A N   1 
ATOM   2545 C CA  . PHE A 1 328 ? 8.404   62.758 70.804 1.00 25.08 ? 331  PHE A CA  1 
ATOM   2546 C C   . PHE A 1 328 ? 8.877   62.321 72.178 1.00 24.69 ? 331  PHE A C   1 
ATOM   2547 O O   . PHE A 1 328 ? 8.204   61.536 72.846 1.00 24.68 ? 331  PHE A O   1 
ATOM   2548 C CB  . PHE A 1 328 ? 8.666   61.681 69.745 1.00 23.64 ? 331  PHE A CB  1 
ATOM   2549 C CG  . PHE A 1 328 ? 8.180   62.077 68.378 1.00 23.42 ? 331  PHE A CG  1 
ATOM   2550 C CD1 . PHE A 1 328 ? 8.965   62.883 67.553 1.00 22.48 ? 331  PHE A CD1 1 
ATOM   2551 C CD2 . PHE A 1 328 ? 6.894   61.738 67.958 1.00 22.82 ? 331  PHE A CD2 1 
ATOM   2552 C CE1 . PHE A 1 328 ? 8.474   63.355 66.328 1.00 22.60 ? 331  PHE A CE1 1 
ATOM   2553 C CE2 . PHE A 1 328 ? 6.392   62.202 66.739 1.00 22.00 ? 331  PHE A CE2 1 
ATOM   2554 C CZ  . PHE A 1 328 ? 7.185   63.015 65.921 1.00 22.66 ? 331  PHE A CZ  1 
ATOM   2555 N N   . LEU A 1 329 ? 10.025  62.830 72.606 1.00 24.43 ? 332  LEU A N   1 
ATOM   2556 C CA  . LEU A 1 329 ? 10.543  62.498 73.928 1.00 24.80 ? 332  LEU A CA  1 
ATOM   2557 C C   . LEU A 1 329 ? 9.845   63.413 74.935 1.00 25.28 ? 332  LEU A C   1 
ATOM   2558 O O   . LEU A 1 329 ? 9.496   62.993 76.041 1.00 25.85 ? 332  LEU A O   1 
ATOM   2559 C CB  . LEU A 1 329 ? 12.061  62.704 73.975 1.00 24.16 ? 332  LEU A CB  1 
ATOM   2560 C CG  . LEU A 1 329 ? 12.876  61.662 73.201 1.00 23.71 ? 332  LEU A CG  1 
ATOM   2561 C CD1 . LEU A 1 329 ? 14.279  62.188 72.920 1.00 22.90 ? 332  LEU A CD1 1 
ATOM   2562 C CD2 . LEU A 1 329 ? 12.927  60.371 74.005 1.00 22.46 ? 332  LEU A CD2 1 
ATOM   2563 N N   . LEU A 1 330 ? 9.638   64.666 74.543 1.00 24.99 ? 333  LEU A N   1 
ATOM   2564 C CA  . LEU A 1 330 ? 8.964   65.625 75.408 1.00 26.03 ? 333  LEU A CA  1 
ATOM   2565 C C   . LEU A 1 330 ? 7.575   65.105 75.755 1.00 27.01 ? 333  LEU A C   1 
ATOM   2566 O O   . LEU A 1 330 ? 7.162   65.103 76.919 1.00 27.12 ? 333  LEU A O   1 
ATOM   2567 C CB  . LEU A 1 330 ? 8.822   66.979 74.703 1.00 24.85 ? 333  LEU A CB  1 
ATOM   2568 C CG  . LEU A 1 330 ? 7.808   67.940 75.344 1.00 26.07 ? 333  LEU A CG  1 
ATOM   2569 C CD1 . LEU A 1 330 ? 8.267   68.329 76.745 1.00 24.40 ? 333  LEU A CD1 1 
ATOM   2570 C CD2 . LEU A 1 330 ? 7.639   69.182 74.466 1.00 25.66 ? 333  LEU A CD2 1 
ATOM   2571 N N   . TYR A 1 331 ? 6.863   64.649 74.731 1.00 27.59 ? 334  TYR A N   1 
ATOM   2572 C CA  . TYR A 1 331 ? 5.508   64.151 74.902 1.00 27.78 ? 334  TYR A CA  1 
ATOM   2573 C C   . TYR A 1 331 ? 5.341   62.765 75.506 1.00 28.86 ? 334  TYR A C   1 
ATOM   2574 O O   . TYR A 1 331 ? 4.298   62.487 76.088 1.00 30.53 ? 334  TYR A O   1 
ATOM   2575 C CB  . TYR A 1 331 ? 4.766   64.190 73.563 1.00 26.45 ? 334  TYR A CB  1 
ATOM   2576 C CG  . TYR A 1 331 ? 4.184   65.537 73.221 1.00 24.95 ? 334  TYR A CG  1 
ATOM   2577 C CD1 . TYR A 1 331 ? 5.005   66.643 73.022 1.00 24.90 ? 334  TYR A CD1 1 
ATOM   2578 C CD2 . TYR A 1 331 ? 2.803   65.711 73.112 1.00 25.07 ? 334  TYR A CD2 1 
ATOM   2579 C CE1 . TYR A 1 331 ? 4.468   67.891 72.727 1.00 24.20 ? 334  TYR A CE1 1 
ATOM   2580 C CE2 . TYR A 1 331 ? 2.254   66.957 72.817 1.00 24.01 ? 334  TYR A CE2 1 
ATOM   2581 C CZ  . TYR A 1 331 ? 3.093   68.040 72.628 1.00 23.35 ? 334  TYR A CZ  1 
ATOM   2582 O OH  . TYR A 1 331 ? 2.565   69.276 72.367 1.00 23.38 ? 334  TYR A OH  1 
ATOM   2583 N N   . GLY A 1 332 ? 6.341   61.895 75.396 1.00 28.97 ? 335  GLY A N   1 
ATOM   2584 C CA  . GLY A 1 332 ? 6.143   60.560 75.932 1.00 29.53 ? 335  GLY A CA  1 
ATOM   2585 C C   . GLY A 1 332 ? 7.237   59.831 76.686 1.00 30.57 ? 335  GLY A C   1 
ATOM   2586 O O   . GLY A 1 332 ? 7.021   58.693 77.102 1.00 31.85 ? 335  GLY A O   1 
ATOM   2587 N N   . ALA A 1 333 ? 8.401   60.443 76.869 1.00 30.13 ? 336  ALA A N   1 
ATOM   2588 C CA  . ALA A 1 333 ? 9.472   59.773 77.598 1.00 30.33 ? 336  ALA A CA  1 
ATOM   2589 C C   . ALA A 1 333 ? 9.628   60.387 78.986 1.00 31.48 ? 336  ALA A C   1 
ATOM   2590 O O   . ALA A 1 333 ? 9.640   61.609 79.138 1.00 32.79 ? 336  ALA A O   1 
ATOM   2591 C CB  . ALA A 1 333 ? 10.771  59.873 76.830 1.00 29.17 ? 336  ALA A CB  1 
ATOM   2592 N N   . PRO A 1 334 ? 9.750   59.544 80.020 1.00 32.06 ? 337  PRO A N   1 
ATOM   2593 C CA  . PRO A 1 334 ? 9.901   60.045 81.390 1.00 31.90 ? 337  PRO A CA  1 
ATOM   2594 C C   . PRO A 1 334 ? 11.173  60.857 81.572 1.00 31.60 ? 337  PRO A C   1 
ATOM   2595 O O   . PRO A 1 334 ? 12.237  60.471 81.092 1.00 31.38 ? 337  PRO A O   1 
ATOM   2596 C CB  . PRO A 1 334 ? 9.915   58.765 82.219 1.00 32.67 ? 337  PRO A CB  1 
ATOM   2597 C CG  . PRO A 1 334 ? 10.628  57.796 81.291 1.00 33.11 ? 337  PRO A CG  1 
ATOM   2598 C CD  . PRO A 1 334 ? 9.943   58.081 79.968 1.00 32.41 ? 337  PRO A CD  1 
ATOM   2599 N N   . GLY A 1 335 ? 11.059  61.987 82.264 1.00 32.08 ? 338  GLY A N   1 
ATOM   2600 C CA  . GLY A 1 335 ? 12.224  62.822 82.499 1.00 31.55 ? 338  GLY A CA  1 
ATOM   2601 C C   . GLY A 1 335 ? 12.271  64.083 81.655 1.00 31.38 ? 338  GLY A C   1 
ATOM   2602 O O   . GLY A 1 335 ? 12.938  65.053 82.020 1.00 31.31 ? 338  GLY A O   1 
ATOM   2603 N N   . PHE A 1 336 ? 11.580  64.073 80.519 1.00 31.02 ? 339  PHE A N   1 
ATOM   2604 C CA  . PHE A 1 336 ? 11.561  65.241 79.646 1.00 30.77 ? 339  PHE A CA  1 
ATOM   2605 C C   . PHE A 1 336 ? 10.366  66.127 79.972 1.00 30.96 ? 339  PHE A C   1 
ATOM   2606 O O   . PHE A 1 336 ? 9.251   65.633 80.137 1.00 31.61 ? 339  PHE A O   1 
ATOM   2607 C CB  . PHE A 1 336 ? 11.489  64.821 78.174 1.00 29.61 ? 339  PHE A CB  1 
ATOM   2608 C CG  . PHE A 1 336 ? 12.685  64.042 77.698 1.00 28.34 ? 339  PHE A CG  1 
ATOM   2609 C CD1 . PHE A 1 336 ? 12.761  62.664 77.894 1.00 27.60 ? 339  PHE A CD1 1 
ATOM   2610 C CD2 . PHE A 1 336 ? 13.729  64.686 77.037 1.00 27.64 ? 339  PHE A CD2 1 
ATOM   2611 C CE1 . PHE A 1 336 ? 13.857  61.934 77.435 1.00 27.32 ? 339  PHE A CE1 1 
ATOM   2612 C CE2 . PHE A 1 336 ? 14.831  63.969 76.575 1.00 27.95 ? 339  PHE A CE2 1 
ATOM   2613 C CZ  . PHE A 1 336 ? 14.895  62.584 76.775 1.00 27.63 ? 339  PHE A CZ  1 
ATOM   2614 N N   . SER A 1 337 ? 10.602  67.433 80.067 1.00 30.94 ? 340  SER A N   1 
ATOM   2615 C CA  . SER A 1 337 ? 9.543   68.396 80.368 1.00 31.21 ? 340  SER A CA  1 
ATOM   2616 C C   . SER A 1 337 ? 9.746   69.651 79.528 1.00 31.22 ? 340  SER A C   1 
ATOM   2617 O O   . SER A 1 337 ? 10.867  69.976 79.143 1.00 30.70 ? 340  SER A O   1 
ATOM   2618 C CB  . SER A 1 337 ? 9.573   68.786 81.848 1.00 32.19 ? 340  SER A CB  1 
ATOM   2619 O OG  . SER A 1 337 ? 9.497   67.653 82.685 1.00 34.09 ? 340  SER A OG  1 
ATOM   2620 N N   . LYS A 1 338 ? 8.664   70.373 79.268 1.00 31.20 ? 341  LYS A N   1 
ATOM   2621 C CA  . LYS A 1 338 ? 8.757   71.577 78.463 1.00 31.92 ? 341  LYS A CA  1 
ATOM   2622 C C   . LYS A 1 338 ? 9.526   72.711 79.139 1.00 31.96 ? 341  LYS A C   1 
ATOM   2623 O O   . LYS A 1 338 ? 10.261  73.445 78.480 1.00 31.44 ? 341  LYS A O   1 
ATOM   2624 C CB  . LYS A 1 338 ? 7.358   72.077 78.086 1.00 31.70 ? 341  LYS A CB  1 
ATOM   2625 C CG  . LYS A 1 338 ? 7.380   73.169 77.023 1.00 32.90 ? 341  LYS A CG  1 
ATOM   2626 C CD  . LYS A 1 338 ? 5.985   73.672 76.668 1.00 33.57 ? 341  LYS A CD  1 
ATOM   2627 C CE  . LYS A 1 338 ? 5.414   74.569 77.759 1.00 34.28 ? 341  LYS A CE  1 
ATOM   2628 N NZ  . LYS A 1 338 ? 6.242   75.800 77.977 1.00 34.88 ? 341  LYS A NZ  1 
ATOM   2629 N N   . ASP A 1 339 ? 9.377   72.845 80.453 1.00 31.96 ? 342  ASP A N   1 
ATOM   2630 C CA  . ASP A 1 339 ? 10.031  73.938 81.159 1.00 32.09 ? 342  ASP A CA  1 
ATOM   2631 C C   . ASP A 1 339 ? 11.309  73.649 81.949 1.00 32.83 ? 342  ASP A C   1 
ATOM   2632 O O   . ASP A 1 339 ? 11.706  74.449 82.793 1.00 32.94 ? 342  ASP A O   1 
ATOM   2633 C CB  . ASP A 1 339 ? 9.014   74.626 82.068 1.00 30.37 ? 342  ASP A CB  1 
ATOM   2634 C CG  . ASP A 1 339 ? 7.742   75.003 81.336 1.00 30.22 ? 342  ASP A CG  1 
ATOM   2635 O OD1 . ASP A 1 339 ? 7.777   75.152 80.093 1.00 28.97 ? 342  ASP A OD1 1 
ATOM   2636 O OD2 . ASP A 1 339 ? 6.704   75.166 82.009 1.00 30.36 ? 342  ASP A OD2 1 
ATOM   2637 N N   . SER A 1 340 ? 11.956  72.519 81.689 1.00 33.97 ? 343  SER A N   1 
ATOM   2638 C CA  . SER A 1 340 ? 13.206  72.209 82.378 1.00 35.23 ? 343  SER A CA  1 
ATOM   2639 C C   . SER A 1 340 ? 14.238  71.872 81.313 1.00 35.98 ? 343  SER A C   1 
ATOM   2640 O O   . SER A 1 340 ? 13.889  71.693 80.144 1.00 35.52 ? 343  SER A O   1 
ATOM   2641 C CB  . SER A 1 340 ? 13.044  71.014 83.318 1.00 35.44 ? 343  SER A CB  1 
ATOM   2642 O OG  . SER A 1 340 ? 13.051  69.798 82.594 1.00 38.45 ? 343  SER A OG  1 
ATOM   2643 N N   . GLU A 1 341 ? 15.505  71.791 81.707 1.00 37.06 ? 344  GLU A N   1 
ATOM   2644 C CA  . GLU A 1 341 ? 16.566  71.464 80.760 1.00 38.48 ? 344  GLU A CA  1 
ATOM   2645 C C   . GLU A 1 341 ? 16.518  69.984 80.402 1.00 37.82 ? 344  GLU A C   1 
ATOM   2646 O O   . GLU A 1 341 ? 17.235  69.520 79.517 1.00 37.19 ? 344  GLU A O   1 
ATOM   2647 C CB  . GLU A 1 341 ? 17.935  71.809 81.345 1.00 40.48 ? 344  GLU A CB  1 
ATOM   2648 C CG  . GLU A 1 341 ? 18.292  73.277 81.248 1.00 44.37 ? 344  GLU A CG  1 
ATOM   2649 C CD  . GLU A 1 341 ? 19.716  73.560 81.695 1.00 47.13 ? 344  GLU A CD  1 
ATOM   2650 O OE1 . GLU A 1 341 ? 20.420  72.612 82.120 1.00 47.72 ? 344  GLU A OE1 1 
ATOM   2651 O OE2 . GLU A 1 341 ? 20.131  74.738 81.620 1.00 49.27 ? 344  GLU A OE2 1 
ATOM   2652 N N   . SER A 1 342 ? 15.671  69.251 81.113 1.00 38.11 ? 345  SER A N   1 
ATOM   2653 C CA  . SER A 1 342 ? 15.485  67.827 80.889 1.00 38.53 ? 345  SER A CA  1 
ATOM   2654 C C   . SER A 1 342 ? 16.757  66.990 80.893 1.00 39.23 ? 345  SER A C   1 
ATOM   2655 O O   . SER A 1 342 ? 16.982  66.196 79.977 1.00 39.23 ? 345  SER A O   1 
ATOM   2656 C CB  . SER A 1 342 ? 14.736  67.602 79.577 1.00 37.60 ? 345  SER A CB  1 
ATOM   2657 O OG  . SER A 1 342 ? 13.449  68.182 79.639 1.00 37.46 ? 345  SER A OG  1 
ATOM   2658 N N   . LYS A 1 343 ? 17.591  67.176 81.912 1.00 39.95 ? 346  LYS A N   1 
ATOM   2659 C CA  . LYS A 1 343 ? 18.806  66.385 82.043 1.00 40.98 ? 346  LYS A CA  1 
ATOM   2660 C C   . LYS A 1 343 ? 18.284  65.007 82.429 1.00 40.98 ? 346  LYS A C   1 
ATOM   2661 O O   . LYS A 1 343 ? 17.566  64.856 83.418 1.00 40.75 ? 346  LYS A O   1 
ATOM   2662 C CB  . LYS A 1 343 ? 19.707  66.946 83.144 1.00 42.38 ? 346  LYS A CB  1 
ATOM   2663 C CG  . LYS A 1 343 ? 20.288  68.315 82.826 1.00 44.85 ? 346  LYS A CG  1 
ATOM   2664 C CD  . LYS A 1 343 ? 21.168  68.832 83.959 1.00 46.86 ? 346  LYS A CD  1 
ATOM   2665 C CE  . LYS A 1 343 ? 21.697  70.230 83.649 1.00 48.36 ? 346  LYS A CE  1 
ATOM   2666 N NZ  . LYS A 1 343 ? 22.562  70.772 84.741 1.00 50.14 ? 346  LYS A NZ  1 
ATOM   2667 N N   . ILE A 1 344 ? 18.633  64.002 81.642 1.00 41.30 ? 347  ILE A N   1 
ATOM   2668 C CA  . ILE A 1 344 ? 18.141  62.658 81.887 1.00 41.60 ? 347  ILE A CA  1 
ATOM   2669 C C   . ILE A 1 344 ? 19.072  61.758 82.695 1.00 42.50 ? 347  ILE A C   1 
ATOM   2670 O O   . ILE A 1 344 ? 20.263  61.629 82.396 1.00 41.67 ? 347  ILE A O   1 
ATOM   2671 C CB  . ILE A 1 344 ? 17.795  61.971 80.537 1.00 40.85 ? 347  ILE A CB  1 
ATOM   2672 C CG1 . ILE A 1 344 ? 16.736  62.799 79.804 1.00 40.10 ? 347  ILE A CG1 1 
ATOM   2673 C CG2 . ILE A 1 344 ? 17.298  60.551 80.765 1.00 40.65 ? 347  ILE A CG2 1 
ATOM   2674 C CD1 . ILE A 1 344 ? 15.467  63.013 80.595 1.00 38.63 ? 347  ILE A CD1 1 
ATOM   2675 N N   . SER A 1 345 ? 18.504  61.137 83.724 1.00 43.71 ? 348  SER A N   1 
ATOM   2676 C CA  . SER A 1 345 ? 19.246  60.223 84.574 1.00 45.40 ? 348  SER A CA  1 
ATOM   2677 C C   . SER A 1 345 ? 19.511  58.958 83.769 1.00 46.63 ? 348  SER A C   1 
ATOM   2678 O O   . SER A 1 345 ? 19.060  58.824 82.632 1.00 47.07 ? 348  SER A O   1 
ATOM   2679 C CB  . SER A 1 345 ? 18.432  59.871 85.815 1.00 45.20 ? 348  SER A CB  1 
ATOM   2680 O OG  . SER A 1 345 ? 17.298  59.097 85.466 1.00 45.70 ? 348  SER A OG  1 
ATOM   2681 N N   . ARG A 1 346 ? 20.235  58.025 84.369 1.00 47.70 ? 349  ARG A N   1 
ATOM   2682 C CA  . ARG A 1 346 ? 20.560  56.779 83.701 1.00 48.25 ? 349  ARG A CA  1 
ATOM   2683 C C   . ARG A 1 346 ? 19.310  55.915 83.575 1.00 48.66 ? 349  ARG A C   1 
ATOM   2684 O O   . ARG A 1 346 ? 19.099  55.267 82.554 1.00 49.04 ? 349  ARG A O   1 
ATOM   2685 C CB  . ARG A 1 346 ? 21.637  56.035 84.494 1.00 48.78 ? 349  ARG A CB  1 
ATOM   2686 C CG  . ARG A 1 346 ? 22.374  54.990 83.691 1.00 48.93 ? 349  ARG A CG  1 
ATOM   2687 C CD  . ARG A 1 346 ? 23.091  55.633 82.525 1.00 48.95 ? 349  ARG A CD  1 
ATOM   2688 N NE  . ARG A 1 346 ? 23.336  54.663 81.467 1.00 49.46 ? 349  ARG A NE  1 
ATOM   2689 C CZ  . ARG A 1 346 ? 23.726  54.980 80.239 1.00 49.22 ? 349  ARG A CZ  1 
ATOM   2690 N NH1 . ARG A 1 346 ? 23.922  56.250 79.907 1.00 48.62 ? 349  ARG A NH1 1 
ATOM   2691 N NH2 . ARG A 1 346 ? 23.901  54.023 79.338 1.00 48.98 ? 349  ARG A NH2 1 
ATOM   2692 N N   . GLU A 1 347 ? 18.480  55.919 84.613 1.00 48.90 ? 350  GLU A N   1 
ATOM   2693 C CA  . GLU A 1 347 ? 17.255  55.126 84.615 1.00 49.16 ? 350  GLU A CA  1 
ATOM   2694 C C   . GLU A 1 347 ? 16.264  55.590 83.554 1.00 48.19 ? 350  GLU A C   1 
ATOM   2695 O O   . GLU A 1 347 ? 15.649  54.767 82.871 1.00 48.16 ? 350  GLU A O   1 
ATOM   2696 C CB  . GLU A 1 347 ? 16.580  55.172 85.992 1.00 51.04 ? 350  GLU A CB  1 
ATOM   2697 C CG  . GLU A 1 347 ? 17.429  54.606 87.116 1.00 54.98 ? 350  GLU A CG  1 
ATOM   2698 C CD  . GLU A 1 347 ? 18.667  55.447 87.391 1.00 57.31 ? 350  GLU A CD  1 
ATOM   2699 O OE1 . GLU A 1 347 ? 18.507  56.592 87.874 1.00 58.22 ? 350  GLU A OE1 1 
ATOM   2700 O OE2 . GLU A 1 347 ? 19.794  54.965 87.116 1.00 58.24 ? 350  GLU A OE2 1 
ATOM   2701 N N   . ASP A 1 348 ? 16.094  56.904 83.423 1.00 46.48 ? 351  ASP A N   1 
ATOM   2702 C CA  . ASP A 1 348 ? 15.167  57.429 82.430 1.00 44.76 ? 351  ASP A CA  1 
ATOM   2703 C C   . ASP A 1 348 ? 15.713  57.217 81.025 1.00 43.45 ? 351  ASP A C   1 
ATOM   2704 O O   . ASP A 1 348 ? 14.953  57.043 80.072 1.00 42.95 ? 351  ASP A O   1 
ATOM   2705 C CB  . ASP A 1 348 ? 14.887  58.916 82.670 1.00 44.55 ? 351  ASP A CB  1 
ATOM   2706 C CG  . ASP A 1 348 ? 13.959  59.151 83.849 1.00 44.62 ? 351  ASP A CG  1 
ATOM   2707 O OD1 . ASP A 1 348 ? 13.190  58.231 84.197 1.00 45.24 ? 351  ASP A OD1 1 
ATOM   2708 O OD2 . ASP A 1 348 ? 13.981  60.262 84.418 1.00 45.24 ? 351  ASP A OD2 1 
ATOM   2709 N N   . PHE A 1 349 ? 17.034  57.222 80.897 1.00 41.93 ? 352  PHE A N   1 
ATOM   2710 C CA  . PHE A 1 349 ? 17.648  57.013 79.598 1.00 41.36 ? 352  PHE A CA  1 
ATOM   2711 C C   . PHE A 1 349 ? 17.231  55.642 79.092 1.00 42.17 ? 352  PHE A C   1 
ATOM   2712 O O   . PHE A 1 349 ? 16.729  55.498 77.976 1.00 42.34 ? 352  PHE A O   1 
ATOM   2713 C CB  . PHE A 1 349 ? 19.167  57.058 79.702 1.00 39.22 ? 352  PHE A CB  1 
ATOM   2714 C CG  . PHE A 1 349 ? 19.862  56.843 78.391 1.00 37.33 ? 352  PHE A CG  1 
ATOM   2715 C CD1 . PHE A 1 349 ? 19.952  57.870 77.461 1.00 36.22 ? 352  PHE A CD1 1 
ATOM   2716 C CD2 . PHE A 1 349 ? 20.400  55.604 78.072 1.00 36.27 ? 352  PHE A CD2 1 
ATOM   2717 C CE1 . PHE A 1 349 ? 20.569  57.666 76.230 1.00 35.37 ? 352  PHE A CE1 1 
ATOM   2718 C CE2 . PHE A 1 349 ? 21.016  55.392 76.845 1.00 36.04 ? 352  PHE A CE2 1 
ATOM   2719 C CZ  . PHE A 1 349 ? 21.101  56.427 75.921 1.00 35.25 ? 352  PHE A CZ  1 
ATOM   2720 N N   . MET A 1 350 ? 17.441  54.633 79.927 1.00 42.98 ? 353  MET A N   1 
ATOM   2721 C CA  . MET A 1 350 ? 17.093  53.274 79.558 1.00 43.73 ? 353  MET A CA  1 
ATOM   2722 C C   . MET A 1 350 ? 15.596  53.108 79.341 1.00 42.05 ? 353  MET A C   1 
ATOM   2723 O O   . MET A 1 350 ? 15.175  52.325 78.493 1.00 41.70 ? 353  MET A O   1 
ATOM   2724 C CB  . MET A 1 350 ? 17.621  52.301 80.607 1.00 46.31 ? 353  MET A CB  1 
ATOM   2725 C CG  . MET A 1 350 ? 19.140  52.322 80.671 1.00 49.93 ? 353  MET A CG  1 
ATOM   2726 S SD  . MET A 1 350 ? 19.817  50.970 81.619 1.00 56.45 ? 353  MET A SD  1 
ATOM   2727 C CE  . MET A 1 350 ? 19.396  51.503 83.300 1.00 53.83 ? 353  MET A CE  1 
ATOM   2728 N N   . SER A 1 351 ? 14.789  53.839 80.099 1.00 40.17 ? 354  SER A N   1 
ATOM   2729 C CA  . SER A 1 351 ? 13.348  53.767 79.907 1.00 39.33 ? 354  SER A CA  1 
ATOM   2730 C C   . SER A 1 351 ? 13.059  54.328 78.517 1.00 37.84 ? 354  SER A C   1 
ATOM   2731 O O   . SER A 1 351 ? 12.224  53.803 77.782 1.00 38.05 ? 354  SER A O   1 
ATOM   2732 C CB  . SER A 1 351 ? 12.619  54.603 80.954 1.00 39.67 ? 354  SER A CB  1 
ATOM   2733 O OG  . SER A 1 351 ? 12.791  54.045 82.241 1.00 42.92 ? 354  SER A OG  1 
ATOM   2734 N N   . GLY A 1 352 ? 13.776  55.394 78.168 1.00 36.05 ? 355  GLY A N   1 
ATOM   2735 C CA  . GLY A 1 352 ? 13.611  56.029 76.876 1.00 34.39 ? 355  GLY A CA  1 
ATOM   2736 C C   . GLY A 1 352 ? 13.978  55.138 75.701 1.00 33.35 ? 355  GLY A C   1 
ATOM   2737 O O   . GLY A 1 352 ? 13.278  55.127 74.687 1.00 32.89 ? 355  GLY A O   1 
ATOM   2738 N N   . VAL A 1 353 ? 15.069  54.389 75.821 1.00 32.14 ? 356  VAL A N   1 
ATOM   2739 C CA  . VAL A 1 353 ? 15.476  53.511 74.731 1.00 31.82 ? 356  VAL A CA  1 
ATOM   2740 C C   . VAL A 1 353 ? 14.470  52.382 74.500 1.00 30.62 ? 356  VAL A C   1 
ATOM   2741 O O   . VAL A 1 353 ? 14.194  52.023 73.357 1.00 30.95 ? 356  VAL A O   1 
ATOM   2742 C CB  . VAL A 1 353 ? 16.915  52.935 74.961 1.00 32.48 ? 356  VAL A CB  1 
ATOM   2743 C CG1 . VAL A 1 353 ? 17.110  52.589 76.409 1.00 34.41 ? 356  VAL A CG1 1 
ATOM   2744 C CG2 . VAL A 1 353 ? 17.139  51.694 74.099 1.00 31.86 ? 356  VAL A CG2 1 
ATOM   2745 N N   . LYS A 1 354 ? 13.906  51.835 75.571 1.00 29.85 ? 357  LYS A N   1 
ATOM   2746 C CA  . LYS A 1 354 ? 12.925  50.759 75.429 1.00 29.99 ? 357  LYS A CA  1 
ATOM   2747 C C   . LYS A 1 354 ? 11.692  51.290 74.694 1.00 29.90 ? 357  LYS A C   1 
ATOM   2748 O O   . LYS A 1 354 ? 11.095  50.597 73.868 1.00 30.41 ? 357  LYS A O   1 
ATOM   2749 C CB  . LYS A 1 354 ? 12.513  50.216 76.803 1.00 29.28 ? 357  LYS A CB  1 
ATOM   2750 N N   . LEU A 1 355 ? 11.328  52.529 75.007 1.00 29.38 ? 358  LEU A N   1 
ATOM   2751 C CA  . LEU A 1 355 ? 10.187  53.205 74.404 1.00 29.01 ? 358  LEU A CA  1 
ATOM   2752 C C   . LEU A 1 355 ? 10.457  53.562 72.933 1.00 29.47 ? 358  LEU A C   1 
ATOM   2753 O O   . LEU A 1 355 ? 9.552   53.516 72.097 1.00 29.10 ? 358  LEU A O   1 
ATOM   2754 C CB  . LEU A 1 355 ? 9.908   54.483 75.188 1.00 28.54 ? 358  LEU A CB  1 
ATOM   2755 C CG  . LEU A 1 355 ? 8.597   54.739 75.933 1.00 29.00 ? 358  LEU A CG  1 
ATOM   2756 C CD1 . LEU A 1 355 ? 8.034   53.476 76.557 1.00 28.00 ? 358  LEU A CD1 1 
ATOM   2757 C CD2 . LEU A 1 355 ? 8.883   55.798 76.995 1.00 28.30 ? 358  LEU A CD2 1 
ATOM   2758 N N   . SER A 1 356 ? 11.707  53.909 72.629 1.00 29.42 ? 359  SER A N   1 
ATOM   2759 C CA  . SER A 1 356 ? 12.115  54.307 71.279 1.00 29.14 ? 359  SER A CA  1 
ATOM   2760 C C   . SER A 1 356 ? 12.266  53.159 70.295 1.00 29.90 ? 359  SER A C   1 
ATOM   2761 O O   . SER A 1 356 ? 12.078  53.339 69.093 1.00 29.24 ? 359  SER A O   1 
ATOM   2762 C CB  . SER A 1 356 ? 13.431  55.074 71.345 1.00 28.61 ? 359  SER A CB  1 
ATOM   2763 O OG  . SER A 1 356 ? 13.335  56.149 72.260 1.00 28.84 ? 359  SER A OG  1 
ATOM   2764 N N   . VAL A 1 357 ? 12.620  51.982 70.802 1.00 30.84 ? 360  VAL A N   1 
ATOM   2765 C CA  . VAL A 1 357 ? 12.795  50.806 69.955 1.00 31.81 ? 360  VAL A CA  1 
ATOM   2766 C C   . VAL A 1 357 ? 11.941  49.705 70.566 1.00 33.07 ? 360  VAL A C   1 
ATOM   2767 O O   . VAL A 1 357 ? 12.449  48.667 70.990 1.00 33.20 ? 360  VAL A O   1 
ATOM   2768 C CB  . VAL A 1 357 ? 14.269  50.360 69.932 1.00 31.78 ? 360  VAL A CB  1 
ATOM   2769 C CG1 . VAL A 1 357 ? 14.482  49.323 68.841 1.00 31.80 ? 360  VAL A CG1 1 
ATOM   2770 C CG2 . VAL A 1 357 ? 15.172  51.565 69.711 1.00 31.31 ? 360  VAL A CG2 1 
ATOM   2771 N N   . PRO A 1 358 ? 10.616  49.921 70.599 1.00 34.27 ? 361  PRO A N   1 
ATOM   2772 C CA  . PRO A 1 358 ? 9.609   49.008 71.153 1.00 35.10 ? 361  PRO A CA  1 
ATOM   2773 C C   . PRO A 1 358 ? 9.590   47.586 70.607 1.00 35.93 ? 361  PRO A C   1 
ATOM   2774 O O   . PRO A 1 358 ? 9.100   46.675 71.269 1.00 35.84 ? 361  PRO A O   1 
ATOM   2775 C CB  . PRO A 1 358 ? 8.304   49.744 70.877 1.00 35.28 ? 361  PRO A CB  1 
ATOM   2776 C CG  . PRO A 1 358 ? 8.590   50.410 69.575 1.00 34.05 ? 361  PRO A CG  1 
ATOM   2777 C CD  . PRO A 1 358 ? 9.960   50.986 69.816 1.00 33.90 ? 361  PRO A CD  1 
ATOM   2778 N N   . HIS A 1 359 ? 10.124  47.397 69.406 1.00 37.00 ? 362  HIS A N   1 
ATOM   2779 C CA  . HIS A 1 359 ? 10.140  46.081 68.776 1.00 38.87 ? 362  HIS A CA  1 
ATOM   2780 C C   . HIS A 1 359 ? 11.418  45.281 69.049 1.00 39.57 ? 362  HIS A C   1 
ATOM   2781 O O   . HIS A 1 359 ? 11.591  44.183 68.516 1.00 39.42 ? 362  HIS A O   1 
ATOM   2782 C CB  . HIS A 1 359 ? 9.970   46.244 67.266 1.00 39.46 ? 362  HIS A CB  1 
ATOM   2783 C CG  . HIS A 1 359 ? 11.017  47.111 66.639 1.00 40.74 ? 362  HIS A CG  1 
ATOM   2784 N ND1 . HIS A 1 359 ? 11.114  48.463 66.895 1.00 40.57 ? 362  HIS A ND1 1 
ATOM   2785 C CD2 . HIS A 1 359 ? 12.039  46.811 65.802 1.00 40.33 ? 362  HIS A CD2 1 
ATOM   2786 C CE1 . HIS A 1 359 ? 12.151  48.958 66.243 1.00 40.53 ? 362  HIS A CE1 1 
ATOM   2787 N NE2 . HIS A 1 359 ? 12.730  47.977 65.573 1.00 40.32 ? 362  HIS A NE2 1 
ATOM   2788 N N   . ALA A 1 360 ? 12.304  45.819 69.880 1.00 39.40 ? 363  ALA A N   1 
ATOM   2789 C CA  . ALA A 1 360 ? 13.559  45.140 70.172 1.00 39.70 ? 363  ALA A CA  1 
ATOM   2790 C C   . ALA A 1 360 ? 13.565  44.318 71.458 1.00 39.67 ? 363  ALA A C   1 
ATOM   2791 O O   . ALA A 1 360 ? 12.918  44.667 72.443 1.00 39.99 ? 363  ALA A O   1 
ATOM   2792 C CB  . ALA A 1 360 ? 14.696  46.159 70.208 1.00 39.20 ? 363  ALA A CB  1 
ATOM   2793 N N   . ASN A 1 361 ? 14.302  43.212 71.435 1.00 39.84 ? 364  ASN A N   1 
ATOM   2794 C CA  . ASN A 1 361 ? 14.434  42.368 72.611 1.00 39.57 ? 364  ASN A CA  1 
ATOM   2795 C C   . ASN A 1 361 ? 15.517  43.008 73.474 1.00 39.40 ? 364  ASN A C   1 
ATOM   2796 O O   . ASN A 1 361 ? 16.038  44.072 73.132 1.00 39.57 ? 364  ASN A O   1 
ATOM   2797 C CB  . ASN A 1 361 ? 14.841  40.943 72.223 1.00 39.72 ? 364  ASN A CB  1 
ATOM   2798 C CG  . ASN A 1 361 ? 16.008  40.911 71.260 1.00 39.88 ? 364  ASN A CG  1 
ATOM   2799 O OD1 . ASN A 1 361 ? 16.920  41.734 71.345 1.00 40.95 ? 364  ASN A OD1 1 
ATOM   2800 N ND2 . ASN A 1 361 ? 15.993  39.948 70.342 1.00 39.06 ? 364  ASN A ND2 1 
ATOM   2801 N N   . ASP A 1 362 ? 15.859  42.364 74.581 1.00 38.82 ? 365  ASP A N   1 
ATOM   2802 C CA  . ASP A 1 362 ? 16.870  42.900 75.479 1.00 38.91 ? 365  ASP A CA  1 
ATOM   2803 C C   . ASP A 1 362 ? 18.248  43.051 74.845 1.00 37.33 ? 365  ASP A C   1 
ATOM   2804 O O   . ASP A 1 362 ? 18.954  44.020 75.120 1.00 36.83 ? 365  ASP A O   1 
ATOM   2805 C CB  . ASP A 1 362 ? 16.956  42.036 76.736 1.00 41.80 ? 365  ASP A CB  1 
ATOM   2806 C CG  . ASP A 1 362 ? 15.767  42.240 77.657 1.00 44.95 ? 365  ASP A CG  1 
ATOM   2807 O OD1 . ASP A 1 362 ? 14.653  42.496 77.142 1.00 46.40 ? 365  ASP A OD1 1 
ATOM   2808 O OD2 . ASP A 1 362 ? 15.941  42.138 78.893 1.00 47.24 ? 365  ASP A OD2 1 
ATOM   2809 N N   . LEU A 1 363 ? 18.638  42.106 73.998 1.00 35.71 ? 366  LEU A N   1 
ATOM   2810 C CA  . LEU A 1 363 ? 19.942  42.202 73.352 1.00 34.41 ? 366  LEU A CA  1 
ATOM   2811 C C   . LEU A 1 363 ? 19.970  43.426 72.439 1.00 33.84 ? 366  LEU A C   1 
ATOM   2812 O O   . LEU A 1 363 ? 20.970  44.143 72.373 1.00 33.28 ? 366  LEU A O   1 
ATOM   2813 C CB  . LEU A 1 363 ? 20.238  40.951 72.530 1.00 33.91 ? 366  LEU A CB  1 
ATOM   2814 C CG  . LEU A 1 363 ? 21.630  40.986 71.901 1.00 33.46 ? 366  LEU A CG  1 
ATOM   2815 C CD1 . LEU A 1 363 ? 22.672  40.914 73.005 1.00 32.35 ? 366  LEU A CD1 1 
ATOM   2816 C CD2 . LEU A 1 363 ? 21.799  39.837 70.921 1.00 33.56 ? 366  LEU A CD2 1 
ATOM   2817 N N   . GLY A 1 364 ? 18.861  43.655 71.737 1.00 33.31 ? 367  GLY A N   1 
ATOM   2818 C CA  . GLY A 1 364 ? 18.761  44.796 70.840 1.00 32.42 ? 367  GLY A CA  1 
ATOM   2819 C C   . GLY A 1 364 ? 18.811  46.109 71.599 1.00 31.84 ? 367  GLY A C   1 
ATOM   2820 O O   . GLY A 1 364 ? 19.438  47.074 71.155 1.00 30.85 ? 367  GLY A O   1 
ATOM   2821 N N   . LEU A 1 365 ? 18.148  46.145 72.750 1.00 31.75 ? 368  LEU A N   1 
ATOM   2822 C CA  . LEU A 1 365 ? 18.133  47.338 73.584 1.00 32.41 ? 368  LEU A CA  1 
ATOM   2823 C C   . LEU A 1 365 ? 19.545  47.644 74.079 1.00 32.96 ? 368  LEU A C   1 
ATOM   2824 O O   . LEU A 1 365 ? 19.941  48.809 74.166 1.00 33.34 ? 368  LEU A O   1 
ATOM   2825 C CB  . LEU A 1 365 ? 17.186  47.143 74.773 1.00 32.11 ? 368  LEU A CB  1 
ATOM   2826 C CG  . LEU A 1 365 ? 15.697  46.997 74.430 1.00 32.81 ? 368  LEU A CG  1 
ATOM   2827 C CD1 . LEU A 1 365 ? 14.893  46.697 75.695 1.00 31.64 ? 368  LEU A CD1 1 
ATOM   2828 C CD2 . LEU A 1 365 ? 15.201  48.280 73.764 1.00 32.46 ? 368  LEU A CD2 1 
ATOM   2829 N N   . ASP A 1 366 ? 20.301  46.597 74.409 1.00 33.20 ? 369  ASP A N   1 
ATOM   2830 C CA  . ASP A 1 366 ? 21.676  46.778 74.864 1.00 33.13 ? 369  ASP A CA  1 
ATOM   2831 C C   . ASP A 1 366 ? 22.519  47.333 73.722 1.00 32.25 ? 369  ASP A C   1 
ATOM   2832 O O   . ASP A 1 366 ? 23.334  48.233 73.926 1.00 31.74 ? 369  ASP A O   1 
ATOM   2833 C CB  . ASP A 1 366 ? 22.291  45.453 75.326 1.00 34.84 ? 369  ASP A CB  1 
ATOM   2834 C CG  . ASP A 1 366 ? 21.701  44.955 76.623 1.00 36.56 ? 369  ASP A CG  1 
ATOM   2835 O OD1 . ASP A 1 366 ? 21.300  45.797 77.457 1.00 37.14 ? 369  ASP A OD1 1 
ATOM   2836 O OD2 . ASP A 1 366 ? 21.656  43.719 76.814 1.00 38.34 ? 369  ASP A OD2 1 
ATOM   2837 N N   . ALA A 1 367 ? 22.320  46.783 72.525 1.00 31.04 ? 370  ALA A N   1 
ATOM   2838 C CA  . ALA A 1 367 ? 23.063  47.223 71.350 1.00 30.69 ? 370  ALA A CA  1 
ATOM   2839 C C   . ALA A 1 367 ? 22.878  48.723 71.146 1.00 30.31 ? 370  ALA A C   1 
ATOM   2840 O O   . ALA A 1 367 ? 23.844  49.449 70.902 1.00 30.21 ? 370  ALA A O   1 
ATOM   2841 C CB  . ALA A 1 367 ? 22.598  46.458 70.111 1.00 29.34 ? 370  ALA A CB  1 
ATOM   2842 N N   . VAL A 1 368 ? 21.637  49.183 71.256 1.00 30.22 ? 371  VAL A N   1 
ATOM   2843 C CA  . VAL A 1 368 ? 21.328  50.601 71.091 1.00 30.59 ? 371  VAL A CA  1 
ATOM   2844 C C   . VAL A 1 368 ? 22.001  51.422 72.191 1.00 31.60 ? 371  VAL A C   1 
ATOM   2845 O O   . VAL A 1 368 ? 22.691  52.407 71.913 1.00 31.17 ? 371  VAL A O   1 
ATOM   2846 C CB  . VAL A 1 368 ? 19.794  50.852 71.141 1.00 30.31 ? 371  VAL A CB  1 
ATOM   2847 C CG1 . VAL A 1 368 ? 19.508  52.346 71.149 1.00 30.44 ? 371  VAL A CG1 1 
ATOM   2848 C CG2 . VAL A 1 368 ? 19.116  50.192 69.949 1.00 28.49 ? 371  VAL A CG2 1 
ATOM   2849 N N   . THR A 1 369 ? 21.798  51.002 73.438 1.00 32.35 ? 372  THR A N   1 
ATOM   2850 C CA  . THR A 1 369 ? 22.371  51.686 74.591 1.00 33.58 ? 372  THR A CA  1 
ATOM   2851 C C   . THR A 1 369 ? 23.882  51.800 74.462 1.00 35.00 ? 372  THR A C   1 
ATOM   2852 O O   . THR A 1 369 ? 24.452  52.872 74.658 1.00 35.21 ? 372  THR A O   1 
ATOM   2853 C CB  . THR A 1 369 ? 22.026  50.944 75.897 1.00 33.79 ? 372  THR A CB  1 
ATOM   2854 O OG1 . THR A 1 369 ? 20.607  50.978 76.095 1.00 34.86 ? 372  THR A OG1 1 
ATOM   2855 C CG2 . THR A 1 369 ? 22.707  51.595 77.087 1.00 33.23 ? 372  THR A CG2 1 
ATOM   2856 N N   . LEU A 1 370 ? 24.533  50.692 74.127 1.00 35.91 ? 373  LEU A N   1 
ATOM   2857 C CA  . LEU A 1 370 ? 25.978  50.696 73.960 1.00 36.99 ? 373  LEU A CA  1 
ATOM   2858 C C   . LEU A 1 370 ? 26.378  51.698 72.884 1.00 37.45 ? 373  LEU A C   1 
ATOM   2859 O O   . LEU A 1 370 ? 27.312  52.482 73.057 1.00 38.20 ? 373  LEU A O   1 
ATOM   2860 C CB  . LEU A 1 370 ? 26.467  49.304 73.554 1.00 37.78 ? 373  LEU A CB  1 
ATOM   2861 C CG  . LEU A 1 370 ? 27.938  49.187 73.148 1.00 38.61 ? 373  LEU A CG  1 
ATOM   2862 C CD1 . LEU A 1 370 ? 28.823  49.644 74.295 1.00 39.27 ? 373  LEU A CD1 1 
ATOM   2863 C CD2 . LEU A 1 370 ? 28.256  47.749 72.778 1.00 39.56 ? 373  LEU A CD2 1 
ATOM   2864 N N   . GLN A 1 371 ? 25.652  51.662 71.773 1.00 37.31 ? 374  GLN A N   1 
ATOM   2865 C CA  . GLN A 1 371 ? 25.909  52.527 70.628 1.00 37.00 ? 374  GLN A CA  1 
ATOM   2866 C C   . GLN A 1 371 ? 25.812  54.030 70.897 1.00 36.63 ? 374  GLN A C   1 
ATOM   2867 O O   . GLN A 1 371 ? 26.521  54.823 70.274 1.00 36.96 ? 374  GLN A O   1 
ATOM   2868 C CB  . GLN A 1 371 ? 24.938  52.164 69.500 1.00 37.30 ? 374  GLN A CB  1 
ATOM   2869 C CG  . GLN A 1 371 ? 25.255  52.807 68.176 1.00 38.18 ? 374  GLN A CG  1 
ATOM   2870 C CD  . GLN A 1 371 ? 26.494  52.213 67.533 1.00 39.16 ? 374  GLN A CD  1 
ATOM   2871 O OE1 . GLN A 1 371 ? 26.919  52.656 66.467 1.00 39.78 ? 374  GLN A OE1 1 
ATOM   2872 N NE2 . GLN A 1 371 ? 27.076  51.200 68.175 1.00 38.76 ? 374  GLN A NE2 1 
ATOM   2873 N N   . TYR A 1 372 ? 24.942  54.422 71.823 1.00 35.64 ? 375  TYR A N   1 
ATOM   2874 C CA  . TYR A 1 372 ? 24.732  55.840 72.109 1.00 35.43 ? 375  TYR A CA  1 
ATOM   2875 C C   . TYR A 1 372 ? 25.222  56.351 73.464 1.00 35.88 ? 375  TYR A C   1 
ATOM   2876 O O   . TYR A 1 372 ? 24.998  57.509 73.811 1.00 36.48 ? 375  TYR A O   1 
ATOM   2877 C CB  . TYR A 1 372 ? 23.239  56.162 71.937 1.00 33.39 ? 375  TYR A CB  1 
ATOM   2878 C CG  . TYR A 1 372 ? 22.808  56.270 70.485 1.00 32.74 ? 375  TYR A CG  1 
ATOM   2879 C CD1 . TYR A 1 372 ? 22.384  55.146 69.772 1.00 31.23 ? 375  TYR A CD1 1 
ATOM   2880 C CD2 . TYR A 1 372 ? 22.852  57.496 69.814 1.00 31.71 ? 375  TYR A CD2 1 
ATOM   2881 C CE1 . TYR A 1 372 ? 22.018  55.243 68.430 1.00 30.64 ? 375  TYR A CE1 1 
ATOM   2882 C CE2 . TYR A 1 372 ? 22.485  57.604 68.477 1.00 30.31 ? 375  TYR A CE2 1 
ATOM   2883 C CZ  . TYR A 1 372 ? 22.070  56.479 67.791 1.00 30.50 ? 375  TYR A CZ  1 
ATOM   2884 O OH  . TYR A 1 372 ? 21.704  56.593 66.469 1.00 29.73 ? 375  TYR A OH  1 
ATOM   2885 N N   . THR A 1 373 ? 25.901  55.502 74.222 1.00 36.23 ? 376  THR A N   1 
ATOM   2886 C CA  . THR A 1 373 ? 26.398  55.903 75.529 1.00 36.55 ? 376  THR A CA  1 
ATOM   2887 C C   . THR A 1 373 ? 27.887  56.228 75.528 1.00 37.10 ? 376  THR A C   1 
ATOM   2888 O O   . THR A 1 373 ? 28.685  55.530 74.909 1.00 37.13 ? 376  THR A O   1 
ATOM   2889 C CB  . THR A 1 373 ? 26.156  54.794 76.574 1.00 36.15 ? 376  THR A CB  1 
ATOM   2890 O OG1 . THR A 1 373 ? 24.753  54.553 76.694 1.00 37.25 ? 376  THR A OG1 1 
ATOM   2891 C CG2 . THR A 1 373 ? 26.702  55.197 77.932 1.00 36.31 ? 376  THR A CG2 1 
ATOM   2892 N N   . ASP A 1 374 ? 28.249  57.303 76.216 1.00 38.07 ? 377  ASP A N   1 
ATOM   2893 C CA  . ASP A 1 374 ? 29.647  57.693 76.360 1.00 39.50 ? 377  ASP A CA  1 
ATOM   2894 C C   . ASP A 1 374 ? 30.021  57.076 77.711 1.00 40.33 ? 377  ASP A C   1 
ATOM   2895 O O   . ASP A 1 374 ? 29.697  57.638 78.757 1.00 39.50 ? 377  ASP A O   1 
ATOM   2896 C CB  . ASP A 1 374 ? 29.775  59.214 76.432 1.00 39.66 ? 377  ASP A CB  1 
ATOM   2897 C CG  . ASP A 1 374 ? 31.209  59.672 76.650 1.00 40.69 ? 377  ASP A CG  1 
ATOM   2898 O OD1 . ASP A 1 374 ? 32.079  58.820 76.941 1.00 40.59 ? 377  ASP A OD1 1 
ATOM   2899 O OD2 . ASP A 1 374 ? 31.464  60.889 76.538 1.00 40.73 ? 377  ASP A OD2 1 
ATOM   2900 N N   . TRP A 1 375 ? 30.682  55.919 77.688 1.00 41.22 ? 378  TRP A N   1 
ATOM   2901 C CA  . TRP A 1 375 ? 31.043  55.233 78.924 1.00 42.82 ? 378  TRP A CA  1 
ATOM   2902 C C   . TRP A 1 375 ? 32.131  55.906 79.743 1.00 43.96 ? 378  TRP A C   1 
ATOM   2903 O O   . TRP A 1 375 ? 32.488  55.429 80.816 1.00 44.27 ? 378  TRP A O   1 
ATOM   2904 C CB  . TRP A 1 375 ? 31.421  53.780 78.633 1.00 42.62 ? 378  TRP A CB  1 
ATOM   2905 C CG  . TRP A 1 375 ? 30.280  53.017 78.050 1.00 43.26 ? 378  TRP A CG  1 
ATOM   2906 C CD1 . TRP A 1 375 ? 30.120  52.653 76.745 1.00 44.02 ? 378  TRP A CD1 1 
ATOM   2907 C CD2 . TRP A 1 375 ? 29.083  52.619 78.727 1.00 43.08 ? 378  TRP A CD2 1 
ATOM   2908 N NE1 . TRP A 1 375 ? 28.894  52.058 76.564 1.00 44.30 ? 378  TRP A NE1 1 
ATOM   2909 C CE2 . TRP A 1 375 ? 28.237  52.025 77.766 1.00 43.75 ? 378  TRP A CE2 1 
ATOM   2910 C CE3 . TRP A 1 375 ? 28.640  52.711 80.053 1.00 43.69 ? 378  TRP A CE3 1 
ATOM   2911 C CZ2 . TRP A 1 375 ? 26.969  51.523 78.087 1.00 44.36 ? 378  TRP A CZ2 1 
ATOM   2912 C CZ3 . TRP A 1 375 ? 27.380  52.213 80.375 1.00 43.87 ? 378  TRP A CZ3 1 
ATOM   2913 C CH2 . TRP A 1 375 ? 26.560  51.627 79.394 1.00 44.45 ? 378  TRP A CH2 1 
ATOM   2914 N N   . MET A 1 376 ? 32.654  57.013 79.236 1.00 45.70 ? 379  MET A N   1 
ATOM   2915 C CA  . MET A 1 376 ? 33.676  57.772 79.946 1.00 47.95 ? 379  MET A CA  1 
ATOM   2916 C C   . MET A 1 376 ? 32.949  58.808 80.793 1.00 48.34 ? 379  MET A C   1 
ATOM   2917 O O   . MET A 1 376 ? 33.561  59.502 81.604 1.00 49.34 ? 379  MET A O   1 
ATOM   2918 C CB  . MET A 1 376 ? 34.591  58.504 78.957 1.00 49.71 ? 379  MET A CB  1 
ATOM   2919 C CG  . MET A 1 376 ? 35.844  57.751 78.546 1.00 52.89 ? 379  MET A CG  1 
ATOM   2920 S SD  . MET A 1 376 ? 37.117  57.782 79.832 1.00 57.07 ? 379  MET A SD  1 
ATOM   2921 C CE  . MET A 1 376 ? 38.059  59.236 79.337 1.00 55.70 ? 379  MET A CE  1 
ATOM   2922 N N   . ASP A 1 377 ? 31.636  58.898 80.605 1.00 48.07 ? 380  ASP A N   1 
ATOM   2923 C CA  . ASP A 1 377 ? 30.832  59.888 81.312 1.00 47.94 ? 380  ASP A CA  1 
ATOM   2924 C C   . ASP A 1 377 ? 29.345  59.513 81.203 1.00 48.06 ? 380  ASP A C   1 
ATOM   2925 O O   . ASP A 1 377 ? 28.515  60.316 80.772 1.00 47.41 ? 380  ASP A O   1 
ATOM   2926 C CB  . ASP A 1 377 ? 31.119  61.253 80.670 1.00 47.50 ? 380  ASP A CB  1 
ATOM   2927 C CG  . ASP A 1 377 ? 30.540  62.411 81.444 1.00 47.33 ? 380  ASP A CG  1 
ATOM   2928 O OD1 . ASP A 1 377 ? 30.441  62.316 82.689 1.00 47.20 ? 380  ASP A OD1 1 
ATOM   2929 O OD2 . ASP A 1 377 ? 30.205  63.429 80.796 1.00 46.30 ? 380  ASP A OD2 1 
ATOM   2930 N N   . ASP A 1 378 ? 29.023  58.288 81.619 1.00 48.37 ? 381  ASP A N   1 
ATOM   2931 C CA  . ASP A 1 378 ? 27.661  57.753 81.541 1.00 48.90 ? 381  ASP A CA  1 
ATOM   2932 C C   . ASP A 1 378 ? 26.578  58.385 82.424 1.00 48.85 ? 381  ASP A C   1 
ATOM   2933 O O   . ASP A 1 378 ? 25.391  58.093 82.250 1.00 49.04 ? 381  ASP A O   1 
ATOM   2934 C CB  . ASP A 1 378 ? 27.689  56.241 81.794 1.00 49.09 ? 381  ASP A CB  1 
ATOM   2935 C CG  . ASP A 1 378 ? 28.162  55.890 83.191 1.00 49.89 ? 381  ASP A CG  1 
ATOM   2936 O OD1 . ASP A 1 378 ? 29.275  56.315 83.573 1.00 50.15 ? 381  ASP A OD1 1 
ATOM   2937 O OD2 . ASP A 1 378 ? 27.419  55.185 83.907 1.00 50.67 ? 381  ASP A OD2 1 
ATOM   2938 N N   . ASN A 1 379 ? 26.967  59.236 83.367 1.00 48.29 ? 382  ASN A N   1 
ATOM   2939 C CA  . ASN A 1 379 ? 25.981  59.874 84.236 1.00 47.66 ? 382  ASN A CA  1 
ATOM   2940 C C   . ASN A 1 379 ? 25.729  61.322 83.859 1.00 46.31 ? 382  ASN A C   1 
ATOM   2941 O O   . ASN A 1 379 ? 25.082  62.062 84.600 1.00 46.73 ? 382  ASN A O   1 
ATOM   2942 C CB  . ASN A 1 379 ? 26.418  59.798 85.701 1.00 48.90 ? 382  ASN A CB  1 
ATOM   2943 C CG  . ASN A 1 379 ? 26.269  58.408 86.274 1.00 50.16 ? 382  ASN A CG  1 
ATOM   2944 O OD1 . ASN A 1 379 ? 25.188  57.815 86.217 1.00 50.38 ? 382  ASN A OD1 1 
ATOM   2945 N ND2 . ASN A 1 379 ? 27.354  57.877 86.833 1.00 51.07 ? 382  ASN A ND2 1 
ATOM   2946 N N   . ASN A 1 380 ? 26.246  61.722 82.704 1.00 44.47 ? 383  ASN A N   1 
ATOM   2947 C CA  . ASN A 1 380 ? 26.070  63.080 82.222 1.00 42.42 ? 383  ASN A CA  1 
ATOM   2948 C C   . ASN A 1 380 ? 24.631  63.247 81.739 1.00 41.49 ? 383  ASN A C   1 
ATOM   2949 O O   . ASN A 1 380 ? 24.223  62.640 80.749 1.00 41.13 ? 383  ASN A O   1 
ATOM   2950 C CB  . ASN A 1 380 ? 27.061  63.349 81.090 1.00 42.26 ? 383  ASN A CB  1 
ATOM   2951 C CG  . ASN A 1 380 ? 27.028  64.780 80.610 1.00 42.17 ? 383  ASN A CG  1 
ATOM   2952 O OD1 . ASN A 1 380 ? 28.025  65.289 80.105 1.00 43.40 ? 383  ASN A OD1 1 
ATOM   2953 N ND2 . ASN A 1 380 ? 25.882  65.433 80.747 1.00 41.17 ? 383  ASN A ND2 1 
ATOM   2954 N N   . GLY A 1 381 ? 23.868  64.069 82.457 1.00 40.48 ? 384  GLY A N   1 
ATOM   2955 C CA  . GLY A 1 381 ? 22.478  64.311 82.116 1.00 38.69 ? 384  GLY A CA  1 
ATOM   2956 C C   . GLY A 1 381 ? 22.272  64.918 80.743 1.00 37.92 ? 384  GLY A C   1 
ATOM   2957 O O   . GLY A 1 381 ? 21.319  64.567 80.046 1.00 37.98 ? 384  GLY A O   1 
ATOM   2958 N N   . ILE A 1 382 ? 23.154  65.830 80.352 1.00 36.80 ? 385  ILE A N   1 
ATOM   2959 C CA  . ILE A 1 382 ? 23.056  66.469 79.046 1.00 36.42 ? 385  ILE A CA  1 
ATOM   2960 C C   . ILE A 1 382 ? 23.321  65.443 77.947 1.00 36.72 ? 385  ILE A C   1 
ATOM   2961 O O   . ILE A 1 382 ? 22.649  65.432 76.913 1.00 36.58 ? 385  ILE A O   1 
ATOM   2962 C CB  . ILE A 1 382 ? 24.090  67.607 78.892 1.00 36.12 ? 385  ILE A CB  1 
ATOM   2963 C CG1 . ILE A 1 382 ? 23.831  68.705 79.926 1.00 36.79 ? 385  ILE A CG1 1 
ATOM   2964 C CG2 . ILE A 1 382 ? 24.023  68.184 77.485 1.00 34.63 ? 385  ILE A CG2 1 
ATOM   2965 C CD1 . ILE A 1 382 ? 22.570  69.495 79.679 1.00 38.45 ? 385  ILE A CD1 1 
ATOM   2966 N N   . LYS A 1 383 ? 24.312  64.588 78.177 1.00 36.99 ? 386  LYS A N   1 
ATOM   2967 C CA  . LYS A 1 383 ? 24.683  63.568 77.207 1.00 36.92 ? 386  LYS A CA  1 
ATOM   2968 C C   . LYS A 1 383 ? 23.627  62.491 77.060 1.00 36.46 ? 386  LYS A C   1 
ATOM   2969 O O   . LYS A 1 383 ? 23.410  61.986 75.961 1.00 36.69 ? 386  LYS A O   1 
ATOM   2970 C CB  . LYS A 1 383 ? 26.027  62.939 77.581 1.00 37.30 ? 386  LYS A CB  1 
ATOM   2971 C CG  . LYS A 1 383 ? 27.215  63.840 77.285 1.00 38.03 ? 386  LYS A CG  1 
ATOM   2972 C CD  . LYS A 1 383 ? 28.528  63.165 77.647 1.00 39.05 ? 386  LYS A CD  1 
ATOM   2973 C CE  . LYS A 1 383 ? 29.717  64.001 77.194 1.00 38.97 ? 386  LYS A CE  1 
ATOM   2974 N NZ  . LYS A 1 383 ? 31.004  63.322 77.490 1.00 39.96 ? 386  LYS A NZ  1 
ATOM   2975 N N   . ASN A 1 384 ? 22.970  62.136 78.159 1.00 35.95 ? 387  ASN A N   1 
ATOM   2976 C CA  . ASN A 1 384 ? 21.924  61.125 78.089 1.00 35.73 ? 387  ASN A CA  1 
ATOM   2977 C C   . ASN A 1 384 ? 20.716  61.701 77.347 1.00 34.79 ? 387  ASN A C   1 
ATOM   2978 O O   . ASN A 1 384 ? 20.076  61.014 76.551 1.00 34.84 ? 387  ASN A O   1 
ATOM   2979 C CB  . ASN A 1 384 ? 21.499  60.670 79.491 1.00 36.35 ? 387  ASN A CB  1 
ATOM   2980 C CG  . ASN A 1 384 ? 22.591  59.901 80.216 1.00 38.35 ? 387  ASN A CG  1 
ATOM   2981 O OD1 . ASN A 1 384 ? 23.393  59.202 79.595 1.00 39.30 ? 387  ASN A OD1 1 
ATOM   2982 N ND2 . ASN A 1 384 ? 22.614  60.012 81.542 1.00 39.42 ? 387  ASN A ND2 1 
ATOM   2983 N N   . ARG A 1 385 ? 20.411  62.966 77.612 1.00 33.79 ? 388  ARG A N   1 
ATOM   2984 C CA  . ARG A 1 385 ? 19.283  63.622 76.970 1.00 32.89 ? 388  ARG A CA  1 
ATOM   2985 C C   . ARG A 1 385 ? 19.501  63.730 75.467 1.00 32.54 ? 388  ARG A C   1 
ATOM   2986 O O   . ARG A 1 385 ? 18.625  63.378 74.680 1.00 32.75 ? 388  ARG A O   1 
ATOM   2987 C CB  . ARG A 1 385 ? 19.062  65.015 77.567 1.00 32.35 ? 388  ARG A CB  1 
ATOM   2988 C CG  . ARG A 1 385 ? 17.932  65.792 76.908 1.00 32.54 ? 388  ARG A CG  1 
ATOM   2989 C CD  . ARG A 1 385 ? 18.461  67.057 76.267 1.00 32.66 ? 388  ARG A CD  1 
ATOM   2990 N NE  . ARG A 1 385 ? 18.697  68.081 77.268 1.00 32.86 ? 388  ARG A NE  1 
ATOM   2991 C CZ  . ARG A 1 385 ? 19.618  69.033 77.175 1.00 32.41 ? 388  ARG A CZ  1 
ATOM   2992 N NH1 . ARG A 1 385 ? 20.413  69.104 76.118 1.00 31.35 ? 388  ARG A NH1 1 
ATOM   2993 N NH2 . ARG A 1 385 ? 19.736  69.919 78.150 1.00 33.45 ? 388  ARG A NH2 1 
ATOM   2994 N N   . ASP A 1 386 ? 20.675  64.198 75.063 1.00 31.94 ? 389  ASP A N   1 
ATOM   2995 C CA  . ASP A 1 386 ? 20.958  64.338 73.642 1.00 31.49 ? 389  ASP A CA  1 
ATOM   2996 C C   . ASP A 1 386 ? 21.116  62.997 72.935 1.00 30.98 ? 389  ASP A C   1 
ATOM   2997 O O   . ASP A 1 386 ? 20.759  62.862 71.764 1.00 30.66 ? 389  ASP A O   1 
ATOM   2998 C CB  . ASP A 1 386 ? 22.202  65.198 73.437 1.00 31.27 ? 389  ASP A CB  1 
ATOM   2999 C CG  . ASP A 1 386 ? 22.001  66.614 73.922 1.00 31.15 ? 389  ASP A CG  1 
ATOM   3000 O OD1 . ASP A 1 386 ? 20.832  67.042 74.012 1.00 31.53 ? 389  ASP A OD1 1 
ATOM   3001 O OD2 . ASP A 1 386 ? 23.001  67.301 74.204 1.00 31.75 ? 389  ASP A OD2 1 
ATOM   3002 N N   . GLY A 1 387 ? 21.642  62.006 73.648 1.00 30.35 ? 390  GLY A N   1 
ATOM   3003 C CA  . GLY A 1 387 ? 21.812  60.691 73.058 1.00 29.79 ? 390  GLY A CA  1 
ATOM   3004 C C   . GLY A 1 387 ? 20.462  60.077 72.733 1.00 29.45 ? 390  GLY A C   1 
ATOM   3005 O O   . GLY A 1 387 ? 20.273  59.484 71.671 1.00 28.95 ? 390  GLY A O   1 
ATOM   3006 N N   . LEU A 1 388 ? 19.516  60.234 73.652 1.00 29.25 ? 391  LEU A N   1 
ATOM   3007 C CA  . LEU A 1 388 ? 18.169  59.705 73.480 1.00 29.56 ? 391  LEU A CA  1 
ATOM   3008 C C   . LEU A 1 388 ? 17.495  60.463 72.329 1.00 30.06 ? 391  LEU A C   1 
ATOM   3009 O O   . LEU A 1 388 ? 16.775  59.884 71.509 1.00 29.23 ? 391  LEU A O   1 
ATOM   3010 C CB  . LEU A 1 388 ? 17.395  59.879 74.789 1.00 30.05 ? 391  LEU A CB  1 
ATOM   3011 C CG  . LEU A 1 388 ? 16.232  58.936 75.092 1.00 31.92 ? 391  LEU A CG  1 
ATOM   3012 C CD1 . LEU A 1 388 ? 16.587  57.515 74.690 1.00 32.52 ? 391  LEU A CD1 1 
ATOM   3013 C CD2 . LEU A 1 388 ? 15.913  58.999 76.581 1.00 32.12 ? 391  LEU A CD2 1 
ATOM   3014 N N   . ASP A 1 389 ? 17.756  61.764 72.269 1.00 29.98 ? 392  ASP A N   1 
ATOM   3015 C CA  . ASP A 1 389 ? 17.211  62.611 71.222 1.00 31.08 ? 392  ASP A CA  1 
ATOM   3016 C C   . ASP A 1 389 ? 17.690  62.081 69.860 1.00 30.65 ? 392  ASP A C   1 
ATOM   3017 O O   . ASP A 1 389 ? 16.903  61.959 68.918 1.00 30.52 ? 392  ASP A O   1 
ATOM   3018 C CB  . ASP A 1 389 ? 17.687  64.051 71.427 1.00 32.64 ? 392  ASP A CB  1 
ATOM   3019 C CG  . ASP A 1 389 ? 16.913  65.049 70.591 1.00 35.29 ? 392  ASP A CG  1 
ATOM   3020 O OD1 . ASP A 1 389 ? 16.425  64.674 69.503 1.00 36.90 ? 392  ASP A OD1 1 
ATOM   3021 O OD2 . ASP A 1 389 ? 16.805  66.221 71.014 1.00 37.23 ? 392  ASP A OD2 1 
ATOM   3022 N N   . ASP A 1 390 ? 18.980  61.761 69.763 1.00 29.80 ? 393  ASP A N   1 
ATOM   3023 C CA  . ASP A 1 390 ? 19.543  61.238 68.520 1.00 29.28 ? 393  ASP A CA  1 
ATOM   3024 C C   . ASP A 1 390 ? 19.027  59.845 68.187 1.00 28.33 ? 393  ASP A C   1 
ATOM   3025 O O   . ASP A 1 390 ? 18.864  59.495 67.016 1.00 27.98 ? 393  ASP A O   1 
ATOM   3026 C CB  . ASP A 1 390 ? 21.073  61.193 68.589 1.00 30.81 ? 393  ASP A CB  1 
ATOM   3027 C CG  . ASP A 1 390 ? 21.701  62.560 68.427 1.00 32.30 ? 393  ASP A CG  1 
ATOM   3028 O OD1 . ASP A 1 390 ? 21.206  63.341 67.586 1.00 34.13 ? 393  ASP A OD1 1 
ATOM   3029 O OD2 . ASP A 1 390 ? 22.695  62.849 69.126 1.00 33.90 ? 393  ASP A OD2 1 
ATOM   3030 N N   . ILE A 1 391 ? 18.787  59.042 69.216 1.00 27.22 ? 394  ILE A N   1 
ATOM   3031 C CA  . ILE A 1 391 ? 18.282  57.694 69.003 1.00 26.09 ? 394  ILE A CA  1 
ATOM   3032 C C   . ILE A 1 391 ? 16.925  57.745 68.313 1.00 25.21 ? 394  ILE A C   1 
ATOM   3033 O O   . ILE A 1 391 ? 16.701  57.063 67.314 1.00 26.05 ? 394  ILE A O   1 
ATOM   3034 C CB  . ILE A 1 391 ? 18.140  56.934 70.342 1.00 26.00 ? 394  ILE A CB  1 
ATOM   3035 C CG1 . ILE A 1 391 ? 19.527  56.550 70.864 1.00 24.89 ? 394  ILE A CG1 1 
ATOM   3036 C CG2 . ILE A 1 391 ? 17.261  55.702 70.160 1.00 24.26 ? 394  ILE A CG2 1 
ATOM   3037 C CD1 . ILE A 1 391 ? 19.513  55.976 72.261 1.00 24.82 ? 394  ILE A CD1 1 
ATOM   3038 N N   . VAL A 1 392 ? 16.025  58.563 68.844 1.00 24.52 ? 395  VAL A N   1 
ATOM   3039 C CA  . VAL A 1 392 ? 14.690  58.681 68.285 1.00 24.74 ? 395  VAL A CA  1 
ATOM   3040 C C   . VAL A 1 392 ? 14.724  59.257 66.875 1.00 25.09 ? 395  VAL A C   1 
ATOM   3041 O O   . VAL A 1 392 ? 14.031  58.760 65.986 1.00 25.46 ? 395  VAL A O   1 
ATOM   3042 C CB  . VAL A 1 392 ? 13.782  59.546 69.192 1.00 23.98 ? 395  VAL A CB  1 
ATOM   3043 C CG1 . VAL A 1 392 ? 12.410  59.700 68.569 1.00 23.78 ? 395  VAL A CG1 1 
ATOM   3044 C CG2 . VAL A 1 392 ? 13.654  58.894 70.559 1.00 23.29 ? 395  VAL A CG2 1 
ATOM   3045 N N   . GLY A 1 393 ? 15.543  60.288 66.669 1.00 25.03 ? 396  GLY A N   1 
ATOM   3046 C CA  . GLY A 1 393 ? 15.653  60.905 65.358 1.00 23.24 ? 396  GLY A CA  1 
ATOM   3047 C C   . GLY A 1 393 ? 16.311  60.015 64.317 1.00 24.12 ? 396  GLY A C   1 
ATOM   3048 O O   . GLY A 1 393 ? 15.845  59.939 63.174 1.00 23.38 ? 396  GLY A O   1 
ATOM   3049 N N   . ASP A 1 394 ? 17.393  59.337 64.701 1.00 23.98 ? 397  ASP A N   1 
ATOM   3050 C CA  . ASP A 1 394 ? 18.103  58.457 63.777 1.00 23.89 ? 397  ASP A CA  1 
ATOM   3051 C C   . ASP A 1 394 ? 17.264  57.252 63.373 1.00 23.83 ? 397  ASP A C   1 
ATOM   3052 O O   . ASP A 1 394 ? 17.192  56.904 62.199 1.00 24.06 ? 397  ASP A O   1 
ATOM   3053 C CB  . ASP A 1 394 ? 19.420  57.957 64.391 1.00 24.22 ? 397  ASP A CB  1 
ATOM   3054 C CG  . ASP A 1 394 ? 20.438  59.070 64.590 1.00 25.37 ? 397  ASP A CG  1 
ATOM   3055 O OD1 . ASP A 1 394 ? 20.294  60.136 63.954 1.00 26.17 ? 397  ASP A OD1 1 
ATOM   3056 O OD2 . ASP A 1 394 ? 21.390  58.872 65.375 1.00 24.54 ? 397  ASP A OD2 1 
ATOM   3057 N N   . HIS A 1 395 ? 16.632  56.616 64.352 1.00 23.81 ? 398  HIS A N   1 
ATOM   3058 C CA  . HIS A 1 395 ? 15.815  55.432 64.099 1.00 24.12 ? 398  HIS A CA  1 
ATOM   3059 C C   . HIS A 1 395 ? 14.532  55.695 63.309 1.00 24.16 ? 398  HIS A C   1 
ATOM   3060 O O   . HIS A 1 395 ? 14.184  54.927 62.412 1.00 24.11 ? 398  HIS A O   1 
ATOM   3061 C CB  . HIS A 1 395 ? 15.450  54.757 65.429 1.00 22.98 ? 398  HIS A CB  1 
ATOM   3062 C CG  . HIS A 1 395 ? 14.419  53.679 65.298 1.00 23.18 ? 398  HIS A CG  1 
ATOM   3063 N ND1 . HIS A 1 395 ? 14.613  52.550 64.530 1.00 24.09 ? 398  HIS A ND1 1 
ATOM   3064 C CD2 . HIS A 1 395 ? 13.182  53.558 65.836 1.00 23.46 ? 398  HIS A CD2 1 
ATOM   3065 C CE1 . HIS A 1 395 ? 13.541  51.780 64.602 1.00 22.98 ? 398  HIS A CE1 1 
ATOM   3066 N NE2 . HIS A 1 395 ? 12.658  52.369 65.388 1.00 23.67 ? 398  HIS A NE2 1 
ATOM   3067 N N   . ASN A 1 396 ? 13.845  56.784 63.640 1.00 23.78 ? 399  ASN A N   1 
ATOM   3068 C CA  . ASN A 1 396 ? 12.577  57.115 63.005 1.00 23.72 ? 399  ASN A CA  1 
ATOM   3069 C C   . ASN A 1 396 ? 12.583  57.992 61.757 1.00 23.91 ? 399  ASN A C   1 
ATOM   3070 O O   . ASN A 1 396 ? 11.677  57.894 60.933 1.00 24.27 ? 399  ASN A O   1 
ATOM   3071 C CB  . ASN A 1 396 ? 11.653  57.740 64.048 1.00 22.85 ? 399  ASN A CB  1 
ATOM   3072 C CG  . ASN A 1 396 ? 11.215  56.745 65.103 1.00 23.02 ? 399  ASN A CG  1 
ATOM   3073 O OD1 . ASN A 1 396 ? 10.456  55.819 64.818 1.00 23.38 ? 399  ASN A OD1 1 
ATOM   3074 N ND2 . ASN A 1 396 ? 11.696  56.925 66.327 1.00 22.15 ? 399  ASN A ND2 1 
ATOM   3075 N N   . VAL A 1 397 ? 13.589  58.841 61.595 1.00 24.10 ? 400  VAL A N   1 
ATOM   3076 C CA  . VAL A 1 397 ? 13.594  59.720 60.434 1.00 23.60 ? 400  VAL A CA  1 
ATOM   3077 C C   . VAL A 1 397 ? 14.849  59.684 59.570 1.00 24.31 ? 400  VAL A C   1 
ATOM   3078 O O   . VAL A 1 397 ? 14.803  59.291 58.404 1.00 24.39 ? 400  VAL A O   1 
ATOM   3079 C CB  . VAL A 1 397 ? 13.349  61.191 60.871 1.00 22.85 ? 400  VAL A CB  1 
ATOM   3080 C CG1 . VAL A 1 397 ? 13.379  62.109 59.665 1.00 20.72 ? 400  VAL A CG1 1 
ATOM   3081 C CG2 . VAL A 1 397 ? 12.018  61.302 61.610 1.00 21.52 ? 400  VAL A CG2 1 
ATOM   3082 N N   . ILE A 1 398 ? 15.970  60.099 60.149 1.00 24.82 ? 401  ILE A N   1 
ATOM   3083 C CA  . ILE A 1 398 ? 17.228  60.173 59.423 1.00 25.24 ? 401  ILE A CA  1 
ATOM   3084 C C   . ILE A 1 398 ? 17.723  58.894 58.756 1.00 25.45 ? 401  ILE A C   1 
ATOM   3085 O O   . ILE A 1 398 ? 17.909  58.865 57.537 1.00 24.89 ? 401  ILE A O   1 
ATOM   3086 C CB  . ILE A 1 398 ? 18.344  60.736 60.330 1.00 24.89 ? 401  ILE A CB  1 
ATOM   3087 C CG1 . ILE A 1 398 ? 17.936  62.132 60.814 1.00 24.96 ? 401  ILE A CG1 1 
ATOM   3088 C CG2 . ILE A 1 398 ? 19.666  60.782 59.569 1.00 23.61 ? 401  ILE A CG2 1 
ATOM   3089 C CD1 . ILE A 1 398 ? 18.919  62.790 61.758 1.00 25.07 ? 401  ILE A CD1 1 
ATOM   3090 N N   . CYS A 1 399 ? 17.937  57.837 59.530 1.00 25.21 ? 402  CYS A N   1 
ATOM   3091 C CA  . CYS A 1 399 ? 18.440  56.609 58.932 1.00 25.59 ? 402  CYS A CA  1 
ATOM   3092 C C   . CYS A 1 399 ? 17.476  55.987 57.934 1.00 25.71 ? 402  CYS A C   1 
ATOM   3093 O O   . CYS A 1 399 ? 17.897  55.448 56.914 1.00 24.87 ? 402  CYS A O   1 
ATOM   3094 C CB  . CYS A 1 399 ? 18.843  55.622 60.020 1.00 25.72 ? 402  CYS A CB  1 
ATOM   3095 S SG  . CYS A 1 399 ? 20.293  56.236 60.941 1.00 29.02 ? 402  CYS A SG  1 
ATOM   3096 N N   . PRO A 1 400 ? 16.166  56.030 58.219 1.00 25.85 ? 403  PRO A N   1 
ATOM   3097 C CA  . PRO A 1 400 ? 15.256  55.441 57.234 1.00 25.67 ? 403  PRO A CA  1 
ATOM   3098 C C   . PRO A 1 400 ? 15.344  56.259 55.939 1.00 25.70 ? 403  PRO A C   1 
ATOM   3099 O O   . PRO A 1 400 ? 15.285  55.710 54.838 1.00 26.27 ? 403  PRO A O   1 
ATOM   3100 C CB  . PRO A 1 400 ? 13.894  55.561 57.910 1.00 25.80 ? 403  PRO A CB  1 
ATOM   3101 C CG  . PRO A 1 400 ? 14.238  55.395 59.363 1.00 25.71 ? 403  PRO A CG  1 
ATOM   3102 C CD  . PRO A 1 400 ? 15.485  56.238 59.511 1.00 25.58 ? 403  PRO A CD  1 
ATOM   3103 N N   . LEU A 1 401 ? 15.506  57.572 56.073 1.00 25.31 ? 404  LEU A N   1 
ATOM   3104 C CA  . LEU A 1 401 ? 15.605  58.432 54.898 1.00 25.87 ? 404  LEU A CA  1 
ATOM   3105 C C   . LEU A 1 401 ? 16.920  58.207 54.153 1.00 26.30 ? 404  LEU A C   1 
ATOM   3106 O O   . LEU A 1 401 ? 16.956  58.247 52.919 1.00 26.59 ? 404  LEU A O   1 
ATOM   3107 C CB  . LEU A 1 401 ? 15.463  59.909 55.287 1.00 25.07 ? 404  LEU A CB  1 
ATOM   3108 C CG  . LEU A 1 401 ? 15.522  60.909 54.121 1.00 25.48 ? 404  LEU A CG  1 
ATOM   3109 C CD1 . LEU A 1 401 ? 14.658  62.126 54.428 1.00 24.73 ? 404  LEU A CD1 1 
ATOM   3110 C CD2 . LEU A 1 401 ? 16.973  61.318 53.859 1.00 24.44 ? 404  LEU A CD2 1 
ATOM   3111 N N   . MET A 1 402 ? 18.001  57.971 54.892 1.00 25.88 ? 405  MET A N   1 
ATOM   3112 C CA  . MET A 1 402 ? 19.287  57.721 54.250 1.00 26.04 ? 405  MET A CA  1 
ATOM   3113 C C   . MET A 1 402 ? 19.235  56.392 53.498 1.00 25.97 ? 405  MET A C   1 
ATOM   3114 O O   . MET A 1 402 ? 19.799  56.264 52.419 1.00 25.85 ? 405  MET A O   1 
ATOM   3115 C CB  . MET A 1 402 ? 20.423  57.718 55.277 1.00 25.43 ? 405  MET A CB  1 
ATOM   3116 C CG  . MET A 1 402 ? 20.719  59.095 55.849 1.00 25.14 ? 405  MET A CG  1 
ATOM   3117 S SD  . MET A 1 402 ? 20.893  60.338 54.543 1.00 26.44 ? 405  MET A SD  1 
ATOM   3118 C CE  . MET A 1 402 ? 22.363  59.659 53.666 1.00 25.55 ? 405  MET A CE  1 
ATOM   3119 N N   . HIS A 1 403 ? 18.546  55.405 54.058 1.00 26.91 ? 406  HIS A N   1 
ATOM   3120 C CA  . HIS A 1 403 ? 18.419  54.114 53.383 1.00 27.30 ? 406  HIS A CA  1 
ATOM   3121 C C   . HIS A 1 403 ? 17.656  54.343 52.070 1.00 27.71 ? 406  HIS A C   1 
ATOM   3122 O O   . HIS A 1 403 ? 18.032  53.825 51.017 1.00 27.92 ? 406  HIS A O   1 
ATOM   3123 C CB  . HIS A 1 403 ? 17.659  53.122 54.270 1.00 26.94 ? 406  HIS A CB  1 
ATOM   3124 C CG  . HIS A 1 403 ? 17.434  51.786 53.632 1.00 28.10 ? 406  HIS A CG  1 
ATOM   3125 N ND1 . HIS A 1 403 ? 18.465  50.930 53.308 1.00 29.13 ? 406  HIS A ND1 1 
ATOM   3126 C CD2 . HIS A 1 403 ? 16.293  51.158 53.257 1.00 28.70 ? 406  HIS A CD2 1 
ATOM   3127 C CE1 . HIS A 1 403 ? 17.970  49.834 52.760 1.00 29.13 ? 406  HIS A CE1 1 
ATOM   3128 N NE2 . HIS A 1 403 ? 16.654  49.947 52.717 1.00 29.17 ? 406  HIS A NE2 1 
ATOM   3129 N N   . PHE A 1 404 ? 16.588  55.135 52.140 1.00 27.63 ? 407  PHE A N   1 
ATOM   3130 C CA  . PHE A 1 404 ? 15.778  55.433 50.961 1.00 27.47 ? 407  PHE A CA  1 
ATOM   3131 C C   . PHE A 1 404 ? 16.571  56.170 49.878 1.00 27.58 ? 407  PHE A C   1 
ATOM   3132 O O   . PHE A 1 404 ? 16.539  55.788 48.705 1.00 26.41 ? 407  PHE A O   1 
ATOM   3133 C CB  . PHE A 1 404 ? 14.557  56.278 51.351 1.00 26.19 ? 407  PHE A CB  1 
ATOM   3134 C CG  . PHE A 1 404 ? 13.744  56.742 50.175 1.00 25.77 ? 407  PHE A CG  1 
ATOM   3135 C CD1 . PHE A 1 404 ? 12.942  55.851 49.472 1.00 26.10 ? 407  PHE A CD1 1 
ATOM   3136 C CD2 . PHE A 1 404 ? 13.813  58.062 49.747 1.00 25.40 ? 407  PHE A CD2 1 
ATOM   3137 C CE1 . PHE A 1 404 ? 12.221  56.264 48.357 1.00 25.91 ? 407  PHE A CE1 1 
ATOM   3138 C CE2 . PHE A 1 404 ? 13.101  58.488 48.636 1.00 26.10 ? 407  PHE A CE2 1 
ATOM   3139 C CZ  . PHE A 1 404 ? 12.300  57.584 47.937 1.00 27.02 ? 407  PHE A CZ  1 
ATOM   3140 N N   . VAL A 1 405 ? 17.280  57.224 50.272 1.00 28.38 ? 408  VAL A N   1 
ATOM   3141 C CA  . VAL A 1 405 ? 18.046  58.006 49.310 1.00 30.17 ? 408  VAL A CA  1 
ATOM   3142 C C   . VAL A 1 405 ? 19.145  57.198 48.631 1.00 30.76 ? 408  VAL A C   1 
ATOM   3143 O O   . VAL A 1 405 ? 19.411  57.382 47.445 1.00 31.39 ? 408  VAL A O   1 
ATOM   3144 C CB  . VAL A 1 405 ? 18.672  59.266 49.958 1.00 30.48 ? 408  VAL A CB  1 
ATOM   3145 C CG1 . VAL A 1 405 ? 19.702  58.874 50.997 1.00 31.26 ? 408  VAL A CG1 1 
ATOM   3146 C CG2 . VAL A 1 405 ? 19.309  60.134 48.881 1.00 32.27 ? 408  VAL A CG2 1 
ATOM   3147 N N   . ASN A 1 406 ? 19.786  56.300 49.370 1.00 31.63 ? 409  ASN A N   1 
ATOM   3148 C CA  . ASN A 1 406 ? 20.838  55.487 48.771 1.00 32.44 ? 409  ASN A CA  1 
ATOM   3149 C C   . ASN A 1 406 ? 20.252  54.450 47.813 1.00 32.38 ? 409  ASN A C   1 
ATOM   3150 O O   . ASN A 1 406 ? 20.835  54.157 46.772 1.00 32.57 ? 409  ASN A O   1 
ATOM   3151 C CB  . ASN A 1 406 ? 21.682  54.819 49.859 1.00 32.35 ? 409  ASN A CB  1 
ATOM   3152 C CG  . ASN A 1 406 ? 22.754  55.750 50.410 1.00 33.24 ? 409  ASN A CG  1 
ATOM   3153 O OD1 . ASN A 1 406 ? 23.655  56.169 49.683 1.00 34.55 ? 409  ASN A OD1 1 
ATOM   3154 N ND2 . ASN A 1 406 ? 22.661  56.080 51.695 1.00 33.43 ? 409  ASN A ND2 1 
ATOM   3155 N N   . LYS A 1 407 ? 19.093  53.902 48.152 1.00 32.67 ? 410  LYS A N   1 
ATOM   3156 C CA  . LYS A 1 407 ? 18.457  52.923 47.280 1.00 33.20 ? 410  LYS A CA  1 
ATOM   3157 C C   . LYS A 1 407 ? 17.891  53.610 46.037 1.00 33.45 ? 410  LYS A C   1 
ATOM   3158 O O   . LYS A 1 407 ? 18.005  53.100 44.922 1.00 33.46 ? 410  LYS A O   1 
ATOM   3159 C CB  . LYS A 1 407 ? 17.321  52.207 48.014 1.00 33.99 ? 410  LYS A CB  1 
ATOM   3160 C CG  . LYS A 1 407 ? 17.775  51.182 49.034 1.00 35.92 ? 410  LYS A CG  1 
ATOM   3161 C CD  . LYS A 1 407 ? 18.481  50.017 48.366 1.00 36.17 ? 410  LYS A CD  1 
ATOM   3162 C CE  . LYS A 1 407 ? 18.837  48.950 49.385 1.00 38.07 ? 410  LYS A CE  1 
ATOM   3163 N NZ  . LYS A 1 407 ? 19.637  47.843 48.790 1.00 38.14 ? 410  LYS A NZ  1 
ATOM   3164 N N   . TYR A 1 408 ? 17.293  54.779 46.235 1.00 32.77 ? 411  TYR A N   1 
ATOM   3165 C CA  . TYR A 1 408 ? 16.686  55.512 45.136 1.00 31.97 ? 411  TYR A CA  1 
ATOM   3166 C C   . TYR A 1 408 ? 17.706  56.028 44.139 1.00 32.13 ? 411  TYR A C   1 
ATOM   3167 O O   . TYR A 1 408 ? 17.522  55.906 42.928 1.00 32.29 ? 411  TYR A O   1 
ATOM   3168 C CB  . TYR A 1 408 ? 15.868  56.696 45.667 1.00 30.87 ? 411  TYR A CB  1 
ATOM   3169 C CG  . TYR A 1 408 ? 15.039  57.357 44.594 1.00 29.13 ? 411  TYR A CG  1 
ATOM   3170 C CD1 . TYR A 1 408 ? 13.762  56.882 44.285 1.00 27.90 ? 411  TYR A CD1 1 
ATOM   3171 C CD2 . TYR A 1 408 ? 15.563  58.400 43.827 1.00 27.36 ? 411  TYR A CD2 1 
ATOM   3172 C CE1 . TYR A 1 408 ? 13.029  57.421 43.236 1.00 27.37 ? 411  TYR A CE1 1 
ATOM   3173 C CE2 . TYR A 1 408 ? 14.842  58.945 42.774 1.00 27.86 ? 411  TYR A CE2 1 
ATOM   3174 C CZ  . TYR A 1 408 ? 13.576  58.449 42.480 1.00 27.89 ? 411  TYR A CZ  1 
ATOM   3175 O OH  . TYR A 1 408 ? 12.877  58.956 41.411 1.00 27.03 ? 411  TYR A OH  1 
ATOM   3176 N N   . THR A 1 409 ? 18.779  56.610 44.655 1.00 32.39 ? 412  THR A N   1 
ATOM   3177 C CA  . THR A 1 409 ? 19.826  57.184 43.822 1.00 33.29 ? 412  THR A CA  1 
ATOM   3178 C C   . THR A 1 409 ? 20.421  56.220 42.799 1.00 34.01 ? 412  THR A C   1 
ATOM   3179 O O   . THR A 1 409 ? 20.955  56.647 41.777 1.00 33.86 ? 412  THR A O   1 
ATOM   3180 C CB  . THR A 1 409 ? 20.944  57.779 44.711 1.00 32.93 ? 412  THR A CB  1 
ATOM   3181 O OG1 . THR A 1 409 ? 20.400  58.862 45.477 1.00 33.07 ? 412  THR A OG1 1 
ATOM   3182 C CG2 . THR A 1 409 ? 22.099  58.304 43.867 1.00 33.03 ? 412  THR A CG2 1 
ATOM   3183 N N   . LYS A 1 410 ? 20.314  54.924 43.068 1.00 35.44 ? 413  LYS A N   1 
ATOM   3184 C CA  . LYS A 1 410 ? 20.839  53.912 42.163 1.00 37.08 ? 413  LYS A CA  1 
ATOM   3185 C C   . LYS A 1 410 ? 20.069  53.894 40.839 1.00 37.40 ? 413  LYS A C   1 
ATOM   3186 O O   . LYS A 1 410 ? 20.647  53.635 39.782 1.00 38.03 ? 413  LYS A O   1 
ATOM   3187 C CB  . LYS A 1 410 ? 20.774  52.534 42.838 1.00 38.61 ? 413  LYS A CB  1 
ATOM   3188 C CG  . LYS A 1 410 ? 21.215  51.363 41.966 1.00 41.65 ? 413  LYS A CG  1 
ATOM   3189 C CD  . LYS A 1 410 ? 21.442  50.082 42.795 1.00 44.50 ? 413  LYS A CD  1 
ATOM   3190 C CE  . LYS A 1 410 ? 20.182  49.665 43.572 1.00 47.11 ? 413  LYS A CE  1 
ATOM   3191 N NZ  . LYS A 1 410 ? 20.350  48.473 44.477 1.00 47.56 ? 413  LYS A NZ  1 
ATOM   3192 N N   . PHE A 1 411 ? 18.771  54.187 40.897 1.00 36.33 ? 414  PHE A N   1 
ATOM   3193 C CA  . PHE A 1 411 ? 17.928  54.190 39.704 1.00 35.37 ? 414  PHE A CA  1 
ATOM   3194 C C   . PHE A 1 411 ? 17.430  55.573 39.299 1.00 34.85 ? 414  PHE A C   1 
ATOM   3195 O O   . PHE A 1 411 ? 17.008  55.773 38.158 1.00 34.45 ? 414  PHE A O   1 
ATOM   3196 C CB  . PHE A 1 411 ? 16.715  53.291 39.927 1.00 35.57 ? 414  PHE A CB  1 
ATOM   3197 C CG  . PHE A 1 411 ? 17.056  51.845 40.105 1.00 36.18 ? 414  PHE A CG  1 
ATOM   3198 C CD1 . PHE A 1 411 ? 17.221  51.014 39.000 1.00 36.21 ? 414  PHE A CD1 1 
ATOM   3199 C CD2 . PHE A 1 411 ? 17.214  51.308 41.376 1.00 35.76 ? 414  PHE A CD2 1 
ATOM   3200 C CE1 . PHE A 1 411 ? 17.535  49.666 39.164 1.00 35.95 ? 414  PHE A CE1 1 
ATOM   3201 C CE2 . PHE A 1 411 ? 17.530  49.962 41.549 1.00 35.95 ? 414  PHE A CE2 1 
ATOM   3202 C CZ  . PHE A 1 411 ? 17.690  49.141 40.445 1.00 35.97 ? 414  PHE A CZ  1 
ATOM   3203 N N   . GLY A 1 412 ? 17.479  56.519 40.231 1.00 34.29 ? 415  GLY A N   1 
ATOM   3204 C CA  . GLY A 1 412 ? 16.991  57.864 39.964 1.00 34.32 ? 415  GLY A CA  1 
ATOM   3205 C C   . GLY A 1 412 ? 17.718  58.693 38.919 1.00 34.46 ? 415  GLY A C   1 
ATOM   3206 O O   . GLY A 1 412 ? 18.759  58.293 38.398 1.00 33.87 ? 415  GLY A O   1 
ATOM   3207 N N   . ASN A 1 413 ? 17.160  59.867 38.630 1.00 34.87 ? 416  ASN A N   1 
ATOM   3208 C CA  . ASN A 1 413 ? 17.725  60.780 37.641 1.00 34.92 ? 416  ASN A CA  1 
ATOM   3209 C C   . ASN A 1 413 ? 18.289  62.046 38.286 1.00 34.02 ? 416  ASN A C   1 
ATOM   3210 O O   . ASN A 1 413 ? 18.627  63.006 37.592 1.00 33.43 ? 416  ASN A O   1 
ATOM   3211 C CB  . ASN A 1 413 ? 16.656  61.164 36.610 1.00 36.91 ? 416  ASN A CB  1 
ATOM   3212 C CG  . ASN A 1 413 ? 17.217  61.998 35.466 1.00 39.01 ? 416  ASN A CG  1 
ATOM   3213 O OD1 . ASN A 1 413 ? 16.689  63.068 35.152 1.00 38.39 ? 416  ASN A OD1 1 
ATOM   3214 N ND2 . ASN A 1 413 ? 18.284  61.501 34.844 1.00 40.50 ? 416  ASN A ND2 1 
ATOM   3215 N N   . GLY A 1 414 ? 18.392  62.050 39.611 1.00 32.91 ? 417  GLY A N   1 
ATOM   3216 C CA  . GLY A 1 414 ? 18.932  63.216 40.289 1.00 32.11 ? 417  GLY A CA  1 
ATOM   3217 C C   . GLY A 1 414 ? 18.461  63.344 41.722 1.00 31.72 ? 417  GLY A C   1 
ATOM   3218 O O   . GLY A 1 414 ? 17.259  63.360 41.979 1.00 31.57 ? 417  GLY A O   1 
ATOM   3219 N N   . THR A 1 415 ? 19.406  63.453 42.652 1.00 31.01 ? 418  THR A N   1 
ATOM   3220 C CA  . THR A 1 415 ? 19.077  63.564 44.067 1.00 30.53 ? 418  THR A CA  1 
ATOM   3221 C C   . THR A 1 415 ? 19.806  64.723 44.729 1.00 30.58 ? 418  THR A C   1 
ATOM   3222 O O   . THR A 1 415 ? 20.999  64.928 44.492 1.00 30.99 ? 418  THR A O   1 
ATOM   3223 C CB  . THR A 1 415 ? 19.462  62.269 44.833 1.00 31.10 ? 418  THR A CB  1 
ATOM   3224 O OG1 . THR A 1 415 ? 18.866  61.131 44.195 1.00 29.74 ? 418  THR A OG1 1 
ATOM   3225 C CG2 . THR A 1 415 ? 18.984  62.341 46.282 1.00 30.69 ? 418  THR A CG2 1 
ATOM   3226 N N   . TYR A 1 416 ? 19.086  65.485 45.549 1.00 29.49 ? 419  TYR A N   1 
ATOM   3227 C CA  . TYR A 1 416 ? 19.678  66.601 46.283 1.00 29.06 ? 419  TYR A CA  1 
ATOM   3228 C C   . TYR A 1 416 ? 19.291  66.456 47.745 1.00 29.03 ? 419  TYR A C   1 
ATOM   3229 O O   . TYR A 1 416 ? 18.108  66.502 48.096 1.00 29.13 ? 419  TYR A O   1 
ATOM   3230 C CB  . TYR A 1 416 ? 19.204  67.947 45.735 1.00 28.64 ? 419  TYR A CB  1 
ATOM   3231 C CG  . TYR A 1 416 ? 19.655  68.186 44.321 1.00 28.33 ? 419  TYR A CG  1 
ATOM   3232 C CD1 . TYR A 1 416 ? 18.900  67.727 43.243 1.00 27.88 ? 419  TYR A CD1 1 
ATOM   3233 C CD2 . TYR A 1 416 ? 20.866  68.828 44.058 1.00 28.24 ? 419  TYR A CD2 1 
ATOM   3234 C CE1 . TYR A 1 416 ? 19.334  67.899 41.938 1.00 28.77 ? 419  TYR A CE1 1 
ATOM   3235 C CE2 . TYR A 1 416 ? 21.316  69.004 42.755 1.00 28.68 ? 419  TYR A CE2 1 
ATOM   3236 C CZ  . TYR A 1 416 ? 20.545  68.537 41.698 1.00 29.81 ? 419  TYR A CZ  1 
ATOM   3237 O OH  . TYR A 1 416 ? 20.982  68.702 40.400 1.00 30.29 ? 419  TYR A OH  1 
ATOM   3238 N N   . LEU A 1 417 ? 20.303  66.278 48.589 1.00 28.45 ? 420  LEU A N   1 
ATOM   3239 C CA  . LEU A 1 417 ? 20.102  66.069 50.018 1.00 27.72 ? 420  LEU A CA  1 
ATOM   3240 C C   . LEU A 1 417 ? 20.501  67.259 50.888 1.00 27.18 ? 420  LEU A C   1 
ATOM   3241 O O   . LEU A 1 417 ? 21.511  67.912 50.631 1.00 27.11 ? 420  LEU A O   1 
ATOM   3242 C CB  . LEU A 1 417 ? 20.897  64.835 50.444 1.00 27.39 ? 420  LEU A CB  1 
ATOM   3243 C CG  . LEU A 1 417 ? 20.790  64.353 51.891 1.00 27.82 ? 420  LEU A CG  1 
ATOM   3244 C CD1 . LEU A 1 417 ? 19.383  63.828 52.150 1.00 26.85 ? 420  LEU A CD1 1 
ATOM   3245 C CD2 . LEU A 1 417 ? 21.829  63.260 52.136 1.00 26.49 ? 420  LEU A CD2 1 
ATOM   3246 N N   . TYR A 1 418 ? 19.709  67.533 51.921 1.00 26.31 ? 421  TYR A N   1 
ATOM   3247 C CA  . TYR A 1 418 ? 20.015  68.634 52.827 1.00 25.98 ? 421  TYR A CA  1 
ATOM   3248 C C   . TYR A 1 418 ? 19.921  68.224 54.294 1.00 26.18 ? 421  TYR A C   1 
ATOM   3249 O O   . TYR A 1 418 ? 19.297  67.220 54.636 1.00 26.06 ? 421  TYR A O   1 
ATOM   3250 C CB  . TYR A 1 418 ? 19.079  69.828 52.587 1.00 24.98 ? 421  TYR A CB  1 
ATOM   3251 C CG  . TYR A 1 418 ? 17.652  69.618 53.059 1.00 24.19 ? 421  TYR A CG  1 
ATOM   3252 C CD1 . TYR A 1 418 ? 17.310  69.789 54.401 1.00 23.62 ? 421  TYR A CD1 1 
ATOM   3253 C CD2 . TYR A 1 418 ? 16.649  69.218 52.170 1.00 23.58 ? 421  TYR A CD2 1 
ATOM   3254 C CE1 . TYR A 1 418 ? 16.005  69.559 54.849 1.00 23.38 ? 421  TYR A CE1 1 
ATOM   3255 C CE2 . TYR A 1 418 ? 15.342  68.992 52.609 1.00 22.44 ? 421  TYR A CE2 1 
ATOM   3256 C CZ  . TYR A 1 418 ? 15.032  69.160 53.948 1.00 22.20 ? 421  TYR A CZ  1 
ATOM   3257 O OH  . TYR A 1 418 ? 13.758  68.910 54.394 1.00 22.47 ? 421  TYR A OH  1 
ATOM   3258 N N   . PHE A 1 419 ? 20.552  69.021 55.150 1.00 26.52 ? 422  PHE A N   1 
ATOM   3259 C CA  . PHE A 1 419 ? 20.540  68.811 56.592 1.00 27.11 ? 422  PHE A CA  1 
ATOM   3260 C C   . PHE A 1 419 ? 20.198  70.178 57.177 1.00 27.66 ? 422  PHE A C   1 
ATOM   3261 O O   . PHE A 1 419 ? 21.035  71.086 57.179 1.00 28.02 ? 422  PHE A O   1 
ATOM   3262 C CB  . PHE A 1 419 ? 21.919  68.364 57.083 1.00 27.72 ? 422  PHE A CB  1 
ATOM   3263 C CG  . PHE A 1 419 ? 21.965  68.024 58.550 1.00 27.64 ? 422  PHE A CG  1 
ATOM   3264 C CD1 . PHE A 1 419 ? 21.375  66.856 59.028 1.00 28.23 ? 422  PHE A CD1 1 
ATOM   3265 C CD2 . PHE A 1 419 ? 22.600  68.872 59.451 1.00 27.75 ? 422  PHE A CD2 1 
ATOM   3266 C CE1 . PHE A 1 419 ? 21.416  66.532 60.384 1.00 28.32 ? 422  PHE A CE1 1 
ATOM   3267 C CE2 . PHE A 1 419 ? 22.649  68.565 60.810 1.00 28.40 ? 422  PHE A CE2 1 
ATOM   3268 C CZ  . PHE A 1 419 ? 22.055  67.390 61.280 1.00 29.18 ? 422  PHE A CZ  1 
ATOM   3269 N N   . PHE A 1 420 ? 18.963  70.330 57.644 1.00 27.24 ? 423  PHE A N   1 
ATOM   3270 C CA  . PHE A 1 420 ? 18.500  71.593 58.208 1.00 27.83 ? 423  PHE A CA  1 
ATOM   3271 C C   . PHE A 1 420 ? 18.888  71.689 59.674 1.00 28.65 ? 423  PHE A C   1 
ATOM   3272 O O   . PHE A 1 420 ? 18.358  70.947 60.504 1.00 29.26 ? 423  PHE A O   1 
ATOM   3273 C CB  . PHE A 1 420 ? 16.981  71.696 58.087 1.00 27.12 ? 423  PHE A CB  1 
ATOM   3274 C CG  . PHE A 1 420 ? 16.437  73.034 58.477 1.00 26.07 ? 423  PHE A CG  1 
ATOM   3275 C CD1 . PHE A 1 420 ? 16.477  74.100 57.584 1.00 25.68 ? 423  PHE A CD1 1 
ATOM   3276 C CD2 . PHE A 1 420 ? 15.898  73.236 59.744 1.00 25.55 ? 423  PHE A CD2 1 
ATOM   3277 C CE1 . PHE A 1 420 ? 15.985  75.355 57.947 1.00 25.64 ? 423  PHE A CE1 1 
ATOM   3278 C CE2 . PHE A 1 420 ? 15.404  74.483 60.120 1.00 24.99 ? 423  PHE A CE2 1 
ATOM   3279 C CZ  . PHE A 1 420 ? 15.447  75.546 59.220 1.00 25.51 ? 423  PHE A CZ  1 
ATOM   3280 N N   . ASN A 1 421 ? 19.789  72.613 60.002 1.00 29.12 ? 424  ASN A N   1 
ATOM   3281 C CA  . ASN A 1 421 ? 20.237  72.747 61.382 1.00 29.96 ? 424  ASN A CA  1 
ATOM   3282 C C   . ASN A 1 421 ? 20.288  74.168 61.923 1.00 31.20 ? 424  ASN A C   1 
ATOM   3283 O O   . ASN A 1 421 ? 21.238  74.545 62.607 1.00 32.01 ? 424  ASN A O   1 
ATOM   3284 C CB  . ASN A 1 421 ? 21.607  72.082 61.550 1.00 29.55 ? 424  ASN A CB  1 
ATOM   3285 C CG  . ASN A 1 421 ? 22.686  72.761 60.733 1.00 29.95 ? 424  ASN A CG  1 
ATOM   3286 O OD1 . ASN A 1 421 ? 22.393  73.584 59.869 1.00 29.70 ? 424  ASN A OD1 1 
ATOM   3287 N ND2 . ASN A 1 421 ? 23.944  72.414 60.997 1.00 30.50 ? 424  ASN A ND2 1 
ATOM   3288 N N   . HIS A 1 422 ? 19.266  74.956 61.622 1.00 31.99 ? 425  HIS A N   1 
ATOM   3289 C CA  . HIS A 1 422 ? 19.193  76.320 62.124 1.00 32.88 ? 425  HIS A CA  1 
ATOM   3290 C C   . HIS A 1 422 ? 18.044  76.415 63.120 1.00 33.81 ? 425  HIS A C   1 
ATOM   3291 O O   . HIS A 1 422 ? 16.914  76.036 62.804 1.00 33.92 ? 425  HIS A O   1 
ATOM   3292 C CB  . HIS A 1 422 ? 18.930  77.309 60.983 1.00 32.88 ? 425  HIS A CB  1 
ATOM   3293 C CG  . HIS A 1 422 ? 18.614  78.695 61.455 1.00 32.61 ? 425  HIS A CG  1 
ATOM   3294 N ND1 . HIS A 1 422 ? 19.569  79.538 61.983 1.00 32.94 ? 425  HIS A ND1 1 
ATOM   3295 C CD2 . HIS A 1 422 ? 17.439  79.363 61.534 1.00 32.90 ? 425  HIS A CD2 1 
ATOM   3296 C CE1 . HIS A 1 422 ? 18.995  80.665 62.368 1.00 33.26 ? 425  HIS A CE1 1 
ATOM   3297 N NE2 . HIS A 1 422 ? 17.702  80.584 62.108 1.00 33.15 ? 425  HIS A NE2 1 
ATOM   3298 N N   . ARG A 1 423 ? 18.315  76.905 64.324 1.00 34.71 ? 426  ARG A N   1 
ATOM   3299 C CA  . ARG A 1 423 ? 17.238  77.049 65.294 1.00 36.27 ? 426  ARG A CA  1 
ATOM   3300 C C   . ARG A 1 423 ? 16.718  78.479 65.219 1.00 36.44 ? 426  ARG A C   1 
ATOM   3301 O O   . ARG A 1 423 ? 17.448  79.424 65.506 1.00 36.62 ? 426  ARG A O   1 
ATOM   3302 C CB  . ARG A 1 423 ? 17.713  76.754 66.721 1.00 37.37 ? 426  ARG A CB  1 
ATOM   3303 C CG  . ARG A 1 423 ? 16.567  76.813 67.748 1.00 37.78 ? 426  ARG A CG  1 
ATOM   3304 C CD  . ARG A 1 423 ? 17.078  76.654 69.160 1.00 38.71 ? 426  ARG A CD  1 
ATOM   3305 N NE  . ARG A 1 423 ? 16.130  77.143 70.160 1.00 38.29 ? 426  ARG A NE  1 
ATOM   3306 C CZ  . ARG A 1 423 ? 15.186  76.407 70.735 1.00 37.60 ? 426  ARG A CZ  1 
ATOM   3307 N NH1 . ARG A 1 423 ? 15.041  75.125 70.416 1.00 36.73 ? 426  ARG A NH1 1 
ATOM   3308 N NH2 . ARG A 1 423 ? 14.395  76.954 71.647 1.00 37.31 ? 426  ARG A NH2 1 
ATOM   3309 N N   . ALA A 1 424 ? 15.458  78.626 64.824 1.00 37.11 ? 427  ALA A N   1 
ATOM   3310 C CA  . ALA A 1 424 ? 14.827  79.935 64.701 1.00 37.56 ? 427  ALA A CA  1 
ATOM   3311 C C   . ALA A 1 424 ? 14.996  80.779 65.962 1.00 38.17 ? 427  ALA A C   1 
ATOM   3312 O O   . ALA A 1 424 ? 14.912  80.273 67.085 1.00 38.98 ? 427  ALA A O   1 
ATOM   3313 C CB  . ALA A 1 424 ? 13.346  79.767 64.379 1.00 37.33 ? 427  ALA A CB  1 
ATOM   3314 N N   . SER A 1 425 ? 15.224  82.073 65.766 1.00 38.14 ? 428  SER A N   1 
ATOM   3315 C CA  . SER A 1 425 ? 15.418  83.007 66.868 1.00 38.46 ? 428  SER A CA  1 
ATOM   3316 C C   . SER A 1 425 ? 14.163  83.227 67.715 1.00 38.70 ? 428  SER A C   1 
ATOM   3317 O O   . SER A 1 425 ? 14.260  83.545 68.898 1.00 38.58 ? 428  SER A O   1 
ATOM   3318 C CB  . SER A 1 425 ? 15.911  84.353 66.322 1.00 38.31 ? 428  SER A CB  1 
ATOM   3319 O OG  . SER A 1 425 ? 14.984  84.896 65.394 1.00 37.83 ? 428  SER A OG  1 
ATOM   3320 N N   . ASN A 1 426 ? 12.990  83.053 67.113 1.00 38.87 ? 429  ASN A N   1 
ATOM   3321 C CA  . ASN A 1 426 ? 11.729  83.252 67.825 1.00 38.69 ? 429  ASN A CA  1 
ATOM   3322 C C   . ASN A 1 426 ? 11.071  81.949 68.272 1.00 38.78 ? 429  ASN A C   1 
ATOM   3323 O O   . ASN A 1 426 ? 9.869   81.922 68.542 1.00 39.02 ? 429  ASN A O   1 
ATOM   3324 C CB  . ASN A 1 426 ? 10.746  84.021 66.940 1.00 38.49 ? 429  ASN A CB  1 
ATOM   3325 C CG  . ASN A 1 426 ? 10.625  83.420 65.550 1.00 39.54 ? 429  ASN A CG  1 
ATOM   3326 O OD1 . ASN A 1 426 ? 10.899  82.232 65.347 1.00 39.23 ? 429  ASN A OD1 1 
ATOM   3327 N ND2 . ASN A 1 426 ? 10.203  84.234 64.587 1.00 38.93 ? 429  ASN A ND2 1 
ATOM   3328 N N   . LEU A 1 427 ? 11.854  80.878 68.353 1.00 38.33 ? 430  LEU A N   1 
ATOM   3329 C CA  . LEU A 1 427 ? 11.340  79.569 68.760 1.00 38.38 ? 430  LEU A CA  1 
ATOM   3330 C C   . LEU A 1 427 ? 10.808  79.620 70.200 1.00 37.92 ? 430  LEU A C   1 
ATOM   3331 O O   . LEU A 1 427 ? 11.515  80.042 71.118 1.00 38.89 ? 430  LEU A O   1 
ATOM   3332 C CB  . LEU A 1 427 ? 12.463  78.531 68.636 1.00 38.93 ? 430  LEU A CB  1 
ATOM   3333 C CG  . LEU A 1 427 ? 12.172  77.135 68.076 1.00 39.77 ? 430  LEU A CG  1 
ATOM   3334 C CD1 . LEU A 1 427 ? 11.533  76.281 69.137 1.00 41.57 ? 430  LEU A CD1 1 
ATOM   3335 C CD2 . LEU A 1 427 ? 11.281  77.240 66.846 1.00 40.31 ? 430  LEU A CD2 1 
ATOM   3336 N N   . VAL A 1 428 ? 9.565   79.191 70.400 1.00 36.48 ? 431  VAL A N   1 
ATOM   3337 C CA  . VAL A 1 428 ? 8.962   79.213 71.730 1.00 35.17 ? 431  VAL A CA  1 
ATOM   3338 C C   . VAL A 1 428 ? 9.255   77.953 72.547 1.00 34.40 ? 431  VAL A C   1 
ATOM   3339 O O   . VAL A 1 428 ? 9.072   77.938 73.766 1.00 34.00 ? 431  VAL A O   1 
ATOM   3340 C CB  . VAL A 1 428 ? 7.424   79.414 71.648 1.00 35.30 ? 431  VAL A CB  1 
ATOM   3341 C CG1 . VAL A 1 428 ? 7.109   80.743 70.986 1.00 35.17 ? 431  VAL A CG1 1 
ATOM   3342 C CG2 . VAL A 1 428 ? 6.784   78.272 70.869 1.00 35.43 ? 431  VAL A CG2 1 
ATOM   3343 N N   . TRP A 1 429 ? 9.702   76.896 71.878 1.00 33.21 ? 432  TRP A N   1 
ATOM   3344 C CA  . TRP A 1 429 ? 10.030  75.653 72.574 1.00 31.63 ? 432  TRP A CA  1 
ATOM   3345 C C   . TRP A 1 429 ? 11.365  75.813 73.300 1.00 31.18 ? 432  TRP A C   1 
ATOM   3346 O O   . TRP A 1 429 ? 12.162  76.686 72.960 1.00 30.82 ? 432  TRP A O   1 
ATOM   3347 C CB  . TRP A 1 429 ? 10.120  74.488 71.583 1.00 30.33 ? 432  TRP A CB  1 
ATOM   3348 C CG  . TRP A 1 429 ? 8.801   74.116 70.967 1.00 30.21 ? 432  TRP A CG  1 
ATOM   3349 C CD1 . TRP A 1 429 ? 8.367   74.418 69.710 1.00 29.89 ? 432  TRP A CD1 1 
ATOM   3350 C CD2 . TRP A 1 429 ? 7.738   73.382 71.593 1.00 29.79 ? 432  TRP A CD2 1 
ATOM   3351 N NE1 . TRP A 1 429 ? 7.100   73.918 69.510 1.00 30.24 ? 432  TRP A NE1 1 
ATOM   3352 C CE2 . TRP A 1 429 ? 6.689   73.277 70.648 1.00 30.33 ? 432  TRP A CE2 1 
ATOM   3353 C CE3 . TRP A 1 429 ? 7.569   72.803 72.860 1.00 29.26 ? 432  TRP A CE3 1 
ATOM   3354 C CZ2 . TRP A 1 429 ? 5.485   72.612 70.930 1.00 29.84 ? 432  TRP A CZ2 1 
ATOM   3355 C CZ3 . TRP A 1 429 ? 6.371   72.140 73.141 1.00 30.00 ? 432  TRP A CZ3 1 
ATOM   3356 C CH2 . TRP A 1 429 ? 5.345   72.051 72.176 1.00 30.03 ? 432  TRP A CH2 1 
ATOM   3357 N N   . PRO A 1 430 ? 11.624  74.973 74.317 1.00 31.13 ? 433  PRO A N   1 
ATOM   3358 C CA  . PRO A 1 430 ? 12.887  75.073 75.051 1.00 30.92 ? 433  PRO A CA  1 
ATOM   3359 C C   . PRO A 1 430 ? 14.113  74.765 74.195 1.00 31.87 ? 433  PRO A C   1 
ATOM   3360 O O   . PRO A 1 430 ? 14.038  74.059 73.186 1.00 31.11 ? 433  PRO A O   1 
ATOM   3361 C CB  . PRO A 1 430 ? 12.707  74.073 76.187 1.00 30.60 ? 433  PRO A CB  1 
ATOM   3362 C CG  . PRO A 1 430 ? 11.817  73.026 75.565 1.00 30.01 ? 433  PRO A CG  1 
ATOM   3363 C CD  . PRO A 1 430 ? 10.795  73.877 74.852 1.00 30.52 ? 433  PRO A CD  1 
ATOM   3364 N N   . GLU A 1 431 ? 15.242  75.300 74.639 1.00 32.91 ? 434  GLU A N   1 
ATOM   3365 C CA  . GLU A 1 431 ? 16.534  75.154 73.985 1.00 33.93 ? 434  GLU A CA  1 
ATOM   3366 C C   . GLU A 1 431 ? 16.960  73.700 73.768 1.00 32.22 ? 434  GLU A C   1 
ATOM   3367 O O   . GLU A 1 431 ? 17.485  73.351 72.709 1.00 30.38 ? 434  GLU A O   1 
ATOM   3368 C CB  . GLU A 1 431 ? 17.595  75.857 74.834 1.00 37.02 ? 434  GLU A CB  1 
ATOM   3369 C CG  . GLU A 1 431 ? 18.804  76.355 74.082 1.00 43.16 ? 434  GLU A CG  1 
ATOM   3370 C CD  . GLU A 1 431 ? 18.647  77.803 73.643 1.00 47.58 ? 434  GLU A CD  1 
ATOM   3371 O OE1 . GLU A 1 431 ? 17.850  78.066 72.709 1.00 49.53 ? 434  GLU A OE1 1 
ATOM   3372 O OE2 . GLU A 1 431 ? 19.314  78.680 74.244 1.00 49.30 ? 434  GLU A OE2 1 
ATOM   3373 N N   . TRP A 1 432 ? 16.743  72.853 74.772 1.00 30.90 ? 435  TRP A N   1 
ATOM   3374 C CA  . TRP A 1 432 ? 17.160  71.459 74.668 1.00 29.86 ? 435  TRP A CA  1 
ATOM   3375 C C   . TRP A 1 432 ? 16.559  70.693 73.485 1.00 29.02 ? 435  TRP A C   1 
ATOM   3376 O O   . TRP A 1 432 ? 17.110  69.684 73.054 1.00 28.48 ? 435  TRP A O   1 
ATOM   3377 C CB  . TRP A 1 432 ? 16.885  70.706 75.986 1.00 29.47 ? 435  TRP A CB  1 
ATOM   3378 C CG  . TRP A 1 432 ? 15.436  70.406 76.297 1.00 29.19 ? 435  TRP A CG  1 
ATOM   3379 C CD1 . TRP A 1 432 ? 14.603  71.125 77.109 1.00 28.84 ? 435  TRP A CD1 1 
ATOM   3380 C CD2 . TRP A 1 432 ? 14.665  69.289 75.821 1.00 29.06 ? 435  TRP A CD2 1 
ATOM   3381 N NE1 . TRP A 1 432 ? 13.365  70.524 77.173 1.00 28.92 ? 435  TRP A NE1 1 
ATOM   3382 C CE2 . TRP A 1 432 ? 13.375  69.398 76.392 1.00 28.82 ? 435  TRP A CE2 1 
ATOM   3383 C CE3 . TRP A 1 432 ? 14.940  68.209 74.970 1.00 28.04 ? 435  TRP A CE3 1 
ATOM   3384 C CZ2 . TRP A 1 432 ? 12.361  68.468 76.139 1.00 28.62 ? 435  TRP A CZ2 1 
ATOM   3385 C CZ3 . TRP A 1 432 ? 13.931  67.284 74.716 1.00 28.91 ? 435  TRP A CZ3 1 
ATOM   3386 C CH2 . TRP A 1 432 ? 12.655  67.421 75.301 1.00 28.94 ? 435  TRP A CH2 1 
ATOM   3387 N N   . MET A 1 433 ? 15.445  71.175 72.947 1.00 28.54 ? 436  MET A N   1 
ATOM   3388 C CA  . MET A 1 433 ? 14.811  70.499 71.823 1.00 27.93 ? 436  MET A CA  1 
ATOM   3389 C C   . MET A 1 433 ? 15.495  70.785 70.483 1.00 27.54 ? 436  MET A C   1 
ATOM   3390 O O   . MET A 1 433 ? 15.243  70.091 69.500 1.00 27.81 ? 436  MET A O   1 
ATOM   3391 C CB  . MET A 1 433 ? 13.325  70.869 71.768 1.00 27.47 ? 436  MET A CB  1 
ATOM   3392 C CG  . MET A 1 433 ? 12.515  70.260 72.901 1.00 27.55 ? 436  MET A CG  1 
ATOM   3393 S SD  . MET A 1 433 ? 10.810  70.855 72.994 1.00 30.11 ? 436  MET A SD  1 
ATOM   3394 C CE  . MET A 1 433 ? 10.011  69.843 71.734 1.00 28.07 ? 436  MET A CE  1 
ATOM   3395 N N   . GLY A 1 434 ? 16.356  71.802 70.450 1.00 27.35 ? 437  GLY A N   1 
ATOM   3396 C CA  . GLY A 1 434 ? 17.099  72.148 69.240 1.00 26.82 ? 437  GLY A CA  1 
ATOM   3397 C C   . GLY A 1 434 ? 16.321  72.486 67.975 1.00 26.88 ? 437  GLY A C   1 
ATOM   3398 O O   . GLY A 1 434 ? 15.365  73.265 68.002 1.00 26.76 ? 437  GLY A O   1 
ATOM   3399 N N   . VAL A 1 435 ? 16.763  71.920 66.855 1.00 26.41 ? 438  VAL A N   1 
ATOM   3400 C CA  . VAL A 1 435 ? 16.117  72.127 65.558 1.00 26.27 ? 438  VAL A CA  1 
ATOM   3401 C C   . VAL A 1 435 ? 15.046  71.034 65.464 1.00 26.45 ? 438  VAL A C   1 
ATOM   3402 O O   . VAL A 1 435 ? 15.291  69.905 65.014 1.00 25.84 ? 438  VAL A O   1 
ATOM   3403 C CB  . VAL A 1 435 ? 17.145  71.993 64.415 1.00 26.78 ? 438  VAL A CB  1 
ATOM   3404 C CG1 . VAL A 1 435 ? 16.529  72.433 63.088 1.00 26.03 ? 438  VAL A CG1 1 
ATOM   3405 C CG2 . VAL A 1 435 ? 18.370  72.839 64.735 1.00 26.03 ? 438  VAL A CG2 1 
ATOM   3406 N N   . ILE A 1 436 ? 13.857  71.406 65.915 1.00 25.88 ? 439  ILE A N   1 
ATOM   3407 C CA  . ILE A 1 436 ? 12.701  70.532 66.010 1.00 25.70 ? 439  ILE A CA  1 
ATOM   3408 C C   . ILE A 1 436 ? 12.026  70.022 64.741 1.00 26.14 ? 439  ILE A C   1 
ATOM   3409 O O   . ILE A 1 436 ? 12.030  70.668 63.685 1.00 25.73 ? 439  ILE A O   1 
ATOM   3410 C CB  . ILE A 1 436 ? 11.644  71.218 66.896 1.00 26.28 ? 439  ILE A CB  1 
ATOM   3411 C CG1 . ILE A 1 436 ? 12.288  71.600 68.231 1.00 26.19 ? 439  ILE A CG1 1 
ATOM   3412 C CG2 . ILE A 1 436 ? 10.447  70.309 67.120 1.00 25.63 ? 439  ILE A CG2 1 
ATOM   3413 C CD1 . ILE A 1 436 ? 11.430  72.507 69.074 1.00 27.21 ? 439  ILE A CD1 1 
ATOM   3414 N N   . HIS A 1 437 ? 11.452  68.831 64.882 1.00 26.08 ? 440  HIS A N   1 
ATOM   3415 C CA  . HIS A 1 437 ? 10.710  68.151 63.831 1.00 26.08 ? 440  HIS A CA  1 
ATOM   3416 C C   . HIS A 1 437 ? 9.602   69.105 63.381 1.00 26.40 ? 440  HIS A C   1 
ATOM   3417 O O   . HIS A 1 437 ? 8.803   69.559 64.199 1.00 26.38 ? 440  HIS A O   1 
ATOM   3418 C CB  . HIS A 1 437 ? 10.094  66.873 64.411 1.00 25.07 ? 440  HIS A CB  1 
ATOM   3419 C CG  . HIS A 1 437 ? 9.438   65.986 63.398 1.00 24.93 ? 440  HIS A CG  1 
ATOM   3420 N ND1 . HIS A 1 437 ? 10.134  65.389 62.367 1.00 24.20 ? 440  HIS A ND1 1 
ATOM   3421 C CD2 . HIS A 1 437 ? 8.162   65.543 63.296 1.00 24.43 ? 440  HIS A CD2 1 
ATOM   3422 C CE1 . HIS A 1 437 ? 9.316   64.612 61.678 1.00 24.26 ? 440  HIS A CE1 1 
ATOM   3423 N NE2 . HIS A 1 437 ? 8.114   64.687 62.221 1.00 24.30 ? 440  HIS A NE2 1 
ATOM   3424 N N   . GLY A 1 438 ? 9.576   69.426 62.091 1.00 27.13 ? 441  GLY A N   1 
ATOM   3425 C CA  . GLY A 1 438 ? 8.549   70.309 61.564 1.00 27.15 ? 441  GLY A CA  1 
ATOM   3426 C C   . GLY A 1 438 ? 8.874   71.793 61.521 1.00 28.07 ? 441  GLY A C   1 
ATOM   3427 O O   . GLY A 1 438 ? 8.092   72.581 60.988 1.00 27.76 ? 441  GLY A O   1 
ATOM   3428 N N   . TYR A 1 439 ? 10.024  72.200 62.045 1.00 28.34 ? 442  TYR A N   1 
ATOM   3429 C CA  . TYR A 1 439 ? 10.318  73.622 62.039 1.00 28.54 ? 442  TYR A CA  1 
ATOM   3430 C C   . TYR A 1 439 ? 11.116  74.184 60.883 1.00 28.78 ? 442  TYR A C   1 
ATOM   3431 O O   . TYR A 1 439 ? 11.604  75.316 60.945 1.00 30.03 ? 442  TYR A O   1 
ATOM   3432 C CB  . TYR A 1 439 ? 10.904  74.041 63.390 1.00 28.95 ? 442  TYR A CB  1 
ATOM   3433 C CG  . TYR A 1 439 ? 9.801   74.135 64.420 1.00 29.84 ? 442  TYR A CG  1 
ATOM   3434 C CD1 . TYR A 1 439 ? 9.270   72.986 65.008 1.00 29.99 ? 442  TYR A CD1 1 
ATOM   3435 C CD2 . TYR A 1 439 ? 9.190   75.360 64.701 1.00 30.17 ? 442  TYR A CD2 1 
ATOM   3436 C CE1 . TYR A 1 439 ? 8.153   73.049 65.840 1.00 29.55 ? 442  TYR A CE1 1 
ATOM   3437 C CE2 . TYR A 1 439 ? 8.070   75.434 65.532 1.00 30.07 ? 442  TYR A CE2 1 
ATOM   3438 C CZ  . TYR A 1 439 ? 7.558   74.274 66.093 1.00 30.42 ? 442  TYR A CZ  1 
ATOM   3439 O OH  . TYR A 1 439 ? 6.439   74.339 66.891 1.00 30.77 ? 442  TYR A OH  1 
ATOM   3440 N N   . GLU A 1 440 ? 11.239  73.402 59.817 1.00 27.53 ? 443  GLU A N   1 
ATOM   3441 C CA  . GLU A 1 440 ? 11.910  73.886 58.622 1.00 26.65 ? 443  GLU A CA  1 
ATOM   3442 C C   . GLU A 1 440 ? 10.774  74.370 57.714 1.00 26.84 ? 443  GLU A C   1 
ATOM   3443 O O   . GLU A 1 440 ? 10.979  75.183 56.814 1.00 27.27 ? 443  GLU A O   1 
ATOM   3444 C CB  . GLU A 1 440 ? 12.691  72.769 57.922 1.00 25.43 ? 443  GLU A CB  1 
ATOM   3445 C CG  . GLU A 1 440 ? 11.873  71.874 56.992 1.00 23.94 ? 443  GLU A CG  1 
ATOM   3446 C CD  . GLU A 1 440 ? 10.946  70.913 57.720 1.00 24.42 ? 443  GLU A CD  1 
ATOM   3447 O OE1 . GLU A 1 440 ? 11.047  70.785 58.958 1.00 23.50 ? 443  GLU A OE1 1 
ATOM   3448 O OE2 . GLU A 1 440 ? 10.120  70.269 57.043 1.00 25.05 ? 443  GLU A OE2 1 
ATOM   3449 N N   . ILE A 1 441 ? 9.570   73.866 57.976 1.00 26.85 ? 444  ILE A N   1 
ATOM   3450 C CA  . ILE A 1 441 ? 8.389   74.208 57.191 1.00 26.95 ? 444  ILE A CA  1 
ATOM   3451 C C   . ILE A 1 441 ? 8.163   75.715 57.107 1.00 27.72 ? 444  ILE A C   1 
ATOM   3452 O O   . ILE A 1 441 ? 7.939   76.254 56.019 1.00 27.48 ? 444  ILE A O   1 
ATOM   3453 C CB  . ILE A 1 441 ? 7.111   73.539 57.775 1.00 26.62 ? 444  ILE A CB  1 
ATOM   3454 C CG1 . ILE A 1 441 ? 7.267   72.017 57.764 1.00 25.70 ? 444  ILE A CG1 1 
ATOM   3455 C CG2 . ILE A 1 441 ? 5.883   73.930 56.951 1.00 25.50 ? 444  ILE A CG2 1 
ATOM   3456 C CD1 . ILE A 1 441 ? 6.137   71.288 58.460 1.00 23.93 ? 444  ILE A CD1 1 
ATOM   3457 N N   . GLU A 1 442 ? 8.221   76.399 58.246 1.00 28.23 ? 445  GLU A N   1 
ATOM   3458 C CA  . GLU A 1 442 ? 8.013   77.844 58.242 1.00 29.71 ? 445  GLU A CA  1 
ATOM   3459 C C   . GLU A 1 442 ? 8.967   78.574 57.290 1.00 29.88 ? 445  GLU A C   1 
ATOM   3460 O O   . GLU A 1 442 ? 8.620   79.633 56.753 1.00 29.69 ? 445  GLU A O   1 
ATOM   3461 C CB  . GLU A 1 442 ? 8.117   78.411 59.666 1.00 29.94 ? 445  GLU A CB  1 
ATOM   3462 C CG  . GLU A 1 442 ? 9.309   77.958 60.474 1.00 29.79 ? 445  GLU A CG  1 
ATOM   3463 C CD  . GLU A 1 442 ? 9.101   78.200 61.959 1.00 30.04 ? 445  GLU A CD  1 
ATOM   3464 O OE1 . GLU A 1 442 ? 8.137   77.641 62.519 1.00 30.19 ? 445  GLU A OE1 1 
ATOM   3465 O OE2 . GLU A 1 442 ? 9.893   78.947 62.571 1.00 30.79 ? 445  GLU A OE2 1 
ATOM   3466 N N   . PHE A 1 443 ? 10.153  78.008 57.066 1.00 29.16 ? 446  PHE A N   1 
ATOM   3467 C CA  . PHE A 1 443 ? 11.105  78.620 56.143 1.00 29.44 ? 446  PHE A CA  1 
ATOM   3468 C C   . PHE A 1 443 ? 10.749  78.266 54.699 1.00 29.84 ? 446  PHE A C   1 
ATOM   3469 O O   . PHE A 1 443 ? 10.920  79.079 53.790 1.00 30.39 ? 446  PHE A O   1 
ATOM   3470 C CB  . PHE A 1 443 ? 12.537  78.171 56.443 1.00 29.10 ? 446  PHE A CB  1 
ATOM   3471 C CG  . PHE A 1 443 ? 13.150  78.855 57.635 1.00 29.94 ? 446  PHE A CG  1 
ATOM   3472 C CD1 . PHE A 1 443 ? 12.905  78.394 58.926 1.00 28.86 ? 446  PHE A CD1 1 
ATOM   3473 C CD2 . PHE A 1 443 ? 13.951  79.990 57.464 1.00 29.60 ? 446  PHE A CD2 1 
ATOM   3474 C CE1 . PHE A 1 443 ? 13.446  79.048 60.035 1.00 29.14 ? 446  PHE A CE1 1 
ATOM   3475 C CE2 . PHE A 1 443 ? 14.496  80.653 58.563 1.00 29.58 ? 446  PHE A CE2 1 
ATOM   3476 C CZ  . PHE A 1 443 ? 14.242  80.179 59.856 1.00 29.63 ? 446  PHE A CZ  1 
ATOM   3477 N N   . VAL A 1 444 ? 10.255  77.049 54.489 1.00 29.04 ? 447  VAL A N   1 
ATOM   3478 C CA  . VAL A 1 444 ? 9.868   76.614 53.155 1.00 28.08 ? 447  VAL A CA  1 
ATOM   3479 C C   . VAL A 1 444 ? 8.683   77.436 52.651 1.00 28.16 ? 447  VAL A C   1 
ATOM   3480 O O   . VAL A 1 444 ? 8.603   77.747 51.465 1.00 27.42 ? 447  VAL A O   1 
ATOM   3481 C CB  . VAL A 1 444 ? 9.486   75.116 53.140 1.00 27.81 ? 447  VAL A CB  1 
ATOM   3482 C CG1 . VAL A 1 444 ? 8.846   74.752 51.806 1.00 26.34 ? 447  VAL A CG1 1 
ATOM   3483 C CG2 . VAL A 1 444 ? 10.729  74.262 53.383 1.00 26.86 ? 447  VAL A CG2 1 
ATOM   3484 N N   . PHE A 1 445 ? 7.768   77.787 53.555 1.00 28.36 ? 448  PHE A N   1 
ATOM   3485 C CA  . PHE A 1 445 ? 6.599   78.582 53.188 1.00 28.66 ? 448  PHE A CA  1 
ATOM   3486 C C   . PHE A 1 445 ? 6.805   80.097 53.332 1.00 29.48 ? 448  PHE A C   1 
ATOM   3487 O O   . PHE A 1 445 ? 5.854   80.877 53.234 1.00 29.41 ? 448  PHE A O   1 
ATOM   3488 C CB  . PHE A 1 445 ? 5.377   78.139 53.996 1.00 27.37 ? 448  PHE A CB  1 
ATOM   3489 C CG  . PHE A 1 445 ? 4.716   76.905 53.457 1.00 26.98 ? 448  PHE A CG  1 
ATOM   3490 C CD1 . PHE A 1 445 ? 5.246   75.640 53.712 1.00 26.54 ? 448  PHE A CD1 1 
ATOM   3491 C CD2 . PHE A 1 445 ? 3.577   77.005 52.663 1.00 26.78 ? 448  PHE A CD2 1 
ATOM   3492 C CE1 . PHE A 1 445 ? 4.649   74.491 53.178 1.00 25.83 ? 448  PHE A CE1 1 
ATOM   3493 C CE2 . PHE A 1 445 ? 2.972   75.860 52.125 1.00 25.98 ? 448  PHE A CE2 1 
ATOM   3494 C CZ  . PHE A 1 445 ? 3.512   74.604 52.384 1.00 25.39 ? 448  PHE A CZ  1 
ATOM   3495 N N   . GLY A 1 446 ? 8.049   80.497 53.583 1.00 30.07 ? 449  GLY A N   1 
ATOM   3496 C CA  . GLY A 1 446 ? 8.389   81.907 53.692 1.00 31.28 ? 449  GLY A CA  1 
ATOM   3497 C C   . GLY A 1 446 ? 7.843   82.770 54.815 1.00 31.92 ? 449  GLY A C   1 
ATOM   3498 O O   . GLY A 1 446 ? 7.762   83.987 54.656 1.00 32.15 ? 449  GLY A O   1 
ATOM   3499 N N   . LEU A 1 447 ? 7.481   82.177 55.947 1.00 33.06 ? 450  LEU A N   1 
ATOM   3500 C CA  . LEU A 1 447 ? 6.962   82.970 57.060 1.00 34.26 ? 450  LEU A CA  1 
ATOM   3501 C C   . LEU A 1 447 ? 7.952   84.053 57.511 1.00 35.11 ? 450  LEU A C   1 
ATOM   3502 O O   . LEU A 1 447 ? 7.547   85.136 57.913 1.00 34.13 ? 450  LEU A O   1 
ATOM   3503 C CB  . LEU A 1 447 ? 6.590   82.067 58.246 1.00 33.92 ? 450  LEU A CB  1 
ATOM   3504 C CG  . LEU A 1 447 ? 5.253   81.307 58.168 1.00 34.44 ? 450  LEU A CG  1 
ATOM   3505 C CD1 . LEU A 1 447 ? 4.097   82.272 58.295 1.00 34.70 ? 450  LEU A CD1 1 
ATOM   3506 C CD2 . LEU A 1 447 ? 5.152   80.557 56.855 1.00 34.61 ? 450  LEU A CD2 1 
ATOM   3507 N N   . PRO A 1 448 ? 9.265   83.777 57.444 1.00 35.90 ? 451  PRO A N   1 
ATOM   3508 C CA  . PRO A 1 448 ? 10.219  84.805 57.870 1.00 37.31 ? 451  PRO A CA  1 
ATOM   3509 C C   . PRO A 1 448 ? 10.187  86.112 57.065 1.00 38.34 ? 451  PRO A C   1 
ATOM   3510 O O   . PRO A 1 448 ? 10.813  87.093 57.463 1.00 38.48 ? 451  PRO A O   1 
ATOM   3511 C CB  . PRO A 1 448 ? 11.567  84.089 57.759 1.00 36.74 ? 451  PRO A CB  1 
ATOM   3512 C CG  . PRO A 1 448 ? 11.213  82.679 58.101 1.00 36.84 ? 451  PRO A CG  1 
ATOM   3513 C CD  . PRO A 1 448 ? 9.944   82.478 57.286 1.00 36.44 ? 451  PRO A CD  1 
ATOM   3514 N N   . LEU A 1 449 ? 9.470   86.137 55.944 1.00 39.09 ? 452  LEU A N   1 
ATOM   3515 C CA  . LEU A 1 449 ? 9.408   87.354 55.138 1.00 40.02 ? 452  LEU A CA  1 
ATOM   3516 C C   . LEU A 1 449 ? 8.463   88.398 55.732 1.00 40.87 ? 452  LEU A C   1 
ATOM   3517 O O   . LEU A 1 449 ? 8.569   89.583 55.420 1.00 41.21 ? 452  LEU A O   1 
ATOM   3518 C CB  . LEU A 1 449 ? 8.979   87.048 53.699 1.00 39.81 ? 452  LEU A CB  1 
ATOM   3519 C CG  . LEU A 1 449 ? 9.750   86.021 52.866 1.00 40.27 ? 452  LEU A CG  1 
ATOM   3520 C CD1 . LEU A 1 449 ? 9.438   86.270 51.398 1.00 40.10 ? 452  LEU A CD1 1 
ATOM   3521 C CD2 . LEU A 1 449 ? 11.239  86.127 53.101 1.00 40.86 ? 452  LEU A CD2 1 
ATOM   3522 N N   . VAL A 1 450 ? 7.534   87.963 56.576 1.00 41.84 ? 453  VAL A N   1 
ATOM   3523 C CA  . VAL A 1 450 ? 6.602   88.888 57.211 1.00 43.45 ? 453  VAL A CA  1 
ATOM   3524 C C   . VAL A 1 450 ? 7.195   89.381 58.540 1.00 44.68 ? 453  VAL A C   1 
ATOM   3525 O O   . VAL A 1 450 ? 7.335   88.624 59.502 1.00 43.58 ? 453  VAL A O   1 
ATOM   3526 C CB  . VAL A 1 450 ? 5.216   88.223 57.423 1.00 43.37 ? 453  VAL A CB  1 
ATOM   3527 C CG1 . VAL A 1 450 ? 5.389   86.806 57.873 1.00 44.31 ? 453  VAL A CG1 1 
ATOM   3528 C CG2 . VAL A 1 450 ? 4.403   88.997 58.442 1.00 42.63 ? 453  VAL A CG2 1 
ATOM   3529 N N   . LYS A 1 451 ? 7.552   90.663 58.561 1.00 46.58 ? 454  LYS A N   1 
ATOM   3530 C CA  . LYS A 1 451 ? 8.170   91.308 59.718 1.00 48.53 ? 454  LYS A CA  1 
ATOM   3531 C C   . LYS A 1 451 ? 7.447   91.115 61.043 1.00 48.62 ? 454  LYS A C   1 
ATOM   3532 O O   . LYS A 1 451 ? 8.078   90.903 62.081 1.00 48.68 ? 454  LYS A O   1 
ATOM   3533 C CB  . LYS A 1 451 ? 8.332   92.808 59.445 1.00 50.04 ? 454  LYS A CB  1 
ATOM   3534 C CG  . LYS A 1 451 ? 9.249   93.153 58.265 1.00 52.22 ? 454  LYS A CG  1 
ATOM   3535 C CD  . LYS A 1 451 ? 10.720  92.785 58.519 1.00 53.47 ? 454  LYS A CD  1 
ATOM   3536 C CE  . LYS A 1 451 ? 11.009  91.300 58.269 1.00 54.41 ? 454  LYS A CE  1 
ATOM   3537 N NZ  . LYS A 1 451 ? 12.436  90.942 58.553 1.00 54.38 ? 454  LYS A NZ  1 
ATOM   3538 N N   . GLU A 1 452 ? 6.125   91.192 61.009 1.00 48.70 ? 455  GLU A N   1 
ATOM   3539 C CA  . GLU A 1 452 ? 5.324   91.038 62.212 1.00 49.38 ? 455  GLU A CA  1 
ATOM   3540 C C   . GLU A 1 452 ? 5.608   89.731 62.943 1.00 49.10 ? 455  GLU A C   1 
ATOM   3541 O O   . GLU A 1 452 ? 5.309   89.605 64.132 1.00 49.43 ? 455  GLU A O   1 
ATOM   3542 C CB  . GLU A 1 452 ? 3.838   91.117 61.860 1.00 51.16 ? 455  GLU A CB  1 
ATOM   3543 C CG  . GLU A 1 452 ? 3.447   92.408 61.152 1.00 54.64 ? 455  GLU A CG  1 
ATOM   3544 C CD  . GLU A 1 452 ? 4.131   92.572 59.800 1.00 56.50 ? 455  GLU A CD  1 
ATOM   3545 O OE1 . GLU A 1 452 ? 3.778   91.830 58.859 1.00 57.35 ? 455  GLU A OE1 1 
ATOM   3546 O OE2 . GLU A 1 452 ? 5.027   93.438 59.679 1.00 58.20 ? 455  GLU A OE2 1 
ATOM   3547 N N   . LEU A 1 453 ? 6.190   88.762 62.243 1.00 47.99 ? 456  LEU A N   1 
ATOM   3548 C CA  . LEU A 1 453 ? 6.477   87.474 62.860 1.00 47.15 ? 456  LEU A CA  1 
ATOM   3549 C C   . LEU A 1 453 ? 7.749   87.436 63.695 1.00 46.96 ? 456  LEU A C   1 
ATOM   3550 O O   . LEU A 1 453 ? 8.002   86.461 64.402 1.00 47.29 ? 456  LEU A O   1 
ATOM   3551 C CB  . LEU A 1 453 ? 6.492   86.370 61.802 1.00 46.45 ? 456  LEU A CB  1 
ATOM   3552 C CG  . LEU A 1 453 ? 5.100   86.056 61.244 1.00 45.47 ? 456  LEU A CG  1 
ATOM   3553 C CD1 . LEU A 1 453 ? 5.175   84.823 60.360 1.00 45.30 ? 456  LEU A CD1 1 
ATOM   3554 C CD2 . LEU A 1 453 ? 4.121   85.827 62.393 1.00 44.11 ? 456  LEU A CD2 1 
ATOM   3555 N N   . ASN A 1 454 ? 8.556   88.487 63.604 1.00 46.55 ? 457  ASN A N   1 
ATOM   3556 C CA  . ASN A 1 454 ? 9.766   88.588 64.417 1.00 46.31 ? 457  ASN A CA  1 
ATOM   3557 C C   . ASN A 1 454 ? 10.971  87.701 64.096 1.00 45.55 ? 457  ASN A C   1 
ATOM   3558 O O   . ASN A 1 454 ? 11.623  87.195 65.012 1.00 45.62 ? 457  ASN A O   1 
ATOM   3559 C CB  . ASN A 1 454 ? 9.397   88.391 65.894 1.00 47.40 ? 457  ASN A CB  1 
ATOM   3560 C CG  . ASN A 1 454 ? 8.387   89.414 66.388 1.00 48.69 ? 457  ASN A CG  1 
ATOM   3561 O OD1 . ASN A 1 454 ? 7.780   89.243 67.447 1.00 50.12 ? 457  ASN A OD1 1 
ATOM   3562 N ND2 . ASN A 1 454 ? 8.210   90.489 65.627 1.00 49.24 ? 457  ASN A ND2 1 
ATOM   3563 N N   . TYR A 1 455 ? 11.273  87.493 62.819 1.00 43.61 ? 458  TYR A N   1 
ATOM   3564 C CA  . TYR A 1 455 ? 12.455  86.709 62.477 1.00 41.90 ? 458  TYR A CA  1 
ATOM   3565 C C   . TYR A 1 455 ? 13.549  87.740 62.218 1.00 41.31 ? 458  TYR A C   1 
ATOM   3566 O O   . TYR A 1 455 ? 13.263  88.931 62.112 1.00 41.33 ? 458  TYR A O   1 
ATOM   3567 C CB  . TYR A 1 455 ? 12.237  85.868 61.214 1.00 41.13 ? 458  TYR A CB  1 
ATOM   3568 C CG  . TYR A 1 455 ? 11.308  84.683 61.378 1.00 40.09 ? 458  TYR A CG  1 
ATOM   3569 C CD1 . TYR A 1 455 ? 9.926   84.825 61.249 1.00 39.48 ? 458  TYR A CD1 1 
ATOM   3570 C CD2 . TYR A 1 455 ? 11.817  83.412 61.638 1.00 39.75 ? 458  TYR A CD2 1 
ATOM   3571 C CE1 . TYR A 1 455 ? 9.074   83.727 61.369 1.00 38.53 ? 458  TYR A CE1 1 
ATOM   3572 C CE2 . TYR A 1 455 ? 10.976  82.310 61.762 1.00 39.30 ? 458  TYR A CE2 1 
ATOM   3573 C CZ  . TYR A 1 455 ? 9.607   82.471 61.626 1.00 39.10 ? 458  TYR A CZ  1 
ATOM   3574 O OH  . TYR A 1 455 ? 8.779   81.372 61.745 1.00 37.84 ? 458  TYR A OH  1 
ATOM   3575 N N   . THR A 1 456 ? 14.798  87.299 62.125 1.00 40.73 ? 459  THR A N   1 
ATOM   3576 C CA  . THR A 1 456 ? 15.893  88.228 61.867 1.00 40.28 ? 459  THR A CA  1 
ATOM   3577 C C   . THR A 1 456 ? 16.075  88.393 60.364 1.00 40.47 ? 459  THR A C   1 
ATOM   3578 O O   . THR A 1 456 ? 15.468  87.667 59.577 1.00 40.67 ? 459  THR A O   1 
ATOM   3579 C CB  . THR A 1 456 ? 17.216  87.720 62.453 1.00 40.09 ? 459  THR A CB  1 
ATOM   3580 O OG1 . THR A 1 456 ? 17.603  86.517 61.778 1.00 39.44 ? 459  THR A OG1 1 
ATOM   3581 C CG2 . THR A 1 456 ? 17.070  87.450 63.946 1.00 39.56 ? 459  THR A CG2 1 
ATOM   3582 N N   . ALA A 1 457 ? 16.917  89.343 59.967 1.00 39.96 ? 460  ALA A N   1 
ATOM   3583 C CA  . ALA A 1 457 ? 17.171  89.585 58.554 1.00 39.13 ? 460  ALA A CA  1 
ATOM   3584 C C   . ALA A 1 457 ? 17.846  88.380 57.901 1.00 38.75 ? 460  ALA A C   1 
ATOM   3585 O O   . ALA A 1 457 ? 17.576  88.061 56.744 1.00 38.48 ? 460  ALA A O   1 
ATOM   3586 C CB  . ALA A 1 457 ? 18.035  90.827 58.382 1.00 38.76 ? 460  ALA A CB  1 
ATOM   3587 N N   . GLU A 1 458 ? 18.726  87.713 58.638 1.00 38.73 ? 461  GLU A N   1 
ATOM   3588 C CA  . GLU A 1 458 ? 19.412  86.552 58.091 1.00 39.88 ? 461  GLU A CA  1 
ATOM   3589 C C   . GLU A 1 458 ? 18.443  85.391 57.896 1.00 39.25 ? 461  GLU A C   1 
ATOM   3590 O O   . GLU A 1 458 ? 18.590  84.602 56.963 1.00 39.35 ? 461  GLU A O   1 
ATOM   3591 C CB  . GLU A 1 458 ? 20.569  86.118 58.998 1.00 41.05 ? 461  GLU A CB  1 
ATOM   3592 C CG  . GLU A 1 458 ? 20.460  86.592 60.434 1.00 44.77 ? 461  GLU A CG  1 
ATOM   3593 C CD  . GLU A 1 458 ? 20.927  88.025 60.604 1.00 45.77 ? 461  GLU A CD  1 
ATOM   3594 O OE1 . GLU A 1 458 ? 22.098  88.300 60.264 1.00 47.23 ? 461  GLU A OE1 1 
ATOM   3595 O OE2 . GLU A 1 458 ? 20.132  88.870 61.076 1.00 46.16 ? 461  GLU A OE2 1 
ATOM   3596 N N   . GLU A 1 459 ? 17.449  85.292 58.771 1.00 38.50 ? 462  GLU A N   1 
ATOM   3597 C CA  . GLU A 1 459 ? 16.471  84.224 58.663 1.00 37.64 ? 462  GLU A CA  1 
ATOM   3598 C C   . GLU A 1 459 ? 15.571  84.441 57.452 1.00 38.15 ? 462  GLU A C   1 
ATOM   3599 O O   . GLU A 1 459 ? 15.140  83.475 56.815 1.00 37.95 ? 462  GLU A O   1 
ATOM   3600 C CB  . GLU A 1 459 ? 15.657  84.117 59.954 1.00 36.73 ? 462  GLU A CB  1 
ATOM   3601 C CG  . GLU A 1 459 ? 16.530  83.718 61.141 1.00 36.21 ? 462  GLU A CG  1 
ATOM   3602 C CD  . GLU A 1 459 ? 15.757  83.539 62.431 1.00 35.90 ? 462  GLU A CD  1 
ATOM   3603 O OE1 . GLU A 1 459 ? 14.918  84.406 62.753 1.00 35.81 ? 462  GLU A OE1 1 
ATOM   3604 O OE2 . GLU A 1 459 ? 16.005  82.536 63.132 1.00 35.36 ? 462  GLU A OE2 1 
ATOM   3605 N N   . GLU A 1 460 ? 15.291  85.703 57.125 1.00 37.98 ? 463  GLU A N   1 
ATOM   3606 C CA  . GLU A 1 460 ? 14.473  85.990 55.951 1.00 38.04 ? 463  GLU A CA  1 
ATOM   3607 C C   . GLU A 1 460 ? 15.290  85.614 54.720 1.00 37.32 ? 463  GLU A C   1 
ATOM   3608 O O   . GLU A 1 460 ? 14.760  85.064 53.751 1.00 37.25 ? 463  GLU A O   1 
ATOM   3609 C CB  . GLU A 1 460 ? 14.103  87.474 55.865 1.00 39.62 ? 463  GLU A CB  1 
ATOM   3610 C CG  . GLU A 1 460 ? 13.762  87.900 54.434 1.00 42.21 ? 463  GLU A CG  1 
ATOM   3611 C CD  . GLU A 1 460 ? 13.326  89.343 54.310 1.00 43.70 ? 463  GLU A CD  1 
ATOM   3612 O OE1 . GLU A 1 460 ? 13.916  90.206 54.991 1.00 45.77 ? 463  GLU A OE1 1 
ATOM   3613 O OE2 . GLU A 1 460 ? 12.401  89.616 53.513 1.00 44.72 ? 463  GLU A OE2 1 
ATOM   3614 N N   . ALA A 1 461 ? 16.583  85.920 54.762 1.00 35.78 ? 464  ALA A N   1 
ATOM   3615 C CA  . ALA A 1 461 ? 17.471  85.604 53.651 1.00 35.23 ? 464  ALA A CA  1 
ATOM   3616 C C   . ALA A 1 461 ? 17.543  84.087 53.471 1.00 34.31 ? 464  ALA A C   1 
ATOM   3617 O O   . ALA A 1 461 ? 17.594  83.588 52.345 1.00 34.18 ? 464  ALA A O   1 
ATOM   3618 C CB  . ALA A 1 461 ? 18.867  86.179 53.910 1.00 33.99 ? 464  ALA A CB  1 
ATOM   3619 N N   . LEU A 1 462 ? 17.548  83.361 54.587 1.00 33.07 ? 465  LEU A N   1 
ATOM   3620 C CA  . LEU A 1 462 ? 17.594  81.903 54.548 1.00 32.36 ? 465  LEU A CA  1 
ATOM   3621 C C   . LEU A 1 462 ? 16.294  81.350 53.961 1.00 31.62 ? 465  LEU A C   1 
ATOM   3622 O O   . LEU A 1 462 ? 16.307  80.414 53.168 1.00 31.62 ? 465  LEU A O   1 
ATOM   3623 C CB  . LEU A 1 462 ? 17.799  81.338 55.957 1.00 31.79 ? 465  LEU A CB  1 
ATOM   3624 C CG  . LEU A 1 462 ? 17.677  79.815 56.068 1.00 31.24 ? 465  LEU A CG  1 
ATOM   3625 C CD1 . LEU A 1 462 ? 18.693  79.150 55.157 1.00 31.58 ? 465  LEU A CD1 1 
ATOM   3626 C CD2 . LEU A 1 462 ? 17.886  79.387 57.502 1.00 31.17 ? 465  LEU A CD2 1 
ATOM   3627 N N   . SER A 1 463 ? 15.172  81.935 54.354 1.00 30.96 ? 466  SER A N   1 
ATOM   3628 C CA  . SER A 1 463 ? 13.879  81.497 53.855 1.00 31.26 ? 466  SER A CA  1 
ATOM   3629 C C   . SER A 1 463 ? 13.809  81.698 52.340 1.00 32.47 ? 466  SER A C   1 
ATOM   3630 O O   . SER A 1 463 ? 13.377  80.802 51.609 1.00 33.10 ? 466  SER A O   1 
ATOM   3631 C CB  . SER A 1 463 ? 12.759  82.276 54.550 1.00 30.38 ? 466  SER A CB  1 
ATOM   3632 O OG  . SER A 1 463 ? 11.478  81.779 54.203 1.00 29.13 ? 466  SER A OG  1 
ATOM   3633 N N   . ARG A 1 464 ? 14.255  82.862 51.865 1.00 33.08 ? 467  ARG A N   1 
ATOM   3634 C CA  . ARG A 1 464 ? 14.229  83.157 50.431 1.00 32.84 ? 467  ARG A CA  1 
ATOM   3635 C C   . ARG A 1 464 ? 15.081  82.170 49.644 1.00 33.28 ? 467  ARG A C   1 
ATOM   3636 O O   . ARG A 1 464 ? 14.676  81.701 48.576 1.00 32.83 ? 467  ARG A O   1 
ATOM   3637 C CB  . ARG A 1 464 ? 14.695  84.592 50.169 1.00 32.49 ? 467  ARG A CB  1 
ATOM   3638 C CG  . ARG A 1 464 ? 13.665  85.647 50.562 1.00 32.01 ? 467  ARG A CG  1 
ATOM   3639 C CD  . ARG A 1 464 ? 14.160  87.072 50.309 1.00 31.95 ? 467  ARG A CD  1 
ATOM   3640 N NE  . ARG A 1 464 ? 13.140  88.061 50.658 1.00 33.15 ? 467  ARG A NE  1 
ATOM   3641 C CZ  . ARG A 1 464 ? 12.058  88.318 49.927 1.00 33.29 ? 467  ARG A CZ  1 
ATOM   3642 N NH1 . ARG A 1 464 ? 11.847  87.668 48.790 1.00 32.47 ? 467  ARG A NH1 1 
ATOM   3643 N NH2 . ARG A 1 464 ? 11.172  89.213 50.345 1.00 33.95 ? 467  ARG A NH2 1 
ATOM   3644 N N   . ARG A 1 465 ? 16.256  81.853 50.175 1.00 33.39 ? 468  ARG A N   1 
ATOM   3645 C CA  . ARG A 1 465 ? 17.155  80.894 49.535 1.00 33.96 ? 468  ARG A CA  1 
ATOM   3646 C C   . ARG A 1 465 ? 16.485  79.527 49.413 1.00 33.00 ? 468  ARG A C   1 
ATOM   3647 O O   . ARG A 1 465 ? 16.521  78.896 48.361 1.00 33.13 ? 468  ARG A O   1 
ATOM   3648 C CB  . ARG A 1 465 ? 18.424  80.720 50.364 1.00 35.49 ? 468  ARG A CB  1 
ATOM   3649 C CG  . ARG A 1 465 ? 19.653  81.411 49.834 1.00 38.18 ? 468  ARG A CG  1 
ATOM   3650 C CD  . ARG A 1 465 ? 20.809  81.146 50.782 1.00 40.32 ? 468  ARG A CD  1 
ATOM   3651 N NE  . ARG A 1 465 ? 21.153  79.729 50.817 1.00 42.44 ? 468  ARG A NE  1 
ATOM   3652 C CZ  . ARG A 1 465 ? 21.726  79.127 51.853 1.00 43.34 ? 468  ARG A CZ  1 
ATOM   3653 N NH1 . ARG A 1 465 ? 22.014  79.822 52.946 1.00 43.69 ? 468  ARG A NH1 1 
ATOM   3654 N NH2 . ARG A 1 465 ? 22.020  77.834 51.790 1.00 43.58 ? 468  ARG A NH2 1 
ATOM   3655 N N   . ILE A 1 466 ? 15.896  79.064 50.511 1.00 32.38 ? 469  ILE A N   1 
ATOM   3656 C CA  . ILE A 1 466 ? 15.235  77.767 50.529 1.00 31.66 ? 469  ILE A CA  1 
ATOM   3657 C C   . ILE A 1 466 ? 14.045  77.742 49.577 1.00 31.76 ? 469  ILE A C   1 
ATOM   3658 O O   . ILE A 1 466 ? 13.884  76.804 48.797 1.00 32.18 ? 469  ILE A O   1 
ATOM   3659 C CB  . ILE A 1 466 ? 14.791  77.403 51.969 1.00 30.58 ? 469  ILE A CB  1 
ATOM   3660 C CG1 . ILE A 1 466 ? 16.036  77.093 52.811 1.00 28.70 ? 469  ILE A CG1 1 
ATOM   3661 C CG2 . ILE A 1 466 ? 13.826  76.213 51.948 1.00 29.64 ? 469  ILE A CG2 1 
ATOM   3662 C CD1 . ILE A 1 466 ? 15.757  76.829 54.268 1.00 27.07 ? 469  ILE A CD1 1 
ATOM   3663 N N   . MET A 1 467 ? 13.216  78.777 49.629 1.00 31.86 ? 470  MET A N   1 
ATOM   3664 C CA  . MET A 1 467 ? 12.066  78.832 48.742 1.00 31.97 ? 470  MET A CA  1 
ATOM   3665 C C   . MET A 1 467 ? 12.518  78.804 47.288 1.00 31.77 ? 470  MET A C   1 
ATOM   3666 O O   . MET A 1 467 ? 11.883  78.158 46.449 1.00 31.47 ? 470  MET A O   1 
ATOM   3667 C CB  . MET A 1 467 ? 11.244  80.097 48.981 1.00 32.32 ? 470  MET A CB  1 
ATOM   3668 C CG  . MET A 1 467 ? 10.400  80.083 50.238 1.00 33.33 ? 470  MET A CG  1 
ATOM   3669 S SD  . MET A 1 467 ? 9.168   81.409 50.166 1.00 36.86 ? 470  MET A SD  1 
ATOM   3670 C CE  . MET A 1 467 ? 10.206  82.820 50.592 1.00 33.07 ? 470  MET A CE  1 
ATOM   3671 N N   . HIS A 1 468 ? 13.613  79.498 46.985 1.00 31.10 ? 471  HIS A N   1 
ATOM   3672 C CA  . HIS A 1 468 ? 14.089  79.529 45.612 1.00 30.64 ? 471  HIS A CA  1 
ATOM   3673 C C   . HIS A 1 468 ? 14.678  78.179 45.213 1.00 30.54 ? 471  HIS A C   1 
ATOM   3674 O O   . HIS A 1 468 ? 14.554  77.770 44.057 1.00 29.98 ? 471  HIS A O   1 
ATOM   3675 C CB  . HIS A 1 468 ? 15.109  80.649 45.399 1.00 30.75 ? 471  HIS A CB  1 
ATOM   3676 C CG  . HIS A 1 468 ? 15.332  80.981 43.955 1.00 30.92 ? 471  HIS A CG  1 
ATOM   3677 N ND1 . HIS A 1 468 ? 14.301  81.321 43.105 1.00 31.17 ? 471  HIS A ND1 1 
ATOM   3678 C CD2 . HIS A 1 468 ? 16.460  81.000 43.204 1.00 30.74 ? 471  HIS A CD2 1 
ATOM   3679 C CE1 . HIS A 1 468 ? 14.782  81.534 41.893 1.00 30.68 ? 471  HIS A CE1 1 
ATOM   3680 N NE2 . HIS A 1 468 ? 16.090  81.346 41.926 1.00 30.60 ? 471  HIS A NE2 1 
ATOM   3681 N N   . TYR A 1 469 ? 15.316  77.491 46.161 1.00 29.94 ? 472  TYR A N   1 
ATOM   3682 C CA  . TYR A 1 469 ? 15.858  76.159 45.888 1.00 30.14 ? 472  TYR A CA  1 
ATOM   3683 C C   . TYR A 1 469 ? 14.683  75.241 45.531 1.00 29.93 ? 472  TYR A C   1 
ATOM   3684 O O   . TYR A 1 469 ? 14.677  74.592 44.488 1.00 30.05 ? 472  TYR A O   1 
ATOM   3685 C CB  . TYR A 1 469 ? 16.526  75.549 47.121 1.00 31.02 ? 472  TYR A CB  1 
ATOM   3686 C CG  . TYR A 1 469 ? 17.904  76.051 47.477 1.00 32.42 ? 472  TYR A CG  1 
ATOM   3687 C CD1 . TYR A 1 469 ? 18.823  76.416 46.490 1.00 32.61 ? 472  TYR A CD1 1 
ATOM   3688 C CD2 . TYR A 1 469 ? 18.320  76.079 48.810 1.00 31.65 ? 472  TYR A CD2 1 
ATOM   3689 C CE1 . TYR A 1 469 ? 20.125  76.793 46.824 1.00 32.75 ? 472  TYR A CE1 1 
ATOM   3690 C CE2 . TYR A 1 469 ? 19.608  76.448 49.155 1.00 32.75 ? 472  TYR A CE2 1 
ATOM   3691 C CZ  . TYR A 1 469 ? 20.509  76.805 48.161 1.00 33.65 ? 472  TYR A CZ  1 
ATOM   3692 O OH  . TYR A 1 469 ? 21.787  77.175 48.514 1.00 33.18 ? 472  TYR A OH  1 
ATOM   3693 N N   . TRP A 1 470 ? 13.697  75.187 46.425 1.00 29.12 ? 473  TRP A N   1 
ATOM   3694 C CA  . TRP A 1 470 ? 12.517  74.345 46.239 1.00 28.60 ? 473  TRP A CA  1 
ATOM   3695 C C   . TRP A 1 470 ? 11.804  74.613 44.906 1.00 28.14 ? 473  TRP A C   1 
ATOM   3696 O O   . TRP A 1 470 ? 11.545  73.689 44.133 1.00 27.46 ? 473  TRP A O   1 
ATOM   3697 C CB  . TRP A 1 470 ? 11.526  74.556 47.397 1.00 27.44 ? 473  TRP A CB  1 
ATOM   3698 C CG  . TRP A 1 470 ? 11.658  73.613 48.585 1.00 27.73 ? 473  TRP A CG  1 
ATOM   3699 C CD1 . TRP A 1 470 ? 10.634  72.946 49.209 1.00 26.94 ? 473  TRP A CD1 1 
ATOM   3700 C CD2 . TRP A 1 470 ? 12.851  73.287 49.325 1.00 27.33 ? 473  TRP A CD2 1 
ATOM   3701 N NE1 . TRP A 1 470 ? 11.111  72.235 50.282 1.00 27.20 ? 473  TRP A NE1 1 
ATOM   3702 C CE2 . TRP A 1 470 ? 12.465  72.423 50.379 1.00 27.47 ? 473  TRP A CE2 1 
ATOM   3703 C CE3 . TRP A 1 470 ? 14.203  73.639 49.202 1.00 27.30 ? 473  TRP A CE3 1 
ATOM   3704 C CZ2 . TRP A 1 470 ? 13.384  71.907 51.306 1.00 27.36 ? 473  TRP A CZ2 1 
ATOM   3705 C CZ3 . TRP A 1 470 ? 15.118  73.126 50.124 1.00 27.22 ? 473  TRP A CZ3 1 
ATOM   3706 C CH2 . TRP A 1 470 ? 14.701  72.268 51.163 1.00 27.31 ? 473  TRP A CH2 1 
ATOM   3707 N N   . ALA A 1 471 ? 11.488  75.880 44.646 1.00 27.78 ? 474  ALA A N   1 
ATOM   3708 C CA  . ALA A 1 471 ? 10.791  76.271 43.423 1.00 27.24 ? 474  ALA A CA  1 
ATOM   3709 C C   . ALA A 1 471 ? 11.629  76.010 42.177 1.00 27.35 ? 474  ALA A C   1 
ATOM   3710 O O   . ALA A 1 471 ? 11.116  75.544 41.163 1.00 27.80 ? 474  ALA A O   1 
ATOM   3711 C CB  . ALA A 1 471 ? 10.397  77.747 43.494 1.00 26.39 ? 474  ALA A CB  1 
ATOM   3712 N N   . THR A 1 472 ? 12.920  76.309 42.247 1.00 28.06 ? 475  THR A N   1 
ATOM   3713 C CA  . THR A 1 472 ? 13.796  76.079 41.103 1.00 28.26 ? 475  THR A CA  1 
ATOM   3714 C C   . THR A 1 472 ? 13.887  74.584 40.810 1.00 28.74 ? 475  THR A C   1 
ATOM   3715 O O   . THR A 1 472 ? 13.906  74.166 39.648 1.00 29.75 ? 475  THR A O   1 
ATOM   3716 C CB  . THR A 1 472 ? 15.198  76.637 41.362 1.00 27.54 ? 475  THR A CB  1 
ATOM   3717 O OG1 . THR A 1 472 ? 15.101  78.042 41.621 1.00 26.98 ? 475  THR A OG1 1 
ATOM   3718 C CG2 . THR A 1 472 ? 16.096  76.406 40.159 1.00 26.50 ? 475  THR A CG2 1 
ATOM   3719 N N   . PHE A 1 473 ? 13.943  73.778 41.865 1.00 28.50 ? 476  PHE A N   1 
ATOM   3720 C CA  . PHE A 1 473 ? 14.003  72.332 41.700 1.00 28.72 ? 476  PHE A CA  1 
ATOM   3721 C C   . PHE A 1 473 ? 12.698  71.849 41.078 1.00 29.05 ? 476  PHE A C   1 
ATOM   3722 O O   . PHE A 1 473 ? 12.692  70.983 40.203 1.00 29.04 ? 476  PHE A O   1 
ATOM   3723 C CB  . PHE A 1 473 ? 14.182  71.632 43.050 1.00 28.66 ? 476  PHE A CB  1 
ATOM   3724 C CG  . PHE A 1 473 ? 13.974  70.140 42.982 1.00 27.85 ? 476  PHE A CG  1 
ATOM   3725 C CD1 . PHE A 1 473 ? 14.980  69.303 42.498 1.00 27.38 ? 476  PHE A CD1 1 
ATOM   3726 C CD2 . PHE A 1 473 ? 12.755  69.579 43.361 1.00 26.86 ? 476  PHE A CD2 1 
ATOM   3727 C CE1 . PHE A 1 473 ? 14.775  67.926 42.391 1.00 26.21 ? 476  PHE A CE1 1 
ATOM   3728 C CE2 . PHE A 1 473 ? 12.538  68.208 43.257 1.00 26.65 ? 476  PHE A CE2 1 
ATOM   3729 C CZ  . PHE A 1 473 ? 13.551  67.378 42.770 1.00 26.49 ? 476  PHE A CZ  1 
ATOM   3730 N N   . ALA A 1 474 ? 11.589  72.405 41.551 1.00 29.14 ? 477  ALA A N   1 
ATOM   3731 C CA  . ALA A 1 474 ? 10.279  72.024 41.049 1.00 30.48 ? 477  ALA A CA  1 
ATOM   3732 C C   . ALA A 1 474 ? 10.176  72.319 39.560 1.00 31.67 ? 477  ALA A C   1 
ATOM   3733 O O   . ALA A 1 474 ? 9.630   71.527 38.790 1.00 31.71 ? 477  ALA A O   1 
ATOM   3734 C CB  . ALA A 1 474 ? 9.193   72.781 41.804 1.00 29.35 ? 477  ALA A CB  1 
ATOM   3735 N N   . LYS A 1 475 ? 10.727  73.460 39.164 1.00 32.70 ? 478  LYS A N   1 
ATOM   3736 C CA  . LYS A 1 475 ? 10.678  73.909 37.782 1.00 34.28 ? 478  LYS A CA  1 
ATOM   3737 C C   . LYS A 1 475 ? 11.637  73.222 36.813 1.00 33.97 ? 478  LYS A C   1 
ATOM   3738 O O   . LYS A 1 475 ? 11.286  72.993 35.658 1.00 34.41 ? 478  LYS A O   1 
ATOM   3739 C CB  . LYS A 1 475 ? 10.912  75.422 37.745 1.00 35.75 ? 478  LYS A CB  1 
ATOM   3740 C CG  . LYS A 1 475 ? 10.940  76.032 36.354 1.00 38.57 ? 478  LYS A CG  1 
ATOM   3741 C CD  . LYS A 1 475 ? 11.250  77.526 36.428 1.00 40.71 ? 478  LYS A CD  1 
ATOM   3742 C CE  . LYS A 1 475 ? 11.199  78.188 35.052 1.00 42.63 ? 478  LYS A CE  1 
ATOM   3743 N NZ  . LYS A 1 475 ? 11.378  79.675 35.125 1.00 42.88 ? 478  LYS A NZ  1 
ATOM   3744 N N   . THR A 1 476 ? 12.834  72.880 37.282 1.00 33.70 ? 479  THR A N   1 
ATOM   3745 C CA  . THR A 1 476 ? 13.845  72.274 36.418 1.00 32.79 ? 479  THR A CA  1 
ATOM   3746 C C   . THR A 1 476 ? 14.377  70.917 36.849 1.00 33.11 ? 479  THR A C   1 
ATOM   3747 O O   . THR A 1 476 ? 14.961  70.195 36.040 1.00 33.07 ? 479  THR A O   1 
ATOM   3748 C CB  . THR A 1 476 ? 15.068  73.193 36.304 1.00 33.40 ? 479  THR A CB  1 
ATOM   3749 O OG1 . THR A 1 476 ? 15.702  73.291 37.590 1.00 32.89 ? 479  THR A OG1 1 
ATOM   3750 C CG2 . THR A 1 476 ? 14.653  74.587 35.842 1.00 32.10 ? 479  THR A CG2 1 
ATOM   3751 N N   . GLY A 1 477 ? 14.199  70.575 38.120 1.00 32.63 ? 480  GLY A N   1 
ATOM   3752 C CA  . GLY A 1 477 ? 14.714  69.311 38.613 1.00 32.16 ? 480  GLY A CA  1 
ATOM   3753 C C   . GLY A 1 477 ? 16.117  69.501 39.164 1.00 31.63 ? 480  GLY A C   1 
ATOM   3754 O O   . GLY A 1 477 ? 16.847  68.535 39.387 1.00 31.25 ? 480  GLY A O   1 
ATOM   3755 N N   . ASN A 1 478 ? 16.483  70.765 39.371 1.00 31.44 ? 481  ASN A N   1 
ATOM   3756 C CA  . ASN A 1 478 ? 17.788  71.158 39.898 1.00 31.36 ? 481  ASN A CA  1 
ATOM   3757 C C   . ASN A 1 478 ? 17.572  72.417 40.748 1.00 31.64 ? 481  ASN A C   1 
ATOM   3758 O O   . ASN A 1 478 ? 17.081  73.433 40.251 1.00 31.90 ? 481  ASN A O   1 
ATOM   3759 C CB  . ASN A 1 478 ? 18.740  71.478 38.744 1.00 31.72 ? 481  ASN A CB  1 
ATOM   3760 C CG  . ASN A 1 478 ? 20.157  71.775 39.211 1.00 32.28 ? 481  ASN A CG  1 
ATOM   3761 O OD1 . ASN A 1 478 ? 20.369  72.384 40.262 1.00 32.83 ? 481  ASN A OD1 1 
ATOM   3762 N ND2 . ASN A 1 478 ? 21.136  71.359 38.417 1.00 32.62 ? 481  ASN A ND2 1 
ATOM   3763 N N   . PRO A 1 479 ? 17.938  72.370 42.039 1.00 31.88 ? 482  PRO A N   1 
ATOM   3764 C CA  . PRO A 1 479 ? 17.759  73.532 42.920 1.00 32.28 ? 482  PRO A CA  1 
ATOM   3765 C C   . PRO A 1 479 ? 18.615  74.750 42.565 1.00 33.66 ? 482  PRO A C   1 
ATOM   3766 O O   . PRO A 1 479 ? 18.309  75.878 42.966 1.00 33.34 ? 482  PRO A O   1 
ATOM   3767 C CB  . PRO A 1 479 ? 18.097  72.967 44.296 1.00 31.48 ? 482  PRO A CB  1 
ATOM   3768 C CG  . PRO A 1 479 ? 19.143  71.937 43.980 1.00 30.79 ? 482  PRO A CG  1 
ATOM   3769 C CD  . PRO A 1 479 ? 18.562  71.250 42.767 1.00 31.21 ? 482  PRO A CD  1 
ATOM   3770 N N   . ASN A 1 480 ? 19.679  74.520 41.804 1.00 35.01 ? 483  ASN A N   1 
ATOM   3771 C CA  . ASN A 1 480 ? 20.587  75.592 41.415 1.00 36.90 ? 483  ASN A CA  1 
ATOM   3772 C C   . ASN A 1 480 ? 20.171  76.360 40.171 1.00 38.45 ? 483  ASN A C   1 
ATOM   3773 O O   . ASN A 1 480 ? 19.583  75.808 39.242 1.00 38.32 ? 483  ASN A O   1 
ATOM   3774 C CB  . ASN A 1 480 ? 21.989  75.027 41.206 1.00 36.14 ? 483  ASN A CB  1 
ATOM   3775 C CG  . ASN A 1 480 ? 22.536  74.385 42.452 1.00 36.43 ? 483  ASN A CG  1 
ATOM   3776 O OD1 . ASN A 1 480 ? 22.774  75.060 43.456 1.00 35.78 ? 483  ASN A OD1 1 
ATOM   3777 N ND2 . ASN A 1 480 ? 22.729  73.069 42.406 1.00 35.89 ? 483  ASN A ND2 1 
ATOM   3778 N N   . GLU A 1 481 ? 20.493  77.647 40.170 1.00 40.93 ? 484  GLU A N   1 
ATOM   3779 C CA  . GLU A 1 481 ? 20.186  78.529 39.051 1.00 43.43 ? 484  GLU A CA  1 
ATOM   3780 C C   . GLU A 1 481 ? 21.149  78.282 37.899 1.00 43.78 ? 484  GLU A C   1 
ATOM   3781 O O   . GLU A 1 481 ? 22.341  78.041 38.110 1.00 43.63 ? 484  GLU A O   1 
ATOM   3782 C CB  . GLU A 1 481 ? 20.296  79.989 39.495 1.00 45.42 ? 484  GLU A CB  1 
ATOM   3783 C CG  . GLU A 1 481 ? 19.059  80.526 40.174 1.00 47.92 ? 484  GLU A CG  1 
ATOM   3784 C CD  . GLU A 1 481 ? 18.044  81.008 39.170 1.00 49.07 ? 484  GLU A CD  1 
ATOM   3785 O OE1 . GLU A 1 481 ? 17.828  80.301 38.165 1.00 50.57 ? 484  GLU A OE1 1 
ATOM   3786 O OE2 . GLU A 1 481 ? 17.464  82.091 39.384 1.00 50.68 ? 484  GLU A OE2 1 
ATOM   3787 N N   . PRO A 1 482 ? 20.644  78.344 36.658 0.50 44.14 ? 485  PRO A N   1 
ATOM   3788 C CA  . PRO A 1 482 ? 21.499  78.123 35.492 0.50 44.09 ? 485  PRO A CA  1 
ATOM   3789 C C   . PRO A 1 482 ? 22.535  79.235 35.372 0.50 44.11 ? 485  PRO A C   1 
ATOM   3790 O O   . PRO A 1 482 ? 22.184  80.412 35.296 0.50 43.91 ? 485  PRO A O   1 
ATOM   3791 C CB  . PRO A 1 482 ? 20.504  78.127 34.338 0.50 44.33 ? 485  PRO A CB  1 
ATOM   3792 C CG  . PRO A 1 482 ? 19.480  79.116 34.802 0.50 44.37 ? 485  PRO A CG  1 
ATOM   3793 C CD  . PRO A 1 482 ? 19.276  78.700 36.242 0.50 44.16 ? 485  PRO A CD  1 
ATOM   3794 N N   . HIS A 1 483 ? 23.808  78.857 35.378 0.50 43.77 ? 486  HIS A N   1 
ATOM   3795 C CA  . HIS A 1 483 ? 24.888  79.825 35.255 0.50 43.64 ? 486  HIS A CA  1 
ATOM   3796 C C   . HIS A 1 483 ? 24.790  80.938 36.297 0.50 43.09 ? 486  HIS A C   1 
ATOM   3797 O O   . HIS A 1 483 ? 24.839  82.120 35.962 0.50 43.08 ? 486  HIS A O   1 
ATOM   3798 C CB  . HIS A 1 483 ? 24.879  80.434 33.849 0.50 44.16 ? 486  HIS A CB  1 
ATOM   3799 C CG  . HIS A 1 483 ? 24.984  79.421 32.751 0.50 44.66 ? 486  HIS A CG  1 
ATOM   3800 N ND1 . HIS A 1 483 ? 26.044  78.546 32.644 0.50 44.94 ? 486  HIS A ND1 1 
ATOM   3801 C CD2 . HIS A 1 483 ? 24.160  79.143 31.713 0.50 44.55 ? 486  HIS A CD2 1 
ATOM   3802 C CE1 . HIS A 1 483 ? 25.868  77.772 31.588 0.50 45.01 ? 486  HIS A CE1 1 
ATOM   3803 N NE2 . HIS A 1 483 ? 24.732  78.114 31.006 0.50 44.93 ? 486  HIS A NE2 1 
ATOM   3804 N N   . SER A 1 484 ? 24.654  80.552 37.560 0.50 42.48 ? 487  SER A N   1 
ATOM   3805 C CA  . SER A 1 484 ? 24.559  81.512 38.656 0.50 41.65 ? 487  SER A CA  1 
ATOM   3806 C C   . SER A 1 484 ? 25.919  81.685 39.323 0.50 41.26 ? 487  SER A C   1 
ATOM   3807 O O   . SER A 1 484 ? 26.855  80.938 39.041 0.50 40.65 ? 487  SER A O   1 
ATOM   3808 C CB  . SER A 1 484 ? 23.540  81.025 39.689 0.50 41.56 ? 487  SER A CB  1 
ATOM   3809 O OG  . SER A 1 484 ? 23.586  81.812 40.865 0.50 41.19 ? 487  SER A OG  1 
ATOM   3810 N N   . GLN A 1 485 ? 26.025  82.670 40.209 0.50 41.19 ? 488  GLN A N   1 
ATOM   3811 C CA  . GLN A 1 485 ? 27.275  82.924 40.916 0.50 41.65 ? 488  GLN A CA  1 
ATOM   3812 C C   . GLN A 1 485 ? 27.203  82.410 42.349 0.50 41.47 ? 488  GLN A C   1 
ATOM   3813 O O   . GLN A 1 485 ? 28.213  82.354 43.050 0.50 41.56 ? 488  GLN A O   1 
ATOM   3814 C CB  . GLN A 1 485 ? 27.590  84.421 40.919 0.50 42.42 ? 488  GLN A CB  1 
ATOM   3815 C CG  . GLN A 1 485 ? 27.707  85.032 39.530 0.50 43.52 ? 488  GLN A CG  1 
ATOM   3816 C CD  . GLN A 1 485 ? 28.714  84.308 38.656 0.50 44.09 ? 488  GLN A CD  1 
ATOM   3817 O OE1 . GLN A 1 485 ? 29.902  84.249 38.974 0.50 44.60 ? 488  GLN A OE1 1 
ATOM   3818 N NE2 . GLN A 1 485 ? 28.241  83.750 37.547 0.50 44.26 ? 488  GLN A NE2 1 
ATOM   3819 N N   . GLU A 1 486 ? 26.002  82.034 42.775 0.50 41.41 ? 489  GLU A N   1 
ATOM   3820 C CA  . GLU A 1 486 ? 25.777  81.516 44.120 0.50 41.30 ? 489  GLU A CA  1 
ATOM   3821 C C   . GLU A 1 486 ? 26.481  80.173 44.286 0.50 40.95 ? 489  GLU A C   1 
ATOM   3822 O O   . GLU A 1 486 ? 26.838  79.528 43.302 0.50 40.21 ? 489  GLU A O   1 
ATOM   3823 C CB  . GLU A 1 486 ? 24.278  81.327 44.359 0.50 41.81 ? 489  GLU A CB  1 
ATOM   3824 C CG  . GLU A 1 486 ? 23.438  82.553 44.055 0.50 42.96 ? 489  GLU A CG  1 
ATOM   3825 C CD  . GLU A 1 486 ? 23.516  83.599 45.145 0.50 44.01 ? 489  GLU A CD  1 
ATOM   3826 O OE1 . GLU A 1 486 ? 22.918  83.377 46.221 0.50 44.47 ? 489  GLU A OE1 1 
ATOM   3827 O OE2 . GLU A 1 486 ? 24.178  84.637 44.931 0.50 44.49 ? 489  GLU A OE2 1 
ATOM   3828 N N   . SER A 1 487 ? 26.678  79.757 45.534 1.00 41.50 ? 490  SER A N   1 
ATOM   3829 C CA  . SER A 1 487 ? 27.321  78.475 45.824 1.00 41.71 ? 490  SER A CA  1 
ATOM   3830 C C   . SER A 1 487 ? 26.409  77.364 45.310 1.00 40.81 ? 490  SER A C   1 
ATOM   3831 O O   . SER A 1 487 ? 25.183  77.461 45.408 1.00 40.32 ? 490  SER A O   1 
ATOM   3832 C CB  . SER A 1 487 ? 27.527  78.302 47.332 1.00 42.29 ? 490  SER A CB  1 
ATOM   3833 O OG  . SER A 1 487 ? 28.172  79.431 47.893 1.00 44.15 ? 490  SER A OG  1 
ATOM   3834 N N   . LYS A 1 488 ? 27.005  76.307 44.769 1.00 39.95 ? 491  LYS A N   1 
ATOM   3835 C CA  . LYS A 1 488 ? 26.223  75.206 44.228 1.00 39.20 ? 491  LYS A CA  1 
ATOM   3836 C C   . LYS A 1 488 ? 25.927  74.068 45.195 1.00 38.64 ? 491  LYS A C   1 
ATOM   3837 O O   . LYS A 1 488 ? 26.805  73.602 45.926 1.00 38.97 ? 491  LYS A O   1 
ATOM   3838 C CB  . LYS A 1 488 ? 26.909  74.632 42.989 1.00 39.70 ? 491  LYS A CB  1 
ATOM   3839 C CG  . LYS A 1 488 ? 26.938  75.578 41.801 1.00 40.52 ? 491  LYS A CG  1 
ATOM   3840 N N   . TRP A 1 489 ? 24.668  73.640 45.185 1.00 36.82 ? 492  TRP A N   1 
ATOM   3841 C CA  . TRP A 1 489 ? 24.199  72.527 45.994 1.00 34.41 ? 492  TRP A CA  1 
ATOM   3842 C C   . TRP A 1 489 ? 24.593  71.338 45.136 1.00 34.50 ? 492  TRP A C   1 
ATOM   3843 O O   . TRP A 1 489 ? 23.970  71.076 44.110 1.00 34.80 ? 492  TRP A O   1 
ATOM   3844 C CB  . TRP A 1 489 ? 22.679  72.587 46.116 1.00 32.78 ? 492  TRP A CB  1 
ATOM   3845 C CG  . TRP A 1 489 ? 22.056  71.562 47.020 1.00 30.65 ? 492  TRP A CG  1 
ATOM   3846 C CD1 . TRP A 1 489 ? 22.558  70.332 47.352 1.00 29.97 ? 492  TRP A CD1 1 
ATOM   3847 C CD2 . TRP A 1 489 ? 20.772  71.653 47.646 1.00 29.35 ? 492  TRP A CD2 1 
ATOM   3848 N NE1 . TRP A 1 489 ? 21.661  69.651 48.143 1.00 29.82 ? 492  TRP A NE1 1 
ATOM   3849 C CE2 . TRP A 1 489 ? 20.556  70.439 48.339 1.00 29.62 ? 492  TRP A CE2 1 
ATOM   3850 C CE3 . TRP A 1 489 ? 19.781  72.641 47.686 1.00 29.05 ? 492  TRP A CE3 1 
ATOM   3851 C CZ2 . TRP A 1 489 ? 19.386  70.188 49.066 1.00 29.04 ? 492  TRP A CZ2 1 
ATOM   3852 C CZ3 . TRP A 1 489 ? 18.614  72.390 48.410 1.00 29.01 ? 492  TRP A CZ3 1 
ATOM   3853 C CH2 . TRP A 1 489 ? 18.429  71.172 49.089 1.00 29.05 ? 492  TRP A CH2 1 
ATOM   3854 N N   . PRO A 1 490 ? 25.641  70.608 45.530 1.00 34.56 ? 493  PRO A N   1 
ATOM   3855 C CA  . PRO A 1 490 ? 26.050  69.460 44.720 1.00 34.77 ? 493  PRO A CA  1 
ATOM   3856 C C   . PRO A 1 490 ? 25.031  68.330 44.692 1.00 35.31 ? 493  PRO A C   1 
ATOM   3857 O O   . PRO A 1 490 ? 24.273  68.119 45.640 1.00 35.26 ? 493  PRO A O   1 
ATOM   3858 C CB  . PRO A 1 490 ? 27.361  69.033 45.369 1.00 34.49 ? 493  PRO A CB  1 
ATOM   3859 C CG  . PRO A 1 490 ? 27.105  69.326 46.810 1.00 34.67 ? 493  PRO A CG  1 
ATOM   3860 C CD  . PRO A 1 490 ? 26.458  70.703 46.750 1.00 34.46 ? 493  PRO A CD  1 
ATOM   3861 N N   . LEU A 1 491 ? 25.029  67.611 43.582 1.00 35.51 ? 494  LEU A N   1 
ATOM   3862 C CA  . LEU A 1 491 ? 24.148  66.481 43.387 1.00 35.42 ? 494  LEU A CA  1 
ATOM   3863 C C   . LEU A 1 491 ? 24.619  65.369 44.328 1.00 35.77 ? 494  LEU A C   1 
ATOM   3864 O O   . LEU A 1 491 ? 25.815  65.233 44.590 1.00 35.28 ? 494  LEU A O   1 
ATOM   3865 C CB  . LEU A 1 491 ? 24.251  66.030 41.929 1.00 35.79 ? 494  LEU A CB  1 
ATOM   3866 C CG  . LEU A 1 491 ? 23.295  65.023 41.292 1.00 36.88 ? 494  LEU A CG  1 
ATOM   3867 C CD1 . LEU A 1 491 ? 21.866  65.543 41.293 1.00 36.14 ? 494  LEU A CD1 1 
ATOM   3868 C CD2 . LEU A 1 491 ? 23.759  64.784 39.858 1.00 37.72 ? 494  LEU A CD2 1 
ATOM   3869 N N   . PHE A 1 492 ? 23.675  64.596 44.858 1.00 35.72 ? 495  PHE A N   1 
ATOM   3870 C CA  . PHE A 1 492 ? 24.009  63.484 45.732 1.00 35.43 ? 495  PHE A CA  1 
ATOM   3871 C C   . PHE A 1 492 ? 24.208  62.284 44.814 1.00 36.26 ? 495  PHE A C   1 
ATOM   3872 O O   . PHE A 1 492 ? 23.287  61.875 44.107 1.00 36.45 ? 495  PHE A O   1 
ATOM   3873 C CB  . PHE A 1 492 ? 22.869  63.217 46.730 1.00 34.36 ? 495  PHE A CB  1 
ATOM   3874 C CG  . PHE A 1 492 ? 23.030  61.938 47.521 1.00 33.64 ? 495  PHE A CG  1 
ATOM   3875 C CD1 . PHE A 1 492 ? 22.773  60.699 46.936 1.00 32.80 ? 495  PHE A CD1 1 
ATOM   3876 C CD2 . PHE A 1 492 ? 23.448  61.973 48.849 1.00 33.59 ? 495  PHE A CD2 1 
ATOM   3877 C CE1 . PHE A 1 492 ? 22.928  59.512 47.657 1.00 32.62 ? 495  PHE A CE1 1 
ATOM   3878 C CE2 . PHE A 1 492 ? 23.607  60.792 49.581 1.00 33.66 ? 495  PHE A CE2 1 
ATOM   3879 C CZ  . PHE A 1 492 ? 23.345  59.557 48.982 1.00 33.14 ? 495  PHE A CZ  1 
ATOM   3880 N N   . THR A 1 493 ? 25.415  61.733 44.811 1.00 37.43 ? 496  THR A N   1 
ATOM   3881 C CA  . THR A 1 493 ? 25.714  60.580 43.969 1.00 38.38 ? 496  THR A CA  1 
ATOM   3882 C C   . THR A 1 493 ? 25.963  59.358 44.840 1.00 39.00 ? 496  THR A C   1 
ATOM   3883 O O   . THR A 1 493 ? 26.396  59.474 45.985 1.00 38.57 ? 496  THR A O   1 
ATOM   3884 C CB  . THR A 1 493 ? 26.962  60.822 43.104 1.00 38.45 ? 496  THR A CB  1 
ATOM   3885 O OG1 . THR A 1 493 ? 28.098  61.018 43.955 1.00 39.29 ? 496  THR A OG1 1 
ATOM   3886 C CG2 . THR A 1 493 ? 26.770  62.049 42.223 1.00 37.64 ? 496  THR A CG2 1 
ATOM   3887 N N   . THR A 1 494 ? 25.687  58.185 44.287 1.00 40.43 ? 497  THR A N   1 
ATOM   3888 C CA  . THR A 1 494 ? 25.872  56.939 45.015 1.00 41.33 ? 497  THR A CA  1 
ATOM   3889 C C   . THR A 1 494 ? 27.295  56.773 45.547 1.00 41.43 ? 497  THR A C   1 
ATOM   3890 O O   . THR A 1 494 ? 27.505  56.170 46.603 1.00 41.52 ? 497  THR A O   1 
ATOM   3891 C CB  . THR A 1 494 ? 25.518  55.740 44.121 1.00 41.86 ? 497  THR A CB  1 
ATOM   3892 O OG1 . THR A 1 494 ? 26.186  54.568 44.604 1.00 43.34 ? 497  THR A OG1 1 
ATOM   3893 C CG2 . THR A 1 494 ? 25.931  56.011 42.696 1.00 43.15 ? 497  THR A CG2 1 
ATOM   3894 N N   . LYS A 1 495 ? 28.264  57.332 44.828 1.00 41.27 ? 498  LYS A N   1 
ATOM   3895 C CA  . LYS A 1 495 ? 29.667  57.232 45.218 1.00 40.68 ? 498  LYS A CA  1 
ATOM   3896 C C   . LYS A 1 495 ? 30.143  58.245 46.260 1.00 40.59 ? 498  LYS A C   1 
ATOM   3897 O O   . LYS A 1 495 ? 30.728  57.863 47.278 1.00 41.05 ? 498  LYS A O   1 
ATOM   3898 C CB  . LYS A 1 495 ? 30.559  57.339 43.978 1.00 40.64 ? 498  LYS A CB  1 
ATOM   3899 N N   . GLU A 1 496 ? 29.902  59.531 46.011 1.00 39.66 ? 499  GLU A N   1 
ATOM   3900 C CA  . GLU A 1 496 ? 30.359  60.571 46.930 1.00 38.84 ? 499  GLU A CA  1 
ATOM   3901 C C   . GLU A 1 496 ? 29.372  60.978 48.035 1.00 38.22 ? 499  GLU A C   1 
ATOM   3902 O O   . GLU A 1 496 ? 29.771  61.572 49.040 1.00 37.62 ? 499  GLU A O   1 
ATOM   3903 C CB  . GLU A 1 496 ? 30.811  61.795 46.124 1.00 39.27 ? 499  GLU A CB  1 
ATOM   3904 C CG  . GLU A 1 496 ? 32.002  61.494 45.200 1.00 40.63 ? 499  GLU A CG  1 
ATOM   3905 C CD  . GLU A 1 496 ? 32.541  62.729 44.495 1.00 40.70 ? 499  GLU A CD  1 
ATOM   3906 N N   . GLN A 1 497 ? 28.094  60.663 47.847 1.00 37.14 ? 500  GLN A N   1 
ATOM   3907 C CA  . GLN A 1 497 ? 27.058  60.952 48.844 1.00 36.65 ? 500  GLN A CA  1 
ATOM   3908 C C   . GLN A 1 497 ? 27.082  62.346 49.479 1.00 35.43 ? 500  GLN A C   1 
ATOM   3909 O O   . GLN A 1 497 ? 26.924  62.484 50.689 1.00 34.84 ? 500  GLN A O   1 
ATOM   3910 C CB  . GLN A 1 497 ? 27.121  59.886 49.943 1.00 36.59 ? 500  GLN A CB  1 
ATOM   3911 C CG  . GLN A 1 497 ? 26.748  58.499 49.434 1.00 38.57 ? 500  GLN A CG  1 
ATOM   3912 C CD  . GLN A 1 497 ? 27.291  57.376 50.294 1.00 39.02 ? 500  GLN A CD  1 
ATOM   3913 O OE1 . GLN A 1 497 ? 27.011  57.298 51.487 1.00 39.05 ? 500  GLN A OE1 1 
ATOM   3914 N NE2 . GLN A 1 497 ? 28.073  56.491 49.682 1.00 40.09 ? 500  GLN A NE2 1 
ATOM   3915 N N   . LYS A 1 498 ? 27.249  63.375 48.658 1.00 34.49 ? 501  LYS A N   1 
ATOM   3916 C CA  . LYS A 1 498 ? 27.298  64.746 49.154 1.00 34.79 ? 501  LYS A CA  1 
ATOM   3917 C C   . LYS A 1 498 ? 25.947  65.331 49.564 1.00 33.84 ? 501  LYS A C   1 
ATOM   3918 O O   . LYS A 1 498 ? 24.892  64.934 49.064 1.00 33.67 ? 501  LYS A O   1 
ATOM   3919 C CB  . LYS A 1 498 ? 27.925  65.668 48.101 1.00 35.63 ? 501  LYS A CB  1 
ATOM   3920 C CG  . LYS A 1 498 ? 29.397  65.407 47.831 1.00 37.96 ? 501  LYS A CG  1 
ATOM   3921 C CD  . LYS A 1 498 ? 29.925  66.298 46.709 1.00 38.78 ? 501  LYS A CD  1 
ATOM   3922 C CE  . LYS A 1 498 ? 31.373  65.968 46.380 1.00 39.92 ? 501  LYS A CE  1 
ATOM   3923 N NZ  . LYS A 1 498 ? 31.852  66.697 45.170 1.00 41.37 ? 501  LYS A NZ  1 
ATOM   3924 N N   . PHE A 1 499 ? 25.999  66.285 50.483 1.00 32.64 ? 502  PHE A N   1 
ATOM   3925 C CA  . PHE A 1 499 ? 24.805  66.970 50.948 1.00 32.25 ? 502  PHE A CA  1 
ATOM   3926 C C   . PHE A 1 499 ? 25.237  68.307 51.524 1.00 32.55 ? 502  PHE A C   1 
ATOM   3927 O O   . PHE A 1 499 ? 26.424  68.528 51.764 1.00 33.10 ? 502  PHE A O   1 
ATOM   3928 C CB  . PHE A 1 499 ? 24.061  66.123 51.991 1.00 31.07 ? 502  PHE A CB  1 
ATOM   3929 C CG  . PHE A 1 499 ? 24.715  66.077 53.346 1.00 29.13 ? 502  PHE A CG  1 
ATOM   3930 C CD1 . PHE A 1 499 ? 24.405  67.028 54.316 1.00 28.30 ? 502  PHE A CD1 1 
ATOM   3931 C CD2 . PHE A 1 499 ? 25.599  65.051 53.673 1.00 28.86 ? 502  PHE A CD2 1 
ATOM   3932 C CE1 . PHE A 1 499 ? 24.962  66.955 55.595 1.00 27.84 ? 502  PHE A CE1 1 
ATOM   3933 C CE2 . PHE A 1 499 ? 26.160  64.969 54.950 1.00 28.18 ? 502  PHE A CE2 1 
ATOM   3934 C CZ  . PHE A 1 499 ? 25.839  65.922 55.911 1.00 27.45 ? 502  PHE A CZ  1 
ATOM   3935 N N   . ILE A 1 500 ? 24.285  69.207 51.726 1.00 32.93 ? 503  ILE A N   1 
ATOM   3936 C CA  . ILE A 1 500 ? 24.606  70.517 52.270 1.00 33.15 ? 503  ILE A CA  1 
ATOM   3937 C C   . ILE A 1 500 ? 23.828  70.793 53.546 1.00 33.43 ? 503  ILE A C   1 
ATOM   3938 O O   . ILE A 1 500 ? 22.843  70.120 53.843 1.00 32.36 ? 503  ILE A O   1 
ATOM   3939 C CB  . ILE A 1 500 ? 24.267  71.646 51.269 1.00 33.32 ? 503  ILE A CB  1 
ATOM   3940 C CG1 . ILE A 1 500 ? 22.754  71.708 51.041 1.00 34.32 ? 503  ILE A CG1 1 
ATOM   3941 C CG2 . ILE A 1 500 ? 24.963  71.395 49.948 1.00 34.12 ? 503  ILE A CG2 1 
ATOM   3942 C CD1 . ILE A 1 500 ? 22.284  72.977 50.339 1.00 34.54 ? 503  ILE A CD1 1 
ATOM   3943 N N   . ASP A 1 501 ? 24.295  71.773 54.310 1.00 34.47 ? 504  ASP A N   1 
ATOM   3944 C CA  . ASP A 1 501 ? 23.597  72.177 55.520 1.00 35.56 ? 504  ASP A CA  1 
ATOM   3945 C C   . ASP A 1 501 ? 22.677  73.293 55.042 1.00 35.37 ? 504  ASP A C   1 
ATOM   3946 O O   . ASP A 1 501 ? 22.886  73.867 53.971 1.00 34.80 ? 504  ASP A O   1 
ATOM   3947 C CB  . ASP A 1 501 ? 24.553  72.738 56.582 1.00 36.93 ? 504  ASP A CB  1 
ATOM   3948 C CG  . ASP A 1 501 ? 25.502  71.691 57.135 1.00 39.27 ? 504  ASP A CG  1 
ATOM   3949 O OD1 . ASP A 1 501 ? 25.113  70.505 57.196 1.00 40.04 ? 504  ASP A OD1 1 
ATOM   3950 O OD2 . ASP A 1 501 ? 26.635  72.060 57.526 1.00 39.69 ? 504  ASP A OD2 1 
ATOM   3951 N N   . LEU A 1 502 ? 21.658  73.593 55.832 1.00 35.22 ? 505  LEU A N   1 
ATOM   3952 C CA  . LEU A 1 502 ? 20.718  74.642 55.488 1.00 34.64 ? 505  LEU A CA  1 
ATOM   3953 C C   . LEU A 1 502 ? 20.612  75.530 56.714 1.00 35.04 ? 505  LEU A C   1 
ATOM   3954 O O   . LEU A 1 502 ? 19.929  75.193 57.680 1.00 35.06 ? 505  LEU A O   1 
ATOM   3955 C CB  . LEU A 1 502 ? 19.362  74.021 55.147 1.00 34.33 ? 505  LEU A CB  1 
ATOM   3956 C CG  . LEU A 1 502 ? 18.761  74.255 53.757 1.00 34.43 ? 505  LEU A CG  1 
ATOM   3957 C CD1 . LEU A 1 502 ? 19.835  74.180 52.683 1.00 34.05 ? 505  LEU A CD1 1 
ATOM   3958 C CD2 . LEU A 1 502 ? 17.664  73.221 53.513 1.00 32.59 ? 505  LEU A CD2 1 
ATOM   3959 N N   . ASN A 1 503 ? 21.310  76.657 56.684 1.00 35.49 ? 506  ASN A N   1 
ATOM   3960 C CA  . ASN A 1 503 ? 21.293  77.584 57.806 1.00 36.41 ? 506  ASN A CA  1 
ATOM   3961 C C   . ASN A 1 503 ? 21.729  78.970 57.350 1.00 37.38 ? 506  ASN A C   1 
ATOM   3962 O O   . ASN A 1 503 ? 21.900  79.206 56.159 1.00 37.61 ? 506  ASN A O   1 
ATOM   3963 C CB  . ASN A 1 503 ? 22.214  77.075 58.920 1.00 35.78 ? 506  ASN A CB  1 
ATOM   3964 C CG  . ASN A 1 503 ? 23.642  76.883 58.450 1.00 35.86 ? 506  ASN A CG  1 
ATOM   3965 O OD1 . ASN A 1 503 ? 24.241  77.794 57.878 1.00 36.22 ? 506  ASN A OD1 1 
ATOM   3966 N ND2 . ASN A 1 503 ? 24.199  75.698 58.692 1.00 33.75 ? 506  ASN A ND2 1 
ATOM   3967 N N   . THR A 1 504 ? 21.911  79.887 58.293 1.00 38.85 ? 507  THR A N   1 
ATOM   3968 C CA  . THR A 1 504 ? 22.309  81.249 57.950 1.00 40.27 ? 507  THR A CA  1 
ATOM   3969 C C   . THR A 1 504 ? 23.803  81.423 57.670 1.00 41.32 ? 507  THR A C   1 
ATOM   3970 O O   . THR A 1 504 ? 24.239  82.499 57.265 1.00 42.10 ? 507  THR A O   1 
ATOM   3971 C CB  . THR A 1 504 ? 21.898  82.232 59.058 1.00 40.03 ? 507  THR A CB  1 
ATOM   3972 O OG1 . THR A 1 504 ? 22.590  81.908 60.270 1.00 41.05 ? 507  THR A OG1 1 
ATOM   3973 C CG2 . THR A 1 504 ? 20.400  82.153 59.301 1.00 39.54 ? 507  THR A CG2 1 
ATOM   3974 N N   . GLU A 1 505 ? 24.587  80.371 57.881 1.00 42.26 ? 508  GLU A N   1 
ATOM   3975 C CA  . GLU A 1 505 ? 26.026  80.435 57.636 1.00 43.22 ? 508  GLU A CA  1 
ATOM   3976 C C   . GLU A 1 505 ? 26.314  80.098 56.176 1.00 43.99 ? 508  GLU A C   1 
ATOM   3977 O O   . GLU A 1 505 ? 25.446  79.593 55.469 1.00 44.36 ? 508  GLU A O   1 
ATOM   3978 C CB  . GLU A 1 505 ? 26.770  79.452 58.555 1.00 43.09 ? 508  GLU A CB  1 
ATOM   3979 C CG  . GLU A 1 505 ? 26.724  79.814 60.040 1.00 42.77 ? 508  GLU A CG  1 
ATOM   3980 N N   . PRO A 1 506 ? 27.536  80.391 55.698 1.00 44.84 ? 509  PRO A N   1 
ATOM   3981 C CA  . PRO A 1 506 ? 27.889  80.094 54.304 1.00 44.97 ? 509  PRO A CA  1 
ATOM   3982 C C   . PRO A 1 506 ? 27.734  78.601 54.023 1.00 44.98 ? 509  PRO A C   1 
ATOM   3983 O O   . PRO A 1 506 ? 28.086  77.770 54.858 1.00 45.21 ? 509  PRO A O   1 
ATOM   3984 C CB  . PRO A 1 506 ? 29.343  80.549 54.214 1.00 44.99 ? 509  PRO A CB  1 
ATOM   3985 C CG  . PRO A 1 506 ? 29.394  81.688 55.194 1.00 45.38 ? 509  PRO A CG  1 
ATOM   3986 C CD  . PRO A 1 506 ? 28.620  81.132 56.367 1.00 45.20 ? 509  PRO A CD  1 
ATOM   3987 N N   . MET A 1 507 ? 27.217  78.264 52.847 1.00 45.45 ? 510  MET A N   1 
ATOM   3988 C CA  . MET A 1 507 ? 27.009  76.864 52.486 1.00 45.69 ? 510  MET A CA  1 
ATOM   3989 C C   . MET A 1 507 ? 28.238  76.001 52.728 1.00 44.96 ? 510  MET A C   1 
ATOM   3990 O O   . MET A 1 507 ? 29.365  76.421 52.481 1.00 45.60 ? 510  MET A O   1 
ATOM   3991 C CB  . MET A 1 507 ? 26.604  76.738 51.014 1.00 46.76 ? 510  MET A CB  1 
ATOM   3992 C CG  . MET A 1 507 ? 26.310  75.301 50.576 1.00 47.27 ? 510  MET A CG  1 
ATOM   3993 S SD  . MET A 1 507 ? 26.014  75.128 48.797 1.00 48.51 ? 510  MET A SD  1 
ATOM   3994 C CE  . MET A 1 507 ? 24.297  75.581 48.696 1.00 48.84 ? 510  MET A CE  1 
ATOM   3995 N N   . LYS A 1 508 ? 28.005  74.791 53.220 1.00 43.76 ? 511  LYS A N   1 
ATOM   3996 C CA  . LYS A 1 508 ? 29.073  73.836 53.473 1.00 42.56 ? 511  LYS A CA  1 
ATOM   3997 C C   . LYS A 1 508 ? 28.615  72.495 52.922 1.00 41.96 ? 511  LYS A C   1 
ATOM   3998 O O   . LYS A 1 508 ? 27.467  72.094 53.126 1.00 42.48 ? 511  LYS A O   1 
ATOM   3999 C CB  . LYS A 1 508 ? 29.349  73.703 54.972 1.00 42.55 ? 511  LYS A CB  1 
ATOM   4000 C CG  . LYS A 1 508 ? 29.871  74.969 55.624 1.00 43.66 ? 511  LYS A CG  1 
ATOM   4001 N N   . VAL A 1 509 ? 29.508  71.811 52.219 1.00 40.39 ? 512  VAL A N   1 
ATOM   4002 C CA  . VAL A 1 509 ? 29.197  70.513 51.644 1.00 39.36 ? 512  VAL A CA  1 
ATOM   4003 C C   . VAL A 1 509 ? 29.780  69.427 52.534 1.00 39.39 ? 512  VAL A C   1 
ATOM   4004 O O   . VAL A 1 509 ? 30.917  69.538 52.991 1.00 39.84 ? 512  VAL A O   1 
ATOM   4005 C CB  . VAL A 1 509 ? 29.791  70.383 50.223 1.00 39.18 ? 512  VAL A CB  1 
ATOM   4006 C CG1 . VAL A 1 509 ? 29.559  68.975 49.679 1.00 38.39 ? 512  VAL A CG1 1 
ATOM   4007 C CG2 . VAL A 1 509 ? 29.159  71.420 49.304 1.00 38.31 ? 512  VAL A CG2 1 
ATOM   4008 N N   . HIS A 1 510 ? 28.998  68.380 52.781 1.00 38.94 ? 513  HIS A N   1 
ATOM   4009 C CA  . HIS A 1 510 ? 29.439  67.270 53.620 1.00 38.29 ? 513  HIS A CA  1 
ATOM   4010 C C   . HIS A 1 510 ? 29.195  65.961 52.891 1.00 37.77 ? 513  HIS A C   1 
ATOM   4011 O O   . HIS A 1 510 ? 28.638  65.949 51.799 1.00 37.47 ? 513  HIS A O   1 
ATOM   4012 C CB  . HIS A 1 510 ? 28.659  67.248 54.934 1.00 38.54 ? 513  HIS A CB  1 
ATOM   4013 C CG  . HIS A 1 510 ? 28.718  68.530 55.697 1.00 38.14 ? 513  HIS A CG  1 
ATOM   4014 N ND1 . HIS A 1 510 ? 29.862  68.967 56.329 1.00 38.76 ? 513  HIS A ND1 1 
ATOM   4015 C CD2 . HIS A 1 510 ? 27.776  69.476 55.923 1.00 38.84 ? 513  HIS A CD2 1 
ATOM   4016 C CE1 . HIS A 1 510 ? 29.622  70.128 56.913 1.00 38.56 ? 513  HIS A CE1 1 
ATOM   4017 N NE2 . HIS A 1 510 ? 28.364  70.459 56.681 1.00 39.13 ? 513  HIS A NE2 1 
ATOM   4018 N N   . GLN A 1 511 ? 29.594  64.858 53.514 1.00 37.90 ? 514  GLN A N   1 
ATOM   4019 C CA  . GLN A 1 511 ? 29.412  63.544 52.920 1.00 37.83 ? 514  GLN A CA  1 
ATOM   4020 C C   . GLN A 1 511 ? 28.975  62.514 53.946 1.00 37.54 ? 514  GLN A C   1 
ATOM   4021 O O   . GLN A 1 511 ? 29.307  62.620 55.125 1.00 37.27 ? 514  GLN A O   1 
ATOM   4022 C CB  . GLN A 1 511 ? 30.710  63.077 52.259 1.00 38.79 ? 514  GLN A CB  1 
ATOM   4023 C CG  . GLN A 1 511 ? 31.002  63.754 50.931 1.00 41.00 ? 514  GLN A CG  1 
ATOM   4024 C CD  . GLN A 1 511 ? 32.382  63.415 50.390 1.00 42.06 ? 514  GLN A CD  1 
ATOM   4025 O OE1 . GLN A 1 511 ? 33.395  63.858 50.932 1.00 43.38 ? 514  GLN A OE1 1 
ATOM   4026 N NE2 . GLN A 1 511 ? 32.427  62.624 49.322 1.00 41.44 ? 514  GLN A NE2 1 
ATOM   4027 N N   . ARG A 1 512 ? 28.223  61.523 53.476 1.00 37.09 ? 515  ARG A N   1 
ATOM   4028 C CA  . ARG A 1 512 ? 27.734  60.432 54.308 1.00 36.85 ? 515  ARG A CA  1 
ATOM   4029 C C   . ARG A 1 512 ? 27.038  60.866 55.595 1.00 35.93 ? 515  ARG A C   1 
ATOM   4030 O O   . ARG A 1 512 ? 27.498  60.566 56.697 1.00 35.54 ? 515  ARG A O   1 
ATOM   4031 C CB  . ARG A 1 512 ? 28.891  59.487 54.627 1.00 36.92 ? 515  ARG A CB  1 
ATOM   4032 C CG  . ARG A 1 512 ? 29.492  58.851 53.384 1.00 37.96 ? 515  ARG A CG  1 
ATOM   4033 C CD  . ARG A 1 512 ? 30.566  57.842 53.732 1.00 38.52 ? 515  ARG A CD  1 
ATOM   4034 N NE  . ARG A 1 512 ? 31.124  57.213 52.539 1.00 39.92 ? 515  ARG A NE  1 
ATOM   4035 N N   . LEU A 1 513 ? 25.915  61.558 55.438 1.00 35.24 ? 516  LEU A N   1 
ATOM   4036 C CA  . LEU A 1 513 ? 25.124  62.048 56.565 1.00 34.17 ? 516  LEU A CA  1 
ATOM   4037 C C   . LEU A 1 513 ? 24.845  60.948 57.589 1.00 33.84 ? 516  LEU A C   1 
ATOM   4038 O O   . LEU A 1 513 ? 24.198  59.948 57.280 1.00 32.74 ? 516  LEU A O   1 
ATOM   4039 C CB  . LEU A 1 513 ? 23.808  62.640 56.043 1.00 33.81 ? 516  LEU A CB  1 
ATOM   4040 C CG  . LEU A 1 513 ? 22.733  63.138 57.013 1.00 33.45 ? 516  LEU A CG  1 
ATOM   4041 C CD1 . LEU A 1 513 ? 23.322  64.119 58.009 1.00 34.26 ? 516  LEU A CD1 1 
ATOM   4042 C CD2 . LEU A 1 513 ? 21.624  63.792 56.212 1.00 32.56 ? 516  LEU A CD2 1 
ATOM   4043 N N   . ARG A 1 514 ? 25.353  61.152 58.804 1.00 34.20 ? 517  ARG A N   1 
ATOM   4044 C CA  . ARG A 1 514 ? 25.194  60.221 59.922 1.00 34.12 ? 517  ARG A CA  1 
ATOM   4045 C C   . ARG A 1 514 ? 25.386  58.762 59.544 1.00 33.03 ? 517  ARG A C   1 
ATOM   4046 O O   . ARG A 1 514 ? 24.661  57.881 60.010 1.00 32.64 ? 517  ARG A O   1 
ATOM   4047 C CB  . ARG A 1 514 ? 23.823  60.421 60.579 1.00 35.63 ? 517  ARG A CB  1 
ATOM   4048 C CG  . ARG A 1 514 ? 23.672  61.811 61.193 1.00 39.09 ? 517  ARG A CG  1 
ATOM   4049 C CD  . ARG A 1 514 ? 22.456  61.913 62.083 1.00 40.39 ? 517  ARG A CD  1 
ATOM   4050 N NE  . ARG A 1 514 ? 22.618  61.156 63.319 1.00 42.08 ? 517  ARG A NE  1 
ATOM   4051 C CZ  . ARG A 1 514 ? 23.451  61.490 64.300 1.00 43.23 ? 517  ARG A CZ  1 
ATOM   4052 N NH1 . ARG A 1 514 ? 24.205  62.577 64.186 1.00 43.21 ? 517  ARG A NH1 1 
ATOM   4053 N NH2 . ARG A 1 514 ? 23.522  60.744 65.402 1.00 42.71 ? 517  ARG A NH2 1 
ATOM   4054 N N   . VAL A 1 515 ? 26.392  58.509 58.718 1.00 31.99 ? 518  VAL A N   1 
ATOM   4055 C CA  . VAL A 1 515 ? 26.668  57.162 58.248 1.00 31.89 ? 518  VAL A CA  1 
ATOM   4056 C C   . VAL A 1 515 ? 26.994  56.171 59.367 1.00 32.52 ? 518  VAL A C   1 
ATOM   4057 O O   . VAL A 1 515 ? 26.558  55.023 59.332 1.00 32.66 ? 518  VAL A O   1 
ATOM   4058 C CB  . VAL A 1 515 ? 27.812  57.183 57.204 1.00 31.15 ? 518  VAL A CB  1 
ATOM   4059 C CG1 . VAL A 1 515 ? 29.099  57.687 57.841 1.00 29.92 ? 518  VAL A CG1 1 
ATOM   4060 C CG2 . VAL A 1 515 ? 27.993  55.804 56.607 1.00 30.44 ? 518  VAL A CG2 1 
ATOM   4061 N N   . GLN A 1 516 ? 27.744  56.617 60.368 1.00 33.39 ? 519  GLN A N   1 
ATOM   4062 C CA  . GLN A 1 516 ? 28.124  55.745 61.476 1.00 34.25 ? 519  GLN A CA  1 
ATOM   4063 C C   . GLN A 1 516 ? 26.901  55.142 62.174 1.00 33.60 ? 519  GLN A C   1 
ATOM   4064 O O   . GLN A 1 516 ? 26.802  53.928 62.325 1.00 33.73 ? 519  GLN A O   1 
ATOM   4065 C CB  . GLN A 1 516 ? 28.972  56.527 62.486 1.00 36.02 ? 519  GLN A CB  1 
ATOM   4066 C CG  . GLN A 1 516 ? 29.826  55.663 63.416 1.00 37.15 ? 519  GLN A CG  1 
ATOM   4067 C CD  . GLN A 1 516 ? 30.919  54.901 62.674 1.00 38.46 ? 519  GLN A CD  1 
ATOM   4068 O OE1 . GLN A 1 516 ? 31.571  55.441 61.776 1.00 38.53 ? 519  GLN A OE1 1 
ATOM   4069 N NE2 . GLN A 1 516 ? 31.133  53.645 63.057 1.00 38.75 ? 519  GLN A NE2 1 
ATOM   4070 N N   . MET A 1 517 ? 25.970  55.990 62.596 1.00 32.72 ? 520  MET A N   1 
ATOM   4071 C CA  . MET A 1 517 ? 24.769  55.512 63.274 1.00 32.29 ? 520  MET A CA  1 
ATOM   4072 C C   . MET A 1 517 ? 23.793  54.783 62.343 1.00 31.39 ? 520  MET A C   1 
ATOM   4073 O O   . MET A 1 517 ? 23.142  53.823 62.750 1.00 31.06 ? 520  MET A O   1 
ATOM   4074 C CB  . MET A 1 517 ? 24.045  56.677 63.964 1.00 33.07 ? 520  MET A CB  1 
ATOM   4075 C CG  . MET A 1 517 ? 24.864  57.355 65.051 1.00 35.17 ? 520  MET A CG  1 
ATOM   4076 S SD  . MET A 1 517 ? 25.467  56.172 66.284 1.00 38.06 ? 520  MET A SD  1 
ATOM   4077 C CE  . MET A 1 517 ? 25.752  57.255 67.700 1.00 39.04 ? 520  MET A CE  1 
ATOM   4078 N N   . CYS A 1 518 ? 23.696  55.224 61.094 1.00 29.65 ? 521  CYS A N   1 
ATOM   4079 C CA  . CYS A 1 518 ? 22.770  54.585 60.174 1.00 29.02 ? 521  CYS A CA  1 
ATOM   4080 C C   . CYS A 1 518 ? 23.202  53.192 59.725 1.00 29.29 ? 521  CYS A C   1 
ATOM   4081 O O   . CYS A 1 518 ? 22.365  52.388 59.310 1.00 29.27 ? 521  CYS A O   1 
ATOM   4082 C CB  . CYS A 1 518 ? 22.492  55.509 58.988 1.00 28.42 ? 521  CYS A CB  1 
ATOM   4083 S SG  . CYS A 1 518 ? 21.521  56.970 59.498 1.00 28.00 ? 521  CYS A SG  1 
ATOM   4084 N N   . VAL A 1 519 ? 24.495  52.888 59.810 1.00 29.21 ? 522  VAL A N   1 
ATOM   4085 C CA  . VAL A 1 519 ? 24.941  51.544 59.462 1.00 29.52 ? 522  VAL A CA  1 
ATOM   4086 C C   . VAL A 1 519 ? 24.411  50.642 60.581 1.00 29.47 ? 522  VAL A C   1 
ATOM   4087 O O   . VAL A 1 519 ? 24.077  49.478 60.360 1.00 29.75 ? 522  VAL A O   1 
ATOM   4088 C CB  . VAL A 1 519 ? 26.486  51.424 59.405 1.00 30.21 ? 522  VAL A CB  1 
ATOM   4089 C CG1 . VAL A 1 519 ? 26.890  49.945 59.326 1.00 29.97 ? 522  VAL A CG1 1 
ATOM   4090 C CG2 . VAL A 1 519 ? 27.020  52.158 58.187 1.00 30.10 ? 522  VAL A CG2 1 
ATOM   4091 N N   . PHE A 1 520 ? 24.331  51.197 61.787 1.00 28.68 ? 523  PHE A N   1 
ATOM   4092 C CA  . PHE A 1 520 ? 23.823  50.458 62.936 1.00 28.65 ? 523  PHE A CA  1 
ATOM   4093 C C   . PHE A 1 520 ? 22.326  50.179 62.792 1.00 28.32 ? 523  PHE A C   1 
ATOM   4094 O O   . PHE A 1 520 ? 21.880  49.041 62.941 1.00 28.12 ? 523  PHE A O   1 
ATOM   4095 C CB  . PHE A 1 520 ? 24.051  51.247 64.227 1.00 27.95 ? 523  PHE A CB  1 
ATOM   4096 C CG  . PHE A 1 520 ? 23.320  50.682 65.415 1.00 29.03 ? 523  PHE A CG  1 
ATOM   4097 C CD1 . PHE A 1 520 ? 23.817  49.571 66.093 1.00 29.12 ? 523  PHE A CD1 1 
ATOM   4098 C CD2 . PHE A 1 520 ? 22.115  51.245 65.838 1.00 28.64 ? 523  PHE A CD2 1 
ATOM   4099 C CE1 . PHE A 1 520 ? 23.127  49.025 67.177 1.00 29.05 ? 523  PHE A CE1 1 
ATOM   4100 C CE2 . PHE A 1 520 ? 21.417  50.709 66.917 1.00 29.38 ? 523  PHE A CE2 1 
ATOM   4101 C CZ  . PHE A 1 520 ? 21.927  49.592 67.590 1.00 29.66 ? 523  PHE A CZ  1 
ATOM   4102 N N   . TRP A 1 521 ? 21.556  51.226 62.510 1.00 27.61 ? 524  TRP A N   1 
ATOM   4103 C CA  . TRP A 1 521 ? 20.109  51.096 62.364 1.00 28.30 ? 524  TRP A CA  1 
ATOM   4104 C C   . TRP A 1 521 ? 19.641  50.404 61.091 1.00 29.01 ? 524  TRP A C   1 
ATOM   4105 O O   . TRP A 1 521 ? 18.595  49.761 61.092 1.00 29.80 ? 524  TRP A O   1 
ATOM   4106 C CB  . TRP A 1 521 ? 19.432  52.470 62.428 1.00 27.01 ? 524  TRP A CB  1 
ATOM   4107 C CG  . TRP A 1 521 ? 19.524  53.141 63.759 1.00 26.68 ? 524  TRP A CG  1 
ATOM   4108 C CD1 . TRP A 1 521 ? 20.309  54.208 64.086 1.00 25.87 ? 524  TRP A CD1 1 
ATOM   4109 C CD2 . TRP A 1 521 ? 18.793  52.799 64.943 1.00 26.11 ? 524  TRP A CD2 1 
ATOM   4110 N NE1 . TRP A 1 521 ? 20.111  54.555 65.401 1.00 26.35 ? 524  TRP A NE1 1 
ATOM   4111 C CE2 . TRP A 1 521 ? 19.186  53.706 65.951 1.00 26.00 ? 524  TRP A CE2 1 
ATOM   4112 C CE3 . TRP A 1 521 ? 17.841  51.815 65.249 1.00 25.94 ? 524  TRP A CE3 1 
ATOM   4113 C CZ2 . TRP A 1 521 ? 18.660  53.660 67.249 1.00 25.83 ? 524  TRP A CZ2 1 
ATOM   4114 C CZ3 . TRP A 1 521 ? 17.317  51.770 66.541 1.00 25.55 ? 524  TRP A CZ3 1 
ATOM   4115 C CH2 . TRP A 1 521 ? 17.730  52.688 67.523 1.00 25.53 ? 524  TRP A CH2 1 
ATOM   4116 N N   . ASN A 1 522 ? 20.395  50.541 60.004 1.00 29.98 ? 525  ASN A N   1 
ATOM   4117 C CA  . ASN A 1 522 ? 19.989  49.937 58.740 1.00 30.73 ? 525  ASN A CA  1 
ATOM   4118 C C   . ASN A 1 522 ? 20.596  48.581 58.429 1.00 31.26 ? 525  ASN A C   1 
ATOM   4119 O O   . ASN A 1 522 ? 20.014  47.795 57.680 1.00 31.37 ? 525  ASN A O   1 
ATOM   4120 C CB  . ASN A 1 522 ? 20.278  50.890 57.574 1.00 30.85 ? 525  ASN A CB  1 
ATOM   4121 C CG  . ASN A 1 522 ? 19.464  52.165 57.652 1.00 30.86 ? 525  ASN A CG  1 
ATOM   4122 O OD1 . ASN A 1 522 ? 18.345  52.159 58.153 1.00 31.11 ? 525  ASN A OD1 1 
ATOM   4123 N ND2 . ASN A 1 522 ? 20.017  53.262 57.146 1.00 30.12 ? 525  ASN A ND2 1 
ATOM   4124 N N   . GLN A 1 523 ? 21.760  48.294 58.998 1.00 31.82 ? 526  GLN A N   1 
ATOM   4125 C CA  . GLN A 1 523 ? 22.401  47.019 58.724 1.00 31.57 ? 526  GLN A CA  1 
ATOM   4126 C C   . GLN A 1 523 ? 22.539  46.091 59.922 1.00 31.32 ? 526  GLN A C   1 
ATOM   4127 O O   . GLN A 1 523 ? 22.022  44.976 59.902 1.00 32.55 ? 526  GLN A O   1 
ATOM   4128 C CB  . GLN A 1 523 ? 23.767  47.263 58.087 1.00 31.85 ? 526  GLN A CB  1 
ATOM   4129 C CG  . GLN A 1 523 ? 23.689  48.082 56.803 1.00 33.41 ? 526  GLN A CG  1 
ATOM   4130 C CD  . GLN A 1 523 ? 25.058  48.380 56.203 1.00 34.66 ? 526  GLN A CD  1 
ATOM   4131 N N   . PHE A 1 524 ? 23.210  46.541 60.976 1.00 30.76 ? 527  PHE A N   1 
ATOM   4132 C CA  . PHE A 1 524 ? 23.415  45.677 62.134 1.00 30.10 ? 527  PHE A CA  1 
ATOM   4133 C C   . PHE A 1 524 ? 22.198  45.286 62.975 1.00 29.76 ? 527  PHE A C   1 
ATOM   4134 O O   . PHE A 1 524 ? 21.903  44.097 63.127 1.00 30.44 ? 527  PHE A O   1 
ATOM   4135 C CB  . PHE A 1 524 ? 24.470  46.276 63.068 1.00 29.33 ? 527  PHE A CB  1 
ATOM   4136 C CG  . PHE A 1 524 ? 24.812  45.386 64.229 1.00 28.47 ? 527  PHE A CG  1 
ATOM   4137 C CD1 . PHE A 1 524 ? 25.528  44.205 64.027 1.00 28.39 ? 527  PHE A CD1 1 
ATOM   4138 C CD2 . PHE A 1 524 ? 24.395  45.708 65.516 1.00 28.60 ? 527  PHE A CD2 1 
ATOM   4139 C CE1 . PHE A 1 524 ? 25.825  43.358 65.086 1.00 27.25 ? 527  PHE A CE1 1 
ATOM   4140 C CE2 . PHE A 1 524 ? 24.684  44.865 66.590 1.00 28.68 ? 527  PHE A CE2 1 
ATOM   4141 C CZ  . PHE A 1 524 ? 25.403  43.686 66.371 1.00 28.95 ? 527  PHE A CZ  1 
ATOM   4142 N N   . LEU A 1 525 ? 21.504  46.271 63.537 1.00 29.11 ? 528  LEU A N   1 
ATOM   4143 C CA  . LEU A 1 525 ? 20.360  45.989 64.396 1.00 29.62 ? 528  LEU A CA  1 
ATOM   4144 C C   . LEU A 1 525 ? 19.317  45.039 63.806 1.00 30.45 ? 528  LEU A C   1 
ATOM   4145 O O   . LEU A 1 525 ? 18.887  44.096 64.474 1.00 30.12 ? 528  LEU A O   1 
ATOM   4146 C CB  . LEU A 1 525 ? 19.684  47.292 64.827 1.00 29.17 ? 528  LEU A CB  1 
ATOM   4147 C CG  . LEU A 1 525 ? 18.579  47.115 65.874 1.00 29.55 ? 528  LEU A CG  1 
ATOM   4148 C CD1 . LEU A 1 525 ? 19.151  46.431 67.116 1.00 28.63 ? 528  LEU A CD1 1 
ATOM   4149 C CD2 . LEU A 1 525 ? 17.993  48.471 66.235 1.00 29.74 ? 528  LEU A CD2 1 
ATOM   4150 N N   . PRO A 1 526 ? 18.882  45.282 62.556 1.00 31.69 ? 529  PRO A N   1 
ATOM   4151 C CA  . PRO A 1 526 ? 17.884  44.405 61.935 1.00 33.14 ? 529  PRO A CA  1 
ATOM   4152 C C   . PRO A 1 526 ? 18.406  42.973 61.871 1.00 34.95 ? 529  PRO A C   1 
ATOM   4153 O O   . PRO A 1 526 ? 17.670  42.014 62.120 1.00 35.71 ? 529  PRO A O   1 
ATOM   4154 C CB  . PRO A 1 526 ? 17.706  45.011 60.545 1.00 32.38 ? 529  PRO A CB  1 
ATOM   4155 C CG  . PRO A 1 526 ? 17.998  46.466 60.772 1.00 32.92 ? 529  PRO A CG  1 
ATOM   4156 C CD  . PRO A 1 526 ? 19.207  46.414 61.669 1.00 31.69 ? 529  PRO A CD  1 
ATOM   4157 N N   . LYS A 1 527 ? 19.686  42.844 61.538 1.00 36.49 ? 530  LYS A N   1 
ATOM   4158 C CA  . LYS A 1 527 ? 20.334  41.542 61.441 1.00 37.65 ? 530  LYS A CA  1 
ATOM   4159 C C   . LYS A 1 527 ? 20.386  40.886 62.823 1.00 37.88 ? 530  LYS A C   1 
ATOM   4160 O O   . LYS A 1 527 ? 20.207  39.677 62.953 1.00 37.95 ? 530  LYS A O   1 
ATOM   4161 C CB  . LYS A 1 527 ? 21.741  41.716 60.867 1.00 39.05 ? 530  LYS A CB  1 
ATOM   4162 C CG  . LYS A 1 527 ? 22.428  40.431 60.460 1.00 41.81 ? 530  LYS A CG  1 
ATOM   4163 C CD  . LYS A 1 527 ? 23.703  40.721 59.674 1.00 44.00 ? 530  LYS A CD  1 
ATOM   4164 C CE  . LYS A 1 527 ? 24.413  39.427 59.262 1.00 46.03 ? 530  LYS A CE  1 
ATOM   4165 N NZ  . LYS A 1 527 ? 25.554  39.670 58.320 1.00 46.18 ? 530  LYS A NZ  1 
ATOM   4166 N N   . LEU A 1 528 ? 20.618  41.691 63.855 1.00 37.87 ? 531  LEU A N   1 
ATOM   4167 C CA  . LEU A 1 528 ? 20.673  41.181 65.221 1.00 38.03 ? 531  LEU A CA  1 
ATOM   4168 C C   . LEU A 1 528 ? 19.282  40.740 65.686 1.00 39.18 ? 531  LEU A C   1 
ATOM   4169 O O   . LEU A 1 528 ? 19.121  39.654 66.253 1.00 38.67 ? 531  LEU A O   1 
ATOM   4170 C CB  . LEU A 1 528 ? 21.233  42.261 66.162 1.00 36.94 ? 531  LEU A CB  1 
ATOM   4171 C CG  . LEU A 1 528 ? 21.324  41.987 67.673 1.00 36.11 ? 531  LEU A CG  1 
ATOM   4172 C CD1 . LEU A 1 528 ? 22.267  42.998 68.327 1.00 34.39 ? 531  LEU A CD1 1 
ATOM   4173 C CD2 . LEU A 1 528 ? 19.938  42.064 68.309 1.00 35.35 ? 531  LEU A CD2 1 
ATOM   4174 N N   . LEU A 1 529 ? 18.282  41.586 65.449 1.00 40.17 ? 532  LEU A N   1 
ATOM   4175 C CA  . LEU A 1 529 ? 16.912  41.276 65.851 1.00 41.30 ? 532  LEU A CA  1 
ATOM   4176 C C   . LEU A 1 529 ? 16.372  40.041 65.149 1.00 42.47 ? 532  LEU A C   1 
ATOM   4177 O O   . LEU A 1 529 ? 15.593  39.284 65.729 1.00 42.66 ? 532  LEU A O   1 
ATOM   4178 C CB  . LEU A 1 529 ? 15.986  42.463 65.571 1.00 40.56 ? 532  LEU A CB  1 
ATOM   4179 C CG  . LEU A 1 529 ? 16.185  43.688 66.466 1.00 40.25 ? 532  LEU A CG  1 
ATOM   4180 C CD1 . LEU A 1 529 ? 15.276  44.828 66.013 1.00 39.43 ? 532  LEU A CD1 1 
ATOM   4181 C CD2 . LEU A 1 529 ? 15.900  43.299 67.905 1.00 39.52 ? 532  LEU A CD2 1 
ATOM   4182 N N   . ASN A 1 530 ? 16.786  39.836 63.903 1.00 43.79 ? 533  ASN A N   1 
ATOM   4183 C CA  . ASN A 1 530 ? 16.328  38.685 63.135 1.00 45.47 ? 533  ASN A CA  1 
ATOM   4184 C C   . ASN A 1 530 ? 17.027  37.392 63.554 1.00 46.30 ? 533  ASN A C   1 
ATOM   4185 O O   . ASN A 1 530 ? 16.429  36.319 63.512 1.00 46.19 ? 533  ASN A O   1 
ATOM   4186 C CB  . ASN A 1 530 ? 16.543  38.927 61.639 1.00 46.19 ? 533  ASN A CB  1 
ATOM   4187 C CG  . ASN A 1 530 ? 16.104  37.748 60.788 1.00 47.73 ? 533  ASN A CG  1 
ATOM   4188 O OD1 . ASN A 1 530 ? 16.779  36.719 60.733 1.00 48.91 ? 533  ASN A OD1 1 
ATOM   4189 N ND2 . ASN A 1 530 ? 14.961  37.890 60.128 1.00 48.82 ? 533  ASN A ND2 1 
ATOM   4190 N N   . ALA A 1 531 ? 18.291  37.497 63.955 1.00 47.10 ? 534  ALA A N   1 
ATOM   4191 C CA  . ALA A 1 531 ? 19.058  36.329 64.373 1.00 47.95 ? 534  ALA A CA  1 
ATOM   4192 C C   . ALA A 1 531 ? 18.655  35.885 65.773 1.00 48.82 ? 534  ALA A C   1 
ATOM   4193 O O   . ALA A 1 531 ? 19.143  34.877 66.279 1.00 49.39 ? 534  ALA A O   1 
ATOM   4194 C CB  . ALA A 1 531 ? 20.544  36.639 64.334 1.00 47.76 ? 534  ALA A CB  1 
ATOM   4195 N N   . THR A 1 532 ? 17.763  36.645 66.397 1.00 50.01 ? 535  THR A N   1 
ATOM   4196 C CA  . THR A 1 532 ? 17.290  36.324 67.737 1.00 50.71 ? 535  THR A CA  1 
ATOM   4197 C C   . THR A 1 532 ? 15.777  36.498 67.808 1.00 51.00 ? 535  THR A C   1 
ATOM   4198 O O   . THR A 1 532 ? 15.268  36.526 68.949 1.00 52.19 ? 535  THR A O   1 
ATOM   4199 C CB  . THR A 1 532 ? 17.949  37.235 68.802 1.00 50.96 ? 535  THR A CB  1 
ATOM   4200 O OG1 . THR A 1 532 ? 17.650  38.607 68.517 1.00 51.02 ? 535  THR A OG1 1 
ATOM   4201 C CG2 . THR A 1 532 ? 19.461  37.045 68.810 1.00 51.28 ? 535  THR A CG2 1 
HETATM 4202 C C1  . NAG B 2 .   ? -19.389 83.318 49.054 1.00 57.16 ? 9010 NAG A C1  1 
HETATM 4203 C C2  . NAG B 2 .   ? -18.502 83.335 50.320 1.00 59.22 ? 9010 NAG A C2  1 
HETATM 4204 C C3  . NAG B 2 .   ? -17.977 84.752 50.585 1.00 60.96 ? 9010 NAG A C3  1 
HETATM 4205 C C4  . NAG B 2 .   ? -19.132 85.735 50.797 1.00 61.28 ? 9010 NAG A C4  1 
HETATM 4206 C C5  . NAG B 2 .   ? -20.331 85.366 49.912 1.00 61.24 ? 9010 NAG A C5  1 
HETATM 4207 C C6  . NAG B 2 .   ? -21.064 86.600 49.421 1.00 62.06 ? 9010 NAG A C6  1 
HETATM 4208 C C7  . NAG B 2 .   ? -18.838 83.035 52.718 1.00 60.98 ? 9010 NAG A C7  1 
HETATM 4209 C C8  . NAG B 2 .   ? -19.691 82.442 53.834 1.00 60.74 ? 9010 NAG A C8  1 
HETATM 4210 N N2  . NAG B 2 .   ? -19.249 82.829 51.464 1.00 60.60 ? 9010 NAG A N2  1 
HETATM 4211 O O3  . NAG B 2 .   ? -17.191 85.181 49.481 1.00 62.54 ? 9010 NAG A O3  1 
HETATM 4212 O O4  . NAG B 2 .   ? -19.522 85.738 52.164 1.00 62.01 ? 9010 NAG A O4  1 
HETATM 4213 O O5  . NAG B 2 .   ? -19.886 84.637 48.742 1.00 59.07 ? 9010 NAG A O5  1 
HETATM 4214 O O6  . NAG B 2 .   ? -20.165 87.680 49.209 1.00 63.84 ? 9010 NAG A O6  1 
HETATM 4215 O O7  . NAG B 2 .   ? -17.830 83.681 53.003 1.00 61.23 ? 9010 NAG A O7  1 
HETATM 4216 C C1  . NAG C 2 .   ? 18.857  62.179 33.695 1.00 42.75 ? 9020 NAG A C1  1 
HETATM 4217 C C2  . NAG C 2 .   ? 20.388  62.045 33.748 1.00 44.21 ? 9020 NAG A C2  1 
HETATM 4218 C C3  . NAG C 2 .   ? 21.041  62.613 32.485 1.00 45.23 ? 9020 NAG A C3  1 
HETATM 4219 C C4  . NAG C 2 .   ? 20.404  61.992 31.243 1.00 45.97 ? 9020 NAG A C4  1 
HETATM 4220 C C5  . NAG C 2 .   ? 18.898  62.240 31.289 1.00 45.72 ? 9020 NAG A C5  1 
HETATM 4221 C C6  . NAG C 2 .   ? 18.176  61.678 30.071 1.00 46.02 ? 9020 NAG A C6  1 
HETATM 4222 C C7  . NAG C 2 .   ? 21.228  62.050 36.006 1.00 43.84 ? 9020 NAG A C7  1 
HETATM 4223 C C8  . NAG C 2 .   ? 21.766  62.842 37.185 1.00 43.61 ? 9020 NAG A C8  1 
HETATM 4224 N N2  . NAG C 2 .   ? 20.910  62.736 34.913 1.00 44.22 ? 9020 NAG A N2  1 
HETATM 4225 O O3  . NAG C 2 .   ? 22.434  62.333 32.506 1.00 45.83 ? 9020 NAG A O3  1 
HETATM 4226 O O4  . NAG C 2 .   ? 20.959  62.569 30.069 1.00 46.89 ? 9020 NAG A O4  1 
HETATM 4227 O O5  . NAG C 2 .   ? 18.340  61.618 32.472 1.00 44.11 ? 9020 NAG A O5  1 
HETATM 4228 O O6  . NAG C 2 .   ? 17.513  60.455 30.361 1.00 47.32 ? 9020 NAG A O6  1 
HETATM 4229 O O7  . NAG C 2 .   ? 21.099  60.826 36.091 1.00 43.80 ? 9020 NAG A O7  1 
HETATM 4230 S S1  . PE7 D 3 .   ? 3.372   67.864 61.391 1.00 41.27 ? 999  PE7 A S1  1 
HETATM 4231 C C2  . PE7 D 3 .   ? 4.919   67.791 62.367 1.00 44.14 ? 999  PE7 A C2  1 
HETATM 4232 C C3  . PE7 D 3 .   ? 4.955   68.552 63.656 1.00 44.73 ? 999  PE7 A C3  1 
HETATM 4233 O O4  . PE7 D 3 .   ? 4.422   67.767 64.725 1.00 46.42 ? 999  PE7 A O4  1 
HETATM 4234 C C5  . PE7 D 3 .   ? 4.058   68.558 65.863 1.00 46.98 ? 999  PE7 A C5  1 
HETATM 4235 C C6  . PE7 D 3 .   ? 3.069   67.844 66.742 1.00 46.66 ? 999  PE7 A C6  1 
HETATM 4236 O O7  . PE7 D 3 .   ? 3.643   66.646 67.260 1.00 48.83 ? 999  PE7 A O7  1 
HETATM 4237 C C8  . PE7 D 3 .   ? 3.281   66.372 68.620 1.00 47.62 ? 999  PE7 A C8  1 
HETATM 4238 C C9  . PE7 D 3 .   ? 3.988   65.136 69.093 1.00 46.60 ? 999  PE7 A C9  1 
HETATM 4239 O O10 . PE7 D 3 .   ? 3.098   64.313 69.839 1.00 47.51 ? 999  PE7 A O10 1 
HETATM 4240 C C11 . PE7 D 3 .   ? 3.323   62.915 69.657 1.00 47.19 ? 999  PE7 A C11 1 
HETATM 4241 C C12 . PE7 D 3 .   ? 2.029   62.162 69.743 1.00 47.53 ? 999  PE7 A C12 1 
HETATM 4242 O O13 . PE7 D 3 .   ? 1.578   62.113 71.092 1.00 48.93 ? 999  PE7 A O13 1 
HETATM 4243 C C14 . PE7 D 3 .   ? 0.264   61.575 71.234 1.00 48.58 ? 999  PE7 A C14 1 
HETATM 4244 C C15 . PE7 D 3 .   ? 0.051   61.151 72.652 1.00 49.56 ? 999  PE7 A C15 1 
HETATM 4245 O O16 . PE7 D 3 .   ? -1.189  60.455 72.800 1.00 50.18 ? 999  PE7 A O16 1 
HETATM 4246 C C17 . PE7 D 3 .   ? -1.022  59.147 73.360 1.00 50.91 ? 999  PE7 A C17 1 
HETATM 4247 C C18 . PE7 D 3 .   ? -1.832  58.974 74.620 1.00 51.23 ? 999  PE7 A C18 1 
HETATM 4248 O O19 . PE7 D 3 .   ? -3.126  59.554 74.480 1.00 51.71 ? 999  PE7 A O19 1 
HETATM 4249 C C20 . PE7 D 3 .   ? -4.181  58.597 74.578 1.00 52.87 ? 999  PE7 A C20 1 
HETATM 4250 C C21 . PE7 D 3 .   ? -5.388  59.199 75.227 1.00 52.91 ? 999  PE7 A C21 1 
HETATM 4251 O O22 . PE7 D 3 .   ? -5.910  60.265 74.439 1.00 53.58 ? 999  PE7 A O22 1 
HETATM 4252 O O   . HOH E 4 .   ? 7.101   52.147 56.382 1.00 16.83 ? 1001 HOH A O   1 
HETATM 4253 O O   . HOH E 4 .   ? -1.769  57.259 62.329 1.00 18.25 ? 1002 HOH A O   1 
HETATM 4254 O O   . HOH E 4 .   ? -6.477  48.877 60.978 1.00 23.16 ? 1003 HOH A O   1 
HETATM 4255 O O   . HOH E 4 .   ? 3.726   68.597 57.650 1.00 21.28 ? 1004 HOH A O   1 
HETATM 4256 O O   . HOH E 4 .   ? -0.653  62.963 58.812 1.00 19.91 ? 1005 HOH A O   1 
HETATM 4257 O O   . HOH E 4 .   ? -5.591  44.704 57.239 1.00 28.53 ? 1006 HOH A O   1 
HETATM 4258 O O   . HOH E 4 .   ? -1.649  69.332 52.468 1.00 22.10 ? 1007 HOH A O   1 
HETATM 4259 O O   . HOH E 4 .   ? -14.907 59.488 56.908 1.00 24.27 ? 1008 HOH A O   1 
HETATM 4260 O O   . HOH E 4 .   ? -7.342  67.572 57.639 1.00 20.95 ? 1009 HOH A O   1 
HETATM 4261 O O   . HOH E 4 .   ? 3.354   81.218 32.244 1.00 38.46 ? 1010 HOH A O   1 
HETATM 4262 O O   . HOH E 4 .   ? 2.901   53.690 63.444 1.00 19.39 ? 1011 HOH A O   1 
HETATM 4263 O O   . HOH E 4 .   ? -0.061  76.953 62.011 1.00 27.14 ? 1012 HOH A O   1 
HETATM 4264 O O   . HOH E 4 .   ? 3.610   66.762 36.406 1.00 21.44 ? 1013 HOH A O   1 
HETATM 4265 O O   . HOH E 4 .   ? -15.409 66.102 51.575 1.00 26.24 ? 1014 HOH A O   1 
HETATM 4266 O O   . HOH E 4 .   ? -13.548 61.866 56.643 1.00 26.56 ? 1015 HOH A O   1 
HETATM 4267 O O   . HOH E 4 .   ? -4.421  51.702 56.088 1.00 23.10 ? 1016 HOH A O   1 
HETATM 4268 O O   . HOH E 4 .   ? -1.000  66.072 39.865 1.00 30.69 ? 1017 HOH A O   1 
HETATM 4269 O O   . HOH E 4 .   ? -0.466  69.248 62.189 1.00 28.25 ? 1018 HOH A O   1 
HETATM 4270 O O   . HOH E 4 .   ? -10.672 65.359 68.652 1.00 29.30 ? 1019 HOH A O   1 
HETATM 4271 O O   . HOH E 4 .   ? 0.315   69.946 68.480 1.00 22.75 ? 1020 HOH A O   1 
HETATM 4272 O O   . HOH E 4 .   ? 10.492  68.378 59.736 1.00 20.35 ? 1021 HOH A O   1 
HETATM 4273 O O   . HOH E 4 .   ? -4.513  85.144 39.464 1.00 32.08 ? 1022 HOH A O   1 
HETATM 4274 O O   . HOH E 4 .   ? -15.420 67.114 49.211 1.00 19.66 ? 1023 HOH A O   1 
HETATM 4275 O O   . HOH E 4 .   ? -12.348 62.677 59.168 1.00 25.95 ? 1024 HOH A O   1 
HETATM 4276 O O   . HOH E 4 .   ? -3.692  50.711 59.377 1.00 27.20 ? 1025 HOH A O   1 
HETATM 4277 O O   . HOH E 4 .   ? -0.101  69.010 59.607 1.00 21.30 ? 1026 HOH A O   1 
HETATM 4278 O O   . HOH E 4 .   ? 3.448   51.207 64.317 1.00 25.35 ? 1027 HOH A O   1 
HETATM 4279 O O   . HOH E 4 .   ? 7.423   71.824 82.233 1.00 30.21 ? 1028 HOH A O   1 
HETATM 4280 O O   . HOH E 4 .   ? -6.529  83.473 38.726 1.00 32.25 ? 1029 HOH A O   1 
HETATM 4281 O O   . HOH E 4 .   ? -2.034  75.189 52.681 1.00 30.10 ? 1030 HOH A O   1 
HETATM 4282 O O   . HOH E 4 .   ? 21.419  52.001 53.915 1.00 37.66 ? 1031 HOH A O   1 
HETATM 4283 O O   . HOH E 4 .   ? -18.043 68.210 48.918 1.00 29.56 ? 1032 HOH A O   1 
HETATM 4284 O O   . HOH E 4 .   ? 18.197  60.097 41.708 1.00 26.55 ? 1033 HOH A O   1 
HETATM 4285 O O   . HOH E 4 .   ? 17.839  50.523 44.890 1.00 34.05 ? 1034 HOH A O   1 
HETATM 4286 O O   . HOH E 4 .   ? 15.443  52.638 61.604 1.00 31.49 ? 1035 HOH A O   1 
HETATM 4287 O O   . HOH E 4 .   ? -15.678 59.930 48.884 1.00 30.45 ? 1036 HOH A O   1 
HETATM 4288 O O   . HOH E 4 .   ? -4.281  69.720 62.322 1.00 24.52 ? 1037 HOH A O   1 
HETATM 4289 O O   . HOH E 4 .   ? -13.518 57.519 56.345 1.00 25.16 ? 1038 HOH A O   1 
HETATM 4290 O O   . HOH E 4 .   ? 22.906  54.459 54.888 1.00 34.47 ? 1039 HOH A O   1 
HETATM 4291 O O   . HOH E 4 .   ? 3.884   80.432 51.391 1.00 25.89 ? 1040 HOH A O   1 
HETATM 4292 O O   . HOH E 4 .   ? -2.572  77.474 62.283 1.00 28.60 ? 1041 HOH A O   1 
HETATM 4293 O O   . HOH E 4 .   ? -4.698  70.382 33.815 1.00 28.57 ? 1042 HOH A O   1 
HETATM 4294 O O   . HOH E 4 .   ? 7.311   46.402 53.496 1.00 25.94 ? 1043 HOH A O   1 
HETATM 4295 O O   . HOH E 4 .   ? -3.647  49.726 61.829 1.00 31.80 ? 1044 HOH A O   1 
HETATM 4296 O O   . HOH E 4 .   ? 3.499   50.272 69.417 1.00 27.89 ? 1045 HOH A O   1 
HETATM 4297 O O   . HOH E 4 .   ? -8.272  71.050 52.505 1.00 27.48 ? 1046 HOH A O   1 
HETATM 4298 O O   . HOH E 4 .   ? -6.876  61.067 65.155 1.00 20.55 ? 1047 HOH A O   1 
HETATM 4299 O O   . HOH E 4 .   ? 11.317  64.499 35.494 1.00 34.51 ? 1048 HOH A O   1 
HETATM 4300 O O   . HOH E 4 .   ? 23.068  66.982 47.896 1.00 29.58 ? 1049 HOH A O   1 
HETATM 4301 O O   . HOH E 4 .   ? -18.172 64.941 61.067 1.00 30.23 ? 1050 HOH A O   1 
HETATM 4302 O O   . HOH E 4 .   ? -7.496  69.937 56.223 1.00 21.03 ? 1051 HOH A O   1 
HETATM 4303 O O   . HOH E 4 .   ? -8.971  60.530 63.391 1.00 21.75 ? 1052 HOH A O   1 
HETATM 4304 O O   . HOH E 4 .   ? 18.656  85.050 50.297 1.00 30.96 ? 1053 HOH A O   1 
HETATM 4305 O O   . HOH E 4 .   ? 7.412   70.270 39.050 1.00 25.34 ? 1054 HOH A O   1 
HETATM 4306 O O   . HOH E 4 .   ? -21.730 45.611 66.792 1.00 36.63 ? 1055 HOH A O   1 
HETATM 4307 O O   . HOH E 4 .   ? -12.064 66.861 37.100 1.00 28.52 ? 1056 HOH A O   1 
HETATM 4308 O O   . HOH E 4 .   ? 3.797   55.579 70.255 1.00 38.44 ? 1057 HOH A O   1 
HETATM 4309 O O   . HOH E 4 .   ? 9.031   88.221 48.125 1.00 41.42 ? 1058 HOH A O   1 
HETATM 4310 O O   . HOH E 4 .   ? -9.909  51.592 54.601 1.00 31.45 ? 1059 HOH A O   1 
HETATM 4311 O O   . HOH E 4 .   ? -9.083  58.014 64.373 1.00 24.16 ? 1060 HOH A O   1 
HETATM 4312 O O   . HOH E 4 .   ? -20.333 74.946 37.285 1.00 33.98 ? 1061 HOH A O   1 
HETATM 4313 O O   . HOH E 4 .   ? -1.074  68.248 66.880 1.00 37.90 ? 1062 HOH A O   1 
HETATM 4314 O O   . HOH E 4 .   ? -18.720 60.002 41.854 1.00 36.37 ? 1063 HOH A O   1 
HETATM 4315 O O   . HOH E 4 .   ? 10.480  55.343 68.495 1.00 23.71 ? 1064 HOH A O   1 
HETATM 4316 O O   . HOH E 4 .   ? 7.517   63.438 78.912 1.00 24.29 ? 1065 HOH A O   1 
HETATM 4317 O O   . HOH E 4 .   ? -3.294  46.132 71.905 1.00 43.84 ? 1066 HOH A O   1 
HETATM 4318 O O   . HOH E 4 .   ? -7.849  57.546 44.388 1.00 32.05 ? 1067 HOH A O   1 
HETATM 4319 O O   . HOH E 4 .   ? 15.904  52.556 58.947 1.00 31.41 ? 1068 HOH A O   1 
HETATM 4320 O O   . HOH E 4 .   ? 11.647  67.113 67.253 1.00 28.26 ? 1069 HOH A O   1 
HETATM 4321 O O   . HOH E 4 .   ? -9.689  61.913 59.601 1.00 24.03 ? 1070 HOH A O   1 
HETATM 4322 O O   . HOH E 4 .   ? -6.870  56.194 73.580 1.00 38.09 ? 1071 HOH A O   1 
HETATM 4323 O O   . HOH E 4 .   ? 7.421   75.471 60.923 1.00 24.22 ? 1072 HOH A O   1 
HETATM 4324 O O   . HOH E 4 .   ? -7.143  50.245 49.431 1.00 35.77 ? 1073 HOH A O   1 
HETATM 4325 O O   . HOH E 4 .   ? 6.382   62.302 35.138 1.00 33.81 ? 1074 HOH A O   1 
HETATM 4326 O O   . HOH E 4 .   ? 0.276   56.349 37.996 1.00 31.52 ? 1075 HOH A O   1 
HETATM 4327 O O   . HOH E 4 .   ? 1.484   43.136 54.643 1.00 25.09 ? 1076 HOH A O   1 
HETATM 4328 O O   . HOH E 4 .   ? 12.743  83.253 47.448 1.00 29.42 ? 1077 HOH A O   1 
HETATM 4329 O O   . HOH E 4 .   ? -7.870  58.953 41.889 1.00 25.95 ? 1078 HOH A O   1 
HETATM 4330 O O   . HOH E 4 .   ? -9.717  55.607 44.719 1.00 40.95 ? 1079 HOH A O   1 
HETATM 4331 O O   . HOH E 4 .   ? 4.157   64.436 35.187 1.00 25.23 ? 1080 HOH A O   1 
HETATM 4332 O O   . HOH E 4 .   ? 25.055  58.672 52.364 1.00 29.05 ? 1081 HOH A O   1 
HETATM 4333 O O   . HOH E 4 .   ? 8.444   49.658 37.000 1.00 40.54 ? 1082 HOH A O   1 
HETATM 4334 O O   . HOH E 4 .   ? -0.161  67.324 64.177 1.00 26.88 ? 1083 HOH A O   1 
HETATM 4335 O O   . HOH E 4 .   ? -14.053 41.161 63.009 1.00 41.64 ? 1084 HOH A O   1 
HETATM 4336 O O   . HOH E 4 .   ? 19.291  84.743 62.735 1.00 36.15 ? 1085 HOH A O   1 
HETATM 4337 O O   . HOH E 4 .   ? 24.678  66.135 84.883 1.00 41.93 ? 1086 HOH A O   1 
HETATM 4338 O O   . HOH E 4 .   ? -1.066  50.707 42.370 1.00 35.91 ? 1087 HOH A O   1 
HETATM 4339 O O   . HOH E 4 .   ? -10.026 64.883 38.174 1.00 29.38 ? 1088 HOH A O   1 
HETATM 4340 O O   . HOH E 4 .   ? -2.365  57.058 66.523 1.00 31.15 ? 1089 HOH A O   1 
HETATM 4341 O O   . HOH E 4 .   ? -3.668  75.698 64.383 1.00 28.59 ? 1090 HOH A O   1 
HETATM 4342 O O   . HOH E 4 .   ? -0.479  65.722 68.072 1.00 35.71 ? 1091 HOH A O   1 
HETATM 4343 O O   . HOH E 4 .   ? -4.268  56.033 38.991 1.00 43.90 ? 1092 HOH A O   1 
HETATM 4344 O O   . HOH E 4 .   ? 4.335   55.182 78.211 1.00 29.20 ? 1093 HOH A O   1 
HETATM 4345 O O   . HOH E 4 .   ? 3.520   46.905 65.117 1.00 37.81 ? 1094 HOH A O   1 
HETATM 4346 O O   . HOH E 4 .   ? 25.349  66.310 74.408 1.00 35.86 ? 1095 HOH A O   1 
HETATM 4347 O O   . HOH E 4 .   ? 4.618   46.064 40.233 1.00 43.80 ? 1096 HOH A O   1 
HETATM 4348 O O   . HOH E 4 .   ? 24.760  58.406 41.042 1.00 33.29 ? 1097 HOH A O   1 
HETATM 4349 O O   . HOH E 4 .   ? 8.387   76.474 76.070 1.00 32.08 ? 1098 HOH A O   1 
HETATM 4350 O O   . HOH E 4 .   ? 13.256  86.065 47.045 1.00 36.67 ? 1099 HOH A O   1 
HETATM 4351 O O   . HOH E 4 .   ? 4.911   59.421 69.937 1.00 20.17 ? 1100 HOH A O   1 
HETATM 4352 O O   . HOH E 4 .   ? -4.078  56.848 63.741 1.00 29.05 ? 1101 HOH A O   1 
HETATM 4353 O O   . HOH E 4 .   ? 4.098   77.739 78.404 1.00 37.28 ? 1102 HOH A O   1 
HETATM 4354 O O   . HOH E 4 .   ? -3.731  68.419 78.835 1.00 40.95 ? 1103 HOH A O   1 
HETATM 4355 O O   . HOH E 4 .   ? -6.321  58.270 39.908 1.00 33.29 ? 1104 HOH A O   1 
HETATM 4356 O O   . HOH E 4 .   ? 1.612   63.877 35.312 1.00 26.36 ? 1105 HOH A O   1 
HETATM 4357 O O   . HOH E 4 .   ? 20.694  59.439 40.788 1.00 33.83 ? 1106 HOH A O   1 
HETATM 4358 O O   . HOH E 4 .   ? 3.986   63.393 60.966 1.00 37.49 ? 1107 HOH A O   1 
HETATM 4359 O O   . HOH E 4 .   ? -0.033  63.503 75.116 1.00 39.78 ? 1108 HOH A O   1 
HETATM 4360 O O   . HOH E 4 .   ? 5.568   56.377 35.506 1.00 47.35 ? 1109 HOH A O   1 
HETATM 4361 O O   . HOH E 4 .   ? 3.826   44.149 65.540 1.00 50.71 ? 1110 HOH A O   1 
HETATM 4362 O O   . HOH E 4 .   ? -0.953  65.254 72.736 1.00 33.69 ? 1111 HOH A O   1 
HETATM 4363 O O   . HOH E 4 .   ? -3.175  76.894 31.023 1.00 42.73 ? 1112 HOH A O   1 
HETATM 4364 O O   . HOH E 4 .   ? -14.413 71.037 65.444 1.00 34.58 ? 1113 HOH A O   1 
HETATM 4365 O O   . HOH E 4 .   ? -3.550  66.180 74.350 1.00 51.45 ? 1114 HOH A O   1 
HETATM 4366 O O   . HOH E 4 .   ? 9.639   79.882 65.041 1.00 32.84 ? 1115 HOH A O   1 
HETATM 4367 O O   . HOH E 4 .   ? 7.346   48.808 65.957 1.00 47.22 ? 1116 HOH A O   1 
HETATM 4368 O O   . HOH E 4 .   ? 9.524   56.036 35.939 1.00 34.78 ? 1117 HOH A O   1 
HETATM 4369 O O   . HOH E 4 .   ? 5.578   61.057 72.064 1.00 36.87 ? 1118 HOH A O   1 
HETATM 4370 O O   . HOH E 4 .   ? -8.545  53.092 43.839 1.00 49.24 ? 1119 HOH A O   1 
HETATM 4371 O O   . HOH E 4 .   ? -4.489  60.629 34.241 1.00 36.33 ? 1120 HOH A O   1 
HETATM 4372 O O   . HOH E 4 .   ? 9.462   44.700 43.558 1.00 45.10 ? 1121 HOH A O   1 
HETATM 4373 O O   . HOH E 4 .   ? -5.957  40.497 56.806 1.00 44.08 ? 1122 HOH A O   1 
HETATM 4374 O O   . HOH E 4 .   ? 22.431  79.340 61.696 1.00 43.00 ? 1123 HOH A O   1 
HETATM 4375 O O   . HOH E 4 .   ? -3.264  51.655 43.728 1.00 39.69 ? 1124 HOH A O   1 
HETATM 4376 O O   . HOH E 4 .   ? 16.842  63.672 66.882 1.00 31.45 ? 1125 HOH A O   1 
HETATM 4377 O O   . HOH E 4 .   ? 31.213  69.739 45.998 1.00 48.65 ? 1126 HOH A O   1 
HETATM 4378 O O   . HOH E 4 .   ? -8.584  66.792 72.297 1.00 32.46 ? 1127 HOH A O   1 
HETATM 4379 O O   . HOH E 4 .   ? 27.577  63.303 45.772 1.00 32.04 ? 1128 HOH A O   1 
HETATM 4380 O O   . HOH E 4 .   ? 18.105  74.902 37.416 1.00 32.75 ? 1129 HOH A O   1 
HETATM 4381 O O   . HOH E 4 .   ? 3.466   45.635 61.020 1.00 34.99 ? 1130 HOH A O   1 
HETATM 4382 O O   . HOH E 4 .   ? 14.158  76.142 63.855 1.00 37.04 ? 1131 HOH A O   1 
HETATM 4383 O O   . HOH E 4 .   ? 18.258  67.178 73.063 1.00 38.90 ? 1132 HOH A O   1 
HETATM 4384 O O   . HOH E 4 .   ? 6.117   44.123 53.840 1.00 33.99 ? 1133 HOH A O   1 
HETATM 4385 O O   . HOH E 4 .   ? -15.536 72.610 53.898 1.00 38.00 ? 1134 HOH A O   1 
HETATM 4386 O O   . HOH E 4 .   ? -1.101  74.682 31.271 1.00 43.98 ? 1135 HOH A O   1 
HETATM 4387 O O   . HOH E 4 .   ? 13.437  68.542 57.051 1.00 26.93 ? 1136 HOH A O   1 
HETATM 4388 O O   . HOH E 4 .   ? 9.936   52.511 79.322 1.00 38.66 ? 1137 HOH A O   1 
HETATM 4389 O O   . HOH E 4 .   ? 27.833  65.884 42.715 1.00 31.44 ? 1138 HOH A O   1 
HETATM 4390 O O   . HOH E 4 .   ? 4.326   49.722 66.796 1.00 32.75 ? 1139 HOH A O   1 
HETATM 4391 O O   . HOH E 4 .   ? 18.135  91.372 62.429 1.00 49.71 ? 1140 HOH A O   1 
HETATM 4392 O O   . HOH E 4 .   ? 0.039   82.692 57.771 1.00 45.78 ? 1141 HOH A O   1 
HETATM 4393 O O   . HOH E 4 .   ? -15.437 74.401 50.893 1.00 41.18 ? 1142 HOH A O   1 
HETATM 4394 O O   . HOH E 4 .   ? -20.123 56.489 59.455 1.00 32.24 ? 1143 HOH A O   1 
HETATM 4395 O O   . HOH E 4 .   ? 24.771  58.104 55.446 1.00 43.56 ? 1144 HOH A O   1 
HETATM 4396 O O   . HOH E 4 .   ? 25.295  54.036 53.115 1.00 48.72 ? 1145 HOH A O   1 
HETATM 4397 O O   . HOH E 4 .   ? -11.059 81.998 33.327 1.00 47.25 ? 1146 HOH A O   1 
HETATM 4398 O O   . HOH E 4 .   ? 13.278  84.456 43.507 1.00 42.63 ? 1147 HOH A O   1 
HETATM 4399 O O   . HOH E 4 .   ? 4.782   50.162 62.052 1.00 32.74 ? 1148 HOH A O   1 
HETATM 4400 O O   . HOH E 4 .   ? 8.359   54.215 80.638 1.00 38.90 ? 1149 HOH A O   1 
HETATM 4401 O O   . HOH E 4 .   ? -10.787 46.780 75.637 1.00 46.31 ? 1150 HOH A O   1 
HETATM 4402 O O   . HOH E 4 .   ? 19.708  62.601 65.090 1.00 30.76 ? 1151 HOH A O   1 
HETATM 4403 O O   . HOH E 4 .   ? -0.036  41.250 64.054 1.00 44.75 ? 1152 HOH A O   1 
HETATM 4404 O O   . HOH E 4 .   ? -7.013  48.207 73.737 1.00 36.82 ? 1153 HOH A O   1 
HETATM 4405 O O   . HOH E 4 .   ? 26.403  68.861 59.248 1.00 44.92 ? 1154 HOH A O   1 
HETATM 4406 O O   . HOH E 4 .   ? -10.714 68.213 78.035 1.00 43.64 ? 1155 HOH A O   1 
HETATM 4407 O O   . HOH E 4 .   ? 14.146  50.903 56.206 1.00 35.16 ? 1156 HOH A O   1 
HETATM 4408 O O   . HOH E 4 .   ? 16.614  57.311 35.961 1.00 27.89 ? 1157 HOH A O   1 
HETATM 4409 O O   . HOH E 4 .   ? -20.382 68.599 50.674 1.00 48.65 ? 1158 HOH A O   1 
HETATM 4410 O O   . HOH E 4 .   ? 25.020  61.376 52.523 1.00 25.74 ? 1159 HOH A O   1 
HETATM 4411 O O   . HOH E 4 .   ? -5.751  76.317 66.388 1.00 50.13 ? 1160 HOH A O   1 
HETATM 4412 O O   . HOH E 4 .   ? 23.934  60.967 39.838 1.00 44.31 ? 1161 HOH A O   1 
HETATM 4413 O O   . HOH E 4 .   ? 11.411  77.018 84.159 1.00 49.30 ? 1162 HOH A O   1 
HETATM 4414 O O   . HOH E 4 .   ? -5.117  87.684 34.804 1.00 41.23 ? 1163 HOH A O   1 
HETATM 4415 O O   . HOH E 4 .   ? -6.926  55.112 42.391 1.00 48.61 ? 1164 HOH A O   1 
HETATM 4416 O O   . HOH E 4 .   ? 18.324  79.446 46.338 1.00 35.92 ? 1165 HOH A O   1 
HETATM 4417 O O   . HOH E 4 .   ? -16.202 53.665 47.409 1.00 51.80 ? 1166 HOH A O   1 
HETATM 4418 O O   . HOH E 4 .   ? -6.710  88.281 42.228 1.00 40.99 ? 1167 HOH A O   1 
HETATM 4419 O O   . HOH E 4 .   ? 26.366  48.133 69.088 1.00 49.63 ? 1168 HOH A O   1 
HETATM 4420 O O   . HOH E 4 .   ? -20.142 59.043 58.912 1.00 32.65 ? 1169 HOH A O   1 
HETATM 4421 O O   . HOH E 4 .   ? 14.027  87.031 66.654 1.00 48.32 ? 1170 HOH A O   1 
HETATM 4422 O O   . HOH E 4 .   ? -4.243  82.788 51.720 1.00 37.10 ? 1171 HOH A O   1 
HETATM 4423 O O   . HOH E 4 .   ? 4.168   43.431 55.367 1.00 33.65 ? 1172 HOH A O   1 
HETATM 4424 O O   . HOH E 4 .   ? 19.353  67.630 38.325 1.00 33.33 ? 1173 HOH A O   1 
HETATM 4425 O O   . HOH E 4 .   ? 25.200  66.323 59.875 1.00 45.61 ? 1174 HOH A O   1 
HETATM 4426 O O   . HOH E 4 .   ? 2.026   40.533 62.582 1.00 46.94 ? 1175 HOH A O   1 
HETATM 4427 O O   . HOH E 4 .   ? 22.117  61.699 41.757 1.00 32.67 ? 1176 HOH A O   1 
HETATM 4428 O O   . HOH E 4 .   ? -20.572 77.265 47.149 1.00 36.14 ? 1177 HOH A O   1 
HETATM 4429 O O   . HOH E 4 .   ? 18.950  58.622 35.259 1.00 33.74 ? 1178 HOH A O   1 
HETATM 4430 O O   . HOH E 4 .   ? 21.096  82.272 53.707 1.00 39.36 ? 1179 HOH A O   1 
HETATM 4431 O O   . HOH E 4 .   ? 12.853  65.683 33.450 1.00 43.52 ? 1180 HOH A O   1 
HETATM 4432 O O   . HOH E 4 .   ? -5.836  82.415 53.774 1.00 51.53 ? 1181 HOH A O   1 
HETATM 4433 O O   . HOH E 4 .   ? 5.494   53.117 80.611 1.00 39.91 ? 1182 HOH A O   1 
HETATM 4434 O O   . HOH E 4 .   ? 10.020  88.327 60.307 1.00 41.51 ? 1183 HOH A O   1 
HETATM 4435 O O   . HOH E 4 .   ? -8.760  64.652 70.780 1.00 37.54 ? 1184 HOH A O   1 
HETATM 4436 O O   . HOH E 4 .   ? -4.467  79.717 58.264 1.00 49.40 ? 1185 HOH A O   1 
HETATM 4437 O O   . HOH E 4 .   ? -7.379  83.004 30.809 1.00 47.87 ? 1186 HOH A O   1 
HETATM 4438 O O   . HOH E 4 .   ? 11.990  67.165 83.224 1.00 34.60 ? 1187 HOH A O   1 
HETATM 4439 O O   . HOH E 4 .   ? 20.800  72.073 78.974 1.00 35.39 ? 1188 HOH A O   1 
HETATM 4440 O O   . HOH E 4 .   ? -1.509  71.755 73.205 1.00 36.82 ? 1189 HOH A O   1 
HETATM 4441 O O   . HOH E 4 .   ? -7.190  42.133 67.682 1.00 39.91 ? 1190 HOH A O   1 
HETATM 4442 O O   . HOH E 4 .   ? 10.881  70.442 33.995 1.00 37.84 ? 1191 HOH A O   1 
HETATM 4443 O O   . HOH E 4 .   ? -11.600 68.609 75.416 1.00 57.05 ? 1192 HOH A O   1 
HETATM 4444 O O   . HOH E 4 .   ? -2.112  60.452 34.861 1.00 41.79 ? 1193 HOH A O   1 
HETATM 4445 O O   . HOH E 4 .   ? 13.116  58.785 78.975 1.00 38.18 ? 1194 HOH A O   1 
HETATM 4446 O O   . HOH E 4 .   ? 23.040  77.307 53.982 1.00 46.91 ? 1195 HOH A O   1 
HETATM 4447 O O   . HOH E 4 .   ? 14.364  52.548 84.211 1.00 51.72 ? 1196 HOH A O   1 
HETATM 4448 O O   . HOH E 4 .   ? 19.680  58.300 32.953 1.00 47.22 ? 1197 HOH A O   1 
HETATM 4449 O O   . HOH E 4 .   ? 0.555   40.268 57.155 1.00 25.95 ? 1198 HOH A O   1 
HETATM 4450 O O   . HOH E 4 .   ? -12.980 39.313 61.988 1.00 55.46 ? 1199 HOH A O   1 
HETATM 4451 O O   . HOH E 4 .   ? -13.670 51.021 49.279 1.00 40.73 ? 1200 HOH A O   1 
HETATM 4452 O O   . HOH E 4 .   ? 26.912  63.643 59.521 1.00 35.56 ? 1201 HOH A O   1 
HETATM 4453 O O   . HOH E 4 .   ? 6.127   66.338 79.114 1.00 32.04 ? 1202 HOH A O   1 
HETATM 4454 O O   . HOH E 4 .   ? 27.945  53.547 50.723 1.00 43.77 ? 1203 HOH A O   1 
HETATM 4455 O O   . HOH E 4 .   ? 12.102  77.119 62.765 1.00 32.12 ? 1204 HOH A O   1 
HETATM 4456 O O   . HOH E 4 .   ? -6.111  78.337 72.857 1.00 71.70 ? 1205 HOH A O   1 
HETATM 4457 O O   . HOH E 4 .   ? 13.194  49.660 53.527 1.00 37.58 ? 1206 HOH A O   1 
HETATM 4458 O O   . HOH E 4 .   ? 26.229  59.071 77.410 1.00 59.26 ? 1207 HOH A O   1 
HETATM 4459 O O   . HOH E 4 .   ? -13.354 73.559 31.182 1.00 43.48 ? 1208 HOH A O   1 
HETATM 4460 O O   . HOH E 4 .   ? 5.127   41.083 56.618 1.00 48.03 ? 1209 HOH A O   1 
HETATM 4461 O O   . HOH E 4 .   ? 7.650   78.616 67.662 1.00 43.68 ? 1210 HOH A O   1 
HETATM 4462 O O   . HOH E 4 .   ? 7.974   79.925 37.720 1.00 48.12 ? 1211 HOH A O   1 
HETATM 4463 O O   . HOH E 4 .   ? 22.284  56.886 38.749 1.00 44.51 ? 1212 HOH A O   1 
HETATM 4464 O O   . HOH E 4 .   ? -6.679  45.880 51.384 1.00 50.13 ? 1213 HOH A O   1 
HETATM 4465 O O   . HOH E 4 .   ? -17.819 63.721 67.134 1.00 45.30 ? 1214 HOH A O   1 
HETATM 4466 O O   . HOH E 4 .   ? 5.200   88.727 68.290 1.00 63.79 ? 1215 HOH A O   1 
HETATM 4467 O O   . HOH E 4 .   ? 16.350  73.879 77.559 1.00 39.27 ? 1216 HOH A O   1 
HETATM 4468 O O   . HOH E 4 .   ? -21.404 49.004 70.160 1.00 37.13 ? 1217 HOH A O   1 
HETATM 4469 O O   . HOH E 4 .   ? 1.096   52.222 73.762 1.00 47.59 ? 1218 HOH A O   1 
HETATM 4470 O O   . HOH E 4 .   ? -4.463  67.657 65.689 1.00 40.51 ? 1219 HOH A O   1 
HETATM 4471 O O   . HOH E 4 .   ? 5.213   47.263 63.291 1.00 56.90 ? 1220 HOH A O   1 
HETATM 4472 O O   . HOH E 4 .   ? -6.952  39.698 66.499 1.00 46.11 ? 1221 HOH A O   1 
HETATM 4473 O O   . HOH E 4 .   ? -18.855 52.094 72.388 1.00 44.80 ? 1222 HOH A O   1 
HETATM 4474 O O   . HOH E 4 .   ? 2.125   63.926 76.792 1.00 34.88 ? 1223 HOH A O   1 
HETATM 4475 O O   . HOH E 4 .   ? -17.406 67.369 65.013 1.00 56.00 ? 1224 HOH A O   1 
HETATM 4476 O O   . HOH E 4 .   ? -4.342  39.747 62.669 1.00 32.22 ? 1225 HOH A O   1 
HETATM 4477 O O   . HOH E 4 .   ? 1.566   46.335 39.886 1.00 47.37 ? 1226 HOH A O   1 
HETATM 4478 O O   . HOH E 4 .   ? 6.987   64.735 80.900 1.00 38.02 ? 1227 HOH A O   1 
HETATM 4479 O O   . HOH E 4 .   ? 26.653  58.994 62.890 1.00 45.47 ? 1228 HOH A O   1 
HETATM 4480 O O   . HOH E 4 .   ? -12.477 64.332 41.582 1.00 27.45 ? 1229 HOH A O   1 
HETATM 4481 O O   . HOH E 4 .   ? 15.948  79.861 69.579 1.00 40.78 ? 1230 HOH A O   1 
HETATM 4482 O O   . HOH E 4 .   ? 22.551  72.203 76.811 1.00 51.83 ? 1231 HOH A O   1 
HETATM 4483 O O   . HOH E 4 .   ? 21.076  77.522 64.785 1.00 43.27 ? 1232 HOH A O   1 
HETATM 4484 O O   . HOH E 4 .   ? 16.961  58.240 31.581 1.00 75.59 ? 1233 HOH A O   1 
HETATM 4485 O O   . HOH E 4 .   ? -16.262 58.532 73.328 1.00 43.59 ? 1234 HOH A O   1 
HETATM 4486 O O   . HOH E 4 .   ? -14.623 65.184 66.926 1.00 45.57 ? 1235 HOH A O   1 
HETATM 4487 O O   . HOH E 4 .   ? -10.836 81.082 55.530 1.00 48.70 ? 1236 HOH A O   1 
HETATM 4488 O O   . HOH E 4 .   ? -4.231  85.241 53.690 1.00 54.31 ? 1237 HOH A O   1 
HETATM 4489 O O   . HOH E 4 .   ? 11.544  47.124 73.926 1.00 47.19 ? 1238 HOH A O   1 
HETATM 4490 O O   . HOH E 4 .   ? -23.745 51.151 59.792 1.00 49.49 ? 1239 HOH A O   1 
HETATM 4491 O O   . HOH E 4 .   ? -11.229 51.634 77.216 1.00 41.97 ? 1240 HOH A O   1 
HETATM 4492 O O   . HOH E 4 .   ? 17.937  45.390 79.239 1.00 56.48 ? 1241 HOH A O   1 
HETATM 4493 O O   . HOH E 4 .   ? -15.549 57.414 50.523 1.00 42.19 ? 1242 HOH A O   1 
HETATM 4494 O O   . HOH E 4 .   ? 9.286   62.051 35.570 1.00 51.33 ? 1243 HOH A O   1 
HETATM 4495 O O   . HOH E 4 .   ? -8.978  62.364 72.330 1.00 41.41 ? 1244 HOH A O   1 
HETATM 4496 O O   . HOH E 4 .   ? 16.440  88.534 52.227 1.00 44.48 ? 1245 HOH A O   1 
HETATM 4497 O O   . HOH E 4 .   ? -1.770  50.205 73.427 1.00 52.81 ? 1246 HOH A O   1 
HETATM 4498 O O   . HOH E 4 .   ? 13.531  74.178 66.123 1.00 37.60 ? 1247 HOH A O   1 
HETATM 4499 O O   . HOH E 4 .   ? 2.969   44.376 75.081 1.00 63.74 ? 1248 HOH A O   1 
HETATM 4500 O O   . HOH E 4 .   ? 4.704   57.261 75.858 1.00 41.65 ? 1249 HOH A O   1 
HETATM 4501 O O   . HOH E 4 .   ? 6.637   90.091 69.889 1.00 64.43 ? 1250 HOH A O   1 
HETATM 4502 O O   . HOH E 4 .   ? 10.873  47.140 76.945 1.00 53.59 ? 1251 HOH A O   1 
HETATM 4503 O O   . HOH E 4 .   ? 10.013  74.388 33.627 1.00 50.01 ? 1252 HOH A O   1 
HETATM 4504 O O   . HOH E 4 .   ? -17.807 78.783 50.807 1.00 61.74 ? 1253 HOH A O   1 
HETATM 4505 O O   . HOH E 4 .   ? 16.037  62.065 84.422 1.00 43.65 ? 1254 HOH A O   1 
HETATM 4506 O O   . HOH E 4 .   ? -4.788  50.154 48.207 1.00 49.06 ? 1255 HOH A O   1 
HETATM 4507 O O   . HOH E 4 .   ? 2.883   81.365 73.459 1.00 50.01 ? 1256 HOH A O   1 
HETATM 4508 O O   . HOH E 4 .   ? -4.957  42.330 69.574 1.00 42.51 ? 1257 HOH A O   1 
HETATM 4509 O O   . HOH E 4 .   ? -5.009  57.771 36.774 1.00 38.59 ? 1258 HOH A O   1 
HETATM 4510 O O   . HOH E 4 .   ? 20.547  69.941 71.226 1.00 47.47 ? 1259 HOH A O   1 
HETATM 4511 O O   . HOH E 4 .   ? 16.791  49.809 56.628 1.00 47.10 ? 1260 HOH A O   1 
HETATM 4512 O O   . HOH E 4 .   ? 16.411  50.062 62.697 1.00 37.67 ? 1261 HOH A O   1 
HETATM 4513 O O   . HOH E 4 .   ? -5.875  47.435 49.505 1.00 57.51 ? 1262 HOH A O   1 
HETATM 4514 O O   . HOH E 4 .   ? -12.274 89.029 46.430 1.00 39.98 ? 1263 HOH A O   1 
HETATM 4515 O O   . HOH E 4 .   ? 34.206  61.623 77.302 1.00 47.59 ? 1264 HOH A O   1 
HETATM 4516 O O   . HOH E 4 .   ? -8.463  79.312 31.420 1.00 62.26 ? 1265 HOH A O   1 
HETATM 4517 O O   . HOH E 4 .   ? 21.237  72.137 71.932 1.00 47.55 ? 1266 HOH A O   1 
HETATM 4518 O O   . HOH E 4 .   ? -0.797  55.027 73.536 1.00 44.90 ? 1267 HOH A O   1 
HETATM 4519 O O   . HOH E 4 .   ? 14.921  64.910 84.015 1.00 38.27 ? 1268 HOH A O   1 
HETATM 4520 O O   . HOH E 4 .   ? 18.851  78.958 43.596 1.00 38.16 ? 1269 HOH A O   1 
HETATM 4521 O O   . HOH E 4 .   ? -15.694 56.179 72.598 1.00 37.17 ? 1270 HOH A O   1 
HETATM 4522 O O   . HOH E 4 .   ? 6.559   48.173 55.539 1.00 35.15 ? 1271 HOH A O   1 
HETATM 4523 O O   . HOH E 4 .   ? -6.915  40.026 63.830 1.00 44.36 ? 1272 HOH A O   1 
HETATM 4524 O O   . HOH E 4 .   ? 6.227   81.586 62.911 1.00 51.19 ? 1273 HOH A O   1 
HETATM 4525 O O   . HOH E 4 .   ? 14.993  48.167 63.746 1.00 43.84 ? 1274 HOH A O   1 
HETATM 4526 O O   . HOH E 4 .   ? 11.455  42.320 51.549 1.00 47.25 ? 1275 HOH A O   1 
HETATM 4527 O O   . HOH E 4 .   ? 10.229  76.291 77.994 1.00 31.43 ? 1276 HOH A O   1 
HETATM 4528 O O   . HOH E 4 .   ? 11.205  90.663 62.530 1.00 50.42 ? 1277 HOH A O   1 
HETATM 4529 O O   . HOH E 4 .   ? -9.382  44.517 51.151 1.00 45.68 ? 1278 HOH A O   1 
HETATM 4530 O O   . HOH E 4 .   ? 22.744  59.204 85.969 1.00 50.79 ? 1279 HOH A O   1 
HETATM 4531 O O   . HOH E 4 .   ? 6.085   74.866 32.774 1.00 65.58 ? 1280 HOH A O   1 
HETATM 4532 O O   . HOH E 4 .   ? 0.474   96.302 45.704 0.50 34.93 ? 1281 HOH A O   1 
HETATM 4533 O O   . HOH E 4 .   ? -14.878 77.718 50.464 1.00 54.90 ? 1282 HOH A O   1 
HETATM 4534 O O   . HOH E 4 .   ? 14.670  91.395 51.490 1.00 61.20 ? 1283 HOH A O   1 
HETATM 4535 O O   . HOH E 4 .   ? 7.256   92.140 55.985 1.00 50.13 ? 1284 HOH A O   1 
HETATM 4536 O O   . HOH E 4 .   ? -10.611 75.551 65.985 1.00 59.87 ? 1285 HOH A O   1 
HETATM 4537 O O   . HOH E 4 .   ? -7.918  72.818 67.651 1.00 50.04 ? 1286 HOH A O   1 
HETATM 4538 O O   . HOH E 4 .   ? 31.678  58.748 50.284 1.00 52.54 ? 1287 HOH A O   1 
HETATM 4539 O O   . HOH E 4 .   ? -19.172 72.034 51.260 1.00 60.05 ? 1288 HOH A O   1 
HETATM 4540 O O   . HOH E 4 .   ? 4.168   64.155 63.784 1.00 53.16 ? 1289 HOH A O   1 
HETATM 4541 O O   . HOH E 4 .   ? 9.771   46.385 53.456 1.00 32.07 ? 1290 HOH A O   1 
HETATM 4542 O O   . HOH E 4 .   ? 6.578   78.805 64.391 1.00 40.71 ? 1291 HOH A O   1 
HETATM 4543 O O   . HOH E 4 .   ? 28.803  58.016 71.493 1.00 50.89 ? 1292 HOH A O   1 
HETATM 4544 O O   . HOH E 4 .   ? -10.134 71.645 67.539 1.00 44.50 ? 1293 HOH A O   1 
HETATM 4545 O O   . HOH E 4 .   ? 34.533  58.905 48.235 1.00 54.25 ? 1294 HOH A O   1 
HETATM 4546 O O   . HOH E 4 .   ? 0.652   92.884 52.254 1.00 46.60 ? 1295 HOH A O   1 
HETATM 4547 O O   . HOH E 4 .   ? -19.640 62.605 60.942 1.00 40.09 ? 1296 HOH A O   1 
HETATM 4548 O O   . HOH E 4 .   ? -23.831 55.068 59.386 1.00 51.10 ? 1297 HOH A O   1 
HETATM 4549 O O   . HOH E 4 .   ? -6.448  65.338 31.845 1.00 54.62 ? 1298 HOH A O   1 
HETATM 4550 O O   . HOH E 4 .   ? 17.656  39.112 74.302 1.00 40.05 ? 1299 HOH A O   1 
HETATM 4551 O O   . HOH E 4 .   ? 11.044  58.384 86.440 1.00 56.75 ? 1300 HOH A O   1 
HETATM 4552 O O   . HOH E 4 .   ? 17.281  89.762 54.372 1.00 47.96 ? 1301 HOH A O   1 
HETATM 4553 O O   . HOH E 4 .   ? 20.776  71.177 67.676 1.00 50.18 ? 1302 HOH A O   1 
HETATM 4554 O O   . HOH E 4 .   ? 11.800  86.738 44.389 1.00 45.55 ? 1303 HOH A O   1 
HETATM 4555 O O   . HOH E 4 .   ? -14.186 87.224 45.818 1.00 49.46 ? 1304 HOH A O   1 
HETATM 4556 O O   . HOH E 4 .   ? -3.740  42.561 46.826 1.00 64.13 ? 1305 HOH A O   1 
HETATM 4557 O O   . HOH E 4 .   ? -0.858  60.044 77.819 1.00 48.25 ? 1306 HOH A O   1 
HETATM 4558 O O   . HOH E 4 .   ? 24.746  70.417 63.181 1.00 51.08 ? 1307 HOH A O   1 
HETATM 4559 O O   . HOH E 4 .   ? 28.726  59.215 61.026 1.00 40.66 ? 1308 HOH A O   1 
HETATM 4560 O O   . HOH E 4 .   ? 1.816   43.774 41.240 1.00 73.43 ? 1309 HOH A O   1 
HETATM 4561 O O   . HOH E 4 .   ? 17.535  84.334 48.021 1.00 32.50 ? 1310 HOH A O   1 
HETATM 4562 O O   . HOH E 4 .   ? 21.669  59.615 38.304 1.00 48.29 ? 1311 HOH A O   1 
HETATM 4563 O O   . HOH E 4 .   ? 6.961   58.539 35.339 1.00 54.64 ? 1312 HOH A O   1 
HETATM 4564 O O   . HOH E 4 .   ? -14.579 47.364 78.068 1.00 58.00 ? 1313 HOH A O   1 
HETATM 4565 O O   . HOH E 4 .   ? -4.203  82.490 32.182 1.00 57.64 ? 1314 HOH A O   1 
HETATM 4566 O O   . HOH E 4 .   ? -24.501 56.963 54.002 1.00 63.21 ? 1315 HOH A O   1 
HETATM 4567 O O   . HOH E 4 .   ? -18.507 74.619 31.245 1.00 64.45 ? 1316 HOH A O   1 
HETATM 4568 O O   . HOH E 4 .   ? 1.594   56.244 72.870 1.00 57.12 ? 1317 HOH A O   1 
HETATM 4569 O O   . HOH E 4 .   ? -10.348 60.285 40.075 1.00 56.71 ? 1318 HOH A O   1 
HETATM 4570 O O   . HOH E 4 .   ? -21.465 69.483 47.999 1.00 64.01 ? 1319 HOH A O   1 
HETATM 4571 O O   . HOH E 4 .   ? -1.810  80.075 71.293 1.00 49.78 ? 1320 HOH A O   1 
HETATM 4572 O O   . HOH E 4 .   ? 28.207  67.742 78.488 1.00 49.19 ? 1321 HOH A O   1 
HETATM 4573 O O   . HOH E 4 .   ? -10.262 63.339 40.541 1.00 44.12 ? 1322 HOH A O   1 
HETATM 4574 O O   . HOH E 4 .   ? 22.574  77.629 43.928 1.00 47.23 ? 1323 HOH A O   1 
HETATM 4575 O O   . HOH E 4 .   ? 30.018  52.287 71.270 1.00 51.83 ? 1324 HOH A O   1 
HETATM 4576 O O   . HOH E 4 .   ? 22.291  61.524 28.339 1.00 67.12 ? 1325 HOH A O   1 
HETATM 4577 O O   . HOH E 4 .   ? 25.347  62.111 73.811 1.00 45.96 ? 1326 HOH A O   1 
HETATM 4578 O O   . HOH E 4 .   ? 15.910  58.394 87.564 1.00 58.50 ? 1327 HOH A O   1 
HETATM 4579 O O   . HOH E 4 .   ? 19.191  73.632 77.705 1.00 48.01 ? 1328 HOH A O   1 
HETATM 4580 O O   . HOH E 4 .   ? 8.424   50.478 77.880 1.00 53.95 ? 1329 HOH A O   1 
HETATM 4581 O O   . HOH E 4 .   ? 25.851  51.480 53.563 1.00 75.05 ? 1330 HOH A O   1 
HETATM 4582 O O   . HOH E 4 .   ? 31.069  57.951 72.546 1.00 49.16 ? 1331 HOH A O   1 
HETATM 4583 O O   . HOH E 4 .   ? 12.558  59.620 57.205 1.00 45.71 ? 1332 HOH A O   1 
HETATM 4584 O O   . HOH E 4 .   ? 19.649  83.378 64.823 1.00 59.10 ? 1333 HOH A O   1 
HETATM 4585 O O   . HOH E 4 .   ? 14.021  42.646 45.423 1.00 55.29 ? 1334 HOH A O   1 
HETATM 4586 O O   . HOH E 4 .   ? -12.700 59.307 38.387 1.00 60.90 ? 1335 HOH A O   1 
HETATM 4587 O O   . HOH E 4 .   ? 8.689   94.300 55.147 1.00 59.55 ? 1336 HOH A O   1 
HETATM 4588 O O   . HOH E 4 .   ? 23.292  78.546 46.720 1.00 54.83 ? 1337 HOH A O   1 
HETATM 4589 O O   . HOH E 4 .   ? -18.188 54.932 72.834 1.00 44.11 ? 1338 HOH A O   1 
HETATM 4590 O O   . HOH E 4 .   ? 10.203  51.314 36.996 1.00 44.45 ? 1339 HOH A O   1 
HETATM 4591 O O   . HOH E 4 .   ? -1.447  94.864 44.763 1.00 52.81 ? 1340 HOH A O   1 
HETATM 4592 O O   . HOH E 4 .   ? 17.975  87.822 50.338 1.00 50.99 ? 1341 HOH A O   1 
HETATM 4593 O O   . HOH E 4 .   ? 19.917  74.018 68.304 1.00 36.78 ? 1342 HOH A O   1 
HETATM 4594 O O   . HOH E 4 .   ? 12.882  48.445 36.875 1.00 66.31 ? 1343 HOH A O   1 
HETATM 4595 O O   . HOH E 4 .   ? -3.965  38.938 57.896 1.00 46.88 ? 1344 HOH A O   1 
HETATM 4596 O O   . HOH E 4 .   ? 15.858  86.177 46.795 1.00 38.15 ? 1345 HOH A O   1 
HETATM 4597 O O   . HOH E 4 .   ? 5.735   47.244 75.434 1.00 46.63 ? 1346 HOH A O   1 
HETATM 4598 O O   . HOH E 4 .   ? -7.991  42.957 48.458 1.00 76.33 ? 1347 HOH A O   1 
HETATM 4599 O O   . HOH E 4 .   ? 19.946  37.495 60.356 1.00 53.22 ? 1348 HOH A O   1 
HETATM 4600 O O   . HOH E 4 .   ? 1.380   40.493 54.582 1.00 37.15 ? 1349 HOH A O   1 
HETATM 4601 O O   . HOH E 4 .   ? 31.831  65.389 55.551 1.00 51.18 ? 1350 HOH A O   1 
HETATM 4602 O O   . HOH E 4 .   ? 6.375   48.811 79.326 1.00 51.61 ? 1351 HOH A O   1 
HETATM 4603 O O   . HOH E 4 .   ? -22.310 71.924 49.667 1.00 57.98 ? 1352 HOH A O   1 
HETATM 4604 O O   . HOH E 4 .   ? -21.924 68.145 42.878 1.00 50.01 ? 1353 HOH A O   1 
HETATM 4605 O O   . HOH E 4 .   ? 8.725   49.413 74.801 1.00 38.97 ? 1354 HOH A O   1 
HETATM 4606 O O   . HOH E 4 .   ? 21.080  64.804 63.950 1.00 44.08 ? 1355 HOH A O   1 
HETATM 4607 O O   . HOH E 4 .   ? 24.907  77.236 41.038 1.00 54.54 ? 1356 HOH A O   1 
HETATM 4608 O O   . HOH E 4 .   ? 14.508  45.833 62.357 1.00 56.83 ? 1357 HOH A O   1 
HETATM 4609 O O   . HOH E 4 .   ? 20.804  82.508 36.461 1.00 65.21 ? 1358 HOH A O   1 
HETATM 4610 O O   . HOH E 4 .   ? -11.230 78.847 33.120 1.00 50.67 ? 1359 HOH A O   1 
HETATM 4611 O O   . HOH E 4 .   ? -9.204  44.629 75.278 1.00 63.28 ? 1360 HOH A O   1 
HETATM 4612 O O   . HOH E 4 .   ? 11.301  46.509 38.100 1.00 58.10 ? 1361 HOH A O   1 
HETATM 4613 O O   . HOH E 4 .   ? -13.175 76.056 65.319 1.00 60.79 ? 1362 HOH A O   1 
HETATM 4614 O O   . HOH E 4 .   ? 31.216  55.330 48.399 1.00 54.76 ? 1363 HOH A O   1 
HETATM 4615 O O   . HOH E 4 .   ? 10.864  48.754 54.547 1.00 41.20 ? 1364 HOH A O   1 
HETATM 4616 O O   . HOH E 4 .   ? 5.311   77.383 81.396 1.00 39.51 ? 1365 HOH A O   1 
HETATM 4617 O O   . HOH E 4 .   ? -18.903 76.794 49.516 1.00 57.98 ? 1366 HOH A O   1 
HETATM 4618 O O   . HOH E 4 .   ? 5.283   45.756 57.039 1.00 54.13 ? 1367 HOH A O   1 
HETATM 4619 O O   . HOH E 4 .   ? 27.852  54.176 53.113 1.00 57.37 ? 1368 HOH A O   1 
HETATM 4620 O O   . HOH E 4 .   ? -9.707  39.153 61.679 1.00 52.60 ? 1369 HOH A O   1 
HETATM 4621 O O   . HOH E 4 .   ? 15.116  77.073 76.978 1.00 44.22 ? 1370 HOH A O   1 
HETATM 4622 O O   . HOH E 4 .   ? -21.026 70.936 35.278 1.00 47.00 ? 1371 HOH A O   1 
HETATM 4623 O O   . HOH E 4 .   ? 27.871  38.709 57.220 1.00 56.56 ? 1372 HOH A O   1 
HETATM 4624 O O   . HOH E 4 .   ? 12.889  49.458 61.491 1.00 60.13 ? 1373 HOH A O   1 
HETATM 4625 O O   . HOH E 4 .   ? -11.804 72.068 65.417 1.00 39.50 ? 1374 HOH A O   1 
HETATM 4626 O O   . HOH E 4 .   ? 9.476   91.110 53.217 1.00 56.15 ? 1375 HOH A O   1 
HETATM 4627 O O   . HOH E 4 .   ? -18.808 71.032 34.289 1.00 50.80 ? 1376 HOH A O   1 
HETATM 4628 O O   . HOH E 4 .   ? -0.107  66.076 36.655 1.00 27.55 ? 1377 HOH A O   1 
HETATM 4629 O O   . HOH E 4 .   ? 6.908   81.647 65.405 1.00 57.10 ? 1378 HOH A O   1 
HETATM 4630 O O   . HOH E 4 .   ? 8.981   48.612 62.663 1.00 56.48 ? 1379 HOH A O   1 
HETATM 4631 O O   . HOH E 4 .   ? 2.243   66.163 64.258 1.00 53.13 ? 1380 HOH A O   1 
HETATM 4632 O O   . HOH E 4 .   ? -6.102  75.273 69.331 1.00 60.42 ? 1381 HOH A O   1 
HETATM 4633 O O   . HOH E 4 .   ? -23.114 47.686 67.515 1.00 47.44 ? 1382 HOH A O   1 
HETATM 4634 O O   . HOH E 4 .   ? 16.651  88.751 48.160 1.00 51.09 ? 1383 HOH A O   1 
HETATM 4635 O O   . HOH E 4 .   ? -14.340 62.758 37.652 1.00 50.45 ? 1384 HOH A O   1 
HETATM 4636 O O   . HOH E 4 .   ? 4.413   88.961 71.018 1.00 52.04 ? 1385 HOH A O   1 
HETATM 4637 O O   . HOH E 4 .   ? 13.013  45.192 78.678 1.00 50.98 ? 1386 HOH A O   1 
HETATM 4638 O O   . HOH E 4 .   ? 6.754   48.344 59.415 1.00 51.94 ? 1387 HOH A O   1 
HETATM 4639 O O   . HOH E 4 .   ? 0.117   74.763 79.491 1.00 65.47 ? 1388 HOH A O   1 
HETATM 4640 O O   . HOH E 4 .   ? 31.782  55.023 51.663 1.00 54.44 ? 1389 HOH A O   1 
HETATM 4641 O O   . HOH E 4 .   ? 21.066  54.195 33.310 1.00 39.19 ? 1390 HOH A O   1 
HETATM 4642 O O   . HOH E 4 .   ? 18.821  80.627 69.470 1.00 60.62 ? 1391 HOH A O   1 
HETATM 4643 O O   . HOH E 4 .   ? 32.417  57.803 61.127 1.00 43.04 ? 1392 HOH A O   1 
HETATM 4644 O O   . HOH E 4 .   ? 2.622   39.691 59.049 1.00 45.76 ? 1393 HOH A O   1 
HETATM 4645 O O   . HOH E 4 .   ? 0.479   64.881 70.625 1.00 39.12 ? 1394 HOH A O   1 
HETATM 4646 O O   . HOH E 4 .   ? 4.397   41.337 51.744 1.00 43.99 ? 1395 HOH A O   1 
HETATM 4647 O O   . HOH E 4 .   ? -15.862 64.805 36.260 1.00 57.87 ? 1396 HOH A O   1 
HETATM 4648 O O   . HOH E 4 .   ? -17.850 39.294 69.512 1.00 47.25 ? 1397 HOH A O   1 
HETATM 4649 O O   . HOH E 4 .   ? 23.454  51.353 80.800 1.00 54.67 ? 1398 HOH A O   1 
HETATM 4650 O O   . HOH E 4 .   ? -11.460 67.664 70.153 1.00 50.95 ? 1399 HOH A O   1 
HETATM 4651 O O   . HOH E 4 .   ? 3.977   86.540 41.775 1.00 46.52 ? 1400 HOH A O   1 
HETATM 4652 O O   . HOH E 4 .   ? 5.075   79.023 68.148 1.00 53.32 ? 1401 HOH A O   1 
HETATM 4653 O O   . HOH E 4 .   ? -20.247 69.359 57.444 1.00 51.71 ? 1402 HOH A O   1 
HETATM 4654 O O   . HOH E 4 .   ? -11.269 70.304 69.646 1.00 56.16 ? 1403 HOH A O   1 
HETATM 4655 O O   . HOH E 4 .   ? 32.908  60.326 53.076 1.00 67.07 ? 1404 HOH A O   1 
HETATM 4656 O O   . HOH E 4 .   ? 4.114   43.493 63.005 1.00 65.06 ? 1405 HOH A O   1 
HETATM 4657 O O   . HOH E 4 .   ? -22.914 51.141 56.580 1.00 58.49 ? 1406 HOH A O   1 
HETATM 4658 O O   . HOH E 4 .   ? 13.837  79.571 39.162 1.00 58.77 ? 1407 HOH A O   1 
HETATM 4659 O O   . HOH E 4 .   ? 21.543  51.458 32.952 1.00 44.41 ? 1408 HOH A O   1 
HETATM 4660 O O   . HOH E 4 .   ? 13.705  68.156 86.121 1.00 59.21 ? 1409 HOH A O   1 
HETATM 4661 O O   . HOH E 4 .   ? 0.015   41.033 50.899 1.00 43.79 ? 1410 HOH A O   1 
HETATM 4662 O O   . HOH E 4 .   ? 2.519   41.830 50.401 1.00 35.28 ? 1411 HOH A O   1 
HETATM 4663 O O   . HOH E 4 .   ? 13.639  42.244 50.097 1.00 54.09 ? 1412 HOH A O   1 
HETATM 4664 O O   . HOH E 4 .   ? -7.651  72.428 71.718 1.00 59.90 ? 1413 HOH A O   1 
HETATM 4665 O O   . HOH E 4 .   ? -8.732  77.520 66.809 1.00 62.98 ? 1414 HOH A O   1 
HETATM 4666 O O   . HOH E 4 .   ? 6.641   43.987 65.528 1.00 63.91 ? 1415 HOH A O   1 
HETATM 4667 O O   . HOH E 4 .   ? 15.919  49.057 59.173 1.00 53.24 ? 1416 HOH A O   1 
HETATM 4668 O O   . HOH E 4 .   ? -20.433 51.052 51.415 1.00 58.95 ? 1417 HOH A O   1 
HETATM 4669 O O   . HOH E 4 .   ? 26.549  73.164 60.220 1.00 48.92 ? 1418 HOH A O   1 
HETATM 4670 O O   . HOH E 4 .   ? 8.257   46.944 73.860 1.00 43.82 ? 1419 HOH A O   1 
HETATM 4671 O O   . HOH E 4 .   ? 21.453  80.377 64.979 1.00 70.50 ? 1420 HOH A O   1 
HETATM 4672 O O   . HOH E 4 .   ? 22.174  65.886 69.821 1.00 58.36 ? 1421 HOH A O   1 
HETATM 4673 O O   . HOH E 4 .   ? 23.576  52.270 55.860 1.00 66.72 ? 1422 HOH A O   1 
HETATM 4674 O O   . HOH E 4 .   ? 7.001   43.159 62.781 1.00 62.80 ? 1423 HOH A O   1 
HETATM 4675 O O   . HOH E 4 .   ? 20.203  55.508 36.401 1.00 50.81 ? 1424 HOH A O   1 
HETATM 4676 O O   . HOH E 4 .   ? -4.398  72.874 73.173 1.00 50.26 ? 1425 HOH A O   1 
HETATM 4677 O O   . HOH E 4 .   ? 32.544  72.598 51.626 1.00 57.33 ? 1426 HOH A O   1 
HETATM 4678 O O   . HOH E 4 .   ? -20.050 85.801 54.757 1.00 52.08 ? 1427 HOH A O   1 
HETATM 4679 O O   . HOH E 4 .   ? 12.112  44.672 75.083 1.00 64.87 ? 1428 HOH A O   1 
HETATM 4680 O O   . HOH E 4 .   ? 12.977  51.057 59.328 1.00 62.98 ? 1429 HOH A O   1 
HETATM 4681 O O   . HOH E 4 .   ? 8.678   42.354 67.281 1.00 61.82 ? 1430 HOH A O   1 
HETATM 4682 O O   . HOH E 4 .   ? 20.352  46.727 51.897 1.00 52.85 ? 1431 HOH A O   1 
HETATM 4683 O O   . HOH E 4 .   ? -19.819 67.414 60.350 1.00 58.76 ? 1432 HOH A O   1 
HETATM 4684 O O   . HOH E 4 .   ? 21.648  83.758 62.818 1.00 70.59 ? 1433 HOH A O   1 
HETATM 4685 O O   . HOH E 4 .   ? -13.707 51.826 44.239 1.00 61.54 ? 1434 HOH A O   1 
HETATM 4686 O O   . HOH E 4 .   ? 9.117   49.341 58.935 1.00 62.07 ? 1435 HOH A O   1 
HETATM 4687 O O   . HOH E 4 .   ? -7.061  80.943 58.791 1.00 53.54 ? 1436 HOH A O   1 
HETATM 4688 O O   . HOH E 4 .   ? 8.883   88.855 44.258 1.00 67.09 ? 1437 HOH A O   1 
HETATM 4689 O O   . HOH E 4 .   ? 15.116  56.751 33.743 1.00 52.61 ? 1438 HOH A O   1 
HETATM 4690 O O   . HOH E 4 .   ? 1.500   94.442 42.836 1.00 46.33 ? 1439 HOH A O   1 
HETATM 4691 O O   . HOH E 4 .   ? -4.334  38.172 60.563 1.00 54.21 ? 1440 HOH A O   1 
HETATM 4692 O O   . HOH E 4 .   ? -16.524 43.975 54.348 1.00 56.90 ? 1441 HOH A O   1 
HETATM 4693 O O   . HOH E 4 .   ? -25.220 71.488 40.862 1.00 49.41 ? 1442 HOH A O   1 
HETATM 4694 O O   . HOH E 4 .   ? 21.389  79.208 42.262 1.00 53.99 ? 1443 HOH A O   1 
HETATM 4695 O O   . HOH E 4 .   ? 22.836  64.891 86.082 1.00 69.71 ? 1444 HOH A O   1 
HETATM 4696 O O   . HOH E 4 .   ? 26.872  60.341 74.999 1.00 51.98 ? 1445 HOH A O   1 
HETATM 4697 O O   . HOH E 4 .   ? 22.720  75.745 36.382 1.00 63.49 ? 1446 HOH A O   1 
HETATM 4698 O O   . HOH E 4 .   ? 6.670   92.467 48.120 1.00 48.07 ? 1447 HOH A O   1 
HETATM 4699 O O   . HOH E 4 .   ? 27.457  75.275 57.842 1.00 56.93 ? 1448 HOH A O   1 
HETATM 4700 O O   . HOH E 4 .   ? 29.349  72.031 44.610 1.00 69.18 ? 1449 HOH A O   1 
HETATM 4701 O O   . HOH E 4 .   ? -5.734  47.942 44.276 1.00 59.62 ? 1450 HOH A O   1 
HETATM 4702 O O   . HOH E 4 .   ? -9.928  81.255 72.960 1.00 44.67 ? 1451 HOH A O   1 
HETATM 4703 O O   . HOH E 4 .   ? 20.896  83.887 55.973 1.00 48.79 ? 1452 HOH A O   1 
HETATM 4704 O O   . HOH E 4 .   ? -21.535 66.068 45.199 1.00 50.48 ? 1453 HOH A O   1 
HETATM 4705 O O   . HOH E 4 .   ? -21.798 66.091 47.840 1.00 47.59 ? 1454 HOH A O   1 
HETATM 4706 O O   . HOH E 4 .   ? 14.974  78.908 36.729 1.00 50.36 ? 1455 HOH A O   1 
HETATM 4707 O O   . HOH E 4 .   ? 22.044  50.904 45.632 1.00 69.76 ? 1456 HOH A O   1 
HETATM 4708 O O   . HOH E 4 .   ? 30.770  81.523 39.477 1.00 72.40 ? 1457 HOH A O   1 
HETATM 4709 O O   . HOH E 4 .   ? -9.957  83.983 53.575 1.00 51.85 ? 1458 HOH A O   1 
HETATM 4710 O O   . HOH E 4 .   ? -6.964  67.960 29.907 1.00 51.96 ? 1459 HOH A O   1 
HETATM 4711 O O   . HOH E 4 .   ? -24.708 39.004 68.722 1.00 51.61 ? 1460 HOH A O   1 
HETATM 4712 O O   . HOH E 4 .   ? 26.750  45.391 59.861 1.00 40.76 ? 1461 HOH A O   1 
HETATM 4713 O O   . HOH E 4 .   ? -1.727  62.376 76.876 1.00 42.90 ? 1462 HOH A O   1 
HETATM 4714 O O   . HOH E 4 .   ? -18.203 71.482 32.006 1.00 55.13 ? 1463 HOH A O   1 
HETATM 4715 O O   . HOH E 4 .   ? 22.307  83.272 48.730 1.00 57.15 ? 1464 HOH A O   1 
HETATM 4716 O O   . HOH E 4 .   ? 5.044   97.155 46.277 1.00 74.22 ? 1465 HOH A O   1 
HETATM 4717 O O   . HOH E 4 .   ? -26.324 38.050 66.588 1.00 69.15 ? 1466 HOH A O   1 
HETATM 4718 O O   . HOH E 4 .   ? 10.239  81.065 37.027 1.00 54.99 ? 1467 HOH A O   1 
HETATM 4719 O O   . HOH E 4 .   ? -21.648 60.055 62.833 1.00 40.73 ? 1468 HOH A O   1 
HETATM 4720 O O   . HOH E 4 .   ? -22.420 45.576 73.599 1.00 66.81 ? 1469 HOH A O   1 
HETATM 4721 O O   . HOH E 4 .   ? 20.806  86.127 46.669 1.00 53.24 ? 1470 HOH A O   1 
HETATM 4722 O O   . HOH E 4 .   ? -24.587 68.059 46.159 1.00 65.68 ? 1471 HOH A O   1 
HETATM 4723 O O   . HOH E 4 .   ? -23.273 60.213 59.895 1.00 72.96 ? 1472 HOH A O   1 
HETATM 4724 O O   . HOH E 4 .   ? 28.548  53.830 68.938 1.00 84.93 ? 1473 HOH A O   1 
HETATM 4725 O O   . HOH E 4 .   ? 8.594   90.605 49.225 1.00 49.67 ? 1474 HOH A O   1 
HETATM 4726 O O   . HOH E 4 .   ? 20.551  51.405 36.108 1.00 45.23 ? 1475 HOH A O   1 
HETATM 4727 O O   . HOH E 4 .   ? -16.754 75.736 55.288 1.00 72.40 ? 1476 HOH A O   1 
HETATM 4728 O O   . HOH E 4 .   ? -15.215 86.594 33.076 1.00 62.41 ? 1477 HOH A O   1 
HETATM 4729 O O   . HOH E 4 .   ? -23.509 56.695 51.074 1.00 54.78 ? 1478 HOH A O   1 
HETATM 4730 O O   . HOH E 4 .   ? 2.997   63.819 66.197 1.00 50.27 ? 1479 HOH A O   1 
HETATM 4731 O O   . HOH E 4 .   ? -0.582  79.798 64.248 1.00 61.35 ? 1480 HOH A O   1 
HETATM 4732 O O   . HOH E 4 .   ? 27.455  67.574 76.045 1.00 50.18 ? 1481 HOH A O   1 
HETATM 4733 O O   . HOH E 4 .   ? 30.040  67.017 74.637 1.00 55.22 ? 1482 HOH A O   1 
HETATM 4734 O O   . HOH E 4 .   ? -8.840  41.478 75.507 1.00 70.38 ? 1483 HOH A O   1 
HETATM 4735 O O   . HOH E 4 .   ? 18.932  73.704 34.954 1.00 58.65 ? 1484 HOH A O   1 
HETATM 4736 O O   . HOH E 4 .   ? 20.177  63.922 85.793 1.00 67.54 ? 1485 HOH A O   1 
HETATM 4737 O O   . HOH E 4 .   ? -1.605  79.071 66.684 1.00 60.32 ? 1486 HOH A O   1 
HETATM 4738 O O   . HOH E 4 .   ? -13.831 40.445 54.517 1.00 52.90 ? 1487 HOH A O   1 
HETATM 4739 O O   . HOH E 4 .   ? -21.846 53.816 70.828 1.00 43.86 ? 1488 HOH A O   1 
HETATM 4740 O O   . HOH E 4 .   ? 27.563  46.434 57.467 1.00 61.11 ? 1489 HOH A O   1 
HETATM 4741 O O   . HOH E 4 .   ? 16.904  47.067 56.024 1.00 61.79 ? 1490 HOH A O   1 
HETATM 4742 O O   . HOH E 4 .   ? 25.671  64.479 71.701 1.00 79.34 ? 1491 HOH A O   1 
HETATM 4743 O O   . HOH E 4 .   ? -17.933 49.323 48.900 1.00 58.33 ? 1492 HOH A O   1 
HETATM 4744 O O   . HOH E 4 .   ? 4.788   86.998 66.533 1.00 66.20 ? 1493 HOH A O   1 
HETATM 4745 O O   . HOH E 4 .   ? -22.899 58.023 62.630 1.00 57.11 ? 1494 HOH A O   1 
HETATM 4746 O O   . HOH E 4 .   ? -22.497 59.218 51.874 1.00 56.42 ? 1495 HOH A O   1 
HETATM 4747 O O   . HOH E 4 .   ? 29.704  51.469 68.573 0.50 68.77 ? 1496 HOH A O   1 
HETATM 4748 O O   . HOH E 4 .   ? 24.921  80.250 50.595 1.00 61.55 ? 1497 HOH A O   1 
HETATM 4749 O O   . HOH E 4 .   ? 17.116  68.787 84.372 1.00 44.75 ? 1498 HOH A O   1 
HETATM 4750 O O   . HOH E 4 .   ? 29.679  63.957 43.738 1.00 54.77 ? 1499 HOH A O   1 
HETATM 4751 O O   . HOH E 4 .   ? 3.763   92.703 42.628 1.00 73.63 ? 1500 HOH A O   1 
HETATM 4752 O O   . HOH E 4 .   ? 1.493   77.100 78.692 1.00 68.78 ? 1501 HOH A O   1 
HETATM 4753 O O   . HOH E 4 .   ? 3.750   58.302 73.448 1.00 67.87 ? 1502 HOH A O   1 
HETATM 4754 O O   . HOH E 4 .   ? 20.028  45.414 54.591 1.00 57.23 ? 1503 HOH A O   1 
HETATM 4755 O O   . HOH E 4 .   ? -25.030 59.893 61.813 1.00 57.46 ? 1504 HOH A O   1 
HETATM 4756 O O   . HOH E 4 .   ? -20.814 81.337 44.650 1.00 53.85 ? 1505 HOH A O   1 
HETATM 4757 O O   . HOH E 4 .   ? 19.048  65.393 68.737 1.00 51.50 ? 1506 HOH A O   1 
HETATM 4758 O O   . HOH E 4 .   ? 22.332  65.661 66.622 1.00 51.42 ? 1507 HOH A O   1 
HETATM 4759 O O   . HOH E 4 .   ? 4.737   91.850 56.280 1.00 78.25 ? 1508 HOH A O   1 
HETATM 4760 O O   . HOH E 4 .   ? -11.204 89.849 34.649 1.00 79.40 ? 1509 HOH A O   1 
HETATM 4761 O O   . HOH E 4 .   ? -0.768  45.078 42.150 1.00 73.39 ? 1510 HOH A O   1 
HETATM 4762 O O   . HOH E 4 .   ? -11.189 58.133 44.018 1.00 86.83 ? 1511 HOH A O   1 
HETATM 4763 O O   . HOH E 4 .   ? 21.525  84.750 34.266 1.00 58.61 ? 1512 HOH A O   1 
HETATM 4764 O O   . HOH E 4 .   ? 0.027   85.560 32.430 1.00 61.30 ? 1513 HOH A O   1 
HETATM 4765 O O   . HOH E 4 .   ? 23.556  81.706 63.909 1.00 64.51 ? 1514 HOH A O   1 
HETATM 4766 O O   . HOH E 4 .   ? 3.457   54.430 75.006 1.00 55.59 ? 1515 HOH A O   1 
HETATM 4767 O O   . HOH E 4 .   ? 8.994   78.217 80.121 1.00 56.04 ? 1516 HOH A O   1 
HETATM 4768 O O   . HOH E 4 .   ? 16.244  84.677 44.336 1.00 50.38 ? 1517 HOH A O   1 
HETATM 4769 O O   . HOH E 4 .   ? 14.730  75.361 80.466 1.00 53.94 ? 1518 HOH A O   1 
HETATM 4770 O O   . HOH E 4 .   ? 17.121  70.000 32.486 1.00 62.38 ? 1519 HOH A O   1 
HETATM 4771 O O   . HOH E 4 .   ? -20.503 51.511 76.937 1.00 62.33 ? 1520 HOH A O   1 
HETATM 4772 O O   . HOH E 4 .   ? -15.542 60.312 76.310 1.00 75.36 ? 1521 HOH A O   1 
HETATM 4773 O O   . HOH E 4 .   ? 26.514  70.259 75.059 1.00 61.97 ? 1522 HOH A O   1 
HETATM 4774 O O   . HOH E 4 .   ? 28.388  57.527 41.531 1.00 45.37 ? 1523 HOH A O   1 
HETATM 4775 O O   . HOH E 4 .   ? 13.233  71.564 32.614 1.00 64.12 ? 1524 HOH A O   1 
HETATM 4776 O O   . HOH E 4 .   ? 24.737  63.549 67.404 1.00 65.07 ? 1525 HOH A O   1 
HETATM 4777 O O   . HOH E 4 .   ? -16.000 86.267 47.349 1.00 83.44 ? 1526 HOH A O   1 
HETATM 4778 O O   . HOH E 4 .   ? -14.588 75.888 59.858 1.00 56.42 ? 1527 HOH A O   1 
HETATM 4779 O O   . HOH E 4 .   ? 2.809   85.662 33.832 1.00 62.71 ? 1528 HOH A O   1 
HETATM 4780 O O   . HOH E 4 .   ? -15.826 83.406 46.441 1.00 61.06 ? 1529 HOH A O   1 
HETATM 4781 O O   . HOH E 4 .   ? 1.530   87.562 41.668 1.00 53.85 ? 1530 HOH A O   1 
HETATM 4782 O O   . HOH E 4 .   ? -4.858  50.608 45.228 1.00 42.34 ? 1531 HOH A O   1 
HETATM 4783 O O   . HOH E 4 .   ? 14.983  42.178 61.630 1.00 51.86 ? 1532 HOH A O   1 
HETATM 4784 O O   . HOH E 4 .   ? -27.026 38.078 63.939 1.00 66.54 ? 1533 HOH A O   1 
HETATM 4785 O O   . HOH E 4 .   ? -16.348 55.607 44.761 1.00 60.79 ? 1534 HOH A O   1 
HETATM 4786 O O   . HOH E 4 .   ? 26.836  60.246 65.260 1.00 50.80 ? 1535 HOH A O   1 
HETATM 4787 O O   . HOH E 4 .   ? -24.445 79.958 41.725 1.00 52.32 ? 1536 HOH A O   1 
HETATM 4788 O O   . HOH E 4 .   ? 29.754  58.705 65.008 1.00 70.17 ? 1537 HOH A O   1 
HETATM 4789 O O   . HOH E 4 .   ? 16.207  47.083 78.558 1.00 77.41 ? 1538 HOH A O   1 
HETATM 4790 O O   . HOH E 4 .   ? -4.631  90.893 36.335 1.00 56.77 ? 1539 HOH A O   1 
HETATM 4791 O O   . HOH E 4 .   ? 29.389  53.327 85.774 1.00 67.48 ? 1540 HOH A O   1 
HETATM 4792 O O   . HOH E 4 .   ? 33.731  62.160 84.437 1.00 54.53 ? 1541 HOH A O   1 
HETATM 4793 O O   . HOH E 4 .   ? 2.011   89.131 32.002 1.00 62.78 ? 1542 HOH A O   1 
HETATM 4794 O O   . HOH E 4 .   ? 34.486  70.601 51.444 1.00 71.57 ? 1543 HOH A O   1 
HETATM 4795 O O   . HOH E 4 .   ? -3.598  79.662 78.484 1.00 64.62 ? 1544 HOH A O   1 
HETATM 4796 O O   . HOH E 4 .   ? -22.369 45.497 64.094 1.00 41.83 ? 1545 HOH A O   1 
HETATM 4797 O O   . HOH E 4 .   ? 34.054  62.934 81.983 1.00 64.21 ? 1546 HOH A O   1 
HETATM 4798 O O   . HOH E 4 .   ? -16.169 43.652 51.232 1.00 62.99 ? 1547 HOH A O   1 
HETATM 4799 O O   . HOH E 4 .   ? 22.059  57.759 32.378 1.00 70.92 ? 1548 HOH A O   1 
HETATM 4800 O O   . HOH E 4 .   ? -21.405 38.476 58.036 1.00 69.12 ? 1549 HOH A O   1 
HETATM 4801 O O   . HOH E 4 .   ? 2.066   89.644 54.281 1.00 28.77 ? 1550 HOH A O   1 
HETATM 4802 O O   . HOH E 4 .   ? 16.232  88.012 67.954 1.00 54.72 ? 1551 HOH A O   1 
HETATM 4803 O O   . HOH E 4 .   ? 6.781   73.073 29.842 1.00 57.66 ? 1552 HOH A O   1 
HETATM 4804 O O   . HOH E 4 .   ? 0.674   48.157 75.860 1.00 43.76 ? 1553 HOH A O   1 
HETATM 4805 O O   . HOH E 4 .   ? 28.300  67.473 60.164 1.00 74.59 ? 1554 HOH A O   1 
HETATM 4806 O O   . HOH E 4 .   ? -1.483  47.193 74.561 1.00 51.21 ? 1555 HOH A O   1 
HETATM 4807 O O   . HOH E 4 .   ? -13.612 76.725 29.593 1.00 56.42 ? 1556 HOH A O   1 
HETATM 4808 O O   . HOH E 4 .   ? 25.068  48.125 76.918 1.00 54.33 ? 1557 HOH A O   1 
HETATM 4809 O O   . HOH E 4 .   ? -9.390  36.957 58.360 1.00 62.53 ? 1558 HOH A O   1 
HETATM 4810 O O   . HOH E 4 .   ? 13.134  41.043 68.447 1.00 60.45 ? 1559 HOH A O   1 
HETATM 4811 O O   . HOH E 4 .   ? 14.130  92.683 59.991 1.00 77.48 ? 1560 HOH A O   1 
HETATM 4812 O O   . HOH E 4 .   ? 24.628  73.100 39.103 1.00 39.94 ? 1561 HOH A O   1 
HETATM 4813 O O   . HOH E 4 .   ? -21.086 65.657 57.854 1.00 49.39 ? 1562 HOH A O   1 
HETATM 4814 O O   . HOH E 4 .   ? 17.818  32.677 68.871 1.00 67.39 ? 1563 HOH A O   1 
HETATM 4815 O O   . HOH E 4 .   ? -27.001 82.824 41.102 1.00 54.07 ? 1564 HOH A O   1 
HETATM 4816 O O   . HOH E 4 .   ? -23.022 36.517 68.773 1.00 66.96 ? 1565 HOH A O   1 
HETATM 4817 O O   . HOH E 4 .   ? 23.708  69.801 39.883 1.00 48.28 ? 1566 HOH A O   1 
HETATM 4818 O O   . HOH E 4 .   ? 14.915  72.070 86.135 1.00 65.70 ? 1567 HOH A O   1 
HETATM 4819 O O   . HOH E 4 .   ? 0.889   88.377 55.792 1.00 50.20 ? 1568 HOH A O   1 
HETATM 4820 O O   . HOH E 4 .   ? 25.092  67.589 83.067 1.00 55.62 ? 1569 HOH A O   1 
HETATM 4821 O O   . HOH E 4 .   ? -1.508  38.164 56.968 1.00 49.57 ? 1570 HOH A O   1 
HETATM 4822 O O   . HOH E 4 .   ? -9.791  69.645 54.603 1.00 30.73 ? 1571 HOH A O   1 
HETATM 4823 O O   . HOH E 4 .   ? 13.916  39.676 75.458 1.00 44.89 ? 1572 HOH A O   1 
HETATM 4824 O O   . HOH E 4 .   ? -0.069  89.905 54.330 1.00 36.04 ? 1573 HOH A O   1 
HETATM 4825 O O   . HOH E 4 .   ? -7.469  60.011 71.958 1.00 44.43 ? 1574 HOH A O   1 
HETATM 4826 O O   . HOH E 4 .   ? 13.064  55.265 84.558 1.00 72.68 ? 1575 HOH A O   1 
HETATM 4827 O O   . HOH E 4 .   ? 7.669   65.969 82.901 1.00 45.71 ? 1576 HOH A O   1 
HETATM 4828 O O   . HOH E 4 .   ? 13.816  56.718 87.178 1.00 75.60 ? 1577 HOH A O   1 
HETATM 4829 O O   . HOH E 4 .   ? 21.068  84.046 51.225 1.00 61.05 ? 1578 HOH A O   1 
HETATM 4830 O O   . HOH E 4 .   ? 3.610   65.655 78.731 1.00 45.14 ? 1579 HOH A O   1 
HETATM 4831 O O   . HOH E 4 .   ? -2.168  39.962 64.814 1.00 60.83 ? 1580 HOH A O   1 
HETATM 4832 O O   . HOH E 4 .   ? -3.025  77.122 54.720 1.00 60.33 ? 1581 HOH A O   1 
HETATM 4833 O O   . HOH E 4 .   ? 28.193  52.296 64.050 1.00 60.50 ? 1582 HOH A O   1 
HETATM 4834 O O   . HOH E 4 .   ? 11.613  61.160 85.846 1.00 63.09 ? 1583 HOH A O   1 
HETATM 4835 O O   . HOH E 4 .   ? -21.824 60.001 47.031 1.00 53.23 ? 1584 HOH A O   1 
HETATM 4836 O O   . HOH E 4 .   ? 10.990  79.712 40.244 1.00 69.88 ? 1585 HOH A O   1 
HETATM 4837 O O   . HOH E 4 .   ? 16.805  49.897 77.992 1.00 59.26 ? 1586 HOH A O   1 
HETATM 4838 O O   . HOH E 4 .   ? 6.460   93.665 52.593 1.00 51.32 ? 1587 HOH A O   1 
HETATM 4839 O O   . HOH E 4 .   ? 13.369  62.105 33.994 1.00 85.49 ? 1588 HOH A O   1 
HETATM 4840 O O   . HOH E 4 .   ? 23.873  55.951 40.618 1.00 69.67 ? 1589 HOH A O   1 
HETATM 4841 O O   . HOH E 4 .   ? -2.619  37.675 54.175 1.00 52.64 ? 1590 HOH A O   1 
HETATM 4842 O O   . HOH E 4 .   ? -19.249 74.691 34.082 1.00 67.01 ? 1591 HOH A O   1 
HETATM 4843 O O   . HOH E 4 .   ? 17.708  46.468 53.431 1.00 51.15 ? 1592 HOH A O   1 
HETATM 4844 O O   . HOH E 4 .   ? 22.611  62.014 85.724 1.00 66.45 ? 1593 HOH A O   1 
HETATM 4845 O O   . HOH E 4 .   ? -5.601  78.458 76.435 1.00 84.28 ? 1594 HOH A O   1 
HETATM 4846 O O   . HOH E 4 .   ? 17.459  66.668 35.054 1.00 63.44 ? 1595 HOH A O   1 
HETATM 4847 O O   . HOH E 4 .   ? -2.212  96.977 49.111 1.00 63.82 ? 1596 HOH A O   1 
HETATM 4848 O O   . HOH E 4 .   ? 24.925  54.709 47.571 1.00 63.26 ? 1597 HOH A O   1 
HETATM 4849 O O   . HOH E 4 .   ? 11.020  93.276 55.655 1.00 62.46 ? 1598 HOH A O   1 
HETATM 4850 O O   . HOH E 4 .   ? 30.904  59.566 62.317 1.00 56.43 ? 1599 HOH A O   1 
HETATM 4851 O O   . HOH E 4 .   ? 25.645  83.489 53.753 1.00 61.03 ? 1600 HOH A O   1 
HETATM 4852 O O   . HOH E 4 .   ? 24.521  75.923 62.737 1.00 50.65 ? 1601 HOH A O   1 
HETATM 4853 O O   . HOH E 4 .   ? 18.823  74.784 70.720 1.00 57.06 ? 1602 HOH A O   1 
HETATM 4854 O O   . HOH E 4 .   ? 20.220  73.694 75.392 1.00 52.46 ? 1603 HOH A O   1 
HETATM 4855 O O   . HOH E 4 .   ? 22.617  50.952 50.049 1.00 58.02 ? 1604 HOH A O   1 
HETATM 4856 O O   . HOH E 4 .   ? 25.410  60.184 68.240 1.00 56.24 ? 1605 HOH A O   1 
HETATM 4857 O O   . HOH E 4 .   ? 12.446  79.534 75.023 1.00 62.29 ? 1606 HOH A O   1 
HETATM 4858 O O   . HOH E 4 .   ? 17.472  64.308 63.984 1.00 47.46 ? 1607 HOH A O   1 
HETATM 4859 O O   . HOH E 4 .   ? 1.880   82.613 61.159 1.00 49.86 ? 1608 HOH A O   1 
HETATM 4860 O O   . HOH E 4 .   ? 26.105  62.683 38.677 1.00 55.28 ? 1609 HOH A O   1 
HETATM 4861 O O   . HOH E 4 .   ? -0.541  36.400 58.776 1.00 63.15 ? 1610 HOH A O   1 
HETATM 4862 O O   . HOH E 4 .   ? 24.190  59.360 24.764 1.00 64.22 ? 1611 HOH A O   1 
HETATM 4863 O O   . HOH E 4 .   ? 24.643  60.746 29.403 1.00 55.31 ? 1612 HOH A O   1 
HETATM 4864 O O   . HOH E 4 .   ? 7.209   77.942 35.698 1.00 52.63 ? 1613 HOH A O   1 
HETATM 4865 O O   . HOH E 4 .   ? -21.380 61.395 49.939 1.00 44.06 ? 1614 HOH A O   1 
HETATM 4866 O O   . HOH E 4 .   ? -2.298  65.189 76.997 1.00 51.22 ? 1615 HOH A O   1 
HETATM 4867 O O   . HOH E 4 .   ? -22.762 74.594 44.206 1.00 55.18 ? 1616 HOH A O   1 
HETATM 4868 O O   . HOH E 4 .   ? 23.287  68.638 36.972 1.00 54.16 ? 1617 HOH A O   1 
HETATM 4869 O O   . HOH E 4 .   ? -3.733  62.191 74.947 1.00 57.37 ? 1618 HOH A O   1 
HETATM 4870 O O   . HOH E 4 .   ? 21.512  65.361 28.624 1.00 61.44 ? 1619 HOH A O   1 
HETATM 4871 O O   . HOH E 4 .   ? 19.614  61.777 26.841 1.00 62.83 ? 1620 HOH A O   1 
HETATM 4872 O O   . HOH E 4 .   ? 26.668  68.524 40.900 1.00 57.11 ? 1621 HOH A O   1 
HETATM 4873 O O   . HOH E 4 .   ? 30.664  61.509 42.576 1.00 52.54 ? 1622 HOH A O   1 
HETATM 4874 O O   . HOH E 4 .   ? 8.475   41.985 54.364 1.00 49.31 ? 1623 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   4   4   SER SER A . n 
A 1 2   GLU 2   5   5   GLU GLU A . n 
A 1 3   LEU 3   6   6   LEU LEU A . n 
A 1 4   LEU 4   7   7   LEU LEU A . n 
A 1 5   VAL 5   8   8   VAL VAL A . n 
A 1 6   ASN 6   9   9   ASN ASN A . n 
A 1 7   THR 7   10  10  THR THR A . n 
A 1 8   LYS 8   11  11  LYS LYS A . n 
A 1 9   SER 9   12  12  SER SER A . n 
A 1 10  GLY 10  13  13  GLY GLY A . n 
A 1 11  LYS 11  14  14  LYS LYS A . n 
A 1 12  VAL 12  15  15  VAL VAL A . n 
A 1 13  MET 13  16  16  MET MET A . n 
A 1 14  GLY 14  17  17  GLY GLY A . n 
A 1 15  THR 15  18  18  THR THR A . n 
A 1 16  ARG 16  19  19  ARG ARG A . n 
A 1 17  VAL 17  20  20  VAL VAL A . n 
A 1 18  PRO 18  21  21  PRO PRO A . n 
A 1 19  VAL 19  22  22  VAL VAL A . n 
A 1 20  LEU 20  23  23  LEU LEU A . n 
A 1 21  SER 21  24  24  SER SER A . n 
A 1 22  SER 22  25  25  SER SER A . n 
A 1 23  HIS 23  26  26  HIS HIS A . n 
A 1 24  ILE 24  27  27  ILE ILE A . n 
A 1 25  SER 25  28  28  SER SER A . n 
A 1 26  ALA 26  29  29  ALA ALA A . n 
A 1 27  PHE 27  30  30  PHE PHE A . n 
A 1 28  LEU 28  31  31  LEU LEU A . n 
A 1 29  GLY 29  32  32  GLY GLY A . n 
A 1 30  ILE 30  33  33  ILE ILE A . n 
A 1 31  PRO 31  34  34  PRO PRO A . n 
A 1 32  PHE 32  35  35  PHE PHE A . n 
A 1 33  ALA 33  36  36  ALA ALA A . n 
A 1 34  GLU 34  37  37  GLU GLU A . n 
A 1 35  PRO 35  38  38  PRO PRO A . n 
A 1 36  PRO 36  39  39  PRO PRO A . n 
A 1 37  VAL 37  40  40  VAL VAL A . n 
A 1 38  GLY 38  41  41  GLY GLY A . n 
A 1 39  ASN 39  42  42  ASN ASN A . n 
A 1 40  MET 40  43  43  MET MET A . n 
A 1 41  ARG 41  44  44  ARG ARG A . n 
A 1 42  PHE 42  45  45  PHE PHE A . n 
A 1 43  ARG 43  46  46  ARG ARG A . n 
A 1 44  ARG 44  47  47  ARG ARG A . n 
A 1 45  PRO 45  48  48  PRO PRO A . n 
A 1 46  GLU 46  49  49  GLU GLU A . n 
A 1 47  PRO 47  50  50  PRO PRO A . n 
A 1 48  LYS 48  51  51  LYS LYS A . n 
A 1 49  LYS 49  52  52  LYS LYS A . n 
A 1 50  PRO 50  53  53  PRO PRO A . n 
A 1 51  TRP 51  54  54  TRP TRP A . n 
A 1 52  SER 52  55  55  SER SER A . n 
A 1 53  GLY 53  56  56  GLY GLY A . n 
A 1 54  VAL 54  57  57  VAL VAL A . n 
A 1 55  TRP 55  58  58  TRP TRP A . n 
A 1 56  ASN 56  59  59  ASN ASN A . n 
A 1 57  ALA 57  60  60  ALA ALA A . n 
A 1 58  SER 58  61  61  SER SER A . n 
A 1 59  THR 59  62  62  THR THR A . n 
A 1 60  TYR 60  63  63  TYR TYR A . n 
A 1 61  PRO 61  64  64  PRO PRO A . n 
A 1 62  ASN 62  65  65  ASN ASN A . n 
A 1 63  ASN 63  66  66  ASN ASN A . n 
A 1 64  CYS 64  67  67  CYS CYS A . n 
A 1 65  GLN 65  68  68  GLN GLN A . n 
A 1 66  GLN 66  69  69  GLN GLN A . n 
A 1 67  TYR 67  70  70  TYR TYR A . n 
A 1 68  VAL 68  71  71  VAL VAL A . n 
A 1 69  ASP 69  72  72  ASP ASP A . n 
A 1 70  GLU 70  73  73  GLU GLU A . n 
A 1 71  GLN 71  74  74  GLN GLN A . n 
A 1 72  PHE 72  75  75  PHE PHE A . n 
A 1 73  PRO 73  76  76  PRO PRO A . n 
A 1 74  GLY 74  77  77  GLY GLY A . n 
A 1 75  PHE 75  78  78  PHE PHE A . n 
A 1 76  SER 76  79  79  SER SER A . n 
A 1 77  GLY 77  80  80  GLY GLY A . n 
A 1 78  SER 78  81  81  SER SER A . n 
A 1 79  GLU 79  82  82  GLU GLU A . n 
A 1 80  MET 80  83  83  MET MET A . n 
A 1 81  TRP 81  84  84  TRP TRP A . n 
A 1 82  ASN 82  85  85  ASN ASN A . n 
A 1 83  PRO 83  86  86  PRO PRO A . n 
A 1 84  ASN 84  87  87  ASN ASN A . n 
A 1 85  ARG 85  88  88  ARG ARG A . n 
A 1 86  GLU 86  89  89  GLU GLU A . n 
A 1 87  MET 87  90  90  MET MET A . n 
A 1 88  SER 88  91  91  SER SER A . n 
A 1 89  GLU 89  92  92  GLU GLU A . n 
A 1 90  ASP 90  93  93  ASP ASP A . n 
A 1 91  CYS 91  94  94  CYS CYS A . n 
A 1 92  LEU 92  95  95  LEU LEU A . n 
A 1 93  TYR 93  96  96  TYR TYR A . n 
A 1 94  LEU 94  97  97  LEU LEU A . n 
A 1 95  ASN 95  98  98  ASN ASN A . n 
A 1 96  ILE 96  99  99  ILE ILE A . n 
A 1 97  TRP 97  100 100 TRP TRP A . n 
A 1 98  VAL 98  101 101 VAL VAL A . n 
A 1 99  PRO 99  102 102 PRO PRO A . n 
A 1 100 SER 100 103 103 SER SER A . n 
A 1 101 PRO 101 104 104 PRO PRO A . n 
A 1 102 ARG 102 105 105 ARG ARG A . n 
A 1 103 PRO 103 106 106 PRO PRO A . n 
A 1 104 LYS 104 107 107 LYS LYS A . n 
A 1 105 SER 105 108 108 SER SER A . n 
A 1 106 THR 106 109 109 THR THR A . n 
A 1 107 THR 107 110 110 THR THR A . n 
A 1 108 VAL 108 111 111 VAL VAL A . n 
A 1 109 MET 109 112 112 MET MET A . n 
A 1 110 VAL 110 113 113 VAL VAL A . n 
A 1 111 TRP 111 114 114 TRP TRP A . n 
A 1 112 ILE 112 115 115 ILE ILE A . n 
A 1 113 TYR 113 116 116 TYR TYR A . n 
A 1 114 GLY 114 117 117 GLY GLY A . n 
A 1 115 GLY 115 118 118 GLY GLY A . n 
A 1 116 GLY 116 119 119 GLY GLY A . n 
A 1 117 PHE 117 120 120 PHE PHE A . n 
A 1 118 TYR 118 121 121 TYR TYR A . n 
A 1 119 SER 119 122 122 SER SER A . n 
A 1 120 GLY 120 123 123 GLY GLY A . n 
A 1 121 SER 121 124 124 SER SER A . n 
A 1 122 SER 122 125 125 SER SER A . n 
A 1 123 THR 123 126 126 THR THR A . n 
A 1 124 LEU 124 127 127 LEU LEU A . n 
A 1 125 ASP 125 128 128 ASP ASP A . n 
A 1 126 VAL 126 129 129 VAL VAL A . n 
A 1 127 TYR 127 130 130 TYR TYR A . n 
A 1 128 ASN 128 131 131 ASN ASN A . n 
A 1 129 GLY 129 132 132 GLY GLY A . n 
A 1 130 LYS 130 133 133 LYS LYS A . n 
A 1 131 TYR 131 134 134 TYR TYR A . n 
A 1 132 LEU 132 135 135 LEU LEU A . n 
A 1 133 ALA 133 136 136 ALA ALA A . n 
A 1 134 TYR 134 137 137 TYR TYR A . n 
A 1 135 THR 135 138 138 THR THR A . n 
A 1 136 GLU 136 139 139 GLU GLU A . n 
A 1 137 GLU 137 140 140 GLU GLU A . n 
A 1 138 VAL 138 141 141 VAL VAL A . n 
A 1 139 VAL 139 142 142 VAL VAL A . n 
A 1 140 LEU 140 143 143 LEU LEU A . n 
A 1 141 VAL 141 144 144 VAL VAL A . n 
A 1 142 SER 142 145 145 SER SER A . n 
A 1 143 LEU 143 146 146 LEU LEU A . n 
A 1 144 SER 144 147 147 SER SER A . n 
A 1 145 TYR 145 148 148 TYR TYR A . n 
A 1 146 ARG 146 149 149 ARG ARG A . n 
A 1 147 VAL 147 150 150 VAL VAL A . n 
A 1 148 GLY 148 151 151 GLY GLY A . n 
A 1 149 ALA 149 152 152 ALA ALA A . n 
A 1 150 PHE 150 153 153 PHE PHE A . n 
A 1 151 GLY 151 154 154 GLY GLY A . n 
A 1 152 PHE 152 155 155 PHE PHE A . n 
A 1 153 LEU 153 156 156 LEU LEU A . n 
A 1 154 ALA 154 157 157 ALA ALA A . n 
A 1 155 LEU 155 158 158 LEU LEU A . n 
A 1 156 HIS 156 159 159 HIS HIS A . n 
A 1 157 GLY 157 160 160 GLY GLY A . n 
A 1 158 SER 158 161 161 SER SER A . n 
A 1 159 GLN 159 162 162 GLN GLN A . n 
A 1 160 GLU 160 163 163 GLU GLU A . n 
A 1 161 ALA 161 164 164 ALA ALA A . n 
A 1 162 PRO 162 165 165 PRO PRO A . n 
A 1 163 GLY 163 166 166 GLY GLY A . n 
A 1 164 ASN 164 167 167 ASN ASN A . n 
A 1 165 VAL 165 168 168 VAL VAL A . n 
A 1 166 GLY 166 169 169 GLY GLY A . n 
A 1 167 LEU 167 170 170 LEU LEU A . n 
A 1 168 LEU 168 171 171 LEU LEU A . n 
A 1 169 ASP 169 172 172 ASP ASP A . n 
A 1 170 GLN 170 173 173 GLN GLN A . n 
A 1 171 ARG 171 174 174 ARG ARG A . n 
A 1 172 MET 172 175 175 MET MET A . n 
A 1 173 ALA 173 176 176 ALA ALA A . n 
A 1 174 LEU 174 177 177 LEU LEU A . n 
A 1 175 GLN 175 178 178 GLN GLN A . n 
A 1 176 TRP 176 179 179 TRP TRP A . n 
A 1 177 VAL 177 180 180 VAL VAL A . n 
A 1 178 HIS 178 181 181 HIS HIS A . n 
A 1 179 ASP 179 182 182 ASP ASP A . n 
A 1 180 ASN 180 183 183 ASN ASN A . n 
A 1 181 ILE 181 184 184 ILE ILE A . n 
A 1 182 GLN 182 185 185 GLN GLN A . n 
A 1 183 PHE 183 186 186 PHE PHE A . n 
A 1 184 PHE 184 187 187 PHE PHE A . n 
A 1 185 GLY 185 188 188 GLY GLY A . n 
A 1 186 GLY 186 189 189 GLY GLY A . n 
A 1 187 ASP 187 190 190 ASP ASP A . n 
A 1 188 PRO 188 191 191 PRO PRO A . n 
A 1 189 LYS 189 192 192 LYS LYS A . n 
A 1 190 THR 190 193 193 THR THR A . n 
A 1 191 VAL 191 194 194 VAL VAL A . n 
A 1 192 THR 192 195 195 THR THR A . n 
A 1 193 ILE 193 196 196 ILE ILE A . n 
A 1 194 PHE 194 197 197 PHE PHE A . n 
A 1 195 GLY 195 198 198 GLY GLY A . n 
A 1 196 GLU 196 199 199 GLU GLU A . n 
A 1 197 SER 197 200 200 SER SER A . n 
A 1 198 ALA 198 201 201 ALA ALA A . n 
A 1 199 GLY 199 202 202 GLY GLY A . n 
A 1 200 GLY 200 203 203 GLY GLY A . n 
A 1 201 ALA 201 204 204 ALA ALA A . n 
A 1 202 SER 202 205 205 SER SER A . n 
A 1 203 VAL 203 206 206 VAL VAL A . n 
A 1 204 GLY 204 207 207 GLY GLY A . n 
A 1 205 MET 205 208 208 MET MET A . n 
A 1 206 HIS 206 209 209 HIS HIS A . n 
A 1 207 ILE 207 210 210 ILE ILE A . n 
A 1 208 LEU 208 211 211 LEU LEU A . n 
A 1 209 SER 209 212 212 SER SER A . n 
A 1 210 PRO 210 213 213 PRO PRO A . n 
A 1 211 GLY 211 214 214 GLY GLY A . n 
A 1 212 SER 212 215 215 SER SER A . n 
A 1 213 ARG 213 216 216 ARG ARG A . n 
A 1 214 ASP 214 217 217 ASP ASP A . n 
A 1 215 LEU 215 218 218 LEU LEU A . n 
A 1 216 PHE 216 219 219 PHE PHE A . n 
A 1 217 ARG 217 220 220 ARG ARG A . n 
A 1 218 ARG 218 221 221 ARG ARG A . n 
A 1 219 ALA 219 222 222 ALA ALA A . n 
A 1 220 ILE 220 223 223 ILE ILE A . n 
A 1 221 LEU 221 224 224 LEU LEU A . n 
A 1 222 GLN 222 225 225 GLN GLN A . n 
A 1 223 SER 223 226 226 SER SER A . n 
A 1 224 GLY 224 227 227 GLY GLY A . n 
A 1 225 SER 225 228 228 SER SER A . n 
A 1 226 PRO 226 229 229 PRO PRO A . n 
A 1 227 ASN 227 230 230 ASN ASN A . n 
A 1 228 CYS 228 231 231 CYS CYS A . n 
A 1 229 PRO 229 232 232 PRO PRO A . n 
A 1 230 TRP 230 233 233 TRP TRP A . n 
A 1 231 ALA 231 234 234 ALA ALA A . n 
A 1 232 SER 232 235 235 SER SER A . n 
A 1 233 VAL 233 236 236 VAL VAL A . n 
A 1 234 SER 234 237 237 SER SER A . n 
A 1 235 VAL 235 238 238 VAL VAL A . n 
A 1 236 ALA 236 239 239 ALA ALA A . n 
A 1 237 GLU 237 240 240 GLU GLU A . n 
A 1 238 GLY 238 241 241 GLY GLY A . n 
A 1 239 ARG 239 242 242 ARG ARG A . n 
A 1 240 ARG 240 243 243 ARG ARG A . n 
A 1 241 ARG 241 244 244 ARG ARG A . n 
A 1 242 ALA 242 245 245 ALA ALA A . n 
A 1 243 VAL 243 246 246 VAL VAL A . n 
A 1 244 GLU 244 247 247 GLU GLU A . n 
A 1 245 LEU 245 248 248 LEU LEU A . n 
A 1 246 GLY 246 249 249 GLY GLY A . n 
A 1 247 ARG 247 250 250 ARG ARG A . n 
A 1 248 ASN 248 251 251 ASN ASN A . n 
A 1 249 LEU 249 252 252 LEU LEU A . n 
A 1 250 ASN 250 253 253 ASN ASN A . n 
A 1 251 CYS 251 254 254 CYS CYS A . n 
A 1 252 ASN 252 255 255 ASN ASN A . n 
A 1 253 LEU 253 256 256 LEU LEU A . n 
A 1 254 ASN 254 257 257 ASN ASN A . n 
A 1 255 SER 255 258 258 SER SER A . n 
A 1 256 ASP 256 259 259 ASP ASP A . n 
A 1 257 GLU 257 260 260 GLU GLU A . n 
A 1 258 GLU 258 261 261 GLU GLU A . n 
A 1 259 LEU 259 262 262 LEU LEU A . n 
A 1 260 ILE 260 263 263 ILE ILE A . n 
A 1 261 HIS 261 264 264 HIS HIS A . n 
A 1 262 CYS 262 265 265 CYS CYS A . n 
A 1 263 LEU 263 266 266 LEU LEU A . n 
A 1 264 ARG 264 267 267 ARG ARG A . n 
A 1 265 GLU 265 268 268 GLU GLU A . n 
A 1 266 LYS 266 269 269 LYS LYS A . n 
A 1 267 LYS 267 270 270 LYS LYS A . n 
A 1 268 PRO 268 271 271 PRO PRO A . n 
A 1 269 GLN 269 272 272 GLN GLN A . n 
A 1 270 GLU 270 273 273 GLU GLU A . n 
A 1 271 LEU 271 274 274 LEU LEU A . n 
A 1 272 ILE 272 275 275 ILE ILE A . n 
A 1 273 ASP 273 276 276 ASP ASP A . n 
A 1 274 VAL 274 277 277 VAL VAL A . n 
A 1 275 GLU 275 278 278 GLU GLU A . n 
A 1 276 TRP 276 279 279 TRP TRP A . n 
A 1 277 ASN 277 280 280 ASN ASN A . n 
A 1 278 VAL 278 281 281 VAL VAL A . n 
A 1 279 LEU 279 282 282 LEU LEU A . n 
A 1 280 PRO 280 283 283 PRO PRO A . n 
A 1 281 PHE 281 284 284 PHE PHE A . n 
A 1 282 ASP 282 285 285 ASP ASP A . n 
A 1 283 SER 283 286 286 SER SER A . n 
A 1 284 ILE 284 287 287 ILE ILE A . n 
A 1 285 PHE 285 288 288 PHE PHE A . n 
A 1 286 ARG 286 289 289 ARG ARG A . n 
A 1 287 PHE 287 290 290 PHE PHE A . n 
A 1 288 SER 288 291 291 SER SER A . n 
A 1 289 PHE 289 292 292 PHE PHE A . n 
A 1 290 VAL 290 293 293 VAL VAL A . n 
A 1 291 PRO 291 294 294 PRO PRO A . n 
A 1 292 VAL 292 295 295 VAL VAL A . n 
A 1 293 ILE 293 296 296 ILE ILE A . n 
A 1 294 ASP 294 297 297 ASP ASP A . n 
A 1 295 GLY 295 298 298 GLY GLY A . n 
A 1 296 GLU 296 299 299 GLU GLU A . n 
A 1 297 PHE 297 300 300 PHE PHE A . n 
A 1 298 PHE 298 301 301 PHE PHE A . n 
A 1 299 PRO 299 302 302 PRO PRO A . n 
A 1 300 THR 300 303 303 THR THR A . n 
A 1 301 SER 301 304 304 SER SER A . n 
A 1 302 LEU 302 305 305 LEU LEU A . n 
A 1 303 GLU 303 306 306 GLU GLU A . n 
A 1 304 SER 304 307 307 SER SER A . n 
A 1 305 MET 305 308 308 MET MET A . n 
A 1 306 LEU 306 309 309 LEU LEU A . n 
A 1 307 ASN 307 310 310 ASN ASN A . n 
A 1 308 SER 308 311 311 SER SER A . n 
A 1 309 GLY 309 312 312 GLY GLY A . n 
A 1 310 ASN 310 313 313 ASN ASN A . n 
A 1 311 PHE 311 314 314 PHE PHE A . n 
A 1 312 LYS 312 315 315 LYS LYS A . n 
A 1 313 LYS 313 316 316 LYS LYS A . n 
A 1 314 THR 314 317 317 THR THR A . n 
A 1 315 GLN 315 318 318 GLN GLN A . n 
A 1 316 ILE 316 319 319 ILE ILE A . n 
A 1 317 LEU 317 320 320 LEU LEU A . n 
A 1 318 LEU 318 321 321 LEU LEU A . n 
A 1 319 GLY 319 322 322 GLY GLY A . n 
A 1 320 VAL 320 323 323 VAL VAL A . n 
A 1 321 ASN 321 324 324 ASN ASN A . n 
A 1 322 LYS 322 325 325 LYS LYS A . n 
A 1 323 ASP 323 326 326 ASP ASP A . n 
A 1 324 GLU 324 327 327 GLU GLU A . n 
A 1 325 GLY 325 328 328 GLY GLY A . n 
A 1 326 SER 326 329 329 SER SER A . n 
A 1 327 PHE 327 330 330 PHE PHE A . n 
A 1 328 PHE 328 331 331 PHE PHE A . n 
A 1 329 LEU 329 332 332 LEU LEU A . n 
A 1 330 LEU 330 333 333 LEU LEU A . n 
A 1 331 TYR 331 334 334 TYR TYR A . n 
A 1 332 GLY 332 335 335 GLY GLY A . n 
A 1 333 ALA 333 336 336 ALA ALA A . n 
A 1 334 PRO 334 337 337 PRO PRO A . n 
A 1 335 GLY 335 338 338 GLY GLY A . n 
A 1 336 PHE 336 339 339 PHE PHE A . n 
A 1 337 SER 337 340 340 SER SER A . n 
A 1 338 LYS 338 341 341 LYS LYS A . n 
A 1 339 ASP 339 342 342 ASP ASP A . n 
A 1 340 SER 340 343 343 SER SER A . n 
A 1 341 GLU 341 344 344 GLU GLU A . n 
A 1 342 SER 342 345 345 SER SER A . n 
A 1 343 LYS 343 346 346 LYS LYS A . n 
A 1 344 ILE 344 347 347 ILE ILE A . n 
A 1 345 SER 345 348 348 SER SER A . n 
A 1 346 ARG 346 349 349 ARG ARG A . n 
A 1 347 GLU 347 350 350 GLU GLU A . n 
A 1 348 ASP 348 351 351 ASP ASP A . n 
A 1 349 PHE 349 352 352 PHE PHE A . n 
A 1 350 MET 350 353 353 MET MET A . n 
A 1 351 SER 351 354 354 SER SER A . n 
A 1 352 GLY 352 355 355 GLY GLY A . n 
A 1 353 VAL 353 356 356 VAL VAL A . n 
A 1 354 LYS 354 357 357 LYS LYS A . n 
A 1 355 LEU 355 358 358 LEU LEU A . n 
A 1 356 SER 356 359 359 SER SER A . n 
A 1 357 VAL 357 360 360 VAL VAL A . n 
A 1 358 PRO 358 361 361 PRO PRO A . n 
A 1 359 HIS 359 362 362 HIS HIS A . n 
A 1 360 ALA 360 363 363 ALA ALA A . n 
A 1 361 ASN 361 364 364 ASN ASN A . n 
A 1 362 ASP 362 365 365 ASP ASP A . n 
A 1 363 LEU 363 366 366 LEU LEU A . n 
A 1 364 GLY 364 367 367 GLY GLY A . n 
A 1 365 LEU 365 368 368 LEU LEU A . n 
A 1 366 ASP 366 369 369 ASP ASP A . n 
A 1 367 ALA 367 370 370 ALA ALA A . n 
A 1 368 VAL 368 371 371 VAL VAL A . n 
A 1 369 THR 369 372 372 THR THR A . n 
A 1 370 LEU 370 373 373 LEU LEU A . n 
A 1 371 GLN 371 374 374 GLN GLN A . n 
A 1 372 TYR 372 375 375 TYR TYR A . n 
A 1 373 THR 373 376 376 THR THR A . n 
A 1 374 ASP 374 377 377 ASP ASP A . n 
A 1 375 TRP 375 378 378 TRP TRP A . n 
A 1 376 MET 376 379 379 MET MET A . n 
A 1 377 ASP 377 380 380 ASP ASP A . n 
A 1 378 ASP 378 381 381 ASP ASP A . n 
A 1 379 ASN 379 382 382 ASN ASN A . n 
A 1 380 ASN 380 383 383 ASN ASN A . n 
A 1 381 GLY 381 384 384 GLY GLY A . n 
A 1 382 ILE 382 385 385 ILE ILE A . n 
A 1 383 LYS 383 386 386 LYS LYS A . n 
A 1 384 ASN 384 387 387 ASN ASN A . n 
A 1 385 ARG 385 388 388 ARG ARG A . n 
A 1 386 ASP 386 389 389 ASP ASP A . n 
A 1 387 GLY 387 390 390 GLY GLY A . n 
A 1 388 LEU 388 391 391 LEU LEU A . n 
A 1 389 ASP 389 392 392 ASP ASP A . n 
A 1 390 ASP 390 393 393 ASP ASP A . n 
A 1 391 ILE 391 394 394 ILE ILE A . n 
A 1 392 VAL 392 395 395 VAL VAL A . n 
A 1 393 GLY 393 396 396 GLY GLY A . n 
A 1 394 ASP 394 397 397 ASP ASP A . n 
A 1 395 HIS 395 398 398 HIS HIS A . n 
A 1 396 ASN 396 399 399 ASN ASN A . n 
A 1 397 VAL 397 400 400 VAL VAL A . n 
A 1 398 ILE 398 401 401 ILE ILE A . n 
A 1 399 CYS 399 402 402 CYS CYS A . n 
A 1 400 PRO 400 403 403 PRO PRO A . n 
A 1 401 LEU 401 404 404 LEU LEU A . n 
A 1 402 MET 402 405 405 MET MET A . n 
A 1 403 HIS 403 406 406 HIS HIS A . n 
A 1 404 PHE 404 407 407 PHE PHE A . n 
A 1 405 VAL 405 408 408 VAL VAL A . n 
A 1 406 ASN 406 409 409 ASN ASN A . n 
A 1 407 LYS 407 410 410 LYS LYS A . n 
A 1 408 TYR 408 411 411 TYR TYR A . n 
A 1 409 THR 409 412 412 THR THR A . n 
A 1 410 LYS 410 413 413 LYS LYS A . n 
A 1 411 PHE 411 414 414 PHE PHE A . n 
A 1 412 GLY 412 415 415 GLY GLY A . n 
A 1 413 ASN 413 416 416 ASN ASN A . n 
A 1 414 GLY 414 417 417 GLY GLY A . n 
A 1 415 THR 415 418 418 THR THR A . n 
A 1 416 TYR 416 419 419 TYR TYR A . n 
A 1 417 LEU 417 420 420 LEU LEU A . n 
A 1 418 TYR 418 421 421 TYR TYR A . n 
A 1 419 PHE 419 422 422 PHE PHE A . n 
A 1 420 PHE 420 423 423 PHE PHE A . n 
A 1 421 ASN 421 424 424 ASN ASN A . n 
A 1 422 HIS 422 425 425 HIS HIS A . n 
A 1 423 ARG 423 426 426 ARG ARG A . n 
A 1 424 ALA 424 427 427 ALA ALA A . n 
A 1 425 SER 425 428 428 SER SER A . n 
A 1 426 ASN 426 429 429 ASN ASN A . n 
A 1 427 LEU 427 430 430 LEU LEU A . n 
A 1 428 VAL 428 431 431 VAL VAL A . n 
A 1 429 TRP 429 432 432 TRP TRP A . n 
A 1 430 PRO 430 433 433 PRO PRO A . n 
A 1 431 GLU 431 434 434 GLU GLU A . n 
A 1 432 TRP 432 435 435 TRP TRP A . n 
A 1 433 MET 433 436 436 MET MET A . n 
A 1 434 GLY 434 437 437 GLY GLY A . n 
A 1 435 VAL 435 438 438 VAL VAL A . n 
A 1 436 ILE 436 439 439 ILE ILE A . n 
A 1 437 HIS 437 440 440 HIS HIS A . n 
A 1 438 GLY 438 441 441 GLY GLY A . n 
A 1 439 TYR 439 442 442 TYR TYR A . n 
A 1 440 GLU 440 443 443 GLU GLU A . n 
A 1 441 ILE 441 444 444 ILE ILE A . n 
A 1 442 GLU 442 445 445 GLU GLU A . n 
A 1 443 PHE 443 446 446 PHE PHE A . n 
A 1 444 VAL 444 447 447 VAL VAL A . n 
A 1 445 PHE 445 448 448 PHE PHE A . n 
A 1 446 GLY 446 449 449 GLY GLY A . n 
A 1 447 LEU 447 450 450 LEU LEU A . n 
A 1 448 PRO 448 451 451 PRO PRO A . n 
A 1 449 LEU 449 452 452 LEU LEU A . n 
A 1 450 VAL 450 453 453 VAL VAL A . n 
A 1 451 LYS 451 454 454 LYS LYS A . n 
A 1 452 GLU 452 455 455 GLU GLU A . n 
A 1 453 LEU 453 456 456 LEU LEU A . n 
A 1 454 ASN 454 457 457 ASN ASN A . n 
A 1 455 TYR 455 458 458 TYR TYR A . n 
A 1 456 THR 456 459 459 THR THR A . n 
A 1 457 ALA 457 460 460 ALA ALA A . n 
A 1 458 GLU 458 461 461 GLU GLU A . n 
A 1 459 GLU 459 462 462 GLU GLU A . n 
A 1 460 GLU 460 463 463 GLU GLU A . n 
A 1 461 ALA 461 464 464 ALA ALA A . n 
A 1 462 LEU 462 465 465 LEU LEU A . n 
A 1 463 SER 463 466 466 SER SER A . n 
A 1 464 ARG 464 467 467 ARG ARG A . n 
A 1 465 ARG 465 468 468 ARG ARG A . n 
A 1 466 ILE 466 469 469 ILE ILE A . n 
A 1 467 MET 467 470 470 MET MET A . n 
A 1 468 HIS 468 471 471 HIS HIS A . n 
A 1 469 TYR 469 472 472 TYR TYR A . n 
A 1 470 TRP 470 473 473 TRP TRP A . n 
A 1 471 ALA 471 474 474 ALA ALA A . n 
A 1 472 THR 472 475 475 THR THR A . n 
A 1 473 PHE 473 476 476 PHE PHE A . n 
A 1 474 ALA 474 477 477 ALA ALA A . n 
A 1 475 LYS 475 478 478 LYS LYS A . n 
A 1 476 THR 476 479 479 THR THR A . n 
A 1 477 GLY 477 480 480 GLY GLY A . n 
A 1 478 ASN 478 481 481 ASN ASN A . n 
A 1 479 PRO 479 482 482 PRO PRO A . n 
A 1 480 ASN 480 483 483 ASN ASN A . n 
A 1 481 GLU 481 484 484 GLU GLU A . n 
A 1 482 PRO 482 485 485 PRO PRO A . n 
A 1 483 HIS 483 486 486 HIS HIS A . n 
A 1 484 SER 484 487 487 SER SER A . n 
A 1 485 GLN 485 488 488 GLN GLN A . n 
A 1 486 GLU 486 489 489 GLU GLU A . n 
A 1 487 SER 487 490 490 SER SER A . n 
A 1 488 LYS 488 491 491 LYS LYS A . n 
A 1 489 TRP 489 492 492 TRP TRP A . n 
A 1 490 PRO 490 493 493 PRO PRO A . n 
A 1 491 LEU 491 494 494 LEU LEU A . n 
A 1 492 PHE 492 495 495 PHE PHE A . n 
A 1 493 THR 493 496 496 THR THR A . n 
A 1 494 THR 494 497 497 THR THR A . n 
A 1 495 LYS 495 498 498 LYS LYS A . n 
A 1 496 GLU 496 499 499 GLU GLU A . n 
A 1 497 GLN 497 500 500 GLN GLN A . n 
A 1 498 LYS 498 501 501 LYS LYS A . n 
A 1 499 PHE 499 502 502 PHE PHE A . n 
A 1 500 ILE 500 503 503 ILE ILE A . n 
A 1 501 ASP 501 504 504 ASP ASP A . n 
A 1 502 LEU 502 505 505 LEU LEU A . n 
A 1 503 ASN 503 506 506 ASN ASN A . n 
A 1 504 THR 504 507 507 THR THR A . n 
A 1 505 GLU 505 508 508 GLU GLU A . n 
A 1 506 PRO 506 509 509 PRO PRO A . n 
A 1 507 MET 507 510 510 MET MET A . n 
A 1 508 LYS 508 511 511 LYS LYS A . n 
A 1 509 VAL 509 512 512 VAL VAL A . n 
A 1 510 HIS 510 513 513 HIS HIS A . n 
A 1 511 GLN 511 514 514 GLN GLN A . n 
A 1 512 ARG 512 515 515 ARG ARG A . n 
A 1 513 LEU 513 516 516 LEU LEU A . n 
A 1 514 ARG 514 517 517 ARG ARG A . n 
A 1 515 VAL 515 518 518 VAL VAL A . n 
A 1 516 GLN 516 519 519 GLN GLN A . n 
A 1 517 MET 517 520 520 MET MET A . n 
A 1 518 CYS 518 521 521 CYS CYS A . n 
A 1 519 VAL 519 522 522 VAL VAL A . n 
A 1 520 PHE 520 523 523 PHE PHE A . n 
A 1 521 TRP 521 524 524 TRP TRP A . n 
A 1 522 ASN 522 525 525 ASN ASN A . n 
A 1 523 GLN 523 526 526 GLN GLN A . n 
A 1 524 PHE 524 527 527 PHE PHE A . n 
A 1 525 LEU 525 528 528 LEU LEU A . n 
A 1 526 PRO 526 529 529 PRO PRO A . n 
A 1 527 LYS 527 530 530 LYS LYS A . n 
A 1 528 LEU 528 531 531 LEU LEU A . n 
A 1 529 LEU 529 532 532 LEU LEU A . n 
A 1 530 ASN 530 533 533 ASN ASN A . n 
A 1 531 ALA 531 534 534 ALA ALA A . n 
A 1 532 THR 532 535 535 THR THR A . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 56  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 413 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 1281 ? E HOH . 
2 1 A HOH 1496 ? E HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-07-17 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    1550 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    1573 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.15 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 1563 ? ? 1_555 O A HOH 1563 ? ? 4_556 1.92 
2 1 O A HOH 1465 ? ? 1_555 O A HOH 1465 ? ? 5_675 2.05 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 22  ? ? -164.31 116.54  
2  1 PHE A 45  ? ? 78.47   -13.89  
3  1 ALA A 60  ? ? -111.04 53.54   
4  1 SER A 108 ? ? -163.67 72.37   
5  1 ALA A 164 ? ? -152.07 67.52   
6  1 SER A 200 ? ? 57.98   -123.52 
7  1 GLU A 299 ? ? -128.10 -74.53  
8  1 THR A 317 ? ? -162.84 -161.33 
9  1 ASP A 380 ? ? -164.45 55.18   
10 1 VAL A 400 ? ? -126.31 -64.25  
11 1 ASN A 457 ? ? 72.50   39.55   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASN 42  ? CG  ? A ASN 39  CG  
2  1 Y 1 A ASN 42  ? OD1 ? A ASN 39  OD1 
3  1 Y 1 A ASN 42  ? ND2 ? A ASN 39  ND2 
4  1 Y 1 A ARG 46  ? CZ  ? A ARG 43  CZ  
5  1 Y 1 A ARG 46  ? NH1 ? A ARG 43  NH1 
6  1 Y 1 A ARG 46  ? NH2 ? A ARG 43  NH2 
7  1 Y 1 A LYS 52  ? CG  ? A LYS 49  CG  
8  1 Y 1 A LYS 52  ? CD  ? A LYS 49  CD  
9  1 Y 1 A LYS 52  ? CE  ? A LYS 49  CE  
10 1 Y 1 A LYS 52  ? NZ  ? A LYS 49  NZ  
11 1 Y 1 A GLU 89  ? CD  ? A GLU 86  CD  
12 1 Y 1 A GLU 89  ? OE1 ? A GLU 86  OE1 
13 1 Y 1 A GLU 89  ? OE2 ? A GLU 86  OE2 
14 1 Y 1 A GLU 260 ? OE1 ? A GLU 257 OE1 
15 1 Y 1 A GLU 260 ? OE2 ? A GLU 257 OE2 
16 1 Y 1 A GLU 268 ? OE1 ? A GLU 265 OE1 
17 1 Y 1 A GLU 268 ? OE2 ? A GLU 265 OE2 
18 1 Y 1 A LYS 270 ? CE  ? A LYS 267 CE  
19 1 Y 1 A LYS 270 ? NZ  ? A LYS 267 NZ  
20 1 Y 1 A LYS 357 ? CG  ? A LYS 354 CG  
21 1 Y 1 A LYS 357 ? CD  ? A LYS 354 CD  
22 1 Y 1 A LYS 357 ? CE  ? A LYS 354 CE  
23 1 Y 1 A LYS 357 ? NZ  ? A LYS 354 NZ  
24 1 Y 1 A LYS 491 ? CD  ? A LYS 488 CD  
25 1 Y 1 A LYS 491 ? CE  ? A LYS 488 CE  
26 1 Y 1 A LYS 491 ? NZ  ? A LYS 488 NZ  
27 1 Y 1 A LYS 498 ? CG  ? A LYS 495 CG  
28 1 Y 1 A LYS 498 ? CD  ? A LYS 495 CD  
29 1 Y 1 A LYS 498 ? CE  ? A LYS 495 CE  
30 1 Y 1 A LYS 498 ? NZ  ? A LYS 495 NZ  
31 1 Y 1 A GLU 499 ? OE1 ? A GLU 496 OE1 
32 1 Y 1 A GLU 499 ? OE2 ? A GLU 496 OE2 
33 1 Y 1 A GLU 508 ? CD  ? A GLU 505 CD  
34 1 Y 1 A GLU 508 ? OE1 ? A GLU 505 OE1 
35 1 Y 1 A GLU 508 ? OE2 ? A GLU 505 OE2 
36 1 Y 1 A LYS 511 ? CD  ? A LYS 508 CD  
37 1 Y 1 A LYS 511 ? CE  ? A LYS 508 CE  
38 1 Y 1 A LYS 511 ? NZ  ? A LYS 508 NZ  
39 1 Y 1 A ARG 515 ? CZ  ? A ARG 512 CZ  
40 1 Y 1 A ARG 515 ? NH1 ? A ARG 512 NH1 
41 1 Y 1 A ARG 515 ? NH2 ? A ARG 512 NH2 
42 1 Y 1 A GLN 526 ? OE1 ? A GLN 523 OE1 
43 1 Y 1 A GLN 526 ? NE2 ? A GLN 523 NE2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 N-ACETYL-D-GLUCOSAMINE                NAG 
3 '1-DEOXY-1-THIO-HEPTAETHYLENE GLYCOL' PE7 
4 water                                 HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1   9010 9010 NAG NAG A . 
C 2 NAG 1   9020 9020 NAG NAG A . 
D 3 PE7 1   999  999  PE7 PE7 A . 
E 4 HOH 1   1001 1001 HOH WAT A . 
E 4 HOH 2   1002 1002 HOH WAT A . 
E 4 HOH 3   1003 1003 HOH WAT A . 
E 4 HOH 4   1004 1004 HOH WAT A . 
E 4 HOH 5   1005 1005 HOH WAT A . 
E 4 HOH 6   1006 1006 HOH WAT A . 
E 4 HOH 7   1007 1007 HOH WAT A . 
E 4 HOH 8   1008 1008 HOH WAT A . 
E 4 HOH 9   1009 1009 HOH WAT A . 
E 4 HOH 10  1010 1010 HOH WAT A . 
E 4 HOH 11  1011 1011 HOH WAT A . 
E 4 HOH 12  1012 1012 HOH WAT A . 
E 4 HOH 13  1013 1013 HOH WAT A . 
E 4 HOH 14  1014 1014 HOH WAT A . 
E 4 HOH 15  1015 1015 HOH WAT A . 
E 4 HOH 16  1016 1016 HOH WAT A . 
E 4 HOH 17  1017 1017 HOH WAT A . 
E 4 HOH 18  1018 1018 HOH WAT A . 
E 4 HOH 19  1019 1019 HOH WAT A . 
E 4 HOH 20  1020 1020 HOH WAT A . 
E 4 HOH 21  1021 1021 HOH WAT A . 
E 4 HOH 22  1022 1022 HOH WAT A . 
E 4 HOH 23  1023 1023 HOH WAT A . 
E 4 HOH 24  1024 1024 HOH WAT A . 
E 4 HOH 25  1025 1025 HOH WAT A . 
E 4 HOH 26  1026 1026 HOH WAT A . 
E 4 HOH 27  1027 1027 HOH WAT A . 
E 4 HOH 28  1028 1028 HOH WAT A . 
E 4 HOH 29  1029 1029 HOH WAT A . 
E 4 HOH 30  1030 1030 HOH WAT A . 
E 4 HOH 31  1031 1031 HOH WAT A . 
E 4 HOH 32  1032 1032 HOH WAT A . 
E 4 HOH 33  1033 1033 HOH WAT A . 
E 4 HOH 34  1034 1034 HOH WAT A . 
E 4 HOH 35  1035 1035 HOH WAT A . 
E 4 HOH 36  1036 1036 HOH WAT A . 
E 4 HOH 37  1037 1037 HOH WAT A . 
E 4 HOH 38  1038 1038 HOH WAT A . 
E 4 HOH 39  1039 1039 HOH WAT A . 
E 4 HOH 40  1040 1040 HOH WAT A . 
E 4 HOH 41  1041 1041 HOH WAT A . 
E 4 HOH 42  1042 1042 HOH WAT A . 
E 4 HOH 43  1043 1043 HOH WAT A . 
E 4 HOH 44  1044 1044 HOH WAT A . 
E 4 HOH 45  1045 1045 HOH WAT A . 
E 4 HOH 46  1046 1046 HOH WAT A . 
E 4 HOH 47  1047 1047 HOH WAT A . 
E 4 HOH 48  1048 1048 HOH WAT A . 
E 4 HOH 49  1049 1049 HOH WAT A . 
E 4 HOH 50  1050 1050 HOH WAT A . 
E 4 HOH 51  1051 1051 HOH WAT A . 
E 4 HOH 52  1052 1052 HOH WAT A . 
E 4 HOH 53  1053 1053 HOH WAT A . 
E 4 HOH 54  1054 1054 HOH WAT A . 
E 4 HOH 55  1055 1055 HOH WAT A . 
E 4 HOH 56  1056 1056 HOH WAT A . 
E 4 HOH 57  1057 1057 HOH WAT A . 
E 4 HOH 58  1058 1058 HOH WAT A . 
E 4 HOH 59  1059 1059 HOH WAT A . 
E 4 HOH 60  1060 1060 HOH WAT A . 
E 4 HOH 61  1061 1061 HOH WAT A . 
E 4 HOH 62  1062 1062 HOH WAT A . 
E 4 HOH 63  1063 1063 HOH WAT A . 
E 4 HOH 64  1064 1064 HOH WAT A . 
E 4 HOH 65  1065 1065 HOH WAT A . 
E 4 HOH 66  1066 1066 HOH WAT A . 
E 4 HOH 67  1067 1067 HOH WAT A . 
E 4 HOH 68  1068 1068 HOH WAT A . 
E 4 HOH 69  1069 1069 HOH WAT A . 
E 4 HOH 70  1070 1070 HOH WAT A . 
E 4 HOH 71  1071 1071 HOH WAT A . 
E 4 HOH 72  1072 1072 HOH WAT A . 
E 4 HOH 73  1073 1073 HOH WAT A . 
E 4 HOH 74  1074 1074 HOH WAT A . 
E 4 HOH 75  1075 1075 HOH WAT A . 
E 4 HOH 76  1076 1076 HOH WAT A . 
E 4 HOH 77  1077 1077 HOH WAT A . 
E 4 HOH 78  1078 1078 HOH WAT A . 
E 4 HOH 79  1079 1079 HOH WAT A . 
E 4 HOH 80  1080 1080 HOH WAT A . 
E 4 HOH 81  1081 1081 HOH WAT A . 
E 4 HOH 82  1082 1082 HOH WAT A . 
E 4 HOH 83  1083 1083 HOH WAT A . 
E 4 HOH 84  1084 1084 HOH WAT A . 
E 4 HOH 85  1085 1085 HOH WAT A . 
E 4 HOH 86  1086 1086 HOH WAT A . 
E 4 HOH 87  1087 1087 HOH WAT A . 
E 4 HOH 88  1088 1088 HOH WAT A . 
E 4 HOH 89  1089 1089 HOH WAT A . 
E 4 HOH 90  1090 1090 HOH WAT A . 
E 4 HOH 91  1091 1091 HOH WAT A . 
E 4 HOH 92  1092 1092 HOH WAT A . 
E 4 HOH 93  1093 1093 HOH WAT A . 
E 4 HOH 94  1094 1094 HOH WAT A . 
E 4 HOH 95  1095 1095 HOH WAT A . 
E 4 HOH 96  1096 1096 HOH WAT A . 
E 4 HOH 97  1097 1097 HOH WAT A . 
E 4 HOH 98  1098 1098 HOH WAT A . 
E 4 HOH 99  1099 1099 HOH WAT A . 
E 4 HOH 100 1100 1100 HOH WAT A . 
E 4 HOH 101 1101 1101 HOH WAT A . 
E 4 HOH 102 1102 1102 HOH WAT A . 
E 4 HOH 103 1103 1103 HOH WAT A . 
E 4 HOH 104 1104 1104 HOH WAT A . 
E 4 HOH 105 1105 1105 HOH WAT A . 
E 4 HOH 106 1106 1106 HOH WAT A . 
E 4 HOH 107 1107 1107 HOH WAT A . 
E 4 HOH 108 1108 1108 HOH WAT A . 
E 4 HOH 109 1109 1109 HOH WAT A . 
E 4 HOH 110 1110 1110 HOH WAT A . 
E 4 HOH 111 1111 1111 HOH WAT A . 
E 4 HOH 112 1112 1112 HOH WAT A . 
E 4 HOH 113 1113 1113 HOH WAT A . 
E 4 HOH 114 1114 1114 HOH WAT A . 
E 4 HOH 115 1115 1115 HOH WAT A . 
E 4 HOH 116 1116 1116 HOH WAT A . 
E 4 HOH 117 1117 1117 HOH WAT A . 
E 4 HOH 118 1118 1118 HOH WAT A . 
E 4 HOH 119 1119 1119 HOH WAT A . 
E 4 HOH 120 1120 1120 HOH WAT A . 
E 4 HOH 121 1121 1121 HOH WAT A . 
E 4 HOH 122 1122 1122 HOH WAT A . 
E 4 HOH 123 1123 1123 HOH WAT A . 
E 4 HOH 124 1124 1124 HOH WAT A . 
E 4 HOH 125 1125 1125 HOH WAT A . 
E 4 HOH 126 1126 1126 HOH WAT A . 
E 4 HOH 127 1127 1127 HOH WAT A . 
E 4 HOH 128 1128 1128 HOH WAT A . 
E 4 HOH 129 1129 1129 HOH WAT A . 
E 4 HOH 130 1130 1130 HOH WAT A . 
E 4 HOH 131 1131 1131 HOH WAT A . 
E 4 HOH 132 1132 1132 HOH WAT A . 
E 4 HOH 133 1133 1133 HOH WAT A . 
E 4 HOH 134 1134 1134 HOH WAT A . 
E 4 HOH 135 1135 1135 HOH WAT A . 
E 4 HOH 136 1136 1136 HOH WAT A . 
E 4 HOH 137 1137 1137 HOH WAT A . 
E 4 HOH 138 1138 1138 HOH WAT A . 
E 4 HOH 139 1139 1139 HOH WAT A . 
E 4 HOH 140 1140 1140 HOH WAT A . 
E 4 HOH 141 1141 1141 HOH WAT A . 
E 4 HOH 142 1142 1142 HOH WAT A . 
E 4 HOH 143 1143 1143 HOH WAT A . 
E 4 HOH 144 1144 1144 HOH WAT A . 
E 4 HOH 145 1145 1145 HOH WAT A . 
E 4 HOH 146 1146 1146 HOH WAT A . 
E 4 HOH 147 1147 1147 HOH WAT A . 
E 4 HOH 148 1148 1148 HOH WAT A . 
E 4 HOH 149 1149 1149 HOH WAT A . 
E 4 HOH 150 1150 1150 HOH WAT A . 
E 4 HOH 151 1151 1151 HOH WAT A . 
E 4 HOH 152 1152 1152 HOH WAT A . 
E 4 HOH 153 1153 1153 HOH WAT A . 
E 4 HOH 154 1154 1154 HOH WAT A . 
E 4 HOH 155 1155 1155 HOH WAT A . 
E 4 HOH 156 1156 1156 HOH WAT A . 
E 4 HOH 157 1157 1157 HOH WAT A . 
E 4 HOH 158 1158 1158 HOH WAT A . 
E 4 HOH 159 1159 1159 HOH WAT A . 
E 4 HOH 160 1160 1160 HOH WAT A . 
E 4 HOH 161 1161 1161 HOH WAT A . 
E 4 HOH 162 1162 1162 HOH WAT A . 
E 4 HOH 163 1163 1163 HOH WAT A . 
E 4 HOH 164 1164 1164 HOH WAT A . 
E 4 HOH 165 1165 1165 HOH WAT A . 
E 4 HOH 166 1166 1166 HOH WAT A . 
E 4 HOH 167 1167 1167 HOH WAT A . 
E 4 HOH 168 1168 1168 HOH WAT A . 
E 4 HOH 169 1169 1169 HOH WAT A . 
E 4 HOH 170 1170 1170 HOH WAT A . 
E 4 HOH 171 1171 1171 HOH WAT A . 
E 4 HOH 172 1172 1172 HOH WAT A . 
E 4 HOH 173 1173 1173 HOH WAT A . 
E 4 HOH 174 1174 1174 HOH WAT A . 
E 4 HOH 175 1175 1175 HOH WAT A . 
E 4 HOH 176 1176 1176 HOH WAT A . 
E 4 HOH 177 1177 1177 HOH WAT A . 
E 4 HOH 178 1178 1178 HOH WAT A . 
E 4 HOH 179 1179 1179 HOH WAT A . 
E 4 HOH 180 1180 1180 HOH WAT A . 
E 4 HOH 181 1181 1181 HOH WAT A . 
E 4 HOH 182 1182 1182 HOH WAT A . 
E 4 HOH 183 1183 1183 HOH WAT A . 
E 4 HOH 184 1184 1184 HOH WAT A . 
E 4 HOH 185 1185 1185 HOH WAT A . 
E 4 HOH 186 1186 1186 HOH WAT A . 
E 4 HOH 187 1187 1187 HOH WAT A . 
E 4 HOH 188 1188 1188 HOH WAT A . 
E 4 HOH 189 1189 1189 HOH WAT A . 
E 4 HOH 190 1190 1190 HOH WAT A . 
E 4 HOH 191 1191 1191 HOH WAT A . 
E 4 HOH 192 1192 1192 HOH WAT A . 
E 4 HOH 193 1193 1193 HOH WAT A . 
E 4 HOH 194 1194 1194 HOH WAT A . 
E 4 HOH 195 1195 1195 HOH WAT A . 
E 4 HOH 196 1196 1196 HOH WAT A . 
E 4 HOH 197 1197 1197 HOH WAT A . 
E 4 HOH 198 1198 1198 HOH WAT A . 
E 4 HOH 199 1199 1199 HOH WAT A . 
E 4 HOH 200 1200 1200 HOH WAT A . 
E 4 HOH 201 1201 1201 HOH WAT A . 
E 4 HOH 202 1202 1202 HOH WAT A . 
E 4 HOH 203 1203 1203 HOH WAT A . 
E 4 HOH 204 1204 1204 HOH WAT A . 
E 4 HOH 205 1205 1205 HOH WAT A . 
E 4 HOH 206 1206 1206 HOH WAT A . 
E 4 HOH 207 1207 1207 HOH WAT A . 
E 4 HOH 208 1208 1208 HOH WAT A . 
E 4 HOH 209 1209 1209 HOH WAT A . 
E 4 HOH 210 1210 1210 HOH WAT A . 
E 4 HOH 211 1211 1211 HOH WAT A . 
E 4 HOH 212 1212 1212 HOH WAT A . 
E 4 HOH 213 1213 1213 HOH WAT A . 
E 4 HOH 214 1214 1214 HOH WAT A . 
E 4 HOH 215 1215 1215 HOH WAT A . 
E 4 HOH 216 1216 1216 HOH WAT A . 
E 4 HOH 217 1217 1217 HOH WAT A . 
E 4 HOH 218 1218 1218 HOH WAT A . 
E 4 HOH 219 1219 1219 HOH WAT A . 
E 4 HOH 220 1220 1220 HOH WAT A . 
E 4 HOH 221 1221 1221 HOH WAT A . 
E 4 HOH 222 1222 1222 HOH WAT A . 
E 4 HOH 223 1223 1223 HOH WAT A . 
E 4 HOH 224 1224 1224 HOH WAT A . 
E 4 HOH 225 1225 1225 HOH WAT A . 
E 4 HOH 226 1226 1226 HOH WAT A . 
E 4 HOH 227 1227 1227 HOH WAT A . 
E 4 HOH 228 1228 1228 HOH WAT A . 
E 4 HOH 229 1229 1229 HOH WAT A . 
E 4 HOH 230 1230 1230 HOH WAT A . 
E 4 HOH 231 1231 1231 HOH WAT A . 
E 4 HOH 232 1232 1232 HOH WAT A . 
E 4 HOH 233 1233 1233 HOH WAT A . 
E 4 HOH 234 1234 1234 HOH WAT A . 
E 4 HOH 235 1235 1235 HOH WAT A . 
E 4 HOH 236 1236 1236 HOH WAT A . 
E 4 HOH 237 1237 1237 HOH WAT A . 
E 4 HOH 238 1238 1238 HOH WAT A . 
E 4 HOH 239 1239 1239 HOH WAT A . 
E 4 HOH 240 1240 1240 HOH WAT A . 
E 4 HOH 241 1241 1241 HOH WAT A . 
E 4 HOH 242 1242 1242 HOH WAT A . 
E 4 HOH 243 1243 1243 HOH WAT A . 
E 4 HOH 244 1244 1244 HOH WAT A . 
E 4 HOH 245 1245 1245 HOH WAT A . 
E 4 HOH 246 1246 1246 HOH WAT A . 
E 4 HOH 247 1247 1247 HOH WAT A . 
E 4 HOH 248 1248 1248 HOH WAT A . 
E 4 HOH 249 1249 1249 HOH WAT A . 
E 4 HOH 250 1250 1250 HOH WAT A . 
E 4 HOH 251 1251 1251 HOH WAT A . 
E 4 HOH 252 1252 1252 HOH WAT A . 
E 4 HOH 253 1253 1253 HOH WAT A . 
E 4 HOH 254 1254 1254 HOH WAT A . 
E 4 HOH 255 1255 1255 HOH WAT A . 
E 4 HOH 256 1256 1256 HOH WAT A . 
E 4 HOH 257 1257 1257 HOH WAT A . 
E 4 HOH 258 1258 1258 HOH WAT A . 
E 4 HOH 259 1259 1259 HOH WAT A . 
E 4 HOH 260 1260 1260 HOH WAT A . 
E 4 HOH 261 1261 1261 HOH WAT A . 
E 4 HOH 262 1262 1262 HOH WAT A . 
E 4 HOH 263 1263 1263 HOH WAT A . 
E 4 HOH 264 1264 1264 HOH WAT A . 
E 4 HOH 265 1265 1265 HOH WAT A . 
E 4 HOH 266 1266 1266 HOH WAT A . 
E 4 HOH 267 1267 1267 HOH WAT A . 
E 4 HOH 268 1268 1268 HOH WAT A . 
E 4 HOH 269 1269 1269 HOH WAT A . 
E 4 HOH 270 1270 1270 HOH WAT A . 
E 4 HOH 271 1271 1271 HOH WAT A . 
E 4 HOH 272 1272 1272 HOH WAT A . 
E 4 HOH 273 1273 1273 HOH WAT A . 
E 4 HOH 274 1274 1274 HOH WAT A . 
E 4 HOH 275 1275 1275 HOH WAT A . 
E 4 HOH 276 1276 1276 HOH WAT A . 
E 4 HOH 277 1277 1277 HOH WAT A . 
E 4 HOH 278 1278 1278 HOH WAT A . 
E 4 HOH 279 1279 1279 HOH WAT A . 
E 4 HOH 280 1280 1280 HOH WAT A . 
E 4 HOH 281 1281 1281 HOH WAT A . 
E 4 HOH 282 1282 1282 HOH WAT A . 
E 4 HOH 283 1283 1283 HOH WAT A . 
E 4 HOH 284 1284 1284 HOH WAT A . 
E 4 HOH 285 1285 1285 HOH WAT A . 
E 4 HOH 286 1286 1286 HOH WAT A . 
E 4 HOH 287 1287 1287 HOH WAT A . 
E 4 HOH 288 1288 1288 HOH WAT A . 
E 4 HOH 289 1289 1289 HOH WAT A . 
E 4 HOH 290 1290 1290 HOH WAT A . 
E 4 HOH 291 1291 1291 HOH WAT A . 
E 4 HOH 292 1292 1292 HOH WAT A . 
E 4 HOH 293 1293 1293 HOH WAT A . 
E 4 HOH 294 1294 1294 HOH WAT A . 
E 4 HOH 295 1295 1295 HOH WAT A . 
E 4 HOH 296 1296 1296 HOH WAT A . 
E 4 HOH 297 1297 1297 HOH WAT A . 
E 4 HOH 298 1298 1298 HOH WAT A . 
E 4 HOH 299 1299 1299 HOH WAT A . 
E 4 HOH 300 1300 1300 HOH WAT A . 
E 4 HOH 301 1301 1301 HOH WAT A . 
E 4 HOH 302 1302 1302 HOH WAT A . 
E 4 HOH 303 1303 1303 HOH WAT A . 
E 4 HOH 304 1304 1304 HOH WAT A . 
E 4 HOH 305 1305 1305 HOH WAT A . 
E 4 HOH 306 1306 1306 HOH WAT A . 
E 4 HOH 307 1307 1307 HOH WAT A . 
E 4 HOH 308 1308 1308 HOH WAT A . 
E 4 HOH 309 1309 1309 HOH WAT A . 
E 4 HOH 310 1310 1310 HOH WAT A . 
E 4 HOH 311 1311 1311 HOH WAT A . 
E 4 HOH 312 1312 1312 HOH WAT A . 
E 4 HOH 313 1313 1313 HOH WAT A . 
E 4 HOH 314 1314 1314 HOH WAT A . 
E 4 HOH 315 1315 1315 HOH WAT A . 
E 4 HOH 316 1316 1316 HOH WAT A . 
E 4 HOH 317 1317 1317 HOH WAT A . 
E 4 HOH 318 1318 1318 HOH WAT A . 
E 4 HOH 319 1319 1319 HOH WAT A . 
E 4 HOH 320 1320 1320 HOH WAT A . 
E 4 HOH 321 1321 1321 HOH WAT A . 
E 4 HOH 322 1322 1322 HOH WAT A . 
E 4 HOH 323 1323 1323 HOH WAT A . 
E 4 HOH 324 1324 1324 HOH WAT A . 
E 4 HOH 325 1325 1325 HOH WAT A . 
E 4 HOH 326 1326 1326 HOH WAT A . 
E 4 HOH 327 1327 1327 HOH WAT A . 
E 4 HOH 328 1328 1328 HOH WAT A . 
E 4 HOH 329 1329 1329 HOH WAT A . 
E 4 HOH 330 1330 1330 HOH WAT A . 
E 4 HOH 331 1331 1331 HOH WAT A . 
E 4 HOH 332 1332 1332 HOH WAT A . 
E 4 HOH 333 1333 1333 HOH WAT A . 
E 4 HOH 334 1334 1334 HOH WAT A . 
E 4 HOH 335 1335 1335 HOH WAT A . 
E 4 HOH 336 1336 1336 HOH WAT A . 
E 4 HOH 337 1337 1337 HOH WAT A . 
E 4 HOH 338 1338 1338 HOH WAT A . 
E 4 HOH 339 1339 1339 HOH WAT A . 
E 4 HOH 340 1340 1340 HOH WAT A . 
E 4 HOH 341 1341 1341 HOH WAT A . 
E 4 HOH 342 1342 1342 HOH WAT A . 
E 4 HOH 343 1343 1343 HOH WAT A . 
E 4 HOH 344 1344 1344 HOH WAT A . 
E 4 HOH 345 1345 1345 HOH WAT A . 
E 4 HOH 346 1346 1346 HOH WAT A . 
E 4 HOH 347 1347 1347 HOH WAT A . 
E 4 HOH 348 1348 1348 HOH WAT A . 
E 4 HOH 349 1349 1349 HOH WAT A . 
E 4 HOH 350 1350 1350 HOH WAT A . 
E 4 HOH 351 1351 1351 HOH WAT A . 
E 4 HOH 352 1352 1352 HOH WAT A . 
E 4 HOH 353 1353 1353 HOH WAT A . 
E 4 HOH 354 1354 1354 HOH WAT A . 
E 4 HOH 355 1355 1355 HOH WAT A . 
E 4 HOH 356 1356 1356 HOH WAT A . 
E 4 HOH 357 1357 1357 HOH WAT A . 
E 4 HOH 358 1358 1358 HOH WAT A . 
E 4 HOH 359 1359 1359 HOH WAT A . 
E 4 HOH 360 1360 1360 HOH WAT A . 
E 4 HOH 361 1361 1361 HOH WAT A . 
E 4 HOH 362 1362 1362 HOH WAT A . 
E 4 HOH 363 1363 1363 HOH WAT A . 
E 4 HOH 364 1364 1364 HOH WAT A . 
E 4 HOH 365 1365 1365 HOH WAT A . 
E 4 HOH 366 1366 1366 HOH WAT A . 
E 4 HOH 367 1367 1367 HOH WAT A . 
E 4 HOH 368 1368 1368 HOH WAT A . 
E 4 HOH 369 1369 1369 HOH WAT A . 
E 4 HOH 370 1370 1370 HOH WAT A . 
E 4 HOH 371 1371 1371 HOH WAT A . 
E 4 HOH 372 1372 1372 HOH WAT A . 
E 4 HOH 373 1373 1373 HOH WAT A . 
E 4 HOH 374 1374 1374 HOH WAT A . 
E 4 HOH 375 1375 1375 HOH WAT A . 
E 4 HOH 376 1376 1376 HOH WAT A . 
E 4 HOH 377 1377 1377 HOH WAT A . 
E 4 HOH 378 1378 1378 HOH WAT A . 
E 4 HOH 379 1379 1379 HOH WAT A . 
E 4 HOH 380 1380 1380 HOH WAT A . 
E 4 HOH 381 1381 1381 HOH WAT A . 
E 4 HOH 382 1382 1382 HOH WAT A . 
E 4 HOH 383 1383 1383 HOH WAT A . 
E 4 HOH 384 1384 1384 HOH WAT A . 
E 4 HOH 385 1385 1385 HOH WAT A . 
E 4 HOH 386 1386 1386 HOH WAT A . 
E 4 HOH 387 1387 1387 HOH WAT A . 
E 4 HOH 388 1388 1388 HOH WAT A . 
E 4 HOH 389 1389 1389 HOH WAT A . 
E 4 HOH 390 1390 1390 HOH WAT A . 
E 4 HOH 391 1391 1391 HOH WAT A . 
E 4 HOH 392 1392 1392 HOH WAT A . 
E 4 HOH 393 1393 1393 HOH WAT A . 
E 4 HOH 394 1394 1394 HOH WAT A . 
E 4 HOH 395 1395 1395 HOH WAT A . 
E 4 HOH 396 1396 1396 HOH WAT A . 
E 4 HOH 397 1397 1397 HOH WAT A . 
E 4 HOH 398 1398 1398 HOH WAT A . 
E 4 HOH 399 1399 1399 HOH WAT A . 
E 4 HOH 400 1400 1400 HOH WAT A . 
E 4 HOH 401 1401 1401 HOH WAT A . 
E 4 HOH 402 1402 1402 HOH WAT A . 
E 4 HOH 403 1403 1403 HOH WAT A . 
E 4 HOH 404 1404 1404 HOH WAT A . 
E 4 HOH 405 1405 1405 HOH WAT A . 
E 4 HOH 406 1406 1406 HOH WAT A . 
E 4 HOH 407 1407 1407 HOH WAT A . 
E 4 HOH 408 1408 1408 HOH WAT A . 
E 4 HOH 409 1409 1409 HOH WAT A . 
E 4 HOH 410 1410 1410 HOH WAT A . 
E 4 HOH 411 1411 1411 HOH WAT A . 
E 4 HOH 412 1412 1412 HOH WAT A . 
E 4 HOH 413 1413 1413 HOH WAT A . 
E 4 HOH 414 1414 1414 HOH WAT A . 
E 4 HOH 415 1415 1415 HOH WAT A . 
E 4 HOH 416 1416 1416 HOH WAT A . 
E 4 HOH 417 1417 1417 HOH WAT A . 
E 4 HOH 418 1418 1418 HOH WAT A . 
E 4 HOH 419 1419 1419 HOH WAT A . 
E 4 HOH 420 1420 1420 HOH WAT A . 
E 4 HOH 421 1421 1421 HOH WAT A . 
E 4 HOH 422 1422 1422 HOH WAT A . 
E 4 HOH 423 1423 1423 HOH WAT A . 
E 4 HOH 424 1424 1424 HOH WAT A . 
E 4 HOH 425 1425 1425 HOH WAT A . 
E 4 HOH 426 1426 1426 HOH WAT A . 
E 4 HOH 427 1427 1427 HOH WAT A . 
E 4 HOH 428 1428 1428 HOH WAT A . 
E 4 HOH 429 1429 1429 HOH WAT A . 
E 4 HOH 430 1430 1430 HOH WAT A . 
E 4 HOH 431 1431 1431 HOH WAT A . 
E 4 HOH 432 1432 1432 HOH WAT A . 
E 4 HOH 433 1433 1433 HOH WAT A . 
E 4 HOH 434 1434 1434 HOH WAT A . 
E 4 HOH 435 1435 1435 HOH WAT A . 
E 4 HOH 436 1436 1436 HOH WAT A . 
E 4 HOH 437 1437 1437 HOH WAT A . 
E 4 HOH 438 1438 1438 HOH WAT A . 
E 4 HOH 439 1439 1439 HOH WAT A . 
E 4 HOH 440 1440 1440 HOH WAT A . 
E 4 HOH 441 1441 1441 HOH WAT A . 
E 4 HOH 442 1442 1442 HOH WAT A . 
E 4 HOH 443 1443 1443 HOH WAT A . 
E 4 HOH 444 1444 1444 HOH WAT A . 
E 4 HOH 445 1445 1445 HOH WAT A . 
E 4 HOH 446 1446 1446 HOH WAT A . 
E 4 HOH 447 1447 1447 HOH WAT A . 
E 4 HOH 448 1448 1448 HOH WAT A . 
E 4 HOH 449 1449 1449 HOH WAT A . 
E 4 HOH 450 1450 1450 HOH WAT A . 
E 4 HOH 451 1451 1451 HOH WAT A . 
E 4 HOH 452 1452 1452 HOH WAT A . 
E 4 HOH 453 1453 1453 HOH WAT A . 
E 4 HOH 454 1454 1454 HOH WAT A . 
E 4 HOH 455 1455 1455 HOH WAT A . 
E 4 HOH 456 1456 1456 HOH WAT A . 
E 4 HOH 457 1457 1457 HOH WAT A . 
E 4 HOH 458 1458 1458 HOH WAT A . 
E 4 HOH 459 1459 1459 HOH WAT A . 
E 4 HOH 460 1460 1460 HOH WAT A . 
E 4 HOH 461 1461 1461 HOH WAT A . 
E 4 HOH 462 1462 1462 HOH WAT A . 
E 4 HOH 463 1463 1463 HOH WAT A . 
E 4 HOH 464 1464 1464 HOH WAT A . 
E 4 HOH 465 1465 1465 HOH WAT A . 
E 4 HOH 466 1466 1466 HOH WAT A . 
E 4 HOH 467 1467 1467 HOH WAT A . 
E 4 HOH 468 1468 1468 HOH WAT A . 
E 4 HOH 469 1469 1469 HOH WAT A . 
E 4 HOH 470 1470 1470 HOH WAT A . 
E 4 HOH 471 1471 1471 HOH WAT A . 
E 4 HOH 472 1472 1472 HOH WAT A . 
E 4 HOH 473 1473 1473 HOH WAT A . 
E 4 HOH 474 1474 1474 HOH WAT A . 
E 4 HOH 475 1475 1475 HOH WAT A . 
E 4 HOH 476 1476 1476 HOH WAT A . 
E 4 HOH 477 1477 1477 HOH WAT A . 
E 4 HOH 478 1478 1478 HOH WAT A . 
E 4 HOH 479 1479 1479 HOH WAT A . 
E 4 HOH 480 1480 1480 HOH WAT A . 
E 4 HOH 481 1481 1481 HOH WAT A . 
E 4 HOH 482 1482 1482 HOH WAT A . 
E 4 HOH 483 1483 1483 HOH WAT A . 
E 4 HOH 484 1484 1484 HOH WAT A . 
E 4 HOH 485 1485 1485 HOH WAT A . 
E 4 HOH 486 1486 1486 HOH WAT A . 
E 4 HOH 487 1487 1487 HOH WAT A . 
E 4 HOH 488 1488 1488 HOH WAT A . 
E 4 HOH 489 1489 1489 HOH WAT A . 
E 4 HOH 490 1490 1490 HOH WAT A . 
E 4 HOH 491 1491 1491 HOH WAT A . 
E 4 HOH 492 1492 1492 HOH WAT A . 
E 4 HOH 493 1493 1493 HOH WAT A . 
E 4 HOH 494 1494 1494 HOH WAT A . 
E 4 HOH 495 1495 1495 HOH WAT A . 
E 4 HOH 496 1496 1496 HOH WAT A . 
E 4 HOH 497 1497 1497 HOH WAT A . 
E 4 HOH 498 1498 1498 HOH WAT A . 
E 4 HOH 499 1499 1499 HOH WAT A . 
E 4 HOH 500 1500 1500 HOH WAT A . 
E 4 HOH 501 1501 1501 HOH WAT A . 
E 4 HOH 502 1502 1502 HOH WAT A . 
E 4 HOH 503 1503 1503 HOH WAT A . 
E 4 HOH 504 1504 1504 HOH WAT A . 
E 4 HOH 505 1505 1505 HOH WAT A . 
E 4 HOH 506 1506 1506 HOH WAT A . 
E 4 HOH 507 1507 1507 HOH WAT A . 
E 4 HOH 508 1508 1508 HOH WAT A . 
E 4 HOH 509 1509 1509 HOH WAT A . 
E 4 HOH 510 1510 1510 HOH WAT A . 
E 4 HOH 511 1511 1511 HOH WAT A . 
E 4 HOH 512 1512 1512 HOH WAT A . 
E 4 HOH 513 1513 1513 HOH WAT A . 
E 4 HOH 514 1514 1514 HOH WAT A . 
E 4 HOH 515 1515 1515 HOH WAT A . 
E 4 HOH 516 1516 1516 HOH WAT A . 
E 4 HOH 517 1517 1517 HOH WAT A . 
E 4 HOH 518 1518 1518 HOH WAT A . 
E 4 HOH 519 1519 1519 HOH WAT A . 
E 4 HOH 520 1520 1520 HOH WAT A . 
E 4 HOH 521 1521 1521 HOH WAT A . 
E 4 HOH 522 1522 1522 HOH WAT A . 
E 4 HOH 523 1523 1523 HOH WAT A . 
E 4 HOH 524 1524 1524 HOH WAT A . 
E 4 HOH 525 1525 1525 HOH WAT A . 
E 4 HOH 526 1526 1526 HOH WAT A . 
E 4 HOH 527 1527 1527 HOH WAT A . 
E 4 HOH 528 1528 1528 HOH WAT A . 
E 4 HOH 529 1529 1529 HOH WAT A . 
E 4 HOH 530 1530 1530 HOH WAT A . 
E 4 HOH 531 1531 1531 HOH WAT A . 
E 4 HOH 532 1532 1532 HOH WAT A . 
E 4 HOH 533 1533 1533 HOH WAT A . 
E 4 HOH 534 1534 1534 HOH WAT A . 
E 4 HOH 535 1535 1535 HOH WAT A . 
E 4 HOH 536 1536 1536 HOH WAT A . 
E 4 HOH 537 1537 1537 HOH WAT A . 
E 4 HOH 538 1538 1538 HOH WAT A . 
E 4 HOH 539 1539 1539 HOH WAT A . 
E 4 HOH 540 1540 1540 HOH WAT A . 
E 4 HOH 541 1541 1541 HOH WAT A . 
E 4 HOH 542 1542 1542 HOH WAT A . 
E 4 HOH 543 1543 1543 HOH WAT A . 
E 4 HOH 544 1544 1544 HOH WAT A . 
E 4 HOH 545 1545 1545 HOH WAT A . 
E 4 HOH 546 1546 1546 HOH WAT A . 
E 4 HOH 547 1547 1547 HOH WAT A . 
E 4 HOH 548 1548 1548 HOH WAT A . 
E 4 HOH 549 1549 1549 HOH WAT A . 
E 4 HOH 550 1550 1550 HOH WAT A . 
E 4 HOH 551 1551 1551 HOH WAT A . 
E 4 HOH 552 1552 1552 HOH WAT A . 
E 4 HOH 553 1553 1553 HOH WAT A . 
E 4 HOH 554 1554 1554 HOH WAT A . 
E 4 HOH 555 1555 1555 HOH WAT A . 
E 4 HOH 556 1556 1556 HOH WAT A . 
E 4 HOH 557 1557 1557 HOH WAT A . 
E 4 HOH 558 1558 1558 HOH WAT A . 
E 4 HOH 559 1559 1559 HOH WAT A . 
E 4 HOH 560 1560 1560 HOH WAT A . 
E 4 HOH 561 1561 1561 HOH WAT A . 
E 4 HOH 562 1562 1562 HOH WAT A . 
E 4 HOH 563 1563 1563 HOH WAT A . 
E 4 HOH 564 1564 1564 HOH WAT A . 
E 4 HOH 565 1565 1565 HOH WAT A . 
E 4 HOH 566 1566 1566 HOH WAT A . 
E 4 HOH 567 1567 1567 HOH WAT A . 
E 4 HOH 568 1568 1568 HOH WAT A . 
E 4 HOH 569 1569 1569 HOH WAT A . 
E 4 HOH 570 1570 1570 HOH WAT A . 
E 4 HOH 571 1571 1571 HOH WAT A . 
E 4 HOH 572 1572 1572 HOH WAT A . 
E 4 HOH 573 1573 1573 HOH WAT A . 
E 4 HOH 574 1574 1574 HOH WAT A . 
E 4 HOH 575 1575 1575 HOH WAT A . 
E 4 HOH 576 1576 1576 HOH WAT A . 
E 4 HOH 577 1577 1577 HOH WAT A . 
E 4 HOH 578 1578 1578 HOH WAT A . 
E 4 HOH 579 1579 1579 HOH WAT A . 
E 4 HOH 580 1580 1580 HOH WAT A . 
E 4 HOH 581 1581 1581 HOH WAT A . 
E 4 HOH 582 1582 1582 HOH WAT A . 
E 4 HOH 583 1583 1583 HOH WAT A . 
E 4 HOH 584 1584 1584 HOH WAT A . 
E 4 HOH 585 1585 1585 HOH WAT A . 
E 4 HOH 586 1586 1586 HOH WAT A . 
E 4 HOH 587 1587 1587 HOH WAT A . 
E 4 HOH 588 1588 1588 HOH WAT A . 
E 4 HOH 589 1589 1589 HOH WAT A . 
E 4 HOH 590 1590 1590 HOH WAT A . 
E 4 HOH 591 1591 1591 HOH WAT A . 
E 4 HOH 592 1592 1592 HOH WAT A . 
E 4 HOH 593 1593 1593 HOH WAT A . 
E 4 HOH 594 1594 1594 HOH WAT A . 
E 4 HOH 595 1595 1595 HOH WAT A . 
E 4 HOH 596 1596 1596 HOH WAT A . 
E 4 HOH 597 1597 1597 HOH WAT A . 
E 4 HOH 598 1598 1598 HOH WAT A . 
E 4 HOH 599 1599 1599 HOH WAT A . 
E 4 HOH 600 1600 1600 HOH WAT A . 
E 4 HOH 601 1601 1601 HOH WAT A . 
E 4 HOH 602 1602 1602 HOH WAT A . 
E 4 HOH 603 1603 1603 HOH WAT A . 
E 4 HOH 604 1604 1604 HOH WAT A . 
E 4 HOH 605 1605 1605 HOH WAT A . 
E 4 HOH 606 1606 1606 HOH WAT A . 
E 4 HOH 607 1607 1607 HOH WAT A . 
E 4 HOH 608 1608 1608 HOH WAT A . 
E 4 HOH 609 1609 1609 HOH WAT A . 
E 4 HOH 610 1610 1610 HOH WAT A . 
E 4 HOH 611 1611 1611 HOH WAT A . 
E 4 HOH 612 1612 1612 HOH WAT A . 
E 4 HOH 613 1613 1613 HOH WAT A . 
E 4 HOH 614 1614 1614 HOH WAT A . 
E 4 HOH 615 1615 1615 HOH WAT A . 
E 4 HOH 616 1616 1616 HOH WAT A . 
E 4 HOH 617 1617 1617 HOH WAT A . 
E 4 HOH 618 1618 1618 HOH WAT A . 
E 4 HOH 619 1619 1619 HOH WAT A . 
E 4 HOH 620 1620 1620 HOH WAT A . 
E 4 HOH 621 1621 1621 HOH WAT A . 
E 4 HOH 622 1622 1622 HOH WAT A . 
E 4 HOH 623 1623 1623 HOH WAT A . 
#